1YDGA

Crystal structure of trp repressor binding protein wrba
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
201
structure length
201
Chain Sequence
APVKLAIVFYSSTGTGYAMAQEAAEAGRAAGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEVIFKSGGNPYGASVTANGQPLLENDRASIRHQVRRQVELTAKLLEGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the tryptophan repressor binding protein WrbA and complexes with flavin mononucleotide.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Protein binding
molecule keywords trp repressor binding protein WrbA
total genus 81
structure length 201
sequence length 201
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ydgA00
1CZLA 3UXHA 3QFRA 2XOEA 1AG9A 4OXXA 1JA1A 1C7FA 2Z9DA 4M0CA 4CF6A 3N3BC 4H6PA 4D02A 2Z98A 1YRHA 5B3KA 5LLDA 3NHSA 4QOJA 4F8YA 4U7HA 2MOKA 1OBOA 2AMJA 2R97A 1FLAA 1FX1A 3N3AC 1OBVA 1AHNA 2A5LA 4LTMA 1YCGA 1D4AA 3KLBA 3HLYA 2MTBA 4J8PA 4ZVMA 3U7RA 3NHUA 5EAIA 1E5DA 3NHLA 2FDXA 4NLLA 1KBQA 2ARKA 1CZRA 2MWMA 1C7EA 4C14A 1F4PA 3NHRA 2QWXA 3F6RA 1ZWKA 1RTTA 2FCRA 2FOXA 1CZOA 2FX2A 2QMZA 3GFSA 4LA4A 1FTGA 2BF4A 3OVMA 4LTDA 1AKRA 2RG1A 4YALA 4GR9A 5F4BA 1TIKA 2Z9BA 4C0WA 4HS4A 3D7NA 1AKQA 1J9ZA 2BZSA 1XYVA 2HNBA 3OWXA 3GFQA 4DY4A 1YOBA 2GSWA 3O73A 4YAOA 1YCFA 4ZVKA 1WSBA 3U7IA 1YKGA 3ESXA 2WC1A 1RLIA 4PTZA 5LBUA 1CZKA 3N39C 1AKTA 1GG5A 2Z9CA 1TLLA 2QX9A 3B6IA 3OX1A 3EDOA 4FGLA 4BMPB 5LMCA 1FLVA 3B6MA 3JSXA 3G5MA 3OX3A 5LJIA 1YDGA 1I1OA 3F2VA 2OHHA 3F6SA 1VMEA 2HPVA 3OJWA 3L9XA 3FNIA 4N9QA 4XDHA 4Y9RA 2M6SA 1DXOA 1FUEA 1KBOA 2BMVA 2FAXA 3NHWA 4PTYA 1J8QA 3EYWA 5A4KA 1FLDA 2V5UA 1ZX1A 4FGKA 5LJLA 4FX2A 4N82A 3NHFA 3B6JA 3FVWA 4ICIA 4QODA 2KLBA 4ZVLA 4Y9UA 4U7FA 4U7GA 3QFCA 2QR2A 1D03A 5FA6A 5LVAA 3W78A 5F12A 5FUQA 1AKVA 2BN4A 2BPOA 1H69A 1J9GA 2ZKIA 3ZHOA 1FVXA 5FX2A 2FZVA 3KAQA 3NLLA 1AKWA 3W79A 4GI5A 2QX4A 