2P6OA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
b'MELWLVRHGETMWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
molecule tags Hydrolase
source organism Thermus thermophilus
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p6oA00
2WNIA 4D4KA 5CX4A 2OWEA 2H0QA 1V37A 3BIFA 3LNTA 1SKAA 2A9JA 2YN0A 3K4PA 3HJGA 4JOBA 3PGMA 4PGMA 1SK8A 2P6OA 1DKOA 1DKLA 1BQ4A 2H4XA 4MA4A 2WU0A 3GP3A 1DKMA 1BIFA 1UJBA 1E58A 1NT4A 1SKBA 4ODIA 2P77A 3K4QA 1FBTA 1QHFA 2H4ZA 1DKNA 3QPWA 2H52A 2P2YA 4JOCA 1ND6A 3R7AA 1C80A 3FDZB 3F2IA 3D8HA 2ENUA 1QFXA 2P2ZA 1V7QA 2WNHA 4FDUA 2EKZA 3NFYA 3E9DA 4D4LA 1RIIA 4EMBA 3QPVA 5AJXA 1IHPA 2P79A 3FJYA 2EKBA 1FZTA 5PGMA 3E9EA 2DWPA 3NTLA 1C81A 3O0TA 1XQ9A 2DWOA 3LL4A 4E3WA 2BIFA 5AK0A 3DB1A 4QIHA 2I1VB 2P9FA 3E9CA 4ARVA 2P78A 4FDTA 5CU7A 4GPIB 1TIPA 3DCYA 2F90A 2GFIA 2P30A 2HHJA 4HBZA 4IJ5A 4TSRA 3GP5A 5CDHA 1RPAA 2HPAA 4ARUA 3ZHCA 3MBKA 1YJXA 2YN2A 4GPZA 3IT1A 2EOAA 1CVIA 1RPTA 3IT3A 4ARSA 3D4IA 5AJYA 3MXOA 1UJCA 4D4MA 3D6AA 4PZAA 1EBBA 2RFLA 3C7TA 2ENWA 1SK9A 5AJZA 1DKQA 3GW8A 2A6PA 2PA0A 1E59A 5AJWA 3IT2A 4AROA 1DKPA 2P75A 4IJ6A 1K6MA 3LG2A 2OWDA 1BQ3A 3FDZA 4PZ9A 3F3KA 4JODA 1C7ZA 3IT0A 4EO9A 2P9YA 2QNIA 3OI7A 1YFKA 1H2FA 2P9ZA 4D4JA 5AJVB 5HR5A 3QPUA 3EZNA 3KKKA 2HIAA 1H2EA 1QWOA 2P6MA 2IKQA 1ND5A 1T8PA 3EOZA 2AXNA 5HTKA
chains in the Genus database with same CATH superfamily
4KN8A 1RQ7A 1H8HA 4QGFA 4DSNA 1NRXA 1JFFA 4EUKA 2H2FA 1XTJA 4IEEA 1QRSA 1UCFA 1BCRB 1XMOB 4HDRB 1HOTA 1A2QA 4P4TA 2I66A 3EGXB 4FSHA 1C7JA 3B6IA 3KUUA 2E3JA 4NQZA 2ZRAA 2AYZA 1BVYF 1N3YA 3VKHA 4LOJA 4YA6A 2O2CA 2ONKA 1UODA 1NYTA 2BF4A 3ANXA 2YW9A 3ED1A 1WW2A 1SAYA 2Z83A 3NUZA 1XK6A 3IDAA 4OSEA 3ZQ4A 1T36B 4HXYA 3EF0A 4OBBA 1P18A 1LVUA 4RVNA 2AC7A 2DPGA 4QAQA 4RU1A 3AB7A 4BP9A 5H68A 3Q3HA 2BD0A 1JQLB 4NNOA 1Y1RA 2WFZA 2BGGA 5DHFA 2CXOA 2GXUA 2AN1A 2V7XA 4QXOA 4P7JA 3OT1B 2I3ZA 1SKYB 2C9DA 3OH8A 4ON9A 3B48A 3TRHA 1ANKA 4CKEB 4IIDA 3TXAA 3TUJC 3WLSA 3OFKA 3ROKA 4GKJB 2OZLA 1XOIA 5D3QA 5DIFA 3WL3A 4I2VA 2C8JA 5EQFA 2D5IA 2ZSDA 2KSQA 1VBMA 1DEHA 2I4TA 3EH2A 1T4GA 3L1VA 3ICEA 2QX6A 2K5UA 2Q4BA 2JHCA 3BH7A 1BE6A 2P9HA 3IAS1 4HEHA 3T4XA 4L8GA 2Z2IA 2FRDA 1F9EA 4CHTA 2J3EA 4NV0A 5HYVA 4MW2A 5J4HA 3RT9A 1DP4A 4OMUA 2NYUA 2PSFA 3I83A 1Z0SA 4EZIA 5AFSA 3KTFA 4XIFA 3CEJA 2W2QA 3CBQA 2EKPA 5AHRA 4TUYF 2H1LA 4LJ5A 3TTUA 5HQ3B 4JC0A 5H4HA 5HK8A 1VHWA 2I67A 1ZICA 3EISA 5B4TA 2JZOA 4MWEA 4R1SA 1SC3A 2DWUA 3HV0A 2I4LA 2XB2A 2ZVQX 2REQB 3DR3A 4LMAA 4FS8A 2P8JA 4MVXA 4QECA 5E1BA 3ORHA 3U0BA 5JUWA 4LMPA 3IGFA 2IP4A 1L5LA 3LWNA 4AZSA 1KQGA 1JF8A 3THRA 3RTAA 3AVWA 1XYVA 2GTPA 2YIMA 2RKBA 3GCWA 4CE6A 3AVTA 2AZTA 4DJ5X 2ROQA 1FLAA 4LY3A 2G83A 3E03A 4ZA2A 1JHVA 2BBOA 5EP3A 1WIWA 1V2HE 1PSDA 5IAAA 5AM0A 2FWBA 3I52A 2HNKA 4HDMA 1SHZA 4WZBA 3R2JA 4S12A 3GEIA 1YAHA 2ZDGA 3O31A 5AW5A 1B73A 4XEHA 1LSOA 2GB4A 2HNAA 4AROA 4TTTS 5IWAB 3FYHA 2DFLA 1YVDA 4Q05A 4YC7A 2DTDA 5HRUA 1K4YA 1M0WA 1JLMA 1PQ4A 2Y0PA 3KJQA 3PL1A 4UBNA 5FPSA 5JBQA 4JYZA 2Z6UA 2I7DA 1OE0A 3N0VA 3WRWA 1AGRA 2DEUA 4DCCA 2G6TA 2VSOA 2DWQA 2YN4A 2ZR7A 1R74A 3J7TA 4RTKA 3MHTA 1JSZA 3B12A 4ZFNA 1WW3A 3MWEB 1UXOA 3OQIA 4FWBA 3KPVA 2HHHB 5DNEA 1W52X 4OKIA 3SI7A 5GIOE 1EXDA 1ZD8A 1A8IA 1A1SA 4ITVA 4UVEA 2VP5A 1M2JA 1EZ4A 2P4QA 2DBQA 4AW9A 4BKOA 4DA9A 3A2NA 2FHPA 1OZAA 3EIOA 4YAWA 4CCAA 1VYTA 3IDZA 1DKLA 2C2YA 2QP9X 2YZMA 5D85A 4Z1MA 2JS7A 4CHGA 3S8EA 2D7JA 5BT8A 5C4MA 2EW8A 1KDZA 2A30A 2W2KA 3ANSA 3KXIA 3DV9A 3MJDA 3GZTB 4X24A 2WAOA 3TD2A 1HL7A 2B6HA 4NZMA 1EGQA 4N1AA 3IR6A 2PV0A 4ZPXA 4Y1FA 1GEGA 3QM1A 4XFJA 4BLSA 4BWGA 1D03A 4HEJA 5IBPA 5JNUA 1W88A 4O4JF 5FL7D 2AKYA 4KQ2A 2CVHA 5K0BA 2Q1WA 1H2BA 5CTAA 2H4FA 1EUCB 5TS2A 2NO1A 3AEKA 3BXEA 4O2LA 1H2RS 4P5DA 3EA5A 3IAFA 4XTRA 4QZVA 4RS3A 5ICCA 2Q9CA 3C5WP 1YTLA 4DS3A 5H8WA 1DRUA 2D7CA 5BN4B 1QQ5A 1JDJA 3TQTA 2V96A 4PX5A 5FTNA 1FMLA 1QNFA 1GY8A 3CH4B 2C8LA 4DV4B 2CDBA 2C7OA 5AW8A 1VP3A 4WZAE 5DGXA 4OXQA 2VHZA 3MRVA 4XUDA 3WO1A 4C0HA 3KUXA 1SHTX 3GT7A 1SCJA 1UBRS 2AR0A 2FEOA 4B8WA 3R4CA 2ZRFA 4KYVA 4OYYA 4EA6A 1E8NA 2J7KA 2FWNA 2YWEA 1ES9A 1PQWA 2W71A 3NAZA 4FT2A 1ZK0A 1E1MA 3EC1A 1AQ6A 3L84A 1L4HA 1YDFA 3ESXA 2BCGY 2I6QA 3R3YA 5EE3A 3DPIA 2VDLB 1Q0SA 1W581 2DFDA 3T38A 1TJYA 3WIEA 1N2GA 3WYEA 3OIDA 2HBRA 5KTPA 3QVOA 2XH8A 3VOTA 1FSGA 5ARDA 1MFZA 1YI0A 1E7QA 3GDFA 2YHSA 2QTCA 3Q7TA 2DOKA 2HK8A 1RE1A 4CKBB 1UBCA 3PR2B 1U94A 4URUR 3S8YA 3LHFA 3PDCA 1V43A 1Q1EA 4GMXA 4R0NA 2YNMC 2CL5A 2Z2YA 4RKQA 3GHHA 1T1SA 4K87A 3ULKA 1L5WA 1W9HA 4LSGA 3AV0B 3P0JA 2PIDA 2OENG 2ACVA 2P6UA 3HKCA 5E6UA 4BLWA 3Q15C 2JFHA 5FJIA 1UMDB 1U3UA 3D3WB 3LAWA 3C6KA 4AYTA 2NTEA 4AF7A 2PVSA 2RHLA 3JQAB 1U0GA 3SS8A 2VSNA 3GH3A 4WERA 3ZWXA 1Y98A 4Q3BA 4DHEA 1ZUNA 4WA7A 2ERYA 3W9YA 1C7EA 4G0XA 3G0HA 5IAOA 1GG9A 4JK3A 4IH4A 4LV5B 1U31A 1UZUA 2BSAA 2YV1A 2R6R1 4KVGA 2YOFA 3H2IA 2A4KA 4EAQA 5CDFE 2ZI4A 1L5FA 3B6JA 1XCGB 3OZFA 4JUIA 2R86A 3AESB 4E32A 1DC5A 3JQBA 5CB8A 1XTZA 2V0CA 2QL7A 3WYFA 2BFCB 2PS0A 5EIEA 5KQMA 5JD5A 3SQNA 1ISIA 3A1NA 1C0EA 1J0AA 4BKPA 