3CZ4A

Native apha class b acid phosphatase/phosphotransferase from e. coli
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
SPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B acid phosphatase
publication title Structural insights into the catalytic mechanism of the bacterial class B phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 76
structure length 209
sequence length 209
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2008-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cz4A00
3DDHA 1RKUA 3IJ5A 5AKHA 2OYCA 5ALIA 1EK2A 4I9GA 3W5AA 2RARA 1AQ6A 2HHLA 4L57A 3WK9A 3EF0A 3QU4A 3QX7A 5ALZA 5IT4A 3ZTWA 2CFSA 3ZI4A 5ALFA 1RMYA 1O08A 4Y2RA 3ESRA 3NUQA 4OFZA 4L6AA 3I6BA 5ALQA 3ZWKA 3WK4A 3FM9A 3PGVA 4BNDA 1RC8A 2FPUA 1L7MA 2ZBGA 1U7PA 4Y2PA 4UMEA 3BA6A 3L8EA 2YMLA 3A1EA 3E8MA 1ZD4A 2NO5A 4EZEA 1T9ZA 1L7NA 2HEGA 3L1UA 4UMFA 4BEWA 2G08A 4BX0A 5AKLA 4Y2UA 2D2VA 2O2XA 1T5SA 4HAIA 2JAUA 4IFTA 3HLTA 1ZD2P 2YJ5A 4MUMA 4YH1A 4AS3A 3W5BA 3WK7A 3WKCA 3L5KA 3N5KA 2YBDA 4KX5A 2C9MA 2EARA 4BX3A 4E88A 3HYCA 5AK5A 1J8DA 3AR4A 3N28A 2R8YA 3UMGA 4FE3A 3U7FB 4YCMA 2I33A 1QQ7A 5ALDA 1XVIA 2IA5A 3AR5A 4IG4A 5AI9A 3GYGA 2HX1A 2ZBEA 5AK4A 3ESQA 3WGUA 3ZVLA 2WF9A 2C88A 2OA0A 3ZVMA 2HOQA 4UM5A 1NNLA 4H1WA 2W11A 1RQLA 3E84A 3PDWA 4I9FA 4XQ0A 1WPGA 2WF6A 3L1VA 2WF7A 4BYGA 3ET4A 3NIWA 4OCZA 1N8NA 3AR9A 3SF0A 4Y2JA 4Y2XA 3R4CA 5AVSA 2HDOA 5IT0A 4UU0A 3QUBA 3OCWA 1WVIA 5AW4A 1KYTA 4ZEVA 5AKGA 1ZOLA 4XE5A 4MWOA 3TLMA 3WK8A 5AI8A 3J7TA 2IYEA 1S8OA 4CF4A 5AVXA 3SKYA 3I1YA 2I55A 1RMQA 3U7GA 2Q4RA 3VAYA 1TA0A 3WKBA 4NAVA 1ZD3A 5AM2A 2FPXA 2NYVA 5FP0A 1J97A 3DAOA 4Y2VA 3ZUPA 1WZCA 3N8GA 4BKMA 2BY4A 2ZXEA 3R09A 2BDEA 1ZRNA 1RDFA 4EENA 5AKZA 4YIKA 2P27A 3CZ4A 3E58A 1Z4JA 4GXTA 2CFTA 1Z4QA 3QUQA 3ZTYA 2RAVA 2B82A 2MSNA 2WHEA 1EK1A 3ZU6A 2C8KA 4Y2YA 3A1DA 1L7OA 2FI1A 4NWIA 3ZWDA 1JUDA 4O8CA 5AVRA 2B8JA 1L6RA 4EEKA 3FGOA 1ZJJA 3F9RA 5AW5A 2FUEA 1RKVA 4KNWA 4C4RA 2HI0A 2G07A 2WM8A 3W5DA 1YS9A 1O03A 1U7OA 3U7EB 3A3YA 3ZX5A 2JGAA 3WGVA 3UMBA 2Q5EA 2G09A 2ODAA 3QU5A 4EX7A 4DWOA 2X4DA 1RKQA 4UU1A 4Y2TA 2ZBFA 3M9LA 4UAVA 4UM7A 3QU9A 3KDPA 5AKYA 4JB3A 4Y2QA 5ALKA 4JDPA 4RETA 4F71A 5AM3A 5AW2A 4NFLA 3W5CA 2P9JA 3OPXA 3SD7A 3MN1A 2HO4A 3N1UA 5ALSA 2I34A 4Y2SA 4OD0A 3IB6A 2B1QA 4QQFA 1ZRMA 1LVHA 3ZVNA 3KD3A 3U26A 1F5SA 2R8ZA 4CNQA 1L8LA 5AVWA 1VJ5A 1U02A 2HF2A 3U19A 1Z4LA 2EAUA 2P69A 1TJ3A 2HF7A 3MMZA 2Q4TA 4G9BA 3EWIA 3KOOA 3M1YA 2FDRA 2WF8A 2GO7A 3L0BA 2IOHA 4YIHA 2GFHA 1ZS9A 3WKAA 4EELA 5AICA 4UMVA 1VFPA 2AH5A 5IS2A 2C8LA 5AI6A 1Q91A 5AVYA 3QNMA 2JARA 3ZX4A 5ALRA 1NRWA 4HGQA 4C4SA 3NRJA 3UM9A 3ED5A 3QUCA 5AKEA 5A3QA 3ONNA 2B8EA 4BX2A 4GIBA 2HCFA 1FEZA 5AKKA 3L0YA 3UMCA 1WR8A 2FEAA 1Z4MA 1Z88A 5AW6A 4G63A 1CQZA 3NALA 4RESA 2FPRA 1RQNA 4CF3A 4DCCA 4DFDA 5AW1A 1S2OA 1SU4A 5AM0A 1T5TA 4QJBA 4ZEXA 2AMYA 1N9KA 5AI4A 1YV9A 3RFUA 2WF5A 1TE2A 3OCUA 2G1AA 2YJ6A 2YN4A 2W43A 3KZXA 2AGVA 4AS2A 1Y8AA 1YMQA 3SLRA 2G0AA 1X42A 4NABA 2YMQA 1QH9A 1Q92A 1XP5A 3BWVA 4Y3UA 5AKJA 4ZEWA 5AW3A 3DV9A 3AR7A 1ZD5A 1RLTA 5AVTA 5AKXA 5T41A 2GMWA 4CF5A 2B0CA 5ALHA 1YNSA 5E0OA 1YDFA 1QQ6A 5AIAA 5AESA 2C4NA 3B8EA 4L6CA 2YMMA 2JAOA 4NV0A 5ALGA 1Z4OA 2ZOSA 5AI0A 3ET5A 5AK6A 3MPOA 5AVQA 5AW7A 1CR6A 1L8OA 5JJBA 4PNHA 3S6JA 5AW9A 2G06A 2YY6A 2YFYA 4HGNA 4HYTA 5ALTA 4AP9A 5AVUA 3R9KA 2I6XA 2ZBDA 3SHQA 2GHTA 2WFAA 2O9JA 5ALWA 2OBBA 3A1CA 3U13A 1XPJA 3QU7A 4J03A 3WK5A 5AI5A 2CFRA 3AR6A 1MH9A 3EPRA 3WK6A 3EF1A 3CNHA 3PCTA 4HGOA 3WKDA 3L8GA 4UARA 1SWWA 5AK3A 2HSZA 5AHXA 1Z4KA 5ALVA 4UMDA 1L7PA 2MU1A 5ALEA 5AW0A 4F72A 3L8HA 3AR8A 3OCYA 2I7DA 3AR3A 5AKIA 2FPSA 3N07A 3I76A 4KX3A 3DNPA 3FPSA 4DW8A 2GHQA 2AUTA 5AIBA 5ALPA 1Z4IA 3SMVA 3OTQA 4UATA 1SWVA 5AM5A 3QU2A 3KBBA 4YGYA 2R8EA 4BBJA 5ALOA 3RF6A 5AVZA 5ALXA 2IOFA 3OCXA 5AM1A 1RMTA 3QGMA 4KN8A 2PQ0A 3WKEA 4FFDA 5AM4A 3QXGA 4CE6A 1Z4NA 5ALUA 2PKEA 4UASA 5AVVA 1VJRA 4HGRA 2OM6A 1TJ5A 2QLTA 3ZW7A 3IRUA 1LTQA 2VKQA 1Z4PX 1RPZA 2R8XA 4BNDB 3MC1A 2CN1A 5ALLA 3OCVA 1NF2A 3L7YA 2P11A 3L8FA 1U2TA 2I54A 1RLOA 4YCLA 1TJ4A 4EX6A 4FYPA 5ALNA 3K1ZA 3OCZA 2JAWA 5ALYA 1QQ5A 3NASA 1PW5A 3D6JA 4HGPA 4UW9A 2NO4A 3U7HB 2W4MA 4UAUA 5A3RA 4YCNA 1RRCA 2RBKA 3P96A 5ALMA 5ALJA 4OHFA 4C4TA 3AR2A 2RB5A 3QLEA 1U2SA 2YJ4A 4KNVA 2YJ3A 4B6JA 3FVVA 5AW8A 2IOFK 3KC2A 3B9BA 2ZG6A 3L0CA 2EATA 1QYIA 2PR7A 3FZQA 1RLMA 2FPWA 3I28A 4BEVA 3SKXA 4J2TA 5A3SA 1K1EA 3PGLA 3QYPA 1YJ5A 2DQSA 3E81A 3QUTA 2FUCA 1Z5UA 2QYHA 2G80A 2B1RA 2YMPA 2B30A 4KYTA 3NANA 1IWOA 3NAMA 2BDUA 3FPBA 4XPZA 3B9RA 1Z5GA 4XOUA
chains in the Genus database with same CATH superfamily
