2D0PB

Strcuture of diol dehydratase-reactivating factor in nucleotide free form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
NHSAPAIAIAVIDGCDGLWREVLLGIEEEGIPFRLQHHPAGEVVDSAWQAARSSPLLVGIACDRHMLVVHYKNLPASAPLFTLMHHQDSQAHRNTGNNAARLVKGIPFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords diol dehydratase-reactivating factor large subunit
publication title Release of a damaged cofactor from a coenzyme B12-dependent enzyme: X-ray structures of diol dehydratase-reactivating factor
pubmed doi rcsb
source organism Klebsiella oxytoca
total genus 32
structure length 110
sequence length 110
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 2d0pB00
3WB1A 3AUJB 1UC4B 1NBWB 1EEXB 1IWPB 3WB2A 3WB0A 3BRCA 1IWBB 2D0OB 1EGVB 1DIOB 2D0PB 1MMFB 1UC5B 1EGMB 5D5QA 5D5PA
chains in the Genus database with same CATH superfamily
2QNIA 2VJPA 5EESA 4ZRDA 5YASA 1V0JA 3DP9A 3DJYA 5DM0A 5KYYB 5AVJA 4YUXA 3S8MA 2IEGA 4XPZA 2P9EA 4BNHA 1LD3A 1XRNA 4DIEA 4YCNA 4MB6A 2ZIWB 3MCAA 3HR7A 1Q0RA 1XHEA 1W48A 3VYUB 1UPAA 2DMRA 4WZZA 3B3AA 2J59A 2PUFA 2FWMX 2MOKA 3GQBB 1FS6A 4EFLA 5M7EA 2PX8A 3V2HA 2JF0A 5J4LA 4LY3A 2JASA 4AIIA 5AM3A 1QK5A 4ER3A 5JW6A 2EP8A 3F96A 3H5NA 1YUBA 3RHTA 3FBGA 1PG0A 4PNHA 1XTSA 5JCOC 5JNTA 2X15A 1U6IA 2J6HA 1C29B 2XZPA 2GEBA 1NBEA 3BIXA 4L1KA 1VQ1A 4KE9A 5TEWA 6YASA 2CJFA 4TUYA 1VG1A 1V1RA 4W5HA 2QRHA 4PHTA 3G23A 4TVSA 3QEMA 4M3NA 3RBXA 3ZHZA 1VXRA 1KMQA 2ZJBA 5C8VA 4ER0A 1P9LA 2Z09A 3ZE6A 3SIWA 1KEEB 4PG6A 1FZTA 2ZYHA 1ZBDA 1H4QA 2QTMA 3SU8A 3C3AA 2CC2A 3LZ6A 4Q4HB 3VKGA 1E9AA 1H6AA 1FFHA 1LX6A 1V35A 2QPLA 4L50A 3A6FA 2O23A 3P32A 3UK0A 1EE1A 3H3XA 5CJ2A 2B69A 4W9NC 4CLDA 1K7YA 1EFPA 1P2DA 4G4JA 2ORYA 4Z4EA 4P5EA 4PZPA 3B38A 2FP4B 3Q7RA 2ID7A 4RACA 3C85A 3A1EA 3HBMA 4QU5A 2XNJA 2W2NA 3LUHA 3QKIA 3DQZA 4LHVA 1VA5A 1XZGA 2O3RA 1UBTS 1E8MA 3DP7A 3TCXB 1V3UA 3UFXB 3ZVLA 1BEUB 4ZJUA 3Q72A 4X8MA 2B5WA 1KJIA 2NZWA 3UVEA 4MKIA 4D80A 2R62A 2RGGA 3KQKA 2J3QA 2L82A 1JXOA 5K7SA 5KJFA 1DEHA 4B73A 3T1VA 3UB3A 1QRSA 2E1PA 3EBPA 1SVMA 3L0DA 4Z86A 1FZQA 5D7NA 1K27A 4EPXA 4U2GA 1P4JA 2X8AA 1K8YB 5HF8A 1AOXA 3F7NA 1P1KA 3RVLA 3F97A 2WHPB 3AHEA 3HLYA 3LXXA 4WSOA 5FWAA 5H0IA 4TS4A 1IXYA 3DMPA 4FOPA 1VBFA 3PG5A 5IJAA 2VXCA 4DGSA 3TQIA 4C4OA 3DKKA 4YJ3B 3TEJA 4ZYTA 1M1NB 3L07A 2XB9A 2NU8A 1VL8A 3RHZA 3GEGA 3FPAA 2GN8A 3VOSA 5AW7A 4RV9A 3A06A 3H2BA 3JZIA 2QAGA 3S29A 3PNYA 4UW9A 2BH9A 1GR0A 3SYMA 4DEXA 3AUAA 4CT5A 5HJEA 4LJ4A 2C57A 4OATA 3K71B 3KELA 4TRJA 2R4TA 4V3CA 4CMHA 2X9NA 3LDFA 2I4LA 1ZESA 2PKEA 3O75A 5TVGA 4HB3A 3RIYA 3SHWA 1W4ZA 4TN5A 3E0XA 2ZR7A 1IC6A 4YH1A 4F6RB 4AU1A 3U3MA 1OI7A 1OLXB 2Q0HA 3HCRA 4HFRA 4FLEA 2GETA 4PANA 2QGNA 2OLKA 3FAZA 4LJRA 1GVNB 1Y4AE 2JIDA 2PGAA 5DOVA 5MDHA 1B74A 1RQ2A 5T3YA 1CETA 5ELLA 3H1TA 4UXIA 3O4VA 5FWDA 5C8XA 1KVTA 5L8VA 3LHFA 3BSYA 2QD4A 5A1JA 1NONA 4LEIA 4PYIA 4QWMA 1RJEA 1M0WA 3ETNA 3K1TA 4LXIA 1KAEA 2PYIA 2P6UA 3K15A 1L4FA 2WEKA 3DCIA 1WU7A 1H5QA 4M6WA 4OI1A 1ZNYA 4US2R 2BKAA 1PLLA 4RK4A 4N03A 3BMOB 3W6OA 4ETMA 4O4JB 2LPMA 1HBJA 1CJUC 4OD0A 1PVDA 3EF0A 3U17A 1Z4LA 3FGNA 3V2UA 3ZOZA 4QVKA 4AMVA 1M74A 2BE7A 3PB3A 1AURA 4G26A 4GXRA 2FRXA 3H6KA 5ERGB 1G8AA 5I9BA 2NOAA 3IXLA 5C7IO 4BIMA 3G0DA 2DWQA 4EJSB 4OKSA 3AERB 3SQMA 3Q3VA 2VH5R 3MMNA 2VP9A 2G71A 1HT0A 3H1AA 2HUPA 3LX8A 2ZI5A 1DQRA 3HDQA 3NZEA 4TQ9A 2VTVA 3AG5A 4HL6A 2GNAA 4EIWA 1RP1A 4KXLA 3OKCA 2O4UX 4BLRA 3TSAA 2OO7A 2JLVA 3JVUA 1P9OA 3STVA 4LF4B 3MWJA 3EIHA 3KM0A 5I9SA 4EA8A 3OJLA 3EGIA 4PR3A 2O2XA 4XXHA 2OV1A 4RESA 5GPBA 2D62A 4AMGA 3W34A 1FU7A 2J6IA 2ZUEA 1N3LA 5SZKB 1H8ED 1PT7A 1X1RA 1KYXA 3SMQA 2VL7A 3ZCVA 5JNRA 2QORA 3VVMA 4XLTA 2OECA 3UT6A 1Y8ZA 1FP4B 2IIBA 2O50A 4UMVA 2SECE 1E79D 3CLRD 1E62A 3DEZA 2X5OA 2GLXA 3GFTA 1EVKA 3HJGA 3ORRA 3SJCA 1NBMA 4B3DA 4DA8A 5GM1A 2C31A 2R68A 3O3CA 4Q15A 1Q11A 2GK6A 4MINA 4UUPA 3S8EA 3UKOA 2WUVA 5AHOA 3CLTC 1BFDA 5LD2B 3ER8A 3A9TA 2V7XA 3D8RA 4J9UE 4O4LB 1FSSA 4LCEA 2HU5A 1FL9A 5CK5A 4BGIA 5JCJA 3LHIA 4QTYA 4KNVA 3HQ4O 2FPGA 2GXUA 3LHKA 1I6MA 1DKNA 2O2EA 3RLFA 4B09A 5JTUA 5GONA 4BZXA 4QOEA 1POWA 4IOLA 3H13A 1ZCAA 3B6JA 4L0QA 4BBPA 2CBXA 2ZWPA 3O93A 2L0XA 1TADA 5KNDD 5BOSA 4XOUA 3ZX5A 4ZEVA 1HFJA 1Y63A 4ABYA 4RJIA 3EQZA 2J6BA 3VSEA 1VIDA 5ALMA 1BGVA 3O8NA 1OZ0A 1Z4IA 2OV4A 2FRDA 3HJNA 1PP4A 3RI3A 4AZ3B 4Y2UA 3S2SA 2C0CA 3PITA 4WY5A 2WILA 3TQOA 2A1UB 2X2PA 3CUTA 1CR6A 2EP5A 2Q1SA 2W8ZA 5I7FA 2WOJA 4A8JA 5IKMA 2BHRA 1ZZEA 3DDZX 4PYMA 4R0NA 5J2TB 4L22A 3B2QA 2ZG6A 3IERA 1BJKA 5BSUA 1JFTA 3ZVMA 1E4OA 1M67A 2QTFA 2XMGA 5I51A 4UEQA 3DFFA 4FDVA 4NENB 2JHCA 1S8NA 4CM7A 1SD2A 2RCNA 3H11B 3N28A 3NI2A 4YRQA 1BOOA 1YKFA 3F5FA 1YV9A 3ABSB 1A69A 4FQ8A 1HLGA 1SXJC 5F7ZA 5A5VA 3AUKA 3IQXA 4M1MA 2EWVA 5GZ1A 4DYHA 1MVLA 4A15A 5BRNA 1QRDA 4K9DA 1RI5A 3B8EA 3FDJA 4JYZA 3LI2A 4O29A 3A28A 1U98A 1ZMTA 4RK6A 4L5JA 2I55A 3I58A 2QN3A 4KGXA 1SC9A 2I54A 2Y05A 4J0JA 4E5SA 2C2HA 3WIDA 4BQQA 3BMNB 2FH5B 1EFUA 1FQKA 1C0EA 1QFJA 5K0GA 4U6QA 4XFKA 1WCWA 3R9XB 4FDAA 3RGWS 2CV0A 1RXWA 4MV4A 4DDUA 2VDJA 2G72A 3B3FA 3EVFA 4KWCA 3UO8B 5JECA 3GYBA 3MRTA 1FRZA 4Q93A 3KLPX 