2P6OA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETMWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 61
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p6oA00
1UJCA 2P75A 3GW8A 2HIAA 3O0TA 3C7TA 5HR5A 5CX4A 4ODIA 3E9DA 1C81A 2P78A 2EOAA 4QIHA 1E59A 1YFKA 4JOBA 2H4XA 1NT4A 3OI7A 1DKMA 2PA0A 3MBKA 2GFIA 1XQ9A 1BQ4A 1BIFA 1C7ZA 2H52A 3QPVA 1QWOA 1H2FA 1EBBA 1DKOA 2F90A 3GP3A 3E9EA 3BIFA 3IT2A 1IHPA 1TIPA 4PGMA 2OWEA 4PZ9A 1C80A 2P79A 3HJGA 1E58A 4PZAA 1V7QA 5CDHA 3IT0A 3PGMA 1FZTA 1RPTA 2WU0A 3D8HA 4JOCA 3ZHCA 1QFXA 2WNIA 4GPZA 2DWOA 1K6MA 3LG2A 2P9ZA 2BIFA 1H2EA 4JODA 3FDZB 3FJYA 4MA4A 1UJBA 2WNHA 1FBTA 4FDUA 1V37A 4TSRA 2H0QA 3K4PA 1QHFA 2HPAA 2RFLA 2H4ZA 3R7AA 3IT1A 2P9YA 4D4KA 5AJVB 1DKNA 2EKZA 5AJZA 2IKQA 3D6AA 2P2YA 3LL4A 2QNIA 4IJ5A 3NFYA 2AXNA 5PGMA 2I1VB 3GP5A 5AK0A 5AJWA 3KKKA 1SK8A 1ND6A 4AROA 1DKPA 1BQ3A 5HTKA 4D4MA 2P6MA 3QPWA 1CVIA 4GPIB 3FDZA 1ND5A 4FDTA 5AJXA 4HBZA 1RIIA 1RPAA 2EKBA 2YN0A 2P9FA 2HHJA 3D4IA 3MXOA 3LNTA 4ARVA 2P77A 2DWPA 4D4LA 1SK9A 1T8PA 3EOZA 3NTLA 2OWDA 4ARSA 2P6OA 3DCYA 3EZNA 3F2IA 4IJ6A 1SKAA 2ENUA 2YN2A 4EO9A 5CU7A 4D4JA 1DKLA 2P30A 4E3WA 4ARUA 3DB1A 2A6PA 4EMBA 1DKQA 3IT3A 1SKBA 2A9JA 3K4QA 3E9CA 2P2ZA 3QPUA 3F3KA 2ENWA 1YJXA 5AJYA
chains in the Genus database with same CATH superfamily
3IMFA 1GPBA 1K6JA 3ITNA 3LF1A 3OY2A 4I4CA 5K51A 3N28A 5B58T 2MYPA 2FPUA 3EZGA 2X9GA 1RD4A 4JKOA 1JG1A 1R5NA 3QVTA 1IB0A 4PAWA 4BKUA 2V6FA 4ITVA 3PQ8A 4IHJA 2CXTA 1YI8A 3ETLA 1R0ZA 3KD3A 2C2HA 3DJYA 3LX8A 4ESOA 2WOOA 4EY7A 2GZAA 3P94A 3T7SA 5ARBA 2I1LA 4IFBA 3CLTD 1I80A 3EOAI 3DBOB 4DRXB 4ZGGA 3BUSA 5C7YA 2P79A 3RRXA 3IT0A 2QYOA 2TYSB 1VLJA 2GZ1A 3FXAA 4JDPA 5TVKA 1A4IA 2ORWA 4OXRA 3JTEA 3L6EA 1DELA 4IUBS 4QLAA 4ATNA 5H4HA 1FFSA 4RVDA 1XHFA 4BMPB 2ZJZA 3OG9A 4ZZ3A 2OCAA 2V4ZA 3W8FA 2OK8A 2P6UA 5K6RA 3D6TB 2Z2ZA 1KVSA 3GJ0A 2VBCA 3HCDA 3SMQA 1CQIB 5KYGA 1UBFA 2QSYA 3CZ5A 3IXLA 3NH6A 3RTEA 4XM1A 2HHAA 2WJJA 4IGAA 4KPUB 4P3KA 3ILXA 4MIYA 3MWGA 1X1RA 3PHCA 2LP4Y 4C06A 4CQMB 3OCZA 4PZDA 1KH3A 3FHOA 5DHSA 5BXYA 2VNSA 4YC7A 1D2GA 4JWTA 4XCVA 3EVGA 4RLFA 4G24A 4RADA 4BB5A 4RWZA 3IDZA 2XVZA 4QOEA 1DJMA 2BT4A 3MF4A 1BMTA 3F6RA 2HDHA 4ARAA 2IEZA 1U7ZA 5TT0A 3PR1A 1M1UA 3F67A 3JW8A 3L93A 5EI5A 4E2XA 4Z3OA 3K6SB 2OBLA 2FPPA 6GPBA 1Y1RA 2FSIA 5E95A 1GXSB 4TX1A 4CLEA 4YMTA 5BO5A 4BFZA 2A9RA 4P81A 4V0ME 2WKRA 5CTAA 2QRVA 4LNAA 1IMJA 4UTNA 4LDPA 5AUNB 2XA9A 4YRTA 1NHGA 4WJKB 4I3FA 3QHPA 1KXJA 5A3RA 4UU1A 1AQUA 1M72A 2ISSD 3B7GA 1BS2A 4P38A 3CNBA 4LOAA 1WOYA 1EFVA 1U2DA 1H6BA 1MVLA 2AFVA 2IYQA 5E4TA 2WQ7A 4JAVC 3K0FB 4Q9NA 1RQ7A 2AVDA 1GRCA 1E2BA 1J9EA 4RMJA 4BB9A 4RF3A 4HX5A 1M0SA 1YC2A 1Z8HA 3FNGA 4AURA 1CZKA 2VKTA 2OXTA 4AKHA 1N0IA 1IM8A 1SCIA 2M6RA 1SD1A 1Z16A 2ZSHA 4JT8A 4JL6A 3JWEA 2I7DA 3ZD6A 2WFMA 3MTAA 1JZTA 2VSNA 4M9ZA 3WJ1A 3WB1A 1D4ZA 2BTOA 3OZSA 4AB1A 2Q7XA 3K73O 3EPPA 2R6JA 4JI2B 1T1JA 1TF7A 5FBHA 1OJLA 2Q2WA 4FCVA 3TQIA 1TKCA 1XCPA 3U3OA 2ZUSA 3RIGA 4BO0A 3P9XA 2J0SA 3G68A 5ALPA 2BGRA 1Y7IA 2ISQA 3FX2A 5BN3B 2EOAA 4EO7A 3VO2A 1E96A 1V48A 2SKDA 3PSHA 1D5WA 1S89A 2GTIA 2Q9AA 4NE7A 1E3WA 1E66A 4N8EA 4L6IA 1RPNA 3LS2A 2GM9A 1Q11A 1E9FA 3TQTA 4RY2A 2JBWA 1FNSA 2J41A 221PA 2RK6A 1EZZA 3CZQA 2B6HA 4HEA6 4WZBE 2NZ2A 3HEAA 4P4GA 5C1OA 1DOAA 4N9WA 3L1UA 1ZN2A 2Z6UA 1NBME 1WF3A 2XT6A 1U2GA 1KRWA 3TLYA 3WZ2A 3VH2A 4ZO9A 1XZFA 4FONA 4QAQA 5ALHA 1JR6A 2QNRA 2PKCA 3MCWA 2FWIA 4G65A 4H6PA 4MR7A 5CX1A 3NPAA 5TQVA 1K63A 3AFOA 4ASUA 2B20A 1QCZA 2YWRA 3PDJA 1Z33A 1K6IA 1SUIA 3Q98A 4BVGA 5HW0A 3A11A 4NFSA 3OX1A 3UUEA 4BWYA 3EMBA 3RAPR 1R74A 3VO8A 5KVSA 1Y3DE 5FH9A 4QULA 3CZAA 5KYUB 1E1RA 1JXMA 1H6CA 1AKWA 1R0WA 3RR2A 5KVQA 2Q5LA 3GLKA 3GEEA 5A9TA 3CUUA 2H5JA 4C4SA 4INZA 1ABFA 2VYQA 3VJKA 1KQ3A 3AM3A 4N03A 4H1HA 2QVBA 4GP6A 2LBPA 2HEIA 4B6QA 1FUYB 2OAEA 3I6YA 2HCBA 4GX2A 3RIMA 5BVHB 3LL4A 5CUQA 3FMVA 4YRBA 4W5JA 1Z6AA 1NJ2A 1CUUA 3COSA 2I2CA 1K88A 1EQAA 1U3UA 1G7SA 1JDUA 2CK3A 2QMQA 2XB8A 2XQKA 3CEPB 1N1GA 2AOUA 3DF9A 4NAUA 3TVYA 4J0QA 4OMUA 3C8UA 4RSGA 4DR5B 2O8FB 3K4HA 1J70A 4ZQFA 1O03A 1XTKA 4UHHA 1PR1A 2X3UA 1VL5A 3S81A 1SY7A 3AVOA 1D1SA 1MF7A 4ME6A 1XMQB 3A1CA 2ATIA 3EDMA 4ER3A 3GHYA 4GP9A 4EJSA 1TVEA 1GTG1 1ESCA 4GOXA 1I3KA 2PEYA 4A4DA 1Z25A 3V6LA 3O75A 4HKTA 3U37A 1E1CB 1N1EA 3LNTA 3L1IA 5GAJA 5THXA 2J9XB 4KFTA 2BEVA 4LXQA 1NXTA 1YB6A 5B37A 1Y7PA 4E33A 5BN5A 4ND8B 2IH2A 4R98A 4F8JA 2H8KA 3V97A 2YVUA 5FWXB 5ALSA 3O8OA 3SR4A 3KQSA 3FWNA 5B6JA 4WFKA 3N07A 5JT1A 1WS6A 5B4VA 4ZI5A 4KDEA 4G5SA 4GZMA 5IVKA 1NNI1 3QX3A 5BV8A 3JQGB 2CFIA 1H1TA 1RJFA 2AC4A 2B35A 3JR7A 3LGAA 3NHZA 1QLJA 3A1UA 2G5GX 2X58A 3HB9A 3O93A 1XZKA 1EUZA 1O57A 1JH8A 5CDFA 2NOAA 3SC2B 1SVMA 4JYCA 1XZEA 3JAMA 4PYMA 1NN5A 4KXNA 1VXRA 4HB0A 1RAHA 4DSAA 2I3ZA 2VXCA 1KMNA 2FRXA 2VQ3A 2WM9B 3WS7A 3DCNA 3IKMB 2DFKB 5EHQA 2HYIC 5EJFA 5A5GA 1MOPA 4G1FA 4LTDA 4L5CA 1YASA 3GEMA 5AM1A 3VR6A 4BVKA 1AGXA 4K6OA 1UCFA 3F4BA 4LZNA 3GDOA 4ZO8A 1YV9A 1SEVA 3CA8A 4YJFA 4QJ5A 4GZLA 5A7HA 2PGIA 2P6NA 4YXWD 4XCQA 1ZS9A 3CG4A 