1W30A

Pyrr of mycobacterium tuberculosis as a potential drug target
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
174
Chain Sequence
ESRELMSAANVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pyrr (Rv1379) from Mycobacterium Tuberculosis: A Persistence Gene and Protein Drug Target
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords PYRR BIFUNCTIONAL PROTEIN
total genus 53
structure length 174
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w30A00
1DQPA 5IAOA 4RADA 4RV4A 1QK3A 4RHXA 1I0IA 1ECBA 2FXVA 5BRNA 3QW4B 5JV5A 1BZYA 5IPFA 3LRTA 3MJDA 4P80A 4P83A 1ECJA 5JSQA 1HGXA 1DQNA 2H07A 3DAHA 2PRYA 2WNSA 1VSTA 4P81A 4RQBA 5BQOA 1XTTA 4RHUA 1DKRA 1P18A 1L1QA 4X45A 1TC1A 1YFZA 1OPRA 1W30A 1ZN8A 4RAOA 1A98A 1V9SA 1ECGA 3KB8A 1ZN7A 4WMLA 1GRVA 1QCDA 3HVUA 1L1RA 1G2PA 1MZVA 3ACCA 3ACDA 4LZNA 4RAQA 1GPH1 4WN3A 3H83A 2VFAA 1BD3A 2XBUA 1UFRA 1U9ZA 4M0PA 1NULA 4P82A 3S5JA 4ZFNA 2JKZA 1QB8A 2JI4A 4Z1OA 1BD4A 5BQPA 3GGJA 1PZMA 1I14A 2P1ZA 4JLSA 1CJBA 1I0LA 1A95A 2DY0A 1LH0A 4QYIA 1AO0A 3ACBA 3GEPA 5E38A 5HKLA 1TC2A 4QRIA 4LYGA 2YZKA 3O7MA 1JLSA 1R3UA 3DMPA 3LPNA 1A97A 4P84A 4PAWA 1XZNA 2HCRA 1DBRA 4F8EA 1QB7A 1ZN9A 1IBSA 3OZGA 4S2UA 2C4KA 4RHTA 3MBIA 4TWBA 4RABA 5HIAA 4PFQA 5BSKA 2E55A 1Y0BA 4RQAA 1Z7GA 1VDMA 5ESXA 2EHJA 1QK4A 2H08A 1NONA 5KAMA 1OROA 4QYIB 2JKYA 1A96A 4LZOA 1JLRA 3NAGA 1ECFA 1XTUA 3N2LA 2H06A 1UPUA 1WD5A 3EFHA 1G9TA 1XZ8A 4JITA 5ESWA 1U9YA 1A4XA 4OHCA 1A3CA 4KN6A 4RANA 4IJQA 4MB6A 1I5EA 1UPFA 1XTVA 2PRZA 4M0UA 1STOA 1P19A 4RHYA 1VCHA 4X44A 1I13A 1O57A 2IGBA 3G6WA 4M0KA 1ECCA 1HMPA 1QCCA 3OZFA 1O5OA 1OREA 1P4AA 1DKUA 2GEBA 5K51A 3OHPA 4FYMA 3GGCA 1J7JA 3DEZA 2JBHA 4RACA 2PS1A 4LYYA 3M3HA 1G9SA 4LZAA 1FSGA 2AEEA 1P17A 1QK5A 1G2QA 1D6NA 5KAPA 5EUCA 4P86A 4P3KA
chains in the Genus database with same CATH superfamily
1TECE 2J0UB 2RIRA 1U2DA 4F4DA 5DBFA 1VHTA 3WIEA 2LDXA 5FWYA 1LV8A 2HZBA 2I87A 4HNRA 3I5YA 3OQJA 2UYQA 1WHSB 3Q10A 4M1MA 4IIJF 3DBHB 5ALEA 5AJWA 5E1OA 4IDHA 2DWPA 3SX0A 2AUMA 2CNNA 2YV5A 3EVCA 3LCUA 3JV7A 4TN1A 1FYFA 1RCTE 5E4YA 2G9UA 2NZXA 2OK8A 3B3GA 3QIAA 3R6TA 2V9ZA 1LQUA 1AGNA 2RH9B 3KV3O 1XQVA 1GCGA 4W4TA 4XJSA 3RVOA 1ZVMA 3VU0A 2EP5A 2QX9A 1IY8A 2NT3A 3AW8A 1YB5A 3K0KA 3PA8A 2K2WA 1EEHA 4GBGA 2G9ZA 3DE7X 4LYFA 2XWPA 4AMGA 1Y9ZA 2C07A 5DZSA 4DLLA 4EBBA 5C32A 3JD1A 1LDGA 3RRNA 4J7AA 1P5ZB 1F4LA 3D59A 1PEDA 4MPPA 4D9EA 1FJXA 1Z28A 3LVRE 1X38A 2AGVA 2MSLA 4DLVA 3I83A 1GCIA 4DVJA 2JRCA 3D8RA 4MKGA 2PV0A 5TQ0B 3I39X 1VIYA 2UAGA 4EG0A 1X1DA 3ASVA 1FTNA 1FUYB 2X6TA 1QSGA 2GAFA 1T34A 4L8VA 1XMQB 3N8DA 5AXCA 3VYWA 2WZCA 5C8ZA 1T2DA 3TIIA 4ADSG 5EFZA 1TKAA 5KIAA 1WP4A 3G0GA 1AX9A 2GAOA 2UZ1A 3O47A 4LVUA 3JS5A 4QDUA 4Q19A 1HNZB 1FA9A 2A9FA 1TTTA 2HF9A 2NLOA 4WZBA 1DKPA 3TXAA 3ZU5A 4MS4B 4Z1MD 1IWPB 2C96A 4LISA 3MBIA 2PZLA 3QZUA 4TKLA 2NZVG 3KLNA 4N8SA 2X0JA 3P0EA 4RLQA 4Y98A 4Z5XA 2OXFA 2PYDA 1GTG1 3ES9A 2RAPA 2QM7A 1WPQA 5CDUA 2PS9A 5KI6A 5EHZA 3RIYA 1Q0UA 3U80A 3FIUA 4GX1A 1T8TA 4OUKX 1NAIA 3N5CA 4MLPA 2ZS9A 3HA5A 4Q3CA 3RROA 4L57A 3GVXA 4PAMA 1PNOA 1Y4DE 4OL0A 4PC1A 3DJYA 3QLVA 4OOFA 3MFYA 3THYB 1WCIA 1S3IA 4YYZA 4FFDA 3A9VA 2A9OA 4LUCA 2IEIA 3CRMA 4X6YA 4YP6A 3WJAA 4CPDA 1L8OA 2YMLA 1KH1A 4PLZA 4PGMA 3BDAA 1NMZA 1VCHA 4L51A 1OFVA 4J7CA 4R8SA 1DJQA 5AKGA 5TC4A 5IBCA 2HSJA 2IW3A 3COZA 2A0KA 2O23A 3OU2A 3GARA 4RD0A 2E5LB 3GOQA 4CLEA 1X1BA 2HYDA 3HL4A 3L7KA 4NJMA 1E6LA 2QAGA 2RJ3A 2XITA 5IVDA 1B8OA 3CUYA 3DCYA 3FAKA 3WMFA 3B12A 2HIAA 5CNJA 1GQQA 1NNUA 5LC1A 1CFJA 4U4AA 1UEJA 4I8IA 4Q03A 2VSQA 4FFRA 1QP7A 1MOSA 4Q3AA 3LT4A 2QZSA 5E3IA 4B3CA 4TV9A 4Q48A 3ZDCA 3ZBTA 3L7YA 1KEWA 1ZJYA 3OLCX 1KSGA 4B84A 5DNUA 2FXVA 3O4FA 4D44A 3OFKA 5EE3A 5KNBA 2LZ0A 1FDSA 1CS0A 5I01A 1R5BA 3ID6C 2PPVA 4TTTS 4RF3A 4I3HA 5CCXA 1LPAB 2JEZA 2VA8A 3NTQA 3K2EA 3U7JA 3WK4A 4DRZA 1EQUA 1XJWA 3A25A 2ZJ1A 2X8AA 4QU8A 4P3OA 3I3SR 3RRFA 3NDPA 4K6HA 3CEHA 4I5DA 4EG3A 1D9XA 4PFJA 4EJSC 1BXZA 3PQ5A 4C1NA 2XBMA 2QS9A 5A6SB 4AL4A 3OLXA 5KO2A 3NM5A 2HY7A 5IASA 2O14A 4Y2JA 3FGZA 1P3JA 1EVKA 1NVAA 4RD1A 1XVIA 2CNBA 3NVAA 1JYEA 3IX7A 1GGVA 3JVUA 1KOJA 3PDHA 4WK6A 2DFDA 3U3XA 4ZPJA 3G88A 4D4KA 4FMDB 1TFUA 1RPZA 1SIBE 2CVFA 2GJ8A 2PS3A 3O1HB 4N5IX 3P94A 1C7RA 3K5HA 2DJ5A 4RTNA 1M1ZA 3WK8A 1KKMA 3R75A 4EA7A 1UC4B 1YDFA 2BMWA 4EKEA 4DG8A 2JIQA 1SKBA 3DW3X 4RF4A 4WSOA 2XBLA 4OHPA 4A92A 2QRPA 4BLWA 2HCBA 4ZD6A 4A8JC 3OTOB 1C0LA 4X3PA 1KRHA 1L5OA 4BMXA 3H5OA 3QE4A 2NP6A 1YJ5A 2REXB 3WBFA 1Q15A 5BN4A 1BWRA 3OZ7A 1VE7A 3G59A 1MRZA 3BBLA 1VLMA 3BX1A 5B1DA 3LL4A 1Y5IA 4UUQA 5P8WA 2I8AA 2KHZA 3C6YA 3FZYA 4RZUA 4TVKA 2P6MA 1L4UA 3DP7A 3LUKA 1FSZA 4QUHA 1UUFA 3U17A 2OV2A 5KWSA 1YU9A 4GP6A 1IH8A 2GD1O 3G5AA 4JFAA 2I4RA 4NXNB 1D2EA 1R1DA 4C5CA 2WAOA 4RWZA 2CUTA 3AUXA 3E3OA 2Y0CA 1TT5A 2PFSA 2W2TA 1NVMB 2Y1EA 4HXGA 2VTBA 5F51A 1KGSA 1AF7A 2YS7A 3WDMA 3WLEA 5JPIA 5D7NA 1RZVA 4EG7A 3LX4A 4OHCA 1AMNA 3W79A 3HKCA 3BFXA 2J7PA 4NWIA 2QLLA 5BMOA 5CFOA 1FRVA 2FRDC 2ZT8A 2PH7A 3P2JA 2PUCA 3B3AA 1RPTA 2FSVC 4JXJA 2F62A 4TZ6A 3PZBA 4GI7A 4GZ3A 2W2KA 3ITKA 3NV9A 