3CZ4A

Native apha class b acid phosphatase/phosphotransferase from e. coli
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
SPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class B acid phosphatase
publication title Structural insights into the catalytic mechanism of the bacterial class B phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases.
pubmed doi rcsb
source organism Escherichia coli
total genus 76
structure length 209
sequence length 209
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2008-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cz4A00
2B30A 3NANA 4UU0A 2C4NA 4BEVA 1ZS9A 1L7PA 3KOOA 5AM5A 3EPRA 4NFLA 5ALVA 2YMLA 3UMGA 1PW5A 4CE6A 1XP5A 5ALEA 3A1EA 1LVHA 3KBBA 5ALFA 1YMQA 1RQNA 3L8GA 1F5SA 2JGAA 3IJ5A 1L6RA 3HLTA 2HOQA 3D6JA 3E81A 3NUQA 3PCTA 2G08A 4GXTA 4EEKA 1QH9A 5JJBA 2WM8A 3U26A 2CFTA 3ZX5A 4NV0A 1Z4PX 4DW8A 2BY4A 3AR6A 3IRUA 3DDHA 2FPSA 2FPUA 3OCYA 2FEAA 3N28A 3NRJA 1U2TA 2YN4A 4F71A 2HF2A 3ZI4A 3AR9A 4EZEA 4G63A 2ZBFA 2OM6A 3WK7A 1XVIA 3L5KA 2IOHA 5AKHA 1U02A 2EATA 1U7PA 3WKDA 2G1AA 4ZEVA 2IOFA 2YMQA 5FP0A 3AR5A 1L7OA 2HI0A 2RBKA 4GIBA 1ZOLA 4Y2XA 2C88A 2AH5A 3ONNA 1VJ5A 2MU1A 2MSNA 1YNSA 2O2XA 2OBBA 3FGOA 4Y2SA 2PQ0A 3TLMA 3M9LA 3EF0A 1J97A 4BBJA 2Q4RA 3NASA 1N8NA 2ZBEA 2WFAA 2ZBGA 1WZCA 4YIHA 2B1QA 2FPXA 5ALYA 1EK2A 2D2VA 3A3YA 2G07A 4RESA 2GHTA 2I55A 5AK5A 2HSZA 2RARA 3FVVA 5AKJA 5AVXA 4NABA 4UAUA 2C8KA 1RDFA 4G9BA 3P96A 3W5DA 2WF7A 1RRCA 1N9KA 3AR8A 4MUMA 4CF4A 4HGPA 3W5BA 1YV9A 3QU7A 3WK8A 5AIBA 3L1UA 4H1WA 4UM5A 2JAWA 1AQ6A 2OYCA 5AW1A 5ALNA 4KNVA 2B8EA 2P69A 5AI5A 5AKZA 2WF8A 2WF9A 3IB6A 4I9FA 2I7DA 3I1YA 1T5SA 4DWOA 3QU4A 4XE5A 5ALTA 1RKUA 1Y8AA 3OTQA 4AS2A 3RFUA 3K1ZA 4YH1A 1Z88A 2I6XA 1RKQA 5ALWA 1EK1A 5IS2A 3HYCA 3QX7A 3QYPA 4NAVA 3L8FA 2FDRA 1WPGA 3E58A 5AM0A 5ALJA 2AUTA 5ALPA 5A3QA 1K1EA 1LTQA 2YY6A 3UMCA 1NNLA 2WHEA 4YCNA 2CN1A 4J03A 1T9ZA 1X42A 3AR4A 3I6BA 4IG4A 4XOUA 2GHQA 5AK3A 4Y2PA 2PKEA 1CQZA 2I33A 5IT4A 3WK9A 2QLTA 3SKXA 2B0CA 1WVIA 2YBDA 3UM9A 1KYTA 5ALXA 2CFSA 2JARA 2GMWA 3UMBA 3ESQA 2P27A 2C8LA 2G09A 3L7YA 5AW7A 2R8YA 3F9RA 4BNDA 3FZQA 1IWOA 5AVYA 4L57A 2O9JA 3QUTA 1Z5GA 3QU9A 3U7GA 1U7OA 3GYGA 1XPJA 2P9JA 3MC1A 1CR6A 2W4MA 2G06A 1S8OA 1ZJJA 1ZRNA 4C4RA 1Z4KA 2HDOA 1L8OA 2HF7A 5AIAA 3ZX4A 2YJ5A 3QUBA 3BA6A 4EX7A 2FUEA 2R8ZA 3E8MA 2C9MA 1RMTA 4FE3A 3B9RA 3BWVA 3OCZA 4RETA 2RAVA 5AKEA 5ALZA 5ALHA 2GO7A 3R09A 5ALOA 1Z4QA 3CZ4A 4HYTA 1RLTA 1TA0A 3MMZA 1O08A 1ZD4A 5ALSA 3U13A 1Z4JA 5AW2A 1TJ4A 5ALQA 3CNHA 1QQ5A 5AW6A 3PDWA 3L8EA 2CFRA 3DV9A 1YDFA 1VFPA 3L8HA 4UW9A 2PR7A 3WK5A 3NIWA 1JUDA 5AESA 2HO4A 4AS3A 2YMPA 2NO5A 4KYTA 1RMQA 1TE2A 2B8JA 3PGLA 5AM2A 1VJRA 3VAYA 5AK6A 5AI6A 2B82A 3QNMA 5AM3A 5AVVA 3WK4A 1ZRMA 3SMVA 3ZTWA 3ZWKA 5AI9A 4Y3UA 3FPBA 1L8LA 2IA5A 4QJBA 1QQ7A 2IYEA 4BX3A 3OPXA 1U2SA 1Z4IA 5ALLA 5ALKA 1T5TA 4HGQA 2B1RA 2NYVA 3AR7A 2FI1A 4FYPA 1L7NA 5AI8A 5AKKA 1Z4LA 3ZVNA 3RF6A 1QQ6A 3U7FB 3NAMA 3WGUA 3A1DA 2ZXEA 4BX2A 4L6AA 1ZD2P 3I28A 2ZG6A 5E0OA 5IT0A 4Y2VA 5ALMA 2G0AA 2HEGA 4HGRA 2IOFK 3DAOA 3L1VA 3FPSA 5AM4A 3DNPA 5AW9A 2YJ3A 1TJ5A 2FPWA 3N07A 4KN8A 4EENA 5AW4A 3SLRA 4BYGA 2YMMA 4HAIA 3KC2A 1ZD5A 2Q4TA 3QU5A 4YCLA 4Y2QA 4C4TA 2BDEA 2HX1A 5AKLA 4Y2TA 4UMFA 5AI0A 4E88A 1FEZA 3M1YA 2Q5EA 4NWIA 5AKXA 4UU1A 4UATA 2ZBDA 3FM9A 3ET4A 4YGYA 4DCCA 3ZUPA 4HGNA 1Z5UA 5AVUA 2NO4A 3N1UA 5ALUA 1Z4NA 4PNHA 5AW0A 2EAUA 2JAOA 5A3SA 4HGOA 5AVWA 1O03A 2I34A 1J8DA 1ZD3A 4QQFA 4DFDA 2HHLA 4YIKA 2OA0A 3I76A 2W11A 3J7TA 3U19A 1SU4A 2DQSA 5AHXA 4UARA 1L7MA 4Y2YA 3AR2A 4ZEWA 2YJ6A 3QUCA 3WKEA 4BKMA 1Q91A 3KD3A 4KNWA 4C4SA 5AW3A 4B6JA 1RPZA 3W5CA 4BX0A 2QYHA 3B9BA 4L6CA 4O8CA 4OCZA 4UM7A 4XPZA 5ALGA 5AW8A 4UAVA 2EARA 5ALRA 4FFDA 3R9KA 1NRWA 3E84A 2YJ4A 4UMEA 2ZOSA 4UASA 5AVZA 1QYIA 3ESRA 3EWIA 4IFTA 4XQ0A 3ZTYA 5AKGA 3ZVMA 3QXGA 4JB3A 4KX3A 1RLOA 4UMDA 3SD7A 3OCUA 1RC8A 2GFHA 3L0YA 2BDUA 1Q92A 3L0CA 4MWOA 2R8EA 2G80A 2FUCA 3QUQA 4CF5A 3MN1A 2AMYA 3ZVLA 3QGMA 3ZU6A 2VKQA 5AM1A 5AVQA 3ED5A 4I9GA 2WF6A 3ZWDA 2AGVA 4Y2UA 4OFZA 2HCFA 3WKAA 5AVTA 3N8GA 3MPOA 5ALIA 1TJ3A 1MH9A 5AK4A 1RLMA 3EF1A 3R4CA 4OHFA 3U7EB 3U7HB 5AW5A 1RMYA 2YFYA 5AICA 2RB5A 1RQLA 1WR8A 4JDPA 3B8EA 2X4DA 4BEWA 3S6JA 3ZW7A 5AI4A 4CF3A 3AR3A 4Y2RA 3KZXA 3NALA 2ODAA 3SKYA 3OCVA 4BNDB 1YJ5A 5T41A 3PGVA 1YS9A 5ALDA 4EELA 4Y2JA 4J2TA 4AP9A 1SWVA 3WK6A 3WKCA 1Z4MA 4ZEXA 2WF5A 1S2OA 1SWWA 3QLEA 3W5AA 4CNQA 4F72A 5AKIA 3WGVA 3ET5A 5AKYA 1NF2A 3KDPA 5AVSA 3OCWA 3N5KA 5A3RA 4YCMA 4KX5A 2W43A 1Z4OA 4OD0A 2JAUA 3A1CA 2FPRA 2P11A 4UMVA 5AVRA 3SHQA 4EX6A 2R8XA 3OCXA 1RKVA 3L0BA 3WKBA 3QU2A 2I54A 3SF0A
chains in the Genus database with same CATH superfamily
