1YDGA

Crystal structure of trp repressor binding protein wrba
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
201
structure length
201
Chain Sequence
APVKLAIVFYSSTGTGYAMAQEAAEAGRAAGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIFKSGGNPYGASVTANGQPLLENDRASIRHQVRRQVELTAKLLEGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords trp repressor binding protein WrbA
publication title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 81
structure length 201
sequence length 201
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ydgA00
3FW1A 5EMNA 1T5BA 3B6KA 3TEMA 5LLDA 1T0IA 3KLBA 1RCFA 4XDHA 2ZKIA 4Y9UA 4YAUA 3OX1A 2X2OA 4J8PA 2MOKA 4PTYA 2KLBA 2BZSA 4N82A 1CZKA 1V4BA 3QFRA 4U7HA 4ICIA 4M0CA 4S24A 1FLVA 1TIKA 3KEGA 4ZVMA 4FGLA 4HS4A 5FA6A 4HEQA 2Z9BA 3LT5A 4YALA 2OHHA 3N3BC 4FGKA 5FUQA 2OHIA 1YDGA 2RG1A 1YCHA 2V9CA 1J9EA 4YAFA 2F1OA 1BVYF 1QBGA 3NHRA 3LCMA 5EAIA 2N1MA 2M6SA 3JSXA 2QX8A 3F2VA 3NHYA 4F8YA 1CZOA 1AG9A 2QMYA 2Q9UA 3HLYA 2V5UA 3W77A 1I1OA 4GR9A 1AKTA 2BPOA 3F90A 1WSWA 1RLJA 3NHWA 5F4BA 4PU0A 3NLLA 3O2NA 4DY4A 4NULA 4U7FA 2D5IA 1QHEA 3OX2A 3B6JA 3ESYA 1TLLA 2Z9DA 1C7EA 1AMOA 3EYWA 2FX2A 2FZ5A 1YCFA 1XI2A 4QOJA 3F6SA 5LVAA 5NLLA 3R6WA 2MT9A 1CZUA 2KQUA 5FX2A 3NHSA 1CZNA 1FVXA 2XODA 2Z9CA 1FX1A 5A4KA 4XDGA 2QX4A 4H6PA 3B6IA 4C0WA 1ZX1A 1FUEA 3L9XA 4YQEA 5LBUA 4ZVLA 1QR2A 1H66A 1FLAA 2B3DA 1JA0A 3NHJA 3SVLA 1B1CA 1BU5A 4YAOA 4ZVKA 1ZWLA 4D02A 6NULA 1JA1A 3OWXA 2X2PA 1XYYA 5F51A 5EA2A 1J9ZA 1GG5A 2FAXA 3FX2A 1D4AA 1DXQA 2R97A 3S2YA 3TE7A 3B6MA 1AZLA 3KAQA 2FDXA 3K20A 4ZVNA 5LJIA 2OYSA 1CZLA 2FVXA 1F4PA 2BMVA 2R96A 1FLDA 4C76A 3W7AA 1J9GA 2QX9A 4QOHA 3QE2A 3G5MA 4Y9RA 2BF4A 4YAWA 1AKUA 3FNIA 5BUCA 4N65A 1D03A 1NNI1 4QOFA 3ZHOA 3FJOA 3W78A 3TZBA 4QODA 3O73A 1D04A 4LTMA 3HR4A 3KAPA 1YCGA 4U7GA 1WSBA 2HNBA 3OWHA 2HNAA 1KBQA 1VMEA 1ZWKA 5F12A 4GI5A 1OBOA 4FGJA 3UXHA 3RPEA 3NHPA 4OXXA 2OHJA 3NHFA 1FTGA 1OFVA 3K1YA 2M6RA 4LA4A 4C0XA 3P0RA 3ESZA 3GFSA 1E5DA 5LMCA 4LTNA 2QMZA 3ES9A 2Z98A 5NULA 4QOEA 3FVWA 1QRDA 1H69A 1AKVA 5TGZA 2ARKA 3U7IA 1AHNA 4BMOB 1YRHA 4PTZA 1AKWA 1J8QA 2QR2A 1FLNA 1KBOA 4LAFA 5LJLA 1XYVA 3NFRA 3NHLA 2Q62A 3W79A 1OBVA 3GFRA 3OJXA 3GAMA 3UXEA 3ESXA 4CF6A 2FLVA 5B3KA 4C14A 1YKGA 2XOEA 4CETA 1X77A 3OJWA 5LBTA 4Y7CA 4FX2A 4H2DA 4DILA 4ESEA 2MWMA 3U7RA 2W5UA 3L9WA 1SQSA 2BN4A 1XT6A 4N9QA 2MTBA 5JROA 1DXOA 5ULLA 3NHUA 1CZRA 2GSWA 2A5LA 1DX9A 2QWXA 4LTDA 1C7FA 4BMPB 4QOGA 3OVMA 4DIKA 2AMJA 2FZVA 1CZHA 2V5VA 3EDOA 3N39C 2HPVA 1RTTA 3N3AC 4NLLA 5B3LA 2WC1A 4QOIA 2FCRA 1SG0A 3D7NA 1YOBA 3HA2A 3QFCA 2QX6A 3GFQA 3NHKA 4R81A 2FOXA 1AKRA 1RLIA 3F6RA 1AKQA 4GQIA 3OX3A
chains in the Genus database with same CATH superfamily
2ZE5A 4UPVA 3WB1A 2EJVA 2RHJA 3JWHA 4B8YA 3OUTA 3BORA 3C74A 3H75A 4KFSA 4L0DA 3BM5A 3OO0A 2BP7B 2VUUA 2P2DA 1G6OA 2QTBA 5IYZB 2NZ2A 4AJ4A 1WUHS 1EA7A 2GN8A 5TV2A 4GKJB 2C4NA 4GZMA 1JPUA 4GECA 1O6FA 4QUKA 2O14A 1LSUA 3X1ZA 3B20A 3O8DA 3NORA 4MWZA 1ND5A 5DEIA 1XLUA 2HU2A 3UAXA 4IKOA 5ED0A 1JSZA 2Q6TA 2JJQA 1B93A 2YXNA 1G64A 1UQUA 4GXTA 3LY9A 3OZUA 1CIPA 1HETA 1YUBA 2G72A 2V3VA 2JGJA 2TMDA 2EP7A 2I3GA 2OHOA 5EIAA 1V4BA 1UZLA 2HM7A 1K7CA 3HVHA 5F52A 4DE5A 2W58A 3NOQA 3DKRA 3H5WA 2Z57A 4MJLA 2EDAA 2ECQA 4FKBA 1ISRA 1P39A 2OMEA 1ZVQA 4NBWA 1VHLA 3CEHA 4JSRA 3OZFA 2AHRA 3RBAA 2AK3A 1M1YE 4NE2A 3T15A 3ZGLA 1T8PA 2V0NA 1A8IA 2H2IA 3HN7A 1KO8A 4XX0A 2WWWA 4JFAA 3ZBPA 3Q6IA 2O8BB 2G1KA 5K3BA 4OA8A 2UVPA 2W8BA 1LU9A 1BA3A 1G3MA 3LQ2A 1T5IA 1AM4D 4E5NA 5IXJA 2ADMA 2HMWA 1GL6A 3Q1LA 3OECA 3FCAA 3KT3A 4ZJYA 3ICPA 4B3RB 2OHHA 5IN4A 3VYRB 2JI8A 2NADA 4U7DA 1P75A 3FTFA 2RD2A 1F48A 1GPNA 1HK7A 1SQFA 4N39A 1QG2A 2IYVA 5TJHA 1Z6QA 1JEQA 3JQCA 1UBNA 1YONA 4LBVA 4DV3B 5LQRA 3HB5X 3PE3A 1J9EA 2OAQ1 4FHCA 4L76A 4O2AA 3H9CA 4NAHA 2JLCA 3VSEA 4EVRA 3CRMA 1W76A 2I8LA 1QF6A 3H1GA 2QRUA 4AJNA 1X8KA 1J49A 1T2DA 3UC9A 1DBVO 1C1DB 1MAUA 1TE2A 3BOSA 1DBWA 2RJNA 2ZYRA 3OLQA 5JJCA 1V26A 5K8LA 3SK0A 1E1RA 3JSXA 3KQTA 4JI5B 5BORA 2Z6AA 1FRQA 1HT1E 2HNKA 4K9QA 4MVWA 3OU2A 1E9EA 3K7EA 4COKA 3MTDA 3O4VA 4KDRA 4LECA 3T41A 3UENA 1E4YA 1TCBA 3EDRA 2EU8A 4W9RA 5GONB 3RVOA 2P4EA 3W3ZB 2VCYA 4AY4A 3STYA 3P4YA 3AVYA 2ZUUA 5A4JA 4EEXA 1KOGA 1UJCA 2IRWA 3WAJA 1DARA 3IOCA 5JVDA 1UBHS 3DONA 3BHMA 1DX6A 3EH1A 2EFYA 4B4DA 4TKLA 2O06A 3DXYA 3GR6A 3H5NA 4GKKB 5JI3E 3A2LA 1G21A 5I9BA 4M83A 3UPDA 4PC3A 4YMLA 4L4YA 3SXJA 1XMPA 3H97A 6ADHA 4TKVB 1CT9A 4Y1RB 1O96B 1DHRA 3L1JA 3OAAA 4NWIA 1TF5A 3JVVA 2YBDA 5DM0A 3G23A 3ZWQA 4DM4A 3K4QA 4MLDA 9LDTA 3J81k 3V42A 5F98A 3FYUA 4KC0A 2FX3A 1ZRMA 4NCIA 5GV8A 1BVHA 3HWRA 2XX3A 4Y6LA 5DNAA 5EE3A 5EKTA 3VR4A 1MIHA 1KNQA 3HVKA 3NW9A 4J43A 4DFDA 4IH1A 2AE1A 1GUZA 1KYQA 1OX4A 4WLVA 1A71A 2RBEA 2WZQA 1P1RA 2OO5A 1DKPA 2WZBA 3IAFA 3N74A 3O82A 4JLJA 4U2CA 1ZI9A 4I1UA 2IS1A 3ZS8A 2FPOA 1PG0A 2FZ5A 3DLTA 1SUPA 1GZUA 5DNWA 2Q3CA 2GK4A 2MSNA 3K0CC 1DIHA 4DIFA 1K5PA 3GJQA 1QP4A 5SZIA 3DJFA 1LPSA 3B53X 3KQWA 1ONSA 2ABWA 3K1JA 3OHSX 3PWSA 5TMPA 2X4IA 1T35A 5FLEX 1P4HA 1XLTA 1Z3IX 2FQYA 2JJ2A 1P73A 5MN5A 4UHCA 5FOVA 3GELA 