3CZ4A

Native apha class b acid phosphatase/phosphotransferase from e. coli
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
SPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the catalytic mechanism of the bacterial class B phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Class B acid phosphatase
total genus 76
structure length 209
sequence length 209
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2008-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cz4A00
3PGLA 4HGOA 5ALUA 4ZEWA 1ZOLA 4C4SA 1N9KA 1Z5UA 5ALVA 1L7NA 2AUTA 3M1YA 4NABA 4BEVA 4AS3A 4OHFA 3KOOA 4DW8A 1QH9A 2I55A 5ALYA 5AK4A 3ZI4A 3WKBA 2HF2A 3L1UA 5ALDA 1K1EA 2NO4A 3IJ5A 2WF5A 3L0YA 4UATA 3WKCA 1RMTA 2FPRA 3QU2A 4CF5A 4BX0A 3IB6A 3R4CA 3AR4A 3FPBA 2OA0A 4HYTA 3J7TA 4J03A 1PW5A 5AICA 1RLMA 2FPSA 2YN4A 5AVUA 1Q92A 3I1YA 4Y2QA 4MUMA 2WF6A 3L0CA 1U7OA 2JARA 4EX6A 1L8LA 2P11A 5AKKA 4BNDB 5ALTA 1SU4A 3ZVLA 3SKYA 1Z4NA 3QU9A 1F5SA 4CE6A 2B30A 1RPZA 1NRWA 5AI5A 5AM3A 2G80A 2WF8A 3IRUA 3U26A 2VKQA 3W5AA 5AVZA 1FEZA 3NIWA 1RMYA 2W4MA 3L8HA 3E8MA 2YJ5A 4XPZA 2ODAA 2AMYA 3W5CA 3U7FB 1RRCA 2W11A 3L8FA 2QYHA 5ALPA 3ZX5A 3WK9A 1RQLA 5ALSA 1Z4IA 1RC8A 3FGOA 4RESA 3E84A 5ALRA 4BYGA 5ALGA 2B8EA 2HEGA 2D2VA 5AKYA 3EF1A 5ALKA 3TLMA 4F72A 4Y2TA 2FDRA 2GO7A 3N8GA 5JJBA 2G06A 5AKJA 2YMMA 4KNWA 4YIKA 3DAOA 4DWOA 4CF4A 3QUBA 3WKDA 3WK4A 1L6RA 2BY4A 3SKXA 3PCTA 5AKLA 1U7PA 2RARA 2JAOA 4IG4A 3L7YA 1CR6A 3ZW7A 3E58A 1Q91A 3MC1A 2RB5A 2G09A 1X42A 4Y2RA 3EPRA 3QLEA 4IFTA 5ALXA 2HSZA 1L8OA 3A1DA 3A3YA 1Y8AA 2G08A 5ALJA 3F9RA 3DDHA 3UMGA 2FI1A 4C4RA 1IWOA 4EEKA 1AQ6A 3UM9A 5AVSA 3L5KA 2JGAA 2CFSA 1EK2A 4F71A 4FFDA 4Y2JA 3N28A 3FPSA 1VFPA 2C8KA 3U13A 2C88A 2OBBA 3QNMA 5AM5A 2PR7A 2IYEA 2YFYA 3L8GA 2GFHA 4XOUA 2W43A 5AW2A 5AIBA 5AVVA 3W5BA 4YCLA 3MN1A 2YMLA 3ET4A 5A3RA 1TA0A 4Y2YA 2HOQA 4BBJA 5A3QA 4L6CA 3AR6A 1Z4KA 3L8EA 3U7GA 3R9KA 1XVIA 2HO4A 3K1ZA 3QUTA 4JDPA 1YNSA 4HGQA 4G63A 2C4NA 3NASA 4YCMA 2P69A 5AKEA 5AM1A 1LVHA 5AI0A 4HAIA 3QYPA 1L7OA 5AHXA 3SHQA 1Z4MA 4UU1A 1Z4JA 2I6XA 5AI4A 4HGPA 5AK3A 2ZG6A 2IOFA 1TJ4A 4NFLA 2EATA 3QU4A 3ZTWA 1ZD3A 3PGVA 1VJ5A 4G9BA 4KX3A 3ZX4A 1XPJA 5ALZA 2CFTA 2FUCA 2WHEA 4Y2UA 3AR8A 3B8EA 1SWVA 3QU7A 2FPWA 3ZU6A 3VAYA 2B82A 4BNDA 3L1VA 4BX3A 5AESA 3U19A 3A1CA 5AM4A 2FUEA 2IA5A 5AVRA 4UM5A 1ZRNA 3PDWA 4ZEXA 3B9RA 2Q4TA 5ALNA 5ALQA 3ESRA 1QQ7A 2PQ0A 2O2XA 2QLTA 3DV9A 2YJ4A 5AK5A 5AKIA 2B8JA 3RFUA 2AGVA 4L57A 1TE2A 2I34A 1ZRMA 3AR5A 3NRJA 5A3SA 3N1UA 3CZ4A 3AR7A 1U2TA 2HX1A 2HI0A 4NV0A 2X4DA 5T41A 3OCUA 3ONNA 3OCZA 5AW5A 4UAUA 4UARA 3QUQA 1NNLA 5AKZA 3A1EA 3QGMA 4OD0A 1SWWA 2Q5EA 4J2TA 1TJ3A 2GHTA 2BDUA 2ZXEA 1S2OA 3SMVA 4EENA 3R09A 4EELA 3UMBA 4FYPA 4Y2PA 4BKMA 4Y2SA 4DFDA 4JB3A 4ZEVA 3ZVMA 5AM2A 2RBKA 3WKEA 3ZTYA 3OCVA 3U7EB 1J8DA 2NO5A 2B1QA 5ALLA 2I54A 2Q4RA 2P9JA 3P96A 4UW9A 4YIHA 4DCCA 1Z4QA 4O8CA 3S6JA 3OCYA 4HGNA 1O08A 4Y3UA 1RMQA 3E81A 5ALMA 2WF7A 4XQ0A 1YS9A 2ZBFA 1LTQA 3I6BA 3MMZA 4UU0A 4YGYA 1L7MA 4CF3A 2BDEA 3ESQA 3CNHA 3L0BA 4GXTA 5AVWA 2G07A 2G0AA 5AVTA 1ZD2P 4KN8A 4NWIA 3MPOA 5AW3A 5AW7A 2YJ3A 4NAVA 2ZBGA 2YBDA 2G1AA 1ZJJA 3HYCA 4UM7A 1YDFA 5AI9A 1WR8A 5IT4A 3KZXA 2AH5A 1U2SA 2YY6A 4Y2VA 1L7PA 5AVQA 4UAVA 2R8YA 5FP0A 4UMFA 4UASA 4QJBA 3QXGA 1MH9A 1RLOA 5AKHA 2WFAA 5ALWA 5AKGA 1VJRA 3N07A 1Z88A 4I9GA 4UMVA 3ED5A 3ZWDA 3ET5A 5AK6A 1QQ5A 3ZVNA 1JUDA 1N8NA 3KDPA 4C4TA 5ALEA 2DQSA 2C8LA 3FM9A 5AW0A 1T5TA 1Z5GA 4L6AA 4AS2A 5AW1A 3NANA 5AVYA 2ZBEA 1RQNA 3SLRA 2O9JA 4MWOA 2B1RA 1QQ6A 3SD7A 2CN1A 1U02A 4CNQA 2WM8A 3AR9A 4BX2A 3HLTA 4UMEA 5AW8A 1RKQA 2R8ZA 3NUQA 3NALA 4Y2XA 5IT0A 2PKEA 3W5DA 3KBBA 4AP9A 3AR2A 4FE3A 1RDFA 5AW6A 1ZD4A 2JAUA 3WK5A 2EARA 3BWVA 3BA6A 5AKXA 2HHLA 4KNVA 1YJ5A 1TJ5A 3N5KA 1S8OA 2R8XA 3GYGA 1WVIA 2OYCA 1CQZA 2HF7A 2FPUA 3WK8A 4YCNA 2HCFA 4OFZA 2ZOSA 3I28A 4GIBA 1ZD5A 1KYTA 5AI8A 5ALIA 3ZUPA 2FPXA 2NYVA 2GHQA 3WK7A 4EX7A 4PNHA 3D6JA 5E0OA 2YMQA 3WKAA 5AIAA 2EAUA 3QU5A 2FEAA 4KX5A 3NAMA 3OCXA 5ALOA 4BEWA 4UMDA 2MSNA 2P27A 1YV9A 2WF9A 1O03A 1Z4PX 4E88A 1Z4OA 4KYTA 1Z4LA 3DNPA 3FZQA 4QQFA 3I76A 3B9BA 3QUCA 3FVVA 1RKUA 2RAVA 4B6JA 3ZWKA 4OCZA 3WGUA 1XP5A 2YMPA 5AW4A 3OCWA 2I33A 3RF6A 1EK1A 2YJ6A 1RLTA 5AI6A 2IOHA 2R8EA 5AW9A 3M9LA 2CFRA 3AR3A 4YH1A 3QX7A 1NF2A 2HDOA 1T5SA 3OTQA 1QYIA 2B0CA 4RETA 5IS2A 1T9ZA 1WPGA 1WZCA 3SF0A 4XE5A 3EWIA 5ALHA 3OPXA 2JAWA 5AM0A 2I7DA 2MU1A 2GMWA 2IOFK 2OM6A 5ALFA 2C9MA 4HGRA 3WGVA 3EF0A 4I9FA 3WK6A 2ZBDA 1J97A 4H1WA 1ZS9A 3KC2A 1RKVA 3U7HB 3KD3A 1YMQA 4EZEA 3UMCA 5AVXA
chains in the Genus database with same CATH superfamily