4EL5A 3WIUA 4B3XA 3V00A 4DCNA 2JJ2A 2AKYA 2JLSA 4PGAA 2PTHA 4IGFA 1OYVA 1RJWA 1YFKA 4S1OA 1U8EA 13PKA 1PW5A 4CE6A 3UK2A 4RTNA 1YCDA 1VKJA 4F4DA 2HPHA 1Y1RA 4PZLA 4Q1AA 4YFVA 1ZONA 4HVAA 3KTAA 1RZRA 5K0EA 1YMQA 1RQNA 4ZWNA 2LCIA 3HO6A 4WOPA 2H4XA 2JGAA 4GPZA 4DLXA 3IUNA 1E20A 2OOKA 3IERA 4YAUA 3DPSA 4RV5A 3QI7A 1IPEA 4E12A 4E70A 3OEED 3FTPA 4PXSA 1K4YA 2A4MA 2HF9A 2JASA 2CMFA 2ZBUA 3U26A 3D1JA 2XYHA 5J3JA 3NBUA 1NW3A 1ZLXA 3TFQA 2FGJA 2JJQA 2Q28A 4QPPA 1Z12A 4ZVMA 3V3TA 4C6TB 1DKMA 1RQ2A 2L42A 1T5OA 2WFLA 1PR1A 1XAHA 4N5IX 1A4IA 4OGKA 5K9ZA 3NJRA 2VTBB 4OMUA 1I36A 4JI8B 2WVAA 3DOIA 4B79A 3TLCA 1DKNA 1OSNA 4N3GA 1GTJ1 3DBLB 3ENWA 4MHOA 1ZCZA 1YA6A 3TZEA 8GPBA 4GOND 1X87A 3Q7PA 5KKAA 4ARAA 3UJNA 2OM6A 2IVFA 2Y99A 5A4AA 4FX2A 4MUHA 2CE2X 5AJVB 5B3LA 1NN5A 4JT2A 5KYUA 4BAUA 1BMQA 1RYHA 3OFNA 3T6KA 3W04A 1BW9B 1CTQA 4RDIA 3L77A 1T4BA 3HLYA 5IVHA 4XGRA 4XW2A 1IULA 3W6OA 2E82A 1VHJA 2WTBA 1T0UA 3D5QA 4XTCS 5I4CA 3GPCA 1L7QA 2YH2A 1A97A 4ARVA 5MN5A 3WAGA 2DETA 2UYOA 1B0PA 2H1LA 2PZ8A 3MJCA 3TMAA 1BN6A 1IRXA 1NVAA 1WO8A 4KQ6A 4OXKA 3TQFA 4BVGA 4C20A 1CQWA 1YBMA 2B4QA 4RXTA 4DRXB 1HDYA 5BYAA 4OJNA 4E2FA 2RGRA 3H3XA 1BCRB 4C30A 3TRIA 1VDMA 3C3XA 4HAWA 3FWKA 2Q8PA 3D0RA 3GI1A 1Y4UA 1G8AA 4YYZA 1MC8A 3PE6A 4JB8A 3OTIA 4BUCA 1QMGA 4M7PA 4CW7A 2JH9A 3UENA 1DBWA 1NXOA 1Z7GA 3BFKA 1XIVA 3NIBA 3M1IA 4Q01A 5EKSA 5LYYA 1B1CA 1AKMA 4BX8A 2FMXA 5SYMA 4ZEMA 4XVHA 2RHWA 1GT91 2RHHA 3FVVA 3LKVA 1L9XA 3BRSA 3PIRA 5EUQB 2VUUA 3C3PA 1DC6A 5FJIA 5F2NA 4X54A 2L69A 3L7DA 4C6TA 2GBCA 4DSTA 1RLIA 5DE3A 1ENZA 2XV1A 3GPBA 4EMUA 4BMXA 2OHXA 1EEHA 2I3DA 4LJ6A 4LZOA 2X8BA 3FAKA 3TZKA 4JOCA 1V1MB 3VYWA 4UM5A 1JS1X 2HMWA 1E9BA 1HE5A 3CKLA 2OYCA 3GDWA 1GADO 3LH5A 3TM5A 5I7WA 5DCUA 3ZY4A 1MNAA 2B5OA 2I66A 1CUJA 1IM8A 3R5HA 5EXTA 5KAPA 4JYCA 4JOSA 3NHMA 1E2GA 2I7DA 1OH5A 3C7AA 3SQWA 3KT3A 4US2R 1EFRD 1GLNA 1WVMA 5AJZA 5E8JA 1BW9A 2OTCA 4G5SA 3UATA 1XMJA 3CJTA 3HJAA 5TQ0B 4YH1A 3TM4A 3VZDA 2ZRAA 4E5PA 5CU7A 1WU8A 1JX6A 1SOMA 2C7BA 2ZUWA 3D3EA 4NXMB 1EZ4A 3FSRA 1Y6ZA 4YQFA 1A2BA 4WZBE 1ECLA 1RQGA 4KAXA 4P54A 3BGDA 4PYLA 2HSWA 5DCYA 4RF2A 3TRHA 3FKSA 1Z8DA 3OLQA 4R31A 4TWRA 1GGFA 5AM0A 2CDCA 2XVYA 1JPJA 1VZ2A 2CFOA 5FRDA 1T3SA 2CN1A 3K0CA 3QVVA 1QKJA 4I5FA 2XTJA 3W3AH 4AP6A 4XFDA 1X1DA 2I99A 4R51A 1UQTA 1H8EA 1I01A 3BWBA 3ZV6A 1Z25A 3G7SA 3L6CA 2YCLA 5KWIA 5C34B 4ZVLA 5U4QA 1P6UA 3MJFA 2Z6VA 1D07A 3PP8A 4WVLA 1N6PA 1SKBA 3ZJTA 2Q7DA 2JATA 4FFBB 4LWPA 1T1SA 4N3AA 1XTQA 5HQ3A 3RSCA 2FG6C 1ZQ1A 1L4YA 4I50B 1KXJA 3PK0A 2R8YA 4GUAA 5K8VA 4B8WA 2O8EB 1V1MA 3VTFA 3M6FA 2H2DA 3N0VA 1T5IA 3R74A 2HWWA 4MPTA 1T1GA 4ACBA 2ZRJA 5BXYA 4IIUA 1KSHA 1NJ1A 3GYGA 3KE8A 2WHXA 4DG8A 2P9JA 4LDJA 4J2HA 4DB4A 4L0CA 3A9RA 1KJNA 4AN1A 2W4MA 1W85B 1SUWA 3RTBA 1W5TA 1PNTA 1K3UB 3ABQB 5BQFA 5K3EA 3CLSD 4I4NA 2VJOA 1PDVA 3FWHA 1ETHA 5KJEA 5K05A 2UYHA 1U7HA 3DW3X 621PA 1SXIA 2XDAA 5IDQA 1SY7A 2ZAYA 3LK6A 5TQ0A 1DEHA 3IPXA 2ZCUA 3BXGA 2EKDA 3VJMA 3WBBA 3U4CA 2QTMA 4MLDA 4M37A 2WIGA 4FE3A 3R0VA 3HO1A 3VU0A 4MUBA 2CJFA 1ZH6A 3I04A 4MR9B 3WNBA 2H0QA 2UAGA 1Z4QA 4BWGA 3RIGA 4CHTA 2HWYA 3X1MA 2JKVA 1OFUA 1GVNB 2OUKA 2CZQA 3L4EA 4PLWA 5FLKA 2BMWA 3PHIA 1XN1A 5EJMA 5ALSA 4BVLA 4DC1A 3KVNA 3OY2A 3K71B 2KSQA 3G2OA 3S2SA 4CIAA 4H7HA 1FFHA 1Z17A 2A9KA 5FNZA 2PIAA 3ZW8A 4UHHA 2XYQA 2JFXA 3CNHA 3IEIA 2C4VA 3CX7A 3E82A 1F06A 3HC7A 3IBYA 2YFHA 3BB3A 3NHSA 1OLSB 3U7RA 1DX6A 4UPVA 4HO1X 5GINE 1NSTA 1NLZA 1L5LA 1BJKA 1JUDA 4FI3C 2BE9A 4GICA 3RNLA 4BV8A 3OZIA 2OHOA 4RACA 3HV0A 4FFBA 1LU9A 3AEQB 4LYAA 4H7JA 4OAQA 4X94A 4DNXA 5JEEA 4UJ5A 1ZICA 4I50A 1X3SA 4MWSA 1L5FA 1E0KA 1IXZA 2O8EA 1R9GA 1WDLA 1V1RA 2OD2A 4B84A 1QGYA 3RTCA 2BEUB 1TIPA 3H0KA 4QXAA 3WK4A 4CODB 2XCSB 1DXQA 4J7XA 3W0LB 5L4NA 4OFXA 4EG7A 4EJSC 1QO0A 3DWEX 4NZMA 3PD0A 1ZK3A 4CT0A 4QARA 2RGYA 5BWCA 1F3LA 2W42A 4RAQA 2ZRNA 3K70B 4DUZB 3U37A 3WHKA 2W8BB 1Y89A 2FQQA 1Z16A 2F3SA 3V8EA 4AJ1A 1ULUA 2OORC 1PFKA 1THMA 3OG9A 3OZXA 3H18A 4WFJA 4XUCA 1Y1KE 1ORTA 2XWSA 5PNTA 5SZHB 4QDOA 3T3MB 1VHTA 1NX6A 2J7KA 3TNLA 2BPOA 2QM8A 4U6SA 3AY0A 1JPVA 1OW3B 1R0WA 2X0KA 1QU2A 2OFPA 3E03A 3A1DA 3NAGA 4L5AA 4MMYB 3FE2A 4NE9A 4J0GA 2VHEA 2F55A 1AF4A 3L04A 3LUGA 4MR9A 4AJ2A 4L6AA 5KWSA 4ND1A 2J3LA 2HHHB 3QFFA 2FMHA 5JC1A 3KPUA 2HMVA 1E9EA 4GOOD 1VHDA 4HRAA 4QGSA 3F5FA 2G4CA 1N25A 1RCFA 1PYGA 3FPSA 1L5VA 3LVRE 3VC3A 2OQRA 3H9GA 2B83A 4GI3A 1ZZEA 5IJ9B 2A5JA 1JFSA 1OLSA 1YB1A 3GEHA 5H82A 1KK2A 2IUYA 1W5FA 3LOPA 4K40A 3BT7A 1KAHA 3Q3VA 3I61A 5CYGA 3OI7A 3LSYA 1YRLA 3FHJA 4G5XA 1PJQA 2H4JA 3UV3A 3FRJA 1JU9A 3KD2A 1HDEA 3O93A 2CVZA 3NPAA 4U7FA 4D9FA 2D2EA 3AEQA 4GU5A 1BH6A 1DKPA 4KO3S 1WB6A 3Q2OA 4RIHA 1BN7A 1EFCA 2Q5EA 1N1DA 2K7ZA 5HYVA 1A7KA 3K2QA 3LX6A 3I1FA 3MTDA 3OJWA 3QA3E 3TCXB 5LUBA 3I9V1 4CMIB 2PZFA 2JLVA 2RGBA 2ZIUB 3D6AA 2BEUA 3GK3A 4XCVA 4YGXB 1BVHA 2QD1A 1GPLA 2GYVA 5KTTA 4PV7A 1WY7A 5CXUA 1Z6YA 2DBYA 1PWXA 2YXBA 3N0TA 4OI0A 1VTKA 1OKKA 1Z5UA 2RDMA 4DPLA 1ST2A 1UK7A 2G1JA 4E15A 5ELXA 2FWRA 1TDJA 2EQAA 1OWLA 1N5KA 2IS2A 4RTQA 2EAUA 4WESA 2XXJA 4YRBA 3TGPA 4P36A 1O03A 3CZAA 3T1HB 2D6FA 2WHPB 4DANA 3HYNA 3LD9A 1ZIOA 3AJRA 3P2JA 4R6XA 1G8MA 5BR7A 2TMGA 1QRDA 3CSSA 5JI2E 4KKVA 4ZYXA 4MLPA 5J5VA 4DV3B 3F9IA 2RFLA 2NU8B 2DPHA 4S24A 1BAPA 3AVTA 1H4QA 1OWOA 5CLQA 2GD0A 2ZT8A 3RVRA 5JS1A 3JPWA 2Q5FA 4TVBA 3JYQA 1GKIA 4KNWA 1X38A 1TKCA 3HJUA 5BSEA 4IFBA 3IPRA 3BWDD 5C5DA 3BIJA 1KP9A 3LC0A 1MX9A 1YR9A 1PGQA 1YHZA 1FFWA 3OETA 4Y1EA 5ALGA 1S4MA 3W06A 4Y1RB 3D8NA 5JJCA 2NAPA 