1W30A

Pyrr of mycobacterium tuberculosis as a potential drug target
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
174
Chain Sequence
ESRELMSAANVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRR BIFUNCTIONAL PROTEIN
publication title Structure of Pyrr (Rv1379) from Mycobacterium Tuberculosis: A Persistence Gene and Protein Drug Target
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 53
structure length 174
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w30A00
1I13A 4RHTA 3DMPA 1P4AA 5IPFA 4QYIB 4LYGA 4P86A 4RAOA 4RAQA 1XTUA 5BQPA 2PRYA 1ECFA 1ECCA 2PS1A 1BD4A 5JV5A 2EHJA 3DAHA 2P1ZA 4OHCA 4RHXA 1DQPA 4WMLA 1I14A 1ZN8A 3H83A 3GGJA 1A4XA 1VDMA 1G2QA 1QCCA 4S2UA 1NONA 5IAOA 1LH0A 4FYMA 2H07A 1A96A 2PRZA 1QK3A 1L1RA 3G6WA 1A3CA 2C4KA 1U9YA 1A95A 3ACDA 5ESXA 4P80A 1A97A 1UPUA 4RABA 1AO0A 3OZFA 1D6NA 1TC1A 1P18A 1O57A 1UFRA 2JKYA 1XTTA 1P19A 4JITA 1ECBA 4M0KA 2HCRA 3KB8A 3QW4B 1HMPA 1NULA 5KAPA 1MZVA 4QYIA 2DY0A 5JSQA 1QK5A 4QRIA 1JLRA 1JLSA 2YZKA 3NAGA 4X45A 5BQOA 4WN3A 4RHYA 4KN6A 1Z7GA 2JBHA 4F8EA 4Z1OA 3N2LA 1UPFA 1HGXA 2JI4A 1GRVA 4LYYA 4RADA 5BSKA 1P17A 5E38A 4ZFNA 2VFAA 4LZOA 1J7JA 3GGCA 4P84A 1OREA 3GEPA 1O5OA 4P83A 1PZMA 1QCDA 3LRTA 5HIAA 2AEEA 4P82A 1BZYA 4RQAA 1XZNA 1STOA 2GEBA 1Y0BA 2E55A 4P3KA 1G9SA 1TC2A 1XTVA 2H08A 4M0UA 2WNSA 5K51A 3DEZA 1WD5A 3HVUA 1BD3A 1XZ8A 1DBRA 3ACCA 1G9TA 1YFZA 2IGBA 1ECJA 1OROA 3MBIA 5HKLA 1A98A 1IBSA 2JKZA 3EFHA 4M0PA 3S5JA 1ECGA 4TWBA 2FXVA 1FSGA 4P81A 1DQNA 2H06A 1G2PA 4PFQA 1ZN7A 1R3UA 1QB8A 1OPRA 3OZGA 4RANA 3O7MA 1GPH1 3MJDA 4RV4A 1QK4A 4IJQA 4RQBA 4MB6A 1DKUA 1VCHA 4RHUA 3LPNA 4LZNA 1L1QA 3ACBA 3M3HA 1W30A 4X44A 1I0IA 4PAWA 1QB7A 1U9ZA 1VSTA 1I0LA 5BRNA 1CJBA 1ZN9A 3OHPA 4RACA 4JLSA 5ESWA 2XBUA 5EUCA 5KAMA 1DKRA 4LZAA 1I5EA 1V9SA
chains in the Genus database with same CATH superfamily
3I6YA 3MGBA 4K0KB 1C7QA 3W8DA 4JEIA 1XQYA 4MICA 2JAUA 1UWLA 1UPAA 4L8YA 1NYRA 1FFDA 3RVNA 1J42A 1PI3A 3E9NA 1UFVA 3THYB 3MJHA 4HN4B 5D5PA 1NF3A 3IODA 3RC3A 2YHIA 1EZ4A 1R0ZA 2HHCA 3KKEA 3QU4A 4RA9B 1ZZEA 4X0EA 5E9QA 2DH6A 2IEDA 4R84A 5JD4A 2XZTA 4LFAB 3VZSA 4TV9B 4FZVA 2PTHA 4K8RB 4S1TA 3UG6A 4WAUA 3G6WA 5EHIA 4QTUB 3WLTA 5AUOB 3HTXA 2E0IA 2IEGA 2QRHA 5D51S 5CEFA 4EJ2A 1O96A 4MQFB 5CFLA 1GAEO 1L4FA 1TZJA 4KJZA 3W3ZB 2VYVA 3BE5A 4EPTA 2RG1A 3KPVA 1N2IA 2Y1XA 2DKFA 3E9EA 2CNLA 1KO5A 2VK1A 3V1YA 1G19A 1NQUA 2Y1OA 4IGEA 4HPXB 3OOJA 5LUBA 4DV2B 3ICPA 1RXUA 4YXFA 1WMEA 3FZEA 3EVNA 1CQPA 3JQPA 1KYXA 3DWGA 1EFPA 1NBMD 1P31A 5LC1A 1GTMA 1QG0A 4NJMB 4MRAA 3V7YA 3GVXA 2ASVA 3NG1A 3URMA 1DBIA 3CPEA 2D4AA 3FYUA 3GLUA 2VDWB 2HREA 2OXCA 5JSZA 4EYKA 3ZY3A 3ORYA 4OSOA 2QWXA 3ZNPA 1YZFA 1KAMA 1V26A 3JQEA 4WEOA 2JFBA 4PC6A 5DSXA 4LMRA 3FLAA 4G65A 1TFUA 5ILQA 2Q3JA 4HH0A 3GRYA 3RUIA 3JYOA 4B7UA 3BB3A 5DO9A 2PH3A 1CLUA 4PANA 2G40A 2ZYHA 2ZSUA 3NHKA 5A4MS 1WSWA 3E18A 1JSZA 3SAJA 1V5IA 2PA0A 3KPYA 2XY4A 2AQHA 4H1TA 4NV0A 2AFHA 3U3JA 4B34A 3AYXB 4INZA 2LKCA 4LBVA 2IHYA 3FSGA 4F93B 3ILSA 4GFDA 2HLDD 1G20B 4OBBA 4F5ZA 4MA0A 4Y2SA 3T7RA 4EUKA 4ZU1X 4P22A 2O7RA 1QOPB 3B89A 1NY5A 1PV4A 4UOQA 1EFDN 5T8KC 3QXGA 4FKMA 2XWPA 4U2GA 4XLLA 1HFJA 4UTXA 2FZWA 1RPAA 4KXLA 3MINA 4M8IA 3DCYA 3HB9A 2ZBPA 2YXNA 5TF4A 4R5HA 3REFA 3DKRA 4BZWA 4C7MA 5L6LB 4EPXA 1ZD4A 5TDHA 4G4GA 4HUTA 4XUCA 2B2XA 1V4BA 1JG1A 4J3JA 3VX4A 3ADDA 2FQXA 2X23A 3N76A 3UV6A 1JSLA 1FYVA 2IIPA 3BL6A 1ZJZA 3MS2A 3ACBA 4PZDA 1C4OA 2GBLC 2FSVC 2OCBA 4HNSA 4LK3A 3QVLA 4PAWA 3HHPA 5HFAA 1E61A 3BSWA 4PX5A 3B1WA 4P54A 2VOEA 4PG8A 2GN0A 3JQFC 4Q9LA 1LLFA 1YFKA 3UXHA 1K88A 4NBKA 2H1HA 2QNBA 3FOBA 4TWZA 1QRRA 3ONEA 2AX3A 3KLPX 4RFSB 1NQTA 4WOBA 1FDSA 2YCLA 3FFWA 1LSSA 4QYIB 3A6HA 4CL2A 2XJ4A 2BD0A 4G97A 4IIFA 4ZVSA 5LYYA 5LQCA 2UU9B 4MV5A 4FDMA 1EGQA 1EWRA 2XW6A 3Q72A 2L42A 3HJCA 2BV3A 4GMDA 4NATA 1OLOA 1DX4A 1ISMA 4Z3KA 3AFOA 4TRMA 4RNCA 2A59A 2F3QA 1QZTA 2VF8A 4KSCA 3ROGA 3SG0A 3I30X 2GPBA 2ZAYA 4KXUA 4BNZA 4OQLA 2ZT5A 4Q3BA 5ARCA 1TVKB 2SNIE 4LXTA 1XAGA 3RCBA 4G0QA 1J1UA 1PJCA 2IU6A 5D1HA 3DUWA 3UF0A 4NCBA 3V2GA 3WADA 4RK1A 4C7JA 1DE0A 4EBBA 2DR2A 3EOAI 4ZPJA 2C1EA 4F91B 5KQPA 3VR3A 1CUFA 1EDBA 1RABA 1RWKA 3UJNA 2CKDA 2RJ3A 3RVOA 3HH8A 3GJRA 4BO7A 4C7XA 3O4FA 4KITB 4CM5A 5FO0A 4KXVA 4PLWA 2RHDA 2AQKA 3DFMA 4Q7EA 2GUGA 4LOAA 5CXSA 4KPYA 1K2VN 4POAA 1DKQA 3A70A 3RC2A 3S7ZA 4C0AC 4BIMA 5AVUA 3NAGA 1G1AA 4LCBA 1SKQA 4ALJA 5JVDA 1M34B 2CLCX 2XNDD 1O0SA 4WXRA 1EXVA 2X6TA 4Z1OA 3R6DA 2G72A 4P4SA 3N7TA 3K5WA 1PJ2A 3NWOA 2DUWA 4HPWA 3B6EA 3MPOA 1X74A 4WA8A 2D5BA 1A7UA 3GGCA 1DAHA 1Z0KA 4UHDA 4XIYA 2PWBA 2VQEB 4D56A 1EXDA 3B7GA 5KJFA 4P82A 1JIKA 3GDHA 3TSZA 4NCAA 3D8NA 1JVSA 1HT0A 2OHIA 4X54A 3H75A 4KMMA 4D9NA 1QH8A 4OAQA 1XQWA 3P4YA 2C2HA 2AXPA 4RMIA 4OXQA 4B9EA 5H8WA 1GCUA 3ROMA 4NS1A 2D54A 4TTIA 1RC0A 1K27A 4D9JA 4J90A 4MEAA 8OHMA 1XA3A 1GEGA 1LXCA 2YMLA 4IHJF 3O3NB 2XRFA 1Z8NA 5ECGC 3C7DB 3GZNA 2F64A 3F6BX 3QI7A 4NDNE 5IP5A 5REQB 4U8GA 3AIKA 3F2VA 1RRMA 5LOVF 2Z6QA 1KYIA 2FXVA 4J6EA 1J2UA 2Z98A 4EX7A 5C81A 3NDBB 5K8LA 4MRMA 4B3DA 3QE2A 5EWLB 2JIZA 5AVXA 2F62A 