1W30A

Pyrr of mycobacterium tuberculosis as a potential drug target
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
174
Chain Sequence
b'ESRELMSAANVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pyrr (Rv1379) from Mycobacterium Tuberculosis: A Persistence Gene and Protein Drug Target
pubmed doi rcsb
molecule keywords PYRR BIFUNCTIONAL PROTEIN
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 53
structure length 174
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w30A00
4X45A 1ECCA 5KAPA 1DQPA 1P17A 1UPFA 3N2LA 4M0PA 1JLRA 2DY0A 3OHPA 4LZAA 4TWBA 1WD5A 1ZN9A 4RV4A 4JITA 1O5OA 4RANA 1NULA 1L1QA 1YFZA 3GGCA 2H06A 3LPNA 3O7MA 1A97A 4RACA 4QRIA 5BSKA 3DAHA 5BRNA 3KB8A 1QCCA 1VDMA 1IBSA 3NAGA 2VFAA 1ECFA 3G6WA 1CJBA 1A98A 4FYMA 5EUCA 5BQOA 1PZMA 4P82A 3ACDA 1DQNA 1G9SA 2C4KA 2E55A 1AO0A 1O57A 4QYIB 5IPFA 4P83A 1DKUA 1MZVA 3MBIA 4OHCA 2JBHA 1L1RA 4RQAA 1G9TA 4RAQA 1BZYA 1ECJA 4M0KA 3MJDA 3LRTA 1J7JA 1UFRA 2JKYA 1I14A 3GGJA 4MB6A 1UPUA 4ZFNA 1TC1A 1BD3A 1W30A 3OZFA 4PFQA 1OREA 1XTUA 4QYIA 3DEZA 1Y0BA 2YZKA 4WMLA 2XBUA 4RQBA 5JSQA 1I0LA 2PRZA 3ACBA 5E38A 4F8EA 1STOA 4RAOA 1D6NA 1OROA 1G2QA 4LZOA 2GEBA 1I5EA 4P80A 1QK4A 1V9SA 1JLSA 5JV5A 1ZN8A 2HCRA 1G2PA 4P3KA 1HGXA 1XZ8A 4P84A 1ECGA 1HMPA 2IGBA 3S5JA 1XTTA 4LYYA 4LYGA 1Z7GA 4IJQA 4JLSA 1VSTA 4P81A 1A3CA 1U9YA 1P19A 2FXVA 2PRYA 4RHUA 4RHTA 4RADA 4Z1OA 1DBRA 1I0IA 5HIAA 2H08A 1VCHA 5BQPA 5K51A 1GRVA 1ZN7A 5KAMA 2EHJA 1A95A 1R3UA 1A96A 1FSGA 1XTVA 1NONA 4S2UA 4RHYA 2H07A 1DKRA 4LZNA 1U9ZA 4X44A 2AEEA 3GEPA 4RHXA 4RABA 1A4XA 1QB8A 3ACCA 3M3HA 1LH0A 3DMPA 2PS1A 1QCDA 1QK3A 4M0UA 1ECBA 1OPRA 1QB7A 1TC2A 3OZGA 4PAWA 4WN3A 5ESWA 5ESXA 1QK5A 3QW4B 3HVUA 2P1ZA 1I13A 5IAOA 2JI4A 3H83A 2WNSA 1GPH1 5HKLA 3EFHA 4KN6A 1P18A 1P4AA 1XZNA 4P86A 2JKZA 1BD4A
chains in the Genus database with same CATH superfamily
4MOWA 2PZLA 3MCTA 3PGXA 1G3UA 2FX5A 2JIDA 3KE8A 1C3VA 3PUWA 4RYLA 1KI1A 2WJWA 2CLDX 1IWOA 2JHPA 3UY4A 1JA9A 2ENWA 3PGMA 3P0IA 1G42A 4Q4HB 1C1YA 4B2LA 4EB8A 2NQTA 4B09A 4EHNA 3VBEA 2J30A 3O91A 3JATB 3KETA 1F9EA 3FJYA 2B2CA 4OP3A 5DE3A 3BIXA 3KYIB 2GTHA 3PPXA 4PBSA 2DPGA 1T9DA 4OH1A 4UM8B 2H1FA 1V41E 2NU8B 2R6R1 2DFVA 1Z45A 3O4IA 1CW2B 4OHVA 4UTPA 4DCUA 3I9FA 3D6NB 1Y8QB 1N34B 2D2VA 4PZDA 5L3VA 3FAKA 3E1KA 4Y1RB 4Z2YA 4ACAA 2O5CA 3C41J 1WZIA 3V3TA 3WP1B 4ESEA 1NF8A 1OFTA 3T7KA 1XHEA 3MAAC 4IICA 1TF2A 1NGSA 1P60A 4TV8F 1JSRA 4WZAE 4IWNA 3DMRA 4YIKA 4FCVA 2CVZA 1CCWA 1JG7A 2HX1A 3FVTA 4TZTA 2ZU6A 1NHWA 1T1SA 4XQCA 3QMWA 1CV2A 3ZOKA 3ZWBA 4AY6A 1SUWA 1ZEJA 2GJAA 1EXVA 3OPYI 1IATA 4JJGA 2H63A 4KKXB 4JHXA 5A6SB 3RROA 3U4QA 1F6WA 1HNWB 4DNOA 1C9NA 5HKBA 3RUPA 1QV7A 2LGJA 4Q9IA 3AEKB 1KWGA 4P80A 5LMNB 4NL4H 1RBQA 3LDGA 3MGCA 2OC4A 4OHXA 2WG1A 1GL6A 4A0FA 1EUDA 3C5CA 5EG5A 5H3CA 4ALKA 4EFKA 5CB4A 1IXZA 4RKRA 4N82A 2C54A 1DRKA 3TVDA 3GG9A 3M1LA 1JIKA 4HN9A 5G41A 3ZXIA 3RSQA 1KIMA 4JB0A 2QIOA 1Q1NA 2IEIA 3RVNA 3FFBA 4Z4IA 2Q45A 2WICA 1UPAA 2IUUA 4TTJA 1P7PA 1LPSA 2ZRLA 4NV3A 5AUNB 4YCMA 1BWPA 3A6PC 1IYZA 2Y0PA 3CRW1 5AW9A 1TVKA 1JHOA 2AG0A 1TCAA 3HBMA 1Z88A 4MYCA 3DC7A 4WOPA 3ONDA 3ZTWA 4E0BA 2O52A 2A1IA 4JT2A 4D0NA 4BFYA 5H4HA 4ALJA 1K6IA 1HL3A 2P68A 1IPEA 4IUYA 4RZHA 4YQFA 2WWGA 2YN4A 1F5SA 2GLUA 4IHJF 1JZSA 3D6UA 4XLLA 1RWXA 2Y0DA 3HVKA 4KQGA 2DBRA 1PLKA 2M98A 3MRTA 3EPLA 1ZI6A 2WF8A 2XVXA 3I5MA 4NMLA 4FJ2A 4OM8A 1L5RA 3FHCB 4XGQA 5EQDA 3D3QA 4EZIA 1DDIA 1Y3IA 3BTOA 4K6HA 4CF5A 4EX6A 2WJAA 4QGFA 4I1RA 3ZLTA 4LIPD 1DUIA 2VPYA 4ZO9A 3BMCA 1H2BA 1CRWG 5HKKA 3GJYA 4FBMA 3WR5A 2UZ1A 2PH7A 1XWFA 1Y8AA 5LLDA 1G5PA 1RU3A 3M6AA 4RTPA 4YJFA 3G1UA 4QOGA 4EGQA 1NU8A 2HADA 2ZR8A 4HZGA 1QJ4A 2ZYSA 3VZSA 1NZDA 2FOLA 4Q4JB 4O4JB 1FZQA 1RAFA 4NBKA 3SVZA 2UZ0A 1GG5A 2Q1YA 3KVOA 5EWJA 1Z8NA 3PQ6A 3EK2A 5HNKA 2IH2A 2H11A 3HLKA 4R3WA 4R2LA 4L22A 1Q92A 4ZOLA 5K2OA 2WA2A 2Z8XA 4M7WA 4QOFA 3W3AA 1PQ4A 2V7UA 1XZFA 4WAUA 4CMJA 3P52A 2PUAA 3O5AA 3ENQA 1FTNA 2PFKA 2YHIA 1U0BB 2Y77A 3ZE0B 5TJHA 1AH2A 3L6EA 1ZHOA 1TTQB 4WDRA 1ECFA 4Q3EA 3IE1A 3MTBA 4O4LF 3HYSA 4C05A 4RVSA 4MGIR 4KPFC 4EHJA 1Y6JA 2AEMA 3EZGA 1PGJA 4REOA 1KDRA 1KMQA 1IOVA 1NX6A 3AFIA 4HX2A 1Z38A 4DWVA 1G3RA 2V98A 4BMPB 5DBEX 1CZNA 4KR6A 2NPOA 4JWKA 1ULUA 5KINB 1YO6A 4JUAA 3CIOA 3L04A 3O7WA 5A0TA 1E2FA 2CJXA 1A04A 1ABEA 2WZDA 1AK2A 2ZTVA 2VLBA 4CUZA 5KJEA 3KP1A 1TMOA 2NYAA 3OT5A 3ZHZA 1JILA 3ZX5A 3RNLA 2QGFA 3LDFA 4WACA 4NPCA 1TU3A 3W8NA 1A82A 2PR2A 1FFAA 2YY5A 3DOEA 3W8RA 5EJ5A 5A4MS 3JASA 3VR5A 3R4CA 4K9OA 1KE1A 4OK3A 3TBHA 4TT3D 1OZHA 4NHOA 3BRWA 2V3CC 5B3LA 2KSQA 1STOA 1W49A 1D6NA 2CF5A 4N12A 4R1OA 2QVYX 3RIMA 4P3PA 1V47A 4R0VA 4D8VA 3TIVA 4WNAA 3OT1B 3ZVNA 4M54A 3LFHA 3LGAA 5EUMA 4GLLA 1SBTA 1L8AA 1YC5A 2ENUA 1FPQA 2NU6B 4YA6A 3FCXA 4C4OA 2ZSBA 1NURA 3RQSA 1R5BA 2D62A 3QFRA 4LVNA 1SQ5A 4HEQA 5BSWA 3HC7A 3LGXA 5KQLA 1PKXA 3OA2A 3DS8A 3M8KA 3NM4A 3E03A 4ND8A 3JAMA 2OCYC 1K7SN 1PV4A 3IP7A 3R0ZA 1C7QA 3R5KA 1VA4A 2C5BA 3EVNA 4C4TA 3F6PA 4HS4A 4PAOA 3TTWA 1NI4A 3ORYA 3C98A 2DZDA 3MG9A 3NGXA 4IDDA 4J3FA 4JHLA 1ZOOA 2M6LA 3CEJA 4B9AA 4YRMA 1XCOA 