3CZ4A

Native apha class b acid phosphatase/phosphotransferase from e. coli
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
b'SPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B acid phosphatase
publication title Structural insights into the catalytic mechanism of the bacterial class B phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 76
structure length 209
sequence length 209
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2008-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cz4A00
2JAWA 4KX5A 3DV9A 3ESQA 3N5KA 4KNVA 4G63A 4BEVA 3FZQA 1YS9A 3AR7A 3OCYA 2P9JA 2I33A 3WK7A 1O03A 3IB6A 4C4SA 2JARA 3WKAA 4AS3A 3NUQA 4DW8A 4BBJA 4J2TA 2W4MA 4JDPA 4Y3UA 1Z88A 5ALGA 4F71A 1RC8A 3AR6A 5AVTA 3E84A 5ALSA 3W5DA 1QQ5A 4ZEXA 2HDOA 4FYPA 1F5SA 3PDWA 5AESA 5AW3A 4Y2TA 1LTQA 4UMEA 1QQ7A 1ZRNA 2G06A 4YIHA 4CNQA 4YGYA 4HGOA 1XPJA 5AVWA 1O08A 2B1RA 4HGRA 5AI0A 2BDEA 2HF7A 3CNHA 1Z5GA 3AR8A 1U7PA 2FI1A 1U7OA 2JAUA 5FP0A 2P27A 4PNHA 3ED5A 1Q92A 3ET5A 1RMYA 1EK1A 2G07A 1AQ6A 3S6JA 3WK9A 5AW1A 2C8KA 3UM9A 2G80A 1T5SA 2HX1A 3QUCA 3E81A 3ZUPA 2OA0A 4UMFA 3SLRA 3UMCA 2C9MA 3L1UA 2WF8A 1ZJJA 4ZEVA 1TE2A 4KYTA 2OBBA 1YNSA 2B30A 2EARA 2PQ0A 1JUDA 1L8OA 2FPWA 5ALVA 3NASA 2RARA 3IRUA 4Y2SA 2WF6A 1L7MA 3OCXA 5AKLA 4UMDA 2AMYA 2B82A 5AK3A 2YMMA 3U7HB 1LVHA 1VFPA 3HLTA 3QNMA 5AM3A 2FPUA 2ZOSA 5AKHA 1RDFA 3OCZA 3U26A 5AVQA 2FDRA 3FM9A 5AI8A 4B6JA 3QUBA 4HGQA 5ALEA 5AM0A 2FUEA 3NIWA 3N8GA 2HSZA 1L6RA 1S2OA 3ZX5A 3NALA 2NO5A 3WGVA 1L7PA 2GFHA 4Y2UA 1RKQA 3SMVA 1TJ5A 4GXTA 3A1DA 3QU2A 4IFTA 3QU7A 4CF5A 4UM5A 5JJBA 1RLMA 3N1UA 2ODAA 2Q4TA 5AKKA 4EENA 5ALOA 5IT4A 2ZBGA 3WK5A 5ALPA 1Z4NA 2IOFK 4F72A 3AR9A 4J03A 4EZEA 2HHLA 3IJ5A 2FPXA 4OCZA 3L5KA 1RLOA 1RPZA 5ALMA 1YDFA 3DNPA 3KC2A 2HCFA 4I9FA 1FEZA 4UAUA 4Y2PA 2G09A 1L7OA 2PKEA 2NYVA 5ALUA 2P11A 1N9KA 3PGVA 4C4RA 2C8LA 1Y8AA 3BA6A 1CR6A 3WKEA 2I55A 3WGUA 4KN8A 1IWOA 2I7DA 5ALTA 2YJ3A 3ZVMA 2IOHA 3ZWKA 3WK4A 2MSNA 1U2TA 1T5TA 1RKVA 3A1CA 2PR7A 1RRCA 2D2VA 5ALIA 4UM7A 4BKMA 2HF2A 2GO7A 1Z4JA 3MPOA 2ZG6A 2BDUA 4XQ0A 4NFLA 1NRWA 1T9ZA 3GYGA 5AIBA 4BX2A 2GMWA 1Z4KA 4FE3A 4UAVA 1S8OA 3E8MA 3B9BA 4C4TA 4KX3A 3L0YA 2AH5A 3SF0A 5T41A 3QLEA 2O9JA 3RFUA 4UATA 5AK6A 3NRJA 4JB3A 5AI6A 1TA0A 3MMZA 5AKXA 3CZ4A 4DFDA 4Y2JA 1J97A 5A3QA 4Y2VA 4HGNA 4E88A 3EPRA 1NNLA 2B1QA 2AGVA 3EWIA 4OFZA 2ZBFA 5AKJA 4BEWA 5AM5A 5ALRA 4MUMA 2CN1A 3KZXA 4YCLA 3QU5A 1U02A 2BY4A 3AR2A 2QYHA 3ZVLA 1ZD3A 1CQZA 2FUCA 3WKCA 3R4CA 3MC1A 4L6CA 4RESA 3EF1A 3ZWDA 2CFSA 4RETA 3L0CA 5ALDA 3E58A 2O2XA 2RAVA 4YCNA 3L8EA 4HAIA 4QQFA 1SWVA 5AW5A 4UARA 3F9RA 3ZI4A 2WFAA 3RF6A 5ALKA 2FEAA 4UU1A 5ALJA 4CF3A 2W43A 1NF2A 3I1YA 5AIAA 5AI9A 5AM2A 5AVZA 1L8LA 1TJ4A 1Z5UA 1MH9A 3QUQA 1XVIA 4O8CA 2GHQA 3FGOA 3N28A 3OPXA 3N07A 4YIKA 2IA5A 4EELA 4L6AA 5A3RA 3U7EB 3I6BA 2WF7A 5ALZA 4CE6A 4HYTA 3MN1A 4AS2A 3M9LA 1RQNA 5AVRA 1Z4LA 2YJ4A 5AM1A 3I76A 5AVUA 3NANA 3QUTA 4Y2YA 5AICA 3L8FA 2I54A 4IG4A 2ZXEA 4BYGA 2ZBDA 4BNDA 1YV9A 2IOFA 2WF5A 3AR5A 2X4DA 2B0CA 5AKEA 4ZEWA 4UASA 3SKYA 3DAOA 3HYCA 5AKGA 2ZBEA 2YFYA 3OCUA 1RKUA 3I28A 3M1YA 1K1EA 5AKYA 3QX7A 3J7TA 2YJ5A 3B9RA 3ZVNA 3ZW7A 4AP9A 4NAVA 2EAUA 4BX0A 2CFRA 3B8EA 3AR4A 3L7YA 5AK5A 2I34A 3TLMA 5AW0A 3QU9A 1RLTA 1N8NA 3R9KA 3KOOA 2YMPA 2OM6A 1QH9A 3U13A 2I6XA 2G1AA 3PCTA 1ZRMA 1ZD2P 2YN4A 3OCVA 1WPGA 2R8ZA 2HEGA 2P69A 3R09A 4BX3A 5AVYA 5ALNA 2JGAA 1WR8A 5ALXA 2YBDA 5ALWA 1EK2A 5IS2A 4XE5A 1ZS9A 2WF9A 3ZTYA 3FPSA 2YJ6A 4KNWA 4YH1A 5AKIA 5AW9A 4NABA 3L8GA 5A3SA 3OTQA 2R8XA 2B8JA 3W5CA 1J8DA 1QQ6A 1L7NA 2FPRA 5E0OA 4Y2RA 4G9BA 3NAMA 1PW5A 4NWIA 3QGMA 2QLTA 1Z4PX 3U7FB 2G0AA 3ZX4A 5AK4A 4EX7A 2C88A 3KBBA 4MWOA 1ZOLA 4EEKA 1KYTA 4EX6A 4HGPA 3DDHA 1Q91A 1SWWA 3P96A 5AVXA 5AW2A 3BWVA 3U19A 1Z4IA 3FPBA 4XPZA 2GHTA 5AM4A 3WK8A 1WVIA 1YJ5A 3L0BA 2OYCA 3ET4A 3W5AA 1ZD5A 5AI5A 2Q5EA 3SD7A 4L57A 2R8YA 3WKDA 2R8EA 4CF4A 3U7GA 5AKZA 4XOUA 3W5BA 3ZTWA 4BNDB 1X42A 2YMLA 4NV0A 2C4NA 3KD3A 3UMBA 3K1ZA 2AUTA 3QYPA 4DWOA 5AVVA 1VJ5A 2DQSA 4OD0A 5AW4A 2VKQA 4FFDA 3D6JA 3L8HA 5ALLA 2MU1A 3KDPA 4UU0A 3EF0A 4Y2XA 1VJRA 5ALQA 2WM8A 5ALYA 2YMQA 1SU4A 1XP5A 2WHEA 3QU4A 1QYIA 4QJBA 5AW6A 3UMGA 2W11A 3A1EA 5AW7A 3A3YA 2CFTA 5IT0A 4DCCA 1RMQA 5ALHA 2Q4RA 1U2SA 3ESRA 4OHFA 5AI4A 4H1WA 2G08A 3OCWA 3ZU6A 2NO4A 4GIBA 1WZCA 3SHQA 1YMQA 1Z4QA 3VAYA 3QXGA 2JAOA 1TJ3A 3PGLA 2HOQA 5AW8A 2EATA 3SKXA 2B8EA 5AVSA 2YY6A 5AHXA 4UMVA 5ALFA 4YCMA 1Z4OA 2HI0A 3FVVA 2FPSA 1RMTA 4UW9A 2RBKA 2RB5A 4I9GA 1ZD4A 3AR3A 3L1VA 2IYEA 4Y2QA 3WK6A 3WKBA 1Z4MA 1RQLA 3ONNA 2HO4A
chains in the Genus database with same CATH superfamily
