1YDGA

Crystal structure of trp repressor binding protein wrba
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
201
structure length
201
Chain Sequence
APVKLAIVFYSSTGTGYAMAQEAAEAGRAAGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIFKSGGNPYGASVTANGQPLLENDRASIRHQVRRQVELTAKLLEGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Protein binding
molecule keywords trp repressor binding protein WrbA
total genus 81
structure length 201
sequence length 201
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ydgA00
1TLLA 2MTBA 1YCGA 2F1OA 4C0WA 1X77A 2R97A 3FW1A 2QWXA 3NHUA 4FGKA 4FX2A 1ZX1A 4QODA 2FX2A 1H69A 1E5DA 4DILA 4Y9UA 2HNBA 5F12A 4C76A 2M6RA 1J9EA 1AKTA 4F8YA 3GAMA 2Q62A 2XOEA 2RG1A 3NHWA 1I1OA 4QOIA 3TE7A 4C14A 2QMZA 2B3DA 4HEQA 1DXOA 4YQEA 1AKWA 2V5UA 3LT5A 3B6MA 1DXQA 5NULA 2MWMA 5F51A 1XYYA 1T0IA 4PU0A 1CZOA 2BPOA 3R6WA 2N1MA 3JSXA 2Z9CA 2OHIA 3QFRA 1D03A 3EYWA 2QR2A 1T5BA 1RLJA 3KEGA 3F6SA 3OWXA 3F2VA 3O73A 3HR4A 4DIKA 1SG0A 4FGJA 3L9WA 2KQUA 4CF6A 1YRHA 1AZLA 4H6PA 3W7AA 5LBUA 3SVLA 1TIKA 1DX9A 3HLYA 1KBQA 2QX9A 1CZRA 4S24A 4QOFA 4U7GA 3TEMA 5B3KA 3QE2A 1D04A 1J9ZA 3NHLA 1FLNA 1FLAA 4GQIA 1QRDA 1SQSA 2V9CA 4XDGA 1AMOA 1QR2A 2OHHA 2QX8A 4LAFA 5EMNA 3NHYA 2FZVA 3FJOA 1AG9A 1D4AA 1BVYF 3ESZA 1CZKA 4YAOA 5FA6A 3OJXA 3NFRA 3FNIA 1RLIA 2Z98A 4R81A 3KAQA 3OVMA 2W5UA 4YALA 5B3LA 4C0XA 1YDGA 4GR9A 5EA2A 2ARKA 2D5IA 4BMPB 1FTGA 1CZUA 2FDXA 1JA0A 4Y9RA 1XI2A 2OYSA 1FUEA 3W78A 3NLLA 4N82A 2BMVA 3RPEA 3NHRA 3S2YA 1V4BA 4LTMA 1NNI1 2BZSA 1AHNA 2M6SA 3OJWA 2WC1A 5LJLA 3OWHA 1YOBA 2R96A 3LCMA 2A5LA 2FAXA 2QX4A 3GFQA 4ESEA 1QHEA 2BN4A 1J9GA 1QBGA 2FCRA 5BUCA 4M0CA 1B1CA 4N9QA 1C7EA 1OFVA 1BU5A 2FLVA 3HA2A 4LA4A 4PTYA 4QOEA 2MOKA 4XDHA 4D02A 2MT9A 2X2PA 3ESXA 1CZHA 1YCHA 2QX6A 2XODA 3B6KA 3GFRA 3N3BC 4FGLA 4QOGA 4Y7CA 3ESYA 1JA1A 1J8QA 3OX3A 4HS4A 5EAIA 3U7RA 2V5VA 5ULLA 1H66A 2X2OA 2ZKIA 3FVWA 1RTTA 5F4BA 4OXXA 4ZVKA 2KLBA 3GFSA 5LVAA 3P0RA 1C7FA 1ZWKA 5LBTA 1OBOA 3NHSA 1CZNA 2Z9BA 3U7IA 4GI5A 3N39C 1XT6A 3TZBA 4N65A 2AMJA 4ZVMA 3UXEA 4QOHA 4ICIA 1ZWLA 3L9XA 4PTZA 2Q9UA 5JROA 1YKGA 1WSBA 3F6RA 1RCFA 4QOJA 3ZHOA 5LLDA 1XYVA 2QMYA 4H2DA 1AKUA 2Z9DA 3K20A 3W77A 5A4KA 1WSWA 4CETA 5FUQA 4YAWA 3OX1A 3NHPA 4YAFA 3B6IA 2FZ5A 3F90A 3EDOA 5LMCA 4ZVNA 3OX2A 1AKQA 3KLBA 1GG5A 3NHKA 4LTNA 2HPVA 2OHJA 4LTDA 4U7FA 4U7HA 4YAUA 5LJIA 1AKVA 1YCFA 4ZVLA 4BMOB 4NLLA 3ES9A 4NULA 4DY4A 1VMEA 6NULA 1FX1A 1FLDA 1FLVA 1FVXA 3KAPA 3O2NA 5FX2A 2BF4A 3B6JA 2FVXA 3N3AC 5NLLA 3D7NA 3W79A 3NHFA 2HNAA 3QFCA 1AKRA 2GSWA 2FOXA 3FX2A 3K1YA 4J8PA 3G5MA 1F4PA 3NHJA 1KBOA 3UXHA 5TGZA 1CZLA 1OBVA
chains in the Genus database with same CATH superfamily
4PLPA 2JZCA 1X77A 4WBNF 2AZXA 3UYLA 2W6JD 4X94A 2WIAA 3HR7A 2PUHA 4EENA 1JU9A 3OZ7A 5M04A 3N7AA 2PKXA 3G02A 1EI9A 1S0UA 5FO0A 4CMBA 1E9EA 1A4UA 1R2QA 2DFTA 5B5SA 2PIDA 2YQ5A 1QFYA 1NUPA 4EJSB 1RRFA 3I5YA 1GPDG 3CJRA 3FUWA 5IXJA 1KPHA 3E1SA 4FS8A 3E53A 1THTA 1UBEA 3C0KA 3LBNA 3ANYB 4P7FA 1RI2A 2LWIA 3I28A 4UULA 1MQSA 5EHNA 2BM1A 1V2HE 4BJ3A 2IGTA 3FPAA 4GYKA 1NVFA 3F2VA 4TTJA 2P69A 1A76A 1L8LA 3QXJA 5F1YA 3RVKA 3WISA 2HJ9A 2OCYC 3L6OO 1XLTC 5C0OE 2PD4A 3LX6A 3FHLA 3RRBA 2Y05A 4M1EA 5JCJD 1NG1A 2WV9A 4ZU3A 1ISSA 3LVBA 5I9TA 4GPZA 3EIWA 3KSUA 5JD3A 3RVQA 5U9CA 3ZGVA 1F8UA 1KSJA 1R4ZA 2YYAA 4NEHB 1E5QA 4V02A 4FM9A 3VOBA 1DARA 1I6KA 1NN3A 1OI4A 2X3UA 4EELA 4DWVA 2R1UA 2CBGA 4YAOA 4BVEA 2YBEA 1XHFA 4KPGA 3WLEA 4RHUA 1YRWA 4B31A 1SJ9A 4N7MA 5IJ0A 4AY4A 2OPHA 4L8FA 4LXIA 5A5EA 4B0OA 5DXJA 4JXKA 2ZANA 1YQTA 4I14A 1GG8A 2VBCA 1V8ZA 2OP1A 2E6UX 5K3FB 1UJ2A 2O5RA 2QLBA 2VDLB 4LJ4A 5AW4A 5HM6A 4N48A 5C8DA 5IPFA 1JLKA 1NAHA 1ZICA 2W2NA 4YRSA 1K6EA 2INGX 3CH4B 2R96A 3LZDA 4DJ5X 5HE8A 1AU9A 4YJDA 3P52A 1DB3A 1WU7A 3E23A 1L8AA 2HQSA 3GNQA 2G25A 3BE5A 2DUJA 4O2AF 2PTHA 1KYZA 2ZR8A 1ACMA 4JJ7A 3VXKA 1POWA 3DP7A 2ISSD 2PLWA 2A7QA 1MOQA 4J9VA 4CMEA 1U0RA 4RTKA 2RJ3A 2BUBA 5FI1B 2WNSA 2VR1A 2PGOA 3LUGA 1W5TA 3C3JA 1J99A 2HFKA 2GQ0A 3Q5DA 3GFSA 4RE6A 5CM9C 5BSUA 3AUJB 4IFTA 4J0JA 1C2TA 1Z07A 4KQGA 4XARA 1E2MA 3JD4A 1QGUB 3VZBA 1ZJ4A 2NT3A 4XAQA 4YRRA 1PFWA 1SVIA 1YR1A 1D7AA 3HLTA 3KOZA 1P9RA 3MMXA 4QDXA 5BWOA 3WK5A 3CLUD 3D3EA 5KSZA 1PJAA 4ZGWA 2NO6A 5K0ZA 1PKXA 1KKLA 1QIEA 1OIVA 5ESXA 5HTKA 5B64A 3BJEA 3W5UA 3W3AD 3CN7A 4A2QA 2E18A 1Q1BA 4WKGA 3NVAA 1OFUA 5KOJB 5F2KA 1NZFA 2V7TA 6NULA 3HSSA 3QLVA 4HOYA 1E32A 2Q3LA 2EQAA 1HQCA 2WFLA 3GFOA 3DBRA 1PFGA 3X2FA 2P67A 2C4MA 4GU5A 3SF0A 4AT1A 4GWKA 4IX1A 3RU3A 1DC5A 1OX6A 1IB0A 3L4BA 4CM8A 1DIGA 3HO8A 2OAGA 3OPYB 3VNVA 1DAFA 3BRWD 5TGZA 1L4HA 1L7QA 5DISB 3DBLB 1ZHOA 3DEKA 2GEDA 3HUTA 1LNZA 3K2EA 4YP6A 4JI4B 1T6ZA 5FI3A 1DMRA 1RACA 2EZ4A 1U3CA 5ADUS 2RJNA 1MT3A 1T4GA 4R1TA 4W5WA 4ARBA 2YRWA 3U2QA 2DR0A 2WTXA 3U09A 4CL0A 3ONNA 4EK9A 5JYBA 3V2IA 3O7WA 2IHTA 4WN9A 2XD4A 2YVKA 4O2BF 2Z09A 4TTRA 5D7BA 5LP6C 2GZDA 2RH9B 2PVCA 3HDQA 3R9XB 1OZFA 1Y3FE 1KK3A 3E22A 3E8XA 4D5GA 4UM7A 5KOJA 4ZOLF 1OU0A 4NARA 1YRLA 3JSXA 1SOWA 2E4VA 2HDHA 2TMKA 2VT6A 4CV0A 3NIWA 3QFRA 2R00C 4MUHA 3OQVA 3D3WB 3PVSA 2WZCA 1YR6A 