6Q21A 2H0AA 4YT5A 1EKXA 3QJGA 4PC1A 1QZ3A 3L8HA 2HADA 4P3PA 1ETUA 2VNKA 3FF1A 1HF3A 1Z12A 3MVEA 3V3KA 1FZTA 1U4SA 2FK7A 1CZHA 1QYDA 3WB0A 4MUAA 5BR1A 3DKPA 1W5AA 2BSAA 4EEXA 3EVFA 1ISRA 1G8GA 3P9RA 5B5SA 1ZFNA 1O94D 3THXB 1XNRB 1SRRA 1CHNA 3WLHA 4YCNA 3D2CA 2HNAA 2BIFA 2I22A 5DPMA 1L8LA 4QRIA 5AIAA 2J1LA 3FROA 5TT1A 4RHTA 5BN4A 2AN5A 1YQXA 4IIJA 5I9SA 4C21A 1ODSA 1TQ2A 4R1UA 3O47A 3WKDA 1BCRB 4DCSA 2NYRA 4GMXA 1FQKA 4YJ2A 4H7EA 3RTDA 1PJSA 2TMGA 3Q40A 1P1RA 4AS2A 1F17A 5I7FA 5LZ2A 3OURA 2O06A 3LCCA 2EZ8A 1PR3A 4HNTA 1TO1E 1B1AA 1CG6A 4HRAA 5LZ5A 3EGCA 3R77A 2BW0A 4WMLA 3DEJA 2Y9PB 5LP1A 1LI7A 1M8GA 2CCJA 3FUUA 1VZ2A 3DPUA 4GYKA 4IIUA 4LZZA 2EQ5A 4K9DA 3C3XA 3P7MA 3SS8A 1R5OA 1G20E 2PT7A 2BKLA 3AERA 1K8ZB 3RVMA 1OASA 3E5RA 2ON6A 3H1GA 4BO6A 4Q7MB 3IA7A 3DO6A 1V71A 5IZ4A 3VBCA 1M67A 4O3MA 2AMLA 1AH2A 4K7JA 4CL3A 1GOTA 1YA8A 2DE0X 3C74A 3MRVA 4V0QA 5I9MA 3W8DA 3AEQA 4Y9DA 3UM9A 4YRJA 1GADO 2V7PA 3ED1A 2GSWA 3GA7A 3QQ5A 3SXUB 3WLMA 5IZCC 1A3CA 5KJ6A 3NHSA 1H5QA 3K9BA 2OBMA 4I55A 4JBIA 1J09A 1LPPA 3ER9A 5DNEA 3SLKA 3WG9A 1CY8A 3H99A 2M6KA 3QM1A 3VC1A 2YHAA 4RJLA 3RYCB 5B7PA 1FYWA 4BX3A 5DI3A 3D2BA 4DAEA 1XCMA 2GI4A 4JX9A 1SKQA 3QF7A 3OZUA 4HTAA 4HSGA 4A3SA 1MBZA 1YUNA 1V6CA 3L05A 2NT4A 4US0R 4AJ1A 4MR9A 1F2TA 1JDBB 3GJZA 4YRMA 2NUPA 3LBAA 4BJ6A 2QRZA 3WL5A 4ITRC 5AK3A 4DEYA 5LD2B 5F3WB 4LN1A 1NI4B 3I01M 4YK7A 4P33A 1BDMA 4G1VA 5EJEA 2XTNA 1GQYA 3E1SA 1Q0RA 2HEGA 2PL9A 3CONA 2J33A 3DGEC 2Z2YA 1G3RA 3HFGA 4QKQA 4TYWA 2W2XA 3PDIA 2M1XA 3E7FA 1S2DA 1WIWA 3BA6A 4XIJA 2C7GA 1WE2A 1A8SA 2CN1A 1CQJB 2H1WA 2QTFA 2VRNA 4H3VA 4C04A 6REQA 4PONA 1P31A 3QF4A 3T1NA 1ZY2A 1Z6PA 3DEAA 1M6VB 2ZT6A 1R18A 2WJGA 2FPSA 5CDSA 1Y3CE 2G1JA 1JKJA 1LNZA 1H0KA 1PZXA 1T13A 1T3SA 3TJZA 2JJ2D 1G3UA 1DKRA 2UAGA 3N7UA 1SQ5A 3UCEA 5IH7A 3AIKA 4E6EA 3WLAA 3A70A 4HMQA 3N39C 3HMQA 3KCQA 3PIRA 2A92A 2BP7B 3ZJVA 1CP3A 4UNQA 1SU6A 5A5EA 1P44A 4EW6A 3NKLA 3T5DA 3TD6A 3U56A 1ZK1A 1ESEA 4JI3B 4AC9A 1M8FA 3SC6A 4X6XA 1NVVR 2IPNA 4EHAA 5A02A 2P9ZA 3RC2A 2B3DA 2VJOA 4OG2A 5DHUA 3JVUA 5F21A 3BZWA 5I7OA 1P6UA 3L07A 4U00A 5AHRA 1N2JA 1E89A 2PUHA 2O2ZA 2KX7A 4ESVA 2XCLA 3LHDA 4DWJA 2RG7A 3SXJA 5C2JB 1GCUA 5IWCA 5I9NA 1E1NA 1N0UA 4ZYUA 4BLRA 4QYMA 6AT1A 1FDTA 4Q16A 5K8LA 1XYVA 4HX9A 3T4XA 1OKKD 4EQ6B 4J4TA 4UEOA 4BV8A 4FHGA 1GY8A 2RSLA 3TUIC 2C5GA 2NYVA 5K03A 3UGKA 2JIZD 2OV6A 2ZZKA 4KGZA 3HDVA 7GPBA 3U4QB 2CBXA 5ADVA 3PENA 3B12A 2XMSA 3CUKA 2YY5A 2R7KA 3LD9A 3UFXA 4DQLA 4EX7A 1COWD 2EW1A 1Q0UA 1N57A 3AI2A 4JC5A 4XFJA 1OREA 3X43A 2QP4A 1YIAA 4WXRA 2BGGA 2EEPA 1MB9A 1TO6A 3R7LA 1RYBA 4G3XA 1J42A 1Q7CA 1HSOA 1U0OC 5DBEX 4RD0A 3AZPA 5HRCA 3AETB 4W7HA 5B30A 3UOWA 4YRPA 2AJ8A 1Y1TA 2YY7A 1UDAA 2C8KA 3FHJA 4ZJYA 3Q3HA 2WSIA 5CHEA 3C6ZA 1LCIA 3PC3A 2CNWD 3JWHA 1E79D 1ISFA 2HPHA 2WT8A 3TTXA 3BXEA 3GFBA 1WU7A 4NBLA 1U7XA 4MITA 2DSNA 1W5EA 4N0MA 1DXQA 4OIMA 3SSMA 1G64A 1AZSC 4CQMD 1JLKA 3C3WA 2WDZA 4J1NA 4M1TA 2Q3BA 3S2ZA 4MKGA 5CXQA 5HZKA 1JBEA 1XEXA 5DYYA 1GLGA 1I9CA 2ZE8A 3T1OA 1JAZA 4FLFA 1UAGA 1KBZA 4JLSA 4LQCA 5FO0A 2ZXUA 3GGDA 3WY9A 4E21A 2FPOA 3KR0A 4FGUA 5A9RA 3E22B 3PIDA 1SG6A 1K5PA 3OJCA 3O8LA 3R3YA 4B2IA 4L4RA 2NU6B 4G5RA 3HH8A 1QHEA 3ISTA 5A9SA 2EP5A 3WLPA 3TDKA 4WL0A 4ZALA 5TEWA 4WNIA 3IXQA 1HRKA 3ZTWA 4BOYA 2WUVA 5HNKA 4Q1VA 1WXEA 2XE6A 3G2MA 1RHRA 3ROKA 2WSSD 4PIPA 4OQDA 1WB9A 2W83A 1ODFA 1Q7BA 4FDMA 4M49A 3RQIA 1ECGA 5IVHA 4AXBA 3R3VA 3NWEA 1DU4A 4ZICA 2AXEA 4DS3A 3LUPA 1EZ1A 3C3PA 5EL0A 5A5DA 3AUTA 1FFGA 2V7WA 3PIIA 4GH5A 2NSYA 1Y9ZA 3I39X 1WA5A 4WCVA 1UXGA 3IO3A 1T2CA 1VB5A 4ENWA 5CG2A 2O1EA 2O2JA 3NDIA 1NGSA 3FWZA 3FDJA 4Z6KA 1TPZA 3TQSA 4R9UC 2JASA 3ITDA 2IQIA 2WU4A 3G5TA 4LVCA 1ORIA 4TV9F 2XQIA 5FTMA 4N47A 4BJ5A 4JNKA 5MDHA 5CVTA 1KYVA 3TRHA 4O2AA 1ILWA 4XIIA 1RBMA 1R9MA 2GARA 4N0QA 3VR3A 1WSWA 1JSRA 1QFXA 1P0PA 5EP4A 2FPPB 4PNZA 3ROXA 3H5IA 3L7LA 5FUXA 2ZB2A 3FFXA 4A91A 1PGQA 4P5EA 3EVNA 1GUDA 4R2KA 4BB6A 4C0HA 3RRJA 3DLCA 4TQUS 2QRVB 4E5PA 1SCQA 3C6YA 4RDHA 3L0YA 5CURA 3AB8A 1UPCA 1ISIA 2Q41A 4NCIA 5DJ5A 5EHIA 3IMCA 4J6EA 2A9PA 3ZE0B 4O4JA 1JPNA 3H16A 3ULKA 2ZUWA 1DKNA 1MNAA 3PXDA 4PO9A 1E9CA 2RHOA 2F1KA 2PMBA 5ECDA 2ZB8A 4OJQA 3A6EA 4MWSA 2A0WA 3SKXA 3KYBA 4B4OA 1H94A 2YWDA 3NFYA 4ZYLA 4CKZA 1JPJA 4F1JA 3KSZO 5HP4A 1ML4A 4M83A 2O59A 2P11A 5JD6A 3UWKA 4PPGA 1MHPA 2EFHB 2ADMA 1BQ3A 2PRYA 1RWXA 4YMHA 3QSYA 3K9LA 3PHBE 3CRVA 3GGPA 4O29A 5KNLA 1JFFA 4YECA 2X41A 1IY9A 1JLLA 2NV0A 5CR9A 4AZ0A 5AOVA 1YZLA 2PBZA 2XTMA 3ORSA 4UVDA 5IAEA 3RS2A 1SB8A 3JZAA 1NUTA 3FFBA 4JYZA 4J7AA 2FWAA 5CVEA 4DCJA 1LBQA 2NN3C 4PX3A 4X85A 1NZFA 1JBQA 1U1GA 2B21A 4P93A 3ZW7A 5MN5A 5FEUA 4DQXA 1BCSB 4OUDA 1KF0A 2XIQA 5F5LA 1NVBA 1JRLA 5EVJA 3S27A 4DMRA 2DPGA 4WBNA 1UXKA 2G0NA 3VKVA 1GITA 3H2BA 2IY9A 1E3WB 2H1FA 4IGEA 4PQGA 4B82A 2Q50A 2I4LA 1CDOA 3CPEA 3EWSA 5JG7A 4RJ2A 2NAPA 2O54A 1VSBA 2HK6A 2XGGA 4CR7A 2C2MA 3LVBA 4YLEA 4QSHA 1L7RA 4ZRDA 4FFPA 4EYEA 2J3JA 5I7RA 3LUGA 2MHCA 3K05A 3V4OA 1WXIA 5LN1A 4RDCA 1Y1QA 3OCJA 2BH9A 1DG9A 1QMGA 4I8IA 1WDTA 4YLGA 2DQSA 