3OCJA 3L01A 2WWHA 1FYWA 3QLUC 4IH9A 2J3QA 2AL7A 3EW7A 2I9PA 4RORA 3SX4A 4WCFA 5DJ5A 4DC0A 1CIVA 2O8BB 3QYFA 4ZT2A 5L3QB 3FE2A 2IC5A 4XH9B 1R6BX 1E1RD 2QRUA 2QVGA 1JZTA 2RI1A 4K8OA 2WZCA 1HYEA 4FK8A 4KW7A 1AHPA 1P91A 3DLTA 2QRVA 3AKCA 4G0MA 3VSBA 3L93A 3PL1A 4HWOA 3ZCRA 1XLTA 3AEUA 2JLBA 2CJPA 3NMUF 3DAFA 5CT5A 1G66A 3GEBA 4DR4B 1PT8A 3A9CA 3KTDA 2JJ2A 4YUYA 1BTOA 3U3KA 4IIXA 1TJ4A 4HLDA 4YYEA 1PTJC 4M4SA 5I51A 4EHNA 3MFQA 4H6VA 1Z63A 1FF9A 2BUAA 3DEAA 1TQ6A 5LLSA 3UHOA 4BVJA 1F7UA 1J8MF 2ZIGA 5SICE 1XTRA 3DGFC 3FDIA 3G9XA 2JKVA 5J2TF 1IQRA 1VGQA 1J2YA 1Q0HA 4H9GA 4JNCA 4TYWA 1PZNA 3HUDA 4WOJA 2KLBA 2G36A 3Q6MA 2W6ID 3CT6A 3OEEA 2JI9A 1SCQA 5JEEA 1M72A 4EGAA 1UZLA 4IEFB 5F9MA 2RAUA 4HX2A 3ZDYB 1U1DA 4RF5A 3M49A 2ZR7A 1EVYA 5KINB 3R3SA 1A4XA 3ITEA 4KZPA 4W5QA 1V1RA 4Z4IA 1HZZA 3ZUPA 4P0PB 3WL3A 2EKDA 5FOUA 1OFGA 4O6VA 5DSZA 4XYGA 3B9QA 3H6KA 4DMFA 3R5SA 3WHLA 4AQYB 4FUTA 2YNMA 2UYCA 1DMSA 5JO9A 4D8WA 3UO8B 2JFYA 4HFJA 1CW2B 3GVIA 4I99A 2XRZA 1EH5A 1PV2A 5FV7A 3V8MA 1A2QA 5G0TA 3U3MA 1IHOA 2GEUA 1RI3A 1NWCA 4P98A 4DQXA 2EATA 1NM5C 4LBZA 3W4KA 4QJ4A 5JSQA 4F2HA 2WUFA 1EDOA 4TSRA 1T3GA 2HT6A 4CKCB 2YMMA 5DYGA 3PZRA 5HKAA 1HBJA 2YWXA 4U2FA 1NXPA 4D8XA 4YR9A 1TEZA 1GTL1 1E79D 2AGVA 2BPOA 2G3YA 4ROSA 2DFLA 3Q5GA 2AZDA 5TQVA 1ZNYA 2QL6A 3BAZA 1Z0JA 3FXAA 3VC1A 5IK2A 3SNHA 5BN1A 2JEOA 5IS2A 1O5IA 1JN0A 2YOGA 3OWHA 3PE6A 3WMWA 2H1SA 2DH5A 3W9UA 1THTA 1ZISA 2HF2A 3Q8WA 3QQ5A 1Z2EA 3KUUA 4TKUB 1HNXB 1N6NA 1HM5A 1GNRA 1DOAA 3NASA 1SU8A 2PBRA 2HWUA 5D01A 1UPCA 2Z8XA 1KQNA 5BSEA 4CIWA 2IEAA 4RPCA 2UUBB 1GVNB 1XCOA 3JVDA 2FEPA 1SVMA 2YFYA 4IZOA 4OB8A 2RGUA 2ZBUA 1JHQA 4R16A 4ZI2A 1RRFA 1YZKA 1PU2A 2A9FA 2C2KA 2H06A 2R7AA 2WSSD 3H1GA 3N07A 1TW2A 2CMHA 3QXSA 5DHAA 1RW4A 1CIJA 1NE2A 4M3NA 4GWKA 4QNNA 2JFXA 2CZCA 1N9ZA 2BUCA 3EBPA 3R5TA 1L8OA 1ARZA 2I4NA 2ZU0C 4LZZA 3VOSA 1U9JA 4YS6A 1T8SA 1FVOA 3CB2A 5DBOA 3RLFA 2O2ZA 3DB1A 3PI6A 3UA4A 5HSGA 1R66A 2PRSA 5CEJA 2ETVA 4KWHA 3ABIA 4LVNA 4E5PA 4NOMA 5HF9A 3JPWA 2XQFA 3U5ZB 4M2LA 5K4AA 2IIBA 5BWOA 4WFKA 1GAWA 1KFBB 4L6AA 2ROQA 2VAVA 3LX5A 1WXXA 2XXJA 1Y63A 5TEVA 1JQ3A 3WWCA 3RU2A 2I7CA 5BR7A 1N0IA 4J1TA 2XVAA 1YQWA 3VAZA 1ODJA 1TUIA 2R5WA 4UCWA 2FPGA 2B25A 1Z4KA 4TQ9A 3GLTA 4OSPA 3ZZ0A 2BBTA 2NGRA 2V7WA 2X1MA 1NUQA 1LB1B 3QEKA 4MDHA 4NNOA 1OGJA 4P31A 2FK7A 2AG5A 3PWTA 4LVOA 4WK2B 3KU1A 4Q4HA 2X8JA 1P6UA 3C16C 2WZQA 2NU8A 3ZVRA 1XOIA 4G2TA 4BGIA 1EFVB 1KORA 2BL4A 1PW5A 2G5TA 2D1YA 2R7LA 3TYXA 2DR0A 1MBZA 1V71A 3IVXA 4OHVA 5BQPA 3VTKA 4MW7A 1W7AA 3FSGD 3ZZMA 2W90A 2GGSA 4YJGB 3UGKA 1UBTS 4CL3A 3P4UA 4Q4JB 1T6ZA 2J08A 2VN8A 1IN6A 3FR8A 4Y2TA 3OJFA 1XMOB 3TLXA 1ADCA 4HK4A 5HTKA 1MC4A 5DYYA 1C41A 2J87A 1JQLB 2G1JA 2H17A 3DOOA 4MUHA 3S70A 4CUZA 2AC4A 4F3CA 2FVYA 1E2UA 4RTPA 3QQPA 2NYAA 3ME5A 3B3FA 5HZGA 2C77A 2DY1A 4RABA 1P3DA 2HIAA 2JNWA 2GPWA 3I0MA 1IN5A 2HD4A 2IHUA 2L82A 2XUIA 1V39A 2AB0A 3P71T 4ALIA 4CLEA 5EIWA 2OORA 2Q2VA 2GZRA 3Q88A 3GD5A 4I1OA 2R44A 4G9GA 4I5GA 1JEOA 2OR3A 4NKRA 4XPIB 3WMXA 4R2MA 1VI5A 1EBFA 1DXYA 1R0CA 3Q11A 4YMVA 1V95A 3STHA 3UM9A 2D0OB 3VU9B 4Q3KA 2PS9A 2IX3A 3QA3E 2ZE5A 2R8ZA 4KV7A 4LA4A 3TNDA 2H18A 4EYOA 3JVEA 3ZLUA 4I81A 2ZB2A 2JD2A 4LECA 4KH1A 2LUOA 2JI8A 3IRVA 4HAUA 3EIFA 3GDWA 3L8ZA 4YT4A 2Q4DA 4OQ4A 1PSZA 2H1WA 1H8EA 1UDCA 5EQDA 4M9SA 4EVRA 4LRUA 3G5LA 5K1ZA 4BNLA 3QWBA 4BLQA 4JB3A 3UOGA 2QMEA 1VMEA 2QRQA 1CY2A 4L4YA 1PSDA 3K4HA 4FLEA 2ANBA 3M5PA 4IHJB 2WHEA 5ALZA 3OIGA 3USZA 5K8VA 2JGNA 3F8TA 3G5UA 1YVRA 1P1IA 1XI2A 1ZXXA 1FNNA 4RD3A 2I22A 2E89A 3LX8A 4Q9KA 5JE8A 4ENRA 2MCFA 3JYLA 1MW9X 3NR2A 1V2GA 3BQ9A 3L77A 1U94A 2X3FA 1T4CB 4QQ8A 1EINA 1NUHA 4P3YA 1VCOA 1TO2E 2IGBA 2WINI 3QW2A 3QKIA 4BEBA 4YQFA 1CUVA 3B82A 5F78A 2O2CA 3NPAA 4GC9A 1DRUA 3U2QA 1G59A 1U7ZA 2HK7A 5E6UA 3WE7A 1HRDA 2CE7A 2EFDB 2WD7B 2OYRA 1SQFA 4RH0A 4U7JA 4KIGA 3LDAA 3H1AA 2JZCA 4LF4B 1SN7A 4I2VA 4AWXA 5KYKA 5F2EA 1CUJA 1B8NA 2Z5VA 1GNVA 1U2TA 4FS3A 1ZMXA 3BXFA 4HZGA 4AO8A 1CF2O 4DPMA 3NTOA 4AVYA 4RVUA 2Y4NA 2XAAA 1WXGA 1YDEA 4ZDIA 1D1SA 4DV1B 2ST1A 5HUHA 1W0JA 4XSGA 1EFAA 5AHKA 4ZRDA 5JJ5A 1GPBA 5G3YA 1OCEA 1P9WA 4KQ6A 4KXXA 1VBMA 5KQMA 2IPAB 5J2TB 3EE6A 2H3HA 4B71A 2Z2IA 3IQZA 1CR4A 1MO6A 2VL7A 2CFTA 1L5QA 4L4ZA 5IT5A 2O8EA 2FXIA 2XWQA 3ORSA 3WKDA 5ISMA 5MFPA 5LOVB 4MX8A 3TZCA 5HJ7A 4GYYA 4TUYF 4GECA 1P4AA 4PQRA 3PDIA 3LUPA 1Z25A 1NJ2A 4LYGA 5E95A 5KDLA 5J4KA 3AP2A 4J75A 4ZO9A 3D2AA 1UPBA 1W52X 3HNRA 1I51A 3RFFA 1Q2UA 2P9ZA 2YWEA 4ITRC 3OQ1A 1G8HA 4G6ZA 1L9KA 2CN1A 1M7GA 3GGJA 4RA6B 3IQXA 1ZINA 3TH5A 3FYSA 9ABPA 4BO1A 3EZXA 1D9ZA 2P91A 1OGIA 4OHUA 5I4CA 1JEAA 3M6FA 5DI3B 3ESBA 3P94A 2IXDA 3EDCA 2PUTA 2IYXA 2NPOA 2Q4RA 4H3VA 3D4NA 2FPMA 1UC5B 3CRQA 4W9NA 1MJ5A 5DNWA 3V8RA 3QPWA 3BXOA 3GJ4A 3LO5A 5IM4F 5C8VA 1BFKA 4DLWA 3FNEA 4AJHA 2WEKA 1G4UR 2PL9A 4KBYA 4KLAA 3NHUA 4G0XA 3DBLB 4ND3A 4OQPA 3DV2A 4DVJA 1BO6A 1Y7PA 3C74A 1SUEA 3K70B 3IJ5A 4Q3LA 2JJ2D 3TLBA 4GNKA 3TAUA 1A1SA 1W96A 4F46A 2W0SA 5JNWA 5FWNA 1UBNA 2ERYA 3T52A 2GH1A 2G28A 3D3KA 3E03A 4JKOA 1Q19A 2ZWIA 3FF4A 2A5DA 2CVZA 5ABPA 3EEBA 2HV9A 