4PYIA 3VZRA 2F9MA 4E14A 4P3PA 3DM9B 4MOWA 2J6HA 1OOEA 2VF2A 4F5YA 1XJCA 4OHVA 3TEJA 3DAFA 4KYUA 4QPCA 3IEIA 4GE0A 4XYBA 1NVVR 5CJ2A 4YRFA 1K6MA 3UG6A 4BN4A 5CCXA 1LXCA 2HTFA 3DUWA 3DWFA 1ESMA 4L4RA 2EOAA 3ZHQA 1DWUA 1F38A 1FFEA 3BJEA 1WU7A 2W6CX 1E2LA 5TRTA 3VNRA 1U0OC 1JYFA 2FPIA 1KXZA 4RKWA 2VHEA 1XC7A 1LX7A 4PINA 3UW3A 4M7WA 3SOPA 4RA6B 4JKOA 4HL6A 3TKAA 2C00A 4C0KA 3K8QA 3GFVA 4PM4A 1AKYA 1Q1EA 3ANMA 1WO8A 2QTNA 2FWNA 1OTHA 2Y0BA 2ZB4A 4JP1A 3SIRA 4EPTA 3OPMA 3PEUA 4HUQB 1Q12A 4LHXA 1JLSA 2O4UX 4ZICA 4JUCA 2DH5A 2FMHA 5E0KB 2AN9A 1UBKS 3CM0A 2VJBA 2XNDD 1H66A 1W8IA 2A2ZA 2F3SA 1H5NA 2OENG 2WTEA 3IIJA 4KG7A 1BX0A 2I2WA 5DCYA 3AJDA 4AS1A 3AM1A 5AKLA 2YIVX 3DDNA 1Z5UA 1USGA 3F3KA 4PGHA 5BT8A 4FR0A 4C2UA 4RIIA 4X93A 1YZ3A 5HS4A 4RSGA 1XXHE 6NULA 2XUIA 4PPFA 2RB4A 3RQIA 1YOVA 4ZN6A 2NG1A 1FNDA 1LF5A 1ZKDA 1MW9X 2H29A 2H2GA 4X8LA 3RYFA 5JANA 1V41E 1JAZA 1WHTB 4YGYA 2BHRA 1GJRA 1G7TA 2YXPX 1W4BA 3DEJA 4A27A 4LJAA 4MIOA 1G17A 2HA0A 2ZJ4A 4RZIA 4P7GA 1WZ2A 4DA6A 3I2IA 3K0FA 2OGZA 4J6EA 2VYCA 4YRPA 1E96A 2YOHA 2Z04A 6LDHA 3H9GA 3KTOA 3ILHA 4JLSA 4Y2YA 3OU6A 6ABPA 1C41A 2Z0MA 2ST1A 2Q1UA 2LCIA 3IXMA 3KAQA 3ZNOA 4N5LA 1L5FA 4FZVA 4XX0B 3OQBA 3F98A 4AY3A 5COQA 2Q27A 2Z43A 3IT1A 5H83A 1IATA 4EHJA 4C7XA 2PQMA 4ESOA 1BEUB 2UVPB 2W8BB 2NUBA 5DX8A 1QG0A 3SF0A 6YASA 4DNQA 1EWQA 3SJBA 5LJIA 1RYZA 2AN3A 3AR5A 2C9MA 3DTNA 3K9CA 1O89A 2FN4A 4S3MA 4CQLA 1CZLA 1JSXA 3AO0B 4HZUA 4Q7LA 3BMCA 4UTZA 1UBLS 5KJ6A 4XR4A 1BE8A 3PBKA 3DULA 4HTFA 5E3JA 1ACLA 1LV7A 2R96A 3SC4A 3ZU5A 3THXA 2C7RA 5IJWA 3TECE 2XMQA 2X86A 5KSPA 3NRCA 4UQLA 1Q77A 1DVRA 2YMQA 3CF0A 3CV3A 1UPAA 3EAGA 4IGEA 1NVXQ 4FFVA 1HPLA 1E0DA 2V6JA 4XWTA 1T5OA 3IKMB 1JEQB 1AQJA 3OAAD 1SQGA 3QFFA 1ZHHA 1UXJA 5FUBA 4BFWA 1B8UA 2H7VA 4IVNA 2PS1A 4O2AB 1M34B 3OFJA 1ZIDA 4ZT5A 5C1OA 4QPJC 1QVVA 4R2IA 5CDGA 1P8AA 1V39A 1UJBA 2IOHA 4KK4A 2FSPA 2ATEA 2PH1A 4X84A 4C87A 2OBLA 1SG6A 2W90A 2R7KA 1J2TA 1OAOA 1XTQA 4K26A 5HZHA 3ASYA 1P2BA 1KRHA 1GUDA 2I2FA 1XZBA 2ZRBA 1Q92A 1J39A 2OC4A 3IUPA 4BNXA 1SK8A 4GYKA 5ALIA 1N7GA 4M54A 3R5TA 5IT4A 1XZGA 3L8EA 4FHGA 4HBGA 5KZMB 2KBEA 5LC1A 5L3SB 2WDPA 1E5LA 1XD9A 4GU5A 1N0VC 1ZCFA 2ZUWA 1R37A 2HWYA 2QVZX 5B37A 3PGVA 3OKCA 2AUMA 5KQGA 3TLJA 3MIZA 2KPOA 2ZSBA 1RZVA 3AVOA 4NEQA 3ZDEA 3PGJA 4FKMA 2A9FA 3OE1A 4IVRA 3CPEA 1WUJS 1TU0A 3DBRA 4M37A 3ZQKA 1S0UA 1BOFA 4N76A 4BZPA 3VGPA 1PBNA 1X1EA 1G21B 4B7CA 5FUMA 1IPHA 3ZV3A 4C7OA 4KI0A 1C9DB 1XK6A 4I6EA 1J5PA 4KWTA 1K6IA 1N8TA 1AUQA 4LF9B 4M9ZA 2XCTB 4JBGA 2JFGA 3N0XA 2AFHA 3QRWA 4ALKA 4ZCTA 4CUJA 3C6YA 2XJ9A 5A0FA 3IQGX 3GY0A 4MUKA 3OM9A 4AKTA 2QPTA 2WJYA 1YU9A 1OX4B 3L06A 1P3DA 2CLMB 4DGQA 2BTEA 4MV6A 4BFVA 2ZBDA 4DKJA 1AF4A 2ZJZA 3KEOA 3K6SA 1Z2CA 2UYOA 1QO0D 1C50A 1O94A 2XECA 2FMXA 1QDLB 2FSHA 1CR1A 1YV9A 2JIPA 3NHFA 3KELA 3QBJA 4HQRA 4UHDA 5HFAA 1IWOA 1HE2A 3O1JC 1L5HA 3WNZA 1RQXA 1FC0A 3M1YA 2FP4A 4M8NE 2SCUA 5D85A 5BQ5A 4OHYA 1VKRA 4Q7KA 1YIAA 3UJHA 4LA4A 4MV9A 2HQSA 2A33A 3K09C 3T7KA 4E6PA 2PJZA 1Y9ZA 2WD9A 3I6MA 1K08A 3OUZA 4U7TB 4ENUA 1CY4A 2B7LA 4E4TA 4GR4A 3R5JA 3VOSA 3WLMA 4B3HA 1D0IA 3JRWA 1UJ5A 3FVWA 3LM8A 3EE6A 3FI9A 4LQCA 4BTVA 2OEPA 2ANBA 3KDSE 5CK5A 3TZKA 3DKVA 4LVCA 2G5PA 2AF4C 4YRNA 3A0UA 1CNMA 5KTYA 5HK9A 1ABEA 3U4IA 1H4SA 2XQGA 1VPVA 2B9VA 4NOKA 2ZROA 4FCWA 3MJHA 2FPIB 3SOZA 3QXGA 4BCDA 1LLUA 3HKCB 1UFKA 4XYEA 5K51A 2ZEJA 3WJ1A 4MPPA 2YC2C 4IFTA 4P86A 3ZIAD 2FDRA 3DOJA 4S1PA 3ZY4A 5JFGA 2QXUA 4N0QA 2VCHA 3JYNA 4UM8B 3L6RA 5I7AA 3BVPA 1C7QA 1NDHA 3MM4A 4DTIA 2ENUA 5AKYA 2G88A 1XYVA 4QDXA 2VQ6A 4CTMA 2C3PA 1RRPA 2Q2NA 2ZSEA 3GLRA 3LC0A 5DP1A 2OK8A 2YS6A 1L7NA 2XBUA 3ST7A 1SUSA 1QQBA 1OBVA 1U2PA 1TKAA 4Z7NB 4KPYA 3RVMA 2C61A 4L75A 3WMWA 1R9NA 3A27A 2YWRA 3GNQA 4ND3A 1FFBA 5F1OA 4LGCA 4XGIA 4CIBA 2RHHA 4G26A 4CIAA 5HNKA 1YOVB 4CF6A 1O0CA 3V00A 1W19A 1EE2A 4P7BA 2H8GA 4W8GA 2IEBA 3RYFB 5I9IA 2HAEA 4MWTA 3FRIA 4Q7JB 4MUNA 4TTPA 2FLVA 5JRJA 1GTZA 3N8HA 3IV7A 3URKA 1ABFA 3ODPA 1O6BA 2CC2A 1VFPA 1E3SA 1NATA 1RWNA 2PTHA 3MT0A 4LX8A 1KJQA 4MEJA 3BREA 4R3WA 3K0FB 5KO2A 5GY7A 5DKFA 3NAMA 4DCTA 3UMBA 4IDOA 1QO7A 4OAQA 4B46A 3BZBA 4G1EB 5AKHA 4ZVVA 4I8IA 1ZM7A 4LOHA 3GD7A 4C4XA 4LK3A 4JX9A 5T3UA 3OIDA 4IAOA 2O1WA 2F67A 4YA6A 2IS4A 1NU6A 2NVUA 4WXPA 4NQRA 1FYEA 2XYHA 4DILA 4R1PA 3O9VA 1CVLA 4IF4A 4J1TC 1AGRA 3MOIA 1TFUA 1BEZA 4WCFA 3WHIA 5EP2A 4NFLA 4B6PA 5JJ5A 5AXBA 1MP0A 4CQLB 1M1UA 4PPGA 3G2KA 3BMCB 2WIKA 3NAQA 3D7RA 2HRBA 4HDCA 2ZI7A 4M0FA 2FRDC 1HLPA 1WMSA 2OV2A 4HTFB 1V25A 4XTCS 4ZAYA 4BJ6A 5JROA 2H2WA 1VMAA 3IIMA 2JF0A 4V38A 4PRKA 4OQDA 5CB6A 3EXAA 5C80A 5F2NA 4P3KA 4AIRA 4YRRA 3EVZA 3ZWPA 3D6NB 4RS3A 2OT3B 3KRTA 3M6IA 2VQDA 4Z54A 1NFQA 1UOOA 1DPFA 5B4TA 4AJHA 4PN3A 1I4TD 1K27A 3BHIA 1D09A 1OXBB 4OXRA 3TW4A 3WMRA 3PX7A 5IULC 1US8A 1ZMRA 1RYFA 3OJLA 3OM8A 3VU0A 3RVPA 1DX9A 4Y67A 4L6CA 2IPNA 4D4GA 2EJUA 2JDIA 1DQNA 1MRZA 1AS3A 2D2XA 2XB9A 1ZZGA 2CHQA 4QOGA 5JALA 3PNYA 4JCOA 1Z2NX 1KEVA 2QQ5A 1NJFA 1WOMA 1Q2UA 2H1IA 4DPKA 1A9ZA 1IY9A 1MABA 3E9DA 3HCOA 1TQ6A 4PQRA 3UT0A 4ER7A 1JN0A 3PXGA 4GWKA 4TX1A 3R9KA 2V8BA 3KSBC 