2P6OA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETMWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p6oA00
1YJXA 1E58A 1IHPA 4D4KA 2P77A 1QFXA 4JOCA 3K4QA 1C81A 4GPZA 2H4XA 5HTKA 2HHJA 2P9FA 3GP3A 5AJWA 2H0QA 2QNIA 2ENUA 3C7TA 3LNTA 3LL4A 3E9CA 4QIHA 2H52A 4FDTA 1RPTA 4TSRA 1QWOA 4ARSA 2P9YA 2HIAA 4ODIA 1XQ9A 3FJYA 2WNIA 3QPVA 4EMBA 5PGMA 1UJCA 2EKZA 2OWEA 2P6OA 2EOAA 4JOBA 2PA0A 3K4PA 1DKLA 1T8PA 3KKKA 2P2YA 3MXOA 3NFYA 2P30A 3EZNA 2A9JA 1BQ4A 2P9ZA 2DWOA 5AJZA 4HBZA 1BIFA 1C7ZA 3DB1A 3F2IA 3D8HA 1YFKA 2YN2A 3DCYA 5AJYA 3D6AA 3EOZA 2WNHA 1DKMA 3FDZA 1DKPA 3ZHCA 5CDHA 1FZTA 3OI7A 2DWPA 4PZ9A 3E9EA 4IJ5A 2P78A 3GW8A 4PZAA 3IT0A 1H2FA 1SKBA 2GFIA 3IT2A 4ARVA 4AROA 4MA4A 2WU0A 1NT4A 1RIIA 3QPUA 2H4ZA 2P6MA 2P79A 1SK8A 4PGMA 3LG2A 2BIFA 1DKOA 3O0TA 5CX4A 1CVIA 1FBTA 1E59A 2HPAA 4FDUA 3IT1A 1EBBA 4ARUA 3NTLA 1QHFA 4GPIB 2RFLA 4D4MA 4EO9A 2YN0A 1K6MA 1SKAA 2AXNA 3PGMA 3QPWA 3R7AA 4E3WA 2A6PA 1ND6A 1SK9A 4D4JA 4D4LA 1C80A 1DKQA 2I1VB 1V37A 2ENWA 1RPAA 1BQ3A 5AJVB 1UJBA 2OWDA 2F90A 1DKNA 1TIPA 4IJ6A 2P75A 3E9DA 1H2EA 2P2ZA 5AJXA 2IKQA 3GP5A 2EKBA 5HR5A 3D4IA 4JODA 1V7QA 3MBKA 3IT3A 1ND5A 3F3KA 3BIFA 3HJGA 5CU7A 3FDZB 5AK0A
chains in the Genus database with same CATH superfamily
2YNMA 1IFXA 4HKTA 1PI3A 4CKYA 1JJIA 3JXEA 4OPMA 1GL6A 1HFJA 1HF3A 1HSOA 1WDMA 2CXTA 3QY0A 1OH8A 3S28A 4P3YA 1C7FA 3M9WA 4WOBA 4ND7A 2XCSB 2C2GA 3ME5A 1JB1A 4EKGA 3U0VA 2YMPA 3B6JA 1H05A 2XQGA 3FUCA 5EPOA 3DOUA 4HNHA 4WK2B 1PHRA 1CKEA 1E4YA 1SULA 2PWPA 4RL6A 1JAIA 1HNXB 3FNIA 1Q1GA 1N2SA 3BFXA 3UT6A 1XWIA 2AGVA 3U9LA 4Y9TA 3QRWA 5C5CA 5CA0A 3FJYA 1GRVA 1NLFA 3GHYA 2ZKIA 2O0LA 2P6PA 4CXMA 4B3IA 1F51E 2R86A 4G6ZA 3ZVNA 1WM1A 2I4OA 3AI7A 3TK1A 1WDWB 2B8EA 3ZGVA 1DBPA 1G8MA 3K5HA 4EYEA 1TGVA 4LDRA 2J6IA 1MW9X 1R27A 1XDZA 4M0FA 4XDGA 1PJBA 1XTZA 3IUSA 2CHGA 5FPTA 5DM60 1U80A 2GCIA 2W8BB 4N7BA 3TVDA 3WICA 2UYCA 4DR4B 2AQ8A 2VDNB 2LIVA 3IDSA 5EWMB 1SN7A 3RARA 1Q2XA 4DMUB 2AJTA 4DY4A 4OD0A 2PKCA 4U00A 5ARCA 3CZCA 2O3JA 3UAVA 5BYKA 4CIYA 3EVTA 1NLYA 1AQJA 4JI7B 3SYKA 1BFDA 1RHMA 3M89A 4X8HA 4UHDA 5CA0F 1CE8A 2C7OA 1DKUA 4LSWA 5FYDA 4EHJA 1EJ2A 1SVUA 3TRKA 3FMIA 3NHUA 3T5AA 3EDCA 1QJCA 5LL6P 2HIMA 1NFFA 1XLVA 2VCEA 4D82A 1P3JA 1RLMA 4LCEA 2OV3A 3SQXA 2GWHA 3FRJA 1DC8A 2H4YA 1E61A 1JLLA 2AMJA 4FQ8A 4PZAA 5H3HA 1E96A 3V80A 4C1NA 4Q4AA 3NIBA 2BEUB 3GRFA 4GFDA 3EY9A 4O2AB 1OIVA 2I7VA 3EW7A 4AYXA 2Z9DA 5EGNA 3W6UA 4CLOB 5FPKA 3UJHA 3PVZA 4DNXA 3U61B 4B4UA 1DIBA 1VBFA 4BNGA 4JR1A 3GI1A 5B2FA 4NJMA 4X1KA 4R83A 1DKOA 1E5TA 1HDGO 3FYSA 2CFSA 1V6CA 1F4PA 4FHFA 4LRSB 4PG7A 4BVAA 1I0ZA 4C5AA 5BV2P 3RC8A 2RGNA 5DXJA 2XX3A 1Y4ZA 3HA7A 1W29A 1ZDMA 4Y0NA 3QKIA 4L50A 5AK5A 5FULA 2ZIGA 3PNBA 4XDZA 2XT0A 1H3NA 2CF6A 3EVGA 3OWOA 4RF3A 2O2DA 5F2OA 2H07A 3FCAA 3NGMA 4TKVB 2J4DA 2MYNA 4RNCA 1Q15A 4HUQA 5JFTA 5L40A 5EIOA 4NATA 4WKCA 4IMPA 5K3OA 1YV9A 3M5CA 1M2KA 1ZOSA 2XNJA 1S3GA 1UMDA 4BZZA 4OOEA 3TTVA 2B2CA 4XPZA 4B17A 4MYRA 5HHTA 3FUTA 2Q6IA 1SC3A 3KAJA 3D3EA 2X3YA 2ZG6A 3ZLVA 3NOOA 3A6HA 3JQ8A 3VR5H 4KFCA 3EWAA 3BG5A 1EXMA 1NURA 3TTUA 4HBGA 4CIVA 1DNPA 1UUFA 4GC9A 4JODA 5LOVF 2AX4A 3EBLA 1ECJA 2R7KA 4AF8A 2WWWA 4RW0A 4GKAA 1FP4B 1YQEA 3CWQA 4RE5A 4FYPA 3KB8A 4IRUB 1FMFA 1KK2A 1QFZA 4I7EA 4O0MA 2I4LA 4WWHA 4X95A 3UHAA 5FPYA 2NZ8A 4B32A 2RC5A 3QUQA 1BMDA 3N8DA 4FOPA 4DUGD 5JATA 3BFVA 2IDZA 3MWDA 1I2AA 1QZUA 5HA5A 5JAOA 3AUTA 3CVYA 2RGYA 3RYIB 3SHFA 2ZU0C 4Q18A 1YJBA 3OVMA 3O9VA 3CB4A 4Y6LA 3HXPA 1IIRA 3FIUA 3L6DA 1YB1A 2RKBA 1IJKA 2V3VA 3EW9A 3LVQE 2N9UA 1ZP6A 3B8EA 3NXKA 5EAIA 2UYHA 2R96A 5C81A 1WXGA 3KJEA 1DPFA 3LXUX 3EMKA 3SZRA 1ZH4A 1FP6A 1SCJA 3EF0A 4MRMB 4LOKA 3SC6A 3E7FA 4DA4A 4CCWA 4A6DA 3S29A 2JI8A 4ME6A 3MW8A 4TX1A 3L8EA 4EI9A 1Y5MA 4XARA 3TS1A 2PD4A 3H7IA 1WEKA 4A0GA 5AKEA 1BKYA 3CFYA 3D2BA 3Q1KA 2CLDX 3R6WA 3RUAA 1C7QA 4AG3A 2Q4DA 4RETA 4YEDA 2F43A 3NVAA 3PCXA 1BVUA 1RAFA 2BMJA 4JOBA 2ZIEA 1YR7A 1U3DA 2QAGB 2R1TA 2PCJA 2CV2A 1ECCA 4WLUA 1LDYA 4H0FA 1T9HA 3DAYA 4Y67A 4AFNA 4URVR 1IM8A 3MJTA 4YUXA 3HO1A 2JS7A 1L5OA 2NM0A 2I03A 5IVHA 4PBSA 4JP1A 5JSZA 1I14A 4C4ZA 4RPKA 3U3DA 5EZ6B 3V34A 2BJVA 3JR3A 1GCUA 3GIWA 3CNOA 4YRZA 3UMYA 3EIOA 3W8RA 4I1PA 2E5LB 4ENWA 1P0FA 4L7QA 1GZUA 2IELA 3I6QA 2G1JA 3IPRA 1CJTC 4PLFA 1FZTA 1T8YA 1UR5A 3IKMB 2X6RA 1OI7A 2JGMA 4EYKA 3G5LA 4Y3UA 4B8YA 4Z9AA 1QSGA 1WTCA 3KELA 2HU2A 4JL8A 1XNJA 4M87A 2AK2A 4UPVA 1J0DA 4Y9UA 3VNVA 1RWBA 2H57A 4HSGA 1NZJA 1QG6A 1RYZA 1XCMA 3ZQ4A 4ARVA 4AROA 4HDNB 4KLZA 5EJ8A 4PIMA 3BPSA 3AP3A 1RP7A 1UBFA 2ZQZA 4IAOA 4UJ5A 1RU3A 3JQ7A 3WBKA 1J7KA 2FI1A 2PKWA 5IAJA 1L4HA 2O14A 4TV9A 2QN3A 2XGOA 2IYEA 1KZHA 4BIMA 1VGVA 3HY4A 1KH1A 1VRCA 4N0DA 4L9WA 3SQMA 4AWXA 3COJA 4AKIA 4UZSA 5CIWA 1Z22A 1JE0A 4CCSA 4O3MA 2XNDD 4LXQA 2IA5A 5EHNA 5BMVB 4MIYA 1EBBA 1UT6A 3N2LA 1UDBA 4EO4A 1E94E 1G66A 4Y6GB 2R1VB 1UBCA 4HVAA 1DG1G 1PEDA 5M7EA 5KJFA 4GR4A 4XOIA 2G63A 3NKFA 2DSTA 5L6LB 3G5TA 4MOWA 3A6ZA 1JWLA 3OM1A 2Y0EA 4QBFA 4JVSB 4OP2A 2JH3A 2WG0A 1E9FA 2WB4A 2ZYIA 4WK4B 5AJVB 3ZTTA 4TV9F 