4TKVB 2AN1A 4ZXPA 1XB2A 4WTOA 3S4YA 2HQSA 2Q3FA 1UWKA 3MIZA 5JSZA 5L51A 4YWJA 5GPBA 4B8ZA 5TVKA 3X1KA 5C35A 3ZVNA 2R48A 5LBUA 1DHTA 3HYSA 4MYHA 1DNPA 4XLZA 5CDGA 3WIOA 3TLGB 2ORIA 2H57A 2O7RA 3STYA 2QE7A 2O8BB 2B5WA 1T15A 4ZT6A 2HWUA 5HILA 2AHOA 5J5AA 3CF2A 1E2HA 1K5HA 2BM0A 5E7QA 2EOAA 4YJ3A 3UAWA 3DAFA 5ABPA 1JPUA 3WLHA 3IDSA 3SLGA 1U2QA 3SM9A 1G20E 3G5MA 1CRZA 1FS4A 5DLYA 2OKCA 1R18A 2WIAA 1NVGA 5ALIA 5EGNA 4LSWA 4F4CA 3G3EA 2V4UA 3L7NA 4RHXA 1R9MA 3RC3A 1IG3A 2ZUUA 1ECBA 1F48A 1OLXA 2PLNA 1WKCA 2Q7DA 3I8OA 3CIFA 3FUXA 3KLOA 2W43A 4UM9D 2WVAA 5K3FB 4G81A 2AG1A 5AJHA 2XTMA 1Z4MA 3NC4A 4NENA 3M6WA 2GM9A 1N1DA 4BC0A 1GTRA 1JIQA 1IPEA 1ZNYA 3BRSA 1RWOA 2EFGA 5CAEA 5HYVA 3DDNA 3ESBA 2R751 2E48A 4JI6B 1FFGA 2ZRGA 1RABA 4HHEA 4KDFA 4M9SA 4RFSA 5AESA 2YJTD 3THSA 1HTTA 1J2TA 1YQTA 1CY8A 4RD2A 3WMXA 4L8YA 4YLEA 4YQFA 3QG1A 3PF8A 5CM9C 1RTKA 4CWAA 1VG8A 3JQBC 1OYYA 4LNAA 3FJ1A 4EVIA 4NLLA 3CO0S 4L3VA 4QEKA 1PDWA 5LP6F 1IULA 3M6LA 1XDWA 2PY6A 4B8YA 1WF3A 4R1PA 1RP7A 2L2QA 4K87A 1EFKA 5HGJA 1W36B 3KFVA 4IWNA 4DR2B 4LF7B 4BJ6A 4OXIA 1AB6A 5BWMA 1BKYA 2H2WA 5ALTA 3VR2D 1EU1A 2WVHA 1AIPA 3CBGA 2UU9B 3O8CA 3H9JA 3SF8B 2SNIE 4L9SA 4QREA 1MIOB 4FHEA 4WZAE 3LDFA 3N0XA 4JYMA 4O3FA 1TCCA 4EFNA 5TEVA 1XTSA 5J4LA 1RM4A 1P4RA 4RHFA 5C8YA 1Y3BE 1BW9A 4GYWA 5BO5A 2VTKA 1Y3CE 1IN6A 2B5VA 1Q1BA 2QLMA 3PQ7A 4UU0A 4O2AB 5AK3A 2JC3A 1I01A 1DDGA 3EUFA 3KDSE 1XI2A 1J9ZA 1E9CA 1RC1A 2J3KA 3OEWA 4GR4A 2B8NA 1QK4A 2EL7A 1OZHA 2GPBA 5HUHA 2G0AA 3OSZA 3ND8A 4HFJA 4LJYA 1JRLA 1YU6A 2E21A 4AG6A 2LKCA 1B14A 4EPWA 3FPLA 3NFRA 2PZAA 3OC0A 1RYMA 1ADCA 2HNKA 1U02A 2ZUVA 1L5RA 4LG1A 3NYIA 4IZ6A 3WYNA 3B13B 4MB6A 4YPOA 1WMSA 3P4YA 2ZYAA 2R9VA 3P2EA 1I7LA 1VPEA 2BGMA 3LPLA 4AZVA 4MWOA 3TGLA 3EXHC 4AYWA 1WB5A 4TV9F 3MMSA 4UEOA 2G5TA 3FWYA 1VECA 1ESCA 5LMCA 4NQZA 1C1YA 5AOBA 1P31A 2QJFA 3LPMA 4MGIR 3SPXA 5D6OA 5K6TA 1T0IA 3OTGA 4GPBA 5EKTA 4EPVA 5JAPA 3QVSA 1ST3A 1FUKA 1FNSA 1H5NA 2JA2A 1KNXA 1RJWA 3OPYB 4PNPA 4PPFA 5CB8A 1H94A 4RACA 5HF8A 1M2GA 1Y1PA 3V8PA 5DN6A 6REQA 5CFZA 2Q2NA 4S0ZA 2FZKA 2Q6KA 3JARA 2Q9BA 2NVUB 3R20A 4R1MA 4DLPA 4RPIA 2REBA 3KT8A 1UJ5A 4UBOA 1UXOA 4ML3A 2AMYA 1SC3A 3PFKA 2WIDA 2ZI6A 1IHYA 1TGYA 2NU7A 4HWSA 4J0JA 4OI1A 4XPIA 3TMYA 5I7OA 2R7KA 3LX6A 2GUWA 4TLEA 2QSYA 1H93A 1JW9B 3HJTA 2PU5A 2J3MA 3HV0A 2X4GA 1VL1A 4INAA 2YDXA 1WUIS 1S8NA 2HRDA 1PFQA 3KC2A 2OHJA 3SNHA 2DKFA 4S12A 4EI2A 2HW8A 2IU3A 2VJDA 4LWZA 2LTAA 3FMOB 2XA2A 3PPVA 1QH8A 4GXRA 3IJ5A 4IEFB 4NOMA 4EA8A 2O8BA 1CDDA 1GFSA 4GAEA 3C3WA 1TUBA 2DFKB 2NTEA 3GFFA 5L3SB 2LXNA 4YI3A 1JI3A 1UBCA 1PX0A 5JVDA 2ST1A 5E6SA 3A1VA 1E9VA 4JDUA 1H2YA 1YRAA 2ZYUX 3K53A 4IDEA 4DRYA 1SU6A 4NARA 2H1FA 1F06A 1D2RA 4PZPA 4EPTA 2IP1A 1VLLA 3L8ZA 4WY8A 1YDMA 1P1BA 1KQOA 4DF3A 4UEKA 5MN4A 1Z47A 1S2MA 1QH1A 1ZP6A 4OXXA 3WLOA 3NHBA 3K2QA 4PG8A 4GH5A 2DY0A 3C4VA 5AJTA 5DH9A 2HQBA 3ZTTA 4A2QA 2RHOA 8LDHA 4JH0A 4BCDA 5K0EA 2XT9A 4Q3NA 1N2IA 3CMCO 5TB5A 3C3YA 3K0AB 3AB8A 3DKIA 1NNLA 1EX1A 1FLVA 3T5BA 1P7YA 3WL8A 1F20A 1R12A 3F47A 3F8WA 4GZ5A 2ASVA 4HNAA 4K9LA 4N6GA 2GPWA 2V58A 3BGWA 3E05A 4BBJA 4BZZA 1LSUA 1KEKA 4WPGA 1ODTC 1Y8QA 3EZFA 4ZARA 4DMRA 1DT5A 1K6MA 3O91A 4M0FA 3OIGA 4X1OA 4ZU6X 1RM0A 4KL8S 4PQFA 4W5NA 4OB8A 3W8EA 4KMSA 4D8XA 4QBFA 1H4VB 1FFCA 2PLAA 4RV5A 3SR0A 1C81A 4YAOA 3SSNA 4HVLA 2DLNA 5EHXA 1CEQA 2JFNA 4MQ5A 2KQUA 4N6OA 2QW8A 4JI4B 1SXJC 4KKXB 4IICA 1K0FA 1VGVA 5EN4A 1QYRA 4NP6A 4ECEA 1CUCA 4C22A 2N1MA 5HTKA 4P0TA 1GYRA 3R0IA 3IHKA 2NTVA 2WJIA 3BE4A 3RU3A 1SOWA 3LBHA 4RJLA 3I37X 3ZE2B 3ZGXA 1FYDA 1DJMA 4LJSA 4RDCA 1YBHA 3PXDA 4RGQA 3OD5A 4MCHA 1X1CA 2EC5A 2JATA 2KM1A 2PBFA 1P60A 2PLWA 1L4KA 3BOSA 1L5LA 1P19A 4UE3S 5JYBA 5IDQA 4MYSA 3FR7A 4LSMA 2HIHA 1MVLA 3G0HA 3EVBA 4PXYA 4NBSA 1VDZA 5FX2A 4OQNA 1WZIA 1P6QA 4HH3C 4UVGA 3SIPA 4LMBA 4X3OA 1F2UA 4TRJA 4MV5A 4KPFC 3NWPA 4PX3A 4HADA 1AUVA 1NSFA 1QGED 5CH5A 4B3SB 1XL0A 1CZNA 2FQ1A 4FEAA 4TRNA 4V24A 1JG1A 3EQ2A 2BMFA 3EK2A 4G0WA 3FRHA 1JG4A 4N03A 3SHVA 3LI2A 1CW2B 2VTDA 3G0DA 2WFAA 1FFBA 1S5PA 2MTBA 3GIWA 1QORA 4LDAA 4AMBA 2PEZA 5C8VA 2BFEB 5JW6A 2IHBA 3LC0A 2I8CA 3O8LA 4EHNA 5IDVA 1UMBA 4ETNA 4G0OA 2XQKA 4ZREA 4UHEA 3GP3A 4F12A 4BPBA 3CTPA 2GF2A 3U3OA 5HZKA 4BNVA 1U7DA 3HYRA 5LKRA 1WY7A 1M73E 1N8TA 3BM5A 3PRKE 4RH1A 2GTIA 1QLHA 1QFJA 4H1HA 2J4CA 1QKKA 4UZSA 3FKJA 2O1EA 4B46A 2EFEB 6CHYA 4GOKA 2R6HA 1VBNA 1DKRA 1PBTA 1WEHA 2YWRA 2Q3MA 3K7EA 4I9HA 3BSWA 2ONKA 1N7GA 4KE7A 3X1XA 5BORA 5IKEA 3GZNA 4C7OB 4IDOA 4EPRA 1JKXA 3G5UA 1NBWB 4MIOA 4RK6A 3UHOA 3D4PA 3IDAA 4I99A 4NS1A 1QTQA 3LOPA 4LQ4A 3QELB 2IFTA 1XAHA 1J2JA 2CWDA 5HCUA 4O02B 5GV7A 4ENUA 5HXAA 4BQPA 3GC6A 1EFPA 4DIUA 4E46A 1M2FA 3X1WA 2C94A 2NUAA 1DOZA 1S7GA 1PZMA 3GB9A 5IK2D 1NVEA 4H16A 3NKLA 4HS4A 1ZM3A 1YL6A 4K81B 5HOQA 4YJKA 1NM5C 5TMEA 1B0AA 2WMDA 3EJ6A 4DABA 3M1YA 3ZE0B 4F6RA 2EJVA 1F8GA 4EJMA 2Y6VA 3MTAA 4GR9A 1YL7A 4U7TB 4XSHA 3H9QA 1O6GA 5TE9A 3EG5A 1SVSA 4BJ1A 4ARZB 4CL3A 2ODWA 2QRLA 4MV6A 1QPZA 3KPUA 1TEVA 1C0KA 1TPZA 2VDRB 4L8LA 1NA5A 3ZGVA 3RYTC 1PG2A 1F9AA 3KAPA 4LDNA 1A50B 4ZCRA 5IAAA 