3NH9A 3I9NA 5E4JA 3COYA 4XCVA 1Z8HA 2R65A 4FLEA 4KKXB 2B25A 3KYBA 1U4SA 2QTTA 1SVOA 4UCFA 1L4KA 2VAXA 1ODSA 2RAFA 2J9RA 2QLMA 3DBRB 2FCRA 3UCFA 2HT1A 2NM0A 4L5BA 2Q5QA 4IGKA 4ZYVA 5KSYA 1BGXT 1E2IA 4HOYA 2CXUA 3E7PA 1PTJA 4K6KA 2IDMA 4IL5A 5AMXA 5BNZA 2D8MA 3CWCA 3T4UA 1L7XA 1U0BB 1VL5A 3DWEX 2ISQA 1E1YA 4DR4B 3RRJA 1C80A 2OK7A 2BCGY 2AFHB 3H4TA 3SZOA 5IDVA 3E0QA 5KYNA 4LF5B 1R10A 3AY3A 1PV2A 3INYA 5GZ6A 2IV7A 2LE0A 1T34A 5BWBA 2V4MA 1U0NA 4Q82A 5KJFA 2ZT5A 2XA9A 3W2IA 1DC4A 3Q7PA 4WL0A 4Z99A 3AV3A 1AHPA 3IEUA 3AHFA 1COWD 4IFIA 1L5HB 3BWCA 4L15A 1DBQA 4ER3A 2X5NA 2FP4B 4E4RA 3BWEA 4IJ6A 3EDYA 3U2QA 3KQUA 1H3EA 2I4OA 2W6OA 2NU9A 1XR3A 3K70C 3BSYA 1W4ZA 4YAUA 3DVRX 1NJ6A 4GT1A 1F0NA 1I2BA 3WWZA 1IQ0A 5IANA 1EUQA 3N2EA 3DFIA 2P9EA 4QFDA 5DIZA 4C4TA 1XU4A 3PS9A 4PTYA 4K9MA 3CTPA 2HK9A 1NA5A 2RK6A 3DFFA 3ISJA 4QDKA 3R41A 3UO8B 2CSXA 3I6BA 3O47A 2OE2A 5JS6A 1ZN2A 2G1UA 4GQBA 4H17A 2F8SA 1C0KA 1D2GA 4G89A 1U1GA 3DMDA 3PHBE 5L3RA 4HMQA 5AIBA 4AS2A 1NIJA 1Q7RA 2ZREA 3HMQA 3KSDO 4O33A 5CT8A 1L5LA 4EG0A 7MHTA 3HL0A 3JATA 2R751 4WKGA 4OKSA 1H2ZA 4FFOA 3M5PA 2QZ4A 4YB8A 5G53C 3R5HA 1QK3A 4X1IB 1SVLA 3LC1O 5A5VA 3WL4A 2UZAA 1Q11A 3QMMA 4WI1A 2J8ZA 5KNCA 3VC7A 1Q57A 3ZY6A 1X38A 4A8JA 5BNWA 5FA6A 3J7AC 5DSTA 4YT5A 1RI5A 4WLNA 3U5TA 3C3PA 2Q28A 1LDYA 3GVXA 4BVJA 1ENPA 4ETNA 2XUFA 3F47A 4KGZA 4G01B 1M2OB 1XQ6A 3KFXA 2QORA 1JAHA 2P6PA 5K01A 2DCMA 2ZPUA 1N9KA 3ELWA 3OIFA 2NQ8A 3HUEA 3NHBA 4YECA 4KR2A 1QFMA 2A4KA 2CEKA 2IYNA 3AEXA 1U5BA 2OB1A 1KJIA 2PSEA 5F1PA 2PUGA 2F9FA 1XLVA 2RHDA 2ZJ7A 3LVQE 4Q3EA 1UC8A 5HZMA 1F6DA 1SCBA 1VB3A 5K1ZA 3T34A 1YACA 2CB9A 5IX8A 5JAZA 1LWNA 1TOAA 1ZRHA 2RJ3A 1YR7A 1M34E 3L4SO 4FMPA 3CGWA 1IEVA 4QEDA 2GTIA 1KIMA 4GWLA 4BECA 5CFQA 5KHOC 3N6RA 2Q4OA 4PS1A 2CXPA 2YFYA 1ZLXA 2P11A 5KPJA 1QBGA 2ETXA 3A9TA 3ZDXB 3MGKA 4HYTA 3BERA 4Y2HA 4QWWA 1KMQA 1W75A 4ZQBA 2B0CA 4Q18A 3RKRA 2NZWA 2NVUB 1ZC3A 4NS4A 3D2LA 4EYGA 1U7WA 1RAGA 2CHUA 3V34A 5BN4B 4CMBA 1E2KA 1TQ4A 2QN2A 3C6BA 3C98A 3OT5A 3OWOA 2PO7A 4Q9NA 4WCFB 3ZN2A 1RW4A 3HP7A 1U0JA 2V7BA 2ZIZA 3JR7A 5ICMA 1GCUA 1YVUA 1R7RA 3QUBA 2B98A 2YNMC 5ECDA 4W6ZA 3AUYA 2R6JA 3CSUA 1JUDA 2H5LA 3Q40A 3QEKA 1FU8A 4QJ4A 3QW4B 5B58T 3RLFA 1EP9A 3V2HA 4ZCLA 3T1QA 3ZC3A 1G21E 1HDZA 4FILA 4TQUS 4UNIA 1VMKA 4BQIA 1RBYA 3IMKA 2YYSA 2P91A 1WUYA 4D9IA 3BSSA 5FTWA 1N5DA 1GKKA 4FE3A 1XX6A 2CZCA 2O3SA 1GL7A 3A26A 3IOYA 3KFLA 4HB4A 4MUAA 4QGSA 3GVCA 3UFBA 2CD9A 1JDZA 3CVJA 3PC8C 5EIHA 2PCLA 1A7JA 3NOXA 1ULTA 5T64A 2OOSA 3PI6A 3ZD9A 1JAYA 1US8B 4BNIA 3HY4A 3R09A 3ESYA 5FA8A 3RFFA 1HFWA 4MS3A 1W1WA 3GRVA 4RQAA 2O0LA 4MRMA 3R7FA 3P19A 4TTVA 1NW3A 4L3VA 1AKNA 3HN6A 5AKJA 1ZSVA 2JIRA 4MUEA 3U4MA 3LY7A 3AZQA 3GEDA 4XCQA 1QDUA 3OOEA 4LV5B 5DX0A 1MABB 1S02A 5DOVA 2JHFA 3C6KA 5AVTA 3ITDA 4G1VA 2D4HA 3ZI4A 4NYMQ 3JASA 1NDUA 1DAFA 3VTZA 3SCZA 4JK3A 4KHZA 5CPBA 1P9RA 3CUVA 3NBQA 3OZRA 1GEEA 3FGZA 3WMEA 2KE5A 3WDKA 4TRRA 3G88A 5EHGA 3UJCA 1M6WA 5B2EA 3TR0A 4MTCA 4Q05A 5C31A 2Q0HA 3BWBA 5CFRA 1KVUA 1Y3HA 2O7NA 2COKA 1O77A 3LOUA 4WPGA 2P35A 3HDHA 2FYTA 1PL8A 1XQ1A 3QEJA 1WXHA 5EIXA 1RZRD 4HNHA 3B2NA 3JQGA 4C5BA 1PQ4A 3AW8A 2P65A 4DR1B 2YDXA 2CMDA 4GO1A 3QPBA 4R3NA 5TMEA 2H9AA 1C9EA 3PGXA 1M6YA 3OEYA 2FFAA 3TW8A 5AM5A 3K3PA 4RLFA 5JCZA 1F7UA 4MULA 2XUJA 3PSHA 1PR6A 3ZOZA 2YQZA 3OPXA 5KNCD 3TQRA 4G1BA 4QU8A 1CUSA 4D8WA 4KQ6A 4QAJA 4EB0A 2POQX 1YXMA 2OCDA 2XWJI 4QKQA 1VKOA 2IBMA 2NU9B 1UC5B 1FP6A 5G2OA 1QRUA 3W2FA 5EJEA 2YJ6A 3F71A 1W46A 4DJTA 2HSEA 3DE7X 4BOYA 3GT7A 1Q3KA 1F8UA 3MLBA 1ZRSA 3T9DA 4E2ZA 4X3OA 2QX7A 5AH0A 2AC2A 1ZK4A 2HR1A 4IR7A 4ZAFA 3QNWA 4YRKA 1DOHA 2C2KA 1KZ7B 5A7FA 3IV9A 5CFLA 3SC3A 1PL7A 2GZRA 2G07A 4Y30A 4F1KA 2J3EA 3EUEA 1Z4KA 2Q1XA 3E48A 1D4AA 2VYNA 3ETDA 1JKXA 1UUFA 2OV3A 3MUEA 1IM8A 1FTYA 3JATB 1TDJA 3KZOA 3R2JA 1E2BA 1T6XA 3OICA 3RE1A 4DSNA 2WWVD 3AG5A 1VIAA 3GFTA 2A1UA 3HJBA 5TSDA 5JZOA 1L2TA 3LLVA 2PKXA 4W5NA 4PN7A 4UHJA 5AJYA 2LCQA 3WGTA 4KIWA 4CDGA 2AEFA 1MO4A 1R18A 2PWAA 4A8JB 3U4HA 5DIFA 3L1UA 4BLWA 1AGYA 1ZVMA 1YGPA 5JOQA 1U8AA 2ZRKA 5FOWA 3IEXA 2ZAOA 4MIEA 4QARA 1PIWA 4ARSA 2PX5A 2BFNA 1F4PA 4D82A 1B6RA 3AOEC 4CHGA 1GAXA 2E4UA 1P0PA 2IXEA 2XDQA 1UKCA 1GITA 4NC9A 5CNJA 3LX8A 1PF7E 1GPH1 4J0IA 3SU8A 1FFDA 3UF0A 1YBVA 1QHFA 2V97A 3ANYB 4JOCA 3G1WA 4DHWA 2JKYA 1JE1A 1B3RA 1YZUA 3GBVA 1XDWA 3KB2A 4PZPA 3ZWMA 4A0HA 1R66A 1WZIA 4O4IA 5I4BA 1W5AA 4INPA 2Q8QA 5ILGA 1WF3A 4D3YA 5FWNA 3K72B 2BOVA 2HWXA 4B3BA 3G5MA 3R75A 1CD5A 2BF4A 3UHJA 2VS1A 2X40A 2ZI3A 3GRCA 3TRKA 2HXSA 4L8YA 2DUMA 4IVQA 5AVWA 2JVKA 3M6AA 3ZIUA 4AY6A 5FPQA 2F1HA 5AM0A 3ZGNA 5FWYA 3L5OA 2WSSD 3HL4A 5LDGA 1JEDA 3AKZA 1X9HA 4X8MA 4EG4A 4KMSA 2QGFA 2VXCA 4G8JA 1EFHA 2CK3D 3OZVA 4K46A 5JCOC 1SKMA 1NR5A 1SWWA 3B7PA 4I9NA 4TYPA 2ZT6A 3VOAA 1MJHA 4FJ1A 1KPGA 3DHWC 1OWMA 5BRNA 3RSGA 3WICA 4PCAA 3M3HA 1E77A 2XE4A 4I5IA 5JRDS 5JSQA 1ZN9A 4NOMA 5HF5A 5BVGB 2XNHA 3EQ2A 3KAPA 8MHTA 4BX2A 1IXRC 2DBRA 3AEKA 3CUTA 3GHYA 1QDEA 1DC7A 1PEDA 1NUUA 4FUTA 3X1JA 4B6JA 4DMLA 1QGUA 2E5FA 3FDFA 2F2TA 1Z2OX 1M2GA 1G38A 4ER6A 2VZ9A 4X7BA 4KKVA 3FDZA 3AQIA 