1YDGA

Crystal structure of trp repressor binding protein wrba
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
201
structure length
201
Chain Sequence
APVKLAIVFYSSTGTGYAMAQEAAEAGRAAGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIFKSGGNPYGASVTANGQPLLENDRASIRHQVRRQVELTAKLLEGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords trp repressor binding protein WrbA
publication title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Protein binding
total genus 81
structure length 201
sequence length 201
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ydgA00
5B3KA 1KBQA 2QX9A 1OFVA 3EDOA 4ICIA 4R81A 4LTDA 3W78A 1VMEA 2QMZA 3NHFA 3W77A 1D03A 2XODA 1CZHA 3NHYA 4YAUA 3P0RA 1RLJA 5LBUA 5LVAA 4NULA 2X2OA 5FX2A 1RCFA 1WSBA 4Y9UA 1CZKA 4DILA 2FDXA 1QBGA 3F6RA 1I1OA 2HNAA 2FCRA 5JROA 3NHJA 2FZVA 4ZVNA 3G5MA 1OBOA 2OHIA 2OHHA 1H69A 2Q9UA 3ESZA 3OWXA 2OYSA 1E5DA 2Z9DA 1J9GA 3ESYA 3OJXA 3TE7A 1CZLA 4YAOA 2OHJA 4QOGA 3JSXA 5NULA 1X77A 2M6RA 1AHNA 3B6MA 5F51A 3ESXA 4QOFA 1FUEA 3NHPA 3FW1A 1FLVA 3K1YA 4H6PA 5LBTA 1FVXA 4QOIA 3NFRA 2Z98A 2Z9BA 1TLLA 5LJIA 3F2VA 3GFRA 2GSWA 3N3BC 5LLDA 2QR2A 3FVWA 3N39C 1B1CA 4ESEA 1H66A 1DX9A 2B3DA 1D4AA 1J9ZA 4QOJA 5B3LA 1WSWA 3S2YA 3B6KA 4C14A 1JA0A 2FVXA 3ZHOA 1RTTA 1CZRA 4CF6A 4BMOB 4M0CA 3U7RA 2QMYA 2A5LA 1FLDA 2QX6A 2V5VA 2ZKIA 1XYVA 2FOXA 4Y7CA 1BU5A 4XDHA 4GR9A 3UXEA 4DY4A 1RLIA 4DIKA 4ZVMA 1QR2A 4YALA 1XYYA 1DXQA 1FTGA 3GFQA 1KBOA 4QODA 3W7AA 2QWXA 2M6SA 4N9QA 5TGZA 1BVYF 1FX1A 3HA2A 1QRDA 1SG0A 3K20A 5LMCA 1TIKA 2FAXA 4HS4A 3U7IA 1AKVA 1YCFA 3GAMA 4FX2A 3N3AC 5F12A 4S24A 3LT5A 2HNBA 3HR4A 1YRHA 3OX1A 1JA1A 2QX8A 3L9WA 1YCHA 2AMJA 4N65A 4PTZA 3O2NA 3KEGA 3OX3A 2KQUA 2BPOA 4YQEA 5EMNA 1YDGA 1T5BA 3D7NA 1AKWA 2HPVA 3O73A 1OBVA 2FZ5A 2N1MA 1CZOA 5EAIA 1DXOA 3QFRA 2F1OA 1AZLA 3TZBA 4YAFA 3NHRA 6NULA 3OVMA 5NLLA 4GI5A 3W79A 3NHUA 4J8PA 3OX2A 4CETA 1QHEA 1C7EA 2V5UA 1J8QA 4LTNA 3QFCA 3GFSA 5EA2A 5FA6A 1YKGA 4GQIA 4OXXA 4YAWA 3QE2A 1XI2A 4LAFA 2XOEA 5FUQA 3L9XA 3UXHA 3NLLA 4U7HA 1V4BA 4LA4A 2W5UA 2ARKA 2V9CA 2R97A 2FX2A 3RPEA 2BZSA 3B6JA 5F4BA 2BN4A 3OJWA 4H2DA 1SQSA 4Y9RA 1J9EA 1AMOA 3OWHA 4N82A 2QX4A 3R6WA 2MTBA 3KAQA 4FGKA 2WC1A 4LTMA 1FLNA 3KLBA 1AKRA 1XT6A 4PTYA 4BMPB 4U7FA 3FNIA 1CZNA 3SVLA 4C0WA 1CZUA 1C7FA 3NHSA 2R96A 4PU0A 2MOKA 2BMVA 4HEQA 2MT9A 2MWMA 4F8YA 1ZWKA 4ZVKA 3F6SA 4QOEA 1AKUA 2FLVA 1AKQA 5BUCA 1AKTA 4U7GA 3ES9A 2KLBA 4FGJA 4NLLA 2X2PA 3NHLA 2RG1A 3KAPA 3FJOA 1NNI1 3F90A 4C76A 2D5IA 1FLAA 4QOHA 3FX2A 1D04A 4C0XA 3NHWA 2Q62A 3NHKA 3HLYA 2Z9CA 1ZWLA 1T0IA 3LCMA 4ZVLA 3EYWA 2BF4A 1AG9A 1YCGA 1GG5A 4D02A 1ZX1A 4XDGA 4FGLA 3B6IA 5LJLA 1YOBA 3TEMA 5A4KA 1F4PA 5ULLA
chains in the Genus database with same CATH superfamily
3G82C 2HHJA 4OV6B 5HP4A 5HZHA 5BR7A 3INRA 3D7LA 5B1EA 4MUNA 1I3MA 1Y4ZA 4IZ6A 1QH1A 2YMQA 3OQVA 3CVJA 1XZLA 3Q9SA 4ZQHA 4C3VA 5BQXA 1EE1A 4ETNA 1XTZA 2YJ6A 1MUUA 1ADBA 1RBMA 2BIFA 3IP8A 2BHLA 3SZRA 3F3SA 5IM4A 5C80A 4S35A 3ABSB 2O8FA 2QOEA 4J4BA 3VJKA 1P7ZA 2VWPA 1B16A 4M6WA 5FUWA 3VBEA 3VVMA 3M6FA 4B3CA 4HT3B 1GTMA 2NUTB 5C7OO 1OW3B 4ALJA 2F48A 3UWSA 4TLEA 5IZ4A 3L6OO 3NHFA 4PZUA 3HXTA 4GP9A 1ZRHA 2R65A 4BEWA 1Q2XA 2QRNA 4IQFA 3ZWWA 2X2OA 2JAHA 3EXAA 3PWZA 3WJ2A 5LXTA 1WSBA 2YL2A 2BJWA 5ES3A 1WPQA 1OX6A 2I67A 4WY2A 2UXBB 2AN5A 2Q4RA 4OY3A 4R5HA 4Z86A 4ZIRB 3W5JA 1QHSA 5KYVA 7YASA 3KSUA 4II2A 3KKMA 3F8SA 1P17A 3ID6C 1FXWF 1BNCA 2ZT6A 3F7OA 4RH0A 4AYXA 4HI0E 4AJOA 3FUCA 3C3XA 4XW2A 1R0BA 3CLRD 4RBNA 3VMMA 4IV5A 1DRKA 2W6ZA 2QG4A 3VV2A 5F64A 4B75A 4YCBA 3BTUA 2HNAA 4MUJA 3M49A 1JECA 4Q01A 2CD9A 4G85A 1C81A 3DSRA 2NXNA 4Q3DA 5EZQA 1WXXA 3A10A 3EVZA 3P0EA 4UC0A 3DYIA 2P0YA 4F7WA 5KPDA 4EEZA 1E3WA 2JI9A 5B1YA 4KHZA 1PFYA 2GCPA 3SICE 4BMCA 2NO6A 5KOJA 3VKWA 4N12A 3ZOZA 1MG0A 5E6SB 1SOAA 2G0AA 3HXQA 3A9RA 3PX2A 2GK7A 1HT0A 4EHIA 2OM2A 1R0KA 2A67A 5EJ2A 1PRYA 4ND6A 3AP2A 4FNMA 4IH9A 4KXUA 3PHBE 5F5LA 4EELA 3RVKA 2EFDB 5TE9A 1A69A 3AY7A 4DCMA 2I7CA 1KI9A 1KMQA 2XNHA 3WNVA 4FE7A 4FBGA 4IDHA 4DABA 3R0XA 1EUDA 3TX2A 1EFUA 4PZLA 2WU1A 1TCVA 4RXUA 5DGTA 2NX2A 1FSGA 2ID4A 4RJTA 4YAOA 2CNNA 3C5HA 2HAEA 3ZXYA 4XVRA 4RF4A 4M9SA 1AUOA 3SDZA 4JENA 1BA3A 3F9IA 2QL6A 2IK8A 3GH1A 4OQZA 2WIBA 1GFZA 4E6PA 1J06A 1TIBA 2XOKD 4R5MA 1JSRA 3UK0A 1O6CA 4KWCA 3K2EA 1MTOA 3A1CA 3AILA 3PDHA 2YJNA 3IE1A 2HU7A 4BLTA 2G1PA 1MAWA 1FUEA 3U3XA 3DDNA 1UCFA 3FW1A 5A5DA 3LWZA 2LNDA 4ZP1A 5KWEA 1WDMA 1GQ2A 1IG0A 2IA5A 2P35A 4J1TC 4JLJA 4N3CA 4D25A 2QS9A 2VJAA 3ISVA 3MGKA 4WZAE 2JW5A 3V34A 5DM70 1TT7A 2FZEA 2HWXA 2L19A 2QTVB 3ASZA 2J59A 3BREA 4OGLA 1YA8A 3C3EA 2Z98A 4B3TB 4YR7A 1XTBA 2FK7A 1CDDA 1N5RA 2HUPA 2L2QA 3CKYA 3D3WB 4FYMA 3ZY6A 3N2GB 5CCDA 2HEGA 5SZKB 5CLLA 2PAAA 3D6FA 4Q3KA 1SXJA 2GN2A 4EKNB 1FIUA 3A2KA 2VL7A 1N6OA 3QWAA 4FEEA 3WTCA 5IK2D 4QVIA 1KFKB 1DOHA 2CGEA 4DS3A 5BNZA 2ZJ8A 3U4MA 4IJKA 1MOPA 3LVRE 2XWPA 4EKGA 5FO1A 5DW3A 5KKNB 1M2EA 2J6HA 1L5FA 4FNOA 1RJWA 3N39C 4Z0HO 4KR0A 1I1NA 3V8RA 3U44A 4P32A 2VXCA 3A11A 3UKJA 3BN3A 3JD3A 5GQSA 1Y6JA 3X1DA 1NJ1A 1DRJA 2A33A 3BCHA 4R6XA 2FSUA 4G4SO 3OPYA 