2QZ9A 4DEXA 1RWWA 3W7VA 1ZD1A 4O63O 1DL5A 2ZYDA 1KY4A 1GGFA 2L42A 3H86A 1TD9A 3VPHA 4B81A 1V2GA 1XMOB 4MA5A 1C41A 4U2BA 3KJGA 5FV7A 2W70A 2QVYX 1WMAA 4QQFA 3R9KA 5A4FS 1KK0A 2BBTA 3ZVNA 1UF9A 1U2ZA 1VBFA 2VWGA 3AESA 2ZJ5A 4CFYA 1I24A 4IZOA 5HF8A 4D3ZA 2X77A 2RI6A 3QFSA 4RFSA 1EK0A 2VHQA 2XXJA 4K05A 3AT1A 4Q47A 4OXKA 5IKXA 3VPGA 4RLSA 1DKOA 1Q1BA 3TRJA 1ECFA 1YDFA 3IQZA 3SIXA 3CT4A 2G1KA 3B48A 2CZQA 4OGKA 4ACAA 1BDBA 5ESRA 5I7WA 4CEJB 4AY2A 2OUIA 2ZSDA 5E9JA 1E58A 3WKEA 3X1XA 2J0EA 3CZCA 1KO8A 1UKCA 4O8ZA 1KYXA 2V1XA 3A7DA 1QRTA 4NXNB 3FNQA 2DQ4A 1Q2XA 4P80A 2GPAA 3EOBI 2ZDHA 3ROGA 2BGNA 1QLWA 1Y34E 3U9LA 3CMCO 2RGXA 4LMRA 1GCIA 5SYAA 4FFSA 2I0FA 4JODA 3UB3A 5L53A 2C3PA 2XY4A 4WCFC 1GO2A 2NQ2C 1A88A 4B4VA 4EJSB 1YL7A 4B3CA 3UN1A 5SY4A 3UK7A 1JR3A 3F5SA 2PO7A 4RA9A 4IMJB 5KTMA 1O0CA 1BHJA 1TDJA 2IOHA 3GIWA 3I37X 4J2HA 4PYNA 1MXHA 1O9BA 3QU9A 2EBWA 5BN1A 3QUAA 1NMQA 5JAHA 2BEVB 3V8EA 4IJ5A 2NO1A 4LZWA 4MVJA 4XWTA 5LMUB 5BN5B 1YC5A 3SZ3A 3U17A 2QI9C 3WL7A 4BRZA 4O4HA 2UZ1A 2V7EA 2RH9B 3SVTA 3NYRA 3MC1A 3O8OB 2XKBA 5CM8B 3OBIA 1GRNA 4K9MA 4NC9A 5DT2A 3ZG6A 3TFOA 3VYWA 1SUWA 1JIUA 3WKBA 1CVIA 2UUCB 4A8TA 4ZQGA 4MWZA 4ESEA 2VPXA 4RIGA 3F5MA 3ZE2B 3A6PC 4P92A 2ZIGA 4EZIA 3BD6A 2AD1A 3NKVA 5K8VA 1THZA 4QFCA 5FX2A 3S55A 3CU5A 4PO3X 1VMAA 2QRPA 3UY4A 2B94A 4WTOA 2R3SA 4X00A 2CVQA 5EWLA 1LSSA 1NXQA 3QBDA 4RE5A 2BHSA 4GQBA 3JYPA 2P3QA 1ULZA 4ZVRA 5EUBA 5GONF 4JLDA 4PZZA 2WP8J 2PX3A 1D8TA 3KVNA 2D2VA 2OO7A 1XRLA 1SKAA 2NPIA 3L7MA 5AR1A 4A27A 4H4DA 1MT0A 1Q0LA 1R6AA 3INTA 2CHQA 5G41A 4CCWA 5AQ1A 4X84A 5AVSA 2ZUVA 4RNDB 3NDJA 3HEBA 3IELA 1FFHA 3ZDFA 3S2GA 1VDMA 2QYHA 1VSUA 1TFRA 4KNWA 4UEJA 4LF4B 1YK1A 2VYNA 3NHUA 4F12A 3UJ6A 5EPUA 1NHWA 4JBXA 3LOQA 4F3NA 5CEJA 4BRSA 1PL7A 4OFZA 2HO5A 3D5EA 4IGIA 5EWMA 1N9GA 2I6QA 1AF7A 1P7PA 1MXFA 3GGJA 3P4UA 3UW1A 1IEWA 5KTKA 3SSOA 1W5SA 1XFDA 4ZEXA 1RYYA 2JCVA 3HB4X 3NNNA 5HIJA 4EBBA 5C32A 1FUKA 1UPUA 4ZTZB 1TKAA 3MS7A 1IULA 1S7CA 3DMNA 2AW3A 2HC9A 3GVHA 3NWJA 3I1YA 3SQDA 3O8RA 4XDZA 2K2WA 1ATIA 2H4FA 4PAMA 4NSNA 2WUFA 1QTNA 5BN4B 1KC3A 4EIWA 4EUSA 1PG5A 3NHKA 4BECA 1MUUA 1ZM2A 3M3DA 4H59A 1D4FA 5IM4A 3OMLA 1YULA 2VSXA 2WABA 3IEPA 3LWZA 4G5XA 4TKVB 4E5DA 4HDSA 2GFHA 1NJFA 2QB5A 1BMFA 4C4TA 5H83A 2K5UA 3EVCA 3FFAA 4UHJA 3CLUD 3L7IA 3D6JA 5KBYA 3OFVA 1Y5IA 2Q9UA 1T2AA 2QR5A 3QVKA 5J2TF 2NZ8A 1RBYA 3PUJA 2XKKA 4MUHA 1WBJB 4X8MA 1CEEA 3I64A 1H4SA 3R0QA 2Q3HA 2B82A 4FFOA 3FJYA 1LRKA 4MA4A 3Q1LA 3DJFA 5ITZB 5JH7B 4TOIA 5HM6A 2QW8A 3KKZA 3S1SA 1U8FO 4XUDA 4LF6B 5ALRA 1UBHS 4G37A 4GYJA 2X2EA 1I8TA 5LU9A 2RB5A 6YASA 3S1AA 2OHIA 3EW7A 1ENPA 1W75A 3AEQB 2VI5A 4CM4A 2JGRA 4EG4A 4UUPA 1Z56C 2JIPA 3KYIB 3UKOA 1JGTA 1G98A 1SHUX 2C5AA 2ZRKA 4MV0A 3C7DB 4ZN6A 3VZSA 1GPH1 1HFWA 1N5IA 1SBTA 1TZCA 1W4AA 2R1TB 3AU8A 4I55B 1F2DA 3ESRA 2Y1LA 3X2EA 5FB3A 1BROA 2ZYTX 3R0XA 4HO1X 1LUAA 2D7JA 2EVWX 3BE8A 1K89A 2CLLB 2QY9A 2VJAA 2XTJA 1QIKA 1Y3AA 4Q7KA 3LV8A 1Q17A 4R9SA 4YACA 3UOGA 5DI3B 3AEUA 4TLEA 5AKKA 5EXPA 2YV4A 3K0EA 2WFZA 2ZKIA 2C92A 3GN1A 2R66A 3A3KA 2OO3A 2QM8A 1L3CA 2O2DA 1XZLA 2OSBA 1F2TB 1L7MA 1MAVA 3GCGA 4MR9B 2NUPB 1ILEA 2D0IA 3W3AA 1TT7A 3QVGB 1A1VA 2G82A 1LQUA 4V2UA 5EXEA 1ID1A 4MQEA 4EG0A 1B16A 1RACA 4HTFA 4OBBA 4BY9E 4J7UA 5ICGA 2ZREA 1RQRA 4JJ8A 5FOUA 3WQHA 3LTNC 2E4XA 3BS4A 3Q85A 5EIBC 2OK7A 3LL7A 4JYMA 3PDIB 3ONEA 4OOEA 3TN7A 3W1WA 3BK7A 5C37A 3V2GA 4C3OB 5DTMA 1M5TA 4QJBA 1YK0A 5CT4A 1DI0A 4DLBA 2C5HA 2DQYA 3DZDA 3QXCA 3BWXA 5JZSA 2IHJA 1YR2A 4WSOA 2JH3A 2FR1A 1GZ4A 1MAUA 4LISA 3RS0A 5ABPA 4DR7B 5B1SA 1JKJB 5JECA 1EBFA 2A0UA 4US1R 1F0PA 1WULS 2DX7A 2GD1O 2JGAA 3QE0A 1L5RA 2LCIA 3VZCA 3E9CA 3KEFA 1GA6A 4UHKA 2VH2A 2D1SA 2B2CA 3NHFA 3O03A 3RFFA 2ENWA 2FRDA 4NENA 2WTAA 3A3PA 4PYQA 5DNUA 3BT7A 1IOVA 2H5LA 3GD5A 3MCZA 2IUTA 3K1AA 1JLRA 1GL7A 2H59A 2PSFA 2GH1A 1Y48E 1Y5MA 4B80A 3JAWA 4A23A 3AQIA 2VP2A 3R5KA 4XD7A 5JS1A 4WEQA 5HKKA 2DLDA 4FILA 1S2LA 4QOJA 4C14A 1U1IA 3RM3A 1Z4NA 2ZXEA 1X7YA 4FYYA 5TY0A 1NX9A 1O6BA 1D6SA 5GZ1A 3AF6A 4MRNA 1WDMA 2HOQA 1Z34A 4OXXA 3IVCA 3KU1A 4V38A 1KI2A 1VKRA 3CLTC 3LLCA 2QQFA 2IS6A 4PYRA 4C5CA 5G3YA 2H2FA 4D3YA 1BC5A 3VISA 4FQ7A 1T2FA 3U39A 3CXRA 1ZA1A 4R6WA 1HA3A 1Z6TA 3NHLA 4I99A 4F4UA 3W7AA 5ITWA 5G4LA 2P2CA 2QTAA 1XEWY 2BKAA 2D0DA 2JIBA 5JSZB 1HYEA 3UFXB 4NRDA 4BIIA 3HO6A 3DLBA 3NNSA 1K97A 3LG2A 1Y6RA 4D0RA 4GOMD 3OOWA 4OKSA 2Q2VA 1T29A 2O3SA 1QDUA 1WZEA 2R6GA 4Y7DA 3QMVA 2HO4A 5LQDA 2AEEA 4D98A 4YMVA 1XMXA 2ZBGA 4PGHA 5AW1A 3MQ2A 3HGMA 4KAJA 4L51A 2BBWA 5CXUA 1I1OA 2QTBA 5CEFA 4S04A 2O5CA 5EC8A 1V4BA 3JQ8A 3ROZA 1GGJA 2W2KA 5FUWA 2ZBVA 1ZP6A 1MC5A 3TQHA 2ZYUX 1E1QA 1L4GA 2B5VA 3N05A 3OP1A 5BT8A 3K1YA 5AKIA 1TI7A 4JQSA 1Y6GA 2G88A 1QRUA 3D8UA 4JR1A 1BH2A 5BV1A 1WSDA 3FG9A 3HNRA 4YRAA 1Y42X 5JAIA 1YQGA 4GPIB 4ESHA 1U0RA 4JLKA 2D5BA 1E3TA 2COEA 3LYUA 3N7TA 5C1IA 3WYFA 1ZK0A 4B3GA 5A1TA 3B1JA 4NPCA 1WXWA 4YMGA 3I2KA 1W59A 1VC2A 4DLAA 5J3JA 2GXAA 1FE8A 2KLBA 4Y6PA 1U0SY 4LXGA 3S2SA 2O4UX 2F43A 1VCNA 1CJTC 5A9SB 1YOVA 2QRQA 1NMZA 4XM0A 3EOZA 