3T7CA 3DBOB 1XQXA 3LQ4A 5IJ9A 1P5FA 1CWUA 4BNUA 1C4KA 4P86A 4HGZA 4DMKA 5KDDA 1XMQB 2IODA 3Q3IA 1P0PA 2YJ4A 3PSAA 3JCZA 2SHKA 2I9KA 1BRMA 1SVOA 2ZYGA 2HJRA 3C6YA 2ZTUA 1F9EA 3ISJA 3DB1A 1J1UA 4F3CA 1QVRA 3IJEB 4JL5A 2RHTA 3R9WA 2D5LA 5A5VA 4HFJA 1RLOA 2IV3A 3Q9UA 2D7CA 4B76A 2MYNA 2BDUA 1QH1B 4XWKA 1VQ1A 1GVHA 4CMIA 2R8RA 2YV4A 4DBLC 4QASA 3GEGA 4PYJA 3LHIA 3ZHBA 3URMA 2B99A 1E1YA 5IDWA 4BBAA 4IIFA 1N32B 3AOGA 1GV1A 2K4MA 1TB4A 1V8FA 2FEMA 4IZIA 5H02A 1CFJA 5IFKA 5AM1A 4EBBA 5AVQA 4F11A 2Y0BA 4O4HB 4FEAA 1EP3B 3THSA 4G1FA 3BSWA 3X2EA 1TKBA 4PPQA 2AGVA 2ZSIA 4NJOA 1L4EA 4E08A 1KYIA 2AEMA 1SCBA 4D0LB 5BVHB 1EDEA 3HJRA 1FYWA 4Q9KA 2AFHB 3I8XA 5CLHA 3BBPA 1JIVA 4LV5B 3T0GA 3LX5A 3Q8KA 4X63A 1RXYA 3R4CA 1LC3A 1VDZA 4LHSA 3U7HB 1T8PA 3AESB 3VNAA 2R6JA 3ZHSA 3L01A 2NU8A 1ZN8A 2J7PA 1X6VA 5CH8A 3MUOA 4B4KA 4HNVA 5I7UA 5K7SA 1P2DA 5F1KA 4DLSA 3LCVB 1QP4A 4XD7A 3A37A 4IY1A 3GT0A 3H2ZA 1T9GS 3U9SA 4JC0A 3USCS 3MWFA 5JY6A 3W5SA 4KEAA 4GMDA 3SKYA 3V32A 3T7AA 4BPRA 3TQTA 1KEPA 2OAGA 5BOSA 3FDFA 1K27A 2GCNA 4LOAA 5AHWA 2AG1A 5CB0A 1JR6A 1XJWA 3HCOA 4Y1RA 5FA5A 3LXXA 1NE7A 4KOAA 1MA0A 3OF2A 2JDIA 2PZEA 1RCTE 1EBBA 1NUQA 1H2WA 5D3MB 3C24A 1P8AA 2GXUA 5DT9A 1U4OA 3K32A 2OV3A 2R7LA 3VNBA 4AKEA 4EP1A 1J4AA 2OVBA 4HX9A 4ZI5A 1DNPA 1YA8A 3M6XA 4HDOB 5ERGB 1IUKA 2ECQA 1A5AB 1XJ5A 5I4IA 5LMZA 4Q18A 1WZEA 2QRZA 3G1TA 3RFFA 3ZK7A 4DPMA 3ZR4B 3ZLTA 1WZ2A 3U3KA 2IYPA 1U0OC 3O91A 3BK2A 3K6RA 1KZ6A 1QHGA 2OO7A 4QTZA 3HB0A 1KE2A 2Y0PA 3TOXA 2HR1A 1N77A 3WJ2A 1FX0B 3DS8A 5KHAA 1G20E 1N7HA 3SYTA 4AKGA 4FILA 2XODA 5MFZA 3BCHA 2CBZA 1T2EA 1SUEA 2C5FA 2GSWA 2ZB8A 3F5MA 4LMRA 3NBFA 4MV8A 3SOZA 3PPIA 1PL6A 1GRNA 3UJHA 4N40A 2RHRA 2XA1A 4FBGA 4O4HA 4OK5A 4Q4HB 5FF9A 2UUAB 4URVR 3L9XA 3NANA 4QICA 2KLBA 2FU5C 1FLAA 2VPZA 5DRYA 4GQAA 3W2IA 1RHMA 4YGYA 2HNKA 4NULA 1J9EA 3OO1A 2AFHA 4MV9A 5KYGA 1TPYA 2RGDA 4MQ4A 1GQYA 1L5OA 3EYWA 4UNNA 2ZWPA 2CZCA 4W7SA 1D8AA 1K75A 2H0RA 4ZJUA 1EAMA 3AESA 5ALFA 3GJ5A 3KBOA 1TW2A 4QUHA 4RWZA 4IUDS 2Q50A 3ZE0B 1QP0A 2FG5A 1PZHA 1W2GA 1L6RA 4L0MA 5BSWA 5DHSA 5ANRB 1KO5A 4GPD1 2CHVA 2F3UA 2C0PA 2ZWOA 5CDFE 2X14A 1GPDG 3PCTA 3NX4A 4JIMA 1PR0A 3IT2A 2X0FA 4OXIA 4JC8A 3O7MA 1EM6A 3VHXA 3P7MA 1SU6A 4JKYA 2JLQA 1PJ4A 5DISB 3B60A 5DYYA 3AR6A 1JWAB 3IRUA 3EVTA 4JA0A 4XQCA 4RMJA 5T3YA 1P4GA 1LWOA 1OAKA 4HPXB 3R7BA 3NHRA 5LD2C 4KNYA 4UBOA 3A4YA 1EA7A 2QTWB 5D3MA 1F2TB 2GK6A 2CUTA 2JAQA 3VZQA 5TS3A 1QH0A 1HFKA 3E9YA 1WXIA 4F3YA 4U8HA 4F71A 1GP2A 1KDPA 2Y6UA 1TU3A 4MUEA 3SJAA 5JSFA 4KQCA 3GGOA 2ZBFA 4ZC1A 2CDAA 1LBTA 1M6NA 1XVIA 5AKHA 2W5UA 3RKSA 4EZIA 1EVYA 1QO9A 1EB9A 521PA 1YU6A 4BWYA 1U7PA 2HJGA 3C6KA 3ZG6A 2XCQA 1G3MA 1VSUA 4QVGA 3SCZA 4FZ3A 5HPYB 3KQPA 1R6VA 1DVRA 5FOUA 2IOFA 1FX0A 1WZNA 3OFSA 4MS3B 4NLLA 4XUDA 4XYMA 5CJ2A 1T4MA 3VPXA 3E7DA 3UK6A 1HNNA 3AF1A 3EHDA 1V7ZA 2AEEA 2FH5B 4M87A 3H9QA 4O4IB 4R2WA 3EGXB 4ZVSA 2H8GA 1CQJB 4Q4HA 1BGVA 2GA9A 2Z2YA 3D4NA 1IHDA 2EOAA 2X5OA 3FDIA 1HE4A 3DFMA 3IILA 3PQ5A 4J0QA 5J5AA 3U9LA 3AUJB 4OUKX 1JKFA 2ID9A 2WUFA 1T0BA 4LYYA 1YASA 3AX6A 4L73A 3D02A 5IBPA 4BBJA 4DYDA 1FVXA 1Z06A 3KFXA 3OHSX 2ZBEA 2WSBA 3LDUA 3N6RA 1K5GA 4L6IA 1YAHA 4YQYA 3ZD9A 2FZ5A 1GAWA 4EUFA 1E96A 4GLLA 4YIHA 5EP3A 4A26A 3IRVA 1UP7A 1XDZA 2NO7A 2D2VA 1NW7A 2IT1A 4LZLA 2GCOB 1QNFA 2X2EA 4RESA 1YK0A 2GZ3A 3OESA 4L8YA 1XCGB 1TU0A 5DPMA 4C0LA 1Z28A 3TPZA 2JIBA 1W6RA 2X86A 3PQ7A 5CITA 3TBFA 1LPOA 1T3GA 3P96A 4H1UA 2XMGA 1K0FA 4Q7JB 4PZAA 3HFSA 8LDHA 4JA2A 4MUMA 2JIMA 3LA6A 4IGEA 4Y1FA 4PAOA 3G1WA 4RHUA 4CDNA 2OXTA 4NESA 1E5TA 1L5WA 1W29A 3H1TA 3HBNA 2V7XA 4FKBA 3AEKB 4J0KA 4OXRA 4ZAYA 4X24A 4DQKA 4ZDKA 1VG8A 2QL7A 5TGTA 3KZ1E 2VRWA 1W49A 2QOEA 2Q9AA 3F5DA 3IQHX 5AW1A 2WYUA 1ML4A 2ZPAA 3P8ZA 4UE3S 3Q6IA 5EXXA 1RQ7A 5AI5A 1U0BB 1VHLA 3U56A 1S01A 4I9FA 4GL4A 4B4UA 3LLUA 3QELA 4ZKEA 5LZ5A 1XVVA 1M54A 5JTTA 3ELDA 5F21A 2W6OA 1KYXA 3SYLA 1OA1A 1RYZA 4FU0A 4DWOA 2WPDA 1JMKC 1PN3A 4KK3A 1N0VC 2X8WA 4BLWA 1Q17A 3EJWA 1K2VN 4ZZ3A 4F5EA 1WV1A 3EUEA 3AI7A 3K1ZA 3CYFA 4LDNA 4WUTA 4OHKA 2QUJA 4HDQB 4LTNA 4ODIA 1PTJA 1RZUA 4IIEA 4O4IA 3EGXA 4R5HA 1NIPA 3DHVA 3HYCA 5C8YF 1GPUA 2FX3A 3QG1A 2M6RA 5KSYA 3PHCA 3ZU2A 2NQ2C 5D8DA 3JWJA 5DI3B 1Z34A 1WXXA 4YCAA 2Q1XA 1M7BA 5AYVA 4ZV9A 5KJFA 3HVJA 4RZUA 1K1EA 4F2WA 5I7FA 1UADA 1PNOA 5FAKA 3I09A 4FJ1A 4YRNA 1Z5VA 2V7TA 4YCNA 4IRXA 3V4PB 2NUAB 5CFQA 3AR4A 5CLGA 3I6BA 4J1TC 4U00A 3RAPR 1AGPA 3N2IA 3UA4A 1OZGA 3A3KA 3SKXA 3GRZA 4M21A 1VYUA 2ZRFA 4ECAA 3U1BA 1R5NA 3I39X 3E2IA 2OC9A 2WEKA 2OYSA 1H69A 1JA0A 3COPA 1YL7A 4R0MA 3BIWA 4KXFB 5ALXA 3ZHTA 5KC8A 4D79A 1CNMA 1A9SA 3DPUA 3FSJX 3TAHA 1C9DB 1W5EA 3UMBA 4DIKA 4Q7KA 1TA9A 1XTBA 2J0UB 4TV9A 2QU8A 1WF6A 2Q62A 2RD2A 1ZH0A 2X5XA 1JFRA 3CM0A 1YRAA 1I5EA 3AEKA 2FW7A 4DMMA 2ZWAA 3LW7A 2EP7A 3RABA 3QU9A 1PL7A 2OLJA 4MO9A 4LSWA 4RXUA 4YNBA 4AIRA 3WVNA 1ZUWA 4OB6A 3SEZA 3MQ4A 5KREA 4WLUA 4DN6A 2IPMA 5J4VA 3A2NA 1S8OA 2PAAA 3QQPA 3C8ZA 1AGNA 4UEOA 5FR1A 4C4RA 1JYFA 1TYBE 2I2DA 3CBGA 4IDQA 3GJSA 3PVZA 4B4WA 3I3SR 3RS9A 1LPNA 1QFZA 3UWPA 4AO8A 5JXIA 1XCBA 3PNBA 4JFRA 4RKYA 2PXCA 3KXKA 1YDEA 3FWZA 