4EI2A 3RODA 4OXNA 5LNK1 4IIUA 3TMKA 4LC0A 2VTDA 2EKQA 5MFPA 2VJQA 3A6EA 2GPWA 1E7QA 4U4AA 2AF4C 4QDOA 3ET5A 1TUGA 5FULA 2QAJA 3OE5A 3HCRA 4S1TA 5GJCA 4RTMA 2JASA 1IUNA 1QZTA 3O74A 3G2HA 4KOAA 5DMHA 1GADO 1SOMA 5U9CA 2GYUA 2QXUA 3UJNA 1NNSA 4IJ5A 4X6YA 1GL9B 3MWDB 4IUBS 4BZWA 4DBZA 3H84A 1HL7A 2Z2YA 3M4YA 4XEHA 3B2QA 3ER9A 2PBZA 2FSVA 1KYQA 2EEZA 2QXTA 3OKPA 3O4FA 2QGFA 3HVUA 5AP9A 3RK4A 3V97A 5C1PA 1RJEA 1M8PA 2XDQA 1ZM2A 3DVQX 1WA5A 1NI4B 1ONBA 3CLUC 2ZIZA 2PE5A 5G2OA 3AVVA 4PS1A 1XDDA 1T0UA 2R7AA 4P81A 4D1YA 1N25A 2GNPA 2OHFA 3O94A 3UUFA 2ZSEA 4BMOB 4J07A 4RKWA 8ABPA 1F20A 1TKAA 3B7WA 3MTEA 4NCNA 5B58T 4I1OA 1OH6A 4MULA 4WJZA 3U16A 4Z2AA 4F84A 2VNAA 2W2KB 2QT0A 1T6NA 4OKSA 3T6KA 2JLYA 1XRNA 3PEVA 4A7PA 4C6HA 4BLRA 3MS4A 2WNSA 4J16A 3V4RA 3BMOB 4KAXA 1FNMA 4A91A 4QNRA 2AX3A 2BEWB 4WMLA 4J1QA 4HDKB 4PFKA 2CXQA 3PC8C 5DHAA 4XIFA 2CEAA 2CFIA 1ZAYA 4EYGA 3E70C 2BV3A 3DTYA 4RCYA 5DTEA 5IEBA 4YJFB 2IEGA 1KPIA 1Y8RB 4JX8A 2BDUA 1ULHA 2HU8A 3GFOA 4OB8A 2EP7A 3IHWA 2JAXA 4MW7A 1E7SA 2EARA 4YMWA 2W2LA 4DZTA 3IP7A 2XUAA 3NYWA 1UEJA 2E6KA 3GGPA 1BQ4A 1EQUA 2O8DA 1NUSA 1UANA 5A6VA 4M86A 1TUIA 1YJ8A 1QPBA 3H5AA 4RMNA 3K15A 5SY4A 1HSZA 5KTOA 4LF9B 4G1BA 1VYUA 2FP4B 1O5IA 1PGOA 3A04A 1CKEA 1SCBA 3EULA 5AOVA 1GUAA 3MSCA 3NGMA 1Z2AA 2P1DA 4V2UA 2Z04A 4FCVA 1HEYA 1LJLA 2SNIE 4JOSA 4L9AA 5A1JA 5A06A 3DGEC 3BK2A 5A5EA 5BN1A 1P18A 2C5AA 2VHCA 4QFDA 3TLBA 3ZE8A 1T3ZA 2VPZA 3NNNA 3VR4A 2C96A 3A36A 3LKVA 2FMTA 4FCTA 3CYFA 5AJYA 3WICA 3TVYA 3BB4A 3BT7A 4ALMA 3AFMA 4WCDA 4RHCA 4A23A 2I62A 1ZMXA 3IEKA 3I04M 2Q2NA 4FT2A 5EKDA 5C5DA 4XWWA 1FX0B 1LDNA 4UOZA 1SVIA 3W5IA 2I66A 4NBNA 2HNBA 1LPMA 4ZHSA 4OQPA 2GD6A 1NDQA 1XOIA 1EI9A 1XTKA 4A8HA 1X1CA 1YULA 1A5TA 1YCHA 1QC5B 3DMTC 2ZOSA 5DIZA 3ST7A 4DJEC 1BIFA 3OU6A 3AV3A 1YWGO 4AKIA 1M1YA 2FWAA 3F8TA 3OEWA 3QVOA 4WW0A 4Z4QA 1SQ0A 3TSYA 2GEVA 4ZEOA 3E9QA 3B1XA 1MIOB 4NZ9A 4GVPA 2VF2A 3L7JA 2C03A 4Z9AA 1MAHA 3OZTA 3N59A 1MABA 4RTOA 2WUGA 4PHGA 1DEHA 1L9KA 2DWQA 2WYVA 5H4GA 2D13A 5DWQA 3ZY4A 1R4NA 2Q29A 2QPTA 2IHJA 3HPRA 2Y0EA 3I1IA 1GITA 1IZ9A 1RWXA 4Y3UA 3WIEA 1E1RD 4XPIB 1MEOA 4DSUA 4LV8B 1N8NA 5B4UA 1J0BA 4Q39A 5AW8A 2ZULA 1T5BA 221PA 1BN6A 1JEQA 2Z2JA 3PFKA 3RABA 3JQRA 5C53B 1TUEA 3INNA 3O73A 1IN6A 4QGFA 4PC7A 4GKBA 1F8UA 2REQB 3DVLA 3T4UA 3CSSA 4OQQA 2UVPA 2Q9BA 4PZAA 5K8CA 2XLCA 3ZI4A 1XALA 1NMQA 1V5FA 4ZDWA 3IMKA 3CVUA 3BQMB 4MI9A 4ZEWA 2JLRA 1J24A 5AK6A 1ZD2P 3V6LA 5BSEA 2XCRB 1NW6A 2FPSA 3NHUA 4RHYA 3SC4A 1NE7A 1IHYA 3EDRA 1WS6A 2II6A 3K70C 3K0AB 2YXPX 1E1CA 1TA9A 2Q3FA 5K3CA 2WT9A 3UJPA 3NTOA 4I5GA 5BQ5A 1A8QA 2DTXA 2JS7A 3DMDA 1N4AA 4B82A 4RD4A 5FV7A 3BMNB 3R6GA 2WTXA 1WCIB 1KOLA 2BW0A 3VR6D 3H1PA 1T34A 3LQ1A 4I50F 3CNEA 4DCPA 1G5PA 1S2MA 2B9VA 4PLWA 1R8YA 1JLMA 2R8EA 1P80A 4NJEB 4YJHB 5JNWA 2WF6A 1MQ9A 4Z6KA 5AW3A 1QRTA 1OVMA 1TF2A 1L4LA 4PCUA 4X1KB 1NBMA 5FFMA 3H9GA 3KDSE 1T3LA 4CQLA 3JQBA 4MKGA 4UKDA 1P2VA 1XTUA 5AM5A 3LUHA 2L18A 1OC4A 5F9FA 2ILVA 1ES9A 2H1OA 5TR9A 2GZRA 1OLXA 3STWA 4PSDA 3C8MA 1H85A 3WNDA 2VSXA 3O9MA 2E85A 3SFTA 4EYOA 4DREA 3OKAA 4ZYVA 1Z4IA 1FRFS 3HNOA 4BP3A 5JQGB 1ATIA 1KK1A 2PIAA 2VP6A 3D3NA 3HN6A 3T0FA 4XWKA 3MZ0A 3Q9UA 2XWJI 3NM4A 4YJ3A 1NLZA 3JQPA 4ALIA 3O3NB 2YWDA 4EA7A 1DDOA 2POCA 3ER8A 2BFFA 5ES4B 4GWLA 1R6BX 4EUFA 5GIPE 4IIJA 4I55A 4Q7LA 1QGUB 2P0AA 3DFMA 4RVHA 3TL3A 3TJMA 4YWHA 1Z62A 4JSTA 3AIOA 2XQVA 1O96B 2RGWA 3RTAA 2DB3A 7MHTA 3ZBPA 3QMPA 3MXTA 4R40A 5B1SA 5J40A 3ERCA 1JZTA 2A1TS 3E7WA 3RYIB 4BGDA 1KZ4A 1LSSA 4RVSA 5AVTA 3QU9A 3B8HA 2UZ1B 2YW2A 3UW1A 1P72A 1QOPB 4YPOA 3CH6A 4EMTA 3G2NA 3OIFA 1KGDA 1OOEA 3ZHZA 4HB4A 2WD9A 1I6KA 4A0SA 4QGSA 1ODIA 3LRXA 3JQEA 4AKSA 1UDCA 3OTWA 4OH7A 2QF7A 2JDIA 3EQZA 3OCJA 4IV0A 3WGKA 4B7CA 1AKRA 1BE1A 4RDCA 1UJCA 2ECQA 1XQ1A 2X14A 2OWEA 2W70A 3LMKA 5FOXA 1RI1A 3VAZA 4LBYA 3VUEA 1NUQA 2YFYA 3HC7A 2ICAA 4MVJG 3I6IA 2V97A 2ABWA 1MPXA 2BOVA 3A3OA 2DJIA 3IQFA 1PW5A 4CEJA 3OLYA 1PG2A 4JI1B 1MJNA 5EHQA 4HWTA 1H9BA 4UREA 1XN4A 3L92A 5KJCA 3P4YA 2ZDGA 3EZ7A 2ZRPA 3ANNA 5B57C 2XZTA 4BV8A 2VRWA 1EM8A 3FPJA 1E0JA 3BSFA 4FZRA 3DOEA 4ARZA 3K7EA 5CA1B 4NH0A 2Z6AA 5CNJA 5BWOA 4HJRA 1I2MA 2FH5B 1S5PA 3ENZA 4MQFA 5B1HA 3FKQA 2HQSA 1ZOSA 2J5BA 3KPVA 5ENDA 4ER6A 3KKPA 3GG9A 4FGUA 1E2JA 2YJGA 4L0QA 4L5YA 1WBBA 1HA3A 3ZC3A 1PS0A 2J3DA 1G4HA 2WB4A 4LVCA 2KLBA 4PSUA 3O2SB 1CY8A 1TUBB 1U1CA 1Q50A 2OO5A 2YFKA 3IVGA 4QWMA 3UCEA 3G6WA 4AS2A 5AM2A 5HZGA 4YRCA 3A4IA 4Z54A 2WWYA 3KAPA 4G1EB 2X5OA 4FUTA 4M9QA 1BJRE 3DTVA 3AUXA 3QVTA 5L7YA 1HMPA 5F76A 4NS4A 3SY8A 4ARUA 2IEYA 2Q3CA 2WU0A 1HYGA 1RD4A 2DC1A 5EUMA 5EMLA 1A8PA 1FP6A 2GM9A 4J49A 3ROTA 1D04A 1R37A 2ZBFA 1J56A 2VJPA 3LUJA 3ND9A 4PYNA 2FWIA 1DAHA 3IR5A 3ADPA 1RR6A 4CVNA 4DJTA 2F4VB 3V9AA 2H2HA 1GNSA 2IGTA 4CKEB 3WB9A 4PZDA 5HFNA 4XLZA 4BFVA 4YRIA 2HBQA 4B09A 3B1ZA 3X1WA 3TQHA 3HU1A 4Q19A 3W4JA 1ZCBA 4Q37A 1UC4B 4GI7A 3FPEA 4ARAA 3M6VA 1D6NA 3M6UA 1YCGA 3OEEA 4TWBA 1L5LA 4CMIA 1ML4A 4GQAA 4TTTS 2PRYA 5DCLA 2NLOA 3B7GA 3I72A 3P27A 1W6UA 4RDHA 1FSSA 2G72A 4OCZA 2Y67A 2Y0DA 2H2IA 1RWMA 3ZZ0A 4X94A 2C2OA 2QRKA 2BZ0A 4G4IA 