3CURA 1CY1A 1J7JA 4R3WA 4ZOBA 5HUJA 4W1PA 2GZ2A 3T3GA 1P5JA 2NT4A 1T2UA 2BGNA 2JLSA 4YPOA 3TX6A 1SHUX 4F92B 4ZQFA 2IEYA 2X2PA 2PL1A 2FP4B 3EQ7A 2XWJI 2EZTA 4IG9A 4IRXA 4Y6LA 5BT8A 4TYNA 5HNKA 2OBXA 4MA4A 2FOXA 2P9QA 4HWPA 1KGSA 4UBIA 4D2IA 1T9CA 3TLEA 4CMHA 4H4DA 2HJ9A 3ZWBA 1L7NA 3OLZA 4L0CA 4RLFA 3WWZA 4CEIA 2ZKLA 3F5SA 4OJNA 4XIFA 5KSYA 2AC7A 3IUMA 1R64A 2YNMD 2P1DA 4QTXA 3NNSA 1XF9A 3C0KA 3HFSA 3L8HA 4UAGA 1YRWA 2E7ZA 4BFCA 3U60B 2WV7A 2PBFA 2NZ8A 5EXEA 3RI3A 4U7HA 1JDSA 2DFDA 4WBXC 4QXRA 1AS2A 1KS9A 1M7HA 1V5WA 2XMCA 2Q3DA 5JSKA 4I4TA 2XLCA 4BKPA 5IBCA 2FN9A 4D92A 4YFVA 4J9UE 1VIDA 1U2GA 4AO6A 1BQEA 1FEZA 3GQBB 1ULUA 3H2ZA 4NU0A 4R7ZA 4RIFA 5FYQA 1M6YA 5YASA 5JBIA 3HJFA 4RLSA 4R9VA 3E1GA 3K32A 1O6ZA 4HC4A 5F3DA 3L0BA 2NPIA 1X6VA 3F67A 2BFAA 3MM4A 1TJ5A 3BK2A 4O8CA 5D5QA 1AKTA 3OLWA 3CG4A 5B3AA 3TVDA 1B6GA 3U0BA 5CHYA 4GEKA 3IDOA 4B2LA 1M0EA 3G2PA 3R9IA 2O1XA 4BFZA 4UOEA 4A92A 2OCPA 3NIDB 4C5BA 4IIDA 4YROA 3PWZA 3NKVA 3OZBA 4D02A 1IAVA 1ZIDA 3NHRA 3NKLA 5A05A 4Q3AA 3QVKA 4G63A 5CFQA 1JNXX 4NCJA 2ZUEA 1U7PA 3U19A 1WUTA 1KI6B 1R4NA 1ZA2A 3PEUA 4X63A 1BHSA 3T5BA 4D0GA 5HM6A 2PTGA 1T29A 2F17A 1SD2A 1VE9A 2GBGA 3BXPA 4QFBA 4N39A 4NYMQ 1Q0PA 4HRVA 1RM4A 4LY3A 3DOHA 2IWHA 3ZWMA 2FEKA 3K6KA 3T54A 1ORDA 2DYKA 3HB1A 3I3OA 4MGIR 3ZHUA 3NDRA 3AR2A 2CDBA 2TECE 3C3EA 4I50F 4DHWA 1RACA 4NU8X 4NTZA 3K0FB 1YRLA 3B3JA 2O52A 5WRFA 4QGAA 2AYZA 5B3KA 1WCV1 5A4FS 5LDGA 1Z9BA 2Q49A 1ND6A 2R6ZA 2WF8A 2X76A 3RU3A 4CKBB 5BR8B 1JFSA 1X13A 5DM0A 3VVBA 3ASZA 2FMFA 4K9LA 5DWVA 5JC8A 1DU4A 2R4UA 2ZJ2A 3ZOKA 1Z5GA 1GDHA 2F2TA 1XE3A 2GHTA 2BRUC 3IAM1 1YZ3A 3KJGA 1U7HA 3MYYA 3QFFA 4QYMA 4Y2PA 3TTVA 4YRZA 1NYLA 3G5AA 4GGPA 4BNYA 1QGUB 2OXEA 5C7IO 2O19A 4Y2GA 3IOBA 3K2BA 5HCNA 1RXIA 3TNYA 4Q21A 2EF1A 3TR0A 2YICA 5BN5A 3KLBA 1U3GA 2B7CA 2GETA 5FTLA 1KEZA 1NXWA 4J2HA 4YMUA 3O2JA 1YZYA 1X86B 5ADUS 1U9CA 1CUGA 4RW0A 2DBVO 2J3IA 2RHBA 2ZRDA 3DMRA 2HL6A 4H6WA 4KTVE 3VU1A 1AKWA 3WXBA 4C0KA 1KR2A 1NW3A 2I1WA 2QUZA 4EJSA 5L51A 1K0UA 1C7IA 1LI4A 1IK4A 2WQZA 3MRXA 1WW8A 4UPDA 5DLDA 4NU6A 2I29A 1S4MA 3F3YA 1VJGA 1BDMA 2CCJA 2PS0A 4ZVUA 4EX6A 4ENQA 3W5AA 4R9SA 4UVHA 3BRSA 3R3ZA 5F9HA 1J8YF 3A25A 3ANMA 1NW8A 1ZCAA 4PHFA 4AUEA 5HQTA 3OPNA 4V2IA 3F4KA 4GSYA 1BX3A 5T4HA 2BGWA 2B6NA 1O5TA 4P3OA 4MRNA 1VPVA 3OPMA 5AKEA 2X9QA 5EJ4A 5KNDA 4DBLE 4R01A 3INGA 5JOQA 4IH1A 1FFCA 3UV3A 4ND8B 3E1SA 4RK6A 3USES 2D5AA 1OZHA 3H4MA 3TX2A 1MJFA 1F4VA 1SCUB 3D6AA 5U4XA 3WYBA 4YCNA 1K7XB 1LEHA 3QXCA 3QX9A 4RIGA 1XTBA 3RODA 5B6PA 3G8DA 4HGYA 2MSDB 3QUBA 3DKIA 1VMIA 3R74A 3SFVA 1DJPA 1JDNA 5KTPA 4M0DA 2N1MA 3PDUA 1GQRA 3KVOA 2F4VB 2ZEJA 3MTJA 1FFSA 3AVOA 4EKGA 1U0BB 1MB4A 4HEJA 5M04A 3HBLA 1G7TA 2E5LB 1UDAA 2GKOA 1GZVA 2W6JA 1UEXC 2FPLA 3AF0A 1G5IA 3PGXA 1S6YA 3H9QA 3KPWA 3ONNA 4LOHA 4QUJA 3VBCA 4CTKA 1SKMA 1U1EA 3W8NA 1U2RA 3N8DA 4N3GA 3A4IA 4P53A 5FV4A 1ZRNA 4OQQA 4R81A 1H8ED 4Y7DA 3ONFA 2ZITA 4BQSA 2Q3EA 1ETUA 2I4TA 3WLEA 3VO9A 3EB9A 4R1NA 4R9NA 3TPFA 5AM0A 3ZYZA 1YZVA 4JVMA 1DKOA 4PC7A 6GPBA 2VR1A 3TIIA 3CWZA 5T64A 3ABZA 1HXHA 1Q7BA 1QHXA 4YK7A 2GDJA 3BULA 1DSSG 4U2DA 3JVIA 1UDXA 1UMBB 4PLVA 4BBPA 1TZMA 2A9VA 3NAZA 2P7HA 2AG6A 1U0FA 3OJ0A 1PWZA 4S2EA 1MOSA 1Z4MA 4HRXA 3W6ZA 3KQTA 3FPCA 3BSFA 3LQFA 1YTLA 1E2PA 3AL2A 1SUIA 1WUKS 4B47A 5KNCD 1ZGZA 6ABPA 3PBKA 1E8NA 3Q3IA 4IFEA 2H59A 2P3QA 3T7CA 2J6CA 1IG0A 1PGNA 2ZW9A 3FDZA 3L6RA 3O8NA 1YQTA 2J6HA 4H08A 4R1TA 1E2FA 1XDBA 4GOLD 4M1OA 2CJFA 2QZSA 1VSUA 5D3QA 5C3UA 2H1FA 4PZPA 3SSAA 3FMIA 4WESB 5CDFA 4LDJA 4BGVA 1KRWA 3JRWA 5K3CA 2E4WA 3DT6A 2OO7A 4QODA 2BFEA 3RVPA 5AW3A 2W6QA 1O2DA 2IXFA 2BLLA 1QUFA 2QW1A 3IERA 3I61A 2OCDA 3JTMA 2WUGA 2XT9A 3DBVO 1W1WA 3MJSA 1U0NA 4R69A 3VDRA 2OCKA 4N3BA 1T1EA 1U3WA 5FLKA 1WCXA 3THRA 4B80A 3VYUB 4ND4A 2VZ8A 3BMNB 4CYMA 1S1CA 2PGLA 1Z17A 4N18A 3BCRA 4ZTUB 2RHWA 2OTCA 3C8MA 1KY2A 2Q7XA 2IITA 3SKYA 3U4DA 2EZ9A 3AFNA 3QENA 4YWJA 2XADA 4P4NA 1LWNA 3MSCA 1VJ1A 3MW8A 4ZVKA 5TQJA 4DM4A 2F8TA 3TOCA 2A33A 2R6AA 3BFPA 1ZGAA 4LYYA 1SUCA 5H3LA 2OAQ1 3LC0A 3E5HA 1LC3A 1UP6A 3PNQA 1E8MA 1S7GA 2YHSA 1TJYA 3EGWA 4CTJA 1CSEE 1HTTA 2WTMA 3CSDA 3R8XA 4PU0A 1L4YA 1H2HA 1RFLA 4OIFA 5BSHA 1IL0A 3UAOA 9GPBA 5I4BA 4MUGA 4MVJI 3KZ1E 4REMA 3TO5A 4R98A 1URPA 2OKCA 3ZQUA 1NGSA 3OFVA 3LP5A 4EG4A 3DE1X 3V9AA 3B78A 1VL0A 2XCTB 2CLLB 4XLZA 4H1WA 4QEKA 4IZIA 2K2QB 4XW2A 4LPSA 3PQEA 4N5LA 4UZSA 1JEYB 1NMQA 1N2OA 2YS6A 1RKQA 2F8MA 2MR5A 2XCQA 2YXEA 3P9YA 4WBSA 3RANA 3T9DA 4B4VA 1TLTA 2HRDA 2D2VA 2F9MA 3GIDA 3FFAA 4C21A 2ZRCA 1ZM7A 3WHKA 3X1WA 1I6KA 1Q7EA 3FJ1A 5CCDA 5DN6A 3SS8A 2HDHA 1D2NA 2KX7A 4MAMA 2V9PA 3H2HA 4L51A 2CB9A 3PWKA 4OHXA 3KUCA 2G71A 2PXXA 2R3SA 4IIGA 4OOFA 3VSDA 4Z5XA 1A9TA 1U7OA 4FKZA 4AZSA 5K7SA 2J85A 2FG6C 3MT0A 1UBSB 2BGJA 2QM7A 2RHHA 1I2MA 3T3PB 1HNWB 3HPQA 2GJ8A 3ELBA 1WA5A 3HCPA 5A03A 3D4OA 1W94A 3LPNA 3I42A 3RJ9A 3FKJA 1Q14A 1V1MA 4DBZA 1JV2B 1VL2A 2NQTA 1MJNA 3D3WB 1FDVA 3C6BA 1N6LA 5C34B 2BP7B 4PCAA 1P3JA 4QXMA 3A9VA 3LUAA 1V25A 1Q17A 4B44A 1LTQA 5CDGA 3C41J 1V11A 3DZFA 2QTZA 1TM1E 4G07A 3GYBA 4I50B 4BPBA 3HJNA 3H8VA 