3GXOA 4DCOA 2QTFA 2DFPA 1UBEA 1TUGA 3QVGB 4QGGA 3S28A 1X9HA 5IVPA 2JS7A 4GT1A 3EVAA 3ISVA 3P0RA 1XRLA 5CDSA 4F85A 3O3MB 3L5OA 4ZAFA 3HEBA 2P90A 4R8RA 1WBBA 2ONYA 5FL7A 3FTFA 1GTSA 4OQXA 2NADA 2I9KA 2D00A 3C7TA 3LVFO 3VPHA 1ISPA 1DC6A 2D7CA 3EBLA 1V4VA 5EKUA 4C03A 1ZI6A 1E0AA 3LDUA 2ZETA 2H1OA 4N8DA 2GF0A 4MRSA 2VHXA 2X15A 3MCAA 2FQQA 4MMXB 1CF2O 1W4ZA 5KU7A 3VXKA 4KN6A 2WQ6A 3ZWOA 4I3FA 1OXXK 2PZJA 1IFXA 3DT6A 3KDPA 5JJKA 3DOEA 3GL9A 4DNOA 1PQPA 1NPYA 2JGDB 2VK1A 4R68A 3SZRA 1ZXLA 2FFQA 1WQ1R 1ZAKA 2HIGA 2IZ0A 3SK0A 2YHIA 4MKZA 4L95C 2VP0A 4OK3A 3W2FA 4OQ4A 2FPGB 1MEEA 4AXXA 1ECCA 1R0WA 5J2TF 4CKEA 5TIIA 4G23A 1NXOA 5AXDA 1N0WA 2CUZA 1OREA 2D7JA 3WLRA 1HNXB 3WLSA 5C1PA 1QFYA 3V55A 3A05A 3EMBA 2VQFB 3JQRA 3ONVA 2EJCA 1H8HA 2ANCA 3LGAA 4WBNB 3UOWA 1UDAA 4DQKA 4QO7A 4P3PA 4U6SA 2IWRA 3TLGA 1R00A 4Y2GA 2G71A 3SZUA 2XYQA 2NV6A 3MELA 2CLMB 3ANNA 2VOEA 3VSDA 2OGWA 2X1LA 1TLTA 5BN3A 3L4JA 1NVBA 1X8LA 3I2FA 1SUWA 1I0IA 1TF5A 3P2KA 3QE2A 1IXYA 4B2YA 2XKAA 1B2RA 3O3NB 4TV8A 2FOXA 3IFSA 5JUWA 5DBIA 3U13A 5DBHX 4G0XA 5E0OA 2HEIA 4QDTA 2DU8A 2JVIA 3QFFA 4OH7A 5BY2A 3AVVA 4ZN6A 3TD9A 4NBTA 1CQIB 2BV3A 4KR3A 1VSTA 3BK7A 3X1MA 3CW9A 2BR3A 4X93A 5EWMA 1UIRA 1W8IA 3HFJA 4WUVA 4NFYA 2VRBA 1TADA 3PXBA 3F3MA 4W6QA 3PUWA 5B7PA 1I6WA 1GSOA 3VZSA 4ILKA 2FWAA 2X0IA 1L7MA 3HXQA 3IKLA 1E3IA 4XIYA 3LFUA 2CFCA 2C4HA 1FNMA 1XROA 2BI8A 4KWEA 1IVSA 3UA3A 3I2HA 1AY0A 3DGFC 4HWOA 3H1FA 4O4IF 4CM5A 1BFKA 4RCVA 4S1NA 1Y9EA 4IBOA 4QNRA 1B15A 4RVCA 4UDOA 2I4NA 4URFA 3ZY4A 2I7XA 3PJDA 5A5FA 4GPZA 3MJVA 3CRZA 3RUCA 3RC1A 1Z83A 1PU2A 3SBEA 3ASUA 5I7EA 5C7LO 4I1UA 1NV9A 4R8MA 3WQBA 1EFVA 5JROA 1OI4A 1ZIDA 2FCAA 4WA8A 1HYBA 4W1SA 4ASUD 1XZPA 4H0CA 3VR5A 2GBCA 2FEPA 3MGGA 1B42A 1BWSA 1JFFA 2FXIA 1Z2EA 1NM5A 1VBKA 4H18A 4HQRA 4PSVA 5CTJA 1M2OA 4U2KA 4PAWA 4R2LA 4DWWA 4BZXA 5G0UA 1BHO1 2O7VA 2Z3WA 1P1JA 3UJAA 4PRYA 4OQQA 1VKRA 4UJ5A 1H8ED 1YA4A 4TKVA 1PJLA 4Q9JA 3PDJA 3DV0B 3JQCA 4G4IA 4S0XA 4BGDA 3PUYA 3KT6A 3WGOA 4DG5A 2ATVA 2R0QC 1IBLB 3WDLA 5JLJA 1BCSA 2Q4DA 3B53X 3TOCA 1K8QA 1PAUA 4EY7A 3TUZC 3J81k 2VWQA 5FNZA 2HUPA 1FYEA 2OLEA 1WDLA 2BFPA 2C42A 3O9MA 4RS4A 4MKXA 4TLLB 4LTDA 2DECA 1MJFA 5KYKA 1GGHA 1IHUA 1NUQA 1RQLA 2H5JA 2QZJA 1OKKD 1P9WA 1YQWA 3OWXA 4Y30A 4CI9A 5IG2A 4OG2A 5CW2A 5KYNA 2JAPA 4D0RA 1SIWA 1J5PA 3LLCA 3KO8A 2IKQA 5DNYB 3AUTA 2EWMA 3UK1A 1E79A 3JARB 1LBIA 4DZZA 2W6OA 3CT6A 4TSFD 1SOUA 1KK3A 3JRXA 3QX8A 2YC4C 4LGYA 3AH8A 4JCCA 3DDUA 3HUTA 4JGBA 1E5LA 2WWTA 5B3LA 1I24A 1KMHB 3PP8A 5ALJA 2ETXA 2Y67A 3CW8X 4C0WA 2XVYA 3KK0A 2QG6A 3INTA 1KMNA 3OQHA 5DULA 3ANXA 4ZCPA 1YE5A 2OUIA 1L5HA 5LQUA 4MNTA 1TKRA 5G3YA 4BNYA 4Y2VA 4BNWA 3H5VA 3HCWA 1SVKA 4X7RA 4FT2A 3KUDA 4R84A 1FUEA 2CHUA 1PZFA 3ZJ4A 5K8IA 3H3XA 1WSBA 1V6AA 1NDUA 2EKBA 2EZ8A 4HAIA 4BVFA 2V65A 4IJUA 4FNGA 1LLQA 2YOGA 4W99A 3K5PA 3SC2B 3QSYA 3TKYA 2X76A 3DD5A 2QV0A 3N8GA 2EFHB 3K9HA 3PNYA 3CG4A 4GSKA 4JBWA 5IN4A 1JNYA 4DLSA 4UM9B 4C1BA 1H2FA 3NYWA 2PJZA 1UC8A 3LUPA 1YA8A 4JOBA 4UEQA 2YWFA 2XJ4A 4RUKA 1MT3A 1Y8CA 4M1TA 4W5HA 1D5WA 4D99A 3E7XA 1VE1A 3VTKA 1BMDA 4UQOA 3QOXA 3R9XB 4K9OA 4MWSA 1E62A 4B3IA 1XYVA 1DMRA 3S5UA 3KKLA 4J1NA 2D4HA 2ZQ5A 3UM9A 3E5NA 5LB4A 1Y3IA 3UOAB 3URKA 2HI0A 2PMKA 2QUJA 4DNFA 4WFIA 3ACCA 3EQ9A 4I50F 2Q1SA 4HPWA 1RLUA 1UXHA 3C15C 1MA0A 3GJ8A 1CUSA 2J9XB 1OU4A 3KTAA 5REQA 1NQWA 5JFGA 1C0IA 2C4TA 4ZGBA 2V7GA 3VR4A 1FP6A 1WTAA 4P4NA 4TYWA 1RM5A 2IDJA 2KW5A 3FSEA 1P0IA 2YY6A 5E2AA 2OCDA 3FI0A 1NZJA 3M6XA 3TGWA 4YMLA 3CZQA 2GZDA 3DCIA 3RUFA 3WGIA 2DEUA 4UXJA 4I2NA 1YJQA 3IHLA 2MU1A 4CM1A 4CKCB 1U1DA 1QQ6A 2VJBA 4IHJF 5DRTA 4WZZA 5DX1A 2W6ZA 1YS1X 1ZGCA 1AK9A 1PHRA 3DTTA 4MYRA 1G21B 2WU0A 3DFKA 4A16A 5CBPA 1NYTA 2F1JA 4ZPXA 1ZH6A 4DJEC 3ST7A 1UDCA 2VUIB 2GI4A 5EIOA 1KYVA 3R09A 1ZMRA 1AQYA 1P29A 4MWZA 5ALPA 4G6ZA 2QT0A 1GKYA 1CLUA 3L7IA 1VJTA 1ZUNB 3AVPA 4U3JB 4E5KA 3BGOS 3ND6A 2F1HA 1EFVB 3W3AH 3GP5A 1W4BA 4X41A 3VU9B 4B4VA 4C0XA 3CF0A 2YFQA 3OKFA 4IHQA 3TI7A 4K0KB 1UKZA 5EUMA 4HB3A 1RT9A 5T57A 2O5EA 3I09A 4FQ5A 5C7IO 4MQEB 5FUXA 1C1XB 3K70B 1U0RA 3FG9A 3IO3A 1ESDA 5HFAA 1YBFA 3AY3A 2DFTA 1MN6A 3FPFA 3M2TA 2CDBA 3KVVA 5DE3A 2DR2A 1EWVA 1NUPA 4MTCA 5ALUA 2W2XA 1ZSNA 5H59A 3ZHBA 2XHZA 1F17A 1JX6A 3Q6NA 3VKHA 1XDSA 2Y27A 4OK6A 4PYKA 1GSIA 1W6UA 1XJ5A 1U94A 3RAPR 1XDZA 3FR8A 4RLHA 5L4NA 2V0GA 2NYVA 1J21A 3ZBQA 5LQJA 3OUZA 2B4TO 4QDXA 2IYQA 3FD8A 1KO5A 2QVXX 2VDKB 3KZCA 2QTAA 2OZPA 2ZBEA 4HC4A 5CDFA 1TZKA 4HSEA 3BFVA 4MQLA 4M60A 4EUHA 1OWMA 2V1UA 1FDIA 5YASA 4V0LA 4AG5A 1JIXA 1XMPA 3GDFA 4BKRA 5C9ZA 3CLVA 4UUPA 2UZ1B 3WQRA 4XJXA 3LUDA 3LUBA 3RTAA 4BEWA 1TX4B 3U3KA 4EQ6B 3K15A 5G0VA 4FYJA 3ZTWA 2VP4A 3A9SA 4KLNA 4ZYZA 1FSGA 5JQGA 2OC4A 2G04A 1DTSA 4IRXA 4FIDA 1B6SA 2ZSDA 4FSDA 4R1OA 1XCBA 3PUIA 3A9WA 3V97A 1CJKC 2BF4A 4MR8A 3QVOA 4YJFA 2X6QA 2GEDA 5CB4B 3PR2B 3IEVA 3UY4A 4HS9A 2E1PA 1QFXA 1U8UA 2ZSFA 5ICGA 1H6BA 3D3WA 1A9ZA 1WZ2A 2W6QA 4ITVA 4PPQA 3ETDA 1AHIA 3HBNA 2IYEA 5K03A 4CEJB 2NTNA 3KIPA 3RVRA 3LQKA 1UM8A 1C9DB 2A4KA 3I8SA 4JWKA 1E3SA 2VAVA 4IDCA 2CLIB 1UBSB 4ZOQI 3MB5A 4L2IB 