5AUPB 821PA 1HWYA 5DTEA 5IK2A 4UAVA 4DCNA 1KJ9A 4D0SA 1JFTA 1NFFA 3QLUC 1Y4DE 1Z2DA 5FYDA 1PG2A 2QUZA 4XSVA 1WSAA 4RD4A 1G3UA 4EY3A 9GPBA 2WBLC 3EQ8A 2C3OA 4KFUA 5E4YA 3HBNA 5EPUA 4PZCA 4GM1A 4C29A 2Q8NA 121PA 4BAUA 4KO8A 1H94A 2HCBA 4C6HA 1P6QA 4FGKA 4IDQA 4XE5A 3SR4A 1RWXA 3FKSD 3H0CA 5LLDA 4KAFA 5FWYA 4OHFA 2DAPA 2JFXA 2AI3A 2JRCA 2R2AA 1NUHA 4DA4A 3Q10A 3KVRA 1I10A 1A7AA 2H1CA 2OHJA 1HE2A 3R7AA 1Z6TA 2H00A 4MV1A 2R1UA 4PHHA 1XI2A 4YBZA 3CZMA 3SZGA 1Z4LA 1Q7EA 5CXQA 3V1YA 3KKLA 2FPIA 4G89A 3N8GA 4TV8F 3TQIA 5F7OA 1KVRA 2X8WA 4OHWA 3E9DA 5A4FS 3E5NA 3Q3IA 3IRUA 4IR7A 3P5SA 4PG5A 3DC2A 2ATVA 5FR2A 1AVTA 3P1JA 3LC7O 4NBSA 1TVKB 2FRVA 3GQBA 5BVHB 3HBMA 3TGWA 4B5LA 4KFSA 1S8NA 3TQSA 2LCIA 4UHCA 2LCFA 1UDRA 5LZ5A 1PGQA 1P72A 2CDAA 3IE0A 1GA6A 1MX1A 2AXQA 1ADGA 2GCIA 4YWHA 1UFKA 4E15A 5KC9A 3E9CA 3K8YA 3U3XA 2BBWA 2P2NA 2YJGA 1U0BB 2CVQA 1ZNXA 4P80A 3UXEA 4IILA 1IPFA 1N2OA 2FSVA 2YCLA 3DHEA 4WGGA 1UQTA 4CQMB 2A7QA 5BRJA 2B2XA 3A04A 1PR2A 1IN4A 4ZVRA 4C5AA 2RHJA 1LH0A 4L0QA 1P5JA 1N2XA 4DRXB 5IYZB 1SXPA 3GUVA 4WCFA 1UBTS 5IHXA 3AVVA 4BMOB 4L6CA 1RQGA 3DEJA 4FUTA 1DUSA 2BDEA 4I4LA 2QA5A 1KI6A 1Z9BA 4I3GA 1ZUIA 4TS4A 2FETA 1C0IA 1NJ1A 2AMFA 4DIEA 4OHPA 1SJ9A 2GQ0A 4O2AF 4MVJE 2VSYA 2YVUA 4DBLC 4Q93A 3ZNQA 4R1OA 2R2GA 4JS0A 2MOKA 3PPYA 5E9WA 3OZUA 5LZ8A 3C41J 4EVSA 3TTTA 4Z9YA 2F3PA 1CUJA 1BE1A 5CEFA 4LE2A 2WSMA 3ZWQA 1DO0A 5CJPA 2DERA 1SBZA 3GCGA 1JWAB 3KLOA 3BE8A 5LXTF 1ZVVA 2AEMA 2L2QA 4X6YA 1YS9A 4MUBA 4X8OA 5FA5A 4M1OA 4BJ5A 1DT5A 4BCCA 2DM6A 1G17A 1O2DA 1L4KA 1QCZA 3OU2A 1QF6A 2GD6A 2ZBPA 1RDFA 1SUIA 5JJ5A 4GVXA 3CZ4A 3PTZA 2VDMB 1XKQA 3H2BA 1DDOA 1I80A 4UEQA 4KGXA 1K6XA 2AQIA 3FNEA 1D4ZA 1L5GB 3CXRA 4ZT5A 5DTRA 3FSGD 4REQB 4JR2A 4BYMA 4LF8B 2A9RA 2OT3B 2X41A 2ZYRA 3U48A 2EBHX 4B82A 1ADBA 3CVXA 1QFMA 3UJDA 4U6QA 3PXGA 3ZNNA 1A71A 3TBHA 1R6TA 5D5QA 4Q4LA 3IOCA 1D2EA 3GY0A 4JBYA 3SD7A 2CE7A 2JJ8A 4TKVB 1Y81A 3ITDA 4GOXA 1TQ2A 3SU8A 2B2CA 1JILA 4PYRA 4Q82A 4EG1A 4BWYA 5JZMA 5BSGA 4QWMA 1LLFA 2WK1A 3PDUA 1DC4A 3WLMA 3RJMA 1P75A 4Y2HA 4UEOA 3IUEA 1D6SA 1OV4A 1L8LA 2MR5A 4LDPA 4TGLA 4ZCSA 1GFSA 4I4TB 2EBWA 3OE5A 1P4HA 4UCWA 3DE6X 4UVHA 1QDLB 3JD1A 3FDFA 1N33B 5DTQA 4NFSA 4M55A 4AVYA 1MOSA 2DBYA 2OV2A 1JE0A 3ZGOA 1W85A 4J9UE 1DAKA 3TZLA 1PW7A 2V7VA 1QMPA 1XJ5A 4G9BA 1N6KA 1IVNA 4GXTA 3ZDQA 4YLYA 3DWFA 1GPNA 4L72A 4RZ2A 3D3NA 3F6CA 5HCUA 1AKWA 2JD2A 2GN6A 3EWIA 2PT9A 5DK6A 3MQ4A 4FS3A 4FX2A 3E84A 3EEBA 5HE9A 4EQ6B 3I5YA 2JA1A 1BU5A 2VTKA 4DR6B 3VKGA 5HKBA 1MOZA 3B20A 1U7OA 3DFUA 3MFYA 4MGIR 1R0CA 1P4JA 3GLKA 3B60A 4HN4B 5KYUA 4WN3A 1S96A 1ACMA 2DLNA 3BE6A 4TTPA 3K53A 3N5KA 3RBAA 4C7OA 1Z8DA 3DWEX 3HACA 3TW8A 3UT6A 4NJEB 1Q50A 5C1DA 4GMFA 5CVUA 5LMUB 2V7TA 1NJ6A 1NW3A 1UM9B 1MO2A 1M3SA 3T9BA 4RTNA 3ZPXA 2J8ZA 3GXBA 2N75A 3IEIA 3N59A 4N54A 5ILQA 4TRJA 4MUYA 1T9HA 1UP6A 1BE0A 3HB4X 1N78A 1UBSB 2BJWA 4MGZR 3SCZA 4Q34A 1L7XA 3EEFA 3S8MA 1Y8RB 4OIMA 2TRSB 4JQSA 3ICVA 2QTVB 4GG1A 4WZBE 2BGNA 3FZGA 2A92A 5CFLA 3CVWA 4G1CA 4LEIA 1TB4A 4C88A 2D74A 3AB3A 3BD9A 3LWDA 3SMQA 1G7RA 4KV9A 1EDZA 3G13A 1Z0IA 5ALHA 3W9BA 2RAUA 2BZ1A 3CG4A 3UZUA 4CKYA 1F1JA 4D74A 4F3KA 5JQGF 5CNKA 3LPDA 3W78A 4NPCA 3LCUA 2E89A 2H7XA 1G1AA 2IYTA 3SG0A 3ECCA 4C04A 5A02A 2WF9A 2R7KA 4B9EA 4CG2A 3IAEA 1TW2A 2AOTA 3L8ZA 3H2ZA 4H27A 4QQKA 1EJ0A 1U0SY 1I0IA 2GXSA 4WNIA 4WPGA 5ALKA 3VBCA 2QJFA 4CT0A 4RJ2A 1DDIA 1OAOC 2PSEA 4M8LA 1UPXA 4AWXA 1LFAA 1J8FA 2ONZA 2YW2A 2J31A 3COWA 2A9OA 2RBKA 4D3FA 4ZJUA 1JHZA 3T5CA 4F6RB 3RS0A 2R6HA 1EX6A 5KEIA 1THZA 4RVCA 3CUSA 5COBA 4N0MA 2IV2X 2Q0XA 1TIBA 2JPDA 1G18A 1RPJA 3WL5A 5F3WB 5ITSA 3TLJA 4MPRA 2OC9A 5JCOC 1W4LA 4DQKA 3VDMA 4GLJA 3F67A 4KODA 3N7AA 5FORA 3DFMA 1GOTA 3STVA 4ODIA 4ARAA 3RBVA 5D3KA 2CFRA 4M0FA 4BBJA 2Q28A 4HLCA 1FSSA 2LKDA 5CX1B 4Z9AA 3PUVA 4F3RA 5FHQA 4NCXA 4HMQA 4MDYA 3LYAA 1KWKA 1VKNA 2JD1A 3C4JA 4TVKA 2JNWA 4ZDIA 1XPRA 3N0TA 2X9NA 4RXMA 4MH0R 1FP4A 4RKYA 1KMHB 1WPGA 1NDUA 4RYDA 1YI1A 1RFLA 4YJ2A 4FBLA 5DEOA 3BHNA 3ZDAA 1N8SA 4MVWA 3K9FC 1YQGA 4RPJA 1H4TA 2NU9B 2OFXA 3PDJA 1A2OA 1LWNA 1DI0A 4FYJA 3ZQUA 5CK5A 3RT1A 2YZNA 3ZGZA 4WZAA 4C05A 1QKJA 1GUAA 4U1RA 2HRCA 1ZIYA 3B3FA 2XAAA 2VF5X 4IVPA 1XQ9A 4ZHQB 3O21A 3BDIA 1A9XB 5JXWA 1UFRA 1VMEA 4H7KA 3A9VA 2KE5A 4TXNA 4DSAA 1G9XA 2P9FA 2E82A 3KHKA 4WXRA 5SZJA 3VRHA 1XTRA 3SIPA 1YA6A 1PN3A 1QE5A 4QBGB 2WKQA 3JRXA 5COAA 1IN1A 2IHKA 3EARA 1X80B 1GL6A 3E8XA 1PR4A 3TBKA 1PUIA 1RM0A 1NQOA 4I1SA 1NJGA 3SX0A 3NTXA 1ABEA 5AYVA 5BXYA 1JEAA 4FFDA 4CL3A 1WNFA 2VC2B 3ETCA 2IYFA 2H18A 4UUBA 4MIEA 3RJ5A 5KTSA 2PD4A 5C7LO 1JEYA 2CHGA 3IP6A 5LIRA 2PCJA 2HU8A 3EWAA 1C1DB 1M1ZA 4IIGA 4MB6A 4R1NA 1GZ7A 2HLPA 2LZ0A 3P27A 2AN3A 2W6JA 4JJKA 4K05A 3TQQA 3L8MA 3LBAA 3NZEA 3O1LA 2H1RA 2VAMA 3D4NA 3K0BA 4WEQA 1FYVA 2G9QA 4DYHA 4L3WA 1O4WA 2BFBA 4BFSA 5IVHA 4YJDA 4PLWA 4A2WA 3F0TA 3NRJA 4Y9RA 1EFRD 4R7GA 3ZBUA 5JVDF 1NMQA 1C0LA 3CH6A 4J0JA 3RTCA 2PTHA 3G5LA 1LI5A 2XUIA 1H2XA 4YP0A 5K3CA 4WKCA 2BEJA 1PI3A 4IIYA 5CNMA 3IUPA 1UC8A 4EELA 4XWAA 3KQTA 4YRJA 1VJGA 3WGYA 4JQCA 1J1ZA 