4LRXA 5LQCA 3GH3A 4LGYA 1M6VA 2V65A 4PYIA 4IDEA 1E1MA 1K7SN 2HK9A 3L46A 4HVTA 4B45A 5I9NA 3SCZA 1HSOA 2A0FA 1A5AB 1UFQA 1UWLA 3ANSA 3OX4A 1SKQA 4XM2A 2X8BA 1K5GA 4O2BA 1FA9A 1L5OA 3RFUA 3VPHA 4BKOA 1WU8A 3EVCA 4DFDA 5A4DA 1P75A 5JALA 5JMWA 4RV5A 9LDBA 4ZO7A 1JHVA 1O2DA 2QN2A 3JR3A 4UXHA 4XOUA 3VZSA 3RTEA 4NKRA 2QM7A 1F7UA 3GJ7A 3DV9A 2CFSA 1JPVA 2OK7A 3LKBA 1OU4A 4HNQA 3HZZA 4JLWA 4N41A 3QOWA 3BX1A 4A0FA 2GBLC 2HWYA 1Z5NA 5LM3A 2NACA 3STTA 2HW8A 1QGDA 1MIHA 2VZLA 4F3CA 3NHYA 4YAUA 4B4KA 4G5FA 5KMGB 1DEOA 2C5LA 3GCGA 3H9BA 4IIGA 3GN1A 4N3BA 2H85A 2HUNA 4WX2B 4EWLA 3ZDAA 2GAIA 5GIOE 4NEQA 1KIFA 3U62A 5IKMA 1H2FA 3TI7A 4BVFA 4ESOA 1CW2B 1P4RA 2FR1A 3H7AA 3HR8A 1OMOA 4HGOA 4XD2A 5GJWC 2PZBA 2ZRNA 5I9MA 4CKWB 5E7MA 2MJLA 4C0HA 3KQOA 4ECAA 4Q7KA 2B4KA 2JEYA 2P9FA 3X1XA 4V39A 4X0EA 1Q7BA 1CUBA 1VPDA 5KQLA 4HK4A 5MN4A 1A76A 1UEXC 3IELA 1E7YA 1C4XA 2VJMA 5EJFA 4HBZA 1I1OA 2XCSB 1QRUA 1GYRA 2FCRA 4OI4A 2BDTA 1DIOB 2CN1A 4LYGA 4CQNA 3ZWCA 2F3TA 2IYUA 1OLSB 1P19A 2OHIA 3QOXA 1H2AS 3H5NA 4GE0A 2FEAA 4CEIA 3R0VA 1Z6ZA 2MYTA 1K7FB 4FILA 2PMKA 5I3ZA 4IIHA 5DNYB 5I01A 1XMJA 4QIHA 2GLXA 2PYZA 3HY3A 5IJZA 1AN0A 4JNCA 1N5KA 3GR6A 1OJLA 2VHVA 5LZ8A 5HUJA 2A58A 2WJHA 1TW2A 3IOYA 3UAZA 1U4NA 1SXIA 5D8DA 2JZNA 1Y8QB 1KI8A 1EA7A 3WBFA 1E59A 1T1RA 2PHZA 3T15A 4TUYB 1DJLA 1UBFA 5GP1A 2KS6A 4AG3A 1L5YA 1YH3A 2IPMA 3E4DA 3I6BA 5KTRA 1C7JA 2OAP1 4WUVA 2O2DA 2M6RA 1WXQA 2XZLA 2XBUA 5H68A 5FPSA 3VTZA 2O3SA 1U65A 3LUBA 3MJVA 3JD1A 4ZAVA 1POXA 3PDIA 1G6Q1 3D3QA 2IWHA 1D2EA 3SPXA 1PK7A 4R8RA 4RCZA 2VH5R 1K7XB 4H3HB 4C7VA 2CT8A 4INPA 4HMQA 2CUTA 4PX5A 4B47A 1FU8A 1JLRA 1JALA 1GPWB 2ZRCA 4PPQA 1B14A 5GZ6A 4FVTA 3T1QA 4M1SA 4POAA 2FEOA 1KH1A 4BFUA 3H1EA 4I50A 3EXHB 1PUXA 3N6RA 4K3VA 2HDWA 2ATIA 3A1WA 1PZEA 1MOZA 3VKUA 5EGNA 1G8GA 4YAKA 3PC6A 1NKSA 2WBLC 5BV8A 4D80A 1OBFO 2RH8A 2HBZA 3LUCA 4OK3A 4RIFA 3SC2B 4F6RA 5EPUA 3X1JA 1P45A 2CXSA 2E55A 2QT9A 4B6SA 4HWPA 3NNDA 3OCXA 5BSGA 3A1FA 2WR8A 2YWRA 4UAJA 3S2SA 4COKA 4P2GA 2CNWD 2RGYA 4QDZA 2HMWA 3IP1A 4PLZA 4GWGA 4NBWA 3DP9A 1Z2PX 1E9CA 1W4BA 2R1VB 2AK2A 2EEPA 3BHNA 3L6BA 3GJ3A 4IDFA 2ZP1A 5A0VA 2WPDA 1E8NA 1E9AA 1RYFA 1CLEA 4KXWA 4LJYA 4QD3A 5FXMA 2AFIA 3HEAA 3P0JA 3INTA 4V1CI 5LZ2A 5ARDA 4NCKA 1XMXA 1VP9A 1C2YA 3AYZB 2NVOA 5E1BA 1T5OA 4QOJA 5DYIA 1DIGA 3OPVA 1G64A 1VHTA 2BDEA 2XE8A 5AM3A 3W8FA 2ZJ6A 2I6GA 1H2RS 4GX1A 2W2PA 1VL8A 1OF1A 1ZOIA 2N0SA 1YFLA 3N07A 1U2TA 3ICWA 1PZMA 1JA0A 3CUUA 3M1YA 4C14A 1GU7A 1RQXA 5I9TA 1HV8A 1OAKA 3CEHA 3VZDA 4TMWA 3ZIUA 2WG1A 1CHDA 4XCQA 1C1DA 1CFZA 4L5BA 1BDMA 1Z4MA 3MWJA 4LGCA 5ALPA 5TPZD 3TMYA 2QLFA 1M76A 2VWGA 5I4IA 1U0JA 3T5PA 1LQUA 2DWUA 4WZAA 3UH1A 3ZS8A 3NOXA 2CWWA 3IEPA 4LXQA 3K3PA 3KUXA 3QEOA 1QK3A 1U2GC 2OCGA 3FPGA 4LMBA 3WZLA 1UKEA 3B12A 1B8PA 1VE6A 3PDWA 1XZFA 3OPQA 2DSTA 1M0EA 3RYTC 3RFXA 3LDUA 4AS1A 2BFEA 2ZRLA 3EDCA 2ZVQX 3SN6A 1E3DA 1GT6A 4TVKA 3TSCA 1Q2UA 4UTOA 1BU5A 3PRKE 2NZXA 2WSSA 1LS1A 4OXQA 3TRHA 4C4PA 4D0GA 3PCTA 4EJSA 3GUYA 3MOSA 4L3OA 2B82A 1DKMA 5FV4A 2P62A 2PX4A 2QLLA 3IIEA 3JRXA 3OZAA 3U3JA 3TW8B 2PANA 3U4DA 5EJIA 4F9FA 2ZR0A 3IT0A 4DIKA 4ZDIA 3NBFA 1A5ZA 2Z5LA 4WKBA 5F7OA 4RVCA 3ZQJA 2Y4NA 2PSSA 3FYUA 5CYPA 4GBED 1Z88A 2GRAA 2IPOA 2V7VA 3E2MA 4M9UA 4LDAA 1G6KA 3NUGA 1R4ZA 3QU7A 2A9PA 1L1EA 3EGIA 4UU1A 1POWA 4RVGA 1DWOA 3K1AA 5DDIP 3OQPA 2V1XA 3A6KA 3O9VA 1NUTA 3PU6A 5JCOA 1WRBA 3EMDA 5ICSA 3FAKA 1N2IA 3I1YA 4K6FA 4AZWA 1C5KA 3AHFA 3LKZA 4K6HA 5H7XA 1ZGBA 2Z5GA 4Z2YA 5A62A 5EJAA 1SBIA 4JL5A 4ZU6X 3VKVA 1UOOA 4IDOA 1A7AA 1VG0B 2O5VA 1JT2A 3PFHA 4A2CA 4OQDA 3DHVA 1K0FA 1KJ9A 2FF5A 3BAZA 4PZCA 3AT1A 3VPFA 3QI7A 1JJFA 1QE5A 4L8YA 4L5CA 1V0JA 4MW1A 5JFOA 4ZCTA 5JH7F 1TIPA 3WKAA 5JYEA 1EDEA 3HSYA 2KMLA 5DN6A 4YT4A 4XCXA 3IERA 1XCPA 3TZ6A 1RRVA 5GWXA 3WIDA 3AR2A 5ICMA 1U9ZA 1ISPA 1I94B 2A1IA 5HQ3B 3DNPA 2G9VA 2OENG 5U1PA 5CB6A 4PZ9A 1ZVQA 1T1GA 2Q4EA 3BSSA 4C21A 5BOVA 4YHHB 2GK6A 3LT5A 3MJ4A 4LQCA 2BWJA 3EE6A 5HCIA 3P97A 1FS6A 1TA4A 4DC1A 4U3JA 1T8TA 1KC1A 2BI4A 4QNNA 2CNBA 2DCMA 3F96A 4G5XA 4I9NA 3U17A 5D3MA 5MGNA 1DAFA 4XFKA 4FYWA 1FUIA 4BFXA 3B9QA 4MI6A 1FDUA 1E4OA 1Y0BA 1ZSYA 3DV0A 1YHYA 2YBDA 4GEGA 1BX1A 1P1RA 3OHMA 3HFSA 2GJKA 4JT2A 2VEDA 3K0CA 3MEQA 4JOCA 3CXRA 1ENPA 3G0IA 4L75A 3VHLB 4XUEA 2IE8A 2J9ZB 3L0DA 1UZLA 3RIGA 1VPTA 1YE5A 5G0SA 5KOIA 2W6JD 1IY0A 1KY3A 1Q1QA 2Z4RA 2ZBRA 3MT8A 3UWKA 4HFRA 1G5FA 1LFAA 3I6QA 3QG5A 1VJCA 3CVWA 4A6EA 1IONA 1J2TA 3N2YA 5IZCA 3R9WA 2FZ4A 3B78A 1P3Y1 5C5EA 5FWYA 1H65A 2I7DA 4MIOA 5DT9A 4NE9A 1ADFA 4DT1A 3MMXA 1MP0A 4JXXA 1OBVA 1PTJA 1FRNA 3H1FA 1PT5A 4KO4S 3OO0A 4NECA 3AEQA 4NYIQ 4TKVB 3ZZMA 4OHVA 1ABBA 3UN1A 5JRZA 5F21A 2XEXA 3QWBA 1J2UA 4HFJA 1O6GA 3L8MA 2BGMA 1AZLA 2CNDA 5EVCA 2P5SA 4TQUS 1GZVA 3CH4B 3BFJA 1A9XA 3DLIA 4DLLA 5F9MA 2ZXEA 3CX7A 1SUEA 2ZS9A 1QFZA 4HGPA 2ZB8A 3A0RB 2NWQA 4JD5A 5SZIA 1DEAA 2I03A 3GLHA 4GKVA 1OGJA 3QTTA 2OHVA 3K35A 3GU3A 1GNLA 5HCNA 2FR8A 1MVLA 2D7JA 3WE7A 3WL6A 3H17A 1ZESA 3GUVA 3L7DA 1QVRA 1L8QA 4UJ3A 1KR5A 5HKAA 2V55B 3HABA 5DHUA 1NWHA 1ZONA 1PX2A 2D0DA 3UWDA 3LF1A 3AKDA 4NV0A 4Q1VA 2DLDA 