1W30A

Pyrr of mycobacterium tuberculosis as a potential drug target
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
174
Chain Sequence
ESRELMSAANVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pyrr (Rv1379) from Mycobacterium Tuberculosis: A Persistence Gene and Protein Drug Target
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords PYRR BIFUNCTIONAL PROTEIN
total genus 53
structure length 174
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w30A00
1MZVA 4Z1OA 1XZNA 1L1RA 4TWBA 1AO0A 1QCDA 2EHJA 1UPFA 3OZFA 1U9ZA 1I5EA 3M3HA 2H06A 1BD3A 1QK4A 3MBIA 5HIAA 1QB8A 3ACCA 4RHUA 1VSTA 4S2UA 1G9TA 2PRYA 1QCCA 1VCHA 1DQPA 1TC1A 1OROA 1D6NA 1BD4A 1I0LA 1O5OA 1TC2A 5BSKA 3H83A 1ZN8A 2GEBA 2JKZA 1A3CA 1U9YA 4M0KA 3DMPA 3ACDA 1ECJA 3GEPA 4P83A 1A4XA 4RABA 2AEEA 2YZKA 1NONA 4JITA 3OHPA 4PFQA 2E55A 4M0UA 4RQBA 4OHCA 1P19A 1XTTA 1STOA 1XTUA 2JI4A 1ZN7A 1VDMA 4PAWA 5BRNA 1PZMA 1OREA 4KN6A 5ESXA 5EUCA 4P80A 4RADA 1I13A 1UFRA 2PRZA 3GGJA 3KB8A 4RANA 5JSQA 1BZYA 2DY0A 1ECBA 4LYYA 4P81A 4RV4A 1GPH1 4WMLA 3N2LA 4LZOA 1I0IA 1JLSA 1V9SA 4QRIA 1CJBA 2PS1A 3ACBA 4JLSA 1Y0BA 4ZFNA 1A97A 1WD5A 4X44A 1UPUA 1NULA 3HVUA 1G2QA 1P4AA 3DAHA 1QB7A 3OZGA 5HKLA 5BQPA 4LZNA 4X45A 2VFAA 5E38A 3LPNA 1JLRA 4LZAA 3NAGA 2JBHA 4P3KA 5BQOA 5KAMA 1FSGA 4QYIB 1QK3A 2C4KA 4IJQA 4RHXA 1G9SA 1I14A 3S5JA 2FXVA 1ECCA 1W30A 1A95A 4P82A 1L1QA 1ECFA 4WN3A 4F8EA 1DBRA 1DKRA 4RAOA 4FYMA 1P18A 1ZN9A 4RHYA 2WNSA 4LYGA 2JKYA 4QYIA 4M0PA 1QK5A 2IGBA 1DKUA 3EFHA 1GRVA 1Z7GA 4RQAA 3O7MA 2XBUA 1HMPA 4P86A 5IPFA 1DQNA 1J7JA 3MJDA 4RHTA 1OPRA 3G6WA 4P84A 5IAOA 1LH0A 1YFZA 5KAPA 5K51A 3DEZA 2H07A 4RACA 3GGCA 5JV5A 3QW4B 1A98A 2P1ZA 1ECGA 1G2PA 1XTVA 1R3UA 4MB6A 4RAQA 3LRTA 1HGXA 2H08A 1A96A 2HCRA 5ESWA 1IBSA 1P17A 1XZ8A 1O57A
chains in the Genus database with same CATH superfamily
1M6HA 4JI4B 3ILVA 2JIBA 1U7XA 1SOUA 2O7VA 4OFZA 3SU8A 1LF0A 1OR8A 4RZXA 3DKPA 3C1OA 3U44B 1N4AA 4BZPA 3QLUC 5GP1A 2O3TA 3QXXA 4IL5A 4EZIA 1MO4A 5KNCH 1C3VA 1R0CA 3QF4A 2YDXA 4PRYA 1GLGA 1R0XA 4ZALA 1EI9A 3DD1A 1WVIA 2YVAA 5FTNA 1GAEO 5HJ7A 2QRHA 4D3SA 2PQ2A 2RCNA 2ZR7A 4IRXA 5C1IA 3TD9A 4FQ5A 3AC0A 2X5JO 4ZO9A 2NOAA 4F4HA 4IMRA 2W58A 1EAYA 4P7FA 2AJ8A 1NV8A 2VPIA 4XTRA 3TTXA 5KQLA 2BEKA 3KJEA 5IKEA 4QQRA 2IBSA 3KKLA 2BKUA 1GV1A 1PI3A 4ZEWA 2VQEB 4L50A 3K16A 1P0IA 2DHEA 3TZCA 2CK3A 1KSFX 2Q5EA 2QLMA 3LWDA 4GR9A 4R3WA 5EJ9A 3VOAA 1O9GA 4X61A 1FYWA 2QRNA 4OM8A 3V80A 4IUYA 2AOTA 3UT5B 5TPZD 4NF2A 2R85A 2QL5A 1N5OX 1L4EA 3A25A 2AQIA 4M8SA 5DH9A 2AOVA 4TLMB 5KDDA 3U9TA 1QP7A 1QQBA 1G2OA 4S3MA 2QTMA 3A9CA 1CS0B 4AFNA 3Q7QA 2AUTA 1A69A 2I6UA 3RSSA 1EWVA 2R1UA 4BO7A 3TMYA 4CTOA 1I33A 3FNGA 3HVHA 3H17A 2YUTA 2YWBA 3IURA 3TI7A 4WIAA 2Z5FA 1ZIOA 4ZMRA 3TGPA 1OI2A 5GJCA 4E5UA 4IDGA 2XCRB 4P35A 4YGYA 2QE7A 2FPXA 3TFWA 2QHXA 2XUDA 4RFVA 1XF9A 2WPDD 3N2IA 1FYXA 1JHOA 2PTGA 5J2TA 2FSHA 4G1MB 5FTWA 4B33A 1W581 4MWDA 3PPVA 1JHQA 1N2ZA 1R18A 4IKPA 1QBKC 3H1FA 3DBLA 3GBVA 3PTLA 4UUPA 1TQ4A 3RH0A 2WTUA 5IKMA 2HMTA 4G4JA 1KNXA 1EFRA 1AF7A 1P5JA 2G0TA 2Q0QA 1IY1A 4IVRA 4ZCPA 1C9KA 3L06A 1IY9A 3E48A 1D09A 1T8WA 1M8KA 2C96A 1JR3E 1GA1A 1TT5B 3PUZA 4FLFA 1T9HA 3KWLA 3LPLA 3W90A 4RCVA 4F6LA 2FQYA 1P5ZB 4XI9A 1AKEA 2SKDA 5CDUA 1O94D 3HJGA 3MIZA 1DIOB 3P4XA 3FCCA 2WFZA 4LGMA 4M9QA 4KE6A 4Y0AA 2BZSA 2GN4A 2VJQA 4HDKB 3R0IA 4I2VA 3PYXA 2XB8A 4B8ZA 7GPBA 1RADA 3BQMB 5P21A 4HDRB 3J7TA 2MYNA 2W43A 3VNRA 1PR0A 1OYVA 2H07A 5ALXA 1VYUA 1XJQA 4Y6SA 4K3VA 5EE9A 1QX4A 10MHA 2X14A 2WZDA 2ZULA 2PX8A 4YQEA 4EA8A 3DBOB 4X41A 4TS3A 1GM5A 2HU7A 3KR9A 1CUVA 3D9QX 2M1ZA 3X2SA 3QVSA 1C0LA 3H7IA 3LLVA 3NM4A 3NP9A 3W34A 2FMHA 4ZZ0A 2C0QA 2PZJA 4BO4A 2B69A 3ABQB 4XDGA 4D92A 3AIIA 2RGNA 1UMCA 3IKLA 1OAOA 1FYDA 1XTJA 1E1DA 2W2MA 3ISTA 4GVLA 5JMWA 1C81A 2R5FA 3KB2A 4YY3B 3WZLA 4A1FA 4AY2A 2Q5IA 3R75A 3B5EA 3FJ1A 3ANYB 3OOYA 2G83A 2CE7A 3OESA 3O8OB 3UCFA 2BD0A 1N7GA 2LDBA 2F00A 4P58A 2WHYA 4DPLA 4YV7A 1O5OA 2C20A 1E8NA 2UZ0A 3FPHA 3R7SA 4HWOA 4LGCA 2VG8A 1NQWA 1Z2CA 2W2NA 2YWEA 3NWBA 3PVSA 4QGFA 2F64A 2D7JA 2IW3A 3GVPA 3KEFA 3CSUA 3KPUA 1ZGHA 4JYPA 4QU5A 4P2GA 2XCSB 5BWOA 4Y2JA 4L27A 5JTUA 3KYDB 2OT3B 5B1HA 4B82A 1EBBA 2C7VA 2HMWA 5LYYA 3O92A 2JW5A 2AC2A 3KZKA 3D3NA 4ZVSA 4K26A 4DRZA 3HCFA 1WRBA 4LXUA 1F60A 3NWJA 5HRAA 3DCNA 4I9GA 4LBVA 1Q0HA 3FZNA 4L8YA 1O6BA 4F72A 1FFCA 3DMRA 4MINA 4OATA 1AS3A 3ZY6A 3L0IB 4IHKA 1USKA 1Y6RA 5IDXA 1X7HA 3QWFA 2DFTA 3ZOKA 1CX9B 3WLJA 1XDUA 2FPPB 2WKRA 3AQ4A 3QEOA 4PC3A 2RHOA 5E1BA 3SC2B 3IHWA 3SYRA 2JAQA 3VQTA 2B36A 1R4NB 4X1IB 3FMVA 3KBBA 4IOJA 3DAGA 5K01A 4GXNA 5ENVA 4WLNA 3DLPX 1XLTA 1Y9JA 3MUEA 4BFLA 5HK9A 1JG2A 3W5DA 3C1AA 4X1IA 3L7LA 1XXHB 1L5VA 4D8YA 2Z2JA 2V1UA 3LKBA 4ZPJA 1S8NA 4YEDA 2WM8A 5INTA 3RKRA 5EL0A 5EWMA 2N42A 4DT1A 1RQPA 1K5HA 4LNUB 5F52A 1Z4JA 1HKUA 2ISQA 2O3JA 4LDRA 3VH3A 2JCYA 4XGRA 3BFKA 3W8FA 3DVLA 5GJBA 1EHIA 3H75A 2FN7A 3ND8A 3OOJA 4YMUA 4YX9A 4JXXA 5JS1A 5AUPB 1D0IA 1V96A 2GEDA 1XDSA 4XM0A 2RJNA 4MHOA 3F3SA 4FONA 4B3HA 2ZQZA 4UHHA 1K9VF 2WHQA 1WVGA 2G25A 4HC4A 5FUXA 3ECSA 3QKRB 5KHAA 