2HWUA 4D9JA 3KQPA 4ARBA 1SM4A 1HLPA 2G8LA 2FDCA 1GNSA 4HDAA 5D8DA 3EZ2A 1TVCA 4XDZA 1XBTA 1ECGA 4IP0A 1RPNA 3PNMA 1ZO8A 4J7AA 4R2JA 3VZPA 3WIDA 2Y76A 4TMZA 4V0LA 5HKAA 1HT0A 2WWXA 3BMCB 1CUSA 3DPUA 1JKFA 1YZNA 2VWHA 4YRQA 1PEAA 4GKAA 2EARA 4EI8A 6AT1A 3OZSA 3VPGA 3ABSB 3WK6A 1KYYA 2D8MA 2CDRA 1ZWKA 4DR1B 5DLPA 3I4CA 1HX7A 4G56A 3TQHA 2D0DA 2YVAA 1L8OA 4Z7NB 3UMYA 5BN3B 2W4QA 5IT4A 4ZMBA 4DR4B 1E64A 1VYHA 2NV0A 2V6JA 3MSXA 1IOZA 1JU9A 4BXOA 4BRUA 4GL4A 2E9SA 2FR8C 4EB0A 4MDFA 3ONFA 4NENA 3HJGA 1DC7A 4HJXA 4OXNA 4PGMA 1XQ6A 3EAGA 2PKRA 1M7BA 4FDLA 2O48X 4ND3A 3V7NA 4TYPA 1W19A 3RK1A 1MX9A 3TK1A 1U7PA 1D0SA 3CEMA 1ZI8A 3RRNA 5CAEA 5CX1A 4JZYA 1IUNA 4G4GA 1Q44A 2OILA 4WE3A 3OHMA 3O92A 4L0MA 4KI0A 2XYHA 1M1NA 3EYAA 1ZOIA 5E4TA 3SZLA 1XXLA 2QM3A 1DAIA 1KOJA 1L7DA 2ZOSA 3DEKA 3GJQA 4NEGA 4JOCA 4QTZA 5AVRA 3PGVA 3R7BA 2PZKA 3FKSA 4HNAA 5LP6A 4PGFA 2QLJA 3ESDA 4IS2A 4DBVO 5CDGA 1SUFA 2I3BA 2Y99A 3EUWA 3O8OA 2OCLA 3GLQA 4AS2A 4KB5A 1L5SA 1ZD2P 2EWVA 1HUQA 3A0UA 2JHGA 1H0HA 3Q6MA 4BP1A 2D62A 5EE5B 4B83A 4O2BF 1I7QB 2GH1A 2FV8A 4ZGGA 2BKEA 1B1CA 5KCMA 4O4JA 1BKDR 3FPFA 4FFOA 4F38A 5GINE 2AJLI 1P73A 2FMUA 4JOQA 4NJMB 3Q5DA 2O57A 4MO2A 3EW7A 2R7LA 3V7UA 5A3VA 2ZJBA 4YRDA 4D80A 4ETMA 1OT5A 1OAOA 1Y5IA 1WM1A 1FVOA 1MUUA 2P62A 3CC8A 2PUAA 4MUNA 3NX4A 2Z4TA 2O1SA 3NHKA 1BHO1 4A0GA 2WI8A 3OPQA 1HRDA 2WYUA 1V5IA 1PYGA 2VUSA 3CE6A 4G2NA 4C0SA 5AVVA 2ZTSA 3V8PA 3ZWCA 5ITZB 3J7AC 4TYNA 4LCBA 4OK3A 1TAUA 5LCXA 1GNLA 4KQJA 4IH9A 3OD5A 1RPTA 3Q8LA 3SMVA 1B8VA 3OOYA 1KJQA 3THXA 3D6UA 1N6LA 3PFFA 3Q3GE 4Y1RB 3WLJA 3K96A 1SKYE 3R7WA 1LJ8A 3LDAA 1EVYA 3CNQS 3GVIA 2O8DA 1TK2A 4EY4A 1E79D 4N01A 1TPZA 2IXDA 4C21A 1U5AA 3TAUA 2GBFA 4IW3B 5GV8A 1T0BA 5HCIA 1DE0A 2I2AA 2GM4A 1HNWB 4AI6A 4AJEA 2WWIA 3SHOA 3KS9A 3FY4A 4UBLA 2OZVA 1C2YA 2F1KA 1ZJ4A 5C34B 4NE2A 2JCGA 1NKSA 1PD1A 4M21A 1E1KA 2H54A 2B4YA 5JADA 1IQPA 1YFKA 2OUIA 1OH5A 4R7ZA 3LYUA 3FPGA 3ENKA 4WVFA 1NP7A 4NFHA 3NOOA 4JL6A 3RVRA 2Z2JA 3ERCA 5AW2A 1NW9B 1TT5A 2GR9A 1CUFA 1F60A 4XGQA 5DPMA 5CCEA 2Z9DA 3CPJB 1N0VC 5F64A 5KAMA 3C3AA 2AOWA 2PA3A 4MA0A 4F8EA 1MEEA 2JLZA 3SS9X 2M9MA 2AGVA 2N3ZA 2Y0EA 4YCBA 4URFA 3RLIA 2UU9B 1BE8A 2OXEA 1FDIA 1ZS9A 1SHKA 1UXIA 1ZX1A 3ABQB 2VJCA 4TN1A 2JIBA 1A88A 4W1QA 4C4OA 4MKIA 5DGTA 1EVEA 3OOHA 4X97A 4YRTA 5C80A 1V1JA 2ST1A 5I9SA 4M1YA 3JQ6A 3JASB 3FFXA 3MJCA 4MW4A 1TAQA 2WILA 4AM8A 5CVCA 2VG8A 3HPQA 2OXIA 3PB3A 1YWGO 2ODTX 3JVUA 2VP2A 2JBAB 2X13A 3OX2A 3ZE2B 3VR0A 4WBNA 3FGPA 1I13A 1WUKS 5G1OA 5JISA 1ULSA 2DC1A 4W8OA 1D7OA 3HYSA 4LV6A 2P4SA 2CBZA 3T5AA 1WXIA 5JG7A 1ZSVA 2VUHB 1D8TA 1YB5A 1PFYA 1V35A 1CY1A 4DJDC 2HOQA 2X1HA 3DLHA 3KFLA 2PX0A 1VHQA 1WNTA 4PY2A 4BKRA 4C87A 1H5UA 5G4LA 1QYDA 3L6UA 4R2WA 3D0KA 4G4JA 3DBHA 4BC1A 3N86A 3CLRD 3T9EA 4RF5A 3ENVA 3ZDCA 2B61A 4FONA 3O8DA 4JKIA 4KPGA 4REQA 1G60A 4D26A 4YP5A 1F2TA 4RENA 1E79A 2WUFA 4QG3A 1SOVA 3CUEF 1K7CA 3B3JA 3KWJA 5HX7A 2BGIA 2PQMA 2P65A 5B6IA 1L9XA 2YVKA 2IOHA 3ISVA 3B9QA 2O2IA 4XD2A 4R8RA 3S7TA 1DJMA 1ZDMA 1NL3A 2XD9A 2YDXA 5K3BA 1E1LA 2QRHA 3KOWA 3N58A 4YCAA 1MXHA 3VUFA 2P27A 1SO8A 2I62A 3RTBA 5CT5A 2DCUA 3VHQA 3HZRA 2WF6A 4MYDA 2PBZA 3L4JA 2RGYA 1VGVA 2C5HA 3D4BA 3I9OA 4RF4A 3EBLA 1S8OA 4HRYA 4ZAFA 1K8XB 3VH4A 3L8YA 1AE1A 2C29D 1Y63A 1HQCA 4I5EA 4H7HA 5FBWB 5HIKA 5JSFA 1U3CA 1T2EA 1QV9A 3L8CA 5L40A 4PPGA 4XJSA 3AVXA 1L7PA 1DBVO 2O0KA 3F46A 3HVKA 4OLAA 2G9ZA 1U1IA 4GUDA 3VR6A 4HHEA 3LT5A 1X7DA 4JD5A 4L6AA 4LJAA 1KAEA 3D2AA 3V4RA 2X0NA 4DDTA 3MVEA 5F1PA 2JBWA 2COUA 3RG2A 5FNVA 4NBLA 5L6MB 3R8FA 1BMQA 2WM3A 1IBKB 1QP0A 2D2VA 2BHNA 3EE6A 2RIPA 3OTIA 4PXYA 5IH7A 2OBMA 1M8PA 2OKGA 2QG4A 2W0MA 2YBDA 5EMKA 5EWJB 3VVMA 5AVXA 2W42A 2B2NA 3QFSA 4XGNA 1WEKA 1GGHA 3O1HB 1ZK1A 4N0PA 4MV0A 3JQDA 4DIBA 3RROA 4X71A 4DRYA 3HY4A 3WIVA 4GWLA 1P3JA 1KO4A 3LTEA 5GPBA 2VH5R 3F49S 2PRKA 5JPIA 1G5PA 4ZOLB 3FOCA 4HF7A 2KM1A 2HA5A 4P0TA 2WUWE 2O0JA 1N2IA 3N2YA 4MIOA 2NU8A 1US8B 3M4YA 2Y0CA 3OIYA 3DWGA 1PTKA 1AGXA 4WJZA 5KB3A 5ESRA 1NNLA 1UWKA 3FG9A 3KNZA 2I65A 4RJIA 3ZHOA 2B3DA 3QPCA 4X93A 1DG1G 3HXMA 3VYVA 5JBNA 1BS2A 1TUBB 3STTA 2SBTA 4WSOA 3SIRA 2PUJA 3FGOA 3ZCTA 5JCJA 1N9ZA 1DTSA 3MZ0A 5IF9A 2D5CA 3KYJB 2V7EA 2VPTA 1VL2A 1EA7A 1P1HA 3EVTA 2ZAIA 5CEJA 3AZQA 3QE9Y 2JIDA 1K2WA 1RZUA 2OV1A 1O9BA 3STHA 3AP1A 1CR4A 4AJLA 2Q3MA 2VRCD 2ONCA 4L57A 5THKA 5A0FA 2DMRA 2OAEA 2BAGA 2RHOA 4WAUA 2BGJA 3G82C 2P77A 2BMEA 4U02A 3H1TA 4E03A 1N75A 3CNNA 4FYXA 4JI3B 4AF8A 2GK4A 2JIRA 3DVAB 1W36D 3HKDA 4Y6SA 4LXIA 2UV8A 1NUQA 2IPXA 3GEBA 3E3OA 2CJYA 2UYQA 3WX0A 4PYQA 2O8CA 4C0AC 3QPBA 4XWTA 4ZAWA 4GOMD 2EC5A 2WB4A 3DHNA 4C4AA 4LTMA 4GI3A 4IGAA 2E85A 5IN5A 3K94A 4BFUA 2D8AA 3NTUA 5CDSA 1BXRB 2FMHA 5FWXB 1BAPA 3TSWA 1EVKA 3GJZA 2X4LA 5I47A 1KZYC 1PFWA 4YT5A 5MGNA 4TV8A 4JR1A 2I8CA 1FY2A 4NZYA 4OBXA 3WMFA 2RK6A 3Q7SA 4PVCA 2JGDA 4D82A 1IHYA 3QELB 3GRFA 4LCEA 5DV9A 1X2BA 4YJKA 1XNJA 4G8DA 2C97A 3IHWA 1NJSA 3CF0A 1M6NA 1NX6A 3ETDA 3JQBC 5DHRA 2D4HA 5TNXA 3R4VA 4W1PA 5C8VA 2ZJ2A 1ILWA 2LIVA 4QOHA 2ZCJA 3A58B 3PDIA 1UPTA 4JJAA 4CL0A 