3CZ4A

Native apha class b acid phosphatase/phosphotransferase from e. coli
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
SPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B acid phosphatase
publication title Structural insights into the catalytic mechanism of the bacterial class B phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 76
structure length 209
sequence length 209
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2008-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3cz4A00
2G08A 3AR5A 2G80A 3OCXA 5A3RA 3L5KA 1K1EA 3NALA 2DQSA 3EPRA 4G9BA 3KOOA 3ET4A 1Q92A 2WF7A 2I33A 2OA0A 3E81A 2JGAA 2YMQA 3I1YA 3WKAA 2CFRA 3PDWA 1TJ4A 1Y8AA 3QGMA 5AK3A 4QJBA 5AKEA 1SWVA 2YMMA 4HYTA 2OBBA 1L8LA 3UMGA 5AVXA 3PGVA 3WKDA 2HF2A 2I55A 4YCLA 1XVIA 2C8KA 5AIBA 2CFTA 3NANA 3NRJA 1YS9A 2HOQA 2FUEA 2AH5A 1TJ5A 3ZWKA 3U7GA 1RC8A 3ESQA 2C9MA 2GHQA 5ALPA 3HYCA 4NV0A 2FPXA 3WGUA 1L7PA 2C4NA 2W11A 2PQ0A 5ALEA 3OCYA 3BA6A 5AM1A 5AW1A 1Z4MA 3QUCA 3WK8A 4C4TA 4YIKA 4UU0A 3NASA 1WR8A 5ALOA 5ALFA 2YJ3A 3DV9A 4QQFA 3SKYA 3CNHA 5AW4A 1U7OA 4NWIA 3L0CA 3QUTA 4OCZA 1Z88A 1U2SA 5AI0A 3L0YA 3U7FB 3M1YA 1CQZA 5AM3A 5AW8A 4UMDA 2GHTA 3U26A 3N28A 2GMWA 2YMLA 4I9FA 4UAUA 4BNDA 4OD0A 3N1UA 2I7DA 2IOFK 1IWOA 1PW5A 4HGRA 2JAUA 5AM2A 5AW5A 2ZBEA 5JJBA 2BDUA 3NIWA 1L7NA 3ZTYA 2AUTA 2OM6A 5ALWA 4EZEA 5AKKA 1Q91A 1RMQA 2YJ4A 3ZUPA 1XPJA 3L8HA 4HGPA 2RAVA 2HDOA 3IRUA 5AW7A 5AVYA 2EATA 3L1VA 4KNWA 2YJ6A 3A1EA 2B0CA 2B30A 3ZVNA 1YMQA 2WM8A 1Z4KA 2ZXEA 2G06A 5AI6A 2P9JA 5AM5A 5ALVA 3WK4A 4AS3A 4OHFA 2P11A 3DNPA 4UMEA 3KDPA 1X42A 3E58A 1RDFA 4GXTA 5AKJA 5ALNA 2YBDA 1ZD3A 4GIBA 2IOHA 1RQNA 3EF0A 5AK4A 2G09A 2Q4TA 2R8ZA 2RBKA 4UM7A 1LVHA 5A3SA 3QU5A 3SHQA 4CF5A 3QU9A 1QQ7A 3CZ4A 5AVZA 4L6CA 3SKXA 5ALMA 3QU4A 1Z4JA 3A1CA 4XE5A 3KBBA 5AVRA 2WF5A 3F9RA 3FPBA 4BX2A 1QYIA 3QX7A 3B9BA 3GYGA 2R8EA 4I9GA 3ZWDA 2FUCA 5ALLA 3ZTWA 4UARA 2HHLA 1ZJJA 4HGQA 2JARA 4HGOA 1Z5GA 3QXGA 2MU1A 1YDFA 1ZRNA 1N8NA 3ED5A 3KZXA 3WK9A 1L6RA 4ZEWA 3K1ZA 2HX1A 5AI9A 3WKEA 2FPRA 4OFZA 1RLMA 4UATA 1XP5A 3OCWA 2HCFA 2OYCA 3WK6A 1NF2A 3AR9A 3I28A 3SD7A 4UU1A 3RF6A 4J03A 3KD3A 2B8EA 4Y2SA 5AI5A 3M9LA 4BX3A 1AQ6A 2AGVA 4L57A 4YCMA 2Q4RA 4BKMA 3U13A 5FP0A 1EK2A 4NAVA 1MH9A 2HO4A 2NO4A 5AVVA 1VJRA 1ZD5A 1TJ3A 2O2XA 2W4MA 2O9JA 3SLRA 1RRCA 2PR7A 4XOUA 4BEWA 3N07A 2HF7A 5AKYA 5AKZA 4DCCA 4DW8A 4Y2JA 3SF0A 2FEAA 5AVWA 4C4SA 1O03A 1L7OA 1RMYA 4KYTA 4F71A 5AIAA 4EEKA 2WFAA 3TLMA 3WKBA 1T9ZA 2FPSA 2YFYA 2I34A 4CF4A 2HEGA 1NNLA 3BWVA 5ALHA 2D2VA 1U7PA 4UW9A 3N8GA 1F5SA 4HGNA 2ZBFA 4UMFA 3U7EB 1CR6A 4G63A 4EX7A 4PNHA 3WK7A 1WPGA 5ALYA 1VJ5A 3I76A 3OCZA 2BY4A 1EK1A 4DFDA 4UMVA 1ZD4A 1L8OA 1Z4IA 2CN1A 3E84A 1RQLA 5T41A 3W5CA 3L7YA 2IA5A 5ALJA 2WF8A 2C8LA 1FEZA 4O8CA 3UMCA 5A3QA 3W5BA 5ALZA 4CF3A 3ZU6A 4UAVA 4YIHA 3MMZA 4AS2A 5AW2A 2AMYA 2FI1A 4MUMA 1RKUA 3ZVMA 3AR8A 3DDHA 4HAIA 4Y2RA 4RESA 3RFUA 4Y2PA 3WGVA 2W43A 3EWIA 2X4DA 4DWOA 1U2TA 1Z4NA 3AR7A 3L0BA 2EAUA 3B8EA 4XPZA 3NAMA 3U19A 1J8DA 2B1QA 3ZX5A 3UM9A 2JAOA 2WHEA 5IT4A 3L8EA 2B8JA 3N5KA 2HI0A 3I6BA 1ZD2P 1T5SA 2BDEA 5AK5A 5ALUA 4B6JA 1O08A 4Y2XA 4H1WA 3QUQA 4XQ0A 4L6AA 3PGLA 3E8MA 1QQ5A 2NO5A 4UM5A 3L8FA 4Y3UA 3QU2A 3SMVA 5IS2A 1T5TA 5AVTA 4BBJA 1WVIA 4Y2TA 4JB3A 5AICA 1S2OA 4Y2VA 2ZBDA 1QH9A 2G07A 2QYHA 5ALKA 5AI8A 3B9RA 1Z4OA 1J97A 3A3YA 3VAYA 4CE6A 5ALXA 5ALQA 3UMBA 1Z4PX 2NYVA 4C4RA 2ZBGA 3EF1A 5AKHA 1ZOLA 4Y2YA 3FGOA 1N9KA 2IOFA 3D6JA 3IB6A 2ZOSA 3IJ5A 4NFLA 2EARA 1YV9A 2FPWA 1TA0A 3DAOA 4ZEXA 3KC2A 5AVSA 5AKGA 5AKXA 3U7HB 1KYTA 2FPUA 4JDPA 4MWOA 1RMTA 5ALIA 4F72A 4KX3A 3OPXA 4IFTA 1SWWA 2WF9A 4BX0A 3AR3A 4RETA 4YH1A 3MN1A 4Y2UA 3AR2A 5AKLA 5AVUA 2Q5EA 1LTQA 3NUQA 3ONNA 4YCNA 4AP9A 1WZCA 5AI4A 5AESA 3R09A 5AK6A 3S6JA 5E0OA 1Z5UA 3MPOA 3ZW7A 1QQ6A 3QNMA 3FPSA 4E88A 3MC1A 2YN4A 3ZVLA 3ET5A 2RARA 2GO7A 3ZX4A 3QLEA 4ZEVA 3HLTA 3W5AA 1ZRMA 1S8OA 4YGYA 5AW6A 1VFPA 2G0AA 3FZQA 1SU4A 2YJ5A 2YY6A 1YJ5A 2QLTA 5ALDA 4Y2QA 4CNQA 2B82A 5AM4A 1RKQA 3QU7A 2IYEA 2P69A 3OCUA 3QYPA 3OCVA 4BEVA 2I54A 2R8YA 5AM0A 4FYPA 2CFSA 2PKEA 3FM9A 3ZI4A 4BNDB 4EENA 3PCTA 5AW3A 1L7MA 1RKVA 2MSNA 1TE2A 3WK5A 4UASA 1JUDA 5AW9A 3ESRA 2C88A 1ZS9A 4EX6A 2ZG6A 3AR4A 5IT0A 3WKCA 4EELA 4IG4A 2JAWA 2FDRA 5AVQA 1RLOA 1Z4QA 2P27A 2YMPA 3OTQA 5ALSA 2VKQA 3R9KA 3L8GA 1Z4LA 2I6XA 2ODAA 2R8XA 5ALRA 5AW0A 3W5DA 3FVVA 4J2TA 1RLTA 4KN8A 4FE3A 2RB5A 4NABA 3QUBA 1YNSA 1NRWA 2B1RA 1U02A 4KX5A 3A1DA 5ALTA 5AKIA 3L1UA 2WF6A 5ALGA 5AHXA 1RPZA 4BYGA 3R4CA 2G1AA 3AR6A 4KNVA 4FFDA 2HSZA 3J7TA 2GFHA 3P96A
chains in the Genus database with same CATH superfamily