2LV8A 4MQMA 2JAWA 4ZAFA 2OHFA 4RFVA 1QJ4A 3IPRA 3TCKA 1OIWA 3T3DA 2OV1A 1QF6A 3SKVA 3IBTA 3NM5A 4H0FA 3ILHA 4MRVA 4V0ME 5CB0A 5ADWA 2JLRA 3VYRB 2IEGA 2AUMA 3CBGA 4HZGA 2LCFA 3ZYZA 1YR3A 3MBOA 5ITVA 2ZJ5A 3DLTA 5KTMA 5HFJA 2EJCA 2FZKA 2GKSA 2HNKA 2AK2A 2N42A 4TUYF 5FI0B 2WTUA 3O38A 4QM7A 1ISGA 3EVTA 3UK0A 3O2JA 2JARA 3GGJA 5AJTA 2RD2A 1QTRA 3HTXA 1TK9A 5CW1A 3HFRA 4F71A 1RC8A 3BORA 1X7WB 2QY9A 2CNDA 5DRYA 1VG1A 1SVKA 3JQRA 4H0CA 2H1FA 2LDXA 1YZVA 1M6HA 1WCIB 2Q6OA 5DYIA 3C7CB 3K2IA 1WY7A 1LNSA 4X3CA 1X86B 5CNMA 2JDID 4M0MA 5E6SA 1EB9A 5KNBH 2BN4A 1AZSC 1Z6GA 2W0SA 2AOXA 2BC9A 2N3ZA 3H19A 3HHEA 4QREA 3TSWA 1BTOA 2P9ZA 2QZJA 1YVUA 4CNQA 3KJXA 4IRUB 3IAAA 1AV7A 4YRQA 1UMCB 3BIOA 2PUBA 1XDZA 3LAWA 2SKEA 2NG1A 3C8UA 3IQGX 1ORVA 3HUUA 4C7KA 4J75A 1H0KA 2FN9A 1E2PA 2X15A 3JVEA 1TQHA 4HDQB 3D81A 1PEAA 5DN6A 1Z0IA 2FWRA 2I6FA 1I7SB 1SXJD 3RWBA 2DQZA 2ZJ3A 2Y0CA 4KQIA 3JQDA 1Y9AA 4O3FA 1FTQA 1T5SA 1NMEA 1NX6A 2W71A 2Y93A 4YQFA 2BTQA 4LDQA 4MO2A 3SLRA 1UM9B 3WBBA 1NJ1A 2B92A 1GPJA 1YKSA 2H8GA 2VDMB 1I4OA 4GOLD 4N5DA 4R8VA 2W2LA 4TPKA 4D4GA 1FOEB 4MYUA 1J8FA 4NE2A 3IUEA 1KE1A 5JH7A 4WFIA 4X3OA 5SICE 3CT4A 5IZCC 4BZWA 1C7ZA 2V45A 1CQIB 3CLKA 4OHKA 2NP7A 4HYEA 1C9JA 3OM0A 6PFKA 1ULUA 3V4ZA 1EWTA 3SGLA 2FPWA 1UWLA 2Q0XA 3QYFA 5GM2A 4BWFB 2XCUA 4ED9A 5MF6A 5KNLA 2BFEA 2H18A 1GXSA 5GJBA 1ESNA 4R84A 1I1NA 3KALA 4PHTA 1L5LA 3VR6D 4EUHA 1F06A 3KXPA 5BV7A 1MFZA 1T6YA 4LAFA 1TTTA 2X0NA 3FCUB 4FFLA 9MHTA 3CGWA 4EPRA 5AM3A 2R65A 2F59A 1Q0ZA 1ZK2A 2Z95A 3BS4A 3U60B 2FGJA 4M1QA 4DNFA 1UBGA 2ZTMA 3LW7A 1WO8A 4FFPA 3TIXB 3V1LA 1E7QA 4BZQA 3DNFA 4E5KA 1CK4A 4E70A 2F8SA 5ER6A 4MAMA 3KZ1E 3GVCA 3IDAA 3N8GA 4CQNA 3NHUA 3DVAA 1IY9A 1GA6A 1LS1A 3PFIA 3O2QB 3FSEA 4B5KA 4JUFA 1E2MA 1GYRA 2H7XA 1QMGA 3MPUA 5DBHX 1L7PA 4X93A 3JYOA 4GECA 5CHEA 4A16A 1TM2A 2PMDA 3GFQA 1SBNE 1RWBA 5JJBA 1NQOA 2FN7A 5I9BA 4LHXA 1Q6YA 3E6AA 5E9WA 2CY0A 3WI7A 5BR1A 4HQNA 2ZJ6A 2QPTA 4NPHA 4DKXA 3U4GA 4D8XA 1JYEA 1FYXA 4GU5A 3RT1A 4MDHA 5DGDA 4F72A 4OM8A 2X23A 5CLJA 2TMDA 2PEYA 3HP7A 2Z56A 3DMYA 3FPLA 1KI7A 1P45A 1BS1A 3GJZA 3ED1A 2DYKA 4J1QA 1NASA 4Y8VA 1OFUX 3GJ5A 3MCTA 5JRZA 3H9CA 4JR2A 5I7EA 3ORFA 3JPYA 2HH9A 2I99A 4IQFA 4B73A 4F21A 1OFHA 1YONA 4WADA 1DC5A 3NU1A 1NF8A 3AXSA 4NNOA 4U2GA 1VLZA 3G5LA 5EIBD 2VTKA 3GRCA 5CVEA 4D0RA 2PL9A 4MP3A 1AK2A 3GRKA 5FBQB 1W4BA 3QEOA 4HGYA 4FOTA 1EINA 4POAA 5I01A 5I7AA 4RTNA 3EDMA 4DUZB 3L0OA 3KX2A 2X8LA 3D4LA 4IGKA 1FMFA 5BWOA 3HBLA 3FKSA 3SXJA 5CBPA 4D97A 1SD2A 1NQWA 2AZTA 4J0GA 4J16A 4XJXA 1W5BA 1LJLA 1TEXA 4GSKA 4AMZA 4Z4CA 4GKKB 3H5LA 3SIRA 4TM7A 2NU8A 1C9KA 4K40A 4KFTA 1ZVQA 4D9KA 1JEYB 3ZCQA 2O0KA 4MRMA 3K70C 1FFYA 1XDDA 2DBYA 1AU9A 4BX2A 1TCUA 4FEEA 1CR0A 1CS0A 1JX6A 2EFYA 2FKAA 2GD2A 2GMWA 2X8JB 4MV9A 5EIWA 4F8YA 3HNPA 3K9LA 4D0SA 5ED4A 4XRRA 1RBQA 3SQDA 2R7NA 3PFCA 1IIRA 1QAQA 4ZI5A 5IN4A 4IVNA 5FQNA 5B6PA 3OFKA 4AUKA 3TLAA 4ILKA 3VVBA 5HJ5A 5AI6A 2OZLA 2JCSA 3HR7A 2JEZA 2BD0A 3LPDA 4I6JA 1S0UA 1K7YA 3F4BA 5HK8A 3KYCA 3HWX1 3HKCB 3B82A 3GEGA 1H9AA 4LCJA 5AOCA 3CRVA 4ZC1A 5ITZB 3THYB 4J1SA 5FI1B 3WGQA 3GLFA 5FD8A 2ZR0A 2ZPAA 3KFLA 1XZBA 1NVMB 4G67A 3T34A 3VRHA 1QRSA 2ZAMA 1RYFA 1E4VA 2PX0A 2ZYIA 3H5VA 4JJZA 2V6MA 3RU7A 3MIZA 5G0TA 1ZK0A 2JLBA 1KQ3A 4DS3A 3NS7A 3SOZA 2QAJA 1AUXA 4HL6A 1NW4A 4ISCA 4Y9UA 2HHCA 4LJ8A 3VZRA 3E18A 4FOPA 4MWEA 2J0EA 4LMBA 4PG4A 3FVQA 1JR3E 1ITZA 1KMQA 4RESA 2ON6A 5BXQC 3OTHA 3QFSA 4IIYA 4DUGD 4H77A 1CJCA 3BWDD 4I1RA 3PZBA 1R3DA 3IEPA 4MUYA 4L2IB 1NJ8A 2I4IA 1MG0A 3CHYA 1NDHA 2JGDB 3O9VA 4UNQA 3RJ9A 2DTEA 5BSMA 2IH4A 4RWEA 1E0DA 4Z9FA 4XVCA 5AW5A 2HFJA 4UARA 3EJ6A 3H13A 2P91A 3T38A 3KUUA 1ECFA 2MOKA 2PFKA 2C1EA 3GEPA 5JJKA 2GCIA 5FPHA 4ZJUA 5CFPA 1Z18A 3A9RA 2OAEA 2A9PA 1Q2XA 3L8YA 1M2OB 3E9ZA 2YXEA 4B32A 4AN0A 3JQGA 4R0NA 1U31A 2H3EA 4CMIB 5BW6B 2GASA 4Q1BA 2G1PA 1V43A 5LYJB 1OMOA 1VL2A 2JK1A 4BFYA 2P5YA 3FGOA 3ZU4A 1D2CA 2FKNA 3C4JA 2ZU6A 1Y7HA 4IHKA 1A2QA 2H0RA 1YJQA 4QVGA 1NT4A 2F90A 4DPLA 3KJZA 2FLVA 4HQKA 4KWCA 1M8GA 5TPWB 5A3RA 3O47A 1YB1A 1I1OA 2GXQA 2VP2A 4EQ6A 1KEVA 4UUNA 5AVRA 2I3DA 1G1AA 2XUZA 2YJ4A 1OI3A 1UINA 2EW8A 2IXAA 3ADKA 1U3VA 1IBMB 1HLPA 2K4MA 1UFOA 4LHEA 5JARA 3MM4A 1C9MA 3PUHA 4JELA 4II3A 4X8MA 3CC8A 3VPXA 3GVHA 1R10A 4Q7MB 5HQJA 1O94A 1D6JA 2ZXEA 4H9GA 4IWNA 4CV2A 3PD1A 4US0R 1N5KA 3OUUA 2HV9A 2J7KA 4N39A 3LCVB 2UYGA 5JSYA 4BNDA 3LDUA 1V1RA 1T2DA 5DI9A 3WV4A 3KQKA 1LI4A 2F3TA 3DEFA 3LD9A 2Y77A 4R9NA 4RY8A 5F4BA 5L3RA 2QUHA 4AKGA 5EIHA 2P3QA 2XTNA 2YFYA 1R0KA 2P0EA 2XNKA 4KRXA 3LE8A 4F1JA 1U8CB 5AKYA 1BE8A 4EIWA 4AMUA 2ZAGA 3QF4A 5HILA 3VUFA 3J7TA 3R6LA 5F4ZA 1FTGA 2FF7A 2OP1A 1GFIA 1RTKA 2DE0X 3K70D 3HSYA 2JAHA 1TYEB 3CF4A 2OL4A 3RTGA 1CVIA 3FR7A 4R4JA 3UEOA 2Q9BA 1WPXA 3AR4A 5J40A 4ZZIA 1CUXA 3LY8A 4LX8A 1SQ5A 2GUGA 1THMA 2B3TA 4DLRA 3DL4A 3IERA 4AN4A 6LDHA 1SD5A 1Y6ZA 3IUBA 2F55A 5ITSA 4RIFA 4L22A 1QH9A 2OT3B 4GZLA 5IWAB 2P62A 4RIGA 4BO9A 2O1EA 4ZTUB 2Q62A 3IHTA 3BRQA 5L7YA 4S35A 5EJIA 2V5AA 3THRA 1EVIA 2JJ1D 1JVNA 5KCZA 3MBIA 3R09A 4TV8B 3AZPA 3ILSA 2JIBA 2JLCA 1W581 2P5TB 3FFWA 3GMIA 1LH0A 3BRSA 4NIMA 5I3ZA 4DR2B 2XXBA 3AHGA 2IIPA 3ROPA 4RLFA 1NOJA 4KDCA 1MIHA 1N2SA 1YR8A 1IQPA 3FB4A 2IU0A 3EXIB 1QLWA 1DRVA 5J43A 4B2IA 4G0VA 1ZOIA 3PPVA 1TW2A 3OEEA 1TD9A 1VHTA 2ZS8A 3QTBA 3L0ZA 1V0JA 3ND6A 3IYLW 4V0QA 1E94E 1E1RD 3K15A 3WLTA 2ZRNA 5A71A 5IAKA 5BQFA 1ZGJA 3KAPA 1IZYA 1XZEA 1WDMA 4G86A 2PGJA 1I6LA 3DXFA 4YRMA 3LRPA 2QOEA 4EYSA 1G16A 2RBEA 2ALJA 2BP7A 1OTXA 5TPZD 3UIEA 3UJ9A 1T25A 1I51A 3ZU2A 5ADUS 4LRUA 2J7PA 4XSGA 1E79D 2OXRA 