4J7CA 3V2UA 1BXGA 3BGSA 3F2IA 2Q0XA 1WZIA 1C9EA 4Q9NA 5IF9A 1JILA 3B9RA 3MFQA 1CP3A 2ODWA 3OCZA 1NQWA 1VPDA 2NACA 1SHKA 3ICEA 2VLBA 1B8NA 3Q8LA 5EXDA 1D6NA 1FB5A 3NOOA 5CK4A 4RHYA 4Q9JA 5BUZA 5GJCA 4M9XA 4W4TA 4BHTA 5DI3A 1U2QA 3D6UA 2BFOA 2V7PA 4XI9A 5F2OA 3CVJA 4FW9A 4IXWA 3DAFA 3JVUA 2Q6IA 2QTNA 2WSLA 4NV3A 5AOCA 5J1SB 2W2XA 2Q29A 1Z4JA 2CEAA 4X60A 1OH6A 3BICA 4CKXA 3IEVA 2VVTA 3KSRA 3GGSA 3L8YA 2VYVA 4ZU6X 2HEIA 4MEBA 3OOEA 4QUGA 5BV0A 1SC9A 4LXQA 4RFSB 2YKGA 2GVDC 2NUAA 3WIDA 3RRMA 1NUAA 4C89A 1LBQA 2ASEA 4OK6A 3CR3C 3R8XA 4EHNA 3RYFB 1BYIA 4FSXA 5LQRA 2FN9A 1JG1A 4FGKA 2W6JA 4E11A 2L19A 1RAHA 2XECA 1P1BA 1W76A 4WCVA 1QG4A 3AF2A 3RFCA 2Z58A 4WEQA 1D6MA 1I9CA 1H1DA 3NI2A 3BDVA 3WLKX 2G7MC 4AJOA 5FL3A 4PPGA 3T5MA 4LZJA 2GBGA 5DGCA 3S2UA 2R8PA 1YBHA 2AN5A 2VPQA 3L7MA 1SIBE 4IX9A 4Q1CA 1WXHA 1M76A 1Z22A 4M1OA 1ZRMA 2A1IA 5GZ1A 4Q7MB 2I4RA 3X1WA 3C8HA 5KTYA 1JJBA 3BVPA 4U9UA 4E2YA 2I4TA 5MDHA 2P7IA 1L5GB 1RYDA 4UDYX 4BAZA 3M8KA 5FOXA 2MSLA 2AG8A 3SXJA 2WUVA 2J48A 3REGA 4ERXA 3LF1A 4QJ4A 3W6NA 1CBUA 2W48A 3A9WA 3KEMA 4DV1B 1FNNA 1KMNA 1USGA 2YICA 1F7UA 4KXYA 2IZZA 1QRRA 4Q9HA 4RTOA 3ZVNA 1DG9A 3IIEA 4RTSA 1KHTA 3OIVA 3EZYA 1IOLA 2FQXA 1PZNA 2PSEA 2V6GA 3WGUA 1PJTA 1P3DA 1ZM4A 3CUKA 4URYR 1G2IA 5J63A 3VX3A 1JALA 2P6NA 1E5VA 3T8YA 4KI7A 4TOIA 4BE9A 1B41A 4X1IB 4QYXA 5EQJB 2HK7A 2P2CA 1CUGA 1VKZA 1G60A 1KQOA 1XMVA 2P9FA 3FNRA 2IEAA 2CF6A 1WCXA 3PWSA 3MJEA 4TLMB 5TMEA 2W37A 3WBFA 2GVZC 1IVYA 4RFSA 5DW0A 1C29B 3DOUA 4US1R 2PKQP 5ADHA 1SBCA 3FNIA 3EPHA 1PBNA 1MBZA 3PHJA 2YZ7A 1JF8A 3EMDA 5CCXA 3COJA 1BXZA 1NX9A 5ERXA 1RQXA 5C4GB 4GDMA 3TUZC 3ANTA 3V1MA 1JKMA 5E9AA 5FADA 1MO4A 3VOTA 2AVDA 2BGKA 3SC6A 5SYNA 1H23A 4RC9A 4YMLA 3PXDA 3HHEA 2HA5A 4DMUB 3UHFA 3QPVA 1OZAA 3GRUA 3MCZA 1PW7A 2Y1WA 3BCSA 3H86A 1B6RA 1Q3KA 3C1AA 3DAHA 3ZHYA 1TTTA 4KCGA 3L7IA 1XKTA 1JG7A 1UINA 3AZOA 3EARA 3FM9A 3FDZB 3WGNA 4Q6WA 1HYBA 5CPBA 5HUHA 1ADYA 3ZWAA 5FBLB 1VZ3A 5A4DA 3PTZA 1KMQA 1V95A 4X6YA 3ROKA 3T54A 2R44A 3KKPA 2PUHA 4LDAA 2WV7A 1SIWA 2OCYC 1H42A 2R4UA 1JTFA 2Z5LA 3FY4A 5EIAA 2O8BB 3M4ZA 3L84A 2WP8J 1M34B 4MA4A 1LS1A 4XDHA 5F2KA 3UICA 3L8MA 5E95A 5DYTA 2ZWIA 2B9VA 5GJBA 1FFXB 1E2IA 5ESDA 3T9CA 1KA9H 4L7QA 3GRAA 1ZD3A 1CD5A 1G7RA 1N0IA 2J6HA 1IIRA 3L0PA 2X8JB 1U7UA 1QANA 3LXMA 3NUZA 4FXOA 1MJ5A 1Y7IA 4LN1A 4NK5A 5KQLA 2EFGA 4FLFA 1GIAA 4HAYA 2Q7OE 1WPXA 4KQEA 4NOLA 4KVZA 2ZZMA 1R18A 2KHZA 1U0HC 2YJ6A 2ZANA 4GSYA 3WL8A 4BKMA 4BN4A 4DC9A 3KD3A 4M36A 3FFWA 4LFBB 2QDXA 3LP6A 1WBJB 4V3BA 4UNIA 1UL1X 4RV4A 1G291 4O4LF 2V0CA 1UWCA 1IYZA 2AJLI 3E5MA 3U1TA 2P1ZA 3MB8A 1P4SA 3M6VA 3ZXUB 3RJTA 1ITZA 2ZBQA 2RAUA 4LXTA 3EOAI 3WGQA 5EC8A 1AO0A 4MV6A 3IDAA 5DXFA 4NBWA 1KI2A 3DP7A 2A88A 1YZ3A 1KMHB 5DFAA 3DBVO 2HDNB 2VNJA 4AKIA 1SCKA 1KQPA 1K92A 3NKLA 4FLMA 1Q19A 4ITRC 3FI9A 1FSPA 3ZCTA 5KNBA 2ZRMA 2WWRA 4AYXA 4C7JA 3ILSA 1Q95A 1VJCA 1M6YA 4FSHA 3DDUA 4KX3A 4QTYA 1NUPA 3FMPB 4DCSA 1KZ9A 3L0YA 2WTNA 3JASA 1U7WA 4LHEA 4TL7A 1C41A 1J21A 3KK0A 2R8EA 4FGZA 4I1YA 1XLTC 3V3KA 3F7OA 3QPCA 5KYTA 4GBED 2FW0A 3GAFA 1YTLA 2C03A 3NXSA 1UR5A 3FDZA 4KSYA 3ZWQA 1ISJA 1GFSA 1VA4A 3NNSA 4UU7A 1HQDA 5DHFA 3OZTA 1YE5A 3E6AA 3ZVLA 5IMSA 3UAXA 2YXEA 3HXLA 4EIWA 1IJFA 1VPTA 4ZTZB 1DCKA 3DE1X 4K9DA 2J0QA 2EFJA 3SKVA 3EGCA 2VKQA 2SCUB 2Z4RA 3B6MA 1Q1ZA 2O2GA 1SULA 1M34A 3BMCB 4CM3A 1GGHA 4G5OA 4Y2UA 4B6EA 4EFKA 2E49A 1SH7A 3TSZA 3P9YA 4M8LA 1F3OA 4XYLA 1Z0AA 1GG8A 2XMZA 1PT5A 5F4BA 1A9XB 2X8JA 4D9HA 2BTEA 2PX0A 3CLRC 3STYA 2GLUA 1OB5A 4OHFA 1Y7HA 3UKJA 3L8DA 4A36A 1X3LA 5JC8A 5CYOA 1PWHA 2H7CA 4KUHA 3B1VA 1JLKA 2M32A 4RJJA 1YOVB 1G63A 2QQEA 2WIJA 3AJ9A 1TEVA 2F00A 4H4EA 4DWVA 1XPRA 3VPFA 2W2LA 1UODA 3OQHA 3ICWA 3KAQA 4YO8A 3WRYA 3KQNA 3O03A 2AB0A 3IHWA 4Q21A 5HKOA 2WYIA 5U1PA 1EB8A 1VLVA 2CHQA 2JIQA 2QD3A 2GCIA 3NALA 4GMXA 1OLOA 1SM4A 3WFIA 1A1SA 2QGZA 1S2GA 2DY0A 3I92A 3JQ9C 4DBZA 4GKKB 4CN9A 1YJ5A 3TJMA 3DOFA 3HHPA 4TVOA 4JI3B 1DLIA 1RSZA 1Q14A 1I5OA 2C1ZA 3CR7A 2JCXA 3LQFA 2NW6A 1KJZA 4O59O 1KMHA 1NBIA 1DKRA 3GFBA 1XA3A 2WF5A 2Q3MA 4V2UA 1PVDA 1L4HA 1IEVA 4KYVA 4M89A 3GJXC 2ZTMA 4RF5A 2EG5A 4HQKA 5T4EA 5BMVA 5HZHA 4K1XA 1YRWA 5BSMA 1PF7E 2JFWA 3Q9NA 4G5QA 4B3GA 4M0LA 3ET5A 1Z5NA 2D00A 2GILA 4HEA6 1SG0A 2QTFA 4N18A 1YBFA 1H2XA 3KDPA 4FMPA 4O2BF 2YRWA 1KHHA 3QNWA 2VJMB 4OOEA 5F1OA 3ZQ6A 2OL4A 4FJ2A 2HREA 1Z6PA 2HRQA 3OM1A 4D4GA 4XLZA 2CXHA 2QI9C 3RVDA 1P0FA 3OC6A 3V8VA 2NV0A 3NO4A 2R6ZA 3AB3A 3RG2A 5ELLA 5A9RA 3ITDA 1LPSA 5C1DA 3G17A 5FEUA 1P80A 4K2AA 4KGXA 1ODIA 2Y2VA 3FRHA 2SCUA 4WCDA 3CURA 2Z56A 3BMCA 2RGAA 3UUEA 1E60A 4MTCA 4XH9B 1ZGJA 4BLPA 1YE8A 3DLCA 4L2IA 4DM7A 4X65B 4ZCSA 3K30A 2A58A 2BZSA 4QUJA 2XUQA 4LC0A 4NZYA 1IXRC 4U2DA 1AUQA 3QFRA 1DZ3A 1GA4A 1ZR4A 1XP5A 4XJTA 2VNSA 3LT0A 5K45A 3IT0A 2FVXA 1LDMA 2H85A 1O87A 3MUFA 1DL5A 2LRHA 4F93B 3JR3A 1WRBA 2OCDA 2J0VA 4FNGA 5FUWA 5BWNA 4YLGA 3FPFA 1JR3E 2BFWA 1H0SA 1YOVA 2JIZA 5EQDA 4DLAA 1NHWA 4PZCA 5K4AA 1U0LA 2AOUB 4W5OA 4ZGBA 1N2JA 4XB2A 4CM7A 3H6KA 3GJ7A 2ZPTX 2O8DB 1Z29A 1QNLA 1TC1A 5JNTA 1G4AE 1G6HA 2JI8A 1ONNA 3EZFA 4ZVVA 3T1TA 4GW3A 3CX6A 