3ZDAA 3ENQA 3N2KA 3O8CA 1KFBB 1ZGBA 5A3RA 1K7FB 1DGQA 4BE4A 1YO6A 1JKXA 3FUUA 1LJ8A 4FBGA 4R8VA 2FW6A 1FZQA 3HZOA 4DV3B 4K1LA 2VF2A 3IO3A 3NWEA 1KOLA 2FGKA 4X8HA 2OB2A 3D7SA 1LTHR 2VSYA 5SICE 1DLIA 2EF1A 5BMOA 3D54D 4P5DA 4BMOB 3NIDB 3WQQA 3QGMA 2QLMA 3ER6A 4B76A 5B58C 4DF3A 1K4MA 2VJYA 5L3VA 1EWQA 1N0UA 4IS2A 5DP2A 2JEYA 3UT5B 3IDQA 4QU9A 4CQMB 3JD0A 5IVDA 2I22A 3EGDA 5CB4B 4WXPA 4F97A 4RL6A 1OI3A 2ZK7A 4AJLA 5F9HA 1AKTA 3RUHA 3WNVA 1EP9A 5GADl 2WICA 1TK3A 4JLDA 2ZUWA 2Z9DA 3MJTA 2EOAA 4J7UA 5J59A 1A2BA 3H2YA 4CLHA 1A8HA 2NUAA 4R71A 3FYHA 3V2UA 2AHOA 1KEUA 5T4EA 1BVRA 1K7CA 2CBXA 5AIBA 4EYKA 5FOQA 4YJHB 1I14A 3LLUA 4IIGA 1CUUA 5DK4A 2VHXA 4NI5A 3LQ2A 5JAZA 5AVTA 3A6FA 2ACEA 2JLCA 2XWBF 3SZGA 3D4LA 3QOXA 1L7XA 2B35A 2IS2A 2GCGA 3G8AA 2FR8A 4CT0A 4MDFA 5DRYA 5KHLB 1FPMA 2YWJA 1EFPA 2ZJ6A 5IKXA 4RS3A 3ZGYA 1R5BA 2G40A 4PAQA 2OBMA 1H6BA 2ZSEA 3QX3A 4FE4A 1JNYA 2PUVA 2FWJA 2W2PA 3O74A 2PRIA 1XWIA 4GX1A 4L4XA 3G0BA 4LVNA 3P9PA 1P1KA 1DVRA 1X7ZA 1Z4MA 3FOAA 3KJFA 3LE8A 3QJGA 4W1PA 4XUDA 4UDYX 5F5XA 5EHNA 2EW8A 4ZJZA 3WL3A 1VL1A 1Y80A 2Q45A 3L0SA 3PLRA 1ONSA 4D46A 1ODIA 3DV9A 4QQFA 3TTYA 4LRTB 3MM4A 3MRSA 4L7VA 5B37A 2ODPA 4LSWA 4B3RB 3UMFA 3HVRA 3SF8B 4WXYB 3VSBA 1K4YA 4OMUA 2H1WA 2W83A 3MAGA 3GRCA 2FK7A 2EJUA 2QR5A 3M1YA 3VO8A 4DYDA 4RF4A 3S0JA 1IXRC 3U26A 1JMKC 3EQ8A 4II7A 4TV9F 3VI3B 4DYVA 1DOHA 1PFGA 3GUHA 1KPHA 2OWEA 1UT6A 2EZ8A 3EAGA 3L77A 5F1PA 3W77A 3NONA 2OPBA 3DE7X 2XNSA 4MVJG 1JJAA 3W9BA 5A5EA 4RMHA 1JNXX 3UGKA 2GEFA 1FU7A 4NG5A 4UUQA 5AXCA 3ZQ4A 3FTFA 3IPRA 1HL3A 4OJMX 1T9AA 5D7NA 5AM2A 4B4KA 4DQKA 2BDUA 3E03A 4UHEA 4LY0A 2R79A 1XG5A 4ND3A 4HPWA 1GJRA 5HTKA 2BFBB 2HRCA 1RFLA 4L5BA 3Q7RA 1NVGA 3ZNNA 3BWXA 4ZO7A 5K8VA 3LYUA 4YJFB 1CIJA 2X1HA 3R5KA 1E6CA 5A4MS 5KYYA 1XDGA 1JGTA 3C3EA 2DUWA 2G9VA 5EWLB 3D3WB 3DTVA 2JHAA 3Q0EA 4KPGA 3RK1A 2PZEA 1UBNA 4XYBA 4B73A 1PYGA 2COKA 3D0RA 2B0CA 2F00A 3GXBA 4REQB 5FWAA 3RVQA 5MN4A 3VR4A 2OLKA 1X3SA 3LQFA 5ALVA 4JLKA 1XXLA 1TU3A 2CLOB 4OU4A 3JQPA 2F1OA 2OZPA 3DF7A 4AS3A 4EYSA 4OHFA 4YCSA 2BFEA 1KJZA 2R47A 1Z2AA 2Q2VA 2R8BA 3WMXA 3K5WA 1XQ1A 1C0PA 1BIFA 2BPOA 4JQSA 3D3NA 3RSGA 1Y8QA 2EZ9A 5KYGA 4DC0A 3SZ3A 1RS0A 4ZOBA 3ZNOA 4GSLA 3KYCB 1I0LA 3I2GA 2HT1A 4DNPA 3L3BA 4TLMB 1SKMA 2HA2A 3HYSA 3T9BA 4UPVA 2ERYA 1JXMA 1PNOA 2JD0A 4MMXB 1WZ2A 4ZTBA 2XNDD 1EQUA 1UDXA 2Y1CA 5B6JA 1XI2A 4JFRA 3F7MA 4RV9A 4D96A 3K4QA 4EW1A 4PO1A 1N5DA 4R69A 3RYHA 4NBLA 3RR2A 2OO3A 1FSFA 3NHMA 4IX9A 2Z1NA 1F12A 4O2BB 4CKYA 1LBQA 1X94A 3AVPA 3EJ6A 3GYGA 3RVBA 1SIOA 3HJUA 1MXHA 3ETEA 4IJMA 1H94A 1TIBA 1TZJA 4MVJI 1X7XB 3F6YA 3SC2B 5IJ9B 3K3PA 3FMIA 3I5UA 1XTBA 3PDIB 3UT5A 2ECKA 1WJGA 2C2ZA 3LQ4A 4QODA 3BH0A 3ZDRA 5CB4A 3ROTA 1SUPA 3EIQA 1BC5A 2HA7A 3ZCPA 5EIOA 1JVBA 5T3YA 5AMXA 1TQHA 2CC2A 1Z6ZA 1PQYA 5KO2A 4HDQB 4ZTZB 3QTTA 3UWDA 3B53X 4H7FA 5I5GA 1E92A 1M1XB 3WG9A 1GZSA 1EDZA 3IQIX 1JH8A 4HNUA 5IHPA 3FFTA 1R0XA 4GQAA 2WAMA 1CK4A 5DM0A 4K8RB 1TO1E 1WZNA 2WTUA 1U2RA 4B5LA 2FRXA 1L4YA 5K3CA 4YJHA 2FZEA 5FOSA 5E2AA 3SX2A 3ZWPA 1QONA 3UK1A 1DPFA 3PPVA 4GVLA 4KIGA 3NTXA 3GLIB 3KOUA 1YHYA 4RDCA 4L57A 5AJTA 2J67A 1JEEA 4X1OA 5KEIA 4B3TB 4QOEA 2OD2A 4HXGA 1N9ZA 2JRCA 3U7RA 2R2AA 2OHGA 5B55A 1GDDA 4RJLA 2ZJ7A 1TTHA 1AGNA 1KI7A 3LDAA 4HMOA 3PUVA 4OXXA 3UJ6A 1J2RA 2FUKA 2Q3DA 1P1HA 4TVBA 2PR7A 3WWCA 3RJMA 3KWFA 3ED1A 1VJ0A 1RVDA 5THKA 1Y89A 5AKZA 3DMHA 5HZHA 2WAOA 4DW8A 1RJDA 1AB5A 4LKRA 1RMYA 4RWZA 2NYUA 4W63A 2CHQA 5E1BA 3TI9A 2NO1A 5GY7A 4CM3A 4B6EA 2J87A 3LMKA 4AX4A 1OC4A 2PMWB 3SF8A 2FOLA 4QYWA 1QYXA 2GDJA 1A04A 4KMSA 2AKYA 3TDKA 4WASA 5FD8A 5KB3A 3SNKA 3C70A 4N01A 1I7DA 2MR6A 1UBMS 1QLWA 3LUJA 3BTOA 4A6EA 2XGOA 3G2KA 5B3KA 1WB5A 1JHXA 1M5TA 4RKQA 4EPYA 1XZNA 2DY0A 3W6PA 5FA5A 4L51A 4LBWA 3I5YA 2P5SA 1SD1A 4TLEA 1AN9A 3JZFA 2N75A 1P5RA 4OHOA 3OIYA 5J2UF 3U0BA 4YMHA 1LDNA 5DTQA 3HO1A 3ABIA 2ORWA 1EK1A 4MPRA 1ZK3A 4UHJA 5EWMB 1V2HE 2KYRA 4DHWA 3BQMB 3FSGD 3NUGA 4ABYA 5A0TA 2JAXA 3HP7A 4RVSA 4HX9A 1K6XA 1RQLA 3NHJA 1KZ6A 1IQPA 2BFBA 2VJQA 5SYAA 2QENA 4ARBA 3PEWA 4GGPA 3J7AC 2H7XA 3FCYA 1S3IA 2I29A 3Q72A 3RC7A 4EYOA 1RPNA 1XMQB 3HVKA 2EFEB 3I9MA 3H8VA 1D0SA 3D3WA 1N3YA 4KAAA 4UBMA 4RLSA 5EWLA 5FNZA 3QE9Y 3C3PA 1YTLA 4G37A 2BGGA 1DAKA 2AN3A 4REQA 4QJIA 2O7SA 3IPCA 1FX0B 1TT7A 3GN1A 4JODA 1A5AB 1DAOA 1E4EB 1BEUB 2HHCA 2NZYA 2QRLA 5LBIA 4C6HA 1KWKA 2OHFA 4LOJA 2BBTA 3KQQA 1YR3A 4GPBA 1DKMA 9MHTA 3KWJA 3FF1A 5I7HA 4TWRA 3KYCA 1XQWA 4MVJE 1IHDA 3F71A 4TYYA 3B6MA 2GCEA 3F7OA 2RAFA 4AYTA 1J8DA 4YQFA 4ZI7F 2TSYB 1E59A 3A4TA 5KC8A 2UYCA 1QIHA 3GBVA 5KTKA 2CNLA 3ZHOA 3K9FC 5EZ5A 5C51B 1IUPA 2PYZA 4FXOA 5HZMA 4K87A 3WLJA 1NR7A 1ABEA 2MHCA 5FJJA 5DMXA 2X86A 4JASB 1AK9A 3FWHA 4WBNF 1R5NA 2JANA 3QW4B 5FBKA 1U4NA 5HK8A 2UXDB 1KGDA 3WYEA 1KYZA 4ZT7A 5P21A 1ZK4A 5ESRA 1M9NA 4N9QA 3ZGZA 3DFKA 2TMGA 2X14A 2P9YA 2G9NA 3V4FA 5A2QA 3RSQA 2GM4A 1X7XA 3SC2A 3DMRA 1R3UA 3H3JA 4H3SA 2BEVA 1TNDA 3PGKA 5G1PA 2JIRA 3C8DA 3HO6A 3PDIA 2ABWA 5EQDA 3TS1A 2B83A 2JI8A 5KSYA 4ALJA 4L8YA 3TINA 5D2CA 1FS5A 1NR1A 4WE3A 2FKNA 4FLEA 4XGRA 1R74A 2PKRA 2PTHA 3LT2A 3OZDA 4EPXA 3S55A 5ALKA 3LSTA 2WTNA 4PFKA 3QLUA 1KDVA 3RJZA 4BFTA 3V4VB 5LXTB 2LVBA 2ZPTX 3U4HA 3VZCA 4CKBB 1PFUA 3RIHA 3S44A 2RBGA 2WBLC 1P39A 3BQ9A 1C4OA 1KKUA 1RWKA 2EL9A 2JAPA 3I32A 2EW1A 3KE8A 1UZMA 3LC1O 3L0PA 2JEZA 4R5MA 1GT91 1A98A 2HRDA 2JBWA 4C7BA 1QIMA 4DLXA 3LZCA 4DIUA 1VG1A 4MTCA 2F3UA 3LKZA 4R51A 4G2NA 4PX5A 3AIOA 4DR7B 2CD9A 2C8VA 3Q6MA 1QHSA 4I50F 4FP9A 3ETCA 2EARA 3WISA 2ZM5A 1M2JA 1CUHA 2JCYA 2Q3HA 4QFDA 1C3XA 1Z07A 3DL4A 4EKIA 