2FZ5A 4DILA 5NULA 4YQEA 2OHJA 1SG0A 3ESZA 4H2DA 1DX9A 1XT6A 2X2PA 3GFRA 2X2OA 1OFVA 1T0IA 1FLNA 3O2NA 3W7AA 3SVLA 2XODA 1RCFA 2KQUA 3KAPA 1BU5A 1DXQA 2W5UA 4ESEA 2HNAA 2Q62A 3NFRA 4R81A 3K20A 4ZVNA 3ES9A 1XI2A 1QRDA 2M6RA 1CZUA 4LTNA 2OHIA 5EMNA 4CETA 1D04A 3HR4A 5LBTA 4YAUA 4NULA 5JROA 3R6WA 1QBGA 2V9CA 1JA0A 1V4BA 4QOGA 4FGJA 4QOEA 4S24A 4PU0A 5B3LA 2MT9A 1AZLA 2QX8A 1H66A 2R96A 2FLVA 3OWHA 4HEQA 4DIKA 6NULA 4YAWA 1YCHA 2N1MA 3OX2A 2V5VA 3L9WA 3P0RA 3TE7A 1SQSA 3GAMA 2D5IA 5F51A 3W77A 2QMYA 2FVXA 5BUCA 5TGZA 4N65A 5ULLA 2F1OA 5NLLA 1T5BA 3NHYA 1RLJA 3K1YA 1AMOA 4LAFA 1J9EA 1CZHA 4BMOB 5EA2A 1BVYF 3ESYA 4C0XA 2B3DA 1QHEA 1XYYA 2OYSA 2Q9UA 3FJOA 1NNI1 1CZNA 3LT5A 3QE2A 3HA2A 3RPEA 4YAFA 4XDGA 3UXEA 1B1CA 4C76A 3OJXA 3TEMA 1AKUA 3TZBA 3NHPA 3KEGA 3NHJA 1WSWA 3NHKA 2QX6A 1X77A 4GQIA 4QOIA 4QOFA 3FW1A 1ZWLA 1QR2A 3S2YA 3B6KA 3LCMA 4Y7CA 4QOHA 3F90A 3FX2A
chains in the Genus database with same CATH superfamily
3Q5GA 1FVFA 1X3LA 1U02A 1Y80A 3V7NA 5BQXA 3WISA 1SBQA 2GZSA 2XKKA 2XGJA 2Z98A 4ZAFA 2QSJA 2CCKA 1OTYA 1XVUA 3BQNB 4ZAYA 1W88B 2HDWA 3Q1LA 2QTHA 4CDRA 3BMCB 2ZPAA 4MV9A 5ICFA 3MJ4A 1CNFA 2QW8A 4K6KA 4P7GA 3CEAA 3ZQKA 1DNPA 1ZNXA 3U4QB 2I34A 3HVIA 1DIOB 3IQWA 4IIHA 2JIZD 4BO3A 4KV9A 4OJMX 1KF0A 3GPBA 3Q3CA 4IIJB 2QUKA 1K4YA 1K6MA 2XMPA 1UADA 4MKGA 2J67A 4BX3A 1TXGA 4IHJB 1D07A 4UUOA 4X62B 5JH7B 5LOVA 2D2IA 3QFHA 2ECQA 2K6GA 1N3IA 2PS9A 4FK8A 4NH4A 4Q93A 3SYTA 1KZ1A 3AUXA 3V5NA 1F0YA 1LBSA 2JLYA 1C9EA 3QA3E 1ZCFA 2A88A 1IM5A 3ECCA 3IAM6 4YYZA 1NULA 2JCBA 2XAUA 3G6KA 3H18A 5ALVA 2WJHA 1B6GA 4GUDA 4CCSA 3KS9A 1V8PA 3WB1A 1A7KA 1NW4A 3HUTA 3ITNA 5DK4A 3TQRA 4J3NA 1FNDA 3IUJA 3UM9A 4DBVO 4PAGA 3TI7A 2VHJA 3A06A 3GAZA 5BNTA 4YJ2B 1PVVA 2OWDA 5JSUA 5T4FA 4AJHA 1SGWA 4RTMA 1QF9A 4R16A 3H84A 4Q3OA 4QRHA 2VYND 4HAVA 4NHOA 3SC6A 5ELMA 3AK4A 2Q8NA 1UZLA 4IV8A 3ZBUA 