2VTEA 3KBBA 3LCMA 2Y1XA 3GEHA 4OLJA 2PZ8A 5F7JA 3TQQA 4B8WA 4EEKA 4F45A 4F86A 4YRIA 5ADVA 1YQUA 4KYIB 2X8WA 3UH1A 5IWCA 2HHHB 4IIJB 4RKQA 1GZUA 1GLGA 2EJWA 1EZZA 1OHHD 1R1DA 1GT6A 2WQZA 3GJXC 4OQXA 3VR3A 2NX2A 1L4BA 3EC2A 1J7KA 1DADA 5BOSB 2GSDA 2OSVA 1JDZA 4KVZA 4OXIA 1YAHA 3BWVA 1WAMA 3TYXA 1WMAA 2LBPA 1QRDA 1UXKA 3FPBA 2ERXA 2O59A 1MB4A 3A6FA 3DEKA 3T7AA 1R5NA 4DPMA 3M1IA 2X1LA 2ZRIA 4OXYA 1SM4A 2Z3ZA 4S1OA 4E1VA 1G9TA 2CYAA 3CLTC 2DPLA 4BNJA 2P2ZA 3I9JA 4IJKA 5L9AA 2HIGA 4L6IA 1G98A 2VUSA 3CSUA 2QTMA 3GIWA 3JALB 3I6IA 2NU6B 4OKNA 1B00A 1JA0A 4BLWA 3W5AA 1UOQA 3N70A 1YWGO 4PE5B 1IM5A 5K0TA 1ZIXA 1ESZA 2ZI5A 5IAJA 1AMOA 2AN5A 1FRFS 3G88A 2IV7A 4CEHB 3E05A 1U2ZA 4GYKA 4F6CA 2W37A 3O3MB 1RYBA 4X60A 4WERA 2FW7A 3C6KA 3X1XA 4EPWA 1R74A 4FFSA 1SY7A 4Z2AA 3K6SA 4JV5B 1KRXA 1FVXA 3INGA 4US2R 4B3RB 4UXHA 4J94A 2BWJA 4HS4A 3K0BA 5EHNA 2ECOA 2R8BA 3KD3A 3WJAA 1MD9A 2RK4A 4E46A 5HXAA 4BAGA 2P9CA 4DWOA 1F4PA 4E3WA 1ISPA 1O7JA 4N3CA 4TV9F 4JIGA 3FSGD 2IDJA 2FWMX 3W2FA 1NV9A 1W2HA 3LNTA 4V0LA 3JU3A 2MU1A 3BDVA 4H7PA 4X7PA 1G6KA 4OY3A 3ZV3A 4ETNA 4LWPA 2FW8A 3IHKA 3ZZTA 4BFZA 4OB7A 5C34B 1TD1A 1XA4A 3INYA 4NBKA 2ZI4A 1QYIA 3SBOA 3WX0A 2HQOA 4BQEA 1ZO8A 3H0CA 4NYJR 4YK7A 3AUAA 3S7TA 2GZMA 2WG2A 3A6EA 1ZFNA 2PQ6A 2OLEA 5I9TA 5T5QA 1OGJA 2CHVA 1UZMA 1E1KA 1ZN9A 1E60A 2VRNA 1N1MA 2YV4A 1NW8A 2OCPA 3UKDA 2Q0QA 4I6EA 1HO3A 2O2JA 3M0EA 4MW2A 3H1GA 4O4HA 3H11B 3K8QA 5K51A 2PQ2A 3IUJA 4C3OB 8ADHA 2Y67A 2YYYA 4XYEA 3TD2A 1W1UA 2XE7A 5ALHA 3WIUA 8GPBA 4I66A 2H17A 4IIEA 1NVWQ 2F9LA 2C5GA 5CJ2A 3P7MA 4AWAA 2Z83A 3MBKA 2G08A 2J46A 4MW1A 4YRAA 3EVZA 4NE9A 3QWBA 1JJ7A 1A8PA 4QJ3A 2YV2A 2VJAA 3SJBA 4P98A 3PC8A 4LKOA 1I3LA 4JCCA 2ZJ8A 2RK3A 4KR7A 4GMFA 2ZVQX 3HJUA 1ESEA 3VU9B 1GNLA 3AESB 1ANKA 1XAIA 1DDIA 3HV0A 3CLSC 2HSDA 3O2SB 3VPDA 4HQ0A 5BUSA 4ND6A 1CRQA 4G0NA 3SHOA 5FJIA 3VNBA 5KJCA 2PZLA 5EKTA 3NHBA 2VPTA 2NSLA 4N5NA 4OXRA 3CIOA 3HBJA 4RELA 3MJEA 1KY5A 1D0IA 3CEAA 4OMDA 2PBFA 4G3XA 1MO5A 2RH8A 3Q5DA 3A10A 3ETHA 1JLSA 3VZDA 3PPIA 3SK0A 2XUOA 5IYZA 4GD3Q 1SCUB 3STTA 3WIOA 1KAGA 4MJ7A 4RU1A 4Z4IA 4D46A 3QW4B 4KNVA 2XCRB 1H2BA 3QOFA 1DPGA 1B8OA 2CHUA 1SUFA 2QLBA 3TRDA 1Z6QA 2PU7A 3L9WA 3KCNA 1GU1A 2H2GA 1VMAA 2PX8A 1FP2A 4L9RA 1ZXBA 3N8KA 5CAEA 3MT0A 1VKOA 1KMIY 2G9QA 2HJRA 3TAXA 1QYWA 1DHTA 2UYCA 2QI9F 3CVOA 4JB0A 4KQGA 3TRKA 2X0JA 3BWYA 3EVAA 1UJ6A 4KFCA 1SOWA 5H9VA 1WZUA 4LGVA 1L8AA 4Y3UA 1JT9A 1BVUA 2PRIA 3LCRA 2BFOA 2CZQA 1U0TA 3E84A 2R7AA 2WUFA 3H3FA 4NOMA 5A0FA 2XADA 2HDOA 5A4JA 3C39A 4GPBA 4KYVA 3L9XA 5D85A 3WXBA 4EABA 1J8MF 4GX5A 5DNVA 1NXXA 2OPHA 4ZQCB 3B3JA 2PX6A 3IE2A 1GT91 3AKCA 1PV1A 2FUKA 2ZCJA 5C5CA 5K9ZA 3UWSA 4HB0A 5DNWA 5IAAA 4HGOA 1P3JA 4OATA 2I4NA 4YPOA 5BN5A 4BBZA 1GUFA 4MWCA 4Y7DA 2AJBA 4KR2A 3VDRA 3U3RA 5LL6P 2O6LA 1JQBA 2GARA 3EQ8A 1WL8A 2PXXA 2P9QA 1OAAA 3JPWA 2REQB 3LT5A 4PICA 2CLEB 2X2PA 1PKXA 4WY5A 4XM0A 2Z6AA 1BD4A 4ALJA 1GGMA 3O1HB 1D2HA 2PX3A 3DBRB 4FBGA 1JALA 2GILA 4BATA 1DEOA 2QDKA 5TS3A 1IN8A 1GPUA 1HTBA 1RC0A 3LF1A 2Z1DA 1Q1ZA 3E81A 2JIRA 3BG5A 3ENNA 1Y9ZA 4GQAA 3REQB 1VYHA 4PLTA 2Z3VA 5EUQB 5DLQC 2IT1A 2GD0A 1VMEA 1T36A 2QUKA 4XIJA 3Q12A 3IMEA 3ZDBA 3AWDA 2R68A 4MJ3A 5HOQA 2X7JA 4NESA 4CV1A 3I05A 1P5HA 1CF4A 1PL8A 3CM0A 1C5KA 4E3ZA 3GFBA 2B1JA 4NMHA 3VDNB 4NFYA 4F93B 2JZCA 2NZ8A 1T35A 3KKOA 4JQSA 2EBWA 3LQFA 4ZCSA 1TC2A 4EMBA 1OGYA 2OGZA 4OQMA 2QU7A 1JA9A 1PI3A 4D0GA 2AFIE 5HZGA 1ZD8A 4RTJA 2HIMA 2WW8A 5BSHA 5BUZA 2GN6A 4TOIA 1PO7A 2Q99A 3U7HB 2FSSA 3H1PA 1VFPA 3OQOA 4U9IS 2C95A 1OLUA 1UFQA 4H2DA 2YVUA 4MDFA 1HDXA 4GOJA 3TX2A 2WDPA 1GNQA 4MMXB 1WHSA 2IZZA 1X1QA 3DFKA 4L5CA 4KQFA 3W8NA 1ORDA 3R5TA 4G23A 1YJCA 1Y6GA 1KH2A 1A8QA 1LNZA 2EKLA 3IA2A 4NULA 3NP7A 2VTDA 3F5DA 4DG5A 3QVWA 4MVJD 2R00C 1ZJYA 3BJRA 4IQ8A 1X80A 2AFHB 1W85A 4IYJA 2D4AA 4Q4CA 4KPYA 3DZKA 1U2DA 2IYWA 3OPYI 3DWGA 3FETA 3M6AA 4WCVA 3WQQA 4CF5A 1HRKA 3FYSA 4ABTA 3KOMA 4L7VA 4P0TA 5TJHA 5KI6A 4E22A 3ZD9A 1PGQA 1GCAA 1PWXA 1V7ZA 3MIIA 3NV7A 4P4TA 3BCHA 3OJLA 1FS6A 3WK5A 1GNVA 3EDQA 3I5XA 1NI3A 4U63A 3TCXB 2UVDA 5ILOA 2GF0A 1RWOA 5CB6A 3EFOB 2E1PA 1S01A 4DAEA 2RK6A 3W06A 1A9XB 1JSXA 1P1FA 1RPZA 2ID4A 1NBAA 3BKWA 4I8XA 5C7IO 4IDBA 2I65A 3R6DA 2B4TO 5YASA 4BCCA 2JH8A 4F6RB 2HCFA 5LKRA 3OF5A 4GC9A 6Q21A 5KJEA 5F1KA 4JUBA 1NNEA 3PG5A 3WIEA 4UVHA 5K6AA 4D4HA 4DA6A 3ITEA 1E98A 1YZLA 4OLHA 4QOSA 4EZIA 2LIPA 3PDHA 5TY0A 2W2QA 1KPIA 2J6IA 1QZTA 1KZ6A 1VA5A 4YC7A 1ZN7A 4KN8A 4R7ZA 5K8TA 3GPLA 1T9HA 4O63O 1R6TA 3D0KA 1JEJA 5A4KA 3K6KA 4JYAB 4JI1B 1GD1O 2GVNA 1YAJA 3LS2A 1DKRA 3DD1A 2O07A 1B6RA 3DCNA 3X2SA 1AKYA 1H65A 5CG1A 2HHAA 3L8CA 3V2IA 1UKCA 2OCXA 1N3BA 3D4IA 1EWRA 1MT0A 1PBNA 3PUKA 4G5OA 2WUDA 3LCJA 4LNHA 4C08A 1IVNA 2J9FB 2GYYA 3MPOA 2BFCB 2FWIA 4W9NA 3X0DA 4YV1A 5L95A 1HWYA 1EBFA 1RZ3A 4NBVA 2HCJB 4GXQA 3PFGA 4BNLA 1QFZA 1GA4A 1DKPA 2X22A 3B9BA 3OQ1A 5M34A 4P7KA 4II7A 3A2MA 1Y80A 4KX3A 1NW7A 3IVGA 4G97A 3I1FA 1NLYA 1I7NA 4DRXA 2P9TA 1Y7PA 3P27A 1T2VA 3USES 3ADPA 3KELA 2INGX 4M9CA 5AK6A 3PGA1 4I4NA 3W1EA 3CPEA 1U2EA 2QNIA 4Y0VA 3LQ1A 5J59A 3CZ4A 2V65A 2VXOA 3HCDA 