5CDHA 3AV0B 3PNKA 1T6NA 2PZKA 1DJPA 2XYGA 4S1TA 4GP9A 4PQRA 2CLSA 5AKXA 5EHGA 3UMVA 3PG5A 5L3QB 2HAEA 4OHPA 2ZE6A 4BO9A 4G0XA 4JUAA 5A0FA 2P2LA 1M6NA 4BZXA 3EVNA 5FWXA 3H6GA 1YS1X 4FR2A 3ZU5A 4AY6A 1WPXA 1TU0A 1RRVA 1UKEA 1YE3A 2IKQA 2VTBB 5BSGA 4ALKA 1XMXA 1NOJA 3N0TA 4ENUA 2D7DA 4IUCS 2QM7A 3ZH2A 1EXNA 3H18A 1SIBE 3UGQA 2Q9UA 2VK1A 2NU6B 2GJ8A 2VNJA 1G63A 2WAYA 2WRZA 4MS3B 2ONJA 6Q21A 4R7GA 5KJ1A 4QRHA 3AL0C 2IWRA 2JEOA 1V9LA 2QLFA 3DFFA 3L8CA 3LL4A 4GG1A 5CIQA 5A02A 2YUTA 1MB9A 1UBUS 2EKBA 4NU8X 3NFRA 3UGJA 2RH4A 1G5TA 2QSJA 3GVHA 2XYHA 1YL6A 3I09A 1KAQA 3LX5A 2Y0BA 3MFQA 4JOSA 3RTAA 5TDHA 1J00A 2GBIA 1X1RA 5EWMA 1WB4A 3NORA 2JH9A 5T4BA 2YY6A 1LDYA 4MSUA 3C7DB 5BSEA 5CDSA 2HMSA 2QYTA 2B7CA 2C4UA 2H51A 3WYBA 5LNK1 4G0ZA 4YDHB 4RTOA 3BWMA 2BKUA 3COYA 3N3AC 1ZIOA 5AM4A 1OH7A 1J8VA 3AM1A 2IXFA 1H9CA 1E79A 4FI3F 5KDOA 3IEUA 3NHPA 2XLBA 5KOHB 3FD8A 1SOWA 3KSMA 1ZJWA 4Z0HO 1W85B 4AMZA 5KQRA 1ODTC 1YASA 3ND5A 1U0FA 5ITVA 2FPOA 4KGZA 3LHKA 2VP9A 3O8LA 1N6PA 1X19A 2OOKA 2OZVA 5JS2A 2HDNB 5JDIA 2H4JA 5CU7A 5JXIA 3EOBI 3LUDA 3PXEA 4N3GA 3BJEA 5DSTA 1CUWA 1RKVA 3R0VA 5DNUA 3RAEC 3NEJA 1E4EA 3U4GA 4MIOA 2ZRHA 4DUZB 1UDWA 2AC4A 2W4IA 4TMKA 4O4IB 1CS0B 4I4TB 5IN5A 1V95A 2Y0DA 4HEA1 1POXA 1TZBA 4AN0A 3SVLA 3LFHA 3NM5A 3I92A 4BX9A 4LI0A 5FH9A 2Q1XA 2I87A 3IQHX 3MF4A 1L8AA 5B4VA 4YUZA 2N1BA 2W2LA 4AKSA 4P38A 1NPDA 2JGFA 2W9XA 1EFCA 3EQ9A 4OP2A 5T57A 4CWAA 2YMPA 2BTOA 3NTVA 3RM3A 4ZPXA 1F2UB 3CVJA 3V2HA 4QDOA 3F96A 3M3PA 3SCZA 2H1SA 2NSYA 2BKVA 4TKVB 3PFIA 1GGEA 2EL7A 1WF6A 1TK9A 3HVJA 1P5JA 3PJDA 5TGTA 4CEJB 3HZHA 3RE1A 3EBPA 4LISA 1P2VA 4LW8A 1JN0A 1O95D 4MA4A 5HMLA 3UWPA 3A1DA 3H2SA 2Q3CA 4BGDA 2O2CA 3NT5A 5SY9A 2ZSIA 2JJMA 3P9CA 2LPMA 4PY2A 2Z6UA 2FGJA 2JFOA 1V1RA 1OI7A 3R4CA 1H2XA 3DMDA 3LUBA 4IIEA 4P5EA 4BNXA 2A35A 4C04A 2XNCA 4I19A 3OH8A 1JFFB 2ISSD 4OL9A 1P18A 5CT8A 2MWMA 3CTPA 3EW9A 2QSUA 4EUSA 1J5PA 2YYZA 2VDMB 1UMBB 1VI2A 3OCXA 3MT9A 2FX5A 3ZLBA 2VOJA 5LXTA 1J1UA 2OFWA 5J9FA 2JCBA 2OE2A 4CKBA 1OFTA 3S2ZA 2I65A 1X8KA 2PS9A 4JX9A 4P0QB 1VBFA 3ET4A 4KXLA 4OHMA 1U2DC 1UPTA 1JIIA 2XUZA 1Q92A 2YWXA 4OHWA 1JJIA 3ZD8A 3EPPA 3DZDA 5EY5B 4BNJA 1YFJA 4RGQA 4KQGA 3QY9A 4QARA 1MF7A 4QGHA 2BISA 4XIIA 1VM6A 1B3RA 3HVUA 1K6IA 3DZBA 1D5CA 1TC2A 2RI0A 2Z2JA 2C00A 1DBQA 2I2FA 1PL7A 2HSDA 1J9GA 2I1QA 1FK8A 1LSUA 3HKBB 3M6UA 4KVFA 3M7IA 4PLPA 5F1KA 5K09A 2FUG6 2XUFA 4TS3A 1UOPA 3AZOA 3BXEA 2WFLB 3E70C 3STHA 3U4CA 5C46F 5KTMA 5L3QA 1QRTA 2L18A 3SBEA 1TZCA 2O07A 3THXA 2IYXA 2X77A 5EP1A 5F64A 1Q7TA 2I55A 3C7CB 4LRSB 2R9VA 2D1RA 1MP0A 3NHYA 1ZD9A 4BV3A 2OK7A 4F3RA 5J1SB 4CMAA 1BKYA 4EHFA 1KIMA 2HYDA 3HV2A 2DJ5A 5ADVA 2VTBA 1T2UA 3L0ZA 1A8UA 1SC4A 2B1IA 1OZAA 3EC1A 4CFZA 1ACJA 1XROA 1Y81A 2DHEA 2XTZA 1KBQA 2ZJZA 3JQFA 3A3OA 3EC7A 4FC6A 2NU6A 4IX1A 2XE8A 3B6KA 3P2KA 1KDYA 5I9IA 3KTOA 1HA3A 1L4NA 4J76A 5KAMA 3DXXA 4YHBA 5ICCA 4PTZA 2Q0XA 3D3EA 4UQPA 4QO8A 3QF7A 2QMHA 1N2GA 2FPMA 3WGUA 1Q15A 2E49A 3ZOKA 4KYVA 5ALEA 2GZ1A 2OBFA 4AXXA 4XRGA 1EG2A 1XK6A 4UREA 4YAEA 3W0LB 3FNIA 2KBFA 3BFJA 1Q7BA 1T6XA 3ILSA 3P8ZA 4WIAA 3KB8A 3QUCA 4DA6A 3O95A 4P35A 1Y6QA 2OV6A 4MV3A 1XDUA 4Y6SA 1CB7A 1A7JA 3S1AB 4RO0A 3AL3A 4JQOA 4NQZA 2ECOA 3C8MA 1QG4A 1ZC4A 1ONOA 3P1JA 2JRLA 3MNFA 4GGMX 5GM2A 3WA6A 4NOLA 3L41A 3I2YX 4CV0A 1U2SA 3L0YA 2YWFA 5KOHA 1YRQA 4AY2A 1Z8NA 1QYRA 2BELA 1W85A 2D7JA 4UMDA 3PFHA 3VYRB 3ZWYA 4V1CI 3CVVA 3R5SA 2OC9A 3EPHA 4OI2A 2WTBA 2ZYUX 3N2IA 1CDOA 4UAUA 4JI1B 4OD0A 1S4QA 4E11A 4BEBA 2FH5B 2CLIB 5CGQB 2OBNA 4D3FA 3IR5A 5BXQC 2BCJQ 1LLFA 3EGEA 2QD3A 5LDDC 1SEPA 1AB6A 3GZJA 3JV7A 1CS0A 2O7QA 3F3SA 4I4TA 4O4IA 5DCUA 3FUCA 3V80A 4DBLC 5JZ9A 4RPGA 1JIUA 2EYUA 1HX7A 4NY1A 4EG1A 4YP1A 1RT9A 2P6NA 3KJHA 4DCOA 1JXQA 1NLYA 3AEYA 3G7SA 4RD0A 3NQ41 1JPJA 2CBZA 1L1RA 2CMGA 3KKKA 1N2CB 1HH4A 1R7RA 2TS1A 3UN1A 3EMBA 1X7HA 2PCLA 1MX5A 3BSWA 2I8LA 2ZRAA 3FBGA 4TKVA 5IZCA 4ISCA 5BP7A 2A0KA 1QB8A 2IFTA 3PR2B 2CL5A 1FP2A 4CEJA 2UUCB 2E2WA 2ZXEA 4GICA 3CH4B 3ML1A 4QSMA 5EG5A 5EINA 1FTGA 1JFSA 2YOFA 5IVPA 3GJYA 4EECA 3DNPA 1E18A 2D5BA 3EUEA 3JS5A 3KDPA 3U16A 5IJAA 4EW6A 2BEJA 3B52X 1PJLA 3EXFB 1TO6A 1YA4A 4GXTA 4ZQCB 3WWZA 1DS6A 1UJ2A 4FKZA 4JLSA 1QZTA 2Y99A 2NVBA 1E2BA 1JFFA 1F9AA 1GCOA 4RMGA 4J49A 4LQLA 4V0RA 3VBEA 1UMBA 1I8TA 4IJKA 4OHVA 2WUGA 5C1PA 4OHUA 5JYEA 3SHQA 3TAHA 1SVMA 1C5KA 1EPUA 3TAUA 5HE8A 2GD0A 3ZBUA 3BK2A 3WP0A 3SKXA 3MGGA 1HM5A 2PZAA 5F2EA 1RI2A 1L7BA 3ASZA 1K3FA 4QEZA 4DQUA 1BW9A 1TM1E 1NJ5A 2XCOA 4HD8A 3ZIUA 2V54A 2X9LA 3FPBA 3P0JA 1EZZA 2UU9B 3KELA 3HFJA 1UAYA 5GV8A 4RADA 3REOA 4M36A 2C2MA 4NE7A 2F3QA 4IWNA 3EXG2 2QX9A 4QT0A 2XGGA 5L40A 4B71A 4RE5A 1JKMA 4I36A 1ULUA 1IRIA 3HKBA 4Q6BA 1YC2A 5EA2A 4KXQA 2GZ3A 4X1IB 2WFLA 3HN2A 1YIOA 3MYYA 5I3CA 3HWRA 4B7XA 4OH7A 4HAVA 2MSKA 3MMSA 3ASYA 3T7DA 2J0VA 3I6QA 3OCWA 2HM7A 3DLIA 2FEWB 3U3KA 3RS9A 2QJWA 1B73A 5IXSA 3OPNA 1S1CA 4BV9A 4Q3KA 1V3TA 3EEQA 3I6YA 3SZOA 1YJ8A 2CFIA 2V7UA 3LDUA 5EJ9A 2XZTA 4UU1A 2H2WA 2ZAYA 3GPIA 4DIEA 1TA4A 3OOJA 3SZRA 1IDN1 1QBKC 3IOYA 3Q0IA 5L3ZA 2FK8A 1E5QA 3B1FA 5C34B 4A0RA 2AEMA 1MRZA 3DZJA 