1W30A

Pyrr of mycobacterium tuberculosis as a potential drug target
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
174
Chain Sequence
ESRELMSAANVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PYRR BIFUNCTIONAL PROTEIN
publication title Structure of Pyrr (Rv1379) from Mycobacterium Tuberculosis: A Persistence Gene and Protein Drug Target
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 53
structure length 174
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w30A00
1I0IA 5JV5A 2JKZA 1I13A 1A3CA 1V9SA 1G2PA 1ECFA 4P81A 1L1QA 1TC2A 1ZN7A 1AO0A 1CJBA 4QYIB 1A4XA 3ACBA 5BRNA 4RAOA 2AEEA 4RHYA 3MJDA 5HIAA 5HKLA 1A97A 1A96A 4P86A 4LYYA 1VCHA 1O57A 4KN6A 1Y0BA 1DKUA 1I0LA 4OHCA 1G9TA 2H06A 2PRZA 1XTVA 1OPRA 5JSQA 1STOA 1QK3A 1GPH1 4TWBA 1W30A 3EFHA 1ECJA 1NONA 1BZYA 1P19A 4LZAA 1P17A 1ZN8A 2XBUA 1QK4A 4M0UA 2VFAA 1P4AA 1UFRA 5ESWA 1NULA 2H07A 5BSKA 2EHJA 1I5EA 1XTTA 2JBHA 3LPNA 4P80A 3OHPA 1L1RA 1UPFA 3QW4B 1A95A 1G2QA 4Z1OA 4RACA 1XZNA 1MZVA 2P1ZA 1BD4A 3M3HA 4RANA 5EUCA 5K51A 3LRTA 3O7MA 1DQPA 1LH0A 1QCDA 2JI4A 3GEPA 1GRVA 4RHXA 1XZ8A 2FXVA 2GEBA 2IGBA 3DMPA 4M0PA 4P83A 1TC1A 3DEZA 4ZFNA 5IAOA 4LZNA 1R3UA 1G9SA 1J7JA 1XTUA 3HVUA 4M0KA 3G6WA 4PAWA 4PFQA 4IJQA 1QB7A 4QRIA 3S5JA 3GGJA 1PZMA 1YFZA 3OZGA 5BQOA 1ECBA 2DY0A 4P84A 3ACCA 5KAMA 1QCCA 1U9ZA 1O5OA 4MB6A 1UPUA 4X45A 2JKYA 5ESXA 2C4KA 2PRYA 4S2UA 3OZFA 2PS1A 2HCRA 3GGCA 4RHUA 4FYMA 4RHTA 1DKRA 1FSGA 1U9YA 1IBSA 1A98A 3N2LA 1HGXA 1JLRA 3MBIA 2YZKA 2WNSA 4RABA 1DQNA 3ACDA 1D6NA 1JLSA 3KB8A 4P3KA 1DBRA 1WD5A 1OREA 1ZN9A 5IPFA 3NAGA 1HMPA 1I14A 4RQBA 4QYIA 4LZOA 4JITA 4X44A 4RADA 5KAPA 5BQPA 2H08A 1ECGA 1Z7GA 4WN3A 4RV4A 1ECCA 3DAHA 5E38A 1VDMA 4WMLA 1OROA 3H83A 1BD3A 1QB8A 4RQAA 1P18A 1VSTA 4RAQA 4F8EA 1QK5A 2E55A 4JLSA 4P82A 4LYGA
chains in the Genus database with same CATH superfamily
1J8YF 2F3TA 4PHGA 4LPSA 2D5IA 4JX9A 5E4TA 4KC0A 3SCZA 2TECE 4COKA 4IG9A 4CEJA 3VC7A 3BBPA 3DOIA 1RXEA 3MILA 1LNZA 4QUDA 5LKAA 3BBLA 3LIIA 3Q41A 1XNGA 1DHRA 4L5BA 4QLBA 1ZH0A 2I3BA 3ZY3A 3K6KA 4D82A 3HP7A 3SKYA 1LBEA 2WABA 4RJ2A 3GROA 3VV2A 1BDBA 1M67A 5GWXA 2P0YA 5IJAA 3EQZA 1U7WA 4I50F 4TKUB 3VJMA 4ARAA 4EMSA 1F1BA 1C2TA 5L7WA 2BFBA 4N5IX 4QT4A 1C1HA 4WK4B 4IPTA 3AZOA 1ZMTA 1LBQA 4OHYA 5JQGB 3EODA 3O4IA 1STOA 3AR6A 4B4KA 1P4HA 2VJBA 2C3YA 5IBQA 3TNDA 4DV2B 2ETXA 2AMVA 5HKBA 2AEFA 3EBPA 1QRTA 2HLPA 1SCQA 1XEXB 4CM6A 1TQ4A 2W42A 1NUHA 3BB3A 3GWGA 3TSZA 2R7NA 3FTDA 3LX8A 4LI3X 1RZRA 2A8YA 1XD2B 3G49A 1RXCA 3FOEC 3E5RA 4LAFA 1GGFA 3QPVA 3MXOA 5C31A 2J08A 1Y8RA 4UEKA 1UKCA 1KVUA 2QLJA 3F7OA 4G0PA 5J2UF 2C58A 1V6SA 5KSZA 3DV2A 4LCJA 3H2BA 2QORA 3WISA 2JBAB 2O5RA 4G1BA 4YP1A 2ZOSA 3SHTA 5ED4A 4UE3S 5ILQA 1BD4A 1WTAA 4MEBA 1RXIA 1I7LA 1GXSA 4B6GA 1I2AA 4IIFA 4DF3A 4EPYA 3CVYA 3I1FA 3F3YA 1U8AA 2WVAA 5BUQA 3K31A 1H1LB 3JYLA 3IKVA 4LC0A 3RHTA 1WXHA 1YQTA 2HQRA 2ZSFA 3KETA 13PKA 5U9CA 1J24A 4KZKA 1U28C 1UXJA 4Q24A 1GAQA 1OIXA 3DZKA 3K0KA 2IV3A 4X20B 4V03A 4BC1A 5AQ1A 4DB4A 1ZA2A 4DWOA 3H8SA 1OXTA 5EMNA 1HF3A 1XHEA 3KOMA 2O14A 4GF5A 2I3AA 2VK4A 4NESA 1EGAA 1ZRMA 2VJPA 5TMPA 4M83A 4M89A 2BKXA 4GMGA 1UM9A 2Y2VA 3FROA 3JR3A 3BTVA 4JLMA 1AKRA 3RBXA 3WK8A 3OQ6A 4ZOEA 2NO6A 2E4VA 3AHEA 3PEFA 5DHQA 2SKCA 3NJRA 4AY5A 4EJSC 5CYOA 3OPMA 4EG8A 3FCYA 3TPFA 2XXAA 1SC3A 1V35A 3RK0A 5HJ5A 1EJ6A 1U2PA 1N78A 3N3AC 5K4HA 4BB0A 2LWIA 221PA 3FOCA 5AI6A 3I9KA 3MCVA 4K5QA 4Q3EA 1D2HA 4ETNA 5EMLA 3G59A 2CNWD 4HVAA 3KXIA 4HWPA 4F4HA 2NO5A 2WIGA 1QDLB 4BMNA 3ICQB 1H6DA 1KO7A 4N3CA 4GXQA 4UEOA 4MUYA 1IJBA 1YH3A 1BD3A 3OCCA 5CYFA 1E92A 1OUMA 2IPLA 3ZY4A 2V5VA 2QTHA 4I4NA 5CNIA 4WKGA 2YXBA 3IAFA 2RHLA 1DC7A 3N2KA 1IEQA 2LD4A 4F2PA 1FNDA 3ZZTA 4NCHA 2H4ZA 4PG4A 3FHJA 4LYHA 2CXOA 2W0MA 3KR2A 3LUPA 5IAAA 5A9SA 3OQPA 1FUYB 5KUTA 3I3SR 3PSAA 4AMVA 3OY2A 1SBTA 5BUZA 1OI3A 2ID8A 3I01A 4ZYWA 1E1CA 1XZHA 4LY9A 1E79D 3L7OA 4NEQA 4ZOLB 3ZNNA 1MH9A 2WKQA 4UTZA 2R60A 1CEYA 3Q8WA 1P77A 2DAPA 6NULA 2FHPA 3CVWA 4D8WA 2CV0A 5D3MB 3DO5A 3DULA 3KLNA 3SK0A 2EZ4A 3G9XA 2WJZB 3NHAA 4BBJA 1JWBB 4Z3KA 4LF9B 5E0OA 2UDPA 5ESDA 2QRNA 1GQOA 2G5GX 1NVFA 1WBBA 2GCIA 2IP4A 1NYQA 3ADCA 1T25A 1CE8A 1AKTA 1VIMA 3QG1A 1OWLA 2I4TA 1HG1A 3QFSA 1YQUA 3H9BA 3TLCA 3N0WA 4FYVA 4A1FA 4QWWA 1RHJA 3UPTA 5FI3A 3LT1A 1DOHA 4P08A 3DMHA 4B6PA 1HRKA 1F6WA 1NM5C 3EQ8A 4JI1B 4A6DA 2MU1A 5A3JA 4RK7A 4YI5A 5AQEA 1KPGA 1R1DA 2Q4EA 4OV6B 1CR6A 2VPTA 4BNZA 2XSZD 3N8NA 2FFAA 4X6LA 1YQXA 1L5YA 2WAMA 2WD9A 2VT7A 2EEZA 2FUG1 1XZGA 1U8EA 2FN4A 3L7KA 2C2YA 1A95A 1QFMA 5F33A 1XA4A 4D26A 5DGCA 2QM3A 4JY7A 4CFSA 2V3VA 5FBWB 2HLNA 3OPYI 3WGLA 2PEZA 4KZPA 4MITA 5AM1A 5IDXA 3W5IA 5CX1B 1AKEA 1QZTA 1FJ2A 1KZ4A 4CV2A 4RH1A 3ELYA 5C9ZA 1SVKA 2O8CB 2H2GA 4H60A 1B74A 1TKBA 2BBTA 4XB2A 4AXBA 2KE5A 1PEKE 4KKVA 3A9SA 3SSNA 4B3TB 2VRCD 1DKMA 2Q49A 1N3IA 4C04A 1HQKA 2JAHA 1DB3A 3GFOA 4KWCA 3MZ0A 1TTQB 2GTPA 2KYRA 4L51A 5CFLA 1P9NA 4DKJA 5FTJA 4EY8A 1SU6A 2OD9A 4MLPA 2EIHA 4RELA 5ENDA 1NXWA 3OD5A 1R88A 3P2KA 3O4VA 5LP6A 5I51A 3P9SA 1Q17A 2IA5A 3T9DA 2XIQA 2XHZA 3REQA 3U4MA 5K0ZA 2FPSA 