4PN3A 4PZPA 1I51A 3SR3A 2GRAA 4RVUA 3JV7A 1LPAB 1ZGZA 1RQRA 3OTIA 1H6CA 3ECAA 2R4TA 3JZFA 4KAFA 5CP8A 2YQ4A 4F6RB 1TU3A 2GAAA 5FBVB 2NXWA 3GVIA 5ULLA 4LTMA 4Q48A 4WADA 1RACA 1QPGA 3KXKA 1A9TA 4L57A 5KKAA 1JDZA 2EBFX 1KDPA 3NR2A 4ZOCA 2OORA 3B85A 4G4GA 5JNLA 1OBHA 3PLRA 1F2UA 1D9ZA 1PX2A 3P0HA 3QVVA 1T6BY 1IIRA 2IYVA 3CX8A 4ZQBA 2Z6AA 1ADCA 3EDMA 3IOCA 1NFQA 1WUJS 1EX1A 1DB3A 3WQHA 2R87A 1PSWA 4C0AC 4ZVUA 2WDPA 4KDEA 3VPHA 1SD2A 2G06A 1DP4A 3I6YA 1TADA 4KXNA 3X1YA 4QGGA 3B38A 5K3OA 4J91A 1ISSA 3SEAA 2HIHA 3KB1A 1MOPA 5LZ2A 3S7ZA 1C5KA 4B09A 2GPWA 3KXLA 5HF9A 4KWHA 5JWOA 5TC4A 1TMKA 2VBIA 4QG7A 4R31A 3DL0A 5LQKA 3OZFA 2B4RO 4KFUA 4AZVA 1C9DB 5EIWA 1ZJZA 1GPNA 2IP1A 4HVCA 3L0OA 2OO5A 2OHGA 3QE4A 1NBMD 2RBKA 1D2MA 3A3OA 4BRSA 3WZMA 2F62A 1J0XO 1DCMA 4GVXA 4XZ3A 4Z49A 4PHHA 2FB9A 2Z2YA 4G0NA 3E3NA 3ESYA 1TC2A 1HZZC 3ESCA 3GQVA 3QQ5A 4QXQA 2GX6A 4PC6A 5DP1A 5A05A 2OHFA 3D2LA 2AJBA 3OFKA 3IDQA 4LOKA 1E1RA 1N3LA 2B78A 5KYVA 2H29A 2FY8A 1R50A 4ABYA 1A4XA 3RTDA 2R8PA 4I1UA 1U9IA 4N5HX 1NP6A 5B30A 3BOSA 2XECA 3QP9A 3ZUPA 2ZRNA 3CNQS 2RGUA 3R77A 2EFJA 2EF0A 3A6EA 4QJBA 4RC9A 1ZVVA 1SM4A 2JDID 4V2IA 4CIVA 3GDFA 2HC9A 2WYVA 4UAVA 2EYQA 4BN4A 3L43A 3QU2A 2WICA 4GSLA 3UF0A 4GOJA 4KDCA 3WXBA 3RBXA 3KL4A 1R6XA 4MUBA 2I1VB 3NHUA 4CL8A 2VJLA 3WIEA 2HWKA 3T34A 4IIDA 3TIIA 5LJIA 5BWMA 3LUPA 3PR1A 1K8YB 3TZLA 4NC9A 1YDFA 2ZJYA 3UOWA 1IY0A 4BMOB 2WIBA 2V7TA 4FVTA 3W5IA 2D2EA 4TQ9A 4LX8A 4ZAGA 4CQLA 1SHZA 5MN6A 5ALJA 1BCRB 3BDIA 1JIVA 3IYLW 4KRXA 2OAP1 5EXSA 1PHPA 3OG9A 1PJZA 1WCXA 1X7DA 2PKWA 4LG1A 4S1OA 4C0XA 2VOEA 1VPWA 4IZ6A 2XUHA 1CY8A 1EXMA 2VH2A 2VDNB 3OBIA 4PO8A 1K7CA 1I9CA 1ISHA 2HSJA 3F6CA 4JJEA 1ZITA 3DPSA 5DSZA 4BN5A 5JSYA 4Q47A 3FRHA 1S4MA 3EIWA 3HWRA 1Z2OX 2EQAA 4OAQA 4HRXA 2GHRA 1XF1A 4JDPA 5EE5B 5TQ0B 3QEAZ 4Z1MD 1KARA 3CG0A 3Q2KA 1PX0A 2ZJZA 1U7ZA 1T2AA 1W5SA 3RHTA 3KOZA 2PMCA 1CUBA 3PUXA 4GRDA 1ESZA 5H5JA 3CIFA 3HVJA 2ID4A 5B37A 3I9FA 3K0FA 2FSVA 3FHCB 1U2TA 3RIMA 5KINB 5JAPA 3KV1A 2QX7A 4NAUA 4UC0A 3A4IA 4MR7A 4P5DA 3ZU6A 2R00A 1EK2A 2Q2QA 5TQ2B 1N5RA 2RC5A 1IRIA 4B4WA 1SUSA 4WFJA 3U26A 4CETA 1YA6A 3DBVO 3HXTA 4EQ6A 5MGBA 2GPJA 3NHFA 4US0R 5JD6A 4DXAA 2VKQA 1GUDA 2I6TA 4U6SA 4QFMA 3LQ1A 3DL2A 5F2EA 5PGMA 5HBGA 3ZCRA 3N07A 3CY6A 3FNFA 4I5EA 1W5BA 4ZCTA 1GFWA 3W8RA 4DUGA 1JEDA 5EHIA 4BBPA 1BX1A 4CCSA 3BD6A 3E2IA 2XQFA 1PDWA 4EG1A 3V2HA 1LBHA 1C7IA 4F9GA 4LNHA 2QR2A 3N58A 4K8RB 4TWBA 3PQCA 3SQWA 3ZDRA 4Q3NA 1ULSA 2O2GA 4DZRA 2J48A 3JQ7B 5GVSA 2BBWA 2NXEA 1CDOA 3HCDA 4MWCA 3X0DA 4F60A 1BCSA 1ACMA 3QIVA 5LKAA 3QXHA 2P5SA 5BYJA 1VL2A 3KKPA 2IWRA 3EEYA 3JARB 2JCBA 1WSBA 3F7NA 1FNSA 3KUXA 1GL7A 1TFRA 4WY5A 1DL5A 4AZSA 2W71A 1FUEA 4V3CA 3NM5A 1AXGA 1VIYA 3WRYC 3V1MA 1M6WA 3OZSA 3TTTA 4C3OB 1Z6QA 3PD1A 3H5VA 1T3LA 3ONWA 3PHLA 3R8CA 2QJRA 4ZHSA 3M6MD 4RVOA 2PUCA 4KRYA 4XPIB 1JKJB 4Q1FA 3MS4A 5JC1A 1TTTA 2INGX 5K20A 4BQPA 4D3DA 1SIUA 2RGCA 4N03A 4PFQA 5E8RA 2V4MA 4GXQA 4J1SA 5FCDA 4DV7B 1O6ZA 3IC5A 3VISA 2YIDA 1D0SA 3R0XA 1Y8CA 3A1TA 4MRMA 2I9PA 1XNJA 1NDHA 3IQEA 2GPAA 3IVAA 2O1SA 4Y2XA 1P4GA 3VBEA 5CCEA 4JX9A 3OTGA 4EY8A 1NLYA 4PVDA 2X2PA 5TMDA 3IQZA 4ND4A 1LBSA 1Y8AA 2BM8A 4ZV7A 4C29A 1CNFA 4I8DA 1I36A 1NHWA 2DQ4A 4TSKA 4LK2A 5D00A 4PXYA 3GMTA 5DNAA 2O2XA 2Q21A 4L7VA 3I73A 3UMRA 2ZE7A 5A2QA 5LYJF 3K9FC 4ZCSA 5H0IA 3Q4GA 1WD5A 4JVOA 4X44A 3PE4A 1FXSA 1RYEA 2JFQA 1EWTA 2Y9MB 2YH2A 3WK9A 3GDWA 3M33A 5ERXA 1P61B 1XD9A 3A9VA 1JIXA 3Q3JB 3ZYZA 3GVXA 1SXQA 3IL2A 4ARBA 1THZA 1Z7BA 3DUWA 3KELA 3O38A 5I51A 3BMOB 3WWDA 2NP6A 3K0HA 1VHQA 3G5UA 2G1UA 2R7KA 4W5WA 2QYTA 5FYDA 5CIQA 3H2GA 3HPRA 1LLDA 1GPYA 2JGEA 3CO0S 1TMOA 2AB0A 3GB9A 4JBXA 4LYDA 4MLDA 4XIGS 1OZ0A 1VSBA 1HDEA 1W47A 4OQDA 4O02B 3V4VB 3ZVLA 6LDHA 3EXHA 1RHKA 1ZRMA 1JXMA 1ZN9A 3JR7A 1ZIYA 3ADKA 1SU4A 2GF2A 2BUBA 1N5IA 4F97A 1B76A 2A0UA 2VYFA 4KKVA 4DDUA 1J90A 2NVBA 2Y77A 4LMAA 2FMFA 3GLGA 5T41A 1QO0D 6REQA 2ZREA 3GLFE 3KYIB 1H2YA 1WHTA 3SHVA 4NK5A 3JQBA 4GAEA 2WAAA 3DCYA 2V8OA 2B4AA 3R6DA 3CRNA 1J20A 4KZKA 4OXKA 4YI5A 2ONJA 2B1JA 5ESRA 1QAMA 3RTEA 4AY6A 1H65A 1N2CE 3RYFB 1DAMA 3GGCA 3IO3A 2UUCB 1U3VA 5ILGA 4IDQA 3HJBA 4YUXA 4B2IA 1SHTX 4FFOA 4ZJZA 4LPKA 1QFYA 5EJGA 1XKLA 4V03A 1ZWLA 3ZZMA 2YC4C 4AB1A 2JIOA 4X60A 4KQ1A 5DNWA 1EFLA 1SU7A 3U4IA 4G01B 4LYJA 1ZJ6A 4ND5A 5G0VA 2NTNA 1XQYA 2V6JA 5FI5A 3TLGB 1S1MA 3KQHA 4KH1A 1XQ9A 4M88A 4PZ0A 3LGAA 3BBPA 4J76A 1ADJA 1E9AA 4BU1A 5SZHB 1UXHA 3DXZA 3FAZA 5DGCA 5EKUA 1M2WA 1PZEA 2JJMA 2QVGA 2VUIB 2WP8J 2XNDA 2AUNA 2GEFA 2Y4NA 3C5EA 4RZQA 5AJZA 2OBFA 2XA1A 4G36A 3VPBA 5JO9A 4PPNA 2OBXA 5FA5A 5IH3A 3C87A 1EQUA 1JA0A 2IV3A 1RI3A 1JT2A 1PFKA 3NRBA 4UARA 3PNQA 1BXGB 3U17A 3RD5A 1GP2A 3E84A 2I7DA 4Q01A 3UW3A 3TDKA 4IS3A 3ZNQA 3A1EA 2PSSA 2OFFA 2Q9BA 2VDVE 3TQOA 2HCJB 4IF6A 4B3MB 2I1QA 4HNRA 2AMJA 3SNHA 3L7OA 1KI7A 2C2ZA 4YMIA 1P75A 3ZWVA 1U3UA 1OBOA 3MWFA 5DTIA 3U3DA 4DEVA 1GGVA 4TKVA 3L6CA 5I7RA 3HCWA 4UVHA 4CLHA 5IK2D 1V5FA 1U0GA 4O4IA 4OJMX 3B12A 3VU8A 1DX9A 1JBKA 2WA1A 2Y1LA 1X1RA 1FVHA 3BF8A 2IDJA 3S70A 1JLMA 1HF3A 3T3IA 3KT0A 1U99A 4UM9B 2J67A 