1DQYA 2QSUA 3ZWWA 3OEWA 2HR1A 5F52A 1HE3A 4B80A 2RARA 3T5BA 2V54A 1AQ6A 2XE6A 1HMYA 5ILQA 3B70A 1F7UA 4NU8X 4EPWA 3WSTA 2MMCA 2V9CA 2AC7A 2CFSA 3FHTA 4BEBA 3M5PA 2ACVA 4ZV9A 3L92A 1OLSB 3UPDA 2QKYA 4G3XA 4ETWA 4XSGA 4C0WA 3OBIA 3ZGOA 1K8XB 1VA4A 4HF7A 5ALQA 3WLTA 1N57A 4UE3S 1E5XA 4K81B 3LW8A 1L4KA 4KQWA 5GONA 5IKPA 4BJHB 2I2DA 3R7BA 5EJ8A 1US8A 3JWEA 4ER7A 5JMPA 5C18A 4F8YA 1BMFA 3BA6A 3L8EA 3LUDA 2VJPA 3S1AA 1JZTA 2D2IA 1BXZA 2NO5A 4QD3A 5JCZA 2Q0HA 4OHCA 4Y30A 5C9ZA 4LQLA 4LWZA 3H6KA 1ZFNA 2D6FA 4KQ2A 3NTLA 2P2YA 3JS5A 4F3KA 1WP9A 1XLWA 2NP7A 4MUMA 4HKTA 3W5BA 2AG5A 4V0RA 1N2JA 3Q7IA 3UQZA 1DJLA 4QOGA 1C7ZA 3IAEA 4I1UA 4O4IB 4CQJA 5INTA 5KQMA 1B76A 4L8VA 2CVOA 4OAOA 3U60B 3EAQA 1SKQA 4WCVA 3WLNA 3KT3A 1Y1PA 2FP3A 4C6TA 4LWOA 4NSNA 2WSBA 4PX3A 3HNOA 2FFJA 2Z4SA 4DQKA 1VBFA 5CA1F 3HXMA 2ZYTX 3EXAA 2C7OA 3ZI7A 3CKMA 5DLQC 5IDXA 2YXNA 5FUXA 2HLDA 5IW8A 4DILA 4FKMA 1RM5A 2G83A 3A14A 4F3TA 1XAGA 2FUG6 4X92A 2OEPA 4HNHA 2EWVA 1DKOA 2QY9A 4MKFA 5HQJA 5T67A 2VTVA 2YINC 1DB3A 2FCAA 3DHNA 3QWHA 2JBWA 2QMQA 3L18A 2C88A 1E8DA 1KYVA 4L08A 3L7JA 4LGMA 4UDYX 1G8AA 3V8NA 3WA6A 5DHSA 1GV0A 3S7TA 5CFLA 3PDWA 1KIAA 2R7NA 3ONFA 4L4ZA 1JQJC 3E8XA 4B46A 1PG0A 3IPAA 3QE2A 4Y2PA 1Z2CA 1UZNA 2VA9A 4PY2A 5IEBA 4B3DA 1Y5LA 1UL1X 1EDOA 5EEHA 4UNQA 1UWVA 1RSZA 4Y2JA 3VPHA 3FOZA 3EDOA 4GI5A 1NBHA 1AZTA 2PYIA 4GICA 1LS6A 4C4AA 3CUUA 2VAXA 2VF2A 1XTKA 1ZWLA 4BNGA 1EPUA 3I9V6 3HUTA 4DJAA 2IXAA 1CF2O 3M4NA 1CRLA 2YHUA 1JFLA 1Q0SA 1NU6A 2QXUA 3LT2A 3A9CA 1IEQA 3MQ4A 2L18A 2D2XA 2Q5JA 3ANLA 1RACA 4QU0A 3RCBA 1TTHA 3JPWA 4YMTA 1WTCA 2F43A 3PLNA 3ZH2A 2JJ1D 2PEYA 3HXLA 3R5XA 2BN4A 2E55A 2HHJA 5L4SA 1JMKC 4DJTA 4CKBB 1I2DA 1E6EA 1XTJA 1DL5A 2I55A 4L75A 2Y0DA 4IQ0A 4RK4A 1LBEA 3RVSA 2J4FA 4RLFA 3TLGA 1T8TA 4JXZA 1SHUX 3TL6A 5KNCA 1IN8A 1HUQA 4MKHA 3G7NA 3UB4A 1QF6A 4H7EA 4R81A 3EQ9A 2NLOA 4Y2VA 5CBKA 4LDPA 3IV6A 2WABA 4BN5A 5BYAA 2OUIA 5BUZA 4DLZA 3DT9A 2VTBA 3OJXA 3T1QA 1S8NA 5IAKA 4WGFA 1XJWA 2J59A 4Q1VA 5JMOA 1YFLA 1ST2A 3EW7A 2F8TA 3V2GA 3C8UA 4YBZA 5EKXA 3ID6C 1SIUA 1KC1A 2OBYA 3UY4A 3VZRA 3HUDA 4Q4HB 2ZJ8A 4HEJA 4F3YA 3FZNA 4A36A 4K0RA 1V6AA 4J0QA 4B44A 3AI7A 1ULSA 2VJOA 3VV3A 2XGOA 4QVKA 1BWQA 1N0IA 2QPOA 4CL8A 1Y3AA 5CBPA 1GNLA 3MF4A 1RPJA 3BXEA 1XU7A 4M1YA 521PA 1EE1A 3RRMA 4PAQA 4ZQIA 4R5HA 4KPUB 2CNWA 3K6SA 3WTCA 3EVTA 2DHCA 3FSRA 3FGOA 5EXTA 4CTMA 4CEHB 2FUEA 4I5DA 1SQGA 1XVVA 3Q6NA 5CXXA 3K20A 5HZKA 3X1XA 1DAFA 2W6ID 3U7EB 1FZTA 3AK4A 3TMAA 4FFPA 1U6JA 3A6KA 3ZX5A 3KS9A 5LZ8A 4I3HA 4XTCS 4AZ3B 4CCYA 3FH0A 3SC2B 1PZFA 4F4IA 3PQEA 4DL9A 4D9EA 4WSOA 2JIQA 3NQ41 4I55B 3AVOA 2FSGA 2FHPA 4RL4A 3FUCA 3H2BA 4G97A 5HKBA 4DV0B 5HZGA 3E7XA 3Q1KA 3FNRA 3PJDA 4JGBA 5DBGA 3CRMA 3B51X 4EH1A 5JO0A 1QX4A 1VYVA 1W1UA 3ASVA 2HLNA 2LXNA 3M6XA 4WQMA 1TW3A 2OHIA 3ETCA 2WZBA 1PR6A 1I5EA 5JLJA 3I0ZA 1QV6A 2DUNA 2R00A 5EHNA 4BCBA 1OAOC 1ZL2A 1M2OB 2NZ8A 1JW9B 2JC3A 5IAGA 4F1WA 4QFCA 1MDBA 5HGXA 2XRFA 2B6NA 2XVZA 4V3CA 3ZG6A 5KZMB 2HHHB 3DWGA 1ZRMA 2CLDX 1H6BA 1JDNA 1QCCA 3LBAA 4KQGA 4LQCA 5JXHA 2ZWPA 2H8KA 4IUDS 1TCBA 2R8ZA 4U6NA 3OZSA 4W8HA 3R7SA 1L8LA 1P5RA 2O50A 3O9VA 4RZXA 1J9GA 2X42A 3VJMA 4YBRA 4AF6A 3ESDA 4JNCA 1P2SA 2I9PA 5JSZA 3FMIA 2VYND 2A5DA 2X8LA 4FOSA 1EFLA 4PGGA 4V3BA 5GOTA 4D02A 4ARBA 4S0ZA 4EDHA 4ZXFA 1L5QA 4PGAA 3DBLB 3JARA 1H8ED 3PI7A 4YYZA 1YAHA 4HNRA 4A0SA 5EIFA 2PA0A 3ZS8A 1IPHA 3VR3A 1ABFA 2IIQA 4EJSC 2IEYA 1W4CA 4MB2A 5HTOA 3F5MA 2Q5HA 1B42A 1F2UA 4EELA 1KZYC 3ZWXA 3E03A 1KEEA 1CUUA 3W0LB 1TT7A 2QP9X 2YS6A 3L79A 3RIHA 2O7NA 4DYDA 5KYWB 4DIKA 3MTEA 4RKQA 2JLYA 1KE2A 4QT0A 4FEEA 1OJ7A 1USWA 5HF8A 3BD8A 3PL5A 4DYVA 4UM9D 2W2PA 3QX8A 4TQAA 3WNCA 2PZAA 3QJ5A 3MYRA 1ZBDA 2JHFA 5A3QA 3OECA 5DFAA 3KJNA 5I8WA 3OZIA 3WLIA 1FEZA 4FU0A 4R9RA 4YP5A 4GLFA 2MTBA 5AJUA 5EZQA 4EKYA 4Y18A 5A4IS 1PQWA 2WFLA 2PZMA 4FW9A 5MHTA 1E6CA 2Y6UA 3DTVA 4P31A 4E1AA 4EW6A 1QU2A 2WBLC 5IDYA 1TZMA 1M0EA 2NNLD 4MVJD 1WXXA 1Y8QA 2RGWA 3T5GA 2QX6A 4RVDA 1QUFA 2B7CA 1JG2A 1BU5A 3S2YA 4R40A 3NH9A 3QUAA 5FUWA 1V48A 3Q3IA 1FDSA 2I9KA 1F8XA 5KQLA 1LW6E 3H99A 1Z39A 4JC4A 4ON9A 5M5BA 3WP0A 3VNSA 2R00C 4KTVE 4BQPA 2QUKA 3HB0A 4WNAB 2W43A 1U99A 5HG0A 4P3NA 2ZJFA 3OD5A 1JEAA 1Y1QA 3N8NA 4I1OA 1X42A 2HXGA 2WNHA 3PQ5A 4P83A 2PBFA 4N01A 4YK7A 4YMVA 5EIXA 1E63A 1EHYA 1UBJS 2AD5A 3FZYA 3LKZA 4MPJA 3VJRA 3KVVA 1Q92A 5CJJA 1GL7A 3F6CA 3V48A 1LTHR 2DC1A 3DWIA 3LQ4A 3I4CA 2PH3A 3RVQA 1EQUA 2Z09A 4FHEA 3ZDQA 2J0EA 4HQ0A 1JXQA 1P4RA 1WUKS 4ABYA 1P81A 2UU9B 3PD7A 5B36A 2DR3A 1PNQA 3N7AA 5K5EA 1YJCA 5HM8A 1BWRA 1KF0A 2O8CA 4B73A 1YU6A 1D2MA 2QHXA 3H13A 5D3MB 5CLFA 1DJMA 1U8YA 2H51A 3SHTA 3UUEA 3X1YA 4QYIA 2IE0A 3AL3A 5CFQA 1OA0A 1TCUA 3N2KA 1MNQA 2BHSA 2ZE5A 3D0KA 2O1XA 1RYBA 4MB6A 3LUHA 3N39C 3TMYA 3ZWVA 2E5LB 5AW7A 3ADPA 4R2JA 3TSWA 4FDMA 1EVKA 3DMGA 2J5KA 3KELA 2W6ZA 3AYXB 3STWA 4ZRMA 1SXJB 4UBOA 4D96A 4UEOA 4BZZA 3ONEA 4G8CA 4TN5A 5IYZB 1PRYA 4MPDA 1ISSA 1F6BA 1W9HA 3NHKA 1E2PA 3CNBA 5C32A 2G04A 1YVEI 3F7NA 3UATA 2XNDA 3F97A 2IS4A 2GZDA 1PBNA 1Q11A 3I9FA 4DR7B 3DBIA 4UQPA 1HWYA 1RIFA 5EE5B 3COJA 3JR3A 4AZWA 1RHMA 4GMKA 3D3EA 3FSEA 3U13A 1N6OA 4OLBA 2P8JA 2RH8A 2HBZA 2Q99A 5DJ5A 1AV6A 1J49A 2IUYA 4Z6KA 2Q21A 1WM1A 4N5HX 4WBNA 4L0CA 1HMPA 2QUZA 1FTNA 3TRDA 5GZ3A 2P2ZA 1YJAA 4ERXA 2FQQA 2B9EA 3KJIA 4J8PA 3GN1A 1F9EA 4QG7A 3WS7A 4EG5A 3T5AA 3KRTA 4UMDA 1XXHA 3R23A 3LY7A 3LCRA 2MU1A 3ILYA 1ECGA 1W73A 1NDHA 3BD6A 5K3AA 3ZNOA 5AW0A 5JHGB 1YZUA 4Q1CA 3TLZA 1AH2A 1MT0A 2V7GA 1QFXA 4FSXA 3U3RA 4CKEB 1XWIA 4U1RA 2PUGA 3I9JA 2ILVA 4Q48A 2I1QA 2A59A 1XWFA 