3IDZA 4N48A 4JN6B 1KYTA 2YNMD 5DSXA 5IKMA 3PC6A 4IG4A 3JQEA 3Q8XB 4I50A 2G77B 2Q3LA 4PG5A 5H9VA 3EZ7A 3ETCA 4WNAA 4EPTA 1IBCA 3H5IA 2A2ZA 3TSZA 1G21A 4AF6A 3MBKA 4OXYA 5B58T 4BTVA 1RM0A 3H6HA 3JYPA 4KDCA 4URYR 1Q91A 2FWNA 1HRDA 4J2HA 4C78A 4PR0A 5HMLA 5ALHA 4IUBS 3PIRA 1XMPA 1Y1RA 4ZT4A 5LA6A 5SV2A 1O6BA 1IY1A 2Q7DA 3MCWA 3UJ7A 1VTKA 2IOFK 3EGDB 2W90A 4KV9A 4MUJA 5DLQC 2B5OA 3HKBB 4OQDA 1KYYA 1W35A 3FFWA 4DNPA 5F1OA 5C51B 4AL4A 5HJ5A 1OWNA 4I50F 1GA6A 2FOXA 1S2GA 2J45A 1IZYA 4IXDA 1M2WA 3LW8A 1DXYA 1EGHA 3WRYA 2OLJA 3B3JA 4ARSA 3I01A 4O25A 4KU4A 3VC2A 1TMYA 1FF9A 2HPZA 3GDGA 4DR2B 4TXLA 4A8JA 4YUZA 4HNAB 4LOJA 4Q1FA 1U31A 2IEZA 1F12A 2IPMA 4IOMA 5LA6F 4B3CA 1Z13A 4L28A 2I8LA 1CZUA 1TLLA 2CYCA 2O3UA 3D43A 4NZNA 2FPLA 2W6JD 4L0DA 3H2JA 1AHNA 4R2KA 4V03A 2AVNA 3TDKA 2JNWA 1AK1A 5I48A 1ZW1A 1X7XB 4PSAA 4W6QA 3PXDA 4ND2A 4ZT6A 4QXAA 4ARBA 5KBYA 2JK0A 2FX5A 5D87A 3IHTA 4UTZA 4UAUA 5C1PA 3ZQJA 2ZUBA 1U9YA 3OPQA 5A4MS 2Z3WA 5E7QA 4ZTBA 4OAPA 1J2TA 3B1ZA 4QRDA 1SBNE 1TU0A 5EJMA 2IGTA 4MEJA 4RA6B 3G1WA 2G1KA 2GHQA 3ENWA 1QCZA 3GH3A 5LZ5A 3WA7A 5FOQA 2HADA 3WK5A 2QRHA 4QNMA 4OIFA 1ZYUA 3CUYA 1NR1A 4M22A 1A2QA 4P8RA 4DARA 5IJAA 4JZKA 3B3FA 4BFLA 1OYWA 1ADJA 4ZAGA 1PEYA 1X8KA 5C7YA 4OMFG 3HBAA 4XGIA 1EFKA 1M8FA 2YJTD 1HK7A 3C6ZA 1RJFA 3AY0A 3WIDA 3W1EA 4E4YA 1ZQ9A 5H8WA 1M1YB 4RH0A 5JG7A 1GFIA 1BA3A 4GWGA 4PO9A 4YRAA 1RLUA 4M0UA 3ZXUB 4YX9A 1LVUA 3G9UA 4PN7A 1S7CA 5FAKA 5JY1A 1J5XA 1H1DA 3FYUC 4KXWA 3RPEA 5ICGA 2LIPA 2JGDA 3SNKA 4IZOA 4DIKA 1RRGA 1I7SB 3HZOA 1D0VA 4RV5A 5KQGA 3NVMB 3TYXA 1N0HA 4IM7A 5CGZA 3WWZA 4EJMA 1MT3A 2D1TA 2LV8A 1KK3A 3KE8A 2FX2A 2NTYC 2CZQA 2V54A 2WFZA 4P54A 2YHUA 1QH9A 4BNUA 1EEHA 5CVCA 3JCZA 3QEMA 1XV5A 2I1LA 3CPJB 1V39A 4J7UA 5KTSA 1J97A 3QKWA 3V46A 4LMAA 1DAIA 3QQPA 4FJ2A 3SS9X 5LP1A 4BXOA 1WUYA 4CGZA 4MJXA 3M83A 1R50A 3KV3O 3LQKA 2W2PA 4S05A 3V8BA 3VPGA 2REQA 1X1TA 4J1NA 5B64A 1I4OA 4BU0A 4ZYZA 4Y2JA 1ZOPA 2PU7A 1NVFA 4B3MB 4TXNA 1FFBA 1ZM4A 4KZKA 4C07A 1NN3A 4IV0A 5IT4A 1V8ZA 2XA9A 3HMQA 3FJOA 4AKSA 1L3BA 4ER3A 2W2VA 4WHMA 4M55A 4JOSA 1VPLA 2RMKA 5ELLA 4GOND 1K4MA 1XALA 2OQVA 3SJUA 4BBAA 2J67A 5B58C 2SICE 2XOXA 1TZMA 4Z7QB 3KIPA 4FNAA 5BV7A 2PO7A 1SIUA 3H5AA 1MD9A 1SVSA 1CQZA 3NM4A 5DLYA 2WHXA 1T9GS 1TYEB 5DNEA 4HS9A 1QC5A 3QOYA 3VR3D 4UEOA 3UAOA 1P0PA 4IIFA 3TLCA 2HIGA 3MMNA 1ZEJA 2XE8A 2A0XA 2MINB 2C54A 2VJCA 5E6UB 1DBWA 5C4GB 3F8SA 3WR5A 2PUCA 1EX7A 4D81A 3WAKA 1Q0SA 1K5GA 4I4TB 3R7NA 4CDMA 1U4OA 2OCLA 3IIJA 1CJUC 2Z6QA 4DIFA 3ACBA 4TMXA 4BX0A 3CLUC 1EVKA 4Q4HA 4XFKA 4Y9DA 2VPWA 4GKJB 3T7KA 2O7VA 2DPYA 4RZSA 4BKPA 3O8BA 3N2NA 3ABIA 4LHVA 3DOCA 1AZWA 5LBIA 5ELXA 2IW1A 2G36A 3NOXA 2BFCB 1UK8A 4LJKA 3UAWA 4CI0B 5JPDA 5BWBA 1MH1A 3OX3A 3IL2A 3MXOA 3TLZA 2QN1A 3IQHX 4GXQA 1QQBA 2WV9A 2XUKA 2B20A 3EZNA 1LK0A 1NONA 4YV1A 1R66A 3AF2A 3NP9A 1ZSNA 4KNYA 3EFOA 1Y0BA 4GGPA 1E5QA 1HM5A 3NCHA 5DHAA 3AJ8A 1SD5A 2WQZA 4NCKA 3FETA 1OC2A 2V65A 3WK7A 1WU7A 1Z0SA 4EAAA 4AJ1A 2CUTA 2GN4A 1T9DA 5I47A 4DTCA 5EXEA 1ADFA 4B9AA 1QU3A 5EZYA 1BDMA 1TZJA 4FPXA 3WQBA 1EP9A 3HYSA 1LF0A 2QUHA 1XCJA 3ED5A 2ZM6B 3NIWA 1XZPA 5GINE 3PNQA 2DKOA 3KT0A 1SC6A 2B4AA 4UEQA 2ZW9A 4BJ3A 3V2GA 2H08A 1GITA 4WN3A 3CVWA 3ND8A 2XUDA 4OP1A 1U8AA 2GZAA 3THRA 2E5WA 3U49A 2HWKA 3KYBA 2F55A 4Q24A 3R40A 3F7NA 5J2TB 2P9BA 4E1BA 4NTZA 1YK1A 4A2CA 3VPFA 4WNCA 3H4IA 5LQNA 1AQNA 5FTJA 4D3FA 4QHTA 3V4OA 2A9FA 1KERA 1H0HA 1Q1AA 4MJ3A 4PR3A 5FYQA 2WT9A 2GN8A 1E3IA 2FP3A 5TE9A 4EYOA 4CKEB 1J4AA 1SG9A 2JK1A 3WDSA 4K9NA 3PKIA 3EC1A 4PRLA 4LSMA 4D42A 4D0GA 2FMKA 4F5EA 3PQ8A 2VJDA 1XVVA 1F1JA 4ITVA 5LZ7A 1OVMA 3SZ3A 5MFPA 2YWHA 1HE1C 2GEVA 4ABTA 1XXHA 2QRKA 4RK0A 5BN5B 2IP1A 4YCDA 2XUJA 3H8JA 1EE9A 3D3WA 2YWFA 1MG0A 1OWMA 5KC9A 1A9SA 1USVA 2CVHA 3AEXA 1EK6A 1ECLA 5TRTA 1WPGA 1LS1A 1NKVA 3HJAA 2ORVA 4WVFA 3LVRE 5L95A 1EFCA 1RBYA 5KNBH 3L7BA 2IC5A 4WJKB 4Y2VA 1Z8DA 4QUKA 4QWMA 5B4UA 1CS0B 4CL3A 3W2TA 4B8WA 4ZCMA 5L3QB 1J1ZA 3JY6A 3H8WA 4GLOA 5LIRA 1KC3A 5G53C 2R66A 4F4DA 2V7UA 3NQ41 3ZDYB 4V0MA 5ERGB 3ZX4A 3EXAA 3RKSA 1N9ZA 1OFHA 2QTZA 2NXJA 3WG9A 5JT1A 2A84A 1LDGA 1YBMA 3ABQB 3C3KA 1FDTA 3LLVA 1XAIA 4L0QA 1JJVA 1Z35A 1A50B 5T4EA 3A9UA 3JQFA 2PU5A 3ITNA 1I2MA 1NR5A 1D8AA 1GAWA 3PT5A 1VE7A 3BWXA 2FFHA 2CNDA 2GBLA 3PYXA 3LCUA 4MINA 4OFXA 1QTRA 4XR9A 3O4FA 1U02A 4NBLA 4ZI7B 5TXGA 1T8WA 4O2BB 4R6XA 1FPQA 2IYNA 4NIMA 5F9HA 3WZ2A 2XA1A 5KJEA 3WL3A 4OL0A 2CLMB 3IR5A 2JBAA 4Q02A 1COZA 3PHIA 2DBRA 2UYQA 3JTMA 4Y1FA 4HX2A 4ARIA 1KQFA 4B44A 4CG0A 2I6QA 3GFTA 4IEIA 1UM8A 2K2WA 2VAMA 3IUPA 4GGOA 2FUG6 5B1DA 3RYTC 2QX7A 1UAYA 2EKPA 4WDRA 4YMTA 1O03A 2ZIUB 4PHFA 5A2GA 3I30X 3OO1A 3KD2A 5CDTA 3DTYA 3UB2A 3O92A 3FCOA 2ZS9A 3UT5B 1XYGA 3QM1A 3DAGA 3OKFA 4TMWA 5JLAA 3STUA 2Y99A 4OJMX 4KNWA 3UXHA 4JC5A 1CVLA 2PLRA 2QBYB 2BMEA 3CKMA 4XRRA 5JDIA 1CUGA 1E3LA 1A7UA 1IHYA 2G70A 3IUNA 3K9GA 4FDAA 1OB5A 3E7WA 2N46A 5ALFA 3V8VA 4DPMA 2P40A 2HFJA 3H9JA 3JQQA 5ESWA 3WLTA 3K1JA 4P86A 5E1BA 3O31A 3QMWA 4RZ2A 4PBRA 3T5GA 2GM4A 1QRSA 3KKEA 4MIEA 2P8SA 4N49A 