5MFPA 3HFGA 3IUSA 2QSYA 3SI7A 3RC1A 4YRMA 3VZBA 4B09A 2D3TA 1KJQA 2ALJA 4KQ9A 5A06A 2HF2A 5C4MA 5IM4F 2NP7A 4TL8A 3RBXA 1DBRA 1G64A 3SQLA 5CLJA 4F4UA 1S02A 4PCVA 2IOHA 3UN1A 1N57A 1NVEA 1EVZA 1QZXA 2OP0A 5EHQA 4PXAA 1P1RA 4CM1A 2FNAA 4MJ7A 4LE0A 3V1NA 2OZPA 2YVAA 3C6XA 3CXUA 3PQ2A 1U2ZA 1ILWA 3GFTA 3A9SA 4UNQA 3A6JA 3JYLA 4ETIA 1A82A 3FZGA 4X9XA 4BU1A 1Q22A 3CV3A 1SIOA 1ISFA 2RKOA 3F1KA 3BH6A 3WOVA 2GKSA 4G3XA 3VC7A 2WI8A 4MWEA 5FI0B 1ZU5A 4WAUA 3LKDA 5C5IA 2PRZA 4ZT6A 1PQPA 4ZYZA 5KKNB 1R8QA 4I2VA 1KS9A 1UBLS 1XBTA 2H63A 4MQFB 1SOWA 2BR4A 3B7PA 1SUIA 2MSNA 3DULA 2O1XA 5JCOA 3SLGA 4R69A 3WHIA 3JZDA 4PTZA 3V46A 2Z1MA 1N36B 1OF1A 3RGGA 4U63A 1ESNA 2BHSA 4XYBA 3BJIC 4RPIA 4PLHA 5CB6A 2XD9A 2XAUA 3OTOB 1HG0A 1PLKA 1RWNA 2G5GX 4QPCA 3AVQA 1AGRA 4LS3A 3ZHQA 3EASA 1CR4A 1XRMA 1ZIXA 1QIDA 2CVPA 5FV7A 2RBEA 1YCFA 1Y9DA 1F1BA 3A11A 3A3YA 4IIDA 4RX1A 5JBIA 4GI5A 4HY3A 4GX0A 2PG3A 3AY7A 3K0BA 3IEKA 1B6GA 1EWTA 3KR2A 2AOUA 4P3PA 3VSBA 1U5AA 3L4BA 1M9NA 4LJ5A 4KZPA 1IOZA 3RIXA 2C8KA 1X7XB 4DJ5X 4KQHA 4HVCA 3IAS6 2J3QA 3KJGA 1I2CA 3B1KA 2NMVA 2O8DA 2HPAA 3KNZA 1EUQA 1SZJG 1JR4A 1B0ZA 3TZCA 3V7FA 1D5CA 2GEUA 3IUJA 2ZJ4A 1JTEA 1LZKA 3P1JA 2R79A 4IH9A 5HF6A 1XRQA 4EO9A 2JLBA 4FDUA 1PBTA 3VGPA 3WDLA 4LIPD 5JQGF 3ZHZA 4TTRA 1P33A 2FPPB 2I1VB 2GN1A 3JU3A 5KTRA 2FZLA 4M54A 4EUKA 4MHTA 1DDGA 1XK6A 2B8EA 4Z5XA 5GQSA 5B7GA 4Y8VA 3DE0X 2WF9A 3RVPA 1CUSA 3CRNA 2BTQB 3F5QA 4RY2A 3SX4A 2XA2A 2FKAA 1HMPA 4V03A 4ZQIA 4B85A 2K2QB 2NZYA 2PRKA 4FC7A 4PINA 4QL3A 4XJVA 1OILA 3VHLB 5IZCA 1GDHA 3LCCA 4KXVA 1D6SA 3ES9A 4QOGA 3R5TA 1D2GA 1BMDA 1RHUA 2C98A 2H7XA 3HB9A 4JLUA 1A5ZA 5DWDA 1TZKA 1QCYA 2LBPA 5EE9A 4E14A 4KRFA 3GP5A 4CTOA 1V11B 2QRVB 4IUBS 1UBFA 4MQFA 3SJ7A 1CVRA 3PUZA 3ZQKA 5BV8A 1P60A 2MMGA 2IXTA 1MNQA 3L8FA 3TKYA 4XDGA 3D7SA 3I01M 3LVBA 4L9AA 4QDKA 2W6ID 3OFVA 4JI1B 1EE1A 4RPGA 4Q12A 1Q1EA 1Q7CA 2ZIXA 4YDHB 5EJEA 4DR2B 4C07A 4BCDA 1QDEA 2KBEA 1UBNA 1X1TA 3CPHA 4UC0A 1PKXA 2N1BA 4HXGA 5JISA 1T3LA 3G0CA 3RHTA 5KVAA 4IG4A 1Q1QA 2PSSA 2ZIZA 4MAMA 2XE8A 1K7SN 4NR0A 2WYVA 3WYNA 1NBMD 5SZIA 2FLKA 3KTFA 4GRIA 4BJHB 1MZPA 2PMKA 3HXPA 2CHFA 2ATXA 5DGTA 2VUHB 4HZIA 2CFSA 3HUEA 5I4KA 2FRDC 2GMWA 1NR1A 3EN0A 4HATA 1A5TA 2RGNA 1UBMS 2RMKA 1V37A 4NPAA 3D2CA 4UHEA 5IEJA 3FLAA 2XY4A 2BW0A 2RAPA 3OOSA 2P68A 5L4LA 3RUCA 1M0EA 2VR1A 1E7SA 4A0HA 3DC2A 4KBFA 3CT4A 5IDVA 1IBRA 2NU6B 2Y92A 2H54A 3ABZA 4N39A 4RZ2A 3UWKA 1NLYA 1U7OA 1RE0A 4FNMA 2DPGA 5JALA 1G0NA 2CLOB 4JQYA 5AFSA 4ZT4A 1T25A 1T36A 4OXXA 2RGWA 4FYHA 4IDCA 4PRZA 1ZJJA 4G26A 5JOQA 1XWWA 2G17A 1JDBB 1C80A 3Q9LA 4HNQA 3LK7A 4TTIA 1ESMA 3PQ6A 1XKLA 2YJ5A 1KAMA 1F0KA 2PFGA 3KWJA 3MOGA 1TD1A 1R50A 3C3BA 2O1EA 3A25A 2R8ZA 3O3NB 1M2WA 4ALMA 5BUCA 1OU0A 1OFGA 4QHYA 1HT0A 3LBHA 1V11A 1XQ6A 1EJ0A 1NYQA 5KS2A 4OHCA 4Z4CA 1E6CA 3V33A 5ALZA 1G5IA 4HWOA 2QI9F 1RWXA 3HK2A 4HMPA 1EJ2A 2RBGA 1UZUA 2GPNA 3N2KB 5CFOA 1P0IA 1U9CA 1FDOA 1E4OA 4KUEA 4AJIA 2JGMA 5AH0A 3BEOA 4OHOA 4MEJA 2FN4A 3ROGA 2HT6A 1IE3A 2C3MA 4KO2S 4PO3X 2HPVA 2AFIB 2HYDA 1C30B 3MG9A 4KVAA 2COEA 4PYIA 4UNSA 5ALQA 4B87A 4W9NA 3O1LA 2RCYA 2QRPA 4PQYA 5JMWA 2W2OA 2ZJ3A 3AH8A 2ZTVA 4N49A 4W5WA 2CFRA 3RYIA 4EHAA 5FFMA 1NN0A 1E3SA 4HEHA 1SXJC 2XBUA 1P1KA 4UNPA 3B20A 4G0UA 3BTSA 3F0TA 4GYJA 4C04A 3SDZA 1PJ8A 1T3ZA 2G70A 5F35A 3O92A 5LUAA 4A16A 1WP9A 3IAHA 4JQZA 4HQRA 4ZDIA 1RBZA 2B2NA 1QP7A 2P9QA 5D7NA 4EMBA 1YZLA 3D4IA 4PQGA 3HRHA 3I4CA 3J80A 1EVJA 1FXSA 1VJ0A 1NI4B 2P62A 3DAPA 5CX1B 2W83A 5AM3A 2WM9B 2IBTA 3IAEA 4JC4A 1YQWA 2NU6A 4AY5A 1RXUA 4D0NA 3ZTWA 5AI9A 1UT8A 5ICGA 3TMYA 4EUHA 4D6YA 4ESVA 1GFWA 3BC1A 2BEVB 2ZJOA 3TRDA 4QJBA 2D62A 5MF6A 4DA6A 2OBMA 3E5NA 3PDHA 5BO5A 2Q6KA 5CBPB 4PWZA 4YRLA 4PCUA 1SBNE 2AV6A 5BRNA 4ARBA 4OSEA 3MTJA 3CS3A 5F1YA 4IIBA 2I6UA 3FHTA 3DMNA 4XR9A 3LDFA 4YO7A 3F5SA 4C87A 5K4GA 5ECDA 3BGWA 3WB2A 3EVAA 4DIEA 1GZHB 3EZ2A 3FYDA 5D87A 3WO0A 3R3ZA 4C7VA 4HH0A 3RYCB 1ZHOA 2C9OA 1NY6A 2IYRA 3SHTA 4CQLB 3VTZA 3W4KA 2EDAA 5BNZA 3N2KA 4N0DA 4OHVA 3RC3A 5J58A 3FA2A 3H4TA 4IHJB 3DVRX 4V0OA 1FFCA 4D96A 4BTVA 2JVKA 4M1EA 2AFIA 1G6Q1 1C30A 5B2ZA 3VPSA 4MS1B 4JQSA 4XDYA 3HJBA 1U8UA 2C1XA 1U0SY 1R3UA 1Z8NA 2HLNA 3DNPA 1MPXA 1FQWA 1QV7A 2QXUA 1L4KA 3TLAA 2Q2VA 5B3KA 2IY7A 3TIGA 3MRSA 4YUZA 2SKCA 3LO5A 4L5JA 2FWIA 4N4AA 3S3TA 3L6UA 3M6MD 5DOVA 2ISSD 1RM4A 2FFQA 1MP0A 1ZP6A 2WHRA 3EQ2A 3FRIA 5AKLA 4DARA 1OIXA 4PLPA 4BE4A 1HUQA 1RYFA 2CHGA 1NZDA 4HN9A 4GYYA 1WCIB 3O26A 3E8XA 4JELA 4HNSA 5H59A 1E6UA 1JI0A 1VHQA 1XTVA 3KLPX 4LY6A 5CX1A 3RT9A 1NI4A 1JTVA 4B5LA 4CL8A 2ZBDA 1HR0B 3QPAA 5LMNB 3RI3A 3O6VA 4DCCA 4WEOA 2V4UA 5CVJA 1G41A 1EBUA 1FBTA 1JBEA 2BEVA 3T3HA 4DHWA 1LFDB 2YW9A 2HUNA 3I8SA 5CDUA 1O95A 1JDVA 2OE2A 4F2GA 3K4QA 3CZ9A 5CBPA 1NRJB 5HX7A 3DE5X 3WNVA 1T1JA 1E89A 1VG1A 3G5AA 3O4VA 2Q5CA 4FSDA 4IIJB 2JAOA 4Q9AA 1GL6A 4HGOA 3X1JA 4HAOA 1YFLA 3Q7SA 4QQFA 1O0SA 1JAIA 3BTOA 2HHLA 3MUEA 1YVPA 4X3CA 3HA2A 4UU8A 2OA0A 2QV7A 4IGAA 5TE9A 3I76A 2W11A 4LOIA 2ZI3A 3CX4A 4ZQFA 2DQSA 3VPBA 3RYCA 2D7DA 2CKMA 4Z4QA 2IEDA 3QE2A 1YVRA 1O1YA 2DF8A 2OZVA 3K4HA 1T3HA 4OSPA 4Y2YA 3VU1A 4CQLA 