5H82A 4P3KA 3TOZA 3TR0A 1PGOA 2P65A 1YI1A 2YJNA 3UUWA 2A5JA 2QYSA 5ITWA 2G63A 4B7UA 2CFOA 2A1TS 2XIJA 1H1DA 4ID3A 4QU8A 2RC5A 4I3GA 4OAQA 2B1QA 4AZTA 1D4AA 5EWMA 4WV3A 1L7RA 2ZBFA 3IXLA 3BTVA 4MUMA 4CM8B 4DBVO 1SXJC 1IZZA 3MLEA 4KPUB 3RAGA 3TKYA 1O5OA 1I0LA 1OZGA 2G7MC 2IVZA 4FZJA 4DWJA 1LQTA 1JJAA 4Q3CA 3SJZA 2B94A 2HKIA 2WKWA 2NAPA 1V8DA 2DLNA 1IK6A 2DKOA 1SIBE 2C5EA 3NATA 2GCPA 2ZJ0A 1XU9A 5IARA 2VYCA 2ORYA 3AUTA 2BFDB 2QP3A 2Q1WA 3WTCA 4UNIA 5FX2A 5E0KB 4UVIA 1TF2A 1KSJA 1JJFA 1NT2A 3BCRA 4IUBS 3DTVB 2C9YA 2H51A 3LCCA 4ERNA 2CLDX 3PP8A 4AZVA 3RTDA 5JFTA 2Z5LA 2GN9A 2LD4A 3VR5D 1U7UA 5BYKA 3DDZX 2FX3A 3KSRA 1M0EA 1YD7A 4GW3A 1USVA 3BXPA 3DVLA 4Z6KA 2QBYB 2AG1A 1MJGA 3VR2A 1RXIA 1H85A 1FZQA 5IKPA 4JROA 3DZHA 3DE1X 4YJ2A 1Z62A 3UJPA 4JBGA 1FS4A 2D00A 2H59A 1UAGA 2P9YA 3JQBA 4GLBA 1GAWA 4EUSA 3NDIA 1RAGA 3WL8A 1RXWA 2IL1A 2H4HA 3RNOA 5KDDA 3CZ5A 4JFRA 2I91A 2OD9A 1GV0A 3RYIB 1I3KA 4Z3OA 3FJOA 1M66A 4M8SA 1M7GA 3CUVA 1ZQ1A 4WT7A 1QC5B 1SCIA 2GXUA 5K3FA 2Q7DA 1OV6A 1NURA 1C7FA 5C1PA 2Y1LA 3LOUA 3LVBA 1KPHA 3AOEC 3GJYA 4IDDA 1T34A 4AY5A 3QUTA 4YA6A 5FNVF 1GKYA 2NVUA 4U2DA 5GV8A 4CLRA 4EECA 5EL0A 4W5QA 4M0FA 3R6TA 4BCBA 3UK1A 4KPGA 4MA4A 3TLGB 3SM3A 2CXQA 4A1FA 4BYGA 4KGZA 3KTDA 2BBTA 1EWVA 1P0IA 2O2GA 2OQRA 4PX9A 5LC1A 4AWXA 4FT2A 1I6WA 4RPHA 5AYVA 4B47A 1MO2A 5CTAA 2BAGA 4OHMA 5B4VA 4Y6SA 2H85A 3VJRA 1Q6ZA 4ZOCA 5CGZA 1R66A 2XXAA 3A36A 2Y1CA 2YJ5A 1Q84A 1VL8A 2QD5A 3PR2B 5G1NA 5GQSA 1LTKA 1H2YA 4FLMA 3W9UA 3ZW7A 4F4CA 2C00A 3JRXA 2LIVA 4QLOA 5D6OA 3TOXA 2HW8A 2ZW9A 3FTPA 3PNOA 4BLQA 1YCFA 1WB9A 4EH1A 2K2QB 4XYGA 1Y4AE 3RTEA 1U7ZA 1RLTA 1XMOB 1KS9A 2A9QA 4OYHA 1ZNZA 4KBFA 2J07A 3RIMA 3W5VA 5JHGB 2HHJA 4GSYA 4ZAZA 5JU6A 5SY9A 3WLHA 3MOSA 2YCLA 3FVTA 3MJSA 4U4AA 1EDDA 4TM8A 1CDZA 1DJPA 2ZCUA 4I19A 2PJDA 4BV9A 3AVOA 1TU0A 3BJEA 5ALNA 1QIEA 1UAYA 3ECSA 2CVHA 2A0WA 2W00A 3BGSA 4DDWA 5JD5A 1EK2A 1F51E 3ISJA 4N8SA 4AD8A 3T5BA 4CIVA 4YLGA 5LQMA 1MHTA 1NBWB 2DBVO 2PLRA 4EB3A 2PCJA 4B3BA 4GXNA 2ZSIA 3K6RA 4XVQA 3SIXA 3U4HA 1X3SA 1JI3A 5K20A 4IIXA 1AE1A 1G6Q1 3ZWMA 3DA8A 4H3VA 5HG0A 1UBSB 1XLTC 1C1HA 1J8YF 4F4UA 1B2RA 3RRJA 2IEIA 1Q7BA 4WHMA 1T6BY 3A3NA 1ZXXA 4W63A 3CVVA 4HDKA 1Y37A 3G0HA 4N7JA 4ENSA 2OWEA 2QROA 2J1LA 4FK8A 4MA0A 3WLQA 5HKKA 4UOEA 1QVVA 2A2ZA 1NVKA 2I2WA 4MCAA 5THXA 3MMNA 3R6GA 4OP2A 4PANA 5JYCA 3DOJA 2JRLA 3OC6A 4RDCA 1VYTA 1U99A 3TTTA 3JV7A 3ZHCA 4MV6A 4BLPA 4Y7CA 1DRKA 3I23A 3MW8A 4LDPA 1R9GA 4MVCA 1XZIA 4JCOA 1AA9A 1XQ9A 3FVRA 3LWDA 1XTJA 1SA0B 2E55A 1YOVA 4L08A 1DARA 2YYAA 4KIGA 5AW2A 5BNZA 1Z4IA 1E1MA 1IDOA 4H7KA 2CCKA 4XPZA 1R0LA 4YI5A 3OZXA 1QX4A 1VLLA 3HVRA 4MKIA 3UC9A 1BGVA 2X42A 3RIEA 4WECA 3B3AA 3WB1A 2OBMA 5B64A 5ERXA 3GRUA 1J39A 4Q37A 4DQXA 1KZYC 1HMYA 4F9FA 3WL7A 3SMQA 1XN4A 2R8YA 2P2SA 4HKTA 5A5DA 1PNVA 1U94A 2VC2B 5JBQA 4QUHA 1GRRA 3VH2A 1WQ4A 5T3YA 5LOVF 3E9MA 3GVIA 3KR9A 1TZCA 3AIKA 2J4FA 1SCBA 3TRJA 2QRVA 5IVPA 1K66A 2LNDA 2H4ZA 1ONOA 1ODJA 3GIDA 3U37A 4LC1A 3V48A 4B45A 3U09A 4NV0A 4YMTA 1W8DA 1ZISA 3HABA 2C2MA 3K9NA 1XEWX 1ABFA 2XLCA 2QRKA 1Z2PX 4UUQA 1WXFA 2O1WA 2XODA 1RCFA 1GUAA 4TYNA 3RTCA 2ODBA 3CUYA 1O89A 3Q8WA 1PJ3A 2ZIGA 3BJZA 3QFFA 1D04A 5CNJA 3UHPA 3CY6A 3H2JA 4CEIA 1TM5E 1XQ1A 4KXVA 4HAOA 3Q7PA 3TW6A 1ISMA 1N7JA 3LX4A 4CL0A 5BV0A 3G2QA 3RS0A 2B8TA 2FSVA 2XMRA 1TIPA 2ZVJA 1N78A 1YIDA 2OFPA 3LY5A 5J2TF 4R54A 3C3PA 4W5RA 1E3QA 1IEXA 1RWQA 1V5EA 1S4MA 4YBRA 3ZU3A 2PRYA 2HRCA 3D02A 3GAZA 2Q6LA 3IBCA 3FRIA 2I29A 5IK2A 1C2TA 3WYDA 1N3LA 3LC0A 1HETA 2HTFA 5I7RA 1ECCA 2P9EA 3NEYA 4JZYA 4OBXA 2CL7X 4AW9A 3O4RA 4FWBA 4EG0A 1DX4A 1HSOA 2IY9A 3K1AB 5DH9A 3K2QA 1QS0A 1GZ4A 2IF0A 3C74A 4WAUA 1MRNA 1BVHA 1U11A 1CQPA 4XUCA 3W3AH 4MB6A 4IO0A 2CLKB 1EUDB 1T24A 1G5PA 3L46A 1GJRA 2C0CA 4UEWA 3RUDA 2HY7A 3DCJA 3LV8A 4FZRA 4KE6A 1YO6A 1XTIA 4IX1A 1EUCA 4X1YB 2OGSA 4G5HA 3WP1B 1M2VA 4ITVA 2HSWA 3AG6A 2J85A 3LA6A 5EMNA 1AUQA 1UC5B 3JZDA 3T7TA 3AVQA 3N8IA 1KMHB 2NSJA 3F5MA 3FMPB 3FGNA 1EX7A 4QLAA 2BGMA 5FXMA 4S05A 5JAQA 2B8EA 1Q95A 4DA8A 3DP7A 4Q9NA 1WJGA 3AL2A 4A0GA 1NR7A 3H2KA 1WXWA 3FPKA 1QE3A 1R64A 4PQFA 1K6MA 3B6MA 5DXAA 1UUFA 4IXNA 4MHSA 5E4TA 1UBNA 4BP3A 1X1EA 4AULA 4BFXA 2RB5A 3THXB 2YY7A 5DISB 1RI1A 2ZANA 5HS4A 2WNHA 1F7VA 4JBIA 1UBFA 1EFHA 5IP5A 1P0QA 2NUAA 1YVEI 4CLOA 4W7HA 3RIXA 2IPAB 4KL8S 3PJGA 2J3DA 4ZVUA 3HR4A 4J76A 3UYLA 4AS2A 2GBIA 4NZMA 1II8B 3OLCX 1J24A 4KX5A 1JHDA 4CN9A 4D45A 3O0TA 2QD2A 1S8FA 3DNMA 3E7FA 1P33A 2ZM5A 2V9CA 4H35A 5AHKA 3OO1A 1BE1A 1LBQA 4JC8A 4NYJQ 1RABA 3GLUA 1CY1A 2EIHA 1MTZA 2YOFA 4TVKA 3ACCA 3RUIA 4GBED 3CH4B 4BVGA 4AJHA 2DR3A 5DM70 2D0OB 2VL7A 2BL4A 3OEYA 1PR6A 1TQ6A 1L9XA 4C4SA 5I7UA 3TCNA 2QLMA 1Y7LA 5K4GA 3WO1A 1QMPA 2YC2C 4H6VA 4ZIRB 1WSWA 1HZJA 1WSBA 2PEZA 2OG1A 1G6OA 4NTZA 2O8EA 5C5IA 5LR6A 3FWNA 5CXSA 1XDSA 3WYEA 1CW2B 4AJEA 3ZK9A 2R1TA 2AS0A 5SZIA 1LI5A 1QPGA 2OMKA 4IDFA 1GNPA 4X90A 3FKQA 3ASZA 2V6FA 2WJAA 3DBLA 4FLEA 4QBHA 5E2AA 3SZMA 4B6SA 3QVOA 4DWWA 1E7MA 2J3QA 2WYWA 2AJDA 2Q9CA 1FYVA 3QFTA 3WLEA 2W2OA 3ETGA 3BL5A 5AESA 1FJXA 1ZU5A 5BR7A 4FXPA 1HC7A 2DHDA 5DLYA 4R2KA 