5TMDA 2CEKA 3GNSA 4O2AA 4KIGA 2OBLA 2OILA 2COKA 3KSRA 4FHFA 3O4JA 4HH0A 1P4HA 2QORA 1KYWA 3LRXA 1XEWY 1PJ2A 2Y0BA 1ZNZA 2FAXA 2P7IA 4X1KB 4LDZA 1ZITA 3I76A 2RI6A 1U2GA 3T1VA 4BX8A 1YUBA 3CLHA 3AWIA 2AV6A 3NOVA 3CE6A 1OV6A 3PNOA 4RMJA 4X8OA 5DX8A 5J63A 5B2FA 4L15A 1JH9A 1B6RA 5JOQA 4KK4A 4LHSA 3BJEA 2D5IA 4WGFA 2AD1A 1MB4A 2Y9PB 2PR2A 4GEGA 3W5CA 1M7HA 4FR5A 4CDNA 1GG5A 4JLSA 4NDNE 4P5PA 1E9FA 1Y80A 2W58A 3OX1A 4DYDA 5J2TA 4B82A 1CP3A 5BN1A 4RTMA 4G5YA 3JW8A 3AF0A 4KR6A 1ZICA 2V59A 2M98A 1UM9B 3LZ6A 3TAXA 5BR7A 5LNK1 1OH8A 1J00A 1VZ2A 1Z88A 4YHHB 3ZCVA 5H3HA 4M53A 1A97A 3ANMA 3ZE7A 4I9UA 1ZC3A 2J3EA 4J0DA 3ENZA 4PICA 2GBLA 1ADYA 1Z2PX 3WNZA 2G4VA 1X7ZA 4ER5A 1XPRA 2D13A 2A1UA 1C4WA 5FI0B 1XIVA 3OJLA 1N2HA 2AXEA 3LT5A 4BEVA 4EZBA 4JASB 2H4FA 5FWXB 2HOQA 3SP1A 2HWYA 4RQAA 3UJBA 1XQWA 4V1CI 1E6WA 5EP1A 3HKBA 1EHIA 1FTGA 3OQIA 1CRQA 1F2UB 3JQEA 1Q74A 3PHJA 5U9CA 1ODCA 1NJ6A 1RWMA 4FWBA 2BSXA 4UEJA 2RCYA 3SEZA 1IJFA 4DCNA 1KRXA 2N3ZA 1OCEA 3KPYA 5KWVA 5JALA 3K1AA 5DM2A 1DADA 1JXAA 3DZIA 2UVQA 5AW9A 4PV7A 2FUNB 3DE5X 3GUZA 1KYQA 2HHLA 3EA5A 3RHZA 2GM3A 2A92A 3LHDA 4NI5A 3FLEA 4R05A 1UPFA 4UC0A 4B31A 2IYOA 4D92A 3COWA 4DC0A 4EHHA 5K0GA 1DXHA 4JWTA 4Q9IA 1F0YA 2PGNA 3VU9A 2ZUSA 3T9BA 2YUIA 2FR1A 1L5SA 2ERCA 4JLBA 4U3JA 4Z9FA 1MV8A 4ZI7B 2G8NA 5EWMB 3ZOKA 4TLDA 5JVDB 4MLZA 1KEEA 3K6JA 1XSEA 3H13A 5KTYA 1DJLA 2FFRA 1NIPA 3GJ0A 5G40A 5I9NA 3MT8A 2BHSA 1MO3A 4TMXA 2L82A 2G6TA 3V34A 1OXMA 2JFXA 3R0QA 4AN1A 1HY3A 4HV4A 3OSUA 2M1XA 4Z2AA 4IFTA 3SX4A 1R6UA 2TMDA 1ICEA 4ZT2A 2H2HA 4LXGA 1FSSA 2PZBA 4LN1A 1V2HE 2XXAA 2XTAA 3RR2A 4LX8A 3PDWA 1CSEE 2BI7A 3OLYA 4BO2A 4JI1B 4XYBA 1T3ZA 3IBCA 1PJTA 2EF0A 2LBPA 4WA7A 4HQLA 1UXKA 4QD3A 1KBOA 1RWWA 1OVGA 2NG1A 1AXEA 3PFCA 1U28A 1T29A 1N6LA 4EJSA 4CL2A 1UOOA 5I51A 4ZIRB 2NQTA 4JT2A 1XTTA 1E2IA 3A3PA 3ISTA 5KJ1A 1V6SA 1BOFA 2RC6A 3WLFA 5IABA 1VYVA 2QDKA 1U2DC 4HBZA 4JMPA 2IL1A 1VSBA 2W8BA 5AM1A 5CDHA 4BLUA 2CDNA 3TN7A 4BV9A 3VYSB 2G7ZA 3L8MA 5F3WB 3AKZA 3KZMA 4HEHA 5BR4A 5KTRA 1YUMA 2NO4A 1YVUA 1ZESA 2HGZA 5DT2A 2QPLA 2YWEA 1Z08A 3QLUC 5JHHB 4RMNA 3NC0C 1TT7A 5I9LA 3F46A 3EASA 5ILQA 3QUQA 3TZLA 3UWKA 1LW7A 2P2GA 1U8FO 3AIIA 3BXZA 3JVIA 2CWWA 3HCNA 2ZRQA 2Y0PA 3K71B 2XMCA 2AMFA 2KE5A 4RELA 4BGUA 2YWJA 3VPBA 1VSQA 5DXJA 1M3SA 1W5EA 1YVEI 3IR6A 1GKIA 4PC3A 4PYIA 4ARVA 3SEAA 2H1LA 1CRLA 2AYYA 2QP9X 5DDIP 4C4AA 3TGPA 3EXEA 2ROQA 3BL6A 3EUWA 1BNCA 3F6EX 3SVTA 4YMVA 1PL6A 1WCV1 1X9IA 1Q3KA 1IIBA 5EQJB 5BT8A 5HTOA 4IXNA 2WVGA 4AP5A 4ZJZA 3QYJA 3EGDB 4OHFA 4OX9Y 1CZHA 4C14A 3U7QB 2IJGX 1E4OA 1GVHA 2QENA 3QPBA 4Y2RA 4F5DA 3HZOA 1W73A 2GYVA 3WE7A 4NCNA 1I10A 2X77A 1V8DA 2HXGA 1F7VA 4XDYA 2V7QD 4I2VA 4JNKA 1H2BA 4KAJA 2ES4A 1II9A 4NJEB 5DP2A 4DUGD 4TUYA 2BHTA 5LD2C 1XMVA 1DEHA 3K3PA 1U9IA 1LDYA 2D5CA 2ZJZA 3TQIA 3TI9A 3K0HA 2H06A 1AE1A 3DG9A 3ZD8A 2Y05A 2FQWA 4MYTA 1GNQA 4Q1AA 4WN9A 1PZGA 4Q3OA 3DP9A 2YIMA 4TMYA 1UFQA 2AW5A 4Y6SA 2AN9A 3ABSB 1K3UB 1ZHHA 1CFZA 1P1KA 3NHWA 3DMHA 3IESA 3KR1A 1WKVA 3HNOA 3NLLA 3PFGA 1Z5NA 5B1SA 6AT1A 1ZJ4A 1KXJA 1JU9A 4E30A 4J4HA 2VZ8A 4PLGA 2PMFA 5CHEA 2OV3A 2OFFA 2AOWA 1FVFA 2B4AA 4ZQFA 5HE9A 1D2AA 2ZU0C 4R40A 2IYAA 4Z2YA 1YMQA 1TYCA 4RK4A 3DR3A 4MW0A 1RYNA 1MXFA 1VA5A 5CUQA 4BX9A 4C78A 4HNTA 3F9IA 1NBMD 3MT9A 4JHLA 4PBRA 1DAEA 5TGZA 1EM6A 4TMTA 3GXBA 1O3YA 5DOVA 2PG3A 1PR5A 4N41A 1U7WA 4CG0A 1YACA 3SWWA 2F8SA 3NEPX 1T3HA 1GTJ1 4H9GA 2VHJA 4XA8A 3RT9A 2YN4A 1YRHA 4CUZA 1KQFA 1Z2NX 2GZ2A 4LJ8A 1F3OA 1Y3AA 1BA3A 2ENWA 2W6ID 3IAS6 4LNUB 2A0UA 4U7JA 3VAYA 5H8WA 2W70A 3B89A 3CLTC 3RBVA 2CXNA 4TZ0A 4KP7A 3JZDA 4RHUA 4YAUA 1QBGA 2CL6X 4DA4A 4BBZA 5H9VA 3OPYI 3ORYA 5JZOA 1FX1A 3F7NA 4RO0A 4HQKA 4N54A 2WPDD 1XA0A 4Y0VA 3VVLA 4A0RA 3P2IA 3ERCA 3Q7RA 5DYTA 1G291 2WTAA 4FTWA 4G5QA 2VJNA 2HK9A 3H2BA 4RE5A 4A3SA 5AHXA 4LSGA 2I0FA 4A91A 1IYZA 1MX1A 1AZLA 5A4KA 2J09A 1R10A 4KSBA 3N2EA 5CAEB 4KYTA 4TV8B 3A36A 4JBLA 4KQJA 1V39A 1RLTA 2BY4A 2BSAA 3MWEB 4FZRA 4NIMA 4JXXA 4FINA 2GDJA 1Z82A 1G21E 5HFNA 1Z75A 4LOJA 2YASA 5A71A 1N8SA 2PDAA 4HGPA 5IKOA 3VPAA 3L46A 3F78A 4XIJA 3GT3A 2QUIA 2II6A 1YQQA 3EGDA 3BSYA 3DZ8A 2EFYA 3ODPA 1X9GA 1RAIA 3WWYA 4C7VA 3GN1A 1I3CA 4YACA 2OMKA 2PTHA 3WSVA 4MO9A 4AB1A 1B7GO 4HT3B 3FCXA 4AJ4A 5LDHA 1X1SA 3QBDA 1AGPA 1ZDMA 3HGMA 4ENPA 4IJWA 1XZAA 4HYTA 2C03A 3C6BA 3DVAA 5ESXA 5FOQA 2XXAB 5JPCA 4P5EA 4GBMA 2PRIA 2X0RA 3H4MA 4YJGA 3VZBA 3KZXA 4DIBA 3T3NA 4BMCA 3K8YA 1MF7A 4QEZA 2FMUA 2VJOA 3R7AA 5HIKA 2CMGA 3AR8A 3BWYA 3F71A 5AW7A 4F6CA 3IPRA 4EFKA 2WHPB 1BE1A 1G8FA 4NCHA 5BYAA 3FKSD 5AI5A 3UQZA 5L45A 1HDRA 1MW9X 1RW4A 1JIVA 3N8IA 4HLDA 4M0UA 5G02A 1XAGA 4F4FA 5K6RA 3HUDA 2W8ZA 3R0VA 5J4HA 2O8VA 4GEKA 4BWFB 1AC5A 1U9JA 2FQYA 2XQJA 4WT7A 2EJTA 2IRWA 2FSFA 2KJQA 4LEIA 4O63O 1J20A 2JAWA 5F78A 2IZ1A 4ECAA 5B7QA 4Q66C 1QNLA 2AEJA 2W83A 3M8KA 4AJ2A 1DAPA 2ATXA 1PSWA 5ALHA 4BWGA 1Y1QA 3Q88A 1GVNB 5FULA 2HJHA 2I2CA 1JJ7A 3HNPA 1MABA 3H1GA 2NACA 1G59A 2O2JA 4EI9A 2C98A 4G1CA 4MPRA 4P3YA 2W42A 4UQPA 4AVYA 1OT3A 2ZE6A 2OCAA 5ANRB 4UTPA 5DGTA 1NOKA 1CXZA 2Q99A 4FZ5A 4K6KA 2XB6A 4MVJF 1HA3A 