1DWUA 1QM5A 4YRGA 1XF1A 1ZXBA 2ECOA 2O23A 2ZQYA 3A27A 3BF7A 3EIFA 3K5PA 1AKTA 4IHJA 4Z53A 3TF5A 1FTWA 4YMGA 2FV8A 3BRWA 2PGAA 3H7IA 1YU9A 5A4JA 4DHEA 2B1GA 1ANKA 2PQMA 2RK3A 3EF3A 4MS1A 4GGMX 1VJTA 1SHJA 2J9GA 5A9SA 1RRFA 1GPYA 1LNQA 1MTOA 1Q3TA 1XYYA 5DVZA 5AD1A 5L9AA 3ROPA 4DA8A 5B1YA 2BN4A 1DOHA 1DRVA 1B6SA 4DWWA 4ENQA 3QYFA 1XZAA 1DARA 1DO2A 3FVRA 3ZDZB 3WIVA 1JFVA 3DTYA 1KR5A 1RI2A 1VXOA 3QEMB 3N2GB 2NZJA 1ORVA 3O4JA 4R40A 3OCUA 4WBXC 5B55A 1RC8A 5JH7B 3GLHE 3DGEC 1WCIA 3PUVA 3A36A 2OXRA 1CJBA 1PTJC 2CBXA 2F1JA 2HF8A 1H9AA 1YS7A 1GU7A 3DHWC 4GMKA 4K6OA 3VQTA 4I99A 3WMEA 2REXB 4DYHA 4XVQA 3SYMA 1WW3A 3JW8A 2A5DA 4GPEA 2CB9A 2GETA 2RH9B 1JSXA 3CH5A 4WX2B 1FZTA 2MTBA 3DTVB 4LGMA 5ARCA 5HGXA 1DGQA 3NYWA 3L0IB 2AKEA 2NZVG 2WIKA 1ZCJA 4ARIA 2UYQA 2C2YA 1VG9B 5LL6P 4S1WA 1XNHA 3DF7A 3ZWDA 4FDMA 5KDOA 2X13A 1KOFA 4RPKA 5ALIA 1RADA 1DWOA 1RTTA 1E1MA 3LUJA 1MH9A 4I1UA 3A1FA 3N2ZB 1OX4B 1E2MA 3EZ6A 3F78A 5LIPA 4OQEA 2IHVA 3RRBA 1P2VA 4PR3A 1SBQA 4WBNF 4DDKA 1RHQA 2MDTA 2COUA 1O4VA 1XHFA 1XU7A 1T24A 1MW8X 2QL6A 3H5IA 1WR8A 2E5LB 4Z7NB 1W94A 3CNQS 3ZHCA 1SPXA 2X4DA 5AVJA 1E3IA 2J9YB 5SV2A 5KWJA 1EGMB 4P5EA 4BZXA 2RHBA 4GF5A 4IS3A 2AUMA 4Q9IA 4ZVNA 4MEAA 1Q7RA 3O8OB 4HRYA 4EKNB 3TXXA 1KJWA 2IOYA 4R0VA 4RD6A 3LJKA 5EUBA 2G04A 2MIIA 3VZPA 2FE4A 3K9GA 2H1WA 1II9A 1E6EA 1EBFA 1P72A 2DR2A 4WPGA 2XUAA 4HADA 1AMUA 3NEJA 2ZJ8A 4ZEXA 1VPLA 4AXBA 1K89A 3K9FC 3BHMA 2PH1A 2OM2A 1ZSNA 1DRUA 3CTPA 3B3AA 3KVYA 2HLDA 4D0RA 4PEVA 3PU6A 1ZXLA 3RSHA 1MAUA 2BUBA 3N2GA 1OBOA 3QEMA 1GZSA 1G5TA 4U9IS 2IYUA 2O6HA 2BH2A 1JIXA 2I4MA 5LWQA 3PRYA 2CMGA 3PC6A 2X0EA 2QBYA 2AIRA 1FFEA 1Z4OA 3AHFA 3D3QA 2JAUA 2FZKA 3PQDA 4HI0E 4OQQA 1R4MA 3D64A 4I3HA 1Y5IA 3GLVA 4CKCB 3BKXA 4BLOA 3NVMB 4IEEA 1BSVA 2PX3A 3GP3A 4TLEA 4Y6PA 3T7JA 4MITA 3W5VA 1TYEB 3I04M 3RKRA 1T6BY 4ZT7A 5DULA 4YUXA 3AOEC 3G9QA 2OHHA 3SF0A 4I5EA 1G3RA 1ORHA 3G2QA 3O9VA 3MINB 4Z2YA 3RVJA 3DAYA 5DGDA 3MGCA 4C5BA 5BURA 4NFLA 3FYUC 2P9CA 1F0YA 1BCSA 3DOCA 3IKMB 1L4BA 1OX4A 1AKWA 1X2BA 5JJKA 4AMYA 3QQ5A 5JATA 4WK0B 2X42A 1HKUA 4WKPA 4OYHA 4U2BA 3VMMA 4JOQA 4EHJA 5F9MA 3NHWA 3AIIA 3G0DA 1IZ7A 3JRNA 3TTWA 3WLLA 1UEJA 1CUYA 3FUTA 4KO4S 2WU1A 3K1AB 1NBHA 2NVWA 4K9NA 1MENA 4MOWA 5HWSA 1USVA 2FZCA 1SD2A 2HBYA 3KJHA 1U31A 4RENA 1SOAA 4CUJA 3ETCA 3EC7A 3O8OA 4ND4A 4NVRA 3SP1A 3PSHA 1HV8A 3ASZA 1FS4A 1N3BA 2JIPA 1SXJD 3OKPA 4DQVA 3WI7A 4HVLA 3L79A 1KI6B 5ICCA 5ITVA 3I0ZA 4D2IA 1TZCA 1Y42X 3RIYA 5IJAA 4DNOA 1QK5A 3L4KA 1VMIA 3L6RA 1ZCAA 2IP2A 1VYTA 2C2OA 4QHTA 2CNBA 3K16A 2AOVA 4BAGA 4DIBA 2DR3A 1TAGA 2OZEA 3KQTA 5HM8A 3R4VA 9ABPA 2WKWA 3ZI4A 1S8AA 1BHO1 2HA6A 2OBFA 1BKYA 4JBWA 5COQA 3OVMA 3EC2A 2ZTSA 1U02A 1YC5A 1ULHA 1GSIA 3L07A 3RK4A 4E4RA 3UAVA 2P9ZA 1UPXA 3A6EA 4WASA 1QLHA 5L3QB 4RTRA 1SZPA 5H8WA 2VF5X 1DAIA 1U11A 4O4JB 2YWJA 5FA8A 4LGCA 4YRKA 1A2OA 1B4DA 4CKCA 2WJYA 3N0WA 4DJDC 2BGNA 1L7OA 4TXHA 5FNVB 1AS0A 1WMFA 3OJFA 4GIBA 2O57A 2G3YA 1U1EA 3JQ6A 4G07A 5DLQC 5BQ3A 4ZVPA 3ND9A 4IYJA 4RWEA 3PX2A 1V4NA 2VP3A 3OCCA 4H16A 2ZIVB 1KK1A 3EBOA 4NECA 5KWEA 1ZI9A 2FSUA 3MINA 2NXWA 1WULS 1RAGA 1RC1A 3M9LA 5TV2A 3LRXA 4GZ5A 1P5ZB 4RKWA 2PGJA 1JQAA 3C14C 2YZNA 4D42A 1O0CA 1P2GA 4I8DA 2CNLA 4YJ2B 3WYBA 1RKXA 2ZRKA 3IALA 2WJ6A 1OAAA 3AB8A 3RRXA 4EDFA 2ZQ5A 3IPCA 5BWOA 4W8GA 2FPXA 2JFHA 1ZM9A 3R6GA 4KXNA 1WXDA 4PHTA 3K1AA 3VR0A 5TGDA 4NZPA 4HB4A 1VRWA 2OXEA 1JEQA 4LTMA 4GT1A 3RRFA 3ENZA 1JJ7A 3EVGA 1OR8A 4GX2A 1PX2A 4DGSA 3E4CA 4XTRA 1LSUA 3VGJA 4EGJA 1FQKA 3FTFA 1VPVA 5CNIA 1KI6A 4D9JA 2DY1A 2NNWB 4WL0A 2BFAA 4CMBA 1X8JA 4BGEA 4HLDA 1KIAA 3KYBA 3G23A 1SHLA 2CMKA 2FEKA 1UJNA 2E89A 2YHBA 1XEXB 4G67A 4Y9TA 1HL3A 1YRYE 5I7HA 2WV9A 2IU6A 4MWZA 1FDSA 5ALNA 2G5TA 1DIBA 1R6DA 1Z0IA 1HURA 2XUHA 1YB7A 3ECSA 4NBNA 3RROA 2XVMA 4OBBA 2E21A 1WQ1R 1MEOA 1YVDA 2OK8A 4MVJF 5ELMA 5C32A 1N5OX 2NYUA 1NJ8A 2AI2A 1YS1X 4JS0A 4MYCA 2A9OA 1W9MA 3GH3A 5L3QA 5EJ4A 1DAPA 3EWNA 3OA0A 3GA7A 3Q15C 3TWOA 4O4JA 3ETGA 3I1JA 4H1TA 3TQSA 3IBCA 2D1SA 2H7VA 3CX8A 3NBQA 2WJPA 1Z6QA 3V4RA 3GEPA 1AKNA 3KWFA 4NAUA 5FNVA 2XT6A 5SY6A 1YJXA 4GZLA 2BFMA 3BILA 3C6QA 3N86A 1CT9A 1IBCA 4MW4A 5CGZA 1EK1A 5B53A 5K2MA 2PUAA 3HNPA 5T4FA 4QM7A 2IPOA 2XRFA 4DDWA 1NMXA 1L1RA 3THYB 2YIJA 5FL7D 4J76A 1F12A 1U3CA 3K1TA 2ZUDA 3FROA 3QPWA 3LPNA 3A2KA 3LUFA 3G0HA 4YJ2A 3GBPA 1AK2A 1WOMA 1Y81A 4FFLA 4OLFA 2TMYA 4JAVC 3E53A 1NNLA 4HDCA 2BKVA 4MULA 3O95A 2QRQA 2FQYA 2YQ5A 1DDOA 3O1IC 3LHFA 4Y2PA 3G2PA 5EKUA 1HO3A 1I0ZA 1T5LA 3NG1A 4BQQA 1OFVA 2H3HA 3P19A 4Q39A 1XZKA 4N8EA 1ZCFA 2JGEA 4DBVO 5KWVA 3PLAE 3OPMA 3JQAD 3O82A 1CRQA 4ZQBA 4DLNA 4W1PA 3EIWA 2Q3HA 1P39A 2O06A 1KYTA 3OM8A 4MVJD 4DS3A 3VKWA 3OIYA 4IGKA 4YJ3F 3WMGA 1LDYA 1R5OA 4GLJA 1CZOA 3D6MA 3JZFA 4PAQA 5CH5A 4ZCTA 3ESQA 3SQDA 3WLQA 1F48A 4KIFA 2P27A 3BZUA 2A5YB 4CM8A 5KYYB 3ZJVA 2BLNA 1KFKB 1U8FO 3IJPA 2YVLA 1C0EA 4BNDA 1T13A 3E27A 2DHEA 1T0HB 4CLHA 5I9NA 4Q1BA 4U7HA 1WIWA 3AINA 1JG6A 3R7LA 1JRLA 3LG2A 5C52B 2ZCVA 4I55F 4N7JA 2WU0A 1GPBA 3GDGA 3H99A 5J2UB 4BDSA 1QRUA 5L3ZA 4AY2A 1UBRS 5FIUA 4RK1A 5JNRA 4ZZ0A 1XTZA 2YTZA 3B53X 1U3GA 3NT2A 