3R7WA 3R6WA 3DZFA 4G5RA 5I5EA 2A9OA 3UCEA 2A5LA 2E37A 1AKMA 2LR0A 1QKKA 3GHYA 3L92A 4LHZA 3TECE 1AHNA 1Z5GA 3D3KA 3MAJA 1A8HA 1DAPA 2N1MA 2Y05A 3ZR4B 1Y3HA 2QX4A 5DEOA 1YGYA 4AMYA 4J0CA 2OTCA 5FP0A 2V7EA 5A6VA 2R1VB 5JCZA 1LZLA 1VB5A 1MPTA 1S96A 2C77A 1F8XA 3F4LA 3AP3A 4DLYA 2Y76A 1JQLB 4A0HA 3ORHA 1FYWA 1GDDA 4RFSA 2C9MA 3T1HB 1WETA 3LJKA 2X9LA 4RTOA 3H3XA 1MQ8B 5IEJA 3HVKA 2Q2NA 4ZEVA 4QGBA 2B7LA 4TTJA 5JHHB 4HFJA 1M83A 2WJ6A 3NJ4A 4G8DA 3C6QA 1XDGA 2KHZA 2DFTA 3C3JA 3F6RA 4MV1A 4ZI7A 3ZD6A 1BDMA 1JUDA 1XF9A 1XC7A 3QLVC 3UW1A 1XB2A 3D2CA 1G3QA 2YTZA 4KQ1A 2D5AA 2IXFA 2CDAA 3VH3A 2JVJA 4QDXA 3UAVA 3WYGA 5CFOA 2PGAA 4ZTBA 4KITB 4F12A 2POCA 4UVGA 4QPNA 2RARA 3K20A 4CUKA 3ADDA 4R1MA 4UCWA 3IVAA 5F76A 5JCPA 3E70C 5DJ5A 4I99A 4L0MA 5HVNA 3U4MA 2P2DA 1TUIA 4HDRB 4OI4A 4JJIA 3FROA 3N2GA 4H31A 3QPDA 1H5NA 2O48X 3KKQA 2C5SA 4HDMB 4EARA 2W83A 5DN6D 2BYTA 2JG3A 3H42B 4IDEA 2BFNA 4URYR 1GILA 1OGIA 1WKCA 5SYMA 3QUBA 1EFVB 4B3CA 4PGHA 1VL6A 2I6TA 1OT3A 2P2LA 1L3IA 1AGYA 3C3KA 5LZ2A 2O52A 1P4RA 3GGDA 3D54D 4X8OA 3QTTA 2W2LD 1W1WA 1WXDA 4G4IA 2C8JA 3NAGA 4M6WA 4WZBA 4MWSA 5T4EA 1Q14A 5AO9A 3E23A 4LYYA 3RV3A 1H05A 2ZIFA 4MLCA 1MA3A 3M3DA 5F23A 1U5AA 3N0XA 4LI3X 1XTPA 1X6VA 1BS9A 4NXMB 1TEVA 2B8WA 1DRJA 2DUUA 1Z5NA 3ONWA 5HJEA 1TZMA 4ZO4A 1ULTA 1SHTX 3NT5A 1MA0A 2OKCA 2Y92A 1GL3A 4ZZ2A 1OH5A 3CJQA 3ORRA 2YZGA 1N2BA 3MXOA 4LF7B 2IUEA 3T9CA 3UQZA 4OCZA 4QOEA 1ESCA 1ECLA 4CBVA 4DQLA 3P9KA 1U1DA 2FSPA 5ALMA 1V47A 3DNPA 4M36A 4MR8B 2JASA 3S8YA 2WU3A 3M9WA 4LBWA 2XVMA 1L5OA 2XE6A 2V4UA 3MRSA 4MI6A 3FRJA 3TQHA 3FHCB 4WPGA 3REGA 2Q0HA 3E53A 3T7SA 1RYHA 4IJMA 3T3EA 1JVBA 1YUBA 1ZK4A 2P11A 4FT4A 2Z8XA 4HLUA 1F6DA 3UK2A 3HJCA 3F73A 4O8ZA 3FUCA 1L5WA 4M0KA 5L3ZA 1L8QA 3G6WA 4HAYA 1N2CB 3IEXA 1BXGB 2J3LA 4KH0A 1FQJA 4NU5A 4CG2A 1IOWA 2VDOB 2FN3A 4G9GA 5EJ6A 2NMVA 1TKRA 4CG1A 3VMFA 4PQRA 5E95A 3PLAE 1R4MB 3R20A 4OYYA 4V1CI 2CXPA 3IILA 1TK3A 3MGGA 3BC1A 1SCNE 1Y89A 3GFSA 4MVWA 5F5NA 3AJDA 4C5BA 3AM5A 4DC0A 1E2HA 3WAJA 1ZWLA 1UFVA 3DOUA 1ENYA 4Q9IA 3RSZA 5T7BA 1F1BA 3CPHA 4KAFA 1OIXA 2NUPA 3IMGA 3Q9SA 4BLSA 1EXNA 5E6UB 2EL9A 3HS3A 3TBFA 1ND5A 2E4WA 4CM9A 1PR3A 1E3EA 1CB0A 1U4NA 1WWKA 3DVQX 4AX4A 2IH2A 2XGOA 5DHSA 3W79A 4CTKA 4JI7B 3T7CA 2XI4A 5FL3A 1PLKA 3QLEA 3HVHA 2IEZA 5B5SA 1MT3A 2RGCA 4HYQA 5BR8B 2YICA 4IRXA 1DZ3A 4KR9A 5T8KA 4AXBA 4LVUA 1GSHA 1SUWA 1TCVA 2WLSA 3RRNA 1YA6A 4CIAA 3ZH2A 3IAFA 1DJNA 1XQVA 4JGBA 4WNCA 3DMTC 3VH1A 1QO0A 3OZTA 1J97A 3Q10A 2VTVA 3GZTB 4OP3A 4F85A 2FW0A 4FHEA 3PCXA 4ZCIA 3WGGA 4Q82A 1Q0SA 4XIFA 5DHQA 3RQIA 4TLMB 1KNXA 1TRHA 2W58A 2XYQA 3FY4A 3OPNA 1KBOA 1QH8A 4U7DA 1COZA 1YHZA 1FNBA 1G291 1D07A 3FKSD 4J29A 1Y8QA 1NTRA 4INJA 4CT0A 5I7HA 4I1SA 3VTKA 3NDBB 3VNUA 4OA8A 1DJQA 3WB0A 1GARA 1ZMOA 2XOXA 1Z68A 4RPKA 1QJCA 1YQXA 4RIEA 2QM3A 3S2GA 4CDRA 3X1YA 1ZH4A 1ISIA 1JHRA 5TC4A 1IN7A 3BOSA 3UMYA 1U3FA 1T3ZA 3N2YA 3E58A 5BOVA 4EK9A 5SZKB 3U4QA 2ZUFA 2R86A 3D9QX 2EDCA 2XUHA 3L8EA 1QYDA 3FWHA 4JI3B 4ZC8A 4KUEA 1JRLA 3BA1A 5A4DA 1H0RA 5EWLA 3R7BA 1GPBA 3QVSA 3TZ6A 1X70A 3MF4A 4F96A 1CR1A 1IY1A 3FVWA 4QGHA 3VKVA 3E4CA 2YZMA 4WTOA 1XK7A 2PPVA 4CF3A 1FDTA 1FFEA 4DMLA 1GTSA 3CKKA 1PSDA 3PWSA 1JE0A 1PDVA 3EG9B 3VNSA 4RZXA 4KN6A 3VVMA 4AZ0B 5KNDA 3LTNC 3PEUA 4TV9B 4XOIA 3TXYA 5AM2A 4IXWA 3BF8A 3K0FA 3NWOA 4NBWA 4PYNA 2RGWA 4M88A 3DC2A 2GHQA 4KGVA 4GPAA 5EZQA 4DGSA 4DM4A 3OOJA 1H1LB 1L5RA 1SVWA 4K3UA 4RADA 2OFWA 1EBBA 1FB5A 3WMFA 1VDMA 1VHWA 2IA5A 2A57A 1JLMA 4DZTA 4YP5A 5I9IA 2FDXA 2ZR7A 1Z2CA 1JVSA 4G89A 3VR4A 4EMUA 4MUXA 2VJDA 3MN1A 4K9DA 3SJ7A 2UVPB 2WHRA 3MD9A 1Z4LA 4DCGA 1KVQA 2FPPB 1IXYA 5LZ5A 2RMKA 5C1BA 4MYHA 1L5HA 4QLBA 3QKTA 2WZBA 3OP4A 2UUCB 2I54A 2JFNA 2CSXA 2I4RA 3DO5A 4IOKA 4LRTB 1TJNA 3GRRA 4MQBA 2ZKLA 2J0UB 4JX9A 4V2IA 2O8CB 3VV2A 4BLTA 2GK4A 2JS7A 3AR5A 2G0NA 1CJKC 1ONPA 2QM8A 4JLPA 4E12A 4D7AA 5KYUA 4ROSA 4AMBA 5B53A 3DAOA 4BP9A 1ZZEA 4ZI2A 1DCMA 1E3LA 4WZAB 4YCBA 1SFRA 3WHIA 4BOYA 3TLXA 1XVUA 3MCUA 3ZVNA 1O87A 1GKUB 4W1QA 3T7DA 3MS7A 4ZJZA 3HCOA 4H18A 1I3CA 2CFRA 1YA8A 2ZBVA 3FBTA 3BTUA 2J5RA 4B2PA 1SG6A 3ISTA 2Q3JA 2FVXA 2DU8A 3C3AA 4M1WA 4W1SA 1NDUA 4KAJA 3SQMA 3STXA 3UHAA 4DEYA 4ZDJA 4P36A 2COKA 1YZUA 1W36B 3KOOA 1E7YA 1TF7A 4FKZA 2MSLA 3EA4A 2VDJA 1UODA 3K09C 2QP9X 3P1JA 1E0SA 1KVRA 2O3UA 2A8YA 2Q5IA 4B17A 5KBYA 1UEJA 5CFLA 4U2KA 2PGOA 821PA 3JY6A 2ORWA 2FRXA 3G82C 4KLZA 5EC8A 1WPGA 3W4IA 4D8TA 1O94D 2EERA 5MFZA 2EL7A 5JPCA 1CY8A 2HJGA 4UAGA 4HTFB 1T3GA 2F00A 3ZXYA 1JEQB 3THOA 4BMOB 1F38A 3L0PA 3PICA 4B3FX 4W82A 5C8VA 3REFA 2ES4A 1OU4A 3OM1A 1J90A 3KYDB 1PJTA 4DEXA 4KXFB 2HGZA 3JWGA 1RNLA 4INOA 5KTKA 3QG5A 3OX3A 1FE8A 3DEJA 2R60A 2V6IA 4FJ0A 4J9UE 4JLWA 3OWOA 4N18A 5KYYA 4D9BA 5TGDA 4KO2S 4HNTA 4TKVA 1P5JA 2X86A 3QM1A 4BWVA 4EY5A 4BFCA 1NP7A 3USCS 1PT8A 4TMFA 4QAQA 5LP1A 4PHGA 3KLPX 2NWQA 4MWBA 2QGNA 4RKWA 1XBTA 2K6GA 2ST1A 2C7OA 2V4ZA 4BLVA 3Q0IA 2PWZA 3NI2A 1QFYA 4LJKA 4MV7A 1PVVA 4URWR 4P93A 2PFGA 3TI9A 2GD1O 3HP1A 1NLFA 4IXTA 1X0XA 4R1UA 2ATEA 4FS3A 3LQRA 2CHEA 4Z4QA 3DKKA 5EFZA 3L5OA 4BKPA 1SURA 1E2IA 2Q8NA 5DEIA 4DHWA 