1Z0AA 3T3IA 3UMSA 1CK4A 3P9IA 4EKEA 3HGTA 3L5OA 5JBNA 2DHQA 4CLRB 4DY6A 1GKKA 4BLQA 2H1LA 3D7LA 4BNNA 4C0BA 621PA 3FVRA 3LY7A 3A2NA 2I4TA 4DB4A 1SOMA 1A9SA 4UM5A 4EY7A 5SZHB 3LUFA 1XLTC 5IF3A 3K09A 1B8NA 1GAWA 1P0IA 1TCUA 1Q20A 1ZCZA 2HSJA 1YCGA 2DUMA 3DEYX 1E1QD 2H2GA 3NOVA 1TK9A 4L9WA 4E2YA 3EA0A 3UK7A 1J99A 4P4UA 2TSYB 2Y0CA 3GEDA 2J3KA 1R6DA 2R8ZA 1I51A 3CVUA 4IFEA 2P8SA 4NXNB 2B4KA 4PQRA 2RKOA 2VUHB 3O38A 2NZ2A 2Z2YA 3DAYA 3R5SA 1F7VA 3IEIA 5ALYA 3H4IA 3L4BC 4MEBA 1SCKA 2Z8YM 1VM6A 1J8DA 1BYIA 1OJ7A 1VCNA 5DVZA 1ITZA 1WEHA 4O2AA 3V46A 2ZVPX 3FCEA 4U8HA 5EOVA 5CFZA 4W1QA 1TM3E 5HHTA 1KXJA 3T3MB 2O5EA 4H7IA 1Z33A 3RH0A 3OFJA 1UZLA 3G89A 5P8WA 2XADA 4X1KA 4ALIA 4Y0NA 4D98A 2XDYA 2XGMA 4AYXA 4IDBA 2QJOA 4FKZA 1NW6A 4KQKA 3GH3A 2HFJA 2AJ8A 2RGNA 2ZETA 3KLMX 4WASA 2PL1A 1S2MA 3RUFA 4RF3A 4CQLB 3PVCA 3WQSB 1S3IA 3I01A 2ZR9A 3PNOA 3DZJA 4F7WA 1N5LA 1NDHA 3A1SA 5LUBA 1FDOA 2E85A 3RTDA 2BKEA 4LHWA 4R6XA 4D99A 3M33A 2VATA 4AX4A 3BB4A 4XFDA 2C29D 5JARA 5GJVC 2CFIA 3HN7A 4N5LA 2A2ZA 4TOIA 3BZWA 1S3SA 1PBNA 2X58A 1SOUA 2NM0A 3TLEA 3K70B 4X45A 1YDEA 1Q0LA 2J07A 2C4NA 2LDBA 3QELB 3TOZA 3OQNA 4URZR 3NNSA 5CLIA 1L7MA 2FWAA 2FUNB 4H08A 4QU0A 2JIPA 4BUJA 3A2LA 2YHAA 4PBRA 4E31A 1CUVA 1Z8NA 4W5WA 3EQ7A 2EW8A 3NIBA 4IDCA 4E2FA 2QTWB 1A88A 5EXSA 3JQ9C 2PLNA 2VEOA 2JFZA 3HY6A 4RFSB 2Q5IA 2V5VA 1KI2A 4UPDA 3A1WA 3FLBA 4L0DA 4BJ6A 2B4YA 5H3CA 3ZVKA 2BFCA 5CBPA 1L5RA 1UOOA 4WZ6A 4GMXA 1FRFS 1L2TA 1R7RA 1TL7C 1TQ4A 1Z6TA 2BR3A 2C99A 2R8EA 1ZICA 4FKBA 2VQ3A 1T15A 4FTWA 4C1BA 1FJGB 1RWWA 4IVNA 1YIAA 4YLYA 2PPLA 5CLLA 1Y6QA 1GZVA 2Q28A 2XNSA 1GUAA 3AFIA 4N0EA 1XVUA 3GX1A 3NWOA 1D3AA 1QO0D 3FOEC 5D3ZA 4JB3A 2IUTA 1EDOA 5HUQA 4LX0A 1JBQA 3K16A 5H9WA 5HVNA 1DTWA 1DKUA 1LRKA 2JPDA 2FKNA 1F6DA 3G1TA 3CT6A 2X0EA 3GPLA 5AI4A 3I6BA 3HYLA 1PFQA 3G79A 4HLQB 3G2NA 1S2DA 5K6AA 2POCA 4CQNA 1FY2A 1O6ZA 1KZ9A 2YH2A 3A6DA 1QM5A 3F6SA 3AZOA 5I7SA 4WZBB 2B8EA 2BFDB 4BMYA 4EX6A 4RJ2A 4PZCA 3RSLA 3D3EA 4ZGWA 1K5DA 2H2HA 1GZ3A 2YV3A 4N1AA 4FT4A 5F9MA 3ZYZA 2P68A 4MO9A 1J2UA 2DTEA 4B3MB 1NF9A 4Z9AA 4D9IA 4ZVUA 3EX7C 1GLGA 1CUZA 3RRYA 5JI3E 2XSZA 4TRMA 4OI0A 2YMMA 2JLCA 1XHFA 2AGVA 3OUZA 3A4IA 2Y1KA 3SC6A 5ES4B 2OMKA 1JKMA 2OZLB 4JL6A 2EJTA 4BKRA 1KR5A 3UW1A 3WICA 4OX9B 1K63A 4Q9HA 2FJPA 5LDGA 3M1YA 3SFVA 4QYXA 5U1PA 1B43A 1TKCA 2DCMA 3B78A 3C3PA 1UEJA 5DCUA 3GMTA 3HVKA 5JIBA 4ENVA 4C89A 4LW8A 3R7NA 3OZBA 1FFBA 3CINA 3GUUA 4OQZA 4X62B 1O94C 3JSAA 4B46A 4EY8A 9GPBA 4E7OA 4Z2AA 2H7XA 2E6KA 2OY0A 3GN1A 3CS3A 3N2KA 4QAQA 1JWBB 4L75A 3ZDXB 4R1UA 4ZKDA 4F3TA 1Q1QA 1OA0A 3HKCB 5A3VA 1F2VA 1F2TB 1FJ2A 1MGPA 2A78A 4Z6KA 5BVGA 5FDFA 1V9LA 4OXRA 3AEQA 4E5DA 3A4VA 1CJCA 4F71A 4ESOA 4RTMA 5BQ5A 3FIJA 3O1JC 1L8LA 4TMTA 5IYZB 2XUHA 1BXRB 4NBSA 2PZMA 4A10A 3K0FB 3LC0A 3N2GB 4BLVA 5IAJA 5TQ0A 4XAQA 5ARBA 2QRUA 3RSQA 8ABPA 5JJ5A 2YYSA 5K05A 2PBLA 3RS0A 1AO0A 1R2QA 3RHFA 4A16A 1L4GA 3GLFB 2PAAA 1Z6PA 1YQUA 3Q0EA 4F4HA 4G1UC 2H7CA 1BCSA 2QPTA 1FRQA 1X8JA 4RKRA 5C5IA 4EKIA 1CVLA 5JI2E 3EPJA 1B0PA 4XWYA 4KIFA 3E2IA 2CMKA 2ZUDA 5CHYA 1OC2A 1MV5A 2ON6A 1MB4A 3LUAA 3LRPA 3G2LA 3EXFA 4GOXA 1T6YA 1Z83A 4UXJA 3WXBA 3PFIA 3ROEA 5JJLA 2YS6A 2O2ZA 5JZSA 3A3KA 3UATA 1ZINA 4R40A 3AF6A 3R3VA 1E4VA 3ETEA 3QOWA 3QI2A 1A9PA 1U31A 1ANKA 1ZUD1 1R0CA 4K03A 2DBRA 1XCOA 3RT9A 4UDNA 4JBXA 1P4SA 1QX3A 3N5CA 5HILA 4XWWA 3PLAE 2BPOA 1NMYA 1P5RA 3RDPA 3RRZA 4C4AA 3O6VA 2M2IA 4JP8A 5AXBA 3I9OA 1XJCA 4GP7A 5DBHX 3I2JA 4QRIA 1R5OA 5AOVA 5C9ZA 5EQJB 5ESDA 4F2GA 3GJ8A 5C51B 1EA5A 4DLXA 4YWJA 3DZHA 3TZBA 4UEKA 4A26A 2NO4A 3HA3A 3D6AA 3RCBA 1E3WB 3LLMA 4OHOA 4ZYUA 2QY6A 4Z7JA 3ZIAD 1L4YA 1ZH2A 2SCUB 2XIJA 4I9HA 1ZVVA 1U9IC 4OA5A 1JHPA 3EZLA 4XR9A 3VOBA 5IZCC 1DADA 5FX2A 4FEAA 1M34A 2JHGA 1J5PA 3R0ZA 4CHTA 5ECWA 1U3CA 5EGSA 2H2IA 4TPKA 3IOCA 4NRDA 1NG1A 1LLDA 2XVAA 5KMGB 2VO1A 1ISFA 4KQCA 3S5JA 3ZKAA 3Q5DA 3QX8A 1FA9A 4OH1A 2Q9AA 5K6RA 1L7VC 4TQAA 1W88B 2IBSA 1U0LA 3AR9A 3U4CA 1XCJA 2P41A 2CYBA 2REQA 1XQ1A 5FPYA 4QQRA 4WV3A 1KMHA 5KNLA 2O57A 2O3SA 4IDNA 3WV4A 3B1ZA 3UTCA 4PLGA 1L7QA 1NQXA 1X94A 3BRSA 1QAQA 4J0KA 4WL0A 5G0UA 3B6KA 1G1MA 4RQBA 1RLOA 4MUJA 5GOZA 3ZLUA 3JXEA 5EUCA 3P0HA 3QVLA 3RJZA 5B12A 3QU7A 3E9DA 3EFHA 3Q15C 2BEUB 1MJHA 4I4TF 4N9WA 1FDIA 4E6PA 4BUCA 3NFYA 3CZ5A 4RTRA 3DTVD 1EXVA 1AN9A 3NAMA 5ALPA 1X2BA 4F72A 3BCUA 3E05A 4ZJYA 3N0RA 1HLFA 4NCKA 3BORA 1N36B 4TZKA 1RZRD 1RM3A 3LXRA 1K5HA 2GKGA 2RKWA 4BE7B 1U7WA 3KB2A 4KNYA 4EJ6A 5BP7A 2WICA 3L6RA 4RVFA 3P52A 4NFLA 4B75A 1E96A 2VSOA 4ON9A 3VHXB 2D1FA 2L42A 1JDZA 2NGRA 2Z83A 1M7GA 4IIYA 1EHYA 2BTOA 4LXYA 4NY1A 1N0IA 2PZLA 1YAHA 2QT9A 4AO7A 4QLBA 2JNWA 2Q9CA 1DI0A 3HCPA 4TVBA 5CJJA 3LXMA 3FNGA 1O97D 1MABB 5CNKA 4ZT3A 4RHUA 1JPUA 3FZGA 3AF0A 3RAFC 4M1YA 4UMFA 3HGMA 5AXDA 2P1RA 3EGOA 2F00A 2V5UA 2C1XA 4LRQA 4G0XA 1XLUA 5AI6A 4CU5A 1CUAA 2A4MA 2JI9A 2GASA 4MITA 1T8YA 1V5FA 2FFAA 3H65A 4A2PA 4JDUA 4XVQA 3BE6A 3C1UA 1SEPA 3S6JA 5JAPA 2FPPB 2XV1A 1ZKDA 4HDNB 1XTBA 3C8HA 2ZJ8A 4D4JA 3J7AC 1XEXB 2JIBA 2X7HA 5TJ9A 3ANXA 4GUDA 5EERA 2G77B 4FFDA 4I5DA 1NZDA 4RUKA 4DZRA 4I4NA 1K8QA 2YNMA 1M83A 