3DVAB 4EGAA 1ODJA 4WOKA 1Z8NA 2D1FA 2G1JA 5KCMA 3BYZA 2KQUA 2WDZA 4ZICA 3CBGA 4G24A 4HV4A 3UT5A 1IU9A 2IYEA 5FL3A 2IIVA 3N2IA 3PR1A 1BFDA 4HDRA 2C00A 1Q21A 2PNJA 3D1JA 3LRXA 3O2QB 4J1TC 5KC9A 2B34A 2W2QA 2WJHA 3MG9A 4ZCIA 4X66B 3F7OA 3PTAA 4OQMA 1U2DA 1J6UA 2O3RA 3K5WA 3VPDA 2NZWA 2ZI6A 3G17A 3ZDDA 5KYTA 4QQKA 3G9UA 1LH0A 4E33A 4YT5A 5C8XA 4BQRA 3JVVA 2DY1A 2W5UA 3IV6A 1IM5A 1ZZEA 5B3LA 2I3DA 3PWZA 3F47A 1GZUA 1C9MA 2LR0A 4RYDA 3TZQA 3MLAA 2GD0A 3OT5A 1M0WA 4RLFA 1BFUA 2EJWA 2WUFA 3ZV6A 5CNMA 1CQIA 2MJLA 1PFUA 4RNCA 2WYVA 3P9YA 2CKDA 1GUBA 1NPDA 1WQ4A 2I87A 3AJDA 4YAKA 5A9SA 4WZ6A 1YS6A 2NV2B 5FTJA 3CX6A 3STUA 2Q3DA 3GFQA 5ALTA 4R2LA 3DULA 4W8OA 1Y98A 3EMDA 2JLCA 4DV0B 3GLKA 1ECCA 1ZITA 2DOKA 2ZB3A 4UCQA 5C8VA 1H5UA 1F6DA 4JVSB 2DWPA 2ID8A 3HHEA 1SCUB 5JXWA 4OF4A 2HGSA 4EW6A 2IC5A 3IV9A 4O1MA 3RS3A 2PSEA 2NP7A 1T8WA 3TSAA 1N3LA 2ZIAA 3DC2A 4U7WA 1C7FA 3T5TA 5HFJA 3EZLA 4RFVA 1PHPA 1FPQA 4WV3A 3SEAA 3T1HB 1JP7A 3PU6A 4RCZA 1ORTA 1XRSB 3DE7X 5HUJA 1ND6A 1DUSA 1RI4A 3E3OA 5JVDA 1RD4A 1YKGA 1IHUA 2W70A 1SM4A 4FCTA 5AVXA 4OK5A 4PFJA 3TVDA 3UHAA 1GYPA 5AYVA 3C3DA 5ICCA 1JAYA 3KWFA 3MWFA 3IJPA 3WTBA 1G3UA 4D9KA 3W9UA 4E31A 1N2ZA 1Z73A 1J0DA 1PEKE 1QFXA 3DUWA 4NF2A 1V1MA 5E7QA 3UENA 4EPVA 3B9QA 3ES9A 3DCYA 4I1OA 2OGTA 3M49A 3VGJA 2XX3A 3VHQA 3KLMX 1EG7A 1BZYA 1TTHA 1LBSA 2JIDA 3C70A 3H83A 1SCUA 2GB4A 2PGNA 4QUBA 3SXPA 4JUFA 1LEHA 1U6KA 4B7AA 5J2UA 2GDJA 3TVTA 3EPHA 3U1TA 3OPQA 4QDZA 4DDKA 3FX2A 4C7XA 1QE3A 1YXMA 3OOYA 1FBTA 3L4JA 3A70A 3Q9LA 3QUSA 3HWX1 2Y6UA 4WE3A 4IW3B 3D54D 1VG0B 2FN7A 4M21A 3EUWA 3GW8A 3T9FA 1J1IA 3WYNA 4U6NA 4D80A 3MPOA 3TMKA 1E0SA 1N6RA 3PWSA 1ZKMA 4U6QA 4R01A 4AY6A 3IBCA 3V42A 1I6LA 1HDRA 1CR2A 1N92A 4HNGA 3GAMA 4PV7A 1BS2A 2BKUA 2MSKA 3TKLA 3LCCA 3RFFA 3UHPA 3TR0A 4A0GA 3TUJC 4X7MA 1R4NA 4NU8X 4LF6B 2KSQA 1SQ0A 4YJKA 4AZ0A 4Z7JA 4KQHA 1ZM2A 3AYZB 1NY6A 2JZNA 3R74A 4DT1A 1WR8A 4G1FA 4OKNA 4KI0A 2H3EA 3MERA 1LTKA 3MS7A 4PLVA 3K2IA 2W98A 2OXFA 2XWBF 1K0FA 3OTQA 3SVTA 5B1HA 4LPKA 4YFYA 4YWHA 3RWMB 2R6AA 4RVCA 3V6LA 2FE1A 4KXLA 1BTOA 1ODLA 1UXOA 3RFTA 1X2BA 1NATA 2RHCA 3WIVA 1DJPA 2P75A 1A4XA 1K7FB 1JNXX 4JODA 3EC1A 3NCHA 4GPAA 3A6LA 4HAOA 1AMUA 2FZVA 4PWZA 4TV9A 4KPEC 2Q5LA 4RAOA 2VRWA 3SD7A 4JITA 4EHLA 2VN8A 2YFQA 1JKIA 2BD0A 5E1OA 5HOEA 3IPCA 5AESA 3QOWA 4UBIA 1FTGA 1CZUA 3NBQA 3T35A 5F33A 1XVUA 1RQNA 3EVEA 2HSZA 4WLNA 1UJBA 1UFRA 3A6GA 4OB6A 1M66A 5EMLA 1UBHS 2EP7A 1NDQA 2PM8A 1IE3A 3JWHA 2QL9A 4UXHA 3VYTB 1H23A 2Z4SA 2J0SA 3LCMA 4PYNA 1OXXK 2NVUA 3AC0A 1R00A 3G1WA 4FUTA 1P33A 2Y1OA 1P3JA 1RM4A 1DAKA 2QRPA 3Q0IA 3EXIA 4H3VA 1CZHA 3G8BA 4UU1A 1XLTA 1Q0RA 2C84A 3BHJA 3MB8A 3EVCA 5AMXA 5EXXA 5IAEA 1TT5A 1NXWA 3V8VA 5IW8A 4F9EA 4BQSA 4EG3A 2JDIA 4K2HA 1SVOA 4YWJA 1P3DA 4A8JB 1L5LA 4IGIA 3KDSE 1N78A 1TMYA 1I36A 3IPLA 1Z4JA 4PHFA 4KSCA 3HK2A 2MSLA 1LLDA 1V5EA 5FHQA 5A4MS 3D6JA 1N4DA 1VB3A 3T1VA 2D13A 2COEA 5G1PA 5JO0A 1BJRE 2CMGA 4A6PA 4URZR 4XVHA 3CT4A 4XB2A 2EIXA 3M2PA 4NBWA 4C88A 1MF7A 1B1AA 4LDRA 1A8QA 2AUTA 3ZR4B 2CVQA 3F73A 3N2NA 3PB3A 4JC5A 1ENOA 2RHBA 3AM3A 3F6PA 2DXIA 4TZ6A 2IDJA 1ZNWA 4HZGA 4MQMA 5AKJA 5EHIA 2B25A 2W6ZA 5D1NA 4BNTA 2PZAA 5HK9A 1ODIA 4L5BA 3L8ZA 5I7FA 1KJZA 1LUAA 2FG7C 2JCSA 3AF1A 2IUSA 2IOFK 2OXTA 3ZVLA 5CBPA 4RTRA 4J3NA 2AA3A 4J8PA 3IR7A 3G8AA 4WNIA 4RZ2A 4UUQA 2C04A 2FSPA 1C1DA 1M2OB 2OBYA 2WWHA 2Z1DA 3DR5A 4N4AA 4QU5A 3OEYA 1U0JA 1ZJWA 2O4UX 3FW1A 1I10A 1NW6A 2O2JA 4JEIA 2HXGA 2SICE 4OSOA 4UEKA 4JI7B 5ARDA 2PX3A 5D3QA 3DBHA 4S12A 2RI1A 1XK7A 3FR8A 3I6BA 3E9RA 4IDPA 3EVFA 5TR9A 1U31A 4Y2TA 4BN0A 1CLEA 1B8PA 1KQ3A 4ZIRA 2Q5FA 3OU6A 5FH9A 4DA9A 1HO3A 5HR5A 2XUZA 3IOEA 1DXOA 4GKJB 1E3WB 2HBRA 3O95A 4HWRA 5KQPA 3ABZA 4UJ3A 5B6JA 3C7DB 3RE1A 2X8JA 2ECFA 1NC1A 1BN6A 1VMIA 2C9OA 2PR2A 3AVPA 3FDZA 3KEGA 3ZU6A 1NI5A 4EHBA 3VKGA 1LRKA 3TRIA 2C9BA 4B4OA 2B98A 4D9NA 3G0DA 2GRJA 4M7OA 1NTRA 2FZEA 1RPAA 1WB6A 1EYZA 3ICCA 4A5SA 2XMCA 3COJA 3U1VA 3UUWA 1Q7CA 3RBVA 3WGQA 4NCBA 5K51A 2WAAA 5KREA 5G2OA 2YWCA 1AG9A 3ENZA 2BMEA 4N49A 1KAGA 2RGBA 4FR5A 1USGA 2NUTB 1PNTA 4V0MA 5KPJA 1OB5A 4MWOA 1E3WA 1I4TD 1SUAA 1PNVA 4XSHA 1L7DA 4PN7A 1C30A 3L7DA 1PLJA 4KW7A 1CY0A 4XD2A 5LCXA 1UWKA 2XJ9A 1S2OA 1T4MA 3QVMA 5TQJA 6ADHA 1RZRA 3TEFA 3GFTA 3X44A 4GSKA 3IXMA 3OLCX 2CJWB 1CUGA 1JLLB 1CY6A 2A5LA 4H7FA 1H4VB 1B42A 2PLFA 1BWQA 4JA0A 4ND1A 4UAJA 2PWBA 1X9HA 1JDTA 1YQQA 2QNRA 3TK1A 5BN3B 1I7PA 2BEUA 5FOQA 3CLUC 4URHA 1AX9A 1P7YA 2BJWA 4PYKA 3AO0B 2WYWA 3N75A 3U60B 1L8QA 2G5GX 2PH7A 4LQDA 3P9KA 2NYVA 1NX6A 4D46A 3PE3A 4KE8A 1U7ZA 3H97A 3VR5D 3V4SA 2ZT8A 1VYUA 3WYGA 3EOAI 1U1CA 2ZE6A 3CZRA 1WOYA 3OICA 3KFLA 1CT9A 5F4BA 3OCUA 4AP9A 5LVAA 4FN5A 5JPCA 3M3PA 5TPZA 2ZPAA 4BJ1A 1O8BA 4I6GA 4D6XA 4PFSA 4H7DA 2ZLBA 2BTQA 3OE7D 3FTCA 2ZBPA 5F21A 3CGWA 3VI3B 5DNWA 1FYDA 3ORHA 2PDAA 4FYYA 2Z9DA 1U4OA 4KDFA 4I9FA 1KDYA 5BUQA 2IOYA 2VHCA 1W581 4BNNA 4G37A 4RBNA 1W1IA 2BLNA 2H2WA 3TAXA 3PGXA 3BWBA 4PNPA 2WF6A 5HYVA 3LWZA 2ZUSA 4ZVLA 5CB6A 2RDMA 1YZUA 4A4DA 3R0QA 3KXLA 3LWNA 4H17A 4L8VA 1C7QA 4CIVA 3X2SA 1V8BA 3QFHA 4BAGA 3AHEA 1A9QA 