1RLTA 2XVXA 4EW6A 1UF9A 4LZOA 1TUEA 1O96B 3I39X 3NHWA 3SEFA 4LDJA 4XASA 3EA0A 3UJAA 3AY0A 4KN9S 4M3NA 4OGKA 3RFCA 3TKYA 4EMBA 4QM7A 2HRRA 1AKYA 4WE3A 1RTKA 4DIDA 3A27A 1YRQA 4HPXB 4P4GA 1A2BA 1RU3A 3U16A 1YCHA 4J2OA 1YQGA 2DUWA 2Q6KA 1QIIA 4UNRA 3NU1A 1FIUA 1GRQA 3GOQA 1YRBA 3KSRA 1XZPA 5BT9A 3ICQB 1NQAO 2RC6A 4Q24A 3KD2A 5TR9A 3TLBA 1DX4A 5ALRA 4G5GA 2HL6A 1T5LA 4GS5A 2WTAA 3A7DA 4Q4HB 2OP1A 1SQ5A 2VI5A 3TZKA 4OGLA 3X43A 4EYOA 3QRWA 3S44A 2O4UX 2XODA 5E1MA 5IASA 4B3TB 4HGNA 1WPXA 4O4HF 3RFTA 4Y1RA 3OPXA 3WB9A 2VTVA 4U7PB 2VAWA 4RLQA 3CEHA 4QHYA 4DMMA 2QQ0A 2YICA 5DLEA 2BW0A 4X63A 2JATA 2V4UA 1QH1A 3SJBA 4ZT2A 2BWJA 1ULHA 4R1PA 1UBRS 2HHHB 3RAFC 1ODCA 2BELA 3JSXA 3AKEA 2I99A 5JVDA 2ZUBA 2WBLC 4TKMA 1I30A 4ER5A 1W5FA 3V9AA 1RCUA 2Z5VA 1JYEA 2BOVA 3GROA 5HDQA 3S29A 1HQYE 1QC5A 4MQEA 3TTVA 3QW4B 1XYVA 2NPIA 4ZKDA 1X9HA 4N82A 2ZRDA 3IFSA 2B3TA 3DF9A 4JXZA 5KOYA 3N2KB 1UJMA 4XDZA 5D7BA 2OL4A 3DONA 4AJ2A 1S4QA 2VYVA 4I19A 3OQMA 3G0HA 1W9MA 2SCUB 1EFKA 3FLBA 3QLVC 4AXXA 3LX5A 4YDSA 1WW8A 3WLQA 3BFXA 2WZBA 1U8YA 2AH5A 1CY1A 1P7ZA 4HNHA 3EIQA 5LD2C 3PWZA 3KKQA 4JQZA 3GC6A 3S4YA 2I2WA 3FKJA 2BFCB 4KIUA 4C07A 1T2FA 1JZTA 1UBJS 2RGNC 1MOQA 4KDFA 5FKJA 1YHYA 1YR9A 5D3MB 4ZKEA 4RY2A 4DMGA 4Y2TA 3ND7A 5LB2A 3EQ9A 3QJGA 1SWWA 2QSYA 3CUKA 2WINI 1RAEA 3OCVA 3BXOA 1PLLA 3FY4A 1DAFA 3OQHA 1QAOA 4QU8A 4TV9F 5IVIA 4MYDA 3RI3A 4AYTA 4BFWA 1DJNA 3AO0B 4TLBA 2IY9A 2Q1WA 3WLEA 1OT5A 3A04A 1N1EA 3E18A 5AKIA 2GJKA 1PK9A 1G19A 1G64A 1MOSA 3B6KA 3OU2A 5JAIA 1NRWA 5KWIA 1Z63A 1YZFA 3FA2A 3Q10A 1J0DA 1Q0PA 1YL7A 2H8KA 2NSLA 2P2ZA 3C43A 1Z88A 3KKMA 2Y1GA 3RK0A 3T5PA 4KW7A 1YDWA 3H99A 4JLKA 4IFBA 4LJLA 2OHVA 4H59A 4OV6B 4N40A 3TLAA 1XTUA 2BKEA 5KREA 3PLAE 1JBQA 3EEBA 2IU3A 4DSUA 1TZ2A 5AXAA 5CMLA 2NIPA 5TGDA 3PYMA 5K8LA 2GM3A 3COSA 3PC2A 5TS2A 2J87A 1GRNA 2CFSA 2MMGA 3ZHOA 1AKNA 1X1TA 5DHAA 3I2IA 2Y1WA 2VRCA 1ESEA 3PL1A 2C61A 1BMQA 4QZVA 3TVYA 3OWOA 1VSQA 4MTCA 2EFEB 4RV4A 2BGWA 2EZUA 3M3PA 1FQWA 3DAFA 3EAFA 4XIIA 2ARKA 2V0NA 5EZQA 5FHRA 1OAAA 2AW3A 1PJ8A 3RS3A 2JLRA 1DKQA 2CLLB 3SN6A 5EIBD 1JDNA 1ISRA 1WX1A 3RVBA 1XRMA 1PEDA 3JPYA 2XHZA 3QKSA 4NBWA 2EQBA 5IJ9B 1DNPA 1I2BA 3F46A 3AYZB 2QAIA 5A3RA 1P7CA 3CEAA 2C4MA 1QDUA 1W59A 3KSUA 4KIJA 3CA8A 1RSZA 2H4JA 4D3FA 4F3TA 1TVKA 5JLJA 3FOCA 3CMCO 3FZGA 3NIFB 2M6LA 1LLCA 4NCAA 1G21B 2AVDA 2E37A 2PU7A 3PDCA 4MQ6A 4YXWA 1U8FO 1OH8A 4RDXA 2Y27A 4KPFC 1R74A 3RTGA 5AW5A 3WP0A 5HBRA 1U3CA 5DN9A 2BF4A 1ZH2A 2QRVA 1PFQA 2REOA 3TFOA 3NG1A 1PJBA 2ACVA 4G23A 3KVVA 3S2IA 1AQLA 2B94A 1PNVA 2LIPA 2OV1A 2X1MA 4WCFC 1E18A 5HA5A 2QD4A 4HEJA 4Q0MA 3HNRA 3RJMA 3OP4A 4X1KA 4YRDA 3WWCA 4H18A 2F55A 3TMAA 3PI7A 3SG0A 4ARIA 2J6IA 3N8DA 1P4JA 4BNUA 4GR5A 2Q1XA 2O07A 4IAOA 1CFZA 1GZUA 1U2QA 2P62A 3PHGA 1NJGA 3AW9A 4JASB 5DM2A 5DOZA 4CRWB 4MW1A 1ZAKA 2YFYA 3RYHB 1AKQA 1E4VA 2I2BA 5E0OA 3FM9A 3VDRA 1HFKA 1IJBA 3UM9A 3DMYA 1CBUA 1P5RA 3BHJA 5H3HA 3CX3A 5KJFA 3L0BA 1OCEA 3D2BA 1O7JA 4KN8A 4LMPA 3WO0A 1XZGA 2QV7A 5LXTB 1YZLA 3OJXA 3DH0A 1DQRA 5HUJA 3G2OA 2IK8A 2LVBA 3PTZA 5EUQB 4A2CA 2VNKA 4G0OA 5LP6C 1QBGA 3L9WA 2FZWA 2G5GX 3WGUA 1THTA 5AUQA 3M1LA 2H1CA 4M0LA 4YI3A 1NMSA 1EDDA 1QCDA 3LVFO 3W7AA 1X9IA 2X41A 1VGQA 3K2QA 4DA4A 1C4OA 3NJ8A 1AD2A 4R6XA 4BQQA 2IBTA 1JKMA 1O6FA 2FQQA 1NJ8A 2AD5A 3RSGA 3ZWKA 2VHVA 2B8JA 3B6ZA 5EHXA 1BD4A 4DG9A 1A9XB 3PUWA 5IBPA 2D5BA 2J9FB 3ZE8A 2DEUA 4D4IA 2J3LA 4E30A 4DV2B 3OTWA 2BGJA 4FYVA 2IQIA 1TW3A 1EAMA 2FW7A 3AIMA 4JSTA 1E5DA 5TARA 5DX8A 4GG1A 1KE2A 1YQQA 1G8HA 3ZLBA 5BR4A 3TG8A 2W6IA 2HCFA 2C97A 2X1VA 1U2ZA 2AW5A 3O93A 1XYYA 1Z6GA 4TXMA 1XZBA 1DCKA 1FS5A 4OQEA 3SF8B 3CF6R 2ZIAA 3DG9A 3BJRA 1GPBA 4NAHA 5E6UB 4CG2A 4BXOB 4CGZA 4RM3A 5CFQA 2NO7A 4P80A 1HURA 3HSYA 1FUUA 2P79A 4K5QA 3RVRA 3FLMA 1NATA 1QRDA 3F5DA 3FAKA 2PD3A 1Z6TA 3EJ6A 5DZSA 1V5EA 1L7NA 1YNSA 1XTIA 3PQEA 3ZHSA 3KPJA 3CR8A 4AN1A 4P4SB 2ZYRA 4WZAE 1UPTA 5D86A 4DLKA 3LF2A 4UREA 2FPIB 3TF5A 1XZDA 1ABFA 1QR6A 3A1SA 4FYJA 3HZZA 3OLXA 2JIMA 4HAXA 2W2PA 2FFAA 2FZLA 3N8KA 1VMAA 2ICAA 4JKIA 2AG1A 2OKGA 3GV0A 1ZZGA 2J30A 3PJGA 4IDHA 1Q0LA 4O25A 2QTBA 3U2QA 1YUBA 1T3SA 3ANLA 1DJLA 4PLTA 5DM0A 3IUEA 1RJDA 1EP9A 3FPEA 2W2OA 4FMBB 2QN6A 2IPXA 4CF5A 2VPQA 4HXFB 1T13A 2X7XA 4OIFA 3AWDA 4O0MA 4WL0A 3OX1A 5AKGA 1J2JA 4N5DA 3WLNA 2JJ2D 1M54A 1UBHS 3JQFC 1SCQA 3MSCA 4L9WA 4A1OA 3DE5X 3F9IA 1YE8A 3G8DA 4R68A 1JH8A 3AESB 1IOZA 3M1IA 4D46A 1XCGB 1X1BA 3G49A 3KD3A 1CQJA 2ZUTA 4BTVA 1TUGA 3ONDA 4KZPA 4XKJA 3T3OA 4E4RA 5DNDA 1KDOA 1TF5A 3L1KA 3QXSA 1K5DA 1EQ2A 1NW9B 2P2DA 3HWWA 4IHJA 2PLAA 4MVCA 1CV2A 4QYSA 3ROKA 2XYGA 4GXTA 1AVTA 3Q41A 4OK3A 4WEQA 4WLOA 5AI0A 1YDHA 1WDKA 3KQQA 3ZR4B 5IRCD 4BKQA 3ZV3A 3GXBA 4HZUB 2DKFA 3RHSA 2G4VA 2PCJA 1DUSA 3NBFA 3VPCA 4V02A 4WOPA 2R5NA 3TJZA 1Z06A 3IIMA 4N6OA 1CZOA 2BUAA 2YBEA 4YLEA 1JJ7A 4YASA 1UZLA 4DJAA 2QLLA 4H6VA 4N6NA 1W25A 3BCSA 3AR5A 3BFJA 1T1RA 3EVZA 1DBIA 2HI0A 4G5FA 4L4UA 1YB6A 5EFZA 4B34A 2EU8A 4JY7A 2D2XA 4Y7DA 3PNKA 4D98A 5EJ7A 1DDIA 4LV8B 5JS2A 3K4QA 1KSHA 4GNRA 5DM1A 1OWNA 2VLIA 3HYRA 3LRTA 3OLZA 3PHJA 2FGJA 4PANA 