3CVVA 5EN4A 3UAWA 1R3UA 3K9LA 4G36A 4S2UA 1BFDA 1H9BA 1JXQA 1THTA 3GOQA 1A9XB 4KDCA 5CJ2A 3SQDA 4AKTA 4IIJB 3HJNA 3UK2A 2RJNA 2QRQA 4QFDA 1NNEA 3AHIA 4D0LB 3TOCA 3DD1A 1KETA 1L7VC 1DJNA 2P1DA 4DCJA 1EKXA 1GQSA 5IHXA 2A84A 5AI8A 3AIOA 4M9CA 5FI1B 2PS1A 3W06A 4AMUA 4DRYA 4Z4EA 2YJGA 3E5MA 3L7NA 4KPUA 1AUVA 3M4YA 3DSRA 4UHBA 1OPRA 1Z36A 1L6RA 4P9NA 2YN2A 4X1KB 4YP5A 5ESWA 1OFGA 1M34B 3UHPA 4B3TB 1SKAA 2I34A 3IPYA 2GXQA 3B1VA 4GU5A 5H5JA 4XD7D 3P4XA 4M49A 4Z9BA 4QM7A 2VSQA 2XUKA 3UJCA 1P8JA 1CQJB 3PI6A 1ZLXA 5HKLA 4OLBA 3UPDA 4N0QA 1NFQA 3H9QA 4X20A 5IZCA 3I5XA 3ONVA 1V5WA 2V8BA 5EGNA 2I33A 2JIZA 3OHSX 3CZ5A 4LHSA 5IP5A 5J2TF 4C04A 1TK9A 1WXEA 2BFBB 3P96A 3DWIA 1R6AA 4GXTA 1DSSG 4UU0A 3JQGB 1IL0A 4EM6A 1JEEA 3GDGA 4L4YA 1O6ZA 2Y68A 1IH8A 3EUEA 3HBAA 1CJKC 3COSA 4UHDA 2AZ4A 1U98A 3TTVA 4U7WA 2WJ4A 2BKEA 4C14A 1BKDR 4F3KA 1EUYA 3DDWA 5AVZA 5IKEA 4MB2A 3R7NA 2SKCA 1JHAA 1SN7A 1JVNA 3WGHA 1A8QA 3BX1A 5JS7A 4Z7OB 4IYRA 4FVTA 4LDJA 3NAGA 3WG9A 3DOCA 3V97A 4R1PA 1O57A 4PX5A 1PF7E 3G2HA 5FNVB 4EHLA 2XLBA 4Q9JA 3SGLA 1K6XA 1XXHA 3ZDYB 1OQAA 4HEJA 5HKOA 5LA6B 2PT7A 5EP4A 2FUEA 1BA3A 5L3RA 4KPYA 1YZFA 2X77A 5AJHA 5IULC 2Q2NA 2ZJ5A 4PX2A 1RJ9A 4JQCA 3LV8A 3DBRA 1WRBA 2HWKA 2X5XA 2RHDA 3HDYA 4FBLA 4KGXA 4TXLA 3RVRA 5AW0A 2F90A 1W1WA 4R2KA 4BNXA 4IIEA 1S96A 2P78A 3MUOA 1WSDA 1TAQA 1GZ5A 2MIIA 3GZNB 3PA6A 2G9NA 3V8QA 1GTVA 4HYEA 4AVYA 3PFKA 1DIAA 5CFPA 4YV7A 2D3WA 3TXAA 1IN6A 4GG1A 4NVRA 3TE6A 2ZYHA 3JCZA 3T5MA 4MH0R 4OIMA 2HRDA 2NO5A 3B6JA 3CZ4A 2REBA 1KHTA 5A9SA 4CLOA 1GM5A 1G2PA 1YCGA 4WV3A 4F2PA 7AT1A 3G8BA 4J4TA 1N2BA 4D8YA 1KBOA 4RTRA 3IEIA 2ZJ8A 2NV2B 3E2PA 1ONSA 4IDNA 4II7A 4MUMA 2ZM6B 4NPAA 1ZUNB 3ZJVA 3ANYB 2WBLC 4FYJA 1XIVA 2BLNA 2PLAA 2J0QA 4UNSA 1LPNA 1HBJA 1FLDA 3H2BA 1WB4A 4DL9A 1U9YA 3BXXA 3PGLA 1YQ9A 1JIUA 1GGVA 4HQ0A 4RTSA 2PUDA 5CA1F 1ADBA 1ZM2A 2CNLA 2YVQA 5I7UA 1OI3A 4N5NA 1P31A 2IIQA 1Y4ZA 2C9CA 2F55A 1B41A 3WHKA 2FY8A 2NXEA 4LOIA 4EDHA 1IZ8A 2JFHA 2RHMA 1GTJ1 2A9PA 1BX0A 4Z7JA 1A5AB 4G37A 3PJRA 2F8TA 4LQDA 4DNXA 3ULKA 3NH6A 3PQ8A 1A4IA 1Z4NA 2A9JA 4P35A 4U9HS 3CG0A 3KQMA 3OOSA 2OG2A 3OUUA 4S1VA 4Z4CA 1E0SA 2FKAA 2XUZA 1SCAA 2FPPA 3TQOA 4A2QA 1LEHA 3UMSA 3QV1A 3AB3A 5JQGA 4BBZA 3OURA 5E6SB 1Z4LA 4XFDA 2W8BB 2QL6A 3HWX1 5HYVA 1P80A 2VQ3A 3GLHB 4MVJA 3EPRA 3JTEA 2OY0A 2PYZA 3GRVA 3I9JA 4IIYA 4M99A 2RH5A 1P0PA 1G8GA 5K20A 1TJ5A 4QUBA 1ENZA 4DUZB 3I4CA 1IBKB 3GDOA 3QVOA 1WU7A 1FX0B 4FYKA 3EUWA 5CNJA 5C3MA 2WKWA 5FPKA 1VKZA 2FWIA 4HXFB 4ED9A 5JR3A 2QX8A 5U1PA 4AC9A 3OQOA 3N2LA 2C5FA 3JQ9A 4MYTA 3TLXA 1Y5RA 1Y3HA 4CTOA 3H6KA 3E3AA 1YCDA 2CE2X 3E1SA 1WM1A 2VBGA 2YX1A 3FD8A 2A4MA 5LZ4A 4M60A 3DYBA 1HKHA 4DSAA 1NUSA 3U7RA 1DINA 4GMHA 1TT5A 2GN0A 2VZ0A 1AD2A 3PZRA 3STTA 3UMCA 4UMFA 3RHFA 1Z2EA 2XB2A 1VKHA 2ACVA 4UNQA 5DISB 1PK9A 1UXOA 2G0AA 4D74A 2GK7A 4YUXA 3LBYA 1ULBA 2X22A 2BYTA 1AT1A 3KIPA 3WB0A 1CDEA 2D5LA 5CXSA 3GG2A 4NEHB 4X63A 4F9GA 3IUNA 5IPFA 1NI3A 1JUDA 1WXQA 3H2JA 4FGZA 2Q3LA 3GRAA 2WUWE 3CH6A 3D1LA 3IXQA 4MCAA 1KOLA 3K5IA 4IJ5A 2XNDD 3GI1A 3RFTA 5I9IA 4YMIA 5FLKA 3OE7D 1P9LA 2ZUDA 1FDOA 4XM0A 5EZYF 2P62A 3RAGA 2BMVA 3IHLA 2HA4A 4QT0A 4B46A 1BW9B 4BNMA 4L73A 1QGUA 2OFWA 5CB6A 3V48A 4GPBA 3RHZA 2QUZA 4YJKA 5LQRA 2GARA 2GXSA 4D57A 4DDMA 2BMDA 3H86A 3C3JA 3ED5A 1OFIA 1XWWA 1ND5A 1OXUA 4J90A 2X19A 4F1WA 2GBLA 3W4KA 1OWLA 2PGLA 4F2HA 4UHHA 3VNVA 5E38A 2XWQA 1W4AA 5EE9A 1O9HA 3I39X 2WD8A 2DUJA 2G36A 4LYAA 1YCHA 4HB0A 1PVDA 1O08A 2W6QA 4KL8S 4U5XA 5J58A 1FDSA 1JKJA 3OIFA 1SQSA 3PFGA 5EIXA 1ZIDA 2VYQA 5J4LA 2BOVA 4E46A 3CPEA 1OSNA 1DBSA 4DYDA 1O58A 2FWBA 4J1TA 4IZHA 3AC0A 4LSZA 4XSGA 3T4PA 1CY4A 1IEXA 1UJ2A 4OQMA 1WTAA 1FNCA 2VH2A 1BDBA 3ZJ5A 3T1YB 3A9CA 5TV2A 1KR5A 5K3BA 1D0SA 1TLFA 2FXVA 2OUIA 2OZLB 1Y34E 4IMPA 4DR5B 3TZ6A 5KKNB 2P75A 3E2MA 4BTVA 4EVRA 1K86A 4D96A 2L69A 1IM5A 4GLBA 5IT5A 5SZJA 5L3SB 3AVVA 1T5TA 1ZU5A 4MVJM 1DX6A 2CXHA 3EOAI 2DBVO 3G2NA 4CN8A 3L8HA 4INOA 9MHTA 2XMZA 1XCMA 5U4QA 4FFRA 2WHRA 1DJPA 1F2TA 1WJGA 2COKA 3A1EA 4MS3B 3DBHB 2BEUA 2GPSA 3PFHA 1RCTE 2IIVA 3I0MA 2NPFA 2C98A 1NNSA 1ZCFA 1P1CA 3KKPA 4XAQA 3UC9A 4UC0A 2ORYA 2O0HA 2PUJA 3O92A 2RD2A 3CKMA 2EZUA 2QNBA 3H6GA 3BB4A 2VPTA 1EPUA 2RK3A 2YXBA 2IYPA 1VE1A 3R24A 3JYLA 2GFIA 2GFHA 2X0EA 3ZDRA 2SBTA 3SVLA 5HRUA 4OA5A 2QQ5A 3JZFA 4UDOA 4EMUA 5L95A 1FY2A 4M3NA 1X3LA 1RRFA 1BN6A 3TRJA 1WDMA 1ZNYA 1EVJA 1U2SA 1G5QA 1F12A 5AK3A 5IEBA 3WYGA 5AW1A 4KEAA 2QTAA 1NF2A 1OLUB 2PCLA 4DLUA 4DRZA 3L8YA 1U6KA 3KKMA 5BN3A 1QE0A 4J29A 4MO9A 1AXGA 2H2AA 2FUCA 2HA0A 3ICOA 4IZ6A 4FONA 4KQXA 4RPGA 4UPDA 3FLEA 4AJOA 3GGGA 3U62A 3GLFA 4I1VA 4RULA 2B94A 4GPAA 5AYVA 2QENA 3LYLA 2O0JA 5HMMA 2I62A 1TM3E 3DGEC 4DUPA 4D81A 3ESXA 4TMVA 2QRVA 4OHYA 3CSUA 4AY4A 1WOYA 2CN1A 4FWIB 5DEOA 3K0KA 2FVXA 4V0RA 4ZQHA 4YCSA 3LRXA 3Q3JB 1YZLA 3GJQA 3VR6A 3I53A 3JQ9C 2B3DA 2GD0A 3L0PA 2Q2VA 1M2HA 3HCAA 3OEED 4DC0A 5BQ5A 5TIIA 3UH0A 1ZSYA 2CNWA 3E7FA 4W6ZA 1Q0HA 2PZKA 4L4ZA 4XWTA 3EAFA 3SP1A 4JJZA 4W5NA 1RVV1 5K6TA 1M1YA 2ACEA 2MSLA 1NVMB 1XD2A 1P74A 2B36A 2AH5A 2QSZA 2Y93A 2AI1A 4A1FA 1JQLB 