2D7JA 2H7VA 4ZICA 4GKKB 3WJ2A 2ZI5A 1YA4A 3FDZA 3HSSA 4DMLA 4QUGA 4UNSA 3R1IA 3OHMA 2DGDA 1SBTA 2E55A 4L76A 4IFEA 4BE9A 3GLIE 3OIDA 4QBHA 5A03A 1MQAA 2PRKA 1WUHS 4ZI3A 3WGYA 1T6NA 4HXFB 2OOSA 1DX6A 2JLUA 2EYQA 3P5SA 1DG1G 3IE1A 3TLEA 5YASA 4D9NA 1GQ2A 1N7GA 1RE0A 1CUUA 4ZOEA 4XIJA 5J2UF 1P6UA 3JAKA 4JZKA 4QYTA 4BJ1A 2CLLB 3SSMA 8ATCA 2FRDA 4EI7A 3L0ZA 2IHTA 2G82A 4F3TA 2QUZA 2FB9A 2V55B 2YFQA 2ZLBA 3QV1A 4EK9A 3ZW7A 1T6XA 3E9RA 4M1QA 2XUHA 4QBTA 5KOIA 4YN3A 3MSXA 2TMDA 1B14A 1XD2B 1XK7A 1J5XA 1YRLA 2NSLA 1TU4A 3KWFA 4GX0A 3QWFA 3EFHA 1AT1A 4RK6A 4S1WA 1SQSA 3KZKA 4O29A 5LA6A 1Z17A 1HL3A 1O58A 4A6DA 1WG8A 2F1IA 4XH9B 3KFVA 3OLCX 2YN0A 1OX4A 4WSOA 4EW3A 1VM6A 3CIOA 3TE6A 1MCZA 4MVWA 3DBRB 3MUOA 2D2EA 3JQGA 2LGJA 3N7UA 521PA 3UWOA 1P1HA 1WVGA 5FV4A 1QG0A 4XTCS 5CXUA 4V0KA 3QPAA 1XK6A 2OCDA 1TCAA 3HV2A 2BDTA 1V71A 3CNLA 3TTTA 3A2LA 2VEOA 3MRXA 2IBSA 2PTGA 2PT9A 1H2AS 1DIGA 4UHHA 3U26A 5CH5A 2QVYX 1F0NA 3TIXB 3H5WA 3MRTA 3QTTA 5K09A 3UUEA 3M4ZA 4P5DA 3TLGB 1N5LA 3WAGA 1ORIA 3DXZA 3EIOA 2R2GA 1V5WA 4W7IA 3RS8A 3HPRA 2QQ5A 3BXEA 3IQDB 3MINB 4NCBA 4RTRA 2ZCUA 3KZMA 4EAQA 1E0JA 1NDHA 3BA1A 1VQ1A 4X91A 5IH7A 3UN1A 3MCZA 2O8VA 3BL5A 4CCYB 1XZCA 5EAIA 3D6VA 1OAOA 4HB3A 1J49A 2X8JA 1I4EB 1L3IA 4NI5A 4B3MB 2GK4A 2RGBA 3SBEA 4AKSA 3BICA 1YACA 5KYVA 3OE5A 4GYYA 4AK9A 3PYXA 5DGCA 5KTRA 1B00A 4LZNA 1CUFA 5DPMA 4W5OA 3FYDA 4GPAA 3GCGA 1UDWA 1F14A 4ABTA 1BG6A 2HMWA 2WJYA 3OWXA 3FNBA 5K99A 4JBYA 4L9SA 1JFLA 3R0VA 4PPFA 1I7QB 4BMNA 2EYUA 1QZTA 4FLMA 1IDOA 4HQ6A 4PSUA 3E1GA 3FFXA 3C3AA 4FYHA 2BR5A 4CQMB 4P3XA 1FEZA 2D5CA 4JX8A 4O4JB 4YP1A 1F8GA 1U7PA 5H02A 3K1TA 2ZYIA 3TTVA 2II6A 1YASA 5IYZA 1VLJA 2CFIA 3PIRA 1ZOPA 3SY8A 3PX7A 1ESEA 1YI8A 3IOMA 4TZTA 3H3JA 1QG2A 5FBWB 2FR8C 3DVAB 5K01A 4WKOA 1L2TA 1KPHA 1W5SA 4IRMA 1X19A 3NVMB 3TFOA 1T5LA 3C7KA 2HREA 4O33A 4MIYA 3PUXA 4EGAA 