3BGWA 3CXUA 3OIFA 4G2NA 4TM7A 5JCJA 4AROA 1R10A 2LVBA 3C4VA 3CRZA 1JIIA 3F98A 1QCYA 2WG2A 3QKSA 2L69A 3WMEA 3ZJUA 1AQYA 1VHLA 2J7PA 3GH3A 3O9MA 4GX0A 2PKQO 3QW4B 1NQOA 1QOZA 4KH1A 3GJRA 3HBJA 3E9DA 2EFGA 4UATA 4J0DA 3O8CA 8MHTA 4YWJA 2DWOA 3NM5A 2MYNA 3IBFA 3ORHA 2VP2A 4P36A 1GGNA 3QRWA 4BWYA 3NBUA 4ALIA 1T4GA 2DCMA 2BTQB 3EMDA 2X0IA 3EVGA 1BS9A 1UDCA 2C7GA 2UZ3A 2MR5A 3NHRA 3PHCA 2HIGA 4Y0VA 3I9OA 4XASA 4EAQA 4GI3A 1WOMA 2H06A 5L53A 1QHIA 2PWPA 4HRYA 4BJ1A 1C0EA 3NDRA 3JQFC 3DFIA 4LI0A 2EIXA 1TI7A 4FFDA 5BSWA 4N7JA 4YLGA 4HV4A 2A8YA 4ID3A 4KUGA 3SVLA 1VMEA 2DUWA 2H92A 2OWDA 3GCWA 1VJRA 3DDOA 4HOYA 1RXVA 4Q7EA 5KTTA 2IDKA 1C7EA 3TZLA 5EIOA 1U8CB 1QE3A 3BA1A 4C87A 4J76A 3PNYA 1RPZA 2FE4A 2XMZA 3ENVA 2AE1A 1N1GA 3JSXA 2PO5A 3DF9A 1DBPA 1QYCA 3HFJA 4AZVA 5CT5A 4AM8A 4EY5A 4YMSA 4GX1A 4FJ1A 2ORYA 1W5BA 2Z58A 1TZJA 5SY4A 3RUDA 3IUQA 1B2LA 1SELA 4E94A 4EECA 3WBFA 1KAQA 2HJRA 3U61B 1UBUS 1C50A 2KLHA 2OHGA 3EBOA 3K1ZA 3VQTA 4EX6A 5I9NA 1J0DA 1RZRD 3MEQA 1SZPA 3CJTA 3WLJA 1O4WA 2Y2UA 3GVPA 4ZHSA 4PNEA 3D6JA 2CNDA 4L9AA 3GJYA 5ECDA 1OYWA 4KTTE 5HMLA 1VTKA 4YCNA 1J20A 3S55A 1FA9A 4XSHA 1HLPA 1DCMA 1NVUQ 3ZGYA 1L7XA 4N0MA 5CFOA 4QOSA 2O8BA 3GPDG 1L1RA 3HCAA 2QN3A 2WIJA 3EGIA 3K09A 3LXXA 4FGLA 1C1YA 3LXRA 4KBYA 1U2SA 4R1UA 4MI9A 1DG9A 3JVVA 2I8AA 2CV0A 2JJ2A 3G3EA 5EKUA 4EPTA 5I6DA 1LV7A 1DHTA 1W6UA 2AZ4A 5AW8A 1IFXA 1GPBA 1TRKA 5CFNA 1PV4A 3UGJA 3K9QO 1CV2A 1GU1A 2YNMD 4R9NA 4BLOA 2YW2A 1QGYA 5J2UA 2BZGA 3M4YA 3OTIA 1ODCA 4F2WA 3H11A 2H4WA 2HBQA 1FW8A 3HXPA 3UZUA 1BAPA 5CFPA 2QE7D 4EZBA 4KE9A 4NU0A 5SZKB 3C3EA 3WYGA 1A7KA 3H5AA 1G21B 4URUR 4X6XA 2J41A 1AGYA 2IP2A 5THXA 2JH8A 5HZMA 4RHFA 4HY3A 1MEOA 4KYTA 1UBHS 1Z12A 5FP0A 5DIZA 3WJ1A 2BEWB 1K68A 4QXOA 3STTA 1UBLS 3QE4A 2BDUA 4LF4B 2B6HA 2C5SA 2YDXA 3IOMA 4K2HA 1Q20A 3PVZA 4RU1A 3UNXA 3VOBA 4BUJA 3THWA 3B9RA 2QL6A 4IH1A 3KKOA 1ATZA 1J4AA 1FMJA 4Q19A 4Y2GA 1JQDA 3IQIX 4EKEA 2WT8A 3I9NA 4JGGA 1G2IA 2FK7A 2WW8A 2UVDA 2XWQA 3SS9X 3U62A 4AXXA 1IJEA 5JC8A 4ZT7A 5HJEA 5JH7A 4KK3A 1N0HA 2I4TA 1Q0QA 4JJEA 1TUBA 1WU8A 2CY0A 2XSZA 5HKKA 3UCFA 1RXWA 1OROA 1CHNA 1JE0A 3HA7A 3IELA 4GL4A 4IHAA 3ZHBA 1Z0UA 2PXXA 3T1HB 4TZTA 4LFAB 5I7WA 2O4UX 3GLHB 1NN1A 4OFZA 5A9RA 3ADOA 5ED4A 3DAGA 3HP7A 1B1CA 4LN1A 4P80A 5KWVA 1R74A 2VNAA 1ID8A 3HV2A 3B6EA 2DMRA 2GXQA 2X3FA 3K0BA 3K0AA 5M34A 1K8ZB 1I7NA 2NZVG 1C2TA 3F6SA 2ZIVB 4LMAA 4PYNA 1VRCA 4QTZA 4RPCA 4DLSA 1BMFD 1ZMBA 5GINE 1XNRB 4Q15A 4DIEA 2VJMA 3KWJA 2XNSA 2YJTD 5LA6F 4QKQA 4Q9IA 3EOAI 4BLPA 1PJZA 3QQ5A 4HNAA 3M7IA 2HEGA 3I30X 3M4ZA 3MT7A 1HO3A 2G08A 2AMFA 1F4VA 3EZNA 3HFSA 4CL0A 1Q7CA 4ALKA 3DNFA 3I64A 3LH5A 3K09C 4D46A 1BEEA 1HBJA 1D2HA 1Q0ZA 2CXXA 3QVOA 1ES9A 3IBGA 4DCJA 2CVPA 2XRYA 2AYXA 1YJXA 3L5KA 5DZSA 4KX5A 3E5HA 2UZ1B 2ZVJA 3N5CA 4Y9SA 4YJGB 2PSSA 3T9AA 4N8DA 1E69A 4V0NA 5J4KA 1UM9B 4HS9A 5JG7A 4NJMB 1JHPA 2I1WA 3RSCA 3VM6A 2HLDD 1ZGZA 3CF0A 4XJXA 3A4LA 3AOEA 1QG4A 3U4GA 1NOIA 3JVEA 2I33A 3EK2A 3IT0A 3B78A 4CU5A 3GGPA 2JFBA 4YCMA 7ADHA 5KNBH 4Z4IA 1XFAA 1D03A 1E5TA 1U3FA 3IKMB 2IWRA 1IQPA 4N41A 1OMOA 2QOEA 4Q05A 1OPRA 3NDIA 3LLMA 2VUUA 3WGUA 1N4DA 1R50A 2ISSD 4BX8A 1OASA 4QAJA 2B5OA 4CI0B 3VO1A 3IPLA 2HOQA 2ZT8A 2B5WA 1H2RS 4H1WA 3CZMA 2GEDA 3INGA 3UXEA 4KKVA 4TWJA 1EJ0A 3BJIC 2PXHA 1P72A 3WGZA 1FNDA 4J29A 4WN3A 4D9HA 1U9IA 3GFOA 1E4VA 3CE9A 4TT3A 3FKQA 1PK8A 1JIKA 3RREA 3TQCA 4WT7A 4BV3A 3BK1A 3LHSA 1GDHA 2ZEJA 4M9SA 5FPSA 3PGXA 3FWNA 3P9NA 4I1SA 2NXJA 4LOHA 4NEQA 3GRAA 3DE5X 4NCKA 1VL5A 2DZDA 4L9RA 4E2XA 3VKHA 1FLNA 1WVIA 2OCLA 1KI2A 1IOWA 2FB9A 4G85A 2BP7A 1JDBC 3DO8A 4LMRA 4Y7CA 4JIGA 3O83A 1A9XB 1WZUA 4WN9B 4X1IB 2BR5A 3E70C 3WK8A 4R2XA 1KDZA 1IXRC 2G36A 1ZL0A 4CTKA 1L7EA 1KMMA 1FJ2A 1JHXA 2X0NA 4G5YA 1UBCA 2P9TA 1R0SA 2R48A 1FMTA 4RL6A 1SIBE 2HCTA 3SKYA 1YC5A 7YASA 3TGWA 2FW1A 4NRDA 2DU8A 2E89A 4GECA 5CT6A 3MILA 2XUAA 2GILA 3NWEA 1HG0A 4Q16A 4M7RA 1OLSA 2QEQA 5FBLB 2IH4A 4RADA 4F2HA 3QVSA 1AHHA 1ORDA 5BQ5A 4D92A 4B09A 2PD6A 3B5JA 4X93A 2VDUE 5EL0A 3AINA 4NBUA 1G18A 2OLKA 3WHPA 4A2WA 5KYTA 4TL7A 2PJRA 1XDZA 1YBMA 1RE1A 3E3MA 5H4HA 3SNKA 4KXXA 3B13B 3VKUA 2PAFA 2RGAA 4K3VA 1DCFA 2JBAB 3CUEF 3AVTA 3QITA 4XVUA 4K28A 4DWWA 2WHEA 1K5HA 3CLTC 1ZHFA 4Q9NA 3JD4A 4GDMA 2FU5C 1E89A 1MX3A 2FW6A 2ZAGA 4COKA 4XYEA 5DM70 1D04A 2NUPA 3ICWA 2GEUA 1Y80A 4CMEA 1ESZA 4Q5IA 2FNAA 4CTJA 4QYTA 1B6TA 4JFAA 2INGX 3IP1A 3JD3A 3AOEC 4O4IA 4PLGA 4WPGA 4BRZA 3AY6A 2AJ8A 4C21A 2WJPA 4AZTA 5IBPA 3W5IA 4AXBA 3HEMA 1ADCA 1J33A 3LT4A 4NDAA 4G0UA 3AHDA 3FMVA 4DGQA 2BFOA 3DHEA 3TE6A 3D8BA 1YTUA 3DHVA 1ZZGA 3I73A 3N05A 3E2IA 1G63A 1XR3A 4HFNA 4QLOA 3U4DA 5DN9A 5D85A 1M1YB 1QZTA 4L8YA 5AKEA 4DV7B 1CS0B 3QPDA 4Q9LA 1C0LA 1R6AA 2DP4E 2R62A 3AG5A 3AHGA 1L5FA 4L0MA 1EX9A 4P32A 4DIFA 2N3ZA 2YY7A 3KBOA 1NZFA 1U9IC 1LRJA 2VVTA 5KQPA 4TSKA 3WLRA 2CF6A 2Y1CA 4JLUA 4I6JA 1GPH1 1Q7EA 5A3JA 3E7WA 4N5IX 4Z53A 2PYDA 1XCLA 4IIJA 1MO6A 4FGWA 4NY1A 2GYUA 3GUHA 4CRWB 3KDPA 1HDYA 1Y1TA 4QUEA 3EBLA 1RJWA 1Z7EA 1X7HA 4F71A 3ELYA 4R2MA 2PUCA 1BE8A 5JBQA 4GNRA 5ALSA 5LBUA 3R0VA 1QB7A 2I34A 2WILA 3D1VA 2P2GA 