4CV3A 2FEMA 1DAIA 4F1WA 3AY6A 4II3A 3ZWWA 2W2NA 4ZCSA 4IJ6A 2WM2A 3I12A 1Q83A 1QGOA 3WHIA 1NATA 1IBKB 5F1YA 1T8YA 2H1IA 2RGDA 4FNOA 3HO8A 2GAJA 7YASA 4F5ZA 1CRPA 5J1SB 3LFUA 1K6EA 3PICA 2CMGA 4OGLA 2C03A 2XDQA 3V48A 4DDMA 1T0BA 1UZLA 1JMYA 2E1PA 4Y2GA 3TW6A 5COAA 4LK2A 1CU1A 4IJKA 4Z99A 4FPXA 1W76A 2E6KA 1BTOA 2VBGA 5JS7A 5JXWA 1MW8X 2VWQA 2REXB 5A3JA 3D3NA 3K0CA 1N8SA 3DSRA 3ZKAA 1MVOA 2OYSA 1P2UA 4GLFA 2OCLA 4ZFNA 2K7FA 4O2AB 2DZDA 5LP6C 3EGWA 3VZRA 3AJ8A 3C8ZA 4JSTA 2D5AA 121PA 2XH8A 3KVYA 4D4IA 4XIYA 2CMFA 1ZCBA 4ZT7A 2AHRA 2Q0XA 3C70A 3PUKA 2PA0A 3MT0A 4R2HA 5A05A 3SHFA 4URXR 1HYGA 2XE4A 4XJTA 5BQOA 1SU8A 1OZHA 2O6LA 4GEKA 4DOMA 3HA2A 1KP3A 4B6OA 1C3OB 4BASA 3UUFA 1KZ7B 2JI7A 2QENA 1TVKA 3FHLA 2Z1MA 4K28A 3RV3A 2V03A 1TCCA 3FLEA 4XM2A 3WGZA 2Q3FA 4RD2A 5F64A 5JRJA 3O1HB 1NZJA 4AZTA 3BHMA 5LZ7A 1K08A 1V7QA 1NVEA 2IYUA 3MOIA 3PJFA 4LV5B 1QIFA 2H2IA 1QAOA 1RQXA 3PPIA 1ZK3A 1GQ2A 3WNDA 3V4RA 4O1IA 5K01A 3DQQA 2J7KA 2AL7A 4ZOLA 5KQSA 3BAFA 3LYHA 1YTUA 2R6FA 4HF7A 1JIIA 1FRZA 1UINA 3VR6H 1JFFB 3AG5A 2ZIZA 2BRUC 4HQFA 1VFNA 4AZ0B 1NSFA 3F78A 1AG9A 1EFUA 3UKDA 3D4OA 4EX6A 1S1CA 3S8EA 2RGNA 4TVKA 2R5NA 4H3KB 4PZCA 4Q3LA 2HPAA 5DOVA 1G8JA 3HFSA 1ZDMA 2AG0A 3MJ4A 1LNSA 1WEKA 2VXYA 1HT3A 4B48A 4LZPA 1F8YA 1RRPA 4I1SA 3IUYA 3ZDDA 3H84A 1QORA 3X3HA 2I54A 2H3HA 2PT6A 2WK1A 3OTGA 1NF9A 1E1RD 3INGA 4FNAA 4IIBA 1KVTA 1O7JA 2EERA 2GN8A 1I10A 4NOKA 3EAGA 3LT0A 3VVLA 3OEYA 3URMA 1EPUA 1SXHA 2WDPA 3GMSA 4Z4GA 2D1QA 4MW1A 2Z9DA 2AN3A 1Y4DE 2H11A 5DE3A 4HQKA 2RHRA 1D2EA 4UCFA 5FV4A 3ICOA 3SYRA 5HK9A 1XRJA 3T3NA 4OHKA 1PNRA 1D2NA 1RWPA 2ZSKA 1EVEA 1X8XA 3QUSA 2X5OA 1KSFX 4I5GA 4OJKA 3QLUA 4Q21A 4TWRA 4PWZA 5I9TA 3LVFO 2J5KA 3UAGA 1YRWA 3ZBPA 3G23A 3KOMA 2AB0A 2CK3D 2HK9A 4KLAA 1BOOA 1DIOB 1H05A 3L0IB 1XDBA 4A8JA 4DNPA 3DTYA 4CM8A 1NF2A 1BXRA 1MC4A 1YACA 1GEGA 2Y1XA 3GGSA 3OIYA 2O7VA 3RH0A 4EL0A 2JHPA 1N77A 2ZI4A 1T9HA 1CTQA 3ENVA 4ROTA 1ZAYA 1GV1A 1J2TA 2IOFA 3JQ6A 4RKFA 2YN2A 2P1RA 1KVRA 1B0UA 2CVFA 3QFRA 1ZZGA 4FSHA 2QROA 4D4JA 2NZUG 4HDKA 3QIVA 3DDZX 3TTVA 3MWKA 1U6IA 4UUNA 3PXGA 3U7EB 3ZE7A 1A2QA 3EF0A 2HDWA 4CNQA 5B6IA 4C7MA 1B2RA 1JQ3A 3D7NA 2A9KA 1X7WA 4DB2A 1DHRA 4Q9JA 3PA8A 4RLHA 2TSYB 5EGSA 3L43A 3WL8A 4EI2A 1T2VA 2R8PA 4QGFA 5H81A 3DXXA 1R8YA 1DRUA 5DOZA 3GPDG 3RUFA 2D62A 4YXFA 2YRWA 1NM5C 3IJRA 2OVBA 3LO8A 1JUDA 4Q19A 2JFUA 1F8FA 1RXWA 3AH8A 2NV6A 2I80A 1CY4A 1CHDA 5I3ZA 1X94A 4FD3A 3G59A 9ATCA 3RU7A 3PGA1 3IIKA 1GP2A 4QICA 4G8DA 1P2VA 1JQKA 2PCLA 4FX5A 1MV5A 4XE5A 2Q8QA 3O8CA 1LPBB 1WZCA 1UAAA 3JQBC 3HXMA 1CQZA 1FUEA 2QORA 4KUEA 4BNNA 3ADKA 2OT3B 2JCYA 2E6UX 2Q5JA 4L6AA 4U5XA 2PLRA 1QHIA 1Q14A 1QOQB 4PX5A 1NIJA 4RA9B 4R8LA 5LYJB 1QC5A 2VA9A 2BFDB 3TLZA 4BMYA 4BPRA 3DE2X 3O1JC 4L50A 2W6PA 3HJFA 1ZGAA 3AVUA 1MEEA 2BFCB 1AZWA 2YCBA 2CNBA 4CIYA 4AX8A 3RKSA 5FHRA 1SBYA 4MS1A 1QTIA 3PTZA 3PXBA 2C42A 4M9XA 4Y9TA 5IVPA 1RWNA 3BGVA 3FY4A 4TLBA 1PEYA 2B4TO 4CKXA 4O4HB 2UZ1B 3MOGA 1H8EA 1TEHA 4FP9A 4QRDA 1M7HA 2PMEA 1JB9A 5KVAA 2F9MA 4RH0A 3V8QA 4ZI7F 3R09A 4D9KA 1O8BA 4UOEA 3RC3A 4BLTA 3WGHA 2JLRA 3GRYA 2PWYA 1PEAA 2B9EA 3OU7A 1TIBA 3JVIA 4P0QB 3K8QA 1J7JA 4LPKA 3RS4A 2JLWA 2FWJA 4BJ1A 2BGIA 4HGYA 2IZOA 2YXEA 4GWKA 4JL5A 4R9VA 1L5NA 4BIMA 1Q3HA 4C7VA 3LLUA 1OGYA 3BWDD 4B4UA 2D74A 2LKCA 2QE6A 4GOND 4LBZA 4K9NA 5EWLB 3UB4A 2FEPA 5KNDD 1P1KA 5ALLA 3FOAA 3CZMA 3O94A 2ZPAA 1J33A 3FUTA 4Z9FA 3T41A 2YMMA 3W5DA 3OJFA 1WW3A 2E49A 3IVAA 4PTLA 3EGDB 4PG8A 1V8FA 2HN9A 3ELBA 3AKEA 1QPZA 1Q7GA 1I2MA 1Z47A 4PBSA 1ESNA 2R25B 3MYYA 2D59A 3QXHA 4FWIB 4RAQA 2CSUA 3DZIA 4KWTA 1RC8A 1DC8A 2YYSA 3RRFA 1L5YA 1PUXA 1QIJA 4FBMA 1GFZA 2H7CA 1N5DA 2HBZA 3I83A 3NOXA 4QHSA 1T6BY 5HOQA 2PUAA 4QBHA 5ESXA 3FOBA 1K9VF 3IILA 4EZEA 1GCOA 4HEJA 1RRGA 1TVCA 3E35A 4E22A 3AW8A 4MP3A 2P9FA 2BONA 3U3JA 1B4DA 5EWMB 1F0KA 2OQVA 2ZUCA 3WDMA 1HQCA 5AI6A 3N0TA 1WXGA 5A4JA 4L4XA 1O97D 1W1IA 1UL1X 2FWRA 2F4VB 3KC2A 3PQ5A 4DLPA 2QX8A 3B9BA 3FPKA 2FDXA 4KIGA 3E3LA 4P31A 5IDWA 4Q1FA 3W7BA 5C0OE 5JJCA 2G1UA 3RSFA 3ZWNA 3D5TA 5JSQA 5AP9A 2Q8NA 3T3PB 3KFXA 1LB1B 2BKEA 4D74A 3SDBA 2RI0A 2M98A 4CM3A 3DDWA 4D9EA 4DHWA 5IKOA 1ZONA 4JELA 2BHRA 4PAGA 2WAYA 3W2HA 3D31A 3F4KA 4MSUA 4QOGA 1G2QA 2XMQA 1GAXA 1KPGA 1Z37A 3OZAA 1DKUA 4HDSB 4KAAA 3C39A 5FTJA 4OCZA 3NYQA 2QZ4A 5AHXA 3NDBB 4L95C 3R0VA 4YYZA 4CIBA 1K7CA 4CLRA 3K16A 3UMGA 2Z8ZA 1BO6A 2NMVA 3A1DA 1U3TA 4QFMA 3ZIAA 4FB5A 3MMSA 3I42A 3QJ5A 4G09A 5C3UA 4BAZA 1YGYA 2Z2KA 3NH9A 3IUNA 2Z95A 3BCRA 3UV6A 3K35A 4DV2B 1DAKA 3UQZA 1EGQA 3K0SA 1O8CA 2V6IA 1Y1SA 4IJWA 2WILA 5I47A 1OTHA 3WP1B 1QIIA 4J29A 4XSVA 1VSQA 4R2XA 1ECPA 1D2MA 1VA4A 1ZH8A 1EA5A 2RE8A 1Z4QA 1ZINA 2XXAB 4F3YA 1IN8A 2J6CA 2V7BA 5B1YA 5JW6A 3QMPA 1A8PA 1HBJA 1FYXA 4OD0A 4R8KA 5I01A 3S1AB 3KSDO 1PJRA 5DIZA 4QNMA 2W6JD 2H9IA 1M76A 4TROA 4Y2TA 5JCJA 3H7IA 3BBPA 5HE9A 4CM4B 2YKGA 1U1DA 4NFHA 3A3NA 1DB3A 3TB4A 2W8BA 2D3TA 2WG1A 3B36A 4LV6A 3PR2B 3TMYA 2QZSA 4Q01A 2DUUA 2GA8A 4LEIA 2YCLA 4QDUA 3OCCA 2ZUFA 1EP9A 4YGXB 3WLQA 2NX2A 2VH5R 5IEBA 2GN6A 2IDJA 3OD5A 