4LNAA 2IOFA 4AQ7A 1LVHA 1PD1A 4TN5A 5GM1A 3E9RA 4HOYA 4ANFA 3T5AA 3ZD6A 1NPTO 1QYVA 5CLIA 1ZUHA 4FFBB 5LUAA 3IYLW 1SCNE 2GM4A 2A1IA 3I01M 3LXXA 4CMIB 4WA7A 3WGQA 3L7KA 3G89A 3BN3A 4MQ6A 1HX7A 4EFNA 1Z82A 1F0NA 4LJYA 5D87A 1N1MA 4WXYB 1AMUA 4OJQA 4E88A 4UBNA 1X1CA 2QZJA 2FN3A 4UBJA 4UPEA 3RRZA 2AK3A 1EUCA 3M4YA 3O8OA 4RVGA 4TLLB 3ACDA 3LHSA 4ZO7A 2DFKB 5UKDA 2OC9A 1I2BA 3B9PA 1SG0A 3G0OA 3PE4A 4FPXA 4IIJA 2X8WA 4OY3A 2ZT8A 4MAFA 5DX8A 1PDWA 2OZKA 5IYZF 1YCDA 3ET4A 4MRVA 4Y0AA 4BNFA 4YP5A 1RCFA 4PSUA 2DUJA 4PX2A 5TQ0A 2NUTB 4G85A 4R9RA 3TLYA 3VNQA 1I7PA 4B4KA 1OA1A 5DLPA 1J2EA 4QUEA 4YCBA 16PKA 4BZQA 2QVCA 1OF1A 1QF9A 1QYWA 2O5VA 2ZRJA 5HDBB 4HTFA 2I9KA 5CA0B 2FN8A 2G9QA 1YFLA 4H1HA 1Q74A 2Z5FA 3QPAA 2PX8A 4HXGA 5HQJA 1XRSB 2ECOA 1UZNA 2WW8A 3A4NA 2ZYGA 1P17A 3A6EA 4BMCA 1AKEA 5TQ2B 1LDNA 4LZOA 5FPTA 3IBYA 3ADPA 4TTTS 1RU3A 3IFSA 1HYQA 1YB2A 4GBMA 2BCJQ 4KFTA 4YAIA 1KMMA 1RTKA 2VC2B 4KMRA 3ZLTA 4BMZA 1STOA 2XRMA 1X7HA 2EJCA 2NZWA 3GPBA 5A6SB 3UGJA 3SXJA 1F1BA 4RTJA 3KQKA 2CXNA 1ZSNA 2B1RA 1S3GA 1ZCBA 3CVVA 3A0UA 1FFWA 2J0UA 1B41A 3TEFA 3OZAA 2A0YA 2PYIA 4EJFA 3U7IA 1IB0A 5ALMA 2QA5A 4R7GA 1Q0TA 2CLIB 2OD9A 3NBUA 1KDOA 2XUAA 4FGUA 4N5NA 3GJ8A 3AM1A 4TWBA 3BIFA 1CRLA 4G25A 1SUWA 3IPRA 3FZYA 3W5HA 3NM6B 3WLRA 4EAAA 5BW6B 5BV8A 2FRXA 1E9VA 3VUEA 5CMLA 2ES4A 3SWWA 1O54A 3WOHA 1I6WA 5JXJA 1DADA 2WFZA 2BFMA 5JDIA 3EFOB 2EXXA 1KSHA 1E3WB 4W82A 3DWFA 1K66A 5ALSA 3RV4A 4QDOA 4BQQA 3HVHA 5CIYA 1OYYA 4FEEA 4IZ6A 2CCKA 3JQ9A 1I1NA 3SDBA 4HN2A 5KVVA 4GPAA 1C29B 4R1LA 1E2KA 4QXOA 3UBMA 4CIXA 1XEFA 2E4XA 2BM0A 1JJAA 4WINA 1BWSA 3U7FB 1P0CA 5KOJA 4AY4A 3ZHVA 3DMDA 3HFJA 4BEVA 1F0KA 2CLEB 2HA4A 4BU1A 2IU0A 4JBGA 4N3NA 3WIOA 4DXHA 4GXRA 1O89A 3RVBA 4TKVA 2CKMA 3N87A 4ZVVA 5DOZA 3F98A 1DC8A 5K2MA 1ZVQA 4HQ0A 4ZP1A 1PJZA 4CF7A 1ZAYA 1GOTA 1Z6PA 1ONOA 2BH9A 1W46A 3BZUA 2HBYA 2QT0A 5TVKA 2BFDA 3UH1A 4H17A 3SJCA 2RGEA 3RROA 2Z0MA 2JCVA 3H2SA 1IAQA 4JS0A 5ARBA 2NVWA 5BVGA 3ZDEA 3QU5A 1GL3A 1QGYA 3K16A 5HRCA 3O7WA 3GZTB 4PXSA 3K9HA 5CJJA 5FA6A 4CCAA 3R5KA 3MCZA 4CF3A 4CLRB 4US2R 1ZVKA 4FX5A 2EG9A 1SC3A 2WTXA 4JJKA 2IYLD 1JT2A 1XZCA 4U7FA 2X40A 4ZALA 1LFDB 4FQ5A 3NEAA 3C45A 5KC8A 2I91A 5GJBA 2W6JD 1Z7EA 3ZW8A 4L0QA 1K97A 4PAOA 4XUEA 3W9BA 5KSZA 3QUAA 3ZEIA 3IT3A 2RGCA 5GMOA 3S2YA 1OA0A 3OC0A 3Q8LA 2JBWA 1F48A 3H3XA 2ZP1A 3B5IA 4ZDWA 2I87A 5FBWB 4EYQA 2P0YA 1AN9A 1L5MA 3RVKA 3M70A 1X7ZA 2YZKA 4ESVA 4HQKA 4BMPB 3FPGA 4UZEA 5AKIA 3SR4A 2UXDB 2Y1DA 4M22A 1UC9A 1UPFA 1MHTA 4WLFA 5EYPB 4DLKA 2KSQA 3O8QA 1EWVA 4OQFA 4OLBA 1IEWA 4BV9A 2J0QA 4GF5A 4IDNA 4YP0A 3EASA 1KZ6A 4HNTA 2VPTA 1E99A 3H11B 3MQ4A 5TSDA 2NWQA 3TM5A 3ESAA 4FJ2A 4ZD6A 1FUEA 1RZ3A 4CCYB 1VZ2A 3SQLA 2Y1WA 4M0MA 2PGIA 1TCBA 1A04A 2YFQA 3CUVA 3GT7A 3ICCA 4D9CA 3WQSB 3QK7A 4I5FA 3OQ6A 4MYSA 2IZZA 3G8BA 4NV1A 1XTVA 3ZW7A 3OIYA 4YI3A 3FDJA 1C1DA 1BX1A 3E8MA 2JGLA 3FFTA 4UXIA 4C0SA 4LWZA 4CG1A 1AB5A 1N25A 1QH9A 5EIXA 3X1JA 4JELA 1Q92A 2AMJA 3UJ8A 2BDTA 2X2OA 2A58A 2UUCB 4L72A 1HR0B 3PQ3A 1ZK0A 3TLJA 3TZHA 4G9EA 2GZSA 4AS2A 5C51B 3AUJB 2PX4A 2QX6A 4AN0A 3RABA 1D4FA 1SURA 4G1VA 1MT0A 3KXDA 2PSJA 5E2IA 2P5TB 1YB7A 2A0FA 1NE7A 2J30A 2BFBB 3KXLA 4K9QA 1P4SA 2OVFA 1OGYA 3CMMA 5M2QA 1DC4A 3C2QA 3JSAA 1W88B 1Z26A 2VYCA 5HS6A 5A2QA 3OTHA 4ZYVA 2VNIA 3TAXA 1RZRA 4DANA 3RBXA 1XKXA 5E0KB 2WIKA 4K9SA 1NBHA 3ZDAA 1J4AA 2BGKA 3M1LA 1LQUA 3OY7A 4DSAA 4HMOA 4OHYA 2A4MA 5ALGA 2IHTA 2NZXA 3GCXA 5KI6A 1PDVA 2VTVA 1C30B 2VJMA 1XWFA 1YU6A 2EFCB 1CB0A 3DNPA 3JQ9C 4UE2A 5CX1A 1Z38A 1Q0SA 1OAAA 1FYDA 3BT7A 4YP6A 3QFRA 4DILA 1HQKA 3LVRE 3F9IA 4CQLA 4N40A 1FX1A 1UPTA 1DHRA 1F4PA 1OYWA 4FHGA 4I55A 3V7WA 1RLIA 5G1PA 1RCUA 4TWIA 2H57A 4D6YA 3U7QB 5JNVA 3LGXA 2DWCA 3DM5A 4Y9DA 3RS9A 2D2IA 1ORWA 4WPGA 1V9SA 3GRKA 1E66A 4U7DA 2QTFA 2HN9A 3KIPA 3N2KB 3TRIA 4U02A 3C6MA 3C8ZA 3IPAA 4RAQA 4XWWA 3RIHA 2C3UA 1AA9A 5IAAA 1SBCA 3DZ8A 4K6GA 4V0KA 1Y9EA 4BVLA 4KR2A 2O9JA 3H5RA 1CWUA 3R5XA 4ZYYA 3C7TA 3PX7A 4HBGA 1TF2A 3HY4A 4EELA 4ZGBA 5CK5A 1SCJA 3GC6A 4CEJA 3WGUA 2V58A 1H4VB 4V1CB 1T91A 1V2HE 2G8NA 3EVAA 1SC1A 1ZDMA 3HCBA 5DN6D 3AVYA 1QRUA 4JI6B 4D44A 1P1RA 4LE1A 3G7NA 4M87A 4UCFA 1Z0FA 2P90A 3LSTA 2C54A 1USKA 1VKNA 5IZCC 2CV2A 3DZIA 2QR2A 3LQRA 3VHRA 3WRVA 1VKOA 4ZOAA 1X1TA 2CHUA 3BXGA 1E9FA 4GKKB 1HL3A 1YR9A 4WFQA 4ZHSA 4DLAA 1VLZA 2HTFA 3ZIUA 4AK9A 4JITA 1TE2A 4PYQA 4Q03A 1IY9A 1T3ZA 4F56A 5TJHA 1SBHA 1NULA 4HH1A 4JJ8A 5I8PA 5IWCA 5HMMA 1P72A 3NM5A 5IZ4A 1R37A 2C7GA 4WXEA 1GPLA 4UTZA 4W5HA 4D80A 1CUAA 3HRKA 3ZJUA 3DCIA 4WK4B 1IOVA 1R9MA 4ZXFA 3MLAA 5F12A 1ESDA 5HKOA 1ZLXA 1PLJA 2GNAA 2JFOA 1RRGA 4BFXA 1YHZA 2JFFA 2QEQA 3EQZA 4AG6A 4RTLA 2NX2A 4HWGA 3ZZNA 3I05A 3H6GA 2R60A 4RS3A 3WDSA 4EMBA 4YJ3A 3OLVA 3R3JA 5BOVA 3D64A 5THKA 3VOTA 1NI3A 5JQGF 3FZGA 1F17A 3C7CB 4XVUA 4DDVA 1FDUA 1VA4A 3IP3A 4TTRA 2IUSA 5DLEA 1OOEA 2MOKA 4CV1A 1RYYA 1SXJA 1NMSA 2CLHB 2OV1A 5F4ZA 4F5EA 2JFHA 5MDHA 5F5NA 3E6AA 1NLZA 1QOZA 2XI4A 2HCFA 1ZM4A 2XTZA 4JB0A 4WKNA 2OMKA 2G7MC 2P9GA 5ELLA 3AI1A 2CEAA 1OTXA 2GAFA 2Y1LA 2IYVA 4R54A 1KDRA 1NI4B 1UMCA 2I7XA 3P0HA 