4HGOA 2ZUBA 2GM4A 2R7AA 3IVMA 5AK0A 1D8AA 4B34A 3EXFB 2RKOA 3LHKA 3TQCA 5H9WA 3M83A 1L7NA 3EOZA 3OH8A 4O4HA 3ZXXA 2H0AA 5JZOA 4DKXA 3F6BX 3T3HA 3IUPA 1P2SA 4A8JA 5LVAA 4WKNA 4HT3B 2XADA 1B3RA 1EVJA 1DBSA 1G2IA 4H7FA 1KS9A 4TZTA 6Q21A 5IJ9B 4XKJA 1USVA 4NARA 5FUXA 2MDTA 5KMGA 1PKXA 1E69A 2AMVA 5GVRA 4K7JA 1JHVA 3CZRA 4COKA 3AV0B 2IYWA 1DXHA 2IF0A 1M0EA 3JVUA 4BX9A 3D2AA 1KQFA 1NHGA 4MV4A 1F2UA 2BMDA 5J5CA 4ZOLF 4CQMB 4LJ8A 1B43A 3SJ7A 4DT1B 1VYUA 2OYRA 4DA6A 2C61A 3AR4A 5EKDA 4BGDA 4JODA 3DE5X 4BMYA 2VPTA 4FCWA 2QSYA 4EB3A 1BA2A 1EVIA 1XA4A 2ZYHA 4HZIA 4OQLA 5J4HA 3HGQA 3SC6A 1MRSA 3PU6A 1Z38A 2RK6A 2BE7A 1JDTA 3AB8A 1E2LA 1KI6B 1NP6A 3T94A 4JEMA 3M6LA 1AXEA 2YC2C 4JLOA 2JARA 1E0JA 3FVRA 1L8LA 2OGUA 4QYSA 1G3RA 5AD1A 1ISMA 1KJJA 1RADA 2VR1A 4RCYA 3FMFA 3P7MA 3ON5A 4HV4A 1U7TA 1SUAA 3S5UA 4HQRA 2LCFA 2HBYA 2XTNA 4QL3A 1RZRA 1UXKA 5DLQC 5KQGA 1DQZA 4CE6A 4IKOA 3JQGB 1RPZA 1VBMA 3CG4A 3CZQA 4PSAA 1ODJA 5HIIA 1A71A 4YRJA 3PUIA 4LSMA 3WBJA 5L45A 2XOKD 4TYYA 1FNSA 3TSCA 1UBFA 4FS3A 2QAJA 1E5DA 1RI5A 1DKOA 2F9MA 1DT5A 3IBGA 4H16A 5B7QA 1ZRSA 2XQFA 4GM1A 3UTCA 4ZO8A 4MHTA 3IYLW 2XBLA 4N3GA 2H0RA 5LIRA 1Q84A 4FI3F 1T9GS 1AIPA 1XRRA 3FNQA 4FR0A 4RZUA 5NULA 2G9UA 3QVGA 5ANRB 4NBWA 2FZGA 521PA 4QQKA 3PJEA 1YR3A 4D26A 1QF9A 2P40A 1H8HA 3TJMA 1NC1A 4N12A 1EXNA 4Q6WA 1T1JA 5FYQA 5BQXA 5FV7A 3FGOA 4WXEA 3ECSA 1D7AA 1U3WA 4U6NA 4WW0A 4RWZA 3IKVA 4ZJZA 1UBJS 4ZI5A 3GRZA 1L3IA 3ZLBA 2FSSA 1UOEA 1WS6A 3IURA 1PCXA 5IHPA 1FNDA 1G5PA 1K7CA 1P80A 1FE8A 1VM6A 2J9FB 3AUTA 3DEKA 5DWQA 1C1DB 2OD2A 3O1JC 1HFJA 2SECE 4HB3A 4TMZA 4AX4A 2D2XA 1ESEA 2G1KA 3HU1A 4Y0AA 4CM9D 3SWWA 2X1VA 3VV3A 2BEWA 1Z83A 1A7KA 4CF4A 3VPDA 1ARZA 1ENZA 1NJ2A 1XMPA 2CUTA 3NVKI 3AYZB 4JIGA 1AGRA 4O2AF 2FOIA 3PCTA 1N2OA 3CW9A 3NGXA 1QIKA 2NUBA 1P2BA 3B3JA 3PLNA 2A0WA 1KH3A 4LE2A 4RA6A 3OIUA 2IUEA 1T8RA 5K4GA 4QU0A 4L5IA 3TLYA 3ILHA 2XTZA 5EOVA 4DDKA 4WZBA 3H3JA 4H4EA 1H2BA 3D7MA 3LUKA 4X1KA 3UWKA 4D44A 4F2WA 5LQCA 1U8XX 2JGNA 2QE7D 4KJXA 2P77A 4M98A 4EPXA 4IIHA 4CETA 2LWIA 5CIYA 3INGA 4WLUA 5D01A 5HMLA 5KWJA 1HDGO 4X92A 4D6YA 4WADA 1EWQA 1F12A 3TTSA 1MDBA 3EUFA 3LDGA 4KXNA 4KPFC 4AT1A 1GTSA 3MT7A 3UV6A 3CNQS 3IEIA 2WAAA 1S96A 3BXGA 3G5AA 3K5IA 3VYVA 4C7XA 5HHTA 1LV8A 2DHCA 2REQB 1GHTA 5I7EA 1XGKA 1RTKA 3QV2A 1SCJA 2R7NA 2YIMA 3GVCA 1BEUB 1KO8A 1HETA 3H5NA 5FNVA 3MHTA 4XSGA 4QYMA 1XNRB 3F4KA 5DV9A 4DJDC 1Q17A 1QRDA 3LUAA 5DJ5A 2ORED 2QX7A 1PDWA 3OSZA 1TLLA 3QPAA 2RK4A 2QRMA 2I65A 3T1HB 1N6KA 4HYYA 4U7WA 1GUZA 1NIPA 4IWYA 1CB7A 1XU7A 3U9LA 3IE1A 4OM8A 4Q4LA 3QEMA 3QJGA 1YIDA 5JISA 1CUVA 3NBXX 1E9VA 2JVIA 5AM5A 1KXJA 4JGIA 4IBOA 1QZ3A 2ZITA 3TNLA 1GTRA 5F7ZA 3LP6A 1GGHA 1AY0A 3GGCA 4GWGA 1EK0A 1T9AA 1YCHA 2CNLA 4G9GA 3R8XA 3NUGA 4A7PA 1DDIA 2QQFA 3ANNA 3T35A 4CLOB 4M88A 2GWRA 1FTYA 4NF2A 4EATA 4WE3A 1KVUA 1R6XA 2D3TA 4N82A 2FPLA 1Q83A 4UPDA 4EW6A 4GX1A 3GL9A 3DHYA 3ZZ1A 3WYNA 5ESRA 2PKCA 2L42A 2JJ8A 1DRJA 4BPRA 1RRFA 3VC3A 2LGJA 2BV3A 4IYRA 3BWDD 4DDTA 4HLNA 4F12A 2Z8YA 1SQGA 2PLFA 1HYGA 1QONA 2LCQA 3ULKA 5CNKA 2AS0A 7MHTA 3C3XA 1KVQA 2V7QD 1MORA 1YJXA 2Q6LA 4JH0A 4RK4A 2NTYC 2QL7A 3BMOB 2QN9A 1MPTA 1V45E 3ZNOA 5HK8A 1MJHA 1LF0A 1NVBA 3C7TA 4OFBA 5FFNA 4EGCB 4NCKA 5BSKA 3HRIA 1Z7GA 1KY2A 2K2QB 1V3UA 3ASYA 2D8AA 1FBNA 1JEJA 4Y1FA 4Z1OA 4KQXA 1ZUIA 1I24A 5JDCC 2DJ5A 1TVEA 4N6GA 1DARA 1B6GA 4G5FA 3T15A 4B0PA 5K3SA 1XTTA 3WGGA 5KKAA 3E7DA 5K3FB 3TCNA 1QGUA 2QJTA 3KKQA 1VJ5A 2P4SA 4MAFA 4RGBA 5ALZA 4W5QA 1PGPA 2QUKA 1ZXXA 4Y2UA 5F21A 2R5WA 3RARA 2X1LA 4G3XA 4K9QA 1JSRA 2P7HA 2FPWA 2V7EA 3HB5X 4BNDA 4OQQA 5FORA 4M9QA 2P1RA 4U6SA 2I4TA 1EFRD 4K9SA 1LDMA 4HLQB 2XB9A 1BGXT 4ISBA 4NZOA 1I13A 4PLWA 3TS1A 4LK3A 1IEQA 5B3JA 5AM4A 4G6ZA 1K8QA 2HDHA 4W9NA 3FTEA 2ZJ5A 4LGVA 4RCZA 4AJLA 2XUAA 2CB9A 1V8DA 3PA6A 1CJBA 1QHGA 4DLXA 4DN6A 4FN4A 3N58A 5I7OA 1M74A 1C30A 5CDSA 1HNNA 4HVAA 5EESA 2PQ0A 1C29B 3DV9A 1TM4E 1T43A 2XVMA 4RZIA 4DRXA 4JVNA 4B44A 1UDWA 1URPA 4AKSA 2OCDA 4RMJA 3MT8A 3U81A 1HA3A 3AIIA 2J3MA 2AGVA 2YCBA 3CEMA 3PNYA 3OC6A 3LECA 4MW2A 3TI7A 1XZAA 1ZSNA 1SNYA 3TSWA 4TKVA 3BGSA 2XDQB 4CMIB 1N5OX 3CGGA 3UYKA 5DGHA 1C9YA 2WUEA 1IOZA 5J1TB 2D2EA 5CAEA 2G4CA 1E3WA 1U2RA 2ZTUA 5B4UA 2F1KA 1WWKA 3MRTA 1AKUA 3S5JA 2V96A 3DVSX 1GU7A 3R7LA 5D8DA 2FFJA 3AI3A 1XG5A 3NRCA 4XYGA 3RSQA 4XUEA 4FW9A 3K94A 5J58A 3HHPA 5IEJA 2ALJA 2PKWA 2ZDQA 3R44A 1X8KA 2WRZA 2B9EA 5JC1A 4ZVTA 4LRUA 4F9GA 1KYZA 3LYUA 4BGUA 2QRHA 2Z3WA 4EENA 5JZMA 4Y2PA 3TOVA 3EXHA 4TZ0A 1A7UA 2QRJA 3DXXA 1N0HA 1WHSB 4KQIA 3CEPB 4L51A 1AO3A 2MSWA 4QQ8A 3GMIA 3ZD8A 5I7UA 2ZR0A 4N6OA 5LMZA 4RPLA 2O3QA 3P2KA 4PZPA 3DSRA 2P41A 1Y4SA 2I54A 4L5AA 4YIHA 5F2EA 3TUZC 1A88A 3I58A 3E3NA 1Y9JA 2ZI6A 3S6JA 4B73A 4ZK2A 3GLVA 4N7JA 3AVTA 3M6WA 4UOQA 2AXQA 1MNAA 2ZSUA 1DWPA 3INNA 3KT8A 4WBXC 3M1LA 3FWZA 1MZVA 3PNMA 4OF4A 4TOIA 4TT3A 4UTOA 1I7NA 1LRKA 1S8FA 2VL7A 2YW2A 3TGLA 1CS4C 5EA2A 1YTUA 3TQQA 4AIRA 2EBFX 2NX2A 1PWEA 4S2EA 4CF3A 2Q27A 1T4DA 3HNRA 4RFSB 2JH9A 1YC5A 4QM7A 3LLVA 3NWPA 4I81A 2NXJA 1F14A 4JROA 3ENWA 3FX2A 3T5TA 5AVTA 1Z8DA 3MPUA 4OYYA 5F4BA 4TZ6A 3HXKA 4BMCA 4KN8A 3A1WA 1T9HA 1M67A 3PPWA 1IFXA 1Z68A 2C9DA 4DL9A 4HFNA 4NIMA 3TH5A 1T6YA 5DTRA 2P6NA 4NZZA 5LYYA 4C76A 3UC5A 6AT1A 1NMEA 1E3MA 3ZWVA 1K2WA 2CHFA 1CX9B 2E4VA 2OAP1 1NDQA 3EFOA 4QBKA 1DKPA 3OQBA 1AKWA 3TZ6A 2WSBA 3EG9B 3C3BA 4FHCA 3JQAA 4MCIA 4R6XA 4RMIA 4Q9LA 3O8BA 3WGIA 1G63A 1JJVA 4R1PA 5ADHA 5J2TA 1W93A 2D0DA 3ZWXA 3VR2D 4ZFNA 1XKTA 3NBFA 1FFYA 2ORVA 4MUNA 1DBRA 1WXIA 4N6NA 2CDBA 2WZBA 1K6EA 3TOSA 1FDWA 4I2VA 3IODA 2XWPA 2ZBRA 1D1PA 2IOYA 