5B7QA 4WN9B 2X0KA 1Z15A 1QQBA 3P0FA 1ECFA 1KOJA 5K6AA 4V03A 2IEZA 1NMZA 4WXHA 2RH4A 3HVKA 3K09A 4MOWA 4B5KA 3WWDA 1CEQA 2WICA 5L9AA 3S1AB 2QPLA 4ZTZB 1SN7A 2NUTA 3A3KA 4JZKA 1YBFA 4Q4HB 1ZQ1A 4UE6A 4P35A 1PI3A 4BQFA 1SBYA 3LCVB 1VRWA 2N3ZA 3Q3EA 2NVWA 3G1UA 3LE8A 4DLUA 4MTCA 3OJ0A 1ZMOA 2QTHA 4XQEA 5B6PA 3Q9NA 4WZ6A 3DFIA 2D0IA 2AKEA 5CVTA 3WZ2A 1E5VA 4CN8A 4QQNA 2C2ZA 2ZAIA 4E5NA 3E61A 4EKDA 4YCNA 3GZJA 3V1NA 4ZIRA 4JVOA 1Y3BE 2QEQA 4MV1A 1INLA 2WJJA 4GYWA 3LLSA 4TVOA 5B1IA 3RVLA 4F1JA 2OZVA 5ISMA 1L4EA 2RH9B 2O19A 1DFIA 1EFCA 2I78A 3EK2A 1NQVA 4IS3A 1OXMA 3I04A 3HJTA 2R00C 1ZD3A 1CYDA 3FA2A 4LX8A 1A97A 2LW7A 3OJWA 3M4JA 3FWZA 1ZRMA 3QLVA 2VUUA 3T7AA 3E18A 5IAKA 2FFRA 2H5JA 2HA0A 2JCSA 2JKZA 3U2QA 3N0XA 4KDEA 4CMEC 5KKCA 3SM9A 1WMAA 1LQ2A 4QAQA 2LVBA 1UM9A 3AUJB 1KP3A 1SCDA 3UCFA 1E4YA 2ZYIA 3GN2A 5ESDA 2ADFA 1KAQA 1D4FA 2NO7A 2PR7A 1PDVA 1F4VA 3C7KA 1RM0A 3PGXA 4K9NA 4CMAA 2FRDA 3O95A 3RYCB 3ABRB 1KQOA 4FGKA 1IUKA 3RU7A 2KB0A 4UM7A 1M0WA 2WE7A 3F1KA 3PITA 3M5WA 4FEYA 5KDOA 3Q6MA 5TVGA 3INYA 5BV0A 1M2WA 1SHJA 2XEDA 5EFZA 3LV8A 1SBHA 2XAUA 1NSYA 1U0OC 1F14A 3OC6A 4O4LB 1PR5A 4J3JA 1DP4A 3D3JA 5CIQA 4Q3CA 2XZPA 1UFKA 3MTGA 5CRIA 3W2TA 3QEAZ 1FFCA 4NBTA 4JLUA 3V7YA 3UYLA 1XTRA 4L0CA 1JQ5A 2GO7A 5H3LA 1NJ2A 2H16A 1PZGA 3LC7O 1LRLA 4MUXA 4KGVA 5E9JA 3SR0A 3Q0TA 1EINA 4TQ9A 2WAYA 1SXJD 2BR5A 4Q21A 3D7SA 4ZV7A 4E22A 2PBLA 4G65A 5DNVA 2V4ZA 3KOOA 4FMDF 4JJKA 1I36A 4K40A 3UB2A 1DC3A 1NRXA 1ULZA 1N6HA 5C0OE 1DS6A 3HEBA 3V33A 3S4YA 3TTSA 2R96A 3QUQA 2W37A 4EHBA 5CR9A 3F5MA 3ON5A 1ODJA 2QSJA 5JLJA 1LDBA 3AHIA 3AR5A 2BHNA 2J9GA 4K9OA 2LIPA 1I2AA 3FDFA 3VR2A 2OKGA 1OIWA 4ZVKA 5HQTA 4K9KA 3I9NA 3KT3A 4EGQA 4R1PA 3T7RA 5A4IS 5A4MS 3MIZA 4HWKA 1A7JA 4OFXA 1FP1D 1QIIA 2CB0A 3D3WA 4Q1DA 1M7GA 1QE3A 1AKQA 2O7RA 2WSYB 1MOQA 3N2GA 4HLDA 5BPHA 5I7RA 1YR3A 3P9KA 4JR0A 5K9ZA 3LBYA 3ND6A 2YMMA 5DSXA 4B84A 4KR6A 2JAQA 4X65B 2PUVA 4NJMB 5KQGA 4YCLA 1P0IA 2WF5A 4GGOA 2AN9A 4MGIR 3I9V6 4NLLA 2O2IA 4HAZA 4L4SA 4ARBA 1OBCA 3NHLA 3OJEA 4G5QA 1RHKA 5K0JA 5LYJF 3MFQA 4QBGB 4HEA1 1WL8A 1RACA 3MYRA 1DCKA 1N1MA 4BQIA 2GD0A 3MMNA 5IVIA 2C9BA 1L5MA 4S3MA 3NDBB 4TS9A 3REOA 2P4EA 1HQKA 4UAGA 3WLNA 1FVFA 4RHXA 3ZHCA 1ZC3A 1ZRNA 2YOHA 5LD2B 2J0QA 2O8CA 3TKAA 3HUTA 1YR1A 2XYGA 2EW2A 5CCBA 1T25A 2POQX 4G41A 3RS7A 5AIBA 3R6DA 3T1VA 1JPUA 1X1QA 2BF4A 5ALTA 3AETB 4OX9B 2X4GA 1WB9A 2FE4A 2HIHA 3P20A 4XA8A 3SG0A 4Q93A 3FKJA 3CVOA 3QBTA 3STYA 1KI6A 1P60A 1E2UA 4EA6A 4E14A 4H1HA 2B0JA 1XEAA 2JAOA 3CSUA 4FHCA 3HDGA 1NUHA 4FLMA 4Z1MA 5B64A 1WW3A 4HYTA 4R2XA 3CN7A 2AJ8A 3W5AA 4MVWA 4AG5A 1CXZA 4BNDA 1H3NA 3NT2A 4QFCA 5EMJA 5BWMA 3UT6A 5IKXA 1NI4A 3ZV7A 4C4AA 4UXIA 3S40A 5C52B 2Z6UA 4IKEA 1BMFA 4I5IA 3BWMA 3RYCA 4GRAA 4OTZA 2CVPA 2W2LD 2ZAYA 1IWOA 1JBEA 1RRMA 1Z08A 2I55A 3NM5A 3DOIA 5DVZA 2PWYA 4CG0A 5HQJA 2V9PA 2OV1A 4PG4A 2VP3A 7ABPA 2GDJA 2D3TA 4R41A 3VAAA 5K4HA 1P5RA 1R9NA 5KZMB 1Y3CE 4S1NA 3ZI0A 4R05A 1NVVR 2ZETA 3RTBA 1XZDA 1AQYA 2ZJAA 1MB2A 1W34A 3BH0A 4QL3A 5CUQA 1EJ2A 3P19A 4M0EA 1HDCA 5EZYB 5IAAA 5J23A 3K0SA 5LVAA 2ZM6B 1PZNA 1Y3IA 2BEWA 3RC7A 1JQ3A 3AR8A 5JAOA 2AJLI 3IRUA 4HYEA 4JJZA 2KX7A 4PAOA 2GQ0A 5L4SA 4QJ4A 4WPGA 1V5IA 3Q7QA 1T6ZA 4PO1A 3C6ZA 4LXGA 2BFWA 3PXAA 1ITZA 5LLTA 1P5FA 2O2ZA 2CFCA 4BNKA 2ANBA 2XBMA 4GD3Q 3BIXA 5DX8A 1Q57A 1J25A 1G8MA 1U3TA 4W8OA 1MRZA 3RUHA 4D9KA 1KRWA 3BA6A 4QGHA 3F4LA 3V6MA 5CJPA 1JYEA 3O83A 1EGAA 4QASA 4XEUA 4XIYA 5E2BA 2HJSA 3BRWD 3MCAA 1G66A 3ZUGA 4H7KA 4NR0A 2DMRA 1VIMA 1WBJB 2FP4A 4F8YA 2A94A 2FXIA 3BERA 5LMUB 3Q3HA 4P3PA 2XPCA 5BO5A 3L93A 1A9YA 1S2DA 3AM5A 4IX1A 2V7PA 3H2ZA 4JP5A 3TDKA 1AQ6A 3VU1A 2D59A 4FLFA 3KZMA 3A4MA 3RFTA 3BS4A 3DNFA 3EVTA 1Q0RA 3S99A 2OV3A 3LHDA 1C9EA 1CVLA 3KWMA 3QW4B 3AKYA 3JWEA 3R3JA 1UMCA 4EHAA 3DT9A 2XF8A 2O59A 3FOWA 2UYQA 3FKSD 4U63A 1AQNA 4MP3A 2FUG6 5DGCA 5D3QA 3NKVA 1PL7A 3BDAA 4QOGA 3PIIA 3I9MA 4NBSA 4PYMA 5E9WA 1ABEA 4IICA 2HLDA 5NULA 3H18A 3DO8A 1TVKA 5LA6F 4D9CA 4FXOA 2ZI9A 2DWCA 3RTGA 1SXJC 4OGGA 3AF3A 5A0TA 3SQXA 1E64A 1YD7A 1QC5A 4BO8A 1CUCA 5G41A 3A37A 3DB2A 4QOFA 1GSOA 2NZUG 4J0EA 2I1VB 4JJGA 4L4UA 4R16A 4ZT2A 4ZQCB 3TRFA 3WSVA 4E2WA 4YLYA 1TU4A 1HLPA 1DQZA 4RIGA 2PEZA 4WK0B 4Q7EA 3DQZA 3IEMA 4Q4AB 1EFLA 4W1PA 4MP6A 4OA5A 4EJMA 1RQPA 1ZN2A 1SC6A 2E4XA 2PD6A 5FUMA 4KREA 3E8MA 4DPLA 2QMHA 1BFUA 2FNAA 3DM9B 5I7SA 2PUJA 2KW5A 4EHJA 2ZBEA 3AF6A 1FJXA 2Y1KA 1I10A 4FFDA 3R7WA 3WNQA 4XPIA 5BMOA 1LVGA 3D8SA 4IHJF 4TX1A 3W4IA 2P75A 3HNRA 3WFJA 3AP3A 1FRQA 5AH0A 4JVLA 2JIZA 4Z3OA 2HHHB 1C7ZA 1ZJ5A 3QNMA 1TLTA 3AJAA 4GMDA 3FVWA 2XNDD 3LVBA 5E0OA 2ZE7A 4UBLA 2BH2A 2REQA 5EJMA 4FDTA 4KVGA 1EB8A 4S1WA 5ICEA 2FW9A 3O4IA 5KYYB 1NMSA 2ZBQA 1OWPA 3VMFA 5HRCA 1R0RE 3BJIC 3NWJA 3QELB 2P9CA 2VUSA 2AFHE 2FN8A 2W6ID 2ZE6A 1WLYA 4V1CA 3ZZUA 3D64A 2FSVC 3DW3X 4B4OA 3V7FA 1PJ4A 4ROTA 4D0NA 4G5RA 1GGEA 4EJ2A 3OJOA 4EF5A 2GKSA 2HTEA 4JP8A 3TVDA 1NULA 5REQA 4NFHA 1D4AA 3K16A 4MQ6A 5H16A 3K0AA 1GWNA 2ZTSA 1TTPB 4DNXA 1JHPA 3CZPA 5EXTA 4P5DA 2HJGA 4U8HA 4PANA 2IH2A 4LECA 2ZRAA 1Y1SA 1F38A 3CX6A 4MR9B 5IEJA 4KPEC 5BSVA 4GIBA 2OO3A 