1W30A

Pyrr of mycobacterium tuberculosis as a potential drug target
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
174
Chain Sequence
b'ESRELMSAANVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRR BIFUNCTIONAL PROTEIN
publication title Structure of Pyrr (Rv1379) from Mycobacterium Tuberculosis: A Persistence Gene and Protein Drug Target
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 53
structure length 174
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1w30A00
1TC1A 1ECBA 1AO0A 1QK4A 1DKRA 1A96A 1R3UA 4RQAA 4RABA 1XZ8A 5E38A 1IBSA 1G9SA 1YFZA 2EHJA 4RHXA 1OREA 1OPRA 4TWBA 1G2PA 1DQNA 3M3HA 3QW4B 4P82A 4IJQA 4F8EA 1QK3A 1XTUA 1D6NA 1P18A 1O57A 4FYMA 4M0KA 2XBUA 5EUCA 1ZN8A 1V9SA 1I0LA 1G2QA 2JI4A 1XTVA 1XTTA 4P80A 3O7MA 1UPUA 4LZOA 2AEEA 4M0PA 1QCDA 4QYIB 1P4AA 3GGJA 4RHTA 1DQPA 4PFQA 1OROA 1P17A 1Z7GA 5BQOA 5HIAA 1WD5A 4RHUA 4WMLA 1BD4A 1ECGA 4X44A 3NAGA 4QRIA 1UPFA 5BRNA 3OZFA 1A95A 1A98A 3S5JA 2H07A 3DMPA 1J7JA 3N2LA 3MJDA 2E55A 3OHPA 4JITA 3DEZA 5KAMA 4P3KA 1UFRA 2HCRA 3ACBA 1ZN9A 1NULA 2YZKA 1NONA 5JSQA 4M0UA 1VCHA 1VDMA 2FXVA 2VFAA 4QYIA 1I14A 1A3CA 1DBRA 1O5OA 1G9TA 3MBIA 1ECCA 1QCCA 1U9YA 5BQPA 4P86A 1P19A 2JBHA 4MB6A 2IGBA 1GRVA 1QK5A 1QB7A 4RANA 4RHYA 4RAQA 2JKZA 4RQBA 2C4KA 1ECJA 5JV5A 4X45A 4ZFNA 3KB8A 3EFHA 1I0IA 4LZAA 1LH0A 2H08A 1VSTA 2WNSA 1ZN7A 1STOA 4RV4A 1A4XA 1I5EA 1QB8A 1FSGA 1PZMA 1W30A 4S2UA 5HKLA 3HVUA 5ESXA 2PS1A 3OZGA 4LYGA 2GEBA 1BD3A 2P1ZA 3DAHA 1U9ZA 1TC2A 2PRYA 1ECFA 1MZVA 5ESWA 4RAOA 1L1QA 1JLRA 3GEPA 3LPNA 3ACDA 4LYYA 1I13A 4PAWA 4Z1OA 3LRTA 4OHCA 1HGXA 4P83A 3G6WA 1GPH1 1Y0BA 4WN3A 1XZNA 5IPFA 3ACCA 4P81A 1L1RA 1BZYA 2JKYA 5BSKA 1HMPA 4JLSA 2H06A 4RACA 4LZNA 4P84A 4KN6A 3H83A 1A97A 1DKUA 2DY0A 3GGCA 4RADA 5KAPA 5IAOA 1CJBA 1JLSA 2PRZA 5K51A
chains in the Genus database with same CATH superfamily
3ZX5A 2V54A 2V74B 3I8SA 1NUUA 4OO3A 3KAKA 1G20E 1KERA 2ZT8A 4L75A 1PN3A 4ZRMA 3OE7D 5J43A 2OK7A 2I66A 3PPXA 4F93B 1I2CA 1K8RA 3O4JA 1MDBA 1ZCFA 1GCAA 1O6FA 4GPEA 1ODIA 2HA3A 4QDOA 3I2KA 4XTCS 5LQAA 3AILA 2ZJYA 3FVWA 1Z0KA 2HNBA 1CJVC 3S2GA 2ZWOA 1JYEA 3O4IA 5EUCA 2Y1DA 3QKIA 3N8GA 4D0RA 3TZQA 1XEXA 3SF0A 4DSOA 1LF0A 3EXHA 1I3NA 2VSOA 1QRAA 1XNJA 4ZEVA 5COBA 4IOKA 4XVCA 4JIMA 3CZPA 3KETA 4QOIA 5BQXA 1Q91A 2OAQ1 1RFGE 3F7OA 3RSGA 3WGLA 4D8YA 1KBOA 1QVAA 4RESA 5KNDD 1TD1A 4ZVUA 3RIYA 5TDHA 1PO7A 3KL2A 5LLSA 3CJTA 3H2KA 3CZ5A 3I52A 5AXDA 4ZV9A 2WWXA 2X6QA 2IW1A 3QVJA 2Q7OE 1G59A 5JIBA 1R0YA 3ETGA 1EIWA 4X9XA 1YGYA 1RAGA 1BJKA 3F5QA 4KGDA 1LEHA 1X13A 5FBVB 3ZLUA 2WIDA 1VC2A 4OKIA 1ZCZA 3I9KA 5TGTA 2WUEA 3HXKA 3OQJA 1SPBS 1V6CA 1X2BA 1IUOA 5KJ6A 3WI7A 3S44A 3ZHSA 4IXWA 4HH1A 4OLAA 3D31A 1BRTA 2JHAA 2PSDA 2Q4BA 1XEAA 1R9NA 4CLOA 1QHIA 3EGVA 2K7FA 2G1PA 1WCWA 1CRPA 3T12A 1LWOA 4DIOA 4GPTA 3U9TA 5A4KA 1CY8A 1W1IA 3OJEA 4QDJA 1EP9A 3NNSA 4LVCA 5FD8A 4P86A 4YV7A 2J6HA 2B5OA 3BBLA 3UJAA 3A4YA 5EJ2A 4Z1MD 5KTRA 1SPXA 3W6OA 3TVYA 3WRYA 1NZDA 2FFHA 4JASB 2YCBA 4RPHA 4OUKX 3M82A 1IOZA 2G4LA 3I6BA 5AJWA 1ULSA 2UYGA 3N58A 4TTRA 4ARSA 4BE4A 3LHSA 1MGOA 4JA2A 5CB6A 3GH1A 1A9SA 1P2TA 2BFBB 3K20A 4RY8A 5LQRA 1PBTA 5I7OA 1O54A 1USUA 1S2NA 5L3SA 5CG2A 2H4WA 2BBTA 4FFMA 4J2OA 4M9ZA 3SBXA 2GM4A 3NVKI 2NU9A 5IT9A 3IDQA 1DG1G 1G8HA 5K1ZA 3D81A 3E5HA 3UAYA 1GV0A 4TT8A 1ZJ5A 2PZLA 1JG6A 5CDGA 1WCXA 1MORA 2M6SA 3X1WA 4RD0A 3HKEB 4DIKA 1Z38A 4CIVA 2GRUA 3G9TA 2E9SA 4IOLA 3CLKA 3ACDA 3U16A 3OLQA 4HL6A 5FNVA 2W6JD 3KPJA 3DXFA 4MYCA 3RKRA 4EKGA 1RKUA 3BAFA 1JJ7A 1PZXA 5DGTA 1BHSA 1VBKA 1QVRA 5IHXA 2CV0A 1WB6A 4TMFA 2N3ZA 1KH1A 5F1PA 1L7EA 2GBCA 3HEMA 4I08A 4J03A 2G4VA 3A70A 4NU6A 2C5BA 4PO3X 3ZKAA 4B87A 5KTSA 3OQHA 1TJ4A 4RPGA 1GDDA 3AJEA 4UUMA 1OTYA 1V1JA 1Z6PA 5EQDA 2CL6X 4WA7A 5L6LB 3FROA 2YWRA 3I0NA 4KXMA 3R7WA 3TSOA 5FULA 4BEBA 3CUVA 1LRLA 3B3JA 3A1FA 3D8NA 3H17A 4K0RA 3MA0A 5ALLA 3S28A 3U61B 1SD1A 1QV9A 3RYTC 4MV5A 5EZYF 3K1TA 3S2EA 2E0IA 4YAEA 4ENRA 4IMPA 3HXTA 2YWHA 2Z08A 5A03A 5EIEA 1A7AA 2WYHA 4CKWA 1Z63A 4EI2A 1CUIA 1RJ9B 1VKJA 5DX8A 2FXIA 3V8EA 1QX3A 2KJQA 1SEPA 1XCOA 3BCSA 4G1BA 4QU0A 4KPUB 4Y2SA 3S2FA 1L5OA 1THGA 2JI4A 2XQIA 2ZUUA 2Y92A 2FK7A 3RFCA 3WHKA 3L1KA 1JXQA 1M0TA 2QRZA 1E1CA 3O9VA 3ZS8A 5A4MS 2ZRBA 5H80A 1O87A 5IBQA 1I8TA 2O2CA 2FZEA 4GP6A 3L40A 4D3FA 1QIJA 2IODA 3GLFA 1Y6GA 3TW0A 2Z5VA 3JRXA 1W34A 4GZ3A 5F33A 3VNQA 3MRTA 5B64A 5L40A 5KYWB 1U8CB 1X8JA 5LQNA 3O8RA 2IZOA 2NZUG 3DF7A 4CR6A 4JOQA 3A4NA 3A4LA 2H1IA 2RI6A 1RP1A 4QUBA 3REOA 4I36A 5YASA 4CFZA 2B8JA 4CG0A 4XIYA 3R3YA 2GCIA 4UULA 1GU0A 1DX6A 4WDRA 5JFGA 5LDHA 4D98A 2WTEA 3OZDA 2X0NA 3PITA 1F2UA 1N2IA 1VLVA 5AVZA 5D01A 521PA 4B79A 2BEWB 4H7FA 4CJXA 5EVJA 1FFDA 1N4DA 3OZWA 2P5SA 3C3XA 2O3QA 3I12A 5IJAA 5KQRA 4RIEA 1EPUA 3CLUD 4RPJA 1VSUA 2VQDA 3B9QA 5DXJA 1PEYA 1UPCA 1Q11A 2JRLA 2YYZA 5T4BA 3H3XA 4I9UA 4OFZA 2OC4A 4CIYA 2LVBA 4C7OB 4V1CA 3ER9A 5F64A 3MAAC 3W5UA 3NJRA 4R1NA 3ETLA 4KK3A 1NVXQ 4KHZA 4WN9A 1OFVA 2HZ7A 4C7XA 1J21A 2DQ4A 3ELWA 1CNEA 1GY8A 2P9FA 4OQYA 2K2WA 4QEKA 3WLLA 2WWVD 4S1TA 1EESA 5LYJF 5B1YA 1U2DC 5HG0A 4MWDA 