4I3HA 2XWPA 4H3KB 1RWOA 2YMPA 3LKDA 4NE2A 2VSNA 4A8JA 4X3PA 4I1SA 8LDHA 4QDZA 2F1IA 4RTJA 2VNJA 4J49A 4N41A 2YJGA 4XVRA 3JD0A 4BQNA 2VWPA 3JCZA 4OGWA 3BEDA 2V6FA 2XXAA 2Y1KA 3STYA 4M54A 5DJ5A 2F8LA 2N9UA 3KOUA 2OC9A 2BM9A 2CLOB 4XUEA 4F5YA 3AV0B 4CMAA 1FRVA 4IFEA 1A76A 2Q1SA 3LL7A 2PZ8A 5DT2A 5GONA 4L5JA 4AG6A 5KOJA 2OHHA 2WPNA 3UNXA 1NQUA 1PYOA 3R5SA 2L0XA 4N54A 1H2XA 4W8HA 5LA6B 2PPVA 2Z6VA 1N6IA 3VVBA 2X2OA 3HCRA 2WSYB 4ESHA 1YKSA 1KQ3A 4ZI2A 3DMPA 1CRPA 1MHPA 3A37A 5FT9A 3HMQA 3QY9A 1XD8A 4UVIA 2WPDA 3DYBA 3AEQA 4ZK2A 4N9QA 3I2YX 4BO1A 3T5TA 4CM6A 3S1SA 2GN0A 2BP7A 4EJ2A 2AOXA 4CEJB 3S2GA 1LW7A 2BVNA 1TJ4A 2ODPA 1IN5A 3USES 1BQ4A 1SD1A 2ZYWX 4JI7B 1OTHA 4LY0A 3OQIB 3GT4A 1ZM9A 3GJYA 4UBIA 1Z13A 2QLFA 3ZIAD 1XNHA 1IZ9A 3PDJA 1OYYA 1B73A 2GTHA 2V9ZA 3TX6A 2XUGA 2AGVA 4MS1A 3RASA 4RTLA 5BR8B 4DQKA 4Y6LA 1K2VN 4PGHA 3TGLA 2ZJAA 4XVUA 2P41A 1K8QA 4WMLA 1Z56C 2Q3MA 3N2LA 4IQFA 5BSWA 2ZM6B 3K1TA 3MD0A 4I9NA 4M49A 1JI0A 2VSXA 1NX6A 2YQ5A 3RC9A 3ONEA 3VI3B 3E8XA 2NNWB 5C1OA 2G82A 3TQSA 1EUDB 1O94C 1KZGB 1X0XA 2ZSFA 3MQFA 4FILA 5ERYA 2C4UA 3HJNA 4ME6A 3WLRA 3OEWA 4YAKA 5F1OA 5AVOA 3UPDA 1R8JA 2ACWA 3NC1C 2XADA 1W49A 4OQLA 5EJ2A 4RJ2A 2AD1A 1I7LA 1H8EA 2I2DA 3JQGA 2FQWA 4YJ2B 4ZT7A 2HQBA 2CFOA 1SOWA 4M98A 1OI3A 2GM9A 1G18A 3QYPA 1C1YA 1Q6ZA 3BUSA 2AUMA 2G72A 3IQHX 4MUIA 1T36B 2MYPA 3DV9A 2XNDD 4JBHA 1DBRA 2BTQB 3QVJA 3TFQA 1T4CB 1XD2A 2YHSA 1S2IA 1V2GA 2AA3A 4BECA 1VSUA 1BJKA 1M1YA 3T6KA 2BHLA 3T35A 4J3JA 2F8MA 1GD1O 2DU8A 2QOEA 3C8MA 3EPPA 3IMEA 2CMHA 3AEUA 1TOAA 5B2FA 3EFOB 1L7DA 1L5WA 1RIIA 2AG6A 3VYRB 4YRNA 5JALA 4DT1B 4QVIA 4I9UA 2W42A 4Q9DA 4RHTA 1I4WA 3HGMA 5IABA 5IN4A 3G6WA 2HRCA 2VJYA 3LDFA 4DEXA 1VIAA 1N5KA 4P93A 5HWSA 1VBFA 4K6CA 3D5TA 4QU0A 1JDBB 1U1EA 2Z4TA 2IIBA 4YAWA 5D6OA 5FORA 4YONB 3R7BA 3S2YA 5JV5A 3HY4A 4IGFA 3KWJA 4QNRA 2WD7A 5TT0A 1SXJA 2VS1A 4BUCA 4O8CA 2B5OA 5A4FS 1MW8X 3AILA 4LKOA 3H5TA 5BNWA 3B9BA 3AKZA 2PUAA 1Z4QA 4KPGA 4X24A 5AUOB 1ODSA 1OB2A 1J4AA 1MIHA 1EMDA 2FUG1 1SRQA 1P1HA 2BM1A 4YMSA 2XYQA 5JANA 2I7XA 1QQ6A 1Y8QB 1TM2A 3M3HA 4ZMBA 5EIEA 5JXHA 1ND5A 4FNOA 4X0EA 1ODLA 2IQ5A 3TYXA 1E3LA 3QKIA 4YV0A 1VSTA 2FE1A 2QL7A 4LNAA 1Y3DE 3AGPA 4DPMA 3K9LA 3HABA 4EYEA 1CS0A 4I4TA 3E1GA 4F04A 4HX9A 1G63A 4QDJA 5K0LA 1F8FA 1VMEA 4KR6A 4NJEA 1N6LA 3H5NA 4X6LA 3IT0A 3V34A 1C3OA 1F8GA 1NA5A 4KE8A 4PPGA 4TLEA 1W36B 1KEWA 1Y33E 1U04A 2A5YB 2FSGA 2NACA 5IN5A 4HO1X 1C4XA 4GX5A 2CFTA 4YJHA 3HKEA 1GCAA 2WWIA 5D7NA 3I61A 2E55A 3DEYX 4IDOA 2I62A 3AR7A 1K0FA 1ZN7A 4ZK6A 3B6JA 2FKNA 2ZSKA 1D0VA 2O0JA 3I9NA 3MIIA 3KXIA 5CLJA 4HZIA 5E1DA 2FOLA 3ILHA 4BVLA 5A7GA 2YHIB 3JRXA 3TWOA 1YZ3A 2EAUA 3GZNA 1UBSB 1T5DX 3TNJA 5DBFA 4LJRA 4ZTBA 1FSFA 3CKMA 1DKOA 1QS0B 3ZDQA 1AKVA 3DQPA 1PZGA 4RS3A 2ZCJA 1U7DA 1OPXA 1Z5UA 2Z8YM 3AUKA 1GGHA 1EJ2A 1IN7A 4QTZA 5HMLA 1II8B 3CUVA 3UMFA 2FZEA 1PO7A 2E85A 4OSPA 1Q1ZA 1GFZA 3BRWD 3U4GA 1EXVA 2RHGB 1DT3A 1R6UA 2VDLB 4C78A 2ZP1A 3AG5A 1PUXA 4O59O 3H2IA 3NDRA 1YB7A 3NWPA 4V39A 2YBDA 4MDYA 3T7CA 1G7CA 4D81A 1GGJA 2EDCA 2JIDA 4MS3B 3THRA 1KMHB 5ADWA 3HO1A 1X2BA 3K0CC 4NIMA 3WAKA 4CBVA 1FU4A 4EHAA 1RHQA 2EEZA 3HFRA 2G71A 2Q0XA 4H0CA 3UJNA 4WFQA 4ERNA 3FZQA 1FPQA 4CMIB 1SNYA 3WP1B 4CUJA 5A03A 2II6A 3ELYA 2DLDA 2RGAA 2P2GA 3OZWA 1P72A 4G5OA 3RAJA 1PV4A 3FCUB 3BGIA 1VKOA 1G21E 4QBHA 1SBZA 1L1EA 3I04A 4E5SA 3I3OA 2CFRA 2XYHA 4MV0A 3W5JA 3F8SA 4R2LA 1KFEB 5EJIA 2NPFA 1YO6A 3FDFA 1TO6A 5CG1A 4ZEXA 1X87A 3BMOA 3ZWCA 5IS2A 1E8MA 2X8AA 1DHRA 3VO2A 1W7AA 2F17A 3CCCA 3IBSA 1ZNZA 3X1MA 4D9EA 3T3NA 1P74A 1ZHHA 5C5DA 4QE3A 6ABPA 3KFXA 2EV9A 1T35A 3OZIA 1C4WA 3WYFA 4DR7B 3SX4A 3I6ZA 1X42A 1SVWA 1HDXA 5I3CA 3E82A 1SO8A 3A3YA 5JUWA 4BZQA 1QORA 2AN5A 4PFSA 4Y6GB 1HPLA 3DV0A 2C42A 3HB0A 1G5IA 1IAVA 3CM0A 1JHZA 1P17A 3AY6A 2JEOA 2XD9A 1KI1A 1NT4A 3O4RA 1UMDA 1MAAA 4EF5A 2H9IA 3WDSA 3WB1A 4RA9A 3H5OA 2VP9A 3M5PA 3U1BA 3M9XA 2YHIA 3RTBA 3BB4A 2ZIWB 4GMDA 4IDAA 1FK8A 4DY6A 3DTYA 4LSMA 3ZUGA 6Q21A 2CT8A 1T10A 2CLFB 5EP2A 2H2AA 4OL9A 5U4XA 2OHIA 2IUSA 5FRDA 2ZYDA 5KCZA 1O0CA 1NXQA 1OV6A 3D6JA 4TQUS 1YE5A 1KAGA 3IALA 3VOBA 4EQ6B 1KAEA 2XTJA 5A6VA 1Z18A 2D2IA 4X6YA 2MIIA 1NBAA 3T52A 2AXPA 2QVCA 3M5WA 5DCUA 3RNOA 4C4XA 1YQWA 1ESDA 1EVYA 2TECE 3PCXA 4F2WA 4B3RB 3NHYA 1B6SA 2AT1A 1CB0A 1EH5A 2G77B 2H63A 1YOVB 2HDWA 3I6BA 4Z7OB 5AVVA 1P9OA 1CDEA 1W4CA 1XA4A 2XYPA 1WXHA 4J0QA 4KXQA 4NICA 4V0OA 4C6HA 4JC4A 1RLOA 2GO7A 4GWGA 5L9AA 1Z28A 2HTFA 4LJ5A 1SKQA 3GRFA 1SQSA 1V16B 4I1OA 1F0KA 4H3SA 3KWFA 3ZV5A 4AO8A 3ZWMA 3VKHA 1UPAA 4B9AA 4DARA 4YREA 4EENA 4O2BF 1K75A 4JBYA 2RKBA 2OKCA 4U8GA 2QG6A 2J4FA 5C18A 5CH5A 3W2TA 4E5YA 1NWHA 1QV9A 3DMGA 2R6JA 3JASA 1RXEA 4QUAA 1KMCA 1IHDA 3VMMA 1IULA 3BWMA 3B6MA 4BO8A 4Q1BA 1GRRA 2O8VA 2QL9A 1UJ6A 2A78A 4YCNA 4R1TA 4EHNA 1JF8A 2ZBUA 3BIXA 1T9GS 4LC1A 4IIGA 1ML4A 3L0CA 1HNWB 2MU1A 2WD7B 4YT2A 2R0QC 3V1NA 4R8RA 3HDVA 2H5IA 2COKA 1VIVA 2QJOA 2R4QA 3AUYA 4J7AA 1FFWA 3DZKA 1Y1KE 4FUTA 4RLSA 1OUMA 2FJ0A 2QRGA 1E1YA 1NVWQ 1FNCA 1NXTA 1RE0A 4BNHA 1GAQA 2PL9A 2WIGA 3NCTA 3B8EA 4IDBA 1PR6A 1N5MA 3O1JC 4BE7B 2R1TA 