4U39A 1DWOA 4N8EA 1Z56C 2PZKA 3MNFA 4ZQEA 4D8YA 1PT6A 2B4TO 4LZZA 4RJLA 4PY2A 1V39A 2MSKA 3SF8A 4PO3X 1I6WA 2Y1DA 4NU8X 5FFFA 1U8CB 1DC4A 5IN5A 4MA0A 2KWIA 4QYMA 1NVXQ 3TECE 3DOCA 1VLHA 1JKXA 4I1YA 7ADHA 1RWPA 1Z45A 3G49A 4LGCA 4EO9A 2W90A 3ACBA 1U8UA 4H6PA 5BY2A 4PC7A 3VAZA 1D6NA 3JAKB 3UJPA 1HEIA 3IALA 4BNJA 2QQ5A 1YL5A 5EQDA 3MWDB 4URFA 2I4MA 1XZBA 1YDWA 2FEXA 5HE9A 4YPOA 3NETA 1BN6A 2P5YA 4PINA 4UC0A 1JDPA 2B36A 1V9CA 1XTTA 1P6QA 2E21A 1JZSA 3HE3A 4MV5A 4O63O 5JDIC 5HCNA 2GPYA 2ONYA 2AOTA 4LI3X 5TARA 1NLUA 1N5JA 1C7RA 2QWXA 1RRMA 3OM0A 3TLJA 5EL0A 4PG5A 2VTKA 1QK3A 2EW2A 3VUEA 1RI1A 3DYBA 1QOPB 3DUFB 3RFCA 5F7OA 5JWOA 3JQEA 3MELA 1EUDB 3BD8A 4S2EA 4EB8A 5JADA 4DUPA 3AVYA 4NBUA 1K6IA 5JZOA 3DS8A 3OY2A 1W47A 5E9WA 3W5VA 2FW6A 3ZY2A 3WBKA 1GTG1 1NN1A 2INGX 2Q3JA 4IXWA 1I5OA 2YZ7A 4KSYA 4Y2VA 4JJIA 4BAUA 4D44A 1URPA 1V4VA 1GGJA 1SZCA 2AI1A 3FPBA 1ODTC 3MT9A 4WIAA 4OQLA 4Q3OA 2YWCA 4KAFA 4UFOA 4GQIA 2QLMA 4UVIA 2PGXA 3RKRA 1D1QA 3X1MA 3PRKE 1BROA 4QKQA 1A9TA 3OUTA 4MYDA 3UXEA 4C4TA 4Q1VA 4EG1A 3LL7A 1ZQ9A 4B2LA 4EVRA 3AHGA 3E23A 3MILA 3O0TA 4W5JA 1LW7A 1I2DA 3R3UA 4Z9XA 3A1FA 4X20B 3I1FA 1U4OA 4P80A 1XO1A 2BEKA 2CHFA 4IHQA 4ZPJA 2QRJA 1RYHA 5NULA 4DC1A 3GLIB 3R3JA 2DFKB 1Z5VA 2SNIE 1T36B 1DCMA 1JEDA 2XUIA 2HDWA 4ZI7B 4UHKA 4FN5A 2FE1A 4M7PA 1KFCB 2OGSA 3VPGA 3WC4A 1QHGA 1TQDA 3RM3A 1V3QE 1T2UA 5FBLB 3U60B 1Y6JA 4EENA 1W1WA 1U0GA 2H06A 3WL8A 1SKQA 4F04A 2GKOA 1WXGA 2XOEA 1W0KA 2QTNA 4PTLA 2FW8A 1KHTA 1H2XA 4FYYA 1M6HA 4V0ME 2OBFA 4YBRA 5AOAA 1JBEA 1PD1A 2JCSA 1KH3A 1TYDE 4EHAA 2PT5A 1EI9A 5DTIA 4ZJZA 4C22A 4XIFA 2JGDB 4Z4CA 3PLRA 2ZM6B 4BXOB 5FT9A 1AHNA 1H9AA 3FVQA 4YP5A 2W2XA 3DPIA 5F76A 1YSCA 3I6QA 2ZYGA 5BQPA 5L6MB 4AX8A 4EFKA 3AL0C 1BDIA 3GAAA 1K6XA 4OMUA 4KRFA 2QS9A 2DECA 2XR1A 5E4JA 2H16A 2EDAA 2OXRA 4RVCA 1RQPA 1ZITA 2Z56A 1M2VB 2OB2A 4YJFB 2AC2A 5TPWA 5BOVA 5LLSA 5LM3A 2WUWE 1NXTA 3B1XA 3BF7A 1HQCA 4QXMA 3ND6A 3W3AH 1HNWB 4HXFB 2JKVA 3RYIB 3V8QA 1R6TA 4ETNA 5JALA 3WE7A 1QB8A 2WW8A 3KPVA 4M88A 4MQUA 3WLAA 2ZIGA 1HQKA 4DLSA 1XA0A 1F5NA 4NJMA 1GKUB 5JRZA 4EGJA 3WLPA 4J7AA 1NXPA 2AUMA 3FKSD 3HO6A 3KP1A 1ORWA 3M6UA 5JSQA 3W3AA 4AECA 2PSDA 1MPTA 3EFBA 1P18A 3MERA 5TGDA 2HHJA 1O2DA 3U4QB 2IHUA 2FFHA 3N70A 3T3EA 2QENA 1JZQA 4LOJA 2VTBB 1IUPA 2JATA 4ZQFA 1O54A 3E58A 1MRNA 3GJ4A 4MW0A 1PR1A 1G21A 4FMCF 2FNAA 1QGUB 4GPZA 3WGTA 2OENG 3OE4A 3V34A 3EJ6A 2K87A 2BTEA 4ZQBA 2XIQA 4OXXA 3L7DA 1K8ZB 1W49A 2V7QD 4B6RA 4Z49A 5K8UA 1QYCA 1Q3HA 5IAOA 1I4OA 4FUQA 1GIAA 2QVXX 2D5IA 3UM9A 3ZJ5A 5DEOA 5J5VA 1V5GA 5GWXA 3JARB 3MWFA 2PQ0A 4J29A 3URKA 2BZSA 5TB5A 4A91A 4F5EA 4ZOLA 2O2SA 2P7HA 2ZRHA 5AVVA 2DWCA 1LSSA 5LVAA 5M29A 3WMGA 4F6LA 3TIVA 1YR6A 4I5EA 1WZUA 2GSWA 2B8JA 3IP5A 3REGA 1Q21A 1UOPA 1RC0A 3AR3A 5TGTA 3S2YA 4CV2A 1RCFA 3OZFA 1GDDA 1E2QA 1P9NA 3M4JA 4V0OA 4XCVA 4C2TA 3OQJA 5HBRA 5BRJA 1SRRA 1TNDA 1P75A 2WJGA 1I14A 1ZH6A 4MUNA 4DMLA 4DABA 5BWNA 4RD6A 1AHIA 1U8AA 1IN5A 1N57A 3DYIA 3P1JA 4BDTA 4WCFA 1I3KA 1V26A 5CR9A 2O1XA 2VPPA 3FRIA 3L6DA 4KQJA 1U81A 2R6ZA 2UZ0A 3BXFA 3LQKA 1E77A 1S7GA 1C14A 5FAKA 4AP6A 5FNVF 2PE5A 1XMVA 3DE7X 4MI6A 3REOA 1QH1A 1ECFA 4ZODA 1HE2A 1HNZB 1JSLA 4DTCA 2IS4A 2QE6A 2JFVA 4XQEA 4REQA 3SBDA 2FYTA 4CETA 3D1LA 2W6IA 4XWTA 1LNSA 2BFEA 2P79A 1Y0BA 4A0GA 3OJCA 3LIIA 5IDXA 4TX1A 3QTLA 3QVGA 1E5XA 4WESA 3URMA 3ACDA 1RYNA 2R85A 4RCZA 1KAMA 5KNCH 1G5IA 4BB0A 3PR3A 1N9GB 2E55A 2X4GA 3FDZB 3QLUA 3BERA 4LOAA 5J58A 2G70A 3PEVA 5KSPA 1OMOA 3VISA 1MAAA 3KR2A 4E5PA 4ZO6A 3PK0A 1TVMA 1U90A 4D6YA 5K8LA 1HNXB 3CF4G 2V54A 3BXXA 3WQQA 1T5IA 1QHYA 3EQ8A 3ZHOA 1M5TA 1IFXA 2QD1A 2QVLA 3BFKA 5DCLA 4DA0A 1QU3A 1GQFA 3WMWA 1RXVA 4CU2A 4L4UA 3S3TA 1OFUX 5T41A 3NATA 3RVOA 5M3BA 1F4PA 4YPVA 4JLAA 3I05A 2FWJA 3ZDCA 5B1YA 1NC1A 2FEAA 2PVCA 1V41E 1SCUA 2O3QA 1YUNA 4FMDB 1KYVA 3OLVA 4FYHA 2ZBGA 1XPOA 2REBA 2JCBA 2WFZA 4Y2YA 1YBVA 2VJAA 3OX3A 3T3PB 4BAGA 4CQMD 1GM5A 3F90A 5H5JA 3TSZA 3OCCA 5KOHA 2PIDA 2D0PB 3ESAA 4C01A 1TYBE 5LPNA 2NTYC 4U2CA 2BHNA 5J4KA 1CXZA 2YBDA 4DV6B 1ULZA 1WMAA 2A1TS 2CXUA 4UVGA 3TE6A 2WQ7A 4CCYA 1BG6A 3IFSA 1YQGA 4LWQA 4WAUA 3QJGA 2IELA 4BRWA 3G6KA 4MUGA 4UCQA 5KS2A 2JK0A 3C7AA 3A9VA 2QTCA 2ZVJA 3HC7A 4G5OA 1B1AA 4V0KA 1QUFA 2D2EA 4R8KA 5DLPA 3TLYA 2ZRLA 4OOEA 3H1BA 1ODJA 5DGIA 5FPTA 2I91A 1SCIA 5FTJA 4A9AA 1C1YA 4M86A 5DSXA 2D3WA 4PS0A 3C2QA 4RWZA 1PD0A 4D4KA 2UYCA 1ZOPA 2FWPA 2IIQA 3L0YA 4D45A 2NO6A 4EJ2A 4BNVA 5REQA 3ANSA 5B55A 1IZZA 1Y8QA 1XZMA 1AJEA 1Q95A 2AMLA 2IQ5A 4KKXB 2HMVA 4P8RA 1IY8A 4EKDA 1Y5NA 4ECEA 1TYZA 2IF2A 4JT4A 3WO0A 4QEDA 2DHDA 4C6HA 1O08A 4Q4JB 1UQRA 2GAAA 1E3JA 3RYFB 4NP6A 8OHMA 3HU2A 1T13A 3KOYA 4DR6B 2GXSA 3H3JA 4WXMA 5IUJC 1X1SA 1R4MB 4FNAA 4L8WB 3TLGA 3O8DA 4W8OA 3K70C 3AP1A 2OHIA 1TKBA 5H4HA 1SO8A 4P4NA 4C87A 2P9TA 5FUWA 4P35A 5ALXA 3RTEA 2HWYA 1WS6A 1YCFA 3QXXA 3ZHTA 2B5OA 1QIEA 1SVWA 2LKCA 4Y1EA 3E9CA 1QQAA 1KK2A 1YS1X 5B1EA 5DLQC 1YB5A 4E1AA 1IOLA 3MJDA 5JRDS 4GMHA 2OBXA 4QTTB 4P0QB 5F9HA 3VYSB 5KTTA 1ECJA 3WKBA 2RHGB 4FW9A 3W3AD 1H8HA 3RVRA 3ABQB 2X86A 2PUJA 4YUYA 3AR2A 5LA6F 2BONA 4EQ6B 2WTUA 1TGYA 2AUTA 2ILVA 