4RZQA 4BNXA 3EZ6A 5HSGA 2DEUA 3ZHVA 2DWOA 4Q3OA 3UAWA 2FZLA 4ZIRA 3TSZA 2FOLA 1KJ9A 1XQYA 2O6HA 2VNIA 1X6VA 2JHAA 2ZRAA 3I73A 3WBFA 1Y98A 3PE4A 5D6OA 3CRMA 4YMSA 4W5NA 2H0QA 1WV0A 4LDRA 3ZBTA 1OV6A 4P84A 1YMVA 4W8OA 2E7ZA 1U7TA 3MFYA 1I2ZA 3LYLA 1XCJA 3GJQA 2EBFX 3SZUA 3MLEA 5JD5A 4MQEB 3OKFA 2CE2X 3N58A 2VN8A 3RK4A 3K2QA 4UU0A 2DHDA 1FYVA 7MHTA 2JIRA 1NQVA 4RKYA 3AV3A 1E98A 1L7EA 4YV0A 3BGDA 2WHXA 3VSEA 1DNPA 2PT5A 2QX7A 1UMBA 5DBOA 1ESZA 1X42A 2L17A 3B3GA 4TTQA 3LBHA 1UP7A 1GCGA 4NZNA 3UWPA 5ES3A 3ASZA 3KAKA 4NEQA 1GKKA 1S3GA 4B3IA 4OLBA 2V8BA 4X1OA 3A4MA 4XLLA 4WVFA 1HG0A 3U4IA 1N1MA 3PQ6A 2PRJA 5IUKC 5GV8A 1UDBA 4QT0A 1BKYA 1NF3A 3IAXA 1L7XA 4U7GA 2QY6A 3B1VA 1V9SA 5KHOC 1ZK2A 1ST3A 4U4AA 1PTJA 2QOEA 1KJJA 1U94A 4NENB 4DMKA 2DH5A 3DEHA 2DGDA 4RZ2A 4OX9Y 1Y8AA 1F5NA 1E99A 1YJQA 4DBVO 5U4QA 1GJRA 3TUJC 1KH1A 3UXMA 1CEQA 5JFOA 3VZDA 4CV0A 2I6SA 4PG4A 4CLDA 4JI7B 4JZYA 4OAPA 2IEAA 4LSWA 4B6SA 4D82A 4GBMA 3NAQA 5JO0A 1IXZA 5I5GA 2RJ3A 2R8ZA 2X23A 2AJCA 4RPLA 2P91A 2XODA 1BVRA 4KHZA 1R27A 4UVIA 4AMBA 5HOEA 2H7VA 2OECA 3H9UA 3QV2A 5B4UA 2P65A 2ZE5A 5TNXA 3UMCA 4KSBA 3SM9A 4MQ4A 3GJYA 5BR7A 1CDDA 5FT9A 2AXPA 3AVQA 4XUCA 2BPOA 2FZCA 3WYGA 1GU0A 2ONZA 3DOIA 1QIMA 2PH3A 2BN4A 4YA6A 3D1LA 3HJBA 1J99A 3FCYA 1VL1A 4EF5A 5KS2A 3OMWA 3T35A 4EY4A 4DA9A 3PUYA 2BYTA 1Y6FA 2CXUA 3NMUF 1UJMA 2V0NA 3OF5A 3IP1A 3MWEA 4MVYA 2ZRMA 1H0HA 3QBTA 3QYPA 4O4IA 2PUFA 2X4IA 3DV2A 3KQKA 4PQYA 1PWXA 3R6LA 1Y4SA 4I4IA 4QTUB 4RCVA 5LIPA 4IHJF 2FCAA 5CNMA 1MJ5A 2JD1A 5JTUA 1ZRNA 2I03A 4Q7EA 4HMPA 2O2GA 4DNQA 3K8OE 3NJ4A 5F98A 3DE0X 4Y2SA 1NP3A 3R3XA 4HWTA 3IQGX 5AOAA 1MOSA 1UBTS 3CLVA 3DZFA 5BSTA 1RAGA 2PGDA 5CDHA 3JQ8B 4RHEA 5DN6D 5G02A 2VTEA 4MR8A 4KQEA 2WWIA 1R8XA 2OD7A 2OFOA 3BJIC 4Q3DA 2R7MA 2V9CA 4M1QA 3S7TA 3H2GA 4DG8A 2V7GA 2HQ1A 1RE0A 3GR6A 4ENTA 1V7CA 3TQFA 4X6LA 5ERXA 2AMVA 2GK7A 4E09A 4FINA 4DWWA 1FMTA 1KARA 4RA6B 4W1RA 5CIYA 3K0HA 4X63A 5HS6A 1XEWX 2XA1A 4OL0A 1AURA 5C1BA 3DOHA 3I04A 4TMVA 1X1TA 4B3JA 4NPAA 3BOSA 4GU5A 1QVWA 4MQFB 4NBTA 1PYDA 3ZEAA 7ABPA 3VR3D 1J8DA 2PUGA 5JAUA 3CZRA 1XAIA 1HE5A 1QV7A 3VR1A 4B0PA 1GIAA 2CXOA 1JA9A 1KP2A 2FR8C 3Q10A 2GZHA 2GLTA 3CTMA 1H4VB 3RE1A 1SCUA 3BDIA 2C9BA 5EKSA 2P2LA 5K8TA 5KC8A 2ZJBA 2HU7A 2PZEA 3H11A 4R2MA 3V7WA 2GBIA 1KZ6A 2BFEB 2PS1A 4PN7A 8ATCA 1VE9A 3A10A 2YMQA 4UE2A 4ZDIA 4XI9A 2HQOA 3R9XA 2C3OA 2MMGA 1JTVA 1KORA 4X91A 1PWYE 1HZZA 3VTKA 2IDMA 3DMRA 5LDGA 2AW5A 3W6ZA 3H9JA 1E1LA 3Q3GE 3O7MA 3KWJA 2A1UA 4JLPA 2YHIA 3FYHA 3QTTA 4KJXA 4MGEA 1ZISA 5AKLA 3WIDA 5CFRA 5HKAA 3D4IA 4MHOA 2UYGA 1M10A 4R81A 3HN6A 4RVGA 4JOQA 4W5WA 5FBLB 4CI9A 2P8SA 4WGGA 4F2WA 3EISA 2WIDA 1BS9A 4K1LA 5EPEA 1JR4A 1WRBA 4JBGA 5BNZA 2VQFB 3RV4A 2ZJ8A 3KOWA 3RSSA 1ZL0A 3DFIA 3JVDA 4FKBA 3Q8KA 1RJEA 1WQ3A 3DMHA 1H65A 3GOHA 1E7QA 4JJZA 1U9CA 3FOEC 3AILA 4U7DA 4BNZA 1N3IA 2O8NA 1TVKB 1VHQA 3DBHA 3GRCA 4HN9A 2WU3A 1CRLA 2YVKA 3BORA 1T6ZA 3HN2A 5AKJA 3RREA 3WNBA 2E48A 1NPDA 2UYQA 3UJNA 5LQNA 1WDLA 2HLDA 3KDPA 5ARCA 4BNIA 1AKVA 4BQFA 1CQXA 2WJWA 4L2IB 5E7MA 1YZKA 5L4NA 5L51A 1TK3A 1PJZA 2QVZX 3HB5X 1Z0UA 1VKNA 4QWWA 3ZQ4A 4CODB 3WGGA 2I99A 2B7BA 1L5ZA 1JU4A 1P4SA 2IOQA 1FFWA 3HB0A 4HYYA 4CLOA 1GA4A 2RIPA 2OC9A 3LP8A 1PS8A 3PDUA 4LS3A 4XAQA 4OH1A 3ZHOA 3NHYA 4QGSA 4ZYYA 1FMCA 4MCJA 1IG0A 1PHRA 3T0GA 5KWEA 5EZYA 4DV7B 2YXBA 3G8AA 2A1TR 4ID3A 3IIIA 4NABA 5DM1A 1MZPA 2F59A 1YS1X 3KR2A 5EP3A 1YS6A 3S1LA 2EWMA 5BMVA 3OQ1A 2BR4A 1P74A 3F6BX 4MI3A 4Y1FA 1ZEMA 4F6RA 2WJHA 3HZZA 1QR6A 4J0KA 2B8NA 2QX6A 4AP6A 2H1SA 3MJSA 3E0XA 4FHFA 3RRMA 2WWRA 3HZOA 4C08A 2PT9A 3BCSA 5KJEA 4DDVA 4PC6A 5AW6A 1KZ9A 1RPTA 2CNLA 1HK7A 3TMAA 2NUBA 4OSOA 5E6UA 3ZNPA 4MO2A 2ORED 4LFCB 4EECA 2PXAA 3EB9A 1C4XA 4PSUA 4A16A 2OEPA 4XSHA 5K0ZA 2C7RA 4D3XA 2OP1A 3FF4A 5JU6A 4U3JB 1T9GS 1BFUA 4E7OA 3T7EA 3TNLA 1DQSA 1SR8A 1AM4D 1OD6A 4W6QA 1OLXA 1WEHA 4MWTA 4RH3A 1GZ6A 1J2EA 1T4DA 2B78A 4UXJA 3EVZA 1XKLA 3JD0A 4GMHA 5LA6A 3WBBA 3F6YA 1OC4A 3ZYCA 3IT1A 4LGYA 1CZRA 3NIBA 1JEQA 4KK4A 4Q3BA 5FNZA 2IKQA 2REBA 3ENZA 2J0UA 3MN1A 3G6KA 4LDQA 4CM8B 4E1AA 4G25A 2F1HA 3BDVA 4TUYA 1EVJA 1G4HA 2LKDA 3DDNA 1OILA 3L01A 1A5SB 3R8FA 4EAAA 1YVEI 3BM5A 3AV0B 4CU2A 2ZUUA 5BWNA 2YC4C 2VF2A 5JZVA 5G0VA 3AM4A 1AQNA 2NNLD 3L6BA 3NM6B 2PXHA 1J6UA 4HDKB 3WLIA 2WF9A 3C3CA 2DFLA 1IQUA 4OV6B 3ZTYA 4C0XA 3RFVA 1X7WB 4AN0A 1XR3A 1EAYA 4MAFA 3VSDA 3O91A 5T4BA 1FY2A 5TQ2A 4AFNA 3ET4A 2ODPA 2PV0A 3MRTA 4MVJD 1USVA 1Z83A 4GRIA 2JAWA 2QPLA 3IGFA 5ECYA 3UG7A 5KCZA 4NF2A 1PR2A 2A5LA 3C43A 3WK4A 4LGVA 3ED5A 1IWPB 3CWQA 4O08A 3LPDA 3W05A 1KJZA 2F3PA 1YB7A 4OJYA 3RTAA 1LX6A 2O2SA 3BXFA 4X66B 3GLGB 1Q1EA 2G28A 2OLJA 5FKJA 4BX9A 3O6VA 1RYZA 2Z6AA 4D43A 1N3YA 1R0CA 1AMOA 4BGIA 3H4IA 1T26A 3TLGA 2BJHA 3HBNA 4FGLA 4NU0A 3A14A 4B76A 4N5IX 2IY8A 3KAPA 3K7EA 4JUFA 2Z43A 3EARA 3PDWA 3T7DA 2OGUA 4ERXA 4YP7A 4DV0B 3FCUB 3O84A 4NYIQ 1XMJA 4R8SA 5MFPA 2HBYA 2ZWIA 2QLNA 4NNJA 4QUJA 3G6WA 3KQWA 4K6MA 2HMTA 1X0VA 2OFXA 3AQ4A 4FE4A 1J97A 2I2DA 3OZ7A 1N2CE 3ETGA 3V2IA 3VH1A 2J09A 4L3VA 3W3AH 4TQGA 