3IDAA 2YS7A 3MHPA 2HRDA 4Z4QA 1HQCA 2GGSA 4B4DA 2FW7A 4ZD6A 1ZK3A 4AQDA 3SQNA 1ZJWA 2WFAA 1WG8A 2IT1A 1YRYE 5CVDA 3WWCA 4ZQGA 2FWNA 1E2FA 2I6GA 3BE5A 3R5HA 4LOJA 4GSKA 1EUYA 3MEQA 3ZXSA 5CBKA 2CZQA 3OE7D 4LPKA 2GCGA 4NFHA 4S04A 2QTMA 1NI5A 4JB8A 3NTXA 2Q0QA 4NECA 2EJUA 2Z5VA 3BIXA 4C4TA 4JCOA 2P0YA 4OHVA 3S8YA 4EW3A 3UMRA 1JE1A 1E8MA 1QOPB 5AW9A 4FMCF 1PFVA 4UZFA 4BBZA 5FTWA 2XUOA 1Z5GA 4FKMA 2H11A 2LNDA 4AW9A 1LSUA 1OFIA 5C7YA 2AHOA 2EYUA 3V4RA 2KQUA 3H11A 4BRSA 4B3TB 5FPQA 1RLJA 4BKUA 4DLLA 5TIIA 1EVEA 2FWJA 2O2GA 2WIAA 3KSRA 2J48A 3JWGA 1U02A 3Q7TA 4OP1A 4PPNA 2Z57A 1SVWA 3X43A 1OH8A 3DBRB 2PLNA 4B43A 1FXWA 2LXNA 1NG9A 2VP5A 1NONA 3F96A 3FZEA 3PF8A 2FN8A 4KOAA 4J0JA 4QUDA 5IWAB 3MCTA 3TIIA 2H85A 5HIJA 4G89A 4QECA 421PA 2V5VA 3WGYA 1R0WA 4X41A 1CUCA 2RC5A 4JI0B 2ZJ4A 4ML3A 4Z4GA 4IRXA 4MEJA 2LUOA 4Y30A 3UY4A 4C4AA 5IABA 3FYUB 3K2QA 3MGGA 2J6IA 3B1XA 3H2YA 4ITVA 2E1RA 2BR4A 4KO3S 1M66A 2YJTD 4HLUA 4IM7A 3PPYA 1KC1A 3IRVA 1JQDA 4DLUA 1G21A 4PPQA 2J07A 1CUDA 2DFNA 4ZIRA 3EEIA 3PA8A 1I2ZA 2NACA 4OFZA 1JG2A 3TE7A 3CB2A 5AOCA 3C4JA 5BRJA 1KK1A 1ZIDA 1ZD5A 2ASVA 2HMAA 2P9GA 2CZCA 1W2HA 4POAA 3H2IA 3EGXA 3H5TA 4RNDB 3RQIA 2DC1A 3PRYA 4NZPA 2OG1A 1DO2A 4D8WA 4EX7A 1NVVQ 3I52A 3KAKA 4MMYB 3QU5A 1AQUA 4QE3A 1IBCA 3O95A 1IU9A 4NPAA 2ZZMA 4M0EA 5IBCA 2H4YA 2HLNA 2CMFA 2PE5A 1EVKA 4WK6A 2C2KA 1F17A 2GPAA 1WE2A 2BFBA 3OQIB 2IZ1A 1Q0ZA 2PX0A 2SKCA 4YPVA 1E2IA 1SCDA 1Z4LA 1OA0A 2N46A 3MJHA 4HN2A 1CVLA 5ITSA 4JYZA 3GLIE 5DN6A 3ZGVA 2OO5C 2ONYA 2D0IA 5C1DA 1V8FA 1U1CA 1WEHA 2OAEA 2RMKA 3I0NA 4IVQA 4RWEA 3I2GA 5SZIA 3GBVA 1JQ5A 3B89A 4LZZA 4EHBA 4G07A 3BRQA 1ZPDA 3VSCA 4L9SA 4UFOA 3E22B 1R4ZA 4FQ7A 1LTHR 3FSRA 3RT9A 3TEMA 3IS3A 4QO8A 4CDGA 3AFIA 1W34A 1II8B 2AX3A 2CJPA 3HBLA 1BHQ1 2YL2A 2FW6A 3TPZA 2OFXA 1KYXA 4UVDA 3DBVO 5FXMA 1NJSA 3GUZA 3TN7A 4V0OA 5F1YA 1RCTE 3SPXA 1SBHA 1KAQA 4I4IA 2ENUA 3FMPB 4XOIA 1DCFA 2ZRFA 1E99A 3EEBA 3VVBA 3SMQA 4BB9A 2B99A 3MA0A 1U5BB 2A59A 2X1HA 3T5DA 4Z2AA 5I7FA 4AO8A 3GIWA 3KUUA 3WRXA 5J23A 1WHSA 5ECWA 3VYTB 3WGVA 4LA4A 3BG5A 3UBTA 3DAHA 1CR2A 2XHZA 5JMOA 2F00A 3AFNA 4MS3A 3MUFA 3T06B 1NLFA 1PJSA 3OOJA 3AM5A 1VGQA 4IGKA 5CVJA 4WZAB 4BCDA 5G40A 5JTTA 3BM5A 1QYXA 4N48A 5CEFA 5LQKA 1IRIA 2R8RA 2C2MA 2I87A 1X7GA 2CNWD 3AUSA 2C03A 3DDUA 3HDQA 1NYTA 3LKVA 3PB3A 5BR7A 5IT5A 4D3DA 3CLTD 2BFCB 1NXTA 3E9MA 4P08A 5K01A 1LY1A 3LT0A 2HLPA 5TPZD 2UZ1A 1V7ZA 1SVLA 3G2IA 5FBLB 2Z08A 5BXQC 1USIA 4TUYB 1PTJC 1H0HA 3N0TA 3TVTA 1KI8A 3LVBA 3LWDA 3AHCA 3AEKB 3C85A 3RT7A 3MWEB 3QOYA 2BH9A 3R5JA 1S3IA 1W0JA 1Z22A 3DC7A 1E3LA 2UVDA 4JY7A 1EHCA 3TR0A 2UZAA 1R0XA 3AF1A 4TV9F 1O0CA 2BJWA 3RRJA 5LZ5A 4X1YA 2VTBA 4FMPA 4YMTA 1YRHA 3R4CA 1ZM4A 4PZEA 2BPOA 3HY6A 1R8JA 1GQFA 2GTHA 4NMWA 4PY2A 5LBTA 1LDEA 3IKLA 4N0QA 4E30A 4G5HA 5IDQA 3FUWA 2VH5R 3MCAA 3O4JA 4G0XA 3BD9A 1PW5A 5IW8A 3VAZA 5KTYA 1MQSA 4UE3S 2Y68A 5LMNB 3JATB 2C92A 4CUJA 1G7TA 2NUPA 4MP6A 1TA4A 2YVLA 1Z5OA 2JKZA 1BW9A 3TRFA 2W8ZA 3IX7A 4BNDB 1H05A 2XX3A 4ROTA 1LLCA 1PJ2A 2NTEA 3RVPA 3FOCA 5DNAA 4HUQA 4AWXA 4X1IA 5LIPA 1DXQA 3N86A 1E3SA 1YK1A 1RWMA 1OV6A 3FYCA 1CRZA 2V6FA 3GU3A 1K66A 4YMSA 5I47A 3I5XA 3ZWQA 3UMYA 4IF4A 3D4OA 5BWLA 2VJDA 3RTGA 1V1RB 2BBWA 1KBZA 4IMRA 4HFMA 2ZE6A 3W79A 1JG1A 4G41A 4J3JA 2VHVA 3RB8A 2XGSA 5AVZA 3R2JA 3LSYA 1B0AA 1E18A 1DAGA 1PL6A 3BJEA 1Z2OX 5JNLA 5FB3A 1GKIA 3FYUA 4D43A 1NI4A 4RMHA 4TGLA 2C7GA 2FP4A 2GPWA 3PT9A 4KQWA 1RCFA 1OUMA 5K3BA 2YASA 1QHIA 3WK9A 1UC5B 3LXXA 3IJRA 1G6KA 3OMXA 2CLIB 3DLCA 2YQZA 3CQ9A 3HR7A 4LJSA 5G3ZA 1C1DA 2OSBA 3CONA 3PHGA 3NPAA 3ZQ4A 4Q34A 3D3QA 4F6RB 3W5HA 3DBRA 1C0IA 1HZZC 3RAJA 2Y8EA 4PC1A 4IDBA 1P0IA 4XGKA 2HEGA 1GZHB 4JN6B 5AKYA 5CFPA 1WOYA 2IZ0A 1L4MA 3TQSA 4FLEA 5FTLA 1AS0A 4M0CA 4BO6A 3LXRA 2BTQA 2CF5A 2YNMA 3HY3A 5AMXA 3TKYA 1X8XA 4ZXFA 2WJ6A 4JR2A 3VKWA 1US8A 3EIUA 4ARBA 2G06A 2PO5A 4CTNA 2DXIA 3FZGA 2XWBF 1IG3A 2GCEA 2YMMA 4KXWA 4WT7A 5EZYF 3VYRB 1H2XA 1KEUA 2P4QA 3QUBA 1Z8HA 2Q21A 4Q9HA 1ND6A 4B45A 1SBTA 1JIXA 2PNFA 3KQPA 4I1OA 4XD2A 2Q3CA 1O87A 3DT6A 4C03A 2IUUA 3PQ7A 1JFTA 3C3CA 3BB1A 3PNKA 4J7XA 1EESA 3PS9A 3QBVA 1JEAA 1UPXA 1KOFA 2FSGA 2ZR9A 3IKJA 3S0JA 3ONFA 4FZ3A 3AFOA 1EUDA 4KFCA 2V7XA 1R6AA 3HV2A 3KL2A 4V1CA 1HG1A 1ODLA 2Y92A 5KO2A 2D3WA 1U7WA 2Y9MB 4UEKA 3TM4A 4U3JB 3MWDA 1L5VA 2O0KA 4RY0A 1VCNA 5TT0A 1JXMA 4DM4A 2C2OA 1OA1A 1FVXA 5CBPB 3I53A 3LF1A 3MT0A 3N3AC 1SKQA 3TB4A 1HBJA 1AQ6A 2WLSA 2ZE5A 3FBWA 3UM9A 1SXJD 4E09A 2E5LB 4I46A 2AKEA 4E70A 2D5BA 5FTKA 4NOLA 4NOJA 3S44A 3OZGA 5DRYA 5E2IA 1J8QA 1K6IA 1CZNA 1ZD8A 3DVLA 1IHYA 3V48A 2IIVA 2X42A 4U2KA 2NXWA 5SY6A 1CZRA 2B35A 3ZK9A 3ZE1B 3OJEA 4BZZA 1J90A 4AZVA 1I3NA 3U1BA 5LYJF 1LNQA 2GCPA 2H2WA 3R7WA 1W85A 4WZAA 5F4ZA 4EUKA 4K0KB 1CT9A 3OHPA 4MPPA 5ERGB 2UYOA 2WIFA 3E03A 1Q7EA 3ZZTA 3ODPA 1Z75A 3SBDA 2J45A 3AM3A 4U7GA 5D84A 1TYBE 4MVJA 1FYWA 1HY3A 4S1WA 3FCYA 3QIAA 4DLKA 4DPKA 2FSUA 3GT7A 3HNOA 1U2GC 1UJ2A 2QORA 1BCSB 1U4NA 2JJ1A 2UVPA 5E2AA 3HR4A 1YCGA 4R1TA 5CIQA 4DYHA 4UTNA 2ATXA 2OV4A 1PK8A 3B1KA 2A6PA 3C3KA 5CNMA 4YCMA 1IONA 1G7SA 2P69A 2UUPA 3GHYA 3PICA 