2QQFA 2RGBA 1AHHA 1DQSA 1WCIA 3KKKA 5JHGB 1UDXA 2PR2A 3CRMA 3K9LA 5LLSA 1DNPA 1Z22A 1PR9A 4L57A 4O1HA 1IBRA 3GPCA 1T9ZA 3KWLA 4BCBA 2DECA 1HLDA 3EIEA 3F4KA 2FPKA 1VZ2A 3VPXA 4AZ0B 2Y0CA 3UK2A 4KZKA 4G2TA 4J0GA 5JARA 1KJWA 3ZU3A 2M1ZA 2UYYA 4S04A 2HA7A 2J48A 2RHGB 1HDRA 5K3EA 4PPFA 2HZBA 5HIIA 4EGJA 4P4TA 3GOHA 2HA6A 2IOFK 3D9QX 5G1NA 3VTKA 5BRJA 1ORTA 1KZ6A 1Q0SA 1GP2A 3CF4A 2E2WA 3PHCA 3RK1A 4IQGA 1VG9B 1N2HA 1YQXA 3BFKA 4CKBB 4EHFA 1BHQ1 1KAHA 3JQFA 4DMLA 3GV0A 5HJ2A 1W36B 3SC3A 2HMUA 5JI3E 1WHTB 3DOCA 4LK3A 3H9QA 5JQGA 5DYGA 3THSA 3PUWA 4MHOA 5K3OA 2OV6A 3P8ZA 4LOLA 3GK3A 3IP5A 4NK5A 4IH1A 2G9QA 2IX9A 4CIBA 1ZKDA 4I1RA 4PZYA 2WMYA 3LOUA 1GG9A 3GW8A 3HCEA 3JZMA 2Z2IA 3BGVA 3FOCA 3K72B 1Y89A 4N49A 5D2CA 4CTNA 4EHKA 2FSGA 1X9GA 2EL9A 4PPNA 4F3YA 5L3VA 4WV3A 3DMFA 4N1AA 4AROA 1QGUA 1TZJA 4LYHA 4BKPA 1ZJYA 3I6MA 3AESB 3VH2A 4E21A 2CVZA 4MO2A 2B2CA 4YUVA 2YHIB 4RXMA 4E12A 5DNAA 1MFZA 4ED9A 5D3KA 4WH0A 4KRYA 1O96A 1ZN7A 3BQNB 2OZKA 3IQEA 1FY2A 3KXKA 1T8WA 1U4SA 4RH1A 1BCRB 1Y4AE 4M7PA 1MX3A 2XV1A 2RBKA 3N86A 4D6YA 3D0OA 3L7LA 4DN6A 1E2GA 2Q6OA 4LJ7A 1JIIA 3AUYA 4NS1A 1T43A 2UZ1A 5LQRA 4UQLA 3JYNA 4F6CA 1GUDA 2GR9A 3BMXA 4MV6A 3VVBA 1T5TA 1I5EA 1QRDA 1JVBA 3D8TA 1ZXBA 2O5CA 2BTQB 1KERA 2NM0A 3F5QA 4HGQA 4NZZA 1PLKA 4S2EA 4BHTA 4MRMB 1TAHA 2PUTA 3GLFE 1R5BA 2JHFA 1UBJS 4UPVA 4FX2A 5D87A 2IU3A 3ZV6A 1MHTA 4AK9A 1MEEA 3UJBA 4UM9D 3T1NA 1PQUA 3SFVA 3WSWA 2ZJ3A 3ZDFA 3TYXA 2HO5A 4Q6WA 1IXKA 3MTQA 4GM1A 2HA4A 2R11A 2Z56A 3M9LA 3SKXA 2PTGA 4X44A 1VSTA 2XZDA 1SU8A 4R1MA 2KYRA 3JXEA 4DYDA 4OLBA 2Q3LA 2OCLA 5EG5A 3RHFA 1GG2A 4KKXB 4MWGA 4B0OA 2PUGA 1U9JA 3D6AA 2F67A 1JUDA 4FYVA 4MRVA 3NASA 3QIVA 3WLAA 4BAGA 4BNUA 3EIHA 3N05A 4IXWA 1GN9A 3DPSA 4E32A 3H83A 2XTAA 4Q9JA 4D5GA 3EPLA 3NAZA 4BJ3A 1FUKA 5DW0A 2I54A 1HC7A 1DJPA 4A8JA 3DO6A 3AL3A 3OE4A 4GEKA 2GN0A 5BVHB 5C8ZA 3JW8A 4LISA 3V1TC 3I61A 2PZMA 3BXGA 3RC2A 2Q5JA 1J1IA 3FTCA 1RMTA 2R7KA 3ODPA 4TL7A 2PL1A 2P6PA 3CZ9A 4ND7A 1T5SA 3OEED 5EIBC 3IUYA 3H9CA 2PRKA 2JLBA 3PYXA 2JCGA 2F43A 1TUBA 2KQUA 3EVBA 3H5WA 1GR1A 4FYJA 1T4CB 2CDCA 1ZCZA 5SICE 1J70A 4HP8A 1Q19A 2IXAA 4K26A 2GCGA 1GRRA 2OK8A 2B7BA 3KTOA 4P0QB 3RSGA 2HJVA 3GZ4A 2X8JB 3RUAA 5E6RB 4YCCA 1AKWA 1V8PA 1W8DA 5LDHA 4IQ0A 2B83A 3COWA 3L7OA 5HS6A 3WADA 1MDFA 1D0SA 2RGDA 3M9XA 4HAOA 3NVKI 5CVCA 4N0MA 1MXFA 4BJ6A 1CSEE 3QXJA 1N2JA 1EP3B 1DKNA 3K9QO 4B87A 2QYOA 4CKEA 3C3PA 3TWOA 5J1SB 4OJQA 4MWSA 4D3XA 5I9IA 2A0UA 2JRCA 4J76A 4RHUA 1YZQA 1IY9A 3EAFA 5JJ5A 2XBLA 3RE1A 3AWDA 5HYVA 5AR1A 1Z2EA 5JZBA 2W0MA 3JQBC 4URZR 1MGPA 2D1RA 1SXPA 1TU3A 2GZ2A 3QU5A 4P7GA 3BXFA 3BL6A 5K3SA 4D46A 3VR6H 1DV1A 3LHIA 4KQ1A 2VAVA 2PU5A 3O5AA 2NP7A 1M66A 3OP4A 1Q0TA 2YMLA 2C8LA 4BFWA 3QYAA 1XDBA 4KO2S 1WXFA 1BXGB 3UHFA 4XVHA 1U11A 4ENRA 1ZEJA 4J0CA 3O8RA 3KALA 4P7JA 4TRNA 3VNBA 3AGQA 3D2BA 1B73A 3UJCA 1UOPA 2ZR7A 1YB6A 2OOSA 4OBEA 1US8B 3HI6A 5DTIA 4CR6A 1N0UA 4IWXA 1ZI6A 1TMOA 3OTHA 2YVQA 4FYPA 4MWZA 4N0PA 3WO1A 5C18A 3C5WP 3CMCO 3C45A 1NIJA 5HE8A 2VDLB 4WD3A 3AR3A 3TXXA 2PT7A 2WU8A 1FYVA 3Q40A 1CUJA 2JGMA 4ZGBA 5KMGA 5TVKA 3D3KA 1KDPA 4RACA 3S2FA 3TAHA 1U1IA 2ZVJA 2BFMA 3H8WA 2NTNA 2JJ8A 4REMA 4LHVA 5KAPA 2LWIA 3PNBA 3B38A 1E9EA 2JANA 4J6FA 4CKWA 1J8YF 1P31A 4WJKB 1OVGA 1V4BA 2V6MA 2VJCA 2IOQA 4Q82A 5A4FS 4LWPA 5B12A 5CFOA 1AHPA 1YR8A 5LA6A 2IYWA 2R97A 3DPIA 3B52X 4QUKA 4BRUA 1K3TA 2BFCB 2OQRA 4L07A 1E7WA 4L2IA 3QHQA 1U5CA 1HG0A 3B3AA 1P4AA 3OO1A 2I3AA 3EFHA 1GJRA 2HF2A 3WNBA 1Y5MA 1SHZA 2Q2QA 4CFSA 1OAOA 1WF3A 1SZJG 2LUOA 1OLSA 2GEFA 2R86A 1T9HA 2X5NA 3WISA 4OXRA 4B71A 3LX6A 4K6MA 5JQWA 1VGRA 4KQ6A 4BCCA 3LKDA 3I2FA 4LDQA 4BKUA 2PDAA 4M49A 1PUIA 4N82A 2AKAB 4NCJA 3T9CA 3IUBA 3VU3A 4E4RA 1L8LA 1YIAA 3MUNA 4O4IB 2UZ0A 1FDOA 2WC1A 2R1UA 4QRHA 2QTLA 1IN5A 4UBIA 4CV1A 2GPAA 1PSZA 4HQFA 4MS3B 3KQNA 1SUIA 3RSOA 1Y8QA 1W88B 5EVJA 2IZOA 4CIWA 3VNVA 1CUDA 1KY5A 3M3HA 1LX6A 2OWDA 3RS5A 3AKZA 3TM4A 1PR3A 2PKQO 2PAFA 3JASB 1XZHA 2I2AA 2P9BA 3BXPA 4C3UA 5LP6B 2NOAA 3PQ3A 3LUFA 4JN6B 1CIJA 3RRXA 2FPOA 5JEDA 1FFGA 3HU5A 4LMAA 1DBQA 1KHHA 4C0WA 1PKEA 3ZD8A 5ERXA 5AKXA 3T3NA 5C37A 2XUOA 3GEBA 3GVXA 1P2SA 3HADA 3LXXA 3TLAA 3HYLA 2MOKA 1SK8A 1KL7A 4PU0A 2H17A 3WWEA 5D01A 5BR4A 1JR3E 4RPCA 5E9QA 5EN4A 4W5NA 2Z30A 4B3HA 3D5TA 1WMFA 2QROA 5KB3A 1ODCA 1T35A 4RC9A 5JAIA 3MWFA 2HRZA 4BX0A 2AR9A 2HCFA 4PNEA 4DLVA 3B5JA 2W4IA 2EV9A 4NX2A 1G1AA 3ZJYA 2WPDD 5CFMA 1N4DA 4CCYB 2FLVA 1QQ5A 4EJ0A 1QFSA 4PC1A 3EXHA 1DO0A 1GVNB 2A9FA 2WUWE 1IEQA 1W5SA 3NALA 2JAUA 4D4HA 1DKOA 2C5FA 2NP6A 1SCUB 1VI5A 1HNZB 3L8DA 3PHIA 4CQMD 4O4JB 2G07A 3CV3A 4MRNA 4HGZA 2B4YA 2CLLB 1KO8A 2J3IA 3HUDA 3ZDZB 3QG1A 1M3SA 1YUNA 5ICCA 1R0YA 2R6GA 4I6EA 5B2ZA 2D5IA 2GHQA 1HNNA 2Z2XA 4BC1A 2RHDA 5FYQA 1EX7A 1GZ3A 2JI6A 2O6LA 2ZT7A 1TO6A 3DMPA 4F4UA 1GPNA 3CX8A 2PZEA 3Q85A 2R1VA 4QQ8A 5TDHA 4NCIA 3GUCA 2PM8A 3TPCA 1W9MA 4CBVA 3DFUA 3CZMA 5FI3A 3R3UA 3RFCA 3VPAA 4DV4B 5CG2A 5KTPA 4AY5A 3JWGA 1PWXA 1IC6A 5C1BA 1VLJA 2F9FA 3GD7A 5BN4B 3U80A 2NXCA 3R3ZA 3NIBA 5K03A 4I1PA 2O7VA 4C2AA 1UPAA 1BCSA 2BT4A 2P9ZA 3KAKA 4S12A 3BYZA 3ENNA 