5KX5B 1YI0A 3FCXA 2EFEB 2W58A 5JYCA 4UTVA 2JLYA 2ET6A 3BD7A 2ZS9A 3MTGA 2ZUBA 3C7TA 1DCMA 3X1KA 3BKWA 1CZOA 4HEQA 1M1YB 1OX5A 2V7VA 4F06A 1JW9B 1PNOA 1DKMA 2ACWA 2BM9A 4YJGB 1T1RA 3H0EA 1XDZA 2HJSA 4R05A 1PJ2A 3D6NB 3QPVA 4JV5B 4XH9B 2IFTA 5DHQA 5LFAA 1II9A 1JHXA 2FZKA 4OB8A 1U31A 3HV0A 2RONA 2OWEA 1AB6A 4FFNA 1ODKA 3RRBA 2AOVA 2PKYX 1S7GA 3T61A 1ISGA 3IAM6 2J6HA 1QYWA 3BMOB 2HAEA 1EAMA 1YZFA 1U3DA 1I2AA 3CLUC 2WIKA 4LW8A 4QGBA 4EYGA 3U0VA 4ENVA 3I8SA 3OKCA 3FRJA 3TXXA 4MEJA 3KPJA 2GYYA 1TEZA 3MZ0A 4YLYA 2GBCA 4CEHA 5FADA 3ZDRA 4V0MA 3LU1A 3WKCA 1CW2B 1PBNA 5GM1A 3EDRA 3QA9A 3UT5A 2PNJA 4EFDA 2W42A 3AFGA 4PVDA 5EIFA 5CA0B 4EENA 5AM2A 3C41J 2CLFB 1P5FA 1R0RE 2QK4A 1BMFD 4JX8A 3S2FA 4PN3A 5LD2C 1LH0A 1WHSA 2GFQA 2XCOA 3AUAA 1GT91 2RFLA 3K30A 4IDCA 1DSSG 2CF6A 4CR6A 2QW1A 1MDFA 1U0FA 3BMCB 4IIJF 1Z5PA 4JENA 2INGX 5I4KA 4RJIA 4DYHA 4J0EA 2AOTA 3IAUA 3KVOA 1LSUA 4YJ2F 4B6PA 4LX8A 3DOOA 4KO4S 4L0DA 1I4LD 3ZVLA 3T4UA 1G7TA 5C3MA 3PQ4A 4G2TA 3NDPA 3U4DA 1TGYA 3HFJA 1Q1QA 5KSZA 1FFYA 3BB1A 3D54D 4ECAA 1IHYA 3VKWA 2IXEA 5CH5A 4K26A 3EEBA 4B7AA 1L4HA 3H2HA 5AVZA 4B40A 2WUGA 4XARA 2UXBB 4OK6A 4HQNA 2GN4A 4GPTA 4M54A 1VP9A 1EX1A 3IMGA 4HN2A 3DFFA 2XNKA 4CKCB 3HB1A 3NEAA 4DJFC 3G0BA 3D8RA 4QUHA 4LF8B 1N5JA 2G0AA 3PF8A 2FYTA 2P62A 4IDAA 1KSGA 4CLRB 5CDUA 4AJ9A 4ID9A 2Q4OA 3JTMA 4A5SA 1C5KA 3BHJA 2JH8A 2Q21A 2OHVA 3HCRA 4KFRA 1DQRA 1A7JA 3GVCA 4QHYA 4RV9A 1P0FA 4L75A 3VU8A 1QBGA 3ZWAA 4C29A 3B2QA 3GD7A 4UBJA 5EZ5A 3DR3A 4N7BA 4X7MA 1F6DA 3G9UA 2WYIA 4LXYA 4I55F 4CUZA 1XAJA 4MYUA 2P9HA 1V5IA 3W3AD 1I4WA 5LU8A 3SVLA 2JJYA 4MYTA 5EWJA 3QBJA 3O4IA 3RDPA 1ZM3A 3FYUC 5DHRA 2Q3MA 2N1BA 1GPMA 1ZICA 2J9FA 2OFWA 4WZZA 1MIHA 1Z08A 3GUCA 1XMVA 1T8RA 4W6ZA 1DZ3A 2W4MA 1WD7A 3G0OA 4QOFA 3LKBA 2M6SA 2W8BB 4YP1A 4DV4B 3L1JA 1V3UA 5IULC 3ZZNA 4OXQA 2DHCA 1RAFA 3FCOA 3K71B 2YVLA 4M0UA 1DDGA 4JOBA 1CUZA 1DRJA 1AD2A 2KB0A 1TM1E 2RHLA 2ZJ4A 4HXYA 3SBXA 4TS4A 4ZIRB 5K9ZA 1T36A 2PUWA 1Q1NA 3EXG1 1QGED 3C1TA 3GFQA 5C81A 3TSCA 4DM3A 1P91A 4IG4A 5GOTA 4Y0VA 3IJ5A 4AULA 1SO8A 3R3JA 4UUAA 4XZ3A 5A4IS 3WGIA 1N3LA 2GUGA 1DIGA 4MW6A 5J43A 2VRCD 2IBTA 1GLNA 5EJIA 1YZGA 1QRAA 1BD3A 4DEVA 3BXHA 1XZPA 3MT7A 3ZXYA 4XYLA 2QN3A 1U0NA 2IIQA 1CJBA 3BEOA 3B9RA 1FNMA 1C30A 1VGVA 3B89A 1QIHA 2HIGA 3FYDA 4RSHA 4XASA 5EYPA 5HKKD 5ALTA 2OZVA 3Q5GA 4OF4A 1UMBB 1JE1A 1PZNA 4J0CA 3K70B 1PGJA 4CR8A 4B85A 4Z1MA 3PE3A 4EA8A 3F3YA 4WA7A 4FMDF 4EWLA 3MW8A 3I62A 3ELUA 3PHHA 3KKMA 4URYR 1NXWA 4QDXA 1FDVA 5KQRA 1WTAA 4F97A 2M1ZA 2PFKA 1N7GA 4OVKA 3U4MA 5LQMA 1KMHB 3UMJA 2JRLA 3FPLA 3QYFA 4FMCB 1KO5A 2H4WA 1HZJA 3D4LA 4QPPA 1QZZA 2PJRA 3NHPA 1Z68A 1C2TA 4FC7A 1DO8A 3RD5A 4EGFA 1U7HA 4FEYA 4PPFA 4YRIA 3OUUA 5HGXA 3LWNA 4UQLA 4ZTUB 1B6GA 3D6AA 2BUCA 3AFNA 3ROTA 1JIXA 2XBUA 4BX0A 3OQVA 1LJLA 3GDGA 4IJVA 3NP9A 1N2ZA 4DW8A 2EFDB 2EXXA 1UM9A 1E3LA 2J5RA 2XUOA 3L2OB 3UHPA 3KUDA 3P9PA 5BR4A 1SKMA 4KR3A 3EIWA 4YO8A 3OFSA 4OA5A 4P7JA 5A7FA 4MQ5A 4DKXA 4F3KA 3NT2A 4PEVA 3OIFA 4BQOA 1EM8A 2AH5A 4QXMA 3RIYA 4WRRA 3W3ZB 3IBGA 5DP1A 1WB6A 1YCGA 1AKUA 4JLVA 3RW9A 5GQSA 2H65A 5JSHA 1HDRA 4G2NA 1UKZA 3KXLA 4AUKA 2D0OB 1XZNA 3GLVA 4H18A 5DNWA 2QEQA 3TVTA 1T8UA 3F0TA 1E1QD 4V0LA 2HHJA 3IH5A 1RXYA 3HVHA 3KZNA 2W2OA 1PFQA 1RIFA 3U9TA 1W44A 1A98A 5AOCA 4C01A 4DGQA 1HORA 4KQ2A 4INAA 1YDHA 1MDBA 3MUNA 8GPBA 5KWIA 1FSFA 5MN4A 2FH5B 2JZNA 3PFWO 3PL5A 2PZBA 3ZY3A 4XQGA 1GTMA 2AK3A 3U81A 1T5TA 4I50A 3A4VA 1E2UA 2XQFA 1T4BA 2OZLA 4BL5A 2HD4A 1XAHA 1NW4A 3LBFA 1IZYA 1IXKA 4POAA 3SFVA 4ZMSA 2GXSA 1U5CA 3TI9A 3VPXA 5F3DA 3SKVA 2CB0A 2D2FA 3IVXA 2XUHA 3NBAA 3BWBA 2W00A 3HJNA 4IEFB 5AJHA 3ABIA 1JT9A 2VDLB 5IDYA 3CF0A 5DM4A 3UJ3X 2NZWA 3I2IA 4BGUA 2WQZA 5CYOA 1KR2A 2IF2A 2R79A 5JPCA 4N8SA 2BGUA 1QZXA 1VJ5A 2IHZA 4MR8B 1NRWA 4RXUA 4BO9A 3H5WA 3VYVA 1RMQA 5FWYA 3LQQA 5SZJA 3EBPA 5T57A 8ABPA 3T1HB 2ZI6A 3F3MA 1XDGA 1E7WA 3FPAA 3DMYA 4LNUB 3OA0A 3P97A 2XUGA 1KBQA 5LZ9A 1PT5A 1LW7A 2J08A 3PSAA 1T0JB 2A35A 1FUUA 2ODEA 4MDHA 5E9AA 3IUJA 5KAPA 3TPCA 1PFKA 1DBPA 4NOJA 3G0GA 1ZC3A 4ZU3A 1XZBA 1WPXA 2QIOA 2XEXA 3DV0B 1D1TA 1YZTA 2GD6A 2Y1KA 5FL7D 4PZ9A 3CR7A 1UBLS 2W2PA 1AKYA 1LS6A 4KQFA 1J2RA 4BNJA 3WDLA 5AVUA 3UQYS 2JAUA 3VTFA 1UM8A 1WP4A 1KSHA 1GUYA 3HQ4O 4AJJA 5A4KA 4WFJA 4DDKA 1HH4A 1SCUB 4JOCA 1KPIA 2JFYA 3FMPB 2FMIA 4HG2A 1PCXA 2PZAA 3BGOS 3DBVO 2UUAB 3CYFA 3A9VA 2QTRA 3H5NA 5CB4B 5ENZA 2OV4A 4O2AF 3TM5A 4R1OA 2Q6OA 4XWWA 1G20A 1U98A 5IZCA 5FA5A 3R9XB 4CMKA 1LSOA 3EXFA 1KKUA 1QIEA 1VL0A 1F6WA 1PFVA 3AF3A 1SBIA 1SUFA 3FYSA 1YR6A 2Y05A 1QJ4A 3IKTA 3NBZC 3G2NA 3KDAA 3MGGA 1HT1E 3FPCA 3NZEA 3PFGA 2VKQA 3OVMA 4YPOA 2IPMA 1VG8A 2YHIB 4K6KA 3W8NA 1T35A 5BUSA 1MX9A 1OXKB 5AJVB 2V45A 2ZB7A 4Q1DA 1NN0A 1HDZA 4P3OA 3NTXA 1KQGA 3E7DA 1YU6A 1V3QE 3FWHA 3C6KA 4GBJA 4O4JF 4OMDA 1M2HA 3JYQA 4MARA 5BORA 1X1QA 3CB4A 2F3SA 4KX3A 4P6VF 4UMDA 4UEWA 5K8UA 4ETIA 2DYKA 3Q3JB 2Q3DA 4U8HA 3SI7A 1GSHA 3CPSA 3A9RA 4BKQA 1F7VA 3ZGZA 4LOIA 5F2EA 3WX0A 2ZYIA 1T9BA 2FHPA 4DCGA 1L2TA 2OZPA 3CX8A 2BEKA 1TK9A 3DBHB 4C20A 1JQBA 