3HNOA 3EWAA 3RADC 2VBIA 4LTNA 2WJPA 3G2HA 1DKLA 3P8ZA 3KG2A 2BM0A 5K51A 3H3FA 2I4RA 4H1TA 2WLSA 3BEOA 4IIUA 4QC2A 3VKHA 1YMVA 1L5QA 5EWLA 4A92A 1GN9A 4TYQA 5HDBB 2Z58A 1YGPA 5BN4A 3W2TA 5ARDA 5JHHB 3VV2A 1FEZA 5DLDA 2PNFA 3ZE0B 3K0SA 2VC2B 4OCZA 4MQEA 4AUNA 2GCOB 4PGMA 1EK2A 4IJKA 1N4AA 3TZQA 2Q9UA 2HCRA 2AHRA 3M6LA 4LE1A 5AI8A 4J1SA 1O89A 4R8RA 1JHDA 1I33A 1V2GA 2BSQA 5KU7A 2VRBA 5LB2A 5FP0A 1UJNA 3O9ZA 2YZKA 3CLUC 3QVSA 4GX0A 1SFRA 4I8IA 2EKZA 4AJ1A 2DXIA 3QUCA 3I5YA 4D25A 3C43A 3KXIA 1AV7A 2OBYA 2G06A 2LTAA 3KETA 1CP3A 1J9GA 1W94A 4NAUA 1T9GS 5TY0A 4QXRA 4QQ8A 1EE2A 1H2BA 5TS2A 3QPVA 3PI7A 4M37A 1C4XA 5FHRA 2NU9A 5CBKA 3K4PA 2ZIVB 1CUDA 1NWHA 2Q3MA 2BBOA 3K5IA 1F6WA 1GL7A 1IN7A 1QIHA 1QPBA 2D1RA 2HK8A 3IHLA 1GPDG 1K5PA 1E8NA 3TBFA 3EIQA 2FG6C 2Z2KA 3GJXC 3B20A 3PF8A 1GQ2A 4RS4A 3OLXA 3H1GA 1NNLA 2OCIA 4E5MA 5C7YA 1G5TA 4TZ6A 2JJ2A 4EPYA 1Z4JA 2P69A 2WMOB 4WFIA 2DUNA 2NXEA 2A33A 3AXTA 3GRUA 2APJA 5ADHA 3RWBA 5HGXA 1QPZA 4U3JB 4C07A 1BDHA 3G0HA 2BEWA 3BWCA 3ZE7A 5KYGA 1EUYA 3OAAA 4DJEC 1UQUA 4FC7A 3DOJA 1JIJA 4HS9A 3S5UA 1MNQA 3VO9A 1MHPA 3L40A 4J76A 1XNQB 1DU4A 2A5DA 4S05A 1PT5A 3ZJ4A 3ISJA 3HRIA 2X41A 2H5LA 2IHJA 3HVJA 4ZI5A 4DUYB 5DV9A 3MWLA 4FDLA 3REFA 4G5SA 5F3WB 1WG8A 3E7PA 5KDDA 1DAMA 2P27A 2P4SA 4NV0A 5BYKA 1TD1A 4KO2S 5L3SB 3E8SA 2N1BA 1AQLA 3E7XA 4R9RA 4XQGA 5CHEA 5HQ3B 5IEBA 3D8BA 5ITSA 1ML3A 2IU3A 4HUJA 4FWBA 5BMOA 4BRUA 1YU6A 4AC9A 1XCBA 4I4LA 4AVYA 4UMDA 3NU1A 4BFLA 4CTJA 1UMCA 2BD0A 4MRSA 5AVKA 5FRDA 2O8VA 3RS3A 5KNCD 4P4SA 2AOUA 2AWNA 2WIBA 3MRXA 1WR8A 4RH1A 1R0SA 4KQHA 3CKYA 3K0BA 3M81A 4OHKA 3UK2A 3CJQA 4B79A 4ZC1A 1YACA 2VAXA 2C9BA 2WJHA 3UAGA 4BMVA 5CA1B 4AICA 3AJAA 4P32A 5GVRA 4POAA 2PRJA 1HZZA 2Y4OA 4DR4B 1U7UA 3PX7A 1ORHA 3AHIA 1NVMB 1CE8A 3RG8A 2VJMA 3EXIB 3LQRA 4UE6A 2Z5FA 3VGJA 1UC8A 3GPCA 4PZ0A 5DGDA 2F17A 3T9DA 3BIFA 4LHXA 5AJUA 4QYSA 1NRIA 2BGWA 3RUDA 3FPGA 3EGXB 1NDQA 2B3TA 4XJVA 2YOGA 5EKTA 3EVZA 2JIOA 1WCIA 1JIQA 3B1KA 3A1UA 3ZBTA 1PR6A 2OD2A 3IXQA 2W2KA 2HZBA 2Q46A 5G40A 3MMPA 4I19A 1E99A 2BRUC 3WRXA 3BE8A 3NTUA 4LYYA 3SHQA 1TEVA 5LWHA 4URXR 2H8KA 3MT8A 5T4HA 3RIXA 1R10A 4HH0A 3WHKA 4DLVA 4Y0AA 4OLHA 1L4EA 3B7GA 3NGLA 4XPIB 4EFDA 1PYDA 2ZBRA 4OJTA 1DKRA 2HIAA 3ZVRA 5ECGC 3V4RA 2IS2A 3FCUB 3NOXA 4XDZA 2I6QA 1L3IA 3GDGA 4J2OA 1U7HA 2PKQP 1W0JD 2LGJA 3Q3CA 1IUKA 2HOQA 2EZ8A 3ONEA 2VDOB 2I8AA 3X1ZA 4YRZA 1L7XA 1LW6E 3PYLA 3FVTA 1Y1PA 4MICA 2GK3A 3WB0A 1CFJA 3QPUA 3P2MA 1BO6A 4FNMA 1TUIA 4TXMA 1J24A 2C4UA 2XAUA 3LWNA 3EPLA 1ESNA 2EIXA 4LWPA 3A6PC 3AHHA 3VI3B 4OBWA 2L2QA 2OC9A 4LF5B 2FMXA 2H6EA 1NVUQ 2VDLB 2AG0A 1PZXA 1O95C 1JAZA 1GEEA 2I71A 3IIKA 3MYRA 3O90A 4IDDA 5AMXA 3RAGA 5C53B 4RD4A 1M73E 3TX6A 4TZ0A 4F11A 2HJWA 4RGBA 1E1LA 2A84A 2XHZA 4W1RA 1PTJA 1W4AA 2GO7A 3Q6MA 3PC4A 4O25A 1ACMA 3EPRA 4BO3A 4C4XA 2Z43A 1VKZA 2PA0A 3FZYA 2XWPA 3HCOA 3K20A 4AJIA 5JPCA 1YKGA 3AL2A 4OG2A 2MMCA 4TUYB 5B3JA 1V1RB 2OCBA 2VUTA 4J3JA 4PLFA 5AK6A 3UAZA 4CLHA 1U3GA 3RRBA 1WSBA 2P9HA 2Q27A 1P44A 1I2MA 3QEMB 4E09A 2ZRNA 3F3MA 5ANRB 1RMTA 4A1FA 1YAJA 3ENQA 4R1SA 4B7AA 4JOSA 2JD2A 1G42A 3EFOA 2PO7A 4K6FA 3D81A 5CIYA 4YWHA 1KI8A 4UBIA 2QJFA 3VR5A 3FZEA 2JHFA 2FPKA 4L5BA 7REQA 1EFPB 4XSGA 2HA2A 4URUR 4LZPA 3K73O 2C58A 4DS3A 3OE1A 4XIIA 2ZTSA 2GS9A 3R40A 2C2BA 1N0UA 3GRRA 5T6BA 1E4EA 3EW7A 3PC8C 4N4AA 3ZGNA 3NASA 4J03A 1H22A 3FFTA 4TMZA 1TTQB 4BX0A 1ZO8A 3DOUA 1DAGA 2RH9B 4HDCA 3WLKX 1R15A 2WDPA 4NECA 2WFAA 2GHQA 4AJ4A 1E2EA 2YY5A 3NCHA 4M22A 1VGVA 1N5DA 1NUQA 5FTNA 2OQIA 3MCVA 1JXAA 3VR4H 4FR0A 3ZD8A 1LBTA 2ZQYA 4MV0A 1OLUA 2E4AA 2FUCA 2PFGA 3MYYA 2O2IA 1I36A 3DMFA 1Y6ZA 4OY3A 3DOOA 3EC7A 3HR8A 1G6HA 3DTYA 3V1UA 3ZR4B 3B1VA 2K7ZA 5AW4A 4D9NA 3NPMA 5AW3A 1KMCA 3CG0A 2NZJA 4YGYA 4CMEA 4KQ1A 2WUDA 1YF3A 3QYPA 3FUUA 1N92A 2WYIA 2YJ6A 3CW2A 2X6QA 3V55A 4MB0A 2NU8B 4PGAA 5K0BA 1XOIA 1N3YA 2P2SA 3AQ4A 2QAGB 5LLTA 4KQEA 4JS0A 1XA4A 3MGKA 3WLEA 5AQ1A 2OG1A 5LMNB 1VKJA 1RE1A 1IK4A 1RXYA 2AMFA 4I3GA 4WDRA 2JC3A 3AM4A 3IAM1 1N0HA 4JMLA 3TB4A 3VR1A 2CEAA 1N5IA 1M33A 2GD2A 3BTOA 3L7MA 4A0HA 3TB6A 3O8CA 2X5KO 3ND7A 3VR3A 5HW0A 2VPZA 1VDZA 4MVJH 1LDBA 3OEWA 4GPAA 1PFGA 1VJTA 3HCDA 2BMFA 2QN2A 3TTSA 3L43A 2Q6OA 3SC2A 4A5SA 4W7IA 4CG1A 1X86B 5EZ6B 3QE3A 3LC1O 1KYYA 1JLSA 1ZWLA 3F78A 3NHUA 2ZYRA 4QPCA 2LBPA 1FFAA 1RHKA 4TLBA 4UVDA 1O96A 4XYLA 3CT4A 2F62A 2WDZA 1ZONA 5MF6A 3S40A 5HF6A 1ZI8A 4MVJA 4H2DA 4KR7A 2WUFA 1RQLA 2PDAA 1V4BA 4XJTA 3VX4A 1I3LA 1R9JA 4M6WB 2QTBA 4MR9A 2O0JA 4GQBA 2ORED 3C45A 4B8YA 2ZRMA 3PWTA 4Y6QA 4ZALA 1NQTA 3QH4A 2IUSA 4BN4A 1H65A 1QYWA 2BKUA 1P7CA 3DM9B 4HGPA 2JW5A 2NT3A 2B25A 2Z6UA 5LDHA 5CM2Z 3FWHA 4KB5A 1VTKA 1KP3A 3IAEA 3JTEA 4IO1A 5BSGA 3IA7A 3R7FA 3VV3A 3N39C 2EZ9A 5JR3A 2BKXA 4OI2A 1SURA 1BXKA 4KBYA 4MUYA 2NVBA 1VOTA 3EYAA 4AZVA 1F9EA 4EUSA 3R5JA 3A58B 2CE7A 3GIWA 4KAJA 3FPFA 4C7OA 4JXJA 2FJUA 3K2EA 2CNOA 5HIIA 1P6XA 3SG0A 1XL1A 2XUKA 1LI7A 2P2LA 3FFXA 3L1IA 4FGSA 1OWPA 2HBYA 4L6AA 4PLTA 2WU0A 4BFSA 3S0JA 5JYEA 3TMYA 1GL6A 2OA0A 4A7PA 3FB1A 4WK0B 4V1CI 4LPSA 1NIPA 2VF4X 2Y93A 3BEDA 3L6BA 1I2AA 4PPGA 4Q01A 4D8XA 9ATCA 1UK8A 