4NOLA 4AJ4A 2Q46A 4N7RA 2N3ZA 4UM8B 5L4SA 2QRKA 4L27A 3GLFA 2FPMA 1FSFA 2HRQA 3KJNA 2VQSA 4AJNA 9ABPA 3DNPA 1DE0A 5D87A 4OI1A 1UKYA 3NHBA 3VDNB 2MIIA 2E18A 2ZB4A 2C4TA 5EE5B 1EESA 4Z51A 2BCGY 4GDFA 2OM2A 4DJ5X 3HBLA 3ZJ5A 2ZI6A 5I7HA 1JLSA 4EG1A 4HEA1 4D9IA 5BNIA 4JXKA 4R1TA 5CT6A 1CJKC 2HY7A 4YPOA 3X1XA 5KSPA 3DWGA 1L7NA 3EXIA 1QGUA 1B00A 4YCDA 5EKUA 3BFVA 2NO7A 4ZVOA 1U0EA 4ZVPA 4J90A 1F6BA 1Z2PX 1ZDMA 5AT1A 3A4MA 5FPSA 4BVGA 4YTEA 2PLRA 2W6CX 1JIQA 3RC1A 4JJ4A 5IYZF 3RVSA 4LOJA 4F8EA 4E1VA 5ARBA 5BY2A 3NBFA 5AVJA 4BLUA 2JFPA 3WRWA 1D8AA 5JH7F 3UPUA 2RIRA 2PRKA 1FLDA 1V7PC 1PZFA 2EFHB 2JFQA 3H65A 1ODJA 4O63O 4BNIA 5FOQA 2X0KA 4IJMA 4GECA 1L9XA 2Y9PB 1EWKA 3VPGA 3MCTA 1UDXA 2EBHX 4N76A 1ES9A 2F3UA 5ADVA 1RAIA 2MSKA 3I83A 5IM5A 4WOJA 5M29A 3EDOA 5K8UA 3ISTA 2D5BA 2X9VA 2J9FB 1UPCA 3ESZA 2GETA 1TQHA 2XZDA 3N0TA 3V2IA 4MJ3A 4R9UC 2LRHA 1M2WA 3SXPA 1GPMA 1PFQA 1ILEA 1LKZA 4GC9A 4IH1A 2VSYA 2QUIA 2XE4A 4ZJPA 3EIQA 2GEFA 2XKKA 4H18A 2HIAA 4JI0B 4KBFA 3U3KA 3LX6A 3R0XA 1MJHA 1QO9A 1IOVA 2JFXA 4HFMA 2C3MA 4NL4H 5F23A 1LZKA 1UJ6A 2KMLA 3RAFC 3S28A 4XOUA 3SG0A 1IIRA 1TAQA 1QLJA 5K2MA 1LXCA 4MQUA 1C1DA 4PE5B 2DTXA 5FPPA 2YUIA 1QK4A 4INJA 3O2SB 4PZDA 2VFAA 3V8VA 2P4QA 3MJFA 5EJ6A 3F6CA 2X13A 4EUSA 4I9UA 2QP3A 3AZQA 4JC5A 1R5OA 4WJZA 2R4UA 2V03A 4LOKA 1Q11A 5DNAA 4MS1B 2ZANA 4BGUA 1PUJA 2HUPA 2GPYA 3OOWA 3HRHA 3U40A 1J0BA 1OFTA 2WUDA 5K2OA 1EYZA 1GQ2A 2CD9A 1XHFA 1RJEA 4NH0A 1Z0ZA 2JH9A 5JSUA 4P2BA 1RLOA 5D1HA 1P2TA 4F4JA 2PHZA 5LDHA 4M7WA 1QLWA 4JASB 1LJLA 2OHIA 2RHMA 4FILA 3BCUA 4DIFA 3R23A 4U5XA 3E61A 1JHRA 1KO1A 3GDWA 3W5VA 4LISA 3UNXA 4RXMA 5BOSA 3BE6A 3HCNA 4QRDA 3PGMA 1EWQA 2HQOA 2HA6A 3LOQA 3P9IA 5G02A 1U2GA 4C4PA 5KB3A 1M1NB 3AI2A 5CIYA 1SB9A 5UKDA 5A4IS 4OKSA 2VP3A 4DBZA 4ZK6A 1MT0A 1G5HA 3ET5A 3ZI0A 1CEXA 1PG2A 2R1TB 3NOQA 2C9MA 1R0LA 1PQWA 4ISBA 3MK31 4TX1A 3CB2A 5MF6A 4DSUA 1ZJZA 2QY9A 3ZQUA 4JJKA 3DV0A 1N9GA 1QYXA 2IYUA 4B3HA 4YAIA 6AT1A 4F3KA 4Z7JA 4D8TA 4IAOA 1X1RA 3HJTA 4R8LA 4PC7A 1V16B 2VQEB 1HYHA 2VUUA 2XD9A 1DBPA 1I9CA 1L7OA 3EG9A 1VP3A 1GGMA 1F51E 3DDZX 4BC0A 2VEDA 4Q4HA 4DCNA 2FPWA 1UDAA 3AETA 4GZ3A 4Q9AA 3VR6A 4BFWA 1JX6A 3ZUPA 4E4YA 3NAGA 4XCQA 4RQBA 2O7NA 4MAMA 4BFLA 2VJAA 1QQ7A 1O77A 2BCEA 3RRFA 4GOKA 2I7XA 4BPBA 1I36A 1E9EA 4LOIA 2BGRA 2QTCA 3WNQA 2BKAA 3QU4A 3VKUA 3BVPA 1UZNA 1UFKA 4OB8A 3AB8A 4D74A 5ALFA 1OXXK 5DP1A 3PJEA 5IEBA 1IBKB 3OFJA 2J6HA 2E6KA 1DVRA 4MS4A 2DFVA 3AUTA 1DPGA 2HPAA 3R7SA 4JR0A 1Y7IA 2EATA 4KK4A 1H8HA 2VUHB 2AMJA 3WA7A 4O2RA 4B7CA 1WF6A 3AUXA 4KQ1A 3K6SA 2Z9DA 3QK7A 2FSSA 4GU5A 3ZE8A 3W2EA 1RM5A 3PHGA 1E20A 4IZIA 4M0FA 4CG2A 2VHYA 4PAOA 4R01A 2CVOA 1WTCA 2OV1A 2QN8A 2MOKA 2R4TA 2R1VA 3B6KA 3HUUA 4GM1A 1CUXA 1TCVA 1RRCA 2UVDA 3OH8A 4Y30A 1QFJA 3U62A 3R0VA 3VA7A 4P5DA 4G4JA 1PVOA 3K72B 1SXJD 3AVXA 4GKBA 4C3VA 1X7WA 5IUJC 4V2IA 5CA0F 3DCJA 3X1JA 1IBLB 4DIKA 1UINA 2OOKA 3PVSA 1SK8A 2G9VA 5JZBA 4I5GA 4ZZ0A 1OY1A 3BZUA 3HO6A 3RKUA 5K0BA 4MA4A 4FCCA 4UOEA 4CVNA 3NX4A 3OZDA 4OIMA 3CNEA 2BSXA 2MMGA 3NLLA 1SKUA 4UEQA 3QYFA 2BGTA 2XLBA 4RA9A 4XIJA 1NMSA 4UCFA 3PA8A 3DV9A 1YE5A 3CWQA 1X15A 2CK3A 2P30A 1C3JA 3KTAB 3PXCX 3HFGA 1G5RA 2AOTB 1AV6A 3F3SA 3OT1B 3QVWA 3TG8A 1ZCAA 2DFLA 4LMBA 1Q19A 3GRRA 4BNDB 1I4TD 3K0FB 3PQ6A 3AUFA 4OQXA 2O3SA 3NGMA 1RJFA 2G17A 2ISQA 2JVJA 1U6IA 3UPDA 1YFZA 2JCSA 3QFTA 1ZBQA 2ZB3A 2UYOA 3P9CA 5BSEA 1B8UA 5BXQC 1BFKA 3PQ7A 2IHTA 5GPBA 1NP7A 4CR6A 1EX6A 1BXKA 4KN8A 4F6RA 2E4UA 2OILA 1CUBA 1P5HA 4L4YA 3V1MA 4MR9A 4TYMA 3ZBPA 4TTVA 4ATNA 3RT9A 3K09A 3UHPA 1LV8A 1GRRA 2QRVB 3EQ6A 4C0AC 3PGVA 2LE0A 1XZMA 1RPTA 1SUDA 2OT3B 3OETA 5FBVB 1ZD4A 5G4LA 4HEHA 2NV6A 2WD8A 4FR0A 4IOJA 1Z4QA 1GQYA 1Z3CA 1Z25A 1WD5A 2ZJ5A 3DBHA 4JP2A 1YB1A 3L4BC 4M2LA 4WCFA 1V7CA 3NUGA 4OQMA 4KH1A 5G1PA 2PUHA 3JAWB 1WRBA 5AKKA 4C7JA 2JI6A 4RD1A 2WVGA 1G4UR 3CZ4A 1NAHA 4TLDA 4V3CA 5I8WA 5KNBH 3HBMA 4DS3A 2Q4OA 3PHBE 3PHHA 2HMYB 1NASA 1KJYA 1XZEA 1ZGBA 2D8AA 1T0IA 2RBKA 2WUGA 3FTNA 2Z83A 4AJOA 2AV6A 2OBBA 4C6SA 3PC8C 1N9ZA 4HDNA 3HJCA 4HJXA 2CVPA 5DX0A 1N7HA 5AI5A 1ZRNA 4L7QA 2BFFB 2NXJA 5DGDA 1F2UB 4A8HA 3K8OE 4KRFA 5FPKA 1SFRA 4JEUA 2AR0A 1SBHA 1CJSA 3PA6A 3ETHA 4G0YA 1HDXA 2VXYA 2ZUCA 3QXJA 2UVQA 5BQXA 4B6FA 2SICE 1N1GA 5LYYA 1AG9A 3GR6A 3OJEA 2WM9B 3OX3A 2PVSA 3MJTA 2YWHA 4N6NA 3L0PA 2PCLA 4PZEA 3I6IA 4F5DA 1HUQA 2GJ8A 2NVWA 2ZJ0A 4QPDA 3CH6A 1H1DA 4FGSA 2GF9A 3ORQA 3PHIA 1QUEA 4Y7DA 2NZYA 2C2XA 1GRQA 4UNNA 2CT8A 3K2QA 4HB3A 4KX5A 1KHTA 3DDNA 1L2TA 2B0JA 1VHLA 4WI1A 5DU2A 3I4CA 1I9GA 5T4EA 2CKDA 3ONEA 1L5VA 4HBZA 4K9PA 5E3HA 1TLTA 4DQKA 3U3RA 2RBEA 4JT8A 2B9VA 1Z4KA 3ZGOA 4GGMX 1TLLA 4R5MA 3ZDDA 2WF6A 3A05A 3HNRA 1K3TA 5AUNB 5IJZA 4MYDA 3SY8A 2JGFA 2AN1A 1KEEB 4Z9YA 4JBYA 3TCNA 1NR7A 5L53A 2MR5A 3CPEA 1JALA 2H11A 1AB5A 4OLFA 3T8YA 1W36B 3UJ7A 2A9OA 1EP2B 2DOKA 2PLAA 1GJRA 4QARA 1NBEA 4X64B 1A9XA 2Q4TA 2RK4A 3W8DA 1BA2A 3K6RA 2F00A 1BMFD 4GMDA 2BGJA 2FOIA 1TYAE 2YWRA 3LS2A 3ML1A 1DXOA 4JU9A 4YRQA 5JUWA 1S3IA 2H1HA 2O6LA 4OHRA 2LDBA 3NDRA 4JQSA 3UICA 4DR5B 2FDCA 1QRRA 4MWEA 3QE9Y 2NQ8A 2RH4A 1DWOA 2V9PA 