4HSEA 5J43A 3AO0B 5DYNA 2UU9B 4XM2A 1N6LA 3R7FA 3HKBA 5ETJA 2OHOA 4ZGBA 1AGYA 2QX4A 2DWQA 3T1VA 2ODAA 1SNYA 1Z5OA 1ZP6A 3EWNA 5EIHA 1WBDA 4RS4A 4ZO9A 3B9PA 2OAQ1 3NTUA 5FFFA 1MU0A 1QIKA 2GD6A 8ABPA 2D8MA 2FKNA 3CS3A 4ZTUB 1XFAA 1FOEB 1T5TA 2DUUA 3NAQA 3V4RA 2BM9A 3IRVA 4KACA 1FX0A 4J2OA 1ADYA 3PNPA 1RYNA 3LVRE 1UXIA 2VAWA 2KX7A 4WJKB 5F3WB 1X7WB 3I4LA 4P6VF 1NBHA 4KR2A 1OVMA 3JQPA 1VSBA 1GPH1 2W2MA 3IKTA 3FUXA 2B0JA 1XNQB 4F3YA 4RULA 4H27A 1RBZA 4L28A 4V03A 1MORA 2VPPA 5EWJA 1VHQA 4OLAA 3PE3A 3ZQ4A 4TRRA 4DWOA 4EF5A 3K9BA 4PZLA 1F2VA 1FFSA 1HLFA 4MWDA 1LZKA 3BWVA 3RHFA 3SC4A 4MRAA 3JYQA 4EYEA 5A5GA 1UCFA 2Q6VA 4Z7QB 1TU0A 2MYUA 4B6FA 3K70B 1QGUA 2IGBA 1NMXA 4IUYA 1ZO8A 2VUHB 4JYMA 3ISTA 1GKKA 2HQBA 3EIXA 4JU8A 3ZVRA 2A4KA 2Y3IA 1LU9A 1F4LA 4JI1B 1MB4A 3QTBA 1E4VA 2NIPA 1XR3A 2BFWA 2C8JA 3SF8B 4RHCA 5MHTA 2AJDA 1WXDA 1J8MF 4HGQA 4MR9B 4DKXA 2J3QA 4QELA 3WZ2A 4Q4AB 2P67A 5EGSA 1M1UA 1TKAA 2N47A 3HUUA 2OV6A 3JXEA 3K9CA 1XDWA 1EQ2A 2JCXA 3MMXA 1E2LA 4CF6A 4DMRA 1J2JA 4DLVA 4HQFA 2XLCA 5LLDA 3LHDA 1F17A 4D3XA 1YBVA 1M8JA 2ISCA 2QP9X 2ZJ0A 2C4UA 4DDKA 5CB4B 1DXHA 1J99A 5LZ4A 4BASA 2NO7A 1D4AA 1GSHA 1PR9A 2FUNB 2ZIUB 4LWPA 4ALNA 1SPBS 2BKXA 2OFWA 5AKXA 5E1MA 4FFSA 2JEZA 3QXSA 5E6SA 2QD5A 2WPNA 2H4WA 3U4DA 3DE0X 3RK0A 1HQCA 1RACA 4F9GA 2CSXA 1EP3B 3OQBA 2XSZD 4JT2A 2XX3A 3ZWAA 3WX0A 3MJTA 1D8TA 1MV5A 1PNOA 2CMGA 1EQUA 2FHPA 2IEZA 3EZNA 1E61A 2AN4A 3IFSA 3MJHA 2KHZA 3D8RA 3ZEAA 3F5DA 1XVIA 3MXOA 1BSVA 5AJVB 4M49A 2X58A 2FNAA 2BZGA 2NTEA 2QGFA 2Y0EA 5DP1A 4YRKA 1P4SA 3AU9A 3BYZA 4U39A 3A1TA 4FFRA 1YXMA 4UREA 1MO2A 3DAPA 4YRFA 3T95A 1A2QA 3GY0A 2QVBA 3BXHA 3Q7IA 3WKEA 4LF9B 3LBYA 4TL6A 2V74B 2WQZA 4Q3BA 1WB4A 3L5OA 2AR9A 1D6JA 1DS6A 4UM5A 5REQB 1P8JA 2REQA 4MVJA 5GGXA 2F1JA 1OZ0A 1SUSA 3DLIA 3G7UA 2EF0A 4B7AA 1XDGA 2WAAA 3G8DA 2CHGA 4CM4B 1YR9A 5DTIA 2VDRB 1LF5A 