4UUAA 2Z9CA 3IKJA 2KLHA 3ZWQA 4BNIA 3A4LA 4I3GA 4E2XA 2RGAA 2ZIXA 1W49A 1ZOOA 4I1VA 1ZOSA 3UANA 4GNRA 1GAJA 2B20A 2VDPB 3C15C 3PC6A 1XN1A 1PL6A 3NAMA 4PYLA 2NTNA 4EUSA 1VFPA 1BEEA 1VLVA 3E9QA 1GZDA 4WT7A 3H5OA 2YIVX 1ZI9A 3JZIA 2Z08A 3CLRD 1GVHA 2GPNA 3AR8A 1QWOA 2AMFA 2BC9A 4LN1A 4QBKA 4RD0A 4YP1A 1BQ3A 5JYDA 4OXNA 2JIPA 1H9BA 1T1JA 1L4BA 4MEJA 1RQRA 3FNGA 4TLEA 4BKQA 3KHSA 2H00A 5LD2B 1XTPA 1RSZA 3C48A 1JU4A 1MA0A 4M99A 3SN6A 5LQRA 1XMXA 3PXAA 4J94A 4PPFA 3PDJA 2EKBA 4HGQA 4M7PA 3ZGXA 1HDEA 4JIMA 4KRGA 1E1CA 3PUKA 4X71A 1QFZA 4CT0A 3RUCA 3H87A 2AI3A 3S27A 3HCDA 1JZSA 3KEFA 1NA5A 1RD4A 5FL3A 1OFUA 2F00A 1ZD2P 2JCBA 2RGNA 2X3YA 4HDKB 1DAMA 3CF4A 5EIFA 1THGA 4LRSB 4PG6A 1A5ZA 4OAPA 4LXUA 1V8OA 1KEWA 2G1KA 1XTUA 2I71A 3NGMA 2BGLA 1BROA 3W8RA 4EO4A 5JYBA 2QSJA 4NENA 1I2AA 1OT5A 4JA0A 4F11A 1FYXA 1V9LA 1HEIA 1P8AA 3M4NA 4EVSA 4IOJA 2X4DA 1R27A 3D81A 1V16B 4H0NA 3LUJA 3GLGB 1S3IA 3DOIA 3IPXA 1KEEB 1Z2NX 1M0TA 4BLWA 2ZS8A 4XOIA 5JNLA 4EA7A 2ISSD 4LE0A 3T7KA 1EVIA 1MD9A 2QX8A 4JB2A 3DPUA 3OX4A 1AKQA 1ZUNA 2VPPA 3GJ7A 3MN1A 4OD0A 1U1CA 2VH5R 1C2YA 3EMKA 5A5DA 1HTWA 5HZKA 2HK9A 1Q1GA 1O57A 1XL1A 5C5DA 3A1EA 4TMFA 1IHYA 1T8RA 4XGIA 4PO8A 4YCLA 3VPFA 2BHRA 5DM60 1M73E 4B7AA 2FI1A 4AYXA 3WQBA 5B1YA 3M9WA 3TZKA 1ENPA 1NP7A 4H6XA 4HLNA 4LAFA 3VXKA 3KYCB 4LW8A 5JPDA 1ADJA 3GUYA 3KAKA 3NETA 1Q77A 3H9CA 2B4KA 4DCVA 621PA 3PD7A 4HB2A 3DDCA 3HJRA 3SHTA 2ZSKA 3LY9A 5EPEA 4CMCA 4K1LA 3WMEA 2B69A 4E33A 3IGFA 4GR4A 1P1FA 4BNDB 2EL9A 3BCHA 2O2XA 2OB2A 3HN7A 3D1JA 1SG9A 2PVCA 4BFWA 1OWMA 4CM8B 4UXJA 3RRYA 1DUIA 3NHYA 4MO9A 5KCMA 4KU4A 1JIIA 3QKSB 1PO7A 3SE7A 2PJDA 3F49S 3KWJA 2PWAA 5BQ3A 2OBMA 2VJDA 5KX5F 3V1MA 2CNBA 1KHTA 2B5VA 3P9IA 2C3MA 3QOFA 2HSWA 1K6IA 2QUKA 4C7KA 5JI3E 4RGQA 4I1UA 4M0EA 4U2BA 1VTKA 2B8WA 2GFQA 2O48X 2SBTA 4PSVA 3KP1A 4EATA 2QGZA 4MWZA 3ZUGA 3M6LA 4MMZB 2HIGA 2QTMA 2FMKA 4NHOA 3A1CA 2UVPA 4K05A 5DLYA 3MMXA 5EINA 1FP2A 5EJ5A 1J07A 2PGXA 1U28C 1EP1B 2OCAA 3AUUA 4O0MA 1GGVA 4M38A 5EY5B 4CR7A 4CIYA 3AIIA 2YR0A 1TVCA 2C59A 2V7EA 4MQLA 4P1ZA 3PGA1 1QP7A 2D0PB 3A6DA 1W35A 1W9MA 1YTUA 1HLDA 4BO6A 4E30A 4ZEWA 3ZHOA 3LW8A 2JHFA 1DWUA 2QSUA 2OGUA 1AGRA 1DNPA 5GP1A 1XNHA 5SYAA 3X1DA 1C9NA 4A5SA 4BVFA 3E05A 2O6LA 3HVIA 3IA7A 3K94A 2FW6A 1EX1A 2O3TA 3COVA 3K3PA 4ZTZB 1LBQA 4JUIA 3QWHA 5AVKA 1C3EA 1EP3B 1KC3A 2R2GA 4PRKA 2I8LA 2ISCA 1J21A 3U3XA 1WUYA 2Z3ZA 4JZKA 4LDRA 2QVBA 4PYOA 4B87A 5EKUA 2G5CA 4K86A 1P45A 3MXTA 3N2GA 5JXIA 1DUSA 4WXMA 1CZRA 4E51A 2BKAA 1MNQA 2VJKA 3P2EA 5IKMA 4N5HX 3RHSA 2P3SA 2AN5A 3I2GA 1JHRA 3MJFA 3CLUC 3P9RA 3Q7PA 4CEHB 2NO6A 2GVDC 2HY7A 1FYEA 3GHYA 5F3RA 1D4OA 3F1LA 4JEUA 4F60A 1AZTA 3OG9A 5LQNA 1COWD 1RC8A 1Y82A 4FR2A 1QX4A 4CLOB 3TRJA 2FPPA 5EESA 5AT1A 1QCCA 4L76A 3ZG6A 3P19A 3AKYA 4PY2A 4V0ME 3NRCA 3N8IA 3D6MA 2NO0A 3OJLA 4C0BA 1RZRD 2ZJOA 4Q00A 2NAFA 3U7JA 2HXSA 2YN4A 4K2HA 3HXLA 3PHCA 3H2IA 1XD2A 1NJ6A 2AOTB 4Q24A 4U00A 1BEZA 3D8SA 4NNJA 1JJFA 1FXUA 1PZFA 2QTVA 1F8XA 4RPHA 5COAA 2PQMA 4JMLA 4CLDA 4YACA 5ALQA 2N0SA 4WADA 2DE0X 3SDZA 1OQAA 4M53A 3LQ2A 3TQTA 4KOAA 3U3ZA 3W06A 5BWLA 1D0VA 3QEMB 4E2YA 4L4RA 3PD0A 5JAOA 4RYDA 3HG7A 3K0CC 3NCTA 4XDYA 2XZLA 4M0KA 4O2BF 1XTSA 1KZ7B 3CVWA 5ALJA 2NP7A 1PRYA 2VSFA 4HLCA 3EPJA 5JQGB 3FI0A 2O7SA 3MJVA 1HL7A 3R7NA 3RYHB 3WNQA 3JQ8B 4HX5A 5P21A 1TMYA 3DEKA 4ILEA 4U4AA 1GLNA 1U2DA 2EFGA 1HE1C 1HDCA 3U3OA 3EVGA 5B58T 3VR4H 4RVOA 2YJ5A 5JZMA 2R87A 4ZOQI 1A7JA 2GCOB 3W6NA 4OLAA 2NN3C 3GGOA 1KIMA 5ELMA 1PZMA 1XEXB 3TMYA 4D57A 1SB9A 2MT9A 2VHCA 4TLBA 1HFWA 4DRXB 2RCNA 3KAPA 1D4ZA 4OTZA 4P3KA 4PAQA 2ZS9A 3HMKA 1JDUA 1O4WA 2WNSA 4LNUA 2JGIA 4YNBA 4UZFA 2H9YA 3AF6A 1JIVA 1Q1QA 3AEXA 1OSNA 1WMSA 2YBDA 3Q7RA 4D3DA 1NVEA 1LPMA 3EZNA 2GK4A 3ZY5A 5BQ5A 1BWRA 4A2WA 1RYDA 4K03A 1PZGA 4M0CA 1KFKB 3H4IA 1Q6ZA 5FJIA 4BHTA 5B3JC 4BZZA 3QTLA 4RDXA 1G3MA 3GROA 4IDPA 3QMPA 3VDMA 3IAS6 2IOHA 1YAHA 4UDOA 1XXHE 2IT1A 2V3WA 3Q8KA 3EDRA 1FNSA 1ZIXA 1NN5A 3TG8A 3REQA 1Y3DE 4X3OA 5KOYA 3AVUA 1OU4A 2JA1A 1T2VA 4MYDA 4RVSA 1A9PA 4MB6A 1II8B 1L4NA 1MNAA 3FPEA 1PS8A 4ZJPA 4D99A 2VNSA 3NLLA 1QH1A 1LJUA 3Q3CA 4DSZA 1VIAA 4FD3A 4XGQA 3G0IA 1GP2A 3HQ4O 5FWXB 1Q21A 1D9XA 1TPZA 4CTNA 1KH2A 1ZD1A 1N0UA 2D2EA 2FUKA 4G4SO 3DMHA 5LR6A 2ZCVA 7REQA 1AKUA 2IK8A 3OQBA 3AEQA 2LBPA 1GPNA 4XUGB 2ZRHA 1K8XB 1SXJD 4QSMA 5ESRA 4FYYA 1ONSA 3JQBA 3NVAA 4RY8A 5BUSA 5KEIA 3P0EA 3HK2A 1E60A 2W00A 2BEVA 5HHTA 1H5QA 4KPFC 1S2GA 4N6GA 2BMEA 3UXYA 1KHHA 4WHMA 4QXQA 5KZMB 4C76A 1D04A 1V7CA 2I2BA 5F7JA 2EW8A 1WV0A 3KDPA 4U2KA 2VYNA 4TXMA 4KE9A 4F4UA 4NYMR 4INAA 4LDPA 5BUQA 2K6GA 5DFAA 3DLCA 1AXEA 2Y6VA 2PCLA 4CETA 4X1KB 1ODFA 1RZUA 3GPIA 3S28A 3KSMA 1RZVA 2TYSB 4NZPA 1JAIA 1ZH0A 2GESA 4HFRA 4XVHA 3SX0A 5JYEA 1DIHA 2XMGA 4C0LA 3L4JA 4QEDA 5JAIA 4P92A 3BC1A 3K5HA 4PHTA 2CEKA 5IBRA 1XTKA 1Z73A 4KQ2A 1KGDA 3DMGA 3SOZA 4B8YA 4MGEA 1KIAA 4IS3A 1RJGA 2FP3A 2DZDA 3DEFA 2RB5A 3F4BA 3HA2A 4UD6A 3BGWA 2CNDA 5AFSA 4N0QA 5GIPE 3A2KA 3CM0A 4GRAA 1Y5MA 3WY9A 1ECBA 1Z16A 4J0EA 4K2AA 3LCCA 2AEFA 3ZDCA 5TPWB 1AZWA 1U4NA 4MQEB 4R6XA 3VTAA 2CVQA 4JLWA 1YV9A 