1GNRA 3MT7A 4FI3C 4PGGA 4YLGA 2WEKA 2HIGA 4W5QA 2F3SA 4ZI7B 4EJSB 1PFKA 2C4TA 4V0RA 3BMQB 1ZPDA 2XVYA 3HYTA 3L77A 3FD8A 2AN5A 2QD1A 4M8NE 4QYIA 4F8YA 3RYFA 1R27A 5F35A 2R25B 4PPYA 3SF8A 5KWJA 1KZ7B 1RZVA 1I33A 2EOAA 3KKOA 2AZ4A 3MOGA 1AUOA 1SD1A 1SXJD 3ZE8A 5BN5A 5BWOA 2ODWA 2RCNA 3AF6A 1FFYA 1WZCA 4CKCB 5FEMA 3WDSA 3X2EA 1FJXA 5LN1A 1SFRA 5LA6F 1FYEA 4O29A 2JIZD 3M3DA 4DA0A 1X77A 5JPDA 2SCUB 2EERA 3MFQA 2XNSA 4EJSA 4DJFC 5K3OA 5TPWB 2VPWA 3I9V1 1A27A 1P9LA 4PC3A 3DTVD 1XALA 3GLSA 3PF9A 1ZD5A 3FYCA 4PXSA 5LB2A 1U0JA 2HUPA 5EFZA 2EXXA 3WHLA 1EVLA 5JYCA 3U1BA 2GM5A 1B1AA 2P69A 1AX9A 3IT0A 3LFHA 1KJNA 5DBOA 4KIJA 3EIEA 4F4DA 1C7RA 2ZAMA 3DF9A 1UXGA 3LHDA 3W4JA 4OL0A 2FWJA 3BC1A 3PLAE 1D0VA 4WFJA 1R8JA 2KW5A 5H3CA 3ZHTA 4U63A 4G1MB 1EU1A 2AOUA 1U2QA 2PSDA 3MINB 4R8SA 1LBSA 3MLEA 1G5TA 4AAYA 4DN6A 3M5PA 2HMYB 2FK8A 3UMRA 4B3CA 4F21A 1G3RA 2BFEB 2W8BA 3O1IC 3RUIA 4AWAA 4RPLA 5K5EA 1W8DA 2XQKA 5A2GA 2L0XA 1MIHA 3FH0A 3L07A 1ZOLA 2YY6A 3I0NA 3CEHA 1ODFA 3DUWA 5FWXA 2OV6A 5BMVF 4HFMA 1W59A 4HNSA 1CETA 4W8HA 1O58A 3BIWA 1U8XX 4DLZA 1J06A 3RBZA 4DM7A 5JNTA 1VPWA 1C29B 2XRYA 2ZUEA 2FSPA 3AJAA 4NYMQ 1ZRSA 1G38A 2EATA 1T8SA 2FUG1 3D5EA 4X90A 5J5VA 5IJ0A 5EHIA 1X87A 4UNQA 1KO1A 1AZWA 4IS3A 5HF9A 1RJ9B 3O7WA 4HQ0A 7ADHA 1HF3A 4KQMA 4R9UC 1U6JA 3FWHA 1XVIA 3BSSA 3GH1A 2VJMA 2IDJA 3UMBA 4CEIA 2H1IA 1HK7A 1QDUA 2IL1A 3HSSA 4JEIA 5D3ZA 1VPVA 4I6JA 4FFBA 4CT4B 5DNVA 5K01A 1OI2A 4M0EA 4YQFA 3EMKA 4HYTA 3PXAA 4LYYA 2P3OA 3OJ0A 2QYSA 1S4MA 1TFUA 4AN0A 2GXAA 1QYWA 3GT3A 4M3NA 1N3IA 1YR9A 2X0IA 1QP8A 2VATA 3JQGB 3M2PA 4WX2B 3WGZA 1YK0A 4HUTA 4UXIA 1Q74A 2H57A 5TF0A 1KI7A 2NO9A 1UAAA 4Q9NA 1SBHA 3FR7A 1LW6E 1P45A 4US0R 2BFPA 1T8RA 2EDAA 2OLEA 3PUJA 3UT5B 1UBFA 4RTJA 1Z47A 4AP5A 4MLCA 3URKA 3BCHA 3COPA 1CRZA 3EXIB 3W5UA 3AJ9A 2BTOA 2PKYX 4KW7A 2XCSB 4BTVA 5DRTA 1D1TA 1G5IA 1KHHA 1NX9A 1QLWA 2OAQ1 1V1MB 1CVRA 3LUGA 4IIJA 4IXDA 1Y8ZA 2QP4A 3KL4A 2V54A 4FHEA 4M1SA 1W1IA 4DNQA 3H6KA 3EGDA 3OUUA 1MC5A 5CFOA 4RPIA 1NMXA 3SZUA 4BZWA 3M4XA 4DCMA 2BKLA 4CM1A 3GJ8A 2B1JA 5H4GA 1Q7BA 3TRKA 2YFHA 3R6TA 4Q37A 1XF1A 1N7IA 3UKJA 2Z1NA 1WHTA 3CV3A 4D6YA 3I37X 3H75A 2BFBB 2C31A 2H1VA 2B7BA 2ZB3A 2G3YA 1MB3A 3A6FA 3IBFA 4TMFA 1UZMA 2RG7A 2AIRA 1IXSB 1Y9EA 2QN8A 3KQWA 3R9XA 4G81A 3B13B 4FIDA 1ZXLA 5AW3A 4HDKB 1LPBB 4KXVA 3LF2A 1CR2A 4YJFB 1LD3A 1TOAA 2IU4A 2JC3A 1JTFA 1SA0A 3C14C 5DSTA 4DWWA 5HJ5A 5EESA 3FOZA 2DPLA 3U61B 2I71A 3EFEA 2WB2A 2IT1A 2GCPA 1K6MA 2OWDA 3PIIA 3MWKA 4EGFA 4IXNA 2QU7A 2FUNB 5J1TB 5CVDA 3D31A 4U6NA 3OE7A 5BSUA 4R6XA 3KO8A 1S2IA 3W7BA 4R1LA 4WECA 2GPAA 2BGMA 3TKLA 3IP5A 3VJKA 2Q1TA 2VTDA 2FEAA 1C3VA 2WJIA 5EUQB 2IZ0A 3UW3A 5T4HA 2AVDA 1W4CA 1TUIA 2AFIB 4C22A 4DCPA 2XWPA 3ODGA 4KBFA 5L3ZA 3P8ZA 2QXYA 1GPMA 2XVMA 1UAYA 3WV5A 3PPIA 5B2FA 2ATCA 4S2UA 3Q7RA 2EIXA 4YPVA 4KXUA 4RL4A 2FWRA 5DCYA 1Y34E 3C3EA 4W7IA 5EHXA 1XZFA 3M9XA 1RRKA 2PFGA 4XB2A 1Q15A 3H84A 2G9NA 4B3TB 4RJLA 2NT4A 5AJUA 1U2SA 2VXYA 4CCSA 1QVVA 1JZQA 1H0RA 1TK9A 5KVVA 4DMGA 3MIIA 4JR0A 4OXXA 3RS8A 1G5RA 4ND7A 4TLLB 3TR5A 1XP8A 3LT2A 1KY5A 3BA6A 3R9IA 1QJCA 1LV7A 2VF7A 4FGSA 4WASA 5DVZA 4OBEA 3D4LA 2JBAA 4P3PA 2YYYA 1JLKA 3A6GA 1R9NA 5DNYB 4M38A 2ISCA 2X0EA 4B6OA 3A6PC 1D2NA 2NSDA 2R68A 3EGVA 1DQYA 4QNNA 5FBHA 3VZDA 2CLFB 1A9QA 2Z9CA 1OXKB 3UAGA 3X1JA 1N2ZA 3RV3A 3DEYX 2YJTD 1Q7GA 4HDRA 7YASA 2XYGA 4Z9FA 3SFVA 1V71A 2E4AA 5C31A 4BWVA 1FA9A 1ZNZA 2OLJA 4HDCA 2IEIA 5DCUA 1NNUA 2PH5A 3P52A 2AH5A 2KBFA 3HB5X 3ZLBA 4CFYA 2PL5A 3COYA 1EAMA 3CF4A 4IZ6A 2APJA 4JZKA 3VNRA 2XTAA 4XUEA 2Y05A 4LYDA 1XRSB 2PRSA 1AO3A 4OIFA 3W8FA 1RRMA 1ZI6A 4TWRA 3Q72A 3I92A 4GZ5A 2QRZA 4EGQA 1CJKC 4W5HA 1W4RA 2RHHA 2BONA 5TJHA 4MRVA 2LDBA 2LNDA 4F5EA 1LSJA 2ESRA 1YQUA 5JVDB 3U81A 1FJGB 3UYLA 1BXGA 3CGWA 3O90A 3B1XA 3BCUA 3HLYA 2G09A 4M6WA 2KJQA 2XGGA 5CK4A 2YIJA 3KSRA 3ZLVA 1DBQA 4CIWA 5EZYF 3UNXA 4PPQA 4QXAA 2ZU0C 3D0OA 3RFFA 1H22A 2XCUA 3DCNA 3JQAD 4S1WA 5BUZA 1VCIA 3TSYA 5C7IO 1XB2A 2XMSA 4MARA 4PQGA 3OX3A 5CFMA 3ZDFA 4RF3A 1EJ6A 4R5MA 4AC9A 2W70A 3ZBQA 3WZLA 2GCGA 1IK4A 2DPHA 2ZITA 4QBHA 1OZHA 5CHYA 2BF7A 1A8HA 4YT2A 4GKKB 2VCEA 3DPSA 3W5IA 5DHAA 3LPNA 1E1QD 1Q16A 2XMPA 4A6PA 1BJRE 1SR8A 3S2GA 2HFJA 4OBWA 3DTNA 3PNLA 5JVDA 4ZYLA 2QPOA 2X23A 4F5WA 1EFTA 1XU7A 1PE0A 5JJLA 2AF3C 3IEPA 4GXNA 4OGKA 1IN8A 2UYHA 1UUFA 4YFVA 5FH9A 5JJKA 1E1NA 2C2ZA 2QTRA 3AVOA 3ZWAA 3A4NA 1IG3A 1WDKA 3V8MA 5IK2D 1I32A 2ZB8A 3EVAA 3WXBA 2FMIA 2YXPX 3G0BA 3GLHA 2JJ2D 3ICWA 4FFRA 4RM3A 4LYFA 3PUXA 2QAGC 4GOJA 4HH4A 2WTUA 1L5ZA 1B3RA 3DL2A 4CIBA 2XKKA 5IABA 1XDSA 4PGAA 4FFLA 5JEEA 5IKOA 5EYPB 2PT7A 1ODLA 3W5JA 2QTTA 3BCRA 3O8OB 5FOXA 1AUXA 4F3TA 3KCQA 3LP8A 3RTDA 1K8ZB 2QBYB 5AW4A 3T4PA 1RAAA 2IHZA 1OFTA 1EVQA 4KK3A 4TMKA 5EZYA 5TPZA 4E5PA 5LP6B 4G26A 2EQBA 5KQLA 1FRVA 1UBOS 1JPNA 2VPPA 3PA8A 4RK5A 3IPXA 4D0NA 1CJSA 2XMQA 1R64A 1YRYE 3N70A 2Q4RA 1EUYA 4BO7A 2VZ8A 1KFCB 3U49A 5JCXA 2NO0A 4QFMA 4E2YA 3W9UA 1SOWA 3NIFB 4DSTA 4H17A 2TMKA 3RG8A 1VJ0A 5FHRA 3GWZA 4FGLA 4E94A 5JY1A 1FCJA 1OGYA 4WTOA 2Z8ZA 4DDVA 3IEVA 