1NF9A 3BE5A 4K1XA 5K01A 1QZXA 2ZR0A 4JLNA 4LNHA 3DWEX 5GY7A 2VQDA 1MC4A 3AUYA 3TRKA 2R8YA 4DV1B 2PWAA 1IC6A 1Z73A 3T1QA 1G3QA 4DDKA 3FPJA 3OJOA 1WG8A 2IYUA 1X87A 2VOJA 3L6BA 2NXCA 2OMEA 4MGKR 3PQFA 5A4JA 1GFWA 4QUIA 3GJ5A 3TQCA 1EWKA 1YS4A 1EZ4A 1XQ1A 4I9NA 4IS2A 4TTRA 4L1KA 3LHSA 1JLLB 3NBAA 5EFOA 4J16A 3UUWA 4BRWA 3PGJA 1E7SA 1XLTC 1ZN8A 2QN6A 2YYYA 4FGWA 4XPZA 3VH1A 1N0UA 1Q14A 1R0LA 5LBIA 4LXIA 1ODIA 4TRMA 3ZX5A 1SVUA 1B0UA 1OUMA 2Z9CA 3X2SA 5LJIA 3OCJA 2YZ7A 3KHKA 3IUYA 1A76A 5JI3E 4CEHA 1JE0A 3LIPA 2REQB 5K0NA 3UJ6A 3ZHOA 5HCNA 4D57A 2ERXA 4Z3OA 4EA6A 4EL5A 1LI5A 3QK7A 4F4HA 1C14A 1PJZA 3KRTA 1UJMA 1RPNA 3HBJA 4F21A 5I5EA 1BJTA 2DUUA 2EV9A 1XCOA 3ACBA 3OWHA 5L9AA 2P5TB 3U3ZA 2O3RA 2Y2VA 3JR7A 5U4XA 1XHFA 2XUQA 4MDYA 4ZALA 2FJUA 4ZC8A 3EQ8A 1PVOA 3P5SA 3ZLTA 3SR4A 2C58A 3ZCQA 4H7DA 5K0TA 3QE0A 3HEMA 4IUYA 2GRUA 4AY5A 5LOVA 2F00A 2ZE7A 5FD8A 3M3DA 3ROXA 4UTRA 4RVFA 2A5YB 4G4JA 4WRRA 4BYMA 4HMPA 3IAM6 3DL0A 4BP1A 3WHLA 3M82A 1MCZA 1MFZA 2VHTA 4WW0A 4X6XA 5DEIA 3CZRA 4WZ6A 4A1FA 3MS7A 3AI2A 3VJRA 1H2EA 3EGCA 3MOGA 3CVXA 4UMVA 4Q9LA 4KLCA 2XTZA 4PG4A 4L0CA 4BLSA 3R7BA 2QLFA 2Z2ZA 5BNFA 3VAAA 4ZA2A 2QUKA 4RBNA 4OQYA 3NYQA 3W5DA 4Z4GA 5K3AA 3NJ8A 1PT9A 3D6VA 3IEUA 3UB2A 5DIZA 1SWWA 2KLBA 1E92A 1XTUA 3HGTA 2HQOA 1TD1A 3K8QA 4HAWA 4ZVTA 1EVYA 2I80A 2ODTX 3KOXA 1Y98A 1E77A 1AB5A 5FBHA 4WJLA 3E4CA 2BFFB 2L42A 1B93A 4HEQA 4NAVA 1PG0A 3EXG1 4JELA 2DHEA 5KNDD 2IOHA 2DQYA 4LYAA 2XUHA 1E6KA 1XVLA 5DX0A 3MTDA 4EFMA 2A35A 4R01A 1SUIA 3GW8A 1B8VA 4QSMA 4HNQA 1M6VB 3KG2A 4G1BA 4TXHA 3AG6A 4U02A 5I7AA 3SYLA 1E59A 4RYLA 3OHPA 1XEFA 3PIRA 1QFSA 2HLDA 4HWRA 4JC0A 1Q3TA 3T1YB 3PC8A 2O57A 1Z0SA 4MVWA 3PLNA 4JT9A 2O2IA 3WI7A 4BV2A 1OLXB 1RR6A 1JEJA 2CK3D 2I8LA 1DARA 2YZ2A 2D1SA 1CIVA 3AP1A 4MI9A 3N8HA 4WK2B 5I45A 3IB6A 1IZ9A 1HLPA 4ZXFA 4LOHA 1L5MA 4IDPA 4JP5A 4NRDA 1OFUX 4WZBE 4KE8A 4YJ3F 2OAEA 3MRVA 2G0TA 2Q4RA 3M4JA 4N65A 1OZGA 2GLUA 4LBZA 4JYCA 3VYTB 1VJRA 1EXDA 2A9JA 2Z09A 4IXWA 5AM4A 3ZNOA 1QDUA 3SJAA 1SHUX 3WLPA 5DN6D 1KK1A 4QU5A 4DSAA 1GDDA 5DTRA 2BMEA 2I6QA 1RXUA 3OBIA 3V4RA 5KKNB 3MJHA 4MW7A 3ZGNA 3L02A 2BMAA 2G9QA 3FVRA 3QH4A 3BTSA 4ZJUA 2BYTA 3OPXA 2J3IA 4YP1A 1PGPA 1DKMA 3W5AA 2W48A 3OUUA 1QHXA 4MRPA 3TNDA 4MYUA 1TUIA 4O3MA 4RS3A 3S1AA 3UMGA 2P4QA 1LRKA 4MO2A 3ESXA 1DJNA 1B73A 3HJHA 4Q34A 2ZSJA 2IS4A 4JCOA 1ZVKA 2FYTA 3D6HA 5ECGC 2AUTA 4Y1GA 3ZXUB 2O59A 2XE7A 3ED1A 2OBFA 3FGNA 4OFXA 4PF1A 3N58A 5JAUA 4BAGA 5IKXA 2YR0A 3PKIA 2IYFA 1HSZA 3TLCA 1PR3A 2V7UA 2ODBA 1I0LA 2IDZA 3EF3A 1E1CA 2BBTA 4Q15A 2R44A 4QBGB 4B3DA 2Z98A 3H8JA 2FI1A 2PHZA 2W9XA 1CR1A 3C39A 3NV7A 4MV0A 3IAEA 3SZOA 4EKIA 5ITWA 3O1IC 4HZGA 3LQQA 5F7ZA 4I7EA 3A0RB 4BATA 1K6XA 2Q7OE 3LSYA 3PIDA 1BROA 1WVMA 1XV5A 2WK1A 3PC7A 3QUAA 4CMEC 1JHZA 2AE1A 4CM4B 5D5HA 3LHFA 3N28A 1XFDA 5DW0A 5CFPA 1Q0LA 3K6KA 2IYSA 1FQKA 7MDHA 1LSJA 3GJRA 2E55A 3R40A 1Z5ZA 2EL9A 3HA2A 3HDVA 4W7IA 1M5UA 3BC1A 4J8PA 8OHMA 5KYXB 1F1JA 3RPEA 2GN4A 4JA2A 4OVKA 3L4KA 1OD6A 2DC1A 4KV9A 3AJRA 3L7BA 4W9NC 1GO2A 4RD4A 1MHTA 3PWSA 2VVTA 5HRAA 3NBFA 4J9UE 1YQEA 1NPTO 1VE3A 3NRBA 4N4AA 3K6SA 3RADC 2XX3A 4DUYB 2ZUWA 4DC9A 4TUYB 1VCOA 1PJCA 1IK6A 2QSZA 1DAIA 1E5QA 2YHSA 5I9TA 3OF3A 4G5GA 3SEFA 3RTDA 3QXGA 1ZC4A 2VHEA 1G6OA 3TW8A 1A27A 1T2VA 1X3SA 1S2DA 2CHGA 2JI6A 2ZYIA 1SCJA 3C8DA 2E87A 3KYIB 1PFKA 1W581 2NXWA 3BSFA 3NT4A 2IX9A 1X8XA 2Q9CA 4KUEA 4Q05A 1PTJA 4I8DA 2OORC 4XQEA 3WGGA 5C8YB 4GRDA 2RJOA 4KPGA 2B7LA 2FN3A 2CE7A 4RU1A 3U2QA 1WP9A 3R7NA 1SVLA 4Z4EA 1I2BA 1R6VA 4GM1A 4H6XA 4PIPA 2VF5X 1I1NA 3DBHA 4JEMA 3WL7A 1A9PA 2XNHA 3KETA 2QJRA 5G1OA 3S2IA 5CM2Z 2JH8A 4PCUA 5BN4B 4CT5A 1CS0B 5AVSA 2G1UA 2LCFA 3DLAA 4LXUA 4XTRA 5JMPA 2IIBA 5CH8A 3FBGA 3RSOA 4WFJA 5E1BA 2VRNA 3CR3C 1ND5A 1Z16A 1QIJA 4QOHA 4Y2QA 3K0FA 3NFYA 3PC4A 4CCAA 1CUAA 1SQ5A 2CMHA 1NQTA 5DJ5A 4S1VA 5KC8A 3TKAA 4XQ9A 2LD4A 1DKQA 2WTNA 3WNDA 4I46A 3L7OA 3PWKA 5G53C 2O2YA 5I7VA 4XFDA 3UAVA 2NPIA 1GPAA 3IMKA 2BJWA 1W4CA 1ZMBA 3FTQA 1HEYA 2H59A 3ZC3A 5HVNA 4PHHA 1O9HA 5JWRA 3QV1A 4QUKA 4JR1A 5L6LB 1O03A 2DFNA 2HWKA 2V03A 1FFAA 4OQPA 3KQOA 4PSKA 5AVTA 5DCYA 4UHBA 3NHZA 2HF2A 4TS9A 3RVQA 1QQBA 3JWIA 4DBLE 2ZRCA 3FX2A 4XXHA 4E3WA 3I23A 3QG5A 2PUBA 2UUPA 4C3VA 4TMKA 5IZCC 1W2WB 4WDQA 1C3OA 5ICCA 4GLJA 1ECGA 1SNYA 3FNBA 3TDNA 4HNGA 2AHRA 2ZRIA 4TRRA 5FEUA 2DETA 2O3SA 4WEQA 3RJMA 3AJ9A 5ULLA 3FB1A 5IJ0B 2PSSA 2J6BA 2F3TA 4FN4A 3ICQB 2JI7A 4U7PB 3R5SA 3UAGA 5GJVC 4BWYA 3HYNA 3O2NA 1Z74A 2C82A 5IUKC 2AYZA 3RUIA 4XD7D 5G3ZA 3IMEA 1DBQA 2ZT7A 4B6SA 5DWDA 4AKSA 1O97C 3BWBA 2KBFA 5HF9A 2XSZA 5IF9A 3C5WP 2WWHA 3TX2A 2JLXA 2AOTA 2G77B 4B3FX 4G07A 2VQEB 2JBAA 4TXLA 2HLPA 3U3JA 3MHTA 1CP2A 3BCRA 3ZD6A 2LV8A 3HXOA 5J58A 1PZXA 1NLZA 4BMPB 1DWPA 2GSDA 2BZ0A 2OHOA 1JG2A 4R9NA 4H60A 4RCYA 3KSAC 4MV7A 2AQHA 2WHPA 5DYWA 2R5WA 1JFFB 3FZEA 3GLIB 1U3TA 4DV3B 4IP0A 2HO5A 2YOFA 1NJ8A 2JFPA 3PENA 4IG4A 5CNMA 3W9SA 3HCCA 1FPMA 4F2DA 1PWZA 3KVNA 3QEBZ 2FR8A 4NBLA 3VYRB 3CVOA 1NJ5A 2OO7A 4BRZA 5JZMA 1YT5A 3RW9A 5AYVA 2B4YA 3ORRA 4EG8A 4JUBA 2CV1A 2ZIUB 3RYIA 4G8DA 3E9YA 5MDHA 