4YACA 4KE7A 2AFHE 4AWBA 2K6GA 4J75A 4AKSA 3A2MA 4IIJF 3FMIA 4WUTA 3V8PA 4YRBA 3GJSA 3WIUA 3IQDB 4E2YA 4W7IA 3B3GA 4FGJA 4NZOA 3AB8A 3DBLA 4MS3B 1UZUA 2AS0A 3BEDA 4AJEA 3DLBA 4MRMB 3T5CA 3DMYA 3L0ZA 1RLTA 4LV6A 4UXJA 5KKCA 1NHWA 3MIIA 5DXJA 4UM7A 4E7OA 5LMZA 3H84A 2HQ1A 4LIPD 5EHIA 2NZYA 3LZ6A 4Y6RA 3ZK9A 2DFPA 1I4OA 5DYNA 3VAZA 2Q6KA 3Q6NA 4GEKA 3UH1A 4IWXA 4MAAA 2Q99A 1N0UA 5CUQA 4JSYA 4YMUA 5LQNA 4BTLA 4OM8A 4B5LA 1PFVA 5AJVB 2A0FA 4MHTA 4DSOA 1T13A 2OCIA 4HGYA 3NU1A 3CPHA 3RNLA 5KYXA 2C2ZA 2XGMA 3BS4A 7GPBA 2XIJA 3P2YA 5G4KA 2O19A 3NNNA 5SYNA 1FS6A 2PXAA 3LBNA 5LQJA 4TTAA 2QS9A 3RC2A 3ORRA 3JQGB 4P1ZA 4QVKA 3SX0A 2CBGA 5HCUA 4RF5A 3QBDA 3GT4A 4Q03A 1RHMA 3OE4A 3KJZA 4LE1A 4BP3A 1PDWA 5SZHB 3U19A 1DIBA 2QN6A 4OJTA 3RG2A 4BV8A 3PFNA 3BQMB 3VNVA 2UZIR 3TGLA 2YJZA 2JAUA 3JZMA 1KJWA 3T5PA 4LAFA 3SYTA 3MGCA 3B8EA 3K0KA 1KAMA 2KMLA 4CBVA 4M0LA 1JFSA 4TTJA 3FMFA 2GM9A 4B6FA 3WLPA 4YROA 3KEQA 2UYYA 3LF1A 3Q2OA 4NPAA 5K0BA 5KC8A 4JIGA 5FO0A 2ERYA 1CNFA 4MMZB 2GKGA 2J31A 1CY1A 5CU7A 3GFRA 4CR6A 5EJ4A 1Y7IA 1KJ8A 3JWGA 1P5ZB 4IQFA 3C0KA 2J4FA 3QY0A 2V7VA 4J4BA 1O58A 1QX4A 3TR6A 4Q7EA 1LNSA 2HW8A 1MCZA 3S1SA 3C5WP 4MV1A 5CLHA 3TOXA 1DI0A 4Y6OA 4LSGA 3H8JA 5TJ9A 1O8CA 2B6NA 3PR2B 4C14A 5A5DA 5IEJA 1M0EA 2AYXA 3K9QO 1JLLB 1TU4A 3DE6X 3VC3A 3W1EA 4Z4CA 4EJSA 1KNXA 2JD0A 3HXOA 4M60A 1ELOA 1XAHA 1V8DA 4Y8VA 3UFXB 1QP8A 4FBGA 5BNIA 1WNTA 3T1VA 4UNSA 5ICEA 3RRNA 5CMLA 4AUMA 1IJFA 2A1UB 2Z5VA 3HDTA 4ZRNA 3OQPA 4R54A 4DCJA 4R1OA 5BWNA 4H6WA 4YPOA 1C7RA 1UWKA 3IULA 2RCYA 1VP3A 2XUAA 1GSAA 3PCTA 4KLCA 4XQEA 5I9MA 3UUWA 3WIVA 4ECEA 5IKXA 3OTQA 4JI1B 3U7RA 1EXVA 4YJ2A 2W2OA 5DEOA 3HCRA 1RRKA 1Z0FA 2PBRA 3E9YA 3P9ZA 5GMOA 4C89A 4EGAA 1UCFA 4WN3A 5JSZA 4N9QA 2J5XA 1RQLA 2AW3A 3M9LA 5L3ZA 3CRNA 3TQSA 1SY7A 3IQHX 4ZVRA 4BZQA 4EQ6A 2IY9A 2QZPA 2XDQB 2WDZA 4FGWA 1SC1A 2D3TA 1Q0TA 1UQRA 1HZZC 5B3AA 3MWEA 4JBXA 2R79A 3WIBA 4YYEA 3JAMA 1U8EA 3X1YA 3MN1A 3THOA 2XD9A 3THYA 1GZVA 4O4IB 4PSAA 3NMUF 5ALKA 3UJ8A 221PA 4M7RA 3UMSA 3ZWAA 4ZD6A 1WDKA 3TF5A 1TT5A 3O95A 1ND6A 3R5SA 3UH0A 2PZFA 2DERA 3BCUA 1WU8A 1GNVA 1MC8A 2QJFA 3I32A 3K94A 4RZUA 3ZTTA 4R83A 2ZSAA 3VNQA 4F0JA 2J3IA 4XWGA 2ODTX 3OLWA 4RMJA 5FWYB 4IPTA 3WYAA 4PQYA 1T2NA 5FWXA 2P67A 2WWYA 4OQXA 4B3JA 4GX1A 3V1UA 1G6Q1 4MDEA 2H3HA 2VI5A 3GO4A 4BPBA 1M2FA 1ACJA 3FPEA 3W6NA 2I2AA 3RRFA 5JXIA 4LZLA 4E2XA 4KRFA 3L6OO 1OY1A 1XMVA 2ZWAA 4KQHA 4OREX 4F2PA 3ORYA 7YASA 4AX8A 2PL9A 5L7TA 1O95C 1DBRA 2AT1A 4CMAA 3DQZA 1ZD9A 4C7KA 5B7PA 1TKRA 2C95A 4FE7A 3K15A 4NBTA 1EK1A 3AEKB 3AVTA 3A1UA 1HEIA 2E89A 4QOIA 1NBAA 2EC5A 1QGUB 2C92A 2AI3A 2E4ZA 3OFNA 3H5IA 3TIXB 4Z49A 3QJYA 4FQ7A 5KMGA 5ITWA 1NJ1A 2PQ2A 2WIFA 3FDZB 3IKVA 4RABA 3R7AA 2DY0A 4ZJUA 4HPWA 3NKLA 1ZONA 2VO1A 4PG6A 3EY4A 4I5DA 4QJIA 2YJNA 3T1NA 1JECA 2Q3JA 3SXUA 4P53A 4K28A 3UQYS 5D01A 3E35A 4QU0A 4GPBA 4D4KA 1M2KA 2LDBA 1ZOLA 2VSXA 4J0CA 2HSWA 3DBLB 4HQ6A 3VR3A 521PA 1H2XA 3ZUGA 5IVHA 1BG6A 1E7MA 1ZSNA 2I9KA 5KI6A 1EM8A 1WKVA 3OM0A 4IUDS 4RPKA 3GXBA 4ZO9A 2OXRA 4BFUA 4OQQA 3R44A 1JKFA 2P2NA 1U04A 2I8CA 3HWWA 4WMLA 3HB1A 3H1AA 1GAQA 1GGNA 1Q1AA 1T0IA 3SQLA 3SF8A 5I51A 4E5KA 2AOVA 5DI3A 1JFLA 3HZHA 1I4DD 2CJYA 2FPLA 4POAA 2QVXX 1U0TA 4W9NC 4KOEC 1E9FA 2X2OA 1UKYA 2QJOA 4AW9A 4J8PA 3FUXA 2OG1A 5IU6A 2V6FA 2HLHA 4ID9A 2BHSA 4JT4A 3BA1A 3HDJA 5KAPA 3R9XA 1OBHA 2A88A 3DBOB 3TAUA 3IA7A 4M89A 2C4UA 5KYXB 3EGOA 3NT5A 5ALTA 2D1QA 1DXHA 1THTA 2QLTA 4M8IA 4W63A 5G4KB 1N77A 3KEMA 2Z8ZA 1LQUA 1FVHA 2Y1XA 3AUUA 4G0UA 5I47A 3BL5A 2ILVA 3KB6A 4JP8A 3O4FA 5JS8A 1J5EB 2DSNA 2X0IA 1LRKA 1PHPA 2ZRJA 2YX1A 4HB2A 3EZ2A 1V4NA 1FSFA 3TZCA 4FNAA 2IZ5A 3R24A 5HE8A 1GPWB 5HTKA 5A4DA 3LDGA 3HY6A 1W93A 4N41A 1U0GA 2FX5A 4QVIA 5A6VA 4MV4A 4RFVA 1VQ1A 1ZVVA 4L9WA 3P2KA 1UEJA 3RIEA 1DDOA 4DJJA 3GZJA 3QITA 1IUPA 1Q7TA 3GJ0A 3MUFA 2OP0A 3L8CA 2VF7A 3GAAA 1T6YA 5EKDA 3FUTA 1LV8A 4JVOA 2CUKA 3I45A 3NJ8A 1G5RA 1PDOA 2PGOA 1WDLA 5ALGA 3FKQA 1H65A 1TQDA 5EQFA 4B35A 4MNTA 4KDEA 2C9ZA 4ZO4A 1ANKA 4FJ2A 3EVTA 1NJ2A 3KJXA 3V8RA 3ER9A 2OD7A 1GZHB 1SIBE 2ODPA 3S29A 4KUGA 1J8DA 2Q3LA 3RHTA 1U9IC 3FROA 3IE0A 4X1OA 5K3FA 2XMGA 1UXOA 4ZC1A 3WDMA 3C7CB 3NHRA 2IU3A 2QG4A 3PR3A 5M29A 2N1MA 1B23P 2I55A 2HJWA 5HKOA 1FDVA 3UV7A 2P1RA 1W73A 1JJFA 1YNSA 4CKBA 2F48A 3I3SR 3QYPA 3LP6A 2H0QA 3SJUA 2PBZA 2NTYC 3VISA 4WNCA 4BKPA 4GXQA 2D74A 3LPAA 10MHA 3VNUA 3CF4G 1GNRA 1EESA 1AMNA 1SC9A 4P80A 4FFRA 3WNVA 3E2MA 5JSZB 1DQSA 5BSVA 4GWGA 2RMKA 3H17A 3AC0A 2Y1LA 3RVDA 5IM4A 1JQKA 1D2CA 4EQ6B 5LP6F 4QULA 3ZDBA 1FE8A 2ZTUA 4IOLA 4LRSB 4CL0A 2PY6A 3IQEA 5KNDH 3MWEB 4JJ4A 3AZOA 5EGSA 1XZLA 4B3XA 1K2WA 3DYIA 4DMUB 1A0OA 4U8GA 2XOKA 1V6SA 3L7BA 1L5OA 3O2NA 1GT6A 4FMDF 4NE7A 4M1WA 5AW9A 3WTBA 3STTA 4CLEA 5HOEA 4W5OA 4DMRA 1XHFA 2BE9A 3D4NA 2HCBA 3V55A 3N6XA 4E2WA 1TT5B 4H16A 4XW2A 2HCFA 4N3AA 4JDUA 3W7VA 3JAKA 2H5EA 2XLBA 1OVMA 1VLQA 2IE8A 3M70A 4X6LA 5FKJA 3RS9A 4DLTA 2WUWE 4EKNB 2GHTA 2PVPA 2B6HA 2Z4SA 5HZGA 1BFDA 2HK6A 4MROA 4PO8A 5FWXB 1LKZA 2Y1CA 3STWA 4AJJA 1II0A 4HXFB 4C2AA 5CA1A 5H4GA 2DOKA 5AVZA 5BY2A 2TYSB 3HGQA 3JS5A 3AT1A 