2GD1O 4C0BA 4ENVA 5LN1A 4C7OA 1E77A 1AKNA 1J23A 1KY4A 1A8UA 1IXZA 5IWCA 3KOMA 3NU1A 4BRZA 1T29A 3ZDRA 4TS9A 3RAGA 2XZOA 1X1QA 2W8BB 6GPBA 4DIUA 2VP4A 2VP0A 2EX4A 2EW2A 4E5NA 5I4BA 4LECA 2GJ4A 2JFYA 2NO0A 5TVGA 3U48A 4E6EA 1JI3A 4O2BA 4CM7A 3D6VA 1DDIA 4HWKA 1CTQA 2VAMA 4TQAA 3H6GA 1B16A 3BB3A 4GIBA 1Q5PA 1L7RA 1I1OA 4HAWA 3EF0A 1NE7A 2ZU6A 3MCAA 3N0VA 1MC5A 4OXNA 4BEBA 1E64A 4ND2A 1UODA 3GNTA 4W5NA 1V39A 1PI3A 5C3UA 3FETA 4IDFA 1F6BA 4ZRMA 4A6XA 2CVHA 1Q1EA 2EOAA 1C3EA 3AB7A 1I7LA 3DL2A 2JKYA 1A69A 3UH0A 1M34A 2YV1A 2QT0A 3GUYA 2C5HA 2E4AA 2KBEA 1YVRA 3KJEA 2EKQA 3AJAA 4S2EA 4HQ0A 2C9YA 4WXEA 3QMWA 1II8B 1XTVA 3X1WA 4OOFA 1RQXA 1K9SA 2K2QB 3KQMA 3U26A 1CJBA 1G2OA 1T9DA 2IYAA 4LG1A 1IDOA 2FN4A 2WK1A 5LYYA 1BOFA 4IFIA 3Q15C 4BASA 3DO8A 4OHMA 4ARIA 3PXBA 2IWRA 5FOUA 1FCJA 1ZK2A 4QYXA 2W2VA 1Y89A 3ZVMA 3EPPA 1G8JA 1Q0TA 5I9SA 1IJBA 4M38A 4ER5A 1GLNA 3KG2A 4UTNA 4KEAA 3AEXA 1T3GA 4E4RA 3H1BA 3I45A 1LNSA 3RASA 4MR8B 2F62A 1E18A 3W04A 1M3SA 5AW1A 5JAMA 3M1IA 1PJ8A 3TGLA 1XWWA 1S8AA 2O8DA 1WUIS 1C1HA 2O0JA 3G7SA 3R3HA 1AHNA 3EODA 4OSPA 4X85A 5K4AA 3CVOA 5I7UA 3OCYA 4YB8A 4AKEA 4DNFA 5I9IA 1BVRA 1U8AA 5DN9A 2DPYA 1J9GA 1NYQA 1QCDA 5JBQA 1N2SA 4GF5A 2C03A 2WIFA 3M1YA 4EFMA 1NQ5A 4LY9A 4HQRA 1Z7GA 4H1VA 4RJKA 3KPUA 1RQRA 1SUIA 3FF1A 4MICA 4PZAA 4AS3A 3JRNA 2QT1A 3V7YA 2VLIA 2V5VA 1ZU4A 1XHEA 3H2IA 1U2RA 4DXHA 4YRZA 4QG3A 3QLEA 2FB9A 1NLYA 2FZ4A 1JG6A 1P18A 2BRUA 4IRUB 4G85A 2D06A 3VC1A 1JLRA 3JQRA 1MQ9A 4I1UA 3BGDA 4AUEA 4B3XA 3MJRA 2P1ZA 2J3DA 1MPXA 4G89A 1KJQA 4ARSA 4DRYA 1YWGO 2JI9A 3G8YA 5BOSB 1NQTA 1T5OA 1RM0A 1I2DA 4XEHA 1MW9X 2CNWA 3K9HA 5EZ6B 1XPOA 1NYLA 4K46A 3IKJA 3AB3A 3KELA 3RSGA 2YOFA 221PA 3WGVA 4Q3EA 5MFPA 2P0YA 1P1HA 1CU1A 1R6VA 2D62A 2ODWA 3BXOA 2X6TA 5CNIA 1RIIA 4BTVA 1NKTA 1VP3A 4DC9A 1PGQA 1VLLA 3VNAA 1KMHA 4PS1A 1Z68A 4UDXX 3HKEA 1QQBA 2PRSA 1EIZA 2O52A 3MINA 3TH5A 4KFCA 1MQAA 1RAIA 1W6RA 2HU5A 1QFSA 4FONA 1WHSB 2AKYA 2Q1SA 3LA8A 3T95A 3ZIAD 1Z0KA 3H1FA 4BLSA 4NCIA 1OQAA 1QHGA 1N6HA 1TM4E 4ACAA 3SMVA 3IAS6 1GCUA 1YDHA 4W1SA 5F78A 4D9BA 5J2UF 3BORA 3FYTA 1Z62A 3DEHA 3DUFA 3G0GA 2AEEA 3B36A 4J16A 4MQBA 4HH0A 1QWOA 3FGOA 3RT7A 3TFWA 1MBZA 5J4KA 3S8EA 4C4XA 1I6MA 4WY5A 5M3BA 2PRJA 1WCWA 5LDHA 1GARA 1LPPA 4Q4AB 1HNNA 1AXRA 2ETVA 2VNIA 4MQLA 4PYMA 1WB4A 3KB1A 3TL3A 4FQ5A 2CCKA 4YQEA 3AG6A 3RUIA 5JJKA 3SQMA 3N6RA 4DN6A 1WIWA 3HP1A 2OBMA 5B1YA 5C52B 3EIOA 2FP4B 3BICA 4MQ6A 2IOFA 3U19A 1ZK1A 1T9AA 3PQ8A 3ZWPA 5H5JA 5JXHA 2ORVA 4JMLA 3T38A 3HKEB 1EZZA 2WB4A 4GDFA 1KVUA 1UMBA 4MV0A 1BCRB 2JK1A 2OWEA 4FFOA 4CKEB 3NHMA 1S8NA 4TROA 3QWIA 4Z9BA 5DJ5A 3LGAA 2C7GA 1QP7A 5JDIA 4Q7KA 1GGJA 4NFYA 5FORA 2CL7X 5DW0A 2QJFA 5FQNA 2Q8QA 3KKQA 1C7ZA 1Q3KA 2NVBA 1QQAA 4RWEA 3VPSA 3QA3E 4MMZB 3S1SA 3ZK8A 1X8XA 2AUMA 2WZBA 1JTFA 1ECPA 2NPIA 4L6AA 1TMOA 2KLHA 1ORRA 5LMZA 1NRXA 2ENWA 4A8PA 3R77A 2SCUA 1T26A 5I7VA 3W0LB 2FWNA 2Q5CA 3R0VA 1A2KC 1J7KA 2CSXA 1OPXA 2D0DA 4GH5A 2O0KA 2GGSA 3EXFA 2EBUA 1GTL1 4UPDA 4QUGA 3DMFA 4JYMA 5EIAA 3W5JA 2QS9A 4D81A 2HAEA 4MR7A 4NCNA 1OLOA 3B1VA 3DOUA 1AZSC 5K0GA 3ACDA 1VIVA 2AFHB 3RC7A 1J24A 1NXSA 4FOPA 3ZC3A 3FOBA 2IXGA 4X61A 3RV3A 2AFIB 3G59A 1YMQA 4N8EA 4A0QA 4BEJA 2NADA 1FYWA 1VIMA 3KHKA 4GYYA 4QUDA 3HJRA 5DEIA 2J5KA 3H6KA 4MMXB 2GKOA 4Q66C 4XFDA 4WAUA 4B3IA 4R54A 4CM5A 2F3TA 1EP3B 2AG5A 4CQMB 1TNDA 1G21B 1P4JA 3WGOA 3B7PA 5FULA 2L17A 2R0QC 5DHQA 1ODTC 3A2KA 1NGSA 2FSUA 3ND7A 2ECPA 2AG1A 1WPGA 1UZAA 3V8QA 4RO0A 4BX2A 3JR7A 1SZCA 5KQSA 3B2EA 2C2KA 1KZHA 3KLOA 2XNDD 2WSSD 1FDOA 3I9NA 3OEEA 1U0LA 4TTQA 5EKTA 1EP9A 2BF7A 1PWXA 1R74A 4KDEA 1Z83A 2O50A 4MVJF 3SKVA 4TSKA 3LX8A 1E1KA 3IMEA 4ZEMA 2C2OA 1K1EA 1QJCA 1YU6A 3ZW8A 1NQXA 3P2YA 5C1OA 4Q7JB 3ZLUA 4D2IA 1FRNA 1TLLA 4G25A 5AKIA 1GTVA 2WWYA 1JL3A 3C3EA 3PFWO 1EVZA 2R7NA 2RH5A 3JV7A 2BMWA 2P79A 2Z58A 4GRDA 2GZAA 4M0PA 4Q4HB 4MUKA 1E5DA 1QH1B 1GXSB 4C2BA 2IZ7A 3KQLA 5KUTA 4GP9A 3VU1A 2IY8A 2VUHB 2GA8A 3LT0A 4I55A 5AI9A 2VCHA 1XCGB 2NW6A 3QBTA 4N0QA 1OR8A 4QBGB 4Z3KA 3HJHA 1XDWA 1JBEA 3IQIX 5JAUA 4PIMA 2VRNA 3LG2A 3ZU5A 3TW0A 2QUKA 3IAM6 3ZI4A 5MN6A 4RMHA 2UYGA 3Q9SA 2P2YA 1U9YA 4FOTA 4ZQHA 3C3MA 3LS2A 4ZZ3A 4QJBA 3C85A 4TTSA 4EG8A 3CZ9A 4P54A 2ZQYA 3KHUA 1NYRA 4B3FX 4U9HS 3P0EA 3P2OA 3PC6A 5KTKA 1SQFA 2BFFA 4YRDA 3CCCA 4OH7A 1FNBA 4ISCA 3VSBA 2VEOA 1SKQA 4YXWD 1KY5A 4NCJA 1JHYA 4V1CA 5T6MA 2CHVA 3SAJA 1XRPA 1N8NA 5JCJA 2H5JA 4RL6A 3PJRA 5LZ5A 3H86A 1KU6A 4BNFA 1KEEA 1JUDA 3MN1A 4PHGA 3T6KA 1GXSA 4US0R 5IABA 1TZ2A 4F9FA 3L8YA 2E1RA 3K16A 5KNBH 1N1MA 2ZIZA 5JCOC 2GK3A 1U7HA 1CUUA 1RMQA 4EPXA 2LDBA 4F3TA 4W5RA 1Z0SA 3KK0A 3DMHA 4UM9B 3QTLA 1HEUA 5DDIP 1Z2PX 5FL7A 4LGVA 2QAGC 1S6YA 1TF5A 3LUCA 5B4VA 4X62B 1H8HA 2VDUE 1NVWQ 2XVXA 2YV4A 1GNPA 3U4HA 3GVCA 2GESA 3OQOA 4CU5A 2YFHA 4JJ4A 3N74A 4CHTA 4Z7OB 2ID7A 2PKWA 5E4FA 2X0EA 3RVSA 1YB4A 1XNRB 3LBFA 5CA0B 3IELA 3ZH2A 3BF7A 3MRVA 4BOYA 3OIDA 5ITZA 3MT8A 2X2PA 3C3XA 3IOYA 4EA9A 1P2VA 5MGNA 5KTTA 2QDKA 4YAEA 5T4FA 3U7QA 3KV1A 3USZA 4D3DA 3S2SA 1KIMA 2JAUA 4IJUA 3U6KA 1QO9A 1HDOA 2YZ2A 2Q4TA 5EQTA 2JHPA 5ALZA 3KEFA 2P4QA 