4BFUA 4QPZA 1CNMA 1P39A 1TTQB 4QVGA 2PKQO 4JUAA 4ZOEA 5JZMA 1KY4A 2MMGA 4QO7A 1Y7HA 2LR0A 3AFIA 4QLAA 3WISA 2IXAA 4MVJP 4Z7OB 3NNNA 2PD4A 1E5DA 4C4TA 1HDGO 2AK2A 3AG6A 2IITA 1U0RA 1KAGA 3BFVA 3EWSA 3VPFA 2RGEA 3AVWA 2CNLA 2O19A 2XCTB 2A67A 2GCEA 5K0CA 4F9EA 2YIVX 1MEEA 1QHYA 1GTL1 2P3SA 4OD0A 4PCLA 2E37A 2GZSA 2LIPA 1RABA 3ES9A 4ECAA 2PYIA 1NP3A 2YYYA 3TMYA 4UM9B 4N0EA 2A84A 5I9SA 2W4MA 3PWSA 1YFKA 2CDBA 5AVUA 4POAA 1E6UA 4YYEA 1LI4A 2G0NA 1AGRA 3HCEA 5JNTA 2P4QA 5KI6A 2XWPA 3WTCA 5IYZA 1IBKB 1U7OA 3WKEA 1Q84A 5MN6A 3K09A 2IUEA 4JGBA 4YVFA 1A76A 4XM0A 3ZJ4A 2IU6A 2RSLA 4RABA 1E94E 2IYZA 3LH5A 1HURA 2O20A 3KUUA 5FFFA 4DBLC 2HPZA 1RKXA 5A06A 3JQBC 2O8CB 2IXDA 2O3UA 4TT3A 3PDUA 4M83A 2O1SA 1CX9B 3C85A 4ALKA 4FZVA 1C14A 1R6AA 3OPQA 3RYHA 1OMOA 5C34B 1DAIA 4W5TA 3S99A 3HMKA 4INZA 3SU8A 2GEJA 3WJ2A 4RTRA 1TM7E 3THSA 4U7JA 4BJ1A 1PJCA 1BJTA 1R0ZA 1I3MA 3D1LA 3VYUB 2BBWA 1DS6A 1RJGA 5SYNA 3ZI4A 1T9CA 4EUEA 1N36B 2IYWA 3NBXX 2RARA 3NBAA 4R2KA 1CQWA 1I6WA 1VLLA 3FW1A 2GXQA 3GLVA 4LAFA 1U6KA 4DA8A 2I76A 2G5CA 1N3YA 2J9RA 4GMGA 4K9RA 3UK7A 3JVUA 1KR5A 2FWBA 1W76A 1X42A 1Y82A 1ZS9A 3DONA 5CLGA 4BCDA 4EPTA 2E4YA 5I7WA 4IHJA 1I36A 1A95A 3BXZA 1KIFA 1N2ZA 3FF4A 4WOKA 1R5OA 1YJCA 3NHPA 3BD8A 4O33A 1FDTA 2WSYB 4TMZA 2XCSB 2QJWA 3HNRA 3GDGA 1SVSA 2JHCA 1UJMA 1ZMBA 3BRCA 1KBQA 2VPZA 3ZDRA 5IWCA 2O9JA 4MAMA 3OH8A 1W7AA 1CBUA 2WNHA 4C20A 4DVGA 4JWTA 1M54A 4HPJB 4R9VA 3BJZA 1ND6A 3UMVA 4Q12A 3CZ4A 4OIMA 1JHUA 3FTQA 3HCCA 3K2QA 5CB0A 5CT9A 3D64A 2LPMA 2YZ7A 3LT1A 4FOSA 1B8OA 3AHJA 4Q47A 1RZRD 1W36D 1RPJA 3AUKA 1R66A 3GYBA 4AP6A 2R97A 3M3PA 3HADA 1RZ3A 3VXKA 5IASA 4ZJPA 3FFXA 2RJNA 1BH6A 4QJ3A 4RAQA 4XQGA 1M7BA 3JS5A 4G0QA 5D1NA 1JLLB 5HKKA 5EINA 4J0FA 1FYFA 3EWAA 4OXYA 2HHHB 4WDQA 5KPJA 3ZKWB 4FYWA 1Q7RA 3I8XA 2BELA 1U1EA 4HB4A 3OM8A 1DC4A 4LZJA 2GUWA 4FN5A 3HP4A 1JDPA 3ODPA 1ICEA 1EP3B 1SR8A 4FFOA 4R5MA 5HFJA 3SP1A 5HF8A 3PHIA 1W85A 2FFAA 4P2BA 1WPXA 1XRMA 2R8YA 3HVUA 3RTGA 1GTVA 3OC0A 4C6RA 4HQRA 3HXOA 3SR3A 1O4VA 3B3QA 3D2AA 3MJTA 4RZSA 4UAUA 2IHZA 1LQTA 3TAUA 4REQA 2EG9A 3K1YA 4LYYA 4OHFA 4W8HA 4Q4DA 2AOXA 1Z0JA 2ORIA 3GGSA 4TQGA 4UM8B 4YBRA 3UKDA 7YASA 3CG4A 1ZJWA 3CZ9A 1K9VF 4AIIA 2AC4A 2F9FA 2GSDA 1K4MA 1OTXA 1QM5A 4DDVA 1U9CA 1AKTA 4QSMA 1KVRA 4ZYXA 4HDNB 1BMDA 5EGSA 1KEKA 1G7CA 3RD5A 2C9BA 2HU7A 3PQ7A 5J5AA 3SZLA 4HH4A 3V4ZA 3BGOS 1EP2B 1QK4A 2CNWA 3B48A 1A96A 3B78A 1WU7A 3CQ9A 4QUKA 1KMHA 5A3QA 3LHKA 1XZ8A 1FYVA 1TL7C 3W0LB 1TGVA 1YK1A 4ZMBA 2NSHA 3LJKA 2POCA 2MMCA 4EGQA 4G0PA 4WERA 3O1LA 2Z4TA 2ZB3A 4RA9B 1ATIA 4UNPA 1CYEA 2X23A 3UJCA 2OBLA 2FHSA 4KK4A 3SHQA 4FBGA 1N2BA 2R6JA 1D6NA 3ZXIA 3LP8A 3WLSA 3BKWA 3WDMA 3HCRA 4A7PA 4BGEA 5IU6A 2Z5GA 4YROA 5D7NA 1U2DA 3ESYA 2NV0A 2GM9A 2P4EA 4E5DA 3RYCB 1NVTA 3C70A 3MXOA 1OVMA 1N6OA 4RORA 4I9NA 4O4JF 4URFA 5EKSA 2I2DA 3WNQA 1P77A 3IJRA 4M88A 5FTWA 1WCIA 2R751 2QUJA 1KF0A 4YJ3B 4Z49A 4BLTA 1S2GA 3Q0TA 1W5AA 2QI9F 2VDJA 2X41A 2XYPA 3QHPA 1SURA 2ZE7A 3K0HA 4GLOA 1ESNA 2PBZA 1JA0A 3FY4A 4YMWA 2PLNA 1QLWA 3PA8A 5IJ0A 4MQFB 3U7QA 1C1HA 4F2DA 4YT4A 1WSWA 4AECA 1SKQA 2WLTA 3K9QO 1SC4A 1Y89A 2B8EA 4ZI7F 4X6LA 1RXVA 3AFOA 3B6KA 3EZFA 5TT1A 3F71A 3VSAA 1XQ1A 1RQNA 2DYKA 3SNKA 1CUZA 3JZAA 2VKTA 3DTYA 3ZHUA 1O8CA 1MQSA 3CRVA 4YV2A 3MJRA 3DDNA 4RD1A 5BXYA 4HMPA 4LI3X 4OQNA 1RVDA 3AVYA 4HWKA 1PP4A 2IP4A 3WJ1A 4QFMA 1CJTC 2WR8A 3FAKA 3EW9A 1GAQA 3H5LA 1B42A 2JJ2D 1EG7A 3UAVA 3ZNOA 4WZAB 2NTEA 3OSZA 3B6JA 3LQ2A 2EF1A 4LOKA 4DLAA 1MAHA 3W05A 1SA0B 4ALJA 3QNUA 4I2VA 4J94A 1UEJA 2RONA 3NH6A 3NT4A 5AJVB 2GEKA 2QX7A 3RIMA 5E3JA 5BUCA 3CHYA 1T8TA 3OEED 3EJWA 3ZH2A 4F96A 1L2TA 3G2NA 4QAJA 5JNWA 1D0VA 1G6OA 4YJKA 4ZYVA 2IX3A 1XPUA 2X9GA 4PSCA 3ETNA 2A57A 4TQAA 1EZ1A 3V7NA 3P9PA 2YR0A 1NWHA 1NBMA 4WUVA 3F6BX 4ZVRA 5E0OA 3VNBA 4J7AA 4Q9JA 1N2JA 3IILA 3W7BA 1KMQA 1XEFA 4LBYA 3AHHA 3ZVNA 4QOSA 1CR0A 2C4WA 2Q1XA 3Q98A 1SXJC 4YLEA 4BQIA 1A71A 2PUVA 3U9LA 5FKJA 1JN0A 3B1YA 4JLSA 4NWIA 5F5LA 3ZDCA 2R68A 1EDOA 2G25A 2XQGA 2P9GA 4WNIA 5IBPA 5BN3A 5F9FA 5JAUA 3Q7QA 1YU9A 1SH7A 3AFNA 2RHCA 3HLKA 2IYNA 2GWRA 3LXMA 3REGA 3KSUA 5JJBA 3DLBA 3FCOA 1H2AS 3DLHA 4KR0A 1CB0A 1G2OA 1CQZA 2NVWA 1GU1A 3E82A 3F46A 2QD3A 2ZCVA 4MYHA 4U9UA 5REQA 5IKEA 1WVGA 3F90A 5HE9A 1E62A 2FDRA 3G0DA 3E2IA 4LFCB 1OREA 2QTBA 2WPDD 4W1RA 2ZJ5A 4YUZA 1FDSA 4HAIA 1NTOA 2PPVA 3MSCA 4M9SA 3E70C 3G0GA 1VLHA 4I9HA 4MJ3A 4KWEA 2OYSA 3UUGA 4BNUA 4CKXA 1OVGA 1RCUA 3LUAA 4KLZA 3NRJA 2Q1UA 2Z2ZA 2VA9A 4ZVSA 1DO0A 2WINI 1I0LA 4RZQA 1Q3KA 3Q3GE 2X0FA 4YJ2A 2X13A 2BFEB 1SN7A 3ZY4A 2ACVA 1B74A 1GNRA 3Q9NA 1IHDA 1E2FA 3KT3A 3KU4A 1VPLA 4AJ1A 3PQ8A 2GJSA 2BGGA 3DEJA 3A58B 1A2KC 4OQFA 4ZT4A 4PFJA 1R18A 3ZHOA 4BNYA 1TYAE 3S8EA 3FHTA 4FQ8A 3WLNA 4BO3A 3AJ9A 1ZL0A 3HU5A 4WKNA 3PFWO 4J2TA 3NO4A 3PA6A 4JP8A 4M1TA 3HV2A 4FIZA 3H5WA 4YA6A 4ZO8A 1UODA 2VDOB 1YAJA 4GYJA 3B51X 3WHPA 2P2CA 5JBIA 2IGTA 3GNSA 1Y81A 1GZUA 3IOMA 1OWMA 4FCVA 1BS9A 1FSFA 2CHEA 2G88A 2NVBA 2XV1A 4XFKA 5E2IA 1DBIA 3QPBA 2P6MA 1B2RA 1D07A 1FTGA 1MGPA 5E4YA 3C8ZA 3E5NA 1ZAYA 3ENKA 4RS4A 4X3PA 4WD3A 2O14A 4MA4A 2QVZX 