3IEMA 2VDVE 4PYQA 1Y82A 2FPKA 3DDHA 5P8WA 4DLPA 1PF7E 1LW7A 4RMGA 3D7KA 4PSKA 1UK9A 1Y5RA 3KTOA 3CZPA 1D1QA 1R0WA 3U19A 1WNTA 3LBFA 3WWEA 1P1CA 4PVDA 1DKQA 1Q3KA 2PRZA 4KQMA 4KVFA 2VP3A 4OYLA 2C78A 4TVOA 4YJHA 1QG4A 3NZEA 1AQUA 4MQEB 5LU8A 4U1RA 4F46A 5C7LO 1U0NA 3OEED 1SU6A 3ET4A 1CE8B 3N6XA 1R27A 3LPMA 2P68A 2WHQA 3IJRA 2JKVA 3V3KA 3NBZC 4ENWA 3GRYA 3MJCA 4GT1A 1S4QA 2EIXA 1KYXA 2Q5OA 2WINI 5EERA 5TQJA 4D57A 1D4FA 5BNTA 2JFWA 3GGPA 2PBRA 4E08A 2BFBB 3Q8LA 5T4HA 1GGFA 1WCIA 1XWWA 3F8TA 1C0IA 5HFNA 3SYMA 3KT0A 4ID9A 3A1UA 4PR3A 2J7PD 4OQEA 1SCQA 1UBOS 3NCTA 2C4NA 2P3LA 5HGJA 4JEIA 4CFSA 2KE5A 2P4QA 3AW9A 1L4YA 4INZA 2FQYA 1P2DA 4NCXA 4MZXA 3VR3D 1GPAA 1OBCA 4CMAA 4CIYA 2J59A 4KVAA 5DBIA 2ZUBA 5F9MA 3UMVA 4ROTA 1NBME 1RYEA 1UMCA 3EF0A 1INLA 1N2IA 1TJYA 1VJRA 1S2IA 3EOAI 4KEAA 2VCEA 4N6OA 5IUKC 4J1NA 1BXRB 2FHSA 2YMQA 3BD7A 3HDVA 1K88A 3M5WA 1DI0A 1RRFA 3MWEB 4E1BA 2Q4OA 4PG6A 1H93A 1U0EA 1AO0A 3ZDRA 3D64A 4AC9A 2HK7A 3S8EA 2QY6A 2QP4A 5AW6A 1Y5IA 3AP1A 1C9EA 1SC3A 4NYIR 5D5HA 4MI3A 1NY5A 1H2WA 4RH0A 1W34A 2D13A 4YDSA 4MVXA 5FI5A 3LQQA 1AJEA 4Q24A 4TLCA 2VF8A 1JDBC 4K1XA 1JE1A 3P2EA 1OOEA 4KK3A 3RVOA 4FX5A 2UUBB 1F9AA 4JR0A 3AUXA 1ZMXA 4I4IA 1KHHA 1JLLB 3BMNB 2DH5A 3G0GA 4MB2A 3GXOA 1UPXA 1YB6A 1CQIA 1CUEA 1GAJA 4IVQA 4QEKA 4RC9A 3ANXA 5CEEA 2D3WA 4QPPA 1HL3A 1ZJ6A 2PAAA 3ZHXA 3NEJA 4P7BA 4JODA 4X91A 4B4VA 2X3YA 3K35A 2JVIA 4DJEC 4XUDA 2Q2OA 4YAUA 1I33A 2WWFA 3TEMA 2FMHA 4YUZA 1UWKA 4BXOB 4QPCA 3HO1A 3EXHB 4QOGA 4E0BA 4FQ5A 3K5IA 2EATA 1UWCA 3MJFA 4C22A 4RQUA 3O93A 4GVPA 3U1VA 5K4AA 5FCDA 3FVVA 5ARDA 1PL7A 4CCAA 1NFFA 5FWAA 1FDSA 1WBBA 5FA6A 2WP0A 3C3DA 4A4DA 4Q9LA 1B4DA 1GRNA 2HSEA 3RSSA 1A76A 3BX1A 3ZLUA 4EGJA 1L5ZA 1CQJB 1YA4A 1H6AA 3AUUA 4FOLA 4FN5A 2P3OA 2IHVA 2REXB 3PE3A 2WOJA 4N8DA 5CR9A 4BJ6A 3CRNA 1OVMA 1RQLA 1UIRA 2XW6A 2HO4A 3MELA 3PSHA 1JA1A 3A2LA 4O4IF 3ZZ1A 1RIFA 1P5FA 1M7BA 2O23A 2PD6A 2WJWA 2D74A 3OQ6A 4GEGA 4TXLA 3WGZA 4CI9A 4DB4A 1B3BA 3OTWA 4M38A 4DNOA 3L06A 2RHBA 2D0DA 3RC2A 1W46A 3CJTA 5GJWC 1Q7GA 3DAGA 4PSAA 5FA5A 2OK8A 1AQLA 3O8QB 4GDMA 3ANMA 1O8CA 3WK7A 3GC6A 4BGEA 2F8TA 3IPXA 5JALA 3CNNA 4LZNA 4GMDA 5F2NA 1ZJ5A 5EPEA 2ZUWA 4GE0A 2X0IA 2WV9A 2YIMA 2B35A 3CF2A 4DW8A 1Y9DA 3PC6A 3EVBA 1U3TA 1Y33E 2C58A 4JDPA 4MW7A 3VX3A 5GINE 3EQ6A 4IJ5A 1R0YA 4KMRA 1ZMRA 5AVTA 5C4IA 2OCAA 5EJFA 2WJGA 1AZLA 3DZJA 3RHSA 1I24A 2VHYA 1A5TA 2PGNA 4AO8A 3EGWA 3ROXA 1T0PA 2Q29A 2XB2A 3DM9B 1UKEA 2D59A 2ZT6A 3G2IA 1FVOA 1SIUA 4IF4A 1ADYA 4QFBA 4D8YA 5BW8A 3HXLA 4PYOA 4YYZA 5F7XA 4D8VA 5M2QA 3WO0A 2C59A 2AX4A 4G2TA 2ZZKA 5T6MA 5J4KA 4ONEA 2JJYA 3MTGA 1THTA 4QSHA 5IX8A 3BDIA 1Q44A 4HGRA 4ZU1X 1KARA 4FBLA 1E1CB 3DKRA 4XB1A 2AOUB 4QUJA 2J09A 4CDNA 4RCYA 1Q3TA 3HA7A 2CVZA 4BMZA 5BUQA 1NLUA 5J3JA 2IYAA 1L4MA 4JQCA 4EJ6A 2XCLA 2NPIA 3DTYA 3ED5A 4I1VA 4A8JC 3WIVA 1ZSNA 4C3VA 5DPMA 1JEYA 1KFBB 5JSZB 2FWJA 1A4XA 1T0HB 3HXTA 1L5SA 2XMBA 3A4YA 3H8WA 5JBNA 3Q3JB 1NXVA 1KSHA 2X8JA 4MMZB 2XBLA 2A5YB 5JCJA 3EH1A 4C3ZA 3FGPA 3V1UA 2JFFA 1X3LA 3NJ8A 3MWKA 3ELYA 3FWYA 2HPAA 1T9GS 1TX4B 4KYTA 4MRNA 4PLWA 3GHHA 4P81A 2SBTA 3LWNA 4H6XA 3SQNA 1W88B 3GJ0A 4MP8A 4DLWA 2ZBQA 1TIBA 2V1XA 1GRQA 3KAQA 2K7FA 1UOEA 1WUJS 3Q7RA 1QFSA 4HHEA 1LLDA 3FNQA 3GARA 4JI2B 1UXJA 3HKCA 1C3VA 2OBLA 3OQBA 1SKYB 4MGKR 4UE6A 3TW8B 5ITZA 3THYA 3NPMA 1JMKC 1E9VA 1V8PA 2R85A 2P9GA 4RE5A 4BGUA 3AI3A 2HMWA 2Z9DA 4CYMA 5LMNB 1FW8A 3I9MA 3S2FA 5ALLA 3I01A 3KB6A 3KFXA 1S2MA 5B3JC 4QU0A 1RDFA 1D3AA 2Y1FA 4YJGA 3SU8A 3V80A 5HA5A 1NDQA 4ZXPA 4QNMA 4B46A 1KEWA 4NATA 4DLZA 3MHTA 3SN6A 1VIDA 2DP4E 2NSDA 2PSSA 2SICE 3KHUA 2D7CA 3PA8A 3M6WA 5FTMA 4F2GA 5D1NA 2UYYA 2C03A 4FGKA 1PD1A 3TIGA 3U3OA 2G9UA 3JQQA 5AT1A 4YAJA 1A5ZA 4D98A 4EBFA 2BIFA 4BVAA 5KWIA 1QHFA 3HV2A 4EW1A 621PA 2VNHA 3HBMA 2G17A 3LSYA 4KRGA 3PUYA 5CB4A 4L2IA 4PIMA 3EVGA 3JZIA 2JGDA 5EUCA 4BP8A 3I61A 3TTWA 4RJIA 1JHQA 5FYQA 1MZPA 2W6PA 1YS6A 5IVIA 3EGOA 4PLCA 1CLUA 2QE6A 1VYUA 3THWB 1XZQA 2ZTSA 3VZBA 4BGDA 3VOTA 3CVJA 5JNTA 3N76A 3FNHA 2HFKA 4Y6GB 3EGVA 4X1OA 3QYAA 4YQZA 3U16A 3RVSA 1M2OA 2IXBA 1SUPA 3MINA 5F2OA 3WADA 2QV7A 5GIOE 3VI3B 2EX4A 2YS6A 3H86A 1STOA 4CMIA 5HF8A 5A1TA 3T15A 5LYJA 1SUCA 4IQGA 3BFXA 1CU1A 1D7OA 2J5KA 5HCIA 4BU0A 2JLUA 2PWAA 3NBQA 2GZ3A 2JGIA 3EXFB 2VQ3A 2HA7A 3AF3A 1YQ9A 3OFSA 4PBRA 5AR1A 4Z54A 2PG3A 2ZJAA 4CR7A 4D4IA 5JVDB 5TPWA 4F91B 1D8TA 2FFBA 1LDBA 2GK6A 3F74A 3ZHOA 1XOIA 1UKAA 4H7JA 2QXUA 1YBVA 4G5GA 3TRHA 1PGNA 2N0SA 3UGKA 1IATA 3CR7A 4IBOA 4JL8A 1FNDA 4P4UA 1CPYA 5JNRA 5AUNB 1W96A 4D43A 5PGMA 2VR1A 3VNAA 2WRZA 5F78A 5LYYA 5HMMA 2B2CA 3T3GA 1XQ6A 2IPMA 2PLAA 2QN3A 1GDTA 1GGVA 2WUGA 3E0QA 3N2LA 5DI3B 2ZRPA 3UENA 4KP7A 3PITA 1F0YA 1WZIA 2XEXA 4GGPA 3PQ3A 2VRBA 4XQ0A 5CT5A 2QQGA 4EOGA 4M60A 1T0JB 1W44A 5EHGA 1KGDA 3H9UA 3WL3A 3LO5A 5JAPA 1FFXB 2E48A 2GRUA 4PX5A 2UXCB 1YSCA 2XNHA 4LNUB 5CTJA 4K6CA 3TTVA 4LSWA 2IW3A 5U4QA 2Z4SA 1TJPB 1NP6A 4OAOA 2AFHE 3VM6A 5J4VA 2OCKA 1CZOA 2C9BA 2QTGA 4LOJA 4GPZA 2IOYA 2NO9A 3JD4A 4KV7A 1PBTA 2NGRA 1JG1A 4DFDA 3D6AA 4F5DA 1UDRA 1TUEA 1PDOA 5CIQA 2FZWA 3FFBA 2EF0A 3TIIA 3VAZA 