3A0UA 4EPRA 1U3WA 1V48A 3A6GA 2BSXA 3HR7A 1ULAA 3KZCA 3BYZA 1KDYA 2B9EA 4ITUA 5J4VA 2OXTA 4IEIA 3BHIA 2A35A 2GN2A 5K8UA 4W8OA 3LXXA 2M32A 2IP4A 2AZMA 4DJFC 1Z2OX 3ILHA 3JS5A 4XX1A 1EFLA 5EYPB 2JLBA 2ZOSA 1GTSA 3VFDA 4DQDA 1L1EA 1K7YA 2WF7A 3DKIA 4IOKA 4XJXA 2VZLA 3CNQS 2POCA 3KQVA 4OQEA 5H1YA 2GF9A 4IGKA 1JSXA 3QXJA 6CHYA 5EC8A 1P6XA 1YL6A 4N0PA 5LLTA 5AJYA 4G6ZA 1P4JA 2EOAA 3A6DA 2ZTHA 2CT8A 1WBBA 3BN3A 3S0JA 3GLIE 2Q7DA 1M2VB 2OV3A 5L7TA 2GK3A 2OHVA 2PFGA 2GBLC 1XDGA 3ETGA 4XCXA 2PWAA 1NUQA 3K1AB 4HZIA 4PV7A 1KSGA 4UVIA 1HA3A 4DYHA 1J56A 1CIPA 2OZVA 4G23A 5AMXA 3CINA 4EY6A 1UH5A 4UUAA 1RBYA 2XD9A 1DBVO 1EXWA 3GUCA 4H18A 2XE6A 1GQYA 3KDSE 4JIMA 5CT5A 2PYIA 4MMZB 2I71A 3EEYA 3FPGA 3PQDA 2W2QA 2ZRNA 3GMSA 4J1TC 2FN4A 3P27A 5L53A 1XMSA 2CD7A 4M9ZA 2GZHA 1MQ9A 1LC0A 1NF9A 4FMCF 4KZPA 5F77A 2PD6A 4IH4A 3RREA 3LHIA 3WTCA 4AKSA 1IY8A 1T15A 2QYHA 4HVAA 2N1BA 4KX3A 2I6UA 1WMAA 1MF7A 3AGPA 4JC5A 4H0NA 3BEDA 4JLWA 3O4HA 1W1IA 5KCMA 1XMOB 4M9SA 3I9NA 2RFLA 1J33A 4QFCA 2CUZA 1ISJA 1J07A 2FU5C 1I13A 3II6X 2Z04A 3OJOA 3AETA 3NTVA 1A9XA 4ALIA 4RPHA 3DPSA 4OBXA 1A2QA 3W1VA 1T6YA 2R79A 4WZBA 2BH9A 4BVEA 3FTEA 2D4AA 4ZJZA 4CR7A 2QTHA 4ZOBA 1P18A 5F76A 5KWJA 4P33A 4KR3A 4ZVNA 4ZI7F 5AIAA 4OHRA 3SS8A 2X5NA 1RCUA 1KK3A 2QXYA 3DV0B 4YS6A 2Y6UA 4OFBA 2KWIA 3ZWDA 1H2XA 3SY8A 5FWXB 3ROXA 4E11A 5KYKA 1S89A 2FPXA 2W2PA 1BAPA 1PP4A 1KFBB 1RZ3A 2EDCA 5K4AA 3DEHA 4J0DA 5BR1A 2IOHA 2GYUA 3AI7A 3QIAA 1LVHA 4G86A 1ZXLA 1L1FA 5KTYA 2F48A 1JDBB 5KB3A 4A8TA 1W93A 2PFSA 1L1QA 1TUBB 1KOFA 1THMA 3DO8A 4KV7A 3ND6A 5FL7D 3H3FA 3DE7X 4AZ0B 1FVHA 1W88B 3IKTA 5ELMA 1Y1QA 4NOLA 2HLNA 2ZSAA 2VNSA 2AE1A 4TS3A 4PWYA 4AY2A 2Q8PA 3UHJA 1YDWA 5EUCA 3ZHRA 4R3UC 5LM3A 4QOIA 2O5RA 2X23A 3ELBA 3T3EA 1LK7A 1VC2A 1LCIA 2TECE 4I4IA 4NNPA 2QYTA 5LNK1 5A5VA 3ZWYA 4MV9A 2PVCA 2QPTA 3LFUA 3VHQA 3G3EA 2UZ4A 1N3BA 2ID8A 3IIEA 1FLVA 1ZOLA 3K0EA 3Q2KA 3ZHVA 3IR7A 2Q5OA 2Z3VA 2D5BA 3LRTA 2OBMA 1T0UA 3IUBA 3UXMA 5IKOA 5BRJA 4OXXA 9LDTA 5A4JA 2XA1A 2E0IA 4U7PB 1VHJA 2GOYA 4EBBA 3Q2OA 3BAZA 1LV8A 2Y9MB 2ONYA 4L57A 4ZANA 3WGMA 1GU1A 1OOEA 2IXEA 1NMQA 2Y6VA 5ER6A 4W7IA 3LKZA 5CDFE 4FD2A 3V7WA 2OHJA 3QU7A 1KS9A 5K8JB 2CXQA 3PX3A 4V0KA 1L3BA 2AXEA 1HDCA 2QRLA 3DOHA 5K03A 3THYA 4C6TA 3FYUB 3HVRA 1N5IA 3L7AA 5HQ3B 2XRZA 3Q5EA 1INLA 1O7JA 1OVMA 2O23A 3HKCA 4CM5A 4W82A 3ND9A 1S2DA 5MN5A 1E96A 1XTTA 3NHKA 1KNXA 1UMDA 4L07A 3NMUF 3AHDA 3QI2A 4J6EA 5HKKD 2EZ4A 4B83A 3AEUA 4HZUA 5G0VA 3OTQA 3OZAA 3C6YA 3FSEA 2CDRA 4OXKA 4Y8VA 2HIGA 3BEOA 3O3OB 3I34X 1J49A 3IL2A 1EFKA 1ETHA 2OT3B 4FOSA 2AR0A 3AY3A 3ZHQA 3B53X 3NRBA 4DIBA 4MTLA 1C4WA 5TDHA 3W05A 2SCUB 4IDAA 3UB2A 1IZ9A 1CFZA 4FUTA 1ZICA 4US0R 2EP7A 4MK4A 5CW1A 4TZ0A 2H7YA 1GVHA 5DH9A 2FFAA 5AI5A 1T6BY 1ORIA 3DQPA 1VG0B 3GZ4A 2QTCA 4LZNA 4Q1FA 4RFSA 2A8YA 2IOYA 3W3AD 4CUKA 4D41A 4HLDA 4E13A 4I4NA 3H2IA 5ALMA 2O7SA 3K96A 3A1FA 3MFQA 4AQDA 4URUR 4A73A 1QCDA 1DQYA 4PAGA 3OO0A 1EJ0A 1ONOA 4CI0B 1DTWB 3CPHA 1DEAA 2P5SA 2PGOA 5KHAA 5AKLA 1YKSA 1C3LA 3LX8A 4OXYA 4EG7A 4POOA 1QU3A 1Z4OA 1SULA 5HZMA 2ZWAA 4XLZA 2CC2A 2CKDA 4LZWA 2YJ6A 3E9MA 2D2IA 5BUSA 1E60A 2Q1SA 4H3SA 4NMXB 4YROA 2CHUA 1GPKA 1R0SA 2NZVG 3D7LA 3ONEA 2ZSUA 3DZHA 4O8ZA 1U0SY 2BSQA 1MA3A 3PTLA 3V6LA 4EIWA 4QVKA 4AN4A 1J1ZA 1CUJA 1QORA 2GD6A 1XE3A 2EGGA 3OJLA 3PUHA 1F60A 4NCIA 3KK0A 1DIGA 1L5FA 3ZUGA 4NENB 1OH6A 4Y2HA 2ODQA 5J23A 5K8CA 4AS1A 2ZR7A 2R4UA 1N92A 2P4QA 4YDHB 4BQQA 2JFZA 4W1SA 1KA9H 2XI4A 3P1JA 1KE2A 4AJIA 1K6JA 2JAHA 5LL6P 3C4VA 1TK3A 3DTVA 1FYDA 2ESRA 5LYJF 3I76A 1IEWA 3T1HB 2YWXA 4CCYA 1BCRA 1U65A 1JAXA 2CVQA 5F4ZA 4ARZB 3S7ZA 5C18A 1D5WA 3OIWA 2GAOA 4H7HA 2C7BA 2E4XA 2AFIB 2YQ4A 3LUBA 2GDJA 3HDTA 3SLGA 2GHTA 3EGOA 3R6LA 3RYHB 3T3MB 3UW3A 3E4CA 3W8EA 2MDTA 2BFFA 5ITZB 4IF4A 5DX8A 4Z5XA 3HN2A 4QJBA 4M0FA 1BZYA 3U44B 1TCVA 1UMBB 4DQKA 2NP7A 2AN4A 3MJSA 2EEPA 1H1LA 1EFPB 4TKUA 4TTQA 2YVLA 3R6GA 3VPDA 3P0FA 1Y1PA 2E5FA 4XDGA 3FUWA 3X1ZA 2XDYA 1EWTA 4P5PA 1PWXA 1TU0A 3ANTA 3LUDA 5D87A 4LFBB 1P0FA 1TVEA 4M1MA 5D01A 4HYQA 2FZEA 3K09A 4ASUA 3RYFA 1WUJS 4DXDA 4XQEA 3BE8A 2X5JO 1HEIA 2LPMA 3U4IA 3AQ4A 3V2IA 4BMXA 3E1GA 5F2OA 5HM8A 4KTVE 3AKDA 3ZE9A 1H22A 3HBFA 4DJEC 1H8ED 1ICEA 3CT6A 3IT2A 4WXRA 3NBFA 4BL5A 4JU8A 4JGGA 4RZSA 2EW1A 1JDPA 4ZYVA 3EN0A 4TTTS 2O1WA 3QPDA 2OGSA 4FXPA 3U39A 3UFXA 2DR3A 4LJRA 4MKFA 5CR9A 3WL6A 2R7LA 1KYZA 2CVHA 5JD6A 3SFZA 1MX1A 3GLVA 5KQPA 5JAOA 3ND5A 1YV9A 3WWEA 1YIDA 1AZWA 1TEZA 3CZCA 3OF5A 1HORA 4JMLA 5CLJA 3KLOA 4IOMA 5HK9A 1Z0JA 5AK4A 1Y98A 3HABA 2E5WA 1CRLA 2L17A 3F2IA 2I4OA 3KT8A 3OP1A 3DW3X 4KFUA 2QAGA 3NR2A 4PYKA 4O5AA 2Q7OE 4TKZA 3RIEA 1HT0A 4RGBA 4DYVA 1OGJA 1DDGA 2W93A 1DC6A 2AJDA 1ISRA 2HIHA 4WFIA 4BLTA 2AJTA 2YV2A 1NQXA 5EMKA 3BBLA 5TB5A 5ECGC 2WUVA 2WE8A 5KVQA 5G3ZA 3VDMA 2CLKB 5EGSA 3REQB 2EL9A 2WM2A 4AJ4A 1QHHA 2Z4TA 1GT6A 2QZ4A 3PSAA 3T3GA 4RD4A 2O8EA 4NXMB 2C7OA 3SYKA 1MNQA 2HZBA 3GT3A 4NDZA 2YWRA 4N65A 1ZRSA 1H4QA 2Q3MA 3EYWA 4HJXA 2IC5A 3DZBA 3ANLA 3T8YA 3MS2A 1MD9A 5EXDA 4CCWA 5JS2A 1EINA 1HE2A 4XVHA 4KBYA 2W58A 2ZEJA 1BIFA 2CLSA 1P7VA 3F3KA 2C2BA 