4J03A 5BYBA 5EYPB 5SY9A 5BNWA 2NP6A 4BNTA 1NAHA 1P29A 2BZSA 2J85A 2PS9A 1ZGGA 2AW5A 4E33A 2M32A 3HDQA 2QU8A 2ZR8A 1D5WA 5CX4A 1I51A 2MSWA 3BQNB 3EARA 4FFLA 4HWGA 4NECA 1G2PA 5U4QA 2XJ4A 3IQZA 5AT1A 2O8EB 1KR5A 2DSNA 1UZMA 1FX0B 2FETA 2G08A 1BDJA 3HXLA 1I4TD 1M2JA 1T3TA 2ECPA 4FYMA 3GBSA 4W82A 5AKKA 4BB5A 1CP3A 4QEDA 2YYZA 1TECE 3PZBA 5DE3A 4BX2A 1H0KA 1BN7A 1NG9A 3AONB 2P5YA 3DTVB 3H1GA 4LK2A 4C0LA 2GCEA 1PR1A 3HVIA 4IZHA 2P9QA 3AMVA 3PD1A 4N0EA 2WG1A 1V1RA 2C7GA 2GEKA 3N74A 5FA6A 4C7OA 1BQEA 2E55A 2E82A 2Y1GA 1M73E 1UMBA 4JLPA 1UC9A 3TLXA 4EHIA 3RYHB 2EJVA 4RF5A 3HPRA 1ZSYA 2UVDA 1Q3KA 2VAVA 4PO8A 2QR3A 1JXAA 2X4DA 1LTKA 1Z7GA 1KY4A 1YR8A 4URHA 3CB2A 3ER6A 5E1OA 3T1OA 2WUVA 1HO3A 2EYQA 1T0PA 3DOFA 3O3CA 1ZIXA 1SB9A 4DJEC 3E70C 2QY6A 2ZRBA 3CRRA 3DW1X 1JX6A 4MTLA 4CLXA 4UW9A 4DMCA 3TIVA 4V2UA 1EUDB 4I4LA 4MQEB 4R68A 2FN3A 2W6IA 4H31A 4NMWA 3ROMA 2WU3A 4DUPA 3RFVA 3I42A 1D6JA 1XDWA 1PR3A 3I9KA 4MVWA 3ZZ0A 2GTPA 3RS3A 3CX6A 4LZWA 3KQKA 3H1TA 2HQBA 3QVGB 1R9NA 1C14A 4G36A 2XT9A 2FPPA 3K0EA 4BFXA 1KEVA 1A8PA 3VPBA 1GIAA 1IE3A 5DBGA 3RAPR 4YJHA 5FBWB 4KN6A 3N7UA 2O20A 2EF0A 4OY3A 4QEKA 4D3YA 4D9GA 3BBLA 2XXJA 3V4FA 4MGYR 2HN9A 2FP4A 3TMKA 5F2NA 1GTG1 4UPDA 3INTA 5IX8A 4ADSG 2MYUA 2DMRA 1VRVA 4KO8A 3QLVA 4RD3A 3E8MA 3VNUA 2HIAA 4ES6A 3JPWA 2OUKA 3T52A 4DMHA 4EK9A 5AJTA 3ZH9B 4AY2A 1GV1A 4JAVC 2WF6A 2AA3A 3MTDA 2VK8A 2A4KA 4Z2YA 4EJSB 1WXFA 4CMKA 1TLFA 4JCCA 5KEIA 1NQOA 4UATA 4LTDA 4DYDA 3TAUA 3WGIA 3THWB 5F73A 4CM8B 5EJ6A 1EINA 3ETGA 4ZU3A 4LDJA 1WDKA 3NX4A 5CDFA 2IGBA 4FT2A 2BMVA 5DYTA 4P7GA 3ZV5A 1JN0A 3FJ1A 2AFHE 4C3VA 5CXXA 4V24A 3MB5A 1D2EA 1WZIA 4KXXA 5KHAA 2JJ1A 1U3CA 4G07A 3AVVA 4HWSA 5DGCA 3JD3A 1UKEA 2IZOA 1NULA 3ETLA 3KJGA 4RHCA 1L5ZA 5GONA 3UOWA 3GK3A 1OLSA 1VDZA 4WNIA 1ZVJA 4QVGA 1CPYA 1B8VA 2PH1A 3IQIX 1XEFA 1EGVB 4KR6A 4YJGA 4LZOA 1E3WB 4BIIA 3A1TA 3DOHA 4YMUA 1IVNA 1IIBA 1TJPB 3ESCA 4Y2TA 2IBTA 3FB1A 2CDAA 4TMKA 3O8CA 4N41A 4GECA 1TCAA 2X41A 1E64A 4PAMA 5EHXA 1P2SA 2OK8A 3A9CA 3BHNA 4UDOA 3HCPA 3QU7A 3ZY2A 4AMBA 1Q83A 1RXCA 2TMDA 1NM5C 3K6RA 1EUYA 1XDUA 5FI5A 3BHIA 1LWNA 4K9MA 4MLZA 3X1XA 4CM3A 4LRQA 1FXWA 2GERA 3HSYA 3PWTA 4WY2A 3FZYA 3IP1A 5DWDA 4M9ZA 2R6AA 1KSGA 2Z0MA 5GONF 3KBBA 1D7OA 4G23A 3HB4X 2YHIA 3PXGA 3H7AA 2ZBVA 4LBWA 4UD2A 4BBZA 1KP9A 1UMCB 3LNCA 2EX1A 5C34B 4X1IB 1WCIB 1RACA 4DMLA 5HKBA 1RKUA 3ZHQA 4NNPA 4KITB 1TC2A 3IO3A 3BL5A 3GT3A 3HU5A 2JGIA 3KUKA 3BJZA 4AN4A 4PC7A 4MI3A 4CBVA 3IXMA 3OX1A 4ZVTA 5H70A 3LLCA 1S9DA 2D0DA 1GGEA 1FXWF 1WW2A 2BSAA 1UEXC 2VS1A 2WJZB 3H5RA 4HRYA 4IDGA 4DA8A 3SKYA 2Q0SA 1QGDA 3T7CA 4HLDA 5BYJA 1V47A 2HZ7A 1PAUA 3KRTA 4MRAA 4DLXA 3Q7SA 1LDBA 4KQCA 4N7JA 3GUUA 4TZKA 2IPLA 3EIUA 5CU7A 2F1OA 1Y8AA 4PYQA 2EW2A 4U7FA 4BV8A 2GPNA 4P4SA 2JFOA 3GOQA 5C7IO 1NJ2A 1G5FA 2QR2A 1C1DA 3S2GA 4EUEA 3UPUA 4LUCA 3I4LA 2Q49A 3WJ7A 3ZU3A 5JVDB 5J4YA 3O8QA 4N9WA 4Q66C 4Y0AA 3WRXA 1RQNA 1THGA 3EASA 1R5NA 3KHKA 1PNRA 2FUKA 5I01A 4I3HA 2H0QA 3NBYC 4K40A 2BFNA 5K0TA 4HG2A 2Z6UA 1MO4A 2PX2A 1KDPA 1Q0UA 1TZCA 2OE2A 4R05A 1QCCA 2IZ0A 2WF7A 4O4HB 4P32A 2FPKA 4LISA 1FFHA 1PJ8A 1BDIA 1L8QA 4B7XA 5M5BA 2XYVA 4KAJA 1WG8A 5KNDH 1M66A 5F77A 3PRYA 4HN9A 3JQBA 2J3HA 3PNOA 1U6KA 3A7DA 3AUKA 2OQ2A 4G1UC 4JK3A 3MERA 4NMMA 1Q21A 2AOVA 2C84A 1CQJA 2ZSUA 3OZUA 4HWKA 4EB6A 1PGJA 3TUZC 4OXKA 5EZQA 4LXXA 1Y8QA 2BONA 3F1KA 3RWMB 4BDSA 2GCNA 3PQEA 2A9JA 5DBFA 2VTBA 1EHYA 1B00A 2HK8A 1YJCA 2WSLA 3K8OE 3U4GA 1JQKA 3AERB 3CH4B 3GLSA 1MTZA 1A4IA 3DO6A 3MC1A 1ONBA 3K6SA 2ZSJA 3W2IA 2CBGA 1ADBA 3P97A 4ROSA 1Z6XA 3T5TA 2I0FA 2YRFA 4F1WA 2BGJA 1VI6A 4RCYA 1T3LA 5AOCA 4HY3A 2ZI3A 5DYGA 4EVSA 2VHTA 4CPDA 3UHOA 3HCRA 4AIRA 4MW6A 4NS4A 1YOVB 1XEXB 5HFJA 5H9WA 4BKOA 2IEBA 1N3LA 3DGEC 2N0SA 3EG5A 4UKDA 1FJGB 2GK3A 4J9UE 3FTCA 3FA2A 3AEUB 5K0GA 2P1RA 1NJ6A 3OLVA 4DBLC 3REFA 2BKUA 5LZ8A 5KYXB 3NHPA 1RXVA 5K8VA 4KGZA 4FHGA 1B41A 3A3PA 5F5LA 2K2QB 4HWRA 4EYSA 4A6XA 3ADKA 4OF4A 2V6JA 4K6CA 3RQSA 3ZOKA 4WXMA 1BE0A 3ZHTA 1SY7A 3OPYI 1NTOA 1FYEA 3NRBA 3TKAA 1WXHA 4I4CA 3O4IA 3BJMA 4X1OA 2WHPA 3QEJA 5D1NA 1GPWB 1UEIA 1MB9A 1RLOA 2C83A 1V4VA 3R5FA 4XCVA 4QSHA 5LKAA 1KRWA 2FZGA 4Q19A 4UAGA 1SA0A 2OCIA 2ZZNA 2CV0A 3F73A 3LUHA 2PSHA 2X86A 1ADYA 3RC7A 3TGWA 1L3CA 1AQ6A 5KYVA 1BJTA 2OO5C 2I8AA 1RZ3A 2W6ID 4U9UA 1EHIA 4UU1A 1OXVA 5AW0A 2ZJ2A 1UOPA 2Y1KA 3RHSA 1RYBA 2YWXA 4IZ6A 5GTDA 4BVHA 5IJWA 1H66A 2P9EA 1P7YA 3OJFA 4CIBA 1WX1A 5LDHA 2JKYA 5BSTA 4PO1A 4X85A 2GM3A 1UBEA 4BFZA 2HLDA 3DBOB 1PFUA 3PVCA 4R3UC 4ZIRB 4QQNA 1BH6A 4BE7B 2GKOA 4FKMA 4ATNA 1QPBA 4MGKR 3GHHA 5HQ3B 3FHLA 4O1MA 2SNIE 5TIIA 2VH5R 1WW3A 3I2YX 3UJ3X 3KYDA 4HWOA 1OKKA 4EG5A 3M5WA 5CH3A 3FTFA 1U9CA 2HHHB 3SF8A 5BQ3A 1SRQA 2E37A 5DU2A 3FPHA 1JDJA 5DKFA 1X7DA 2Y71A 2XCUA 2Q3EA 3TSAA 2CLOB 4AD8A 1BWPA 2JGFA 1T35A 5KOIA 4FN4A 3H9GA 4K6FA 1HZZC 3K7EA 4B3JA 2F8TA 1E0JA 1KZ9A 3FCYA 1SQFA 3OHMA 4LOLA 4IHAA 1RTKA 4D9CA 3X2FA 3V8NA 2DQSA 1RYFA 2AG8A 4UC0A 2RK6A 1J0AA 2IF0A 3L1JA 4QOSA 2VFAA 1X2EA 2XRMA 5K1ZA 2A30A 5FNVA 2WAAA 1VCHA 1A8UA 3EE6A 