3AHEA 1Y4ZA 2CNKA 1QX3A 1W35A 221PA 2ECPA 1W0KA 2OEPA 3QWHA 3KCQA 4W7SA 3ZWYA 4B87A 2YJ3A 3BMNB 2RG7A 4MVCA 4OHYA 1KY3A 3JYQA 3CLTD 2ACVA 1R5NA 4JJKA 4OP2A 3TQFA 1COWD 3F4BA 4N1AA 4KN5A 1PQ4A 1F38A 3I61A 3EF1A 3PFNA 3UJHA 3NKVA 1Z2DA 2I2FA 3SD7A 4CM7A 2SCUB 1S2LA 3A11A 3JZFA 2Y1KA 3BORA 1JU3A 2XF8A 4YH1A 4RZ3A 3NT2A 3GN2A 4KLRA 4WBXC 1YR8A 3JYLA 3IUSA 5T64A 2YV4A 4TL8A 5I9IA 3ZQKA 3C3PA 1LWNA 1U3CA 3GEGA 4W8GA 3VR0A 4E31A 5J2TB 3PHBE 4HX9A 1WDMA 3UAOA 4J1TC 4MA5A 3LCJA 5AM5A 1XTKA 5JWHA 1SXQA 3I2YX 1ATIA 3G7NA 1DWUA 2YINC 1D4FA 4ZQBA 1L7PA 1IM5A 4KVZA 3N2GA 5EHQA 1TTQB 4CIDA 2HRBA 4KGZA 1CQXA 2QN8A 5F12A 5JH7B 2IDKA 2PQ0A 3ZQUA 1ZIOA 4ZHQA 1OBOA 2VPXA 3ZHZA 3VR5D 3GHYA 2YIDA 3BAFA 4Z4IA 4N39A 3DAHA 4U00A 4EYQA 6Q21A 3G79A 3CBQA 4B33A 1RTTA 4PLTA 3ZJTA 1JLMA 1ZK3A 2C1XA 3KZVA 1QE3A 2OBYA 3NHAA 2YS6A 4GXQA 2AOXA 4PPYA 4V0OA 3RAGA 1R15A 3W7BA 3X43A 3RJZA 3IUPA 1BYUA 1NLFA 1LQTA 5KQPA 3BZUA 3ZV4A 3DOCA 3L07A 3SF8A 4JD5A 1I5OA 2J0QA 3QMPA 3GMDA 3VPGA 1T3SA 1O54A 3PF9A 5C80A 2B94A 4DR3B 4UDNA 4JLAA 3G0BA 3DDCA 3ADOA 2VYND 3W9YA 1G3MA 4GM4A 1RXWA 2B69A 4JNCA 4YUXA 1ZK4A 2HDOA 3JWPA 4KZPA 1VCMA 2PA3A 2V0CA 3NH6A 3E03A 4H0NA 4EJ6A 3S81A 4Q4LA 3VVCA 1IIRA 4CTNA 1TM4E 1NT2A 1SG6A 4UNRA 1T8RA 2BFAA 3F6YA 3QVGA 5LDGA 3EYAA 2A3RA 1K9SA 5ESDA 1ADGA 4JJ4A 3WBBA 3M9XA 1LLUA 4FB4A 1ANKA 1I4DD 4TL6A 2X41A 5JJIA 4L5JA 3TSYA 2LP4Y 3KZOA 3FUCA 1LSOA 1AHNA 3LF2A 2DLDA 2PMDA 2PZ8A 4GDMA 1AKTA 1SUSA 1XT6A 5AI6A 6GPBA 1SH7A 1JPNA 3A7EA 4UE6A 3P9RA 3E48A 4XUEA 3L1VA 2VBCA 3FDIA 4JJ7A 1DUSA 2WUWE 1M6NA 3DMTC 2V7WA 3THYA 1RI4A 3MRTA 1WWKA 2VP3A 2WOJA 3WQQA 4MWGA 1K7XB 1UT5A 2Q21A 1EEXB 2ZJ8A 5JQGF 1NJ1A 4Y3UA 4L85A 4NHOA 1WCIB 4RFVA 2H0RA 1QZ3A 4N7RA 4O59O 3TIXB 3FWZA 1XAIA 2DHRA 2QI9F 1AGRA 1TIKA 2M6SA 2WYVA 4AO7A 2D2EA 3IOYA 4MVJH 5A9SB 4EW3A 1HFJA 2N46A 2ZTUA 2VPYA 3BIOA 1NXVA 2I4OA 3ENNA 3FNHA 3JALB 2OGZA 2XUIA 3MAAC 4NDAA 2WJ3A 3EA0A 4FONA 4OAOA 5JD5A 3EXEB 2GCIA 3IS3A 3GZNB 5LIRA 3OU7A 4DGSA 4LYEA 1I33A 4RSGA 3B85A 3NHMA 1AQLA 1DBSA 4X44A 4INZA 1A1SA 4Q7JB 1PKXA 4HH4A 4GFDA 4WZBB 5CB0A 3UHAA 1QXSA 2I2BA 3N59A 1QKIA 4BPRA 4GX2A 4C4PA 4FLMA 1AA6A 4YJ2A 4R69A 1Z5PA 1ZRHA 4QFBA 1O77A 3VRHA 1QHIA 1VL8A 4N7BA 1FP1D 1W85B 2O1XA 3NUZA 5AVOA 2P30A 3BCHA 4JI5B 1E63A 2W6JD 5FL7D 4FXPA 4Y2SA 3UCEA 5KVSA 1DFIA 3MGAA 1WOMA 1ZM7A 3M3HA 4IXDA 2OHIA 2WA1A 1FPQA 1U1IA 4KDCA 3PNQA 3EA4A 1K89A 3TTTA 4F45A 5BN3B 2WC1A 2YYSA 3BWDD 3OE4A 3L41A 4RA6B 4UJ3A 4KIFA 4Y6OA 1ZOPA 3SYKA 1WW3A 2N42A 4UCQA 2YICA 1ISHA 3LLMA 4P3KA 1O4VA 2C9ZA 5IAOA 2RI0A 3KTAB 4MH0R 1MO6A 4PZEA 2F43A 3UJCA 2M1ZA 2EP7A 2YFYA 1EIWA 5T4HA 5EZYF 1N3BA 1X74A 4IO0A 4BVAA 4DMCA 2RGDA 2O7SA 2V96A 3MXTA 4FC7A 5AP9A 1KXZA 5KQMA 5ALLA 3C7KA 1UFVA 1KNQA 1N5DA 3O3OB 3UKDA 3O5AA 5A4MS 1FY2A 1CB7A 3M5WA 2QD4A 4C3OB 3Q8KA 3EH1A 3AJ8A 1AZTA 1KOGA 3BWCA 5HIIA 1XNQB 2VJLA 2FWMX 1UBLS 1UKCA 1VHQA 2F59A 2NVOA 3LBAA 2CNWA 1L4LA 2XR1A 4UVEA 4WKOA 4FGUA 2MT9A 4WKCA 1JJBA 2PX4A 4B7XA 3DHNA 4D3FA 2H0AA 2IBTA 3ZW9A 3WA6A 1JQAA 1XZMA 1MENA 3TLYA 1HQYE 4PGHA 4URUR 4ZHSA 3RC8A 4K1LA 2HREA 4E11A 1ULTA 2EKQA 1DCFA 4DDHA 4ZVKA 4J16C 3ET5A 2BGJA 4OQFA 4YB8A 3CEJA 2O2EA 2CCJA 2HU8A 2BFOA 1LNSA 2FUKA 2XVXA 3CZ5A 4OXRA 5J59A 1NLYA 1KPGA 1GAJA 3UCXA 2PNFA 1CJUC 1OZAA 1Z6GA 2O3QA 1BXGB 1Q83A 4PHTA 5E6RB 1KF0A 5HKLA 1YB1A 1H2WA 4FE4A 2PIDA 5LZ7A 5TPWA 4E15A 3WAJA 2F4NA 1GL9B 4OXYA 3TL6A 1U2SA 3OD1A 3DMPA 2FPKA 2YQZA 4GC5A 1B0ZA 3UFXA 2DTEA 2JFQA 1NRWA 2QRUA 2QYSA 1BDJA 1C30B 2Y0EA 4CNQA 4GO1A 2NV2B 3PTAA 3FFTA 3R8FA 4FYHA 2CLDX 3BHJA 4AQDA 1MPTA 1COWA 1LVHA 1XF1A 1S96A 2EIHA 3MINB 4IUCS 2CHEA 4IDQA 4QOEA 1LEHA 3AR3A 3D3JA 3U1VA 4BVLA 3LCRA 3ORFA 4ZZ0A 3AYZB 5HIAA 2QEQA 3A4LA 5D51S 3UZUA 4X94A 3C7DB 5IANA 1JMKC 2IUEA 4I55F 1ZG3A 4OBWA 2HMVA 4YRFA 2LKDA 1CUBA 4GKBA 3VBEA 5I3CA 5FI3A 4FDAA 2V3CC 2IXFA 4I6EA 4P98A 1ZS9A 1IY1A 3FIJA 1K92A 3T6KA 1U3UA 1ILWA 1MEJA 4J2HA 4PTLA 1N3LA 2E18A 2NUPB 2YXNA 5CVCA 5FWXA 1GM5A 2PUAA 2NSLA 1BGWA 4RDXA 1GG9A 2GZHA 3PYLA 5LQMA 3G8YA 2WYOA 1GRRA 2IP2A 3OFJA 1DAMA 1YQUA 2JFHA 4J0EA 5T3UA 3ZXYA 5AVYA 5K0SA 1KYXA 4IIVA 4NBVA 1PNTA 4O6VA 4P4LA 3Q85A 4AG3A 5HKKA 1F6DA 1SG9A 1STOA 4AX8A 4S2EA 1YZVA 1NLMA 4LMPA 1OSNA 5LU9A 1NI5A 1H1LB 1XXLA 3G17A 3ZWXA 3L05A 1G55A 3P1JA 1HBJA 1SCKA 1Z2OX 3PVSA 3T7CA 4AS3A 4C0AC 2EHDA 2ZE5A 3I42A 2FUG1 3G2OA 4BZWA 3Q3IA 5D00A 4ENQA 1FTQA 2PKYX 3DBIA 1MOQA 3AX6A 4DR5B 1EXMA 2B98A 4Q4CA 5AM0A 2YN2A 4NX2A 1TCAA 1W0JD 3A1SA 4OHUA 1UAAA 3NHKA 1MUUA 2ZI3A 3FMFA 1T25A 4AJPA 1YQXA 3KCNA 3PHGA 4MSUA 3R5FA 2Q2OA 4R1NA 1USWA 4I4IA 2C8LA 2H2GA 3Q3CA 1QTRA 2Z5GA 3E22B 1QYCA 4H4CA 1LK7A 3ESYA 4HLQB 1I4WA 3ZCSA 1YR3A 2HRRA 1L3IA 4V3BA 3C43A 1KJJA 4GMDA 1IN4A 1O6CA 1X80B 5T8KA 2ACKA 3KXPA 1QR2A 1LI7A 1AKQA 3B8HA 4G4SO 5BQFA 1R0YA 3VMFA 2PBLA 1M2KA 2A5JA 5CDYA 3GUVA 2NTJA 4KB5A 5IKPA 1F0NA 1F4VA 2Q6IA 4FD3A 1Y63A 3TO5A 2BKLA 4Q93A 5EJFA 1NBME 4GP7A 3L06A 3I2KA 1SOMA 2A5LA 2V4ZA 1MAAA 4KIJA 4O1IA 4FFBA 3GEMA 2G36A 1KIAA 2XXJA 3DEJA 1X77A 3NPMA 5EJ8A 1KI4A 1DG3A 1YNSA 1QRDA 1MAHA 1X70A 5DBOA 