1UC8A 4DRYA 3LUKA 4P7FA 2D5AA 4HWRA 4Y30A 3E7DA 4FX5A 5AKKA 2ZJZA 4OHMA 2XQJA 3OKAA 4BWYA 3BILA 3C6KA 3IO5A 2XT9A 4UBLA 3CCFA 5A6SB 4CNBA 4B3IA 3U5TA 2FEOA 3DP9A 3SE0A 1OSNA 2Q4RA 3ZJTA 4NHOA 2FHPA 4F5DA 1KZHA 4ND5A 3FNHA 4GU5A 1Y1TA 2EZTA 3EA0A 3ILHA 4GPBA 1P2VA 4F60A 4WJLA 5JJKA 4QXOA 3WZMA 1F3OA 3CNQS 4NCHA 4Z99A 3NYIA 4BLUA 1J39A 1K5HA 3H9CA 1LK7A 2HLPA 3DC2A 4GGMX 4YFVA 4KPGA 2I4RA 4LHVA 1BCRB 3G85A 8GPBA 1HYBA 2X8BA 3KZMA 1KDYA 2EJBA 2W98A 3IR7A 4P0QB 1A77A 4INJA 2SCUA 4KUHA 2A9VA 4NU8X 4FGLA 1WBBA 3D3WA 2XXAB 3DKPA 2Q3JA 4GM0A 3ZBUA 4C7KA 1MZVA 3FRHA 5K0SA 5KQMA 1OBHA 4I1RA 2PUGA 1NV8A 1U0FA 2BHLA 4MEAA 4P7KA 3OHSX 3BWYA 2UVPB 1JI3A 1KI1A 2IYXA 4LTMA 2BFFA 3FUXA 5E2BA 3SPXA 1UEXC 2NW6A 5K9ZA 5FDFA 2OY0A 4MYDA 3QQ5A 4BFZA 3IURA 2L42A 4P4SB 2WAMA 1M0EA 2OGWA 2XUKA 5AW7A 1A9QA 2ZS8A 2HD4A 2JFYA 2XUGA 5CPFA 5B6JA 4TUYA 3RG2A 3PC7A 2CZGA 5IAJA 1P0QA 5NLLA 3B9BA 1GQQA 3O8QA 1MEJA 1CJBA 3NV7A 1EK5A 4M9QA 4QFDA 2OA0A 2HA2A 2O2IA 1YCGA 3DFMA 4P3PA 3UMJA 1WEHA 2ADFA 3LQRA 4CMAA 2CNBA 1QIKA 1TKBA 1N2CE 1ZSNA 1UBFA 1JMYA 2NUPA 4TVBA 1UBOS 4HNVA 5HKOA 4OHRA 3U3MA 3N86A 2JGLA 5CX1A 4GL2A 2O52A 4MKHA 2JLSA 3KV3O 3M6MD 1U90A 3VH4A 4BO1A 4N6OA 1ZGAA 4R0NA 2EGUA 3THYA 1BG6A 1L0BA 4PPNA 4WCFC 4WVFA 1RHMA 1Y37A 1T1RA 3D8UA 4EK9A 5TQ2B 1ZN8A 3KSRA 5B6IA 1KJQA 4CLRA 2AJLI 3LDUA 4BX0A 1B8UA 3BK7A 1TTHA 5HDQA 4CEIB 3R44A 1W88A 3G6KA 3G2HA 4JK3A 4FQ7A 4Y9RA 4YRPA 5KVCA 1OKKA 4BQRA 4OHYA 4UHDA 5T67A 2EEPA 1S8NA 3JVDA 3LRXA 3NTVA 3W8FA 4N3NA 4ZQFA 1KSGA 4Y2RA 4R7GA 1OLSB 2ZOSA 2ARKA 1M2VB 1OROA 4OK3A 3N9IA 4O2AF 5E4FA 4DMRA 3U4AA 4IWYA 4PTYA 4XQEA 4YUVA 3L0DA 2AKYA 1V37A 1XK7A 3ZZUA 2AG6A 3CUTA 3GFPA 1LVHA 3PTLA 3NWEA 2X4DA 3R5XA 4J91A 2AJDA 3EIEA 4MYRA 3N2EA 1XKTA 3NIWA 1A98A 3QPAA 2DFKB 2WFZA 4EPYA 1AK1A 1NPDA 1OLUA 3CSSA 4XTRA 1N5RA 1N2SA 3RSLA 1SXJA 1IB6A 1SVOA 3FYTA 3MT9A 1FUKA 4P08A 2D2FA 5EJ8A 1CUJA 4J1SA 5ER6A 3GK3A 2BE7A 1WHSA 4OJMX 4UARA 4UTXA 3UUWA 1LBEA 2A9RA 4BWGA 3FYHA 3CZAA 5CLFA 4PFSA 4KO1S 3RU9A 2JJ8A 3Q0IA 2GRJA 4AP5A 4F84A 1JWLA 1N6NA 2H92A 5LJIA 5LBUA 1C0EA 3DBOB 5FTNA 2EGHA 2YIDA 4RVFA 4PWZA 2DKFA 2X42A 2PJUA 5EG5A 3W4KA 4XGRA 1L4LA 4RK4A 4MEBA 1JRLA 3QG5A 4E5UA 5DYGA 3M70A 3F49S 3M6AA 2AN9A 4D3YA 2CL7X 3R6DA 4IDBA 4B84A 1AY0A 4PPFA 2XZOA 1BGWA 1ZD3A 2WUVA 3CUUA 3HM2A 3B1WA 3AFGA 3VNRA 3G02A 4HDKA 4HWPA 4AULA 4HUTA 2G9RA 2C4VA 3IVMA 3FR8A 1D2EA 1FCJA 1UAGA 2BSAA 3KTFA 1GXSA 5BR1A 2FI1A 2AR9A 4JKOA 4ZOLB 1G18A 2GEBA 1XX6A 1ZJJA 5K3FB 1OFUA 2M2IA 1R4MB 3CUYA 3YASA 3JD1A 5B30A 1UZMA 5KWIA 4N49A 1CERA 4TS4A 3ISTA 1XRQA 4X61A 3WSTA 3K0BA 2F1JA 1V4NA 4LEIA 5KQGA 2NQTA 2Y99A 3UICA 5IMBA 5AVXA 4RF2A 2NM0A 1M1NA 4BVEA 5G40A 1C7ZA 4HXFB 3TLGA 1GSOA 3E03A 4D41A 3T4EA 1VE3A 3G2PA 4EG6A 3P71T 4JBIA 4UBOA 2CUZA 3RR2A 4DR3B 5D6OA 1T3ZA 4FGKA 4BC0A 1LI5A 1A5TA 1WMSA 1YJAA 4D0GA 4UTRA 4D5GA 3JAKB 1C7JA 5HM6A 3CH4B 3CBGA 1VJCA 1D4ZA 2Y66A 3KHUA 1KIAA 1U3CA 4YPOA 5EJ4A 1N34B 1G5FA 4F6RB 3CTMA 2P3QA 2RGGA 2NZ8A 1VB3A 2Q5IA 3GJ7A 2BM0A 3IKLA 3PQDA 4LYFA 4FWBA 3W2TA 5IFKA 5F7XA 4PZ0A 3TQQA 1YR7A 1CK4A 4L3OA 3QEKA 1F2DA 1C81A 2ZJBA 1Z29A 4TWBA 1MO2A 3V46A 1XDDA 2HCJB 2IZZA 4KUEA 4MDFA 3W8EA 3WL3A 1DFGA 1JLHA 1CY6A 2DHRA 3U09A 1XN1A 4PQGA 2YMMA 1HETA 3WQQA 4YMUA 1N9KA 2ONJA 3OEYA 4REOA 4RTNA 3ZYCA 5CU7A 3T9CA 2KLBA 1QHGA 3GMIA 5AKJA 4CDGA 4OYHA 4DUGD 2AUNA 2EQAA 4YJ3F 3HEAA 2A58A 3WA6A 4XYEA 2VYVA 3KHKA 2AVDA 4LISA 2Q3DA 4ZO7A 4E4RA 5L3VA 4Y3UA 3AI2A 3CH5A 5T41A 5K99A 1NXQA 1Q20A 2MSDB 3AL3A 5KJ1A 2FQYA 4IHAA 4JQYA 3ZE8A 1E99A 1YGPA 4HX5A 1WM1A 2WTBA 4ILEA 4JAVC 4YBZA 4A03A 4F9GA 1YB2A 4Q9HA 4NCBA 1S96A 4LI0A 3LX4A 4NIMA 3A6HA 1GO2A 3U37A 1EQ2A 1G20B 2WICA 3W8RA 1E3DA 3HL0A 3IHLA 3QX9A 5C8YA 3V7FA 4W1QA 1Y3DE 1QZTA 4P32A 4J3NA 5K0TA 3CG0A 2ENUA 1BE6A 2W2PA 3C3DA 5BV7A 3AM3A 5CLQA 4QGGA 4QUGA 5CFOA 1UDBA 2O7QA 2ZRHA 3C1UA 1JDVA 2IPMA 3NM4A 1MV8A 2GESA 4OGKA 1LPAB 2I3GA 4NE7A 1RACA 5IJWA 2VNSA 3CEHA 5AESA 2D6FA 2CV1A 3T3NA 4M0DA 1LCIA 4V2UA 2JCGA 3L93A 2I7XA 1P5RA 4XYMA 2DT8A 4OEHA 1FXUA 3WLOA 5E3HA 4ZVKA 1Z83A 5I47A 4DSZA 5GZ3A 3NGLA 4PU0A 3ICEA 3NHMA 3ONVA 3QFTA 4TTSA 2P68A 4U2BA 1C8KA 4A0QA 3AKEA 5DW3A 4R69A 1SUAA 2PAAA 3RJTA 3MWDA 5D85A 1H2XA 4NCKA 1REQA 3PGMA 2V0CA 3PEUA 1PFVA 5FL3A 1CFJA 1EFUA 3FTEA 1DC7A 3J7AC 1IM2A 4GOXA 5EP3A 3MHTA 2OCKA 1WJGA 1A5AB 3PQ5A 2RBGA 3O8LA 5JJLA 1LPMA 1STOA 1T2UA 1E3LA 5IC6A 3E9RA 2V55B 5CRIA 2ZIXA 1J8FA 1W59A 1KTVA 2Q6IA 3ENNA 1MO3A 3VO9A 4ZU1X 1TC2A 3NKFA 3IEIA 4ABYA 1XCLA 2XRYA 4QU5A 1OBFO 5FYDA 4BP9A 1JFFB 4FCCA 4RAOA 4DLYA 1RAAA 2AFIA 3ASVA 1JSXA 1JLRA 3DFKA 4I7EA 1Z2PX 1TO2E 1FFYA 1TMYA 4QDTA 2AIRA 2V6GA 4JLBA 3ELDA 4RJTA 2W00A 4AYTA 1AKWA 3T3IA 1GJRA 5J4VA 1YBVA 4AJJA 2R84A 3DTNA 4RIFA 4C05A 2HDHA 1B23P 4IIHA 1I10A 4X8LA 1ULHA 3O95A 4JLOA 2Z9BA 3DHYA 5EXDA 3WZ2A 5FX2A 2B1IA 4UD2A 2YHAA 4JYAB 5DWVA 1EXNA 1IHYA 2IDKA 4YDRA 1I2BA 3G49A 3UWMA 2XPCA 4TKVA 1SVUA 1TKAA 4N47A 2VSXA 2FPIA 1KPIA 3WKAA 5HA5A 3MBKA 5CNKA 2XEXA 2PX3A 1GCIA 3STYA 3V7UA 1DBWA 2CHQA 1OZAA 2R4UA 1FTQA 2QGNA 4S24A 1R7RA 2WD8A 1CZOA 3FUWA 