4A0GA 1PFUA 4FOSA 3GGGA 3KR0A 1E96A 3KLMX 4EHBA 1MDBA 4JXXA 2V5AA 1QPZA 3QKRB 4LQDA 1KWKA 1J97A 4ZJUA 4D9IA 1GR1A 1OX6A 2P9HA 5D3MA 1H66A 3RTAA 3ZU6A 4OUDA 1BVUA 3IOCA 1BRTA 4HNQA 5EEGA 5CJPA 2ID7A 4RGBA 5JHGB 3ICVA 1QHYA 1Y7LA 3A05A 3OJXA 3PITA 2YZ2A 3AR7A 2ZR0A 2Z83A 1Y9AA 1SXQA 1G60A 3LKBA 2CWDA 4PQEA 4WZAA 1GFSA 4RQAA 4TMVA 4AMZA 2C7VA 5H68A 1GQOA 2H2IA 3KCQA 3NC4A 4FEGA 5F1YA 4XWYA 2OECA 3FYHA 4GE0A 3GXOA 4RIHA 3RPEA 1WXWA 3AZQA 5HF5A 1SVNA 3SFZA 2MHCA 4BNNA 3ULKA 3HYNA 1H05A 1Q1NA 3DBOB 4EA8A 2ATCA 4KQ9A 5TV2A 5JAPA 1X1SA 5JISA 4IRMA 5A9SA 2G1UA 4DEVA 4UE3S 1QGAA 2V9ZA 4F8YA 1NJ8A 3S68A 1HFKA 3N74A 2M6SA 1T0PA 2POQX 2B4YA 4QARA 2UZIR 4FVTA 4RQTA 3FNRA 2CL0X 1G2PA 2JATA 4IWNA 4RHCA 4BRWA 1QORA 3P26A 4EUFA 4HAYA 3D0KA 3FNHA 3SKVA 3OIUA 1RBYA 3OX1A 4QFCA 4LYEA 3ZQ4A 3FHJA 4DV3B 3QHAA 4TRNA 4BX3A 2PSHA 1UFOA 1YBAA 4HWKA 2VEOA 4L5CA 4O5AA 1UBJS 1KRXA 2ZI6A 2PJRA 1UK6A 3THXB 1M10A 2QTGA 3KR2A 3UATA 2CVPA 2D8AA 3KD3A 4DCCA 2ZS7A 4G56A 2ADMA 3KQMA 4JYBA 2YQ5A 4P33A 4YXWA 1NN3A 2JJYA 3F78A 4M54A 4CKWA 1TYAE 3OT1A 5ERXA 1DTSA 3PLNA 4ZVQA 3OM8A 4HAIA 3EXIA 1IM2A 2A9OA 3PYMA 3BS4A 4B1FA 1Z36A 5JS8A 3VKGA 2ZZKA 2P2YA 4WLOA 4IUBS 3UMYA 4M89A 5K0GA 3ZKWA 1T5TA 2H48A 3DZDA 1VCNA 3HZHA 4QHYA 4XDZA 1N34B 4ZEMA 2B9EA 4AKHA 3X2EA 3N1UA 2QTLA 3V4LA 1UBRS 5DHPA 1SHKA 3JAWA 3VPHA 4JC0A 2A9PA 2JLAA 3NC1C 3CJRA 4RVNA 3BFJA 2UYQA 3EVZA 3ZE2B 1F3LA 4FE7A 3WLMA 2JK1A 2EWVA 4TMZA 4GXTA 3DVRX 1H42A 3I0ZA 3R0XA 4GX5A 3GMIA 3QVWA 4NFYA 4TXHA 2VHXA 4DT1B 1BHJA 1IBCA 2HMTA 1E5DA 1GL9B 3A1NA 2L69A 2VI5A 4KYVA 5K3SA 3RSQA 3SBXA 3ZWYA 1WF3A 4G5HA 2RGDA 4GRIA 4FDAA 1HV8A 2WOOA 5FWYA 3BCSA 3TKLA 3WOVA 1D2CA 3NH6A 3O82A 3F6PA 2GM3A 5H1YA 3ONVA 4D46A 1DOZA 3EG9B 4O2BB 3B6JA 3FYTA 1IDN1 1UPUA 4FGJA 4C03A 1L5VA 2R9VA 3B5JA 1X1RA 2HEIA 4NMHA 5CPBA 2D7DA 2XUQA 4EI8A 2ET6A 2AE2A 5EI5A 2YWRA 3TR6A 4CMAA 4E11A 3HWWA 4FFDA 1Y3FE 4DQDA 1Q11A 5KAPA 2FY8A 2O07A 2ACVA 3TGPA 4JHXA 2HSZA 1BHQ1 2W7TA 4PG4A 3WK4A 4ND1A 4EI2A 4KC0A 2VDRB 2QU8A 7GPBA 1EG7A 3ZHQA 3QYAA 3AC0A 4ARUA 1YAJA 2REQB 4QXPA 4S3MA 5E1OA 4L75A 3TIGA 4D98A 4QIHA 1S89A 1QONA 3FIUA 3FMPB 1FUUA 5HRUA 3CLTC 2YWCA 3IHTA 2LVBA 2AJTA 1G21E 3EF1A 4OHOA 1TRHA 3DVSX 2W8BB 3N3AC 4HWRA 5D86A 5I5GA 2XVMA 3D5TA 4LZJA 4MR7B 3TW8A 2FPOA 2NSYA 1Y80A 3BA6A 4N5DA 1HDIA 2Y27A 2ZATA 1QVWA 4IGAA 4DGSA 4ZQEA 2QRPA 4F6LA 1P60A 3GLIA 3SHVA 1Q7GA 3DM9B 3G0GA 3TGLA 5EXSA 3N0RA 4IEEA 3IXMA 3ANLA 1E2IA 1Q44A 5EWJA 2JBAA 1H5NA 1AT1A 1F38A 1XTQA 3NV7A 4ZO8A 3LT2A 4DMHA 3A1FA 1YB6A 2YIJA 4V39A 4JD5A 1KP9A 4MKRA 4ZIRA 4L2IA 3C6XA 3A7EA 5J5VA 4D4JA 4L8LA 1IN7A 1SD5A 2I2CA 1OC2A 3H8JA 2VPWA 4LJ7A 4MR9A 4R0VA 1CZHA 3K96A 3IEMA 1HYBA 2QE7D 2E5WA 5FADA 4E5UA 1WU7A 3OQPA 3MD9A 1Q12A 3JWIA 4MPRA 1EG2A 1TM4E 3ZDBA 2F7SA 3DAYA 4Z7NB 3PLRA 5CW1A 2FKNA 2WHXA 3PPXA 3OOEA 3L7OA 2YHIB 3NVDA 1LDEA 4DQKA 4IH4A 4B3MB 1AG9A 1WZEA 2PKWA 4JN6B 3HKEA 1C7FA 4LX8A 2DWPA 2OUKA 1RLUA 4J7AA 4RDIA 4YAGA 1CEEA 1N92A 1O96B 4B3FX 4QYTA 3KQQA 2CXOA 3V8EA 1H2AS 4Y9RA 4BLTA 1W76A 3UUEA 1K8ZB 1TQ4A 5TMEA 4EGFA 5AVYA 2ECKA 1HORA 3HCNA 3NEYA 4OOEA 4EHJA 1CJVC 2ISQA 2DPGA 2FUNB 2GZMA 3ER6A 1WIWA 5I9IA 5CX4A 4G8BA 3W5BA 1ABBA 2IXEA 1NQXA 3DTYA 2YC2C 2WYVA 1EFPB 4OFXA 2F90A 1C9DB 2WVJA 4JFRA 4X8MA 3ILXA 3QBVA 1KE1A 2CNOA 3IR7A 2GZHA 3TLKA 5CT4A 1H0HA 3FTNA 3KPUA 3TMAA 3WFZA 1GO2A 3FYUB 3O2QB 4XAQA 4GYWA 1PBTA 3T5PA 3LVBA 2AR7A 3CTPA 5JSZB 3ROKA 2H4YA 1E2QA 4KLRA 1I32A 1NFFA 1P61B 2QUAA 2COUA 1M8KA 4OIMA 3TL2A 2WJ3A 3H0KA 2DUMA 3RJ5A 5B57C 5K09A 3FYCA 2YXLA 4IM7A 1ESMA 1U04A 2HA5A 3CW8X 4GYJA 4I6GA 4YRQA 4GGMX 3U7EB 4RD6A 5L4LA 3VO1A 5CB8A 1V7QA 5IKEA 4GS5A 1SHLA 3BUSA 1CR1A 1YIDA 2OYCA 3OU6A 2Y92A 3MT7A 4DCTA 4FWTA 1TA9A 2DU8A 3BTOA 3G0CA 2G9UA 3GH3A 4FSHA 4RDCA 5EP3A 3L4SO 2AFHB 1TFRA 4J76A 3H6HA 5EE0A 1A9XA 5IW8A 2AJ8A 1FVHA 3ZWXA 5K20A 1A2BA 5K45A 2I6SA 3USCS 1CY7A 1QNFA 2BVNA 1EQ2A 3C7AA 1WBBA 1J8VA 1OZAA 4QTZA 4Y7CA 5DVZA 3K8QA 1OVGA 4EW1A 4MQBA 3EEFA 5A2GA 4EYSA 1EGAA 2VUIB 3QJ5A 4PYIA 4KHPB 4RVCA 1NRJB 5JYCA 3N2NA 5KREA 3TLGA 1D2RA 1AQ6A 2A0UA 1JSCA 2FYTA 2YZ7A 4P08A 5ER9A 3RYIA 3TMKA 4FMBB 2PXHA 3MINB 1WDKA 1BS9A 5K01A 1OBCA 1TAGA 1R5BA 3TVTA 4ARIA 3HEBA 1NP6A 4RESA 3LCVB 4O02B 3NFRA 4RMNA 2UXCB 1AK1A 3JQRA 4KJXA 3H7IA 5CB6A 4TVOA 4Z53A 4WZBA 5F7XA 1U3CA 3EIXA 3HVUA 3ST7A 1DKNA 1R8SA 2A1UA 4F2DA 3BG5A 1X1AA 1L4HA 3EN0A 4PM4A 1F4LA 2UZ0A 2UZAA 3PQFA 4NCKA 3HXPA 3HEMA 4LI0A 4Y6PA 3WLFA 4UC0A 5G1NA 3D6FA 2FEXA 3MB5A 1NAHA 1BU8A 2GTIA 1VDZA 4OYRA 2C5GA 5A4DA 1LBIA 1NVAA 3MRVA 4BO9A 3NJRA 1BCSA 3CC8A 4W6QA 1GKUB 1PIWA 1GQYA 1CRZA 1S0UA 2ZSBA 3M6MD 3NIWA 2WMDA 5C8XA 3ESRA 2QTCA 3SS9X 3D43A 2WSLA 2BI8A 3RRXA 4LOLA 4YR7A 2PZGA 1VHWA 1PR6A 3N70A 3STWA 3LH5A 4ZREA 4DR6B 2HCTA 3T3HA 2IY7A 1NQOA 1E2MA 4BVAA 1M5UA 3O90A 1ZM2A 3KLNA 2VDQB 1VPEA 1W30A 5JPIA 5IBQA 1HKHA 3U26A 1QFYA 4OL9A 3H99A 4P4GA 1CJBA 1GLVA 1VJRA 4IXWA 5DPMA 2VHYA 1LJ8A 1OFIA 4H16A 4INJA 5EUMA 4A23A 1UBUS 4BMXA 1QKIA 1CULC 4EARA 3U1VA 4LJKA 4ZYTA 4QHSA 1GNTA 3DMPA 4URWR 3SZRA 2HK6A 1P33A 3LC1O 4JI0B 1D2MA 2D3TA 