1TECE 2AOUA 1FMJA 1YCDA 1GCAA 3EUAA 4U7JA 5FPSA 1QFZA 4RVOA 4FOPA 4RTLA 4MB6A 1NM5C 1BA2A 3VUFA 4B34A 1CLUA 2QT1A 4H3SA 5TIIA 2PVSA 2C5FA 2O2HA 3FJ1A 2MT9A 3OEEA 4M0EA 4X44A 4A0SA 1NXXA 5THQA 1UKZA 3ZH9B 3BWMA 1EVKA 1ZVJA 3H9QA 1U2QA 1X2BA 1VSUA 3E03A 4O2LA 3H04A 2V9ZA 1E5TA 1UODA 3BD8A 4EX7A 3M4YA 4BNGA 3FWPA 1OT5A 2CE2X 1K0FA 2GYWA 5E2IA 3SXUB 3ZLVA 3WE7A 1LQ2A 3GJ3A 2H1VA 2FKNA 2QA5A 3V7FA 4NJOA 4YUXA 5BQXA 4O4LA 3D6TB 4QBHA 3BTVA 4AKEA 4XUCA 3GGPA 2P4UA 1V8BA 3QXSA 4YP5A 1V9SA 5BO5A 2Q6OA 2HRCA 1EJ0A 1GEGA 1N9GA 1XZ8A 3C1AA 3KBOA 1DPGA 4I9FA 3FIJA 1E59A 4M38A 2HGZA 2B4YA 1EM8B 3WOVA 3L9XA 2AMLA 3ESBA 1WV1A 5AK3A 1Y33E 4IRXA 1T4BA 3L4BA 1Z7YA 5EXTA 4HNSA 3ZJUA 1I80A 3I9JA 2I1QA 2P5UA 4HLUA 1CY0A 3P9SA 4RSRA 3RK4A 3SF8B 3W34A 1L1RA 3GPBA 5DI3B 4B40A 1JHUA 3DFKA 3B70A 4UVGA 5CIQA 4I8XA 4RVHA 1CUUA 5HFJA 4V0QA 1TAGA 3S27A 4PXYA 3WSTA 3CG0A 5CW2A 2NTVA 3G2OA 2JANA 3FOCA 2JLZA 2XWPA 3SHTA 3K6KA 3QX7A 4RIFA 1EHYA 4MP6A 1AQLA 1SKYB 2GCEA 2GPBA 3T06B 3ITNA 2OMKA 3H2GA 4JEHA 4WW0A 1ID1A 5D5HA 4ZYWA 1W30A 1GU7A 3C97A 2JJ8A 2H48A 3U6KA 2GPJA 1U9ZA 1ODCA 2NOAA 2VK1A 2FA9A 4L51A 1QPBA 3INRA 4BV3A 3CX3A 2YV3A 3AFMA 3JYQA 5G1OA 5KYWA 3JW8A 4E5VA 5ITVA 3QUAA 4XWOA 4OTZA 1RJDA 2F17A 1G3QA 4V1CI 2X0EA 1G3IA 2BISA 3GOQA 1OFGA 2CCGA 1U2RA 3MW8A 4N7JA 3K20A 4BVFA 2QTHA 3CZPA 2J7KA 2YZ7A 4ZA2A 5G3YA 2Q9BA 5IYZF 3UAGA 4C4AA 4EABA 5K45A 1V5EA 2GEJA 4DZZA 1PZFA 2ZM5A 4L02A 4G5XA 4IIBA 4O0LA 3DGEC 1T1GA 4PSVA 3FZNA 4W7HA 5KYYA 1WXDA 3IJ5A 1HY3A 1SCJA 2WB4A 4IDNA 2QRGA 4PR3A 3OQJA 4JJEA 3WLRA 1BGVA 3LKVA 2J0UA 1MV5A 3C41J 2DVMA 4IRMA 5DNDA 3DT8A 2P0YA 2PT9A 2R4TA 4OAOA 1HV8A 5KOIA 3DE3X 3FR7A 3LPCA 1J9GA 1E7YA 2VHJA 3NIGB 4HGRA 5AHOA 1VPEA 2WHRA 4CV1A 2XOKD 1O9HA 4QOHA 5HIIA 2ZYWX 4BO8A 5AW2A 3WYBA 3FGNA 4AYXA 5KVAA 4JUAA 1A2OA 4CM4A 3UBTA 3ZE6A 2FSVA 1GRCA 5K3FB 2O3QA 3SKXA 4XWYA 1GM5A 4A2QA 3A9CA 2H18A 4OMDA 4LPKA 4WZBA 4WY8A 1DEHA 2W7TA 1U7UA 3NFYA 4V39A 4N6OA 3EC1A 4BO4A 4J07A 4CKBB 1U2GA 1NNI1 4NIMA 4PYRA 5KIAA 2QYOA 4FYVA 1O5IA 3S8YA 4Z4HA 1T5TA 5JWRA 2F59A 3B9RA 3CSDA 1C1YA 3FD8A 4L0MA 2YUIA 3AF0A 5HIJA 2FUKA 3D3JA 5E2AA 2H92A 3VZDA 3B52X 3GDFA 3HYRA 1T1IA 3B8HA 4BC1A 2ZI5A 4HRYA 2DBYA 3UJ7A 1ILWA 1CC1S 3IIEA 4PLTA 1CHDA 3LW8A 5B36A 1CUJA 1GOTA 1A04A 5IBRA 4OV6B 2JL1A 3CVUA 3LS2A 2B4RO 3FPJA 2CBZA 1PZEA 1Z8NA 2AG1A 1KHTA 1TW2A 3I5MA 2OLEA 5DF1A 1ZD5A 1FDIA 1Z2PX 2BVNA 2QLBA 5JJBA 5CIWA 3MTQA 2BEWA 1ZH2A 1KDOA 1BKYA 2BKXA 3H8VA 4ZCIA 2DGDA 4CJXA 1Z16A 3D4OA 1J20A 4KH0A 4ZOCA 3SM3A 1Z7EA 1SVKA 1ZNYA 3G8BA 4CCAA 4D9GA 4K3UA 4EFMA 4F2WA 1GG2A 5JCPA 3JAKB 1XQWA 4BTEA 4OM7A 2ISCA 1MX5A 4LBWA 3ISTA 2ZU0C 3NUQA 5HHTA 4KCGA 2C97A 1NW8A 2A9VA 2CHFA 3QLTA 1VKHA 4H9GA 3A2NA 2BGTA 2AHOA 4W8OA 2JEYA 1JS1X 4XQCA 4Q1EA 4ENVA 3DCJA 4HDMA 1BSVA 3EXG1 3G0GA 4FEAA 3UAOA 5ADUS 5CA1B 3I92A 4GMDA 5IK2A 1VE7A 3VKWA 2AOUB 2OOKA 1ENZA 5GONF 4I8DA 1NVDA 3I12A 2RC6A 4ITUA 4L73A 1EB9A 4OF4A 1E5DA 3O3OB 5EJAA 3TN7A 4F1WA 4KYTA 4NU0A 4RFLA 5HILA 5LMCA 4GLOA 2YMLA 3QHQA 4RIEA 2KB0A 1MJ5A 5EJGA 2Z98A 3AI1A 3O75A 3MYYA 1AKVA 2DTDA 5D5QA 1BVUA 1P7WA 1RZ3A 1WVGA 4PAWA 5AQ1A 2WSLA 5GPBA 3IVRA 1L4HA 3EZ7A 1GQQA 4RGVA 1XA4A 3W9UA 3IURA 3K0AA 4ZREA 2YVUA 1AKWA 2CWWA 4JT8A 4RYLA 5CITA 3NTQA 2QRVA 1DV2A 3B1KA 5AJHA 4KLNA 2P40A 4K6HA 5AESA 1TMKA 1EWYA 4LHSA 4O4LB 4ZTBA 4YV1A 2GXAA 1AD2A 4EFDA 2W71A 1ZK2A 1I1QB 3PC4A 3W7BA 2ZB7A 2XCRB 5KDOA 3GLFA 2FVYA 1JJVA 2RH5A 1KDRA 4ZEVA 2AUTA 1N9GB 3NV9A 3A4IA 3IRUA 4ZMRA 1DT3A 1YBAA 3KOYA 2ZVJA 3ESCA 3OTIA 3M6FA 2QMHA 3CX7A 3EAFA 3AI3A 5G0SA 4PWZA 4C1BA 5L4SA 3G0HA 3MJDA 2IY7A 1AB5A 1Z4NA 2C2MA 4PNZA 3O74A 5CH3A 2Q62A 1CJUC 1H2WA 3CONA 2XHZA 3HXLA 3W79A 1JSCA 4EJMA 4N0DA 4YJFA 1L7EA 1S8OA 1QV9A 4HI0E 4B6SA 2IP2A 4BNDB 5DN9A 3IEPA 4XLZA 3DMTC 4KITB 3NXKA 2VBGA 5C5EA 1KK1A 4BO7A 3ICVA 2R1VA 4Z9YA 2IEIA 4RENA 4ZVQA 3UAYA 3GX1A 1P9WA 4H7EA 2I34A 2YMPA 3EMBA 1U1CA 3EEBA 5JY1A 5KJCA 2WJHA 2GEKA 4P34A 3LHDA 1DELA 4Q3CA 2NPFA 3GVPA 4XEHA 4QJ5A 1RWKA 2CVQA 1YI1A 2EYQA 4QUJA 3ZLJA 5BQOA 3GFBA 1YJAA 4K8OA 5AKKA 1WD7A 2J32A 3RUHA 4PEVA 4H1VA 1MT3A 3A58B 3VNSA 4EEKA 5BOVA 3QV2A 2TS1A 2E4XA 5TEWA 1GRNA 5CDUA 2VSQA 1Y6RA 2ESRA 3JRXA 1XXLA 1YIDA 3H3JA 4KEAA 2OR3A 2PHZA 5A3SA 2PLRA 5JNWA 1YFJA 4EP1A 1VLVA 4AK9A 1M10A 2W48A 1HI9A 3DDCA 4NOJA 4P5EA 5HRAA 4X1YA 5KYYB 4OI4A 2VLIA 2MTBA 5DLPA 3JZIA 4RETA 2QVCA 4EWLA 2WKWA 3D0QA 1KH2A 1Q91A 3DAPA 4L2IA 4TLCA 3OPQA 5DHRA 2J0UB 2ENWA 2VRCD 4RDHA 1DG9A 5ED4A 4OHMA 4E21A 2QRJA 3K0BA 1IE3A 1TVMA 4JZKA 4YJ3A 3I6QA 3W8FA 3OQIA 3FNBA 3HC7A 4R1MA 3C8MA 2W0SA 3TUJC 5E6SA 3FVVA 3NHUA 4GP7A 2IF0A 1KEWA 1DQZA 1JYSA 2CFIA 2ORWA 2YYZA 3KWLA 3PNPA 3ULKA 4D79A 2VUIB 3NOVA 1LC3A 5T4BA 3KQQA 3NR2A 4YCJA 2R6ZA 4CM4B 3PJRA 3DB2A 3MTJA 2O2YA 3KB8A 2GWHA 3MMSA 3O0TA 4G9EA 3RSQA 5AICA 3WZMA 4B09A 4WKBA 4QTTB 2RGEA 3RASA 2K7FA 1Z62A 1FTWA 1PGNA 4WZBB 3FHTA 3MNFA 5F1KA 2IYZA 4C07A 2ZULA 4XDZA 5CW1A 4HP8A 4BMPB 1T4DA 2JVIA 1NVUQ 1SVSA 1UADA 2H57A 4JX8A 3NP9A 1H6BA 2Y1EA 3QYFA 2WVJA 4PQGA 4QJBA 5K4AA 3LTNC 4XUDA 1U5CA 3VJRA 2C9CA 2Q21A 1CZHA 1PZGA 