3GEDA 2F9LA 2M1ZA 2F90A 3KPVA 3MJEA 3OT1A 3BXGA 1ADFA 1G4UR 1YQQA 3JY6A 4ZTZB 2B2CA 4JBGA 4LJ8A 1Q77A 2JCYA 3GVXA 3JQAA 4LBWA 5C0OE 4LY9A 1MQ9A 4RC9A 1ZJ6A 3N7AA 4ZQHA 1I9GA 1JQJC 1QKKA 2WTAA 2PZMA 3PNVA 3PIIA 3KLBA 1ZL2A 1XRLA 2Y4NA 3REQB 5EFOA 3ZDFA 4ESEA 2NOAA 2X5NA 4OFXA 4IIGA 3X44A 1EGAA 4LZOA 1DADA 1RKBA 5FLXA 1HYEA 3M83A 4D45A 5I4CA 3W7VA 3NUZA 4F8JA 3Q11A 1C4WA 2I3DA 5CLJA 4R1UA 1NU8A 2RHOA 2V6IA 4FJ0A 3SYNA 5BN1A 1DIHA 4BZZA 3FOEC 4TLDA 3BCHA 1GAJA 5EHXA 1UMDA 2EDAA 1QRDA 1ND5A 5BRNA 1I6KA 3WWOA 1KI7A 3EVAA 1GTRA 2E21A 3OTHA 4IXNA 3W8DA 5LB4A 1IAQA 2YL2A 1THZA 2R6FA 5IP5A 4QOJA 4MI9A 4UMFA 1TF7A 2A4MA 3HP1A 3X2FA 1BEUB 2GUGA 2JH9A 4JU9A 5B1DA 3CEPB 1E5XA 1X94A 4XD7D 4URXR 3VI4B 5IZ4A 2B9VA 2K2QB 2ID4A 3R5SA 2C58A 4R9SA 3Q8MA 2JA1A 4RTKA 1LNZA 1D4OA 3C1OA 4M1YA 3KXDA 5EWJA 1G5QA 4JLJA 4CMKA 3DDSA 5F77A 3B1VA 2BMVA 1LPNA 1XA3A 1ZITA 4Y8VA 3VR6H 4DM7A 1IXYA 4G5QA 1RYYA 1DT3A 3KUDA 2JGRA 1BTOA 1DLJA 4RQBA 3QX3A 4W7IA 2VJMB 3MMXA 1NKSA 4RDHA 4GLJA 2FCRA 4FNGA 4GR4A 4KQ9A 1GGFA 4S12A 4I50B 5EEHA 3A0UA 2X9LA 3TLMA 4KC0A 5E6UA 3S2ZA 1C9EA 1XG5A 2I5PO 3ZNPA 4D44A 2VNAA 2HTEA 1D2MA 3QJ5A 3VU3A 1ML4A 1VMAA 4G5YA 3O74A 5HVNA 2VOEA 1RLOA 5D5PA 3USCS 5UKDA 1YZFA 1YTUA 1ZN2A 3MMPA 2C7GA 3ZTTA 3PNKA 4HATA 2HCTA 2QW0X 3BF7A 3DOFA 3FZEA 3KJFA 4AKEA 3EAGA 1EDBA 1RTKA 3L8YA 3S7ZA 4G07A 2DTDA 3W6ZA 2LGJA 3K70D 2G76A 2ZM6B 5EJ9A 5I51A 1M74A 2C4MA 3VKVA 2C07A 4DLZA 1SEVA 2VZ0A 3CMMA 4LHSA 4O4LA 4OHCA 2QR3A 4P83A 1ORWA 1YVDA 2E6UX 3DJYA 1QPGA 2I99A 4WXYB 2IDZA 2BE9A 3M3DA 4MGIR 2RMKA 5LZ4A 1BZYA 2CXPA 3EH2A 3K15A 4EATA 1W4AA 1KI4A 2XVAA 3FZGA 1SVMA 4FLMA 4GVXA 3VR6A 4R2MA 1BGXT 2FMKA 3JVVA 1PGQA 1KQFA 3QPWA 1BU5A 2CNDA 1YACA 3KOYA 3S8YA 3LKVA 1RRKA 1OA1A 4NR0A 2XTAA 1QV7A 2CXXA 2AHRA 1TOAA 3ENQA 4DBLE 4I2NA 4EVQA 2YHBA 1WW8A 1DV1A 4LXTA 4PZDA 4URUR 3SF8B 1BYUA 1NVAA 3N2GB 2GLXA 4BQEA 4PQEA 4D4LA 1NDUA 1ZH0A 3JD3A 5DHTA 3ADOA 1K6MA 4WVLA 3DXXA 3NLLA 3FNRA 3L3BA 2PZEA 4KIJA 1KGSA 5ALIA 3EZ7A 4TMVA 1XVVA 2X5OA 2IIVA 3LGSA 4BZQA 1J8QA 4GECA 4AD8A 4XIIA 1JR4A 1KAOA 1HE8B 1U7UA 5HZKA 2X3FA 4L5CA 3BHIA 3IPXA 3NKLA 3WNCA 1ESEA 1DDOA 4XRGA 3W4JA 5BV1A 2OOKA 4KWTA 4J4BA 3DMGA 3JALB 3TTXA 3DOCA 3PDIA 5IDWA 4ZQBA 2Q62A 3B2NA 5EXXA 1GD1O 1VSVA 2YV4A 4EX6A 4NYMQ 1BQ3A 2QVXX 2H2IA 3AF4A 3Q7PA 4ER5A 2EATA 4DRXA 1H5NA 1P1FA 3MTJA 4GYYA 3AX6A 2AZXA 4YMTA 4PZYA 4LJ6A 1OWLA 4CV1A 1XI2A 2ZQ5A 3N70A 3PZRA 4INPA 3AHCA 3HBJA 1F38A 5THKA 1QE5A 1RQGA 2VSFA 3QFHA 1ZZEA 2FTKE 3RCBA 2NV6A 3M4JA 1JB1A 4Q4AA 2PK3A 1XCPA 3HJTA 3L1VA 4JFAA 4W5HA 1EDZA 1XZPA 2RAFA 4WGFA 4BLOA 1RM3A 5CA0B 3ZHYA 4FSXA 2CJWA 1OU0A 4IHQA 1G6Q1 1ZJYA 3ASYA 1M76A 1DIRA 2ZTHA 3U0BA 3U7FB 4C3OB 3HABA 3ZDXB 4KREA 1G64A 3KTOA 5H7XA 2CC2A 5JLAA 4DVJA 3UG6A 1A88A 2D7JA 3KFXA 2AFVA 4NS4A 1SO8A 3TBHA 4QUDA 4CIDA 2M6RA 3WKCA 4LQCA 3CM0A 1KVTA 1VJDA 3I04M 3V5NA 2BUBA 4Z4GA 3EXAA 2CUNA 1O5TA 4TTJA 2AG5A 4NOJA 2FGJA 3GRVA 3PF8A 4AO7A 3P2IA 4F45A 1QLJA 4KDRA 4M8LA 3ZBTA 5FWYB 3M0EA 4H4CA 4RNDB 3VHRA 1NG9A 5ARBA 4EZBA 2ZRLA 1U8TA 3ANTA 1JHDA 3LUFA 4ZOLF 1DWUA 1QFSA 4KX5A 5GOZA 4M22A 4LBVA 3FLAA 4RF4A 4RE6A 3C24A 3GIWA 3P94A 1XMIA 2QJTA 4QX6A 4E6EA 4F1JA 5IZCC 2JLVA 1Y4UA 1GFIA 1N1GA 3GAZA 3R7BA 2X2OA 2UXBB 3LFUA 1TLTA 1JWAB 1XWFA 3FMIA 4BRWA 1XDUA 1RFLA 1GPKA 3Q5GA 3U7IA 4CKCB 5JROA 4K0KB 3AKZA 5TF0A 4AF8A 3NVAA 4ZWNA 3TXXA 4BJ6A 1U4OA 3AWIA 5KYXB 1Q0UA 1JJAA 3T3DA 4FOOA 5SZKB 4XPZA 4RZIA 4URHA 4BRSA 2ANBA 2D74A 2R3SA 1RYFA 3ZZTA 4HTAA 3MOSA 4ZALA 2UXDB 2FPLA 4AYXA 4RXTA 4O1HA 2H2HA 1V1RB 3GZNA 4BMDA 4CUKA 3ZD7A 2IZ6A 3S29A 1RQRA 5E1DA 1HFWA 2TMKA 5FR2A 3CW2A 3ZY6A 2XRFA 1YRYE 3AJRA 4QDUA 5EJMA 3V7WA 1BVYF 1H1LA 1JLKA 1JPUA 3SLKA 1KDPA 5AK0A 2WIAA 3G9QA 4RKYA 4X1YB 3X1JA 4W5OA 1N2OA 5I7HA 1VMKA 3IIIA 4TXLA 1NUHA 3KZXA 5SV2A 2Z04A 1W4CA 3DXYA 5EXPA 5F23A 3E1KA 2FPMA 4G67A 4Y2HA 4B6PA 3E23A 1M66A 3AQ4A 4HFNA 4G89A 3RF6A 3PENA 1QVZA 5DSTA 3LOQA 2Q3MA 2C77A 5E1BA 1NRJB 5IARA 5J2UB 1SZJG 4CIAA 4LJKA 3RAFC 3EHEA 5ITZA 3RRJA 3WB0A 3RS5A 4DMGA 3EXEA 4IEIA 3ICQB 3O4HA 3TEJA 3WOVA 1T3SA 1M6YA 3VO2A 3LYLA 2L82A 1KI6A 4DDTA 3ZVKA 3TH5A 2ZJ8A 2QTHA 4E14A 1RXYA 4O2BA 1G5TA 1UC4B 1G3MA 1Z7BA 2A3RA 2AS0A 2ASVA 2FRDC 2PTGA 3BJMA 2VRCD 3DUFB 4RY2A 3I42A 3QVSA 3DLPX 3CXRA 2ZSEA 3N8NA 4ETWA 5AKZA 1PFUA 1IJFA 2ZREA 3O6VA 3EISA 4U6SA 1LXCA 3DTVD 1N2HA 3H2ZA 3QWAA 4FYYA 4HZIA 4P8RA 3RUHA 1MR3F 4ZZ2A 1SELA 1NJFA 4WESA 4YIHA 3NDBB 3WIBA 5EMJA 1ZNQO 2AOUB 3QFFA 1JFTA 1YI1A 4ECEA 2HCRA 4AN4A 2A9PA 3KLOA 4Z7QB 2G1AA 3WBKA 1E2IA 1G3UA 1X7HA 4JJFA 3VH1A 4A6PA 2OK8A 3V6MA 3LPAA 1Z18A 2QZ9A 5KTTA 3GIDA 3JPWA 5FAXA 3ZTWA 2XTJA 1PEKE 2QE7D 4Q4CA 1Q0ZA 4IJKA 2H17A 2O7SA 3O73A 2JK1A 1PR4A 1X38A 4NBSA 3DE3X 4O5OA 3IPAA 2C8VA 1VOTA 1LW7A 4FD2A 1L4HA 3VQTA 1QFYA 1SZDA 2WFLB 3D3KA 1ODTC 2QYSA 3PR1A 4HAWA 1E9VA 5AI4A 2P7HA 4TXJA 4B3CA 3DBRA 2ZPUA 3H75A 3N2KB 2SHKA 4JXKA 5COAA 4FLFA 1YJ8A 2ZT6A 4LZWA 1GAXA 1XNRB 2D13A 4UZEA 5BMVA 2QDKA 4G0VA 1OFHA 2V6BA 1CETA 2BUAA 5A7HA 2QMHA 3QHAA 4QU8A 4NONA 3N7UA 1XZKA 1V35A 3DG9A 4RK7A 2IRWA 3OWOA 1X9GA 