5IFLA 1RBQA 1WZUA 4PICA 1ZIYA 2HA4A 4JBXA 4UUPA 4WKBA 4DR4B 2EHDA 4ASUD 3SEAA 5JANA 4GLOA 2XDYA 2BCGY 4L3OA 1OV4A 1S2LA 3C41J 2Q9UA 5M34A 2JZCA 2QKYA 2Z83A 3LC1O 1NQVA 2DLCX 2C29D 1XXHB 1Z0KA 1N92A 4EB6B 5LP6B 1RMTA 3IT1A 3O3MB 4KMMA 4GGPA 3HDJA 3IO3A 4M38A 4DLLA 5ALHA 3AVUA 1ZI8A 1FRFS 3QITA 1O6FA 3UGJA 3THYA 4Q1FA 5C1BA 3QKTA 3G68A 4PSVA 3B82A 3QVUA 5IDYA 5FYDA 4D9NA 1VYVA 2PX5A 2CXUA 3KSDO 4LJYA 2GKOA 5IYZF 3SZOA 4BO9A 3HYRA 3UKDA 2EFEB 4IX1A 5AUPB 4H0NA 4RLSA 1IQRA 2QX4A 3EZXA 1Z5WA 1QQ5A 3PKIA 4N6NA 4YCCA 2VPTA 5DTQA 4BIMA 3MT9A 4AZ0A 1V3UA 4P5PA 3JQQA 1HLPA 2BV3A 3EGDB 5GPBA 1L7AA 1F1JA 3PFBA 4BNXA 5LYJF 5CNJA 4I4CA 3THXB 2J0SA 1C1XA 1DX4A 1W0KD 3T3IA 3A9UA 1HFEL 4L5BA 2PL3A 6PFKA 4LF4B 2PJDA 3CB4A 5FPYA 1NW5A 1RQRA 2NO5A 5LXTF 1I24A 4ZI7F 2QSUA 2FY8A 3DE3X 4BTLA 3T7EA 1JQLB 5FI5A 4BJ6A 1T26A 2IHNA 2VPIA 3SS7X 2O5CA 2VZ0A 3DDCA 1W88B 1WLYA 2NSHA 5H9VA 3ZCPA 1QK4A 3NNDA 3IT3A 3K8YA 3U44B 2BLLA 1EWKA 3UT6A 3VSAA 4LHVA 3W2EA 3I9V6 4ILEA 3UQZA 5EJ6A 5I47A 2IUUA 5J2UA 4KZKA 4PC3A 3RYHB 4GGOA 4DMLA 4OB8A 5C4IA 2PANA 3HSSA 1JA1A 3A26A 4G4SO 1ZVVA 1YTUA 3KZMA 1P2BA 4LKRA 1SQFA 1UJBA 4OXQA 2PGNA 2QT9A 3D0OA 4L1KA 4DJAA 5ILOA 2HHJA 3K9LA 2CJWA 3JSXA 3R0IA 5KTOA 1KDTA 4R6WA 5ALLA 5F33A 1T8SA 3W2TA 4FM9A 2FP4B 3CF2A 3RVBA 2N9UA 1ACJA 1PJAA 3P71T 3QKUA 4MRAA 3V97A 2DFDA 3VYVA 4FYPA 5KINB 4PG6A 1Y8QB 1XXHA 3C5VA 4IIXA 4QPJC 2FDXA 4EB6A 2FF5A 1H3NA 5IK2D 1DIOB 1QFJA 2JGDA 5HVNA 2C82A 1L4NA 1QQ6A 1ZUNB 2QUBA 1WP4A 3PR1A 4M7OA 4CU5A 4ER0A 3PTAA 3TN7A 1CRWG 1YA4A 3AB7A 3HY6A 4N5DA 1J49A 2BWJA 3S2IA 3JZMA 4FS8A 4AVYA 4G09A 5EMHA 1ESCA 2H1RA 4D9CA 1CQPA 3WRXC 1G18A 1NYLA 2F8MA 4L4UA 1ZU4A 3EZ7A 2AG5A 4YRRA 5I7OA 1E77A 2AZ4A 3VU9B 1A9TA 1EK5A 5I01A 5E7QA 1PJRA 2G0AA 2QRNA 2QSZA 2OR3A 1XJCA 3DAOA 3LT2A 3U61B 1QVAA 3GQBA 1IZ9A 2N1MA 4B3IA 3BEDA 3VR3D 2BF4A 2ORVA 3ZYZA 9ATCA 2PJRA 1K06A 1GTZA 2ZUUA 3S8YA 3BD8A 4X6UA 2BHRA 4NF2A 5D5QA 3P9KA 4S1TA 1U0RA 1Q0LA 3ML1A 3PD7A 4LZPA 2C5BA 3L4SO 3W3AA 1Z2CA 4UTZA 4Y2QA 1C9MA 5D00A 5F5LA 4EFDA 4LRUA 3INNA 1V2GA 5DEIA 4D8UA 4XCQA 1TU4A 1PJLA 2V6BA 3UIEA 3X1XA 1I3KA 1IHOA 2P8SA 2UZ1B 3IYLW 1LBIA 4ALIA 2C31A 1QZUA 3Q0TA 1I7PA 1TT5B 1W88A 3ILYA 3IKJA 3F8TA 1M1NB 5BNTA 3A4MA 2YWGA 4B17A 1RFGE 2WM3A 3U44A 2CCKA 2P6RA 3HH8A 4R3NA 4LXHA 4P3XA 2CL7X 2CHUA 1N0WA 2BSAA 1O94A 4JCCA 4JWTA 1DKOA 1WUYA 4TQ9A 1DINA 1MAAA 4X8LA 3R0JA 2H1VA 2QJOA 3FVTA 3MWJA 5GJWC 1OA0A 1P0MA 4EFMA 4HGNA 3DA8A 3DCIA 3OAAA 2PS0A 3HJNA 3NBZC 4R8RA 1J0XO 2NZUG 4Q4AB 4E03A 3UH0A 3RF7A 2BBTA 4C0AC 3NH6A 3GCZA 5DBGA 4QDZA 2AQHA 3K0AA 4KK4A 4LVCA 1I1QB 1G8HA 3NORA 5AW0A 4K8OA 2FP4A 3DV0B 4F8YA 1EP1B 4RTMA 3CBQA 1V3TA 1KI4A 4D7AA 1KFJB 3EAFA 3OEYA 3HI4A 4EJ0A 3WGYA 4JXXA 1OI4A 1Y8QA 2FCAA 3DEAA 4PYMA 5JASA 5F98A 1JV2B 3ZU4A 1QZTA 1ZUNA 1KEKA 3FTEA 4OL0A 5DJ5A 5FWNA 2P2YA 2GT1A 4DQ0A 3N2EA 3HPQA 1DELA 3WKEA 4EPYA 2X8LA 3OH8A 3CNBA 4IP0A 3NHZA 4AWXA 1R0XA 4MDHA 4F84A 3SZLA 3PPVA 2IU0A 3KEFA 2YS7A 3VU9A 2JKZA 4B6JA 1EUCB 5EGSA 2CL5A 5LQUA 1NXSA 3WTCA 2J09A 1MB3A 4PQFA 2JI9A 3A0UA 3LF2A 5C7IO 1YCGA 1I30A 3DDWA 2VCEA 4LK3A 5JNVA 4W5NA 4IG9A 4ZAGA 1KERA 1NJSA 1BWSA 4OU5A 2GD6A 1S7GA 3MZ0A 1QH8A 2VHVA 1KMIY 1PU2A 3ASUA 3TS1A 4REQB 3PPWA 1E61A 3IC5A 1GNRA 5A1JA 5A05A 2O8CB 5TVKA 1F8XA 1L4FA 3V8NA 1P44A 3EFOA 3C48A 2EXXA 4UMDA 2QAGC 2UZ1A 3MJRA 5DNDA 1JEYA 3C5HA 2D74A 4KPUB 3OC0A 3WGKA 4YAKA 5JNUA 3SLKA 4EFNA 1TT5A 3JQFC 2W6CX 4RABA 4HZUB 1M1NA 1YMUA 2FQ1A 3A6ZA 3F2VA 4QQ8A 1POWA 3T5DA 2G63A 4C0HA 5E8RA 2F3RA 4KQIA 5H3LA 4CF5A 4D3FA 1CEXA 1M10A 1NIJA 1PG0A 2DWOA 2IZ1A 1T29A 1URPA 2GOYA 3H5AA 1K3FA 3P9PA 4U4AA 4X95A 5GGXA 5THXA 3UPUA 1B26A 1EYZA 2ATEA 2QU7A 3RJ5A 3ZWCA 1KZHA 4JLMA 4KQFA 4Q4AA 1Z7EA 4BP8A 4FCWA 4A8TA 3A9CA 4GPAA 3IIMA 3AONB 4LYJA 1UKAA 2A0KA 1ID8A 1SUAA 2IGBA 2W8ZA 1ZMTA 2JZNA 5AVTA 2B25A 5JZ9A 3B9QA 2XGOA 1SFRA 2ORYA 3G59A 3HRIA 2VL7A 3L6EA 3H1GA 3NOXA 2LE0A 4O6VA 2XIJA 4YRTA 4ESHA 3LP5A 1RLMA 5JVDF 3THWB 2AOXA 1UOEA 1U2PA 2IYXA 2ZB4A 4KN6A 4KBGA 4Z8XA 1JIUA 4G6ZA 1O54A 4ZTUB 1KYVA 5JS6A 3ND6A 4O0LA 3KALA 5GWXA 2M6LA 2HIGA 3U4DA 4LOKA 3ZDEA 2BP7A 4AJJA 2JA2A 2Y66A 3DP9A 3K8ZA 3Q0IA 3CT6A 2XNCA 4X1OA 5JPIA 5B1SA 2RGNC 2IUFA 4AN4A 4Y2RA 1AM4D 3RR2A 5JE8A 4JR2A 4KWEA 1CHNA 2FR0A 4ENSA 1EUCA 2ODAA 2D5BA 3OCVA 2HL6A 4DLUA 4M0PA 4NYIQ 1V16B 3O8RA 1Y8CA 3PR3A 1BJTA 4DLZA 3QX8A 4G0YA 4IV8A 1JJFA 4OHWA 5DF1A 1OPXA 2HA0A 1L5MA 3H9UA 1MU0A 5KOYA 4DDHA 2XCUA 4CEHB 1ZJ4A 3M0EA 4M55A 2EWMA 2WJWA 4MROA 3O1JC 4P31A 4WKNA 4REQA 2ZKLA 3OZCA 4WXYB 2DR0A 4F4CA 3PWKA 3RSQA 3EEYA 2IFTA 2O8CA 3CEAA 3WLEA 2QNIA 2RHOA 1TLFA 2G72A 2JBAB 2VHXA 1GGJA 2EBHX 3HGQA 3JPYA 3B52X 4KPUA 4UHCA 3VR5A 4IJ6A 4RLFA 4BVBA 4DCMA 5IXJA 5JDIC 5KNLA 2JH8A 3NMUF 1RPNA 2MYTA 3PIIA 4HZUA 4Y0AA 3PA8A 2P4EA 5CNKA 4AURA 1ABBA 1E2EA 4KX5A 1EFUA 2BZ0A 2CC2A 1T10A 3KS9A 4H7PA 4MB6A 4OD0A 4PAWA 4YP6A 4Z4EA 2C4MA 1Z5PA 2Q99A 5ULLA 2FETA 1L3BA 1VGQA 3HFJA 3CJQA 3QUSA 3SHQA 2HCTA 4MUFA 1PQYA 2H18A 3HGTA 5BW5A 3RC2A 3VOSA 4W9MC 4CIVA 2AN3A 4NE2A 4A8PA 3ANLA 3Q41A 1NN1A 1QRAA 3DT9A 3BB4A 4U6NA 1XXLA 3I2YX 3W7AA 