2SNIE 3QHAA 5EHXA 1T1IA 1RI1A 1XA4A 3BQMB 4U7GA 2XNHA 1IEVA 4Q4HA 1SOWA 5EEHA 4GDFA 2ISQA 4IDHA 1I80A 1NRWA 4QDOA 3FNHA 1TMYA 1GTMA 2HWXA 1W4BA 3MJTA 3KAJA 4MI6A 5C52B 3HYLA 4JDUA 5IKPA 1DKOA 2DGDA 4TWBA 5FBQB 3CJTA 5JROA 1GGNA 4WL0A 5JNUA 1W85A 5JI2E 2HSGA 4IQFA 1G55A 3K0HA 1UBHS 1DAIA 1E6LA 1FTGA 1GILA 4IXNA 4M7OA 1BJTA 1P81A 5E4TA 3LPNA 5A9TA 1AMUA 4ER6A 2JGJA 8ATCA 1YI0A 1JSCA 2AHRA 1LI7A 3IURA 1PJ8A 2D4HA 3K4HA 4ZO7A 1DQRA 1VMDA 3DVLA 4DILA 4QU5A 2VRBA 3A4YA 4O08A 1Y80A 2X4IA 5AHXA 5AXCA 4DJ5X 1I3CA 1LPOA 5IS2A 2QAIA 4PYMA 4L9AA 5FLEX 3X0DA 1QUEA 2HTEA 3OLZA 4JKOA 1T9BA 3P9SA 1FTWA 2BTOA 4WEQA 1O77A 3E8SA 1QANA 3N7UA 4WRRA 1QPZA 3MWEB 4AUMA 5DN9A 2NUAB 3FR8A 4K28A 3QQPA 1IBLB 4JR1A 2IXBA 3WLIA 4J3NA 1QP8A 2JA2A 7MDHA 3DWEX 1KEEB 1N6NA 1RKBA 5EZ5A 1CSEE 1ODFA 4I08A 4OYYA 3PDIA 3AEKA 2IIPA 3GOHA 3O9ZA 4CR8A 4BO9A 1E5DA 4C0LA 4G5HA 1L4LA 4C5AA 4DXHA 2ORED 5JATA 3GZTB 5GONB 1WETA 1DQZA 1EQAA 3TQQA 1VCMA 4JP5A 2I6FA 2M6SA 2C1ZA 3F5MA 4RPIA 5DVZA 3RS7A 4H4DA 3UAZA 3S4YA 4F5WA 2ZBPA 1ZS9A 1R4MB 2BBTA 4X3PA 5CAEA 3WBFA 2Q5CA 1X7DA 4W7HA 4YNBA 6REQB 2H5LA 2ILTA 1Y82A 3VO8A 3MGAA 5LZ5A 5KWEA 1PN3A 1Y4DE 4OXIA 1WHTB 2PY6A 3CZ9A 3FI0A 2VWPA 4IJQA 4N5HX 3RB8A 5J43A 1ZOSA 2CFIA 2RGCA 3M9WA 1AUQA 3K09C 1EZ1A 3CZPA 3UV7A 4D6PA 3GZJA 3NBYC 1AQUA 1ORHA 3CRZA 4IJKA 4D9FA 4OX9B 1FXWF 3EPPA 4YMVA 4HR7A 3QHQA 1WCV1 4OEHA 4JR0A 4Y2XA 4QGBA 2PGJA 5BQFA 1MJ5A 5JD5A 3NWOA 1LF5A 4E6EA 4JVLA 2Z83A 3TJRA 4AZVA 3FCAA 3PVZA 1Z34A 2ZQ5A 3QPUA 1HUQA 2IXDA 4LXHA 4ARBA 4EHHA 5IXSA 3U3KA 4LRXA 5DFAA 4J7XA 1C3JA 1UKYA 2CEKA 3PUIA 1RTKA 4LVUA 5IJ9A 3NAQA 4IL5A 1Q0SA 3DE3X 4MHOA 4BNDA 4ZO4A 2YZNA 3S2EA 2FSFA 3R1IA 3CFYA 1MOPA 3IXLA 3NEAA 3VU8A 4C87A 1QBKC 3PCXA 1KU0A 3ZGLA 3L7CA 5ALLA 2ZWVA 1OH8A 4EW6A 4F06A 1AQ6A 3TS1A 4RJKA 2QAGC 3D02A 1UJMA 3DO5A 4INPA 3SF8B 1MO3A 3WJ7A 5HR5A 5G0SA 4EFMA 5AVOA 1OZAA 3ZGNA 4G5OA 1OR8A 1D6SA 2IZOA 4RQTA 2Z1NA 4HPXB 4BFVA 4DLTA 3GVHA 1GTZA 3HYCA 2MHCA 3ORFA 2G07A 3PR2B 4HV4A 1G18A 4UBOA 4ZC8A 1IHDA 1N0VC 3EZ9A 3VYSB 1Z29A 2UKDA 1G6KA 4OSEA 2FSSA 5I7FA 3G7NA 3ZW7A 5JNVA 4R1NA 5F9MA 5BOVA 1T6XA 4A4DA 4BP3A 4Z6KA 1Z35A 2QX4A 4DY4A 4DV5B 1VHDA 3NT4A 4GOND 2V8OA 1T4DA 2I3ZA 2D1TA 3F5FA 4IY1A 4B3XA 4BYGA 2N46A 3OEWA 1LTKA 2H18A 3HCEA 4K26A 2F4VB 4IOLA 2VUUA 3AVTA 2O8CA 2VHQA 5EINA 3OOYA 1D4AA 1W1UA 3LXMA 2PUBA 1GGMA 1K63A 1R0YA 3I09A 4FFBA 3NH9A 4KO2S 4NMHA 4XWGA 2X1LA 5AKXA 3RG8A 1NVAA 4RCVA 5IM5A 1V11B 3HI4A 5CDSA 2QN8A 1G60A 3NBMA 3KLNA 3VDRA 3ZWPA 3GLUA 1YD7A 1T13A 5CTAA 1YOBA 4UPVA 1ISMA 2CVFA 1PJZA 2IF0A 4ZI5A 2B92A 4MUEA 2GHIA 3OCXA 2AXPA 1LC3A 3LP5A 4BNUA 4Q4DA 4QOEA 3FPLA 4NE9A 2JB9A 4JJ8A 5HCUA 4YRCA 3C6KA 3PIIA 3FSRA 1V26A 1MB3A 2P8SA 1XD9A 2QN7A 4PPGA 3SHTA 421PA 4EG6A 4K2HA 4D0SA 1V7CA 3HBJA 4X7PA 1MBZA 3AP3A 1XNGA 1Z2PX 3DVAA 2C5HA 4JLJA 4F4UA 4QYIA 1U3FA 4HAYA 4PPYA 4YP1A 2GGSA 3S44A 1QC5B 1JDNA 1RTTA 1CQIA 3ETEA 3WGIA 2Q5EA 2CXRA 3LMKA 1N9GA 3EGXA 3OX2A 3F9IA 3ITEA 1EDOA 4JKIA 4UBNA 5EL0A 4LYFA 5AVWA 1KTVA 2XYGA 4RPCA 3SX4A 4Q1EA 4DLZA 2BKVA 1HETA 2XR1A 1DIRA 4S1OA 1TGYA 4FX2A 3TLAA 1IN5A 3EAGA 4FI3C 3KVYA 3OE5A 3GA0A 4Q4AB 3BILA 4BFCA 3ANNA 5DGHA 4EZEA 2HSZA 2CYBA 2IYEA 2QX9A 3CY6A 2EBHX 3EF3A 5BV7A 3T7IA 3W34A 1KEWA 3B2NA 3PGVA 1K5GA 1Z13A 3ZDZB 1P19A 2EC5A 4U9UA 1E3DA 4RHUA 3UGTA 5IMBA 4AB1A 1JHYA 2H54A 3PS9A 4LJ6A 2BCJQ 5SYMA 1BE0A 4DE5A 2XQGA 4HWSA 2TMGA 3OQBA 1I32A 3X1XA 3QPVA 1E4OA 4CU5A 1ODLA 1TIBA 3GLGE 2X6RA 4TS9A 4AK9A 1GDTA 3IA2A 4P98A 4ZQGA 1MG0A 1P1FA 3CT4A 4C01A 1U3TA 2DLNA 2PXCA 5DJ5A 5ECYA 1BQEA 1HYBA 1JB9A 1ZCJA 3S1SA 2NZXA 1M34A 2P11A 3LBHA 3H5TA 1DOZA 2GASA 1HFKA 4JI0B 3AJRA 1U2GA 1KQGA 3LOUA 3P7MA 2GCIA 3F3MA 4OYRA 5DBHX 3UT6A 3VR6D 1W87A 3EJWA 2HTFA 3SC6A 1SBCA 5CUQA 1JTFA 4BB5A 2NSDA 3A05A 3SC2B 4G26A 2CNWD 4PO1A 4ZVQA 1QDEA 3VPXA 2Z6QA 1NC1A 1V2HE 2XW6A 4UD6A 5CT4A 2DH6A 3P71T 1BVRA 1JNYA 4C89A 3JAWB 4PRKA 3GYGA 3M83A 4DLSA 1QQBA 3RSSA 1JIVA 3GQVA 2HIMA 4H4EA 4TSFA 2OWDA 1UBRS 1A9YA 5DX1A 5HQTA 1ELOA 3I5UA 5FWYB 2BD0A 3K9GA 2PWYA 3WSWA 1IB6A 2Z2XA 1XRNA 5AKJA 3KJHA 2J6HA 4JBWA 3OFND 2GAAA 4XQ0A 5DNVA 3R0JA 3VYWA 4NFYA 3HCBA 1I7QB 4LQ4A 1KFKB 1MW8X 1MU0A 2OORC 4J0QA 1FIUA 4C5CA 2LKCA 4PN3A 4UQOA 4OUKX 4V0QA 2FMFA 4OBEA 4QVGA 4YLGA 5LA6A 3JWIA 4PZZA 4B6GA 3A7DA 4XM2A 2R8YA 4DUGA 1HPLA 1KFCB 4OHOA 5LDDC 3CF0A 3TOVA 2HPAA 1F1JA 5CX1B 4RSRA 3REFA 1DU4A 3T38A 2OXEA 4G25A 4D8WA 2X15A 1VG1A 9LDBA 5AKKA 1JIXA 4G1EB 4N5LA 1I5OA 3A70A 3EH2A 1JQ3A 4JL5A 4C7BA 4HUTA 5BRAA 3L0OA 4KXWA 4FB4A 1GG9A 3C4JA 2C84A 5FOVA 3W4IA 5IVPA 4HXYA 3RU3A 4KNVA 2Y2UA 3VC7A 3D1VA 3F0TA 1TCCA 2QMUA 3GJ4A 4EB3A 2ZRJA 3WHIA 4TLEA 3GFVA 3QP9A 3HPQA 3H5IA 2R2AA 4I55B 1N0WA 5LQAA 2PE5A 5U4XA 2H4WA 5JHHB 4D45A 4ZT2A 1OB5A 1OZ0A 2VPZA 1RHJA 2IYSA 3FFTA 4JZYA 1WX1A 2QMOA 4YR9A 1NLYA 4CKCA 1IN4A 4UREA 3LK6A 4BKRA 2PNFA 3B6EA 5HJ2A 4FZVA 2AG1A 2XMRA 1U31A 2CSUA 5CIYA 2RK4A 1GV0A 1VDZA 5LQKA 5EE1A 4N76A 4OXNA 1BQ3A 1TX4B 4DIOA 1YVRA 3HYRA 2R1UA 5G4LA 1ZD8A 2C3MA 3VH4A 3PJFA 5A0VA 3NU1A 4P81A 5FT9A 4IXMA 2L2QA 4RPJA 5THQA 3USZA 1YB4A 