3JQFC 4XRGA 2K6GA 1GRNA 3ONNA 1N2IA 1L7RA 1ZM9A 4CGYA 1I24A 3KB2A 4HMQA 1JG1A 2CGEA 1JLLB 3L02A 3W3ZB 3H5IA 4MMXB 1A9SA 1VE1A 4DUGA 3G5AA 5DJ5A 1KO8A 1RFGE 4MW7A 2PGLA 3S99A 4OQPA 2HU8A 3QXHA 4MUBA 4NONA 3AHFA 1DKRA 2ZTMA 1IPEA 2AFRA 4I55B 5KSOA 1NI3A 1TL7C 3E82A 4QFCA 1BDIA 2BEWA 2HJVA 2GTHA 1RWVA 4C21A 3IMEA 1C1YA 1UKVY 2F6RA 3CISA 3PNLA 3MEQA 5FFNA 2K87A 4FMDF 4UUBA 4F72A 4CWAA 1AF7A 3C7CB 1H66A 1NF2A 2IHBA 4K2AA 1PT5A 1XCOA 3PUZA 3N8DA 2ZJYA 4K3UA 5SYAA 3V1TC 4YAUA 1YMVA 3E7XA 5IAGA 1EXNA 4BO8A 4DLXA 2CLOB 4OJMX 1W4CA 4B3CA 1NOIA 4L5CA 3U56A 4YJGA 1XLVA 1T26A 2J3QA 5B2FA 1NG9A 2HRRA 3UG7A 2ADMA 3B7GA 3Q7EA 1Z33A 2ZRHA 3AJRA 2VNHA 2BE7A 3C16C 1TJ5A 4HFNA 3HVKA 2XKJE 2ZT6A 4R2LA 3QW2A 5I9IA 4CXMA 3KFVA 5I4CA 2JVIA 4JLSA 1F9EA 1TMKA 1XEFA 1UPBA 1G3MA 3DD1A 4RVHA 5BN1A 4GWGA 1YBAA 3C3EA 3M7IA 2QD3A 4FNAA 5BR8B 2JFHA 1OAKA 2CXTA 4ZT4A 5GQSA 4G86A 1Y4DE 3ZD6A 2ZYRA 4W1PA 1ZL0A 2ZJFA 1RKBA 3DBLA 3NT5A 1A97A 5E9WA 3KUCA 4YJFA 4F2GA 4Z54A 5GGXA 2X6TA 2Z3ZA 2PWBA 3L4KA 2XQVA 3NGXA 4UUAA 2ZQYA 2MSNA 1BGWA 5EIFA 3GNQA 4N54A 1FYWA 3GJTA 4P35A 3URKA 4JJEA 3ZLVA 4W5RA 2VBCA 3R24A 2RHGB 3DQPA 2I2CA 4KGVA 1HNZB 3CR3C 3L8YA 3T3GA 3R3ZA 1IATA 4NKRA 3E22A 5JADA 2P1RA 5LWQA 1L5HA 2IZ5A 4KYTA 5THXA 4JYZA 1PKXA 3SDSA 5FWXA 1D2NA 4BGEA 1GQQA 1SHJA 1TM1E 1UFVA 2AKYA 4XTRA 4YCMA 5C7YA 3U9LA 2R4QA 5HFAA 5GZ1A 3OURA 1S2DA 3GEEA 1XNQB 1OT3A 3LGXA 2J0UB 4QJBA 1WXIA 3IAHA 1P75A 1T0JB 4Q21A 3MTIA 1JTFA 3C3MA 2ZUTA 5CG2A 3T1TA 2I4IA 3QUQA 1UBFA 1QHSA 4ITUA 1KO4A 2C4WA 3SC4A 4BRWA 4G5GA 4YDRA 3EEQA 1EQ2A 5BW6B 3RUFA 2HW8A 3ND7A 4W9MC 2ZRGA 1PWXA 1MENA 1P6QA 1ZXLA 3B52X 3AYXB 3CF6R 2I4OA 4I4IA 3BTSA 3D2LA 3KSMA 1JR4A 4UASA 1RACA 2FTKE 3D2AA 3P9ZA 1E1NA 3OPYA 1W36D 4TMVA 5GJWC 2ZI4A 1NW3A 4M98A 1ZIDA 2B69A 4IIUA 5CGZA 2HSWA 4PHTA 3WFJA 3KLBA 2VF4X 1Z6YA 2XXJA 3HHPA 3T99A 5KQRA 4E4RA 2WIDA 2VP4A 3GGOA 1L4EA 5GV8A 4GFDA 4D0RA 1M2KA 3Q3EA 4TL8A 3AL0C 3H7AA 1U8TA 3EXFB 3BPSA 1SVSA 1SKQA 1D1TA 3BRSA 2H2HA 3EBLA 5CVUA 3SYRA 5A3QA 3JY6A 2P67A 4P84A 5HJ2A 3MCWA 2UUCB 1L8LA 3B20A 4I4TB 1J8MF 2RAFA 2IUUA 2FFBA 4WBNB 1EUCA 2E82A 2JKYA 3A6ZA 1YZLA 1MCZA 2CNOA 2NSJA 2VWPA 3GN1A 3K1AB 4QG7A 2DBQA 4WASA 1FPMA 4B9AA 1PT7A 2C54A 4H7FA 4M0EA 4C78A 1II0A 2GVNA 3IESA 3GLRA 4OU5A 4PZLA 2ALJA 1O94A 3IJPA 3A1UA 1UWKA 3NVKI 1JLRA 3RGGA 1RM4A 3FB4A 4RSHA 3N7UA 4IDEA 4NE9A 3TSAA 1ETUA 4JVMA 3QLTA 5SZIA 4LE1A 3TR0A 1W88B 1HE2A 2EKZA 4RZHA 3ZLBA 5LUAA 1PP4A 2Z5VA 2X2PA 1J00A 5CW1A 3VO9A 4XB1A 2E21A 2I66A 1B3BA 4GPEA 3HM9A 3P0IA 1RJ9A 1W34A 1Y6FA 2Q3HA 3EVCA 1M1ZA 3KOOA 3RS9A 1TYZA 2OZPA 3KQPA 3ZD9A 1I7PA 1GSAA 1T3ZA 2DUJA 2H08A 3KUKA 2GHQA 2WWFA 1AN9A 1FP4A 4PHCA 1ZUWA 1EFKA 1SZDA 3GOQA 3FOZA 3A1DA 5JZOA 3IHLA 3UMGA 4QTXA 2AZTA 3FNGA 4IHJF 4K88A 2GT1A 2MR6A 1Q2XA 3AEZA 5EWJB 1KI9A 3DAPA 5SYMA 3TB6A 1MLDA 3VYTB 3L4JA 3K9HA 1MJ5A 1HYGA 3C2QA 4CCSA 5EJ9A 3JZFA 1JAZA 4GBJA 4CCWA 3DM9B 1NSYA 2D2FA 2GA8A 3CO0S 3NP7A 1SHTX 4ZAYA 2CVZA 3QNMA 3WGQA 1FJGB 3VNSA 5BWBA 5LQDA 1CJBA 1ZH4A 3SQXA 1CRLA 3QUTA 1KORA 4F4DA 3S8EA 2FUG6 3CUVA 4MHOA 1I01A 4WQMA 1FVXA 1L7XA 1EHCA 5J23A 3HMQA 1ZEJA 2G5CA 2OXIA 4MWZA 4QE3A 1CB7A 4IILA 3ZZNA 2ZUEA 1Z29A 1T24A 4PBSA 3PLRA 4ZT6A 4XFJA 3UUWA 3M6LA 3KQLA 1OE0A 4D3FA 3OE7A 4B17A 2FZVA 3LT5A 2HU5A 2UYGA 5EXDA 1Z06A 5BSMA 4ARZA 1U81A 2IEYA 1NF8A 3K0CC 2IJGX 3CSSA 1T8TA 3VR4H 4I5EA 4PX9A 4X24A 5EPOA 5C34B 5MGNA 4TYWA 4GLOA 1UK7A 3G2HA 4IIEA 4LJAA 3HYRA 5I48A 1J42A 1TU0A 2Y05A 5IKPA 1JVNA 4MUEA 4FIZA 4ZVNA 1K4KA 1GNRA 2D7JA 3Q87B 1ZMOA 5DV9A 5I47A 3V3KA 3MFYA 3ZD7A 4QSMA 4UUPA 1P1BA 3MJHA 4Q1DA 1ZBDA 1G2QA 4OXNA 4NYJR 5BN5B 4ALIA 4DC9A 1UDRA 4BMSA 3D31A 1AQNA 4L4UA 5FTLA 4AYWA 1XDDA 1AXEA 3P32A 4KO8A 5B7GA 1MJGA 4O4IA 1YZKA 2BV3A 3JZIA 2HPHA 3CH7A 4DSTA 4ZRNA 3T1QA 1W5EA 3I2JA 1G6OA 2IC5A 4KXQA 2AOUB 5HQ3A 2VF8A 4C1BA 4ANFA 4HEA6 2PSEA 4OL9A 2XMRA 2MSDB 5DI9A 4OGGA 4NBVA 4KRYA 2DQKA 2H1FA 4I8XA 2FE4A 2PX2A 4P54A 5DEIA 1Z15A 2AC2A 3T4PA 2PGDA 4IMIB 5BN3A 2J6IA 3JASA 3SJUA 2YFQA 5DBGA 1OBHA 5G1NA 4PLVA 4S2UA 1PJAA 1TPZA 2NUPA 3FM9A 1ACMA 4MPRA 2I1WA 2Q1TA 3D5EA 4OKIA 4PQRA 2X8AA 4O08A 4L6AA 1P5FA 5BW5A 1JQLB 4LHWA 1Q57A 2A7XA 2QUBA 3SIRA 1VCIA 5ELXA 1A98A 3MOSA 1Q3HA 2P2SA 4KDCA 1HA3A 1ONPA 1YVRA 3W6NA 2RIPA 1AQIA 1NXSA 1LDBA 1NVEA 1AUQA 1VFNA 2OESA 4HNGA 1VE6A 3D8NA 4IUYA 4JOQA 5FL7D 1TVKB 3T5BA 2REXB 1GT91 1RKUA 2PKEA 3DEYX 2I0FA 3A6GA 2C9YA 4UCXA 1HMPA 2ZULA 3VJLA 2QT9A 1WUHS 3DWFA 3IDFA 2FWRA 5ICMA 3C7AA 1Z8FA 3FCOA 3RRXA 1MHTA 1UOPA 3MF4A 1G8PA 4GYWA 3QBVA 4U1RA 1USKA 5CEFA 1R3DA 3T06B 4BYMA 4CN8A 1WB4A 1WR8A 2AYZA 4NX2A 3FTQA 1TM2A 4URYR 3M4YA 1B42A 4FFMA 4FYXA 4QBFA 3S2SA 4AD8A 2FAXA 3O91A 5I9TA 1BC5A 1RQ2A 1CNMA 3NC1C 3OEEA 1KDPA 2P40A 3LCCA 4L8FA 3VTAA 3ZU6A 3FDXA 3IOYA 4HDAA 3T61A 4UM7A 4INZA 3EZ6A 3ER8A 1QVZA 1AOXA 2PH1A 1TEVA 4IRMA 5J4YA 1HE3A 2QQEA 3FR8A 4AX4A 3OSUA 2JG3A 2OZLB 2BR4A 1PK8A 3TRHA 1DUSA 4H27A 3KT0A 3TQTA 5HWSA 1VL8A 3DLHA 5AH0A 1RAEA 1PL0A 4AYTA 1TO1E 3PPVA 1DCMA 1P2BA 4XUDA 2H8KA 3P2YA 3LHKA 1PCXA 1ZO8A 1VPWA 1N7JA 4R51A 1ZI9A 2VQ3A 1VJRA 