4AICA 1KQ3A 1WTCA 4QHYA 1V5IA 1T4MA 3F90A 4NE7A 4UAUA 3WGHA 4CI0B 5C4IA 3GLIE 1NKVA 1GLVA 4GI1A 2VIIA 4LRUA 5DO9A 4CMIA 1O0CA 5CLIA 1Z3IX 2JF0A 4D4MA 2AI2A 4JEHA 2GWHA 5BWOA 3RYHA 4LPKA 1C30A 3LKDA 4AWXA 1VHJA 4FEGA 2QF7A 3NWEA 2W2PA 3JVVA 3V7NA 1PR6A 4Y6PA 3R41A 2ID9A 1D04A 3M6MD 2AFIA 5HZHA 2CVQA 3CF6R 1KVRA 4HH1A 4PGGA 3OM8A 4QHSA 5D5QA 5AVZA 1UP7A 2I4TA 3A6ZA 1E1NA 1XZNA 3U3DA 2O2ZA 2H4HA 1OY1A 2HCRA 5UKDA 5H81A 2YHIB 1PCXA 1NATA 1EB9A 5AWFC 3T5GA 2CLHB 3MTJA 2H5EA 3STXA 3OCYA 1T26A 3AYXB 4BKMA 5G0SA 1KRWA 4OGKA 4NCAA 1V5FA 3Q7QA 5E6UB 3TTUA 1CERA 1I2ZA 2W6IA 3AJEA 4HY3A 3OIYA 1X15A 1JB1A 4C2TA 1EAMA 3T06B 4EO9A 2CZCA 2Y1DA 1E3WB 4PY2A 4ZANA 3P2MA 4KI7A 3HXTA 5A3JA 2X2OA 3RH0A 2I9PA 1PK8A 3VPDA 3X1ZA 1CUDA 5EMKA 4MTLA 1J8QA 2Q62A 3GQBA 5EQFA 3FFWA 4ETWA 3KQMA 5K7SA 1Y1LA 4MW5A 1SPXA 4OBXA 2I71A 2RAVA 3FWHA 5BV8A 3W4JA 3I12A 2O3JA 4NV1A 2OT3B 1XOIA 4CMAA 4DV0B 4WOJA 2H7VA 4YC7A 2OLKA 5ERGB 5B55A 2H4YA 4MP8A 4N7MA 2J3HA 3AFHA 3MWDA 4CG1A 2A1IA 2H2FA 2V54A 4G01B 4ND7A 3RTBA 3VO8A 3FYSA 1EI9A 3AHJA 3H3FA 1XHEA 4LZJA 3MHPA 1SG0A 4WBNF 5FPTA 5KMGB 5LUAA 1X7YB 2DPXA 3UTCA 1H4QA 2O3UA 2OOSA 3K1AB 4DSZA 3BWXA 1KKLA 2WE7A 4QT0A 1N2ZA 4BXOA 2XB8A 3B3QA 3HKDB 3L0CA 1VKJA 2NU7B 2VK2A 3R2JA 4TPKA 3RUEA 1T35A 2WG1A 5IULC 1S02A 1K7CA 1Z06A 2O2HA 2AI3A 4HYYA 4D41A 4US0R 3UPTA 4WI1A 4L02A 1HYQA 4DV5B 1TJPB 4J4TA 1J97A 4RV4A 5D3MA 1LXCA 4AMZA 3WZLA 4B3HA 2BGRA 2Y0DA 3MMPA 1O94A 3DC7A 4FNMA 1KZ4A 1Z45A 2ESRA 3IAFA 5FNVA 4A23A 3TSAA 4BNMA 1ZM2A 4JBHA 3U31A 4QGFA 3RRXA 1GPMA 5JJCA 4C5BA 5F9HA 2VI5A 3BGDA 4DQ0A 1N5MA 3OEYA 3NANA 1VOTA 3WLLA 1HL3A 2MSDB 2JHFA 3WOVA 3EXIB 5CW1A 5DHQA 3LTEA 1H0RA 1KBQA 1B1AA 3G2LA 4UXHA 1XP8A 4DILA 1A7KA 1PNRA 3BEDA 2WINI 4MKFA 4ER3A 5J40A 1OASA 2XUZA 4P32A 5DK4A 2FZGA 3PGKA 4BO5A 1Y4UA 3BIXA 3IIMA 4PYQA 1U28C 4ROSA 1BD3A 3HJBA 3LPAA 3WFZA 3PJRA 5EP4A 1J6UA 3ETLA 2WTMA 3Q2KA 1J8DA 4GI5A 3SJCA 1VE6A 2PZMA 4PZZA 5CNKA 4X7BA 2MCFA 3OCXA 1AO0A 2A59A 4UBMA 3DM9B 1UJNA 3GX1A 3VNBA 4KPEC 1PFYA 3NTVA 2C7RA 3EW9A 4X65B 3T4EA 1O5IA 3H9UA 1R8JA 4GOND 1IBKB 3ORHA 4JKOA 2YKGA 2UYOA 4O5AA 2IXGA 1NNEA 2P9FA 4QWMA 3ZHUA 4ZEMA 1L7NA 5FORA 2XCSB 1FSPA 4KO8A 3W5VA 1U1CA 2NAFA 4R6XA 3OJWA 4N47A 2FSHA 2I3BA 3V1KA 2PQ6A 5C5CA 3DE1X 4HAXA 5IJ9B 5A0FA 3UIEA 4GLOA 2AL7A 3IVRA 1YI0A 3LT1A 1RJFA 1W4RA 5HR5A 4ZEWA 4WY5A 3K6SB 1FYVA 4AQ7A 4P2GA 2VWPA 3V8RA 4KKVA 3W2TA 1OOEA 2BJVA 4OYLA 4TWIA 2GX6A 1XBTA 5HZMA 2JD1A 2OWDA 2PKEA 4A26A 2ZI9A 1LFAA 2QTVA 3I0NA 3KU1A 1TK2A 1Z39A 3FMIA 2W6PA 1DZIA 2OFXA 2Z5FA 3VC7A 1JLRA 3BWMA 5CFNA 1QIDA 3FLBA 3QMVA 2R1TA 2VAWA 3FYUB 3M1AA 5CA0A 1Z5GA 3FXAA 2P4EA 5GV8A 5LYYA 3QITA 5JJBA 1U0GA 3MW8A 3S70A 1DDIA 4UAJA 2XGSA 1GWNA 2ZPAA 2UYGA 1FP7A 4TXMA 5F1YA 5JCOC 2CB9A 1D9ZA 4LRXA 1GGFA 3ZDYB 1WETA 1PNQA 2VLBA 1M83A 1R4NA 1Y8QB 3ZE6A 3R5JA 4A0QA 5A4IS 5LM3A 4QODA 3GNQA 1J5EB 3INGA 4TM8A 1M54A 2PKQO 4U8HA 3VKWA 1EFRA 4PS1A 2FPWA 5FUMA 1U04A 5I6DA 2HTFA 2ZUTA 5ETJA 2P3OA 5GTDA 3BXFA 4S1PA 1C3XA 4BO8A 5JTUA 1EPUA 5H4HA 4JVMA 4RIFA 3QEKA 4HKTA 2D1TA 3LZCA 2F3PA 4MPDA 1IHPA 4UHHA 1VMIA 2BEVB 4BQNA 2B9EA 1L5VA 3T1TA 3Q8XB 3VHRA 4JXKA 4R2HA 4EYGA 1S2OA 1LKZA 1IHXA 2PNJA 1V7ZA 2R62A 1KZGB 6ABPA 3LGSA 2XKKA 3KKMA 2IS1A 1L4EA 4DLBA 4LHWA 3KQHA 2HBQA 2WMNB 2R60A 3LVQE 4RQUA 4FB5A 4WXPA 4WEOA 3V8QA 2B1QA 2B7BA 5C8XA 3ROQA 2J8ZA 2LCIA 2C04A 1E89A 3IQEA 1M1UA 2ZYDA 2VF7A 1PO7A 3EULA 4A8TA 3QEMA 3GPBA 3C3AA 4RM2A 1A04A 2J46A 1PQUA 4YI5A 4BE7B 3SCZA 2XRMA 1DINA 2BLNA 2C88A 2IPOA 1SD1A 2QTRA 4Y9TA 5A02A 1BEEA 1ZN7A 5IYZA 4BVHA 3NRJA 2QRQA 1W8DA 3AT1A 4CG2A 4X85A 4CMHA 3E8XA 3TFQA 3EC1A 2IHKA 3OQOA 5BW6B 4JJ8A 3K0BA 1IPHA 2PMBA 2G76A 3I6ZA 4IQ0A 4IIGA 3WJ2A 1SHKA 3BULA 3ZYCA 4WHMA 1JDSA 4LAFA 2EW1A 3KJEA 3TNFA 1P2TA 3KR2A 3L01A 2ZGVA 5ALZA 2OKGA 121PA 5DKFA 5AW1A 5JC1A 3VNUA 5E3HA 1A69A 1GIAA 1RHRA 2ZYWX 1CJBA 3GFPA 5HF6A 5LQCA 2QU7A 2PUEA 4W1RA 6REQB 4C7MA 3EZ7A 2VSOA 4DCPA 1YULA 2CCKA 2ZR9A 2ZB2A 5BNZA 5KTTA 3REQB 1D0VA 2P67A 1TM3E 2YZNA 3H9GA 1BXKA 3LY8A 3D0QA 2GVNA 1Z0DA 3MOSA 3ENVA 1G41A 3N2YA 2P0AA 9ABPA 4JYPA 4QYWA 1J70A 3AF1A 3U26A 2FDXA 4O4IB 1R88A 1CB0A 1TZJA 1G5RA 4ONEA 3V2UA 2BFFA 1QOPB 1N6NA 3AKDA 3MYRA 4GGMX 2XCRB 3IIJA 3X1DA 1ZVJA 2BGIA 3JYHA 3VKFA 1DQZA 2QVGA 3L7CA 1U0OC 3HXPA 5CJPA 1U7ZA 5A62A 1ZOSA 2MYUA 1WSWA 5L95A 4Q9DA 3WMGA 2TECE 2A0YA 4KO2S 4JA0A 4RVSA 1RWVA 1ORIA 2QXTA 3EIOA 1Y7TA 1Z7YA 2QUZA 4D2IA 1PT7A 2ABWA 3X2EA 4FE7A 2DTDA 4XOIA 2V6FA 4OEHA 3WK5A 2R6FA 3I2IA 4C6TB 2FZ4A 3SAJA 2ZBGA 1G7RA 3DDZX 2JGMA 2H3HA 4MYDA 5I5GA 3DF7A 4MCJA 4C4SA 4YECA 4FWTA 3FFBA 1EG2A 1ZD2P 2B21A 3HB7A 5F3DA 4F2GA 2Y8EA 2P0EA 3EZYA 4N3AA 2J9GA 1N8KA 5IM4F 1TJ4A 4J2TA 3QP9A 3OAAD 3UMVA 2CXUA 2YCBA 4PFSA 2RD2A 2GEFA 5DTIA 2P65A 2VP5A 3LA8A 4ZO4A 1KI9A 1GARA 3EWSA 1YC2A 1H85A 1SMKA 4YT5A 1L7AA 1QIIA 2ZRBA 1KARA 1TL7C 2NU6B 3REGA 2VNJA 1V9LA 3K5IA 1M9NA 1JPJA 2WWXA 4WOKA 2WDZA 1J5XA 3KSZO 4F4UA 1LGYA 2P2SA 3BK1A 4K8OA 2Z2JA 1OYWA 2QVLA 3TIFA 4URVR 4CMGA 1N7HA 1UC5B 2OP0A 3GDOA 3PCRB 4OLFA 3WGZA 4YRSA 2XMGA 3KD3A 4NOLA 1P9RA 4X1KA 