1ICIA 3O03A 5J5VA 3D8HA 3O5AA 1D7AA 4MA5A 4WOKA 4DREA 3BL8A 1W2HA 4AP6A 2VPZA 4P35A 3ZIDA 1OU4A 1JEEA 1V48A 1F5SA 2GZAA 2WC1A 4OB8A 1T2AA 4GBED 1MB9A 4MZDA 3OBBA 4Y2TA 5GVRA 3N2IA 2Y2VA 4C4YA 3N2GA 4UVDA 1NLUA 1KQ3A 3D3KA 1QVZA 2BEWB 3ROKA 3QU4A 1MD9A 2FUCA 1QPGA 1R8XA 3PUWA 3PC7A 4FFBA 3VZCA 1E9BA 4O2AF 5AK4A 1ILEA 2BFOA 1YVPA 2NWQA 1ADFA 1PR3A 4H1TA 2NXJA 3ZQUA 3MXTA 4B84A 2O8EB 3TLBA 1YZFA 5AW8A 1JAIA 1HG1A 1Z0AA 1XCMA 4JB2A 5IBQA 2ZUCA 4OJKA 3V32A 4TN1A 1J90A 1XMIA 3BTOA 3HG7A 4HQ0A 4B2YA 3CEMA 2HF8A 2BWJA 1A9OA 5HX7A 4XD2A 3IERA 2VAVA 5CB8A 3IIKA 3PXCX 3B6KA 2VP4A 3HQ4O 4BQEA 1I2ZA 4EA8A 3TPCA 3ZE7A 1TPYA 2H4HA 2QDXA 3H05A 4X63A 4RZ2A 3U7EB 4DG5A 4CEHA 1A72A 5JHGB 3ROTA 1RP7A 3P45A 3CF6R 3RFVA 3NBYC 4GC9A 4OO3A 4E08A 3VDQA 4HWKA 3ADPA 2VRBA 4ROSA 3D4BA 1SGWA 2ZU6A 5BRJA 4CXMA 2NP7A 2UXDB 1UBFA 1SHZA 2D0PB 1TI7A 4NCKA 1SKYE 2FW0A 4JS0A 1Y4UA 1EFTA 5A7HA 3SIXA 2O0KA 3MQFA 3RBXA 3K0AB 3QKTA 2Q0SA 3WK7A 4JODA 2EF0A 2MYUA 2QRVB 5FBVB 1WTCA 2VQFB 1M54A 2GD6A 4MW0A 1R00A 3RI3A 3QFRA 2XDAA 3TVDA 3M0EA 1L1EA 4HYQA 4ND5A 4RTRA 4AF8A 1RXSA 2SNIE 3A6JA 1FLVA 1OKKA 3GLFB 1UL1X 2X13A 1Y5LA 3IVCA 4BMDA 5FAKA 1B0AA 2IYQA 3MUOA 4GSKA 3C3DA 2E1PA 3H2ZA 4Y2UA 3KJEA 3KUDA 4Z86A 4AY5A 3QG1A 2A9JA 3LWDA 3WK4A 3OCJA 1WNFA 3BF7A 5AVRA 1TTQB 2H06A 4S1VA 4B7AA 3IP1A 3UT5A 4G25A 2GMWA 4YJFB 3DMFA 2P75A 5B1DA 1NLZA 3SZGA 5KNDA 4F9FA 5LQDA 1Z8DA 3RBVA 4TVBA 5TY0A 1V8PA 3RV3A 5BUZA 2R1VB 3WZLA 4HVTA 5JXHA 1IB0A 1L3IA 1VYVA 3S1AA 2V9CA 1NMQA 5C4MA 1T26A 4XYGA 1FYXA 1G7CA 3E2IA 5CVVA 4E07A 1ZOSA 5CAEA 1S2MA 1YJ5A 2CLIB 2DFNA 4YAJA 5JZMA 3AF2A 4XAQA 4CLRA 1Y9EA 1BHSA 1T9CA 1O57A 2NYAA 3EZLA 4JP5A 4RM2A 1Q84A 1VJCA 1NKSA 2C5AA 4G0XA 4M49A 5KQPA 5EAIA 1L7PA 1LFAA 1OWNA 2EBHX 2LWIA 3LOPA 3DTVA 4RVUA 2Q7DA 4NBLA 2DP4E 3FSGA 2PLAA 5EXPA 1VJ1A 3WBBA 3ROEA 5HFNA 1SURA 3ZJTA 4NZZA 1K3FA 1QU2A 3G0OA 3K5WA 4R5HA 3G6WA 4QVGA 4X1YB 2JAWA 5EWLA 3IBSA 3P27A 1E3WA 3GH1A 5H7XA 4CU2A 1DEOA 4UVIA 4EO7A 4L2IB 2DPYA 4G0ZA 3MBIA 1EG2A 4I9HA 1IN7A 1PV4A 3CVYA 4YJ3B 2GCNA 2YZNA 1GQSA 1QZXA 3IMCA 3N75A 4GNKA 5LQSA 5E6SB 3QKIA 1XNJA 1N5OX 3A8TA 4PGFA 5GJWC 3AGPA 2Q6LA 1BCRA 3DE5X 1SEVA 1AN0A 1ML4A 5DN6A 5E9AA 3WA6A 4AZWA 4YJKA 3PP8A 5L45A 2XMZA 2O7SA 3LSTA 3E3MA 4KQEA 3FUWA 2C5GA 3GG2A 3PI7A 3R4CA 4KVGA 2IBTA 2ZJYA 3ZGZA 3UHOA 3ZDFA 4KXFB 3O8RA 3FM9A 2EKDA 2XGOA 3HJGA 3II6X 2X19A 1KEZA 2Q7XA 3F74A 4RKEA 1J7JA 2OD2A 3FCSB 4ENSA 4FTWA 1JHXA 4L0QA 1E7SA 1JH9A 4JUBA 3OBIA 2WJ4A 2WWRA 4CV3A 3OG9A 3R8XA 4BZWA 3FBGA 4L8LA 1Z68A 4DG9A 1NAIA 2B36A 1E6UA 4OYHA 5AJWA 3R6DA 5NLLA 1UBOS 1DIGA 3GCWA 4TWZA 2A7QA 3U37A 3K35A 2GDJA 1HDXA 3CINA 4PLZA 4IQ4A 4NMMA 4ZI5A 4MI6A 4HDKA 3SBDA 5LIRA 3QJGA 2BM9A 4OEHA 3N2GB 1A5AB 2OCPA 3JYOA 2NN3C 3HLTA 4M4SA 1A9XA 4LRUA 1V9LA 4FFBB 3FCEA 5KWIA 1P2FA 2H54A 4ZO6A 2LW7A 1N5MA 1FVXA 2W4QA 4D9CA 1MF7A 1EX7A 5EUBA 1ORHA 5EQTA 4J4HA 3DQQA 1T3GA 1GTVA 2JFHA 1U9CA 1IQUA 4GP6A 3LYHA 1ISMA 1ZX1A 1W581 1ZOPA 4IDHA 4AMYA 1KQNA 4C0WA 2I8AA 1O9GA 4B82A 1C3LA 3BRWA 3RHFA 4IGAA 4PVDA 1EFDN 3FNQA 3B51X 4PZZA 3RIHA 3A11A 1CUYA 1JB9A 4D99A 1L1QA 4CN8A 1EIZA 4MQ5A 5CT4A 3ILYA 5KTNA 4CEHB 5A0TA 5FFFA 3NDPA 3FOZA 1CUGA 5FBZA 3SVLA 2H52A 4RL4A 2QPLA 2AEMA 2MYTA 4KQFA 4LJ6A 2IEYA 1SCAA 3L7YA 4B71A 4ARUA 3GUUA 3EISA 3M6XA 1GNPA 3E6AA 3CVOA 4Q9HA 3ZG6A 4JBWA 2V03A 6CHYA 4FSXA 4DC1A 5J1SB 3F73A 4Q00A 5K20A 4LYJA 2C7BA 2YN2A 2C98A 4HADA 3C5CA 3PE4A 4KXLA 2Q3HA 4J2OA 5ICCA 1WP4A 3JTMA 3P97A 3UTCA 3W9YA 2ZJ5A 2OV6A 5I7OA 5KWJA 3U4GA 2WNHA 3B1ZA 1YWGO 3NEAA 2QPOA 4A6XA 3NV7A 5F5XA 3KKEA 3Q3HA 3GNLA 3QXHA 4EHAA 5C9ZA 1ICEA 1OQAA 4F5DA 3A6FA 4YIHA 3R7LA 1UZAA 1EHCA 2C8VA 2O7VA 3GZ4A 3I9V6 3MWGA 4B87A 4K81B 3DOOA 3E7FA 4LPSA 4O25A 3ZCTA 1GPDG 1ETUA 5FT9A 4F5WA 1F1BA 1BX3A 4EAQA 3OLCX 2WTBA 1DNPA 4YRMA 2YUTA 2Q0XA 2P62A 4WAUA 3FDIA 4ACAA 2X0JA 1TM1E 2ADFA 1UXKA 2XUDA 1SM4A 3C3KA 1WCYA 1WIWA 3L93A 3CX6A 4CT5A 4BLSA 1HDCA 5MFPA 4KQGA 4EA6A 1F8YA 1V35A 3V33A 2I7XA 3U44A 3A37A 4AKGA 4WY2A 2XCQA 3S1AB 3EXHB 3K73O 4Z6KA 5LLTA 1K8RA 1QANA 1P2DA 3M9WA 4WNIA 5CAEB 2Z1DA 2Z2KA 1DRJA 4NP6A 1EMDA 4CLRB 2JKZA 4NYMR 1RHRA 2VHYA 5EJ2A 4ZYUA 4KXXA 2FW6A 3D4IA 2HK8A 4WZBE 3T0GA 5HOQA 5JV5A 3VQTA 4Z4IA 1HDIA 3DZFA 4N01A 1ZGBA 4CMGA 2PMBA 1Y89A 3DTVB 1T0PA 4EUNA 3CRRA 3GUYA 1YR1A 3GOHA 4DLKA 1RI3A 1U7OA 4G2TA 5K3SA 2X8JA 2AQIA 3W2EA 3VSDA 2JH8A 3ON5A 4S1WA 1LPPA 1N2EA 2GILA 2UVDA 4ZT7A 2X15A 1YQWA 3MMPA 1IVNA 1SUFA 1V3VA 2VAPA 1E3WB 3ADKA 4R84A 1K9VF 3Q12A 1PZHA 4DDHA 3G1TA 2X77A 1L9XA 4IOMA 3N53A 3AZPA 3EQ9A 4JLPA 1P4AA 2XYRA 5BW8A 4HN9A 5L8VA 5HM6A 1UH5A 1EUDA 2WT8A 4QLAA 1ZAYA 4PLPA 3R1IA 1KBQA 2WI8A 3SE0A 1H9BA 1BCRB 2RKBA 3VJLA 5F12A 1N2JA 1VI2A 2BHNA 3UA3A 1JG7A 4IXDA 4ED9A 4IJUA 4KSCA 2O2JA 3ISVA 3VR6D 5BN1A 4IGIA 4DLYA 4B3FX 2G80A 1RXYA 5F9MA 5HM8A 4PFJA 4RZXA 3BAZA 4HRXA 2HA5A 2LP4Y 4KO4S 2G8NA 3HNOA 1JHPA 2GQ0A 4RJIA 4QBKA 4UNNA 4R2XA 1W96A 1QE0A 1NFRA 2VDOB 4JP2A 4WERA 1FTGA 4PLVA 1L4FA 2I4RA 4GSLA 4LVOA 1YBFA 2LD4A 1BMFA 2M6RA 1V8FA 3DFMA 5EVCA 2IHVA 1QONA 2C07A 4OHOA 1V11B 3P0RA 4LJ5A 4F04A 3C8UA 