3SNKA 3OQNA 3F6RA 2Q5QA 2YDYA 1AZTA 3VC1A 1ZFNA 4AO8A 4KCGA 2EZ8A 1JSXA 3PEYA 3O3NB 2CFCA 1NRJB 1V8FA 4NVRA 3ZJYA 4RVUA 1WSAA 2HN9A 4GGOA 3JATA 1N4AA 1EA7A 3QFFA 1M8PA 3WNCA 3N87A 4YB8A 4WKOA 5LYJF 1OXMA 5JJKA 2JDIA 3KALA 4P80A 1XE3A 1W4LA 1YCDA 1XKXA 2E4ZA 4KI7A 5EIOA 4MKGA 3B3QA 1FX0B 2PL9A 3PRJA 3K7EA 1M34B 4MAFA 5HE8A 4X95A 1GV0A 2C42A 1UMCB 4J6EA 1B73A 1KEVA 1JMYA 2H2WA 2Q6TA 3BG5A 3R0JA 2Q2OA 4GBED 3S27A 3WRYA 3VM6A 5KNDH 4K2HA 4Z3DA 1AGNA 2YY6A 2IU0A 1P7CA 1A9YA 5AW0A 1IWPB 1EE1A 1Z0SA 4LDNA 4AZTA 5DSTA 1Z62A 3DP9A 3EG5A 3RPEA 4ZJUA 3IAEA 3GVXA 5EMKA 4LZNA 1VKZA 2AXPA 1UEXC 2HCBA 3A6LA 3G0IA 3ZWMA 4EJSA 2ZIZA 1KZ7B 2G63A 1ZD8A 2ORVA 4WJKB 1WXGA 3KQNA 2EARA 2ZBUA 2AJCA 3Q8MA 1U9ZA 1E7SA 1HK7A 3AW9A 3LCVB 1NN5A 3JQRA 4A8JB 3PHLA 2OYRA 4XGNA 5LB2A 1KYWA 3A3NA 1EVYA 1PW5A 2NPFA 3ULKA 1G38A 2LR0A 2NP6A 3HBNA 3KQVA 3PQ4A 4BO1A 1VM6A 4N7MA 3OCYA 1SCUB 3FZYA 2Y1XA 5AK0A 5DLQC 2QLNA 1BVRA 1SIWA 3HKCB 4U2GA 3M1YA 1PFUA 2GAOA 4FBGA 4HEQA 4R3WA 3RV3A 4B3IA 3RYHB 4ZT3A 2FNAA 2WF9A 4WV3A 3WA6A 5CYGA 2YNMD 3U17A 3BFXA 4QEZA 5DISB 4OQ4A 1C80A 1DQNA 1KJ9A 1R6UA 4TPKA 2YHBA 5DHAA 5AOVA 4ID9A 4AY3A 4AZ0A 5C8DA 3L77A 3WWZA 2FZEA 4EENA 1HLFA 3MD9A 2EF0A 5DN6A 1QP4A 4AUNA 5AW5A 3WLPA 3VFDA 4TTTS 1FLAA 1M74A 1P0FA 3EZ9A 4P0TA 1UZMA 1CLUA 2G72A 1JG6A 3NT2A 4M54A 5FHRA 1QKIA 2J5BA 1U8FO 2YHSA 3ZDBA 1BQ3A 2LUOA 3L05A 3ROEA 1KI3A 4W9RA 3WGZA 4DCUA 4A7PA 4YVFA 4UC0A 1T5LA 2E55A 3A1WA 3ZPXA 3AERB 4OIFA 3KYJB 1QPGA 2EG9A 1ZK3A 4RIIA 3P8ZA 2IPOA 3BXGA 3TLBA 1KEPA 4OOFA 1JSRA 1T3HA 1GILA 2HK8A 4LC1A 3F5MA 1PT9A 1TT5B 1TC2A 1ZN7A 3IURA 4A5OA 3KDSE 3RUIA 4ZI2A 2NTEA 1U80A 2CBZA 4BCCA 5JRDS 1FMTA 3ETNA 4Q34A 1C9EA 2PU7A 4BASA 3OQ1A 1ZUNB 4F84A 3JARB 5FNVB 1P1RA 2XNDA 1XVIA 4Q7MB 2JI9A 4R2JA 2XXBA 2ZT5A 3KVNA 4L4ZA 2UU9B 2Q7XA 3FKSD 4C89A 3PV0A 5AIBA 2VWGA 4AO7A 3WRXC 1XQ9A 3GAZA 3TDKA 2G80A 2BRUC 3CKLA 4YJ2A 3I53A 1V45E 1OKKA 2W11A 4PR3A 5EIWA 2HYIC 3HTXA 3TBFA 1P8JA 2JFGA 4FOSA 4HNVA 3OICA 4CLOB 1HSZA 2FW9A 3OSZA 1RTTA 3QTTA 4XR9A 3FMOB 1X8JA 3STHA 4CQJA 1SXHA 1TIBA 3DF7A 4DXAA 3WFZA 3VHXB 4Y2JA 1RQ7A 3GFQA 4XX0B 4FMCB 2OQIA 2DBZA 5KDLA 2HXSA 1LCIA 4UNRA 3ZS9A 1W36C 2C4MA 1V5EA 3IQEA 4J8PA 1L6IA 3TOSA 4EY5A 1UJ2A 2J4FA 5CB4B 1OT5A 3PDIA 4D1YA 4RWZA 5DKFA 3GU3A 4TZKA 1VTKA 3CT6A 1TD9A 1R9MA 4H6VA 1Y3CE 1UIMA 4CM3A 2HWUA 3PEUA 4UD6A 2HHJA 2B3TA 4EG7A 3RJTA 2NPOA 3H1PA 4RTSA 4YYEA 2B36A 2Q9AA 2QYOA 1O96A 1SC4A 4COOA 4IV0A 2FEAA 1H2YA 2OSVA 4EB6B 3LFUA 3G0DA 3F2VA 1Z45A 1ZOSA 2RHBA 3L3BA 2QG4A 1FRFS 2G9ZA 1R0ZA 2NUTA 4ZFNA 1KFBB 4JX8A 2X8JA 4W1SA 4WKNA 3KSBC 2IT1A 2WICA 2ZB7A 3M1AA 5HFJA 5BRAA 3D6NB 4G1EB 3AL2A 4X62B 4RHCA 1H1TA 2BFEA 4NFHA 1FBTA 2ZE8A 2SECE 1TVEA 1WPQA 2SHKA 3A9RA 1CY8A 4HR7A 2UZ1B 4M1MA 5E1DA 4MUHA 3HJBA 3CE9A 3UGTA 4ENRA 2YVQA 1AIPA 3PQ8A 4PHHA 4JWKA 4W6QA 5LZ8A 3HB4X 2FZ4A 4RGYA 1QC5A 2JLRA 2ZT8A 3VNVA 1L7PA 3PWKA 2YS7A 3A10A 4YRDA 5L3SB 4JIGA 1KI7A 3IKMB 4CLXA 2WUEA 4HO1X 1K9SA 1VRVA 1JQDA 3T54A 3RE1A 3ADOA 4ZYZA 5KJEA 5C32A 1EDEA 4PHFA 4G1VA 4NWIA 2IZZA 2PCJA 1R9GA 4JJ8A 3ZWQA 3P5SA 3EE6A 2RHDA 1U04A 4F7WA 5KCZA 1MJGM 5AICA 5KAPA 4OQLA 3VO1A 3EISA 2QRZA 2VAXA 1AGRA 3O95A 3V46A 4B4VA 1KPIA 4B82A 2W43A 1Q14A 4CNBA 1DI0A 2YRFA 1U5BB 2WOOA 3SXUA 2OVBA 2ZBEA 1SOVA 4E3WA 3BE5A 3AM3A 4U0KA 4CM4A 4EW3A 3DE6X 1R10A 1VPTA 4PINA 4WZBB 2XCUA 1B0PA 4XJXA 2BKVA 1UBEA 4XFDA 4S3MA 2ZWOA 1FK8A 2FPPB 3D8HA 4TTAA 3UK0A 5CLJA 2OR3A 2DKNA 4RA6A 3T3MB 2EBFX 3G13A 4NJMA 4BCBA 4GS5A 4IHAA 4MI6A 3LRXA 4NBLA 3VTZA 5J58A 2H48A 8GPBA 3EC2A 1D9XA 3BQMB 1WCIA 2Q8PA 4G56A 4L0CA 2N46A 1MX1A 4ZOCA 1RXSA 1NVGA 1UF9A 1Z2DA 2V8BA 2ET6A 1IULA 1JEQB 3ENWA 3PX3A 1PDOA 2JASA 2BT4A 1NUSA 1BCSA 1ZUHA 1KK3A 2GVDC 2QTFA 4OHWA 2PFSA 1P7ZA 1OPRA 2R48A 2VHCA 3X1MA 1HQDA 1Q0PA 1SRQA 4L8LA 3KHSA 3VU1A 1CUIA 1QMPA 2VHTA 4BVHA 3LVBA 1M2OB 2A5DA 2X2EA 5HCNA 4FNMA 5DGXA 1KTIA 2I76A 2IGTA 4PAQA 2OK8A 3OPXA 3O4HA 2ZIXB 1P1KA 2EL7A 2OM6A 1OLOA 3S40A 4FSXA 2QQ5A 4L9RA 5A6VA 5ALYA 3AP1A 3CPJB 3LNCA 4GOLD 5AJUA 3MWGA 1UPTA 4G8CA 4KVAA 1NULA 4TYPA 5I7RA 3NBUA 3TGPA 1QO0D 4RVGA 5JWRA 1XA3A 1XQYA 3FRHA 5I7FA 4YCCA 5DOZA 4AB1A 3HXMA 4Z1MA 3HCDA 1QRAA 4TTPA 5KX5A 3AU9A 3FPKA 4JXXA 2MSLA 1F4LA 3C4QA 1J22A 1FVOA 2PSSA 4J9UE 5C52B 3EX7C 2NO0A 4DIOA 1OI4A 1QV7A 2ECQA 1ADGA 2PNFA 2XBLA 3GP3A 4PZAA 1JHUA 5SYNA 6REQB 2XE8A 2YCLA 4N65A 5FWYA 3X2SA 4F5YA 3CKYA 4Q9DA 4EI2A 2QRMA 1IZ8A 3PGA1 3DUFA 3V4ZA 2X7HA 1NLUA 1BW9A 1C3LA 1WABA 4AF8A 1AKQA 3OT5A 1EFVB 5ALPA 2YV4A 3OX4A 1O95C 4BWYA 4DNXA 4QYWA 1USVA 4WD3A 5BSWA 4GEKA 1G1AA 3VUEA 3PT5A 1H9CA 1T29A 4IJUA 1P29A 1SU8A 4ZVLA 3O1LA 1E9SA 1ZH6A 1C7QA 3D43A 5B36A 4OHUA 3BT7A 3B5EA 2XDAA 1DS6A 3OMWA 4P36A 1OWOA 1WUTA 1M8FA 3HI4A 4XARA 2GPTA 5DWQA 3X1YA 4F3NA 2FQYA 4C7OA 4M87A 1EE9A 3RYFA 4DLBA 3AVWA 2WJ4A 3AEQA 3UV3A 1J1ZA 2QBYB 3AONB 2JCYA 2SKDA 4AMZA 1PX0A 1LSJA 4KSBA 1NVVQ 4L85A 1N5RA 2R6DA 2HNAA 1OYVA 2GZHA 4LXGA 5EA2A 4ER6A 1XDWA 2CMGA 5FCDA 2ZRLA 2ZZKA 4J4HA 4RK0A 1AHIA 5BQPA 5KDDA 1WZNA 5DRTA 1EIZA 4TLCA 5LSAA 1E3IA 4HQRA 3KQQA 1QJCA 3NYIA 1KYTA 