3ASYA 8ADHA 3UMCA 2GO1A 3A7DA 3W2IA 1T9HA 1DBSA 2ZJ1A 4TV9F 1XZAA 3R6LA 4RIGA 5CVDA 4BKPA 4LMPA 2XUAA 3G02A 4YMWA 2YQ5A 4LDJA 4D4LA 1HTWA 3GUZA 4RQUA 1MX1A 2B5VA 1TC2A 4U9UA 4DMFA 2Z2ZA 4B2YA 3QLVC 1E60A 5E3IA 4RTNA 4LF7B 3IV9A 4JLVA 3LA8A 4C88A 1OU4A 1RABA 4MCJA 4BNGA 1IEVA 5JS1A 3LZDA 1LVUA 4HWGA 1SBTA 1PG2A 5LOVF 1QRAA 1U2GC 3M3PA 1KC3A 5B6IA 2FPMA 3HXPA 3E82A 3DHVA 3TLMA 1N2ZA 2DCUA 4GBJA 3PJEA 2FPGB 1Q84A 1AH2A 2EBUA 4JKIA 5HTOA 3SDSA 2GJ9A 4GPBA 3PHGA 4RFLA 2GA9A 3MOIA 4NZ9A 4NONA 5GONB 3C3CA 1VBMA 1NV9A 1L5SA 2QLTA 2A9FA 3GRAA 3OZAA 5HKKA 2CLIB 4PQGA 3QF4A 5LJIA 2HK9A 1FOEB 4AJLA 1NXOA 2VHTA 3M8KA 5FL7A 2XLCA 5BOSB 3T1TA 1V9SA 2NV0A 5A1TA 3TMKA 2XPCA 1WZIA 3VPSA 2IZ1A 4GP6A 3AESA 4B6QA 2HDHA 4F3NA 3DLPX 3I62A 1ELOA 2NSHA 3EPPA 3GJTA 2VP5A 4ZEWA 5CYPA 1SWVA 3W2GA 4CKBA 3IE1A 3IKVA 1XYYA 5DM70 3AVVA 2QNRA 3QNWA 3IRUA 4L8LA 1ODCA 2Z9CA 4OGLA 4PIMA 4PN3A 2DTDA 3NHAA 4A8JB 4XYEA 3IAFA 3PNQA 1OWNA 1NKVA 3RS5A 2WF9A 4O02B 1KFBB 2PXXA 2R5FA 5FPHA 1Z8DA 2QZJA 2WSSA 1O9HA 3CU5A 4XJXA 5EE9A 5CB4F 4BX9A 4HDOB 4HUTA 1CT9A 3CVJA 1Z74A 4JJEA 3TTWA 1JHMA 4PEVA 3I8SA 4FE3A 2BDUA 1A8SA 4ACAA 4AYTA 2HJVA 4B6SA 4YMGA 5D51S 4C0XA 2H65A 1V1JA 1ZN7A 2IYWA 3DD1A 3WK4A 5A3QA 1ZHOA 1NL3A 4ZT2A 4Z4GA 4GT1A 1FYDA 5I7VA 4IDGA 2WAOA 1R0RE 5KSYA 1SU6A 2X23A 2N0SA 2R87A 3OQPA 3R7LA 2HMTA 2ILTA 1PGNA 2PV0A 2Q5FA 2WD8A 3V6LA 3IP1A 1PJRA 3NNDA 5KQGA 2H59A 3I73A 4TL6A 2HV9A 1C3OB 1NFQA 1J7KA 3BHIA 4L7VA 1MO3A 3A1VA 2EJUA 2GK4A 3PC3A 1HT3A 1GPJA 4RL6A 2QSZA 2ZUUA 5JVDF 2WB4A 3TDMA 4DV2B 1NR5A 3RANA 5LIRA 3P4UA 1DJLA 4G8DA 3O8OA 4R1OA 3RD5A 5LSAA 3OD1A 4UU1A 1KYTA 1UJ6A 3SPXA 3VR2D 3LCUA 4EWLA 1YVEI 3QOFA 3U40A 1X1CA 4FFMA 1OIWA 1BFKA 3RT1A 5AFSA 2RJ3A 2XCOA 1UDXA 3NHBA 4DV4B 4ZK2A 4IGFA 6GPBA 4MK4A 4NV1A 4KV9A 1PG5A 4WVFA 2PZFA 3ONVA 2IJGX 4UM8B 1E2UA 2V5AA 2F1RA 3MIIA 3VR4D 2X1LA 1K4MA 3HZZA 4HBGA 3BCSA 1ATZA 2H00A 4UTRA 1SRQA 4EL0A 2YR0A 4H1VA 1XC7A 1U7PA 2DQZA 1L5ZA 1U5CA 4GO1A 3GLTA 4UUBA 2R5WA 4MP8A 3SMVA 2XY4A 4YR9A 4MKZA 4QOGA 1HFWA 4RD3A 2Q7XA 4ECAA 3Q7IA 5J63A 3JASA 4NJEA 3AI3A 4K40A 3HBNA 4XW2A 2HCTA 3U7GA 4UNRA 4MQBA 3W78A 1SUWA 3ZXIA 3EHEA 1K1EA 3VR3D 2CDCA 3R0VA 4AMYA 4BFWA 3NBUA 1L5GB 1HDZA 4M0UA 2J5KA 4AJJA 1UM8A 1GGHA 4GG1A 2JH8A 1IUOA 2XECA 4O2AB 1L6RA 1WTCA 2C7BA 4X63A 4RMHA 2GF0A 5JEDA 2DETA 1NPDA 2VBGA 3FTCA 4G36A 1ZMRA 1YZLA 2AFHE 5IN4A 5H8WA 1PW7A 3DLIA 4EMUA 3UCEA 3QFHA 3ETGA 3NXSA 3RAPR 2D2XA 3Q7TA 1L5VA 4MVJD 1UPUA 4GGPA 2CFRA 4AG3A 4YUVA 3JWPA 4KUHA 1WBBA 3E4CA 3DMGA 1DAKA 2HPZA 3IR6A 4RVUA 4UTVA 5TF4A 5BMVB 1M76A 1NW5A 1U0FA 4LZOA 3ZNQA 3IUJA 1R0LA 2IPNA 3T1YB 5AT1A 5MN4A 1ZU5A 2HRBA 3I2KA 3OCZA 3IT2A 4H7DA 4X93A 5JDCC 3WQBA 2I9PA 1D8TA 2NYUA 2ZRCA 4L8YA 5CDFE 5IC4A 5KTOA 1M8FA 2ZIXA 1ZGZA 2ZSFA 3BRCA 2Z4RA 4FYVA 3W8DA 3QFTA 3CBGA 4CKXA 1KMMA 4YYZA 4BP9A 1RSZA 5E8RA 5CB8A 2GN1A 2YVLA 2OILA 3F4BA 3EVDA 5K8IA 5CCEA 1DAIA 3FM9A 1QFYA 3IQGX 1W4BA 1ZNZA 4MAFA 4OREX 4Q7KA 1TVEA 1NBOA 3NT5A 5JD6A 1RYZA 4DJDC 4QPNA 4U7GA 3AY7A 1OLOA 3DG9A 4PO8A 3G8CA 3PWKA 2ZYTX 2BVNA 3PDCA 3GELA 1RXCA 2JFYA 4P33A 4YMVA 1OFTA 3IUYA 3THWA 3JYPA 3QYFA 2BFCB 3L2OB 3ZBQA 2YKGA 1B0AA 2OVBA 4HTFB 3K53A 2XNKA 3HCEA 3FDXA 1H2RS 4G01B 4MWOA 3D0KA 1DIGA 5HQTA 2NSJA 1Y9ZA 4LECA 2QU8A 1PQUA 2W9XA 1JZTA 1KL7A 2I4NA 2PRYA 4WMLA 1GARA 4BMCA 3MTJA 2JLUA 4LCBA 3NJ4A 1YULA 3W8EA 2BGIA 4BPRA 1T6BY 3FMVA 5AVOA 4FOSA 4UAJA 5F51A 5J2UF 3W5IA 2X2OA 4ZCSA 5HJ5A 3C3WA 5BR8B 1I4LD 5CDHA 1W5AA 3NCTA 1DTWB 1BHSA 3W6PA 1I5EA 4CCSA 5C3UA 3CX6A 4CL0A 4GEKA 3AUYA 2HB6A 1HF3A 5BQOA 5DX0A 3CR7A 2ZXEA 1PV2A 2IIVA 5ALDA 1VIYA 4MYUA 3VZBA 3DZ8A 3OFNA 1D03A 2IZ7A 4BFUA 3I9V1 1H3NA 2B35A 4LIPD 4ZT7A 5KJ1A 1GQQA 4FIDA 3R0JA 2BISA 2V03A 4AF8A 4E30A 1XJ0A 1PJ4A 1ENPA 1IB6A 1DAHA 2MYUA 3CN9A 3UN1A 1G7CA 4EFMA 2BMWA 2I2CA 2M6SA 3EMBA 3CZRA 1MDFA 3GLIE 4ZOQI 3NYRA 4EDHA 2EF1A 4EA9A 1DRUA 5EHZA 3C5EA 1NVAA 2GSDA 5AUQA 1EXWA 4DMUB 1Y1TA 2VLIA 2YWGA 4Y9RA 4AP5A 1S02A 3AETA 1PRYA 3CY6A 4TQUS 1WXEA 1Y80A 4RDIA 3CSDA 4PICA 1Y5RA 1CZUA 2Z9BA 4MW4A 2WAMA 5FOXA 1ZI6A 4YO7A 5B53A 2DYKA 4AN0A 4R54A 5J40A 3OD5A 4HF7A 4HLCA 1ZN9A 2ZYAA 3FOWA 4EEKA 3OX2A 1H85A 1JPNA 1ADBA 2R2GA 3ORFA 4ZVRA 3ICVA 4JL5A 5F5NA 4II2A 5HBGA 2CNNA 2V59A 1WB6A 3MC1A 3U9TA 1FYEA 3PE3A 4LQ4A 2VZEA 3TPZA 4W5NA 4B81A 2FEKA 1A8HA 3U1VA 1MG5A 2FMKA 1Z0UA 4JI4B 4IIVA 3EXG1 1DKQA 5THQA 1K3TA 4DADA 1WUIS 2Z8XA 1AZTA 1R0KA 3N2KB 1F9AA 4PCAA 1DEKA 1NR1A 4WA8A 2Y1WA 5BVGB 1JP7A 2P90A 3EASA 5I8PA 4KXUA 2EJVA 1FNMA 1QPGA 1JHYA 1SIBE 2KI5A 3L82B 4ZT4A 4UUNA 1HI9A 4EG0A 1OILA 2JIZD 2NYAA 3JQ6A 4Q7EA 3LT1A 1T0JB 4F4JA 1RZ3A 4K9RA 3UMGA 4WK2B 2DFNA 2WKSA 4P5DA 5EKSA 5TQ0B 3TDKA 3TQHA 2GJKA 3ZE9A 2GEFA 2UDPA 4U9HS 3ROFA 4NMHA 3OFKA 2BFBB 5EE5B 3NVMB 1BCSB 2FN3A 1CF2O 1RJGA 2GK7A 1SIOA 1M2JA 2HTEA 2LRHA 3PXBA 4AJNA 4YQYA 1NMZA 1XSEA 4K88A 1YK0A 1FE8A 2VAVA 5HDQA 3E3NA 4FGUA 3TSOA 2VJNA 1UXOA 3EXFB 3I9NA 3A26A 1A76A 3OZ7A 2HK6A 3KQHA 3V9PA 3P9CA 3WYBA 1MTOA 2I99A 1E7YA 2HJ9A 2ZYSA 5EMMA 5MFZA 5PGMA 3UCXA 4Z9YA 4JBGA 1SC4A 3S7TA 2FMUA 3HJHA 4IRUB 3Q8LA 1LI5A 3WGOA 4DJ5X 