3AEUB 4U7GA 2Q7OE 1MUUA 3WV4A 1JWBB 1YE3A 3TF5A 3I39X 5BV0A 4CR8A 1QYDA 1YKFA 5A4AA 2W8BA 1LVHA 1PJBA 1NLFA 4RANA 1Y7IA 2V7VA 4RGVA 4F3NA 1F5SA 3GBVA 3FPAA 4EBBA 4AJ2A 2QX8A 3C8MA 5LQCA 2F55A 2Q1YA 5BXQC 3FCYA 3P9QA 5AVWA 5L3QB 2AQIA 2NSJA 1UQTA 2F1JA 2WDZA 2IGBA 3FYSA 3H8SA 4UVIA 3UH0A 3ZHQA 1LS1A 3U3ZA 1R4MB 3DBVO 4LUCA 4CKBA 1UBEA 3SZRA 3JWIA 5FJIA 1Q16A 3HK2A 5JAZA 1W1IA 2OTCA 1ESCA 2NT4A 4KR3A 4ZO7A 4WXHA 2IHNA 1NP3A 2JVIA 2OSVA 3AIIA 5J23A 5A62A 5IX8A 3HKBB 3M81A 2IOHA 1KNQA 1G9TA 2GFHA 3A6DA 5DWQA 5DM0A 4YXWD 3WKAA 3UIEA 4R9UC 5DOZA 5EQJB 3SEAA 4CMEC 4IOMA 4Q9JA 4YT4A 1JNYA 3PWZA 1K6XA 4YX9A 3NUZA 1Y1RA 2C8LA 2ZB4A 1P1IA 2XTZA 4PSAA 3VYVA 1F4LA 1VRWA 1DXOA 4G9EA 4I8IA 4IDCA 4MNTA 1EWQA 3BJEA 1NRWA 3UJBA 2C5AA 1CHDA 4DUGD 5LKRA 2IPXA 3TXYA 1Y5NA 1UMDB 1DBVO 3N2IA 4C4SA 3ED5A 3FCXA 4IILA 2EJUA 4EG8A 1HZZA 3VDNB 3E22B 3ONNA 4RCVA 3B3QA 4B6EA 3GZJA 2PAAA 4EB6B 2Z2ZA 1ZVMA 2VQEB 4CUJA 4KPUA 4A23A 4R3UC 2J3DA 4DT1B 5CHYA 4UXIA 1W34A 4CEHA 3AB7A 2ONCA 1IN6A 2JCBA 1QHEA 3KKQA 3GLFB 4GSYA 1AB5A 1Z2AA 2OP0A 4ML3A 5CVCA 4EFMA 2FFAA 4BUZA 4TRJA 1SU4A 3EVBA 4TMVA 5ITZA 1GFZA 5TMBA 1YF3A 2HGSA 1E9EA 2EQBA 3DBHB 3D6AA 3IP8A 2ZJ3A 4AZ3A 3BORA 3SC2A 3JR7A 3ZZ1A 3WVNA 4QZVA 3ZCTA 4LC1A 3V34A 4LF5B 2DQZA 1B3BA 4I55A 1K9SA 2UZIR 4YRCA 4GAEA 1JH8A 8ATCA 1XZBA 3L6RA 1I4OA 5CHEA 1LLFA 1YMQA 3KEFA 2IH5A 1X0VA 2VWHA 3FLEA 5CA0B 1Q57A 2ZQYA 3LM8A 1XLTA 4MYDA 1OI3A 3CS3A 2DFDA 1M7BA 4BV9A 4Y3UA 1HEYA 4Z3DA 4CMAA 3M6AA 4MP3A 1TO2E 4CMCA 1IEWA 1W76A 3DV9A 3Q7EA 4OB6A 1M2OA 3AR7A 1SO8A 2XYVA 5HHTA 5M3BA 3MT9A 4DNOA 4RTMA 3VO2A 2FZKA 1GL3A 4KI0A 3WRXA 3DVAB 1G8GA 1VE9A 4B6PA 4OQQA 1L8QA 1NFFA 2X58A 3UPTA 5E0OA 3KAQA 3F2IA 1XQWA 3VUEA 1HTBA 1FFWA 2R1TB 3KEOA 3KYCB 2DPMA 1PAUA 3PUHA 5EGSA 1K92A 4O1MA 5JS8A 1V5IA 2XDAA 2XZDA 3JQRA 1IXKA 1O58A 2EHJA 2PU5A 2O59A 3CUWA 2XWJI 3QLTA 3DDUA 2YDYA 1D6NA 1Z4OA 4NBSA 1BYIA 1S8AA 1Q0TA 4MARA 5DM4A 2WUDA 4M86A 1OFVA 2Y9PB 2VYVD 5AVQA 3DBLA 1ODFA 2G28A 1NUPA 1E4YA 2PGDA 5G0SA 3GWZA 2JGLA 3QQPA 4F12A 4BO1A 2AFHB 5CCEA 4M0EA 1RP7A 1Q1EA 5GJBA 1ZOSA 2FUNB 3LBYA 1EXDA 5F9HA 3IXLA 4N7RA 2XNDD 4TLEA 3FYTA 3U3JA 1Y5RA 2GB4A 3W8FA 5KYUB 721PA 3WLQA 2DPGA 4C4ZA 4KQ9A 3DBOB 1QYRA 3GP8A 2FQXA 4OGLA 2QUIA 2ZIWB 2HJWA 5JOQA 2QJRA 1TKBA 2B4TO 3T9BA 1NBMD 3EISA 2FSIA 2VXOA 4LJSA 4C1BA 3THXB 4R8VA 3WP1B 1GZSA 4Y1EA 3PCTA 1ESNA 3AVQA 3AETB 1KO4A 1MG0A 1PL6A 3OT4A 1RBYA 1RWXA 2BHTA 2EZTA 3K5HA 1DINA 2BKVA 2HWKA 3KE9A 3RUPA 4M38A 3SSAA 1RAHA 1E3DA 2DUUA 4M0CA 4XI9A 1IULA 4GP7A 4LBWA 1FLAA 4L2IB 5EA2A 6YASA 4B9EA 1AKEA 4PPNA 5ALEA 2HSDA 4C6HA 1MGPA 3OZCA 1AG9A 2QORA 3KHUA 3CX6A 3PC3A 2VDPB 5ESRA 2QLLA 3HCOA 2RH9B 3DUWA 2VIIA 1LU9A 4BKUA 2J0UB 3GCZA 2BFDB 5IASA 2VLBA 2PL1A 3CINA 3O95A 4Z4HA 3LPNA 5BSRA 1EHCA 1P31A 4N9WA 2IYWA 4U0JA 4JEMA 1SCBA 2J7PD 1EVEA 3V3KA 5C8DA 4D5EA 1L4HA 5BPHA 1S7CA 4C06A 1MR3F 2ZUDA 3G1TA 3I2GA 3NEPX 3PNQA 4KXLA 1ZUHA 4GPAA 4RNCA 4WNAA 1L5HB 4CGZA 3OTQA 3R3YA 3NIFB 1QC5B 2H4XA 5HILA 3WRXC 2H18A 3AF2A 3ETLA 4CEJB 3ZHUA 1E20A 2C4HA 3B1KA 5K99A 5T8KA 5BRJA 3C1OA 1EDZA 2GZ2A 2H5EA 2PO7A 5ALXA 5IUKC 3WGLA 3S1LA 3HEAA 4COOA 1XDGA 4FGKA 5EE3A 1CVLA 1GPLA 3LLVA 2O0JA 2R4TA 3M6WA 2O23A 4MA0A 1VP3A 1XF9A 3TTVA 5CD9A 3USZA 5FCDA 1XU9A 5DHTA 5I8PA 5BV2P 2P0AA 5AM4A 1CYEA 2R8RA 3KQQA 4DUYB 1V37A 5ALUA 3IMEA 2XVXA 1G3MA 5EG5A 5D3MA 1H6AA 5HE8A 3O21A 2BFBB 1CLUA 3KSBC 2EL7A 3BQMB 1ZJ4A 3FLAA 4QGFA 4ZO4A 2FN9A 2OY0A 3NFYA 4TSRA 3R24A 1NY5A 1RD4A 3UAYA 4V1CB 3HLKA 4XRGA 2HFJA 2PPLA 2JF0A 2YWJA 3OOYA 4HSEA 1KYWA 1P1JA 4B7ZA 1EFVB 1YIAA 3LS2A 3K6KA 4ZVVA 4TUYB 4K26A 2XODA 4IZIA 1SXJA 1WMDA 1XJ5A 2I54A 2B61A 2FLWA 1KYQA 3BIJA 1QGZA 1U1GA 3F67A 3KZKA 4BNLA 3W7AA 5BNTA 5IYZA 3C98A 1HYBA 2CK3D 1YQEA 4G8JA 4ZOQI 3FF4A 5BW5A 5A4JA 1V0JA 4O8ZA 1PGJA 1KVQA 4JVNA 5C34B 5JNWA 2XGJA 1KYIA 4HDAA 5KAMA 4Z51A 1K88A 4ZZ2A 2ECFA 2VAVA 3TQOA 1M6WA 5ALMA 1E6LA 2VDMB 4P8RA 2GK7A 3QFFA 1OIXA 4FYXA 2BKXA 5FV7A 2F1OA 1B16A 3EVZA 1R0LA 1AZWA 3FSGA 2AXPA 3MNFA 1FQOA 2JJ2D 1F14A 3D54D 3HDGA 2D00A 4L5BA 2HIAA 1WU7A 1E1LA 3K96A 3P97A 4MRNA 4RLQA 4D81A 4AWBA 3FVVA 4DS3A 1GAJA 4Q1AA 3WNQA 3Q15C 2Y0BA 3PX3A 3BGSA 2DPHA 1T9HA 3LC1O 4N7MA 4XKJA 2WMDA 3CUVA 1BA2A 3USCS 1BXGB 5CXQA 4B76A 2R6HA 4CKEA 4D56A 1ZGHA 1W48A 5F7XA 3NB0A 1NPDA 2G9RA 1YJ5A 2GPWA 3FCOA 3OX2A 4X90A 5CIQA 1N5OX 1N34B 3R1IA 5F4ZA 4WA8A 5T8KC 1NBEA 3WWOA 5CDGA 3QUTA 1KJNA 3FKSD 2X1VA 1UK6A 4D5GA 1O6ZA 3BEDA 3ZGVA 3PR3A 1SVWA 1G9XA 4DA8A 1XA3A 1MG5A 3RI3A 3WR5A 3OM0A 4JJZA 1TU0A 4HLUA 3LL7A 4RGBA 2C84A 1TC1A 1L7DA 3ZU4A 1GKIA 2PG3A 4ZCRA 2GBFA 5KTYA 1SURA 1ATIA 1NULA 3F90A 3TR5A 1PVOA 5ANRB 1DXHA 2GHRA 3C24A 4OHWA 4B8ZA 2WQ6A 2VF7A 2PLRA 4ZOLF 4H0FA 1QQBA 4GZMA 4JLAA 3BL6A 4LYDA 4Q9AA 3RVJA 5HKKD 2IEIA 1GEEA 1NFRA 1SD2A 1BRTA 3K9NA 1U7HA 3UJPA 3E53A 1T1RA 4Y1GA 4YEDA 3AW8A 3B3GA 1KJ8A 1VJ0A 3AUJB 2YICA 5IDQA 3OWOA 2OQIA 2GPSA 1S2GA 3INTA 1SXJC 4QSMA 2WM2A 4DR6B 1WLSA 2RGNA 3E3AA 3I6BA 4XDHA 5BR4A 3S40A 3T7TA 1T8WA 3TGLA 1GPAA 1XEAA 3AI2A 4LJ6A 3MUNA 5LZ4A 1QGAA 3RKUA 4XDGA 4HR7A 1EUQA 2JD0A 1AUXA 