1MLDA 4R2LA 2GD1O 1AKMA 3HBLA 1OWOA 1T6YA 3I45A 3N1UA 3R3HA 4BO7A 3I3SR 4NDNE 2ECKA 1UKCA 2GN9A 2YZGA 5GTDA 1GDTA 1KJZA 4RO0A 4F5WA 1L7DA 3O93A 4UE3S 1W1WA 4X7RA 3IIIA 1S2OA 4M55A 5IUKC 2SECE 1AD2A 1CUWA 3ZLUA 3X2FA 4TXJA 2XCOA 4UBOA 4EHHA 5INTA 3DDCA 3ICQB 4TMKA 3IVCA 4UMEA 1W46A 2ZM5A 5DH9A 4RS3A 5CDYA 2ZQYA 4HVLA 3ZI7A 5BR8B 2P2CA 3W77A 2NU6B 1OXBB 2BAGA 1I4OA 3O47A 3P9QA 3EG9B 4Q4DA 1K0UA 2BSXA 1RBQA 3SF8B 3M1IA 4O3MA 1ISMA 1NBHA 4ZDJA 1SCIA 1T3TA 4UEJA 2PG3A 3LSYA 3T4EA 4QYXA 3M6MD 2D62A 1T91A 4DCVA 4DLTA 2VUTA 1CE8B 1XDGA 1XR3A 4REQB 1K88A 4P9NA 4LF6B 3RVDA 4F04A 3PE6A 1A27A 4N5HX 1ULSA 4EB3A 2IY7A 5DN6D 3RS2A 3MRVA 2ZUFA 3GJ5A 2AN1A 2BZ1A 5IBCA 2VJYA 3PJRA 5B6JA 3ZXUB 1OC2A 2IDZA 3FZQA 4X1YA 4TSFA 1XZGA 1GPYA 2CLCX 4BOYA 4R1SA 2XSZD 4UTPA 2QVCA 1P81A 4C20A 1V3UA 3NHJA 3EZ9A 3UPTA 1OZAA 1U2ZA 4KN6A 3UPDA 4LYAA 4Y0AA 4ASUA 4CM9A 3CLTC 3BGSA 2RGEA 1Z68A 1V2HE 1YL5A 5AVVA 4GBJA 2CXOA 5FPHA 2X58A 2OHHA 3T1HB 3PRJA 4INJA 3EC1A 5FEMA 4DSZA 4CLXA 3D1JA 4YRFA 4CKXA 1MW8X 4DPMA 3ACBA 1QV9A 2ZIWB 2WFLA 3HB9A 3IULA 1RBYA 5U4XA 4M7WA 4ARIA 2A78A 3G59A 1DKQA 1EQ2A 1PR6A 3EGWA 2NQTA 1EDBA 2VSNA 2XAAA 3QM1A 3MA0A 1SUBA 1ENYA 4KGXA 4LDZA 1O9HA 4AUKA 4E08A 4KE7A 2FX5A 1SFRA 1GTZA 2PJUA 2N46A 3CW8X 1J5EB 3DE5X 3KZOA 2XKBA 1LBIA 2OHJA 3V1LA 5LIRA 1QIKA 2FPMA 4GMFA 3IAM6 2ZG6A 2FQWA 3T54A 1L8AA 2OUKA 2XB6A 1OH8A 3WXMA 2DR3A 1X77A 2WTEA 1Y6ZA 3HEMA 2GS9A 2W8BA 4CFYA 3I4FA 1G9XA 2YYAA 4U5XA 1XAJA 1ZM9A 1AHNA 1HE5A 2AOUB 4KR9A 2GGSA 2GKGA 1I3NA 2EHDA 1UDRA 2QX7A 3C98A 3QE3A 4MW5A 5IMSA 2XMGA 3D31A 3L6UA 3SBOA 5KYGA 2PGXA 2Q3HA 1L7QA 5FTJA 1Z06A 3MUFA 4MV9A 1WOMA 5JVDF 1DAPA 1QONA 3LVQE 1PK9A 4F7DA 1Y1LA 4ZVRA 1S96A 3SXUB 5EE3A 1UDAA 4QOIA 1K8RA 1OYOA 3ROXA 2FUNB 3ESRA 4G1UC 5I8ZA 5CG1A 3KB2A 3GZTB 2PGNA 4MSUA 3R76A 4O8ZA 3WRYA 2WFMA 2YV2A 1A9OA 3T94A 2MIIA 1NFRA 1KS9A 2EFEB 1JQLB 2C78A 1O87A 4U39A 5C2JB 2YHSA 2PWBA 1T5LA 2SHKA 2R8OA 1VHLA 3FGOA 1NP3A 1B0PA 2WIFA 3HV2A 2R7LA 4RD0A 4KQJA 2PZLA 3CNHA 5HILA 2FJ0A 4TKVA 4JB8A 4DCOA 1VKOA 2V0NA 4HPXB 3VGPA 3A6DA 2JNWA 2GAOA 2WZBA 4GXTA 4JBXA 5T57A 1WCV1 2CVOA 4ESEA 1X1TA 1YZFA 2EAUA 3G9QA 4QO7A 4D9MA 2B3DA 4N0EA 3GT7A 1ZH8A 4PTLA 2BKVA 2W6NA 1Z2NX 1EFRA 3G88A 1PK8A 3MSXA 5TEVA 3TSZA 4ANFA 3EZYA 4US2R 3GGGA 2XUJA 1HR0B 5K3BA 2VG8A 1P2UA 1GKIA 2YZ7A 3T3EA 2OYRA 5JXHA 2AXQA 1W4CA 1ZUNB 2B8WA 4P8RA 3RWMB 5BWBA 4MITA 2J3HA 3AR7A 2XCUA 4CG3A 3GJYA 1B8OA 3SGLA 1SHKA 2I1LA 1P2BA 4Q3NA 2C4WA 4XD7A 3UJHA 3UAVA 1ZM4A 4TMYA 1KI1A 4BZQA 4HGNA 4CV3A 4EOGA 5I9LA 3KHTA 4FYYA 4GSLA 4TTIA 1QJCA 4OQXA 3WLPA 1FS4A 3LYHA 3PPYA 4EJSC 2Q3EA 4NWIA 3ZHSA 1O95A 4ZYLA 1N0IA 3JRNA 1M6EX 1A72A 4ZT7A 4D9HA 1FJGB 4CF6A 2AW5A 4A73A 3Q8KA 2QUIA 4FFRA 2RI1A 3UBMA 2R1TB 1IN8A 3AIIA 3UENA 2RKBA 4L4ZA 4BCDA 1NGSA 1THZA 3NEJA 4R83A 4P22A 1YT5A 1ZNWA 3W8NA 5J5VA 3AFIA 2ILTA 2I1QA 2OV4A 2WF7A 3EH1A 1SXQA 1Q1NA 4D79A 2V5VA 3UANA 3LBAA 3QQ5A 1XYVA 4J91A 4M9XA 4Q9DA 2I29A 3GJ0A 2ATEA 2GRUA 3O90A 3OLWA 4FR0A 3EZFA 3ONWA 3WIUA 3PB3A 1JFRA 1YF3A 3HU3A 3CO5A 4Y2GA 4EVQA 2MU1A 3RRBA 5FI5A 1H4TA 3L7BA 1FMTA 4DVGA 3C14C 3UXEA 1ARZA 4W5OA 4C1BA 4UQPA 1B26A 4OXKA 4KN9S 3OOSA 2K4MA 3PEFA 1VPWA 4I4LA 3ZGYA 1GRQA 2OHOA 1SKMA 3U3ZA 3T5CA 4EITA 3B1JA 1WOYA 1XRSB 4H7IA 5AKJA 4JYCA 4TN5A 2CJWA 5FO0A 2C88A 2D5CA 3DF7A 5F33A 4L1KA 1VPLA 2Q5QA 2BFDB 1XTTA 4ND4A 2J9XB 2JCBA 4DDTA 2MSDB 4GS5A 5E4TA 3HJUA 3TFWA 2IYNA 5AKLA 4YQFA 1G2OA 1YDFA 2QN8A 3PNVA 4M46A 4AJ2A 1DWQA 1G21B 2NNWB 4H6WA 2HZ7A 1XZPA 2F3PA 3A3YA 1FPMA 1BVYF 2WAOA 4MYTA 2OORA 2JVKA 4TMZA 3SHQA 3ZDDA 4HAYA 3VJRA 3VR2D 3WWOA 1Q77A 1UJ6A 4HS4A 5CK4A 5TQ0B 2QGZA 2CMFA 1Y5IA 3FMPB 3HS3A 4NONA 5IDVA 2C7VA 4HAUA 1D6JA 1FOEB 1UMBB 4AJIA 1OTHA 4BB5A 1PO7A 2QPAA 1ISIA 3F49S 4DSTA 1V11B 2QI9C 1WUJS 2W2XA 2ZJ1A 3MTIA 5AJTA 5HF5A 2FEPA 4GL4A 5B5SA 1DKLA 4F97A 1QAQA 3DEHA 2IXGA 4IGFA 4KEAA 1BSVA 4CG2A 1I0IA 1RWBA 3DM5A 4NABA 3WV4A 2CLSA 3K0CC 2X4LA 5I9SA 3CX4A 2WHQA 3HR4A 1V7ZA 3A6LA 3ZD6A 2PGDA 1LJUA 3PNQA 2XDYA 3G85A 3NJ4A 2HHAA 5LZ5A 3T3DA 1FNSA 4X24A 3F74A 5DYNA 4CMBA 3U09A 4V0QA 4YO7A 5IRCD 4AUMA 1ZVKA 3L4BA 3BHJA 4FMCB 4MPPA 5IZCC 4EY8A 2AJDA 4YDSA 1ZIYA 4EX7A 2B61A 4MDFA 3HU2A 2XA2A 3UXMA 3NTQA 5I5EA 1U2SA 1PTJC 2F8LA 3AO0B 1OWNA 3DBHA 3D4IA 3HSKA 3KSZO 3PQDA 2ZSIA 1VE5A 2RH5A 3DDSA 2VK8A 3QFSA 3QKRB 1UWVA 1GA4A 1U02A 2Z5FA 3HBAA 3JZIA 3HY6A 3L8EA 3MVEA 4XM0A 3AI1A 1BXRA 2PS9A 4NJMA 4MCAA 5CYGA 4PLGA 3UZUA 2PSJA 3DE2X 3B5IA 1FCJA 3FPSA 2C3YA 3IA2A 4LGVA 2JLWA 4MJLA 4LJKA 2EZ4A 3DYBA 4R51A 4AZVA 3GNTA 2OE2A 1Q92A 2JFOA 3G49A 4LZAA 4K6CA 2H7CA 4NZOA 4WAUA 3T61A 3WLLA 8AT1A 4X66B 2FR8C 3E05A 1S3GA 1TAQA 3MGAA 2GSDA 1P7WA 3CRVA 3TTTA 1ADJA 4QSHA 5KX5F 1RABA 1A9QA 4QLBA 3EWNA 1QRAA 5THXA 2H00A 4D92A 4W6QA 3ZGNA 3VSDA 4WOJA 4MGYR 2ERCA 4EUKA 1NONA 1FFWA 1BMFD 2ZRIA 3R74A 2OY0A 4KRGA 3RBXA 1RHUA 5H83A 3WAKA 1PJBA 2N42A 4EB0A 4AY6A 2HR1A 4RNDB 3FOAA 2PMDA 2EZTA 1L5SA 3AETA 1X86B 1Y4DE 3K09C 2HLPA 1IUPA 1VP3A 3ZN2A 1YGPA 5JO0A 3GF4A 3V7NA 3OX2A 4G26A 1T2VA 4QU9A 5FWDA 1FJ2A 3Q4GA 2ZTLA 4QHSA 3PX3A 3BCRA 4R3WA 5M7EA 4HLCA 