4Q19A 4Z0PA 5SY6A 3ZDBA 2ZSJA 4FUTA 4KV7A 4D6XA 1P2UA 3GRAA 3AI7A 3LC7O 1O96B 1QOZA 3SHTA 5CBPA 1A9RA 5DO9A 4ABTA 2QPAA 2XGGA 1SXJE 2QAGB 2FZ4A 4L0MA 2Q07A 2J9XB 3WSWA 2VJAA 3KYBA 3S6JA 2UZ1B 3KYDA 3ZV3A 1QCYA 5ITSA 1M2JA 3TLZA 2R8RA 3FR7A 4YJGA 4UW9A 1A4UA 1QAQA 4F5EA 2B1JA 5F78A 2NU8A 3UMFA 1G1AA 3UWKA 3HB9A 2ZQZA 2HBRA 4B40A 5CA1A 5DE3A 3K0KA 5DYWA 2Q9BA 5TQ0B 1K27A 1U0JA 3R77A 3UMGA 5JPDA 2UZAA 4EFNA 4TVOA 2G1JA 4MW5A 5ES3A 4BLVA 1NHWA 1R6BX 5HUJA 3ZU2A 3L4BC 3P9ZA 1BMTA 3OE4A 5GGYA 4RHXA 1A5SB 2PGNA 4EELA 4Z4IA 2JIOA 3TIVA 4QGFA 2HSDA 2JI8A 2FPPA 1W2GA 5EUMA 2AX4A 4HTFB 1DTSA 4MUGA 3A3NA 4UPVA 2FW9A 7MHTA 3HBNA 4GIBA 4RLFA 1SBHA 2X0RA 4BQPA 2NP6A 1CQIA 1PSDA 2NWQA 2QUIA 4MWGA 5JARA 1WHTA 4IKEA 3KD3A 4OLFA 4ETIA 4RE5A 4PLZA 4C1BA 5AUOB 3HUEA 1Z6QA 2NTYC 1T29A 2WFMA 4C07A 1TRHA 2C4TA 2RHTA 3MTBA 1HKHA 2GM3A 4HN2A 1HQCA 1T2EA 2JI6A 2YN4A 1XEWX 3TLYA 4OTZA 4BBZA 3U19A 5EKDA 1XUOA 4GRDA 2O5RA 2JLCA 1OLXA 3ZVLA 4BXOB 3EQ9A 1L7OA 3HSYA 1EWVA 3I2IA 3SIXA 5LKRA 1EEXB 3AF1A 2B1RA 3U40A 4DTCA 1I2MA 2VHWA 4HP8A 3HO6A 1AUVA 4HR7A 2BMWA 1CJSA 1T36A 2B7BA 3F78A 3GFRA 3P8ZA 4UFOA 2CLKB 5FAKA 2YV5A 4G5OA 1C0PA 1SC3A 2Q7DA 3ZDEA 5CHYA 3RTAA 4JQCA 5K8JB 3BA6A 3EMKA 4KO4S 1CUSA 1WNTA 2C2OA 2PKEA 1KOJA 1UJ4A 3OQIB 2REOA 5JSQA 2ZIFA 4FW9A 2NZYA 1A3CA 4EI7A 5EMKA 3OIUA 3USES 3PX2A 1UJNA 3KJXA 2WWWA 3EY4A 1QRUA 2IYVA 1TVCA 2QN1A 2PAFA 3AEKB 3M6IA 4RJLA 5IC4A 2X6TA 4YJHB 1KYIA 13PKA 1ECJA 2WUFA 3BB4A 3L0ZA 4D42A 1RYMA 1YMVA 5LA6F 1W581 2C9YA 2CNOA 4WFQA 1Z4LA 1Y98A 4WCVA 2VXYA 4HGNA 1V1MA 2NQ2C 5C32A 4OQZA 2NSJA 2H57A 4Z9FA 4KHPB 1UJCA 5ALGA 2BH9A 5CLHA 2F8TA 2AOVA 2RBEA 3O1IC 5C3MA 4A2CA 1KO4A 4HRVA 5EE1A 1LV8A 4WXEA 2IQIA 1A04A 3L7JA 3RHFA 1CCWA 3KR2A 2OQVA 4CVNA 1R4AA 3I62A 1TQ2A 2WHPA 1XL0A 1FU8A 3LO5A 3Q41A 3SYKA 4BMXA 3GQVA 4P31A 2Q0QA 2GYYA 4CM9A 3MCUA 4K9MA 2XTMA 1RAHA 1DNPA 2XUQA 3F4LA 1IQUA 2WUGA 3I9OA 5LM3A 5C8DA 2FRDA 1NURA 3MINA 4EJSB 3DYVA 4NJEA 1Y5LA 4X97A 2W6JA 3L6DA 4J16C 1E2JA 1GL9B 3JCZA 4TPKA 1HMPA 4CMIA 5ESDA 1ISFA 3VJLA 1CHDA 1QKJA 2IYEA 3EXHB 1X87A 4L8VA 3WV4A 3VJRA 4KO3S 3L7IA 1WPQA 1S89A 3NDRA 1QYCA 3OX2A 4QUHA 4A16A 1C2TA 5FQNA 2QYOA 3W04A 2J9GA 2C61A 2XCUA 3FNFA 1NRXA 2VQ6A 3AK4A 3CZQA 1CC1S 3EVNA 4B09A 4EB6A 3K0EA 4M98A 3LUPA 3J81A 1PKXA 3JWIA 4DQLA 5TF4A 2HJRA 5AW6A 1OASA 1FQWA 1WTAA 3AOEC 5FUWA 4B3GA 1D6JA 1OIWA 2Z98A 1GN9A 3VAAA 2FZWA 3DEAA 4FE3A 3UT6A 1B43A 1KFKB 3QJGA 2QNIA 2HQRA 2V4MA 3CW8X 3O4VA 1BE8A 4B6JA 1M0SA 1IZ7A 1IY9A 2VAVA 4MLCA 4BAZA 3A6GA 4HRXA 4TMWA 3EHDA 2GYUA 3QU7A 1LI7A 1W6RA 2YVKA 3KT0A 1DKPA 3LL4A 2GN9A 2WT9A 4GI5A 4CLOB 4J4TA 4E6PA 3A36A 3QXGA 4QYSA 4V03A 4TTIA 3VDMA 2AFIE 2A1TS 4M89A 2AXQA 3EPKA 3OY2A 2GSWA 4GPD1 4N1AA 5ADUS 1P91A 3LZ6A 2VDLB 7MDHA 5K6AC 5TSDA 3EIXA 1N2CB 3GO4A 4YJFA 4EYGA 3H0KA 2ZYUX 4K8RB 4RK0A 4UEJA 2GCOB 4JY7A 1KJ9A 3Q6IA 4RLQA 2VOJA 1BSVA 2F17A 3JQ9A 5D00A 5ELXA 5DYTA 1ADJA 2P1RA 4HGZA 4I4CA 1TO6A 4PGFA 3HCAA 5HCUA 3X2EA 1E18A 5L3SB 4OX9B 4Y6RA 1E9DA 1FNNA 1BXRB 1MTOA 1UFRA 2DBRA 1ZN9A 2OBNA 1QTNA 1S9DA 2H16A 1DIGA 2Q0XA 4LKRA 4ENUA 1JQBA 2J3HA 2VUUA 4ML3A 2HA6A 4UEOA 3WGKA 4A36A 1E7MA 1NQVA 1VG9B 2QUZA 3C6BA 2CXRA 3AH8A 1FRVA 1Q1AA 3EEBA 3BRWD 3N39C 3BEDA 2CEKA 2J4FA 3G0BA 1VHJA 4Y0NA 4D4JA 5JS8A 4R2JA 1SCJA 2RG1A 1MXFA 2QRQA 3HKCA 2OZVA 5B2FA 2WU4A 3L06A 2VZLA 4MI1A 3BREA 4JQSA 3DKIA 4OY3A 2JVJA 4PWYA 1EFCA 1E2EA 1VKNA 5DX1A 2QSZA 3BGVA 4K1LA 4OVKA 4DCOA 2PFSA 3EVCA 1XD9A 4KQHA 4ZHQA 5ALXA 2AOWA 4KSBA 2C04A 3NHJA 1GGMA 3EAQA 1DXYA 1JFLA 3H2SA 1E1RD 1E1KA 2IPOA 1NN1A 3K70C 3ABQB 4EEKA 3PYXA 4U6QA 3IALA 1WUYA 1U2SA 1LLFA 3PKZA 2ZB2A 1AKMA 5U1PA 1U3WA 1JYSA 1YBFA 3R7WB 4V0SA 3ZCQA 4BNTA 3HI6A 3SVZA 4EQ6B 4YN3A 2GETA 2DM6A 1TU3A 2Y0CA 3LZDA 1O6CA 1LK0A 1N7HA 1T4CB 3LUHA 5HILA 2MR6A 3AGPA 3UG7A 1G2IA 4Z8XA 2XMGA 2BFDB 5BRJA 3MGAA 3NP7A 3TOSA 4DS3A 4RADA 1E1CB 2H1OA 3AB7A 4WLEA 1ZOOA 2ZRCA 4KMMA 5IXYA 3KWJA 1ORHA 1OI3A 1PK9A 5IVPA 1GZ5A 4ZYZA 3R40A 1G19A 2YVAA 3HCWA 4M8SA 1E59A 1ESCA 2PYDA 5K4AA 4C4AA 1HZZC 4UUOA 3QVOA 1LDMA 2OBBA 3ORQA 4QYWA 5KOIA 2ONYA 4KH0A 1I3LA 4LDNA 1HTTA 3K4PA 2JJQA 1HNZB 1A4IA 3MERA 3E22B 4NG5A 3C87A 4ZGBA 1RBYA 3FGOA 3HFSA 3GGOA 2CD9A 4GM4A 4ZV4A 1Z6GA 2REQA 2P9EA 4PPYA 4TXMA 4C7MA 1P9NA 2D4AA 1EGQA 1DG9A 1X1DA 1XRNA 2BGKA 1K2VN 3HU1A 1PJZA 3I58A 3NKVA 3KEMA 1KOGA 1HT2E 5DYIA 1FQJA 1C7EA 2PGDA 3LFHA 3H1GA 1BHJA 3O5AA 5FWAA 1PI3A 3SBDA 3C3KA 4V1CB 2C57A 2H6EA 2IEIA 3M6UA 1W0JD 1Y34E 3A1UA 4Z0HO 4C6TB 2O8FB 1T3HA 2FP3A 3GYGA 4HSEA 4WN9B 1G5PA 1SKMA 5K8UA 4OFBA 2VHVA 2QMEA 1GRQA 4NF2A 2P9CA 2W2MA 4L07A 4CCYA 3CF0A 4HXYA 2FJPA 3N3AC 5AM5A 1MOZA 4MUNA 3FG9A 5HS6A 3LXXA 3A1VA 3P7MA 1JG3A 4QSHA 2YWBA 4LX8A 4A4DA 1SM4A 4DABA 4ZJZA 2ATEA 3CA8A 3IAAA 3KEOA 2JLUA 2HF8A 4QG7A 3LKDA 4RVGA 1Y6JA 5FBLB 2IHUA 1VBNA 1MB4A 3CE6A 4QQNA 1JU3A 1Z0UA 1VKRA 1X80A 2R7MA 4UDXX 1DKMA 3C6QA 4BPBA 4RKEA 4XOIA 3SGLA 4LDPA 3QLVA 4PYLA 4NTZA 5FLEX 3G23A 2EGGA 3KEGA 1QP0A 4RGYA 2LW7A 3M7IA 2P5TB 2QV0A 3QKRB 2JD2A 3RVNA 5FV4A 1NFQA 3HR8A 3CJQA 4LV8B 4PY2A 3PQ2A 2PUWA 2HHJA 5LZ5A 