4BZPA 5IN5A 3I5UA 1KFKB 4QBGB 1X92A 3BB4A 1J2YA 1DDGA 4B3HA 4R71A 2A1TR 1EVKA 2D5LA 3I4LA 4FOSA 4ARIA 5CA1B 3P9ZA 1ZONA 1R6DA 3E8SA 4TV8A 5T3UA 2PVSA 2XNSA 2QSJA 5F9FA 4A6EA 2GZDA 1QE5A 2WWVD 4B2YA 2V97A 4RD3A 3TNJA 4XIGS 2BGGA 1F0NA 4G65A 3FMGA 1GTRA 3BT7A 2BY4A 4CVNA 1UPUA 2JI6A 4AG3A 3V1YA 3PYLA 1ZJ4A 1P19A 3TOSA 2LP4Y 4E5NA 4JJKA 5MN6A 3ZD8A 3TQFA 4HDNB 4DDKA 3C5EA 1E0AA 3L6DA 4IDPA 4LYGA 3G2KA 1NUPA 1NBMA 3WDLA 1CY7A 5FOWA 3WLAA 2CXOA 1E2QA 2A67A 3IE1A 2PUAA 3QQ5A 2B78A 2VBCA 4WSOA 5IM5A 3KPJA 4NEGA 2XKJE 3T5CA 1GTVA 3QXCA 5E3HA 2XNCA 5B1SA 1K68A 2VQDA 3I04M 5HF6A 4DM3A 5ICEA 3KQTA 2FEAA 5I3CA 4FGUA 1B43A 3ESAA 3OQIB 2A3RA 2W43A 5KJFA 4HP8A 3O8LA 4P0PB 3NWEA 4JYPA 2VDRB 4IIJA 3K9GA 3B13B 4IEIA 4WBSA 4WNIA 4YRBA 5M7EA 1MH9A 5GY7A 2YASA 1XD2B 1XF1A 5HBRA 5BOSA 3M1LA 2QMYA 1ZMTA 2GNAA 2ZCVA 3ZJ5A 1CZUA 4IUDS 2Z30A 1NBEA 4OLFA 2CE7A 1NF3A 5EGSA 4UTPA 1IY0A 4DV0B 4MLPA 1SB9A 5I47A 4M55A 2JFXA 5CPBA 4BXOA 4L74A 3GA7A 3HSKA 1MC4A 2IJGX 2QMUA 3JALA 2QE7A 3FJ1A 4J49A 4J6FA 2NU6A 1GKKA 3CGGA 3R7SA 3I76A 4W7IA 4DV7B 1A7UA 2JGKA 3IQHX 1RM3A 3RVJA 2RDMA 3ZN2A 3OFVA 4CEHA 3GLVA 2XTMA 1EYZA 2FQWA 3ABOB 4I9UA 4IKOA 4NZ9A 2VSNA 1PZMA 1G3UA 4P83A 5HM8A 2GCGA 3JZFA 3T4UA 4EP1A 3FZGA 4TZ6A 4ENQA 1SG9A 1FFWA 2I6QA 2ZBDA 3CPJB 3VTFA 1YV9A 4QPZA 2B99A 1Q0RA 1Z6TA 3ZW9A 2OXFA 2B0CA 2X4DA 3CNOA 2BMWA 3LHFA 3MTJA 3ACBA 3SKYA 2PGXA 3B38A 4JLAA 4IEFB 3BDAA 3VR2D 4EY7A 1FVHA 4KTVE 5HZHA 1OWOA 2BBSA 3R5HA 1LB1B 3V55A 3LY7A 3ST7A 1C3XA 1JS1X 1LBIA 1OV4A 3WHLA 4AJ2A 3IEUA 1Y4UA 1WRBA 1YQEA 2DFDA 2QTNA 1S6YA 1X14A 3T1OA 5EE5B 2HDHA 2HNBA 3B1FA 1H6BA 3B8EA 3IDSA 4BX0A 1DCFA 1YH3A 3K9QO 5D86A 3UKOA 5EEGA 4GKJB 1T29A 1OSNA 1LPNA 2BKLA 3ULKA 4DJJA 1K89A 1UP6A 3M83A 2HA0A 2GB4A 3HGMA 3WNBA 2ZYVX 4QWMA 1DBWA 1H4SA 4PF1A 1H22A 3MRVA 2IZ0A 2VKTA 2Y0EA 121PA 2GI4A 4HPXB 4HWRA 1NVTA 3SBDA 2JFZA 1PG0A 3RSLA 1RI3A 3LL4A 2BKEA 3C5WP 1Y1TA 3C4QA 2HD4A 2GETA 1E2LA 3DWFA 1LI7A 1Z39A 1EGHA 1DBRA 2C5AA 3QH4A 5E9JA 5EZSA 4ES6A 1QH1A 3BCUA 3H11A 1Q0TA 3F6YA 2WYIA 4OM7A 5EPOA 2Q4EA 4RCVA 2VHWA 4X7MA 1ICEA 1KVTA 4DLKA 5LQAA 5JE8A 2O54A 1OWMA 4Z1OA 3KLNA 1JLHA 3OEWA 3Q87B 1CZNA 1MAAA 2FN8A 2YJ6A 4GBJA 2MWMA 2ANBA 4WK2B 2XA1A 4OOFA 2X4LA 4WJLA 5A02A 3G0OA 2OILA 1UMBA 3T3IA 4G4GA 4K1LA 1KZHA 2W4IA 1PYGA 3AESA 1F14A 4MITA 3H4MA 4ZVNA 1E1LA 1Q0HA 4CGYA 4EMTA 1U0OC 4CTJA 3HPRA 3QGMA 3F6BX 2WJ4A 3OZRA 4BGIA 4DXHA 2C9CA 3KOUA 1QWSA 1UBMS 4EX7A 1NUUA 3NOVA 4QEZA 1KYIA 5EMHA 1EVQA 3DBHB 1NYQA 3FNRA 2IQIA 3S0JA 1TT7A 4OLAA 1DTEA 1FCJA 1A72A 2BGKA 1ZLXA 1JDUA 2F7SA 2HWUA 4REQB 3W1WA 3BD8A 5JPDA 1UBTS 3UA4A 1P2TA 1GZSA 1SCUA 4MGZR 2AZXA 1NUSA 1KU0A 2YWRA 4NC9A 4GYYA 4LQCA 3SZRA 4J16C 1NYTA 4M53A 4QEDA 1VC2A 3K30A 2H00A 3H9GA 5JNVA 4S12A 3AVVA 2WAMA 1BVYF 1CRLA 2X4GA 5REQA 1Z45A 3DW1X 4DTCA 4MMYB 3GFGA 3Q88A 5ESXA 1RJDA 1DCKA 3RQSA 3GD5A 5JDIA 4RTSA 4DT1B 5KHOC 2CMFA 3RVRA 2LWIA 2CSUA 2Y99A 2Z8YA 1JQ3A 1W2WB 3F3KA 3AU8A 4C0WA 3PEVA 3D0RA 1SOVA 4ZVOA 2VH2A 4BUCA 2XD4A 5AJUA 3AJ8A 4HLNA 2BKVA 4XOUA 2QRNA 3P2YA 5HKKD 2XGMA 3FMFA 2FP4B 3NBXX 4MS4B 3LWBA 1E4YA 1IMOA 3I0MA 2OK7A 4A36A 3FWPA 1OPRA 3W2EA 1NVVR 1XR3A 2PMFA 2HDWA 3FLBA 3WIBA 1K5PA 3JTMA 4Z99A 3DL2A 4EGAA 4O5OA 3UMSA 4A0RA 4BKUA 5FJJA 3FPCA 5LA6B 5K8VA 2CV1A 4EY3A 1F8UA 4HVCA 4M89A 4DJTA 3B8HA 4O4LF 3R0VA 4INAA 3TBHA 5AVVA 4Q4AB 1VGQA 4EDHA 4EF4A 5ETJA 3ANSA 4GZMA 1RJGA 3HYRA 4YJKA 3TI7A 4YAGA 1NY6A 1U0RA 2FR1A 2WM8A 3KM0A 1UR5A 3FI9A 2CC2A 1YR1A 3B48A 4TXJA 3RC8A 4AJ4A 4AJ9A 3PIDA 3H18A 3I2JA 2GAFA 3KS9A 4KXMA 5J4YA 1QQTA 2Q3EA 3OIYA 3QMMA 5K8CA 3DBRA 5F1YA 3J7AC 1KZ9A 3TZKA 5AOVA 4C2TA 4BO0A 1NULA 3B60A 4MQFB 4FXOA 5TQ0B 3L6CA 3REQA 4UM9B 2V3VA 2QDXA 3M2PA 3JD0A 1T0IA 3AB3A 2HBYA 3DT9A 4MQUA 4RPJA 3QY0A 1Z0UA 5F21A 2XT9A 1SC4A 4OQFA 4OHFA 4DSNA 3HFGA 3GLIB 1JKJB 1Y1LA 2E4UA 2YWEA 3IP5A 3LBIA 3P0FA 2WJPA 3PC7A 2B8NA 3QVKA 3B7PA 3L7LA 3TVTA 2XT6A 2RHLA 5JXHA 2QVYX 2ZIEA 2EFJA 2V58A 1QNFA 2ZSKA 2MMGA 5J4LA 1F0KA 3LT2A 4LJ5A 3NVKI 3ZQJA 2PXAA 2QNBA 2WM3A 1L7BA 4KLRA 1GLNA 1MJNA 3AB7A 3T5MA 1F8GA 2PLWA 3IGFA 4PLHA 4PTZA 3H6HA 3ZXSA 3PXDA 4HWKA 1FSPA 4FEGA 1I4TD 2XZLA 2ORED 1CHDA 3L1IA 4K87A 4UW9A 3RBAA 2IZ1A 4OA5A 5JJLA 1CDDA 3ZV4A 1NVEA 4PAWA 2ZUTA 5EINA 2ZYWX 4JSYA 5FTNA 1J8VA 5KKCA 3ZDQA 2R9VA 3C3EA 3IL2A 5IK2D 4XWTA 1S3SA 3O92A 3FUWA 1O94C 2EQAA 1ISFA 3G7NA 1JKXA 3I0NA 3LP5A 3LUCA 4M86A 2F1KA 1M5RA 2YXLA 2V0GA 2JFHA 5TS2A 1NXSA 3OPVA 3TQTA 1SXHA 1TO6A 2OGUA 4J91A 5K8UA 4K6MA 1E3MA 3LRTA 2AFHA 1PGJA 3KZKA 1T8YA 1J9EA 1OZAA 5JC8A 3U3ZA 4YRNA 5LZ9A 3LBAA 4P7GA 4DR6B 4EHIA 1J9ZA 2ORIA 5DMXA 2CV0A 3OKAA 3PXBA 5GZ6A 1B1CA 5B1YA 5L53A 1N8KA 3PIIA 2DQKA 3BN3A 5LMZA 2UXBB 1IMJA 4NYIQ 2HRDA 4PZLA 4S04A 2DMRA 5F98A 3O26A 4I5DA 1P31A 1P2GA 2OO3A 2DHCA 1EFTA 8LDHA 2C57A 3ZWQA 4RAOA 1A50B 3C8ZA 3ZDYB 2M98A 1M73E 3EFOA 1L7QA 2XBMA 3DAHA 2M6LA 4PNPA 5ICGA 1JIUA 2ZR8A 4I55F 1A9XA 2JI9A 1CY6A 2WT8A 2CNNA 2F43B 4Q34A 5ALSA 2XJ4A 1NE7A 5FLYA 1N36B 4F6RA 2UU9B 2VYQA 1UBLS 1OU0A 4FYPA 4MUFA 1F5SA 2RGUA 1IOVA 4N5IX 3DZCA 1UEXC 1QSGA 4ND2A 3RYTC 3SM9A 5TX7A 