1EJBA 2DT8A 5CLIA 1PUJA 3OBBA 4L22A 5B64A 3DBLA 5FEMA 2ODNA 3O8DA 1F2VA 3OP4A 4YUVA 1V11B 5G4KA 3F8WA 3KQOA 2GZSA 1VQ1A 1V8PA 4EY5A 2C5SA 4DIUA 1ONNA 2OQIA 5KYWB 1FRFS 3UVEA 5LDHA 1OI3A 3GGOA 1M0TA 1E32A 3CRQA 4HATA 2O9JA 1CLEA 4IVQA 3PF9A 2TMYA 1YRLA 4TMWA 2A58A 4G1MB 1EESA 1FPQA 1XA4A 1G17A 1BE6A 1AK9A 1NFRA 4N6NA 4EHDA 2CV0A 4ND2A 2BZ1A 1UXJA 3GVPA 2BC9A 3RG2A 2JK1A 1V8BA 1CY6A 3NUQA 5DSZA 5JWRA 5JZ9A 4WBNF 3BICA 3KRTA 2AUTA 3V4FA 2JFPA 1G21E 3QQPA 3AR9A 1M1NB 2XD9A 3D7SA 3UCFA 2BF7A 1N8NA 5BMVB 1NR7A 3I5XA 4F6RB 1CX9B 1ZMOA 2E5LB 2N9UA 5AXCA 4TTAA 4AQDA 2DB3A 1IPEA 5EMHA 4FOPA 2Q28A 3IIJA 4KQ9A 4I6GA 5LOVA 4R0VA 2BISA 3SNHA 3F6SA 3ANNA 3SJ7A 2QR3A 1ISPA 3HXKA 5KB3A 3REGA 3Q2IA 3R7BA 2A0YA 3T12A 1BRMA 4HVTA 3ZE9A 3K3PA 3QNMA 5E6UB 3U26A 2WZDA 4REMA 3FETA 1RU3A 1GQFA 3UJCA 3VPCA 2V4UA 2JDID 5SY9A 4R1SA 4KX5A 4B4WA 1EP3B 3PQCA 4XRGA 5HQ3A 3QYAA 4X9XA 3EIXA 3G1TA 3Q9SA 1OLXB 1E4VA 2GM3A 2P69A 4MAAA 5CNIA 3H0CA 1SUSA 3DEZA 4ZMRA 3TOVA 3EQ8A 3G2QA 2B1JA 4XR4A 4GSYA 4HOYA 3QG5A 4KGVA 5LA6B 4C87A 1FNDA 3ODPA 1TADA 2IWHA 3ZGVA 1PV2A 1MQSA 3WMEA 4EUNA 1JEQB 2X3YA 2QPTA 1HURA 2OVFA 4OUKX 1EE2A 2JFFA 4Q9KA 3EF1A 4L8VA 4DCPA 5FD8A 4TUYB 2WA2A 3QVVA 5ITSA 3EPLA 2VT3A 4LCEA 1A8UA 1PJCA 1RQLA 3FPHA 3R1IA 3OX4A 2YIDA 2NACA 1BHQ1 3ZCXA 4HAXA 3L6OO 4JY7A 2RKWA 1RR6A 4QDJA 4B5LA 2H0RA 1WXXA 4POOA 1L4YA 4GMGA 3ZZ1A 1Y4UA 5KYXA 1CIPA 1FQJA 1YXMA 3RI3A 5LQAA 5IJAA 4H7DA 1U2PA 2Q3JA 1P5RA 2OHHA 4N7MA 5TQ2B 4TV8A 3FM9A 3L7YA 5GADl 1NQWA 2DQKA 5KNBD 3GRFA 4AY5A 1DJOA 3PJEA 3SJBA 2CLSA 3PNYA 4RH1A 4OHCA 4LKOA 3VPDA 2QT0A 3HVUA 1RAEA 1JEYA 2FKNA 2IITA 2GZRA 3F9CA 4JXKA 4L02A 3UMYA 3E15A 2JJQA 1V8ZA 3NEYA 4JR0A 1N2EA 4MXDA 4MVJF 5GPBA 1TMOA 4KRGA 1WXFA 3ECCA 4M8LA 4O4HF 1E2DA 3V1MA 2WWTA 4UCQA 3DD5A 1T6YA 1EWRA 5K05A 1YO6A 3BMXA 3PG5A 3GIDA 4J0JA 3SHOA 1V1JA 1XIVA 2GM5A 2HU2A 3BZBA 3IVRA 5F35A 1RP7A 5FORA 4BWGA 3ZYZA 2ACVA 5A4DA 4PWYA 2DY1A 4GS5A 4LSMA 3QVXA 2QYSA 4HMOA 2HGZA 2IUEA 5K4AA 3KYDB 4NL4H 2FA9A 4PE5B 3N1UA 4W5RA 1WXDA 2O0LA 1SK9A 1K5HA 2B7LA 2JIDA 1ZIPA 3AFMA 4AG3A 1O97C 4D8TA 5HE8A 1M54A 2BAGA 2YZMA 4HUJA 3AUUA 1E18A 1ZESA 1IZZA 3BFKA 4GPD1 2J3IA 5F7ZA 5LCXA 3ZXUB 5AI0A 2HPVA 1EVYA 4DJ5X 2RDMA 1BEEA 3AW9A 1Z7YA 3E9NA 3PDHA 4JUAA 1EVZA 5JC8A 5JBQA 3LBIA 1CERA 1YJ5A 3DEKA 2Q46A 1J07A 1HFJA 1WD5A 3G5UA 4R5MA 1BEUB 2Q0HA 4YRFA 3TLMA 3TOCA 5JMPA 3EUFA 5JJLA 1CJKC 2Y93A 3O4HA 5EMJA 1EFTA 1A7AA 3KB1A 3BH7A 1AA6A 1UODA 1DINA 2GT1A 1L5FA 4GT1A 1VMEA 4X6UA 1O9GA 4L7QA 2QZPA 2C5BA 3L7OA 4KVZA 4XYMA 5SV2A 3TBHA 2CDBA 1RLJA 4A10A 4YAUA 2AXQA 1O6CA 2LW7A 2PH1A 3U61B 5K0TA 2YTZA 4TXMA 4ZVLA 3LIIA 4PRLA 2AN9A 3MWYW 2C9CA 1C1DA 4EVIA 4DMHA 3UT5B 3ZD7A 1RDFA 1NQAO 3FVVA 2JFVA 2NSJA 3KKLA 1EFPA 1WM1A 1QGDA 2FSGA 3GJ5A 1WHSB 2HA5A 3R6GA 4F60A 2J85A 2OM6A 3RU2A 3K6RA 5HQTA 1M9NA 3R76A 5KU1A 3ZIAD 1OBVA 1ZNYA 2EF0A 3THOA 3Q7QA 4KXLA 3CVYA 2I66A 1JMKC 5FRDA 1R1DA 4UXHA 4DR2B 5IM4F 1U11A 2A5JA 2IYLD 4TTIA 1Q1AA 1J90A 3DTNA 3CEAA 3HYNA 4B8ZA 4C5BA 5IKPA 3V8RA 1QP7A 3M81A 3KJNA 2R6DA 2BWJA 2I67A 3PEVA 4U6QA 3ZK9A 3M6UA 4S1OA 3CNLA 5KOJA 4A7PA 4D5EA 5CFZA 4FYXA 4BHTA 4P32A 3VRHA 3EYAA 5BUQA 2R1UA 5D51S 4LJ9A 2YUIA 1ZH2A 1D2RA 4RETA 4KR7A 4YCDA 2P6PA 4DQVA 1M73E 4RVOA 1EP2B 2ZRBA 3TZ6A 3TBKA 1ELOA 3PUZA 4G01B 3QVJA 3SG0A 3LSTA 4KQKA 4ZAGA 3NBFA 2YHUA 2C4VA 3B8EA 4PZPA 3R7AA 4GR5A 1QPBA 3HB7A 1FRNA 3H2ZA 2Y9MB 3LE8A 1QYRA 3DMTC 4OHMA 4G0OA 3SQWA 2XUJA 4LOLA 2EW2A 3PFKA 5FI1B 4ZYWA 4P53A 3T5AA 4LFAB 2YXDA 5D85A 1PQ4A 3ZDAA 1N6LA 1LVUA 1TPYA 2VDPB 3W2TA 4WOKA 2JFGA 4IQFA 4MPJA 2YJGA 2XRFA 3ZXSA 3QX7A 4ALNA 1ENOA 5LBUA 4PLZA 4KYVA 1QO9A 3T7IA 1GDDA 1KBOA 3X1YA 3L49A 2BEJA 4FMPA 4QPCA 1EVKA 1RMTA 2C96A 5FBQB 4A2QA 1GQOA 2DKNA 2GCOA 2MT9A 4EEZA 4WZBB 4IZIA 1PKXA 1DC3A 2DKOA 2RJNA 2YZNA 3DW3X 4IV0A 5L3RA 4RS4A 3J80A 3NBKA 4V1CI 1SIOA 2B3TA 2WT9A 4MPDA 2AI2A 1DG1G 1OWLA 4F5WA 2C7PA 2J9FB 1RM4A 4RTNA 1ZD2P 4N5NA 4DAOA 4LZOA 3CUSA 1EXVA 4GKAA 2HSZA 2F8LA 5A0FA 3NTVA 5H3LA 5MF6A 3UAYA 2OV3A 3TOZA 3K70D 3KELA 2P77A 4QRHA 5KWJA 1RWVA 4B9AA 4HEHA 1QH8B 2C7BA 4PHGA 3TQQA 4DQDA 1KEPA 5JSFA 4WVLA 2B7CA 3MCTA 4URUR 3WSVA 4MGHA 3CGWA 3RBXA 1YR8A 1XTSA 4BQSA 4XQEA 2VT2A 5IDQA 5KTYA 3W5AA 1W30A 4DA8A 1T36B 4ZARA 1XN1A 3B1YA 5DTJA 2CFCA 2P4UA 3KWLA 4MEAA 2JRCA 4BP9A 2MTBA 2XOEA 3GFFA 4DQ0A 5ALXA 4M76B 1TYBE 5LKRA 3P96A 1NVXQ 2C00A 4WCFA 3BN3A 2W2MA 3FUWA 4HB3A 4KZKA 2GAIA 3TEJA 2X1LA 4AJLA 5KKNB 3FOCA 4WPGA 4ZVMA 5H02A 2PVPA 1C30B 1JDVA 4RZ3A 1U0EA 1A97A 4Y2QA 4G5YA 4NJOA 5EYPB 3RLFA 1C7JA 3B52X 3VSAA 4D44A 4W5OA 1KI1A 1YR9A 2H31A 1SIBE 4S1TA 4DA4A 1QQBA 3B9PA 3K31A 4EK9A 3IAHA 1XDUA 4HC4A 4DIEA 2JEZA 3OTHA 4JBHA 4PGGA 2BM0A 2W4QA 4CM9A 1E20A 3LCJA 4F5YA 3HI4A 4CG3A 3BKXA 3GFTA 2UVPA 1KKLA 1AA9A 3RF7A 3SBOA 1JR2A 2A9QA 4KSCA 4UTRA 2IV7A 4ZT6A 3U2QA 4HUTA 2J5XA 4FFWA 1BMDA 4PQRA 3U3XA 4ER5A 5J2UA 3LHFA 3OLQA 4UDOA 4K5QA 1S01A 3MB5A 3RC1A 3MS2A 3R74A 2YV3A 3IRUA 3WGNA 2PKXA 2C99A 3ZGYA 4EYKA 2I4IA 4IMPA 1EGVB 3A9UA 4CL2A 3FHTA 1JT2A 2GPTA 1EX7A 2I29A 