5D6NA 4BNVA 2YJ5A 1B0ZA 3TSWA 4NBUA 2XECA 2R87A 3F7TA 4HGYA 4LBVA 3EQ6A 3U13A 1FL9A 1ZGJA 1ZIPA 3C4QA 3LPNA 5AKLA 4NYIR 4LC9A 4OJNA 3IVXA 4BS9A 1TJNA 2PVSA 1FB5A 5B4UA 4ID9A 4MLDA 1TZKA 1E0JA 3ZQUA 3HNPA 3ZWQA 3GELA 2JBAA 1AUQA 3DYIA 4HX5A 4PS0A 5AXAA 3SS9X 4RD2A 1IBCA 2FPPB 1GDDA 2YRXA 5GPBA 1EZ1A 2EBWA 4Z99A 4OPMA 3KQYA 3GGOA 4KLRA 4M7PA 2P8JA 3WL6A 2XRMA 4G0MA 4IS2A 4JSRA 2C5LA 1A1VA 4YP1A 1I8TA 1XZCA 2NZUG 2YYYA 5C5CA 3C87A 1KSFX 1H6DA 5CH8A 3BF8A 2AT1A 2HLPA 2F43A 2HQRA 2N3ZA 4E1VA 2F59A 3IP1A 1SK9A 3UN1A 2ZYWX 2GILA 3FCSB 4V0KA 4DANA 4DJAA 4ER3A 4YT8A 4X0EA 2QIPA 4L74A 2WWVD 1U2GA 3EZGA 4BNZA 5AVTA 2DPMA 1RRPA 2J9ZB 4DSOA 2X9NA 1ZINA 5A04A 1O97D 2Q2VA 3M6VA 5AM1A 1IAQA 1ZX1A 4UUAA 6Q21A 1W48A 3MT9A 2RGDA 2WTNA 3OAAA 3RH0A 1WPXA 1LZKA 3L7CA 4TRMA 5LIPA 2ROQA 4RLSA 1SCAA 3I5UA 4YRMA 1JKJA 1ECGA 3L3BA 4C3VA 5FWXB 3P2IA 1CXZA 3DHWC 4D9EA 2FZLA 3FGZA 3PDHA 1OWPA 4HPXB 1FW6A 1CUIA 1QGED 4JENA 4OM8A 1G5FA 4ZK6A 5T67A 3LQQA 4KVGA 1GJRA 2C3PA 4KUEA 4LSWA 1UBKS 3NT2A 1VE5A 2HQ1A 4ZARA 1PG0A 1D03A 1NUUA 1QCYA 1Y7HA 3EHDA 4RHFA 3TPCA 4EKGA 2AFRA 4TTAA 1ZUNB 5M5BA 1TVKA 4KWHA 1VSTA 1G0NA 4WCFC 4ZANA 5CW1A 4CMGA 4TYMA 3QELA 2X0IA 3ICQB 3TRFA 5KDLA 4Q19A 3IAFA 4Q9LA 4GVPA 1S96A 4QVIA 1CDZA 4XUCA 2UUPA 3KEOA 2EGHA 1XMVA 4NE7A 1VLHA 3OZGA 5JYEA 1QRDA 1R3UA 1E1NA 1LCIA 4R1QA 2C3OA 1OMOA 2AX4A 3OT1A 2X8WA 4GMGA 3PUJA 5L6LB 4JC8A 3GMSA 5HILA 4BZZA 3WAKA 4YH1A 1XLVA 2EJUA 1MORA 1MGOA 4QUKA 1F2VA 1JVSA 1BW9B 1E2HA 1OLXB 2AFIE 3ZCUA 1J33A 5A03A 1Z5OA 4D3XA 1QORA 3KR9A 3QBJA 4XQCA 1XROA 2I33A 4BEVA 1FP4A 1JQLB 1Q7GA 4MUIA 4I5DA 1HQYE 2YWHA 3BWCA 3WG9A 2JVKA 5A3RA 5C3MA 5HM8A 3PK0A 1UP6A 4AJKA 1KOLA 3GT4A 1KR5A 2HIMA 2I65A 3PNLA 4V0QA 4DJEC 4OHFA 1NONA 1YS2X 1UM8A 3WLIA 3LIIA 1YZ3A 2FCRA 2JGLA 4PF1A 5BRNA 5EJAA 1TK2A 1SUDA 3SC4A 4AY5A 4Y0AA 1RW4A 4Q3OA 4LYEA 4MWTA 1HKHA 2QVCA 3UGKA 3WGMA 3L93A 2ZXFA 3ISJA 3LYUA 3N3BC 3W5HA 2R4TA 4OU4A 5LQAA 1HYEA 2AOTA 3OX3A 2YXNA 2J41A 3L79A 4Z5XA 5EESA 1L4UA 5C4MA 1Y7LA 3RYHA 3O2JA 3PITA 3PNPA 4G8DA 2AMYA 4Q1AA 3CRZA 2BM0A 1OLXA 2GN6A 3QVSA 1H0RA 2NNWB 1DLJA 1I51A 1GDHA 1U3FA 2ALJA 2RBGA 3UB4A 1AA9A 4EHIA 3ND6A 1KQFA 5FUXA 1P0PA 3RAEC 4HLUC 2I4LA 3R23A 1ZXLA 3NC0C 4EAQA 1R9MA 3CLTC 4R7TA 1XAJA 4XR4A 4DUGD 4X1KB 4MSUA 2CUKA 4KQ9A 3G2OA 2XB9A 5CR9A 3ZBUA 5DOZA 1V45E 3SJ7A 5EKSA 4GXNA 3VVCA 3AF2A 4CE6A 1FLDA 1SVMA 2FPRA 5B3JA 1Y5LA 2DERA 1GPBA 1QGYA 2Z57A 1N8SA 3LVRE 3TCNA 3TSCA 1T5SA 1LI7A 1TOAA 2WNHA 2WB2A 3NHBA 3PLNA 1VFPA 1U5AA 4DZTA 3JRXA 2WTMA 2C1XA 3ASZA 3RYHB 3FPCA 5JS6A 3FCXA 4M1MA 3ILSA 2B5VA 5COAA 3DVQX 4OKSA 4BGDA 2QQFA 4PZDA 3KSBC 4V39A 3OLZA 4QDJA 4IUBS 5FWDA 3S8MA 5IKMA 2ST1A 1GCIA 1NXQA 3I3OA 2NU9A 2O5EA 3T1NA 4NZMA 4Q6BA 4YDSA 5HPYB 1JFLA 1NJ5A 4BNIA 3FM9A 2Z2KA 3JARA 4MKZA 1RRKA 5KQGA 1NXVA 4FFPA 4MNTA 1BMFD 2BR3A 3O8OA 5TEWA 5E2AA 4B32A 2PQ6A 1NUHA 3BK1A 5ENVA 5G4KA 4DL9A 4ZEVA 5CM8B 4DV5B 3QEAZ 1IY0A 2JI8A 5EERA 1R9NA 2OO3A 4PZ0A 3CCBA 2NZ8A 1UBMS 1KNQA 2HF7A 4MV9A 2AQKA 5G1NA 4D9HA 2O06A 2FUG1 3I34X 2V1XA 4RD3A 3N6XA 4LX8A 4GKKB 5ICFA 4K9QA 2R6FA 3Q6NA 5LP6B 1TCCA 3LC7O 3EAGA 4B4UA 5IZ4A 1MV5A 5G1OA 5AVVA 4GGMX 5AJTA 1A8PA 1I4EB 3FD8A 2WQ7A 4I99A 3WGIA 3RU9A 3LMKA 4N47A 4I1IA 1XN1A 4NBVA 5BO5A 1P0CA 2GXUA 4GNRA 2BFWA 3W2EA 4PW0A 1EGHA 4AJLA 3T06B 2ATVA 2JLRA 2XNHA 2ZSFA 5FPYA 2VQDA 2GHRA 5GP1A 4HI0E 2QVZX 4JROA 4YDQA 1IN5A 4RANA 4LDPA 3I2IA 3SFTA 4NCXA 1K8ZB 2QB5A 2H7XA 4YACA 1OWNA 4IO1A 5FNVA 2OBFA 3DLPX 4AN1A 4L15A 4MV4A 1WD5A 1OZ0A 2ZSKA 3S0JA 4PR0A 1U1EA 1E9FA 3TZEA 4BKUA 3GP5A 3O4JA 4C4ZA 4ER6A 4ITRC 3RGWS 3LPLA 3PZRA 1JSRA 3URMA 4KMSA 2O2YA 5T7BA 1DBVO 3OSUA 2DVMA 1V7PC 1ZSYA 1Y8AA 1QBKC 1P45A 2CBXA 1TRHA 4M83A 4NE2A 2V96A 3FPBA 1UM9B 5JJIA 5B2EA 4FEGA 3QU7A 5EC8A 4LRYA 3RYIA 4TS1A 5JYCA 3CLVA 1XNQB 4IXNA 3F7NA 1JDPA 1ZOLA 3C7TA 2G9QA 1LJLA 3MT0A 2QP9X 2BCGY 2O2EA 5EZQA 1IUNA 1NJ6A 1PEDA 1CZNA 1DEOA 2I1WA 3BILA 4REQA 5HUHA 4OD0A 1CULC 1BG6A 4XGKA 1YOVA 4OB7A 2REQA 1XL1A 2XDQA 4DLPA 2CL0X 1KWGA 3IBFA 3M5WA 4A0HA 1D9ZA 3MJHA 5GONF 2ZR7A 2I2WA 2RGXA 1FTNA 3RHTA 2XUIA 3LFHA 4YRIA 4IGKA 1L5NA 3NWJA 2XEDA 5JD5A 4F85A 2REBA 5FKJA 2FJ0A 1LSSA 2ADFA 2IEIA 3N5CA 3PGA1 4IV0A 3P9QA 4ZJYA 2XXAA 2CC2A 4JL6A 4PN3A 2IPOA 5LB4A 3VDMA 3C7KA 3O2NA 1LK5A 1E20A 1UM9A 3AU8A 5AJXA 1XXHB 2XMRA 1GL7A 1RE0A 2B20A 1YGPA 3KOWA 4EOGA 4NV1A 1G1AA 4DQLA 1QIFA 3OBIA 4O8ZA 1TM3E 1LPOA 1VBKA 1KERA 1SUFA 3QVWA 1FVOA 2DULA 1VHWA 1EESA 1RXSA 2I80A 4QTXA 4B4KA 4CDMA 2WFMA 1DPGA 3QHQA 2VDVE 4V0OA 4D8VA 2ODPA 4LJYA 1YOVB 2Q3BA 1HDCA 3RLFA 4F4DA 1QM5A 3I0NA 3LJKA 4HB3A 3RAPR 1P62B 4KQ6A 3MAAC 4LRWA 5KOHA 4M8NE 2QDXA 2EJBA 1ONBA 5FUVA 3JTMA 1CC1S 1VFNA 1JVBA 2QKYA 3IGFA 5AK6A 3T15A 2JGMA 3PCXA 3WLNA 3U49A 4B4DA 4LOAA 2YZKA 5E8JA 4DSZA 3OFJA 2EKPA 3EUEA 3ZH9B 1UBJS 1AO3A 1WNTA 3UW3A 1G4HA 1NG9A 1CB7A 4IHJA 5TXGA 1CRWG 1NMEA 4INZA 3M5CA 2Q6LA 5IFLA 1B6SA 5CCBA 2BHSA 2ODEA 3HYLA 4ON9A 3RKRA 2JIBA 5CFOA 1FUIA 4FT4A 5K3DA 3IPYA 1AHHA 3NVMB 1V71A 2SKDA 2PT5A 3FGPA 4MRPA 4BATA 5LMUB 5LD2C 3PCTA 1GY8A 3MJDA 3NG1A 4H1HA 4K9OA 4MR9B 5WRFA 