2I03A 5AP9A 1QQ6A 1YFLA 2MTBA 3X1JA 2NP6A 2XMQA 3SHTA 1HYHA 2V7TA 4QRDA 3M4ZA 3RW9A 4B34A 3BWDD 2SHKA 2PS3A 1GDHA 3AF4A 3AEKA 1KKLA 2W22A 4AO8A 4UHDA 3H8SA 2WM3A 4COOA 2GT1A 3RUEA 3K3PA 3TUJC 5LIPA 2EF0A 1Q5PA 3KKKA 3JQ7A 3L1JA 1KDYA 4MRRA 1IQPA 3COWA 1V8OA 2RHCA 1ST2A 3HMKA 1M34B 4WGFA 2ZS7A 1XRPA 2JI6A 5DULA 1YWGO 4KV7A 1ZU4A 2R6FA 5DXJA 2YMLA 2PA3A 4FNOA 3L7JA 3OLYA 2VHEA 4DR7B 3TZCA 5HJ7A 1VYUA 3TD2A 2FPOA 4TMWA 2FN8A 2O1SA 3S68A 4NICA 4ZOBA 4BQFA 4A23A 1YQEA 2REQB 2ST1A 1KMHB 1G4HA 2EKLA 5BUZA 3WHPA 1B00A 3LCMA 4WOPA 1ONSA 2OSVA 1HG0A 2QT1A 5EE1A 2HA6A 4C2BA 2F1IA 1HEUA 2FF5A 3GHYA 2ZIEA 3Q9LA 1HDCA 1YZFA 4BQRA 4CTOA 3FLEA 1CR2A 4FFLA 1OHHA 4PYRA 4BEWA 2VDPB 3ZWMA 2XRYA 3NBQA 5EJ5A 3O5AA 4D82A 1PHPA 3F8WA 2B21A 1EK0A 4II3A 5K0EA 2A5FA 2QDKA 4X6YA 1W8IA 1XRRA 1I24A 2D2IA 2WJWA 3KJQA 2UXBB 4GL4A 4FR2A 4BASA 3IIJA 2XMDA 3CUKA 2VRCA 4UAVA 5EJ9A 4QLOA 1EFRD 4WUTA 4LZJA 5ALEA 3PQ7A 3D0OA 1WL8A 3WFIA 4EOGA 1P3Y1 2HX1A 2OYRA 4P31A 4DARA 3OE5A 3RF6A 3Q7EA 1O3YA 4ZAZA 4E4RA 4ES6A 1GTSA 3D5QA 4UVEA 3JV7A 2PT9A 4L72A 1JW9B 3D0RA 5K3SA 2PV7A 1FUYB 4JT2A 3U7EB 1UXJA 3PPIA 2NXCA 1Y7HA 5KZMB 2X5JO 2JJQA 1GL3A 1PFWA 3EQ2A 3LPMA 5HOQA 5KCMA 2GGSA 3KWJA 5JCPA 5AVTA 4D57A 1DBIA 4WJLA 5DBFA 5ALVA 1T5TA 3R9KA 2TMDA 3RFVA 1NU6A 3UGKA 1Y6FA 3TZEA 3GBVA 2HTFA 1FNCA 4JR1A 5AVXA 2DFDA 2W48A 3BFPA 4US0R 2XEXA 1XDBA 3GDHA 4DAEA 3TZKA 2J41A 1I6LA 1N6LA 3BK2A 3DZDA 3M3HA 3EGDA 5H80A 5JCOA 1XMQB 2E48A 1K3UB 1X9GA 3IPRA 4DLKA 4KR0A 1XKLA 1A7JA 1L4NA 1MJNA 2HWKA 2ODPA 1Z88A 2YVQA 3QPDA 1RVDA 1FX0A 1JWLA 3II6X 4XUDA 2XYQA 4XYBA 5CH8A 1I7DA 2O7VA 4KDCA 1NP3A 2OHJA 2Q2VA 3PT9A 4F4IA 2ZIUB 4NNJA 3ILSA 4NR0A 4M1TA 5L4SA 3B5EA 5JJKA 3EZ7A 4UOQA 2JG3A 3KEGA 1WRBA 2B4QA 3WLTA 2Z8YA 3R24A 5AUPB 2FF7A 4L4XA 1Y1RA 2HCFA 2C82A 1D4AA 2BMAA 3EOAI 3KHKA 2BHLA 5EIXA 1XROA 4W9NA 2JFOA 3QKUA 1AMOA 1RM0A 2NZXA 5JAZA 5CDUA 2FDXA 3O1LA 1A8PA 1N2OA 2QL5A 3HZHA 1ZGBA 3MEQA 3TVTA 2CNDA 3QVJA 4Q3BA 4D9MA 4XDYA 5FKJA 1J00A 1VMEA 3BA6A 1MB0A 2AOTB 3NHJA 2XKAA 3INRA 5K4AA 1LDEA 2J87A 1D9ZA 1HDEA 3L8MA 5ERXA 2YRWA 4EA7A 1PNTA 1R0ZA 1NOKA 2Y68A 2G0TA 5LZ5A 5A5GA 1YTUA 2RGRA 3VNBA 3DL2A 5DW0A 2EV9A 2AMJA 3EVEA 2I62A 1QV7A 1YL6A 2QN1A 2WTAA 1I4TD 2VOJA 3T5PA 3PQFA 1MG0A 2NPIA 3OZCA 1Y3AA 1E0DA 4D8WA 2Z6VA 4PZUA 3UG7A 3HVRA 3U6KA 4CODB 2P5UA 4HNAA 4KE7A 4IGKA 4OJMX 4ZTBA 3ZIUA 4GWKA 3FTEA 5DHTA 3LX5A 3PLNA 4L57A 2TMGA 1P1FA 1UXKA 2X9GA 1DX9A 3OWHA 2CYAA 4HH1A 5E7MA 1GJRA 4KCGA 3J81k 3EG5A 4EJFA 1FTWA 1KRWA 2QUKA 5CEFA 2W83A 1VL5A 3IKTA 3FUCA 2B1QA 1P5JA 1VCHA 1S3FA 4TS9A 5K4HA 3OZDA 4G1CA 4WOCA 4AZWA 2ESRA 1NT4A 2RC6A 1DG3A 1DJPA 1QG6A 2FR0A 4G4GA 4KVAA 2IXBA 3SZUA 3OO0A 2GCIA 3I9LA 1NOJA 1VPTA 5GZ6A 3ZZNA 4A0SA 3DBIA 3KQNA 1OH6A 2NACA 3ZOKA 1XMOB 3DOEA 2DC1A 2PUAA 4CM9A 3GOHA 4NCBA 4NARA 4BIIA 1MAHA 3GVPA 1ZKMA 4RZSA 2F3UA 4BKUA 3DLHA 2IQIA 5IXSA 1H6BA 1P0FA 3WB2A 3OQHA 1ZD4A 3A6KA 3LDHA 4EA6A 1Y7IA 1E32A 3FCOA 1BGXT 1UWKA 5AM4A 3VR0A 3F6PA 1LEHA 2YINC 3I12A 1ZD8A 4E07A 4IDOA 4RIHA 821PA 5FLXA 3IL2A 1CEEA 4EG7A 3GP8A 5A0VA 2PRSA 3UBTA 5A4IS 1LA2A 1SQ6A 4NLLA 2CWWA 3ZV4A 3PHCA 3MUOA 1JX6A 1R0YA 3IQDB 4FC6A 4M7OA 2BY4A 1YJCA 2OAEA 4AF6A 3HJUA 1HX7A 1XG5A 3SZLA 1HRDA 1BA3A 3OM9A 2ZRPA 5A3JA 1RYMA 3IKMB 5TEVA 3GVXA 1USGA 3WA7A 2FK7A 2FN4A 2CFSA 2PLWA 1WD7A 4HVCA 2G5CA 2O14A 5AJVB 1GG2A 3QVMA 5TPWB 3ZDRA 3W9SA 3QLTA 3Q1LA 1EGQA 2PGLA 3BXHA 4R7ZA 2A30A 3JD3A 4J90A 1QWOA 2ZRBA 2RBKA 4BTLA 5KTKA 1F8FA 4AP9A 4QT4A 1X14A 2E0IA 3RVBA 2QV0A 4NJMB 3EGVA 4YCMA 2YWDA 3IAHA 3NT4A 5EXXA 2W2LA 3SKVA 2VXOA 4AW9A 1N6RA 1WX1A 2UYGA 1Q7CA 3WI7A 3PJRA 4JB0A 1BXGA 1M6YA 1IONA 4XWGA 5HNKA 1D2EA 4GP9A 4D46A 3HU1A 3WSWA 3DZBA 4PHFA 2IBTA 3G59A 5JSHA 2VH1A 3MT7A 4IDAA 3LT5A 1Y5MA 3QUQA 2YIJA 2P2YA 2IDJA 4OAOA 5FLKA 3AWDA 4A0FA 2I3DA 3WTCA 3NVKI 3OBBA 3PSAA 4ZVKA 1CLUA 1G21B 3KKNA 4AURA 4D5EA 5IDVA 3KS9A 1SBHA 3HWWA 2EEZA 3V8NA 1YQ9A 3GZTB 2R6HA 1H1LA 4G2TA 2BLNA 1E63A 3IVMA 4UPVA 1EZ4A 4ZO9A 5KQMA 4ESVA 5GOTA 4EF5A 4C3OB 4IIFA 1QF9A 5AKIA 4UHBA 3AF3A 4ZOLB 3R76A 4Y2XA 2V0NA 2JFBA 1EP1B 1RXIA 3KWMA 4LSZA 4L07A 4LKRA 3HPRA 3G9ZA 4LY9A 2HY7A 4U4AA 1MVNA 1AA9A 3AKDA 3NLLA 1E66A 1LK7A 3VM6A 3ZY5A 4ZZ3A 1S8AA 4YGXB 1ADFA 3B7PA 2H5IA 3DF7A 2ZVDA 1Z4OA 5DNWA 1FXWF 2HU8A 2JKYA 4NG5A 1FBNA 5DIFA 1X87A 2QY9A 1GZ4A 2GPSA 3MWGA 1T8RA 3QA3E 4HD8A 3AHCA 6LDHA 1JYEA 2QTAA 1WMDA 3G2JA 4RYDA 1GHTA 1VFPA 3ORYA 5AOCA 3RQIA 2Y1GA 1JGTA 1QNFA 1R12A 2HRZA 1E9EA 1CBUA 1P8AA 2UUAB 5A02A 2RHOA 1J56A 3B5IA 4WCFB 2VPXA 5BV8A 2HF8A 4YAIA 5BRAA 3OM8A 1W9HA 2EBFX 1LU9A 3CPEA 2IVFA 3G2KA 3RVSA 1QVAA 3UAVA 1WMSA 2Q3BA 4TT8A 5HGJA 4PNZA 1IHPA 2FSVC 3E9RA 3G85A 4GFDA 3ZW8A 1OTHA 4KWIA 1QH1B 2DE0X 5M5BA 4BZPA 1YS4A 2AYZA 3ETLA 3HSSA 2F90A 3IBGA 3LQQA 3RIGA 4REQB 5INTA 2BUBA 3SQXA 2BFEB 2WIGA 4DIMA 1M8GA 4HNSA 3QVGB 4AKTA 3BTSA 4W82A 3G2PA 1H0SA 1M2WA 4WESB 1NVGA 5FUMA 2R60A 3H7IA 4RPCA 3MIZA 1SXJA 2PVPA 2C5GA 3D7RA 1VB5A 3VU9A 1WHTA 2OP1A 4G23A 4O1MA 1JA1A 1WW8A 2ANCA 5EY5B 2R8BA 3VHQA 4A1OA 3ENZA 1MX9A 1KU0A 2VJYA 4HX5A 1JQKA 3EEBA 1SUBA 2IUEA 4PC6A 2QKYA 3DNMA 5J5CA 