3NONA 2O8FB 5F12A 4UE3S 3VKFA 2PLNA 3BL8A 3IUJA 3AHFA 1KVTA 2F3QA 3QQ5A 2JIOA 1L6IA 2IY9A 2Z09A 4DCVA 3EPHA 1K1EA 1QHNA 1XDZA 3OLXA 2ZI9A 5CT9A 1DAPA 4IUDS 4EPRA 3ER9A 1ZR2A 2ZE5A 1CY8A 3NEAA 5DULA 3MS7A 3KELA 5DWDA 3T7JA 4DEXA 4JI4B 1Z4KA 3AU9A 3UMVA 3MTQA 3IVMA 3MM4A 2ZRQA 1EDBA 4WVLA 3G17A 1T4CB 4E2FA 2J0EA 1L5OA 2VWPA 1ZJZA 4I3FA 2Z04A 4FCVA 5TJ9A 5EG5A 1B6SA 1T9BA 1NMEA 3OIWA 4G2TA 4F84A 5KDDA 1AH2A 1WLYA 4LXXA 1O95D 1RXSA 3GLFB 2QTZA 1JVSA 2I29A 1WJGA 3B1YA 4HQNA 4M8IA 4YREA 1JPJA 1V4NA 4O2BA 2YZGA 2D2FA 4M1WA 1GQYA 4XDHA 3I76A 3RYTC 2HJGA 1CF9A 3AEUB 4MLDA 1KPIA 4P58A 4D8XA 4EAAA 1I51A 4DLVA 2PUCA 2GAFA 1NW8A 5I7VA 1JDBB 4JLKA 4QGGA 2R8YA 4YJFA 2IRWA 1B00A 2JJ2A 2VHVA 1EFPA 2HXSA 1EINA 2JGNA 3FHCB 3MT8A 4N5LA 4DGQA 3PC3A 2B5VA 5K6AC 1WXHA 1XCBA 3PFBA 4IKEA 4TQAA 4EABA 1BWPA 3O82A 3PUZA 2I87A 1YC2A 4L8YA 2QZPA 2LD4A 3SQLA 4DB2A 4DG5A 1GWNA 1POXA 1HO3A 1F3LA 2IYUA 4K28A 1SHLA 5I9IA 1RXEA 5IKEA 1O9GA 3NAGA 4IKOA 1G8HA 1CZRA 1ISFA 3PCRB 3ZNPA 1PZFA 4Q1CA 5AW1A 2QN7A 5HKOA 5HXAA 4F7WA 2C9BA 2VTBB 2C94A 3WKAA 2VSQA 3C8HA 2WG0A 2JK0A 5I3CA 4FYVA 3EXAA 1L4YA 3T7SA 2H2IA 1JA9A 2NTJA 4MAMA 3VDQA 3U4QA 1U7HA 4ZEWA 2Y1XA 2DBVO 3Q0EA 3RRMA 4LKOA 2FPUA 4JKYA 1C14A 1P2UA 3AGQA 3H16A 3UT5A 3ZKWB 3AY7A 4JLAA 1XPUA 1FDTA 1A96A 1L4EA 4EENA 1TL7C 4AJKA 3DOJA 3I42A 2UKDA 1KKLA 2BGTA 3G6WA 2PSHA 5BR4A 3D2LA 1W2HA 3NFYA 4XYEA 1E4EA 3BAFA 2XNHA 4MQUA 4TKUA 2I03A 5BNIA 3PXDA 3K1TA 4ZREA 2XVAA 4EZEA 3NKFA 4J0CA 2JLWA 3M6AA 3DXZA 1YACA 2V5UA 3IP7A 4RVSA 1LNQA 4D1YA 5KCZA 16PKA 4HRXA 4RVFA 3BRWD 2FOIA 2HU2A 4LVUA 2RHWA 3EUFA 3MMXA 3CRVA 1QGUA 3OLCX 3VZCA 1SXJE 2CZCA 1SBTA 5HDBB 2AWNA 4YB8A 4H9GA 2H9YA 2XQJA 2YASA 4HWOA 4OH7A 3TOZA 1ZMTA 1QHIA 3O93A 4KKVA 3LFUA 2JDIA 1SXQA 3SC3A 1HA3A 2QRJA 2YUTA 3AC0A 2O2HA 3L1JA 4F91B 2YWFA 1Z39A 3AWDA 1ESDA 2CLLB 3IV9A 4H7IA 1PEKE 1SIUA 4AQ7A 3KKQA 2J30A 2PO5A 4C76A 3WK4A 1PP4A 3QGMA 4J1QA 4L7VA 3HG7A 5KQRA 4AZWA 2OUKA 2WKSA 3DZIA 5E8RA 1AOXA 3BJRA 3RVNA 4KWEA 3T9DA 1BWSA 3RW9A 3QLUA 3BX1A 3E5MA 3DEZA 1KQNA 2BFCA 3URMA 4IQ4A 5GJBA 1X38A 2BDTA 3F8WA 2RH9B 2WJ4A 1YS4A 5EUMA 1SCDA 3U4GA 4MW0A 1P7ZA 4KWHA 4ZVUA 3BORA 2IYSA 3GJ4A 5FUXA 3BN3A 1GZUA 3EXG1 1SU6A 4Q9DA 2BEUB 2PL9A 4RNCA 4MRPA 4BCDA 4E5UA 1KKMA 4NP6A 3ADBA 3F6PA 1D09A 1CQJB 2O2DA 2VAXA 4ZVOA 4EHFA 1E0JA 2XMDA 2PNJA 1TAHA 4MITA 4ND1A 3EHDA 3IAXA 1X3LA 1Z0JA 2IF0A 3GG2A 5DH9A 3ZGXA 1PWYE 2EAUA 4MZXA 3UXYA 2O8BB 3W06A 2VEDA 4AS3A 2SNIE 3RHSA 3TTWA 1Z18A 3ZHQA 3EVNA 2ZIAA 3BFPA 1J07A 2WE8A 1LBIA 1X15A 3I62A 5GZ1A 1EIWA 3O38A 3IH5A 4TLDA 3IT3A 3AI1A 1E3IA 3LQYA 2QTVA 1Y7PA 3TXYA 3R0XA 1PFGA 4IG9A 2NT3A 2R8BA 3ELUA 4GBED 4GP6A 3GPDG 4G1FA 5EWLA 1SG9A 2Y1WA 2PWPA 3WQRA 1EEXB 2CLOB 4DLTA 2W90A 2ZG6A 1B15A 5DGIA 2HA7A 4UFNA 4FXPA 2HWKA 2O1EA 4ZI7A 1DWUA 3OKPA 3P9RA 4DC1A 2J9XB 4DC0A 3KAQA 3VH2A 2BEWA 2WT8A 1J0BA 1R6BX 4QHSA 4RA6A 4F12A 3TOVA 2XUQA 4H7DA 3TW8B 1VMAA 2ZS8A 2WR8A 4UU0A 2B4RO 4CM8B 4LRSB 3ICCA 1PL0A 3FROA 4IJKA 2IX9A 4P34A 4LZWA 2HK7A 3P2EA 4JJ6A 3DR5A 3NVAA 2NO7A 3DV0A 3P9KA 4KH0A 5JCJD 2NPIA 4RULA 4K8RB 4LJYA 5BNFA 3LCRA 4BQSA 2JF0A 1XWFA 2B5WA 2C9CA 2D1RA 1S7CA 1RTKA 4WLEA 3VFDA 2OCBA 1D6JA 3I01A 1CJUC 2BYTA 5HJ7A 1N6PA 4TV8B 5LL6P 3DT9A 3KUKA 3GGDA 3ZJYA 1GPLA 4QHTA 1FIUA 3PVSA 1GGFA 2SICE 1U9IA 2Q9AA 2GO1A 1LKZA 1E2LA 4LPSA 1ZISA 4MCIA 4Q9IA 5IC6A 3UWDA 3VOBA 3FLEA 2OL4A 3SYMA 4U7GA 2IIBA 1V37A 3OEYA 9ABPA 4MHOA 2BE7A 5C1PA 1R0BA 2QG6A 3FWYA 3TG2A 4E08A 2WSIA 3OU7A 3ZKAA 4URVR 4AXXA 1OWMA 1RYDA 3DMPA 3NO4A 5CFPA 3WQSB 1M2EA 3B5EA 1ODSA 5FOUA 2LGJA 4CCYB 3AF5A 3S4YA 2OYCA 3JVEA 2PRZA 4CF3A 2BM8A 1BMFD 3L0PA 1VLZA 3TFOA 4UUNA 4B76A 2H6EA 4MUFA 3RIXA 1H05A 1P9OA 1W76A 1W36B 3HLKA 4FC6A 1SUPA 2PY6A 3N05A 4KYUA 3V6LA 2CSUA 5CW2A 4NARA 4J49A 5BV0A 2GILA 2CJFA 1GA1A 1XXHB 1KJJA 3OQIB 4AT1A 3L0BA 1NI4A 3MS4A 4G0OA 1Q0LA 5AOCA 2P2DA 2ZBGA 4G0PA 3K09A 3MJEA 1M34E 3QEKA 3QTTA 1HG1A 1US8A 1Z17A 5KIAA 2Q1SA 4A73A 4YRFA 2OAP1 1GQ2A 1MH1A 3G9UA 3OZEA 2HMTA 4C0WA 4F2DA 4J3FA 4C0KA 3E8MA 3TZKA 3UJCA 1G0OA 5B1DA 3TO5A 1MG0A 2P0AA 2XYVA 2R00A 2ZRMA 2AOVA 2QRUA 3DBIA 1J1IA 1E0SA 1AGPA 3EQ7A 1XA3A 1TAGA 1XHFA 2CCGA 3MRSA 3B7PA 2IH4A 1RPAA 3WNDA 4F9TA 4JLBA 2X0DA 3ENNA 3TM5A 4OLFA 2Q5QA 1GVHA 3DQPA 2J6IA 1ZA1A 4YNBA 4YQEA 2PT6A 4K9QA 1O96B 4EYQA 3DTVB 4TYWA 3P20A 4IZIA 4RABA 3TSZA 2ODBA 5DBFA 4OGLA 4BPBA 1CJTC 1F06A 3GVCA 3USES 3EFOB 4GO1A 2HA0A 1Q6YA 3JRNA 2YZ2A 2H7VA 3LUHA 1D2RA 4R81A 3DTVA 4G5OA 1C8VB 5E1OA 3KQHA 1E5TA 4DV7B 1ZG3A 1W5FA 3THWA 3H2HA 2HYDA 4EJ2A 4QE3A 1K68A 2BHTA 5JD6A 3VKVA 1MRNA 3EK2A 1J8YF 1V9SA 3PTLA 3GRAA 4MUJA 2HJVA 5HA5A 3U17A 2PE5A 2FW8A 4FILA 5H3LA 1P77A 1UZNA 4NVRA 3EIXA 3HDTA 2VHTA 3KPWA 3QYFA 4PN7A 3LO8A 1QYVA 5ULLA 3OMWA 3IIKA 1MDFA 1AF4A 4G0VA 1YMUA 1T4MA 1TC1A 3EGWA 4Z2AA 2QD4A 2BKVA 4RVGA 3UJBA 1Q1NA 4YI5A 2X2PA 1R7RA 3IBCA 5DX0A 1VB5A 2W2TA 2G82A 1H4SA 1R66A 1WUIS 4GPAA 3QE0A 4ZOCA 1UMBA 4CCWA 2GM9A 1W87A 4XR9A 3OX4A 1CPYA 1U0NA 2C7VA 1E4VA 3EIUA 4TV9A 1KI4A 1G21E 3B1ZA 2O2EA 2O5EA 2XUFA 2SECE 2ORVA 