4EG5A 1LW6E 2VA8A 2BDEA 3U7EB 3CWZA 4DA0A 4Y67A 1BSVA 1U8YA 1C30A 1Y7PA 5GVRA 4IO0A 1O2DA 5J43A 4ESOA 3TAXA 4KSYA 4GD3Q 4J76A 3VYVA 2JGMA 2JKZA 1KZYC 3JWHA 2IKSA 1MC8A 3A6DA 1A3CA 1WVIA 4X1YA 3UV7A 2JGDA 3NETA 1NP6A 3V7WA 4R3UC 3VGJA 4D4GA 2PJRA 4ZTUB 2A0WA 4OQEA 3LX5A 1WQ1R 1WSBA 5AW3A 3IR6A 1Z7WA 2YXLA 3CUYA 2G1UA 4S1WA 5LXTA 3CZPA 3I4FA 4RL4A 2O3UA 2VBIA 1E60A 3D7MA 4BXOA 4L5JA 1TAHA 1HLGA 4Q16A 2ZAMA 2QVYX 5EWLA 1NYLA 3UAXA 1EM8A 1J33A 1KJNA 4YASA 3A9TA 1QK3A 4UOZA 1K7XB 3VU9A 1P4RA 2BE9A 2EGGA 4K6HA 4YLYA 1YFJA 1EFAA 1C3XA 1XDZA 2PQ0A 3FVRA 4RX1A 2B20A 2C8VA 3N7TA 3V8QA 1K8XB 5F1OA 4A8PA 2BLNA 3PE6A 5CTAA 2DF8A 3U3XA 4XWKA 1A04A 2A5YB 2WIKA 3NV9A 5TDHA 4I1OA 4RZXA 5REQA 1B6GA 4EB3A 2EAUA 2YOFA 4RVFA 9LDBA 2DR2A 1SC6A 1RCUA 1X7ZA 2JBHA 3OZSA 5A0FA 1YA6A 4DIMA 5ED0A 1XOIA 2I3ZA 3EIUA 5K4AA 4LEIA 4P92A 3C3YA 2VNSA 3O1IC 3LDFA 3RBVA 3VR4A 2HNBA 3WNBA 4ZD6A 4ZKEA 1K6MA 4B3RB 1V8ZA 3GRVA 2C95A 1JHOA 2J09A 1QRUA 4EELA 3P2EA 1W5TA 2C77A 2JEZA 1KC3A 5D00A 4D8VA 2YHUA 1PUIA 2Q1SA 3U4AA 2NQTA 2G83A 2ZUVA 4RIFA 4YNBA 3P45A 2ZPAA 1KHHA 2BTQB 2EKLA 2X86A 3AUUA 2FN7A 3FH0A 3Q2OA 4GPIB 4I6GA 4LV6A 1NW9B 3OM9A 2CLCX 3O0TA 3R4CA 4MQ6A 4BAGA 5JJCA 2ABWA 4PFQA 1NUPA 2YIVX 3L8HA 3FWHA 16PKA 1TX4B 4C76A 3BE8A 2JCVA 5FUBA 5BMVB 3KP1A 1SC1A 3VQTA 2A5GA 1D2MA 1MW9X 4KXVA 1DV2A 1TA9A 2QRJA 3LQ4A 2WD7B 3DNFA 3L4BA 4Z99A 3V7FA 2NN3C 2ECFA 4CETA 1B0UA 2W4MA 2D8MA 4KXUA 4LKOA 1UP4A 3MCZA 4YRPA 4HDMB 1XT6A 4BJ3A 5KQMA 4JS0A 1VKJA 2CXRA 3N7AA 1DTWB 3FSJX 4XDGA 5TQ2A 2I8AA 2H29A 2CEKA 5CJJA 4ZRMA 1G8YA 4DCMA 1JKMA 4Q02A 5E7IA 1Q7RA 2YXDA 3DQQA 4C22A 1M33A 3F9RA 3N0RA 3M9WA 1RWWA 3PC8A 4E21A 1N5JA 4RWEA 4E13A 3KB8A 3BWEA 2A92A 3LP6A 4ILKA 4P3KA 4G41A 2W6JD 3CN7A 4YMTA 2G4VA 3I5UA 2ZITA 4EVRA 1YKFA 1YS1X 4IIJF 4X5OA 1F5SA 5K0JA 2VBFA 3WKEA 5HZGA 5M34A 2XVMA 1GNSA 1T10A 1VSUA 2QENA 4CKZA 4JLWA 2O48X 4JJIA 4XUEA 1ZQ1A 2GNOA 4TKUA 1TQDA 3D6HA 1ECLA 3VU3A 4EKIA 1AF4A 3GH1A 1QK5A 1RWBA 2FMXA 3GXOA 2ZYGA 5IKXA 1NAIA 4QNMA 1YDGA 3QHPA 4YUYA 4ZVKA 1OFUA 1XEXA 3LK6A 3WWYA 3MFQA 1DARA 1H2AS 2K5UA 2HLDD 1I10A 2XSZA 3LKZA 3PYLA 3ASZA 1RHKA 4M55A 2E48A 2CWDA 5HKLA 1XD2A 1FXWA 3FNBA 3IHTA 5FF9A 3WOHA 2X9GA 4BNKA 4RF3A 2J41A 4NBSA 1U1FA 4WCVA 3RVDA 2JW5A 3E70C 4W5OA 3A2MA 4H15A 2EWMA 4V24A 3EXEA 1G9TA 1CZOA 3H18A 4O0LA 1QANA 1NMXA 4R71A 4FC6A 4IYRA 1KQGA 2ATEA 2JBAA 2UXDB 1IZZA 1QQTA 3O4JA 3OCJA 2ZIUB 1M5TA 1R4AA 2QTNA 2ZJ6A 3PNPA 1Y9DA 2AFHA 3IV7A 4LDAA 1ZCFA 3QP9A 2WB4A 4BLOA 5CTJA 4DNFA 4YRRA 4L3WA 4ESEA 1H1LA 3Q3IA 2EBUA 3Q7PA 4Q3OA 4H7IA 3PI6A 5IN5A 4DAOA 1ZK2A 1KZGB 1QQ5A 2ZJ7A 3K70D 1LDMA 2UYYA 5DMHA 4ISCA 3OECA 4B09A 3F74A 4C29A 1UDWA 3JS5A 1TZBA 1T5OA 2AA3A 4QXAA 4X20A 4KWTA 5LM3A 4LNHA 2XT9A 1MBZA 3KDPA 4QBIA 2PSHA 1WU8A 1S96A 1T5SA 5THKA 1EX7A 2ESRA 3IP3A 3TIFA 2CCKA 4YJDA 2ISSD 5G41A 1SXQA 4TWAA 1COZA 5E6UB 1P6XA 2YC4C 1U0HC 2YWFA 1NNUA 4ZTBA 3R3YA 4M0PA 4DR3B 1E6UA 2HMTA 2J67A 4KGXA 4ZO9A 4DZZA 1G98A 3HVUA 2BC9A 1LSUA 3K0AB 4PAWA 1GCUA 3E8SA 1NJ1A 2P2CA 2CLIB 2I87A 3DOFA 3ZWOA 1MC5A 2X3YA 2O7RA 2QDKA 1FFEA 1HL7A 2ZRBA 5FFMA 5KNDA 3TK1A 2PANA 1AK9A 2KLBA 4BLQA 1EK6A 3UCEA 4KWEA 4YAGA 3UENA 5GIPE 3LO8A 2KHZA 4UHKA 3ZC3A 2WJIA 2WV9A 2VIIA 4F11A 5AW2A 1WF3A 3TE6A 3G7UA 2XGMA 5AXCA 4HN2A 3EHEA 2FK7A 2AG0A 2CFTA 1C5KA 5IAEA 5T3YA 4CFYA 5F9HA 5BV7A 1CR0A 2I6FA 1O6ZA 4RF4A 3VI3B 2W2MA 1ZW1A 4GI7A 2J33A 2FW7A 3DOEA 3QKRA 3W1WA 4JCOA 4ZOLA 1GEGA 2QMEA 4RY9A 3O1HB 2JFNA 1HDEA 1IEWA 4GR4A 4GLLA 4Y8VA 3IVMA 5HF9A 5JTUA 1MJFA 5D3MA 3AVTA 4C4XA 4IUCS 5FUQA 2YVKA 1UBJS 3CEHA 2LPMA 3TEJA 1HORA 3T34A 2XWPA 1ZA1A 3H2YA 4M1QA 4KQ2A 2Y4OA 1GCAA 5KWVA 1P9LA 3X1ZA 1H2WA 3SS7X 3RSOA 2A0YA 2KBEA 4MP3A 3PZRA 1DG9A 1TA0A 5U4XA 4DFDA 5LFAA 1NPTO 4KPYA 2UYHA 4GGPA 1ZZGA 1DRUA 1MJNA 4H7EA 4Q00A 2NX2A 3L1KA 1QPBA 3GJSA 3VZBA 4D4MA 4ZQIA 3TRIA 3N2ZB 4OHKA 1FUKA 4HFJA 4FFOA 2YWCA 2L69A 2OCXA 2XNCA 2XWJI 4RGVA 2GK6A 2ERXA 4Q01A 2C7RA 1NUUA 1R4NB 1Q7CA 3IUMA 4WINA 5IBRA 1JFTA 4Z4IA 3PF8A 3SLGA 3B9RA 3KQYA 5E4FA 1M7GA 3IUBA 4P3NA 4U7WA 1ISMA 1XA0A 5LJLA 1YJAA 3LXXA 3Q3CA 2G7ZA 5FA8A 3U39A 3TLGB 1TEZA 4NENB 2BR3A 3IB3A 5AVVA 4LY6A 5B3LA 3JYOA 3N3BC 4QGBA 5CX1A 1T6BY 1NWHA 3JSAA 5E3IA 4F46A 5TY0A 2YV3A 1OU0A 2O8CA 2FYTA 3PD7A 1P74A 3D6MA 4NF2A 1X9GA 5CBKA 1H4QA 4RZ3A 4F9GA 1N2HA 4CL0A 3J80A 5HQJA 4IQ4A 2UZ3A 2HA5A 5HSGA 2GZAA 3KS9A 4CR8A 4KQMA 1XNHA 2ZVPX 5D85A 2GZ1A 5AVKA 4EHLA 3KAQA 4OQQA 1PSZA 2KI5A 1UMDA 1A9OA 1U8CB 4CT4B 4E03A 4WACA 5CNJA 4X1KB 1UAYA 2Q6LA 2GS9A 2PH5A 3L7LA 4KQCA 4D9NA 3L0SA 3MW8A 2YH2A 3LYUA 1FW6A 1JDBC 2POCA 3DXXA 4AJ2A 5BV8A 5KOJA 5J47A 1OF1A 1KXZA 3LCJA 3CRZA 4DIEA 5HYVA 3SNHA 3WXMA 2VYFA 1YS2X 2EEPA 1MD9A 2RB5A 1ENYA 3DONA 4G36A 1EE2A 4X92A 5J4KA 2H9AA 1XL0A 2FG7C 1M2VB 3KUDA 2FXVA 1UZUA 3ETEA 4HUQB 4E5PA 4GOJA 4WXPA 3ABRB 4MWGA 2QW1A 4IDBA 3GFGA 4RGQA 1T3TA 1OZGA 5DLDA 3WLIA 2CY0A 4RULA 3Q8XB 4RUKA 4DV0B 3DE7X 5CYPA 4B46A 2AS0A 1KAMA 3Q5EA 2ISCA 5HEKA 4D8XA 4LXHA 2H63A 4MW2A 2VDWB 1SQ6A 4C30A 4R1UA 2O3JA 5T67A 2C5FA 4WY2A 4REOA 2R6GA 3DE2X 4LV5B 2FSIA 2CXXA 2HD4A 