5CG2A 4NDNE 1QZUA 1ORWA 1DC6A 4L8VA 5AJYA 4BEVA 1JIKA 3E3LA 2D5AA 3VAZA 4YMTA 3NDBB 4M1EA 1I10A 4J3NA 2ZE6A 2CV2A 4RQTA 4JL6A 1AQUA 3L01A 2GERA 4LYGA 2HV8A 3BMQB 1FW8A 3FTCA 5DIZA 2IHJA 3WA7A 2ZYGA 4QFBA 2FCAA 3FUXA 4QEDA 2PX5A 4L3OA 3O7MA 1U0SY 1T9CA 2EGHA 2QM3A 4OBEA 2IBMA 1LPNA 3PRYA 1BGXT 4MMXB 4A27A 4GXRA 4BB5A 1BQ3A 5IDVA 3BD8A 3DNFA 2VXCA 4O5AA 4Z8YA 5EG5A 3GI1A 2H0QA 1G4AE 4DL9A 3RUAA 2ZTLA 5AFSA 5IZ4A 3C6KA 4TQGA 4D3XA 1NQVA 4CKZA 4IWNA 1HG0A 1RI1A 3G8AA 4X6UA 2G80A 3II6X 1AHNA 1JHXA 3BERA 2WIKA 1HLPA 2GXUA 4MYUA 3B3QA 4ZGBA 2X8LA 5EJ4A 1CETA 3A3PA 2OYRA 4BQSA 1SR8A 4CTNA 1ZGAA 2Q8PA 4MA0A 3QVLA 2HEIA 4DPKA 3KLOA 1XHLA 2FQ1A 2PH1A 3BWEA 2G9QA 5ALEA 1L0BA 1XDGA 4C0BA 3O8RA 1ZLYA 3VTAA 2AZMA 3RHFA 3SFTA 2KLBA 1INLA 3ORRA 2ZR0A 1CT9A 1HTBA 4AMZA 4LS3A 4C0SA 2BGLA 4K88A 2ZANA 1J6UA 5TXGA 1DTWB 4MWBA 1GITA 2WSMA 2D2VA 2B82A 2JAOA 4AJNA 4WBNB 1VB3A 1SKYE 3COWA 1OFTA 1HLFA 5IM4A 4OXYA 3TOXA 1W2WB 4L2IA 2E21A 3QWHA 4O2BA 2V03A 4KUEA 2PPLA 3AOEC 5T4EA 3P0EA 1LV7A 3VPAA 3MWEA 3D0KA 4MPTA 1E99A 4R7GA 3MQ4A 1QU2A 4ZOAA 1OX4B 4G41A 4X8MA 3AVOA 3QKSB 1B26A 4AMUA 5IJ9A 1GZSA 1O54A 4Z99A 5KYUB 3GG2A 1FZQA 1JQAA 1CY6A 1VKRA 3D1VA 2XA2A 2CCGA 4M0UA 4UJ3A 3ABRB 4OY3A 5CH8A 3UJDA 3CJRA 4IG9A 1PZMA 1ONOA 2IYWA 2FSFA 3A1DA 4UTXA 2X86A 3EODA 3ZNPA 1BJTA 5I7AA 1RPTA 2GKOA 1D1SA 1XCJA 2JIPA 1W94A 3BVPA 2E5WA 4ZOLA 3RWMB 5KVSA 2BGUA 2TMYA 4B7CA 2DSNA 1M0EA 1M0WA 5FBZA 1TEVA 3H97A 3N8HA 4CTJA 4BVAA 3KOMA 1RWMA 5FADA 3GD7A 3M9WA 1JG6A 1IAQA 1KDRA 2ZB3A 3NNDA 3NYWA 1I3CA 4XIFA 2Y9PB 1EDBA 2HR1A 1K6JA 5D5PA 2YWDA 3D3JA 2WSLA 3GN1A 3HKEB 2JGAA 1NW5A 5KO2A 1EK1A 2J08A 2OM6A 1CZRA 4RNCA 4ENWA 3ANMA 2WOJA 1LTHR 1Z0JA 2REBA 3C3AA 4GYJA 4HJXA 2LPMA 4C0HA 2PX0A 2V59A 2NTYC 2MDTA 5LR6A 4FDAA 1D1PA 1GZ7A 1P4HA 1R4MB 2ERCA 2XCLA 3TRKA 3ZHCA 1L4KA 4ZO8A 1RI5A 5CDYA 3U19A 5EMHA 5IC5A 1HSOA 3VR6H 2OK7A 5JQWA 4DR6B 1PV1A 4NPCA 4YMHA 2D3WA 2Y0CA 1Q3HA 3OQVA 1SAYA 4EKNB 1FYEA 2VO1A 5JOQA 2WG0A 4ZRDA 3K32A 1N2IA 2P1DA 2LZ0A 1S2OA 3JQ7A 4J7CA 1P6QA 3EW9A 2NU9A 2OUIA 2FWRA 4QYIA 3L49A 3LDUA 2C3OA 4ZI5A 4JENA 2QM7A 3VU9A 1SUFA 4UEOA 3ELUA 1SXGA 1G9XA 3N39C 3WL3A 2Q46A 3HB1A 3JAKA 4M0EA 4M1MA 3EH1A 4HOYA 5MN5A 4I50B 2QBYA 3L8MA 3I9V6 1PS8A 3KYJB 3ZHTA 2Q3DA 1KHHA 1PJ2A 2W98A 1PG5A 4FDUA 5EP4A 2X0KA 3G2IA 4FJ0A 2PDAA 5TJHA 2BH2A 1SPXA 3VUFA 2OZEA 4MRPA 4PNZA 2OGTA 4NZPA 2HXGA 3ZE0B 1M8GA 5EGSA 4PICA 3RW9A 2JI9A 2OG1A 2DUJA 3Q3IA 4CQMA 1B6TA 4UAUA 3I83A 4ZAWA 5BO5A 4YUAA 5AK4A 2WJJA 2BJWA 4UHJA 1HYQA 2WR8A 1HX7A 1B74A 3G9XA 1DS6A 3IXLA 2GZ1A 4FZJA 5I48A 4JLUA 1GZ5A 1I7PA 2BHRA 2HHCA 4UUBA 4WFKA 3IEVA 1U3GA 3UJ8A 4RO0A 1X2EA 3EWIA 3WWEA 4MICA 2I6GA 3WAJA 4A3SA 4G24A 4NABA 1AXRA 5EPUA 3NHBA 3DKKA 3JQBC 4PYQA 2ZROA 1T8UA 1L6IA 4L4YA 3PRJA 2EW8A 3DVQX 4ZYZA 1OXKB 4JVSB 3HC7A 2JJ1D 3AM3A 3WMXA 3DBRB 1S9HA 4JGIA 3P2OA 3JWIA 2XNHA 5IK2A 1P0FA 1KKMA 3WLPA 2D62A 5TGZA 3KQKA 4BRUA 3TK1A 3UC9A 5C80A 5IH7A 2A4MA 5LBIA 4CEIA 1CVIA 2IOYA 4KMOA 1CZUA 1XXHA 3DCIA 3OHPA 2XOKD 1I1NA 2R751 3D3EA 3QVWA 2OXTA 1QG4A 1VTKA 2HFJA 2V74B 1JILA 4KEAA 2B5WA 3R5HA 5EIOA 3DDZX 2A58A 5LU9A 2QE6A 1N9GB 1Z8NA 4N0EA 3K31A 5HS4A 2PIAA 1NVMB 2FDXA 2IYAA 3JWPA 4OQPA 5KHOC 5A3QA 1UP7A 1EUCA 2OCPA 5I5GA 2P2LA 3VPFA 3LPDA 4YAOA 4HAIA 2YY6A 4MDHA 1VJDA 1GWNA 3FDJA 2ZWMA 1JQKA 1V3VA 3QHPA 5JH7B 1BHJA 5JBIA 2J4DA 3G2MA 3VZDA 5M7EA 4GLBA 4PCVA 5ITWA 2WW8A 5D3MA 4JYAB 4OUDB 2OQRA 3V33A 1TJPB 1VKZA 4B17A 1SVIA 2WJHA 4RYDA 4G0XA 5JXJA 1Z35A 2AF3C 3PA8A 5KC8A 1QR2A 4FR5A 1JAHA 1P4AA 4HS9A 4JC5A 2QWXA 4CV0A 4MEAA 1ENPA 1RM0A 4AZ0B 2YFHA 2GTPA 3N0RA 4JH0A 2H5JA 4BASA 1EIWA 3A70A 3P4YA 5K3AA 5CNJA 2VPXA 2JBHA 3DFUA 5IMSA 2CCJA 2KHZA 1SULA 2FPOA 2WKSA 4V3BA 3LT4A 2OR3A 3GJ3A 3BMNA 2R65A 4YRQA 3O3CA 3OFSA 4KSBA 3PD7A 3WWYA 3ER6A 4X65B 1RI2A 3LXUX 4UTPA 4F4DA 2HO5A 1K3TA 3EA4A 3A28A 4V0MA 1GPUA 3OQ6A 1RHUA 4KX5A 1RRKA 4ITRC 1THGA 1NPTO 2Q5FA 4TL7A 1VYTA 1XEFA 4DC1A 1LRKA 1TAGA 4KN5A 4FM9A 2MWMA 3L07A 3MS7A 1A27A 1CCWA 2B34A 4UQOA 5CUQA 3T4XA 4BNZA 4YHHB 3CRRA 3COJA 3JQAD 1H0SA 1NY6A 2W6PA 4YXWD 4TX1A 3WNBA 2QTLA 3ESXA 2O20A 4JLOA 1M2VA 1PYGA 3RYTC 4DAOA 3AJDA 3RYFA 1WPQA 2JH3A 2PZAA 3F8TA 4DWWA 3K1ZA 1VHLA 4Q34A 1COWA 4LRSB 1Z0AA 5AVWA 1WIWA 2JH8A 3MLEA 4ZOLF 3B7WA 2EEPA 3GXOA 4U9HS 1FTQA 3ZVMA 3MPUA 1VXRA 4CYMA 3Q0IA 1QS0A 1WNTA 1TEXA 4ALKA 3UHOA 1H8HD 3FDXA 4B3SB 4C7OB 1S3SA 3LLSA 5EIXA 1N8TA 3G85A 4KTTE 5ICGA 5DHSA 2GZAA 4GPD1 2GZDA 2O1EA 3FFAA 4MRMB 2EP7A 1PJRA 1Z82A 4G5HA 4JXKA 3RSLA 3OQPA 4GYKA 4AZ3B 5AW1A 5AP9A 5KYGA 3DZJA 5AMXA 5KSOA 5EJFA 4DIEA 3JPWA 1C50A 3IODA 5F5XA 4CLRB 3LT5A 1IQPA 3E9MA 1Y5MA 3OOEA 1JDTA 1R9MA 4N0QA 1VCHA 2ZRBA 4X1YA 5E3HA 3Q87B 1H2ZA 3G2NA 3H8SA 4RJKA 4X94A 5FFNA 1H5NA 5A04A 2QW0X 4TWZA 2F9FA 2QVLA 5TIIA 1XMXA 3LT2A 3KWMA 3HRHA 1XMQB 1PT9A 1YH3A 4LHWA 1TQHA 4YRMA 1BNCA 1VRWA 4R8SA 2A1UA 3IQIX 5AJVB 1IVNA 3U37A 3N70A 2ATEA 1AK2A 1F8XA 1GSIA 3H3JA 3OZCA 1ZDMA 4B7AA 3U60B 2CDRA 2QY9A 3R2JA 4ON9A 1RZ3A 1ID8A 4A91A 5B6JA 4Q00A 4CMKA 4JP2A 3NEPX 1I2CA 1GGFA 4J94A 2QGZA 3SZUA 1HYBA 2VYND 