4L5BA 3L82B 3HY3A 2HHAA 3QVXA 3BB4A 5B1IA 3V7FA 2ZVPX 1GFIA 4ENSA 2YS6A 2IHNA 5LMCA 4DLYA 3EF1A 4EY6A 2A35A 4UBIA 1DCMA 4HNVA 1SVNA 1ZCZA 1WPRA 5DM4A 3D6NB 3LHIA 3BXZA 3E2PA 2FMTA 2CJPA 2H65A 1JZSA 1X8XA 1E58A 4LFAB 4J91A 3UGQA 1T36A 3CTPA 5JECA 3Q8MA 3D1LA 3BVPA 2J0SA 1AQIA 2P90A 4G5QA 4LXQA 1A9SA 2E55A 1E3JA 3FUXA 3KEOA 2J59A 3OURA 3WK5A 3QWIA 1HT1E 1E3EA 5HNKA 5ISMA 2QTBA 1P2FA 3CLTC 3I6QA 1F5SA 4WOBA 1Z7BA 3H9UA 4GGPA 5JWHA 3LUKA 3TE6A 2I76A 1PW5A 2IE8A 1IYZA 4KWCA 2P9CA 1JTVA 4D3ZA 3OICA 4W1RA 1YZTA 4H3SA 1KDVA 4D5EA 5JTTA 1RRGA 1ZH2A 3N2GB 1IIBA 4HDKA 2X9LA 1KVQA 1JJAA 3PSAA 3BXGA 1YZGA 4UBOA 3BBLA 3KOYA 2QMYA 1TTQB 2JIZA 1KEPA 2A58A 4H4EA 3R9XB 4GX5A 1J2YA 2I1QA 1YB7A 2PKEA 1FU4A 1YIOA 1FQOA 2HT6A 1DJQA 3LXXA 4GZMA 3UEOA 3HBFA 2CUZA 3A36A 2ZK7A 3OC0A 3LQ2A 4YRGA 1G3IA 1WHTB 2G5CA 1HOXA 4LOLA 4NOJA 4JL5A 2OCAA 5CDFA 5J58A 2D54A 1G8SA 1ZGJA 2OPBA 2QD3A 2WP0A 1C3JA 3QFCA 3QBJA 4M76B 4ZN6A 3MB5A 4CIYA 1U7UA 2IZ6A 4MKGA 4M9RA 1FP6A 1NLFA 3G23A 3JQ9A 4GP9A 5FI5A 2EYQA 6REQB 5JNVA 5HIMA 2CXTA 5FNZA 4NG5A 1THTA 1II8A 4TVBA 4A2PA 3G2MA 4U4AA 3X1YA 2ATIA 3PQ3A 3VO9A 3FJOA 4D0GA 1VHDA 5EWLB 1B0ZA 3AHJA 3FI9A 2C3PA 3PGJA 1FMJA 2OY0A 4WKOA 2B7LA 3AFIA 2Z6VA 1H1LA 1PHPA 4UXHA 3AH8A 4KEAA 4O2RA 4AU1A 3PJEA 2VNKA 3AI3A 4B6FA 3HEBA 2IYVA 4LA4A 3AR8A 4PYIA 2PMEA 1HDIA 1U7TA 2C0PA 5FAKA 4JYPA 5P8WA 2CVOA 3EVBA 1WCIA 3BRCA 4JP5A 5FBLB 4XLZA 4EUEA 3RFUA 3R5TA 2REOA 1IWPB 4L4XA 4LK2A 1U3VA 3F5SA 2HWWA 3TLCA 2E37A 3X1KA 1RXIA 1RVDA 5I4CA 3VGPA 1PL7A 1QHSA 3AR6A 1JSXA 2G63A 4OQYA 3WGNA 3QLEA 2V8OA 3PHGA 2R8PA 4IFIA 4KE7A 3KJNA 1OFUA 4Q4CA 2HRDA 2WD7B 1OKKD 3PNQA 4HX9A 4PLZA 1MOPA 3KOUA 1LXCA 2IXBA 4FR5A 4Q4HA 1FXWA 2CFCA 4QU8A 1HI9A 5EMNA 3ZY6A 1V11A 1ZEJA 4MHTA 2IYYA 1CLEA 1Y80A 3H5IA 4MULA 2IPOA 2FX5A 3EXHC 2LPMA 4AK9A 1ZFNA 1V26A 5EIBD 1CB0A 3MRXA 3UUFA 3R6GA 3GYBA 4P83A 4JJZA 5KVQA 3PVCA 3KR0A 2OCXA 3KZ1E 3OMXA 3ZIDA 5BN4A 5CCBA 3OQNA 3NG1A 8MHTA 3JZMA 3F96A 4CMAA 2PUBA 3TSOA 4FGZA 2AYXA 2XUGA 2WOJA 1IXZA 3GJ7A 4RQTA 4HLQB 1Q0UA 4L3VA 4KE8A 1V8OA 5DWVA 4IUYA 4ZOAA 5MDHA 4FWIB 2ECKA 5HZHA 1Q0TA 2BFEA 2W8BB 5A6VA 2P35A 2PD3A 5IPFA 1NW4A 3IIEA 4FQ8A 4TLAA 2XHZA 3D2BA 4EYKA 3LQKA 2VPZA 4MI6A 5HP4A 4PWZA 1EVIA 1VRWA 2YS7A 3VJMA 1P0MA 3EHEA 4XM0A 4LQLA 4IFBA 2HO4A 4ND5A 4PQRA 4YJ3A 1JDTA 1SCIA 4J07A 4WY8A 5IM5A 1DV1A 5DMHA 1T4DA 4B0PA 1IC6A 1MAUA 3PFWO 4XSGA 4Y2UA 1MQSA 5K8CA 3BF8A 1D1QA 3Q9LA 1Z2PX 4HWPA 2V0GA 4F1KA 3MPUA 2NU7B 2H29A 3ZLTA 2GZAA 4TKUB 2V7WA 2EKBA 1MC8A 2Q50A 4GMKA 3WV4A 4I5GA 4XVUA 1E3LA 3IS3A 4JC4A 5KX5F 2B6NA 1WCIB 2DSNA 4YLEA 3IP3A 3PC2A 3V9PA 5J4VA 3VJRA 4O0LA 4MYTA 2FAXA 3ETJA 5GJVC 3WI7A 1Y6RA 3P9YA 3GUHA 4MMXB 2R3SA 2RH4A 3D8TA 1R6VA 2QY9A 4V2UA 4Y2RA 4FNGA 3SOZA 3UMGA 4GOKA 1Z8NA 3GZJA 3NXSA 1VI5A 221PA 3AETA 1QB7A 3PFKA 4Q9JA 2HU7A 3ZGVA 3IPAA 1F8UA 2YBEA 2QN2A 1EP3B 3FMVA 4ZRNA 3E5HA 4ND8B 5HS6A 1M8JA 1ADYA 3FB1A 4QYMA 5ALOA 1L7AA 4FCTA 2WDPA 3PRJA 4H18A 4LBVA 4H3KB 3FCOA 3K2BA 4PPFA 1TU0A 2PUGA 2QJWA 3AFMA 3FXAA 2WAXA 1JHQA 2UDPA 2I2FA 3BGIA 4LXTA 4XXHA 5TT0A 1FU7A 1MW9X 5M7EA 1FDSA 4ENUA 1X7GA 4OA8A 1KEVA 4KR9A 3AV3A 4QXQA 1W96A 1GT91 2ID7A 3W2FA 1OFGA 3G1WA 1EFAA 1YU9A 2BFMA 3UK1A 4ECEA 5C2JB 2IOYA 4L9RA 3QPDA 4EO4A 2BELA 3HTXA 2HQBA 4Q9AA 1P2GA 1B4DA 3UPDA 2WHYA 1RYHA 3DLTA 3H9EO 4UTZA 1Q77A 4BWFB 2JFVA 3CR3C 1W0KA 3NGMA 3S29A 4UC0A 4ALMA 5F3DA 1RXUA 5K8TA 4W4TA 1YZUA 4V0QA 3RAEC 5I3ZA 4UEKA 1BKSB 1PT8A 3JX9A 3PWSA 3GJRA 2VO1A 3CISA 1MH9A 4D98A 1CXZA 4RMNA 4QATA 1GPKA 4AZ3A 5EEHA 1BROA 2NV2B 2H5LA 2XDAA 3L9XA 4O2BB 1YR6A 3HKDB 3OKCA 1QZZA 1V8BA 4OQEA 3OZ7A 2V5AA 2II6A 2KHZA 3VHLB 1RQLA 4BFYA 4D4IA 2WTEA 1YHZA 4QGAA 5J59A 3TDKA 1Z28A 4M1ZA 1H42A 1BGVA 1WMDA 3TAHA 1UJ4A 3BXXA 4KYIB 5DYYA 5KOJA 1N7JA 1GD1O 1WE2A 3HNRA 1VLQA 2HMSA 5DX1A 1K4KA 3ND8A 4ZOBA 2PRYA 4W5JA 1ECCA 4B6JA 2WT4A 1HDYA 1KVSA 2H16A 1WBBA 4O02B 1L5KA 3L6CA 1Z37A 3OBIA 1EM8A 1JDVA 2HY7A 2CN1A 1OBHA 4L28A 1TJ4A 2IZ5A 5CPBA 3UOGA 5AXCA 3OT1A 4E11A 3TAXA 2AFHB 3OTQA 1U4SA 3K72B 3LX6A 4INOA 3NBKA 4RMJA 3R9WA 5G0SA 4CXMA 2O8FA 2QRGA 2Q7XA 3VZQA 3B85A 3UPUA 1ECLA 2VAWA 3OKAA 5E0KB 2ZIVB 4JAVC 4LGMA 4QA9A 5CYGA 2MT9A 2PBFA 1X13A 3X44A 2HYIC 5M29A 1QHFA 1K7EB 1G7CA 5A7FA 2HAEA 4RH3A 2ZROA 3P5BA 3TRIA 5KNCD 3C2QA 3ER8A 1XZJA 1A7UA 4N4AA 4NMMA 3H5LA 1FRNA 4TYMA 4ZOLA 1NP3A 3IBSA 1D0IA 4Y2XA 3L0IB 4EI9A 1C80A 2XDYA 4CI0B 1U0FA 4DQVA 2UVPA 3HHEA 3M6WA 3QE4A 1A7KA 1J33A 1GAXA 1W35A 2VQFB 1MGPA 4MPDA 3PC8C 2VIIA 5GY7A 3A2LA 3R7LA 1CZKA 3DM5A 3DVQX 5ALQA 1C30B 2GN4A 2C95A 4PO1A 1LLUA 1PG0A 2J33A 4OGWA 4XPIB 3RV4A 4E3WA 4RSHA 3ZD8A 1VA4A 2NM0A 2ECFA 3UAOA 2OYRA 3WRXA 4BVEA 3W77A 3DJYA 1S3SA 3P2YA 4L4ZA 3O95A 3T1OA 5F9FA 3R40A 1K5PA 1NOKA 2P5TB 3VPDA 3QLTA 3MMZA 3R7NA 1O0BA 2XXAA 1C3OA 1Y3AA 2QRKA 1EVZA 4BQPA 3WQBA 4DUGA 1TRHA 2G17A 4D25A 2GPWA 1OU4A 1NONA 5TQ0A 3K9GA 4YAIA 1PIWA 1V41E 4JEUA 4LYAA 1GP2A 3TW6A 1RJFA 3RIGA 3C3CA 1A9ZA 1OY1A 3KOXA 1IQRA 3BIXA 1O95C 3WWCA 3RRFA 3D02A 1AO0A 3QEOA 1CULC 4CMEA 5DLDA 4EOGA 1KDRA 3OG9A 1BOOA 