5HRUA 1UAGA 2Q5OA 8ADHA 4RELA 1L5VA 4EZEA 1YQXA 4ZVSA 5H59A 1M72A 1CY0A 3LDHA 4ZWNA 1N2BA 1FS5A 3CBGA 4JN6B 4MINA 4C0JA 1D6SA 3R7LA 4WCDA 2JAUA 5H9VA 2G6BA 1HI9A 3K53A 5A2QA 1GL6A 3BIFA 1GM5A 2ZCVA 3D3KA 1TECE 1GZVA 2EEZA 2XYRA 3QK7A 5CNKA 1J5PA 3OO0A 5E3HA 5L3VA 1W87A 2A5FA 3KQNA 1NVMB 1P5HA 3JQDA 4FHGA 2HU7A 2WKWA 3ABOB 1UCFA 2A1IA 2WINI 1AQJA 5ICSA 1G8JA 1EUCB 4AIIA 4HPJB 3MBKA 3MJTA 2P9YA 3K35A 3EFOB 1CJCA 4B7AA 2ADMA 1NIJA 1R0XA 3WMWA 1ODLA 3L43A 1BN7A 3ZIAA 4BNNA 1I14A 2P3OA 4QDUA 3QTLA 1ZVKA 3H6HA 3KSDO 3OFKA 4EWLA 5JNRA 1DC7A 3T7SA 5GTDA 4AG3A 4RORA 4YRKA 4W63A 3LDGA 3O8LA 2OA0A 2HDHA 2WVHA 3RRYA 1NLMA 3UA3A 3UHOA 3VHRA 3ZVMA 1QO7A 1ZLYA 2B4KA 3OLZA 4HLUC 4UM5A 5D1HA 3WL7A 5L7WA 1JHUA 1NG1A 2O2DA 2WKRA 1BZYA 1G21A 1MIHA 3DL4A 5ITSA 2QZ4A 1GKKA 3A6EA 4HJRA 4LVCA 1VJGA 1WPGA 1FFXB 1Y3BE 4RD1A 4TT3D 1VYUA 3L1VA 1T2AA 2AVNA 3CLSC 3SC3A 1W46A 1UXKA 4JSTA 3IOYA 4N39A 1GPJA 1S3GA 3I52A 2BEWA 2J31A 4RZSA 4RY8A 2E3JA 4EPXA 4D0SA 1JU9A 3R4VA 3GDGA 3NVKI 1QBGA 2D7DA 1ZD9A 1ZUWA 2TYSB 1XLUA 2Z5GA 1TQ6A 1CUYA 4W82A 1YUBA 5EJMA 5C51B 2OZVA 1R1DA 2MR6A 4G23A 3SOPA 3DEJA 1YC2A 4DQLA 5H80A 4MGKR 5F33A 3WYNA 4DXAA 2WWHA 3SJZA 2ASEA 2RGNC 4DC1A 1C41A 3D7LA 1A7JA 5DNWA 2JK0A 1NW3A 2K5UA 1YXMA 3PCRB 3NP7A 2YZNA 2WHXA 3IP6A 3ITKA 4K9QA 4K1XA 1I7QB 4CZ2A 1M74A 1TO6A 5AO9A 3ZGZA 1HYGA 1OBFO 3GLHA 4PRKA 3UB2A 4TS4A 1TU3A 1Y8RB 5KJ6A 1PV2A 4HB0A 1FX0B 1GP2A 2P35A 2WOOA 4ENSA 5HEKA 5GIPE 2CNLA 3MERA 4NF2A 1OILA 1P80A 4IBOA 3O4FA 1HK7A 1NY6A 4QGGA 4B9AA 1NZDA 4BOYA 2FOIA 5FOVA 4ZU1X 1DRWA 3N8GA 4OUDB 3FX2A 5CD1A 4W5QA 3GRPA 4QLAA 2Y1WA 3KHKA 3L1IA 4RF4A 2P79A 4ANFA 2WJ3A 3CLUC 4RS3A 2L19A 4GXTA 3KR0A 5ETJA 2I6QA 1Y4DE 1LX6A 5L7TA 2PCJA 1XPOA 1C30B 1LZKA 1G20E 5T57A 3P4YA 3KR1A 1S3IA 2FX5A 3PTZA 3BGVA 1TVMA 3Q9UA 3AIOA 1SOWA 2R87A 1FVXA 4KFRA 4KGZA 3T9EA 4MR9A 4QXAA 4XIGS 3EODA 4WFIA 4TLMB 4R3NA 2UZ1A 5G0VA 3H9QA 5HZHA 3K8ZA 1ULTA 2AXEA 1OX6A 4YJGA 2PQ6A 4C20A 1ENPA 1H2YA 5BR1A 4Q4JB 5KNDA 3F3SA 4AKIA 3F1LA 4GOJA 4OIMA 4YP0A 4C14A 1KFBB 4NESA 1LXCA 4XWYA 2KS6A 5IKEA 3LNTA 2WA2A 2ZB3A 1Z5OA 1QUEA 2WZQA 4R31A 1U7OA 2FFQA 1K4YA 5DEOA 2NU8B 3TQIA 3DOOA 1Z33A 3K15A 1W85B 5JCPA 1SJ9A 3AHCA 4F5YA 3UMBA 2C4TA 4PC1A 4RH0A 3NUGA 1V8OA 4DWOA 1J8QA 1EWRA 3VC1A 4DBLE 4ES6A 5JD6A 4NOKA 4Y8VA 1E2UA 5TXGA 4DR5B 2WM9B 2F17A 1WUHS 1N1DA 1CJTC 4W5WA 1Q83A 1FSFA 3M9LA 3OQMA 2BI4A 4FDTA 4KAJA 1PT8A 3QU9A 2ZS8A 1ADFA 2HZ7A 1L5ZA 3DWEX 2DBZA 4JB3A 3ZVRA 3HCDA 2Z43A 1GTZA 4DUZB 1CERA 4LXTA 4QQ8A 1A5TA 2O07A 3FGNA 5AW2A 3SD7A 2GESA 3PXBA 3RC2A 5L51A 1AQUA 3I2FA 4INZA 4HNUA 2PBLA 1E2HA 2ZJ2A 5HJ7A 2VRCD 3VMFA 2XUKA 4P34A 3DOIA 1VI6A 2V7UA 4YMGA 4QQFA 4RMGA 2BH2A 1NUHA 4X1IA 1A9XA 5TB5A 2G9QA 1SCAA 3E1KA 3EDRA 3AO0B 3C8DA 2RC6A 4JX8A 1GCUA 1I13A 3H8JA 4QULA 2HRCA 1XROA 3DLHA 3SM9A 3DC7A 3O8OB 4DDUA 2CMHA 1U2GA 2Y1GA 2GAAA 3LYLA 1SIOA 2IOQA 2J3IA 3GPBA 3IMGA 4JBWA 4MV3A 1D2CA 3TR6A 2C0PA 3KOOA 3M1YA 3ORRA 2FDRA 3HKDA 4YQYA 5F12A 4R6WA 4AO6A 4TOIA 1K89A 1Q3TA 3F47A 3ZGXA 1CJSA 1UZMA 3TUZC 1ZS9A 4NDNE 4TXLA 1ZR2A 3X1ZA 3AVWA 1NVGA 5FEMA 3PQ6A 2IP1A 1ADYA 3EVDA 1XD8A 4RY9A 2OD9A 4CM6A 4UUBA 2JBAA 3NC1C 1FTGA 4L0DA 3HA3A 2Q5IA 1L4BA 1ESDA 1GG2A 1X7GA 1AIPA 4BVKA 3ANXA 1ZH4A 3ER9A 1FP4B 4K03A 1U4OA 2GH1A 3NRJA 5DTMA 4IVNA 2VAWA 4ENPA 2BF7A 3VX3A 3HWX1 5KX5B 3ESXA 1ZONA 4LAFA 4WCFB 2BIFA 5C7LO 2OB2A 3UBTA 5DWDA 2Z6VA 3COYA 4KYIB 4Q01A 5JD4A 3JXEA 1CQZA 2TMDA 4Z0PA 2O7RA 2RDMA 5LDDC 5AM0A 2VDJA 4D9KA 4BLRA 4Z5XA 2HJ9A 4Q4DA 5EKSA 4BIIA 2VHUA 4M1OA 1M1YA 4ZEXA 3GB9A 4MRPA 3UCEA 3X1DA 1CS0A 4LF8B 3WLLA 1A96A 3I58A 1NMXA 4TQ9A 1AKVA 1EAMA 2BKLA 3N75A 3B7PA 1ORTA 3ND9A 4F11A 1F8GA 5KUTA 2HLHA 5A0FA 4B6FA 3BE4A 5I8ZA 3UAXA 2E0IA 3EMKA 1QHFA 3KCNA 4MCAA 4ND5A 5HKLA 3LLCA 4LQDA 3CWCA 5CVUA 3WLFA 1LDNA 5HS4A 3UJAA 2ID4A 2VHYA 5DNDA 4QDZA 2AEMA 4LECA 4GEKA 3RTDA 5K7SA 2AOUB 4L72A 3OJEA 1I2CA 2QW8A 3FW1A 3PXGA 5BVHB 5AKJA 4IDGA 2PUEA 4I5FA 2EV9A 2FVYA 5A7GA 2FZGA 3LUCA 3EF3A 5EMNA 5AH0A 3VPXA 1QCDA 1WL8A 5AKXA 5IM5A 4WXMA 2E85A 5DM1A 3RS7A 1Y3HA 4D8VA 3RD5A 1YZYA 2IYAA 2AD1A 3MGBA 3S29A 1U2GC 1K6EA 4U9IS 4LRYA 2IL1A 4E2FA 1FQKA 1I9CA 5L3QA 2AF3C 2XDQB 3BAZA 1X80B 3A06A 4X3OA 1K63A 1SVMA 3O2QB 1YI8A 2H63A 4BMOB 1CWUA 1BYUA 3NBAA 3L93A 1CUSA 1KJZA 1R4MA 1TLFA 4JB8A 4X64B 3S8YA 3JY6A 2VTKA 3QFSA 3AZQA 1NVFA 3UFXB 3IA7A 3VHXB 2QX9A 1K8YB 1JL3A 1KFJB 2O5RA 4EIWA 2Z2YA 4OJTA 5A3VA 2K2WA 5D87A 2F6RA 1NPTO 2YN2A 5DT9A 4D8UA 3HKBA 1PR0A 1RWPA 4LDAA 2ZJ7A 4P33A 1AHIA 4NZMA 3KZVA 1JVBA 2Q49A 4MUXA 4S24A 3ZE1B 4J0JA 4A7PA 4K6MA 2PRKA 1D8AA 4DR1B 3PNSA 3PWKA 2OBBA 5CVJA 3TVYA 3A1CA 2HK8A 2A88A 2AI1A 3OJ0A 1KNXA 4UTZA 4JEUA 1N78A 1Z07A 4CMKA 4RD3A 4Y1RB 5J63A 1UMDA 2E2WA 4F5EA 3CH6A 5FEUA 1EVIA 2OK7A 2VCHA 3F74A 3GEMA 4C2UA 3V8RA 1Y1LA 4CLRB 4NK4A 1EKXA 3MMSA 3TIFA 4EB6A 2Z04A 4JVOA 1MABB 2JW5A 3WYEA 2JHCA 4FXOA 4G1FA 1JYEA 4C0XA 1KYXA 2GRAA 1L7VC 2YRWA 3NHAA 3QOYA 2DPLA 3GNSA 4RGQA 5ECGC 4BP1A 4DCSA 4YLYA 1OIVA 1CZLA 2NTJA 4PRZA 1ONNA 3Q6MA 1Z63A 4FT2A 1ZHOA 2AX4A 1PV1A 1ZCAA 4H1TA 4KC0A 1VJ1A 1KZHA 1KI7A 2BEJA 