3JQRA 3I0ZA 1P81A 2GBFA 5CPBA 4BASA 2W8BB 1FU7A 1AHPA 2YH2A 3T54A 2J1LA 3O2NA 5IYZB 1W1WA 5CEFA 1C7RA 1C4XA 4PC2A 5B7QA 5K4GA 4DJ5X 4MOWA 1HI9A 3FWHA 4XWAA 4EGJA 2YS6A 1LBSA 3K0FA 4NG4A 5FTLA 4PSVA 4UQPA 5EKTA 1NX9A 2JFGA 1A2QA 2ANCA 2IHTA 5HGJA 1L4YA 3RC1A 3S1AA 3TZKA 3NWBA 5EXSA 5AJUA 5L3RA 4BQOA 1D8AA 1DAFA 4N7MA 3SCZA 3H1BA 1JZSA 1M3SA 2OORC 4IOJA 1Y9DA 3PUZA 3HZRA 4PBRA 3RYHB 3AF5A 5FPYA 1E98A 3KEQA 1T6NA 3EVFA 1V8PA 5EYPA 3NYWA 1WLSA 1L8LA 1PZHA 4XWKA 1KEEA 2P9JA 3PNSA 1MW9X 3ABOB 5C46F 2X1LA 3TOVA 3HBMA 1GFZA 4OATA 4OA8A 2GN8A 4YGXB 2CFOA 3LPCA 1T26A 5KAPA 3GDOA 2ATCA 3FF1A 3OOSA 4N0MA 3E58A 4MPJA 1T1EA 2PQ6A 4PZCA 3S40A 1E1MA 1JAHA 1SG6A 3L7YA 4HNHA 4UOZA 5C4MA 3MZ0A 5DM60 2QT1A 4LMAA 3EDCA 1YJQA 3NTUA 4RWZA 4EOGA 1R0CA 3FMVA 4NMHA 4PHHA 1U4SA 3UY4A 2PJZA 4GBED 4MQLA 5IM4F 1T24A 2CLCX 2QJOA 1WXWA 2Y1CA 3A1CA 3A1TA 3QY0A 2JDIA 4LGMA 1KKMA 4U5QA 1II0A 4UHJA 1EFPB 2YWJA 1K7XB 2WVAA 1YHYA 1MD9A 4MW4A 2IY9A 1YIDA 3ICWA 5JQWA 4KRFA 3UQZA 4Z9YA 1YSCA 3LLVA 3QUBA 3ZXYA 3CKYA 4JVLA 5LQKA 2H9YA 3EFOA 1CR2A 4P0TA 4W8OA 3HDHA 3HSSA 3NP9A 4A2PA 1ODLA 2FR0A 1YZHA 1UANA 3OJ0A 4MV3A 3V1TC 4BKRA 1AS3A 2O1EA 4LHXA 3VBCA 1BOFA 4IJUA 4BIMA 1QAOA 1XYGA 3D1JA 3IRUA 4BN0A 1LBIA 4ED9A 5ITWA 2Q5LA 1S1CA 2QLLA 3D2LA 4EHJA 3WGZA 4H3HB 4PVDA 4DBZA 2FSPA 4B35A 4TZ6A 4XX1A 1V3UA 4BEWA 2D5LA 2YFKA 3M5CA 1OXVA 1XDWA 4P7GA 4WZ6A 2ZBUA 1RRGA 4QODA 5A4DA 2YN2A 3BXOA 5FIUA 4ARAA 4HEA1 4BZPA 1QH0A 1Y8CA 3HPQA 4EY3A 1GKKA 3TW6A 3OAAA 3GMTA 4Q21A 3FYUC 3I4FA 3UAZA 3THOA 3W9SA 3B1XA 1NQOA 5CDUA 4O3MA 1J0DA 2PBFA 3B12A 3WDLA 3W78A 3U44A 3RB8A 4L95C 1W85B 3T1NA 1KFEB 2R5FA 5DTRA 4LCEA 3TPZA 2VDUE 3UJPA 4DYDA 3BUSA 1D2CA 2G6TA 4ZARA 5JAPA 1MFZA 1KP2A 5KJCA 4C6SA 4DV7B 4ID3A 4RLHA 1Z25A 4Q9LA 3PGKA 2CCKA 2PNFA 3AETB 1PVVA 1RZUA 1HZZA 1R5NA 4JQZA 3C97A 2Q49A 3CC8A 3CX3A 2WAXA 1HLFA 2GMWA 4GWLA 2UZ3A 4KIWA 1JHYA 2IIPA 2DR0A 2OSVA 4FFRA 5H83A 1ZWLA 2B94A 3T06B 2EVWX 2IYAA 4OHPA 4C4RA 5JAIA 2D5BA 1TMGE 2J41A 2NNWB 2Y0BA 2ZRIA 2ZJAA 3HXQA 1VIYA 3ZJUA 4YDHB 2CJPA 5DSZA 1LSUA 4CLEA 2BZ0A 1T34A 3HXPA 4LYAA 2WNSA 4Q5IA 3FVRA 4B80A 5LIRA 3U56A 4BN5A 1SFRA 4KQ2A 3IHKA 1YRAA 3O8OA 3E48A 2QK4A 4BB6A 1N6LA 1JHPA 3L77A 1D5WA 1VYTA 4XB2A 1I24A 2P30A 5EIFA 3RVJA 3OQNA 1H8ED 3CIOA 2V7UA 3LW7A 4IIDA 2JI9A 1ISHA 1R6VA 1YDFA 2FJ0A 3K71B 4BHTA 3A4VA 3L07A 4KAAA 5ARDA 4UUBA 2XUIA 1F9EA 3DNFA 2CXUA 4EA7A 4R4JA 4FX2A 2O8DB 3OCXA 1OH5A 4PLVA 3PWZA 1H2YA 5JPCA 1QF6A 1IVNA 3BIFA 5E4TA 4OHKA 5CG1A 3AW8A 1IN6A 1KRHA 2FN8A 5G1OA 5I01A 2LCFA 3RRNA 2DPYA 3TNYA 3OTGA 3A32A 2X14A 1UQUA 4K6KA 4M4SA 5BV2P 4G0OA 4HWOA 1H2BA 2FUG6 4UVEA 5KNCA 5LFAA 2G0TA 3GD5A 3NHFA 4MR7B 4NH4A 3V6LA 1AUOA 3P9RA 4DR1B 4CKBA 3SM9A 1BROA 2GPJA 2OCPA 1DU4A 1WCIB 1YIAA 3AXSA 5A05A 4JGIA 1QC5B 4YP5A 3OTOB 3NU1A 4JXJA 3CEMA 2PXHA 3LQYA 4INOA 4M1QA 2A1IA 5HK8A 2VF4X 3QVMA 5K3AA 2HIAA 2OZKA 4J3FA 1CJCA 3VPAA 1ZUIA 1JHOA 1DEOA 2IYPA 1EHCA 1MPXA 1B8VA 4AUNA 1AG9A 4UDYX 2NVOA 5J23A 4B31A 2WHXA 2P8JA 2YBEA 4KNYA 3DDOA 3PJEA 2UVDA 4FFLA 5HE8A 5KQSA 1SVKA 3SS7X 5H02A 2II6A 2JLXA 1W0KD 2X8JA 2IF2A 3GA7A 4Q82A 5THXA 3EXG1 3R7LA 3TRKA 4D56A 3K9NA 4E21A 1HE5A 2GEFA 4M9CA 5HM8A 1Z7EA 1FLVA 2HT1A 4OHBA 5JSYA 3A6PC 4BY9E 1FP1D 5B4UA 2HL6A 4NYIR 4NMWA 3BMCB 2QN3A 3VNAA 1RM0A 4FKBA 1YVPA 3UMRA 1T5HX 5A2GA 1E3MA 2ZYVX 4IICA 4YI5A 2NADA 3D8HA 5FTKA 1TVMA 1C4OA 4W6QA 1KS2A 2VSQA 3NDIA 3B6EA 1YVEI 4RZ3A 3Q5EA 2P9BA 3WGOA 3KKZA 1X9HA 4V2IA 3RC7A 4JHXA 4C5AA 1O97D 2IHVA 3CNHA 4LNUA 2AHOA 5B7GA 1RC8A 5BRAA 1M1XB 3ZWDA 4JLPA 1FMJA 1E9SA 4U2EA 4IRUB 4UM7A 3I1YA 3RYFA 4D82A 2BBSA 4YXWD 2VF8A 3BIWA 3I2JA 4IV0A 1OYVA 2HQOA 3GPCA 1TQHA 1NTRA 2TRSB 3PSAA 4JVMA 4S0ZA 3SSMA 2J87A 3ESDA 2QZJA 3ZHQA 1JKJB 2XB9A 1DBRA 3DMHA 4XPIA 2IUUA 4R16A 1S4QA 1DDIA 1X70A 4GDMA 5FNVF 3L8MA 3D4OA 1P0IA 1A7JA 3CRZA 3O9ZA 4TRRA 1Y9JA 1WPGA 3RM3A 3TEFA 1BA2A 4N4AA 4ZODA 2NXCA 1ZINA 3B7WA 4RVHA 4BZXA 2V7QA 2WF5A 4A6DA 3DP7A 4AZSA 1MQ8B 1YD7A 1DE0A 4ZTBA 1RVV1 4O1MA 3A9WA 1SBQA 4FR2A 4IZIA 4C22A 3MUNA 5BN3B 2WU8A 4GOMD 3KLPX 3PQEA 1ONSA 3Q0EA 4GUAA 2YXNA 3T9AA 2WSLA 5A04A 2FMHA 3MT7A 1QBGA 1FX1A 2M6KA 4RMJA 2FEWB 4YREA 5F1YA 2WU0A 2EKZA 3KJIA 9ABPA 4JDPA 2FX5A 1KSFX 3GJSA 2QI9C 1OA0A 3E3LA 1TM1E 2POQX 5CK5A 2PUJA 1YS9A 4GE3A 4WFJA 5EHQA 4XIGS 3LWBA 3TIFA 3LRTA 3AKDA 3NWJA 3WLJA 1QP7A 2KM1A 5LOVA 1NUPA 3KCQA 1W2HA 4FHEA 4YP1A 4EG5A 5JCOA 1TUBA 1CEQA 2P35A 4GICA 1IY1A 4UAVA 1QUEA 1L5WA 3H13A 4HDOB 1LLCA 1RWOA 3FYUA 4BDSA 2R11A 1USVA 4RKWA 4TWRA 3U1VA 5CFMA 4MGKR 5JASA 5K3EA 3C4QA 4JA0A 1UBTS 1TW3A 2IP2A 3IPLA 1FRZA 2I4OA 2HTFA 4MRSA 3TI9A 4I5DA 4ZI2A 4K6MA 1FDRA 1KKUA 3PR2B 1YE3A 2R9VA 3B60A 1JLMA 3E0XA 1MX3A 3ONNA 5IAKA 3ZWWA 3IKTA 2RHWA 1BW9A 4N3AA 1F8UA 1U1DA 1ZWKA 2ZUWA 2YV3A 1N7IA 2ZT7A 1W4BA 3E84A 3TJZA 4EDFA 2GHTA 7ABPA 5LZ9A 3PGA1 1JSZA 4E07A 4BU1A 2I3ZA 4URZR 1N0VC 1VGQA 1C9DB 3KEFA 3I2FA 3X43A 5FNZA 2H1CA 2QL6A 1Z0AA 1JX6A 3EASA 2PGXA 5ICMA 2I4NA 3SC6A 1YKFA 2WSBA 3ZWVA 4PXYA 2O2YA 4FVTA 1T0PA 4ZEWA 4B6FA 1NVVQ 5TVKA 4ZREA 3UZUA 4ZGWA 3RC8A 3DFIA 2VHXA 4R68A 4HMOA 