2IHUA 3VISA 1GOTA 1NVWQ 3CX8A 3IV9A 4H16A 1YF3A 4F21A 2Q4RA 1ZMBA 3LPMA 3FETA 4DDHA 1I6LA 3HSSA 2RHMA 3DJYA 1DWQA 3SXPA 2F1KA 2HMVA 2C5BA 1T0JB 1EFRD 1BX0A 1QGUB 2W4MA 3CMMA 3PFKA 4XCQA 4XIGS 3UVEA 2CVZA 3S4YA 3PRHA 4AJKA 3C4VA 1GLGA 3HGQA 1OW3B 1YRBA 2HF7A 4LYAA 4YJ3B 1QRUA 3MRTA 4OM7A 4KAJA 1TOAA 3QWBA 1GLNA 3S1AA 3VPSA 4BUZA 1T9KA 4Q4CA 2Y6VA 4Y2JA 3TPCA 4AXBA 1L7OA 5F12A 3WIBA 4BVKA 4F71A 1HKUA 2JL1A 1ATIA 2HXYA 3E82A 4P08A 3L18A 5C5CA 1YZ3A 4D41A 5ADUS 1A8PA 3HB0A 1WSWA 1P4JA 3K70B 2I34A 4LJ5A 1G3IA 3PPXA 2I3GA 3G17A 4X91A 4AY4A 3M1LA 2CHVA 1AQLA 1PO7A 2R1VB 1JQ5A 1PGNA 1PCXA 2VSXA 2ZB8A 3F8TA 4HX2A 2C07A 4GPAA 4M99A 3DP7A 4WLVA 1LA2A 1XDBA 2B1GA 2BM0A 1CY8A 3DEHA 1ENPA 3S40A 1LQ2A 5JAUA 2Z56A 5ILQA 1KRWA 1SHJA 1Y4DE 4PNHA 5JFGA 2V3VA 3I9OA 1F8UA 4TZTA 5EXEA 1D7OA 1NT4A 3HR7A 2ZAIA 4UVGA 3RSHA 3U5ZB 1QVAA 2ZVQX 2WZDA 4L6IA 4D4MA 2GS9A 1O5TA 4N0QA 5L3SB 3GZ4A 2QQFA 3K30A 5BSVA 3IBTA 3OQNA 5JNUA 3P9RA 2QRMA 3JAWB 3K0EA 4HGZA 1XMPA 4XYMA 3C45A 3UK6A 3JQ9A 4HDAA 5K6RA 3K05A 1N7GA 4H3VA 4FN5A 3MS2A 3O1LA 5C8YF 2G9ZA 1KU6A 3JTEA 1N2CA 3KU1A 1P1RA 2VR1A 2CHEA 4P8RA 1OAOC 4U0JA 2PRKA 3T1NA 1UAAA 2C3MA 1W2WB 1WMBA 1W52X 1YCDA 4F4UA 3OE7A 3TIIA 4MLPA 2RGNA 2O4UX 3OX1A 3NYIA 5BWBA 1SKYE 1HURA 1Z8DA 2G1JA 2YV3A 2UUAB 3AOEA 2BFMA 4D4IA 2Q5IA 1ZISA 4FNOA 3ANNA 3I64A 3SJZA 2C2KA 3TCNA 1B23P 4K88A 3EXFA 3FLMA 2X7HA 2QLLA 1ORWA 4NCIA 5HEKA 3JY6A 4YDSA 3U31A 4KFCA 1O0SA 5L51A 1F48A 3NKVA 2MSWA 2VDJA 2W6OA 4FZ5A 1Z5VA 2PK3A 2YV5A 4KOAA 1V26A 2BGUA 3CRZA 4KXYA 1I4EB 2P68A 2GYWA 5K0EA 1O54A 3WJ2A 4BGVA 3RAFC 3GEIA 1NXVA 4A27A 4P6VF 2XZDA 2DLNA 3PENA 2FMHA 4B7ZA 2WIGA 3TNJA 1YC5A 1DJMA 1Z12A 3L4JA 5JY1A 2PJDA 2RHJA 4M1ZA 3FJOA 2H2GA 4PG4A 5FAKA 2ZRQA 3N6XA 2Z5FA 2I1LA 2ZJBA 2O3SA 4PONA 5JCJD 1QK4A 5C4MA 2PH1A 4ZMBA 1LS1A 1UJMA 4XYGA 4BBJA 2P1RA 4JL8A 4UM8B 5DSZA 5FKJA 4DC1A 5AR1A 1XZKA 4F2GA 4BMYA 3DG9A 4L16A 2C5HA 4UHKA 2ZBDA 1SY7A 3QNWA 4Y0NA 3COVA 4HDKB 4IKOA 4P82A 4CCAA 1T6ZA 2Q5HA 4X1IA 3VU9B 1FP1D 1TFUA 4G0OA 4MKZA 2VA9A 4IKEA 3URMA 3R1IA 4XJVA 1RU3A 3LY5A 1MNQA 2AVNA 1P4HA 3IOMA 4Q15A 1Q22A 4RXUA 3SK0A 3ZV4A 5IARA 2Z9BA 1HDRA 1LDGA 3SX0A 1E1CB 1ECCA 1ADGA 2IXTA 3BMXA 3L6EA 3RUDA 3NWOA 3I39X 4XSGA 1E1QD 3HFGA 3MXTA 4RANA 1DE0A 2PWZA 1N6NA 3OM9A 1JLKA 4CW7A 2F8SA 3GJRA 5I6DA 3G79A 3DA8A 4TUYF 4EYQA 1OE0A 2XADA 2A1UB 3GGOA 1FW8A 5JALA 4PX3A 3WTCA 4R1TA 4REMA 5DM60 5C81A 4B3MB 3LAWA 3KQMA 1M66A 4JAVC 1P9LA 2WUDA 4MW9A 4S05A 1Z6QA 2C5FA 3ZE0B 4EPRA 2HMYB 3VKUA 2O1SA 6ABPA 3PQDA 2QGZA 5KMGB 1E9VA 4HKTA 4MZDA 1R66A 4Z3DA 3C6KA 4XH9B 3X0DA 4JLVA 4KQIA 4ZJYA 1MV5A 2A5LA 2YXBA 3R75A 2KB0A 2W4QA 3QV1A 3U44B 2CUNA 4DMLA 1IU9A 5FQOA 2IU0A 2MT9A 1YVRA 3A9CA 1U0SY 5AKLA 4BVBA 2VKTA 3RFVA 1IBMB 5JV5A 2C9ZA 3Q6NA 1ZUHA 4M1OA 4BDSA 4OX9B 1FC0A 1NJGA 2XDYA 4BMCA 1K9VF 3INGA 2ANCA 3IAAA 2MMGA 3MPOA 4GI1A 1MD9A 1NSFA 2WOOA 3EW7A 3ZNPA 2CJWB 2B36A 2IH2A 1XZGA 4XOIA 2C8JA 1N6KA 2G4LA 4PPGA 1KOGA 1Z45A 5DHTA 1I7LA 3GUVA 2CXPA 1KHTA 2QYOA 3L7OA 4PG6A 5TARA 1TGYA 3TMYA 5IN4A 4AZSA 4J1QA 2B94A 1U8ZA 1RYDA 2VBIA 2WIBA 3A10A 2F59A 3HLTA 3JD3A 3BJRA 4JZKA 4C3ZA 2HPAA 2RJOA 1G55A 2AJDA 2VHYA 4NYJR 1OXMA 3JASB 5L3SA 2HWKA 2IUEA 2QM0A 2W6JD 4R0NA 2LBPA 4AQDA 4I8IA 1L5ZA 4B7UA 1F6WA 3GFFA 2FR8C 2WD9A 1EMDA 3JAWA 4R31A 1RKQA 3RVNA 4C4YA 4CMCA 1LTKA 1UH5A 2H4WA 3BCRA 1OMOA 1GL7A 4QUBA 1N77A 3OCVA 1XAHA 1ZM4A 4NU5A 4QU8A 4I1UA 5FTJA 1OXSC 1C7QA 3O93A 2DWUA 4KR3A 3STVA 3UPDA 1T34A 1SQGA 3M6WA 3L8MA 4AECA 4MW5A 3QVKA 1C0KA 3T15A 4EENA 1N0VC 2GHIA 1DTEA 1KYWA 1XZQA 3HNPA 1N9GA 5JNRA 3PX2A 4JBGA 2GX6A 3JYPA 1F7VA 1JUDA 4TYNA 1G4UR 1W0JD 1N5KA 3JAMA 2NZ8A 1XEXB 4I1VA 1FS4A 1FRNA 2HD4A 4AM8A 4HH3C 4UVIA 1UFKA 2ZWPA 1KVRA 1KRHA 3AR4A 3SQDA 2WSBA 2XQVA 3DLPX 5FUYA 4U0KA 3GJTA 5DYGA 1L3BA 2OFXA 1J24A 1XNGA 5KOYA 2NADA 4DXHA 4BFVA 4ENPA 5CVJA 4M0LA 1CF9A 3ND9A 4RPHA 2B25A 3DBRB 1SVIA 2JFYA 5LD2C 1GU1A 1L4FA 3PB3A 5G02A 4NICA 3WLNA 4L0CA 4JWKA 4UJ5A 2A3NA 3FVVA 5COAA 3QI2A 4IZIA 3X43A 4I1PA 2BKEA 2OQ2A 2I03A 3WLHA 2GK6A 1GU7A 2XUOA 5EXSA 1FP4B 1KFCB 3AKYA 4HATA 5FPPA 4HNTA 1L4BA 5CFMA 3Q7EA 5KQPA 1N32B 4UDXX 3KWMA 1VP3A 2QW1A 4DQ0A 5CPBA 4NMMA 4EJ6A 1ZXLA 5JWRA 1ZJ4A 2P7IA 3M4JA 5FBWB 4B9EA 2FG7C 5C5EA 3BRSA 2JDID 2C9OA 2PMDA 3C3MA 1QUFA 4OYYA 3WIUA 2QTAA 3WMGA 4HDKA 4KLRA 2XZOA 4L78A 4RZHA 1NJ1A 4JB0A 3VU9A 2IP4A 3OM0A 1AA6A 1OLSB 4YS6A 3EQ2A 3KP1A 3NTUA 1KY3A 5CNIA 4P81A 5MGNA 3CSSA 2MR5A 2BBWA 4H17A 1X77A 3KD2A 4LCBA 1RKXA 3AIIA 2AUNA 1I1QB 3EPRA 3ZY5A 1WVMA 1UWLA 4ON9A 5A04A 1E96A 2QI9F 3COJA 4LRXA 4POOA 1RW4A 1NT2A 2XNHA 3KQSA 3KQYA 3G6WA 1Q95A 1AT1A 1THTA 3N3BC 3SHVA 4CUJA 1Q0RA 4GVPA 4L3WA 1YFLA 3JYOA 1MAVA 4G0MA 4D9HA 5AK3A 4DMKA 4R3WA 1I4OA 2A1UA 1Y7PA 2A5JA 1Z8FA 3M6FA 3TEMA 9ABPA 2PLRA 3HPQA 4GMHA 2AFHE 3TR5A 1QE5A 4DPLA 5TMPA 2X7XA 3RVOA 2X4IA 1I1HA 1V11B 1BWSA 1P45A 3I8SA 3O2SB 4X45A 5AVXA 2XOEA 3ZLJA 1PUJA 2G70A 3G13A 4WZZA 2EQAA 3ZQ6A 5KMGA 5AVJA 3EIXA 5AO9A 1JDUA 1GZ3A 2OFPA 2WU1A 1FTWA 3IAXA 3QWIA 2Q21A 5F3RA 2AC7A 3QF4B 5D1HA 1XIVA 1COWD 3U56A 1QAMA 5BT9A 1LZLA 1XA4A 