3OPYB 5IN4A 1E1CB 4QUDA 3EIOA 4GYKA 3F6RA 1DUIA 2YZMA 3VJKA 3RTGA 1K5PA 2P8JA 1W8DA 3THWA 4JIGA 3FD8A 4I6GA 1H0HA 1F8UA 3WGZA 2WE8A 3MRXA 1M2VA 2VH5R 3M9WA 1KSGA 3X0DA 4HBGA 4IUYA 2HV9A 4IDOA 3AUKA 3EZLA 2H8KA 3E81A 4D97A 4KPFC 1IBLB 1EGQA 3A4TA 2G4LA 3IE0A 4OAOA 3M6WA 2PSHA 4EKEA 1QHSA 1V16A 3OIGA 4PVCA 3T7KA 2OPBA 3UWOA 2A5LA 1FVOA 4DV7B 1GCGA 1U3FA 1N33B 5BT8A 3CUEF 4I4TB 3R5KA 2IF0A 1H1LB 3AVYA 1YZHA 2DBRA 4XA8A 3C3EA 4FDAA 4G4GA 1NVFA 1XEAA 4FFRA 3WZLA 5HEKA 2B3DA 3T9EA 5IVDA 2PZLA 2F1KA 2ZEJA 4GUDA 4MJXA 4EB3A 2RONA 2WICA 3IOCA 4WZAB 2XOKA 4G8DA 4CIBA 1GRRA 4NU5A 3R0XA 3S28A 5TIIA 1GNLA 4GVPA 4CFZA 1ZGGA 3FOBA 3I6YA 2GPAA 4MYUA 2JBAA 1EVIA 1ZN9A 1ZVJA 2ZRHA 1BOFA 3QPDA 1PFGA 2EF0A 4C0KA 4EWLA 3CONA 3B1WA 4P4TA 1QE0A 3VMFA 3EXG2 3DVAB 1GO2A 3CWCA 2JGRA 1V47A 4BO3A 2ANCA 3DFZA 1XO1A 2XH8A 2IE0A 4B71A 4DR6B 2O3JA 3QXCA 3F67A 2HI0A 1VL0A 4GO1A 5K6AC 3ONNA 4X64B 1NE2A 1QP8A 1RWQA 2J41A 3IAAA 3K2EA 3KJZA 3B5IA 3HCAA 4YC7A 5DW3A 1IG3A 1NV8A 2JAXA 3L7KA 1EGVB 1E1CA 3QZUA 4PFQA 3F3MA 2YFQA 4FFMA 2WINI 3O94A 4ENPA 1QFYA 1T2VA 3AKEA 3M49A 3IP7A 3HSKA 1JA9A 1B74A 2QTAA 2ZZKA 3CB2A 1K9VF 3D4LA 3KJNA 3OMWA 4LV6A 4M0FA 4GM0A 3KIPA 3AEXA 4WLNA 1DB3A 1E2FA 3L7NA 5LWHA 2W6ZA 2H5LA 4GWGA 4ZOLB 4CGYA 2E18A 2YV3A 2ORIA 2ZYTX 3ILHA 2ZGVA 2JJYA 4RMIA 4LF8B 4XSGA 1ZOOA 2D5IA 4TUYF 2XX3A 2WWTA 3CPJB 5B3AA 3SYNA 5FTMA 3IVMA 3W5DA 1P9RA 3BE5A 4UBJA 2CF5A 2X2PA 2GJAA 3H1FA 4FOOA 4QAQA 5GTDA 5LPNA 2XGJA 1FK8A 1H1LA 4BB6A 3BSYA 2O3SA 1PNRA 3U40A 1ECPA 3B6EA 3PFNA 3SICE 2FZEA 4EJFA 1HG1A 5BWBA 2HV8A 4KAAA 1BS2A 2OHVA 3VDXA 4LF7B 4KFTA 4L9WA 3RGWS 1OWPA 3O74A 5JXHA 1F0NA 1YF3A 1SVKA 4M8NE 4PHHA 2GK4A 2IJGX 2WD9A 3OA2A 3RV3A 4FZJA 4ZK2A 3MTBA 2I4NA 1DU4A 1VSQA 3ER6A 4DOMA 2YWRA 4UXIA 3DVAA 1T5SA 3QE4A 4PZ9A 1TYDE 5ED0A 5A6VA 1T6ZA 1VBKA 3WGJA 1AQUA 3JD2A 3JQDA 1RKUA 2VYNA 2WTMA 2JEOA 5DOZA 4CHGA 5LQNA 4BLRA 4QRIA 1JYSA 1KVSA 2ENWA 3OZUA 4WK2B 4GG1A 4QU0A 3EY4A 3IQIX 1ULAA 3U4GA 4FDVA 1FYEA 2AZXA 1KGDA 4GSLA 1D0VA 2VK8A 4MWTA 4P4SB 3QX9A 2V98A 1VE3A 1RYBA 4R1QA 4QUKA 4S2UA 1R00A 5FPPA 3K9NA 3P9ZA 2QX8A 1C8VB 2GRUA 3B48A 4FD2A 3QSGA 4JY7A 4MRRA 1MHTA 1SKAA 2VTKA 1H6AA 2J8ZA 3E58A 5J9FA 4YA6A 1ZKDA 4U2GA 2VDNB 2HXGA 4BKPA 2QDKA 1PO7A 4L02A 4RD4A 1L4GA 3TB4A 2Z30A 1KOGA 3GAMA 2XHEA 2PYDA 5FPTA 1UOQA 4PGGA 2C77A 4J03A 3QE0A 2QYOA 1YCHA 1ZLYA 2QJTA 1II0A 1P77A 2QPAA 1A5BB 3HKDA 4EECA 3CVYA 2PQ2A 5IT4A 4X62B 2DTXA 2PPLA 3BD6A 3LZDA 4HX5A 2FOLA 4IBOA 5JRJA 1ZEMA 4XVUA 5JW6A 2F48A 4Y2GA 1W30A 5ERYA 3C3KA 1CUEA 1LRLA 1ZJ6A 2OCGA 3H42B 5F51A 3R5SA 1ENPA 1KOLA 5JTUA 1PRYA 4HR7A 2FMKA 5BV7A 1FLVA 1T6YA 1X39A 2J9RA 1M74A 3ESCA 2ZB7A 4Z7QB 4JENA 5IXSA 3ICOA 3BQMB 1RYNA 3AUFA 3PGMA 1UP4A 2ZR9A 3QKWA 1ZD1A 3U7GA 5MGNA 4F6RB 5A0TA 1MW9X 5JAZA 1UIRA 1D2AA 3VR6D 5FOWA 5CD9A 3AL3A 2GB4A 1IM2A 1Q5PA 3MHPA 4IILA 3HACA 1NFFA 4XIJA 1L8OA 1R4AA 4JDUA 4DUGA 2C83A 3CNLA 1CY6A 4NFHA 4DDUA 4ZEOA 1JT9A 1W1WA 1RXWA 1GZVA 1T2DA 2D1QA 3OJLA 4FQ7A 3AM1A 2VHUA 1P5JA 4N9WA 4QVIA 4LX0A 4JB0A 2C1EA 1JVBA 3AP1A 3I2IA 4WZAE 1PJCA 4P2GA 2HU2A 3S29A 4CL3A 4D9IA 1QE5A 4UVGA 2H5IA 1Q1NA 5CURA 4CBVA 2GO7A 5I3ZA 3KCNA 2ZTLA 3SM3A 3CZ4A 1E0AA 1YC2A 4MKXA 3VJLA 3MIZA 1MDFA 3PXBA 2IL1A 2GJKA 1PHRA 3T06B 1O08A 1Q44A 3DYVA 2VJLA 2R6R1 2X4LA 2YUIA 3D7RA 1TJ4A 4HB3A 2I2AA 3DQQA 4ZJZA 1A9ZA 1PDWA 2WIFA 1P74A 2JVJA 3AZPA 3Q1KA 3GGGA 2UVPB 1V8PA 4GI1A 4KE7A 3L8EA 3R7WB 3U3RA 5HS6A 3A58B 4Y6LA 1YDFA 1GPH1 4M8IA 1V6CA 1ZL0A 3F7TA 4M46A 1X86B 2Y77A 4PCAA 2TYSB 1Y1LA 3PCXA 2QMEA 4HNAA 3VPGA 4C78A 4EYSA 1W73A 1K7EB 2XI4A 3IUYA 1RR6A 3C5WP 3EXHB 3VDQA 1Z6TA 3UVEA 5DT2A 5CA0F 2QRLA 2KX7A 3D6VA 5DK6A 2C04A 3NVAA 4AZWA 5C5EA 4ETWA 1FXWF 2BHTA 4EOGA 4B75A 4BWFB 1ZUD1 5IN5A 3PT9A 1MOQA 3QW2A 5FOVA 3UMYA 5CEEA 5AVVA 1GZDA 3HO8A 1RIIA 3HCPA 3WQHA 3FCAA 1EFPB 4PFJA 1GL3A 3AGPA 1QGDA 4WRRA 5DM0A 3B1XA 3H5RA 4MUXA 1ICIA 4GRDA 1K7XB 4DCUA 5KNCA 1LLQA 3TH5A 5K8IA 1U2SA 1JQBA 1RXEA 4MP3A 2GZSA 4M49A 5GVRA 5L3SB 1QO7A 1T5TA 1UUFA 1OXUA 1UEXC 4CMAA 3V2GA 1FZQA 4LDRA 2FI1A 3S5JA 2ZJ2A 3PJEA 1G5PA 5IAOA 5TSDA 1XTPA 1HDIA 1HM5A 1PZGA 1L7NA 1XD8A 2ID7A 1PUIA 3NUGA 1LB1B 4EO4A 4R71A 1LDGA 3UJCA 5C3MA 3B78A 3G2LA 1LJ8A 3A3OA 3G6KA 5JMTA 1KFEB 3AHEA 2IX9A 3AG6A 4RUKA 3GZNB 2XZTA 5GM2A 3P9SA 2QJWA 1VPWA 3W6PA 3AG5A 3TVTA 1UOOA 2B8NA 3DBHB 5DYGA 2E5WA 6AT1A 1U3TA 1NA5A 1NXPA 1LTHR 3TQCA 4PC7A 6NULA 2FEWB 1KJ9A 1B93A 1ZM2A 2UVPA 1NYTA 4UZSA 3R7WA 5B5SA 3O2NA 3OEEA 5AW4A 5L40A 3U2QA 3OD5A 3H0EA 6CHYA 2R1VA 3HU2A 2PGLA 5CMLA 1EG2A 2Q4TA 3TI9A 1QRSA 2J9XB 4GAEA 3EXHA 2WLTA 4V02A 3ZS9A 2HUPA 4ZT2A 1XMPA 1UEIA 2DVMA 3NEAA 3GPLA 5E1MA 5HKAA 3QEJA 1JLLB 4HVTA 2X76A 4ZGGA 3ED1A 1QZZA 1E8MA 3H0CA 2XUFA 3GG2A 3D8UA 3ITKA 4QDUA 2O54A 4II2A 2Q6LA 1ZH8A 1LV7A 1XTIA 1OI3A 2IZ0A 4R1SA 1BVUA 2PY6A 3A1WA 4J7AA 4P80A 1HSOA 1E9CA 4MV1A 3DEFA 3ZXXA 4JBGA 1QYXA 5AVUA 1GDDA 2AXQA 4R7GA 2IW1A 4G9GA 2PV7A 5KHOC 4KE8A 2PA3A 1A72A 1RRMA 3NTXA 3SZGA 4AK9A 5L3SA 4NDAA 4AG5A 4LJLA 2IEIA 3LHKA 3DZHA 1J8DA 4R1MA 5TDHA 4CPDA 4IJVA 1R0CA 5JNWA 2WQ7A 3MJHA 1C2TA 4KFSA 5DBHX 3L7JA 3BMO