1RJ9B 4N47A 4A15A 4OG2A 1K3TA 1W4ZA 1XAIA 1Y5IA 3UV6A 3W06A 2C2GA 3ZJUA 3DB2A 1TLTA 1U7TA 5FYDA 1H69A 2NTVA 1EP1B 1OT5A 4IGKA 4NNOA 1GT91 4URUR 1SC6A 1RWPA 1U7XA 4PX3A 2R66A 3WRYA 3D0KA 4K26A 2KBEA 1HRDA 1NBIA 3TRHA 4ZZ0A 5D3QA 3IVRA 3OT1B 1IOVA 2HRCA 4F84A 3BHMA 3QITA 4BLWA 2Q62A 3LO8A 3LNCA 4EHNA 2ECKA 2ZIXB 4P83A 4DCUA 4E51A 3FUCA 4EW1A 5HKLA 4CF7A 1KU0A 1CIPA 1YKSA 3Q41A 4OQZA 4B7XA 3ILSA 1E1RD 3GEDA 4A8HA 1GV1A 1XCBA 3HKDA 4K6CA 3WQHA 2GGSA 3I23A 1YIOA 5AUQA 3FUVA 5F23A 1Z06A 1NF3A 2YZGA 3EZ6A 3OX2A 5CFPA 5CW1A 3ZI0A 1DC3A 4DNQA 3VHLB 2I8AA 3VNQA 1MC1A 5DP2A 2ZZNA 2G4LA 4CU2A 3KQSA 2G9ZA 3FDIA 1YZVA 4QQ8A 1DMRA 1JQ5A 3A1NA 4JASB 2G71A 1KVRA 5EYPB 2FE4A 4LWQA 2I87A 3INRA 1OTXA 1XP8A 1JEEA 3VU9B 2E4UA 2JH9A 2BEJA 3S8YA 2FN4A 3OZXA 4C76A 5DGDA 3PPXA 4DR6B 1HE8B 3KZXA 1XJCA 3WYDA 1RJFA 3BJRA 4MP6A 3KSRA 4L57A 4Q1VA 4CKEA 5C5IA 3U1BA 2JAOA 4W5NA 2C9YA 1ZVQA 2CKMA 3EEBA 2HK9A 3OO1A 3WMWA 4CMAA 4U02A 4YV0A 2XOEA 4RGBA 4CEJA 2HU2A 4CF3A 2PL1A 2DCUA 1PCXA 5ALSA 5F35A 3ZZTA 1YZHA 3IDQA 5EPUA 3NHSA 2WICA 3H1EA 2B8WA 1GKLA 2NQTA 4FFBA 1U8AA 5C1IA 1FX1A 2WY2D 5J2UB 4NBWA 2RK6A 2GPBA 3H9CA 1WBBA 4O2AF 2JANA 3KB1A 2O3SA 4NOKA 1ZCZA 3MGBA 1CR1A 4FBLA 5HIJA 1HXHA 1R6AA 1V7PC 2JGLA 2JZNA 5DGHA 1ZK3A 3QTLA 5DHUA 2NADA 5KVAA 2OCGA 3LM8A 1KQOA 4J7AA 3TM4A 4K9QA 4WVLA 4EQ6B 1SZCA 2R47A 3D6AA 1N9GB 2A78A 5M3BA 1PLJA 2Y68A 4G1MB 3P2KA 2G1KA 1RYHA 3K96A 5DB4A 2FWMX 4CNQA 3H1FA 1OYVA 1N6NA 3ZKWB 4DQUA 4K8RB 1AKQA 1N7IA 1P80A 1SKAA 2ODNA 3EXFA 1YRBA 1PS8A 1YDFA 3ZCSA 4EDFA 3UKOA 4B6JA 4CXMA 5B3KA 1H2BA 4B84A 2JIQA 1R37A 3LF2A 1U9IA 1A2KC 1TADA 2C1EA 3S2SA 1U1IA 4B3JA 1PZFA 3RFTA 3CY6A 4AY2A 5IUKC 3ETHA 5ED0A 1VXRA 2C20A 3GDOA 4DR3B 1U94A 4EY3A 1XC7A 3D6MA 1HNWB 3T9CA 4A91A 1IZYA 1QHHA 1VDZA 1GAXA 1TYAE 4UE6A 1OFHA 4FZ5A 3G9XA 1K66A 4YRPA 4ND7A 5K6AC 3C8HA 4UBNA 4IOJA 3ENVA 