2ZJFA 3GFOA 1L8LA 4YO7A 4DN6A 5JR3A 5J1SB 4W7IA 2HKIA 3VZBA 1VKJA 3R3SA 2AR0A 2OXEA 4DCJA 2GKSA 2HT6A 2YVKA 1JQDA 3IDFA 4RL4A 2D7CA 4NCHA 3EEFA 4GL2A 3ZK7A 4QYXA 4YJ3A 2P27A 3IKJA 4LA4A 3HB9A 4Q3EA 1AKMA 4OP2A 5BSFA 5FWYB 3Q1LA 2CNOA 1Z4MA 3G13A 1MOZA 1D6JA 3PXEA 1BWRA 2RK6A 4I4LA 4EL5A 1KZ6A 3JRNA 3SYLA 4HH4A 2PS1A 5A4MS 5CJJA 2JHAA 1MG5A 4W5TA 3G1WA 1G6Q1 1HRKA 8ADHA 1JKFA 1UODA 3FI9A 4E88A 4EI9A 3UKDA 5KNCA 1UMBB 2BMEA 2CSXA 5T6MA 2B0CA 2HDNB 2ZSBA 4CFSA 2O57A 2J45A 3QYAA 4BJ3A 2VXYA 3RQIA 3IP8A 4JB3A 3W8EA 3PVCA 4UZFA 1QFSA 2BPOA 3QEJA 3T9DA 3V4LA 1WCWA 4Q3AA 4B3DA 4B73A 4ERXA 1JHRA 3PX2A 1ZK2A 5FHQA 2BLLA 3DMDA 1PTJC 3ENZA 3QOXA 4G8BA 1W9HA 3BHIA 4IMJB 4EUFA 1T4DA 5TF4A 1TUBA 4EG0A 1CWUA 4QDOA 4ETMA 5J4HA 3L8FA 3DLIA 2PX2A 1GAXA 1E2HA 3UJHA 1M9NA 7YASA 4ZVOA 2DCMA 4AXBA 1Z8FA 4OK5A 4KFCA 4BFZA 2OHXA 4PGMA 2O06A 2V9PA 3BMCA 5ED0A 1B6GA 3UICA 1SCUB 4CKBB 4EFLA 1E3IA 3OX3A 4BGIA 4M0PA 2B7CA 2R6FA 3WSVA 2ONCA 2PS0A 4QBTA 1Y4AE 3A0UA 3BXEA 4C7BA 2H0RA 2GUWA 4KX3A 3JQGB 1UC9A 1PWHA 5DO9A 4RF5A 1YHNA 4DLZA 2FI1A 1N7HA 3SE7A 3RHZA 3KZVA 4INPA 1NM5C 5DB4A 5EP1A 5TNXA 1PD1A 1E3QA 5K0TA 2XIJA 1XKTA 4H27A 1Z6PA 4EZEA 1KP2A 5CBPB 5C7OO 2XKJE 5KC9A 3G5LA 1O89A 3O5AA 3ZK8A 2YS6A 3CN7A 3GAZA 2BFEA 1RJEA 1XDBA 3RG8A 5L3SB 4KDRA 2VSQA 4J2HA 1QIEA 3QI2A 3GPCA 3TOVA 1B0PA 2LCIA 5KYWB 2R8EA 4M8IA 2I34A 4U8HA 1NZFA 4RJIA 1WW2A 1NBEA 2BFBA 5M3BA 5CB6A 1I5EA 5JSZB 2XIQA 4W99A 4ANFA 3MGKA 2HJGA 2O8DA 1GPLA 1QB8A 4CCYB 4QA9A 4W6ZA 2GGSA 3R3JA 4MITA 4LK3A 1L5RA 4BRZA 1JDBC 4YJ3F 1DJPA 5JECA 1I0LA 2NN3C 1GPMA 4MYTA 5ALSA 4QATA 5CM9C 1A72A 1Y3AA 2YZNA 4A8HA 1N6PA 1B3BA 1SG0A 5EPEA 3RKSA 4YPFA 1XVIA 2IFTA 2YNMA 3I0NA 4FNAA 1I1QB 4FR0A 5JSFA 5IDYA 3T9BA 3GNSA 2P9JA 3ZDAA 2Z4SA 1NONA 2ZTMA 3PGMA 2V5UA 4FD2A 3IAFA 5EJMA 4ZVNA 2JEZA 1EXDA 1OI4A 1EE1A 4UTZA 4HD8A 1MJ5A 3CNLA 4YDRA 3DOCA 3GD5A 3RSOA 2WSSD 4HRVA 3UWSA 2DH5A 4ENVA 5JROA 1Z7WA 2OCDA 4KQKA 1JXOA 1J56A 2FEOA 3LQ4A 3WRWA 2IDKA 4S2EA 2OMKA 1DO0A 2WSBA 4IGEA 3FN4A 3RSFA 3O47A 3SQNA 2JAPA 5ICCA 3IULA 3ZBPA 1NOIA 1Z8DA 1J06A 1ONNA 1ZGBA 4FE4A 2ZXEA 4D3ZA 3AVUA 3K5IA 3I92A 3ZY3A 3D0OA 3WJ1A 2RD2A 4GUAA 5BNFA 2JIZA 3UAWA 1LVHA 2A86A 4WXHA 1YRHA 3HWSA 3OCWA 3QY0A 3ORFA 3C5CA 2BBTA 4RK4A 4B2LA 1LLUA 1PL0A 3I6QA 1Y0BA 4FYIA 4RF4A 3OHMA 4YALA 2VT2A 1PT6A 3LXXA 3BF7A 3SVZA 5B64A 1EVQA 3GBSA 4JUCA 4HGZA 1Q95A 2NYRA 1DXQA 5K3SA 4RGVA 3TTUA 4DNPA 3OECA 1KZYC 1V1MB 3IXQA 1BKDR 1E7YA 1GNVA 3HU1A 4KUGA 1SEVA 3ZV7A 3NTRA 1ZI9A 3INYA 5KYXA 1IU9A 1WXWA 4EAAA 2YHBA 2ZOSA 4NFLA 3QEKA 5DLYA 2HNAA 1Z0DA 1NN3A 1XU7A 2ZYHA 2UZIR 2J3MA 4IZIA 4LJ9A 3IILA 4P82A 5CCXA 5BP7A 2A7XA 121PA 1WPGA 2CK3D 2KQUA 3BE8A 4WZBA 1OFUX 2HJWA 3ABSB 4KQIA 4NBKA 4EFKA 4L16A 4MI3A 3K6JA 2X4GA 2Q4BA 3I2KA 3IMCA 2IYRA 4H4DA 4U7DA 4OHZA 4GX1A 5A9SA 1VCIA 1YIOA 2FW0A 2ID9A 3QVTA 4JEHA 4KPYA 4G5QA 1XKQA 2G0AA 2VSYA 4HKTA 4A4DA 4WOBA 1TA4A 2L17A 4LXTA 4QBFA 1MXHA 1ZVQA 1MPTA 2GT1A 2PUWA 5KTYA 2AVNA 2BN4A 3P9PA 3QOFA 4PLFA 5JDCC 1K5PA 5K51A 4BMYA 5DMXA 3BTUA 3WGTA 1O1YA 1E59A 4FJ2A 5CB4A 3VNVA 1TQ2A 1ULTA 3FWNA 3T3MB 4DA0A 1PJ4A 3FDIA 2PX6A 5DBEX 3ESQA 5D85A 2BRUC 1NI5A 3DKVA 3PU6A 1TZKA 2WTXA 4FDMA 3FSGD 3KV3O 3TEFA 1BMTA 4W5QA 2DPMA 1CUIA 3TI9A 3HVRA 2PGJA 3RT7A 2YWGA 3EX7C 3I8SA 2YZMA 1KR5A 3ESBA 2HD4A 1C9MA 4IQ0A 4AT1A 5EYPA 2W7TA 3PXBA 2FPRA 1KVSA 2OSVA 1KFKB 1NUSA 1JMVA 3C39A 3E3MA 3OJLA 4GPZA 2NO6A 4HQLA 4RKYA 5BN5A 3GJXC 2IJGX 4RQUA 1K3UB 2C82A 1WKCA 3WE7A 4B1FA 4BC1A 4BP3A 5EEHA 1ZHFA 1YGYA 3SM3A 4CM8A 2H57A 4P5EA 1JEQA 4GZ5A 4YBRA 3R7NA 4Y6OA 2M2IA 3V8NA 3UFXB 4QUBA 3CN9A 2WNHA 2WHXA 1Z34A 1IZ0A 3V4SA 2DR0A 4JQSA 1FP6A 4MCHA 4D4MA 1X3SA 1TE2A 3EHDA 3VNBA 3E7WA 1ZGCA 3JALB 3UC5A 3BJZA 3ESAA 4Q02A 3T7EA 4X8LA 2WIJA 4YRBA 4G2TA 5HIMA 4NBRA 4U7TB 5B12A 5A02A 5KJ1A 2ECKA 5LQAA 3IRUA 5BQ3A 1T1EA 4JA0A 4BMNA 4TS9A 1A5ZA 5AM4A 3RK4A 3B51X 1EHYA 4AZ3A 3QXCA 3K6SB 5DMHA 1XC7A 4LQ4A 3MRSA 4NQZA 2VDKB 2FR8C 2FA9A 3HHEA 3WRYA 1L7BA 2BFWA 3O8LA 4QXAA 3L04A 3S2UA 2UYGA 1ZOPA 3G5AA 3LX6A 4M1YA 3CIOA 1XQWA 2ODBA 2OD9A 4FWIB 5KOIA 4WZBE 1CUWA 1XROA 4C7OA 4FINA 3K94A 3VU1A 1V4BA 2VJDA 4EY6A 3C3WA 1KI6A 4UBNA 5A06A 1Z22A 1OWOA 1EUZA 1QVVA 4NDAA 2IUYA 2WSIA 3WQSB 1NMXA 2PZKA 4IICA 2BR5A 1KU0A 2G28A 2JGIA 3EVDA 3O95A 4CUKA 1OE0A 2PZLA 1K68A 1FDSA 3T5CA 3X1ZA 3GZJA 4B6QA 3NW9A 2C4VA 5CBKA 1XR3A 2XNKA 2P5UA 2X5NA 2X13A 1SVSA 3EDCA 5K8IA 4K9MA 1N1GA 1CQXA 4TMZA 3TR0A 1LI4A 4P3KA 1KI9A 1O5TA 3F6BX 4H6PA 3RJTA 4AY3A 4GWLA 3V5NA 4HNSA 4CIYA 5BYBA 4NMLA 3CBQA 2GAOA 4WNYA 3KHTA 1ECCA 3ELWA 4G85A 4UAGA 2OESA 4OXQA 2NVUB 1YZVA 5IEBA 3R7FA 5K3EA 1XU4A 1NVDA 1RC0A 1KF0A 5C81A 1SBIA 5JNRA 3P9NA 4HNAB 1T2EA 5LLDA 5HJEA 1GNLA 3FOWA 1FX0B 2A2ZA 2Q9UA 4GQAA 3SQLA 5JEEA 1TTQB 4H0NA 2NO0A 2C7GA 4XD2A 4GE3A 2UYCA 2ADMA 4LEIA 2EG5A 1Y34E 1OBCA 2OUKA 2Z8XA 1V3UA 4IGIA 1RYZA 3PXUA 4O4LB 4HGQA 2QPLA 2ZBRA 1HT3A 3O1HB 5L3ZA 4JR0A 1IHXA 1LC0A 3IAAA 5HW0A 3F4BA 4ZHQF 2NP7A 2JGNA 2XRFA 2XWQA 2Y2UA 4XWOA 3S8YA 3R0VA 2D1QA 4RKEA 3V2IA 5AI5A 4G0MA 1JYSA 2ZXFA 3DOEA 3N2YA 3EG9A 5AIAA 