4XEUA 4EG8A 4F6RB 5KPDA 3U44A 4BC1A 2MIIA 2Q7XA 4D8TA 5HUQA 4CDMA 4QVIA 1K6JA 1K8ZB 3A28A 4K9OA 4P4UA 1W6UA 1S7CA 4C7JA 3P4YA 1O6BA 3G5TA 2ZRBA 1NXWA 2A9KA 2FXVA 1SFRA 1Q3KA 4U7GA 2W2XA 3B6JA 3VC7A 3EN0A 3GIWA 4NV0A 2G5TA 1E2GA 3EVGA 5FI1B 1A4UA 3ZV3A 1B76A 4B6RA 2UZ4A 3UAWA 3T3NA 2J0UB 4M3NA 3TBKA 2WDPA 4HLDA 1UPXA 2IUFA 3O8DA 3TG8A 3Q41A 1OPRA 4ISBA 5H82A 1YTUA 4BLSA 3IT3A 3W3AD 3G0IA 4UUPA 4RW0A 1U1GA 4N8EA 4ENSA 3UPTA 2BM1A 2W42A 2WVGA 5ALFA 5I7AA 3A36A 1L9KA 3CNHA 4N7RA 4OLHA 3IKTA 4YRAA 2VP0A 1O8CA 2ECFA 4D0GA 1JLLB 2Y1WA 4KQ2A 5CJ2A 5LWQA 2BR4A 1CUYA 2R62A 3U61B 5I7UA 2VQEB 2FN4A 3I9FA 4OBBA 2XMGA 4ND8B 4Q05A 5I3ZA 4C0XA 4O25A 2JZCA 4IOJA 4IGFA 1N1DA 1MV8A 3C6MA 1UIMA 3EGIA 5JWOA 1IY0A 5C8YB 5FL7D 4QJ3A 4XPIB 4I9FA 1GU0A 1PDWA 4EBBA 3DXFA 3G88A 4ZAFA 3WRYA 5JUWA 3WBJA 2AW3A 2EP7A 4KTTE 4Z9BA 2V6JA 4HVAA 4K9PA 3RNOA 3AF6A 4AUMA 1C3EA 1M0WA 4I1IA 1V1MB 1X1CA 4AJHA 3FTEA 3VR5D 1UPCA 2GTPA 2QW0X 5F7JA 1XEXA 5KVAA 1M8GA 2NT3A 4UZEA 2O2IA 4ITVA 4XLLA 4PC3A 5GVRA 4ZXPA 5HF8A 3IQFA 4OP1A 2LCQA 3ORHA 1W4ZA 3BTSA 1W5SA 4FOLA 4M7OA 3SJBA 3LCVB 2PL1A 3VU0A 4CBVA 2WWVD 3IVAA 2JLXA 3LJKA 4MS4B 4BCBA 2XRYA 3UF0A 5LLTA 2OM6A 3ND6A 4R41A 3STUA 1LSOA 4AYWA 4PCAA 4BCDA 5DBIA 5KZMB 3GY0A 4IHJB 2NGRA 3DBRA 3K8OE 4AKIA 4H35A 4XJXA 3OZAA 4X66B 4H6WA 3TSZA 2ZTLA 1QC5B 2CDCA 3NHBA 1EFLA 2VDPB 3M6MD 4NFYA 5F77A 5JMPA 4HGYA 3IEPA 4ENRA 1OA0A 2HBYA 1Z38A 2YJ6A 3TJZA 3C3CA 3QXHA 4ZYLA 3IEIA 5DYYA 4WXEA 3PDHA 1W4AA 3C1TA 3PRYA 5AI6A 1FP4A 1U2GA 5AM5A 5CBPA 2OCXA 3M82A 3P2YA 4UMEA 2H65A 3NYQA 2VH2A 3D4NA 5ILGA 3RS3A 4JXZA 1GT6A 2FU5C 3FUVA 1KP9A 3ZJ5A 1L4MA 3UA4A 2NXCA 2WABA 3VYUB 3VPFA 1ZBDA 5GZ1A 3OKCA 1Z37A 4QNRA 1RJEA 2M1ZA 3UXMA 3IBCA 2J3KA 3VJMA 3EF0A 4S0XA 1P2FA 1SPXA 2ZDGA 5DYIA 2VNIA 1MZPA 4G5HA 1GPLA 1OLSA 1T2VA 3ORYA 4IJQA 4I4IA 4UQOA 1ONBA 3D64A 1P0FA 5KYUA 3GWGA 1VMDA 3DLCA 1V5FA 2JLUA 2B4KA 2JFFA 2FZWA 1G21E 4JI7B 4DQVA 4G5OA 1KF0A 3MRXA 5JXJA 3BCHA 1H2WA 2LE0A 2Z5GA 4HEQA 4XE5A 2C78A 2IYAA 4DR1B 4CV1A 3BSSA 5HJ5A 1OYVA 2BUBA 2CXNA 1JSXA 1Z6XA 4I9GA 4CIVA 2KPOA 1XMIA 5EYPB 4KQ6A 3ZTWA 2OCIA 2PANA 2P0EA 2QTLA 4HRVA 4MUIA 3H87A 5JQGB 4XFKA 2P6UA 4EZIA 2W0MA 4GZ6A 2JFPA 1YBFA 1T4BA 4E1BA 3ANXA 1K86A 3K6SA 2IBSA 2ZSKA 3ZLUA 1V11A 1X7GA 3ED5A 3KZXA 4MVJA 5T67A 2OSVA 3W4KA 1RZRA 2H2AA 2GO1A 4QUGA 4D8WA 3LW7A 4OI1A 1U9CA 3K96A 2WSLA 4M7PA 4GOOD 3GLHE 1RBYA 3ODPA 1JSCA 3UKDA 1M1UA 5G1OA 2O8VA 2OPHA 2ZSJA 4X6YA 1VL8A 2OYCA 2R8OA 4WCFB 3QF4A 3NV7A 1T1EA 1FNCA 1K7YA 1O2DA 3TUZC 2FFBA 4F6RA 3FHTA 1E6WA 3SD7A 3HCAA 3WP1B 4FGJA 2FW7A 2LUOA 1NDHA 3TM4A 1NM5A 2GSWA 2Q62A 1WKBA 2HK8A 4UTOA 4B2LA 1AQ6A 5CMLA 1EYZA 2GD2A 1U3VA 3QLUC 2X2PA 4NOKA 2CNWD 2A58A 5IYZF 4YCDA 2E85A 2IS1A 5EE1A 2JI6A 3AB8A 4JIMA 1Z6PA 4HMQA 1ZN9A 2G71A 2J0UA 4PS1A 1M83A 2O2XA 4O4LF 3SLRA 1II9A 3BHIA 2RJ3A 4MUFA 1QFYA 3UZUA 2Z8YM 3NBFA 4FFSA 5IBRA 2AZ4A 1CUSA 2AG0A 4C14A 1K9SA 2WV9A 4HAYA 4OPMA 2NV2B 2VXBA 2PXXA 3AK4A 3KKZA 4JMPA 3NGLA 4I55B 1N78A 1SXJE 4HH1A 1JG4A 2A5GA 2PV0A 3C97A 1AZWA 4MI6A 5DF1A 1N0WA 1VE6A 5EPUA 2ZT8A 5F4ZA 3KSZO 4YJGB 1HLDA 2C3YA 2I2CA 2UVPB 2WFAA 3MGAA 4QTZA 3ZWXA 1GNPA 5JTUA 1JB9A 1JLLA 5G3ZA 3ZCRA 1P19A 3ORRA 3U48A 1AHIA 1HNNA 4M83A 4J3FA 4ND8A 4PSCA 1Q6ZA 2HY7A 5DN9A 3WRXA 4WVLA 5K4GA 2K2WA 3CTMA 5C8YA 4FYWA 4GBED 4LBYA 4XPIA 1LEHA 3KDSE 1SU7A 3PKIA 1FIUA 2WT4A 1K5GA 3BL6A 3OPYB 4JR2A 4YXFA 4A15A 3H8WA 4ZT5A 1Z8HA 2R65A 1M7GA 3JRWA 5JVDF 5CCBA 3AIMA 1B6TA 3KFVA 1Y6FA 1KYIA 1QPZA 4OV6B 1V1MA 1C2YA 1VZ3A 1Y3AA 3LP6A 3TOXA 5IT5A 5JSYA 2PX0A 1R15A 3ADDA 4AKHA 1GR1A 1L8OA 1Z4IA 2VTEA 1R00A 1E5XA 1QHXA 1U0JA 1ESZA 2ATIA 1YRHA 2WI8A 3KAQA 3NOOA 1AZLA 1G7TA 2G82A 3KPUA 3MB5A 5KNBA 2FZLA 3WDKA 3N7UA 4MS4A 1DQZA 5JO9A 3CUTA 3ZR4B 3HJAA 3A9VA 2YV1A 4B79A 1RE1A 4BU1A 1VKOA 721PA 1K2WA 4QHSA 1Z15A 3E2IA 1T3HA 1JIJA 4IHJA 1G2IA 2EQ5A 3OZXA 3V7WA 2O8CB 5CA0F 1QC5A 1J8YF 4EHIA 4IILA 3ZQKA 3CINA 1SNYA 3PFCA 5EEGA 4YUVA 3W7BA 4IKPA 4IP0A 4OJQA 1EX9A 1H5QA 2DR0A 4NF2A 4C2AA 2C2XA 3AGQA 3MUNA 4WESB 2EFYA 1U7WA 5DN6A 1IOWA 1VA5A 3A2NA 3F5MA 1XR3A 1C4XA 2NZJA 4HLNA 4HAIA 3SS8A 1Z3CA 1YFKA 1DIBA 4Q3LA 4QXMA 3S99A 2PKQO 4LWPA 3W1WA 1ZM3A 3CQ9A 2H1LA 4TT3A 3H9EO 3T4UA 2R97A 1QDUA 1C81A 3GDGA 5EMLA 4CM9A 1GHTA 4RF5A 5EHZA 3ZDBA 1WHTB 5ECDA 3H84A 3GLFE 3AV3A 1XAGA 3BSYA 1G6Q1 5CFRA 4N41A 3KEQA 5JDIC 4PC2A 1HMYA 2O20A 1K88A 3NCTA 1F0NA 2JAOA 3PEFA 3UM9A 1JS1X 2DCMA 1SN7A 1T2DA 4FE7A 3EIEA 3EVFA 3I6BA 1T5SA 4IF6A 1ZJZA 2Q5QA 2GZ2A 3F9CA 5ECWA 1I3CA 4FGUA 5FV7A 1B2RA 4N3BA 3VMMA 3T9EA 3HVHA 2BMVA 3QVGB 1SQ6A 1Y9AA 2ZWVA 3DWIA 3I12A 2NO5A 3ICWA 3QW2A 4OAOA 1YCGA 1KMQA 5EYPA 1FRZA 1SG0A 4YQZA 3G2JA 3HUFA 4I5FA 1BX3A 1OF1A 5JQGA 3E48A 1YJQA 4PTLA 4K86A 2OZKA 1YWGO 1ZHHA 5JLAA 1BXKA 3F3KA 1SVSA 3BK7A 3W1EA 5IABA 3WGIA 3B7PA 4DLUA 4F3NA 4LQ4A 4P36A 1Q7GA 1W5EA 4Y7DA 4C5CA 4F6CA 1M34A 1WAMA 2PRSA 1ITZA 1QRDA 5CT4A 1Y7IA 4O2LA 1PHPA 5C1IA 4I9HA 3LT1A 4WCFA 5BR4A 3N8HA 4MARA 1M2GA 5L53A 2SHKA 1EBFA 5JS6A 1QHYA 3MQ2A 1I80A 1WXHA 4D4JA 4EF5A 3AXTA 1X7WA 1X2EA 3BX1A 5E1OA 5HQ3B 1XU7A 2XBUA 3ASUA 