5J5VA 4B4WA 3L8GA 3K8ZA 3SYLA 4ZI5A 1J6UA 2XRMA 5IJ9A 1J2JA 2CKMA 5KYTA 2ZSFA 4RIHA 4EGFA 2YJ5A 3I0MA 2DQSA 3PXXA 4EABA 1WD5A 1C0IA 2PWYA 1VGVA 3UW3A 4MX8A 4DIUA 3X0DA 5HJ2A 1XTRA 1AXRA 2JEYA 1X15A 3L02A 3NM6B 5ERYA 1E20A 4XDYA 3SHFA 3M49A 3HRHA 5T3UA 5EJEA 3CJRA 3FIJA 5C1BA 2UYCA 3HUDA 5JISA 3GBVA 5HJEA 5BYAA 5C9ZA 1OIXA 3RF7A 2B61A 3S8MA 4Q1AA 3I6IA 1U94A 1YZ3A 4GOKA 3C7DB 5LQSA 2JGNA 3P52A 5AXAA 3LC2O 3FCSB 4G26A 5CM8B 1K3FA 2YXEA 5B4VA 4G86A 1XNHA 3D3WB 5JYCA 1EMDA 1P6QA 2QTGA 3C2QA 4J6FA 3UANA 1DBQA 4YP0A 4X7MA 1HDEA 1OWPA 2B3DA 3IQGX 1QFZA 2BFFB 2IYQA 3DH0A 2RB5A 3CONA 4TMKA 3GROA 1GPLA 3KWLA 3AFHA 3QBVA 4RGQA 4K3VA 5IYZF 1U0TA 2NNLD 3RABA 5JSZA 1T4DA 1XF9A 1GL6A 3OPYA 5BNFA 1NL3A 3K0CA 4OF4A 4DLXA 1H69A 3I28A 1ORRA 3MPOA 1NI4A 3JWHA 4JNCA 2XF8A 2FW6A 3AC0A 3O8QB 4LXGA 4BQSA 4S2UA 4QJIA 1IJEA 4Y9DA 2A5YB 1P9LA 1DCFA 1EJ2A 3DZDA 4HLUC 4PG5A 1YRQA 3X1XA 1T8UA 3OQ6A 2NUPB 5U4QA 4DMKA 2WZQA 1C1DB 3I9NA 1TZCA 3GRPA 3VDQA 5KMGA 1OYWA 5JNUA 2E3JA 1EH5A 3B9PA 3KJQA 3UFXA 1MJGM 1X8LA 4C4YA 4L1KA 4CKEA 1WV0A 4O5AA 5EQTA 3NAQA 2P0YA 3L18A 5IPFA 5JATA 4P81A 1IEVA 3LXUX 3GFFA 1TYBE 2BGNA 4MPDA 4HDRB 3UXYA 3WWDA 4Q9AA 3UQYS 1G8SA 2BEJA 4CLRB 5U4XA 3KCNA 3RRMA 2YHIB 1RBQA 2GKOA 1B6TA 1DC6A 1HSOA 1QXSA 1XYYA 2EW8A 2H2DA 4R41A 3LWDA 1I7NA 1MZPA 1J0BA 1BJRE 1R0XA 1KDRA 4LXHA 4Q05A 1Z3CA 4QD3A 5CCDA 3WLMA 2YV2A 2VRWA 4YO7A 2ZBVA 3AUFA 3I5YA 2ECOA 3EGOA 2I2BA 2EHJA 2VDMB 1QGUB 3GHYA 4WZZA 3MT0A 2DWQA 2E82A 3TD6A 3C16C 1JR3A 1F5NA 4R83A 5MN4A 2NT3A 3ICOA 4WKBA 2DUWA 2W71A 1BS2A 1VI6A 2AOTA 2JL1A 2RAVA 3GT0A 2VHUA 1WQ3A 2E48A 1NA5A 3D0KA 3CNLA 1UXKA 1A9XA 1OLUB 3BICA 1F2TB 4K1XA 3OG9A 1SXJB 1LJLA 3E2MA 3U26A 1CNFA 2YMPA 4HS9A 4M1EA 2BKVA 4RTJA 2HJHA 1LJUA 2WSMA 4DQUA 1QMGA 4UCXA 1AHIA 1RI3A 3Q1KA 3QKTA 3WO1A 1L6RA 4B34A 1PJBA 1O94D 4HS4A 1NNLA 2CHFA 4D6YA 1LUAA 3ZIAA 3MJVA 5LQCA 6ADHA 4AURA 1MEOA 3KJNA 4DDHA 3QV2A 3TR0A 3H16A 1SUCA 1Q22A 3JQDA 5KSYA 2DRIA 2XUAA 1IBCA 3HJUA 4FEAA 3BWEA 4AJOA 1WDLA 2AYXA 3KKPA 1CJMA 4V02A 3WLRA 5MN5A 4HDKB 3ETHA 1PGJA 5SYAA 3GEGA 3WE7A 3E1SA 2VK2A 5JZVA 1GXSB 3SKXA 4H4EA 1E3SA 3G17A 1M73E 2R48A 2R2GA 2GPBA 1AKEA 1PS8A 1QX4A 2W2OA 4GE0A 4X6UA 4ENQA 4ES6A 4DLRA 3SJBA 1G8MA 1GCGA 9GPBA 1I80A 1F06A 2BONA 1ISIA 1HOXA 3WL4A 1JBQA 2QLNA 1N92A 4D3ZA 5KTNA 3AUAA 4QFCA 5FUMA 4B4UA 5AM4A 1YVUA 2ORVA 1UXJA 2ZAOA 4C0LA 2CJXA 3N8KA 3F6SA 3EDOA 4QNRA 2E49A 4QM7A 1UIMA 3QKSA 1O0BA 4H0FA 1A27A 4L57A 1UH5A 2V6JA 2ZWAA 4H77A 2JFPA 1DAGA 1NIPA 1E79D 3L7AA 3VR5A 4AFNA 4D1YA 4LYEA 4CEJA 4KZPA 1L3IA 1DIAA 3K73O 4J90A 3UXMA 2ZZNA 4IIBA 4Z4QA 4OHZA 1XV5A 1IXSB 2QTFA 2Y0EA 2HKIA 3VZSA 2G71A 1M9NA 2MSLA 5F12A 1F0PA 3L7CA 1CEEA 3AVVA 2P27A 2VP2A 2PSFA 3TPFA 2JIZD 4Z1OA 4ZA2A 1V95A 4HQ6A 1VHDA 1KMCA 4NOKA 4RFSA 2HBZA 1EK0A 2IV3A 2EQBA 5ER9A 4DNPA 5EWMA 3PX3A 4AZ3B 5C5EA 1JEYA 2YN0A 2P90A 3JYHA 1F7VA 1XZEA 1F0KA 1VE9A 1YO6A 2VC2B 4ZQIA 2WAOA 2QRHA 2CLHB 2X2PA 1DWQA 3TCXB 3G9XA 3QU5A 2R60A 4CL0A 4DSAA 2FN9A 2G04A 1OF1A 3NEJA 2J46A 1ZK1A 4R31A 1FS4A 3ICVA 2A3NA 1I33A 2DFPA 3Q6NA 1WB5A 4KQEA 1GNLA 1L5LA 4I46A 2QRPA 3ESZA 1KETA 1YI8A 2D8MA 4NZZA 1NUSA 1GGEA 1PJLA 2ZUSA 4OL0A 3SC4A 3GFVA 1Q5PA 4JBHA 2C97A 4H1TA 3FPCA 1MU0A 2OZPA 4NZMA 3UJBA 3THXA 3UJ9A 1XTSA 2EIHA 1C1XB 4NSNA 2GCGA 5K0GA 2OQIA 4K88A 1ZMRA 5JQGB 4FE4A 3E1GA 5CFLA 1B16A 2KBFA 1AKNA 3TG2A 4UDNA 3KC2A 5DK6A 2DUJA 1B1CA 1CUXA 4JJ6A 1H3EA 3MTIA 2QG4A 3CFYA 3W06A 3J7TA 5BWCA 1WB4A 3ZE2B 3C6YA 4OLJA 2FYTA 5ESRA 3IMKA 5M29A 2AYYA 3EIQA 2DLCX 5JI3E 2Q45A 1UBMS 4HLUA 1KQ3A 3D6FA 1QOQB 2HSZA 2OMEA 3IB3A 2ZW9A 3PEEA 4B5LA 2JA2A 3BWMA 4YAWA 5JCJD 3PQFA 2ZVDA 4DLKA 3THRA 1UDAA 2P2NA 3L4SO 1BWRA 1FK8A 2FW0A 4YQFA 3ZHRA 1REQB 5HZGA 4UU8A 1R6XA 1QKIA 2ZBQA 4HAYA 4PX5A 2HMYB 3WBBA 1PU2A 4O3FA 4S1NA 2CBGA 3EQ7A 5JEEA 1Q0HA 3AXTA 2BMJA 5H3CA 4EUSA 4WCFB 2FEXA 1DXQA 1J1ZA 1GKIA 2PZFA 3SYRA 3OESA 4FQ5A 2X4GA 1E66A 3CF6R 3GJ3A 4J8PA 4PLHA 5AW2A 2ZIXB 3IUMA 2PR7A 4RD2A 4M0UA 5GP1A 1QGDA 4ME6A 1I14A 1RI4A 1P4RA 2CLSA 5EIWA 3UMBA 5BV8A 1NBWB 1SCDA 2Q1SA 3AIKA 2PT9A 4FMBB 2YUTA 4DZTA 1PFGA 2NO6A 3JPYA 4QTZA 4TSFD 5HTKA 4TLCA 3VU8A 2FPSA 1R5JA 2O2JA 2AFIB 2HV8A 1M72A 4GKAA 4Q1DA 3WGTA 1G7RA 3DVAA 4Y2PA 3S1LA 3VYWA 3W5HA 1Y4SA 4B8ZA 2VJYA 1YJBA 4RVDA 4EHLA 3EDRA 1C4KA 4K9OA 4NZPA 4XVUA 4YRNA 3CS3A 4OQEA 4ASUD 2XB6A 3EGXB 4DBVO 1CR4A 1VL1A 1IG0A 1VSTA 2GWHA 1RMYA 4TN1A 5BWLA 1V2HE 2OWEA 4DSUA 2GXAA 1TZMA 2CE7A 2VA8A 2XVMA 1NW7A 3ICPA 3R5KA 4F2GA 4NJMA 4RULA 4DNXA 4NX2A 3ZU6A 1DCKA 2GD1O 1DFHA 3M9LA 3OT4A 1FSPA 5IW8A 1IWOA 2V9ZA 2WTNA 1YL5A 4EY7A 2AXEA 1Q95A 3AM4A 2QPLA 4D92A 3ZQJA 3RQSA 3OTIA 1KARA 3GFQA 2RGRA 5HFAA 3UCEA 1Y3FE 1UMBA 1YZLA 4JFRA 1C3OA 1U3VA 2HYDA 3P2KA 4JBNA 4D8XA 1WETA 4YRAA 3A9SA 4H7EA 4CE6A 1PV1A 1BFDA 1LZLA 1NQUA 1O0SA 1I2DA 4ID9A 1OH8A 2MOKA 3NTXA 4E09A 1IVYA 2Q4TA 1IZ9A 1D1QA 3DFZA 4KVAA 5E6SA 3T9FA 2FMXA 3EIHA 4HG2A 4MCJA 3L8ZA 1WXIA 1Z8DA 3H1PA 3I9V6 4OUDA 3DOOA 1U65A 1K75A 3GRUA 1ZGCA 3IESA 3O4GA 4JEIA 5TMPA 4WXRA 4CQLA 1FDVA 4DNQA 2IFTA 5IULC 1PFKA 3QKUA 4QPJC 3I01M 2OENG 