4GOOD 2PMWB 4M8IA 5DGDA 4HAIA 2QT1A 3EXAA 3F7OA 2K7FA 1RJ9A 2ZJBA 1ZDMA 3CMMA 4YRLA 7AT1A 5F52A 2QL5A 1Z0KA 2W6MA 1TKCA 1PEKE 3TLBA 1GCOA 1U9YA 4QPZA 2A88A 5IJ0B 2WIJA 4GMDA 1M8PA 4AF7A 4N5DA 4WNCA 2BMJA 3I62A 1E1CB 2OHIA 4TMXA 2RGUA 2WWRA 3I8OA 4E32A 4WN3A 4X6UA 2ODPA 3WADA 5EKTA 4MW1A 3P9IA 1P9WA 4ILEA 4EB6B 3EXG2 1UMDB 3PK0A 1TADA 2P75A 3N8KA 5HIMA 3V34A 1Z2PX 1C3OA 3QU7A 1HDYA 4D8XA 4NOMA 2QUZA 3L1VA 1ZUD1 2A9RA 2BGRA 4WECA 1PU2A 1ZBDA 2FOLA 2E21A 4ZT4A 4A2WA 4KKXB 4OKIA 5GJBA 1MOPA 5EJFA 1PNRA 3M3HA 2H5EA 1N5MA 4H35A 4LRSB 5JRZA 5EJ5A 2QLFA 1ZHHA 2IUYA 3ACBA 4CU2A 1RW4A 2ACVA 2YJ4A 4M1ZA 2J0UA 4YJHA 1FIUA 1PZNA 1E3EA 5DGCA 3QIVA 5HF6A 2GD1O 4NZNA 2JLUA 4MOWA 5JH7B 3DLBA 3A1TA 2X2OA 3DTTA 1C0LA 4Q3AA 1B73A 2QN3A 1OZFA 1DV2A 1OLSB 4KTVE 4OTZA 3HEBA 4JP5A 2ZWVA 2QZ9A 5LNK6 1SCQA 3GF4A 2XJ9A 2FX3A 4QHTA 4ES6A 2WNIA 4NXNB 3Q9NA 1K4KA 5ECDA 3CUVA 1SXJC 4EHHA 1M7GA 1OXSC 2EIXA 2OEPA 4YP7A 2JCGA 3W4IA 1UF9A 2B3TA 3REQB 4D9KA 3A3NA 1UPBA 4KVZA 5AKZA 1KJYA 3QGMA 5GJVC 3T5BA 4Z7OB 1SWWA 4OLBA 2XXAA 2A0KA 4LJ7A 3G89A 2GHTA 4B48A 3EGOA 2JFHA 4PONA 2AVNA 1QYWA 4RSRA 1ZI6A 1PWHA 1XRLA 2YXEA 3C5CA 4FYPA 4KLCA 4I2NA 5B53A 5ED0A 3ESZA 1YCDA 4DV3B 3A7EA 2EWWA 2O0JA 1OXTA 5HF5A 3V8VA 2AFHB 1G8GA 1WOMA 4EMTA 5K05A 1X3SA 3F5FA 2GPYA 2MYNA 4G0ZA 5AJYA 5JASA 1D2AA 3OEWA 2PWZA 2XB8A 5TQ2A 3N0WA 1COWA 3AP2A 1GITA 1IXRC 4KR7A 1DPGA 3MBOA 3ZE0B 3UTDA 4PXSA 4US2R 4FYVA 4UJ5A 5C8YF 4I5EA 1GRCA 1SVMA 3ICEA 2C1XA 4KDRA 1UPAA 2FMXA 4GLOA 2QUBA 4XJXA 1ZJ6A 2Y76A 3CNHA 1GAJA 3CMCO 3TWOA 2O1WA 5LB4A 1VI5A 2G0AA 1FMFA 1AQJA 2HA4A 4JR0A 1NVAA 1TTPB 3MGKA 2X3YA 3UQYS 4F04A 2B4TO 4XI9A 4N18A 2DGDA 4RZSA 2R48A 5CG2A 2W2NA 3VNVA 4RX1A 4X7BA 1AH2A 2OV2A 4JQCA 4NCHA 1GYPA 2PMCA 3KNZA 4OHWA 1K7SN 4XVRA 4A0QA 1QB8A 1UDRA 5FPTA 5GONA 4Q66C 3RC7A 3Q0TA 5JFOA 2OFWA 4UUMA 3UHOA 1V39A 2EOAA 5I3ZA 5JBIA 1U3TA 3N0RA 4WOJA 3N2ZB 3ZJYA 4S2UA 1N7GA 3CGWA 4DLAA 1JHUA 2XNDA 3ICWA 4I4NA 3KYCA 1ZVVA 1GPUA 2Q5CA 2YS6A 3L77A 4J0FA 2GAFA 3LCVB 3FNRA 5HW0A 3C45A 2WTXA 2MMGA 1VE7A 2ZBPA 4I1RA 4P7KA 2FRDC 4OXKA 3M1IA 4C4OA 3ZKWB 5B3AA 1CETA 2AZDA 3LX8A 3NBKA 2RI1A 4QG3A 4QPNA 5AKHA 1W2WB 4DBLE 3QXSA 4LJ9A 4BRUA 1HURA 1NN5A 3EBLA 4MYCA 3PR2B 4M46A 1QRRA 2GZ1A 4KFSA 3MK31 3ABZA 4L9AA 4DCUA 1COWD 2FZ4A 4AZ3A 1MH1A 1XX6A 3SZOA 1QH8A 1IHUA 1VIDA 1NBMA 1W5AA 1C0PA 1CXZA 3OLYA 3TLAA 4D7AA 1E66A 3WL6A 5KUTA 5C51B 1WW2A 1NBMD 1O89A 1QQ5A 3ZVNA 2P91A 4AUEA 5F2NA 4HUJA 3FKQA 5B1HA 3L01A 4MVJD 1B2LA 1CHDA 3BMNB 4LJYA 1OV4A 1E2GA 3FM9A 3EEQA 4Q19A 4I9NA 4TM8A 2ZPTX 4TWBA 4WPGA 3TX2A 3V4PB 3QVLA 2F3UA 2X5JO 1EQUA 1NW9B 3A4LA 2VT2A 4MPTA 3A32A 4R2IA 3DKKA 4FC7A 3ROEA 5JATA 3MUNA 4FYMA 4YC7A 1K06A 1EKXA 2QPTA 4MIOA 2ZCVA 3L0ZA 3OZBA 5JC8A 3AR9A 4A03A 4BX2A 1UBNA 3HCWA 1LJLA 3PNOA 4MWGA 2E0IA 1RHMA 4MRMB 4UMEA 3U4HA 2R8ZA 1ZGJA 1Y3FE 3E9RA 4I36A 4LE1A 4R2HA 2BR3A 1GTJ1 4D9MA 5CCBA 1DEHA 4Y6OA 3D8UA 3T7EA 2FMFA 3QKSB 1E3DA 2VBGA 3P0JA 3W4KA 4RVFA 2YTZA 1ULSA 3U7QA 5M34A 3AHIA 3LVFO 4MR8B 4TV8B 1IZZA 2YOFA 4X6YA 3B5JA 4B6RA 5IBRA 3DJYA 5B37A 1FUUA 1GR1A 4FCTA 3RU7A 1AUXA 1F38A 3PXDA 3H5OA 4BQFA 2Q2OA 3AJEA 5DBOA 2VSOA 1WZ2A 5CDFA 1V9SA 3DMDA 2FPUA 2F8LA 3OM1A 4KIGA 2GPJA 3LD9A 4LAFA 2JFZA 2G67A 3RBAA 1PIWA 5C1IA 3BFPA 4BJ6A 3LPCA 4YAGA 1N2GA 1MX9A 1ZM3A 3FCCA 3UG6A 1M7BA 1W6RA 2YYZA 3OJXA 4NCJA 4RH3A 2LTAA 4QOFA 3QQ5A 1IVSA 4MVJM 2YMQA 1KKLA 5TVGA 4CCWA 2BBTA 1YZGA 3O4GA 4QSHA 2HMTA 1IQ0A 4TLBA 2W93A 2X8JB 4RABA 2XF2A 5CH3A 4ZHQF 3GPLA 2RD2A 3R3UA 4BEWA 3SQOA 4IYJA 1M6VA 4KQGA 3YASA 1VLVA 1H9BA 3KQSA 5CX4A 4LGMA 2OP0A 3NKLA 3THXA 5AXCA 4QXRA 1UP4A 4TMWA 3PL1A 3OM0A 4GICA 1M1UA 2BOVA 2JI4A 3V6MA 1HDCA 5G1PA 3ZHBA 2J7KA 4GE0A 4IJQA 4MMXB 1KEVA 4RZHA 1EG7A 5A5GA 2GM5A 3SU8A 1TKAA 2RHMA 4CIVA 4RACA 4BO7A 4X00A 4Q05A 3RREA 3NNDA 1XYGA 4FD3A 4JQZA 1EFAA 1W59A 5F64A 1BCRB 1FRNA 3P0RA 3SM9A 4GI2A 2J0QA 1O4VA 2X6RA 3VTAA 3HJUA 3B9QA 1YASA 2AFRA 4DHWA 5B1DA 4EHFA 1NF2A 3N8DA 1FNBA 4R6WA 1T5SA 3N0VA 1A4RA 2R6GA 4M0PA 2DOKA 2VA8A 4L4SA 4RK1A 2Q6VA 4LF6B 2JGRA 2QROA 3P94A 1GL7A 2J32A 2OQIA 2WJGA 1GKYA 2WR8A 4HG2A 3Q15C 1HH4A 2MHCA 1JU3A 2N75A 4KE6A 2QLJA 5MDHA 3CW2A 1T3TA 4QKQA 2ZJYA 3KXLA 3P2JA 1D1TA 1JRLA 2JJ2A 1B8OA 2BL4A 1TUBB 3HKDB 4I9FA 4IFEA 9MHTA 1E7RA 3HHEA 4NR0A 3DXYA 4IKEA 2ZBVA 4AYXA 1RKVA 3FCSB 4W63A 3BGVA 3UMCA 1OTYA 1C7QA 2YWHA 3EMVA 5AVXA 4JZYA 5DEOA 4LFAB 1YI8A 2AIRA 4LOLA 4HVLA 2BHTA 2XWSA 3FHCB 4LW8A 1SUEA 2FZLA 3R75A 3D8NA 2XUPA 2AUTA 3NZEA 1QMGA 5J3JA 4NYMR 3LWBA 1SH7A 4RHYA 3DDOA 1QH9A 2O5CA 3UCXA 4KQKA 5EG5A 2J31A 1PZFA 5A2QA 4YS6A 4OLAA 1E1QA 3FF1A 1Q0PA 1K1EA 1JIQA 1WO8A 3L0YA 3WAKA 1CUYA 3A4IA 4KEAA 5TRTA 3VR2A 1M6HA 3WX0A 3WYAA 5LQMA 3BGOS 1Y1QA 1RRMA 4HD8A 5EHZA 1YE5A 2XJ4A 3IB6A 2FRDA 1H1LA 3LF2A 1BDIA 1FP2A 1P4RA 2Y1XA 4JWTA 3V1YA 1UZMA 2HGZA 3S3TA 2IP4A 4I14A 5DKFA 2CJWB 1EZZA 1T8YA 4EYGA 1DC5A 2R25B 4QUGA 2I7VA 3VC2A 2HWYA 3I1YA 2H1IA 4MUMA 1XKXA 2ACKA 5JSZB 3KJIA 3ZD7A 4LS3A 5G02A 3QVSA 5JD3A 3M6FA 2A5DA 5ALTA 4KXYA 3GWGA 1F1JA 1GA4A 3GFQA 1PR3A 2PKRA 3ZVLA 3VU8A 4D4KA 2D1RA 3I5UA 2P2DA 