1ZOLA 2JF0A 3AWIA 2CXXA 2PYIA 2JATA 4L3OA 1LCIA 3OKPA 3AF4A 2IXBA 3NX4A 3DE1X 3QLJA 1PSZA 2A9RA 2PS0A 4MMYB 4KNYA 1SKBA 4AJJA 4NYJQ 5A3JA 4O3FA 5H02A 3GCWA 2O8EB 4D0RA 1IULA 1SXQA 1T36B 1CUCA 1UQTA 2X9GA 2RK4A 3L7DA 7ADHA 3EPJA 1YL5A 3IALA 1G1AA 3P9NA 2FWBA 3Q5EA 4KFUA 2AEFA 2LZ0A 3VJRA 2EBWA 3CU5A 3MWYW 3UY4A 3W2EA 3OEWA 4KWCA 4NHEA 3JYHA 5CK4A 4MR9B 5FB3A 3A1NA 4C0JA 1SG6A 1LPMA 1YB7A 1G18A 1X14A 5EIFA 4YMLA 3H13A 3BB3A 2SCUB 2CUZA 4I55A 5DZSA 2G1PA 3WAJA 2Q6LA 2VNAA 4X24A 1J7KA 4KU4A 3L7IA 4G89A 5FO0A 1M2KA 4YJGA 4ZAXA 2UVPA 1U98A 3DW3X 4BRSA 4NCBA 4FYYA 4AKEA 2R8RA 1V9CA 4CEIB 4LPSA 4RZUA 3GPCA 3KZNA 4PYMA 3T54A 1L5RA 5TGZA 3D6NB 3NEAA 1OFGA 4MH0R 3LVQE 4BMXA 5C8ZA 2DQYA 1ISMA 1DL5A 3OPYA 4DG5A 2BE7A 3OF3A 3H2ZA 4U9UA 5EP2A 5ICGA 1AJEA 4BEJA 2ASEA 1Y6RA 1GGFA 2JI9A 2PA0A 2ZJAA 3A05A 3TXYA 5CDTA 3SMQA 3BFXA 5JJKA 3O7MA 2DPLA 2IZ7A 2QRKA 3ZYCA 3GEGA 1N4DA 4I6EA 3E3MA 2Q5OA 2MMCA 3JQFC 4KLAA 1YJ5A 2QLTA 3WL4A 1VL2A 2ZUBA 2PSFA 4Y2QA 1Z0ZA 3PHLA 5DW0A 1RRFA 1JP7A 1X86B 1Z5ZA 3BXGA 1E2EA 5K99A 1E2LA 1PUXA 1LVUA 2CDRA 1JFRA 3IDFA 1FVFA 3OZBA 2O8CA 1WMDA 1JF8A 3BIXA 1RLIA 2KWIA 4ZV9A 4LOKA 1ZEJA 4JCOA 3IAHA 3JRXA 3PK0A 3QXCA 4GKVA 4RSHA 2PUJA 2ZUUA 4J1TA 4MQEB 1ZINA 4MVXA 2X8AA 4HN9A 1JSRA 4LBZA 3OE1A 3B6EA 3EEOA 5IJ9A 4V1CB 4WESA 1ZO8A 2CLEB 3D02A 5TNXA 1G9TA 3T0IA 2CK3A 2REXB 3W9YA 4C05A 4P9NA 4UTRA 2HCRA 4G5XA 2CXHA 4D0SA 1PYOA 4RXTA 1GYQA 3UATA 4MEJA 4EB6B 3CV3A 3H1PA 2FPGB 1NPTO 4K5QA 3V8RA 5EJ6A 4F5DA 1CFJA 5GMOA 3C0KA 2VRWA 4MAFA 4ZDJA 3GWZA 4LXUA 5NULA 4D6XA 4G1CA 4IG4A 4XCXA 1WHTA 3KO8A 4X3OA 2P27A 3OFSA 3SFVA 1W4BA 2K2QB 1CTQA 2HWXA 1BOOA 4IUYA 3ROQA 4Q4AB 2V9PA 2IRWA 2HBZA 3DT9A 3DDOA 5DHSA 4R0MA 1Z0KA 2I6XA 3G5AA 3KZVA 4NBRA 2VT7A 4O0MA 5IT9A 1XEWX 3H11B 1A2OA 2V5VA 3VKGA 4R1NA 4IIFA 4A82A 5AXDA 4JS0A 2Z3ZA 1J07A 5EHQA 3E3LA 2GJAA 3QVGA 3LOPA 4FGKA 5FUXA 4AJIA 4AN1A 4DEYA 3A58B 5ALGA 3TZ6A 3LQYA 5CB0A 1E1RD 1R4AA 3TPZA 3QKIA 1O4VA 1ID1A 2HA5A 2VSFA 3BG5A 4RSGA 1T8RA 1IJKA 1TIKA 4HTFB 3UV6A 3TLGB 1R37A 5B3JA 2XXAB 4I5IA 2WJWA 4BVLA 3J7TA 3T3PB 4X62B 2GFHA 1NI4B 4ER0A 3TLBA 3HACA 2JLBA 3N8KA 4FJ0A 4HB3A 5TRTA 2PUBA 1WLYA 3JATA 2P35A 2ZIVB 1WXWA 3AY7A 3BIWA 4KXUA 3VQTA 3MJSA 4B6PA 1WOMA 1T2AA 2UV8A 3QWFA 4BUJA 1JL3A 3QBTA 4DR3B 4AG3A 1U2ZA 4IQ4A 5IUKC 3UHPA 1J2TA 5FOTA 3BZBA 7YASA 2IXAA 1SKYB 5ERYA 2QUBA 3M70A 4JROA 4EF4A 2Y1DA 2H5LA 1W5BA 2B6NA 3O73A 5HQ3A 3IRVA 4R9UC 2C7BA 1G4HA 1UT8A 3DBIA 3PDWA 8AT1A 4KB5A 5K8JB 1L5KA 3WIVA 1F8YA 3LZDA 2FE1A 1Q19A 4CIBA 3LK6A 1H0RA 1HE3A 1YIDA 3CR3C 3JSXA 3I6IA 3QSGA 4DLNA 1SC3A 3GCXA 4HYTA 4ND5A 5BWNA 3SHOA 2O8EA 1YULA 1ZMTA 4J7AA 1T36A 1WIWA 2QTRA 3LY9A 1FFSA 2ACKA 3L07A 2PY6A 5T8KC 3L0OA 5JXGA 4ZN6A 1I7SB 3WOHA 3F5QA 4B31A 5HF5A 4QGGA 1HDGO 4MR9A 3DM9B 1A9PA 4KHPB 3PTAA 1HLGA 1POWA 3L4SO 4DIFA 3MTQA 1Z82A 7AT1A 5C52B 1MOSA 2I3DA 4S1NA 2IZ5A 2SCUA 4B75A 3V48A 1IJEA 3IHTA 3NP9A 3NANA 1TMGE 3MIZA 4QBFA 3EGVA 3FROA 4CQMD 2I76A 2OBYA 2H5JA 3LHFA 5F73A 4FINA 4CEIA 4NE9A 3O91A 3K2BA 1U63A 3DPIA 2XRMA 2QRJA 4MQBA 3D6HA 5B7PA 2BFCB 4ZEOA 2RE8A 2H9IA 3GJ4A 3E23A 4GYJA 3OUUA 1UEJA 1W47A 4R1OA 3VDNB 1PJAA 2Q2NA 4HT3B 4UXJA 4AJ1A 2PKXA 1M2HA 1VKZA 1O9BA 5H0IA 1QU3A 4EATA 4PSAA 3LNTA 3FKQA 4P1ZA 3L5OA 4X8MA 4LFBB 3I5AA 3MTJA 4HTAA 1DC6A 2PH5A 4FHZA 5ESWA 4H1HA 5SZHB 3QSYA 3BXOA 3G6KA 2FWIA 4INOA 5CP8A 5F1OA 4CLRA 3BIOA 1O7JA 2X3UA 3OTGA 3WB0A 2YXDA 2QNBA 4FWTA 1NAIA 4HG2A 2VUHB 4JSRA 5CHEA 5FFNA 4BPRA 1WXGA 1KPIA 2NYRA 4GUAA 4I1YA 1USGA 3LQKA 3TZKA 1AK2A 2O0KA 5AI0A 1CQZA 1W4RA 5SZJA 1QMGA 1R27A 2ZZMA 2F3RA 1GTL1 4RU1A 4CTJA 4A6XA 3H83A 2XMQA 1SMKA 4MQEA 4CXMA 3CZCA 3PUIA 2F62A 2QN8A 1ZM7A 2DUJA 1M1NB 3BBPA 3HNRA 3QRWA 3DBOB 1FBTA 4FFRA 5DHAA 1MGOA 1P4GA 3UHJA 4V1CA 3EGXB 4OX9Y 3F5SA 3LQ1A 3TXXA 2Z4RA 2UXCB 4PWZA 3PC2A 1CRZA 3PQ3A 4EB6A 4UOEA 1ZNQO 3A4LA 2FPGA 2YXNA 2W70A 1A8QA 2Q2WA 1L4EA 8ADHA 4XX0B 2YHUA 3T0GA 3QKRB 1XTQA 3W5VA 5F5LA 4QULA 2O6HA 3F8WA 3ZHRA 1F60A 1L7RA 3GMDA 4HDOB 4LKOA 4WACA 3CYFA 5KUTA 2FLVA 4ABTA 1ECJA 4MW6A 3M0EA 2XRZA 2YZGA 4WD3A 4BZZA 2IPXA 5CW2A 4ZOAA 2XOXA 3QEKA 1SHTX 1RJGA 2IJGX 5FBRB 4CI9A 3KKMA 3EOZA 2WQ7A 3D7KA 3IT0A 2EATA 5FOUA 3DE2X 4J2OA 4BGIA 2BT4A 2CV0A 1HL7A 1Q7EA 2XZPA 1LSJA 1VPTA 3H11A 3LUGA 2OV4A 2A9OA 4JLAA 5D84A 3U6BA 2ZE8A 2ORED 3FIJA 3MWLA 3WDSA 3U3DA 3ZJTA 3X1DA 2AXPA 1OWLA 3FCOA 1FNNA 1QNFA 2JK1A 1TUEA 4RD6A 4CKXA 2J7PA 1X6VA 3VPBA 5KTNA 4JYAB 3P4UA 2WNIA 3H5NA 1HV8A 2BYTA 2CD7A 2Q28A 2W37A 4GPIB 5FUVA 4BRZA 3TLGA 2ZR7A 3C2QA 4FYVA 1XPUA 1NI4A 1XTVA 1XWWA 2QVXX 3KKNA 1GPDG 5BQOA 4GYYA 3A8TA 1QZZA 2ZAGA 4CR7A 5HIIA 3V7YA 3L92A 3UJHA 3I2FA 3GGJA 3B5JA 5IKOA 2DBVO 4PC6A 1JHQA 2PKQP 4IDEA 3I58A 3LIIA 4MUXA 4JKOA 1YFZA 4B84A 4DV7B 4JI8B 3PHJA 5C5DA 2XEDA 2VQ6A 4P4TA 2ZJ0A 3BGDA 1NBAA 3KLBA 1DIGA 1W93A 1WZEA 4QGBA 3O83A 2ZRIA 4ZAVA 3AU9A 2YCBA 4NNOA 3UIEA 4Q3CA 1IHUA 1TA9A 4LV5B 2NWQA 4IXWA 2WZBA 1G8HA 1SXGA 4LXXA 1XMVA 4CKCB 1JZQA 1SU8A 1QRRA 2WJJA 3L7BA 3UK2A 5EIHA 3I1IA 4JD5A 4LSZA 4RLFA 2XWPA 4V0KA 3RIYA 3H5IA 2QX6A 4B3GA 1KEEB 3IAM1 4IZ6A 1QPGA 2BFDB 3UBTA 