4UHBA 4C06A 2UKDA 1Y7HA 5DNAA 2IDMA 5JVDB 3A7DA 1JMKC 4OUKX 1HDOA 1YZQA 5DW3A 4HSGA 4P4SB 4NH4A 2I7VA 3WNCA 4QQKA 4FDLA 1N6OA 1ZGHA 4CF5A 3KYBA 4GR5A 1L0BA 2QYTA 3GRZA 1UEIA 3IP1A 4TMXA 1LH0A 5I9MA 3LF1A 3MJRA 2BDUA 3PD1A 5FBRB 1YF3A 1Q7CA 4LXXA 4AMYA 1YJBA 1SCBA 4YCSA 2LCFA 8ADHA 2FZLA 1G0OA 2PD6A 3NNDA 3AHGA 4FBMA 5HIMA 3SZMA 1QH8B 2R66A 3UJ3X 1M0WA 3IE0A 1CFZA 3JWJA 4DLSA 1X3LA 1A69A 2HJRA 2OO3A 4OGWA 4CU2A 3O6VA 1Y1TA 4C89A 1N33B 3C6YA 1HQCA 2YL2A 4FQ8A 4YXWD 2AF3C 2O8VA 5BQFA 1ZIOA 4DR5B 1R0LA 1Z88A 3KT8A 3GZNB 4JLVA 1HLFA 2G1AA 2YVQA 3ISVA 1HE5A 4MRMB 3B70A 1KOGA 1P80A 2ZQ5A 3A37A 3MCVA 1CY6A 3O0TA 2XEDA 2OGTA 3H9UA 4X91A 2EBWA 1VYHA 3NJ4A 1X7GA 1OMOA 2FDRA 4YBZA 4HQNA 2G80A 1R5OA 4FMDF 1WCWA 2W98A 4WCFB 2CD7A 5CW2A 1XT6A 4GZMA 5IC6A 3COSA 3OAAD 2RIPA 2SECE 1FNDA 4ZRNA 2M6LA 3GEMA 1TM5E 3K09A 4XARA 3RVJA 2PRJA 821PA 2I4MA 1KEKA 4DR1B 2C97A 2FPRA 1T36A 1M2WA 2QRVB 2JCXA 3LUCA 4W8HA 6YASA 3WP0A 4MLZA 4DZTA 4LG1A 5ELXA 3AEUB 3OFSA 1HT2E 4NQRA 3A6GA 2DJ5A 1LF0A 1P2TA 1WDWB 1TUBA 2HQ1A 3GRFA 4HY3A 4P2BA 1GU1A 4Z8YA 5HJEA 4X3PA 2HFKA 4UTRA 3PXUA 3LLSA 3I5AA 2B4TO 3H8SA 4JLNA 4A0FA 4O8ZA 4FJ1A 5IN4A 1QG2A 1I7NA 1XDDA 3UPTA 3AFGA 1T8UA 1W44A 3I4CA 2B7BA 1SIWA 4I5DA 4NYIR 2ZRPA 1JSXA 2H7YA 3WGLA 3BE4A 4XWOA 4P6VF 2WLSA 1KJ9A 3RQSA 2X19A 3SJBA 1OU0A 2YRFA 1JFRA 5CFPA 5ADWA 1W36D 4YC7A 2I55A 3IESA 2JHAA 4UBMA 5B6JA 2ERCA 5AI9A 3DMTA 1NNUA 1YB5A 2EBUA 2PKXA 3RUPA 3HDYA 2GTHA 5LPNA 1MH9A 4NZYA 1LDGA 6ADHA 1IJKA 3MBKA 1V1RB 2QI9F 4PG7A 2ZWVA 3G02A 4IDDA 4IX1A 2WYUA 3U3RA 1Q0RA 1XU4A 3A36A 1SRRA 1ZUIA 4M46A 5FPYA 3ZZ1A 5DP2A 3IJEB 5AW2A 5L6MB 1GAXA 2W2VA 1HLPA 4U0KA 4X7PA 4JLAA 3I8XA 4I0WB 4UNRA 1D7AA 2D74A 3KB1A 3I9NA 3VU8A 4UUNA 4BX2A 3RYCA 2ZRMA 1P62B 2WC1A 5HIJA 2OVBA 5EE5B 3WWEA 1FOEB 4M0LA 3G9TA 1N9KA 2MSLA 2G07A 2XZDA 1GAQA 1W8IA 3SF8A 4LTDA 3PFWO 4NJEA 4R05A 4AJ1A 3KX2A 1LDBA 2RHCA 4QM7A 3BWBA 2RSLA 3P0IA 4G89A 5GJVC 2P4UA 1NZFA 4O1MA 3WSWA 5HKBA 5CB0A 3RF6A 1VHJA 3FNFA 4OATA 4S04A 5CT9A 3VR5H 3EGVA 3Q2IA 4P93A 4TLAA 1TQ2A 3LWNA 4BLOA 2E9SA 3SYRA 4QOFA 1KAGA 1ZD8A 3NW9A 5K2OA 2OQ2A 1AF4A 1Z6YA 1QU2A 1SBIA 3ELDA 3LQKA 4V3BA 2NZYA 4N0PA 4PLTA 1LCIA 4QJBA 1MZPA 1HC7A 1ZCZA 2KJQA 4DV0B 4HFMA 1N6IA 2XUHA 3OCYA 4HF7A 2EJVA 4YFYA 1PSWA 5FTJA 2D00A 1L5WA 1QIGA 1QYIA 1WXHA 3PRKE 3LLUA 3NWBA 3PSHA 3J80A 5JVDF 2EFEB 5IUJC 3H86A 1OY1A 3KU4A 1HI9A 1R0RE 1WW2A 1LQTA 3NYQA 5GADl 3NP9A 4N7MA 4O4LA 2FEOA 4P35A 1U8AA 3N2LA 4JUCA 1Q50A 2IDZA 3FPSA 1L8QA 4MVJM 2O0HA 1QANA 3G9ZA 1H2XA 3GZJA 3Q10A 2Q27A 2GN8A 4HGPA 5CURA 4LF9B 3OA2A 1ZKMA 1JXMA 1B8PA 1KYTA 2V0NA 3IH5A 3QVUA 3MUEA 4R7TA 4RK5A 4DSTA 1KU6A 3KYJB 3WNVA 4I4TF 2RFLA 5JXWA 2HUPA 4XFDA 3FPJA 4F6CA 3C24A 5JADA 2GS9A 2XB9A 2O20A 4AF8A 3NYRA 1ZFNA 1C9KA 3BDVA 1ZNXA 2QLMA 1D6JA 2C31A 4IMRA 4KO2S 4QBGB 1H85A 1XMVA 1XX6A 4ZOLA 1EDEA 1BGWA 3E35A 4YT8A 1T5HX 3V46A 2H31A 4P36A 5C9ZA 2VHUA 3HY6A 6AT1A 2FPGB 5LOVA 3TL6A 1YRQA 2GSWA 3KKPA 5C35A 4GWLA 1RMYA 4AW9A 4CIBA 1FU4A 2DQYA 1ULAA 2ZM6B 3CPSA 4Q4HB 2X8JB 2HSGA 2NU8B 3F1KA 1Y34E 2ZIWB 5ALDA 1QYRA 3INTA 3IQGX 2ALJA 4PCUA 3RAPR 3Q12A 1R1DA 3ECAA 3V1UA 3IMFA 2WHQA 1VMKA 3N0WA 1K5DA 4M76B 2CFOA 4HNHA 2E1PA 4BKRA 2ADOA 2V9CA 1Z8FA 2ADFA 2E85A 3O3OB 4UEJA 3C4QA 1K8RA 3RNLA 5JSUA 2W22A 4DMLA 4IR7A 1N3YA 2FWRA 2HWWA 1C81A 2J32A 2JJMA 1TTQB 1E3JA 3BCUA 2NUAA 1QHSA 4JSTA 4NYJQ 1MFZA 2P6MA 4KB5A 5H02A 2CLFB 4AF7A 4AICA 1WDLA 2CK3D 4M8SA 1QAQA 1ULHA 3A1UA 3HJUA 3Q0EA 2C58A 1ZSYA 5C0OE 5KMGA 2Q3HA 3HBMA 1G8KA 2YH2A 1MLDA 3I37X 4MW4A 2QS9A 5IPFA 1E1DA 3OBIA 2X7JA 3VPBA 4C88A 4L4SA 4FBLA 3OE1A 1A8QA 4WBNA 2EKQA 1VL1A 3WL8A 2FLVA 2VJYA 4HVAA 1B3RA 4O29A 3NAQA 2WY2D 1TEVA 3CKLA 1DAOA 4EY3A 2PXAA 4LHEA 4ZVMA 3U7GA 1T24A 1PG0A 2B2CA 4PC3A 4RD4A 4XD7A 2DETA 3JD0A 1XSEA 5EZ5A 5IAOA 3TVYA 2JAPA 2CXTA 4KN5A 4C4AA 2PU5A 4MUMA 1SGWA 4KGDA 4G5QA 1XRJA 4N8EA 1Y5IA 4LJLA 1T9DA 4GL4A 1EJ6A 1KYWA 1WOYA 1E69A 5FXMA 2HHHB 1XQ6A 1XEWY 2QM0A 5E6RA 3GLFA 5LLDA 2CVOA 2HNKA 2QTAA 3EISA 3TTTA 4B31A 5BR4A 2E37A 2EIXA 3GGSA 3Q6IA 1J2JA 3KWLA 1TU0A 5G0WA 5HGJA 4DLVA 2PO7A 5C18A 1KAQA 2BZ1A 1FZQA 1IC6A 4CTOA 1MMFB 3PUXA 4FMDB 1RJ9A 3EQ6A 5JATA 1RM3A 4IVQA 3QGMA 1OBOA 5E6UB 1O6GA 2XXAA 4NEGA 4RSGA 3PQ8A 4JLBA 3DNFA 4QGBA 3VAAA 4AP9A 2CLSA 5E6SA 3AZPA 2V97A 4CGZA 4NCXA 4DG8A 2AF4C 4KR3A 3ZE0B 4IBOA 3L40A 2B1GA 1WZIA 3RUFA 3IOEA 1HYHA 5DZSA 1N0VC 3R7WA 2ZRNA 3UB2A 2NSLA 3WBJA 1Y0BA 2NXNA 3KDSE 5GV8A 1XZDA 1BW9A 4PR3A 1ZC3A 2QLNA 3B1XA 1T15A 3B3GA 5CIQA 1PZEA 1WF6A 5TT0A 4BWVA 3G9QA 2HU7A 3KD2A 2VS1A 1RKVA 4BFVA 4GPEA 5BV0A 4L4UA 1X9GA 5FOSA 5TE9A 3DONA 2VLBA 2O8EB 2Z8ZA 5G4KA 3OICA 1K08A 1S9HA 2KE5A 4JUDX 3KKMA 4TMYA 2YY5A 4PLZA 1OWPA 5AW5A 1EFLA 3A9RA 1X14A 3PDIB 2IFTA 2WOJA 2GO7A 1EFUA 3MS7A 4WL0A 1QMPA 4JFAA 4ZT3A 4IHQA 2AWNA 1N0HA 3MT8A 3OZSA 1ODLA 2Q9AA 4NK5A 4XJVA 4PC2A 1E62A 4ZPXA 3H2JA 4FFLA 3MLEA 3RSOA 4LYAA 1N2ZA 3DDOA 4F7DA 1JB1A 1GTRA 1V96A 2NW6A 4C0WA 4X8LA 4YDSA 1Q84A 2IYFA 4C6TA 3GOHA 4Y2XA 2C4WA 4M1EA 1IUNA 1J0XO 2O2YA 1JLLB 4URZR 2O2EA 3OLYA 2C2XA 5CM9C 3TLAA 1YD7A 