2DH6A 2HCTA 3ZVKA 4GT1A 3D9QX 3MEQA 1QV6A 2GYWA 3PEVA 2UUCB 2UVQA 1UBKS 4G5FA 3N8HA 4QOGA 4Y2GA 3NBXX 1NZFA 2PGOA 2PHZA 1PEDA 1EXWA 4V0SA 3UJHA 4QO8A 4AKEA 2A9FA 4FOTA 3PE6A 1PR5A 4X63A 4BJ1A 1H3FA 3DBHB 4YRZA 5KU1A 3ELDA 3CLVA 4QYSA 4NULA 5IFKA 1GUFA 5EIXA 1Z5WA 2O05A 4MEBA 2GWRA 4QPDA 1UM9A 1VHLA 1C7FA 2X3FA 2XSZD 1XRLA 1UT5A 2H1HA 1UC5B 3CEAA 1T9CA 2VDWB 2WV7A 4LYJA 1EFHA 4R98A 5F21A 3RFCA 5JAPA 2I7VA 3TUIC 5G0VA 1CUEA 2VBCA 4PZDA 2NIPA 3N8IA 2OP0A 3WZ2A 2IDMA 1TLTA 4XM1A 3LNCA 1Y3BE 1VJTA 3LZ6A 1JLLA 4I46A 5CCXA 2XKBA 1L4UA 2AJCA 1SCUA 4AFNA 4DAEA 1J5EB 4MI1A 2A86A 1HY3A 1MU0A 1WUHS 2XUOA 2ZYWX 3AKCA 3L7LA 3G3EA 5DEIA 1UFQA 3HJNA 2XCQA 2D2XA 3HXTA 4HGRA 3NTQA 5CGZA 2GCOB 2IKQA 2OHOA 5EIFA 5FPTA 5GIPE 4ER5A 3D2CA 4N8EA 2AXNA 1AKTA 3SIXA 4Z6KA 2X7XA 2B36A 5CVEA 4ISCA 4DV5B 2A0YA 3HO6A 3PDHA 2MYNA 4UHKA 2H0QA 4A0RA 1C9JA 1AHIA 5AI9A 3R8XA 1Z45A 1E9BA 3QIAA 4HSEA 3WB0A 4BNNA 2D2EA 5DZSA 4DLLA 3PR1A 3Q6NA 4ECAA 3N0XA 1L8QA 2AX4A 4URZR 3VM6A 4MCJA 3GGSA 4NLLA 5HQTA 2QLBA 4B4KA 1RW4A 4M98A 2O1WA 2VOJA 3AIOA 4K7JA 1E6EA 4E1VA 4U7HA 1Z6YA 1E2NA 3AEQA 3NYQA 3R0IA 3WYDA 5CFQA 5AI6A 1TK3A 3DBRA 4X3OA 2PAFA 1ZH4A 1DXOA 3DM9B 3SSAA 2P0EA 4UAGA 2X6TA 1Q5PA 3DOFA 1ZQ9A 5F76A 3GDHA 1P0PA 5TMPA 6GPBA 3QLJA 5THQA 3R7SA 2JI7A 1HNZB 2XE6A 3L40A 1FUUA 3KHSA 3DAFA 1AKUA 2QD2A 3EDRA 4Z86A 4CGZA 5FUWA 4XQCA 1M6YA 3AVPA 2FUG6 3GNQA 2EQ5A 2W6IA 1JXQA 3B5IA 5DGDA 5CB6A 5ABPA 3QNMA 5D5PA 1PWXA 1G98A 5HGJA 2CT8A 1CRQA 4RLSA 5AVKA 1MV8A 3TTSA 2JK1A 4R1MA 1DX9A 3V7WA 2V4ZA 4XX0A 3GL9A 5DHQA 2WC1A 1VE1A 3NRCA 2P7IA 3SEFA 3WJ7A 1JHOA 1MDBA 3DOCA 1UL1X 2KI5A 5AK5A 1N2HA 3I34X 1R0SA 2O2YA 5EE9A 1IBSA 4ALIA 4FE3A 3DE3X 4PR0A 1YCFA 3NEPX 4TL8A 3IEMA 4XDGA 1X1CA 1IN5A 3A11A 3L92A 4NONA 2FWMX 1CQJA 1J5PA 5H70A 5B2ZA 4PTYA 3PD7A 2A94A 1EP2B 3BGSA 1UDCA 2HTEA 2PXAA 1JEDA 2C84A 1NM5A 3A1TA 2ZUSA 2HXYA 3DE5X 4QU0A 4BQQA 5BYBA 2BCEA 3QX9A 2RJ3A 3RREA 2O4UX 1WZUA 2PGNA 4QNRA 3AM4A 4BMDA 4P9NA 4TXHA 1CU1A 4B2LA 5ILOA 3PGA1 1VE6A 3D6AA 2GZ1A 4CLXA 2XEDA 4Y0AA 1ZQ1A 3FCSB 1MZVA 1XWIA 2B1GA 4ARZB 4CM7A 4R3NA 4RQBA 3R76A 5K0EA 1IRIA 1FRFS 1LS1A 3THYA 4NZZA 2V4MA 1VLHA 3FUUA 5EERA 4NI5A 4X95A 3BWCA 5DXJA 3U6KA 3HC7A 2IEYA 4MV9A 4MTLA 4V03A 4ZRDA 4LJRA 3FNIA 3I6ZA 4WDRA 5DOVA 1Z74A 2XTZA 3O4GA 2D5LA 1KZGB 3QY0A 4N0EA 1V1MA 1M1XB 2JJMA 2EJUA 1DLIA 1GADO 2MSDB 2QAJA 4IIJB 4IDBA 4OM8A 2C0CA 1E2KA 4TWIA 5GZ3A 4ZICA 3A9WA 5LP1A 5KYGA 3AETB 4F4HA 2FEMA 2JGJA 3SS7X 2WU8A 5B58C 4PQYA 2R1VB 2QVYX 1IH8A 3T9AA 3DW3X 4W6ZA 3UJ8A 4KXMA 5T6BA 1DQPA 4Z4FA 4UEJA 3EJ6A 4MYRA 4BGDA 3VV2A 1QOQB 2JFZA 4U7TB 3WDLA 3W8RA 4E12A 5JLJA 1USGA 2PO7A 3OQVA 3OTOB 1Z4PX 1NXTA 1T8PA 3I30X 4LDAA 3BMNB 1E1CB 3PFHA 4X92A 4ILKA 5EUBA 2WJZB 2EW1A 4OU5A 4IDAA 1GLVA 2NU7A 1QZTA 1H6AA 1TM5E 1WF3A 3WJAA 3RS7A 3VQTA 3KB8A 2IS2A 5A9TA 1AMNA 2FPIB 4P7FA 3C6QA 3K9QO 3U4IA 1ISMA 5LUBA 3ADOA 1Q7CA 1Y5MA 1ZINA 2B82A 3P0EA 4FFBB 4I5IA 4YBRA 3RSCA 2ZI5A 4PS1A 1ESMA 1AUPA 3AHHA 4CEIB 3AKZA 1W49A 2ZT5A 3SYNA 4H4CA 4IFTA 4JFRA 4K6HA 1PAUA 5FWYB 4G41A 3IVCA 4TQGA 2R1VA 2W4IA 1EEHA 3SSNA 2ZW9A 2XBMA 2IXGA 3A7EA 4K8OA 2I99A 1Y1KE 5F7XA 3E7FA 1E0KA 3JAKA 4URWR 4YR7A 1MT0A 5DF1A 2C2HA 4BQOA 1V7PC 3NVKI 2IEGA 3GA0A 2BY4A 3FRJA 3HJRA 3ZHRA 5LBIA 4C7XA 1J20A 1NJ5A 3HA2A 4WLFA 4YK7A 1AV6A 1XLTA 5SV2A 3S0JA 3EIFA 3D8SA 1OFIA 4ZQIA 2GX6A 3TCXB 1H6CA 2UUPA 1MZPA 1RJWA 3HDHA 3Q4GA 2A5FA 3A10A 3LX8A 1XAJA 1GNTA 2IDZA 2Z5LA 4NAVA 1G4AE 3X3HA 1LK7A 1TQDA 5TVKA 4LRWA 5IJZA 2ZR9A 2WYWA 1M54A 2Z30A 2VDPB 3H9BA 1M0EA 4FSDA 4B2YA 3I9V6 1NF8A 2IEBA 4RV5A 3U3OA 5A7GA 4JI6B 3ZW7A 4DT1B 1U0EA 1XE3A 2WLSA 3IIIA 3GWGA 4MUHA 3U3RA 3MJSA 4LJ6A 1EI9A 4ZT6A 2XITA 4WADA 4II3A 4CQLA 4H6PA 4ZAYA 1RKXA 3JVDA 3WOHA 1VKZA 2V7UA 3GJSA 4K1LA 1YCHA 1WKBA 1YS1X 4AMZA 3AILA 4UOQA 1Y3IA 1Q17A 4LDJA 1PFUA 3OWHA 4EWLA 4EVQA 2XYQA 3DOUA 3K9HA 3HR8A 4Q7MB 4B7CA 1X80A 1YIDA 4W7HA 4YALA 5GJWC 3ZHCA 5JH7F 8AT1A 3HXQA 1LRJA 1O94A 2GRUA 4QXPA 4AYXA 2EJVA 1IZ7A 1SC9A 3EDQA 1COZA 2EX1A 3EUAA 1ZN8A 3MC1A 3ORYA 3TSCA 4CKCA 3H5NA 4RDHA 5BUSA 1XD2B 1OR8A 4G5SA 1P80A 1W5BA 5A4DA 3GT4A 3AIKA 1FDRA 1EBBA 4CKBA 3T7TA 2WTNA 2C9ZA 3BIOA 5JIBA 3KOMA 2C5BA 1DOZA 3PQDA 1Q1GA 2RC6A 4XD7D 3TLXA 1TYDE 3VU1A 5IDVA 2ZBVA 3T5BA 3BMQA 4H6WA 4NHOA 2L82A 3LRTA 4P22A 4LRTB 1UR5A 2JI6A 1ZP6A 3B3QA 1V8ZA 3PS9A 5HBRA 1UEIA 2OESA 2OHXA 6REQA 5GVSA 1BHSA 2VHUA 1KMHA 2ZRNA 4FEYA 4PV7A 4BQFA 5M04A 4MLZA 4KNYA 4NIMA 2PX5A 3SN6A 4G0QA 4QOIA 4B0OA 3OJXA 1XSEA 1Z34A 3H97A 1JNXX 1QKKA 4HRVA 2QNIA 4K40A 5AXAA 2MCFA 3WWOA 3ZY4A 4XRGA 3T5PA 2V45A 4ZANA 4EEXA 2BMDA 2HPVA 4P82A 3HXOA 2RE8A 4B8ZA 2ZJ1A 4F56A 2G4CA 4UNSA 1TU3A 2OGSA 4BBAA 2VRWA 2QN6A 2FEKA 2F9LA 5EE1A 3A4LA 1JZTA 1XGKA 3R3ZA 1ZIXA 3K1JA 4MV8A 3PJDA 1N7GA 2JCSA 4KNWA 1X9HA 4UZEA 2FK7A 4J1TC 4KRYA 1MA3A 4LQ4A 4IQFA 5FYQA 2C61A 4HYEA 3GYGA 3TVTA 5K45A 1K92A 3E3LA 4HEA1 3ETHA 4PFSA 3ITNA 4QEKA 4YPOA 1TM7E 2P9GA 1C9DB 1O5OA 1OA0A 5HE8A 2Y9MB 3EZ7A 5EQTA 3EVFA 2V97A 1RHMA 1DKOA 5DOZA 3KPYA 4OJKA 3X1XA 2ZTMA 4MI3A 2R9VA 5IG2A 