3ZHRA 2W2QA 4HJRA 4YRQA 4QGGA 1AX9A 4ML3A 1NR1A 1S9DA 3BCUA 3KZVA 1VMIA 5AVOA 1D2CA 3T3GA 1UM9B 4LMAA 2Y4NA 3DZCA 3ZHCA 5FFNA 3VNUA 1GAWA 4Q18A 1O96A 3MT9A 3REOA 2RK3A 1GPDG 1G18A 2Q1UA 1DRKA 4ZVKA 4NICA 2CVZA 5F1OA 5CFOA 1DTSA 2J6BA 4QBGB 5IARA 5EIOA 2FY8A 2Q29A 3OU2A 3VHQA 3N0WA 4EFMA 4P4TA 1J00A 3EMDA 2VDMB 4G0PA 4NS4A 3ENQA 7AT1A 3B51X 2IW1A 1QH0A 2D4HA 2YZ2A 3CH5A 4OLJA 4RQTA 4BTLA 1NURA 2OA0A 3OT5A 2GASA 3A0RB 4ZREA 4B3TB 2IRWA 1ZI9A 3KLMX 4LE1A 1V9CA 1Q22A 3QSGA 3EZ7A 2ROQA 1VYVA 2IXGA 1H8HD 1W2GA 3DONA 2AQ8A 2EFYA 2XYPA 3E1GA 1CNFA 2R48A 2XUAA 4OREX 4B9EA 5HJEA 2C95A 3GY0A 3CVJA 3T9EA 1QP8A 4B43A 5B7NA 3SYTA 1B0PA 5KJCA 4DL9A 1SZPA 3ZGXA 1IU9A 1FTNA 1PJLA 3PI7A 1OAKA 4IS2A 3VKUA 2Z5GA 2I9KA 3K9CA 4HWKA 4JVLA 3EA5A 4C4AA 2LDBA 1CUGA 3KT8A 3ME5A 4EKNB 1JS1X 4R0NA 3UJ8A 4G5GA 1Z6ZA 4HUQA 4ETNA 1WZ2A 3GPBA 1VM6A 4L16A 1TJ4A 4DPMA 3MYRA 2PX5A 1IE3A 3SPXA 4P4NA 4JIMA 2XSZA 3M6IA 4DJDC 4AKEA 3TRDA 3ZCQA 2K6GA 5GMOA 4XGNA 2GZDA 5E6RB 4KRXA 2J30A 3EAQA 3EZ2A 3L77A 5CJ2A 5AKHA 3SJCA 4AF7A 1D07A 4D9CA 4E2FA 3VFDA 1GARA 2WJ3A 1UBKS 3HU3A 3CE6A 3O5AA 5TSDA 1C9NA 1H2ZA 4UFNA 2CE7A 3WDSA 1G4AE 3WLRA 1IDOA 3OCYA 1T8WA 3F71A 3L8DA 4IIFA 5IBQA 3H1EA 4RULA 3V3TA 4AZ3B 1ABBA 1IHOA 4NMHA 5C9ZA 4DCUA 4PICA 1UR5A 1PT7A 1DOZA 4L6CA 5EXDA 4NESA 1T5OA 2YWFA 1JA1A 2AG6A 2AUMA 3C0KA 4FOOA 4PYLA 3OZCA 4M9QA 1LBEA 5CP8A 1XTTA 4H16A 3UV3A 1IAVA 4D8VA 5CD9A 1TF2A 3A4NA 1Z0SA 2VT7A 4KFUA 4RL4A 1L5HA 1C14A 2ZBRA 4M7PA 3VAAA 3QE3A 5T8KC 3ZDCA 3A1FA 3ZHXA 4AJEA 4BB0A 1G20B 4ZAXA 3T1VA 4YUXA 1PNTA 1UKAA 2QN6A 1JJBA 3EXFB 2J9YB 2GBGA 2Q4RA 3HN7A 3HVIA 5AJTA 5F2OA 3UAXA 2J4DA 3DTVA 3W5UA 5CAEA 3AF4A 4OL9A 1HLPA 3ZR4B 2EKLA 1FFXB 3V9AA 3EVTA 4NK5A 2R11A 3IHLA 3PHLA 4N7RA 4P1ZA 3TLCA 5FPPA 4HLCA 2PR7A 3F9IA 5FI5A 4QDZA 4JLNA 4IH4A 1MQ8B 3DM9B 2RH5A 5BSWA 5JALA 4F85A 3LT5A 5CFQA 5AESA 4M7OA 5MHTA 4TT8A 1E2HA 2B4AA 2BHTA 3KT0A 4CKBA 3RVOA 4XPIA 4UEQA 3WLJA 1ZH6A 3KVRA 1P7WA 1USIA 8OHMA 5DX8A 3ONWA 1NJGA 3DNPA 3JVVA 1WZUA 4I6EA 1IH8A 2FPGB 4JQYA 4MGIR 4S2UA 2YRXA 1BJKA 3B7WA 5LB4A 1EVQA 2KS6A 4ZOLF 5THKA 4MKZA 2I7CA 5KSWB 1JKIA 3VNBA 2ATCA 2JLAA 1GZDA 2EL7A 1UJBA 4CT5A 4I6JA 2ZOSA 1E9DA 4ZQBA 3SD7A 3V2UA 3I34X 5G4KB 2OENG 1RQGA 1YONA 3ER6A 1PT6A 2Q6LA 1ORVA 2VUIB 3COZA 1KJQA 1QMPA 4PF1A 1K2VN 3SJZA 3EDCA 2GZMA 1I9GA 4GLBA 3X2SA 4LBYA 3ROQA 4B4DA 4D9NA 2CBZA 3DNMA 1W52X 2FETA 4QQRA 5K2OA 4ZT2A 5CVDA 3IDSA 3PRKE 3S44A 3EXIB 3S99A 2DBVO 4UEKA 4YIKA 5CDYA 5C52B 2WNSA 3HLTA 2BF4A 2HF8A 3H87A 4YH1A 3QTBA 5TS2A 4DABA 4Q4HA 2GHTA 2N46A 3IQDB 4IQGA 4WXPA 4R4JA 2OUKA 3AL3A 5C8XA 3HBFA 1OA0A 2ZIFA 2H16A 4LZAA 4URWR 4XWYA 4BFVA 3MK31 4S35A 1ZVVA 1K7XB 3G0IA 3QITA 2W5UA 3GRZA 1ADGA 4GUAA 4XD7D 5TR9A 4F3RA 1K1EA 3ZY5A 1JPUA 5J4YA 1X2BA 3QK7A 3CEMA 4WH0A 4DN6A 2WLTA 1U8EA 5IKEA 3CEJA 3LDHA 1ECBA 1NNLA 2DG2A 3LVQE 4FGSA 2FW1A 3G7SA 5IBCA 5M2QA 1GG8A 5P8WA 2L19A 1GGVA 3UMRA 4XJSA 1FU7A 2CLEB 4MRPA 3DXYA 2ZRJA 4LV8B 1I4EB 4X24A 1P4JA 2EQAA 2DBQA 3DNFA 2ZWPA 3IEMA 3LY7A 5HQ3B 3IC5A 4R9RA 4Z9BA 5DW3A 1WSAA 2O23A 3RYHA 4WK0B 1DKLA 4TWAA 1MZVA 16PKA 1SZJG 3KKOA 4HGZA 2WUEA 4NJMA 3QKIA 4LUCA 3SQOA 3KSAC 3D4BA 3D8NA 5E9WA 5KNCA 1SHJA 4MROA 2E4UA 2XLBA 5TARA 5CEEA 3ZNOA 5EE1A 2ZJ6A 4L8WB 5IYZB 2EIHA 2EDCA 3QLVC 3LC0A 2CDNA 4W8GA 1CUHA 3CXUA 1ZBDA 3DT9A 4Q24A 5MGNA 3SEFA 1X7ZA 4QLOA 4WZ6A 3MWJA 4LXIA 4MKFA 3QEMA 3GJRA 4TRMA 2CD7A 2M9MA 1XB2A 3E3NA 5ICEA 3NDRA 3PEWA 2B4RO 1N6RA 5KYXB 1RRKA 1P9RA 4BFUA 1WZIA 2R4UA 4ZEWA 5J9FA 2P0EA 3QEOA 2YDYA 2GFIA 4QYIA 2FCRA 4KFSA 3EJ6A 4XCXA 2JAQA 2IYAA 1L4MA 1MO2A 3FGPA 2W11A 4BDSA 4H1TA 1ULUA 1W48A 3L84A 5ALEA 5BP7A 4QOHA 2R5WA 4UE6A 2PX8A 2Y0DA 2I7XA 1QHNA 4QFBA 3IT2A 2C4MA 3CB2A 3WTCA 1L4KA 1GUAA 3N6XA 4UUMA 4RQBA 3IR7A 3CG0A 1PDOA 1FX0B 1Q0ZA 1ORDA 1Q84A 1Y6JA 2G83A 4K9RA 2ZFUA 4R51A 5AKXA 3WA7A 1JEYB 2VDOB 4FKZA 3HGQA 2JZCA 3GGCA 2VPIA 1ITZA 3F7MA 1DIBA 4Y2PA 1EYZA 3KUCA 2VQEB 1F14A 2B6NA 5JS8A 2AQIA 3L04A 1XRQA 4ZEVA 1FS5A 3TD2A 5FPYA 4Q4JB 3F6CA 3QOXA 1ODJA 5LZ4A 1JEAA 5DNCA 2C59A 1S6YA 2EX1A 1KDTA 5JQWA 1QPGA 5L40A 1E6KA 4U7FA 4C7OA 1H9CA 4MDYA 3W6PA 4ER7A 5TB5A 2PL5A 2V6MA 4H7KA 1VIVA 5ALMA 1SURA 1R8QA 1CDEA 4ZCPA 5IDVA 5IABA 3LPAA 4A0FA 4QUGA 2ABWA 2G3YA 2XQJA 4XVRA 1QHHB 4ZT3A 2YXNA 5AKGA 5FI3A 1NVAA 1NUPA 1QKKA 3DVLA 4G0XA 4L8LA 5BWLA 2IS1A 1G5TA 3IVGA 2XYHA 4RE6A 4TWIA 1VGRA 2RGGA 2V0CA 4NZYA 1MD9A 3LT2A 3ABZA 1MJGA 4NDNE 3A4YA 4UPDA 5AKEA 3ZWPA 1VKOA 3ABOB 5LP6A 1M7GA 2JLQA 4FOSA 4XUEA 5DNAA 2PMDA 1SBNE 5T64A 5F2NA 2GJ8A 3M9LA 3N2KB 2H1RA 5E7IA 3VR5D 1XKQA 1ZJ5A 4WXHA 2CJYA 3Q6NA 1XRPA 3EHDA 1ND5A 1W88A 4CL0A 5F7XA 1YVRA 3M33A 4LYAA 5H5JA 1HXHA 4DDWA 2O8CB 3AJDA 3G5LA 4WZAA 4RKRA 3THRA 1JDNA 2JIOA 2QRUA 4C03A 1IFXA 3EF3A 3C3DA 2OO5C 1E4EA 1OBHA 1G5RA 2A0FA 2BHNA 1OE0A 1B6TA 2X8JA 3NVMB 4FFLA 4D8UA 1Z4IA 1E7RA 2A88A 1M2WA 3QU7A 5EIWA 5A4AA 1DCKA 4OP2A 2DJIA 3GLRA 1L5KA 1ODCA 2NXWA 1U1EA 2BCJQ 3V7NA 3KQHA 1GNSA 4WCDA 2B4KA 2JA2A 5GIPE 1A0OA 4EUKA 5DIFA 3ZY4A 3F5DA 3IP5A 3TECE 4C6SA 3UO8B 3GAMA <