5AW3A 1LTQA 4HEHA 3K2BA 4LXTA 3A70A 3QKIA 2JLZA 2W6CX 3C6YA 3RFCA 1XJWA 1NPYA 1WU7A 1O08A 3EF3A 4GKAA 5ESDA 1CUCA 4MOWA 3CNEA 3CZRA 1C30B 2QN7A 4ZJPA 2BJWA 4BQFA 4J4TA 1Z0KA 3O8CA 1U7OA 4K8OA 4OOEA 2XRYA 3TMKA 4ZHQF 4N6NA 1QAMA 4U0KA 4Y9DA 1ADCA 1UBCA 1I2DA 4CU2A 3IEIA 2VQFB 3G9ZA 4G1EB 1A2KC 2AZMA 2J9FA 5DK6A 2BFCA 4QXRA 3W2TA 2QSUA 1VHDA 1OXMA 3DE5X 3TQCA 2HX1A 1ZVJA 5SV2A 4BFWA 3ZUPA 4E5YA 3QIAA 3QWHA 5DE3A 3IDFA 5IH7A 1EI9A 1B42A 2W2XA 4H0NA 4HQFA 1N6LA 1NVGA 5EE9A 2NPFA 5DM2A 1VG8A 3PKIA 3W5HA 2QQ5A 3P0JA 2H6EA 1XYYA 2ZE7A 4EA7A 1OXKB 4YO8A 2P90A 1SR8A 1Y63A 3PC4A 3N59A 3Q40A 4MKRA 4BAUA 4YT2A 1EWQA 3CH7A 4GS5A 5D87A 4KQ9A 1L8OA 2N1BA 3PNKA 1XZLA 4RV4A 4XSHA 1FFBA 4OIFA 4RL4A 3RS3A 4A0SA 1J2TA 1PRYA 1R88A 3NO4A 4DUYB 3PI6A 1RE0A 1DJLA 3A7EA 3M3PA 3V2UA 3DO6A 3EC1A 3JSXA 3OHSX 4UFNA 3AFMA 3OCXA 5TNXA 3W9SA 2HWXA 3ENKA 3ROQA 1VYVA 3AY7A 3ANNA 4BQIA 4DR5B 1N7HA 1S2GA 2YMMA 4H17A 4YN3A 4NPAA 1V48A 3AV0B 3E7XA 4EHKA 1FX0B 3FTQA 3I64A 3UJ8A 3ZHYA 4CM8A 3L4JA 2NU7B 5AKHA 1Q16A 2C99A 3OCZA 4NZOA 1XXHA 4P3NA 5K0SA 1NV8A 2CFIA 2HXGA 4LJ7A 3RU9A 4C9BA 3W2HA 3NHFA 1DQSA 4G84A 3UW3A 1TRKA 3LECA 5ALEA 5C51B 1M2KA 3VHQA 1DWOA 2QA5A 3RIGA 4ETMA 1ECPA 1HLDA 4HBZA 3A3KA 4M1TA 4Q05A 2E4YA 3H5WA 2GZSA 4DN6A 4U2FA 1YE3A 4GICA 3DTVA 3GJSA 3S1SA 4WXPA 4ESOA 4FNAA 4NU8X 4UM5A 2Q49A 1ZH8A 3NHYA 3PF9A 3PUVA 3GH3A 3OLXA 3PNBA 4DJ5X 4V3CA 3UB2A 3C70A 4TMWA 4A6XA 3IB3A 3FF1A 4JI5B 2HA6A 4EUFA 5AVOA 3UCFA 4FMCF 2QBYA 4LY0A 2WT9A 5CH3A 1Z4NA 4JMLA 2FEMA 4D0NA 1GWNA 3NH9A 4KLAA 4TQUS 5DX1A 1DS6A 1MOSA 3A6HA 4KSCA 1TOAA 1E6MA 3QSYA 3NDPA 2YOGA 4QDKA 4TLAA 3ZE7A 2O5RA 3A31A 3B5EA 3K8YA 5BSEA 3DOHA 4EL0A 3RYIA 1UZUA 1FDOA 2NVWA 3OD1A 2ZSBA 3U44B 2JEOA 3TL3A 1QC5A 5GOZA 1XWFA 4DANA 1JIIA 1X1CA 3M4NA 5DULA 2ACVA 4YVFA 5ALUA 2B21A 2R8PA 3OZUA 1VRCA 2G1KA 4B7CA 4BFTA 1IY8A 3JQ8B 4LJRA 4LXHA 5BYBA 2BEKA 3OIFA 4M2LA 4MHOA 4G8CA 1EFUA 1ISJA 2NZJA 3R7AA 3VUEA 5KS2A 1BDIA 3MT9A 3GN1A 2H48A 2XYGA 2J3EA 3TLGA 4JB8A 3RADC 4AY2A 4RV9A 4NHOA 1VB3A 5BSUA 2BZ0A 3PFHA 3RD5A 2C84A 3ABZA 4YRFA 1Q1QA 3A1CA 4PAOA 2B3DA 1WVMA 5F7OA 3V8QA 1DWUA 1IB0A 2BRUA 3NV9A 4KQXA 5LZ7A 4FB5A 2ZBRA 3NONA 1BKDR 1QGUB 1EK0A 4CLHA 2XKKA 1YGPA 2G9RA 3BZWA 4Z9YA 3GX1A 5BN1A 2IHKA 1QVWA 2AR7A 3KHTA 1QLJA 1FXWA 2VUHB 1Z4KA 1NU8A 2ZU0C 2CZGA 2M32A 4JC4A 4QELA 4I5IA 2X9NA 4LWQA 4YJDA 4B0OA 2AH5A 1RXSA 2BBOA 4EA6A 2PBZA 3CUEF 3DYIA 3QIVA 2HJ9A 4C4XA 4E5MA 4R40A 1FMTA 3S8MA 1NE2A 1EX1A 1I14A 1U5BA 1WCWA 3NRJA 4EY6A 2K7ZA 3EYWA 3JRWA 4JI4B 2AL7A 2WHYA 4XH9B 2FEKA 3TFQA 5G0UA 1UADA 3K1JA 4CMEA 4XR9A 3V4PB 2P6OA 1BEEA 1H4TA 2MR6A 4R1LA 4D5GA 3O83A 4RA9B 4FKBA 4MVJI 2AGVA 3WFIA 4KZKA 5DSZA 3S2SA 2NZUG 4GPD1 7AT1A 1T6ZA 3P0IA 1KWKA 4TT8A 3DM5A 4HH0A 4C14A 3QEAZ 1HE3A 1NJSA 1QF9A 1W48A 4ZT4A 3AR2A 4HQOA 2C2BA 4J0EA 3L82B 4DIEA 3KVYA 1D5WA 3Q4GA 4AQ7A 1QGOA 3EF1A 4MWGA 5HRAA 3TS1A 3PHHA 1I4DD 1T1GA 4ASUA 4CM9D 1H94A 1X87A 3CT6A 1VI2A 4LBVA 4EB6B 2SKCA 4AZ3A 1JDTA 1QUEA 1JQKA 5JRDS 2O8BA 1AKWA 1QXSA 1VCHA 4HAIA 3GCGA 1TF5A 3LBYA 2JW5A 4JLSA 4LMPA 4MW0A 3V33A 1P2VA 3MCWA 1ESMA 1G1MA 1KK1A 1FNMA 1WMFA 2XB8A 3O74A 1II9A 2JAPA 4I1IA 1WCYA 5DHFA 3SG0A 3D8NA 2UYHA 4QFDA 1QO0D 4NRDA 2XH8A 2ARKA 3R0XA 1ML4A 5K03A 3KLMX 5AUQA 4ARUA 2BGWA 1NF2A 5AIAA 1EK5A 2HU2A 2PUJA 1W0CA 2UKDA 5T4BA 1SXQA 3GDWA 1VL5A 1GUYA 3FD8A 4Y2GA 5HQTA 4OLBA 1MN6A 3GG9A 1GFZA 1SA0A 2DRIA 3HACA 3NTVA 4V39A 5FTKA 5KNBA 3OP1A 3CE6A 4Z7QB 3NWJA 5HP4A 3O3OB 1NYRA 3LYUA 1WKBA 2BKUA 1YE8A 3C7TA 1LZKA 2NYUA 1S9HA 5KAPA 3ITNA 3BFKA 3IUMA 2BGJA 2DLCX 3AF2A 3HC7A 4X54A 2Z1NA 3DGEC 1PR1A 1DC6A 2JIMA 3C85A 3N39C 4GFDA 2J0QA 1RYMA 1XAHA 3PD0A 5DVZA 1IRIA 4EFKA 2FMUA 1IJKA 4J2OA 1PFWA 4ZGWA 1I3NA 5BQXA 4FWIB 2DUJA 3P9RA 4D9CA 2UXDB 3RHTA 1USUA 2VHZA 3NDRA 4XDYA 1B73A 1CJUC 1WXHA 3GB9A 1Q5PA 4HEJA 1C4OA 1ECGA 1ENOA 4UASA 5KOHB 1DKUA 3EPKA 4FPXA 4EHJA 2ET6A 2ZDHA 2H1CA 3M89A 4L1KA 5KNDD 1Y3FE 3I1JA 4KUGA 5H5JA 4E6PA 4M0LA 3MVEA 4ZOAA 5ERGB 4URXR 3RC9A 3DZGA 2Q1YA 3PWZA 4UAJA 5KHLB 2FG6C 4YRZA 4CM6A 3HRHA 4ZYXA 4NBSA 5CFQA 2C7QA 3NC4A 4D82A 1GSIA 2ODEA 1BSVA 4LUCA 4U9HS 1Y3AA 1H23A 2O4UX 3P71T 3IIKA 2WTXA 3AHCA 3VR4D 3V4RA 1QAOA 1YS7A 4WCFB 2W8BB 5IF9A 2H9AA 1A96A 1SVOA 4HRXA 1NOIA 3ASYA 1FFDA 3RGWS 4ZJYA 2HK9A 2BKXA 5K7SA 2Q5HA 4JC0A 2EP7A 4W1RA 1SU8A 3SR3A 2O5EA 3QVTA 1XLUA 4O4IB 2GRAA 1AD2A 1PTJA 4Q3OA 4RF2A 2E0IA 1L4KA 1EDEA 2QTZA 1T4CB 3FUUA 2YJTD 2UYOA 2P4SA 2X2FA 1DO8A 4IIBA 3R9XB 1K8ZB 4R3WA 1TO1E 2JIZA 3D3WB 3LZCA 4YGXB 4AK9A 3QVGB 3F3MA 5DN9A 3D3JA 5DB4A 2EBHX 4MUHA 4X1YA 3Q2IA 1SHLA 1ZYUA 2CXNA 2X2OA 5J1TB 1KI1A 1OI2A 2D1RA 3E9QA 1EFKA 3OJ0A 4RQAA 4GLLA 5LZ8A 3TPFA 4CTOA 3MWYW 2GTHA 2Q46A 1KMHA 2M1ZA 4ZWNA 3CSSA 4MLDA 4RGVA 4S1WA 1ZOOA 3TQSA 4ZYZA 5BT8A 1EXDA 3KHKA 1HV8A 4B48A 1TVKB 5HNKA 2R5WA 1E3JA 1Z26A 3NG1A 2RIPA 3AF4A 3A9SA 1IVSA 4J0DA 3NBKA 5K8LA 2OXTA 1Z73A 5BVHB 4TGLA 2ZSFA 3ENVA 3THXA 2C88A 3IQWA 4RMHA 4B6PA 1KWGA 4JR1A 1DO2A 4Q3LA 2ZWOA 1TTHA 2Q2QA 4IDNA 3NHPA 4ESVA 4TQ9A 1QIJA 2XDAA 1NN3A 2XZDA 1II8A 2OQ2A 1SWWA 3KZMA 1D09A 3H99A 3P96A 2VF5X