3R75A 2AJCA 3WLAA 4BWFB 3B48A 5KOYA 1GQOA 1D5WA 1P1RA 1BNCA 1UZUA 2J46A 3GCWA 4DIOA 3I12A 3BEOA 3ESZA 4ASUD 1Z6GA 1U7WA 1LRJA 2R8PA 5DTQA 5IULC 3UH1A 3GCGA 3UW1A 4G65A 1JBQA 3F6BX 3VV2A 4RFLA 5JQGA 4PGGA 5DLPA 5ELLA 5J4YA 5K6TA 3V4LA 3ZD9A 4NJMA 4D98A 5KSOA 5JI2E 2Q2OA 1XK6A 2EGGA 4NWIA 3V7FA 4LE0A 2H1OA 1N2BA 2BJVA 4BLTA 2BMAA 3CKKA 3Q7QA 4X90A 3LH5A 4KMMA 3BDAA 3R5HA 2VTBB 5BV7A 4CF4A 3KRTA 3LW8A 5E95A 4MGEA 3W5VA 1ZMOA 4EI8A 4DGQA 2MT9A 4G97A 4MR9A 2V0CA 1BMQA 2V9PA 2DU8A 1MB2A 2JJQA 2KPOA 4GLBA 1USUA 1OZHA 3G8DA 4HAZA 5CTAA 2D1TA 1H1LA 4IJ5A 3OI7A 1XKXA 4R40A 2Y1EA 2CXSA 3DHNA 3VR2D 2WVAA 2CDAA 2GEKA 3VR4H 3NTUA 1ZONA 3C15C 4XGRA 1XT6A 5HVNA 2DFVA 4P4GA 2Z1MA 1FIUA 4NX2A 4NOMA 5CH5A 1NRIA 2ZYGA 1SIUA 4C0QC 3L4SO 1E3DA 3GAZA 2ZUFA 5C1PA 2NP6A 1RYEA 4GMKA 3S2UA 4YJ3B 4EO4A 1JPJA 1NZJA 1RKVA 3OZTA 1M74A 4GPBA 4YAWA 1NAIA 2YIDA 3FCUB 4GYJA 4JJZA 3GJXC 3UXMA 1RQPA 2AVDA 4G0PA 3DBRB 2EG5A 2EEPA 3COPA 2A2ZA 3O83A 4PQGA 3DA8A 5LJIA 1CEEA 3Q0TA 1DS6A 1IPFA 2Q28A 4ZT4A 1SHTX 1WEKA 5FIUA 2IE8A 1W47A 1N7IA 2ZUCA 3I2GA 4RHTA 4U0KA 3DV9A 4OBWA 1ZQ9A 4CODB 2ONCA 3C1OA 4IDGA 3OM0A 1HFKA 3KHSA 4E08A 5AW0A 3M70A 2G9RA 5B2FA 2XT6A 1SUBA 1ZZGA 3AV3A 1C7IA 1KK2A 3LF1A 2IY9A 1H2HA 4C0WA 4L3OA 3GLQA 2PV7A 1Y3IA 3JD2A 3I37X 1EDDA 3ONVA 2VHQA 3N7UA 2QUIA 3KJZA 4WN9B 3TWOA 1M10A 3T3OA 3PDUA 3KQPA 5KYKA 1O94D 1WEHA 4L2IB 1UBGA 1V25A 2AB0A 4MAFA 4WA7A 3T9AA 1OH7A 3KKEA 3VU9A 4M3NA 3SHTA 1NSFA 5HJ5A 1YB6A 2CYAA 3Q72A 3EISA 3F5FA 1XJQA 5IFKA 2RI0A 4HQKA 3K15A 2Z2ZA 2Z2IA 1YL5A 1I3MA 2V97A 3QU2A 4I5FA 3TLAA 5CUQA 1S7GA 3BBPA 1GSHA 4WKNA 3E9NA 5FI5A 3Q7SA 2BCJQ 2AJLI 4O33A 1NQUA 4XE5A 3S70A 2HB6A 1ODFA 2ZQZA 4RABA 4FX5A 5HKKA 5DTEA 2VYNA 4M87A 1DX9A 1EM8A 1RYZA 3CF4G 5CP8A 3UJ9A 4L5JA 1NVKA 3LO8A 2RIPA 2Y1FA 3DZDA 3KS9A 4QU8A 4US1R 3V4VB 3T5AA 1T15A 3S5UA 3QF4B 4UE3S 1YFKA 4O5OA 1EBUA 5FTKA 4I46A 2DBVO 3IKVA 4NV3A 3G13A 3U7FB 3EEFA 3G7UA 4LZWA 4R2MA 5CCEA 1RHQA 4HGZA 2VBIA 2YXDA 3H13A 1F9AA 1TLTA 3AFOA 1GTJ1 3JQFC 1HY3A 4KAJA 4P8RA 1P73A 4U2BA 3KE9A 2YW2A 3KAJA 3FZQA 5GOTA 4GLJA 3V34A 1DQPA 2QG6A 5JW6A 3A6EA 5D7NA 5GM1A 3W9SA 3RC8A 4IPTA 1Z2NX 1Y5IA 3IIEA 4IVQA 4KU4A 3GEIA 2Q46A 1XDDA 3A1VA 1W4ZA 2YHIA 2NVOA 4R98A 4B3DA 4L0CA 3QE3A 1PDWA 4Z1OA 3MGAA 5I7SA 1K27A 1A8SA 1JILA 1IHPA 3LHSA 5DLYA 3VISA 4CIDA 4D4LA 4KR0A 4L85A 1ORVA 3FDFA 2MOKA 1F8GA 4TSFD 5BUSA 2C20A 3IBYA 3WHLA 1T1GA 3LX4A 4ALNA 5JCZA 5MDHA 2XCTB 3K0AA 1E9SA 3UM9A 4JCCA 1WPRA 4Q7MB 1GFWA 3O1JC 4EWLA 3C7CB 3Q8KA 1PZXA 2V4MA 2VT2A 2ZWOA 3A04A 1E6EA 4DAOA 1E6KA 1Y6QA 4RZIA 3LTNC 1GFZA 3LY7A 3EIQA 1VDMA 3PFNA 4X7RA 5JJ5A 2J32A 5AK4A 2WHEA 5EJGA 3K70D 4Y2YA 4H3SA 1SVLA 3WHIA 1U2SA 3KU4A 3RIYA 1KMIY 2AL7A 2VJYA 3E27A 3CM0A 3R0XA 4K8RB 5FLEX 3ZJVA 1IEQA 3DDSA 4YX9A 3ZV5A 2D2EA 1HM5A 4KG7A 3KCNA 3P19A 1QKJA 3CB4A 1OT5A 821PA 4AUNA 4N8SA 2JGDA 1KJWA 4NOJA 4QGAA 4U7FA 5BQFA 5J2UB 2FLWA 3QQ5A 3TBFA 5EWMA 3ZNNA 3LNTA 1YS4A 3BSFA 1HFJA 5CLJA 2FVXA 5K3OA 4OK3A 3QVLA 3D8NA 4BQEA 4MVWA 1DX6A 4WX2B 8LDHA 1BA3A 4F5EA 3UXHA 4GRIA 1MABB 4LOJA 1FPMA 4LVOA 3QMVA 2BZ1A 2VI5A 3T7CA 4X1IB 4RD1A 1RAAA 2H2IA 2CFTA 2VJLA 2H4WA 1YHZA 3FNHA 3L82B 1U28C 4KO8A 2C7RA 2Q45A 3FI0A 1CQJA 2BONA 2QVGA 1DEHA 3NW9A 4MUEA 2BFPA 1GRVA 2UUAB 2YIMA 2BI4A 2C77A 3PC3A 1ONSA 4PC3A 4Z3DA 4XQEA 2B3DA 2FX5A 1Z9BA 3M9XA 3PFKA 4EY7A 5ELXA 4HNQA 1BDHA 4RACA 4X44A 1AKWA 2Y8EA 2B61A 2XMZA 1HLFA 2AOUB 1OBFO 5EWMB 1E1YA 2VHZA 4G23A 3ZE2B 2QSZA 1ACJA 1LF5A 1VM6A 2Y27A 4TUYF 2IWHA 2D4HA 1L3IA 1QDLB 2D2XA 3PI7A 3W5IA 5C53B 1DKMA 4B76A 3RIMA 3PT5A 1UDCA 4Q93A 2GCOB 1F48A 3UJBA 2VAVA 5DASA 4M0MA 4RVSA 1KBQA 2E89A 2AXEA 4UBLA 3IQEA 5I7OA 1QG0A 4OO3A 4R7GA 1BH6A 1ZESA 1IFXA 2F90A 2KJQA 2SHKA 1RWWA 2V5AA 3OY7A 2WJPA 4GQIA 4MZXA 5JE8A 3THWB 3CG0A 2R8XA 4TMWA 2A9OA 1E0DA 3ETCA 4GGPA 4HGOA 3ZZUA 2Z5GA 1NJ8A 2ZAMA 2GM5A 1IIRA 2EDAA 4QLAA 4B33A 4F86A 2ZZNA 2H4XA 3C16C 1GNLA 4DR7B 2Y92A 1M8KA 4TT3A 1LV7A 4ZVUA 3SFZA 1KRWA 3IUPA 5FTLA 1W5BA 4P0PB 1BHQ1 1JPNA 2WUDA 3K6KA 1NLZA 1DKPA 2CHUA 1KI1A 2CF6A 1XZGA 1SOAA 1AZWA 2RI6A 3GLHE 4H0NA 3W3AA 1EWKA 4FWIB 2PCLA 4U1RA 2ZIXA 3SSOA 4B6GA 1H0HA 3PXDA 3FMOB 4N5MA 1UK7A 2AOWA 4FFLA 2HU8A 3GB9A 3TQOA 2GCOA 3HYNA 1XO1A 3V1LA 1R6TA 2R1VA 4LOHA 4YC7A 1EBBA 1WUJS 4KQIA 4LA4A 3O31A 4ZDWA 2DM6A 3BE4A 3KSDO 1L7NA 3CEHA 1RC1A 1EUZA 1P0IA 4MUNA 3BB4A 3CZ4A 4P7JA 3WGHA 2CEKA 4UBOA 4BQIA 2IHKA 4MVJI 4M8LA 1W5SA 3ROPA 4EFNA 1VHTA 2CXHA 3DD5A 4NHEA 3UKOA 4EDHA 4ZTZB 3GLIA 5GONA 3TW6A 4QATA 2R65A 1RWQA 3LVQE 2I6XA 1K0UA 2XCRB 1NVEA 4G1UC 4KC0A 5LLDA 1JEQB 2C4UA 1L5OA 4MROA 3L41A 1ABBA 3CE9A 3GDHA 3F3KA 3D81A 4G0OA 3CEMA 5DNEA 2R79A 4A36A 4ZI3A 1U2GC 3RSHA 4HMQA 4O4JA 1XXLA 4RSHA 4X3OA 2NPFA 1M1YE 4BMNA 5SY9A 1R16A 5F64A 1IL0A 1V41E 4TRRA 5C81A 1YE8A 5GV8A 1LWOA 4TWBA 1SHKA 1QGAA 2R84A 4UU7A 3CVWA 3NTVA 3RRMA 1MO5A 2EW8A 2Q4DA 3G2KA 2VCYA 2F48A 5C8ZA 1ATZA 1E6UA 3HBLA 4C7BA 1MIOB 5EN4A 2WJAA 1N75A 3REQA 5K8JB 4FCCA 2P9JA 3ROEA 1X74A 4ZT3A 4EZBA 2JLWA 4M0UA 3WWPA 2BGWA 2AC7A 5EE5B 1OBVA 2E4YA 2V74B 4A15A 1L5WA 1ICEA 3HUEA 3TB6A 3KSMA 