2V7PA 3RYFB 3CSUA 2VKTA 2PUHA 4LX8A 1EZ1A 3ZDYB 3G9QA 3H6GA 2ORYA 2ZUVA 3AZPA 1E32A 1M1NA 1Y3DE 3EULA 2J0SA 1DG3A 3G2JA 1GUAA 1GZVA 4PS1A 3JRXA 1DKRA 2WF8A 1BA3A 1P1IA 3GZJA 3DL0A 3ILYA 5L3QA 5CJ2A 4X1KB 2NU9B 3SEZA 2D13A 1FEZA 1RYFA 1ORHA 2R87A 2JAQA 4ZP1A 1ZVJA 1TCCA 3P9KA 3A6FA 5JHHB 1QH1B 2XHEA 1KFKB 2JS7A 3L8HA 4J0CA 4P33A 2IS2A 2ODAA 1ZAKA 3U7FB 4X3OA 3ICPA 3MMNA 2E1PA 1QHYA 2RJ3A 2YWJA 2GH1A 3GFRA 2J9FA 3LPMA 3ZX5A 3P1JA 5IAJA 5CFLA 3SE7A 1XZJA 1XYVA 3OJWA 3G82C 3VZSA 3VTFA 4HTAA 1QBGA 3ZHQA 4Y6LA 3CF2A 4CM7A 1W9HA 4PN7A 5JSHA 3F73A 1SHKA 3D6AA 1SOWA 2HIMA 4IOLA 2QDKA 2L19A 1WCIB 3E84A 1XQ9A 4OAPA 4ZRMA 1P9LA 4GPTA 4ZVMA 3ZV6A 5TMDA 1P0MA 1V3TA 2ZM6B 2EZ9A 1IIBA 2VHJA 1GOTA 2WYUA 1HOXA 1TPYA 5I9NA 4R81A 3AUFA 3EAFA 3NWEA 2WHRA 2E48A 4H1UA 4Q7MB 5A7GA 4XGRA 4U7FA 4UTVA 4JC5A 1IPHA 2O8DA 4KNWA 3I1FA 1JALA 1T4GA 2CXHA 3JAMA 4ZCSA 2VZ9A 3KETA 1VSQA 2IYPA 3OT1B 2ZBQA 1B7GO 3I6QA 3DMTA 3USCS 3V4ZA 4B7UA 1JFFB 2HJRA 3Q5DA 4LBWA 4XUGB 4HDRA 5FULA 3H18A 1XEXA 1RXIA 1E4EA 2ZYUX 1GRRA 2VF8A 3HSSA 1UT5A 3K0AB 3SIXA 3WGUA 4B3SB 2G6TA 3U9TA 2VEDA 3WAJA 1EZ4A 2QPLA 2Z04A 4DQDA 3A58B 3TGPA 3C14C 1X7YB 2AJDA 1J5PA 4JA0A 5CD9A 1L7VC 2RB5A 4BNTA 5T4HA 2HIHA 2QOEA 2P3QA 3MJSA 5DM0A 1P1FA 4AG5A 3DGFC 5I7AA 1ZCAA 2ZJ2A 4UAGA 3FTDA 2FWMX 3HBJA 1JIIA 5JS2A 1WSDA 4ZOLA 16PKA 3L6RA 1JTVA 1Y8AA 3AL2A 4FOTA 4PCLA 1J24A 4KO2S 4BCBA 2NW6A 2F55A 1UBCA 4O4LA 3RK1A 1J9EA 1VBNA 3WWEA 4UTZA 2BM1A 4BGVA 4U7DA 4XQCA 1VKOA 5FL3A 2XZOA 1JSZA 3KK0A 2HAEA 2BFAA 5C1PA 3DKRA 1EFKA 1NOJA 4RY8A 2Z58A 4DA9A 3R7WB 4HS9A 5C18A 4J4TA 5KTTA 1DNPA 4LFCB 1LCIA 1XVLA 3ANLA 3LPAA 1UEJA 1J0AA 4X93A 2QU7A 1V35A 2Y0BA 1XCJA 3RVRA 2C31A 1HXHA 5IG2A 4G65A 5AHRA 3LKBA 4S35A 2IYEA 1QTQA 2GFHA 4F6LA 4ZHSA 1GRVA 1YUBA 1MXFA 3GJ6A 1LQUA 3JVIA 1SUPA 2NZ8A 2UXDB 2W43A 3R5TA 2C84A 4XQGA 1WCXA 2O59A 1PT5A 4HBZA 3RU2A 1TQHA 1BFKA 1DKQA 3QEJA 1YAHA 2DLNA 2RGCA 3ET4A 1YACA 3KRTA 1KH1A 5A3RA 1NASA 3NTQA 4HDKB 4RK5A 4TX1A 1L5HA 4C5CA 2PCLA 4ARZB 3E9EA 4GM0A 3U17A 1FTNA 1DO0A 3OQJA 4RENA 1GV1A 2KYRA 3NJ8A 6GPBA 3PFKA 5KPJA 4TRRA 1CUAA 3W6NA 4C29A 1J56A 2RGYA 2ZQ5A 1XN1A 4YRMA 4CHTA 3DZGA 1R74A 4FZRA 1T1EA 5IMSA 3V4VB 3UCEA 3QM1A 3R8CA 4WKGA 3KKNA 3W6ZA 1TAGA 3BGDA 1E60A 2JCSA 4TUYF 1V95A 1WXFA 1TT5A 4L95C 2PFSA 4IMPA 4PTLA 1FYEA 1NBHA 1ZY2A 3VSEA 3DPIA 4CODB 2B1IA 3GJQA 4Q15A 1D6NA 1VJTA 2FF5A 1DVRA 1OTHA 3CRW1 1LV7A 4PBSA 5AK3A 5BYBA 4B6GA 3MM4A 2RGGA 3FDIA 1SB8A 4NFLA 1D1QA 2VAWA 1M1YA 2LV8A 5EMLA 1W25A 4HY3A 5IJAA 3OFJA 4DHEA 1G16A 3KOZA 2HDNB 2VATA 2QTBA 4J6EA 3BMQA 3U3KA 3MRXA 4HVCA 1KAMA 1DKNA 3PNVA 1M8KA 1UFQA 3MMSA 4BO2A 4HYQA 2B6NA 2RHHA 3DTVD 4GKBA 4WXMA 2QK4A 2Q5IA 5FO1A 1LKZA 1NU6A 1WXHA 3ZY5A 1GZ7A 2C1EA 3PC7A 4CTKA 3DCJA 2O1XA 2OCGA 1XMVA 3MCVA 1NUUA 4Z99A 1Z6QA 2ODTX 4REOA 3G2OA 5DTJA 2WC1A 4CM4B 4IMIB 2FUEA 2HNBA 2F3PA 3PDWA 3LBNA 3DOJA 3GXOA 3G6KA 3GJ8A 4L3WA 3GUUA 4PZ9A 2IV7A 1LA2A 3OVMA 2X3UA 4H1VA 4ZCMA 1R4MA 1JAHA 3ZWMA 3ROZA 5IN4A 4DR6B 5KVQA 1X94A 2DR0A 1SUCA 3CTMA 2DPGA 5AKIA 4D99A 2HA6A 3JZIA 3C3DA 1M2NA 1XQ6A 3HCFA 1H23A 4HAUA 4N3CA 2V1UA 1FSFA 3SYNA 3LTNC 3P4YA 2X0DA 2F3RA 1AF4A 1OAOC 1R1DA 2IXEA 3AUJB 4LXGA 4Q3CA 5JSFA 2PZ8A 5A3SA 3C43A 3FD8A 2GYYA 4PGGA 3GMTA 5HQTA 5K20A 2F4VB 1V8OA 3AR7A 3C0KA 1JIKA 1PUIA 2PUFA 4DV5B 3K16A 4REQA 3RKRA 4B47A 4LF5B 1KKMA 1OD6A 1V6CA 3ONNA 4MITA 4YLYA 3THWA 3OF2A 4C2TA 1DUVG 1UAGA 2I2FA 1XU9A 2YICA 3QMVA 2AX4A 4LJ4A 4M7OA 4RK7A 4XCVA 2WJJA 1ZW1A 2B98A 4V3CA 4XWWA 5D2CA 2NNWB 2UUAB 1H2AS 4FQ8A 1S2OA 3A04A 3P9ZA 1QYDA 3NCTA 4KQ9A 5KCMA 2G71A 1BMFA 4LYHA 2DHQA 4TKUA 1IUKA 1SPXA 3BHIA 3RC3A 5ED4A 2Q4OA 1HFKA 2RBKA 1L5ZA 3HLYA 4N5NA 2HSGA 1WDLA 2C5HA 4RLQA 5HQ3A 2FQ1A 2ZJ7A 1RSZA 2WSSD 1O9GA 2KWIA 5IWCA 3QYFA 3T4EA 5KZMB 2H1OA 5IXYA 4JAVC 2I4NA 1O97C 4Q4HA 4BMVA 3HJBA 2EF0A 3A27A 3R0XA 1B00A 2JC3A 4N0EA 5DHTA 1T5OA 1T4CB 2GNAA 4D0RA 1BXRA 2G3YA 1II9A 2BCGY 1NTRA 4ABTA 5K51A 4DV6B 2F6RA 5FL7A 5AVWA 3ER8A 6YASA 5HJEA 4DR4B 3DOCA 3RJ5A 3H2ZA 3OE4A 4OIMA 3JVDA 1J7KA 4FFVA 5IX8A 1KAHA 4UUOA 3SP1A 3WGLA 1T35A 1WV0A 3DDCA 2DPHA 1FDOA 2QVZX 4YAOA 4WX2B 3SF8B 1ZLYA 2FPKA 1XZBA 2G1AA 3KAJA 5DMXA 4MLCA 1H5UA 3E5MA 3JS5A 3KPJA 1J42A 4RE6A 1NN3A 5TV2A 5IHXA 2ERXA 5IT4A 1SXJA 3IHTA 3SNHA 1OZAA 1U9JA 1YHNA 3S40A 2WTMA 4QYWA 1X1RA 2JLXA 2OLKA 3NVAA 1XI2A 3F7MA 4BEBA 2YOHA 1IQPA 3BSSA 4Q3NA 4C2UA 1R50A 2FG5A 3NM5A 4NYIQ 4Y2VA 4KRFA 4G0OA 1ZK2A 1W5TA 4QOHA 4RJIA 2REQA 3CA8A 5SYNA 1FLDA 4GR9A 2IEYA 5FIUA 3AMVA 1PZEA 4PO1A 3RWOA 3BXFA 1T8SA 4FN5A 3MWGA 1DE0A 1W36D 4A36A 3B6JA 3H42B 3GFGA 2Y3IA 3ROKA 4LV8B 3HRHA 1U4OA 2XGOA 4FTWA 2IVZA 1ZH8A 2JBWA 3KDAA 2H5JA 2YVUA 4MWDA 3BMNA 5HR5A 3AOEA 3L7KA 1T15A 2GD6A 3IE2A 3BILA 3IDOA 5LP6A 4KU4A 1ZK1A 2FVYA 3AUKA 4M8NE 1SUWA 4OBEA 3TQTA 4EL5A 4GR4A 4B09A 4CQLB 2Z4TA 4NE2A 2DSTA 3CEAA 4RKFA 4REMA 4WTOA 3WRYC 1AZTA 3CISA 3UIEA 5D85A 2CYAA 5CB6A 1EP3B 3CPSA 4IJVA 1EM8A 3V2UA 3LGAA 3EUAA 4MWOA 3RFCA 4IS3A 1QQ6A 1FXSA 4LC1A 3SD7A 4EI9A 1DQRA 2YXDA 4AF6A 4ZYUA 5L6MB 2I1QA 5AW8A 1RKQA 2I9PA 2WD9A 1YA8A 1S2GA 3KBBA 2RIPA 