2XRFA 4XLTA 4X1IB 1MJGM 2D5AA 2HWUA 4DHEA 4RK1A 1GL6A 3QFCA 3I34X 4JSRA 1RWPA 1EBUA 1C1XA 3SYTA 4A82A 1DINA 1B3BA 2J5XA 4LOIA 2HFKA 2WT4A 4C3OB 3URKA 1BJKA 4DHWA 3IT1A 3N6XA 3LFUA 1B6SA 3H4IA 2XB8A 4S0XA 3OQOA 4BNTA 4LC1A 1MXHA 1VHQA 3PI6A 4FE4A 1PE0A 3L1HA 4PX2A 1E2IA 2COKA 4GI1A 2GPSA 4PO8A 1NC3A 1XZMA 1MRSA 4LAFA 3ADOA 5FUQA 1XU9A 3IDSA 4EKEA 3PWTA 1PF7E 3EMBA 2A1UA 1X38A 4NMXB 3PEWA 3JYLA 4R2KA 2AWOA 2YINC 3RSQA 2IZ7A 2J09A 2C4MA 3ZBUA 5JRJA 3QVLA 4WCFB 3ANTA 4U7HA 4AMVA 5CEFA 6AT1A 2FDCA 1YKFA 2OCAA 4UM8B 4WESA 2HJ9A 4PYKA 4C0LA 3CVXA 3RLFA 3K2QA 5KS2A 4D57A 4DSAA 2XUZA 5JNUA 1VCHA 3L7YA 2BZSA 5LOVB 4C5AA 2V0GA 3B6JA 4ZT3A 3VNAA 5ALOA 3T35A 4N5LA 1MTZA 4LI3X 4RIHA 3A1TA 3VM6A 3BG5A 4EB6B 1BDIA 6Q21A 4KXQA 2Q4TA 3CZQA 4RSMA 2XWQA 4FYXA 1OAAA 4S2UA 3RGGA 4AIIA 1U7UA 1ACJA 2C1XA 3R3VA 1KDRA 4LZLA 5CLIA 5AMXA 4KUHA 3RASA 4RMHA 1W7AA 2VJOA 4IJUA 2IJGX 5DWVA 3X2EA 5KNLA 1BKDR 3ZJVA 1G5TA 5EYPB 2BM0A 2FTKE 3R6WA 1EX1A 1NBAA 3RC3A 1MCZA 2AG0A 3M6XA 3RU9A 2HYIC 1RQRA 1CF9A 1LKZA 4J0IA 2JCXA 2PGIA 1RJ9B 2QD1A 3OF3A 3T4XA 3A27A 5BSFA 3B48A 2NUPB 1SVUA 2OXTA 1O8CA 1JHUA 5KKAA 4PRZA 1JPJA 3NDIA 3U3OA 3OKFA 4J1SA 1HDIA 4E3ZA 3QVSA 2OBLA 1PNOA 4CLOB 5A4JA 1YDWA 2PU7A 4HLNA 1G8FA 1FVHA 1PDOA 1UK7A 3QPVA 1ZYUA 1V1MA 2AK3A 4R1UA 1U3DA 3KE8A 2FSIA 2JIZD 1JDSA 4LZPA 5AVKA 3WLFA 3FXAA 3LWNA 1M7HA 3E9EA 3EXEB 4F46A 1T0PA 1ZH2A 1CFJA 4KYIB 1VKJA 1VJ1A 2FEWB 4NAHA 1HPLA 2X2EA 2ZWMA 1RC8A 4DB2A 2O2EA 2BRUA 1ZWKA 3IEVA 1N32B 4B7UA 2BGJA 2ZJ2A 1VL1A 2P30A 4Q4AA 3OIDA 3WMFA 5JNSA 4XYGA 3S68A 1Z16A 3O4HA 1M83A 2F3UA 1BE8A 4RF3A 3I5YA 1F60A 3R6LA 1YOVA 1WCYA 1XCOA 2BD0A 3TW6A 5BOSB 3FDIA 2PWAA 1UBRS 1W5AA 3PFFA 4N0DA 3D7MA 3KOUA 4B2LA 2I1WA 2PD4A 3WB2A 1BQ3A 5CLFA 1J8DA 4OK5A 4LCBA 2ZCUA 5FQNA 5C8DA 5EZ6B 1FMFA 3M6AA 2O7QA 3P0IA 3FMOB 4PZ0A 3VR5D 1SKYB 4DV1B 4QATA 1PWZA 3JPWA 1C8BA 2EG9A 1YC5A 1PWHA 3NDJA 4TWIA 2JGLA 3UMJA 5KYYA 4HS9A 4ER5A 3PR2B 1P9WA 4EO9A 2K5UA 3NHWA 1IMOA 3HFGA 3Q5DA 4IINA 2ETVA 4LXTA 2E4ZA 3EGVA 1NOKA 3G2JA 3HYCA 4UHJA 4EW3A 3EPHA 3DL2A 3GA7A 2BEVB 2VLIA 4QVGA 3MT0A 3Q9LA 5JLAA 1O0SA 4Y2YA 5F7JA 4C4OA 4F12A 4Z53A 3AEKB 1ZWLA 4I1VA 2CBGA 2LBPA 5JNRA 1NLMA 1TGVA 2WHEA 5GY7A 1QCCA 2QAGB 3ROEA 1ST3A 1TM3E 4F5YA 1VIYA 3FJ1A 4MR9A 4RAQA 3TQCA 1Z7YA 1W581 4IG4A 1G21E 2CJFA 3PIDA 1K86A 5LWQA 3L6CA 1X1BA 2NAPA 1C4WA 1WP9A 5FYDA 1HYEA 4HDNB 1W0JD 3FYCA 1ESEA 3EY9A 1VJ0A 3GAFA 2PD3A 1QS0A 4WZBE 4BLSA 5F77A 4LQ4A 1RDFA 2VLBA 3TEMA 3ZH9B 3VKHA 1JB9A 3OCUA 4AZ0A 4UFOA 3ETDA 5ULLA 2XCTB 1X8JA 1ZOLA 3PXBA 3X0DA 3DAFA 2X42A 2G4LA 3F6YA 1KETA 1M8FA 2SKCA 2YXLA 4LHEA 4Q7MB 2CV0A 2O0LA 3CB4A 3TLXA 4DA8A 4V0ME 4NYIR 3HY4A 1WNFA 1YTUA 4DLXA 2CV2A 1W1UA 1SIUA 3QKSA 3IUEA 2FK8A 3JAWB 2GVDC 3CJTA 3WMXA 1OILA 5HA5A 3WR5A 2GLUA 1THGA 2QIOA 5A9SB 1A04A 2C95A 1C4OA 4NRDA 4NXNB 2XYQA 2YIDA 2HIMA 4W5QA 3C5VA 4F38A 1KQ3A 4GRDA 3U6KA 1WHTA 1LK7A 2VYNA 3P0RA 4MUGA 1EUCB 3K5IA 3C3CA 3LNCA 1E63A 1GTSA 3TX6A 2ID8A 1VKHA 1YZGA 4OYRA 5FX2A 5LB2A 3RAJA 3ZHBA 4CF5A 4DIOA 2ENUA 5HCUA 1GEGA 1OPXA 4KO8A 4F4CA 5GPBA 2YDXA 3EGOA 1U7ZA 1ZIOA 4HXYA 2Q0QA 3ETJA 5DNDA 1VFNA 3G0OA 3AG5A 1Z6YA 1UBSB 4KQXA 1RYDA 4WA8A 5B6IA 3CY6A 3AESA 4IW3B 5LUBA 1IULA 1JSXA 4NNJA 1T29A 3H8JA 1W85B 3N2NA 3N87A 2V7XA 2V6GA 4XH9B 3U4GA 4EJ6A 5KNCA 5H5JA 3GFFA 3D8HA 2GKOA 1FMJA 2NU8B 2WZDA 4ES6A 3E22B 5BUSA 4FKBA 4Q1FA 3AW9A 4DCSA 4DDKA 1JHZA 3X1MA 3ODGA 3ASUA 4TV9F 3ZU2A 2C9YA 1V95A 2C94A 5EMKA 4KB5A 1ZD8A 4D3YA 1I7NA 1Y7HA 2QE7D 2YWFA 3EFEA 4BPBA 3DBIA 1E3QA 3NKFA 3OZFA 3VHXA 2CK3A 1DKUA 3M3PA 4FWTA 4C1NA 2I34A 4ISCA 5B2EA 3IPCA 2WAMA 4ZCSA 1P2TA 3KTFA 1YCDA 2NSHA 3NFYA 2ZUWA 1WUYA 3S27A 2QL9A 3IXQA 4KR2A 1FSFA 2VJKA 1GZDA 1P5ZB 3CGGA 4E33A 3BSWA 4UTZA 4G5OA 3TS1A 2C29D 1ZGCA 4Q6BA 4XR9A 3JYOA 1ZD5A 2D2VA 4GYYA 3IR7A 5BQOA 1JR6A 1JDBB 1ULUA 2W6QA 4JI8B 1IBKB 1LC3A 3WP0A 2DUNA 5DRYA 3GPIA 4EBFA 1QGAA 4XCVA 4R0MA 1L5RA 4O2AF 5TS2A 1H1TA 4JP1A 3RUFA 2VHYA 3IPAA 3VH3A 4GI3A 5F51A 3PLRA 5UKDA 3ORFA 3ESXA 5KCMA 4CYMA 1Q0HA 1Y8AA 1GAXA 4G6ZA 3UMRA 2D1QA 3LDHA 1K9SA 2VAMA 3CTPA 2XHEA 1USWA 4W6ZA 3UT0A 2HRQA 4HH4A 3ZWXA 1XKTA 5DFAA 1OWMA 1EWYA 3QYJA 2EX0A 4HH3C 5JR3A 2H1IA 2X0JA 3BHIA 1CDZA 1CQWA 4IQ4A 1QK4A 1T4CA 5E4YA 2L17A 4JH0A 3ITNA 5T6BA 2GSWA 4HEA6 1ISRA 2QHXA 3GJQA 1DELA 2XUIA 5BR1A 2Q2OA 1J1UA 5E6RA 4IV8A 1ORRA 1JFSA 2G08A 4TZKA 1NRIA 2F8MA 2HMTA 3WIBA 1XDUA 4NCAA 1XE3A 2VF8A 5EQJB 1YK1A 4U2EA 5I8WA 4OL0A 4PS0A 3LLMA 3SS8A 3G8AA 2FU5C 4HPWA 4Y6SA 1L4HA 1W25A 1Z6GA 3JQGA 1RXVA 2P68A 1AVTA 2PIDA 3ENWA 2CWDA 4NOMA 3U4AA 4B17A 3MGBA 3IKTA 2AS0A 4X91A 4RD6A 3ORSA 4OJNA 3TIGA 2ZPAA 1F48A 2I9PA 3O1LA 3U1BA 3FHTA 3CPHA 1IDN1 4G9GA 1WULS 4KFTA 3TUZC 3CKKA 4U6NA 3IV7A 3U13A 5AVWA 1OYVA 2A92A 4BE7B 4TMXA 1ODTC 1GT91 1L5HB 1SULA 2V0CA 2MINB 3PP8A 3S2YA 2Z8YM 4CL3A 2XT6A 3QOFA 2ORYA 1I9GA 1Q16A 2P6NA 3DMYA 2ZYSA 4BLUA 5AUOB 5ER9A 2QZJA 4L5IA 5JS1A 3QVXA 4B81A 3ZHVA 4NTZA 1TQHA 1OFGA 4XJVA 4MP8A 1US8A 2O2SA 3RS0A 3ICEA 4H17A 2YJ4A 5CDTA 3S8YA 3NU1A 4Z7JA 4X64B 2JFNA 1QLJA 4RTRA 3Q3IA 4FJ0A 4WT7A 1IG3A 2WD7B 4P4LA 