2HFJA 4D9JA 1YO6A 4CGZA 2FSIA 1C8LA 2IF2A 4TMFA 3MMNA 4HX2A 3FLMA 3STHA 3VDXA 4AP5A 4QOIA 1KJJA 1LPMA 2L0XA 3JYQA 2X8JB 4DCPA 1CBUA 4Q4DA 1RMYA 4EMBA 2Q3FA 3OOEA 3I9OA 2V5UA 3T52A 3VSCA 3UF0A 3C6QA 2W90A 4K9KA 4QOSA 5KWEA 3KQSA 3ABQB 1UAGA 3VPAA 4CG3A 3KQOA 2OHIA 1SOMA 2C8VA 2PD6A 1Z6QA 3EGWA 3FYSA 3VJRA 3O4IA 4KOAA 4ZD6A 3CRW1 3TLGB 1WHTB 3HCOA 4ZO6A 4EQ6A 1Z0AA 5IEBA 1G16A 5FFNA 2QAJA 2GSDA 4QOFA 5C8YF 1OHHD 3QE2A 1DC8A 4YXWA 2VP6A 3T4PA 1TQ8A 3IKTA 4BWGA 4F8JA 3THXB 3NNNA 3GD5A 1N5KA 3DV0B 4X64B 4LQ4A 2LIVA 3AEQB 3G8CA 2PLRA 3ON5A 2P4UA 3SSAA 1PSZA 3FMVA 5LC1A 2DR2A 4R1UA 4WLOA 4GUAA 3C5EA 2XR1A 4MYUA 5J58A 3KDAA 3R5FA 3IR5A 5SZJA 5CBPB 3C1AA 4A27A 5AHRA 1FSFA 1VHLA 1IOLA 2IH5A 3UQZA 2WE7A 3FIUA 2J3LA 3TINA 3IP7A 3N0XA 3R7DA 4R16A 4DA6A 3AVTA 2AV6A 1XELA 3M6FA 2WJ4A 1KYWA 1LLQA 2X6RA 3O3MB 4WADA 4ZT2A 4MDEA 3NJ8A 1X1DA 4F3YA 2ZT7A 3JVUA 3L6EA 2YH2A 4AI6A 1Z5VA 4Q1FA 5FYDA 3BMQB 3NTRA 2F3RA 4DMHA 4KXYA 2DSNA 4QJ3A 3PUKA 1EK5A 4JI1B 1G3QA 3KJQA 3L7MA 2WYHA 2Q21A 3M9LA 4CUJA 2ZRAA 2X9QA 4OP3A 2RHJA 4QYWA 1K3TA 2A58A 2AEMA 3B6EA 1O57A 3BZWA 3MF4A 3PUHA 2IV7A 4RK4A 1P2UA 3L8MA 2DP4E 3ZGZA 2HF8A 4F3KA 3WAGA 4ESHA 2P7HA 4MAAA 3TJRA 5DI3B 5HZKA 4OLHA 3WXBA 4R2HA 2RMKA 1W0CA 3IDQA 4PG8A 3I64A 3T41A 1NVMB 1ZI6A 1A77A 3GLGE 2HZBA 3F90A 1HTTA 4G8CA 1TCBA 1O77A 5GWXA 1C41A 2J3QA 2AN1A 2ZWIA 4KTTE 4MUYA 5I5EA 1F3LA 1X7YB 2XNJA 4FEEA 5D1HA 5BW6B 3AF3A 5ALRA 3OH8A 2W2LA 3OOJA 4XKJA 3WWEA 5A0TA 1YJCA 3OKAA 4JHXA 5K99A 2PS1A 1XEWX 3DE2X 1SCIA 2FFBA 2KS6A 1IQUA 2HNAA 3GVXA 4UOZA 1OLSA 3C8HA 4B3BA 1N25A 1FVFA 4P84A 5CIWA 3DKVA 1ZVVA 3RANA 1IZZA 3NO4A 2GNAA 3HZRA 4R6XA 1F1JA 5CJJA 4YR9A 2W37A 1Q0QA 1I94B 1E59A 2JFGA 2ZYDA 1PZMA 3LP6A 5FQOA 5H3CA 1STOA 1T0UA 1W96A 1YA4A 2FXVA 3ILYA 3TBHA 3ETGA 1XKTA 1L5SA 3BMCA 3GIWA 3A9RA 1S4QA 5BN3A 4N3GA 3IHLA 3K8YA 3GUCA 5SV2A 2ZJYA 3JQ9A 5K09A 4TXJA 4CVNA 4QE3A 2CLDX 4YBRA 1U8YA 4XUGB 1G7CA 4BFYA 4E6PA 4AJEA 1SBIA 1X7YA 4CT4B 2N1MA 2YWBA 3H75A 3NC1C 5HTOA 1JBKA 2Z9CA 3I53A 4JLWA 4O1IA 4CF3A 2VJAA 2HPHA 1YZVA 3FYDA 2JJYA 3ZGOA 5FWYA 1HZZC 3RKUA 4A1OA 3A32A 1E1MA 4JR0A 2A14A 2E7ZA 3M6AA 1XD8A 4H6WA 3ZKWA 1IXKA 2Z3ZA 3JQ8B 3KYDB 4PYLA 1GPWB 2GPJA 2OAQ1 2B35A 1XAIA 3BTSA 4RGBA 4MO2A 5AM3A 1FLNA 1L7BA 1RBYA 1ZG3A 2B0CA 1JEYB 2PT7A 1K4MA 2WOOA 5EIWA 1QIHA 1ITZA 1A5TA 3GZNA 2B1QA 2CXXA 1P1KA 1ZCAA 3RIXA 4N5LA 3OESA 1JEOA 4FI3C 4N3CA 3SHQA 3A1WA 3GRZA 1BS9A 3NUZA 1ABEA 1E7MA 1O8CA 2FDXA 5H4HA 4AMBA 1V6SA 2D5LA 1THMA 3KJHA 3I6ZA 3GRKA 2X1LA 2XIJA 4YO7A 3PD1A 5E6UA 4WKCA 1C7RA 1EHCA 4F2HA 4ENWA 2R1ZA 1JRLA 2DKNA 4ND7A 4D3ZA 4M54A 2MDTA 3U4AA 3HGMA 5F76A 4UAVA 1B76A 3LO5A 3D9QX 2Y68A 3DPIA 4GP7A 5GVRA 4IO0A 1C7EA 1J22A 4PICA 4EFKA 1XALA 1RWPA 1W36D 3SR4A 2CCGA 3A4IA 3UNXA 2V7QD 4EY3A 2PUAA 4KQMA 5EIEA 2V3VA 3L0PA 4CGYA 1FC0A 1Q0HA 2DBYA 5EJMA 5I45A 4MQFA 4WZBA 4GI7A 4QT0A 3KR2A 1SD1A 3V48A 2CDBA 5IX8A 3WGTA 2VNHA 2ESRA 2O3JA 4DQKA 2VJKA 1JSXA 1ADJA 3AOEC 5HXAA 4UM5A 1NI3A 3KSZO 5L3ZA 1ZCFA 1DI0A 1U0BB 4DLRA 1BXGB 1X15A 4TL9A 3ZHOA 5JT1A 1JX6A 1XYVA 4Q9NA 2YOHA 1BGVA 3JALA 1XQ9A 4ZQFA 5PNTA 3FY4A 3MSCA 3O38A 4HAIA 4HYEA 1T36A 3BQNB 1F0PA 1EX7A 4MHOA 1G7TA 4OQEA 2NVUB 2BI8A 1GPLA 4D3FA 2AUNA 4RHXA 3AM1A 3TSOA 1DHTA 4LYAA 1E3SA 4UATA 4XVCA 1Q0PA 3JCZA 4QD3A 4TL6A 3E3AA 3PNMA 1CNMA 4X9XA 5CITA 9ABPA 4HNHA 5T3YA 1ISIA 2XCQA 4DM3A 4ZKDA 5F77A 1CJVC 1DXHA 2VK1A 3GRPA 4OY3A 1A82A 2IE0A 4QBFA 5DW3A 2J5BA 5EWLA 3RUFA 5IUNC 1T3TA 2OO5C 2LXNA 1XTUA 2QU7A 3LYLA 2V0GA 2V8OA 4CIWA 1IG0A 5BVGB 2ZM5A 2FX3A 3EG9A 4FZJA 5CVTA 1E5XA 1JFVA 3FBTA 3TBKA 5JSZA 1P29A 5KTYA 3F3MA 4C5CA 3EPLA 5JADA 1T4CA 3RJ9A 1AMNA 3ZEIA 4PAMA 1XOIA 5F9FA 3C8MA 4M8SA 3GARA 4Y6GB 4C08A 2R7KA 4B47A 5AM2A 3RTBA 5IUJC 1JSLA 2FP4A 2RKWA 3M81A 3FWYA 1H85A 1QSGA 1BJKA 3JZFA 1RZRD 3KQWA 5D6OA 1AHPA 2HRQA 5IDVA 2BPOA 4AL4A 3MUNA 2XYQA 1EWVA 2NU7B 4QM7A 1PL7A 3CX8A 3SHWA 5DOVA 2GAJA 1E2PA 3CFYA 3FNRA 3ZJ5A 5EWLB 2CK3A 4N7JA 4OL0A 1XZIA 4LX0A 3GJSA 4NIMA 4XYMA 1X87A 2Q6KA 3AVYA 4TUYB 3F9RA 3ZN2A 3CRNA 1GQSA 1EK2A 1MJ5A 4O4IF 3TEMA 3K6SB 1JF8A 4FDAA 2BGUA 2IEYA 3FMFA 1XA0A 3K5IA 4HDAA 1PS8A 4YY3B 2RHWA 2UYYA 4CJXA 5LXTA 4E5SA 1S2DA 4A9AA 2AXPA 2FMIA 2QNIA 3DFUA 1Y4ZA 1B7GO 3NKVA 1QH0A 4MW4A 1W6UA 3CNQS 4YCNA 1A7KA 4Y2QA 3G79A 4P34A 3DYVA 1YDGA 3A1NA 1T1IA 2EEZA 3EVTA 4M9CA 1SCQA 4MUXA 2EF0A 3IJ5A 2OYSA 3HKDA 2WAXA 4XB1A 1TUBA 1T2NA 5CDSA 1GNSA 2P7IA 2M32A 3D6NB 4RAQA 3N9IA 1RKBA 2D7JA 3QXHA 3UUFA 1V1RA 1ZNXA 2HLDD 3JRWA 1WDKA 4KTVE 4OQNA 3SX2A 1DEAA 3OF2A 4YGYA 1QIIA 3JY6A 2JRCA 2O2SA 3G7NA 1DFHA 3VZDA 4Q3BA 3WZLA 3F6YA 3O8BA 4ZO8A 4WXMA 1DJMA 1DKRA 2WIJA 3DZ8A 1PV4A 3GFRA 3JZAA 2DBZA 2HRDA 1H2EA 3N59A 4HS4A 2AQIA 4J3JA 5HKLA 4EG5A 1ZMTA 3MBKA 2IU6A 1JXMA 1CY2A 2Z3VA 4O0MA 3TRKA 2Q99A 3ZIDA 5B58C 4DJTA 4XCVA 1XZ8A 2H54A 4L22A 3I9V1 2H1RA 1MTOA 2BE7A 1GPUA 3FBWA 5A5FA 3N8GA 1HDGO 4AKGA 3L92A 2IXTA 3F46A 5CFNA 4JBXA 3ZU4A 1EH5A 2XVYA 2JCXA 1QWSA 2RARA 1NLFA 1QIGA 4FBGA 1WWKA 4FILA 3AIIA 4DCJA 4F06A 3M33A 2X9LA 4UEWA 3RYCB 2PBZA 3WYFA 2V7BA 1B74A 5TGDA 2Q7DA 4LTNA 2H4ZA 