3DAHA 4NOLA 3DBHA 3I76A 4H7JA 4KX3A 4N6GA 1NVWQ 4NZNA 4HRXA 1C9JA 3V46A 2Q5CA 4NECA 3Q3EA 2IPLA 2O19A 1EYZA 2V7XA 3F7TA 1D0VA 4JBYA 1T8YA 4WLEA 3DMPA 4YCAA 3W8EA 2HXYA 1XK7A 3NVDA 2GAIA 1Z2NX 2F1HA 2VP4A 3SHOA 3BMXA 2QD1A 3KLPX 4B2IA 4CCSA 4RSRA 4R9VA 1K08A 5HBRA 1D5CA 2GLXA 5CA0A 3PFKA 3IAM1 4P5EA 4GH5A 1ZK3A 3G85A 1TD9A 2B4RO 3RF6A 3EYAA 5DM60 1QYXA 5H0IA 3CIOA 2CVHA 4MKIA 4A5OA 2HCRA 1WKBA 2J08A 3ZDAA 4XD7A 3I5UA 3V8BA 4PLCA 2QQ5A 1DLJA 2QU7A 4ZO8A 1RM3A 5K0SA 4YACA 3DVAA 2GEKA 3IE0A 1PQUA 3THYB 3RF7A 5AVVA 1J22A 1QLWA 2C78A 1KI6B 1F20A 2BBSA 2R1TA 5LB4A 3KYCA 4N65A 4EVIA 1FMLA 4MIOA 3N3AC 4B2YA 1LVUA 1N3YA 1N2CB 1T4DA 3LQRA 3MBOA 5A4MS 5BVGB 5CCBA 1YQQA 2CBZA 1I7PA 1Q17A 2VA8A 4FYIA 3RPEA 4ZZ3A 1K5GA 2EWWA 2ZTHA 4JCOA 1UMCB 2ONKA 5JHHB 2HL6A 3LT5A 3NHPA 5ENZA 4DNPA 1S1CA 2CYCA 1NF3A 4MA4A 4CBVA 3SP1A 1NF2A 1SXJD 1Q21A 5KB3A 3MVEA 3U39A 2AFHA 1U2TA 1Z83A 2VPTA 1RLOA 3HJTA 2OKCA 4LZPA 4XD2A 3F3KA 4DANA 1OXVA 2D06A 2QLBA 4FYPA 4R2LA 5D5PA 4FBLA 2J3QA 4CL3A 1VI5A 3LAWA 2IJGX 2YJNA 4UQOA 4E2WA 4AP5A 5KYUA 4RM3A 3TI9A 2O8NA 2OBFA 5EIWA 3F5QA 1V5WA 3OZEA 2OXFA 3PPWA 3UGTA 2BONA 2LRHA 4NX2A 4DA6A 4YMLA 3TMKA 3LDUA 4KHZA 3K4PA 4UHCA 3TVDA 3ZCVA 4ZGWA 2O0KA 4FOPA 1NN5A 1NTOA 3THXA 2D1FA 5LYYA 1P2DA 1LB1B 4OGFA 5D84A 4CFYA 3AETA 2ZUBA 3GP5A 3I53A 1GQ2A 2Q4EA 5IH3A 1Y6JA 3QKIA 1ADBA 3TL3A 5BN3B 3T15A 1M2VB 1UXHA 1LDGA 5FI0B 4HEA1 4O4JB 1XEWY 4KVAA 5HDBB 3MTGA 4BWVA 4MW0A 5IJ9B 4CMBA 1WDKA 1BS1A 2NT3A 1C9KA 5JECA 1E62A 1ECLA 1E1QD 3FZQA 3GEHA 3FGPA 4JBIA 1VSQA 3GPLA 4H0CA 3L05A 2RJOA 3LWNA 3L0SA 4XGRA 3ACDA 1G6HA 3DE7X 3TB4A 4CG3A 4KAAA 3CVJA 2YFHA 4J2TA 1JVSA 1ZXBA 4GMDA 1T0IA 4TLLB 1Q2UA 4XIFA 3B1VA 4D0GA 2QMYA 3OJCA 1OW3B 1F1BA 3E61A 5MDHA 1J24A 1JHOA 1ZM9A 4Q3KA 3CSDA 5FUYA 3K2IA 2Q6KA 1OR8A 4JA0A 1DTEA 3LQ1A 1SBCA 2PWAA 2NYUA 1L5HA 4Z4EA 1QC5A 3GFSA 3LG2A 5FNVF 2GWHA 3IRVA 5L45A 2PSFA 4CEJA 1IDN1 3IUNA 4AULA 3BULA 4IEEA 4E3ZA 1KP3A 1USVA 1ZQ1A 5GJCA 1FE8A 5DBFA 1P4SA 4PLZA 1GARA 4ARVA 5LXTF 1M73E 5IN4A 4ENRA 4KR9A 2OQVA 3Q11A 3QIAA 5DRYA 3VBCA 1UF9A 5BOSB 3GFQA 5DT2A 4P08A 1AS3A 1RWMA 1IOZA 2BFBA 4LE0A 3JATB 5ALFA 1WSAA 4YUVA 1JTFA 3UXMA 5JT1A 2OESA 3PHLA 1RWBA 2R1VB 2Y8EA 1EEXB 1MZVA 4GGOA 4PINA 4JWKA 3UWKA 2V9ZA 1X92A 2NTYC 2H1LA 4JYBA 4V1CA 4BQSA 2HA6A 3ZGNA 1S2IA 1RC8A 3NT5A 5H70A 4X60A 5LQDA 4KRFA 1Y4ZA 4J0IA 5JCXA 3AEKB 1CIJA 3EC2A 3M89A 5BO5A 2DKFA 1XZAA 3RSZA 4OQZA 4C43A 2Q9UA 4CCAA 13PKA 3WL4A 5BQPA 4ZC8A 3IKVA 3H4TA 5KTPA 4UREA 3AJDA 1L7NA 1JIJA 1MBZA 2QLJA 3IAXA 3CZCA 2ZE8A 1YOBA 4LK2A 3IO3A 4QBIA 4U7HA 5H5JA 4MDEA 4TKZA 3I34X 1T5SA 1V7QA 1XZGA 3EWAA 3ZCXA 4RS4A 5TX7A 1ZD2P 2XPCA 1GCOA 3CLUD 1DG3A 1H0RA 5AJWA 4AURA 3REQB 3FJOA 5JNLA 2Q3EA 3AI3A 1JEDA 4DMMA 2C9MA 3AU9A 4LOIA 4EY3A 1BMQA 3FTNA 2WYHA 1DV2A 4IKPA 1OLOA 4NFSA 4KSCA 1L4YA 5EZ6B 1L4EA 2P2LA 1VE6A 2MDTA 2VK2A 4JZKA 3KSUA 1Z06A 3L0OA 2RI1A 4B4DA 1GLVA 1LF0A 1N8KA 3C3BA 2RGEA 1IL0A 2BGLA 4HNGA 4QPPA 4PLYA 5FL7A 4LV6A 3NTRA 3PE3A 4UUAA 2ODBA 2XOKA 1MTOA 1WEHA 1JQ3A 2EF0A 5CT4A 1BX1A 4XCVA 5CG2A 5KKCA 1BXGA 2YQ5A 4X41A 1A1VA 2V1XA 4JI8B 1JHYA 3HCBA 5CVTA 5LUBA 1B8NA 3OCJA 3R2JA 3ZOKA 4PZUA 3O4HA 4D82A 5JXGA 3CRVA 4FR5A 1N0VC 3NJ8A 4MW7A 5GY7A 3TLEA 3SWWA 3KQMA 3VDRA 1N77A 2V6BA 3O3CA 4X8OA 1ZW6A 2QLFA 3TAUA 4AYWA 1HRKA 2HMVA 5EQTA 2CE2X 2B1GA 1N8NA 2HF9A 4GC5A 2DE0X 1JLMA 4W5TA 4LOJA 3HWWA 3IQGX 3RRXA 1GEGA 1ZH2A 4KP7A 2XKKA 3R0IA 3GK3A 1ACMA 1Y42X 4ZALA 1V16A 1UFVA 2EHDA 1FTSA 3H1GA 4KO3S 4ESHA 1Q1BA 1WUJS 3QYAA 2IGTA 4H0NA 2L42A 3QIVA 3VHLB 4C29A 3QYFA 4NFYA 1VOTA 2GASA 2ZRPA 3ZR4B 4KFUA 4LPKA 3ZCPA 2IHVA 4Q47A 4LF7B 4EY4A 3UT5B 4CF4A 7AT1A 2VPZA 3O75A 1F8UA 5CT9A 3S44A 3CUKA 2F9MA 3P2OA 3W8NA 3H5WA 3GOQA 3HACA 3TRKA 4E7PA 3ZV4A 3A7EA 4DMHA 1YA4A 3OQ1A 1D4OA 1K7XB 4TX1A 3LBHA 4H1HA 1QVZA 1UKYA 3TCKA 5F35A 1SIWA 2VCEA 3DB1A 4F7WA 2J9FB 2FZCA 4QSHA 1L4NA 2O0HA 2WD7B 3HUEA 2M6LA 2BVNA 4E2ZA 2VSYA 3C5CA 4FZVA 4LFBB 4MV5A 5JSKA 4QM6A 4M2LA 5B1HA 1T5DX 1FFHA 4QT4A 3DLIA 4HADA 3HCPA 2KBFA 3TW0A 4CV2A 1P60A 2RAVA 4WDRA 1JXOA 1EK1A 1NGSA 2ZRJA 1Y3CE 4KJXA 1CXZA 4ZZIA 3ME5A 2PNJA 4JXKA 1ONSA 2FI1A 3TDKA 1SKYE 3K6RA 4CKXA 4JHXA 3WG9A 4EO7A 5CR9A 1N2GA 2IODA 4PHCA 5EZ5A 1PL8A 1VIAA 3ICEA 4QDKA 1A77A 4PBTA 3VPCA 1EUCA 3DL2A 3DNMA 3DB2A 4PO1A 4G5QA 1GAWA 4R16A 2NUBA 3EFOA 3LCCA 4DQUA 2P4EA 1ISRA 3CUSA 5JI2E 4Q82A 5KJ1A 2P3SA 2B98A 4P7GA 4Q02A 4WKBA 1LBHA 4LGCA 3HCRA 3OE5A 4H31A 3U3OA 3I72A 1R15A 1FU4A 1DQNA 4FCWA 1XQ6A 2DF8A 1DJPA 1P5JA 2GERA 1HT2E 1EFRD 2GN1A 4OPMA 5HP4A 1N7HA 1ZMTA 4Y2HA 4QRHA 2KYRA 1E7MA 3L0PA 4GOXA 1VLVA 2P1DA 2F1KA 4A82A 3RLFA 5K6RA 2PXCA 1J1UA 1DEHA 3EUWA 3GCDA 2CL7X 5EMMA 3TAHA 4AFNA 4Z4QA 2JLCA 3CPJB 3R41A 1V9LA 3WL3A 2V45A 3MWEB 1BVYF 3LQFA 3P2IA 5KJEA 1EGHA 1FFXA 1UOPA 2QN1A 4GLJA 4K3UA 1NW9B 1RQRA 4C4PA 1S9HA 4KBGA 2FDXA 2NO1A 1TEHA 2HQRA 4NFLA 5EP2A 3UMJA 5AM3A 1JDVA 4PYKA 2IX9A 3EZLA 4DTIA 3M1AA 4P5PA 5IF3A 5CRIA 2FPLA 5AOAA 4C4XA 3JSAA 4YECA 1REQB 1ISGA 1OT5A 4ZJZA 4DMFA 1EG7A 2OGUA 1O5IA 5FA5A 1DOZA 1YULA 3QPAA 2CB0A 2PFGA 3VGJA 5JXJA 4Y6RA 1Z0SA 