1H0KA 5LWHA 5T67A 3GPDG 1E1MA 2PAFA 3VZPA 1S8FA 1QVWA 1ZLYA 4QELA 3E5RA 3FHOA 1RVDA 4HK4A 2NM0A 3FNRA 2R3SA 2F9FA 1WW2A 1JFRA 5JEDA 2D1YA 4CQMA 3P9CA 3AETB 1FFWA 3EIEA 4OBEA 3ZGOA 4CZ2A 4GL4A 4NOKA 5EP3A 4Y7DA 1PLJA 2R6DA 3E8SA 2EKLA 4P81A 4X92A 2XE8A 4F7DA 1SCDA 4F8YA 4WLNA 2F8LA 4XE5A 1L5KA 1I6MA 1JT2A 3S6JA 1O95A 4X90A 4WJZA 4EP1A 4FD2A 1NASA 5J1SB 1L1RA 1W76A 2VCEA 1T0HB 4H7HA 3U09A 2OQRA 5DEOA 2C7QA 1THTA 3CZMA 1JDUA 1T24A 2PUVA 1J25A 3DYIA 4F38A 2NP7A 2DPHA 4MQ4A 2AOVA 1IQ0A 4M0LA 3W8NA 3EE6A 3RK4A 4OD0A 3KYCA 5BYBA 1YAJA 1X1AA 2JGJA 3EDOA 3KL2A 4JQYA 4W82A 1EUCA 2FE4A 1D1SA 4LF5B 1I4EB 2A1TS 1HV8A 1N4AA 4YUWA 3UBTA 2QUBA 5GVSA 1A95A 1GT91 3KKEA 4GZLA 4KREA 4D26A 4Q16A 2GASA 2QGNA 1NN1A 4OHZA 1TVKB 4G4GA 1E98A 5LLTA 3HVRA 4JLPA 1KQPA 4HB0A 2CD9A 4Z7QB 4R0NA 1Z35A 2YWXA 3GVHA 4Q9NA 3ZCXA 5AFSA 3PEWA 5FOXA 1NI4A 1WBDA 2CVHA 2W90A 3ETEA 3EBOA 1LF5A 4NPCA 2RHBA 2BISA 3AO0B 3WFJA 4TLMB 1SVOA 3Q6IA 4ZICA 2WIFA 3ROPA 1QM5A 2XMBA 1MW8X 5CJJA 2BEVA 3OZAA 2BP7B 5KNLA 4YCBA 2VRWA 3AU8A 5L4LA 5AM2A 4NC9A 4FQ7A 4HRXA 2VDVE 3DEFA 3P9PA 2DUWA 1X7DA 3WRXA 2FSSA 3KQYA 2DVMA 1M67A 3HKCB 2RE8A 4UAVA 1HT0A 1ISSA 1P0PA 1Y1TA 1YV9A 2ZRNA 3DBLB 3C85A 4RVDA 5K8UA 4DUZB 1ZW6A 1RWNA 3LZDA 5K6AA 3CPEA 3HABA 2QB5A 3EFOB 1IHOA 3AEKA 4JLDA 2DQZA 4BFCA 4AS1A 1ACMA 1V41E 2GBIA 4FDMA 3BKXA 4JQZA 4XWYA 1L7RA 1CDZA 1WVIA 1YB2A 1YIAA 4GF5A 4GS5A 4JITA 5ESWA 4NS4A 4DJ5X 3LTNC 2QUHA 1HKHA 2PCJA 3AF3A 3HY3A 1FNBA 1KYIA 4LY6A 3KLBA 4NVRA 5E1DA 3WFIA 4OI4A 1FVXA 3EZ6A 1NJGA 2BZSA 1P9OA 5B53A 1X13A 3HHPA 4RZQA 1X94A 2BW0A 2H1VA 5DU2A 2FQXA 1MAUA 3RVLA 3SMVA 3WGKA 3JQ6A 3K8OE 3JQ9A 4V1CB 4U0JA 5CG2A 4G9EA 1AS0A 1Q91A 2GZMA 2QL5A 2IF0A 5KHAA 3RVMA 4G3XA 4AT1A 3COPA 3OOJA 3UUFA 1W88B 4WACA 1N57A 1WHSA 3OJFA 2XQFA 2IEZA 4XM1A 1BE8A 1YJ8A 4UVHA 2Z1MA 1ENPA 4JVOA 3WMEA 3PK0A 1QS0A 3RAFC 3JQ7B 2G08A 2Q5IA 3N74A 1UIMA 4P33A 2OPBA 3WG9A 4CMJA 5EIBC 3COJA 1PI3A 5B3AA 3J80A 3QRWA 3R74A 3JYOA 3BREA 3EJWA 4JKIA 1CUFA 3ZDAA 2WHEA 2AJBA 4BAUA 5JWOA 5KTNA 2A6PA 2MDTA 4LJKA 5CPBA 4YQYA 3HR7A 4KPUB 1WQ3A 2QGFA 5ARDA 5L3ZA 3B1FA 3DAOA 1C0PA 5EE5B 1HDOA 2ODAA 5AT1A 2IGTA 2YXEA 4JV5B 1JQDA 3KJHA 1BDBA 1J4AA 4UM7A 5A3VA 3KPWA 2BH9A 4ZVQA 2D62A 2O48X 3K09A 3PEFA 3GNTA 1CY2A 3M6FA 1K0UA 1R0XA 1Z0JA 3YASA 1GLNA 4WMLA 1VE9A 5K0FA 3W04A 1O6FA 2NV0A 3R3SA 4JR2A 3U16A 1N2CA 3QNUA 5T8KC 4YR9A 4IOLA 2OZVA 2ZRKA 3CWQA 3QBEA 2B3DA 3UPDA 2GN2A 5KOJA 1IOLA 4WKGA 1XDGA 1UFRA 3K1YA 4TTQA 1I1QB 5IHXA 1NE2A 3K09C 3KV1A 3BTOA 1T6BY 1UP6A 4HO1X 2CD7A 2RHDA 4LOIA 2P1ZA 2Q8NA 3D6MA 1VI2A 4QYIA 1N0HA 3TQTA 1BHSA 3AKEA 3IQFA 2V5AA 3FYDA 3GLUA 1NUHA 2GH1A 3ED5A 1SZPA 1KMHA 2PD3A 5TNXA 4DLAA 3RU7A 1C29B 3KOUA 3K6RA 3G5TA 1I7SB 1T2AA 1WQ4A 4M8SA 3WYGA 4B4UA 1Y5MA 1HDYA 3CQ9A 3FE2A 4O4LA 4KAFA 2ZR8A 3R3JA 2MHCA 1JDTA 3KB1A 5KKAA 3E2IA 1TZMA 4JVLA 3ZKAA 1A2BA 1RLOA 1V11B 1GSAA 5JSYA 4RKYA 3FZQA 4FEYA 3CX6A 5IN5A 2VG8A 1ZD9A 1KU0A 2C4KA 1NZFA 3D7NA 4JJIA 5T41A 3K0EA 4YASA 4PHGA 2X9LA 3Q5DA 1EXVA 3VM6A 4EY5A 4J03A 1TEZA 1XZFA 4TYYA 2I4LA 2AZ4A 3UA4A 5DB4A 3T7JA 1L7OA 1Z8DA 1O96B 4O29A 3OA0A 2NYUA 1HYHA 3UMBA 4C7XA 2O19A 1VYTA 1Z4NA 2CL0X 2WJYA 2IEBA 3CKKA 5TPZA 4QXOA 2C4VA 4IIJB 5LP1A 1TRHA 1GR0A 4GD3Q 4QZVA 4P8RA 3LYUA 4OFWA 3ZUPA 4QWWA 3IJPA 5ALVA 3COVA 1JHYA 4DEVA 4DM7A 1ZK1A 4QRDA 1C80A 3JQGB 3WBKA 1U3GA 3K9CA 3LFHA 4YUAA 4XTCS 1XDDA 1XWWA 4JP8A 2P69A 4DTCA 3F5SA 4Y9SA 2TSYB 3G7UA 3BSSA 4GMGA 5KHLB 5A5EA 1RCUA 2ZI7A 3H17A 4QUAA 1TJ3A 4DQLA 4M1SA 2HFKA 2DB3A 1EVEA 1GA6A 1B3BA 2VNHA 3ZWQA 4OYYA 2BFDB 3I0MA 3OLQA 4OL9A 3HWWA 5CNIA 1HF3A 1E79D 1TKCA 4JQCA 2FWRA 4L6AA 3L8HA 1C50A 3OZWA 3QFCA 2O4CA 1OIWA 1NP3A 1G9SA 3MWKA 3Q3JB 1UBMS 2UZAA 4GBED 4CUJA 2ZCUA 3NP7A 3GJYA 3IAAA 3MUNA 3PBKA 3RUHA 1NN3A 4KQFA 4NXMB 4B3GA 4R8VA 1KWGA 4DEXA 5FV4A 2YMQA 2QMQA 1G4HA 1FMTA 2VSXA 4HTAA 4I1SA 5EUCA 5AK0A 3I9NA 3LSTA 4JLKA 1GZVA 2EX4A 1T3LA 4FX2A 2EIXA 5KX5B 3ELWA 2BTQA 1Z6ZA 3S7ZA 3V4SA 3MVEA 5DP1A 5JCJD 2DT8A 3FI9A 4MR9B 1BGVA 5A7GA 1FSFA 4TTVA 1WE2A 2VNKA 4E2WA 4UUOA 3C74A 1OLUB 1V8FA 4O4JB 4NFHA 3UWMA 3TRHA 4HR7A 1OJ7A 4L28A 4B4KA 3OE5A 4D8TA 3OUTA 3FOBA 4BFYA 2GPJA 4JBYA 1YQGA 2PUFA 1FUUA 3U9LA 3WRYC 2OE2A 4RHEA 3RFCA 5KYWA 2ZJ6A 1OX4B 2W2LA 3KL4A 2WF5A 4JB3A 5SY9A 4BO9A 5GM2A 3G1WA 4QLOA 1RZUA 1XU7A 5K05A 3ICPA 3VI3B 1EK6A 3H04A 3W90A 4EGCB 4I4TA 1QYIA 5IZCA 3CUVA 1XUOA 4PTZA 4JL5A 4G84A 4IF4A 4FUTA 1MJGM 2XDWA 2WJVA 3L82B 3MLAA 3RM3A 3V7YA 1YZKA 4IHJA 1D4OA 2FW6A 3N39C 4TTAA 1Q6YA 1U0SY 3DMNA 4X1IB 1F6WA 5CP8A 1EVLA 4XIIA 1QIGA 1BCRA 3ZXIA 1Z7BA 3BAZA 3DO6A 3OZSA 4IQ4A 1JBEA 2ZDGA 1LTQA 1G0NA 1QHFA 1GQYA 4UUAA 5AW8A 4UD6A 4OMFG 3OTWA 1U90A 4CMBA 1XXHE 3C70A 1SUBA 1W1WA 3FYUC 3EY4A 1JH8A 4FHZA 2Y1FA 4X8HA 3NTUA 1Q57A 2BDUA 3GQVA 4ENVA 3BRCA 4NCIA 5EL0A 3PNKA 1JR2A 5F73A 3W06A 1C9KA 2HDWA 2GN1A 1N1MA 3TSCA 2RBEA 2FV8A 2PT7A 4B1FA 4CHTA 3WZMA 3LY9A 1U99A 2GA8A 4XSVA 7ABPA 3CR8A 5IK2A 5T6MA 1YCDA 2RDMA 3H5WA 2GCOA 1SVNA 1VHLA 3ZU2A 4EENA 5I48A 5LQAA 5C5EA 2AMLA 4WNYA 1FQWA 4DDWA 4W8HA 3O0TA 2ZSEA 4ZYXA 3DZBA 3AZPA