1YI8A 3IBYA 3OCZA 3OCYA 4GSLA 5EFOA 1KAOA 3ZGXA 1TB4A 3O2JA 3IBGA 3OICA 4B79A 1NI5A 5HILA 1MC4A 4Y6SA 2ZIFA 3EGDA 2P2CA 3W9SA 2QGZA 2WWWA 4ROSA 1WDKA 2HHAA 4LFCB 1S6YA 2BHNA 4RD6A 3SIXA 2NVWA 3P9YA 4LDAA 5I9LA 5JFTA 1RXWA 2UXBB 3VRHA 3NHLA 4Q39A 4CKBB 5IRCD 1T8RA 3H1BA 5CNKA 3G2IA 5TVKA 1CUBA 4TSRA 4BU1A 4F3NA 1QB8A 3QLVC 3ZV4A 2I7DA 8ADHA 3ZU2A 5H70A 3NP9A 3DHVA 3H05A 3N9IA 4L27A 3NNSA 2ZUFA 2GCGA 4Q16A 3LU1A 5F7XA 1X8KA 4GLJA 3ZDBA 1GADO 3V4PB 3LYUA 5JZ9A 3IAXA 4C6HA 2Q9BA 2VUTA 1YR6A 4DM4A 2OECA 1FX0A 4HDSB 3N53A 2YRFA 4IP0A 2WIDA 1P2UA 2QMZA 2IXAA 2ZYDA 4KMMA 1OH7A 1EJBA 1YDGA 3EFHA 3VR4H 3EMVA 3VVCA 3AERB 1FRQA 8MHTA 2QL9A 3X2SA 2GZDA 4U63A 3UHAA 2BY4A 3ER8A 1AUPA 3T54A 4WX2B 5BWOA 3T5GA 3E8XA 3SSNA 3JYQA 1KGSA 1QKKA 1BE8A 2P1RA 4L8FA 3KTOA 2J3JA 3JALA 3ASYA 3M6WA 5M7EA 2BI4A 2IZ6A 2GCPA 3GXBA 3HA5A 3HO8A 5B6JA 2ZAGA 3A3NA 1QG6A 2LZ0A 1FFCA 1QNLA 3OJEA 2VLIA 4L75A 3UW1A 3V8EA 3GPCA 3FCCA 1U80A 4R7TA 3DZDA 4TQ9A 1HF3A 2AYZA 1Z7WA 1EM6A 4JEHA 2ZJAA 3NGLA 2CB9A 4E31A 4IV5A 4X91A 1X1EA 1JG2A 1ZBQA 2AYYA 3EDMA 3L77A 3MF4A 4IYJA 4RK0A 4RGQA 3QVJA 4WLVA 5L51A 4S04A 2CLCX 2A86A 2OGZA 4UUPA 4A3SA 2JLZA 5ICGA 3EIOA 1II9A 3EZXA 3IEPA 3ZJUA 1E2EA 2AVDA 4UTRA 1EXNA 2OYCA 4HXGA 1DTSA 1QFSA 4MGKR 3L0ZA 2Z5LA 4UAVA 5HPYB 2OV1A 4N5MA 1IJEA 4X65B 5C9ZA 3JYOA 3MRXA 3OETA 4MR9A 1MA0A 3JYNA 2C0PA 3M33A 1N6OA 3SICE 4RF2A 3V6MA 2GYWA 1WO8A 2Q5HA 4B74A 3DKVA 3JXEA 3D54D 3NVMB 3QBTA 1ZUIA 2G7MC 4JOSA 3BGWA 3N2NA 2VUIB 3NC0C 4OHKA 5FNVF 3W6ZA 1TC1A 3HEAA 5L4NA 1SD1A 3STWA 2JCXA 2BP7A 4J94A 3WB9A 3L0BA 3NBKA 3VBCA 3MINA 2W2LA 3MWYW 4BFWA 2GZAA 3HA7A 5A3JA 2Q5QA 2X8AA 3SZLA 1VPTA 2CMKA 1YWGO 4C7KA 4ENRA 1Z4KA 2DTEA 2EWMA 3W6PA 1RT9A 2RH9B 2WIGA 1EA7A 2SICE 4BFUA 1A9ZA 3VU3A 1YH3A 1TFUA 1C3EA 1DJOA 1V3QE 2HJ9A 2PM8A 3W9UA 3QMMA 3NRJA 1N5JA 4NONA 4RGVA 3BMOB 1BHJA 5K3AA 1RD4A 2C2MA 4L08A 2X9VA 2ANCA 1NYTA 4I14A 3OO1A 4GX2A 5FD8A 1E6CA 2QVLA 3FWPA 3NDPA 3FJ1A 2I99A 1B0AA 3G79A 4BJ3A 3KKZA 3HBNA 3ICPA 3U3JA 5L3SA 3SQLA 2V7WA 2CXSA 4DR2B 3TJMA 2TYSB 4KWEA 1JR4A 5H7XA 3TKLA 5LNK6 3EEBA 5COAA 1XPJA 5DI3A 2O8DB 2CVPA 2I3DA 2PTGA 4PG8A 1MB0A 4BKUA 3O4VA 1GNLA 1HL7A 1AIPA 1R8QA 2I7XA 4ZCPA 1Y5LA 4OJYA 3M5CA 3PDCA 3D6JA 4XKJA 2ILVA 4R6WA 4ZEXA 1UDCA 5K51A 5C53B 3R7FA 2EQ5A 1E2KA 4H0CA 1QIGA 4ZQCB 1WXGA 1M0TA 1GA1A 2RGDA 3CH4B 3IBCA 1BS1A 1ZIOA 4RA9B 4CLHA 2FN3A 2QS9A 4HNAB 5CH5A 1NLZA 1AKQA 3EULA 3WLKX 4G4GA 1WDWB 4HRVA 3SJ7A 4D6XA 4X85A 1EFDN 1HE1C 1XFAA 3CSDA 4Y2GA 5CG2A 1CZHA 1RP1A 2GAFA 3EODA 4ZYZA 5BW4A 5IANA 3BB1A 4F2DA 1YJBA 2VZ9A 1ZXBA 4QBTA 4TN1A 5ALFA 4F56A 1B6GA 1EA5A 1OLUA 2BIFA 2XVMA 3OJWA 4RFVA 1CJSA 1F8FA 2Z5VA 1SC3A 2VCEA 3H99A 3M6IA 3MA0A 4WPGA 1E79D 5AOCA 4ZXPA 3ZK7A 2AT1A 4H6XA 3R9XB 5HFAA 2QRPA 2HYDA 1P5HA 4R1UA 1RC8A 1PZGA 2B1GA 5DTMA 4EITA 4MKHA 4RSHA 5LQMA 5LOVB 1EXMA 1U3CA 1E3IA 2A5LA 3LT2A 4MMXB 3OESA 1JIIA 1ECCA 3R9WA 4P6VF 1EXDA 1FFDA 2PSFA 2AMVA 3VC2A 5BN1A 1JF8A 2ONZA 1MJHA 1XLVA 2DBQA 3PHIA 3PKZA 4KJXA 3ADPA 1TZBA 3VH3A 1CE8B 2P5UA 1OI7A 4O6VA 2XF8A 2QSJA 2DOKA 1M2EA 4HQLA 1V25A 3D3WB 5J5VA 2Y92A 3ICCA 1EGQA 3TZHA 3WSVA 2J87A 3MQ4A 1WUYA 1USKA 1HNZB 2E3JA 2YWDA 3TZCA 3ME5A 1SXJA 2FWNA 4JQOA 1ZCAA 1Z75A 4P3YA 4PLWA 2LE0A 4ZCQA 1M8FA 1D2HA 1FRFS 1F6DA 2NNLD 3C15C 3CU5A 3E22A 1E0KA 5DBIA 4NS1A 1Z28A 2R8ZA 5C5EA 4BLWA 2HJRA 4LAFA 1KQ3A 5BSFA 1JLHA 3DC2A 1HFJA 2Q6LA 1OCEA 3ZIAA 5EVCA 4PS0A 4JBYA 5BO5A 4BNVA 3T1TA 3EIFA 2WU8A 4UM9B 1PNRA 4FOLA 4C6RA 3MW8A 3OTWA 1EFHA 3STUA 2FMIA 1MDBA 1BXRB 4IIXA 3ZNOA 1T6NA 3PT5A 3G2MA 5DB4A 1SWWA 5EYPA 1DWPA 2QLLA 3EC2A 4K9NA 1Y8ZA 4XVRA 1O3YA 4N8SA 1R74A 4FFSA 4FJ1A 3DT6A 1UBJS 1QUFA 4EUEA 1QYRA 3NWEA 1SIOA 2ZIXA 2E37A 5D7NA 5A5EA 3IQIX 3JYHA 4EAQA 3RSFA 3DDOA 4OM7A 4PGFA 2BAGA 3T0FA 1EHIA 4IHQA 3GB9A 4PF1A 4YRLA 3D59A 4BQOA 5P21A 4K3UA 3A2NA 2CV0A 1QDLB 3OTOB 3KZVA 1F9AA 2JJQA 3KTAA 4UHEA 4LXIA 4EPWA 4W9NA 3V4OA 1P2BA 3QA9A 4M0LA 2HU2A 1AKNA 4Q3OA 1KYXA 2PAFA 2FEPA 5K6RA 1XNHA 2Q5LA 2VR1A 2XDWA 2CXUA 1U5BA 3B8HA 3CXUA 3L8GA 3PK0A 4KH0A 1RPZA 3B36A 2FW0A 4MV4A 1DXQA 1FXUA 4JLUA 4TWRA 2IODA 1R10A 3RANA 5I7HA 3GO4A 2GCNA 1IVNA 2DPLA 2GHQA 4MP8A 4L7VA 3W3AH 4XEUA 4M89A 3RM3A 4JBHA 1BC5A 1ZD9A 3ZCSA 4ARZA 1K5DA 4DADA 3ZCXA 2I4NA 1BCSA 4PYQA 5F23A 2A4KA 3BWBA 1GG8A 3R3VA 2C1EA 2OFPA 1FL9A 3HE3A 1OFHA 1WOMA 3I2KA 4PSDA 1CS0B 3EY4A 3GEPA 4OBBA 4P53A 1PYOA 1ZL2A 4U1RA 5E7IA 4NAUA 1UODA 3ZIUA 1C8LA 1XLTA 4CM3A 1T10A 1X7HA 2FRVA 2C42A 3V7FA 3FOFC 4OSPA 3HUEA 3TTUA 3KS9A 4EI7A 3B12A 4O2AA 3EX7C 1E1CA 2A9VA 2A1TS 3AHGA 1FSZA 4KQCA 3ZWKA 1ID1A 4ZICA 4DG5A 2G77B 3G49A 3VO2A 1H94A 2H92A 3Q6NA 3ZX4A 2JS7A 2RJOA 3FYTA 5FO0A 2QTTA 5DM4A 4H3KB 1UAAA 4LHXA 2ZR0A 3E05A 3VAZA 4HXEB 3ZXXA 1Z73A 2GBCA 1T34A 5EJ7A 3DLIA 2B4RO 2VXCA 3ESDA 3HM2A 4MPPA 1TVCA 3C7DB 4GYYA 3RSZA 5DN6D 5FPQA 4EJSC 3AVOA 2FQQA 2OXFA 3IVAA 4LY9A 2P9GA 1J7KA 3TH5A 1RDFA 4WLOA 3BCRA 4BC1A 2Z6AA 1OB2A 1P4HA 1W88A 3ESQA 4EGSA 1CR2A 4QQ8A 3N6VA 4KRXA 1MVLA 1Z25A 2ZB8A 3TQFA 3L7YA 5KYXA 1QQAA 3WGQA 3I05A 1WP9A 4BCCA 1ILWA 1K8RA 1U28A 3CTMA 4AKHA 4LSMA 