3R3JA 3UOAB 3FIUA 5HKLA 1V6SA 1I9CA 5B12A 1BH6A 3OOWA 3EGEA 4NNOA 4A92A 1X9GA 1TGVA 5BUQA 1X87A 3VHRA 2EARA 2CUKA 1KI6A 4HEQA 1SBZA 4P5DA 3BB4A 3KIPA 4TZKA 1L4NA 4DMLA 3IBYA 3PR1A 4OQNA 2XZPA 1NBIA 4AB1A 2J33A 3INTA 1J07A 4HEHA 4KZPA 1IZ7A 3BX1A 1YS6A 4K88A 3U7IA 3HM9A 5LZ4A 1JZSA 4KAJA 4RIIA 4HNAA 4QTZA 3SX2A 3RVOA 5BVGB 1BGVA 3Q3IA 1TM2A 2WJPA 2GD2A 3L1JA 3QQPA 5BQ5A 3G6WA 2I8AA 3K72B 1GGEA 5GAJA 2ODNA 5DHSA 2PWBA 2BEUA 4L1KA 1QGUB 4K6KA 2OOSA 2WWYA 1NXQA 4M99A 1Z25A 1JB1A 4XCXA 1PUJA 3HCPA 3D3JA 3F8SA 3WLNA 2O8CB 1HLGA 3U5ZB 3GDWA 3V2GA 1EP9A 2AF4C 2GDJA 2PL3A 4UHEA 1N77A 3NHWA 1J1UA 3IHWA 1SKYE 3NAMA 4Z9YA 4BASA 1Y89A 1USKA 4L4XA 1JECA 2CLMB 4XGIA 5HE8A 3ZE7A 4DEVA 1HUQA 4PG8A 2GERA 1RIFA 2O8FA 1BMQA 2QB5A 2IHBA 1O03A 4HQ0A 4I66A 3FSGD 1Q3TA 4MS3B 5A5EA 1ZCBA 4ZGGA 1MEOA 3CUWA 4LXTA 4P31A 5CB0A 3JYLA 4JL8A 5KWVA 2NV0A 3PG5A 3GA0A 3QUCA 4LRXA 3VR3D 3CKMA 4IUYA 4P7FA 5JALA 2ZVDA 1PX0A 4M9ZA 1N4AA 3E1SA 3OA2A 3UXEA 3CCFA 4JYBA 4R8LA 4O4HF 1DS6A 2Y0EA 2CDCA 3KUCA 1DIBA 1WP9A 2N1MA 4UCWA 1RLUA 1RLTA 2YJ6A 3PR3A 1KYYA 2VPXA 3K1YA 4R8KA 5IXJA 1IBKB 1P7ZA 4JJFA 3E15A 2LZ0A 4KYUA 1N2IA 4U5QA 1UWCA 2ISCA 4Y6SA 3HA3A 4ACBA 5TMEA 1NV8A 1O4WA 1IPEA 1MXHA 2PZKA 3VPHA 1D6MA 5EINA 1Z8NA 4DWVA 4WAUA 4TRMA 2P9ZA 5CXSA 3UAXA 4B9AA 4GR5A 3F6YA 2JAHA 4W5NA 1T9ZA 3Q87B 3QBJA 4H7PA 1AKRA 4B2YA 4OJMX 3OWHA 3WL3A 3MCZA 3ZV3A 1VLMA 4F5EA 3K0EA 2H54A 3OIVA 2BZSA 2UXCB 4N7BA 2CLOB 3FAZA 1XROA 1RYYA 1SBQA 4PLYA 3HADA 1JHZA 4B84A 1EA5A 4F8JA 1UJMA 2Q29A 3TVDA 4IDAA 1G8JA 4MUAA 5FFFA 1ZS9A 4AJEA 3DBHA 5TQ0B 5C37A 4JOBA 3SE0A 3KD3A 3STTA 3ONVA 3GLHA 3ORSA 2AVDA 1GVNB 4EYEA 4DMGA 4C14A 3K9BA 4PYIA 2JFVA 3V7UA 1Z5UA 2I2DA 3CYFA 3IPXA 1V25A 3P0IA 2OBLA 3M1YA 4FZVA 4BNYA 5I8PA 4Q03A 2ZVQX 5LZ2A 3CZAA 2XVXA 3CHYA 1YJBA 3NI2A 4OHFA 2X0FA 3T3PB 4AVYA 5L3SB 2FMTA 1L7QA 3NBUA 1NJGA 3BICA 3NEPX 3U3RA 2QKYA 3L1UA 3KQQA 4A1OA 1JL3A 4WASA 1R4NB 2JNWA 4MI3A 1KGDA 3L1IA 1VYVA 4F4IA 2XQJA 3TG2A 3V8BA 5G1NA 1PFKA 2O1SA 1C3XA 2EFCB 3COPA 5IT9A 4MI9A 2ZUUA 3NTVA 4H9GA 2AB0A 1D4FA 4OQPA 1RJ9B 1VGVA 1QKJA 3BL6A 3E3AA 1QZUA 4U63A 2OA0A 2C0CA 1NAHA 4ZZ3A 3G5MA 2IW1A 3NT2A 3AGPA 3GCZA 3C5HA 2WM9B 1V3QE 3GGSA 4HUQB 4J03A 4LVCA 4UTXA 4BFVA 3EBOA 2JFOA 1CKEA 2YN4A 3QVXA 4EAAA 5K8JB 4Y2QA 3ZZ0A 1AKYA 1FJ2A 4WCDA 1MX3A 3VJLA 5LP6C 2BSXA 2XUDA 3E27A 1U0HC 3GLHB 1FBTA 1VHQA 1JEDA 2PLWA 2X5XA 4UDNA 3GFFA 1R0ZA 4YA6A 4TLAA 3VPCA 4Y9SA 2FZEA 4JC4A 4E07A 2AZMA 3E2PA 3K0BA 3CBGA 3JV7A 4LI0A 2ZWIA 2C9ZA 2VF7A 1I0IA 2B1GA 4LYGA 5A9SB 4FXPA 2BTEA 5CNJA 4JJAA 3RCBA 2AG8A 4GL2A 1ATIA 4LQDA 4C7MA 3A4TA 1JTEA 1SO8A 4RVHA 4BCCA 2VRWA 2G80A 3CLUC 4HNRA 3QMPA 5AM3A 3QVGB 1JR4A 4A2PA 2BFMA 4ZDKA 7ADHA 4Z51A 5LP6B 3OAAD 2WYHA 3K30A 4BVEA 3T5AA 1AT1A 3A3KA 2PT6A 1KHTA 1CZLA 2FPMA 3OAAA 4KXVA 1UPCA 1KDYA 1E2PA 1GL3A 4E6PA 3IQDB 3LE8A 1RRCA 5JY6A 1ISHA 2RFLA 3LQRA 4JI6B 3C5VA 1PQYA 1E7QA 4D9JA 1FC0A 4L72A 5BSHA 1E2BA 3UGJA 1RC8A 3WICA 2XIQA 1DAFA 3HZZA 4G5GA 4CMAA 3WWDA 1Z6AA 3CF4G 3UB2A 1XBTA 3UGTA 1VJDA 4U0KA 1V2GA 1UDCA 2B8EA 2WU1A 3RUEA 3D2BA 5BRNA 2C2XA 1JYSA 2DQKA 4XFJA 1PK9A 3H3XA 5MFZA 3P9PA 2XDWA 2HLDA 2E5FA 3F5QA 3JASB 2WTNA 4F72A 3FPKA 2O3SA 5CVCA 4CEHB 1PT9A 2XE4A 2PUCA 1IOVA 4XJTA 1Y98A 3WRVA 2C42A 4IWXA 5EQDA 5EHXA 4W4TA 3KYBA 4Q9IA 2V0CA 2W8BA 1GN8A 3DEZA 3EVNA 2BSAA 1FMLA 4BKRA 1U7PA 4YI5A 1JBEA 3U09A 5BUSA 2QXUA 2AJ8A 2IYUA 2XMRA 1A9ZA 2Y1CA 1A2BA 2JAOA 3EIEA 3N0XA 5C8XA 3L7YA 4RV4A 5EWJB 4DMRA 5CA1F 5C3MA 3M70A 1ACJA 1VFNA 3H97A 5AP9A 4PC2A 1B1CA 1XZKA 2QM8A 3MJRA 4EABA 5IYZB 1BXRB 1EWKA 1WF6A 2QDXA 1UANA 4O4LB 4CT0A 2J3HA 4QUAA 1F8YA 1NW5A 3F3SA 4M0KA 2HSZA 3N7AA 3RVSA 5FQOA 2PKQP 4DNXA 5K0CA 2IBTA 4ZVSA 3VDRA 5L7WA 2XDYA 4QT4A 5GOTA 5ALJA 2I2XB 3LWZA 3CO0S 5KTPA 3LM8A 3OICA 2I6SA 3PLRA 4KGVA 3LUJA 2XTJA 1SVIA 1MENA 3O03A 3QLJA 3PIIA 2YWDA 1FX0B 3KLPX 4FFBA 4PLFA 4WN9A 5DXJA 4ND1A 3T7KA 4FB5A 1XC7A 2EX4A 3HZOA 3KTAB 5FLEX 3VISA 1UWKA 5HTOA 2Q9BA 1NSYA 1EXWA 3Q3EA 4FFSA 2Z1DA 4U2BA 3ETLA 1X70A 1L7BA 1Y8QA 4J1QA 5JYEA 2GARA 2WB2A 4JHXA 1C4KA 5K99A 1KZGB 1JNYA 2VAVA 5CW2A 3ZHCA 3GT4A 3K0KA 4OBXA 3KYCB 3PUVA 4XOUA 4ARZA 3T6KA 1EB9A 2VJBA 3WLEA 3WRWA 2BLNA 1U0JA 5IPFA 1X80B 5GOZA 1QGAA 2VSNA 3T7IA 1Q95A 2QD3A 4RQUA 2HT1A 1H6BA 4EKNB 1JR3D 3ONWA 3NBYC 3ROFA 2Z6AA 4D1YA 4L3VA 3T7TA 4DABA 2KX7A 1WU7A 2COUA 1YB2A 4HAXA 2JFWA 4HNQA 4OKSA 3F6SA 4L5BA 2ODQA 1FP4B 1U0TA 1W30A 3IA7A 4POOA 3AY7A 4XB1A 2WAOA 4KR6A 3ESXA 2C07A 1CG6A 3QUTA 5K0LA 2EG9A 2XVYA 1P7WA 5DBHX 1T26A 1W49A 4AJ1A 2C4NA 2IQ5A 4TQ9A 1PNQA 1VG9B 4FYHA 2JGDB 3V5NA 1EFHA 1T6ZA 4JXXA 4BBAA 1KJ9A 2IPAB 3KOXA 1L7OA 1YHYA 2A0UA 3GVIA 4FFBB 4PZLA 4X6LA 3TJZA 4UKDA 4EEZA 4EWLA 2VJAA 3RIYA 4AG6A 1BDJA 1EDOA 3RG2A 5K6AC 3KQKA 4A15A 2DWPA 3M81A 4MV3A 3CE9A 2Q1TA 3W05A 1GV0A 4IQ8A 5EJAA 5EC8A 4DLZA 3R6WA 2O50A 1PFGA 3EC2A 2B2XA 2CBXA 4G9BA 4M0DA 3O3NB 4RD1A 1ETUA 2H4XA 3OF5A 5M7EA 3WNVA 1Y7IA 4L0CA 2WHEA 1QH0A 3ZCPA 3UO8B 1WXQA 5KNBH 3NHMA 2EZ8A 5JS7A 3ZU6A 1QIEA 4XTCS 5JSKA 4B4KA 3IBFA 5FLXA 2OB2A 1CZKA 1E9FA 2BUBA 4IJWA 4KIJA 1WUHS 1RXCA 2PZBA 