5A6SA 3RS5A 1HNZB 1NMEA 3C5VA 3TRHA 3AI2A 4P4UA 1KP2A 3I0NA 1KVSA 5EHNA 3ZZTA 4H4DA 3SQWA 5AI4A 4ZQFA 3D54D 1GT91 1F20A 3GYGA 1ZR4A 5AQEA 5DHUA 3UM9A 1QYCA 1UMDB 1PJ4A 1I6LA 2DFVA 3DWGA 3ETGA 3GJ4A 4HDKB 4PHTA 4WESA 4H1WA 5C4IA 1AHNA 3LCRA 3M81A 2AL7A 2H8KA 2F4NA 5HW0A 1CFJA 1EBUA 1HSZA 3DKIA 1NXVA 2BJVA 1WXQA 4EW2A 3KQLA 2J0VA 3DW3X 4GZ6A 2QR2A 1JHQA 3NASA 3GLFE 3LYUA 3C43A 1TIBA 1Z6AA 2WF8A 1VZ2A 3JQ6A 4DDTA 2M98A 5LU8A 1RMQA 1A27A 4WZAA 3ZW8A 4HWOA 3TXYA 1VRCA 1PGPA 3VOTA 1P4SA 1MQ8B 3RRYA 1EXNA 3DEZA 4D8UA 4QLOA 1KI9A 4DJ5X 1SOMA 4IGFA 1T3ZA 1KK0A 3MJEA 1BW9A 4MWGA 4XFDA 1JIQA 1W2GA 1EFKA 5I7FA 5K03A 1YTLA 3ROFA 2R5NA 1MC1A 1D0VA 2O3UA 4WFKA 1SXJA 2CYAA 3AEZA 4A7PA 1QG4A 1UOQA 2I7DA 3GAMA 3QU9A 4NMXB 4TV9A 4ALLA 3GA5A 1H22A 5JT1A 3BBLA 4EIWA 3TZ6A 3GQBA 5T4EA 4UFPA 4EPWA 3GVIA 1RM5A 5PNTA 4FN5A 1WDTA 2V96A 5AM3A 5JYBA 3WLOA 5KS2A 5L6LB 1W88A 5LZ5A 4YWHA 1DG3A 4MEAA 3MCAA 2O0HA 3ESDA 3WVNA 5HJ7A 2CVHA 2DHEA 3BMNA 5D3KA 4CF7A 1COZA 3G0IA 1TJPB 2L18A 2YMMA 4L27A 5FFMA 3PF9A 5IBCA 5B3KA 5IEBA 2O07A 1O6ZA 4HEJA 1T5HX 1U0FA 4LF8B 3FOBA 4P31A 3SZUA 1NRIA 3R20A 4LNHA 4X3PA 1N1EA 5HQ3A 2DHDA 3JQEA 3ZU6A 1NRXA 2R4UA 2ZIUB 3TLYA 3F7TA 1IOLA 1H6AA 1UT6A 2D1SA 3DZ8A 3KKNA 3L3BA 2V0CA 3TMYA 4BGEA 2EBFX 3EH2A 4I1YA 4TTRA 1U28C 1I5EA 2D4AA 1SOWA 1XDZA 2QM0A 4G65A 4I66A 1SXQA 3ZE8A 1LCIA 1S1CA 3RFTA 1E2GA 3S4YA 2HMSA 4GM0A 2IEAA 2W5UA 3E70C 1JEOA 4CM6A 2ZTMA 1HMPA 2F64A 4C5CA 1RC8A 4O8CA 5G41A 1RJFA 5ELLA 4FMBB 2QR5A 1K2VN 5FR2A 3LE8A 4EVSA 4J6FA 2OC9A 3ZX5A 2C4HA 3L1HA 3A1WA 2DFKB 3R3YA 4G5HA 2ZVQX 5L7YA 5CCEA 1GYRA 1BWPA 1JQDA 1QHHA 1SUEA 4ZCQA 1V5FA 2C5SA 3V8NA 3WR5A 3U44B 1DLIA 1KJZA 2YHAA 2PWPA 3CZ5A 4OJYA 3NB0A 2IEDA 1CZRA 1CJBA 1SMKA 2CLCX 4QUGA 3DBIA 1HYEA 4DXDA 5JZSA 4ABYA 4JI8B 3T3OA 4NU8X 2F55A 2F90A 2VF5X 3D3EA 3HA7A 3PIRA 4HFMA 3JPYA 2PRKA 1ZRNA 3K1ZA 3N5KA 3KSZO 1BDIA 4KAFA 4X60A 5GZ3A 1XYGA 1OVGA 1XL1A 4D4MA 4J0GA 4N5NA 1CBUA 2FRVA 2X8JB 3NBZC 2V5VA 4YCDA 4DMKA 2C5HA 2H6EA 3L6UA 4G1FA 2ZR9A 5EWJB 8OHMA 3D5EA 5B3JC 2JFBA 5CJJA 5E1BA 4ZDIA 1VZ3A 1FJGB 2YN0A 1X9IA 4FNMA 4EYKA 5BXYA 4AU1A 3VSBA 3T7IA 1TQ8A 4FMCB 4MR9B 1X15A 3DMNA 1U7HA 4RD2A 4XQ9A 4F9EA 4X41A 4ZZ0A 3GJ5A 2GO1A 3PTAA 1HLGA 5ILOA 1EUDB 4MJ7A 1TUIA 4NYIQ 4XB6B 2G4VA 3V8EA 1CYDA 5F35A 2RG7A 3ED1A 4LJYA 1Y37A 2YWEA 1PL6A 2IKQA 2HJ9A 3KIPA 4OXNA 4YHHB 3RC8A 3OSZA 1CIJA 1L7BA 3LCCA 3FYUC 5IAAA 1NUTA 1LTHR 2BMAA 1IAVA 1GAJA 3DFUA 2W37A 4B3IA 1DBSA 2X0KA 4JKYA 4TMTA 1VBMA 4JJFA 1OXSC 1HMYA 2WKQA 2OO5C 3DZIA 4LGVA 4U6QA 5CM9C 2IHNA 3E4DA 1ZGCA 4WK2B 5EMNA 7MDHA 3S5UA 3T0FA 5JAOA 1CK4A 1E8NA 5IF3A 3NONA 3RS8A 2BR5A 3RSHA 1JQJC 1Z12A 2ZBFA 2BEKA 2EW1A 2ZKLA 4RGQA 1FP1D 1Z75A 5K0TA 4LWOA 1WULS 4KOAA 4MPDA 1K8QA 4MYCA 4EMTA 2YZKA 2DHCA 2ZKIA 2PKQP 4L8WB 4URUR 5A6SB 1NMYA 1IZ8A 4NTZA 2HEGA 3I9V1 5DPMA 3UQZA 1RKQA 4I2NA 5EL0A 4ZXFA 3TL6A 1AO3A 4GVPA 2VZLA 1KAEA 1R64A 1UC4B 4I50A 1U0HC 2VF4X 2YJ5A 2ZBUA 4LXUA 4RPLA 4TUYA 5U1PA 4B5KA 4WESB 1RYYA 1O6GA 4GOMD 4LBYA 3T8YA 4FGSA 3VUEA 3RS4A 4D6XA 1OILA 1N5JA 2Z2JA 2FEPA 2FPPA 1PQWA 4ZEMA 4IBOA 4NI5A 4D92A 5A06A 3B7WA 2GT1A 5C8DA 1NQXA 1YL7A 1QIJA 1YQXA 2GWRA 1IRXA 2IEGA 4ZT2A 4F9GA 4N6NA 4O2BA 5GJVC 3U9SA 4KR9A 2IYRA 3VTFA 4WZAB 4X9XA 3TUIC 4X6YA 1OR8A 4WDRA 2AWNA 1QJCA 1YZLA 1CY7A 1NLYA 4HS4A 4KAAA 3GJTA 5JRZA 4QNMA 5JECA 1ZXLA 5KJEA 4IIGA 5AW6A 5GOZA 3ZI7A 1BW9B 2ZJOA 4I1RA 2Z9BA 4I14A 1N5IA 1XZFA 1SXJB 1X8JA 2YHIA 4OQNA 5A4AA 3RU2A 1VL2A 4TV9B 2CV2A 1X7WA 4FBLA 2WJPA 3KKPA 5BMVA 3RLIA 2VL7A 1W88B 1W0JD 3C5EA 4R6WA 1ZZEA 3UVEA 2Z3VA 1WXFA 3BMNB 1NNSA 4E3ZA 5F9FA 4REQB 4TSRA 2UAGA 1Z6PA 1EGHA 3DEHA 2P90A 3KEFA 4JYCA 4M9RA 4MVJH 4WHMA 1Y1LA 1P77A 3MLEA 2B37A 3NZEA 3P2IA 4RS4A 2C59A 4BLQA 5GZ1A 1XLWA 2YXEA 2F1OA 3MG9A 4OHZA 3V4PB 4DIUA 2ZUEA 4N0EA 1EH5A 4DCMA 4KAJA 1ODIA 4LFCB 3KLPX 1KHHA 1XTSA 3TSZA 3ZHRA 3MHPA 1GAEO 3G9ZA 1JYEA 1G5FA 1OFTA 2AVDA 3PQ7A 1BWQA 1MA0A 4IKEA 4PG4A 5DOZA 4CL2A 1SUWA 4HS9A 1DZIA 3F2VA 1QM5A 5IAKA 3LWZA 3MFQA 2VJKA 5LL6P 3N0TA 2FZKA 1AG9A 1NXOA 2I6GA 4PHGA 5LNK1 1R0XA 2P6MA 2ZRMA 2CUZA 3MCVA 4CMCA 2VBFA 3SSNA 3NHAA 5ECYA 2L0XA 1QNLA 4BFSA 4DLZA 1VIDA 1CR0A 2EERA 2QRQA 3ZKWA 1YQ9A 1JPJA 3S2IA 1YHNA 2HIGA 4FFWA 5B6JA 2JB9A 2XZPA 1A4XA 1M9NA 4LRYA 1QHHB 1CXZA 3PT5A 4UE3S 3S55A 3IA2A 4D5EA 2OCXA 4KO2S 4RJJA 3HCWA 4EW6A 3EIUA 2BEUA 2HF9A 2PD4A 2D5IA 1S9HA 3F67A 2JH9A 3K70D 1ZKMA 5KCZA 2V6MA 4R8MA 5EPOA 4LKRA 4EPYA 3BCRA 3O1LA 5FA5A 1UBUS 5JR3A 3DVLA 1Z34A 3I2HA 4MUGA 5DYYA 2QQFA 3MJTA 3UWMA 4B3SB 3FNFA 3CXUA 1UF9A 4CFZA 5C8VA 2PLNA 2PO5A 2VC2B 3QNMA 1WZUA 4RCVA 4G0MA 2O2EA 3DL2A 3KBBA 4TWAA 1NV8A 4BO5A 1OAOC 1F8FA 1N1DA 3A6HA 3OZDA 4IIEA 2W6IA 2VZ0A 3NPMA 4X20A 5KYVA 4E32A 3BJMA 1DINA 2IUEA 3ZHUA 4F9TA 2PA0A 3F6SA 4OMCA 2RH9B 3AFGA 1RBQA 1T5LA 2Y8EA 3N86A 4EYEA 1CNEA 3I1JA 4JP3A 4XLLA 3AJ8A 4JYBA 3RUEA 1E2DA 3VR2D 3M8KA 5HCNA 5K2OA 2FG7C 1YZNA 3IAM1 4WBXC 1GQOA 4DIBA 1Q50A 2PIDA 3HCEA 3P9IA 3PNSA 3VMFA 1X3LA 4EVIA 4LRWA 4REMA 5IVPA 3SFVA 3R0XA 4NCXA 2UYHA 1A5SB 3H7IA 2AW5A 1BKSB 1OGYA 2HTEA 2P9HA 4O4IF 3WLFA 1Y6ZA 