5FTMA 3TXYA 4CR7A 5ANRB 1L5HA 2QG9A 3GJ7A 1L2TA 3FZGA 5D5PA 3S29A 3X43A 4ZVQA 4BN4A 1EE2A 1JJIA 3Q10A 3NOQA 1O08A 4XPIB 1NFQA 2ZBQA 3B6JA 3NP9A 2V0NA 4MW1A 2PGAA 2ZSIA 4LCEA 3DXZA 3RTCA 1Z2DA 3T9CA 4Q4CA 4Z86A 1LF0A 2AVNA 2ILTA 3HXOA 4A91A 1NULA 1QH1A 2GKGA 2PS3A 4MVJA 4ER0A 1P2SA 2C2BA 1TT7A 5AICA 3WDKA 4CKCA 1XNHA 3FHCB 1N1EA 2I4MA 3EXFB 5LQMA 2QZ9A 1AGRA 1RE1A 2DY0A 3CHYA 3JATB 3O6VA 3JYOA 4XCQA 1D4FA 4JLBA 4HFJA 5DYNA 1ZLXA 4UE6A 4N1AA 4OHUA 2X0FA 2FQWA 4BFUA 4F8YA 3OZDA 3T3NA 3LYAA 3B38A 3RYCA 2Y71A 3JQAB 3TD6A 2HRRA 1IWBB 3MTJA 4RY8A 1ICIA 1M2JA 4IQ0A 2ZREA 4KX3A 2F00A 5HJ2A 5HWSA 5CXSA 1FXWF 2WA2A 1AK9A 1I5RA 5C4IA 1TCUA 1USKA 2BFFB 1R4MA 4FYXA 3GEMA 4BBPA 3A1CA 5EKUA 2EKZA 1NW5A 2IUFA 1JQAA 1O96B 1JHOA 2C5FA 1N5OX 3P27A 1TGYA 3PNQA 3I32A 3VNSA 1MRNA 4FT2A 4BX0A 5JAZA 3RI3A 3KKMA 1OKKA 4B3SB 2VJBA 3KKPA 4Z2YA 3ZS8A 2C5EA 1RPZA 4PG6A 2IUUA 4JKYA 4JUDX 4PGFA 1J49A 2HPZA 1PGJA 1P4GA 3B1YA 5E2IA 4JBHA 2EWMA 2I78A 4GX2A 1QR2A 2QX8A 1TPZA 2WICA 2Y0EA 3NBFA 3K8OE 4HEJA 4NECA 4DHWA 3LLVA 1WRBA 3O26A 1TF2A 4BE4A 3AUSA 4TV8B 2QENA 2H3HA 3TO5A 1GU7A 3EGVA 1ZMBA 3L1UA 2OGZA 4MUBA 4DLLA 5JXJA 2CNWD 4UTXA 3D5QA 1GKLA 1XZAA 1XTQA 2ATCA 3GFFA 5JIBA 1VSVA 2JKVA 2EKBA 4JXXA 4OBEA 3R7SA 1IPHA 2X7HA 2TMDA 1CDEA 2JEYA 2JJ1D 4ZK2A 2ZT6A 3BTUA 2XVAA 3ISVA 4YTEA 3ZCSA 3OWHA 1G6OA 2XWJI 2JFOA 3OHMA 4ESEA 4YMGA 3U4MA 2JIRA 1B1CA 3JQEA 3L04A 2VDOB 4N9QA 4WLVA 3U3OA 4FBMA 3I05A 1OE0A 3TM5A 2NXJA 5JFGA 4EI2A 4C4OA 1YS9A 3DOCA 3UAOA 3UC5A 1U3VA 1DC7A 3ICVA 4C2AA 5A4IS 4K9PA 3GVPA 2IS2A 4R41A 4OBXA 1Q7TA 2AMVA 1EGMB 4IMJB 1NVVQ 2PZGA 1J56A 1L7OA 2VAWA 4YYEA 3HO1A 3FVRA 1KH3A 1WKVA 4F4IA 3CTMA 4P9NA 3DTVA 3OQIB 4LCBA 1F4VA 3TE6A 2EWVA 2XTMA 1QE0A 4ZI7B 3HBNA 3HVJA 1ODKA 2RKOA 2QMEA 5BRAA 3DNPA 1ZFNA 3V4FA 3F49S 1ULZA 2YHAA 2F4NA 3DQPA 1EDBA 5DIFA 4LPSA 1XDUA 2NO7A 3RC2A 5JQWA 3TQTA 2BGMA 5EG5A 4LTDA 1EAYA 3IIIA 3CPJB 4XSVA 2ZVQX 1V16A 2HMYB 3Q2OA 4PG7A 5CDFA 1JDZA 3BMNA 3WK7A 2XAUA 1WV1A 3RNOA 2GWHA 3DAOA 3GG9A 1X7DA 4PX2A 1HE1C 1ND5A 2Z2YA 1XP5A 1MDFA 1CIVA 1O97C 3VC3A 2O57A 1M0SA 3VR0A 5E6SB 3OIWA 3KTAA 1I7NA 2PMFA 1RNLA 3SHVA 1VIDA 3I6QA 5DM70 2CB9A 2ZRCA 4P82A 5K0SA 2VJMB 4LUCA 3EIUA 2O8CB 3AR8A 2C59A 3I6IA 4KCGA 3ZDAA 3ND5A 3PF8A 3ZY3A 3Q40A 4AECA 1JG4A 4ZKEA 2M6RA 2I6GA 4NATA 2H57A 1C9YA 4R8LA 1TJ3A 4Y6QA 2GN9A 2ZYAA 2YWXA 2BFBA 4HEQA 5E3JA 1GR1A 2HJWA 2B2XA 1T6YA 1WAMA 2J6IA 3RTEA 5IC4A 2D8AA 5DM60 4FI3F 4PZ9A 4B3GA 4XUDA 3VUEA 3H18A 1HRDA 1UAYA 5AKYA 3LHDA 3L6RA 1VMDA 4J0KA 5EIBD 4DMRA 2X0RA 1XU7A 3P9PA 2Y76A 3ETJA 3LWBA 5KYWA 4DV6B 4FHEA 1P19A 3IV7A 3KT3A 5D00A 1BVHA 2C1EA 2HSJA 2YTZA 1E6LA 1U9IA 4I66A 3ZI7A 4JOCA 3IH5A 3FTEA 1GHTA 3UTCA 3DV2A 4L9SA 3MGKA 3ABRB 3M4YA 3ZW7A 4N7RA 4WESB 1WTAA 1WDTA 3S3TA 4NOLA 1Y8ZA 4G41A 4D0SA 1R6AA 5HIMA 2NO4A 1BW9A 2FWIA 1AURA 2X2EA 1KZ7B 3A05A 1FUKA 1NP3A 2G82A 3BXZA 4K88A 3VSAA 4BNDB 4XWGA 4UNNA 5KNBD 3ZHQA 2R5NA 5CA1B 4PM4A 2UUOA 3NGMA 4GR9A 1OTYA 2PXCA 5IAGA 5IMSA 3BE8A 1MC1A 3ORSA 3NNDA 1HL3A 1CP2A 3RREA 1I7SB 2FYTA 3NWBA 4RFSB 4Y1GA 4F4FA 3MCUA 4TXHA 4U4AA 2PJRA 2RK6A 2VYCA 5AVWA 1B0AA 1OXTA 4KH0A 2JFQA 4Q9IA 3S2YA 3LQ2A 3EF1A 5C9ZA 2WNIA 3WIBA 3GCDA 5B6PA 1GADO 4LI0A 4TKVB 2BM9A 4C0JA 3MWDB 2V6MA 1WXQA 2W6IA 4AF6A 4XFKA 3K9FC 5IC6A 5I8ZA 3KYBA 4B3RB 1PCXA 4G4SO 2KBFA 3TLZA 1Z6ZA 3GXBA 4WHMA 5ES4B 1D2RA 1E6WA 4LSZA 4E5DA 4DB2A 1WF6A 4D02A 1WUKS 4M99A 4JN6B 3IAUA 4LJKA 5CVVA 1I2ZA 1GVNB 1LTHR 1LPSA 1Y48E 3FA2A 3P71T 2JH8A 3GJRA 4IJKA 1QU3A 5D3KA 1KDZA 2JIZA 1G5QA 3PKIA 1GGEA 3M6UA 4BNDA 5LIRA 3VDQA 3SLRA 2PFKA 5LA6A 2LBPA 3QIVA 1N77A 5JARA 3E35A 4QQ8A 4UVGA 3CNLA 1EVKA 2WU3A 4RFSA 3J81k 3LQ1A 1NXPA 2Y2UA 3KNZA 1EE1A 2CNNA 2CWWA 2W6OA 2PLAA 2WDPA 4JJIA 3E48A 5EHZA 3EIFA 3OPVA 1VCOA 2AE2A 5K45A 3AI2A 3IQFA 2WU0A 3IEPA 1XQXA 1CERA 3AIMA 3KZ1E 1G19A 2HDOA 1Z4OA 3KJIA 1YDWA 4GVLA 4L3VA 2Q8PA 3MBIA 4ZVNA 5A5GA 3C6XA 2IKQA 3BIWA 2O1EA 3K8QA 1JEEA 1U4NA 4UXIA 1DBRA 4GSLA 3LZ6A 3AQIA 3HA3A 3MXOA 3Q0EA 3PR2B 1XV5A 4WERA 3SSMA 2CNOA 4PINA 4RH0A 2AQ8A 1A96A 5AI0A 3VJLA 2RE8A 1VG1A 2ANCA 1KP9A 2COKA 3RD5A 5AJUA 3H84A 4BKOA 3FH0A 2WJIA 4BECA 3FIJA 1XZEA 2NTNA 3I9KA 3I4LA 2XYPA 1P1IA 3OQBA 1KOJA 4B2PA 2QY9A 4DB4A 3LY8A 2BSQA 1HTBA 3JU3A 3GPCA 3ABOB 1PZNA 1E79A 4ND8B 2Q0HA 2O2HA 4LXHA 4YREA 1JG1A 1ZCBA 4GMXA 1G3MA 3QJYA 1T8TA 3TL6A 1OX4A 1NXTA 1EWRA 3JARB 4FE4A 4LSGA 4Z0NA 2ZBGA 4UQPA 1T6BY 3MQ4A 3ENQA 5BUZA 2GBLC 1U1GA 2ZRHA 4RVHA 4ZYVA 2MSWA 1SCNE 1Z6XA 3GUVA 1XVAA 2XXJA 3QXGA 1YH3A 3ZDYB 2IPLA 1OXBB 3CKLA 5TARA 1EXVA 1PZHA 3ZNQA 2B4YA 2Q5JA 1P81A 3DO6A 4RJTA 5JUWA 4FW9A 4Z1MD 2WABA 2QJTA 4MJ3A 4PU0A 3RVDA 4PZUA 1MHPA 3OZFA 5ALLA 4ZTBA 2P5SA 3W6ZA 1GNQA 2VWPA 4TL8A 4OJYA 4WTOA 3AF0A 2ZS8A 2DUMA 4AD8A 5EWJA 2Z0MA 3DVRX 3AY7A 4X71A 2OHOA 2XNCA 3RS2A 3T5MA 4ZMRA 1KYTA 4FZ3A 1SHZA 2I67A 1FRFS 2J0EA 3DOHA 1LLCA 5DBHX 2VPZA 1GL6A 3CPEA 4LYHA 2PKYX 3CZQA 3DFIA 1OC4A 2V98A 4EL5A 3H4MA 1JPUA 4O4HA 2WT4A 2Q7OE 2H4JA 3K9WA 1XSEA 5KYNA 1Y1KE 4HQ6A 1XQYA 1N9ZA 4KO1S 4AXBA 5JNSA 2FMKA 1UDBA 5EZYF 2CDCA 4Y2UA 1W4AA 3V1MA 4J0IA 3H0CA 