1YRQA 3IT3A 4HNAB 4OATA 2Y27A 4I4TB 1ODFA 4PTZA 5EIHA 2ZT8A 2FR8A 3OZVA 1OKKA 4KRYA 3IV9A 4YQYA 1DG1G 3GGJA 1R6DA 4PW0A 1XZFA 4IDCA 1SBYA 3CUYA 5FR1A 1CPYA 3F2IA 3RKUA 3RSOA 5EP2A 1OXBB 4AFNA 4EJ2A 2CF6A 4OI0A 3ZDFA 1MLDA 3G1UA 3NNSA 4PZCA 3ZV7A 5DO9A 4N76A 3AY0A 3HL4A 1LW7A 1XCBA 2VP0A 4BN0A 1LBSA 4C3OB 1MN6A 1X7ZA 5L3RA 3QEBZ 1BX1A 1J8FA 4QA9A 1JFRA 1UFOA 2P2LA 3S1AA 3QVMA 3ZBUA 4QOIA 4EKIA 1QPZA 1Z5ZA 4KYVA 3G0DA 1VKRA 4LYYA 3SQMA 4MYSA 4AN4A 1RQ7A 3UPDA 3OLCX 1P60A 2R66A 2CL6X 2R8PA 3AC0A 3BB3A 1XLTC 3EUWA 3IEUA 1BEZA 2GAAA 3IP8A 2NO1A 3E8SA 1DKLA 3JQ9A 3KJQA 3MIZA 3OPQA 1MD9A 4OP2A 4EPWA 5A04A 1SULA 3EZYA 3M6AA 1NQXA 4FEYA 4JDUA 5TQ2B 3LDHA 5HZGA 5K6AA 3B6EA 4X5OA 5FOXA 3UMBA 3IELA 3R77A 1Q1ZA 4YMVA 4U7JA 4QD3A 2FG7C 1QFJA 3ZTYA 1FRQA 3O4RA 2RG1A 4I4LA 1R37A 4ZMSA 1A9PA 3HM2A 3GJ7A 5DK6A 4CLRA 3IIIA 1KK0A 2PL5A 1G8MA 4HRYA 3BWXA 4P2GA 5JECA 1JMVA 4HWGA 3MTAA 4P54A 3HO6A 4O8CA 3LP5A 1LB1B 2WDZA 2H2GA 3K32A 3NVMB 4WL0A 5F12A 5IF9A 2H92A 3QBEA 3ZDAA 2FWBA 2CCGA 1EBBA 1B42A 3GUVA 4U8GA 1L5SA 4WMLA 1GAEO 1HDRA 4DCPA 1GGFA 2OE2A 4GZMA 3JX9A 3CKLA 1GUFA 1TIKA 1PS9A 2FEPA 2HBQA 4DZRA 4LZLA 2WOJA 2Y1OA 1B6SA 4Z4FA 3I9OA 4NU8X 2HU2A 1ZEJA 1GPJA 3LZ6A 1FDSA 3EXEB 4XPIB 3ZGXA 1NL3A 1DEAA 1P0FA 4G0PA 3SR0A 5CDHA 3CVWA 1OAAA 3C3YA 3JYPA 2FU5C 2V9CA 1SBIA 5SZKB 3NHBA 2ETXA 4M1OA 4BQRA 1DWQA 3JR3A 2EFEB 4BP1A 4IXWA 1GYRA 4NAVA 4Q7EA 7REQA 1VYHA 4D92A 1ZJJA 4Y8VA 1ZD9A 1FK8A 4R8RA 4UE2A 4XYEA 3DOEA 1ML3A 4NU0A 4OHXA 3T54A 5LMUB 4KMOA 1FUYB 1N36B 3BS4A 1XTPA 2J3JA 3F97A 3I83A 4QUIA 1YB6A 5SICE 4C0SA 3LI2A 5A1TA 1E2HA 1SAYA 4I9UA 2VWHA 2H29A 3I04A 4MICA 4FFNA 3EZGA 3QFCA 3RPEA 3NO4A 4LSWA 4EPRA 1BWQA 2IE0A 1DINA 4F1KA 4YXWD 2Q6IA 3CUKA 3HQ4O 3AKCA 1T3SA 1ICIA 2EZUA 3E9QA 4UBMA 4AUKA 4DG8A 2PX2A 1H85A 3THYA 5G0SA 2NSDA 3LUFA 3UATA 1GZ4A 3KJHA 2GAIA 4Q1VA 4INZA 2DSNA 2P9YA 2UZ3A 3DXFA 3L7LA 1Y7LA 3IJPA 5AKGA 3EPLA 4RKWA 3KELA 4OIFA 4XLLA 5FEUA 2DUWA 1JBQA 2QNIA 5G41A 5JEDA 4QASA 4LOKA 1N3LA 4RVGA 4HYEA 4MPDA 2DERA 2DLDA 4JX9A 2I91A 1RWKA 3FDFA 3KYDB 4KODA 4M37A 4WBSA 3ZE2B 4ILKA 4RFLA 3E8XA 1C3JA 2QYTA 1PZXA 3TL3A 4D98A 3LDAA 4DLWA 5LD2B 3KDPA 5U4XA 5ALEA 2B7CA 1ENOA 1F48A 2DQSA 2CGEA 2C8LA 2HUPA 2RHWA 1Z82A 2XOKA 2HO5A 4R5HA 3RS3A 4ENQA 2Q3JA 5IM4A 5AW1A 1E6WA 2CVZA 3OZDA 4M1QA 4C0KA 5HDQA 3TOCA 4PINA 1DJLA 2O9JA 2XYQA 1IK4A 4Z9FA 3QPBA 1FF9A 4CFYA 1VE6A 2XV1A 3ZYZA 1NNUA 5EP1A 4BZPA 2AN5A 1KOLA 2X8BA 2C2ZA 3A31A 3M33A 4IL5A 1DC6A 4HXEB 2YJGA 5SZJA 1H5NA 4BWFB 1FS4A 2ZKIA 3H9CA 1M2GA 4DREA 3VDNB 2CMHA 1HZZA 2BFWA 3CZMA 4KO4S 4UBJA 4DCMA 5IZCC 5F7JA 1L2TA 2W4IA 2BW0A 3K8OE 2A5JA 1QZZA 1U1DA 3B7WA 2WWVD 3EISA 1GEGA 2F43B 3SS9X 4INPA 1G41A 2X19A 1N7JA 4I8IA 3TZQA 1MJGM 2R1TB 4LJ5A 2EEPA 1JJIA 2BFNA 3H2JA 1H0KA 1U0RA 3ZGNA 1FZTA 5DSZA 2I2CA 1ZN7A 4BL5A 4FB4A 1OLUB 1Y6JA 3S70A 1VTKA 2OORC 3VNQA 1ZO8A 1YUNA 3FXAA 4DCVA 3SKVA 4DSAA 2CXUA 1YVUA 2JFNA 2CHGA 3S2UA 2E7ZA 3V00A 3C70A 1GPAA 3G5TA 2RBGA 4UBNA 4XVHA 3WO1A 1ZL2A 1M2VA 1LQ2A 3ROQA 4B85A 2ERYA 2D6FA 1H8ED 1X7ZB 1FDIA 2FSHA 4F9EA 2P4UA 3BFJA 3D6JA 3O4HA 4QDOA 4IGAA 1YQ9A 2TMDA 3UOGA 4II2A 3WLTA 2EAUA 5F1KA 4CV3A 4URFA 3DDWA 5EIOA 3T9FA 5ISMA 3V7FA 5JSQA 2IBMA 2JKVA 3OZTA 4V3BA 5ALOA 4DYDA 3LNCA 1UL1X 2ZB4A 1Y63A 3ORQA 3KTDA 4F2PA 4ZGWA 5DOZA 3W1VA 1LWOA 1GDHA 3W77A 1IHXA 2OV6A 2W6JD 4KYTA 1E9CA 5IF3A 2XH8A 4KIWA 4R31A 1WABA 1UKZA 2Y9PB 5T64A 5A4FS 2EKZA 3NHUA 3V9PA 1YL7A 3PUKA 4OFWA 4A27A 2DBRA 5E3HA 3SHVA 1SHLA 1GAQA 2ESRA 2V4UA 3D5TA 2AJLI 4JLAA 4M7RA 1XEWY 1FSGA 1H6DA 3BAZA 3P32A 4MSUA 2WINI 1KYIA 4O5OA 3DFFA 2KMLA 3V9AA 4DNFA 5FOTA 5I6DA 2FSIA 2G25A 1GU0A 1HDXA 3DCIA 4HMQA 3L1KA 4X97A 1QZTA 4ME6A 1D2RA 2APJA 2W2OA 3R8FA 1RI2A 3HGTA 1QIIA 4BZWA 1O77A 3HKCB 4QAJA 2HUNA 1J0CA 4FT2A 4X63A 2PMDA 1QDLB 4BNMA 1JJAA 2F1HA 3SFVA 4GPZA 3OTQA 1FX0A 2C5GA 4K86A 4AQ7A 1AK1A 1T8UA 2MSEB 2WFLA 4RHEA 4DIKA 1PD0A 3EVDA 4YT8A 2XXAB 5TGDA 5JJIA 2AG1A 3BIJA 1HR0B 2AZ4A 3C4QA 1JYEA 1S2IA 2A14A 3K31A 2HZ7A 1XEAA 2HMSA 4M86A 4R41A 4CFZA 4BAUA 2J7PA 1QMPA 3EXEA 1CDZA 4XPIA 4Z1MA 3ESDA 3H83A 3UWMA 3ITEA 2W42A 1J2YA 1TO2E 3C8MA 3R6LA 5ALFA 1G8PA 4P0TA 2VJYA 4PXYA 4EA6A 4XVUA 1AHIA 3LOUA 3V2IA 3NUZA 1UIMA 1W581 4ZO7A 5TX7A 5KWEA 4L8VA 1PSDA 3KC2A 4YXFA 4K6MA 2BFFA 4UHCA 2HT6A 4HJRA 2BFCA 2AN1A 4G8BA 1LRLA 1CQJA 5DLPA 1YDHA 2IJGX 2G0NA 1NURA 1N9KA 2D1SA 4LHYA 1U94A 2OLJA 2WJWA 3S2SA 4EHNA 2P5TB 2HNAA 5B1YA 8ATCA 1Z12A 1DJPA 1XRQA 1N9GB 1KMCA 1MOQA 2OPBA 3L79A 3KOOA 3HCDA 2YXLA 1JZQA 3T1TA 5AK4A 3USZA 5E6RB 5K9ZA 1CYEA 1K2VN 3QK7A 4MKXA 3OU2A 3JSAA 2BWJA 1FXUA 3RBVA 2VRCD 4HO1X 3T95A 4EMBA 2OVBA 2AXEA 1E7SA 1QWSA 3QXXA 1T0UA 5IJWA 1VHJA 2PMBA 2P78A 4CF5A 3A05A 2OHGA 5BSUA 1L1RA 4MVWA 1XPRA 1IN4A 2X8WA 1KO4A 4G56A 5BN4A 1IBLB 4LGCA 2G5PA 4JBXA 5DP2A 1RWOA 3NHPA 4R1UA 3I64A 5EI5A 1K6JA 1DAOA 4A0FA 5D87A 3IVCA 4FX2A 1YCFA 3IAUA 3GCWA 3QG1A 4M21A 2QE6A 2WJYA 3OOHA 2ISSD 4HPWA 3QWFA 1U8FO 4CGYA 1A82A 3IQHX 1TM1E 3MOIA 4UNQA 1DCTA 2ROQA 4RHFA 1TF7A 3MJTA 3ZCXA 5JZSA 1KS2A 3VKHA 1KPHA 5IYZF 3WAGA 4XZ3A 5K8IA 1IDN1 4LE0A 