2J9XB 4R41A 5CUQA 1VLHA 5JROA 3FIUA 2ISQA 3QKRB 2W2TA 4BHTA 1BO6A 1U02A 4RTOA 5JJIA 2Q0SA 2DHQA 3COVA 3CVYA 2ZYSA 1CUIA 1CY1A 4PYJA 2EAUA 1SBZA 2IZ1A 1QGOA 2OC9A 3L9WA 3E9QA 5AJYA 5BT9A 3KZOA 2I71A 4QYSA 4BMSA 4H35A 5K45A 4ROTA 1Y8RA 4EPVA 4F93B 1DLIA 4DLTA 3RSOA 3AGQA 4WL0A 1B41A 2WE7A 3WO0A 3CE6A 1PJSA 2Z2KA 3ZQKA 1XWWA 4A0FA 4OYYA 1EWVA 4H6VA 4OUDA 1WX1A 3FMPB 4RFSB 5D6NA 1FNNA 4M9ZA 4XSVA 1QGDA 1M1UA 2CC2A 2AH5A 2HCJB 2P2NA 2FN8A 1NXSA 3SU8A 2X2PA 2EGGA 2V4ZA 4W5HA 3BDVA 4N40A 2I1VB 1BQ4A 3HBFA 3F1KA 3ZX4A 5LOVF 4KR0A 2JVKA 2O8VA 3KVNA 4EPRA 5HQTA 1RJGA 1OX4B 4MQ6A 3SIRA 3RU7A 1CUAA 2YZ7A 3KJEA 3O03A 3GLIB 1ACLA 3CKYA 5DNYB 1P7YA 2BBOA 4L5IA 5D2CA 2NIPA 1V4VA 2II6A 1QG6A 3TN7A 3COZA 1QTNA 1Z5PA 4Q4JA 5M04A 4IF6A 1A4UA 3E1SA 1OB2A 1P0IA 3KQTA 2XMPA 3UUFA 4I2NA 4RESA 3V1NA 3IILA 4DCCA 5JDIA 3FHOA 4CDMA 3QM1A 4HDQB 4IGKA 3V1LA 2NU8A 4G07A 4HN4B 4HWPA 4NG5A 3T34A 4J7UA 2ODQA 4AI6A 3HDJA 2GDJA 3MLAA 1W85A 1ABBA 3GGOA 3EBPA 4QYMA 1Z0FA 4Q9DA 1A69A 1E79A 3C2QA 4ITVA 3RK0A 4ATNA 2MYTA 1C4OA 2W8ZA 3F4BA 2P4HX 4G1EB 3OFSA 3CFYA 3E82A 2C4VA 4MQBA 1NM5C 1XZHA 3IPXA 3BCHA 1Y8AA 5CFZA 4DIBA 2C2KA 2KB0A 3NV9A 5DO9A 2P62A 4KWEA 3DLTA 1K4MA 4N6OA 5K3FB 1WPXA 2FK8A 4KIGA 1BDIA 1QHNA 3PX7A 1L8XA 1WD5A 3EEYA 3LYHA 2FVXA 4RTNA 2XUZA 5LYJF 2UVQA 1S89A 4JOCA 1K7CA 2B94A 4H1VA 5KNBA 3AQ4A 4XEUA 1I9GA 2C2YA 3R77A 2IYZA 1QH8B 3W04A 1X8XA 1NASA 1IM8A 3W2IA 4IR7A 3EY9A 4E5KA 2GMWA 3GUYA 1XDUA 1VKHA 1RAAA 4QFBA 1SVNA 4RVNA 2FYTA 5F5XA 1K6JA 4OHZA 4D4HA 3AM5A 3KXLA 4EHAA 1TFUA 1WOYA 1JAZA 1R12A 4FQ5A 2ZSUA 4MULA 4NR0A 4YV1A 4K8RB 1DDOA 4LRWA 4D99A 2X3UA 1HT1E 3LUKA 1HLGA 5A71A 4UNSA 3L04A 4GQIA 2WUVA 3I09A 1ZEJA 3K0CA 2D2FA 2OFWA 1J5XA 3O8OA 4BNFA 4E22A 4UTXA 5EJ7A 2GEJA 1SFRA 1TAUA 1L8OA 4PNHA 2FRDA 4IHKA 1YRBA 3FFWA 3WB0A 3D7KA 4YRLA 3O7MA 4WJZA 2HMWA 3SEFA 1T91A 4B34A 5LN1A 3RAFC 3TW6A 3VPSA 1E3LA 2FA9A 1UC8A 3E3NA 3MD0A 4BO4A 4EA9A 3BYZA 5I7EA 3R9KA 4ZI2A 2IV3A 2OILA 3WLPA 1E0DA 3A9WA 1OY1A 3BB4A 5C1IA 1DX4A 1PS9A 3GAZA 3LOPA 1TKCA 1JQEA 2O1SA 1NQAO 3UANA 4OOFA 3M4JA 5AI5A 5TQJA 1WCV1 4JNKA 3UUGA 3WK6A 3CHYA 3WKDA 3SLKA 5JDIC 4ZT4A 2DLCX 1IJBA 1ZJ5A 2I87A 4GUAA 3FWKA 4V0OA 2FG6C 2YRFA 4WCFA 5M29A 3PNVA 2Z5VA 3REOA 2QT0A 4NH4A 1VCOA 4PG8A 2GZ1A 3C6MA 3EIUA 2GZMA 4ZAZA 4RW0A 5FOWA 4N4AA 1U3VA 2ZPAA 4HNTA 1N6LA 4O59O 3QTBA 3HCCA 3HR8A 2VDWB 4U2CA 2I4MA 3ROFA 1GGJA 4F4CA 3RAPR 3P4UA 3LT1A 1N3IA 4DCOA 2GHQA 5D7NA 5DHFA 3GGJA 4EUNA 4P92A 5PGMA 4W9MC 3WB1A 3K71B 1DQPA 1IXZA 4EK9A 1ULAA 3VPGA 5DIFA 5MGBA 4GR4A 3ODPA 4A2QA 3TBHA 3L2OB 3SXUB 2CHUA 3RRJA 3DM5A 2AOUA 5BVHA 1MQAA 2VPPA 3N53A 4U9UA 4XD7D 5HXAA 1FJGB 3O6VA 4DSZA 1RPAA 1H3NA 5FBZA 2IOFA 1FFCA 1H1TA 4HAVA 5H9WA 3IULA 2HMUA 3ZWBA 2Y66A 4MV9A 5GVSA 5A4KA 3AHFA 2Q3MA 4Q93A 5DKFA 5FO1A 3K0CC 2BTOA 2ZVDA 3ND5A 1PCXA 4NDZA 3H5VA 3VRHA 4OM7A 4WOPA 1Y8ZA 1O6GA 2MYUA 5JZMA 3CO5A 3VNVA 4DDWA 3BJRA 4KG7A 3EZ2A 3FBWA 3RKRA 1J07A 2FRDC 2JHGA 1YBVA 2QF7A 2XDQA 3K05A 4UD6A 1X80A 1YE8A 4Y9TA 1IHXA 2B5VA 3KQHA 1ADJA 2DWPA 4HUJA 1R37A 3K9LA 2OCXA 1DKPA 4L74A 2NQ2C 3RNOA 1T6BY 2Y1EA 1A5AB 3EIOA 3MC1A 3UFXA 5KWIA 3O93A 4K87A 1XB2A 4NMWA 4JELA 2X7HA 3WQHA 1N6PA 1T3LA 3L8FA 5TJHA 1IN4A 4R05A 2DFLA 3E9ZA 5KC8A 3IUSA 2NYRA 1CVRA 1WXQA 4IDPA 3WLMA 3ETNA 1AU9A 1KFKB 1V4BA 2B34A 4AN4A 3EPLA 3PUZA 1OCEA 1PDWA 1SZDA 2RC5A 2RGRA 2Q2OA 3CNOA 3AP1A 4C0HA 1INLA 4YV0A 1TPZA 4M1EA 4JT9A 4I6GA 2ZJZA 3KTDA 4WCFC 1DCTA 1T5IA 2OHVA 4HFJA 4X0EA 2O5EA 5EE1A 4O1HA 4Q7QA 4KVGA 1W0CA 4FFSA 4Y1RA 2PCLA 2QTAA 2XW6A 3EGXB 5EJGA 4E5PA 5SZJA 4FONA 4V1CI 3QLEA 4F7DA 4CLRA 3V00A 3HJFA 1VPDA 4UUPA 1IN1A 4RLHA 4Y6QA 1MABA 4GX2A 4QARA 1D6MA 2ZRHA 3OLWA 4RKEA 2IOFK 4U6QA 3HHPA 3VAZA 5HUJA 1UANA 2FW8A 4O2AB 3HRIA 4OTZA 4UXJA 3RGGA 1QK5A 1DEAA 2PR7A 3K0EA 3TPFA 4AMYA 4J0FA 1U4NA 2O2YA 1QHGA 1J6UA 1D0SA 1KY4A 4XUGB 1CZHA 1QV9A 2Y93A 4MP8A 1D4FA 2YV2A 1GA4A 3D8UA 2QTCA 5EP1A 2EQ5A 1IUKA 1V1RA 3HBMA 1AGNA 5K0EA 2ZETA 3B1YA 1E59A 5A06A 2CNKA 2VF4X 2G40A 3H5RA 3ILHA 4BJ6A 4JYMA 4J0GA 3OZDA 2ZYAA 3H18A 5FYQA 1DAKA 2QU8A 3I2KA 4TMXA 1M8JA 3DJFA 4RWZA 3IUYA 4A73A 9ABPA 3OWXA 3HPQA 1YRYE 4HMQA 4CG1A 4CLHA 1G5HA 3NAMA 1AT1A 1PVDA 1R7RA 1GYQA 3DXYA 1YJQA 4IH4A 4KLZA 1XEXA 2ZT7A 3MOSA 3MJFA 1NR7A 2OVBA 3WI7A 2GN0A 1GZ5A 2IKSA 3F46A 2O2EA 4LNAA 2CFCA 3NOQA 2Y1XA 2HPHA 2CCGA 3EVFA 3I6IA 2OYCA 4FMDF 3CGWA 1JFVA 1T9KA 4TSFA 1XNGA 4EVQA 4HWRA 4LVUA 4RUKA 3RK4A 5CXSA 1Z28A 1ZJ6A 3TOVA 3OSZA 2QD2A 3VTAA 2EGUA 4JASB 2YXLA 1FRFS 3GFGA 5K3OA 1VHJA 2EFDB 2ZJBA 3ZZMA 2R84A 4PBSA 5BVGA 1N2CA 5FWNA 3LDFA 3T7DA 4LZWA 5LA6B 1S3FA 3ZE6A 1E18A 3IHTA 4MQLA 1OAKA 2J9GA 3A37A 4M9QA 3M6LA 2CVZA 5BSKA 5I7FA 1LK7A 4DSAA 2QT9A 3W4JA 2J4CA 3O38A 4AUNA 5JSHA 1XNQB 1W5EA 1KO5A 2XNKA 3VYWA 2CMGA 5K8TA 1TAQA 3FWYA 3I3OA 1L4FA 2OBXA 1VHQA 2G4LA 4HUQB 3KB8A 4BGIA 5FHQA 4DCTA 2V6JA 1I2MA 4Y2UA 3RIEA 4LDRA 1RYYA 3LUPA 3W1WA 3ROXA 1KS2A 3W7VA 2AOXA 2VXBA 5EXSA 4AS3A 1RADA 3ORSA 4LE2A 2WNSA 1BRMA 4QE3A 5JE8A 1ESEA 3NONA 3CURA 2AXNA 2OVFA 3FMOB 2EJTA 3L77A 4B4OA 4RX1A 4Q6BA 4YJ2A 1ZJYA 4JLDA 1T9AA 4IOJA 