1Z2DA 3FR8A 2WYHA 3AP3A 2EBUA 4Y7CA 5KQRA 2RH4A 1MZVA 1OIXA 4EUNA 3V7FA 1XLTC 2W00A 1CULC 3GR6A 2PGAA 4B85A 4WNIA 4JUAA 1RYFA 1Z36A 1PU2A 3PEWA 1GN9A 1U0OC 3T4PA 5K45A 1TAQA 3U4HA 1NKSA 4JP5A 3UT0A 3U7QA 3MJVA 2CYBA 4NFHA 1DKMA 4MP8A 1QUEA 1SGWA 4XWYA 2WU1A 4M9XA 1FLDA 1RJ9B 4Q3BA 3E22A 4Q3OA 5H81A 4ACBA 1FFYA 2D0IA 2IYXA 3SEZA 4O3MA 3EULA 4Z0HO 1JA1A 5JO0A 1EGQA 2GWRA 1IN8A 3H9UA 4OYLA 3JSAA 1CQWA 1E63A 1UDRA 4E09A 1RPAA 2A9PA 1UK9A 4X20A 3VX3A 2B1GA 1SA0B 1T1GA 3LOPA 4JLPA 4X91A 4TV8B 4EHKA 4G2NA 1RXYA 3CXUA 1X70A 2FG5A 3EY4A 1LGYA 3OEHD 2PKYX 3K2IA 3PKIA 2HSDA 4ZJUA 2GFIA 3D3WB 1XTTA 2BFFA 3FSJX 1XVLA 1BWPA 5B3JC 4PLVA 2ZDGA 3CE9A 3B3JA 2QNIA 3GAFA 3I9LA 3OJWA 4HJRA 1U28A 1E7WA 2JZNA 4MQBA 1ZCAA 4M1QA 5LQSA 1OIWA 3AMVA 5JJ5A 1B1AA 2MHCA 2YMLA 3KE8A 1ZCJA 1U3TA 3OICA 4RA6A 1O9BA 4Y18A 4AULA 2KE5A 1EESA 4ZEOA 3W78A 1FNNA 4YECA 4N4AA 2G9ZA 3TGWA 5DLDA 3DOIA 3TL3A 1UEIA 3P9SA 3A6HA 4DB2A 1EFPB 1V9SA 3E5HA 4IRMA 3ZBQA 4BNFA 4PWYA 1R3DA 5F3WB 4PYLA 2R7AA 4NFYA 3K71B 1XXLA 4Q1DA 2ZSHA 4MYCA 5DEOA 5E4JA 3AR2A 5CLLA 2ECPA 4EI8A 1Y48E 2YCLA 2N1MA 5LSAA 1H1LB 3H18A 1T9AA 4XSHA 4MI6A 4OAOA 1DU4A 4CZ2A 4DBLE 3QTBA 4DV4B 2DPYA 1A4RA 1XK7A 2Q5QA 4BCBA 3AI3A 5K8TA 1UKVY 5E38A 1Q84A 1MAVA 3SS8A 3I9MA 3UTCA 2QM0A 4JR1A 2GCEA 1YS9A 2CMGA 3U4AA 2GCPA 3GUYA 2YIJA 2OM2A 1M10A 4RHXA 7REQA 2RMKA 2Y1CA 3OE7D 2OV4A 4LMBA 4M8KA 5L3VA 2G9NA 2ZT7A 2HNKA 3SR4A 3H8VA 1T36A 3CRW1 4JI2B 2OXFA 5HSGA 1RLUA 3A9RA 4RAOA 2C4TA 4YRZA 1IHYA 1X80A 5F12A 4HX2A 2WKWA 4A2QA 3RM3A 4CEIB 2HQ1A 1YVUA 4LX0A 5C7IO 3P4UA 4F3CA 4D74A 1EA7A 1DEHA 3H9QA 4KQGA 3LIPA 1NVVR 4ZVLA 3KZMA 3A4NA 1V8OA 2HF9A 1DQNA 2P4UA 3G9UA 3EGCA 3NVDA 4FCVA 4BP8A 5B6IA 5GIPE 4RTKA 4RH0A 3VKGA 2IEDA 2ZIVB 4RGYA 4CXMA 1XQXA 3QX8A 4PYJA 1HDCA 1VGRA 2F1KA 2QRPA 3CRVA 5LLTA 4J9VA 1W88B 3HZHA 2B8EA 1N2XA 4QBKA 3U7JA 1PD0A 5LC1A 1CFJA 3QK7A 1DC3A 2Q5OA 2Z5GA 3HJTA 4RIHA 3ES9A 2VHTA 3U40A 1CY4A 3UXMA 5BWNA 2F4VB 4TUYF 3GPIA 1CY7A 1VI6A 1V37A 2PGOA 2G4CA 1N1DA 1RZRA 5JASA 4MDFA 1CHNA 3FGPA 5HZKA 1ZM2A 4M0MA 5HQ3A 2QGFA 5AJTA 3RFFA 1BDBA 1P2DA 1JJAA 3ED1A 4AIRA 4TYMA 5JYBA 2WQ6A 2AIRA 1Y3IA 4DIBA 4IJVA 1Q57A 1CD5A 4JLVA 4C7KA 4EHFA 4JUIA 4U9IS 5FUYA 1POWA 4RSRA 4BNDA 1NOJA 4LQDA 3W6ZA 4U63A 4GOXA 4RD4A 3UV6A 621PA 3ICEA 2Z43A 4NNPA 2HDOA 3VHXB 1HE5A 1G8AA 3I76A 5CEJA 1KPIA 1ZD3A 2PWBA 3B53X 3INTA 1GN8A 4TKUA 1YR6A 1NSFA 3D4IA 3EZLA 3W04A 2WLTA 5JCXA 5ADHA 3N9IA 1SXJC 2WV9A 4DNOA 5C8XA 4MP6A 4O4LF 1LU9A 4F3KA 1QMGA 2H65A 3L1IA 4Q9JA 1LDGA 2F1RA 2H3HA 4CWAA 2A1TS 5CXQA 4P34A 1NVAA 5B58C 2QTFA 1HQDA 3HMKA 1KSGA 2V5VA 1JSZA 2VDWA 5JI3E 5FLEX 1ISGA 1MR3F 2WJPA 4BNIA 2NZVG 4IH4A 3VPXA 1P2SA 3ZY5A 5JNVA 3OOHA 2FPKA 3OJOA 4NFSA 3FCOA 1XPJA 3AVTA 3GA0A 4L0MA 1Y37A 5TQJA 4TTSA 2VBFA 1YWGO 4C0QC 5IX8A 1WETA 4PQRA 3ABZA 4E3ZA 1ODKA 4YACA 4HYQA 4LOLA 3QLTA 1WTAA 2FK8A 3GLIE 3URMA 1L8QA 2PZGA 3V1UA 2R8BA 2GDJA 1RCTE 4LTDA 1BDIA 4G25A 4ZMSA 1BE8A 1RVV1 1JECA 3LK6A 4OJNA 4OQYA 1P2FA 5LFAA 3AUFA 3LCRA 4MV9A 4ZD6A 3J81A 4QQNA 2UYHA 3JQ8A 2FX3A 3LPCA 3ZKWA 4A8TA 3PC6A 1E2BA 1RWWA 1T1JA 2ODEA 3HB4X 3GO4A 5G40A 3M83A 3RYIA 4D4KA 1JL3A 3FTNA 5G0SA 1XXHE 1SCNE 2QYSA 2Q5HA 3AIKA 3OOSA 3GFSA 3HA5A 3LPNA 4W5JA 1XZQA 3AY3A 5H9VA 3WQQA 4A6EA 1VOTA 5JJBA 3UZUA 2PKEA 1QO0A 2XT0A 4F6RA 4BMCA 5BQXA 5KTRA 2EF1A 1OXMA 1XP8A 2QNRA 4PYIA 4FYPA 1PAUA 3EK2A 1DAGA 3NVMB 4MA5A 5KDLA 4BKPA 3EVBA 3DBHB 4PLGA 4X84A 2PQMA 4BNNA 4A15A 3BULA 2AEJA 4LXGA 1EWQA 1PQWA 4F2PA 1HFJA 3MT8A 4JHLA 2I87A 1FY2A 1BU8A 4AJ4A 1CIPA 3NC4A 5BXQC 2N47A 4NBNA 1E2LA 4BZWA 4UULA 3WICA 2ZIEA 4C30A 3E15A 3MS2A 3HA7A 2I2FA 1LK0A 3EF0A 3HEBA 4PSDA 4B6GA 2TS1A 4JNKA 3THOA 4FE7A 4IMPA 3U48A 1N8NA 1NDUA 2W4MA 3LHFA 3QU7A 3ZNOA 3O8BA 1NR1A 3O84A 3NANA 1YQEA 4GX2A 2BMJA 3TSWA 4L5CA 3C2QA 3HFGA 5CAEA 2JBAA 1E61A 5EIBC 1FTWA 3NRJA 5E9JA 1QHFA 1U8UA 1GA6A 2P67A 3I8XA 1FB5A 4IIBA 4M37A 4OH7A 4WCFA 3NHPA 4R83A 3FR7A 4QPZA 3C8HA 7ADHA 1GU0A 5F2NA 5BW6B 4HQKA 1E1KA 5T8KA 4RZSA 2JFWA 4ILKA 4EB6B 5K2MA 2DKNA 2VK1A 1KR2A 1VPEA 3FCEA 3NOOA 4H15A 1Z4KA 1NYLA 3DMTA 4FPXA 1CE8B 2FW9A 3CKKA 1RQXA 1BD3A 5I7OA 3PBKA 3EPKA 2V7EA 4RHUA 5G1NA 2ASVA 1V39A 3KX2A 2ZJ8A 2Q7DA 5CB4F 1MJGM 5IBCA 5KVAA 1RPZA 1E2DA 2OCIA 2DOKA 3EFEA 3D6FA 2VTDA 2P6PA 3DZBA 1O9HA 4LZWA 4IIHA 1TO1E 2EFHB 1SHKA 2Y71A 2JJQA 2B21A 2P3OA 1FNBA 1KBOA 1SCUA 2GDZA 4U2EA 5HNKA 3GEPA 3H2YA 4WN9B 5JCJD 3AVXA 2WF5A 3F97A 4OGGA 3U7RA 3OM8A 2M6KA 4B4DA 1G20A 2NV0A 4DDVA 1ZUNB 4LOHA 1C0EA 1Q2XA 2UZAA 3J7AC 4FNMA 1ND6A 2IXDA 3H4VA 2IVFA 3FD8A 3DZDA 2H1SA 3ZZ0A 1C8LA 5I9LA 5G1OA 4KCGA 4M89A 2GZ3A 3REQB 2LP4Y 4CLXA 1ESMA 3M6IA 3O83A 5BRJA 4NU0A 1RR6A 2CYAA 1F3OA 2EL9A 4L74A 5E9AA 2I91A 2PYZA 2WT4A 5F5NA 3EBPA 4G84A 5LKRA 3KJGA 2HA0A 4ZYVA 2UVPA 3C48A 5CFMA 1W35A 3DPIA 4MUEA 4P7JA 1Z0IA 5LXTA 4IDFA 2FE4A 5HOQA 3VC3A 4GD3Q 4IWXA 3Q72A 4EHDA 5IXJA 3UMMA 5EERA 4IXTA 5CVVA 1KDYA 4RE5A 1E98A 1KI8A 2BE9A 2GZHA 5DN6A 1C30A 3GIWA 1OLXB 3CNOA 4C4YA 1UPUA 2H9YA 1VFNA 2ZUSA 4MKXA 3DP9A 4I6EA 1TKAA 1PFGA 3W0LB 2P0YA 3DMHA 3SHTA 3SGLA 1U7OA 4MKGA 2O2CA 