4M86A 2C9OA 4AN1A 1GEGA 4YJDA 1AV7A 5SICE 1ANKA 2AJLI 3E9QA 1UJ6A 5DXFA 5TQ0A 5C8YF 1GVNB 3F7TA 5BQ3A 5BPHA 5KTNA 5JYDA 2XGJA 1X7ZB 4G5GA 1Z4QA 3FUXA 1FJ2A 3VR2A 3PD0A 2PN1A 2RCNA 1AGYA 3ETNA 4BNYA 1NRJB 1COWA 1G17A 4GGPA 3DAGA 1G9SA 5CCBA 2UUCB 3O21A 3HJBA 4BKOA 1P1JA 3L1VA 1Y9DA 3IJRA 1CR4A 3OA0A 2PNJA 2HBRA 4ETIA 2BGRA 1ARZA 1I3MA 1UK8A 1D2EA 1TQDA 3AJDA 4RE5A 1V3TA 4YRDA 4EGCB 4ISCA 4ZZ0A 1D7OA 1D6MA 2P6MA 2QA5A 1S2MA 3A25A 5KOIA 2WOOA 1WR8A 4UJ5A 2VWQA 1LRJA 3V8NA 3R5FA 4P7FA 1J6UA 2ZYIA 1SXJC 2HAEA 4WASA 2H7VA 2QRNA 4ERXA 5ARBA 5JIBA 2D8MA 3KOOA 1SCQA 4YMWA 4HLQB 4KO4S 2MOKA 4KFCA 3L7MA 5HFNA 3DO6A 4G3XA 1FUYB 1GKLA 3NHSA 1XTRA 2G9UA 2JBAB 5JWRA 4WBNB 5LMUB 3D6AA 2Z5FA 5REQB 3S40A 3HMQA 2LR0A 1GHTA 5GJWC 3N2GB 3UMRA 5KYWA 1E61A 4ND6A 1M5RA 3ENVA 1T29A 5JAZA 3JQQA 3CVJA 2GSDA 2PGDA 4PLHA 4PLGA 1RZVA 4BYMA 4L4UA 1AMOA 3V4RA 4JA0A 4IJWA 3RRZA 2OD2A 2BEVB 3TSOA 4A5SA 1RI3A 4YI3A 1IOZA 4RTKA 1F7UA 1NVEA 1T9GR 4HH4A 3HDHA 4CF4A 3B3JA 4DIMA 1RZRA 1NATA 1I2CA 1NTOA 5JXGA 3FCYA 1W47A 5K1ZA 3OIDA 2RAUA 3UXEA 5IUNC 2MSKA 3GUYA 1NJSA 5B2EA 3A4LA 3AVYA 1P45A 3IH5A 3N0XA 3TDKA 1XTVA 1MV5A 1ZRNA 4NAHA 4FHGA 1ZMRA 3K92A 3O1JC 1E20A 3WYCA 5ICMA 1WUKS 3GRUA 4JEMA 4QSHA 1LSUA 1OT5A 5J2UA 1WUTA 1ZJ4A 3D4OA 1OA0A 3FNGA 3I2IA 4G41A 5B7GA 1FDRA 1VG9B 1FJGB 1NQUA 2WG2A 2C5LA 2OFOA 2QW0X 1WXDA 2PGNA 1Z5VA 2H8KA 3L1KA 4LISA 2QVXX 2VHVA 4L6IA 4DANA 1BDHA 4WWHA 1YB1A 1KJZA 3DWGA 4EJ2A 5K5EA 4K6KA 1FFBA 1RVDA 2O3RA 4E2YA 4GMKA 4CQNA 5DSXA 3RUAA 1BH2A 4NJOA 4HGQA 5CITA 1OLXB 2HDHA 5J40A 3QWBA 4KWTA 4CG0A 1NKTA 2D0DA 2NVUB 3UKDA 3ZLJA 4Y18A 4C2AA 4C7VA 1VB3A 1YR8A 3T7JA 2GMWA 3K32A 3FFXA 4CIDA 1NN5A 1QMPA 4MW6A 4B8YA 1NMZA 4H1HA 1W5TA 4HTFB 4WINA 4U8GA 3EA0A 4HNGA 4NP6A 3X2EA 5F2NA 1EFUA 3ER6A 1XNRB 1NR7A 1UP6A 2QMHA 1Z0AA 1YFZA 2FG7C 5BSTA 4XGIA 2AA3A 2K7ZA 1K5HA 2ZSEA 3DOIA 1SKYE 3EARA 4HPWA 3D8RA 4HUJA 5FOQA 4ZEOA 1H2AS 1RXEA 2GWHA 3T7CA 5B4VA 2Q5JA 2P35A 4G4SP 4FYMA 2QYSA 1W5BA 2ZYRA 5LUBA 3HXTA 1LFDB 1MZVA 2DQ4A 1IIRA 4P22A 3S28A 4LHWA 3K05A 3C3PA 1SVNA 1BSVA 2NO1A 3LUAA 3MMSA 3EEOA 1U28C 1PJQA 2IZ7A 3RU9A 2W42A 4EG8A 5JAMA 3UHFA 1REQA 1PSWA 4G0XA 3EY9A 4CPDA 4U5QA 3JQ8A 5H02A 3FSGA 2QVGA 3TZEA 5KTOA 4YP9A 2O2CA 4RK5A 2FEKA 1AZSC 1WXFA 3B3GA 1GFZA 3GDFA 4PYIA 1B8VA 1X92A 2WU4A 3AB8A 3BL8A 3LBFA 2X6QA 3RIHA 1NVXQ 3K0FB 4MJXA 3AGQA 1QZZA 2AC2A 3IUJA 3BGIA 2P2GA 2R6AA 3NI2A 3S3TA 3ZE1B 4MVJH 1OROA 4NYMQ 5ADHA 1EK2A 2VQSA 2UAGA 3OTHA 2VA9A 5KOJB 2OOKA 1ZNZA 5CXQA 3FE2A 4KPGA 1PJTA 4YY3B 3LA6A 4R8SA 5D85A 1IQRA 3ZW8A 2ZVQX 1I3OA 4PIPA 4Z51A 2VSXA 5GIOE 1HRKA 4ZDJA 4K7JA 1C1DB 2WILA 3A3PA 3I1IA 3L84A 1CZUA 1Q14A 2G9VA 3MQ2A 4Q00A 1YS6A 4QTYA 1XQWA 3RLFA 1A3CA 2C82A 1ULSA 3MJ4A 1NJ6A 2OLKA 3OFJA 4MI1A 4QTZA 4RM2A 3GEGA 5E3HA 4BLSA 2DTXA 1U1FA 1JH8A 2XB9A 2O7QA 4TSFD 3OUTA 2XMSA 5JE8A 1R0ZA 5BXQC 3HR8A 3CWCA 3HCDA 3SM9A 4PTLA 2HCJB 3HB7A 3OBIA 1YQEA 1E5QA 3FPJA 3E82A 1XEXA 1U8AA 2LNDA 2XEDA 2RBGA 1RPAA 2QROA 1LS6A 4IIGA 2FRDA 3AVUA 3H5OA 2NXWA 1UMCB 3NANA 3CUTA 1Z08A 1LLUA 2PRKA 1CG6A 1D1TA 2VDJA 3M82A 4DSNA 1QIIA 1J23A 1KVUA 1M83A 1MCZA 1D04A 2VHXA 4YREA 4A6EA 2B30A 3PI7A 4AIIA 4D80A 3ER9A 3SIRA 2J59A 5BPFA 3DKRA 4DUGD 1T0IA 3C8DA 4QQNA 2NYUA 3K9NA 3DM9B 4JQYA 5GMOA 1XFDA 3RSGA 2VT7A 2CY0A 3IQDB 1H65A 1Q1BA 2HD4A 1ZD5A 3AF4A 5ALIA 3IJ5A 5IDYA 4DLXA 2JIMA 5JVDF 2FR1A 3DTYA 1UKCA 1MXHA 4I4TB 4N9QA 4LMBA 1AGXA 4O1IA 2YFKA 2BGIA 2ZPAA 3HKBB 2C9YA 1I1HA 1ZO8A 2PZAA 4TT8A 5ERYA 3KYCB 1BD4A 5C4IA 1X1RA 2IU4A 5HZGA 3BZBA 4FE3A 2FJ0A 3DOJA 2W70A 5JS8A 2VXYA 2J9YB 1H93A 2DG2A 3ISJA 3N2KA 5H0IA 1HO3A 4NJMB 4QG7A 2DFNA 2GPNA 5DM60 1J39A 2RAPA 3M70A 3OY2A 4RV4A 1GGFA 3AFHA 4TXNA 1PJ3A 4A9AA 4X7MA 1V8ZA 3FPHA 4INAA 4QPPA 3CTPA 4MW7A 4O29A 1QYVA 1OXBB 4R9NA 1PFKA 4HF7A 2VSOA 1GRRA 2GNAA 1PUIA 1CEYA 1JU9A 1UF9A 3B52X 2LTAA 4ITRC 2JAWA 1XDDA 5JNTA 4JSYA 1EUCA 2O59A 4J75A 4WXHA 1J24A 1I6LA 1L9KA 1T9ZA 2VDUE 4J1NA 3V7NA 2ZZMA 2O2XA 4CMHA 1XDUA 3ADCA 3HFJA 1K92A 3DLBA 1X1AA 4EPXA 4KLCA 1XRPA 4B35A 4O0MA 3ZWMA 4FNOA 1WMBA 3FGZA 1G19A 2JBHA 4KO8A 3L4BC 2P2SA 1KEEA 2LKDA 1F8UA 2BFCA 1M2JA 4R6XA 4YT8A 2VAXA 1NXXA 4PQRA 4QXMA 1W2GA 3HNPA 3ADOA 3RG2A 3MQFA 1U2PA 3UAVA 3L2OB 2P2DA 3W2TA 3E8MA 3WHLA 2WAMA 4DRXB 1YQDA 2O0MA 4YJ3F 3UMBA 4QT4A 1YAJA 3CZMA 3D8BA 4BIMA 1QIJA 1L8OA 2WKRA 1BGVA 3UB3A 4BEJA 2C2YA 1W30A 3FVQA 3QNUA 4MXDA 1RXSA 1Z6XA 2J5KA 2OB1A 3HHEA 4IG9A 2F43B 3HZRA 5LDHA 3LTEA 3DZCA 5LZ9A 2EBWA 2V6MA 3KZNA 2PUTA 2HWYA 4O1HA 4JVSB 3GP3A 2EKLA 2XJ4A 3GXOA 1H4TA 1WHTA 3I9V1 2XAAA 2NZJA 2ZXEA 3IXMA 4WCFA 1BYIA 2ZCUA 5K3FB 3SJUA 4DAOA 1D2AA 4UNNA 3QKRA 4TWJA 3FMGA 3FKSA 3IR5A 4BGUA 2FZCA 5A3SA 2D2XA 2AGVA 1I3LA 4RHCA 2D0IA 3LF2A 4NCJA 4G85A 4ENVA 3NCTA 2UVQA 4GRIA 5EE3A 3PX7A 1AKRA 1IDN1 4NCAA 4XARA 1KPGA 4FCTA 3ZJ4A 2QY9A 4PANA 4ZMRA 2VBFA 5FPPA 3OKPA 2LRHA 4AYWA 2ARKA 2VG8A 2JLRA 2AE2A 3CIFA 3F74A 5JAHA 3EXEB 4YK7A 1GNPA 3QELA 2EEZA 3EIUA 1HYQA 2OBNA 5ALEA 4DM3A 5DASA 5HJ7A 3IAM6 2D6FA 1WZ2A 1C8KA 2P2NA 2G0TA 4IIHA 2Q49A 4CM8A 4DVGA 4HEHA 5EXXA 5IT9A 2QZ9A 3VR6H 