3M3PA 3UAGA 1Z37A 5JXHA 4A36A 2XA2A 2IS6A 2C99A 4RHTA 2HBYA 5JAZA 1Z63A 5LC1A 3AQ4A 3VO2A 3BGVA 4ODIA 4EW1A 5J1TB 5DTJA 3EK2A 5T4HA 4ERNA 1NJSA 3DOCA 4LVOA 1PQ4A 4R16A 4IZ6A 4Q1VA 4U7HA 3RC7A 5JWHA 1A5TA 5J4HA 1V1MB 4MVJD 5I3ZA 1KAQA 1NF3A 1U0OC 1FU4A 1MX3A 2QJOA 2X41A 1DBRA 1VZ3A 4PGFA 1KRHA 4V38A 1VL0A 1EA5A 2EL9A 2IODA 3B2NA 4JEIA 4TWZA 1DWPA 1QGDA 5LU8A 4C7XA 3G7NA 3BIWA 1E2GA 3O8QB 4J49A 5DHRA 4ZXPA 1SOAA 3NQ41 4V1CB 1K98A 1K7CA 2Y1GA 2OC9A 4Y2VA 4QU5A 2Z56A 4D3ZA 1XRMA 1GTZA 1KGSA 1HNWB 1JB1A 2E49A 5GM1A 4X8OA 1IUOA 1NUQA 1JA0A 1JR6A 4BFYA 2YOHA 3VKVA 1N5DA 4BNMA 3MJVA 4FS3A 1N8TA 2WP0A 4WNYA 4BB6A 1GD1O 4DV1B 4BMVA 3GDHA 3REFA 1T2VA 1E62A 2FG6C 4GAEA 4CTKA 2VEOA 1G59A 3NGLA 1XTPA 4KIFA 3W77A 4B31A 4YCSA 5M2QA 1CF9A 1X7XA 1PSDA 3MTAA 3W5UA 4O3MA 4O4JB 4Q3NA 1Y0BA 2CHUA 1JLMA 2GJSA 2VJNA 2W98A 4MS1A 5DM4A 3OIDA 1FMLA 4JBNA 2V7WA 5KDOA 1DCTA 2X8BA 3V9AA 3JWGA 4WRRA 3WQSB 2ZK7A 3BIOA 4Z9AA 1MFPA 4ETMA 3KHTA 3LC0A 3LSTA 4B48A 1ZIYA 2V7TA 1R5JA 2H4FA 3C6KA 1YJXA 4I66A 3ZYCA 4JLJA 2H6EA 5M3BA 3RVLA 3S8YA 5K45A 2HRCA 1LW7A 4FFSA 1Z0JA 3I58A 4X7PA 5C8YB 1GA4A 5C8VA 4PYKA 1N7GA 3GFBA 1RLTA 1TCBA 1SKAA 3ILHA 2P9ZA 2GFIA 1FOEB 1VHTA 2GZRA 1MMFB 1OSNA 3DF9A 3HB0A 2WU3A 3G17A 3HUTA 4L4RA 4MW9A 3SZGA 5BSFA 3ED1A 3HO1A 5KMGB 4PV7A 2B61A 1M1NA 4P93A 4WLNA 3EA4A 2XY4A 1W93A 1KBQA 3B12A 3U48A 1NU8A 1A50B 3RFXA 3MAJA 3OZRA 3QX8A 4JH0A 1OXVA 3MRXA 4C0KA 3CE6A 1KRWA 5AOBA 4OQFA 4WBSA 2AK2A 2IL1A 1IEXA 5EUCA 4RK6A 3D1LA 3KZMA 5CU7A 3N8GA 2Y68A 1JPJA 4BEWA 5KINB 1KK1A 2ZJBA 4G81A 1V16A 3F1LA 4YRNA 1Y8ZA 4A16A 4UPVA 1ZVMA 4L5IA 2ZSUA 1TYEB 2GN4A 1B1CA 1OBOA 2VPIA 3AVOA 3O2JA 5LDGA 2CKMA 1GPKA 1Z07A 4M9RA 2DB3A 1E6LA 3BULA 1BWSA 1FFBA 3MTQA 1E3WB 2BZGA 4NCXA 3QUCA 2I1LA 1M9NA 3FVVA 5LA6F 1Y9ZA 4EITA 5LQNA 1E7QA 2PYIA 1QXSA 2C00A 4M53A 2SBTA 2ILVA 2JK0A 2P90A 3NB0A 3KQWA 1ZICA 3LY5A 4M1OA 3TLEA 4JI2B 1GTMA 5EIXA 1T36B 1ADBA 4DMLA 5B1YA 5FEUA 3KTOA 2WV7A 1AHNA 2CYBA 2LW7A 3CMCO 1Y81A 1XTJA 2NAPA 5CJPA 3HLKA 1V8BA 3TQSA 5C51B 1WB5A 4DUZB 3IAAA 1A2BA 5EUBA 4D0SA 5HOQA 1DDOA 4L74A 3FCSB 3ROKA 3UWOA 4BNLA 2NYVA 2QLTA 3K6JA 4MHTA 3BTOA 4ND5A 1H0KA 2FB9A 4HQOA 3ZXUB 3U7QA 1QR6A 2HDNB 1P7WA 3OWOA 3EMKA 7ADHA 3OG9A 4P4SA 2OLEA 1KMNA 1LPBB 2C8JA 1J49A 1Q0QA 3S44A 4RV4A 4PIMA 4D7AA 1IOWA 1DIAA 5AHWA 3R9XB 2XA1A 4H1WA 1D6MA 4S12A 4PY2A 4GX2A 5FJIA 2AJDA 3NJ4A 2WWVD 4EGQA 5D3QA 4QXOA 4EJ6A 4JL6A 4J43A 3H84A 2GGSA 1E6MA 3VJKA 5DGTA 3F4KA 4DDWA 4EJ2A 2HK7A 2FR8A 5ITWA 3M9LA 1RQRA 4LWZA 2DKFA 3FOAA 3NUZA 4UHFA 2CMKA 2IS1A 2VK8A 1NVBA 5COAA 3W9SA 4PNEA 5T7BA 3DDWA 3DKRA 2J9ZB 3ACBA 2BHLA 2PM8A 4RAOA 5BOVA 4HNAA 4M60A 4D4LA 1T6NA 3UK2A 3TUZC 2Q3CA 4N41A 4LYYA 3VNRA 1QGOA 5BQ5A 2P1DA 1XRSB 4EJMA 1ZLXA 2EJTA 1XMOB 4ZYTA 5LKRA 2DWOA 2FX2A 3FMFA 3WGNA 1IMOA 1L7EA 3ZV7A 5LD2B 3MCAA 1SHKA 4YREA 5FB3A 5U1PA 3JX9A 3KTAA 3CPHA 2AOTA 4LTDA 3D59A 3RFUA 3L0ZA 1N1EA 3OT1A 5K8CA 1FNBA 4J03A 2P3QA 1AUXA 4MWSA 5IP5A 4YMVA 4JR2A 4CQMD 4I99A 1X1DA 3K0FA 4KE9A 3R4VA 5FOTA 1ISJA 1S5PA 1KH2A 5H80A 1TF5A 1MXHA 3EEFA 4FEYA 4A3SA 1AXGA 5BSKA 4Y1RB 2QTTA 3KE8A 3B7WA 2P91A 3E5MA 3IO3A 3IOMA 1MT3A 2A9FA 1QCYA 2ZYVX 3NC4A 3OU2A 4MWCA 4CI9A 2CLEB 5GOTA 2ECPA 5J63A 2RGXA 5CB0A 1T5HX 2AYXA 4MTLA 4R0NA 3WKCA 4AF7A 3RC3A 2FQQA 3CLHA 2ZZNA 4EYSA 4TZTA 4UMDA 3C3WA 5C4GB 1T3GA 3BFPA 1VE7A 1WMFA 3SHVA 1WUYA 4PU0A 3TLXA 4B84A 4F4IA 3LRTA 5IT0A 4UJ5A 1CEEA 2QRVA 4MHSA 1KY5A 4JJ6A 2FX3A 4A2WA 4MVYA 4EL5A 3K5WA 1IZ9A 4MWBA 1L5WA 1M34E 1X70A 3BX1A 4U9UA 3T7AA 1CRPA 4M0KA 1OWMA 2IHUA 4GICA 4G5OA 4H59A 3RG2A 1EVEA 3U26A 4B73A 2FMIA 2BMWA 2OLKA 4GNRA 3TLYA 5KQLA 2E2WA 3C1OA 2DY0A 2FSFA 1OASA 3ESRA 3VR1A 5HZMA 4Z8XA 3JAWA 4JELA 1GNLA 2P7HA 1ZGJA 3WNZA 3GFRA 3PIIA 1OGYA 2AFVA 3HKDA 4B7ZA 2HZBA 5B58C 2E5WA 3L82B 1H8ED 4URWR 1R5BA 4MULA 3HJAA 3QKSB 4OMDA 4LJ7A 3AHCA 2PV0A 3QX7A 3RSFA 1XPJA 4YRZA 4OBWA 3RSSA 3SJCA 5KKNB 4HXEB 2IUEA 3L0IB 3D02A 2LIPA 3EEBA 1XD9A 2BFFA 2PD4A 3GRKA 3KYBA 1F2UA 3DZ8A 3LLVA 1N2SA 4MAAA 4PRKA 4D57A 1J1IA 4KJXA 1VMDA 5F5LA 5EEHA 3U80A 1GL7A 1NQTA 1XZBA 2QAGA 3DXZA 3LOPA 2DTDA 4MVWA 4IVRA 4R5HA 2H18A 2WDPA 4C14A 1RVDA 3TLJA 5IULC 3MG9A 2JIDA 4IGKA 5EYPB 4IIYA 3QLUC 4Q03A 4RC9A 5HIJA 5LQKA 5DRYA 4F0JA 3DFIA 2IOFA 2WT4A 1V6CA 1D0SA 3N2GB 2XV1A 4UHCA 2EFJA 1N0IA 3AXTA 3FVWA 1ICIA 2B37A 4Q4CA 1QH8B 1H65A 1F0YA 2AI2A 2COUA 3DBIA 4KJZA 4RMHA 3RANA 3T7JA 4F9FA 1IE3A 2R751 2FZLA 5AKEA 4TMZA 1SCIA 2W6ZA 2X0FA 3ZQJA 4F9EA 2IU4A 4N5MA 3KLPX 4A2PA 1SBYA 3CLUC 1RYFA 2HWWA 3WRXA 4EJ0A 3V4RA 3TN7A 4R2XA 3JQ8B 3F9IA 1DQRA 5H68A 4QDTA 4ZWNA 3RBAA 2FJ0A 2QSJA 3PBKA 2W2LA 3QFCA 4HX2A 4O4LA 5F78A 2BHSA 5TMDA 3LA8A 4DUYB 4MQFB 1L8OA 3AGQA 4KRGA 4I55F 3LWBA 4XOIA 2RB4A 3QTLA 3V1KA 5DSXA 2BTEA 3OEHA 1KEEA 5K01A 4MCHA 5MDHA 1ECPA 4ML3A 4QSHA 1J90A 1E7WA 2NV0A 5TNXA 1U94A 2ZRPA 1K66A 1DFIA 2Z98A 3A3KA 3UXHA 4CM9D 2D0OB 1M1UA 3ANMA 2QE7A 2RGDA 1VCOA 3ESDA 3OF5A 5KJ1A 4YCLA 3AY7A 2G76A 5JW6A 4LFBB 5EQDA 1CKEA 4I7EA 3ROQA 4Y9TA 2NGRA 2XUQA 1NC1A 1R8QA 1G20B 1SZJG 1T34A 3TZLA 3VSBA 5LP1A 1Z0AA 1JIUA 3RVKA 2O8DB 