1G8MA 2XAUA 4XJVA 5FX2A 3QX9A 4RVFA 2M9MA 3K6JA 2UYCA 1GVHA 3DR5A 4KHPB 2A57A 3JZAA 1C4OA 1QGDA 1KEEA 1B74A 1YQUA 3DOEA 5ALPA 1KYYA 4BU1A 5C3MA 5FR1A 1FFWA 1P4RA 3M4ZA 2JFPA 3E05A 3H9UA 2QN3A 1BDMA 1DJLA 4HAVA 2HC9A 3EEYA 3KQSA 5G0UA 4YUZA 2MSWA 4LF6B 3UIEA 3CMCO 1X1CA 3G2PA 3I39X 4P4SA 1LX6A 4LJLA 4D9EA 3TOCA 4C4SA 1O94C 1S6YA 3UAZA 1FRZA 4ZIRA 4TYQA 3IPLA 3N7TA 3GRZA 1RM0A 1TVKA 5K0EA 4UDYX 3OZXA 2OXTA 1V6CA 4PG5A 1AH2A 3ER8A 3R3ZA 3IPXA 2R8PA 1GZDA 4IWYA 4LXYA 2CYBA 2XTAA 3TFWA 4MW9A 5F1YA 5JSUA 2JJMA 2PUFA 1T5DX 1UK9A 2A1TR 2EBUA 2QLFA 3HUTA 3TLXA 3IDFA 4FK8A 4NJMB 4LC1A 1XTKA 1Y7HA 2VYVA 3MS4A 3CZMA 3K16A 1XYYA 2QIPA 1SQ6A 5F51A 2G67A 1IHOA 4I50B 4TUYB 2EGUA 4INJA 3QU5A 1F9EA 1PAUA 1NVFA 1JF8A 1P2UA 4NSNA 1U98A 1Z6TA 2IV2X 1I8TA 4O1IA 1DCTA 2I80A 1DEKA 2FPPB 4BY9E 2VNHA 1SO8A 1WCWA 5D8DA 4EUEA 1EE1A 1TZBA 2ZIXA 1BZYA 3I42A 3AEUA 1P2TA 2HREA 2GPTA 2ZJ6A 1J7KA 1KK3A 2PKCA 2VP2A 4O2BB 5E3IA 4MV7A 3PXUA 1LS1A 3I6ZA 4R41A 2A14A 2PUCA 5IVDA 3AX6A 2VTBA 1H94A 1UOPA 1RNLA 4BNHA 2C1EA 1P19A 2YVLA 1A4UA 2I99A 2VJPA 4AQ7A 4EB6B 3EZGA 4ZVNA 1G3RA 1DKUA 3UXYA 1PUJA 3UT6A 1T29A 1J23A 3ND6A 4YUAA 3WI7A 3FYHA 2CWDA 1R0YA 2YHIB 3VHLB 3TIVA 4ZEOA 3AWDA 3IUQA 2IIBA 5HGJA 4MQ4A 1X7WB 5DASA 4YV2A 4P4GA 1MFPA 3TI7A 2C20A 5BMVB 3FY4A 1UFVA 2Q3EA 1FDOA 4ZOEA 2GF2A 1RE0A 2VF8A 4E51A 2DPGA 4N8SA 1EUYA 3G9UA 3BB3A 1EFUA 4HDAA 2GZ1A 2ZSIA 2G1JA 3GL9A 1FQKA 1A8SA 1AK9A 3Q2KA 3RQSA 5F21A 4RA9A 3Q9LA 5C52B 3IMFA 3LW7A 1WXWA 2JRCA 4K03A 4WE3A 1G5HA 4LMRA 3VC1A 3WMXA 1E6WA 2FLWA 4RNDB 4AG5A 4OOFA 2DR2A 3GUCA 4JWTA 1KWKA 2QTZA 3NC4A 3AETA 4ZVTA 1QQTA 1FA9A 1NN1A 1VG9B 2B34A 2W6ID 1RFLA 3LDFA 1PCXA 1RWMA 4JLNA 4OUDA 2XGJA 3G59A 1YB1A 2R4QA 4M36A 2GRJA 4WCFC 2ZJ8A 2Z56A 2PLFA 3TMAA 1U99A 2HO4A 4PYMA 4E6EA 4GMFA 3BGWA 4K7JA 1J0DA 3M6LA 4DV4B 2XTJA 2G9QA 2V45A 4KU4A 4TS9A 3ZKWB 1G2PA 3P0HA 2VP3A 5U4XA 3ZU3A 1J33A 3MSCA 4MQEB 4AS3A 2YJTD 3GJRA 2OBNA 4HBZA 1I32A 4DY6A 3OMWA 1EVJA 4NS1A 5JNSA 1U3TA 2HNBA 2TRSB 1PT9A 2VEDA 3HU2A 5B3JA 2CUNA 1VKJA 4EYSA 4INAA 1Y3AA 2C8LA 2BEUB 3OF3A 4MZXA 2EKLA 2OBMA 2BEJA 2IXDA 4I1IA 2GLTA 3D3QA 1RPJA 2ZUFA 1OF1A 4BC0A 1KZ6A 2IZOA 5K2MA 4OYYA 3RPEA 5AHKA 1H1DA 4A92A 4DLSA 4F6CA 3D43A 3KCQA 2JCVA 5I9LA 1X7HA 5JEDA 4JU8A 1IXYA 4GOJA 4JB8A 3FCXA 3L1VA 1ESDA 5AW1A 4AUNA 5I45A 3P0FA 4QGFA 1N6RA 2BR4A 1HOXA 3GUZA 3JQ8A 4RMGA 4X20B 4Z0NA 2CNNA 3CJRA 1MUUA 1HR0B 2AJBA 2EDCA 5TB5A 3F8TA 3G79A 2VDMB 2VHTA 1HKHA 2WYVA 4FJ0A 3B1YA 2GKSA 4K87A 4P36A 3STUA 2H00A 3ZNNA 4PHHA 3W6ZA 4BATA 4H4EA 2C7PA 2NSDA 2Y2UA 1Z4LA 1TQ2A 1YUNA 1CRWG 1ZD4A 3MB8A 4GLLA 4Q9JA 1RVDA 2PGJA 1OLUA 1TM4E 2PUHA 4D42A 4A15A 3H13A 2O52A 1ES9A 1DKRA 4OBWA 1NF2A 5FPPA 5KYGA 1BOOA 5HF6A 1PTJC 1LDMA 4PPNA 2X8BA 4I6JA 3E7WA 1POXA 4ZQGA 1THGA 1L4UA 2XAAA 2WG2A 3EOZA 5DM4A 1XZHA 2WWFA 3ESQA 3Q41A 4PLGA 1WOYA 3B1WA 3GNSA 3IRVA 3QVTA 4XI9A 2NU8A 3UHAA 4IMRA 3PFKA 3E1KA 4EPVA 1Z33A 1K6XA 2F43A 3E5MA 4WZAE 1RD4A 2BKEA 1V95A 3QU2A 2VT2A 1R9MA 3QUSA 4OAPA 5FRDA 3F78A 3ICWA 3WJ2A 1O7JA 1OI7A 1PS9A 2MINA 1QH1A 3FNGA 4P4SB 4ZIRB 3U3KA 1SD2A 4CQMD 2SICE 3DSRA 1TVKB 3IX7A 1HTWA 5C8XA 1O6CA 1GY8A 2Q41A 2QP4A 3VU8A 1YBHA 1SXJE 3A1CA 2OZEA 2WBLC 5BT9A 2ZS9A 1ZL2A 3HU5A 1YQQA 2P5TB 3FBTA 3L49A 2GJAA 1UPCA 5LQKA 1ZFNA 3M5CA 3QKRA 3RYHA 3A05A 4OJQA 2OWDA 3E5HA 2PMDA 1KFBB 4Z2YA 4CRWB 3WGYA 2BONA 2XD4A 3CC8A 1NVVQ 4NEHB 5LYJB 5LWQA 4BAZA 1AOXA 3IDSA 4EI7A 4JJZA 2D5BA 1ZISA 4FYIA 4UMEA 3COVA 5FADA 3JQAA 3QKWA 1T36A 4X71A 1QGAA 1LWOA 1QFYA 3L7CA 4NXNB 2O5RA 3NPAA 1MO3A 2WPNA 4RYDA 4WZ6A 3RIXA 3E53A 3T7AA 4JXZA 1JT2A 1VKZA 4JLOA 3E0XA 2A58A 2WIJA 1PX2A 5WRFA 3RDPA 4F93B 3AKCA 1QHNA 3DPSA 3ENVA 2ICAA 4HT3B 3QYAA 3QM1A 1KI7A 1OWPA 1VRVA 4E2FA 1YRLA 2P5YA 2ZIXB 3WWYA 3AEUB 2QZJA 1F9AA 1HQYE 1SG9A 2GAIA 4F91B 4RTSA 2W2MA 3TLZA 1VA4A 1DTEA 4X95A 5I4CA 1U2DA 1NMZA 5EXSA 4YCNA 1H0SA 2CVOA 2PTGA 4QE3A 2VTBB 3H4MA 3N8DA 2D2EA 1FRVA 3DOCA 2YRWA 4KO3S 2G9VA 5A3VA 4A8JC 4YCMA 2EIXA 3GV0A 4HF7A 4HN4B 3ZD6A 1J97A 1OIXA 3JY6A 2V7GA 2YFKA 4L22A 4GFDA 3V7YA 4J0DA 2CLOB 3OCUA 5CLFA 5E1OA 2HL6A 2QEQA 3AFOA 4A8PA 2PWZA 3WGNA 1KQOA 2JIOA 4AZ0A 3PXXA 3NYWA 4D7AA 1UZNA 2QM7A 4WNYA 3WG9A 4E03A 3LL7A 4WKOA 3A31A 5EY5B 1KL7A 2YHBA 3VBCA 3W9SA 5C1BA 5FV4A 3DMGA 4TQGA 5CNMA 4WWHA 5ICFA 3F49S 4HPJB 2IZ6A 3MXOA 1JQAA 3SPXA 2V7QD 2A30A 4P98A 1ZUIA 1OWLA 4UFOA 5EZSA 1GFWA 3PWTA 4RA9B 5CDHA 4U7WA 5FWAA 2DFTA 3M5DA 5UKDA 4Z2AA 3HJUA 4RMNA 1WA5A 3RVNA 4Y0VA 3WYEA 3OE7D 4LDRA 1R5OA 3TFOA 2QQEA 3AETB 4A10A 1CDDA 3WXBA 3F3YA 4MRPA 2VPWA 1NVAA 3SDBA 3C3MA 4OUDB 2B30A 1XVVA 2V65A 1EVLA 4G23A 4WACA 5EG5A 1W94A 4J0QA 4A5OA 1VPTA 2O2XA 3J80A 2R60A 3PD7A 1VHTA 2FW8A 4NFSA 1SULA 4JC5A 3DEIA 1Y3BE 1IN4A 3FZYA 2Q4RA 3NJ4A 1D2HA 4B8WA 4EFLA 1FNCA 4DV5B 1Y1TA 2ROQA 3D1JA 4RU1A 3AFIA 2HDNB 4CI0B 4WOCA 3LKDA 1ZM4A 1TIPA 1XZPA 1CB0A 2IU0A 4Q1BA 5IAEA 3VR5H 3GROA 3D2BA 2LCFA 3M33A 1Y80A 3AFHA 1YOBA 4E46A 3ZE1B 3R5KA 3GFQA 7ADHA 4PZAA 5E1DA 3ZLTA 5ALJA 4MCIA 4DCNA 2FOXA 5LMUB 1C0LA 2BGMA 3DHYA 2D5AA 4AN0A 5BYKA 5DRTA 2BSQA 2V3WA 4OLJA 2OCBA 2FUG1 3G7SA