4N7RA 4PTZA 4D02A 1T3GA 3SXJA 4PXSA 5KWVA 5CDSA 2NAPA 1U7ZA 3AUUA 2V7UA 2CLHB 1Z08A 1NHWA 1XKXA 1SCUB 2X1MA 3ABRB 4Q18A 5CVEA 3T54A 2PZAA 1Y7PA 4EHKA 4B35A 2MINA 4ZZ1A 4CEJA 3LWZA 2GZMA 4AS2A 4B3TB 3L8GA 5JASA 1USUA 2QVBA 3LVFO 2R65A 4HAYA 1V6AA 4N5MA 4QOJA 5KOHB 4CUZA 2H07A 2GR9A 1KYIA 1XLTA 4UFPA 2IP4A 2ZRDA 4EYKA 2H7YA 3G17A 3KU1A 2QTLA 2B7LA 4BX8A 3H2YA 3UT5A 3IHKA 4GPD1 1QVZA 1T2FA 2POQX 3W8NA 4JU9A 4CCYB 4D9JA 4EG8A 4ZDIA 3P9NA 2VQ6A 4C4ZA 1ODIA 1SVUA 2H5EA 2ZWOA 2PZ8A 2NVUA 3D8SA 3WTBA 1KOJA 3JYNA 2FCRA 3KSMA 3A6HA 3CX8A 1UFVA 5L4NA 3U3OA 4B4UA 1D1TA 1P2TA 2MU1A 1X80A 4P4TA 3L4BA 4ROSA 3KKQA 4XCXA 2C1ZA 3PA6A 3UQZA 1IWOA 2WTNA 2J9GA 2YYYA 3K0CC 5TT1A 2RSLA 4KU4A 5DMHA 3VGPA 4ZOCA 5DEIA 5F1PA 3TR5A 3M5DA 2O0KA 3WLNA 1GGKA 1IIRA 4C04A 3LSYA 4HWKA 5REQB 4S35A 1Y8QB 5K8TA 4LS3A 3TQQA 4UZEA 3E84A 4KXWA 2A94A 2OCKA 2IDMA 3P2EA 2RGNC 4XKJA 3SHFA 1FTQA 1FB5A 1RHMA 3S28A 4JHXA 2YXBA 3GLGA 1D1SA 1SAYA 3BWYA 1TU0A 1B3BA 3GZ4A 3TW0A 1TB4A 5A2QA 1F17A 1I32A 3TLGB 2XJ4A 3UWPA 1CC1S 3L6CA 1RPTA 1FFYA 4RTKA 4W5RA 3R4VA 4HNRA 3MZ0A 3HG7A 2X13A 2IE0A 1N8NA 2VYVA 4YFYA 5I9MA 1QCYA 1YTLA 2J67A 3EZFA 1OR8A 4CMKA 2ORIA 4AUKA 1KI6A 1RHUA 2R4QA 3MXTA 4WE3A 1JXMA 4BV2A 5JY6A 1LDYA 3FFAA 4JMPA 2BUAA 2QZSA 2VHXA 5ILOA 2YZNA 5H83A 3JQ9A 1O97C 4X00A 2ZTUA 1SCNE 1JSCA 1HFEL 4TL7A 2BEJA 1D4FA 3W5BA 4E21A 1N6OA 3Q6IA 3GWGA 3NUGA 5DK4A 1VE3A 1ETHA 3F5DA 4H18A 2GJSA 5B2ZA 4BO6A 4DCJA 3W4IA 1CYEA 2NSYA 3T0FA 1IH8A 3M1LA 3V8RA 3ZGYA 5FHQA 5IJ0A 1KBZA 1YE3A 3MGCA 1Y1QA 4Q9KA 5CEJA 3L8FA 1JEYA 10MHA 1C7JA 1JB9A 1QMPA 1N32B 4GECA 1BS9A 3TMAA 2UYYA 4PSKA 4MW1A 4UU0A 3KQPA 4IR7A 4DV5B 1MORA 1ISHA 1OT5A 4L74A 3GGPA 5DH9A 5EWLB 2H1SA 1AVTA 4CMCA 5BN4B 1QIMA 1W1IA 3DHNA 5K6AC 3FYUC 5DHUA 2O8DA 5BN5A 4C6TA 4MQEB 3L1KA 1UWVA 5BYJA 1EFDN 4R71A 5HS4A 3JD1A 1Z5PA 3TJZA 4BN5A 1UZNA 2D0OB 1E92A 5HCUA 4Q3NA 1XMSA 3AH8A 3KOWA 4DB2A 4QUBA 3L92A 3L8YA 2I8CA 2PWPA 4AS3A 2YYAA 1T9BA 2OV3A 5F2KA 1Y1LA 1C0KA 3IUNA 2NU9B 3LBYA 2FW0A 4MNTA 1HR0B 4BLTA 1XCLA 4DMHA 1NMQA 3AR6A 4P4LA 4QICA 2Y0EA 4JYMA 1N7GA 3GLHE 4YYEA 4E1VA 5CG1A 1QYDA 2EARA 2PUEA 1IPFA 4Q39A 3V3KA 2JD1A 1LF5A 2Q5LA 1WQ3A 1X19A 2QOEA 1XCGB 4GD3Q 2P9FA 4EMSA 4AY6A 1D2RA 1LWNA 4X9XA 3EVBA 1Z35A 2YDXA 2UZ1A 4QATA 3L77A 4UVHA 4ILKA 1M6EX 1AY0A 1Z7BA 3ZWNA 2IWRA 5JC1A 3JD0A 5K0JA 1VI5A 4JEMA 2JGFA 1SNYA 4JASB 1C8BA 2E5LB 1O94A 2BEWB 2XGOA 3C4JA 1PLJA 4UAGA 2FZKA 4GKAA 4AFNA 1PQPA 3PRHA 2WF7A 3IILA 5EEGA 4NBVA 3Q2IA 4CKEA 4P3YA 4WBSA 4NATA 2WE7A 1B41A 2WT8A 1X7GA 2C2WA 3ZUGA 4ND3A 3NBKA 4TGLA 2FUG6 1DXHA 1T8UA 1Q0ZA 3HKBA 4L9SA 4MCAA 3WGGA 4EO7A 3LQYA 2O5CA 3VZCA 4QFBA 1RI2A 1P7ZA 1D2HA 2ZITA 1BWRA 3ANNA 1L4MA 3I4CA 3RU2A 3OO1A 3HP4A 3QG1A 1YA8A 1UMCB 3E15A 3IUMA 1U1DA 5LZ2A 2WJVA 1P9RA 2AOUB 2PRZA 4LMRA 3G2OA 3GGJA 1JNXX 2UVQA 4P4SB 4WRRA 1XU7A 1YI1A 3LRXA 3FPEA 3IJEB 5J2TF 5JFOA 1KDZA 5KVAA 3H87A 3IDQA 3LS2A 1RWVA 2FFQA 2L18A 4WKCA 2HHCA 5KKCA 2B9EA 1GA1A 1K2VN 1G3RA 1BE8A 1VMKA 1XD8A 1CE8B 4DGQA 2VJMB 1GNQA 3SC3A 3RFXA 2HIMA 4G3XA 4BMPB 3TR6A 3T4XA 3MBKA 3OU6A 4HYYA 2QK4A 4JWTA 3KZNA 1G4UR 4D74A 2PMWB 2CZCA 1B8VA 1PWZA 1WCIB 4FMBB 2PY6A 2YFKA 5K3AA 1MGOA 2W2KB 1E7MA 4JBNA 5JZ9A 4F2DA 4CMIA 3NJ8A 1DFIA 4DDTA 2PU5A 4NULA 3EZ9A 3UHAA 4BLSA 1B6SA 5JMTA 1SCJA 4X8OA 4M53A 4I4TA 1OT3A 4EUEA 4X7MA 1U9IA 1O03A 1GGVA 1V48A 3HWRA 4D3FA 3LM8A 1YVPA 4ZCMA 1E0AA 2YCBA 2Y1EA 4R69A 2Q62A 1TZBA 2RE8A 1WPRA 4RULA 5FOTA 3TLBA 1N0WA 3D2BA 4CT0A 2KBEA 4FBGA 5AK0A 2AKEA 2HGZA 1CDOA 2CXOA 3AV0B 2G07A 1EAYA 3B1YA 3QLJA 1F20A 2RGUA 4XB2A 2LCQA 4BLUA 1TTTA 1JHOA 3KXDA 1TAUA 2YWFA 2Z08A 3LUPA 4PHHA 1P17A 2WWXA 1MO6A 3BM5A 4OA8A 3SXUA 1DDIA 3L79A 5C8ZA 4F4CA 4TTQA 1HYGA 1KGDA 5CFMA 4DBVO 2NZVG 5G2OA 1XXHA 2R6AA 2YDYA 4U0JA 1TO6A 4YP1A 3BWMA 3DR5A 1NLMA 4HKTA 3RSFA 3W1VA 2HGSA 1TIPA 3HRKA 4TWIA 2XDWA 4UOEA 1N2SA 3AQIA 4YBZA 2PQMA 1DAOA 1XZLA 3DL4A 1K7CA 3H5AA 2CK3A 4PFSA 4NOLA 3WOHA 1DJOA 2RGEA 4UTPA 5EUBA 3EH2A 4XEHA 1M1YE 1XWIA 3H05A 1DAFA 5I6DA 2CLKB 5BR1A 4QUIA 5A7FA 4ARIA 4CF4A 3JZDA 2V9PA 4D43A 4Q9LA 4DLWA 2IH4A 1UT8A 2G9VA 3AINA 4CE6A 5CX1B 5HRCA 3KPWA 3ZZMA 3PNVA 4MPTA 5AICA 3GRVA 5EP3A 3HM9A 4PRLA 1TDJA 5AW5A 3RQSA 4F1KA 3C87A 1UPCA 1DRVA 2IPMA 1W6UA 1QDLB 3M4NA 4M9XA 3LUKA 1JL3A 1VE5A 2NSLA 2D7CA 2V3VA 3EFOB 2FV8A 4MUFA 5ICCA 1U4NA 3AF2A 1GAEO 1HA3A 1E2BA 1MXHA 4J1TC 3Q7QA 2QR2A 1I1NA 4M9ZA 4EHNA 7REQB 1JN0A 1EEXB 2WYOA 3PP8A 2ZGVA 1SPXA 1O6GA 1R37A 3TVDA 1JFRA 4UXHA 2C9MA 3B3QA 5FQNA 3N0XA 4TKUA 1IZ0A 1E4EB 3SEQA 4EY6A 1LWOA 1T2VA 3CH4B 4OO3A 4ZMSA 1ADGA 2O1WA 4NG4A 4EY4A 2G9QA 1LXCA 4JP2A 4XDHA 2NX2A 3L01A 2RAVA 3BK1A 2F8TA 3T34A 2QTGA 3N2NA 4BQOA 1KOFA 2RCYA 5JAIA 4EI7A 3QSYA 2M6RA 2BJWA 1UM9A 2A3NA 3STYA 1T25A 4LBYA 2ODWA 3KEQA 3U62A 3A3YA 4OP3A 1MV8A 5EC8A 2VSFA 1JJFA 1WY7A 2UYQA 2EYUA 4CM4A 1RLMA 3NM6B 4E5NA 3OECA 4UBJA 4WZAE 3C5VA 3H5RA 1BZYA 3GFFA 1BFUA 3L0PA 3TL2A 2CUKA 5EUMA 1SH7A 2GEUA 4EP1A 3OF2A 3N6XA 5T64A 2HA3A 3ZHQA 5JDIA 4FR5A 2AXPA 4HYTA 4GW3A 1IN6A 3K8QA 4F8JA 1G8GA 5I7WA 3EVNA 3X2FA 4RX1A 5FO1A 3HN2A 4D3ZA 3K35A 5K03A 3TGLA 5FR2A 