1KYTA 1KDPA 3SF8A 1U8EA 1GDDA 4WZBE 1NXQA 1FRNA 1WCYA 1XK7A 2PRJA 4J1QA 1HURA 3K0AB 2PKYX 1W4ZA 1KYYA 2W83A 3WK8A 1PD0A 5CD9A 1KPHA 3NB0A 4YRIA 4KI0A 1HDGO 1LLDA 2XB4A 3WIEA 4EMBA 2ZSHA 1G3QA 4MDHA 3T7RA 4GECA 4F72A 3MWLA 4WBXC 2X4LA 3IA7A 1CYDA 3RYCB 1P0MA 1ISFA 2O06A 3IPRA 1FOEB 1EDZA 2XCUA 1OJLA 2W6JD 4A36A 3VHLB 2G06A 4IFEA 1S2LA 3MGBA 2GZ3A 2ZRPA 4Q93A 3RS2A 4KXYA 4N03A 1BEEA 1S01A 1L7XA 3GJRA 3JYPA 2W2LD 3LVFO 1TDJA 3L6OO 3LHDA 1T2FA 3S2UA 1V11A 4CIYA 2V5UA 1VHTA 1ZUHA 2FW8A 3EXHA 3Q8XB 3W2HA 4C7XA 3R3JA 2VJYA 1U7HA 4RESA 4EY5A 5JW6A 1ENYA 1KS2A 2R8EA 3CEHA 5LN1A 1N36B 4AUEA 1SC4A 2ZULA 2QLFA 4QRDA 3RS8A 3ZIDA 2Y1GA 3IMCA 2FNAA 5SY9A 4TRNA 1ZH2A 3AK4A 3IHWA 4X1YB 4DDTA 3OC6A 5FBHA 1NW3A 3NVAA 4LOJA 3WX0A 5LP6F 2WWYA 1L4HA 3IELA 1E7YA 1N78A 2JH3A 3OE4A 2NU7B 4DSUA 1BVYF 2OMEA 2OM2A 1ST3A 1RADA 4YRKA 3FNRA 1QAQA 1ENPA 1T26A 4IGEA 5TEWA 5HSGA 1TZCA 3K20A 4GE3A 4U0JA 5AVVA 5T57A 1L7NA 3A10A 3IOYA 3H87A 3I01A 3G5AA 1UPUA 1MC1A 3RS3A 5IYZB 1YIAA 3PHBE 1SCUA 3V2HA 1OREA 3K9CA 1DT3A 3ZD9A 1WG8A 3FH0A 1F8YA 3PF8A 5CFZA 1JV2B 4XQGA 4YUZA 1SA0A 4DDWA 3JW8A 3VH1A 1L7MA 1KH1A 4I9HA 2OAGA 3PDJA 4HYTA 2WMOB 5E1DA 2P3OA 3HP7A 3T06B 3GVPA 3L4KA 2UYCA 4M0CA 3FTFA 4BMNA 3Q3EA 4QASA 3V4FA 3M34A 3GBSA 2MINB 4DEXA 3MCZA 4EDFA 1NT2A 3GARA 1JLLA 1ETUA 1VHQA 3G82C 5LFAA 2I6SA 1MC8A 1XN1A 1QIFA 1FMLA 1C0LA 4XSVA 2J9FB 2JFQA 4ZRDA 3GFPA 1WHSA 3VMFA 2I1LA 1E5VA 2X1HA 2X9GA 3RHTA 3WICA 1UP7A 4WN9A 4Z0HO 5K2MA 5A3VA 2G82A 3PEUA 4KLRA 2VF2A 4PFKA 3D8HA 1NJ5A 3F73A 3ZU5A 3IDSA 5K0EA 1RKXA 1ZQ1A 4WCFC 1L8LA 3PE6A 4QE3A 1AKYA 1G3MA 2XRFA 4BO4A 1Y6ZA 5DLDA 3PUYA 2J3IA 5LQDA 2BLLA 1P0QA 5G53C 2B82A 4HBZA 2J4FA 4PSUA 2X0DA 5A1JA 4JI8B 3MMNA 4MMYB 5BNWA 4HI0E 3GCZA 4M38A 4HVTA 4KN8A 1OXMA 5CYGA 3F49S 2Z1DA 3I1YA 2GI4A 1M67A 3MZ0A 4E2WA 2O2YA 1XZKA 1CZRA 3DULA 3TIXB 3T5TA 3ACCA 4HMPA 4P92A 4AFNA 3SC2A 1SXJD 3PNSA 1N57A 4R1MA 2H4ZA 1RYZA 2Z2JA 1SEVA 4XUEA 5TF0A 1VPWA 1ML3A 3AM3A 4DA0A 2DLCX 1DRJA 4UCQA 5FPYA 5TEVA 1H5QA 4Y2QA 5JTUA 5IUKC 3DQQA 4V38A 3ZIAD 1ESCA 1ZZEA 2GN8A 3V1LA 5IBCA 3PR1A 4I99A 1JJFA 5A03A 3N0RA 5GVRA 4CEHA 1WNFA 1RKUA 3A6ZA 3FUTA 3NWPA 4LNHA 4UW9A 1B76A 2XCOA 3USCS 3ZZ1A 1MFPA 4XYLA 1UOPA 3O8CA 2E85A 4JFAA 2D7DA 4QGAA 5B7QA 2Y1KA 4GPD1 2IJGX 1R4NB 1WVMA 1W96A 2BEWA 1SG9A 4TLBA 4F3RA 3RCBA 1GFSA 1WF3A 1YI1A 3TVYA 4ZCMA 4DABA 4NCBA 2QRHA 1J8VA 4D3ZA 1Y1LA 4LV6A 1QG0A 3DOUA 2I4LA 1P9NA 3A4TA 2CFRA 3IVXA 2IPNA 5HMLA 2FPMA 4B40A 1ZYUA 4Z0NA 1RZUA 3KB6A 4YQEA 1HDXA 1K1EA 3DOOA 2Y0BA 2QRGA 4U02A 1USGA 1XSEA 2EJTA 2A30A 2VRWA 4YUVA 4Q7KA 3WK5A 4DMFA 1P9OA 1L7BA 3MJHA 4AM8A 1R6XA 5DP1A 1CP2A 1W8IA 5AI4A 2ZUBA 5CX1A 3WXBA 3X1MA 3BF8A 3T7TA 1SOVA 1GLGA 1C8VB 1SXGA 5I9BA 3T5CA 1TEHA 1KEZA 1QH1B 4M1WA 4P3XA 4R01A 1YBVA 2OAP1 1L5ZA 3FR7A 5FBLB 4MKXA 3SX2A 3T3DA 3W0LB 2E55A 2YBEA 4EHFA 4HDAA 5CM9C 2V6IA 3S55A 1LBIA 4LXUA 1DARA 4YRBA 1WB9A 4JYCA 2QUBA 3LY9A 2YKGA 1CP3A 3Q8LA 1X1DA 2NAFA 3F2VA 1Q5PA 1D2MA 1E7WA 1EESA 3QYFA 1G7SA 1MH9A 5AWFC 2AD5A 2VPWA 3EZFA 2MCFA 3QKUA 1E6MA 1WZEA 3CURA 4KGDA 4QU8A 3UJHA 2IBTA 3ABOB 1QRUA 1U0RA 2VQDA 4NOJA 3PTZA 4FFVA 4KHZA 1VLHA 1P0IA 3DT9A 3KJNA 2R3SA 4JQZA 1R18A 4NMWA 1KVTA 4KW7A 1MEOA 1XJQA 2RGAA 2OBYA 2PKQO 1G2QA 4DPLA 5FO1A 3BJIC 4L8YA 3QNMA 2W98A 3OUZA 4ZREA 1V95A 5FOXA 4M6WA 1S02A 4NNOA 1EUQA 3CMCO 4Q4LA 4YMSA 4CDNA 3WLMA 3RC7A 1VM6A 3CUVA 1Z2AA 4Q9KA 1JEOA 5ALTA 1N32B 2PWZA 5HUHA 3H17A 3HV0A 1CC1S 4HDMA 1P6UA 3H0CA 3B5IA 3NC4A 4A6XA 2Q21A 4LJ4A 3UBMA 1V4BA 3FHJA 2VP3A 1U7TA 4R69A 3SG0A 4FLFA 3I9LA 4KQJA 4NIMA 3T9BA 4CKBA 1MB4A 4K03A 2ZI3A 4B73A 1N2ZA 2SECE 1EP2B 3QIVA 5G40A 1T24A 3UK1A 4BRZA 4RVCA 2OENG 3QXXA 4MQBA 5JS6A 3LK7A 1J5PA 1E3TA 3OJ0A 2BN4A 3ZUPA 2P69A 2R6ZA 4G07A 1GRCA 4MVJP 4KLZA 4M1TA 2OE2A 2IYXA 4O4IB 4XCVA 4ZAZA 3WJ1A 1GGKA 2OYSA 2QR3A 5B1IA 2XCTB 2V45A 4BY9E 3I62A 3UJPA 1ZMBA 2I6TA 1VI5A 2IYVA 4TLLB 3VR2D 3I52A 1QHSA 1W8DA 2C1XA 2OHXA 2FPIA 2QPOA 4MYUA 3V1NA 3FPBA 4ZCSA 3FF4A 3OIGA 5I47A 2GPAA 1TJYA 4LZJA 2NLOA 2CZGA 2OEPA 4GZLA 1OTXA 4WJZA 3IVRA 4EA8A 5K0TA 2RHTA 4ZT5A 4PW0A 2JHCA 3WGYA 4JBGA 5IAOA 1DUVG 5FR1A 4YPVA 4ZKDA 3ZD7A 3ERCA 2JI9A 1FFYA 3H13A 2Q29A 4HFRA 4QQKA 1T36B 3A0RB 3EOBI 5H68A 3SWWA 2WFLA 4CNQA 4DQ0A 3TFOA 4D98A 3K15A 2CD9A 4MNTA 1QQ5A 2WE7A 4RWZA 1FNBA 1GPWB 3MWGA 3ZHTA 7YASA 3KXKA 1CTQA 2XUAA 1VXOA 3OU6A 2I66A 1QAMA 3EFOA 1U4SA 4QTUB 3TZBA 3UGQA 3WISA 3ZCQA 4HNVA 1WQ4A 2D1RA 4US2R 3UKOA 2AUNA 1U11A 2AYXA 3NWJA 5T7BA 4CEIA 1NLUA 1NW4A 3CZQA 3NPAA 4P3NA 1V4VA 2GDZA 1K27A 3QUAA 4DLAA 5B3KA 4RV5A 4OHPA 2ODWA 2PRSA 3OPNA 5K0NA 2GKGA 2C31A 2F3SA 1GO2A 4HEA1 1CUSA 2ASVA 3BH6A 4WZAA 2VCYA 3Q7IA 3AI1A 3B85A 3Q7TA 4DY6A 5BUCA 3AKZA 4DXAA 2RB4A 2Q62A 4L1KA 4NESA 4TXJA 5JAUA 2Q3JA 5CA0B 3M9LA 1DAHA 2MTBA 3NNDA 1W2HA 1AF7A 2H0AA 1Z5OA 3SXUB 2IYRA 3TMYA 1AQIA 2QL7A 4P4TA 1TJNA 3ONNA 4KPEC 5BUQA 2VP4A 4LNUA 2X0KA 2XNJA 5CTJA 1E0AA 3CCBA 1DHRA 5JXWA 1DTEA 3JQ7B 1E3LA 2NWQA 2ZAOA 2ZFUA 3H42B 2LV8A 4JJFA 4R41A 2I3BA 2GN6A 1V4NA 1NASA 3AYZB 3UWPA 2BDUA 4JBNA 5F2EA 5GGXA 2Z8YA 2NUTA 3MRSA 3RC8A 