4L4XA 4BLRA 2P5UA 1W5EA 2P4SA 2BL4A 1Q83A 3BWVA 2DFNA 3HJGA 3ITEA 1EQAA 4ZGBA 3EQ8A 5K6RA 4II7A 1SRRA 5AUNB 2LV8A 2D0IA 3N8DA 4NI5A 4OJTA 3TQRA 2C07A 2XE8A 3CNNA 3TAHA 3EY4A 3HA5A 4FS3A 4XDHA 3KB2A 4MKIA 4BO9A 3ZWXA 4WEQA 2ZJ1A 4FGLA 2J3HA 3HB7A 3IMCA 4IMIB 4BO0A 4LV8B 3JWPA 3V7WA 1DBQA 1IY8A 3FG9A 3CSUA 1G5RA 3BFXA 5HQJA 1O4WA 3A6FA 3EGIA 3ZXSA 1YASA 1XWFA 4JSYA 3UJPA 4G5XA 3F3SA 1EFVB 1LFDB 5FO1A 2JBWA 5AI8A 3U7JA 1IEXA 3QLUC 4CDRA 2JLUA 5BV2P 1EXMA 1AKEA 4NZPA 4HMPA 1KDVA 1T0PA 2ZATA 4N5DA 2AD5A 1V95A 2QMYA 4EG7A 3TG2A 1TZMA 2KX7A 4HX9A 3GRFA 1ZNQO 3WYDA 4FEAA 2UVDA 4E2YA 1US8A 3TSYA 3W8EA 2C7BA 2NQTA 2VSNA 4YP7A 2VWHA 4UZSA 3I5XA 3U37A 4A2CA 4DKJA 2RCNA 4MCIA 4X20A 5HS6A 1L1EA 1RAEA 3UOAB 2QTRA 4DY4A 3H2JA 4LJRA 4YRBA 5I4IA 1JG7A 3GDOA 1QZUA 4M1TA 3LQ4A 2GYYA 5KHAA 4Z4HA 2BGNA 1SN7A 2HXYA 2AN3A 3NGXA 1RI5A 1PJRA 3I04M 1MZPA 1QKIA 1TDJA 4M86A 1E1DA 5JAIA 3EW7A 5FF9A 3FKSD 2CMDA 2NUAB 2G0AA 4TLAA 4OQYA 3VNBA 1DX4A 2J1LA 3DE5X 4HPWA 5T41A 5JEDA 1T0BA 2X1VA 1USVA 2J3MA 4HNAB 3RNLA 3IEXA 4GC5A 4KQWA 4MEAA 3HTXA 1E94E 4W5HA 3IQWA 1IVYA 1YZHA 2L42A 1VJ1A 2P4EA 4X00A 1TU3A 1WA5A 3CUVA 4YJFA 1FMLA 3RARA 2C4NA 4QKQA 1US8B 3UV7A 4G5FA 1NJFA 3A7EA 4R1NA 3TIIA 2QN2A 4L50A 1ENPA 5BQOA 1RLOA 5H8WA 1O5IA 3A1EA 1GUYA 5DH9A 3VH1A 2OUKA 4XWWA 4YPFA 2PUGA 3EBPA 3QJ5A 2PJDA 1PFKA 4QQRA 4ZHQB 5CFLA 4LNUA 5FOXA 5HHTA 1DJLA 2B7BA 4CF7A 1EUDB 1JU4A 4MRMA 2HU7A 1U2QA 3X0DA 4UUPA 1P5RA 1ORWA 4CIAA 4EJSA 1IVSA 4MWBA 4IHJF 4UD6A 2IZ1A 3NBYC 3JQQA 1XEXB 4PSUA 3O4RA 4FYHA 1W9HA 1I3OA 3D8HA 2LDXA 4QRHA 1X1TA 3R7BA 3T7TA 4EX6A 1QS0B 1SXJD 2OO5A 3DBIA 2C31A 4AM8A 4Q0MA 2VHJA 3R8FA 1C9EA 5DMXA 1PT8A 1Y3CE 1HI9A 2QBYA 3AR9A 1U2ZA 1N2CE 4RKWA 3RC1A 5B36A 2VVTA 4X6UA 2GMWA 3DPSA 4EB6A 4ZQCB 1IXSB 1C8BA 1OFUX 4EW3A 5MN5A 1JZSA 1E2LA 2BHNA 2D1QA 3QM1A 2N75A 3HG7A 4XJTA 1ULSA 3PP8A 2BGJA 4MWSA 3OJOA 4IDQA 1U0OC 4XJSA 3OWOA 4GKBA 5H80A 2BFAA 3C3PA 1CQZA 2FSVC 1QBGA 1DSSG 4DBZA 3PFCA 5ESWA 5BNTA 3JAKB 4GXTA 4W4TA 2YJ3A 4PTYA 2GEBA 2OMEA 4L8LA 3VPBA 4QXRA 5KOHB 1NVVR 2VWGA 5HRAA 2XB2A 4XFJA 3INGA 2HMUA 3PQ5A 4YCSA 1FNDA 1QYVA 1X92A 5AK5A 1XGKA 3A14A 3JSAA 2VRCD 1Z74A 2I8CA 2P90A 1CB0A 3D3KA 4I36A 3JW8A 2IYVA 4LZOA 1KGDA 5IN4A 2VWQA 2XGMA 3DE3X 1CD5A 3P7MA 1CR4A 3I5MA 2SKCA 1PX0A 1T4BA 4V38A 4XD7D 4LWOA 4HNVA 4DV4B 1L5KA 3F6RA 1IN8A 3FMIA 3A6PC 3F9IA 2ZAGA 3EMBA 3K20A 3PIRA 4M60A 4X3CA 4NABA 4PC2A 2PZJA 2IELA 4QPNA 4IZIA 1XTBA 3LECA 1W87A 2QNBA 3ML1A 1B6TA 3UHFA 4LRQA 5DM1A 2HWUA 5DVZA 1FJGB 3FYUA 3ZE8A 1DQNA 1RIFA 2IHNA 3WB2A 1WJGA 4OI4A 2O20A 2GVNA 2HCBA 3PWTA 4BB5A 3AR4A 1JH9A 5ICEA 3QKRA 1D0VA 2W2LD 4FFWA 1YCDA 1YI8A 3K0BA 4IVPA 1E1CB 3Q8WA 3S40A 2A8YA 1EUCA 1AQIA 1XZHA 2LE0A 3O8DA 3TNYA 1GPMA 2NQ2C 2R9VA 3NHZA 4M6WA 4RZUA 3VVBA 4JMPA 3UGJA 3ZWBA 1BCSB 2GHQA 3KPVA 3AUUA 5F9MA 3MIIA 2SNIE 5E7IA 2GDZA 2ZJAA 4GZMA 3VU9B 3C2QA 5CVDA 1KY3A 5G41A 1MO3A 2YWRA 4MMYB 3HY4A 4MS4A 1ID8A 1OLUB 3FMGA 2VRBA 3G2IA 3L0CA 2UZ1A 4YV7A 8OHMA 4RPJA 3BA6A 4IMRA 4MVJP 1KEZA 1PHRA 3DBVO 1E2GA 4NBRA 3OLYA 3CYFA 4AJ4A 5DF1A 4YJGB 1E2KA 3BZBA 3G9ZA 1A5ZA 3AG5A 3C43A 2FR0A 1Q12A 3HB4X 3P45A 4ERNA 1DNPA 3M4NA 5EHQA 2EFCB 4BCDA 1S2IA 3CWZA 1YR8A 1AKMA 5A1TA 4ZN6A 2F1RA 4BJ5A 4CL3A 1H9AA 1NMYA 1USIA 4AF7A 2Z4RA 4IQ4A 1N0WA 4HQLA 4CQLA 4HO1X 4ABTA 1RXIA 1S9HA 1JEDA 1OIWA 1S2NA 2OPBA 3D6TB 3H2GA 4CLDA 4YJ2B 2CWDA 5T8KC 3UANA 3T1YB 3EHEA 1TYEB 2JGIA 1ZH6A 4AS1A 5I7AA 4H4EA 3ET4A 4P58A 1D4AA 4MYDA 2CJYA 4K6CA 5HF8A 4F1WA 4MRVA 2YW9A 2QQGA 4JI3B 4LF5B 1PL0A 4GBMA 4RV4A 1SC9A 1N5DA 2L19A 4JQZA 4M0FA 4MV8A 2BC9A 4OP1A 4DA7A 2FEAA 2OG2A 4XLTA 2YHIB 2Y1GA 3P32A 2BEVB 4JVMA 5EZ5A 1S2MA 2XZLA 1Q74A 1OGIA 4UOEA 1I9GA 1NKSA 1DIRA 1T10A 1XZQA 1JHVA 13PKA 3CB2A 4U7TB 2OO7A 2GT1A 4IHKA 4KSBA 2VEDA 3U1BA 1OH5A 3QPCA 3F5SA 4P53A 1PUIA 2FUKA 2D8MA 4PNHA 1U3DA 4TXLA 2Z95A 5LOVA 1TMKA 4IIJA 3DLBA 2DCMA 1WLSA 1Z6TA 2NIPA 2EDCA 1T8SA 1U3GA 2FJPA 3D3QA 4B6EA 1M1NA 4QXMA 1JTVA 3HUUA 5HGJA 5CT9A 1HLPA 5LDGA 3C6YA 2H29A 1TJ5A 2X4LA 3D6HA 3AESB 3H17A 5J2TB 4FB5A 3F1LA 2CHEA 2AN9A 1NNSA 1PS0A 2AKEA 2D59A 4A2WA 2WT8A 3ELWA 3K53A 3NIDB 4ZFNA 5GVSA 1A8HA 3O74A 1VOTA 1TA4A 2WPDD 4UVHA 5ILOA 1GNVA 5H81A 5TT0A 3ROXA 2ORWA 4CM4A 2WTEA 4O25A 1FJXA 4RZ3A 1W2HA 2BEVA 2BBOA 4FUQA 4MDYA 1J90A 3VKVA 5J2TF 2CZQA 3IOCA 2QRUA 4JHLA 4FFDA 5IH7A 3T5PA 3AEKB 4JLNA 1YULA 3PGVA 5LA6F 3NH9A 2V54A 1EM8B 3S4YA 4PSVA 4E88A 1IBSA 2CUTA 2Y0DA 3OCCA 5FUQA 1IUKA 4MULA 5LOVB 3MUFA 2HY7A 1AUXA 2HA7A 3VZQA 4LXGA 4BP1A 2R85A 3FHTA 1W0KD 4MUMA 3CV3A 2F55A 4ZV7A 2EL9A 1DHRA 1DP4A 2WKWA 4M4SA 3VOAA 2UXDB 5L7WA 1JHDA 3AVQA 3R9XA 2G9UA 2JVJA 3AXSA 3SEZA 2W2KA 3L4EA 4KE6A 4Y0NA 1MABA 1Y5MA 5IJWA 3B3FA 1XTTA 2I9KA 3G1UA 5BT9A 2YJ6A 3HB5X 3PFBA 4EZEA 4O29A 4NCAA 2L69A 2VZEA 2X8BA 3UWDA 2DWQA 5IU6A 3R0IA 5DP1A 4JGBA 4QM6A 1NU8A 2DFLA 2E5WA 1VE6A 1UBRS 2XMDA 1J42A 2QWXA 4FZRA 4YT4A 1DO2A 3WIEA 4JELA 2XRFA 3FMPB 2LTAA 4I50B 4MRNA 5D51S 4Y0VA 2VQFB 3L5OA 2VG8A 3MUEA 2ZTUA 3GA5A 4MPTA 3WA6A 4YI3A 4L4SA 4GM0A 2V7XA 1OGYA 2DE0X 3D0QA 4GMDA 4OFBA 2CXOA 3WKCA 6REQA