2J3DA 3F7MA 5DTRA 5C1BA 1MFPA 3ULKA 5CURA 1P1JA 1L1RA 2Q8PA 2VDRB 3VOAA 4XWKA 3A4LA 1RM4A 1NMXA 4OHZA 2AEMA 3ANYB 4GKVA 5J43A 2XBMA 2JIRA 1D6MA 2GVNA 2G7ZA 1L1FA 4DWOA 4L5IA 5C8YF 3SC2B 4X66B 4S1WA 4H7JA 4DM7A 1MPXA 2G88A 4OEHA 1X7DA 4XRGA 3V4ZA 3H5OA 4FB5A 1O96B 1U1IA 3F49S 2WM2A 4IGEA 1H3FA 1XU4A 2CJPA 2DBQA 5F7XA 2IV3A 4OQPA 1AUXA 2UUOA 1W5FA 4U8GA 3GUVA 3PXCX 4L4YA 2C84A 5HIMA 1JR6A 4JUDX 2H4HA 3QEJA 4B43A 3LCCA 3GD7A 4X6XA 2G9ZA 4MR9B 4PAGA 2PUWA 3ZDYB 3DMHA 3PWZA 3E2PA 4DLRA 1Z5WA 1RE0A 3HEAA 3FTDA 4V0SA 1OASA 3G0OA 3UMFA 4JLOA 1G9XA 5KX5F 2V4UA 2Y9PB 4Q19A 1GT6A 1N2CA 2NLOA 2XMRA 3H0CA 1P72A 3NBXX 3CUUA 3H97A 4O2RA 4K81B 3VNUA 4BMXA 4IH4A 1PJAA 2LCIA 2VYND 2WG0A 2ZZKA 5HIJA 3FNEA 1R9GA 3MTQA 4C7OB 1E3DA 4B3GA 4XA8A 7ABPA 1IAVA 3IH5A 1S2LA 3OU2A 4N47A 4FZ3A 4W8HA 4DILA 1UIMA 4EY5A 3H8VA 4JI3B 4IIJA 5B2FA 3V00A 1WDKA 1FJHA 4ZARA 3UGJA 4E3WA 3K94A 2FZLA 3SYRA 5SICE 4I66A 3GVCA 1ZQ1A 1D7AA 3RNLA 4CI0B 3N2LA 5J4YA 2M1XA 4CKCA 1KR2A 4IEIA 4KDRA 1VJGA 5IWAB 1DLIA 2RG7A 1WJGA 4B44A 4EELA 4DV7B 1MP0A 2VNIA 4J2TA 5AHXA 1T1RA 3HA2A 3O2QB 4URHA 1PJZA 4R3WA 1G6OA 1AZWA 1Y98A 3UJ6A 1FSPA 1ISSA 3IUPA 4LJSA 2C98A 3CKMA 3JW8A 3QMMA 3TTVA 3CJRA 1F8YA 4UUOA 4LWOA 1T1SA 3VDXA 5C7OO 4HX9A 5G02A 4I9NA 4KGDA 1KEZA 3AVPA 2HCBA 1SVIA 3BRQA 2CSXA 1ECPA 1A9ZA 1LLQA 4WCDA 2HBRA 5ILQA 3OCJA 2CHVA 3BBLA 4LV8B 5AH0A 3FCSB 3MCUA 4G56A 3O4IA 4QXQA 1WABA 3QHPA 3QTBA 3RSCA 1BJRE 4HXEB 3U3RA 2NAFA 1L7EA 2KSQA 5DX1A 2XD4A 4B3SB 2IZ5A 5F3DA 3DQPA 2EIHA 4PFJA 2O8CA 4IIDA 4UULA 2BMDA 5E6UA 3CV3A 1Y4UA 3RO7A 4N12A 4N54A 1NVBA 1DG9A 1JEJA 1U1GA 4KWHA 4LJKA 4S2UA 4EMTA 3OOEA 1T91A 3QF4B 4FFNA 4PHGA 3ZQ4A 4GLBA 4NPCA 1WSWA 3KQMA 4S0ZA 4P84A 3H17A 4W63A 3RYTC 3DAHA 5JWRA 3CH5A 3B82A 5AKJA 2C8VA 1OVMA 2JLBA 1NXVA 1QZTA 3VAAA 3WLFA 3V4PB 1RADA 2VAPA 3AESB 1CRZA 3LQ4A 4PZEA 1KP2A 3B36A 4AZTA 5C80A 4CKBB 2P6PA 3A6ZA 4GS5A 1DPGA 1AKYA 2WJ4A 4QJ5A 4YV0A 3D7KA 5D7BA 2XF8A 2OGUA 3HZOA 2Z9DA 2NPFA 3STXA 1T4GA 3OE7A 4MQFA 5TVKA 2RONA 1NYQA 1XALA 4MAAA 4MVJG 2ZFUA 2ZU6A 3NVAA 5FNVA 4ZYYA 4ZVNA 3TTXA 4OP1A 4PIPA 1E1RA 4NZZA 5DBIA 5DGXA 3KXPA 2XZTA 1RYFA 5TDHA 1G16A 3ZCSA 2QYSA 4G0YA 2RGCA 1I3OA 5C5EA 4C4RA 4QT0A 2EDCA 1EJ2A 1YU9A 2OORC 1LRLA 2H17A 3NBMA 3W5JA 2CD7A 1PR3A 1PX0A 3U0BA 4E7PA 3L84A 1T6NA 2I6FA 3KZCA 2PZBA 3FNRA 4ASUD 1X9IA 4FK8A 3GEHA 4N18A 1ZCJA 1E5LA 2HSZA 3TTTA 1V3TA 5E6SA 1WDWB 2XBLA 3H1FA 4MTCA 3VZRA 4I08A 1Z62A 3SZGA 1AXGA 1KAGA 2IODA 1V11A 1F48A 3B2NA 3GEEA 3QVXA 2RGYA 5KBYA 2R7MA 1NW8A 3WIEA 4GIBA 4L85A 5B57C 3DONA 4KN8A 4F4DA 3O8OB 3PDJA 2IHBA 1TKAA 2YHIA 1SWWA 3BD9A 1UDWA 1GV1A 3IP7A 4HQNA 4N3CA 4EKGA 3U7QA 3WNVA 5LQAA 3CRZA 4OHCA 1B4DA 5KOJA 2X3UA 1FC0A 1P73A 3K1ZA 3OF5A 1LDMA 1TZ2A 3DW3X 3Q3IA 3DZFA 4R4JA 5F2EA 2M32A 3EVAA 4DAOA 4PAQA 4XWAA 1Y8AA 1RBMA 1VGQA 1RIFA 1TCVA 1XZ8A 4RM2A 3TNDA 3ERCA 1ILWA 1MJGM 2V8BA 3PGLA 5IG2A 4Y3UA 3FCAA 3ZXUB 4UUAA 1NLZA 2I0FA 4QOHA 1A9YA 3JALA 1HE4A 4JITA 1XD9A 2ZJOA 4A2CA 1UAYA 3GP3A 4Z0HO 4L9RA 4YQZA 1GU1A 5ICEA 4DREA 1N7HA 2CDBA 2R9VA 2P5TB 2QIOA 3JASB 5JS6A 1C8KA 4NJEB 2H3HA 1PLKA 3ZGVA 4I55F 4OBXA 3WADA 9ABPA 2YFHA 3B7WA 4BVEA 5D87A 2WYHA 4BLPA 2V9ZA 4U7JA 2Q8NA 5BW5A 2QZZA 2XUQA 3KVVA 1ZUNA 2ECQA 4DF3A 5JNSA 1IVSA 1CJTC 4RM3A 1CV2A 2G6BA 5C8DA 2R7KA 1GPLA 5DXFA 5IT9A 1YGYA 1CQIA 1BDBA 4KH1A 1RAFA 1TZKA 1SG0A 2C4KA 5DM4A 5EIFA 4ZVMA 4BE9A 1YBHA 2Q49A 4B48A 2UUPA 3K5WA 3CA8A 1QR2A 2J4DA 3CXRA 3FKQA 3IMFA 1PVOA 4ZOAA 5FWNA 2H18A 5KJCA 3EXEA 2NUPA 3HB5X 4KJXA 4BX3A 4RNCA 2O6HA 3N8DA 1FW6A 3U5ZB 4WNAA 2BFOA 5A2GA 3HVIA 3PUVA 1I13A 3PKIA 2DAPA 3CKKA 1RJFA 1ONPA 1ZHFA 4K86A 4G9EA 1BU5A 4JSRA 2FEPA 2Z6AA 1XWWA 2NNLD 4KWEA 4Q6BA 4GRDA 3G8BA 3M6VA 4G9GA 4NMMA 1WP4A 1RBQA 4P93A 1GCIA 1P91A 2GF9A 5DLYA 2CVPA 1E2KA 4WACA 3IBCA 4Y7CA 5IP5A 3P2KA 4C76A 5JZVA 1ISRA 1I7NA 2ZIXB 1T0BA 3G3EA 3L46A 2C2YA 3DFIA 3S2ZA 3SSOA 2XF2A 4EUNA 1M0SA 2HZ7A 1MFZA 3U37A 1I01A 1W2WB 1II0A 2X6TA 4Y2SA 5CVJA 3RS7A 1UBMS 1L0BA 3TXXA 5CM8B 3U3KA 1XTQA 2CNWA 5HP4A 3C3MA 2VSXA 1NW9B 1UJBA 3VMFA 1F2DA 1PHRA 2PSEA 2VA9A 3F98A 4FSHA 1UBCA 4MV9A 2QTVA 4RHEA 2PWZA 3TSWA 5IHPA 4LGMA 2B83A 4YT8A 3THWB 3CPHA 1GKYA 3L04A 2ID4A 4NBWA 4XEUA 4EBFA 4EJMA 3UMMA 3ZHBA 1F4VA 1U2RA 3INTA 1IE3A 2R5NA 3NHRA 3P9YA 5LA6A 2YXNA 4B3HA 4G86A 4YFVA 2MYPA 5AI9A 3LRTA 4TS3A 5LKAA 4WLOA 2TS1A 2PGIA 5JQGB 3N86A 4BJHB 1TMOA 4FUTA 1OXTA 3OHPA 1V25A 1PFVA 3MQFA 4R7TA 1KAQA 4TT3D 5EXTA 4C7KA 3LH5A 2IWHA 1TX4B 3BL8A 1JLLA 1DKMA 2WG2A 3A4YA 1EDZA 3G2QA 4DPKA 4YMUA 4FU0A 4LSWA 5AKEA 1T9CA 2B9VA 4MVXA 4QDZA 3N8NA 4Q4LA 2IS6A 1KVUA 5KUTA 3RIMA 3RHSA 3WWPA 2NV2B 2ZI3A 3CW9A 3G13A 4AQYB 1MRZA 4A6EA 5BSEA 4HB2A 3MB5A 3CFYA 5GJBA 5ETJA 5KJEA 1IJBA 4KXXA 1JMYA 2CXRA 3FMIA 1QCCA 5U4XA 1E0SA 3LPDA 2ODBA 4S1OA 1T5DX 3HFSA 2AG1A 1W75A 3JWHA 3T7AA 1UODA 1VE7A 1TLFA 2AHOA 3OEEA 1E98A 1OH8A 3QKRA 1DIAA 1SUEA 5EIWA 2QN8A 1R6VA 4YVFA 3AETB 4JP3A 5DTQA 3THOA 4IJUA 1AS3A 4FXOA 1Y9DA 1CY7A 3JQDA 3ZHYA 4HRVA 5TPZA 1DWQA 1K7FB 2ISQA 2YY6A 4LI0A 4I3FA 4LVCA 2ZB3A 4K87A 4ONEA 3NG1A 2OV2A 2X0KA 5KSWB 4F5YA 4GMKA 1RPZA 2O2JA 3C5WP