1EBUA 1OFHA 2CXPA 4ZDKA 2E48A 3T15A 2QQ0A 5DKFA 3SKVA 3BRSA 3ORFA 4LC0A 5KBYA 2F1HA 4MQMA 2FXIA 5AQEA 5B3JA 2IUTA 3H1AA 4FFWA 5ENZA 4XWOA 2CFTA 2DPYA 4JBGA 2Q5JA 1U8CB 2RGNA 4BEJA 4FP9A 3CF6R 5CNIA 1Y6ZA 4ESVA 3S70A 2FFBA 4HLNA 4CL8A 5ADWA 1XLUA 2CFIA 1ZY2A 1R37A 5E3IA 1VB3A 2IA5A 2I6SA 3CZPA 1EUZA 5JV5A 2GJ9A 1IBRA 1QVWA 1ULAA 3W5DA 4DCGA 1MEOA 4NXMB 2DF8A 2ICAA 1BEUB 1TUBA 3ZYZA 1FB5A 1EFRA 4QUKA 1RZ3A 2O19A 1NV8A 1G9SA 3LL4A 1M5TA 2FPSA 2RGAA 4XD7A 4AJ2A 4DHWA 3DMDA 5KTMA 4NCBA 2Q9BA 1BHJA 4J2HA 4OFZA 4X7PA 1QHHA 3V8BA 2QNRA 4B46A 3ZI4A 2HF9A 2XJ9A 4B8YA 2G06A 2YY7A 2QW0X 3WB1A 2C4NA 1YQQA 4U00A 2JHFA 1D8AA 3GOQA 1AZTA 3O9MA 3RHFA 2GN0A 5JSZA 4BC0A 3SGLA 1BXGB 2KLBA 1QYXA 5DN6A 5JQWA 3IKLA 2GCEA 1EK2A 1GPYA 1DXQA 2A57A 2ORYA 3LX4A 4NJEA 5DNDA 3LZCA 5JD4A 1NF2A 2GNPA 4HDMB 4GPTA 1BH2A 2GJ8A 3FN4A 3WIBA 2JLQA 3PQCA 1EQUA 1H66A 4NBNA 2WD9A 4MVJH 3T1QA 4ZI3A 1WVMA 3F4LA 3RADC 2F3UA 4GEGA 1TVEA 1VIMA 2VJYA 1DAHA 3ZJ4A 2DHQA 4ALLA 3FDJA 4RVDA 5KYWB 4S35A 3HNPA 2M6KA 1V48A 2GLTA 5DHSA 5H9VA 2JGMA 1NHGA 2FYTA 1S2OA 3BH0A 2ZIEA 4L51A 5GAJA 2IOQA 2ERXA 2JH3A 2O3QA 3STXA 2OB1A 4CFSA 1W6UA 1KRXA 2A5DA 1U1FA 3AL0C 1RC1A 1OC2A 1YMQA 1AS2A 2C88A 1UIMA 5EL0A 4OAQA 4CF4A 1BMTA 4LDNA 1ZSNA 2FU5C 4FI3F 2GS9A 4KTVE 1B42A 1YZ3A 2WA2A 3FNBA 2OSBA 4S1NA 5JBIA 3U56A 1IN7A 2VDQB 5ALJA 2E21A 2JJ1A 2GNAA 3AW9A 3LC0A 1N9GA 3ZZNA 3GLIA 1DX4A 4M37A 1LSUA 4YIKA 4C2BA 4E33A 4EI7A 1ODTC 1QYCA 2DJ5A 3NHSA 3WXMA 4GLBA 4L9WA 1FDUA 3OX1A 4M0PA 4YUWA 2DKOA 1ZAYA 1PZXA 4LJSA 3CS3A 1RYFA 1Z12A 1XRQA 2FGKA 4CIXA 4ACAA 2QLFA 2ZTUA 4ZMSA 1LI4A 1OXMA 1M76A 4KSCA 1J2JA 1OPXA 2I7TA 3JCZA 4U3JB 4E4YA 3RAGA 4CKEA 3QFFA 4MIKA 4Q3NA 3PHIA 4UBMA 5L7WA 3VMFA 4G4IA 5L9AA 1ENPA 3R24A 5JYBA 3NHZA 3PGKA 4ZT2A 1ZLXA 2HA4A 1RMQA 2FPXA 2HDHA 4EYSA 2AFIA 1I7LA 1ML4A 4ZO6A 3AK4A 1LUAA 4MK4A 3QBTA 1FVHA 2GBGA 3EF3A 3GEGA 4LJKA 4QULA 2HJ9A 4UQOA 4G9GA 3QPAA 2HZ7A 2YHUA 2H52A 5H02A 4LYEA 3GLIB 1BRMA 2PWZA 4ZV7A 4MWSA 2A1UA 2G40A 2H1SA 4G6ZA 4IEIA 5CM9C 4YUYA 2YNMD 3MAAC 5DNAA 2W6MA 3ITEA 4RY0A 5EXDA 3UKOA 4G0YA 1WSDA 4IOJA 3LKZA 3WLNA 3GRKA 3X1MA 1SEVA 1P1RA 1E2DA 1LDGA 1PFVA 5HFAA 3WDKA 3OJLA 3AUSA 3BF7A 3ZV3A 1GU7A 2HLHA 2JVKA 3W1WA 4UOZA 5KTTA 2J9FB 3BFJA 1O1YA 2R6DA 3DS8A 3GRYA 2W2MA 1XCJA 4G5XA 5FI3A 3CZRA 3W2EA 3DG9A 4P4SB 1FYDA 4WN9A 2JI9A 2X8LA 4NBKA 1XD9A 4PYMA 1T34A 1Y0BA 3G8DA 4K46A 4PVDA 5SYNA 4G5YA 2XPCA 3RRBA 5CBPB 2EF0A 4FKZA 1UXJA 3H05A 2DPXA 1Q1QA 2CGEA 2ZB4A 3GG9A 4RGYA 3OC6A 1W73A 4J4HA 4AKSA 4CQMD 1VYVA 4RTLA 2Q8PA 1HTTA 1SKQA 3KCNA 1E89A 4QOFA 3UMJA 2ZKIA 3ZXYA 4JYAB 3WWEA 4FFSA 2BFDB 3IVGA 5FUBA 1W30A 1OYVA 3P9XA 5EFOA 4FNAA 5CDHA 2VDRB 2FZ5A 5LP6F 4IQ8A 1JQ3A 4Z3DA 4GICA 5IDQA 4OCZA 4PIVA 1JJFA 4MWCA 1YJXA 2W2VA 2FRDC 2IF2A 2O8DB 3M4ZA 4BEVA 4EFLA 5A1TA 4BV3A 2W2OA 1M1UA 2FI1A 4N5MA 4F3CA 5C8YB 5KJFA 2HUNA 2I34A 1NT2A 2ZS9A 4PCVA 1RZRA 5AD1A 1WUJS 1KDOA 1KNQA 1KI8A 3A3NA 3R20A 1X1QA 1DIHA 1V6SA 3LA8A 1V1RA 3S1AB 3F5QA 4DUZB 3H8SA 4LV8B 3AY3A 1IHOA 2HO5A 3BKXA 3H17A 3B9RA 4QXRA 2NXWA 2EFHB 2JCYA 5ITZA 2QQGA 5C4IA 4JP1A 5JDIA 3FYUA 2GHQA 4HPXB 1OIXA 2C54A 4JVLA 5KSZA 3LRXA 4HAXA 3T0GA 3DHWC 1RHQA 3DDUA 5LJIA 1F0PA 1KI9A 2BZ0A 2NUTA 2AEJA 1ZA2A 4PZ9A 1TU4A 3R9KA 1AG9A 3OZAA 5JSHA 1F6BA 2GN2A 3RUHA 1R12A 4CMIB 1P0QA 3ABZA 1CZHA 4JP3A 3ZD9A 4DG9A 1YFLA 3U09A 1B2LA 3CLSC 1A4RA 3GUZA 3GCDA 4H1VA 4B48A 5INTA 4Q1BA 1QF9A 2FQQA 4UM9B 1IZ0A 1G8KA 2DT8A 3LP5A 5A5EA 3OZDA 3BZUA 5J2TB 4NYJR 4MQ4A 4U2KA 1Z2EA 2VRCA 4JELA 4ZZ1A 4OXYA 1MPTA 2BGKA 1LBTA 3JAWB 1MA0A 1SPBS 4MW6A 4A8JC 4E6EA 5E9QA 2I80A 3ILHA 1OTHA 2CNLA 2VF8A 1BMFA 3UK2A 5IHPA 4C30A 3N9IA 4C3VA 4R9NA 4BMCA 2AG5A 3ZWDA 1ZUD1 4P54A 3RVBA 1Z6PA 2HSEA 2AOUB 1QAOA 1Z4MA 2AB0A 2NNLD 3F8TA 4HDSB 5JXHA 3Q5GA 4HFJA 2JH9A 3FWZA 4C5BA 3R0ZA 4WKNA 4IICA 1U81A 1U3FA 4X6LA 3VAAA 1E3MA 2WZQA 3FMPB 1CSEE 4GU5A 5A4JA 2RJNA 4A7PA 1MB9A 3IP8A 1Q19A 3R6LA 4EPTA 3QEMA 1ISSA 3AJRA 1G6Q1 2EJWA 3TMYA 2NUTB 1ZNYA 1IPHA 3N2IA 1JQKA 1D2HA 1T3LA 4JLDA 5L95A 4GSKA 1YDMA 4HEA6 4UUQA 1URPA 2A3NA 3TDMA 1G5FA 1JIXA 2G9RA 1BCSA 3D6HA 3V48A 4UE6A 2UZ1A 1GUBA 3L0DA 4LBYA 3VR4D 1W0KD 4IJVA 1IXRC 1HMYA 2WJAA 5EMJA 2B5OA 5IASA 2ZSKA 2FN8A 3K8ZA 5FCDA 1QLHA 3U4DA 3ZKWA 4R4JA 4F4IA 3E9RA 5K7SA 4V39A 1Q83A 3QV1A 4P93A 1OWOA 2BGUA 4HGPA 5CVVA 3U7RA 1UWVA 1XVLA 3CVYA 2PWYA 3GQVA 3PCTA 3WMEA 1VJCA 5TMEA 4BMNA 4BIIA 5FA6A 3DFZA 4JYMA 4BMVA 3R3XA 4Z3OA 3SE7A 3KZOA 2HJRA 3PFNA 1WABA 4CF5A 3TL6A 1K5HA 1XEAA 3N28A 3AYXB 1M75A 1NVBA 3G7NA 1R6UA 4NDNE 5TGDA 5CBPA 4RE5A 2E5WA 7GPBA 5DASA 3YASA 1V8PA 2EKDA 3OEHD 1MVLA 4PC6A 1P8AA 3W1VA 2Q21A 3MXOA 4PM4A 3IQZA 1HMPA 1PV1A 1OLSA 2H4JA 3CJQA 4N6GA 4WN9B 3SFZA 2GERA 2WDZA 1H5NA 4D5GA 5I7UA 3F9RA 3KQMA 3W2GA 3TPZA 3E3AA 1AXEA 2HMWA 3IRVA 2TMYA 3N2GA 3OEHA 1HEUA 3ZTYA 5J4LA 2A3RA 5KYVA 4XYLA 5KQGA 2JLUA 5LM3A 4C14A 1MR3F 1XLVA 1GRVA 3KSUA 3Q2IA 2NQTA 1YJ8A 2VYVA 3ESBA 4WGFA 1XTPA 3S2EA 3U3KA 3AW8A 2Q6VA 1DTEA 1N3BA 2GK3A 3FM9A 4P7KA 2ID9A 3NS7A 1NXOA 1E3DA 1CNMA 2XJ4A 3B1FA 3UMCA 3AQ4A 3NYIA