2VF2A 2Y0PA 3ML1A 3QVVA 2IQIA 4F6LA 1GKYA 4PANA 1GPJA 2WA1A 3PHLA 5I9TA 3TTWA 1N6RA 3W6OA 3DLIA 1T2DA 1R6UA 5E3JA 3GFBA 1T25A 3KQSA 4FFVA 4QWWA 3MOSA 4K0RA 4LQLA 2EFHB 2XKAA 4JMPA 1QCDA 2NUPB 4QOEA 1RKBA 2CVQA 4EHKA 4EYGA 4PPQA 1JDBC 2C3YA 4XIJA 3O90A 3V2HA 1UPFA 3IMEA 3R0ZA 4KPUB 4NONA 2D74A 3LHDA 4YRPA 3GLFB 4D8VA 3G5UA 1JZQA 1ODLA 1Z33A 2FX3A 2XI4A 1OLXB 3HO8A 4TWBA 4X8MA 1T34A 3NANA 3GJSA 4ZPXA 5SICE 1S2LA 4Q3KA 4B75A 4MWTA 3O1JC 4ETIA 4JA2A 1GYPA 3WV4A 4P0QB 2V98A 3A31A 5FNVF 2A9PA 3U17A 5D3MA 4B0OA 1J90A 2I8CA 1CEXA 1JR3A 2QTHA 3DPSA 5A5FA 2HM7A 1AKWA 1PJZA 5I4CA 1K9SA 3N8KA 4FINA 2P78A 4M2LA 3I6YA 1QYDA 4OQEA 2X9VA 1KZYC 4JY7A 2YZ7A 4JI6B 1UKAA 3S44A 2YJ4A 3O2QB 4L75A 3FVVA 1AZSC 3NVKI 4OBXA 5EIHA 3GDWA 4F60A 3ABSB 1ZD1A 2GT1A 5A9RA 1Z18A 2ZRMA 4OHWA 4XWTA 3ZZTA 4DS3A 5ULLA 5JNSA 1UOQA 1U7UA 1BZYA 3F3SA 2ACKA 3C6XA 3KDSE 3FE2A 3LKZA 4OXRA 5CA0B 1O54A 6YASA 4ZYTA 4JGBA 5JAZA 4N0MA 2ZSFA 4MKRA 4EPXA 4EEKA 1W0KD 3EZFA 5G3ZA 1R74A 4AJ4A 5LZ4A 1B0ZA 2QX4A 1P7PA 3U19A 2P6NA 1HNNA 3ITKA 3PLRA 1WB5A 3DHWC 4MITA 3U13A 1CEYA 1V37A 4HAVA 1OUMA 4GZ5A 3SZOA 1YC5A 5DYYA 1V4BA 2R87A 3L4BA 1R3UA 4ZK6A 3N2GA 4TVBA 5JYEA 4BRUA 3E0XA 3L0DA 4RAQA 2JG3A 2WM9B 3C6YA 3DHEA 1SFRA 4MV5A 4B48A 2WILA 2HK7A 2FZKA 1CE8B 3DSRA 1K8XB 3NHYA 5EY5B 3SQNA 2PZEA 4JQZA 2I80A 4KIGA 3KQTA 4JP8A 5L7WA 1RQPA 2REBA 1MOPA 2BHLA 3N2KA 2P11A 4ZU6X 3UV7A 4BP9A 2ROQA 1A9XA 3UBTA 1XXHE 3TAHA 1PFQA 1SJ9A 4LC1A 2G7MC 1JLLB 1YS2X 3CEJA 4JC8A 2BGIA 2ZTVA 4RS3A 2NPFA 4F3CA 1IM5A 3GRAA 4Q4AB 2H4JA 1T43A 1Z4QA 4BP1A 5IVPA 5BNFA 1XQVA 4BNJA 1YRAA 2QJOA 3FDJA 3GROA 2NV6A 4JLUA 4NJMB 4X1KB 3KAPA 5G4KA 1RC1A 2Z56A 4OXXA 4ON9A 4TSRA 4QOHA 2HF8A 4IFEA 1QM5A 2A0WA 3EFEA 5FUVA 3PJGA 2ZT8A 4FJ1A 2QGZA 3GRKA 4RPLA 5KYTA 3W5VA 1LXCA 1Y9EA 2H4WA 4KYUA 5AXDA 5LOVB 2CD9A 5EQTA 2ZLBA 4B3XA 4NFHA 1JMKC 5EA2A 1GZ3A 3SJAA 3K94A 4F2WA 3W2EA 5FEUA 4DQVA 5EE3A 4E15A 3F78A 4GMGA 2O0KA 4HUQB 2AXPA 2V7TA 1QB8A 1V7PC 1P8AA 1P2VA 2ZANA 1UF9A 2G4VA 2WWIA 2IHJA 3AJRA 3KT6A 3NPMA 1MVLA 3CSUA 3I0ZA 1UMDB 2YV4A 4OA8A 4S0XA 4OVKA 5JWHA 3VA7A 3HM2A 4IHJA 4Z3OA 1JQEA 2UYYA 1RJDA 3ADBA 2Q8NA 4OTZA 4KMOA 5ALYA 4F9EA 2B4RO 3JQ8B 4H9GA 4PO3X 5LUBA 2GA8A 2ZS8A 4MDFA 2CKMA 4J0JA 5B1YA 5CTJA 3EHDA 2O3RA 2R0QC 1S9HA 4UBMA 2FAXA 1H8HD 1ZH8A 2L82A 2X15A 3COYA 3FSEA 4XEHA 3D8NA 4B81A 3ICWA 5L9AA 1L4NA 4X45A 2B8WA 2CB9A 2QTTA 2WU4A 3KSAC 4AZWA 2FNAA 5EJ7A 1LCIA 1M0SA 3RJ9A 4D8XA 3CINA 2PS3A 3ZWDA 3L4EA 3MWDB 5JCZA 1PEAA 5K0BA 2PMEA 1A5BB 1Y8CA 1YU9A 2PRYA 4OBEA 1GV0A 5BQOA 1FIUA 2IIVA 1TCBA 1CRWG 4IHJF 1HDIA 2JD1A 5FOTA 3ZDZB 1IBMB 4RSRA 3LK6A 3SLGA 1Z7YA 1D2NA 2WZQA 3SFZA 5A7HA 1N2XA 1C3JA 4G97A 4S2UA 3IPXA 1RRPA 2JFYA 3K5IA 3C39A 1GCOA 4PSVA 1JJ7A 1R0WA 1T9CA 1ZOOA 3GFQA 3KQQA 5KCMA 3OU2A 3FUWA 3BD8A 1EUQA 5AW7A 3NUZA 4CM4A 5LCXA 3NDPA 4B6GA 1RCFA 1HEUA 2HLDD 2VZ8A 2DWQA 3OD5A 4R7ZA 5IBQA 1UL1X 4D4LA 2ACVA 2OGUA 2F43B 1PGPA 3EYAA 3BULA 1P6XA 3UZUA 3B3GA 1PN3A 2H0RA 2PGOA 1RKVA 2VNJA 2V6FA 3EA5A 3EVZA 3V33A 4NMHA 4CWAA 5LQJA 2R1TB 4GYKA 2CK3D 4BB9A 3KCNA 1TCUA 1CB0A 2P2ZA 2C8LA 2JIQA 3G9XA 5JSZB 1F6DA 3HJHA 3TZ6A 4P22A 1S3FA 2AFRA 1E1CA 2YX1A 3D5TA 1H6CA 5HR5A 1SU6A 4KC0A 5JO0A 2CKDA 4IQ4A 4K81B 4GNRA 3QMMA 4MK4A 3I9V6 5DCUA 5TQ0A 3SK0A 1JEQA 3RT1A 3Q10A 4MWGA 3A9TA 5KWIA 4ZRMA 4NH4A 1YMVA 1GLVA 1ZWKA 2XVAA 3OETA 5H0IA 2QSUA 3H1PA 3RIMA 3WB0A 1IHPA 1YQXA 1K89A 3K8QA 2GNOA 1QZXA 2W2OA 1X8LA 3OEYA 1CUSA 1ECFA 2C9BA 2IEGA 3GZNA 2HNBA 4BFUA 3JQ7B 2Y9PB 3EGVA 3N0XA 3NYWA 4KFUA 4EO7A 1PJCA 1YS7A 4TV9B 2O8DA 2RHOA 4JBIA 4K9KA 4OU5A 1AKUA 3EXHA 5M29A 4PQRA 3FDFA 3E7PA 4FFSA 1J70A 3RSGA 1NXOA 1YIAA 5LBTA 3LC7O 4P38A 4IUCS 3QKSA 4NP6A 4GI2A 4YP1A 5K0EA 4PNPA 1D6MA 1ZMRA 4PRYA 3RH0A 5I9SA 1T0BA 2PYIA 2VPZA 1DX4A 4JCOA 1B1AA 3C3EA 5D00A 4V38A 4F97A 5BVHA 1JR3D 2I3ZA 1T4GA 2R84A 4IO0A 5LQSA 3H9UA 3W90A 5BURA 5JTTA 2ZZMA 1B2RA 3WLJA 3CUVA 4MAAA 1M5UA 1RABA 4UREA 1AO3A 3NJ4A 4I50B 1VKJA 1AMNA 3NHRA 3IE1A 4WNAB 3AOEA 4B6PA 4CMAA 2PRZA 2JHPA 3EDMA 2R47A 2BFDA 1G21B 3P9RA 1F8UA 1PJQA 2GK7A 4M1QA 4QYTA 4YO8A 3OZBA 3P96A 4OP3A 1R88A 5D5PA 1E2QA 2GGSA 4I1OA 4JJ8A 5BV8A 2OHOA 4I9UA 3Q7IA 2BSQA 3MUEA 1XOIA 3CUSA 3L49A 4MW7A 4IO1A 3E3OA 5CDSA 4BVEA 3EVEA 3MWFA 1NV9A 2BELA 3Q0IA 5LA6B 2IUUA 1JYEA 3MQFA 1RE1A 3RFUA 4C4SA 2ZCVA 5LMUB 1QG2A 4HF7A 1TNDA 3FKSD 1BOFA 2OVBA 2C96A 3AHJA 4BO6A 4EI8A 4WT7A 4E1AA 1L4GA 2OGWA 2IYZA 3QWBA 4RH1A 5L3RA 1RFLA 1N9KA 2JGEA 4NDNE 4PLPA 3TUIC 3WK6A 1R0SA 1FS6A 3C4JA 2JW5A 4KV7A 3ANLA 1GPH1 1MNAA 1VA5A 3IT1A 4RK6A 1SXJA 2WMNB 1Y42X 4MVXA 4LDZA 1SBYA 1V41E 1Y6ZA 2ZROA 4NOJA 2QQFA 3RKUA 7REQA 1SWVA 3E5HA 2PT7A 4A8JB 2NLOA 3PXUA 4CMEA 2JFVA 1E3TA 5BSWA 2X7XA 3DZGA 4L27A 3K20A 3ZD7A 1DXOA 5IKEA 3TLEA 4EECA 4ZAFA 5BQFA 2JJYA 3E82A 2C3PA 1W8IA 2D8MA 2QVLA 3AZOA 4A8PA 1W59A 4NDAA 5KAMA 3SHOA 5DNYB 2OT3B 4OHBA 2W37A 1L9XA 1UOOA 3IEMA 1IXSB 3LUDA 3A6GA 2OSBA 1LBQA 1NJFA 4G0ZA 4RGBA 3ZYCA 5IBPA 1LB1B 4PSUA 1RXIA 2Q4BA 4ISCA 1THZA 2PVPA 3NFRA 4GOJA 1E9AA 4Q16A 5TDHA 3W3AH 4DLAA 