2EAUA 1E3IA 4YNBA 5F3DA 1V25A 1E4OA 3SC3A 1U1CA 2CY0A 1P7PA 2J48A 3UMSA 1NLYA 3W90A 4R8MA 2P9ZA 1V3QE 3OP1A 1G8YA 2O3SA 1L5HA 4KWHA 2BJVA 3N74A 1H1TA 2IF0A 2XT6A 1M2OA 3G9UA 5JO9A 1C7QA 1DVRA 1Y5MA 2RCYA 3VHXA 4MA5A 5DP1A 5IT0A 1AF7A 2HWXA 2AE2A 1CW2B 1Y6QA 3HY6A 2QUKA 3OA2A 4KU4A 1EXVA 3WKBA 2PUAA 2JS7A 4E70A 3L8EA 2ISQA 2AN3A 1UKCA 1NYTA 2DMRA 3E4DA 3VPGA 4HZUA 3IUSA 3OQPA 4CFSA 3I9JA 5HQ3B 1Y5NA 4CT0A 2I4LA 1F0NA 3FSRA 2O2XA 2H7CA 4Y2JA 4IRXA 5DYNA 1PK8A 3LGXA 5ENVA 1OGIA 5AKIA 1MABB 3QE9Y 1V41E 2CKDA 3KOXA 5LC1A 1N6KA 4BP1A 1BN6A 1Y8RA 4UM9D 2JLZA 1SNYA 2PWPA 4RXMA 3GJXC 4B7AA 4F3KA 3BD6A 4K6CA 3G8BA 1UDCA 4NXMB 2G1UA 5FO0A 4W63A 1D3AA 4ND8A 3UB2A 2ZETA 3LQKA 4ND4A 1U2GA 1NOKA 2BVNA 2HUNA 3KVOA 3B3FA 4F3NA 1KP9A 5E7IA 2X9NA 4L22A 3A3KA 2Q3CA 2XZDA 3VSDA 1IBRA 3F8WA 4G1EB 1DO2A 4KVZA 4UHKA 4PAOA 4F38A 3PNYA 2M32A 2IYYA 1EUCB 3BXHA 3MQFA 3VOTA 2R6DA 1EJBA 4EKDA 5HZMA 4P4LA 4FFDA 2XUHA 2X5JO 3P0IA 2F3QA 2IGBA 4OU5A 3E61A 1D5CA 5IX8A 1L5VA 4YCLA 4HLNA 2JC3A 1GNTA 2XMQA 5KOJA 3UJ8A 3O1HB 1NSTA 1K6EA 2HAEA 1KEUA 3GJQA 4LJAA 4NBTA 3NIDB 4P36A 4TUYF 1JTFA 3CSDA 1CUHA 1DARA 1P80A 1TAQA 1UUFA 3BFPA 3DQPA 4PS0A 5A7GA 2Z2XA 4XFDA 3KAQA 1HYGA 1B00A 5EWLA 3RSFA 4HT3B 2JRCA 4G8BA 2I91A 5JR3A 2VPIA 3I8OA 5I7RA 4RH0A 4IGKA 1CQPA 1FDWA 1M2GA 2BOVA 2HX1A 1P75A 2O50A 1JXMA 3FTPA 4FHZA 1GZHB 4HI0E 2P1ZA 4B2LA 1U9ZA 2WWFA 4BO2A 3D54D 1C30B 2VYFA 3ENWA 3H1EA 2PS9A 3I04A 5JXIA 3P9CA 5MGBA 4JN6B 2I2WA 2GVZC 3QF4A 3RVRA 2IH5A 4MDYA 1QSGA 2F6RA 2C54A 2IYTA 3WL5A 4XR4A 2ZITA 1GTJ1 3CRMA 5JDIC 3AUUA 2A92A 2YJGA 1TEZA 4PYIA 1MC8A 2C1ZA 4LCBA 1X3LA 3FPSA 4V3CA 3CISA 4DR7B 2DLNA 3L0PA 5IEBA 3RU2A 2EFJA 16PKA 1SUWA 2PCJA 3GJZA 4M0EA 2OILA 3ISJA 4EF5A 5TE9A 1PWXA 1M2WA 3LDGA 1OTHA 4PN3A 1QWOA 1YBMA 1Z47A 2NYRA 1NJ8A 1P5JA 3M6LA 4QGHA 1JR6A 4YR9A 4MJLA 1NXPA 5B3JC 2HPVA 3R1IA 4QICA 1VG0B 4MS4A 1ZW1A 3B1KA 1IY8A 4I9GA 1CLUA 4HF7A 1KFCB 2I6FA 4M76B 5F4ZA 1NLFA 1EA7A 1KVQA 2Z1DA 3GG9A 3TL3A 5FRDA 1G3QA 4C0SA 4DJAA 4QA9A 4F3TA 1ZSYA 1G2PA 4OB7A 4ND1A 3WL8A 1RXIA 3L41A 5T4HA 1PRYA 4EI8A 2ZFUA 5K01A 4O59O 4KXFB 2OZLA 4A92A 2I7TA 3LK7A 3TW8A 2CJWB 1SY7A 3HO8A 3AEQB 2WVHA 1OH7A 3A2LA 2YDYA 4KV9A 1WXHA 3OHMA 3EPHA 4YCBA 2N1MA 4EPVA 5ICFA 4FBLA 5I3ZA 4B3XA 5DNUA 1SK9A 4E1BA 4C5BA 4AJ2A 4QPPA 1OX4A 1RHJA 2I9PA 4CMGA 1AE1A 4E08A 4ZVNA 1PZFA 3CH7A 1HF3A 4EL5A 2BY4A 1A5ZA 1QZUA 2XUJA 4PTZA 5TXGA 5BQFA 4A5OA 3J80A 3IPYA 4QWMA 4R51A 3VAZA 3AUXA 3EAFA 1R9MA 1T9DA 2BLLA 3D0OA 2YQ5A 4FI3C 2VPQA 2DQKA 2YQZA 4E0BA 4O2RA 3OA0A 4TLMB 1XZMA 4BBJA 4EW1A 1PT7A 3H6KA 5KYUB 1XCJA 1YNOA 1QNFA 3RTBA 3OPMA 2LDXA 2Z0MA 3VYVA 4AJNA 1Y1QA 4KE9A 1U6JA 1RXUA 1N57A 3EIOA 4ZCPA 5IG2A 1YRWA 3SWWA 4M54A 2M9MA 5GADl 5AKGA 4LC0A 4A8HA 1Y5RA 1E1NA 2B8TA 2R5WA 5F51A 1ECPA 2R85A 3FDZA 3HPRA 4NNJA 4NEQA 3TOCA 3R3VA 2RJ3A 2QBYB 3A28A 2VP4A 3WR5A 4MAFA 1AMOA 2WKSA 1P7CA 1KZ1A 2DBVO 2JGEA 4YCJA 1E61A 4TV8B 4E3ZA 2PX5A 3DZ8A 1F17A 1MB3A 3TUJC 4OI0A 2VXCA 4LF7B 2UYOA 3DTVB 3RUEA 1AS0A 3KSDO 3UTCA 1E0JA 2IW3A 2YMLA 4C43A 1DAPA 1PSWA 4RD4A 2JLYA 2JK0A 4GWGA 1J8DA 1YQWA 2FP4B 3KLNA 4FHCA 1EXDA 1AN0A 4GX1A 4YMIA 4GFDA 3GH3A 1HWYA 2NU7A 2FJUA 2W6QA 1W30A 1R0LA 2I8AA 2XWBF 4PONA 2CN1A 3S2IA 4L8LA 1DOHA 4TL9A 2WTXA 4B71A 4N5LA 5FI1B 2B92A 4RSMA 3QE4A 3M6FA 2FZCA 4NCIA 2G1KA 3LF1A 2Q5EA 4N9WA 4WECA 1PBNA 1H1LB 3M9WA 4TYPA 3ZCXA 5K6TA 1KJJA 2YNMD 3ADPA 2FFQA 2QTRA 2Z2IA 4R5HA 4RTSA 3WFZA 3GUHA 2ORYA 4XJXA 1AZSC 4IH4A 1M33A 5J59A 1L1QA 2SKEA 5JG7A 4CQMD 5JO0A 5IKXA 1CIJA 3G5UA 4JI2B 4C0XA 1KDOA 2EW2A 1NR5A 1HPLA 3IIJA 1T2DA 1WSDA 3GCXA 3N2NA 1L5SA 2W5UA 3DE5X 1NASA 1AUQA 3FUTA 3CWCA 1ZIDA 2QX4A 1JALA 1PTJC 2NU6B 3OFSA 1NJ2A 3NM5A 3QLUC 5HMMA 3RQIA 2UZIR 4YAIA 2JI7A 1EUDB 1X7XB 1YCDA 5IAOA 2BN4A 2VCYA 5EN4A 1HEIA 1SKAA 1J8YF 1V4VA 1TEVA 4CCWA 4D8UA 3EXEB 4UASA 4EY6A 5HRAA 3H2YA 4A9AA 1BQEA 2JAPA 2Q3HA 2GTIA 2OV4A 4EITA 3FTFA 1KI6B 2Q1YA 5AVOA 5G0SA 4BPRA 3CR8A 1IEQA 2J5QA 4R3UC 4O2BB 4X90A 5JTTA 3ANLA 3QOFA 4LMPA 4GT1A 2QDXA 3KR9A 3D8TA 4OJNA 4L16A 1B41A 5JS1A 3HY4A 1JQ5A 4FCWA 3DZGA 2FWMX 4JC4A 3WFIA 4AM8A 5HXAA 4DYVA 4I1PA 1ZM3A 1SUFA 1U0EA 2XBUA 4WESB 2XSZD 1OZ0A 4B74A 3I45A 1IHPA 3C8UA 3I34X 4I5FA 5CXQA 1JE1A 4UD6A 2QVGA 1E1QD 1V5GA 3DFFA 2HLDD 3G2LA 3KVYA 2LXNA 1T5OA 1FUIA 4M7OA 4O4IA 3T0IA 5JCPA 1SBIA 1KXJA 2GK6A 3EBPA 3BGDA 1Z34A 4J07A 2YASA 3VOSA 5JVDA 4E31A 5JZOA 4HNAA 4DKXA 1VQ1A 5TY0A 3FYCA 2OHVA 2Q9UA 4D43A 4HWSA 4N5MA 5C1PA 3SOZA 2GD2A 2A6PA 1CZRA 1H5QA 1Z26A 4ZTUB 4LDQA 1NXVA 3DT8A 1Z4QA 1NXTA 4Z53A 4ODIA 1R15A 1F48A 1PL8A 5ALTA 4D8VA 1TI7A 4JBWA 3S5JA 2PA3A 4PAQA 5M04A 3BE6A 2C7VA 2CL0X 3VZQA 5CJJA 3R6TA 3RGWS 3MFQA 2ZTVA 3O47A 2B37A 2BD0A 3AF0A 1FZQA 4RY9A 5BO5A 1S01A 3T52A 4CMHA 2OG1A 3IQFA 4Y6PA 1IU9A 4EJFA 4W5RA 3FJ1A 3CGGA 1U8XX 2AW5A 2FUG1 2QTAA 2YC4C 1YZUA 1JEEA 2V7GA 3WADA 1N0IA 5JOQA 2CVZA 5FOTA 4HSGA 3QP9A 1K1EA 5B3JA 5KTOA 2QVCA 4G9EA 1KWKA 2ZT5A 1QDEA 2ZXFA 2XOKA 3VVCA 3GFSA 3T3EA 4NBVA 4JL6A 4RJIA 5IDXA 2J6IA 3B38A 4KYIB 5GJCA 1DC8A 4KR6A 2Q6KA 1FNMA 5K6RA 2WDPA 2YWCA 4ARCA 4IM7A 4QATA