4F38A 2F48A 1ZUIA 1TVMA 3SN6A 3U7QA 3KVOA 1G8JA 4AK9A 4YRTA 1UJ4A 3Q9NA 5A0VA 4ITUA 1FU8A 1TQ8A 3B6ZA 3C7TA 4BPBA 1J20A 2EG5A 2FPRA 1K4KA 1L5OA 3AF2A 3BOSA 1E3IA 5LZ8A 4QA9A 5DI9A 3WWPA 4BASA 2V4UA 1MJFA 2XQFA 3V8NA 1ZAYA 1Z5PA 3UAOA 4IWXA 4MUJA 3RS7A 4X41A 4DTCA 3WX0A 3BC1A 1Q2UA 3V97A 3ACCA 2QTGA 1M8PA 3AW8A 4IUDS 4LGVA 2YHIB 4TSRA 4CM8A 3D7MA 1A88A 3DAHA 1Y3FE 3ZJVA 3HL0A 1QX3A 2JA1A 2G6BA 2I8AA 4GVXA 5DGHA 1AKVA 3TGLA 3MAJA 2J6CA 3VDQA 1XRQA 4UNNA 1GUAA 4DXDA 2ON6A 4TSKA 4EITA 4PX9A 2ZRPA 3M6VA 4WQMA 2VPXA 1KFKB 1RWOA 2R7LA 4NQRA 2XKBA 1KOFA 2QGFA 5DGXA 5A1TA 5JCXA 5IMBA 5BW8A 3ZGOA 1M0SA 2W6PA 2BR3A 1I13A 2WILA 3SF0A 1OROA 4WKCA 9LDTA 2M1XA 2R6JA 5CEJA 1TYDE 2CMHA 1M7BA 3SSAA 3T1OA 1EFHA 3TD9A 4WNAB 5E9QA 3I37X 2AJLI 3PHCA 1LY1A 3UA3A 2D0OB 2KLHA 5CFQA 3QFHA 1JAXA 1G19A 2B21A 3SOPA 5ALHA 4Q01A 3BTVA 2AFHB 5DNEA 1ZFNA 2DWPA 2I4OA 2ZBFA 3VZBA 4JLBA 4LMBA 3U7EB 1LPBB 3WJAA 4DIDA 3PXXA 1II0A 1KEWA 4BKQA 2JLQA 1M1NA 2VH1A 3GGCA 2NAFA 2DC1A 4PX2A 5JD4A 4NDNE 3CZ9A 3EGXA 2GZRA 1UPFA 2PVPA 4LV6A 2YICA 1WCV1 4ENWA 1I7NA 3N2GB 5K8TA 2YYAA 3FCUB 1ESCA 1JA1A 3K70C 4QPDA 4J0QA 4R54A 4XX0A 3ZI7A 3IX7A 1DAIA 2JNWA 3QKRA 5T41A 3E8XA 1AQIA 1ZMOA 3D6TB 4C2BA 2AX4A 4DCUA 4CHGA 1FXUA 1P6XA 4WBXC 5BPFA 4MGKR 4JB2A 3S27A 1UMCB 5FDFA 1PWZA 3IHKA 4WDRA 2HIMA 3WWOA 5JJIA 2EERA 2ZU6A 1PL6A 1PGPA 5TMEA 2HBRA 3NT2A 1ZH6A 3JX9A 2BI8A 3UMCA 1GG9A 4KI0A 1XQ6A 3T7IA 2IV3A 4AJEA 5I4CA 5ALZA 4RGYA 4H1TA 4K28A 3PJGA 5FBQB 3PC4A 5TEVA 4UUNA 4IZHA 5M34A 4MV0A 5MFPA 1OVGA 2JFUA 4AUKA 1A4RA 1J0AA 2QGNA 4ZVMA 2PX2A 3BD7A 4DJ5X 1L4LA 3A14A 1GG2A 1NX9A 4HY3A 4TL7A 1DRWA 3AF0A 4JJGA 4PAGA 4RESA 2FG6C 3LX6A 5JW6A 1H3FA 5CFLA 2EQBA 1R18A 1GFWA 3ENNA 4IY1A 2Q3EA 1CD5A 5HM8A 1LPAB 2GK3A 3ENKA 1D6MA 1QG6A 3H9GA 2DSTA 2VDWB 4ZV4A 4FOPA 3U19A 2GASA 3PGMA 3RS4A 3COPA 5DH9A 4M46A 2PBRA 3TD6A 2OP1A 3L8EA 3A4YA 3BGOS 3N5KA 4L8LA 1H2EA 3RTGA 4YRBA 2ECQA 1TCBA 5C8DA 3HA5A 3VOSA 1YI8A 4OSPA 1AGPA 2QZ9A 2D8MA 3ACBA 3JZAA 1PVVA 1SVLA 3PE4A 3QPUA 1A8IA 3EPLA 4L6AA 2K6GA 2Z98A 1E32A 2H48A 2PUGA 3B3QA 2ESRA 1KE1A 1RTKA 3OLVA 4E09A 3IPAA 5D5QA 5J2TB 2CDAA 1Y1RA 3H4MA 3SMVA 1NRIA 2O48X 4CKCA 2HU8A 2HT6A 4DJFC 1G9SA 2JJ2D 3NGMA 2E6UX 2EGGA 2QY6A 1EFKA 1KEEA 1IB0A 4YRGA 3GP3A 1CZNA 2XUKA 1GNLA 1BVHA 3FWZA 3SEFA 2YW2A 4MCAA 2ZJ8A 3KB1A 3MVEA 4V0SA 4JLJA 3W5IA 2HJ9A 4HNVA 3Q10A 2HKIA 1WBBA 4GBGA 2AMLA 4Y6LA 1X1SA 1RZ3A 1R4MA 1H9BA 2JIZD 2Y68A 4RLHA 4XWGA 1UT5A 4C0HA 3LLSA 4IYRA 2VJAA 4DDVA 4FSDA 3VYSB 3ANYB 3OY7A 1J97A 3R24A 4BP1A 2VK8A 4LE1A 1HZZA 3ABSB 4JCCA 4O5OA 1ZGGA 4MCIA 3FLEA 3T7CA 2P0YA 5C5IA 3G9ZA 2JIMA 2UZ0A 3I04M 1CW2B 5EGNA 3SJUA 1FYWA 4FNGA 2V3CC 2GERA 4MIKA 2OFOA 1NTRA 1USUA 4KKXB 3TQCA 1YV9A 3LI2A 1DX6A 1TYCA 4DMMA 4CKZA 1F0YA 1HC7A 1ODSA 3Q8KA 2QPAA 3BORA 4PCUA 4B17A 4D8VA 1BE8A 4MXDA 4JY7A 4ZVSA 4QPPA 5HQTA 1N7JA 4WHMA 4LJYA 1NA5A 5F33A 4C01A 3D9QX 3B89A 4KN6A 1UINA 2IYPA 4PZDA 1EVYA 5JJCA 1IHPA 3CJQA 4JJAA 1G21B 1SWWA 4CNBA 1YMVA 1T4GA 1VC2A 2VATA 2G63A 4LDRA 3MTIA 4WK6A 3VDRA 4BX0A 1GY8A 1N2ZA 5GV7A 4WNAA 2OD9A 5IAKA 3FVTA 3KT0A 4QTTB 3AR2A 3AEKB 1OXBB 4Z86A 3OKAA 2Z9CA 1Q12A 3E1KA 2GZHA 4UTXA 1JALA 2ERCA 1HYHA 2XTNA 3LBIA 4YCNA 1ODJA 3V8BA 4EHHA 4O5AA 4Z4IA 3RRJA 1PJ8A 1QSGA 2PKYX 2AFHA 2RONA 4O4IF 2YFHA 4OOFA 1QVWA 3SEZA 3MS4A 2WMOB 2WPNA 3L43A 3DP9A 3OEHD 3IUYA 3BKXA 2AI2A 5LJIA 2EDAA 3REFA 1O0CA 2Q0SA 3OIDA 3GLVA 4K9MA 1KJNA 2V45A 3GLHB 3H9BA 2IF2A 1DTSA 2JGLA 4KEAA 2PIDA 2FW1A 3N2GA 1ZR4A 5SYNA 2RHGB 1G42A 1PFVA 3LNCA 1G6HA 2VYND 2IPNA 5E6SB 3T41A 2CLLB 2ZXUA 1XCGB 1GZ5A 5HDQA 2YHSA 4X61A 4GR4A 3RDPA 4PICA 4AP6A 2WY2D 1UMCA 3L7CA 7ABPA 1FDRA 1ZMRA 1QQTA 4YMVA 1C9MA 2P69A 5HZGA 4QUIA 1DHTA 4IVQA 2R8YA 4FYPA 5D86A 5LIPA 3ZU3A 3T7JA 4GS5A 3WBFA 1JWLA 4ZCQA 1NBWB 2NT4A 1DRVA 5LU8A 3VKWA 4KYUA 5JCPA 1YB2A 3KQTA 1NKVA 5K6AA 4MR7B 2BOVA 1ZGAA 2CL0X 4UTPA 5A4AA 1HFJA 3E7WA 1VRWA 1ZONA 2GK7A 5AXAA 3HJNA 1MC1A 4EDHA 2EZUA 3BE8A 3NFYA 2JIBA 7MDHA 4YYZA 4NJEB 3NO4A 5CDGA 3VH1A 1DC7A 1YIAA 3HCEA 1PDOA 1SXJB 4RKYA 2G76A 1E9BA 2KSQA 3D6MA 3HA7A 3IUMA 3I6ZA 1DPGA 1SUSA 1YR1A 3DKRA 2VPWA 3KHUA 3AP2A 4L28A 3I2IA 4MV6A 3W3AH 4H9GA 3R0ZA 1ZG3A 2ILVA 4G5FA 3WRYC 2O0LA 3ESDA 3R9KA 5BMVA 5LIRA 1XCBA 3AY3A 3B8HA 1XO1A 4KIFA 1JECA 1MQSA 3DOEA 1UDCA 2V5AA 3H1TA 2XTAA 4LS3A 4KSBA 4ZYTA 1BCSB 5AW0A 1WY5A 121PA 4JNCA 1N6RA 2VJOA 4Q9LA 1S2LA 2QRGA 3GDOA 5JNVA 4C1BA 4C2UA 4G97A 4U7TB 1P1JA 1YBAA 1Y37A 3O31A 4AW9A 4F96A 3SSMA 3EGOA 3M6LA 5ECYA 3WBKA 1JHAA 5F21A 5J2TA 4DZRA 1PS9A 1G8FA 1QVRA 2QAGB 4E21A 5HJEA 4UNPA 1KWGA 3NCHA 2B4RO 2QX4A 3U60B 4KNVA 1O8BA 2QIPA 4O1IA 2YZ7A 1ZUWA 3D0OA 3P96A 1CRLA 3VR5H 2G80A 4JL6A 4L9WA 1WA5A 3GQVA 2IYUA 1KZYC 1PDVA 2XQKA 2I4IA 2QL9A 5K5EA 1UKBA 5LR6A 2OHIA 1HLPA 1JEJA 1NUAA 2BFOA 2OM2A 4UVHA 3KOOA 1E7YA 5CVCA 4D80A 3QMWA 3U39A 2ZRGA 1AG9A 3K73O 4NHOA 1MEEA 4DN6A 5KTTA 2WF7A 1R5OA 1NDQA 3DOCA 3IE0A 2GBLA 1MA3A 1X1TA 3DONA 4DDUA 3DMTA 1Y9ZA 4JC4A 4DT1B 2YMQA 1T0PA 3WFJA 1Q21A 3VX3A 5IJ0B 3CE9A 3JQBA 4J0FA 3WGLA 1O4WA 2RGAA 4H4CA 5AQEA 4BB5A 3IE2A 4JUFA 1DUIA 3ZD9A 