1I3MA 1JDNA 1BHJA 3IT3A 3RIHA 1AZTA 4G2NA 4RJ2A 3SLRA 3SR0A 4BO8A 4RIGA 1IOWA 4AZ3A 2GR9A 1JR2A 4KDEA 2ZRPA 4MA5A 1EZ1A 1X8JA 2HQSA 2QHXA 3V1NA 1E58A 3OT1A 2GJ9A 4RV4A 4FYWA 4F9GA 2GAFA 1HORA 1CUCA 3OCXA 1D4AA 1XZJA 1Z4KA 1MTOA 5J2UA 4F92B 3O82A 3P5BA 1YQUA 2X5JO 3IO5A 1ORIA 2HPHA 2XIJA 4ZJUA 1XJ5A 3JD4A 5BUCA 4Y1EA 3IFSA 3U5TA 1GNQA 1NRJB 2IPNA 1YQWA 1HTBA 3P2EA 2IWRA 1I4EB 2QW0X 2ODEA 4J1QA 2JGDB 2RHJA 1YR6A 3C1UA 1DARA 4TTIA 3BRQA 4TYNA 1TCVA 4X6XA 3ICEA 1PJRA 1G42A 2YJZA 4WADA 1VMEA 4RS4A 5FOUA 1F3LA 1M1NA 4Y2PA 3QEMB 3IRUA 4H1TA 5DBOA 1S8NA 3FWYA 2LCQA 1VIDA 4C0SA 5J2UF 3E3AA 5F7OA 1CD5A 1QHSA 5HK9A 1G20A 1P6UA 4PGGA 4QBKA 4BXOB 3KX2A 3G0BA 1ZMOA 3DJFA 3W05A 1RWWA 1NDQA 5IEJA 3A1WA 1PDOA 3FUXA 2REQB 2H06A 3AG6A 2EJTA 4FC7A 5GJBA 4M9RA 3TM4A 2V7PA 1DTSA 1L5MA 1VLVA 2ZBPA 3A06A 3QH4A 1II9A 1JHMA 2HJHA 3H65A 3S4YA 1LZKA 1PVOA 3DMPA 3ZWPA 1BVRA 1YS1X 3TR0A 4CL8A 4EJ0A 3E3NA 4HFJA 4TS9A 4MPDA 2A86A 4DGQA 3PDWA 5IVDA 4DV0B 4X7PA 5DT2A 2OKCA 1J24A 3RW9A 5KSOA 1Y3HA 3RRBA 1R9JA 1W1UA 5KWVA 2YRWA 3NXSA 1FFGA 2NU6A 1DV2A 1W94A 3WMWA 2AXQA 1SK8A 5CAEB 2XWBF 4BYMA 4E5NA 3AL3A 3KB6A 5BSVA 4U8GA 3CU5A 3A3OA 2ZYWX 2YWCA 1QC5B 4BPRA 4NFLA 1GAEO 2GF0A 4UVIA 3EB9A 4RDXA 5EL0A 3CHYA 3D6UA 4B3TB 4K87A 2HA4A 4RORA 3PRKE 1YRLA 1S8OA 4WAUA 3QFCA 1X86B 4BLUA 3PDIA 5JMPA 2IP2A 3DV9A 2G1AA 3Q7PA 1K3TA 3AFNA 3PI6A 1SVKA 2CEAA 1XJCA 4MVJI 1PS8A 2DKNA 4Q4HB 2IDJA 4TWIA 4P0PB 2R68A 2Z2XA 3VV2A 2HO4A 3OF2A 2OEPA 1D6SA 2CNBA 3OT4A 4MV6A 1R0KA 4G0XA 5KYNA 1T1SA 4NY1A 4QICA 5B6IA 1W48A 2ST1A 1GUDA 3VNSA 1DE0A 2VYVA 1DS6A 3Q12A 4HEHA 4Y6OA 1XL1A 3P1JA 4KXQA 4OLJA 3WDMA 4EL5A 3HGMA 3TCKA 1NNLA 3RK4A 3CVUA 5F5NA 3R5KA 3EAGA 4YJ2A 1P31A 2PR2A 3SWWA 3NTUA 4JSRA 3TIXB 2QQ5A 1FE8A 1PWEA 3EFOB 3M6UA 1P9NA 4K26A 1B6SA 4JXXA 1YTLA 2PMBA 3TO5A 1LSJA 2QTAA 3DUWA 4I1SA 5FBKA 4TVSA 1S0UA 1CDOA 2DUJA 2X1LA 5FNZA 3TQFA 3I34X 3X2EA 3Q3HA 4BQRA 4NE2A 5EZYB 3T1YB 4JI0B 2FDXA 1YWGO 1L4KA 4P80A 5IARA 5F35A 3UOAB 4O59O 3W6NA 2FCAA 2PWAA 1KOFA 1B43A 1R0YA 1J09A 2VSNA 1K2VN 3EWIA 5AYVA 3LPDA 1GL7A 4K9DA 4OB7A 4ZARA 1Y8ZA 3DH0A 3W3ZB 2P62A 1ZVVA 4QM6A 4OAOA 3EDQA 2CUZA 1Z4LA 2J30A 1E1QA 5SZKB 4YJ2F 1V9CA 2YC4C 1TA4A 3OUUA 3AFIA 1JDVA 2ZBGA 3LBHA 4MQLA 4X7RA 2PTGA 4RZ3A 5CM2Z 1SU4A 3MCZA 5CH5A 3NMUF 4F2GA 4RKYA 3X43A 2YJNA 1LTQA 4MDYA 3SEQA 1GEGA 1TJNA 2FN7A 4A6PA 2QD4A 1Z6QA 1B0UA 2ZAIA 3W5SA 2QXUA 3IHLA 3P45A 1UKVY 2ZPAA 3KYCA 1K75A 1YKFA 2H1RA 2CMDA 3MGCA 4EZIA 3ZCTA 1P0CA 5LWQA 2O07A 4GL4A 4JQSA 2IX9A 2QN6A 3CZRA 3GPIA 3CGGA 4FHEA 4RTKA 2J0VA 2QN8A 3VYRB 3WBBA 5KNCH 2QDXA 1RHRA 1XXHB 3U4IA 5KOYA 3UYKA 3T0FA 4NZMA 3ENZA 3D3WB 2VHEA 3OFNA 3VISA 1Z0UA 2NPOA 3COVA 2D62A 2B6NA 3S8MA 1YB4A 1KIAA 4D0NA 3KSBC 4MIOA 1TZ2A 1ZQ1A 1NBWB 4RMGA 2X6TA 3R9KA 4GBGA 1CERA 4I0WB 5ENDA 3KSDO 3UCXA 4G3XA 4DKJA 3D6TB 3L8ZA 4C30A 3K1YA 3DLBA 1N1GA 1YRQA 1ZM9A 1CW2B 3CJTA 3I04A 4OB6A 1Y3BE 2W2QA 3IAHA 1N8TA 1YFLA 1ORTA 1SKBA 2XCIA 5I4KA 2ZCJA 1L1QA 1XTQA 3LF2A 2XTNA 1B16A 3OCWA 3V32A 2Q2OA 3UJ9A 4R1OA 3I76A 4OLAA 1AC5A 2WWYA 3OEEA 2OXTA 4EPRA 2BGWA 1VHQA 4F06A 3PK0A 1KO7A 2WVAA 3QLTA 2OXFA 5FBHA 2Z5GA 1UDAA 2YMMA 1PF7E 3IILA 3R1IA 1PD0A 1XIVA 3ASYA 4P93A 4U39A 2RGCA 1WKCA 4BECA 3DLAA 3OFKA 4YRNA 4JJEA 3LDGA 2JFXA 2UDPA 3PA6A 3AVPA 5FI0B 1XG5A 3DQZA 3FROA 5T3UA 3DZ8A 2G9QA 2OHFA 1YZGA 1ZD4A 4CR6A 4DADA 3A27A 2XCRB 1LPMA 1NW8A 3TOCA 5HTOA 2PSFA 3LC2O 3PKJA 4HYEA 4HNTA 1GYQA 1JQAA 2A6PA 1CDEA 3O4RA 4HFNA 4O63O 4YV0A 1A72A 1XDGA 2P8JA 3BMXA 2VZ9A 3ONVA 4HQ6A 3TF5A 1SUDA 2FWMX 3ECSA 4BGDA 1IMOA 4Q9KA 3FHTA 2JBAB 7AT1A 1GFZA 2Q8QA 4G5HA 1TM7E 4J8PA 3U3KA 4K6HA 3W34A 4KBGA 1J25A 1NVGA 2OTCA 3FNRA 3JQDA 4FE3A 4JSYA 2VP6A 1VP3A 4RXMA 4IDPA 4BMYA 1VPDA 3SZUA 4D6XA 1P1RA 3PENA 4MYUA 4AX8A 5JMWA 2R7AA 5K3AA 4Z7OB 2CHUA 4MW4A 5KNLA 3LOQA 2F6RA 4DCTA 4GMKA 5JS8A 1A9PA 4N01A 5KVVA 3EGWA 1TEHA 1O9HA 5C35A 2C7VA 3WFIA 1EU1A 2WIFA 3OTHA 5EI5A 4OGFA 3GX1A 1KK1A 4ZMBA 3INRA 4Z3DA 1C9NA 1FMCA 1MX1A 1T4CA 1C81A 1GRCA 2H3EA 3A6KA 3QEOA 3HHEA 3AR2A 4LY0A 3ZIUA 3NWBA 2HX1A 1A04A 1RYEA 1UMKA 2PSEA 3H19A 4K8RB 4UEKA 4QBTA 4UM9B 2Z4RA 4UTRA 3IP9A 2GD2A 2A5GA 4LNUA 3ZHXA 4FQ5A 4DQLA 5JR3A 5C52B 2EDCA 5H3CA 3AK4A 2C4KA 1BRTA 1H9AA 2BVNA 3VQTA 5A3QA 3HB5X 1GRQA 4N3BA 2ZBRA 4FDTA 5LQDA 1DJQA 3K31A 4FZVA 1LW6E 3BBPA 1F4VA 2XECA 3KJZA 4DCPA 3THYA 3LQ4A 5DM70 1W7AA 3W5AA 4ZJYA 4P7BA 2A58A 1DJOA 3OP4A 3CVOA 3KQWA 3B36A 1F1BA 4DC0A 4YCMA 5JYDA 4OKIA 2O2GA 2LGJA 4KR7A 3MFQA 5FPHA 3VHRA 4ICIA 2IH5A 4G85A 3WOVA 4A3SA 2QGFA 2B0CA 4B3FX 4JVOA 3TECE 2A1TS 1DX9A 5D01A 1V1RB 3ZWMA 4C7OB 2IXEA 4YRCA 3FZEA 1UMBB 4E08A 1PG5A 1DP4A 5TQ2A 3BILA 2HA5A 1CK4A 4ZMSA 3PITA 4C7XA 4RVNA 4B35A 1ZK2A 1T0UA 5CLQA 5E8JA 5D6OA 4R9SA 2ZI5A 1A0OA 2ZYRA 4LDNA 5H59A 2Q41A 3RSOA 1CJSA 5B3KA 1UBHS 5LLSA 3ZI0A 1HLGA 2B21A 3OOJA 4MUXA 5T4FA 1JTFA 2EXXA 4BMCA 2DFVA 1E79D 5J47A 3LKBA 1UJ2A 2PN1A 2WNHA 1FUUA 3RUEA 1OFUX 3OI7A 4P82A 5FL3A 1QFJA 1X3SA 5I8ZA 1NPDA 5ILGA 4DV1B 4P4LA 1Z7WA 1ZXXA 5IBCA 2PX5A 1Y5LA 3AG5A 4PCUA 