1IOLA 1I6LA 3OIWA 1UJ6A 4OM8A 4WDQA 2B21A 5ESWA 1IZ7A 2AMLA 2R7LA 3GDHA 3EAGA 5BN3A 2Q7DA 3T1YB 2AR7A 5FL7D 2AI2A 1M2VA 1OWLA 3DPUA 4O4JA 5T3YA 4BCCA 1AURA 5IJ9A 1FUKA 4FKZA 2NXEA 2XT6A 3E9EA 4BFYA 4DIUA 2GBPA 3U7IA 1TGVA 1NA5A 3M33A 2QVCA 4IHJB 4BTEA 2BFFB 4D3FA 1Y9JA 2D0OB 2N47A 4R0VA 4PG4A 3R6GA 2ERCA 4L95C 3D8RA 2WP8J 3DHYA 3E84A 4IICA 4IDHA 3LBIA 2BKAA 4HZIA 4OFWA 4DJ5X 4H15A 1S1MA 2P6NA 3C3XA 2IDMA 1FJXA 4I1RA 3MZ0A 2NM0A 3ET4A 4W1SA 1C8LA 5EQFA 5I9MA 4EJMA 2I03A 2PD4A 1DS6A 1XHEA 2RHLA 3NC0C 2Q5LA 2HPAA 4JL6A 2EP8A 1UZLA 1N6HA 3H4MA 4BKMA 1ZA2A 2QTVB 5B12A 5KTSA 4HBZA 3SKVA 2FPPA 2M98A 1WS6A 3B89A 3WHLA 2AK2A 4M9CA 4AL4A 3STHA 4JMLA 3IBTA 4EW2A 5LNK6 4YQEA 3DFUA 4PQYA 4Z9BA 2ZSJA 3BGIA 1TB4A 3PXCX 3AIMA 5A03A 2NZ2A 4OX9Y 1S8OA 4U2KA 4CMGA 2GDZA 4NCXA 3T7CA 5BOSA 1AS0A 5AT1A 1C7JA 2DWQA 1ZRSA 2OL4A 1EGQA 4B84A 2FPKA 3JATA 1RE0A 4ENWA 3EZGA 3C7DB 1U7ZA 4K6KA 2PTGA 3WO1A 2R1VA 1JV2B 3MJCA 2HT6A 3X1KA 3HXOA 3A1NA 4EG1A 2WUFA 5DMHA 1BGVA 3CUTA 1IONA 3KP1A 4Z0HO 3S2UA 3DAOA 3ZLTA 5B1SA 1J99A 4A6PA 3AEKA 4KE7A 1JHAA 2Q46A 1RLIA 4KKXB 3C3JA 4PE5B 2AC4A 3NGXA 2AK3A 1Z4QA 5TE9A 3PQ3A 4KO1S 2B82A 2P2SA 4F21A 3ZU6A 1W6RA 3SIWA 1K06A 1IRXA 3F7MA 3IFSA 2HTFA 4W9NA 1T29A 2CWDA 3O1JC 2I6FA 1SD5A 4YP7A 2ZYVX 3REQA 4HYEA 1JUDA 2I66A 1XKTA 3QH4A 3COWA 4LY0A 2WSLA 3PKIA 2DH6A 4LOKA 5E1OA 1FK8A 2FFBA 2CJYA 1NVBA 4AO7A 3P9CA 2C3YA 2VUSA 3ANSA 2XOEA 1P2UA 5B1DA 4US2R 4UM8B 1BEUB 2N42A 4D45A 4MPRA 3MGCA 2OG2A 3PZBA 5LJIA 1H93A 2YHBA 1A9YA 1OI4A 4PBRA 1O03A 3RFFA 1OSNA 5M2QA 1ZU5A 3MWLA 3ASUA 4DIDA 3DKRA 3R3UA 4QDJA 5T4FA 1II8B 1JB1A 2UUOA 5CLLA 1OWNA 1XXHE 5H4GA 3PVSA 3WGVA 3LX8A 3ERCA 3EEIA 2FH5B 3RH0A 4B74A 4PNZA 1VCIA 2DQYA 4WKNA 1XZ8A 4GOND 4NE2A 4S1TA 3F6BX 3DO6A 2B37A 1NNEA 1W52X 1H6DA 2Q8QA 2OCGA 5EWJB 1WQ1R 4K9RA 2FW0A 2Q2WA 4UM7A 1VPEA 5AWFC 1WXIA 1PR3A 3DDNA 2TSYB 2VZ9A 4AJ1A 2C29D 2GARA 3DW1X 1NFQA 4MHSA 1KXJA 2ZBPA 3I9LA 3QENA 4JEIA 2VKTA 3W3ZB 3DHWC 3ZCUA 5CLHA 3OUZA 3HTXA 3P2YA 3MN1A 1H2FA 3MCAA 2ZVPX 3NKFA 4YROA 3OZFA 1XC7A 1PZXA 3DCNA 3JZMA 5EPUA 3MCZA 3NVAA 3IB6A 2VZEA 4NNOA 4BE4A 3VZDA 2JFNA 3FWZA 1PK7A 2JGEA 3SBEA 2R47A 1RBZA 3RT7A 1FYDA 3NBYC 4TKUB 1E3WB 3RBZA 1OLUB 3LIIA 2JANA 3MA0A 1X70A 1EX7A 1F38A 2ZBVA 3JQAA 1W7AA 2UUBB 3WWPA 4B0PA 2W2NA 2P69A 3OEHD 2LTAA 4YNBA 3UW3A 3A2MA 4FFLA 5IC5A 3GRYA 1M6EX 1S7GA 3N0TA 3GAAA 5JY6A 1L4MA 4LYJA 2Z9CA 5BW4A 2FWNA 1WETA 3PC8A 1Q77A 3U7QB 2FV8A 3L0BA 5FFNA 2J9FA 3BOSA 2Y6VA 2K7ZA 2WD7A 4W9NC 1R9MA 4HDKB 4JBXA 4POAA 2J33A 2Z4TA 3ENNA 2EWMA 2AVDA 3INYA 3QHPA 4TS9A 1KZ4A 3U7JA 2VNIA 3LTEA 2I3DA 4IQ4A 4QPDA 2VJQA 1KI8A 3USES 4AX8A 2GZRA 1OXSC 5K0NA 2K7FA 2IQIA 3MWGA 1I4LD 2OV1A 1E3JA 3HYLA 1CUEA 2E6KA 2JGFA 4IVQA 3SYLA 1KR2A 3B3FA 1UIRA 3QBTA 4L51A 4LJYA 1FXWF 3R6LA 4MRMB 1NXWA 1CRWG 3R7DA 3W5UA 5DNUA 3A2LA 3DE4X 4GI2A 2YWGA 4ZOCA 3ANNA 4CXMA 5F1OA 4Y6SA 1ZSVA 2WKPA 1GG5A 2ADFA 2VJYA 1ST3A 2FLVA 4R51A 2I99A 4H3KB 2WIBA 3U56A 1T5TA 3TOSA 4CMIB 1RI1A 2BFCB 3ZIDA 2O1WA 1ZSNA 2YV5A 4KQKA 5TPZD 3D3NA 1VPLA 2NSHA 4PYIA 3RO7A 3GLVA 1VG1A 4JD5A 1OZHA 3EIWA 1H2BA 4DA4A 2R5WA 5CLIA 1KI4A 3MSCA 4DRXB 3WBJA 4BUCA 3RAGA 1D3AA 3RVLA 5IHXA 1ZNQO 5J1TB 1ZK1A 4JB0A 3IIMA 4JYZA 3FPHA 3TCNA 4ETMA 3PQCA 1F0KA 4C6RA 4NABA 3MWEA 3B38A 3GRKA 3GEIA 2C8VA 3EIXA 1W94A 9LDBA 3BSYA 3TUJC 5KNBD 2I4IA 1QCZA 3H05A 5CDSA 1N5JA 5IKOA 4ZI5A 1H23A 3C5WP 2QY6A 3OE7D 3TS1A 5K05A 2ODPA 1IBSA 3A0RB 3OA0A 4N8EA 1BS2A 4U8GA 3S27A 4BE7B 1NNI1 1M8GA 3U4QB 2H31A 2BLNA 3KQSA 4GPEA 4EAAA 5EUCA 1REQA 1U1IA 1NQTA 5TSDA 4ZVQA 1ZJZA 1IN7A 4C7JA 1CETA 1B6RA 5ED0A 1UUFA 3B1ZA 1B23P 1L7BA 3G1UA 4KOAA 4NEHB 3B1WA 1KMNA 1KAGA 1NW4A 2C4NA 1PR5A 1EP9A 3BERA 1U6KA 2VHZA 3A27A 3M9WA 3ZWNA 4FPXA 2OFFA 3PFIA 5FPHA 1A9ZA 4FSDA 2XUOA 3K0HA 1Y82A 5BW6B 2GYWA 5AI0A 3BJMA 3F9CA 5KI6A 4EGQA 4L5JA 5BNZA 4DLXA 5DLEA 5FTMA 3RJZA 1CR6A 1MIOB 2XEDA 5HIIA 4EHBA 2H5IA 4TWAA 1XZFA 5JJBA 4AP6A 1KBOA 1CEYA 5EZSA 1ISJA 3EXG2 5J9FA 3IDOA 4TMWA 4R84A 2YWFA 2OGSA 4MW2A 2YY6A 2QG9A 2VXYA 4NH0A 1GRNA 5BP7A 1EIZA 4WV3A 3PPYA 5A5VA 5JTTA 5IM4F 2IHZA 4RFSA 4X1KB 1D0IA 2I6XA 2BI7A 5KEIA 2YC4C 2J5QA 2PUTA 1RIIA 2XMGA 4PFKA 4CQNA 3EXHB 3LLUA 3WK5A 1XPJA 2XDYA 2ERXA 3H1PA 1WG8A 3A2NA 4DLAA 4RTPA 1W4AA 3A7DA 1OX4A 4HGOA 1DO0A 4TS3A 3GFBA 3BTSA 1GD1O 3GLIA 4J3NA 3H2GA 3ZDBA 2OWEA 3Q3HA 2I7XA 1BVHA 3LSTA 3IP5A 2IDJA 5FUVA 3SBOA 1L7PA 3PVCA 2ZJOA 5F7ZA 4XZ3A 4CDRA 4M0LA 3KB2A 4N47A 4KHPB 4NQRA 2C3OA 3LYUA 3A36A 2I4LA 2R11A 5I4CA 5T64A 2VT6A 3OCYA 4PLTA 5TMDA 3ICCA 4UBNA 2V59A 4BO8A 4R2HA 1DJNA 1O54A 1HDCA 3LNCA 5A5GA 5CB4B 1JG4A 4FT4A 2HBYA 3HXTA 3GX1A 1JBKA 2BM9A 4A1OA 3ZCQA 1ZWKA 1P75A 4C4OA 2RCNA 1GTSA 3UH1A 3H9UA 1GZUA 1IWBB 3BMOA 3I1JA 1NONA 1M0SA 1QO0A 3PGJA 4L07A 4GKBA 5K3FA 4OQNA 1A2BA 4NMXB 1Q15A 2A9QA 5U4XA 5JYDA 2ARKA 4Y0AA 1FX1A 4Z2YA 4LV5B 2WHYA 5FWXB 2CXOA 1X3LA 4OHPA 4EO4A 4KACA 5AM1A 1DU4A 4UTNA 1QH8A 1LQ2A 3CZRA 4YWHA 2REOA 2ZYGA 3KT6A 5KSZA 1JDSA 1OVGA 2FKAA 1ZIYA 3HMQA 3QV2A 3V8EA 4BVEA 4RSGA 2FZ5A 4U2FA 1UADA 5KS2A 1JFFB 3HCWA 4F85A 1YZFA 2WUWE 4RKRA 3F96A 2YBEA