3WMEA 1SWVA 2O1XA 2H8KA 2WM3A 4XZ3A 4E03A 3VX4A 5T7BA 1EINA 1UBCA 1IEQA 2IYVA 3IUJA 4MUHA 1DXOA 4Q93A 3QPWA 3PXCX 4R2IA 5REQB 2C4HA 3GLFB 1AKRA 1DUSA 1ZA2A 1EWRA 3A6LA 1G7CA 2P30A 1AMNA 1CJKC 4TQUS 1S6YA 2OUIA 5D3KA 5TIIA 3PC8C 1ZR2A 5KTOA 3GP8A 3K2IA 1L4UA 1MORA 3P9SA 3KE9A 1T43A 1YQDA 1K5DA 2Z43A 4PFJA 2CFTA 2YWGA 3KLNA 4CQLB 4EYEA 3U09A 1EVEA 1OHHA 2ZBRA 4XUGB 4DDTA 5LKRA 1OTXA 5CM9C 1JQBA 2H4FA 4WVFA 4E22A 3U7GA 4R2JA 3K5HA 5JMTA 2EBHX 1RIFA 1NC1A 4INAA 1ONNA 1OTYA 2IHJA 2HA4A 3HWX1 1E1YA 2VAVA 1GAWA 1EE9A 1RLUA 2GKGA 1QDEA 3CR7A 1AGXA 1YJCA 4EYGA 5IANA 1Q2XA 3QKSB 1EI9A 3VYTB 2OV2A 5CFOA 3IOBA 2IZ1A 4ZWNA 2FLWA 3DVQX 3ZTTA 2VH5R 4Z9YA 3HDQA 3DV0B 3GRKA 1PK9A 4LRUA 1KAEA 2PZLA 5DXAA 5FOWA 5AW1A 4C4TA 3GLHA 3MSCA 5F9FA 1OWMA 4DMGA 1JAIA 4KPEC 1DAHA 3TEJA 4OQQA 4WEQA 1UL1X 1A4IA 3EUAA 1JG6A 3TQOA 4D1YA 1P5FA 1EZ4A 4GKBA 4LYFA 3QVWA 1CIVA 5AW4A 4DKJA 4KDFA 5JH7A 4GFDA 4XSHA 1PZXA 2W2KB 4H7PA 5F52A 3GRFA 4ZKEA 4A2PA 5KWEA 5EZ6B 3FZGA 1NJFA 1T5BA 2AMJA 4KXFB 1R6DA 3GMTA 2EX4A 2X6TA 2DFDA 4D9JA 3SQNA 2Z5LA 1NNEA 4AO8A 2WLTA 4EO7A 2QE7D 1RYEA 1QIKA 2GNPA 3QA9A 1RWXA 3W6UA 2I7DA 5BV7A 4MR7A 4DM7A 1GPAA 3T5PA 4WGFA 3SYMA 2JGNA 5DISB 5ED4A 3DBHB 3VPDA 4NJEA 1Y4AE 1IATA 3BDAA 3MCWA 1JHPA 1VLZA 4IRXA 4CRWB 3WRXC 1E60A 4LF8B 2CJPA 4YACA 1OILA 4WZAE 4B8WA 9ATCA 3O3NB 1BFDA 3HB7A 5FI5A 5F98A 4FR0A 2RAVA 3ZGNA 1ULSA 1QYWA 2ZSDA 2XD4A 3ZJ4A 3B6IA 1ZPDA 3ELUA 2JD2A 1GKKA 2QE6A 1BCSA 4BP8A 3EWNA 4EA8A 3KVNA 1GZUA 1IM8A 2XOKD 1I2ZA 2ZI5A 5ARDA 9GPBA 3VV3A 1SURA 4EKDA 4GXNA 4V3CA 1NE7A 3R3WA 4BMVA 3FTPA 4G36A 3HWSA 4QDZA 1EAMA 2QAGA 4DXAA 3VDXA 4E1VA 5J2UB 2IDZA 3TOCA 2C2WA 4E2ZA 2AJBA 4MRAA 5IVIA 1MG5A 1C41A 1WMAA 4HQNA 3KFLA 5K45A 4XR4A 2RIPA 4QFCA 2OAGA 2OKGA 1L7QA 2Z1DA 3HG7A 5CITA 2CNDA 3PC6A 2IW1A 3PZRA 4BY9E 4N0PA 2O1WA 1UBEA 3TW0A 1Q1BA 1UXOA 1T8TA 1JU3A 3RU3A 3UXEA 2V7TA 1G3RA 4FEEA 2P6RA 1RYFA 3OZWA 3P20A 3ROEA 4X20B 4P93A 5CAEB 5LUAA 2O8DB 3JALB 1ZVJA 1M6WA 3T7AA 3G7NA 2VTDA 4DT1A 2JHPA 1LW7A 1GA1A 2RKWA 3OJCA 5EMMA 5BR1A 1GSIA 4NK5A 1YUBA 1JYEA 3ND7A 4GQBA 4UARA 3MTAA 4MJ3A 4U3JB 3ZGLA 4HGQA 5CR9A 1CV2A 3I4FA 3SEAA 1N3LA 3SDBA 3R3JA 4G9GA 2HZ7A 1JLRA 3HDJA 3IP6A 4M1WA 1ZNYA 3BH7A 3G2QA 4B6SA 3L7MA 5REQA 3WYDA 4LHWA 4R9SA 1L5MA 2A59A 3F8SA 2H52A 5FWNA 3H5RA 3TMAA 4Q82A 3TZLA 4BOYA 4ZDIA 3QBDA 3JD4A 2ZRLA 3FPJA 1EQAA 1IQ0A 1KA9H 2HCFA 2RGCA 2VHEA 2ATVA 4ZI7B 3WK6A 4C1NA 2X0NA 4Q7QA 3NBYC 3QE2A 2ZT6A 3MWFA 4XXHA 3WNDA 1GTVA 4LAFA 1NI5A 4NPHA 1ML4A 2H1HA 1WG8A 2RC6A 3VVMA 5B30A 1EQ2A 2DQKA 3F6CA 2VP6A 2YQ5A 3P27A 1DSSG 4L02A 5H5JA 2DT5A 3ADOA 4WBNB 4AQ7A 4D45A 4UEKA 3EMDA 1OOEA 3ZCUA 1LLCA 2AX3A 2ZR8A 2AK3A 3QV2A 4G3XA 3GFOA 2QVLA 1TRKA 3P0RA 1OGJA 3GRYA 2I4RA 2HA0A 1LBHA 2AS0A 4H7DA 1QAQA 1ZD5A 2GLUA 2O3RA 3DLTA 4K9LA 2VDOB 3MW8A 1QCCA 3OLYA 4EG6A 1UMDA 4L22A 4JU8A 3DV0A 1LBEA 3GPDG 1VHWA 3N07A 1INLA 1Z5NA 3OZRA 3PWSA 1CBUA 2QL5A 2UAGA 3H2BA 3HSKA 4ZU6X 4TL9A 2BGMA 4YXWA 1BMFA 4RXMA 1IPFA 1FQWA 3DFZA 1NYQA 1IYZA 1CYDA 4FD3A 4DADA 2B92A 2WKSA 2D1QA 1HUQA 3MB8A 1T9BA 4E7PA 1N6HA 4PSKA 2W2KA 1TMKA 1AS2A 3OVMA 5E8JA 5A2GA 2Z6QA 2AN1A 4YRDA 4DLZA 4FGZA 4BWYA 2LCFA 1JIVA 1P2DA 4R3NA 1CFZA 2C0PA 5ESXA 3QY0A 3SYNA 3H5VA 2VXCA 4QUHA 4ZRNA 3NTRA 4BJ5A 1BU5A 2P9BA 3UCFA 1EXVA 2BMDA 5HKKD 1DFGA 3UJ3X 2BP7A 2PYDA 3EZ2A 1G7SA 3OETA 4LDQA 1GVNB 1H65A 5CK5A 1VKNA 2VUIB 4I50B 3DD5A 2VHVA 5IASA 1OYWA 221PA 4D8XA 2PTGA 3WA7A 5M3BA 1FYXA 1XZ8A 1XALA 4FFWA 2PUFA 1G5RA 1PK7A 3DBHA 1W1WA 2O7RA 2CZCA 3CA8A 1DARA 3WNZA 1T5IA 3A7EA 3R23A 1FSPA 1ZQ9A 1WVGA 4Q02A 1DKPA 4QYIB 3TW6A 3K70D 5BWMA 2ZEJA 1XF9A 3CF2A 4NS1A 4XASA 3WWEA 4DTIA 1NOIA 1I94B 3D5QA 2VK2A 1CZRA 3L7YA 5DWQA 2XVMA 4KGDA 2IA5A 3C74A 2F1HA 4X6UA 5DNDA 1AXRA 3SQMA 1SCIA 3R5XA 4G1BA 3CF4G 5EHXA 2GM3A 4N3NA 4UHCA 1I6MA 2WWFA 5FIUA 5I4BA 3G9UA 4TZKA 4ZI5A 5JJLA 3T3HA 3PEUA 1SEVA 2FA9A 3KKOA 2UVDA 3DDHA 3CVOA 3DE5X 3Q3CA 4PZ0A 4I5GA 1NVXQ 1ZY2A 1TIPA 1CY1A 4H0NA 1REQB 4TRNA 1H85A 2VDRB 2E3JA 2OVFA 1EDOA 4D8YA 4JGIA 1Y42X 2FN8A 1XT6A 2QL7A 1EHCA 2YHBA 3MJCA 3ZHSA 4BQFA 4S3MA 1X9GA 5CCEA 3QUSA 1II8B 1RHQA 2M6SA 2P5UA 1HOXA 1Z2DA 3FCAA 3FNQA 1OFHA 3L0BA 3PF8A 4J1TC 3ZX5A 3HHEA 1O6GA 3U4AA 1W75A 2HWUA 3RPEA 2C04A 2J32A 3L8ZA 1IBKB 2RHBA 1USWA 2YH2A 3QKUA 4J4TA 3IA7A 1KDZA 4MAAA 5LN1A 4X5OA 4X20A 1M2WA 2PEZA 2OMEA 2YV2A 2O8DA 4W5NA 2IUYA 3JALA 4XM2A 4UQLA 5DCYA 3V8MA 3E8MA 2RG7A 1STOA 3RV3A 3T9FA 4DNXA 2BVNA 1MEOA 4Y3UA 3FYUB 4J29A 1S01A 3UGTA 4U3JA 4BMPB 1ANKA 3ONWA 5F3DA 3FN4A 3FWPA 1KKMA 3LDHA 4WA7A 4GOKA 4IINA 3M4YA 3PJFA 3DDWA 3U4DA 4MINA 3CKLA 3K0BA 3Q12A 4FYKA 1NSTA 4QDKA 4RVFA 2YIJA 3IGFA 3JQ6A 1WY7A 2JAHA 1DDOA 1Y3CE 1OI4A 1U8CB 1J6UA 3TI7A 3GU3A 1BVYF 1ZLYA 3H0KA 4MRRA 4Y1RB 1SB8A 3Q0TA 1DIOB 1TL7C 4D79A 1MQAA 2XDQB 4FOOA 2AXEA 1JYSA 2ZDHA 4BQNA 2OGTA 1YGYA 4LK3A 1RHRA 3A3YA 3ZIAA 4ZI7A 4M55A 3OOWA 5F76A 2LKDA 1GUBA 1HE8B 1L7VC 5B3JC 4G67A 3ABZA 3RVJA 2V0CA 4EKYA 1WCWA 1N2XA 2SKEA 3K0SA 3ECAA 3HJTA 1NN1A 2E89A 3AI3A 1WF3A 1YS6A 2QZ4A 3I0ZA 1OZ0A 3RKSA 4WBNA 2NSJA 5K0CA 4JVLA 2JLWA 2D1FA 2OFFA 2ZKIA