2F55A 2P67A 3SR3A 1RT9A 3G17A 4HNGA 3LFHA 4ENWA 2P4HX 4NVRA 2OLJA 3IXLA 4MV4A 3KELA 2P78A 1TIBA 3LWBA 1G3RA 3ZWKA 2AW5A 3BGSA 3DXZA 3LUDA 1U5CA 1LY1A 3CT4A 2EW2A 2WM8A 2PUCA 4OBWA 1JDJA 3RASA 4BNUA 4LC9A 2PO5A 1K3TA 1KK3A 3ML1A 1BE8A 1XCMA 3M4XA 1EFTA 4QPNA 4BNJA 1GYRA 5JMPA 3H3JA 1SOAA 2FU5C 4RE5A 2A1TS 4AL4A 3G3EA 4MYUA 2FH5B 3AXSA 3GJZA 4BB9A 5CLJA 3ZTTA 4RJ2A 1RWBA 1JKMA 3E53A 1EJ2A 1R0BA 2XMQA 2A86A 1U1FA 2IYOA 3KSRA 4JUAA 4YRPA 1UK8A 1EK1A 2I2DA 4MYRA 1PT5A 5AK6A 521PA 4JOBA 1IOWA 1D8TA 1XB2A 1XKQA 2K2WA 4OA8A 3PEYA 5JRJA 4QSHA 3O84A 4ZZ2A 3SQDA 4DADA 1SG6A 4F2WA 1HURA 4QGGA 1EZZA 1XNQB 1CJUC 4RZXA 1YA8A 3BJEA 4P4LA 4CEIB 3WWOA 5AVQA 1SQ5A 2RHRA 3RT9A 3TJRA 1JG6A 3NBQA 4QRIA 5MN4A 7AT1A 3S1AA 2JLVA 1PVVA 4I4TB 1M1UA 3K70C 1NUPA 1P4HA 2R65A 1VL6A 3OI7A 1C7JA 1NXVA 5ICFA 3B48A 2C78A 2DFVA 1U7WA 1DCTA 2HSJA 2ZUDA 2V4UA 3MUFA 1JIQA 3KUDA 3PVZA 4NU5A 4UFNA 1LPSA 1F9AA 2J31A 5C5IA 3GU3A 1ZNZA 2CT8A 1T2FA 3ZGVA 5J40A 2PWPA 2H9IA 2XMBA 1MTZA 4WRRA 3RTDA 1KRHA 2YN2A 1R4AA 1WD5A 1YDGA 5A06A 5U9CA 5GOZA 2VA8A 2IYYA 3AJAA 2BMWA 1S7CA 3CXRA 1QXSA 1X92A 5SZJA 1KYQA 2IV7A 4OLJA 4YH1A 1BH6A 4O08A 1BE6A 2IZ7A 4DMGA 2OILA 1BXRA 1YKFA 5LA6A 3MS4A 4ZMRA 2C2WA 1O7JA 4MV8A 4EUNA 4M9RA 3CRZA 1R4NB 2PZFA 3GVHA 4QYXA 5EKDA 2Y05A 4QT4A 1NXQA 2V7QA 2C5BA 4D9EA 5AVVA 2DLDA 5HZMA 2QJTA 1M5RA 1FSPA 4UU1A 3KO8A 1H4SA 4I4NA 4YMHA 4UMVA 2CCGA 3KL4A 3GLHE 2GJSA 3HB4X 4J49A 2XYVA 3LK6A 4OM7A 5T5QA 3QPVA 3T4XA 5CFMA 3D4IA 1K86A 5ERYA 1CQWA 2PZ8A 4Y2YA 3HZRA 3B38A 2DBRA 2F3TA 4JI3B 3TE6A 4OYLA 4KMSA 3ZE1B 1B2LA 4XYMA 4EFDA 4B45A 1KH3A 2EP8A 1H8HD 1VIVA 3IB3A 1MR3F 2OGZA 3OJEA 3PTZA 1I5OA 1QIIA 4FZJA 4O2RA 4ZAGA 2I4RA 3HUEA 3A32A 4L7VA 3NJ8A 4TUYA 1LTKA 1OI4A 3W2HA 5EUQB 2XGSA 4EO7A 5JW6A 1FLNA 3QH4A 4L9SA 1IRIA 2YJTD 1W5TA 1AUXA 1CX9B 1ESEA 1XDGA 2A5GA 2M32A 5JDCC 3IUYA 1N5DA 4GOND 1PWEA 5BN5B 2R00C 4FXPA 3UJ6A 2GJAA 1PUJA 4ZC1A 4BV8A 4ZCPA 1JIJA 1EQUA 4IIJF 3I62A 4IS2A 1TJNA 2JH8A 4QD3A 1WXDA 4WBNB 4M9UA 4OMDA 3FB4A 1Z33A 3DAHA 2XDAA 1GG5A 3I9LA 1TLFA 2YVKA 2SKEA 4EJSB 3GJXC 3DAGA 4U7TB 4PCVA 2Q9CA 1BDJA 5CU7A 4YAEA 4GOKA 4A3SA 2HAEA 4JQCA 3JRXA 4JC8A 1G8GA 3LWZA 1CHNA 1ZOLA 4OBEA 4B6QA 1D1QA 1VLQA 2C4HA 4XDHA 5FHRA 3AW8A 2OV6A 2IA5A 3ILHA 1UKEA 4JGGA 2A6PA 5TC4A 5IM4A 4ETIA 1MO5A 4DG9A 2J3KA 4R68A 5TNXA 4IQGA 2ZBRA 4NARA 4MGKR 2AKEA 3U61B 2ZTHA 3GNTA 2EFJA 4CMJA 1E3DA 1E5LA 2JKYA 3O3CA 1OJ7A 1UADA 3K0AA 3G59A 2CL6X 1GRCA 3LT5A 3WQRA 1ZU4A 3QIVA 3FKQA 4GC5A 1P5HA 4MEBA 4O4JF 3LC2O 3STTA 2DBYA 5J1TB 2C00A 1FFAA 5KNBH 1IMJA 1Z7GA 1NKVA 6LDHA 1CUEA 4E5YA 2EEZA 3OESA 3WGHA 5TLSA 4HQLA 3B6ZA 1GU0A 2G4VA 1ADFA 5FR1A 4CL0A 1FJHA 1TT5A 4GRDA 4P84A 5CFZA 3FTDA 1Q3KA 2Q7DA 2VT2A 3ILVA 4WK0B 1E0DA 3AUAA 1GSHA 3LQ4A 3R6GA 1FS5A 4IWYA 1YL7A 4NPCA 1YQXA 5TXGA 4RIIA 4ZO6A 4KNYA 2LIVA 1M0SA 4BLSA 3ROPA 1EHCA 2PEYA 1RKUA 4XD7D 3HR8A 1O58A 1SU7A 1X0XA 2E48A 2I62A 1OYOA 2HF8A 2O7QA 4FSXA 1YASA 3UQYS 5B5SA 5IF9A 4HXEB 4LRWA 4MPTA 5DP1A 4M9QA 1GZHB 2C9MA 2R2AA 3MWYW 2WV9A 3SC4A 3H18A 121PA 3HJHA 3S5JA 2P30A 1P8JA 4I1SA 3V4RA 6REQA 1P73A 5F2OA 5FTWA 4D26A 2BGRA 2CLMB 1IEQA 2YMQA 3ZBPA 3FTFA 3COYA 4PGAA 4YRJA 4JJAA 1EHYA 3R0IA 5BSWA 1Q91A 2GD1O 5IULC 7MHTA 4A2CA 3FHCB 3V2HA 1REQA 1AMOA 2V8BA 4LGYA 4XQ9A 4RM2A 2CUKA 3FDZB 4FFRA 4KQEA 2W2KA 4D0LB 4BQIA 2O06A 2GM5A 4GI3A 3HXOA 2ONJA 4IL5A 5C1IA 2VHTA 3H19A 2DEUA 4MZDA 1S8OA 1H6BA 4A8HA 5D7BA 4EPWA 3G23A 3DYBA 1RYMA 5A3JA 4MIYA 4K40A 4DKJA 1NX9A 1DC5A 2BFEB 1MB3A 2VVTA 3OQHA 4JU8A 4QU9A 2BTOA 1C3JA 4C22A 3BMCA 4WEQA 2AZ4A 2VP2A 1UODA 1M6VA 3ERCA 3A04A 2IKSA 3O4VA 4PICA 2IYPA 1E9BA 1OJLA 4RJJA 2RK3A 4CQMD 1P77A 5FWDA 4R2KA 3TFQA 3MTGA 4TSFA 4EECA 2ZRGA 1ORVA 4EI7A 5CB4A 3PV0A 1ECFA 4BQEA 3EIOA 3ID6C 1CVIA 4TM8A 3TG2A 2P2LA 5AJWA 3K2QA 4ND6A 2C96A 2R8BA 3CBGA 3L82B 3OSZA 2UZ4A 2IS4A 3CISA 4KHZA 2J67A 3GEEA 2A5JA 3P2IA 4N76A 2PPLA 1B93A 1MVNA 2OWEA 3WHIA 1O77A 1Z6GA 3KL2A 2GNOA 5AWFC 1EVEA 3I2JA 4Y2UA 5NLLA 4ECAA 1PQPA 1JH8A 2GVNA 1UT8A 3QZUA 4WH0A 1MO3A 3DMNA 3KUKA 4WLVA 1Z15A 1L4EA 5COBA 3GVCA 5DHQA 4YYZA 5CEEA 1FDIA 5LU9A 1PJ3A 5EKSA 4EPYA 2H4XA 1VKZA 2J1LA 5EMLA 1VBFA 1Y4UA 4B35A 4LV8B 4HNVA 2KBEA 4ZU3A 3V32A 4J6FA 1AXRA 4A27A 1H9CA 1Y8RA 4FWBA 3MC1A 4N41A 5H7XA 2GSDA 2J7KA 2QX7A 3BQNB 1SKAA 4BU0A 1NKSA 1YZNA 3SD7A 1ES9A 1SC6A 1T26A 1UK9A 3ED1A 3GDFA 3AUSA 5FLXA 5T4BA 1IYZA 3PT9A 1DXQA 5A71A 1R6UA 1XCPA 2X42A 4NMMA 1M2FA 3O74A 3OCCA 2C0QA 1E3EA 1HGXA 3WLQA 1KJ8A 2ZUWA 4JROA 2BF7A 1W2WB 1QZUA 2V8OA 3WK5A 1RCTE 1P0FA 3C5WP 3ORQA 2Q0SA 3IP8A 4YUXA 2Q2WA 4FYKA 5IUNC 2H4WA 1BRMA 3BH0A 3DTVD 3H2GA 1CZNA 3MCTA 2VHJA 4QUKA 3R75A 4DJ5X 4EGJA 1BZYA 2ZBFA 3DPIA 3N8HA 1X8XA 3UZUA 1P4JA 4B4DA 3U7HB 1P75A 1HZJA 1KO8A 4L5YA 4M37A 4DLNA 4FIDA 1PJTA 3PUJA 3CLHA 3PB3A 4EHKA 3G2NA 1V1MB 2AA3A 2FE1A 1XZ8A 3JU3A 3I9KA 4X9XA 5KYGA 1XROA 4QPJC 1WB6A 5FTMA 3SBDA 3OPYA 5G2OA 3TINA 4IMPA 2XITA 1QRTA 2V6GA 1AF7A 2Z4RA 2WUWE 3BJRA 4HR7A 4E6EA 3TUZC 1V11B 2X8BA 1J09A 1QG4A 2O23A 2PIDA 3GRPA 3SGLA 2IPLA 4RC9A 1H93A 2YS7A 2ORIA 4R2WA 3WMRA 5ALYA 1A9RA 3LY8A