3TM5A 5DH9A 1H2EA 3DW1X 4L16A 3RVDA 3VO1A 1N33B 5I7RA 1X14A 2WE8A 1J9GA 1U1IA 3WXBA 1RXSA 1PJTA 1TZJA 4YCSA 2OESA 3P9SA 5CT6A 3QU9A 2OGTA 4OB7A 2PWPA 2Q1UA 4QATA 1W4AA 5IJZA 3ZLTA 1G5QA 1NV9A 2F90A 1B8VA 2IHZA 2CDNA 4KDFA 4LECA 1CEXA 4X64B 2WOOA 3UJBA 4KN6A 1LUAA 1JXOA 2RGNC 2IEDA 2F43A 5BPHA 3PIRA 2G63A 4X45A 3AINA 3U44B 3DZJA 4DS3A 4GYWA 1XPUA 3IMEA 2WI8A 3O91A 1RQLA 1AU9A 1O96A 3MTGA 2W6CX 2K87A 1DP4A 5G0TA 5THXA 2BTQB 1MB4A 4RESA 5EJ7A 3K9NA 3LJKA 4X84A 4Y9DA 2O7VA 3PNSA 2R96A 2PRJA 2QNRA 4ZPXA 4HB0A 2I76A 4CM9A 4GQAA 4M6WA 2NVUA 3H2HA 3MWFA 3PQCA 3TLMA 3G8YA 4Y2TA 5J4VA 5JQGF 1C8BA 1COZA 1V41E 2XUQA 4GI3A 1SMKA 5G53C 1V1MA 4MAAA 4YIKA 2RJNA 1MVNA 3MTBA 5AOVA 3RWBA 2HPVA 5CFNA 2CLFB 2GYUA 2EKLA 3JVEA 2VT7A 1UFRA 1JVNA 1SQ0A 2PUBA 1AS3A 1LX7A 3LT1A 5IJXA 2IYAA 2ZWPA 4GX5A 3CLHA 4MX8A 3V3KA 1MJNA 2A9KA 3BFKA 3NIGB 5FWDA 1P4AA 1J22A 3K3PA 1IL0A 1CDOA 821PA 4G1FA 1QGED 4JU8A 3ZW7A 1V5GA 3RC1A 3RVQA 2G09A 1FNNA 4ED9A 5CNIA 1F8UA 3F6CA 4R2WA 1QE3A 2XODA 3EDRA 3KALA 3IXQA 1TW2A 4Y2RA 1WB9A 4PFKA 1D2GA 3GLSA 4J3FA 4R83A 3H86A 4OLJA 1TJNA 1HLPA 1ORTA 1QG0A 4MP3A 5CA1B 1MB0A 1E3IA 3GGDA 4OG2A 3RYIB 3GWZA 3AIMA 4CU5A 3C98A 2P0AA 2ZYTX 3S1SA 4ZQFA 1NBME 2ZRIA 1WL8A 1T29A 1VMAA 2Z8ZA 1IWOA 3DONA 4QOEA 2DZDA 5K4HA 3PHIA 2ZYGA 1SCNE 3HO8A 4B35A 2HSEA 1DJOA 3F6PA 3C7AA 1VG0B 3K0FA 2SBTA 1GZ6A 1VRVA 1ZBQA 2W4QA 5IN5A 3T9AA 3W7BA 2XOXA 4BWYA 3O73A 1ECFA 2JD1A 2Q3FA 5EJ9A 1I32A 1KK2A 5HF8A 2GUGA 1X39A 2CMKA 2OBBA 2ON6A 1ECBA 1JKJA 4LCJA 1NIJA 2UYYA 1BJKA 5CFRA 1BFUA 1O94D 1QYCA 2V7UA 3WP0A 4G0WA 2DH5A 1B6RA 2ZRQA 4V38A 3QTBA 4Z9XA 2J9ZB 1B0PA 1VG8A 1ZK4A 2C00A 4BLPA 3GRRA 2AE2A 4X62B 1KQOA 2ATVA 5AR1A 3PE3A 3G2KA 3LDFA 4A9AA 1X86B 4HF7A 5ILGA 2XBMA 2RHGB 3WQSB 3DO6A 3U7GA 5JH7F 4CF6A 1YIOA 3IPRA 3NBZC 1KSFX 4MRNA 4OQXA 3BREA 4DMCA 3K2EA 4LJLA 1CIVA 3JD2A 3JTMA 1ZA1A 3K1ZA 4FW8A 4NMXB 4ZO6A 4O8ZA 4HGQA 3TAHA 4HUTA 2JJ1D 3STHA 4DDUA 1P4SA 2HWWA 1DOAA 1NVXQ 2ZSDA 5AKEA 3R0JA 5ARDA 2R79A 1IBRA 5LP1A 2UAGA 4KDEA 2B94A 2NZVG 1NW6A 1TX4B 3HWSA 3Q2KA 3SHQA 4LF4B 1V96A 2RDMA 4AULA 3QHQA 4WOKA 1IUOA 2OQRA 2VJOA 2H8GA 4V0LA 4IF6A 1GDDA 2X77A 2ZUWA 5ETJA 5I4CA 2EATA 2O2EA 4JU9A 2GN8A 1EXMA 2UUBB 5KTSA 4O0LA 5FUBA 4O3MA 2A4MA 5JD6A 1G5RA 1B14A 3NV7A 5CTAA 5H3CA 3WMGA 1P74A 2ASEA 4Z49A 2PBRA 1U3DA 2EW8A 3AU9A 3GLFB 1W35A 1M0SA 5KDOA 2PZGA 3VAYA 1FFEA 4BX3A 1YUMA 3B7PA 2FQXA 4KQ2A 4MPJA 3ZWYA 5BMOA 1JNXX 2Q5HA 1KOGA 3DXZA 2FSFA 4H6WA 1YFLA 2VDMB 3OTWA 4ZMRA 3CLRD 4II3A 1A7JA 2WHXA 1ZR2A 1ONBA 1DX9A 3D43A 4GUAA 5HQ3B 5REQB 5FHQA 1U11A 3QWAA 5H0IA 1KMHB 3AUUA 3UA3A 3BCRA 4L8FA 5B6JA 1FZQA 2FFQA 3IV7A 1K27A 2XQVA 3C1OA 4NZMA 5T3YA 5LLTA 5KNCA 1Z34A 4K8OA 4FGKA 1YJ8A 4L4UA 4GWKA 4JBWA 4W5JA 3R3VA 2EBUA 2M6KA 4XWKA 3FLAA 3U61B 5JXJA 1J0DA 3D7SA 3UKDA 1VLLA 4RSGA 4F45A 1JJBA 1C7IA 2AW3A 2K5UA 4BNUA 2FUKA 2HQ1A 3NRJA 3ND5A 1KDPA 1IZYA 1HV8A 2MOKA 3SOPA 2OBNA 1W4RA 3N1UA 3Q7PA 3CJQA 4MR8A 5DWVA 1E3QA 2Q49A 4R1MA 3M6UA 1AOXA 4DRXB 3MSXA 2W83A 4EB8A 5FOWA 2BELA 2JGLA 5H16A 3F9CA 3KUKA 3PQ2A 4PE5B 1KU6A 1BHJA 1IHPA 3LC1O 4YQZA 5EQFA 4NONA 3VH2A 1BHO1 1DKMA 1QE5A 4B3BA 2WIDA 1NNLA 1JR3E 5MHTA 3WLSA 3N75A 1QG2A 3U37A 1QQTA 3I34X 1B1AA 1G21B 4B4UA 5JDCA 2IH4A 4OYHA 3U80A 3I2JA 3CF6R 3D0QA 4EELA 1Z5NA 4MW6A 2QTVB 1P19A 3KKLA 4NE9A 1DAKA 3PDHA 3E48A 3FVQA 4WFKA 1SHJA 4O25A 4MCHA 1C4XA 4BKMA 5I3CA 4M8LA 4JB3A 4MQMA 4ZYZA 1FYFA 4Z7NB 4QHSA 4B80A 4NULA 4MYDA 4JT8A 2C7QA 2IXFA 4AI6A 1J8DA 4BKOA 3AT1A 4WLFA 4OM7A 3SXUA 2Q4RA 2ZPAA 4PZAA 5BV2P 3M5DA 3PPVA 5C5EA 2QL9A 2GN0A 3QITA 3V97A 1O08A 5JQWA 3FYUC 4EG5A 2Q6OA 1E1DA 4G5XA 5D3MA 3V80A 1JG7A 3FFWA 3UKOA 5KVSA 1OW3B 1W36B 1Q57A 3UWPA 3ME5A 1XTBA 2FZCA 2PEZA 3CV3A 3UC9A 1L7MA 3ZXYA 4YO8A 3UUGA 1JPNA 1SJ9A 3CFYA 3OPMA 4YJ3B 3K6KA 4HKTA 4RORA 5DIZA 5DU2A 1K5GA 2QM0A 1JN0A 3A10A 3R76A 1PQWA 1Y5NA 3RTCA 3V7WA 1OX6A 4NWIA 2PK3A 4P3PA 3EYWA 3OQ6A 3JQDA 2IX3A 4QDUA 4OLHA 2AOWA 4J91A 4J6FA 3K1AB 4F4CA 2V3VA 1XZ8A 4ECAA 4RTMA 3GJZA 3RANA 1V5WA 3C39A 1I3CA 2GN6A 3CW8X 3O94A 3R9IA 2FPIA 3GRVA 1QCZA 2VDNB 1RXWA 1WV1A 2LW7A 1G60A 3AESB 2QLLA 3B60A 3WLMA 3DOHA 4P36A 1TZKA 5KYGA 4JI2B 5DNYB 3PNPA 3DLAA 1W44A 3KUDA 1UWVA 5F73A 4Q7KA 4RQBA 3RRZA 5FAKA 3VYUB 2VZLA 5HBGA 4WESA 5JOQA 1QF6A 1OVMA 3IHKA 3P9RA 4HPXB 2H57A 3AJ8A 1VCIA 5EXEA 5EXDA 1OASA 2JGIA 4K05A 1ICEA 4X9XA 5FP0A 5CA0A 1HT2E 1FW6A 4H2DA 1RAGA 5BSEA 1M2HA 3GJ5A 4QJIA 5FUWA 1WQ4A 4YHBA 3NG1A 4FFWA 1JI3A 4PXAA 1AZWA 5ALWA 4FR2A 3KQLA 1KFJB 4LYAA 1WXWA 4YX9A 3C3WA 3N07A 3RVBA 5ABPA 3PI7A 3VBCA 5KNBD 3LFHA 4J1TA 3PKZA 4UMVA 1UP6A 4CEJA 3LS2A 3DM5A 1AKEA 3P71T 4H18A 4P7JA 2FFAA 1I4OA 2QRKA 2JEZA 4CN9A 3NH6A 2BGUA 1Q77A 4LJAA 1GQSA 2B5VA 1UCFA 3IIEA 1T2FA 1DKUA 2ZJOA 1AMUA 3DFMA 5EWLB 2RHTA 4RD2A 2DP4E 1U6JA 3HVJA 5KKCA 4DWJA 4K2AA 2NPIA 3TQOA 3VKFA 1MR3F 1EUCA 1DRWA 5AVYA 3M49A 4TQUS 3LXMA 4G2TA 3AVQA 1ZQ9A 3RSZA 3UGKA 1N1MA 4LHSA 4IFBA 1I3KA 3GRCA 1LZLA 2C82A 3STUA 1HX7A 2FSVC 1PT6A 2XOEA 4X8OA 4DT1A 4JC8A 4MW4A 3VR5A 3IAS6 4MHSA 5JD5A 4IGIA 3LBYA 3LDUA 3AH8A 1KP3A 1VHDA 3KR2A 4AP9A 4E12A