2A9RA 2IS4A 2ODNA 3EIEA 5EJ8A 4PXYA 1J8MF 2XBMA 3V8MA 3K0BA 4I55F 4ZT4A 2X8JB 4UUQA 1H5UA 3DL2A 2HWWA 3BK2A 3K1YA 1F20A 2WZBA 3LBNA 4UEOA 4DSTA 5JBQA 2R5FA 3KAKA 3PXCX 5KHLB 1K66A 1L3CA 2VHTA 3JQBA 5B1DA 1US8B 2ISCA 4YJGB 1SQ0A 3VKVA 3OZIA 3FX2A 1HNXB 3GDHA 4XR9A 1Y3DE 1J00A 3FWKA 4LBWA 3FHOA 5FUBA 1JPJA 3K6KA 3HY6A 3NJ4A 4HQOA 1KXJA 4YBRA 3USES 2QAJA 1KRXA 3VOSA 1NPYA 2JK0A 2PVPA 4ZVMA 3HK2A 4QO7A 4CWAA 3D8NA 1FYWA 2IX9A 2WWRA 4HYYA 5CH8A 1SB9A 2GM9A 2R1TA 3KVVA 1WZNA 5I4KA 1OXXK 2I2WA 3G88A 3A36A 2PXHA 4RIFA 2HRZA 1S8OA 3X1JA 1P9WA 1NQWA 4JEIA 3SJAA 1LH0A 2QUJA 1Y3BE 2M6RA 1NUPA 1UKBA 4IHKA 4DCMA 1XZAA 2ONCA 2G9RA 3S2SA 1FNNA 1P44A 1MRZA 2NAPA 2PWPA 1ZFNA 4DLBA 3KCNA 3KOWA 3R3SA 4RDXA 2NT3A 4TRMA 3UWOA 2AWOA 3A4VA 3WMWA 2XWSA 2ZS8A 3DFKA 4ODIA 1Z7YA 1DLIA 1SU8A 4GPTA 3TLGB 4BMZA 4Y6PA 4C4AA 5LIRA 5LBIA 4B75A 4RS3A 1PR2A 3EXIB 2HHHB 3VNBA 4H31A 2ZUEA 1HG0A 4EG0A 2VDLB 1M73E 5E7MA 5JH7A 4JL8A 2IOFA 3NUZA 2B5OA 3HGQA 1T2CA 3I73A 4M7PA 1KFEB 1P5RA 1XD8A 4S1WA 1NUUA 4OB6A 1GUYA 3GJ5A 3KPWA 1QP0A 3IULA 4OHFA 3H0KA 4B3CA 3K4QA 5AJXA 2I5PO 3KXDA 3UHOA 3D1JA 1K7EB 1VIYA 5EP2A 3SS9X 4FJ0A 4AW9A 1JQDA 2ACWA 2KI5A 2DP4E 1WUHS 3H6HA 2OYRA 5AW6A 4DA7A 3QFTA 2HGZA 1ZL0A 4PQEA 4BP8A 4ENSA 3E3LA 4YJHB 2NZUG 1ZINA 3PYMA 2QZJA 4MIOA 2EKBA 4UOQA 5DOZA 2AXQA 4ZVPA 3TD6A 1KR2A 4LQCA 2UYOA 2ZTUA 1PR1A 3GVCA 1SBNE 4LVCA 4DDHA 3VO1A 2GM5A 4Z9AA 3ZY3A 5SZHB 4REQA 1BWQA 3N05A 2Z8YM 4FLMA 4P4SB 3ZHOA 4BAZA 2WU1A 1DXHA 1RRVA 3BMNB 2VNHA 2YMQA 2OBLA 3MLEA 4YP6A 4YTEA 4I50F 5AXDA 2ZB7A 3L18A 1G9TA 3KU1A 2GXUA 1TZKA 1NRIA 1I3NA 5JDCA 3UANA 2GBGA 3ZGOA 4GPEA 5DBFA 1VLMA 2VDMB 2J3EA 3CNEA 1M2OB 2ZRIA 4QPNA 5JAQA 5JZSA 5JEDA 1R3DA 1ZAKA 1CY6A 1ODCA 1XZHA 2WQ7A 1OGYA 4QDTA 1H0HA 1YDFA 3F4BA 3VKWA 2AWNA 2E5LB 4K9RA 1SBHA 2AEFA 4G0VA 5TJ9A 1GAXA 4IRXA 2AI2A 3AR4A 3HN6A 5DHTA 4FGUA 5BN5B 3ZKWA 2BH2A 2RG1A 2WI8A 2Q1UA 2YYYA 1USWA 1SKQA 1QO7A 3CUUA 5MF6A 4LF6B 3B1JA 4C7JA 3ZBQA 4EFNA 1X9IA 1I30A 4BNZA 1VJ5A 5HX7A 2V7TA 4G4JA 1K0UA 1LSJA 1WKVA 3NGMA 4ZGBA 4BLVA 2GM3A 4RY0A 4LXTA 4UMEA 5AOVA 4EATA 2IXFA 4IS2A 3IVMA 3O2QB 2IYUA 4BJHB 5HEKA 2ETXA 3ILVA 2XHEA 5ABPA 1NSTA 5J47A 1KI6B 2BUCA 2FHSA 3LYAA 4WD3A 2IOFK 4UEJA 3IDAA 4D3SA 2X2EA 4QEDA 4ZV7A 3QPWA 3EWAA 4MCIA 4MULA 2OFFA 2JLQA 3BXPA 4PIVA 3ITNA 2IEGA 5KDLA 2CXPA 5AM2A 1DG9A 2EFGA 3GLGB 3P2YA 1ZOIA 3ELDA 3R23A 4JLDA 4XUDA 2WIBA 2F7SA 3NHJA 3QF4A 3LKDA 4LRYA 1G0NA 3QUTA 2OCLA 4D99A 1LTQA 2QJRA 1FFEA 1MX9A 3IR6A 2ZT6A 3I32A 4F12A 3PIRA 1YHZA 2CLOB 3ON5A 4Q9HA 2COEA 4D8UA 2A5DA 3F6BX 3JQBC 3L02A 4ZJYA 3B7WA 3PXUA 1D6JA 4DW8A 1PGPA 3SSOA 1TYEB 3OLQA 1LWOA 5CCEA 3FUUA 3NEJA 4CM4A 5JSZA 2E1PA 4FGLA 1YUNA 5I8ZA 4B8ZA 4WUTA 1L5MA 2GVZC 4R1TA 1YBHA 2H29A 1AB6A 1J8FA 4B43A 4CLRB 2VH5R 3Q3VA 3U7FB 2PZ8A 4ND4A 4Z2AA 1SZJG 3TW6A 2OGUA 4LI0A 2VYNA 3AG6A 4LXQA 1X7XA 5D00A 1OZGA 1NL3A 4LZLA 3K35A 5DNYB 3LQRA 3AO0B 3NYRA 4HQKA 4FFLA 4TTAA 2GN4A 1Z63A 2GJ8A 3BIJA 3VU0A 1N5LA 3QYPA 5LQJA 3W5JA 4BZWA 5BV1A 3AEYA 3OFVA 4RK4A 2CL0X 3SC4A 3VO9A 4EPVA 1JTVA 5A3RA 4X54A 5JO0A 1XRRA 5FRDA 3PFIA 4BV3A 4DMKA 4LZAA 4QHTA 2AMYA 5KSPA 1X7ZA 5LOVF 1WMEA 2RHGB 1LB1B 1WNTA 1WBJB 2G04A 4NZOA 4R0NA 1YR3A 4TMKA 4B6JA 3RKUA 4IUDS 3IHTA 4OKNA 4J1SA 3UC5A 4ZMBA 5M04A 3NVKI 4E2ZA 3PVCA 1DAPA 1RXYA 3KQNA 3R3WA 1XNJA 5F1OA 2Q4TA 2NUPB 2Q8QA 1GIAA 4JB8A 1BU8A 3IIMA 1JX6A 3C3XA 1P1KA 1U8ZA 3I2GA 5LWHA 1HLDA 5D5PA 4M8NE 5TF4A 3FRHA 1FVXA 1VYUA 4YP0A 4BFXA 2JJ1D 4D3XA 4GKBA 1SZDA 1JYEA 1ZG3A 2NUBA 1L3IA 5K0FA 2GB4A 2F3TA 2F00A 2FQYA 1O96B 3IBSA 3KB1A 2P40A 4MI3A 1R16A 3WV5A 5G1OA 721PA 1N3LA 3HWSA 3A1CA 2ZVJA 1KC3A 1U6IA 1Z4IA 4BU0A 3HVHA 4NOMA 2PR7A 5F3RA 4AXBA 1UXHA 3HPRA 3ABRB 3VPFA 4M1KA 3CCFA 5LUAA 4NATA 1NDQA 3GJ3A 5LSAA 4EI8A 4I1UA 3M4XA 5REQA 2H16A 1QLHA 5C34B 1XCGB 5DTEA 5JRZA 1PNQA 1XEFA 1XTUA 5D51S 4GKKB 3AESB 1D8AA 1QHNA 2A1UA 5EIEA 1N33B 1XQXA 2B8JA 4K86A 3SBOA 3J7AC 1ZU4A 3MHTA 3CYFA 3CLRD 4FE7A 4UU7A 3VPAA 4BCDA 5A1TA 1YTUA 1MZPA 3DDZX 2H2GA 3N5KA 2DFKB 1OKKA 5U9CA 1I7NA 4L76A 4MRRA 1DO0A 3WYDA 4YECA 1W6RA 1U2ZA 3HNRA 3QHPA 3G5LA 3TLKA 4OHBA 3EPKA 2ADMA 2GYVA 1T2NA 3GFGA 4KVZA 4IDOA 1Z6AA 3W6OA 1X7YB 3EIWA 4U6NA 2TS1A 3TBKA 3WXMA 5JCXA 1Q21A 3U09A 1KI8A 1QVVA 1Y6GA 1ZIXA 3I42A 2AFRA 3E27A 2OTCA 3A04A 2BFEA 4S12A 1K4KA 1JYSA 1C0KA 3TD9A 3KLBA 2GVDC 1GAJA 5AICA 4LJ5A 3SR4A 3I92A 2FCAA 3A9RA 3GUZA 5JADA 4R9SA 2H1SA 2H4JA 4IIDA 3G9XA 3GT7A 3DLHA 3RTDA 3SFTA 1HC7A 2OO3A 4X8HA 1YZHA 2ID7A 4KAFA 3WMEA 4AULA 1Z15A 3I9V6 2JZNA 3KYJB 1YQXA 4CQMA 1H6DA 3ZZNA 4HNQA 4N01A 1P1BA 2CJWA 2P91A 2ZBVA 1YR2A 1OLXA 3QW4B 4NZNA 5FAKA 2DPHA 3Q7RA 4MA0A 2IDZA 5CH3A 3B78A 2HIAA 3AJEA 3L8FA 4QO8A 4EEXA 1QF7A 5MGBA 4QBKA 4MW1A 5HTKA 3MELA 1G21A 3UEOA 3UZUA 1BMFD 2XUPA 4IJ6A 3W2EA 1PEDA 1T8TA 4BN0A 1Z62A 2OGTA 1VSVA 3DP7A 1S2NA 3I6BA 4EKDA 4XWOA 5SZIA 3GGSA 5DW3A 2Z56A 4IVRA 3GX1A 3NKFA 4L0MA 3P5SA 1O6CA 3ITKA 1V6SA 1TECE 1EG7A 3IV6A 4J7AA 5CLLA 5D8DA 3IPCA 1FXSA 1NRXA 2OV8A 5EE0A 2ZR9A 2HQ1A 3E7WA 3TQTA 3O38A 3AINA 2BGTA 3YASA 1PFVA 3G17A 2WC1A 3LT1A 5BUZA 4MRSA 1SC9A