4RKRA 3RQSA 5JXIA 3UB4A 2X4LA 2XUPA 3E35A 2AMVA 3IQWA 3FWYA 1G6OA 1ZRNA 1FOEB 2P2NA 1RYHA 3D6TB 2W6OA 4NESA 1L5OA 2J31A 1P45A 4CQNA 5DRTA 3T94A 5BSVA 4UEWA 4FT4A 4JSYA 3NM6B 4WJKB 3VC7A 4IRUB 3C6QA 4O2LA 4I3FA 4DQDA 1SUAA 3QU4A 1Q3KA 5BN1A 4H1HA 1Z7GA 4RQAA 2LRHA 2PVCA 2XBLA 3GCZA 2Q3LA 3ECCA 1RM3A 4XVQA 4YJDA 4Z51A 5K8VA 1M7GA 1XALA 4ETWA 3WSWA 2IPMA 3FH0A 4QOSA 1JFFA 3MINA 3RJ5A 1L1FA 3VTKA 3G17A 2PRSA 1L7QA 2CY0A 2JFXA 3HCNA 3F6EX 1B42A 5K3FB 3FOEC 2J9YB 2ZR9A 2NQ8A 3MNFA 5FOWA 1P7WA 3SY8A 3NONA 4DSZA 3TIFA 1A96A 1L9XA 2C2HA 3W2IA 5ESWA 1YB2A 4GLJA 3H1TA 5BMOA 2AN1A 4LQLA 3WNVA 1T0IA 1XTBA 1JSRA 5LMUB 1G5RA 3F49S 2VCHA 2FEXA 2P6UA 4UD2A 1PW7A 2EKZA 4JP3A 1SVKA 3WNQA 4XCVA 2P77A 2IITA 4AVYA 3EUEA 1DUVG 3ZHVA 4XUDA 1Y4DE 3DWGA 1SQ0A 4NBVA 4I2NA 3PENA 3ZW9A 1TTHA 2C78A 5MGNA 1OIVA 1PJQA 3MHPA 3PQ5A 2H2IA 2PNFA 2XMZA 1XWIA 1WMBA 3G0IA 4IFIA 4NECA 4PN7A 2WJVA 5ANRB 1Z17A 2QTAA 1UPXA 4GP7A 1QSGA 2IXAA 3GCGA 1U7TA 4S24A 1T5HX 2RGYA 4F71A 3FTEA 3U3XA 1AG9A 2QRJA 5F1YA 1MH1A 1Q19A 3ACDA 3DVAA 1MUUA 4XVHA 1Z68A 3DBHA 4E5KA 1G41A 1F0NA 1RYYA 4XARA 1V7ZA 2NT4A 1FDIA 3CE6A 5TSDA 4CMIA 3EOZA 3CJQA 3UHAA 4EPWA 1UDBA 4NCJA 4INAA 2ZSEA 2ASEA 1NX9A 4WVFA 2P6OA 2ZEJA 3ZGYA 3U1VA 3C6YA 4XLTA 3ZIDA 2QUKA 3IAS6 2DBVO 5CW1A 1F7VA 1O03A 2CN1A 2CB0A 5EUMA 3E3AA 2VATA 1LF5A 2D5LA 2MSKA 3CINA 4MPPA 3V2GA 1UXJA 4WV3A 3H0CA 3D59A 1US8A 1KK2A 4WA8A 1EWKA 1L5QA 3KAPA 5C8YA 3Q2OA 4ZO4A 2XY4A 3F2IA 2BMAA 4GM4A 1OLOA 2J4CA 1N6HA 1IL0A 4BGVA 2IPNA 4PTLA 4GWKA 4G0QA 4M9SA 2HMVA 1F2UB 5MF6A 1YBFA 2QIOA 2R84A 3ASVA 2L42A 2UVPB 4Y9RA 4IFTA 5JSKA 1ZNWA 4RD1A 1XEXB 3QUBA 4D96A 3MGAA 3PV0A 4XA8A 1J24A 2B2CA 3ISVA 3LCUA 1H6DA 1UM9A 2Q49A 5IUKC 3TLJA 1YJ8A 4A0SA 1CQPA 4KJZA 2GQ0A 3C1UA 3WY9A 3JWGA 2YN0A 2VF2A 4OP3A 4G1FA 1W85A 1YAHA 2MOKA 4PAQA 4DQLA 4FBLA 3N86A 5H3LA 5ALUA 3F6YA 2ZJ4A 3NTVA 4HYEA 4CV1A 5I7FA 2K2QB 3TDNA 4RMGA 2AEFA 3K53A 1P8JA 1QHXA 2C8KA 3RFXA 3A2MA 3H9EO 4K1XA 2V9CA 1V3QE 4NZNA 4B81A 3CMMA 1JFLA 1IMOA 1L3BA 2OLEA 4CR7A 3E8MA 1CP3A 3ASZA 3G88A 2VDJA 3LHSA 5JFTA 4HATA 4Q7KA 2IHYA 4EJ6A 4LNUA 2J3JA 3F6SA 3H6KA 4OD0A 2C31A 4C7JA 3HUUA 1X14A 3NOQA 4U3JB 3ZBTA 4CL0A 1BH2A 3AP1A 2AOUB 2ESRA 2Q4EA 4G37A 4RU1A 4WXRA 1F9EA 4F12A 5IAOA 1NGSA 3REGA 4CLEA 5FWXA 3DE7X 3KOOA 1DWUA 4BU0A 2YWHA 3ROMA 5ITSA 2QQFA 4MYRA 4Q7JB 3I12A 1TUBB 3FOAA 1NW7A 4TVBA 1PS9A 1R3UA 2ATXA 3DM5A 1YJ5A 4MEJA 5JD3A 2PLFA 4MAMA 5L95A 2HBRA 4XE5A 3WKEA 1VRVA 3VKWA 5J2UF 2C8JA 5L40A 1MJHA 1PVVA 1UOOA 1WLSA 2VCYA 2ZITA 3QWAA 4D7AA 5C1PA 5BV0A 3O8QB 4O0LA 2W5UA 3VZPA 4E6PA 1VM6A 1Q1NA 4HLCA 4Z9AA 1U8AA 5LYJB 4WXEA 3JQAA 4URZR 5EKDA 4ATNA 1IPFA 2CEKA 1Y3CE 3GF4A 4R81A 1GZHB 4PS0A 3DT6A 4DSTA 1ZMBA 2FN3A 3LBHA 4I36A 1Y3BE 1DADA 4LCJA 3TLKA 4AS3A 3M6FA 1T1SA 4UCQA 1COWD 4IXMA 4MWOA 5AKHA 1N3BA 1QV7A 3L6RA 3RIXA 1RMYA 1X8LA 2C4NA 4DA9A 3CZQA 4AN4A 4MQFB 2EBWA 3F47A 1JEJA 3X1JA 1O87A 4EABA 2X3UA 3ESRA 4LBYA 3A1NA 4X8OA 4RPGA 1E32A 1FX1A 3SICE 1VFPA 221PA 3RVSA 1E2FA 3X2EA 5HFNA 1AV7A 2R6DA 5BV8A 3D5QA 4MQMA 1DC7A 4RMHA 3M3DA 2R00C 5A4IS 2ZIZA 4ND7A 4KO2S 3PXGA 2JRLA 2P69A 2CFCA 1M34E 2AXEA 2PYDA 5TY0A 2IV2X 1L3IA 4OKIA 3PHBE 1Z6YA 5EINA 2PWAA 2PUGA 1GPAA 3JYHA 3ONNA 1VJRA 2GD2A 5FPSA 1TK2A 1I13A 1PJTA 3GEDA 4XFDA 5AM5A 2B9EA 3GPLA 1I2DA 4FFMA 1YBVA 1PNTA 2PXHA 2UVQA 2X9LA 3ZKWB 4IR7A 2VBGA 1XNGA 1WBDA 1J39A 4LPSA 2JL1A 1J1IA 2V0CA 1UAGA 1V11A 3ADDA 5ARDA 3FWHA 2VP6A 4MPRA 2GUGA 3TLZA 1G20B 4MROA 3HXMA 4XCXA 3S5UA 3VYWA 2G36A 1ISMA 4KWCA 2B37A 1E1QD 3K9HA 2ZS8A 4MIOA 1NG9A 4LBWA 1TGYA 3A8TA 3C14C 1TW2A 1V26A 3HKBA 5EGNA 4LF5B 1V2HE 2EFGA 2QVBA 3D7NA 3JAWA 4JJAA 4DKXA 1SXIA 5BN3A 2Q9AA 3FNRA 3KIPA 2K7FA 2IZ1A 4NPHA 3BTVA 3SVLA 2GK4A 2PUFA 4JZKA 1OC4A 3K09A 1YZUA 4EHIA 3AVVA 2Z98A 2HB6A 3K05A 4HMQA 3E05A 4RUKA 3FYCA 2F90A 1JTVA 3Q1KA 3K96A 1EP1B 4R4JA 2ORED 1JALA 4XWKA 1EM8A 3AFHA 3RS0A 2NZXA 3AFIA 1T43A 2YTZA 3K8QA 2I29A 4PZAA 3ZBUA 4TVKA 3H5LA 4J2TA 1I4TD 2BSAA 1NUAA 3EEQA 4XGKA 3MCVA 4BZXA 3TPFA 3FDZB 3THYA 4JJFA 2AJDA 1GUBA 4MVJP 4ZXPA 3F5SA 2H4HA 5DTRA 3V8PA 4F46A 3SCZA 1ULBA 4ND6A 1Y1RA 4HUQA 3FRIA 3U7QB 4P0QB 3AF2A 3IDOA 2OZVA 2AK3A 1DOHA 1H85A 5C7YA 1RKVA 3CPHA 1WB9A 5L3QB 4DLLA 5CA1B 1LTQA 1V41E 1IM5A 3OAAD 3Q3EA 4Y8VA 3H11A 1MRNA 5C4MA 1CS4C 1VE1A 4K9OA 1EVZA 4U5QA 5IJZA 2DWPA 1R8XA 2QMYA 3FMFA 4NONA 4UD6A 1H4TA 4YPOA 1QGUA 3VR0A 2W70A 1U5AA 5L3SA 4NENB 1WU8A 2O5EA 3CLUD 3TL6A 2QZJA 3A6GA 4BVKA 3BFPA 4XUGB 4TYNA 2YY7A 1APBA 3TSAA 5A4AA 5F9MA 2PGIA 1GUAA 3CRMA 4LJKA 1T8PA 2Y68A 5LBTA 3ORHA 5JEDA 3LCJA 1DJMA 2XE4A 4OOEA 3A6FA 4O4LA 1M1NA 2FPGB 5LMNB 1MO5A 2OQVA 4D9FA 1KBQA 4PZZA 5AVYA 5E8JA 2GYVA 1G16A 2OY0A 5FYQA 5FH9A 3BKWA 5AK6A 2YRXA 1P6UA 3QNWA 5T67A 2IP4A 3CQ9A 3AL3A 3ANSA 1L8XA 1N6KA 1JFVA 3ABIA 5HIIA 2ZZMA 4YNBA 5KCMA 6ADHA 1X8JA 1OTXA 1JR2A 2GVDC 3HRKA 1M8JA 4HDMA 4DC9A 1NQXA 1UZUA 2GNAA 3QVOA 3FW1A 3RUFA 2YZKA 1NI3A 2QSZA 2HPHA 3B9PA 4JC8A 1KXJA 4FGSA 3WGQA 2PT9A 5DT9A 3GT3A 3SZOA 2AYXA 4HGRA 4EI2A 1TKRA 4D0SA 5AK0A 1Y1PA 1CIJA 4GPAA 5HG0A 3SJAA 1KEVA 4AI6A 1T2NA 2FAXA