4YASA 2J0SA 2NMVA 4I5FA 2YVUA 3HXLA 5DEIA 4C7OB 2O1XA 2VQFB 1OBHA 1X15A 2Z1MA 4GZMA 5AUQA 3T5TA 1N1EA 3TIVA 4DCGA 1XG5A 5FBZA 5ARBA 2GVNA 5HRUA 4M22A 2AC4A 1V8ZA 2A3RA 3DT8A 5A5GA 3RHTA 4BBZA 4ZZ1A 1A2OA 2O3QA 3HH8A 2YUIA 1A96A 1BFKA 2R8XA 2G67A 3AV0B 3IHTA 1C8VB 4IKOA 3I76A 3QHAA 5AQEA 4KX5A 1SUAA 4H27A 2HJHA 2VJDA 1T9CA 2XMSA 3MJDA 2FMXA 4ITRC 3T99A 3PI7A 4IDGA 3AK4A 4DY4A 2YFQA 1YQ9A 3S0JA 2ASEA 4PYLA 4QPPA 1F8YA 3X2SA 1A4IA 3CRQA 3EDQA 4GG1A 1VMIA 3GYBA 3SSMA 1BXKA 4JB0A 2VHJA 3ZIDA 1KU0A 2JCVA 3HFJA 3T38A 4LF4B 2M9MA 2VF4X 5K09A 3C7TA 4ALKA 1NF8A 1WV0A 3RRYA 4E6EA 1SKYE 8ADHA 3EJ6A 2IHNA 2KJQA 3HL4A 4HRXA 2VRNA 1GDDA 4YDRA 4D3FA 3BBPA 4JI5B 1PJ2A 3TNLA 4AWXA 4A1FA 4UUOA 1EWTA 1H42A 1MJHA 1OSNA 4DXDA 1ZK2A 3FWHA 2YIMA 1CNMA 2DPXA 4O4IA 1P1BA 1ECPA 4Q9AA 3EEIA 3ILYA 5C8XA 1FX1A 1G0OA 2PFGA 3DBLB 4QDKA 4MQEB 5ESRA 5EC8A 1Q7CA 4JLNA 1T24A 4BE4A 2WJVA 4LN1A 3IOEA 2GK4A 4U6QA 2X8AA 3JASA 5KQSA 1LTKA 3G8CA 4PXSA 3TK1A 3TRKA 1NKVA 5HK8A 4YIHA 3VJMA 4AYWA 4YVFA 5D5QA 4O59O 3TB4A 3O4VA 4BFZA 4F8EA 4EB8A 2PT9A 3T3OA 1HKHA 4ZYXA 3WQHA 4GECA 4GOMD 2XMZA 2X5KO 5HFAA 4DXHA 3HJFA 4YNBA 2W58A 5TGTA 4J1NA 3CT6A 5HKKA 2QX8A 3AFNA 3CUYA 2EATA 2QYHA 2CMKA 3H3FA 3HRHA 2RHLA 2X15A 3C87A 2AMJA 2VXBA 2ZCVA 1YO6A 1H4SA 2XMPA 1FW6A 5F7XA 2Z5VA 1JEYA 2YR0A 1HE1C 4UEWA 1Z5OA 4J4TA 4HTAA 1VECA 2YC4C 4OI1A 3IE2A 3ECAA 1Y34E 4Q1AA 4CCYA 5KWVA 1Z6XA 3FYDA 4B35A 5LQUA 4GDFA 2FGJA 1EWRA 1F5NA 3MC1A 3O2NA 1H2EA 4F21A 4P0PB 1DTWB 3DR3A 4JYZA 1YVPA 3RVMA 5AO9A 3MK31 1NT4A 2YCBA 5HVNA 4XLLA 1CS0B 1JGTA 2I0FA 2LV8A 4MRPA 4TT8A 1V39A 3MYYA 4RSRA 3CLKA 4YQEA 4O4JA 4KITB 1FDTA 1LLCA 1FYDA 1YDGA 3BTSA 3KQQA 3FY4A 3I12A 4FMPA 2RGNA 3IPLA 4TTJA 4BO4A 3UMVA 2OV8A 4OHKA 1IUOA 5KEIA 3H1BA 2ZRHA 1LBHA 4QTZA 4Q02A 4CL2A 4J7UA 2N1MA 2ZR9A 2GJ9A 3CSDA 3ETEA 3KPYA 4IIXA 4JODA 3K30A 4O5AA 3VRHA 3H9EO 5AJVB 4EG0A 1TCUA 4TXHA 1XX6A 1EB9A 3D6TB 1FDSA 4ND3A 4DQ0A 1JEOA 6NULA 3OVMA 1QFJA 1FP2A 5ETJA 5AESA 5CH3A 4XVCA 2H7YA 3HR7A 3ZLVA 4RKRA 3M6LA 3O0DA 4RQUA 4Z4FA 3A9VA 4WFKA 3IVAA 4KVZA 1T13A 1XWFA 1KC3A 1QHEA 4AT1A 1KYZA 4R68A 4LVUA 4N4AA 1LLFA 1Q83A 1JDTA 4N9WA 5TJHA 4PR0A 2P78A 5TQVA 2ZIUB 2E7ZA 1TL7C 1RQGA 2NN3C 2WIAA 3B9BA 2YV3A 1E2PA 1AB6A 3ONFA 3EEYA 1G3IA 4ZN6A 4JI2B 1NIPA 3P2MA 3Q7PA 2P3SA 3EAQA 3WAJA 3DHEA 4ZYUA 4LTNA 3EEQA 3LIIA 4HGRA 4UULA 4WBNB 1GCUA 2OD9A 3LDGA 4I5EA 1SJ9A 5EA2A 1L5QA 2ZIXA 3T7JA 3JPYA 4TV9A 2A9RA 4EGSA 1YKGA 2PO7A 2VQSA 5ALMA 1ESDA 2C83A 2I3ZA 4I1IA 5DNEA 5JEEA 2AR0A 4G5GA 1NW4A 1R12A 4MUIA 4TSFD 3EVFA 4IZOA 5L3QB 2OGSA 2XA1A 1EZ4A 4IBOA 2ZSFA 1IY1A 2NU6A 2FPPA 4Z4HA 1FC0A 4CM9D 5TMPA 1QQAA 2P5UA 3EG9A 3FTDA 3L9XA 4Y2UA 5IJ9B 2UZ4A 2G36A 4AO6A 1OAOC 3JQAB 4BMXA 4B3FX 4RTKA 1VKZA 4KODA 1C3LA 1E9VA 3NMUF 3KT0A 1CE8A 3LC2O 4REQA 3TNJA 5AWFC 4XRGA 3I0NA 2RDMA 4Y9DA 3PFIA 5EEHA 4PC6A 1T4GA 3NEPX 3A3PA 3SM3A 5THKA 3TO5A 2ARKA 5JDIA 1GQQA 4UMFA 4LMPA 4BQEA 3RI3A 3Q5EA 1FDRA 4RS4A 1U0NA 1P1HA 4O2AA 1UBMS 2JLZA 3F78A 1D4ZA 5ALKA 5LFAA 1QZ3A 1KJIA 1KI2A 1Z37A 3MGGA 1U0GA 5AT1A 2V7WA 2XJ4A 3DZKA 4M7RA 2ODTX 2GCOB 1C9JA 5BNWA 1QF7A 3K6KA 3PXXA 3R5FA 4ND8B 1XB2A 3D6MA 3KG2A 2PWPA 5T5QA 3SAJA 3QSYA 4DDMA 1QTNA 2QU7A 2HK6A 3CF2A 1ORDA 4U8GA 2DERA 2JFPA 4QPZA 1P4GA 4K1XA 2ZIEA 2CUNA 4NNPA 4CE6A 1RXWA 3LF2A 3GZNA 3WKBA 5DBGA 1E1DA 1ULTA 4KHPB 1T8SA 5DO9A 3GXBA 2G6BA 3D4BA 2W00A 2XQFA 1CQJA 2ZIVB 3UJAA 3M4ZA 3AIMA 1SHLA 4CLOA 1SY7A 5JZVA 1LXCA 1HDZA 1E6WA 4NU5A 2ZPUA 5IP5A 3MJHA 3NYIA 1N6KA 1KORA 3OPMA 4U9HS 2OG2A 3MT7A 3INGA 4UVEA 4D5EA 3ND5A 3EXHC 1IY2A 1Z4PX 7REQB 3E8SA 2UUPA 3IAFA 2J85A 4DOMA 4A5OA 2AOUA 4EY6A 4GO1A 4YCSA 1IZ7A 3VX3A 1Y33E 5LU8A 3KFVA 2B21A 4MQMA 4O4HB 4QZVA 3CKLA 5FA8A 2BMVA 1RPNA 3Q3CA 1HUQA 1I1HA 3L05A 3HA7A 1BYUA 3BSYA 1HRDA 1YFKA 3BKXA 3DHWC 3O0TA 3OICA 1SHTX 5JV5A 5KYNA 4MYCA 3BF8A 1YMUA 3I5AA 3SQWA 1E96A 3NAQA 4G89A 1UQTA 1WF6A 2CDBA 3OIVA 1IL0A 3KYDA 1U3VA 2FR0A 4FOSA 2QDKA 4JYPA 4KGDA 3SXUA 4MAFA 2P4QA 2DUJA 2H07A 1AKUA 2C4VA 2IHKA 3IKMB 4IHAA 4M60A 4ZMBA 3PFWO 1U6JA 4HB0A 1EFRD 1TYAE 3IESA 4GSYA 3CB2A 1JE0A 2WWFA 1PS9A 3LTNC 4U7GA 3ZX5A 1E1KA 2PSDA 1KTVA 1MJGA 5ALIA 1DI0A 2D6FA 4G56A 3RU2A 3L0ZA 3LQKA 4PONA 5IULC 1IJEA 4XD7D 2OCIA 4D98A 3N2IA 3NNSA 4X6LA 3TZEA 3ZHTA 1ICEA 1T2DA 2Z3ZA 4U2DA 4PLTA 4WBSA 4AO7A 2EJUA 1N2CB 4EDHA 1HGXA 1Z63A 4JUIA 1EXNA 3GAZA 2X6QA 2ZZMA 5I51A 3MPOA 3NHKA 4NYJQ 1PQWA 1O95D 4A03A 4AURA 3STUA 3P2YA 4BV9A 2NU7A 1QRRA 2F3SA 4MKXA 1TT5B 3DR5A 1AK2A 3R8XA 2IY9A 3TOCA 5ABPA 8MHTA 2RGCA 4HFNA 3A28A 1PD1A 1YBHA 1SPXA 3DCJA 1KH2A 4UQOA 1ZUNA 3B1YA 5A5VA 1DIRA 1E6KA 1H9AA 4AZSA 1RHJA 1ZZGA 4D02A 4DKXA 3ZNPA 3CCCA 1X1DA 5FAXA 2G9RA 3D02A 3GP3A 2EL7A 3H4TA 3QLJA 2W4MA 3MAGA 5FL7A 1QTIA 3K5PA 1NMEA 3QKTA 4QU8A 2FQYA 1FB5A 3P52A 4Y2SA 2QE6A 3VDQA 5ADUS 4DNOA 4C7BA 2YVAA 4FM9A 1TPZA 4M1YA 2OC9A 4CMCA 2VP9A 1QHHB 1Z07A 1KBQA 1HTWA 2ZS7A 3AHDA 3IEXA 5LKAA 1UAGA 1QORA 1YC2A 4IOLA 1GLNA 5DE3A 2R1TA 1X7WB 3EC7A 5ICFA 4V38A 1S3IA 2VYFA 4X90A 1TXGA 4QUDA 4GR5A 4DEVA 3F67A 3NIGB 3OIYA 4JWKA 1NVMB 1HORA 2FKAA 2PVCA 3KFLA 3KETA 2Y76A 4IS2A