3ILVA 1SCAA 1OHHD 1PX2A 2QW8A 5AW1A 1NPYA 3H2ZA 3L04A 5AM4A 3NT4A 3THOA 1I32A 1JLLA 1ZOIA 3QXGA 4A26A 1IZ0A 3DLCA 5I4IA 1KVSA 3FYTA 2WWRA 1VLVA 3CX3A 2JD0A 4UNIA 2WF7A 5KVAA 3PG5A 1Y63A 4HYEA 1VBKA 2OXTA 4NZYA 2GI4A 4KRXA 5EJ5A 3MGBA 3E4DA 3LP5A 1NJ6A 4ASUD 3KVOA 4GPTA 2BI8A 3M9XA 4XWTA 3NPMA 4HN4B 4NZOA 4EPWA 2JA2A 5K0GA 3VR3D 1X14A 5DLEA 4NTZA 4NEGA 4H35A 2OAEA 4PLWA 3UC9A 1W35A 1IPHA 1EPUA 3BRWD 4Q9LA 2Q9CA 1ONBA 2GJ9A 1EG7A 3LW7A 3NW9A 3VYWA 1QVRA 4YECA 4PN3A 4K0KB 1K2VN 1X86B 2A94A 1CUYA 3WP1B 4AZVA 5BSHA 4FZJA 2O2JA 4RPKA 4A23A 4BWFB 2GCNA 3THWA 1BDHA 1BXGB 2IIVA 3OOHA 5LIRA 3GLIE 3GUUA 3KNZA 3BFJA 4NRDA 4GM0A 3V2GA 4DQXA 2ID4A 3SQMA 1R6DA 4AY4A 3OM0A 4TRJA 1NXTA 3K92A 3I34X 3MSCA 4JEHA 4B9EA 4NHOA 5FPQA 3VOAA 3DR3A 4Z86A 5IXSA 2H3EA 5IPFA 1RW4A 3EYAA 2P41A 1KSFX 4OP3A 4D3YA 1Y6JA 4DNOA 1NIJA 4R2KA 5H0IA 4WW0A 3E48A 4WN3A 3EF3A 1E58A 3ZW8A 1E0DA 1LI4A 3DAHA 5DCWA 3UIEA 5HKKD 3KPJA 2EC5A 5KYNA 4MPPA 4E5NA 1THGA 2CYAA 4PZPA 1K7SN 1OX5A 1JB9A 1YVEI 4CMGA 4CT5A 5CD9A 1RI2A 2NZJA 4MRAA 3DOUA 4EHDA 4RD2A 3UAWA 4JUDX 1NV8A 3TD6A 1E2FA 1TTTA 4NNPA 1A4IA 1MPXA 3C8ZA 1BS2A 1EJ0A 1NC3A 3C8UA 1KARA 4KVFA 4NYIQ 1RC0A 4E31A 2WJ6A 4U7TB 3TLMA 3WNDA 1I5OA 2G36A 1DADA 3UMJA 4WT7A 2K7ZA 1V0JA 1K2WA 2FKNA 4IWNA 1PEYA 4G1CA 2XCQA 2J0UA 4HGPA 4M4SA 4C6HA 3TM5A 1SM4A 4C20A 2G82A 1GT6A 2Q8NA 3CUSA 4BIIA 1HE8B 1LS6A 5DX1A 3SD7A 2MJLA 1GU1A 2QL7A 5FPHA 1YC5A 1UC8A 4WAUA 4INOA 1FUUA 2E5LB 2GZSA 3VVMA 4XIFA 5J9FA 5KSYA 1GU7A 3A32A 3KYIB 4FX5A 1UKBA 4FJ1A 4MKRA 4N0EA 3U37A 4YT4A 2IYWA 2HQSA 3LUBA 1RKVA 2AG6A 2IP1A 5TJHA 1NONA 1FP7A 4NH4A 2PH7A 3OTIA 1L1FA 3U4DA 1H05A 1H0SA 1YFKA 4BP1A 1GNPA 2P9YA 5FQOA 1GCGA 3KQKA 4HWGA 2QTAA 3ZY6A 2I7VA 3FSGD 5ADUS 3IT1A 5H7XA 3K2EA 1FFCA 1M10A 2ZUDA 1NSFA 3CN9A 4I4TA 5FLXA 4FMBB 2PV7A 3IBTA 1F14A 3ODGA 3PJGA 4J0IA 3RUCA 1K6EA 1COWD 4ZC8A 4WBNA 3PGKA 1Z2AA 3K1AA 4OMCA 2WE8A 3I5YA 5E4JA 1O95A 1PTJC 1GTVA 2APJA 1W8IA 4IXTA 4Y2XA 5HW0A 4BMZA 1I6LA 1JZTA 1PR0A 2NO4A 4AWBA 3JVDA 3PC7A 4QT0A 3NWBA 2QV7A 5LBTA 1YC2A 2XHEA 2W6NA 4J0GA 4K81B 3B7PA 3LUCA 3T4EA 3R5SA 1HNNA 5AOAA 3DEFA 3ROGA 1R6AA 1A27A 1W88A 3B1XA 1J5EB 1NV9A 3IR5A 2X9QA 4QWMA 2L0XA 5C81A 3P19A 4V0KA 1L5KA 2BLLA 1ZEMA 2YUTA 1G8HA 5EUMA 1DLIA 5GJBA 4Z4FA 1V37A 3RIYA 4R1SA 5FOUA 1N6NA 1DBQA 4K6KA 3V33A 4YR7A 1EP3B 1YJ8A 3JQ7B 4GL4A 2JLZA 1P2VA 3DPSA 1CNFA 4ZJYA 1W6UA 1QIMA 3DDCA 4DV3B 5EWJA 3RAGA 2OCGA 1O3YA 2G0NA 3V4OA 2ZJAA 1EGMB 3AKYA 3CEMA 4XYLA 2XXAB 2NU7B 3FI0A 2YY7A 2FDXA 2JCBA 2VVTA 3W7BA 1PR3A 3W0LB 3DMTA 3NTQA 2FHSA 5D5HA 5DCUA 4OH1A 4P4GA 1Q44A 4FGLA 4HDRA 1LTQA 4QBGB 4UHHA 2JCXA 3BWDD 1Z2NX 2IYEA 2IIQA 4GRAA 3L92A 5C7LO 1JKJB 4H6PA 4M1YA 4TUYA 4EH1A 2AW5A 4Q4JB 3PTZA 5GZ3A 4H1TA 4CCYB 5FADA 4H1HA 2Q1YA 2FEXA 2QZSA 2YRXA 3HBAA 2EWVA 4L02A 1C7ZA 1Z6ZA 4LC9A 4Z9BA 4KR7A 1E96A 3W4JA 2BMJA 1J2TA 1YA8A 2QWXA 5JCOC 1KRXA 5ARCA 4KUGA 4K9OA 4YIHA 2GYUA 2C03A 4WNCA 2QJFA 3SMQA 3VUFA 3UKOA 3UWDA 1E1CB 3DCYA 1T13A 2QL5A 2ZE6A 5FTNA 2NUAB 1W4ZA 5JAPA 2FZWA 2IXDA 4ER5A 3Q15C 5EL0A 1VOTA 2XF2A 4G0UA 2P6PA 4KUHA 2HGSA 5A0VA 4IGFA 4F2DA 5B7QA 3P96A 4UDOA 4ID3A 2F1KA 2HTFA 3Q6IA 4ENSA 1DFHA 1TO2E 3T38A 1EVIA 1N2CB 4XGIA 2IV7A 1K8ZB 4FUTA 5B1EA 3KPUA 1UPXA 3CLRC 1FCJA 2WZQA 4CF7A 3AFNA 3KBOA 3P52A 4O4HB 1U9IA 4C01A 1KFEB 4E5VA 4MDEA 3TX2A 2GBLC 4RKYA 3I62A 1TF7A 5FA5A 1XZDA 4XVHA 1VCMA 2AOUA 5ALIA 1VA5A 4TWRA 1RZRD 1DAPA 2WTMA 3GEIA 1U8UA 2WF8A 4ON9A 4NV1A 5JDIC 3G1UA 2LNDA 2X4GA 4GSKA 4F04A 4Z53A 3MWKA 3F7TA 2VNAA 1P0QA 1JHMA 1P80A 2WU1A 3CCFA 3EC1A 3EEYA 3DB2A 3EVTA 2VATA 4KAAA 4MWDA 4OREX 1AZWA 1CR4A 3T94A 1J2JA 3L49A 1W0JA 2D3TA 3C24A 2J3KA 3ON5A 4N3BA 1H4SA 5HMLA 1FTQA 4FDAA 4YLGA 3RFFA 2II6A 5DHFA 4DJEC 1E9RA 1MRZA 1RWXA 4OUKX 3CCBA 3COPA 1ODCA 1LNSA 1U3DA 2DSTA 4DG9A 1XEWY 2EQBA 2Z58A 1TW3A 2FLWA 3B6EA 3KAKA 5JZVA 2AXNA 1BEUB 3KU4A 1YMUA 3HJUA 3JQAA 4JK3A 4NQRA 2FRDC 1YBHA 1TVKA 4DTIA 1E9AA 2Z8YM 5IWAB 5F1YA 4Q9IA 4N6GA 1R16A 2FK8A 2HREA 2BI4A 2RK3A 3AU8A 1VE9A 2A3NA 3DOOA 2GDZA 3MLEA 2XA9A 4OGWA 3TEFA 4YMSA 1LLUA 4PLHA 2PFKA 3HB5X 2X5NA 2KM1A 3GT0A 1JGTA 1L4GA 2LCFA 2WTBA 3Q7QA 1E2PA 4ZVRA 1ZMBA 1H42A 1N2GA 3VX3A 1IN4A 1PJQA 3AK4A 3N2IA 3GRAA 4PSCA 1MEOA 3JQBC 2C1XA 5K3FA 1LJ8A 3LDGA 4URFA 3ZWPA 1Q20A 2YMMA 4CLRA 3OMXA 1HSOA 4NE7A 1V5GA 3H9QA 4HB4A 4EI8A 5AKIA 4TKVB 3EZYA 4KE8A 3SBDA 3OEWA 3WO1A 2LCIA 2QMQA 3VAAA 3OD1A 3AESB 5K6TA 3ABQB 3PXAA 4ENTA 3M8KA 3GP8A 2WYIA 3IPYA 3E9MA 3OOJA 1C8LA 1N0VC 1QIFA 1NRWA 2OZLA 4NCBA 1AQJA 2QX8A 2F4VB 2PUCA 3FYUC 3KJHA 4FIDA 2QAJA 5HE9A 1EFRA 3TL2A 1JFFB 3HACA 4AECA 4AMBA 1WY7A 2YWBA 4A0FA 1A5ZA 3FPHA 2OZKA 1Z8DA 4KN5A 4YXWA 1ODSA 5FX2A 1SMKA 1I3MA 4FOOA 3CLTC 5I9SA 1O4VA 3SKXA 5KTMA 1Z4OA 3GYBA 4U9HS 4WESB 2R8EA 3FBWA 4ES6A 4DL9A 1LK5A 3RS7A 2RGCA 3H05A 3O9MA 1EVZA 4EI7A 3A6KA 2FVXA 4ABYA 1CQXA 2H2AA 2X8WA 3KAJA 1W2WB 3EPKA 3WZMA 3PIRA 3HWX1 1JYSA 4AAYA 5AM5A 5K0FA 2I7CA 5TF0A 1E69A 3EEIA 1CJMA 1IG3A 1TXGA 2NZ2A 3X44A 5ALKA 1S2GA 2F3QA 4OBBA 4AUMA 5LD2C 1QBGA 1HG0A 5HF5A 1FX0A 2P3OA 4YBZA 3T3OA 5ALEA 1M34A 2BKEA 