1KQ3A 2J9XB 4PLVA 1VFPA 2X0JA 2BGRA 3TRIA 1RKQA 2V3WA 3ICOA 2CCJA 2E48A 2FPPB 5BQXA 5TQJA 4EA8A 5F98A 4DAEA 2QMYA 4FHCA 1JWAB 2E4UA 3STXA 3WB9A 4DB4A 1CIVA 2PJDA 4YJHB 3KQMA 2PTHA 5AHXA 1JHYA 2TECE 2WM2A 3JYQA 4UHJA 1DQYA 4W6ZA 1KEZA 2IOYA 2OKGA 4G0NA 1A5SB 1B2LA 1G1AA 1XLTC 4P3KA 3TI7A 2HPAA 1NYLA 5JARA 2FP4B 3ZU4A 1P7ZA 1ZA2A 2C03A 2HNKA 3E84A 2W0MA 3PC4A 2NU9A 1REQA 4MW0A 2C58A 5ECDA 4D5EA 4R7GA 3V7YA 1JMYA 3Q5DA 2O2EA 4ILEA 3SJCA 3ODPA 5B36A 3BWBA 2E4YA 1YA8A 4TPKA 3AHIA 2W8ZA 3V97A 1VMKA 1XHEA 3IPYA 1I33A 1OBFO 2IF2A 5FCDA 2O6LA 3ZZ1A 4PPGA 1AMOA 4JB3A 4TV8A 5DNAA 5TB5A 4P2GA 2J6CA 2PMCA 4MWBA 2AH5A 3OZGA 5CYGA 2DXIA 1V48A 2X9QA 4RZHA 3KP1A 3MGKA 5ADVA 3FYUA 2X1HA 2WAYA 2AUMA 3BSWA 5JJCA 5AJXA 4ZT5A 5KWEA 5KNDA 3UXYA 2ZK7A 5EHGA 4MB6A 2XOKA 3VH2A 4BB0A 4CQLA 2A67A 4W5JA 2ORED 3WADA 3WL6A 4A2PA 1BAPA 5CNMA 2F2TA 2EFYA 3H9QA 3RBXA 1ND5A 1VSTA 3MHTA 1CUWA 5GONB 1PTJC 2AWNA 1Z2NX 3NONA 4MQ5A 1W88A 1OLSB 1BU5A 1TYZA 1CZHA 1V8DA 5DM2A 1NBAA 3RS8A 4ZOCA 2NUTA 3P9PA 2W6NA 2AYXA 2XDYA 5E2IA 4YJGB 4TV8F 3UMGA 3VVBA 2HBYA 3B7GA 4Y98A 3OESA 4LF6B 3DZHA 4HVTA 3ADCA 1Z74A 4L5IA 1YHNA 2C4NA 3KLPX 2WUEA 3UWSA 2AK3A 3LWNA 2IX3A 1X0VA 3ZBUA 4FC6A 4BFCA 4HN4B 2FMXA 2JI9A 2OHGA 2VF8A 3IUJA 4QJIA 3UMFA 4HQLA 1EM6A 1YACA 5AHOA 1ZJZA 3DMDA 1L1FA 5CFZA 3NWPA 4ZVSA 4AZTA 1W4LA 2QUJA 3DMGA 3IV9A 4OO3A 3HGQA 4WXEA 5K8UA 4AAYA 2C1XA 4IMIB 3FHCB 3HYCA 6PFKA 3NASA 2YHIB 4NZYA 4DLVA 1QGED 5DIZA 1R5OA 3CGWA 1Y9AA 2R65A 1KEUA 1SQ0A 4WQMA 4YYZA 2GM9A 3U7FB 4K8OA 1LWOA 1IEVA 1NYRA 2EOAA 2CMHA 5TNXA 4B83A 2JCGA 5KTOA 2G07A 1RMTA 2KQUA 4H6PA 4U2DA 2P30A 1ML4A 5JAMA 1ABEA 1MOSA 4JEMA 3REOA 2AMFA 4WZ6A 4HGNA 2P4EA 3L8DA 1RWKA 4B6RA 2FOIA 5KS2A 3ZCPA 2BKVA 1G6OA 5I5EA 2D7JA 2C9CA 2XV1A 3P0FA 4J16C 3EWNA 2FPXA 3OEED 3IAS6 3C6BA 3PUZA 4YMHA 3DFKA 2R8YA 4YUAA 3PTZA 5CB0A 3INNA 2VOEA 2Z8YM 2QX6A 2XAAA 2JH8A 2VO1A 1FP2A 4M9XA 1X38A 4YP6A 2J9RA 4KFRA 3S1SA 2DCUA 4C89A 5BQ5A 5JASA 2F48A 5GM1A 2OXIA 3IBGA 4P4SB 2HBRA 1XO1A 1C1DB 1VE6A 4W5NA 2BFEA 3VKUA 1XD2A 5ABPA 2MIIA 3DEHA 3O8QB 2WINI 4G84A 3CWCA 4FMBB 4EM6A 3NBAA 1FFAA 5ADWA 1ZBDA 2FWBA 2WWGA 4E2WA 1PZGA 3E81A 1PGQA 4E2YA 1YR9A 2RFLA 5FDFA 1O8CA 1K27A 1RZVA 2DG2A 2Z5FA 4II2A 5LQRA 1EWYA 3PI7A 1YZQA 1I1QB 4LI3X 1Q0PA 3V8QA 4ALMA 4CV2A 4CT0A 4EB0A 1WDLA 3AILA 1L7EA 1U28C 1T2VA 4I2NA 3ENQA 3OY2A 1W46A 3EZ9A 2WJVA 1G17A 1NMQA 2NNLD 2A0UA 3KLBA 2JPDA 2OECA 1IZ8A 3G88A 3QTLA 1CQJB 1LRKA 3DO8A 3WO0A 5KOHA 2PUHA 4EB6B 1N78A 1Y8QB 2HUPA 4YMLA 1M6YA 3E58A 3KE9A 3C14C 4IJ6A 1E7MA 3HUUA 3IUBA 1LLUA 4MWDA 2E1RA 4P7KA 3GEGA 4W4TA 2VTBB 4MPRA 3JD1A 4IQ0A 5TPWA 3SVZA 1F5SA 3L7DA 4RXTA 1V7ZA 4TOIA 3K6SB 1U4SA 1R0CA 1KJIA 2C2MA 4PZUA 1MJNA 4BC0A 1HXHA 2X1MA 2D5AA 2A0FA 4EGSA 2AJDA 4ML3A 5JU6A 2H5JA 2OXRA 2XEXA 2BR3A 1GEEA 1UPTA 3GO4A 3PXEA 4D4KA 1I4DD 1DRVA 1H2RS 4D98A 4IKEA 2FG6C 4YY3B 4CV0A 2R6GA 4YN3A 4QUDA 2ECQA 3K5PA 4OJTA 4WCVA 2HDOA 2GLXA 1JXQA 2VOJA 5T67A 4Q3CA 4NOLA 4C3OB 4FUTA 4QO7A 4TN1A 4EG6A 3QE0A 3CPSA 1J22A 2WLSA 3ZXYA 1KFCB 5E7MA 5SYMA 3ZCXA 1AKMA 3OH8A 2JLBA 3B78A 1F4LA 1WXDA 3COZA 3QTBA 1YB6A 1B42A 3WISA 1SXHA 4EB3A 1EWRA 4LMRA 5B6JA 2Q1XA 2ADMA 4D3DA 1C8BA 3MTQA 1NI3A 3H0CA 2PZAA 2WHPB 3RODA 1DWPA 3ZGZA 3D7LA 2ZSKA 1OASA 2HOQA 2I5PO 5KO2A 3UHPA 4WY5A 1SA0B 1Z08A 4X0EA 3BD7A 2F9MA 2YWJA 3K53A 4GX1A 1WY7A 3MUOA 3VR5A 2X5NA 4F72A 1NQUA 3KC2A 5DTQA 3AGQA 3GJYA 2JCBA 2WMDA 3IAXA 2ZT7A 3FI9A 3FLEA 3NHSA 4C6TA 4KKXB 4CFYA 3CLKA 4QATA 4ENUA 2ZJ3A 3IOBA 1CDDA 2GS9A 4HXFB 1T1JA 3F2IA 2GZ2A 3HLTA 1DBRA 3JQAD 4RLSA 5FL7D 3IS3A 1PUXA 1Q16A 4R8KA 4XQ9A 3RU3A 3S1LA 1UKYA 1PJSA 2BBOA 4KR2A 2BR4A 1GTJ1 2B37A 3T7TA 2W2MA 3HDJA 4J0EA 1AGYA 1ATIA 3VPAA 3AJ9A 5JS6A 4CHTA 2VAWA 3ZW9A 4MR9A 3ELBA 5J43A 2BBWA 1FQOA 4RADA 5JSHA 2MYTA 1KEPA 2GVZC 2H59A 1V4NA 1TVMA 2EX0A 2QL6A 3KYDB 3GDHA 3TLMA 4F4HA 2NGRA 3FPSA 3KUXA 4HQ0A 4MA4A 3I9NA 5TQVA 1HE4A 1E89A 4DZZA 1PNOA 5LDDC 3ORRA 5DXAA 3SS7X 3T34A 1R7RA 4EATA 2QTGA 3SF8B 3VI3B 2V74B 1UP4A 2I3GA 1QHIA 1YK0A 4S1NA 5L7YA 2YJ5A 2QTWB 4TRJA 4YRDA 1CP2A 1B6RA 3B6ZA 4PG4A 4V3CA 5EEGA 3H9CA 1HKHA 1XD9A 2B1QA 3QSYA 5C46F 3TINA 3IBYA 1N1MA 1LV7A 2GLTA 1U2GC 2ANBA 5ITVA 3CQ9A 3OMXA 1EB9A 4AP9A 2K87A 3O84A 1NTRA 5GV8A 3UJAA 5FNVB 4G0WA 4JBGA 3NHZA 4D26A 4DMRA 2XOKD 5HKLA 3A1UA 1U2QA 3RGWS 4D4JA 2CJWA 3LYLA 1J07A 3TN7A 1YQDA 3JWPA 2PE5A 2F3QA 1UAAA 3GRRA 2I54A 4WI1A 1GJRA 1XCBA 1PZEA 3QG5A 5HQTA 2NNWB 3OSZA 4AJEA 1OA1A 1YFZA 2HMTA 2ZYHA 1FFSA 2PIDA 2TYSB 2AC4A 4NKRA 4JJ7A 3KJFA 4OQFA 4BN0A 1OMOA 2GBCA 3BL8A 3OICA 3P4YA 3ER9A 2FQXA 1OH6A 1UOEA 3IP7A 3TQSA 4F71A 4QU0A 1LA2A 1RJEA 5CGQB 4JR0A 5K2MA 3V5NA 4CETA 4F4CA 3MGAA 2UUCB 3R9WA 2QB5A 1HYQA 3ZJUA 5JHHB 2XQKA 1QQAA 3VU3A 1YMUA 5SZHB 1SQSA 1NE2A 1HZJA 2B8NA 1IHDA 2PR7A 3I9V1 4KQMA 5D3MB 3GLHE 2IV3A 2MJLA 4TLDA 3IBFA 2W6CX 3UAXA 3MBIA 4DB2A 1OILA 1TIKA 4IIBA 4JGIA 4PLYA 1MH9A 3QPAA 4GM4A 1R6XA 1W5TA 3JAKA 4EEZA 4L8YA 5GVRA 4RKFA 1FQWA 2F9LA 2FFAA 1SVMA 2CXOA 1DI0A 5K0CA 5KDLA 1QJ4A 2AN1A 2WT8A 4C06A 2BD0A 3UC9A 2XB9A 2FHPA 4Y30A 2Q28A 4L8LA 2NZ2A 1XNHA 2HBQA 1SZDA 2GKGA 1X1CA 3NGXA 5LD2B 4BNXA 1RRCA 3I62A 2P69A 3ILVA 4KQHA 3RREA 4JUAA 4DSAA 1ZSVA 3T7SA 4CEHB 1GU0A 2F1JA 2TSYB 4Q9NA 3QU2A 2O2HA 3H9BA 3LHSA 4RJKA 4FWIB 5A4AA 2VZEA 3RVRA 1USGA 1YQ9A 3CLUD 3A3YA 4D3SA 2NVWA 1KMCA 1R8JA 1X13A 1Y1KE 1NVAA 4PBTA 4TLAA 3SX0A 3LY7A 5FT9A 1O4VA 2HF2A 4TSKA 4RM3A 4YC7A 3N2GB 1QVZA 2FF7A 4RTMA 4MLPA 4YH1A 3DZBA 4Q03A 3KOZA 3SPXA 2II6A 2WDZA 4FSDA 4UQOA 5K01A 3IJPA 2FZ5A 2JAWA 5IVIA 5FTWA 1I0IA 4LN1A 5HZKA 1WIWA 2RAUA 3AU9A 2UU9B 2C4WA 5B2EA 3N5CA 1OF1A 1WXWA 2VZ0A 2ZSEA 3HXQA 3T35A 5E4YA 5B1SA 4Z4CA 5JYCA 3LFHA 4U3JA 3N2KB 4IP0A 5ALPA 3C3YA 3H2IA 3LYUA 1A9XB 1P81A 3K9HA 4JBWA 4X6UA 3RS2A 2I6TA 1T2FA 2PDAA 3LXMA 1OIXA 2DJIA 3GA7A 3LIPA 3CTPA 3DMRA 4G5RA 4IIXA 4IV5A 5JAQA 1MHTA 1RWMA 2CJXA 4Z6KA 2H4ZA 4LQ4A 1ZKMA 1Z4PX 3MEQA 4ZYYA 3CRZA 1C8VB 5DW0A 3DO5A 2AKEA 3F96A 5A3JA 4NU5A 2YICA 3I0MA 2R3SA 1JG3A 3JD0A 5U1PA 5G4KB 2Q4EA 2OAQ1 3DEYX 3F6YA 2ADFA 5C5EA 4CL0A 2X0DA 2Q5CA 5EJIA 5EUQB 4KDFA 5A4IS 2O8CA 1CEEA 3D4PA 1MR3F 4II3A 4W7IA 1GHTA 4M99A 3D7NA 3PEUA 1N2CA 1BXGA 3BWYA 4FD3A 3L1UA 4PQFA 4PZEA 2UXBB 1BU8A 2VC2B 4B6JA 2B3TA 1KVTA 5A62A 3BMNA 4H7DA 4IY1A 1NM5A 4C4TA 4L73A 1IY9A 1VPEA 10MHA 1DUVG 2G5CA 4EMUA 1RI1A 3KXIA 4HB3A 1UQRA 1ZL2A 3CY6A 1FFYA 3CKLA 4HYQA 2R5WA 3G68A 1RVDA 4IHJB 1T5DX 4NQRA 3TD2A 2RBGA 1RJGA 5E0KB 5L4NA 4S3MA 2V9PA 4ETNA 4UDXX 2HT6A 2FDRA 2R7MA 3EVDA 3HBFA 4GPD1 4LYAA 2VBGA 4GI3A 3GN1A 3QY9A 5LP6C 1JI3A 2O2CA 3O8NA 1N75A 4F3TA 5TT1A 1YB7A 2W42A 1OREA 3HBLA 1DHTA 1QFXA 2QNRA 1WJGA 2Z43A 2YS7A 3CS3A 4HDAA 4TL8A 3S2YA 4W8HA 1E2UA 2H51A 2NACA 4LVOA 1CXZA 5ECYA 2BTEA 3OM8A 2HBZA 4A0RA 2IS2A 3EEQA 1CHNA 2VQFB 1Y1LA 3ETDA 1ZIPA 5JD5A 1HA3A 2RKWA 1CG6A 4N5DA 3KQYA 1CZRA 2VDKB 4DIDA 3U3JA 4MUAA 5AI0A 1GTRA 1JIKA 4I1YA 3FNGA 3VR5D 3F4BA 1JUDA 1QGYA 2XTMA 4ZZ3A 2V7GA 5IULC 3GQVA 2BUCA 2ZBEA 2A88A 4GOLD 4JITA 5DSZA 1JBEA 2WJWA 1J33A 3JAWA 1NNI1 1WVIA 4AWAA 4UU8A 4EI2A 2JVIA 3WGLA 3VYUB 4L8WB 2JH9A 4X65B 3WS7A 1KYWA 3B3QA 1QOPB 3E3MA 4KX3A 4CM4B 2VBCA 3BWMA 4EY6A 3BXEA 2XGSA 1K8ZB 3R0IA 3DXYA 4DXDA 2Y1EA 2ZB4A 5IJ9A 4IS2A 4CTMA 5AVWA 1XDDA 5HWSA 1VCOA 1XA3A 5DNDA 3WL7A 2G0AA 4OAQA 3GGDA 1FVXA 3VAZA 5BSFA 3T1HB 4F3NA 4KGXA 3INGA 3IDFA 3VZPA 1PT9A 3F6EX 4Q7QA 4PU0A 4M36A 4N0QA 4L4SA 3DCYA 1J49A 1MLDA 3ZGLA 5B1EA 5LZ9A 1JBKA 1E1CB 1NUSA 2QZ4A 2PUGA 5JSKA 1CIPA 2GHTA 1V16A 2X8JA 1QQTA 4XYGA 4YRKA 3AP2A 3FPCA 3OOHA 1DT5A 1CUDA 5TQ0B 5SY4A 4KO3S 1JEQB 2IIBA 3DBHA 3PZRA 3HNPA 4IINA 4KH0A 2PKQO 2Z2YA 1Q74A 4YB8A 4LFCB 2G7ZA 4CHGA 2ZXUA 3WL5A 1WMAA 4KQ6A 4XQ0A 4X94A 1PNTA 2YVKA 3CX3A 4GAEA 2AFIA 3W8DA 2W98A 3OE7D 4H7KA 4BFVA 3UMRA 4BDTA 4CT4B 3GZNB 2G67A 2P91A 3E5RA 2X9LA 3I6ZA 1WXEA 2C7QA 1V5FA 1L7NA 2QPAA 2QTFA 3E8XA 1KVRA 3IHWA 2YY6A 4W1QA 4RPIA 5ITZA 3PFBA 4DCNA 2O8DB 3ZR4B 4H35A 1GSAA 2WSBA 4TTVA 4R2WA 3EDRA 4AY3A 4Q3AA 1JKFA 3EXHB 3GGJA 4OQXA 2IU0A 4D4MA 1Z83A 1AG9A 4Z4EA 4KIJA 4TMTA 3SLKA 2P2NA 5FUYA 1E2MA 1F0NA 1AO0A 1UPXA 3R20A 3QKSB 2JFWA 3AWIA 4BJ5A 3ZXXA 4PV7A 3OTQA 4LGVA 3T5PA 1XVAA 4DUZB 1JIVA 3DP7A 4J94A 4WFIA 3RJMA 1U3GA 3I1JA 4DREA 3AOGA 3DFUA 3R7SA 5BYAA 4RPGA 4DKXA 1A97A 1OIWA 5IH3A 1TIPA 5BVHB 1DUIA 3WP0A 3M1AA 2RIRA 4CFSA 3SFTA 5DYNA 1U2PA 3GRZA 4DV4B 1S2OA 4M76B 6CHYA 3D3KA 1P44A 2ZWIA 3AY6A 4PWZA 3IAEA 3OC0A 2XUHA 4ZQEA 5A9TA 2H4FA 4K7JA 3VZRA 4GVPA 3WK4A 5JAUA 4KAXA 2PWBA 3F3KA 1O94D 1PSZA 2NO5A 3UEOA 4UNPA 5A5EA 2BFDB 1FLVA 9ABPA 5C1DA 2FRXA 4Z4GA 3C6MA 1YOBA 5FJJA 3OD1A 4B4DA 4RABA 3FYHA 4D9NA 1JIQA 3A6EA 4KOAA 5IAKA 2DULA 2CLIB 1EGAA 1YVDA 1ZD9A 1ICIA 3CZAA 2GSDA 1P39A 1R9MA 2OO5A 1GNTA 3M2PA 1KIMA 4DJFC 5ALJA 2EEZA 4R2MA 2UUOA 3K30A 4HMPA 3E2PA 3R2JA 3NM5A 4P4UA 1XTPA 3EA4A 4H6XA 2HDNB 4J43A 4L7VA 1PE0A 5ICFA 2CF5A 1X42A 2GN1A 2ZB2A 4YACA 1D0IA 3DDUA 3L7LA 4UE6A 5LYYA 3VSDA 4U0KA 2JLSA 2WD7A 1W8DA 2NP7A 4R5MA 1E9BA 1YZLA 1E18A 1TJYA 4HQFA 2AZDA 4J2TA 5FOXA 1IUOA 2GPTA 1SXJB 5HF9A 4WK0B 3H4MA 4BNHA 1WLSA 1HTTA 4M0EA 4EMBA 1E6CA 4GI5A 2GN9A 4CTNA 1A3CA 1QLJA 4GOKA 3IVCA 3H0EA 4H3KB 7REQB 4P6VF 4IDCA 1KAMA 3KOYA 1FOEB 1M2GA 3KKKA 1ECPA 3UUEA 1XDBA 3UYLA 4ER7A 5LLDA 2B1RA 1EQAA 5HIAA 3F46A 2FR0A 2ZEJA 4GLFA 4XSHA 3V7NA 1HZZA 4L8GA 1BIFA 3C8HA 4KBFA 3IMFA 3TZCA 5IJXA 1JHZA 4M7OA 3W4KA 1APBA 1H4QA 4X63A 3C15C 1AF4A 4EW1A 3DYIA 4GMHA 3R9IA 4EKIA 3B2NA 1IN8A 4EF6A 4GEKA 3CF6R 2E7ZA 2OESA 2B2XA 3D3JA 2NU7A 4OQNA 4POAA 1I7QB 4DV3B 2EFCB 2OB2A 2WIAA 1UBRS 4GU5A 4AZ3B 2EVWX 2A1IA 1W5SA 3B9RA 4N0PA 2PAFA 2VPIA 1QZTA 2IL1A 1B8PA 1MHPA 2GHIA 4E5PA 3OT1B 2WM8A 2M6RA 1E2PA 2ATIA 4BCCA 1RIIA 3PHCA 1B26A 1J2EA 5K6RA 4ZVQA 5J2UB 5KIAA 2XD9A 2XPCA 4GBMA 1UBJS 4GYYA 1XQ6A 4RX1A 4HH4A 1XZIA 1MAAA 5BSUA 4XM0A 1WDTA 4FGWA 1CR6A 4OJQA 4UHKA 3T7DA 3WX0A 1UBOS 3B70A 1HBJA 2B7LA 2PZBA 1HDOA 2VPQA 3EJWA 3ESDA 3OCUA 4CG1A 5J4HA 1BDBA 2PJRA 1KI6A 3CX8A 4YT2A 5BXQC 1ZGHA 1RQRA 2ET6A 3A1EA 1JKMA 2XMBA 2YHBA 3GG9A 2C88A 2G71A 4N82A 5SY6A 2A94A 4XWAA 1YDEA 3T6KA 4GZ6A 1NUTA 2G80A 2HWXA 3AR8A 1JPVA 4YALA 