3ZTWA 4D96A 2FEKA 5JXWA 4HS9A 4MW6A 4OM8A 5TT0A 4TROA 5T4BA 3A06A 2NSHA 1UMCA 3L5OA 2OBXA 1GGKA 2PTHA 3W3AD 1DJLA 2DFKB 2OBMA 3GFFA 3EAFA 1IB6A 3IKJA 1LA2A 3QV1A 5EP3A 4OTZA 5JBIA 4NEHB 5GZ6A 1ZAKA 4NCNA 3G5LA 2Q6OA 4O1IA 1GL3A 5FLYA 5H5JA 3LLCA 1IK4A 2V7BA 1YL6A 4PPQA 3URMA 3HPQA 2VAWA 2JK1A 3BFKA 4H1UA 4I4CA 1RJWA 3PITA 5KHOC 4PSKA 3G9TA 5C0OE 5KNLA 3KQHA 4MVJH 3CUWA 3K5PA 4WY8A 4HCJA 3E8MA 2GEDA 5DHSA 4N3AA 1I2BA 2YKGA 2VF5X 3AKEA 1L0BA 3C5HA 4XEUA 4A8JA 1CULC 1SBCA 2ATXA 4LY3A 3U60B 4E2WA 4NG5A 3HR7A 2NYRA 4RFLA 2Q1XA 3TVYA 3WQRA 5ITZA 4L4XA 3R77A 3T3NA 1FSPA 2Q5EA 4D92A 1WEHA 2C2WA 2EWWA 2O50A 1SCUA 1PD1A 4FI3F 5E7QA 4X8MA 3STYA 3HKCA 1L9KA 3IPXA 3EZGA 1NJ8A 2FR0A 1LH0A 3PVCA 5B58T 1APBA 2R79A 3DAYA 3H5WA 3MT9A 1XZ8A 3P9XA 1P7YA 2W9XA 5A5FA 1E1QD 2OD2A 3LSYA 1DXYA 1S2MA 4QGGA 4J07A 4YP7A 4BX0A 3RJ5A 3R8CA 1EK5A 1NVMB 2ARKA 3BGOS 3BMCA 5AHRA 5TJ9A 5C3MA 1JFLA 2I6TA 4WOPA 3PNQA 3UMSA 2P3LA 3HY4A 2G9QA 4G4SP 4MVJG 1NIPA 1VPDA 2B5VA 4EX6A 1AVTA 4HX9A 2FP3A 1G8MA 4Q9HA 2GKOA 4Z0NA 3LY8A 2OHHA 2D0IA 2XMZA 1CJCA 2CHGA 3FN4A 2XGSA 3L9WA 4TYQA 1N9GB 4JROA 1NQOA 2HJ9A 4TV8F 1QP8A 5CK4A 4NU5A 3WI7A 1H2XA 5EZ5A 2OFPA 4EPTA 1JEYA 5F3RA 1IQPA 2FSHA 2GPAA 4CV3A 1GLNA 1Q3TA 1IBSA 2MT9A 4OYRA 4FGUA 4M8KA 3AERA 3ZW7A 3UJAA 4HK4A 3JYQA 3LHIA 4G24A 1SH7A 2B8NA 3BSSA 4TLAA 1QOQB 1AS3A 1TT5A 3DT6A 5AXDA 3I5MA 5KTKA 1JSCA 4BQQA 1J0XO 4WNAB 1SVOA 1LWOA 2D1TA 2ZYTX 3EDYA 4JBHA 3B38A 1J97A 1E2UA 2ATCA 2QVZX 4H7KA 4JGBA 4OK6A 4TSFA 1PHPA 5CEEA 3BHNA 1E2QA 1GKKA 8LDHA 3JARA 2VWQA 5FNVA 2DT5A 4XD7A 3BREA 4E08A 3FPSA 1JVBA 1P18A 3TAUA 3L5KA 2G9UA 1QAQA 5I7UA 1E3DA 2ZXUA 2IOQA 2AHOA 2GCOA 4E22A 1VGRA 3H6GA 2PE5A 5FEMA 4TV9B 3DH0A 4KNVA 3GHHA 3U7HB 4PNZA 4CLOA 4IDDA 4P7GA 1DJNA 4PQFA 1O0BA 1TUEA 3AFOA 3NHJA 2GBFA 3PQCA 4M1WA 3TW8A 1C8VB 5IC4A 4Z3OA 4JI8B 4E30A 2VJYA 3MBKA 3MMPA 5JVDB 4BKMA 3VHXA 1DX9A 4XX0A 1YRYE 3OX2A 4N01A 1ABEA 1EZZA 2PA0A 4GMFA 4MR8B 3ZQ4A 5CA1F 3RYCB 2I9PA 1W96A 3G7SA 2HV9A 3OF2A 4RVCA 2DG2A 1YNOA 4GXTA 1VIYA 5DBFA 5CB4A 2OO5C 3T5MA 4YRKA 2R1VB 3L4EA 2VHUA 1L5RA 2IEBA 1RS0A 3QE0A 5F9FA 2AX3A 4N5LA 4NU8X 4KSCA 4JQYA 5DHUA 4Y6GB 2G9RA 4HJRA 4C7VA 3G2NA 3SSMA 1BMQA 3UV6A 4QO7A 1F8XA 2XDQB 2PX5A 3GFVA 4IDGA 1WW8A 2HQ1A 2QTLA 1MVNA 2KW5A 4BCDA 2JHGA 1ZIOA 2WC1A 4FYYA 2FWPA 4BS9A 1JWLA 5GONF 3P2IA 4EHIA 1G2OA 2WPNA 3RIGA 3GLIA 1T4GA 3NRJA 3TZ6A 1TVCA 3WAJA 2BJWA 4DWWA 3MTDA 1YFLA 3MTGA 2EHJA 3CRRA 4DYHA 3E0QA 1KI4A 2YN0A 4MUNA 1UBMS 3E9ZA 5A3VA 5AKXA 3IVAA 4EGSA 3M5PA 1Y7TA 3SJAA 2UZ1A 3FCAA 3KVRA 3BDVA 4JZYA 4Y9SA 2C83A 1Z8HA 3H1TA 2JEYA 2OPBA 2EHDA 3IBFA 1K68A 2DLNA 4HDQB 1LTHR 3F4BA 4HYTA 3FSEA 1PT8A 3D8TA 3HUEA 6YASA 1SU4A 1VB5A 3I61A 1DC4A 1NLZA 3AKCA 4J94A 5L3SA 3EAQA 4O8ZA 4PC3A 1U63A 1GAEO 3VGPA 1IUNA 5ELLA 4E09A 5CJ2A 4LRSB 5EHNA 3EY4A 2KPOA 3FLEA 5K3CA 3LPLA 4CIYA 1D04A 3OOYA 4MW1A 3BE4A 1INLA 1G5TA 4RGBA 4BZPA 2R0QC 1PV2A 4DDHA 2JI7A 3BCHA 4UTVA 4AJPA 1PGOA 2FPKA 1FS6A 3B1FA 3CJRA 3FIJA 4MR9B 4BLTA 5JBQA 2RHWA 1NR1A 3GMTA 1VBFA 1U5BA 2VS1A 3B3FA 4CG0A 2VI5A 3UMMA 3DQZA 2Y6VA 3HCRA 1HEUA 1I2MA 4PYIA 2LKDA 3TNJA 1ZSYA 3B6MA 4IEIA 3SFTA 2ZAOA 3LKBA 5LMUB 1RE1A 2JHFA 4RMIA 1SQSA 5FI0B 7GPBA 5KJFA 1KK2A 3I04A 1QS0B 3LBAA 1IXKA 2C2HA 3H3JA 2F43B 4NBRA 2REQB 2FPPA 3I09A 4Z7NB 4F6CA 4L0DA 3A6JA 3DBHB 2QXYA 2Y93A 1Q6ZA 2I6XA 4WCFB 4F1KA 1TU3A 2H7YA 2XX3A 1ISIA 4H3HB 3VR6D 2XD4A 5D51S 2ZQ5A 1E5QA 2B99A 5ALMA 3RI3A 1H6BA 3VVLA 3BICA 3TMYA 2O1WA 4GKJB 1PR5A 3O9VA 2ON6A 5TQ0B 4ZHSA 3ZGVA 3A3YA 3IUJA 3VDRA 4V02A 2I1QA 5LZ5A 4WHMA 5AUQA 1JEQA 4CI0B 1P5RA 2B21A 1JEJA 4FP9A 2C2GA 4W99A 4HDNB 1A8UA 3OE4A 5EKTA 5TR9A 2BP7B 5H8WA 2V7QA 2O0MA 1MU0A 1W94A 4IOMA 3DC2A 4BP3A 1P60A 3QEBZ 2GN0A 3EGXA 3R3SA 4FKMA 2YZ7A 1GG8A 5EINA 1JN0A 4EMBA 2GKGA 2ASVA 2JFYA 4OGFA 1G9XA 1M2OA 3LF2A 4OYLA 3E1GA 1B14A 1EGQA 1G2PA 1H8HD 2GAIA 5I9MA 5CXQA 2ZUFA 4QYIB 3ZY2A 3FAZA 2O2YA 1ND6A 1C14A 1JR3E 1Z73A 2VDRB 4DV5B 1J0AA 1BVUA 3K16A 2ZDGA 1Y8QB 3R75A 2Z6QA 2V5AA 2Z6VA 1KQNA 4M46A 4XXHA 3ETJA 4P0QB 4MW4A 1R8XA 3PZBA 4I19A 2XNJA 3M83A 2M6SA 3QMVA 3OU6A 1HE1C 1T3LA 2X3FA 421PA 2AJBA 1R6BX 3I0MA 4NLLA 1ZAYA 4XI9A 2C84A 4H7PA 1XLTC 1ZU5A 1DKOA 4Y9DA 4BOYA 3L6RA 4FW9A 4O3FA 4QXQA 3HEMA 3RODA 1T91A 2RI6A 4PCAA 1ILWA 1QH1B 1NFRA 2ADOA 1M73E 2PUDA 2I2AA 1GZSA 1P33A 1E3TA 4R98A 1SRRA 3OTGA 2DEUA 2G40A 2L82A 4UCWA 1W59A 4GO1A 3OE1A 1IY1A 1XTTA 3UHJA 1YZFA 1EFVA 1FSSA 2OC4A 3IEKA 2ZRFA 1R00A 3NFRA 1XG5A 5EUQB 5LQMA 3MIIA 4I1IA 2PZFA 2H3HA 5F35A 2B82A 4ND8B 2J6CA 2QN2A 5IAJA 1YIOA 2CK3D 4IDNA 4E14A 3GMDA 2WUFA 4IZHA 5JR3A 4BNNA 1ZGHA 2A1TS 4RH3A 5G1OA 3ZEIA 1HX7A 4JI4B 1QCDA 1LWNA 2J3EA 4BZWA 2CNBA 1H5QA 3HS3A 2Q3JA 3D4OA 3ZI7A 3V6MA 2QBYA 3ROMA 3L6EA 2X9LA 4DYVA 3T7CA 3DWIA 3A2KA 3FPJA 4IL5A 3ZDXB 4EQ6B 5A4FS 4DGQA 3LT2A 3Q4GA 1Y5RA 1MAHA 1YL5A 2HIMA 4HMOA 5DNWA 4NFYA 4E1AA 5A1JA 2YVAA 1HLDA 3LUJA 4G0MA 3BD7A 4GDMA 4OUDA 4TRNA 3BDAA 3ZH2A 4BQSA 3LBHA 5TB5A 5L8VA 1K3UB 4KFCA 4R41A 1VI5A 3ZIUA 4CKWA 3R74A 4EB8A 3JRXA 2X14A 3L7BA 4HPWA 4N3NA 2QGNA 4C7BA 2BEWB 5KPJA 2GK7A 2PD3A