1M1NB 1DKQA 2QI9C 1IG3A 4DLTA 2OZVA 1G8AA 4UARA 5NLLA 2I2BA 5LXTF 3BRSA 3BZUA 2QLBA 2GVDC 4ZP1A 1G20B 4O3FA 3SHWA 3SJZA 1J8YF 2VRCD 2YXNA 2YJ6A 4WKPA 3EIHA 3VR2D 3HLKA 1H1TA 3LE8A 4MCIA 2IU3A 1N77A 4HX5A 4ETWA 3LX4A 3OA0A 2EKBA 1NGSA 1Q1BA 2I4RA 4QQRA 1Q17A 1JI0A 4OXQA 3ZOZA 5CFRA 4D2IA 3DTTA 4HGOA 2DQYA 3OTWA 4NL4H 5FWXA 3AL2A 4XJXA 3H17A 3SSAA 3TX6A 4NZZA 3ZNNA 3HYNA 4PQEA 1WSDA 4IF6A 2SBTA 3EA0A 4YAEA 4ZPJA 1W36D 2BC9A 4NPAA 5IXJA 1TQDA 3I73A 1F7UA 2IUTA 1E3EA 1QU2A 5EEHA 3IULA 4PSKA 1XI2A 3UJPA 2XMGA 2BHNA 3U39A 4C20A 2NU6B 1GUYA 3PP8A 4HN2A 1EI9A 3N76A 4OHZA 2J3IA 5FQNA 4BP3A 4F38A 5CT5A 3VM6A 2A5DA 3AUAA 4RHTA 1F6BA 2GFHA 2WJJA 4TTQA 4C4YA 3GVPA 5BR8B 3BTVA 1RE0A 2BH9A 4Z53A 1TRHA 4REQA 4DCMA 3R0QA 5JDCC 3SBEA 1YZKA 4RD0A 3ADDA 1TUBA 2IU4A 4QD3A 1KE1A 4MCAA 1YNOA 4I36A 4ZT2A 4F4IA 1VFNA 5FFFA 3EPKA 1AGPA 1UJCA 3PDIB 4CDNA 5LNK6 5DM0A 2EKDA 3K96A 3CZ4A 1KMQA 3RDPA 5ALUA 1YAJA 4CM9D 2V4ZA 3AHGA 2JJ2D 2VATA 1FRQA 3NHJA 4FN5A 3G0HA 4F6CA 4DM7A 1EIWA 5DCYA 2M1XA 3T8YA 2ODNA 3LY5A 1D9ZA 1YL6A 2ZIFA 3NS7A 4RK5A 4CM9A 4GXTA 1TAQA 5T5QA 3BGWA 3QJ5A 3I8XA 4P34A 3REQA 3CUUA 4YJ2B 1AKYA 1W19A 2PL3A 4ILKA 2GZHA 1S2DA 1I5RA 3OMWA 2DKFA 4Q9AA 4QSMA 2NVUA 1GO2A 1E4EA 2BZGA 4H7HA 3OLXA 4NV3A 4E03A 3HBMA 3ZHCA 4HAYA 4WXYB 1QRTA 3AF0A 4OFWA 2GZ3A 2J32A 1VJCA 2C5FA 2O7RA 1EZ4A 1Z06A 4PNHA 3EQZA 2PX8A 3IT2A 4H60A 4D80A 2IXTA 2VP2A 3QW4B 3K2EA 4R8MA 2OQRA 4EHBA 3CG0A 3GLIE 2YXPX 4KIWA 1IONA 4G0MA 4IIUA 4PFSA 6GPBA 4NV1A 2O2YA 3D1JA 1UKBA 4DG5A 4D8YA 3RS7A 2XZOA 5GZ1A 3F4KA 2XNHA 3Q3CA 5EJGA 1KAQA 1PQYA 3OFVA 3OC6A 4WFQA 3IHKA 2I22A 3LUBA 4FFRA 3PEEA 3EC2A 4RY9A 3V8RA 1WP9A 2H1VA 2HZBA 2CY0A 4ZRDA 3RTCA 2VK1A 4BX8A 5K51A 5AM1A 5J4VA 5JNLA 2KM1A 1HL3A 3SYLA 3BGSA 3KYCB 3TQQA 1IHUA 3KDAA 3V6MA 2DTEA 5KYWA 3QOWA 1JQJC 2WM3A 4H08A 3SX2A 4KG7A 3L46A 3H3FA 2KWIA 3TQIA 1L7RA 1OAKA 1INLA 2IQ5A 3NUQA 1O5IA 4ERNA 5HE9A 1PW5A 1E5XA 3MTJA 3O73A 5EG5A 2FV8A 4ZO7A 1D2RA 1UDRA 1FEZA 2DTXA 4V02A 4J1TC 3O9MA 3GVXA 4ETMA 2I4TA 2ZRNA 4HYYA 2LCFA 3CLRC 3FR7A 5DGDA 1WY5A 4UDNA 4E14A 2WSSD 2VCYA 2UVPA 3A6LA 2CNKA 1W85A 2N75A 3CW9A 3L0YA 5AO9A 2XWSA 4KR0A 2O2XA 2V5AA 5ICCA 3LPLA 1NRXA 2WT4A 2WYVA 4L0MA 3VSEA 1OU0A 4CF4A 4YR7A 3K70C 4XUDA 2HGSA 3AM1A 2H9AA 3GEPA 4TT3D 4UFOA 3BREA 3O2NA 1XQWA 1HLPA 4L15A 4LSGA 5D3QA 4EHHA 3QELA 3RM3A 2J9GA 2W83A 1H6DA 1C9MA 3DZKA 3FLMA 3H8SA 4G09A 3VC3A 2IKSA 1ID8A 3JSAA 5M04A 1PQWA 5LN1A 2W6ZA 4AN1A 1X6VA 2X0RA 3BJEA 4POOA 2GB4A 2IWHA 3LL4A 4F84A 5BUQA 1UWKA 1KI7A 1YR1A 2G76A 2FWJA 3WWOA 4BNIA 2WQ6A 2IH4A 2APJA 2H5EA 2YFQA 3V2IA 3C98A 4JENA 4EI7A 4JYBA 1KHTA 4RHFA 4ZEWA 1UEJA 621PA 2VUTA 4JJKA 1BG6A 3QVSA 4J91A 1QYIA 2ZBUA 3AI2A 3I92A 1GLGA 1QKJA 3IJ5A 2C61A 3UKOA 2DUUA 4A15A 1W5BA 4BBJA 1AKTA 5FPPA 4ZCPA 3WWDA 1R8XA 1W581 4L1KA 3WMFA 4INOA 3ID6C 4UDYX 2OV2A 1GGNA 1X80A 2CWWA 4FOSA 4N9QA 4A92A 1DMRA 2Q1WA 2DWOA 3M2TA 4FK8A 5A3SA 1O0CA 2RK3A 5ERXA 1B3BA 5EHQA 1KYIA 1TA0A 4Z3KA 3GZJA 3STTA 1GXSA 3EX7C 4HPJB 5EE1A 3X1YA 4DFDA 4N7MA 3QX9A 1MJFA 4NBTA 2XNCA 4BL5A 1KI8A 3F6CA 3SJ7A 2ZUTA 4ZZ0A 5EP3A 3QFFA 1NX9A 2EW1A 1XX6A 2AEEA 1XNGA 3IAS1 3KWFA 4RUKA 4AUKA 3TGPA 4C01A 4I19A 1V7CA 2PWYA 2XYHA 4KMSA 2XQVA 1XPUA 3PG5A 1NBMD 3LPCA 4YLYA 4PYKA 1ISHA 2FG5A 2JKZA 2ZZKA 3WIBA 1M9NA 4AMVA 2D5BA 3GLQA 3HBJA 5BY2A 5BNTA 1T4CB 3A36A 3NAMA 5JRJA 1KEKA 1GRRA 2D1SA 4WFJA 1VKOA 4UOQA 2B7BA 1CUYA 4AECA 4IIVA 1KFBB 4MO2A 3FWPA 4IJUA 1VSVA 1AUOA 4LNUB 3CIOA 2HAEA 2NAFA 3PXAA 2YTZA 3QXHA 1VJ0A 4A8HA 2OO7A 3N2IA 4EMTA 5FWNA 3UAGA 2AG5A 3LUFA 3RUFA 3WYEA 3TLKA 3FHOA 1MX5A 3PICA 1N2OA 3IC5A 4IEEA 5DHFA 3THYB 1NUUA 1F8FA 1AA9A 4GSYA 3DAOA 4YXFA 1ZK3A 2KBFA 1BROA 1XZCA 4HDSA 5DV9A 2C2OA 5HCIA 4J0DA 3GD5A 2CYBA 4RQAA 4XSGA 3DZDA 5IUKC 3O94A 3KHUA 4MKGA 4M1ZA 2FW1A 2CXRA 2W48A 3D8BA 2VDUE 3HR7A 3TIFA 1VXRA 4XD7A 2O52A 3SYTA 3CTMA 3ZPXA 5F3WB 4DLLA 5FI1B 3VGJA 4HMOA 2FUCA 5HNKA 2QMQA 1FW8A 5ALLA 4AT1A 1VLHA 2ONZA 5AI6A 1SBIA 5F7JA 3G79A 3PR2B 5TQ2B 4JR2A 2OZLA 3EIQA 4DEVA 1Q7CA 1K5DA 4AB1A 3Q3JB 3T7IA 2PL5A 4OYLA 1YKSA 1QLHA 4HDRA 4B4VA 5A71A 3AQ4A 3RSLA 3CSSA 4NPHA 4S1OA 2PVSA 3ZTYA 4LHWA 4OSPA 4ZVLA 4MUYA 1GGHA 5AHWA 3VYTB 4KAAA 1Y7IA 1P18A 3JWEA 3LF1A 4I1RA 4KVZA 1Q6ZA 5HF5A 5C1OA 3QTTA 1UKCA 3LI2A 3SYRA 3G8BA 1XBTA 2J3EA 3M6XA 1BOOA 2ZUFA 4U2EA 4E09A 4QVIA 1NXXA 3NRCA 1GQSA 2QM8A 2WP0A 2V6GA 2XITA 3LWZA 5CCEA 2XW6A 1ZC4A 1QYWA 2D5LA 2BUBA 3OZAA 4NYJQ 4II7A 1M8PA 2G25A 3TZLA 3K71B 3SFVA 4X60A 1Y7PA 3VSBA 3PQCA 2HFKA 3CE6A 1L4YA 4MGEA 3R3WA 1QV6A 3C7AA 2J7PD 4ISBA 1LK7A 4UBJA 5GY7A 4PYOA 3SOPA 3C6QA 1PSWA 5JUWA 5KDOA 4OMCA 1K5HA 1N3BA 4AIIA 3KQHA 3IA7A 5LJIA 5HKKD 1MENA 3GLKA 2W2NA 2NU9B 1REQB 3RT9A 4QXOA 4NOKA 5EMJA 1E2HA 121PA 1RLTA 2ZPTX 4Y1RA 3COSA 4HEA6 3C87A 1J7JA 4JLJA 2ZRCA 2ZVDA 1YU6A 3CPEA 3BRWD 3V8MA 3WMEA 3F67A 4TV8B 1T5HX 2QMEA 1VHTA 1JDTA 1NW3A 3AR6A 3EC7A 4OQ4A 1NUPA 2FWIA 4WPGA 3RFCA 3RSCA 2NSHA 2ZQYA 1YZ3A 3AF3A 3O8DA 3WBFA 5KTYA 3OQMA 3RB8A 3FYUB 5FUBA 2WKRA 2HD4A 4PC1A 1W0JA 1WKVA 3O7MA 2YDXA <