4JENA 3GI1A 2VN8A 2AMLA 3L7MA 1K8RA 2UYOA 3CLSD 3OZFA 3QNWA 4NPCA 4B4KA 4ZC8A 2AJBA 2A2ZA 4BNLA 2I3ZA 5BNIA 4UE3S 4DDMA 3WIVA 3CX7A 3CISA 3NTQA 3EZ7A 2H5JA 1Y5NA 2PAFA 2P8SA 1XLTC 5FX2A 3PUKA 4OV6B 3WHLA 4M8LA 2IDJA 2EEPA 4AKEA 4GQBA 4E12A 1SCJA 3ZLVA 4LJ6A 4CQLB 3N2ZB 1B8PA 4O2BA 3FHTA 4EMTA 3AJEA 4YGYA 2IODA 3GBPA 3R3YA 4URFA 1CJMA 1NMQA 1V9LA 3DPIA 1IWOA 2HA7A 3QX9A 1NFRA 3PWTA 3OO0A 5DCLA 2CMFA 1TTHA 4IPTA 3KAPA 4OA8A 3V32A 1W48A 4NJMA 1GGFA 3SVZA 3OFSA 3UVEA 4E1BA 2REBA 3LXXA 3T5MA 3P32A 2NVUB 4EA8A 1A9RA 1UKAA 2ODEA 1G7TA 1Z7YA 2PGLA 1K7EB 3BTOA 3E3AA 3KVOA 3NYRA 3OQ6A 4QREA 1JWBB 4BLSA 4ARVA 3GNLA 2P68A 1U8FO 1WOMA 4QHYA 5L6LB 1ML3A 2BI7A 2HRBA 4C21A 5JC1A 1KQNA 5K4GA 4PLGA 4QPCA 5H59A 4N40A 5TIIA 5IRCD 3KOUA 3TPCA 3SLGA 3DV0B 1TGYA 4MUIA 3ICEA 4YK7A 1PDWA 3OBBA 5C5DA 4P0PB 1P45A 3PQ8A 1IFXA 2HGZA 4TQUS 1RLJA 4UM9B 1DG3A 1T8UA 2HU5A 3C5EA 4OFZA 3OD1A 3OQPA 1B73A 4R9VA 4UU8A 4YCBA 2GAOA 2H4ZA 1KHHA 2HIAA 4ZCPA 4BLUA 1OREA 1WDTA 4RH0A 4RACA 1E0DA 3DTTA 4WK6A 2NXEA 1GSOA 3LAWA 4QOFA 3X3HA 1JIUA 1KMIY 3GU3A 4DJTA 5IARA 4B81A 5IXSA 2DEUA 2LR0A 1WB6A 1KY2A 3AFNA 2GA8A 3CLTC 3QIVA 3UMBA 1KEUA 2NQ2C 5EE0A 1ONOA 1WABA 4F3CA 2AYXA 4M1ZA 4W6QA 5A3JA 4X90A 2ZUDA 1QLWA 2KW5A 1TX4B 3JAMA 5ALGA 3ZV4A 3CE9A 2WWRA 2ZJZA 5DLQC 1YCGA 9GPBA 1L3BA 2I4NA 1ZD2P 3NO4A 4FHZA 3KX2A 3QHQA 4IDNA 4IJQA 1JLKA 3GRUA 3N6VA 3LHKA 4E3ZA 2QN1A 5JRZA 3LKZA 2YJ3A 2BJVA 1AKMA 2JLAA 3K7EA 4LF4B 5HF8A 3SYNA 3CHYA 4L1KA 1Y3HA 4M98A 4ND1A 1FRQA 1AKRA 1VIAA 3GA0A 3OLVA 4PC7A 4M38A 2GD2A 3VXKA 1AGXA 2GZAA 1EUYA 1UBEA 1XMOB 4EHFA 1HT0A 1TTQB 2X5NA 4MUHA 4TXJA 4DIFA 3K5IA 1HKHA 1SCAA 3PX2A 1WVIA 3HUDA 1WVMA 4MMYB 3RIXA 1KY4A 3F1KA 4PCVA 2GCNA 3OX1A 3GP8A 3DJFA 1WPQA 2XMQA 3OY2A 5A04A 2ZOSA 3S29A 1I51A 5IBPA 1XF1A 2FZEA 5D01A 2P1DA 2GTHA 5AVOA 1D2HA 4ZJYA 3DMPA 1MENA 3GHYA 3ADCA 1FU7A 1M83A 4ZEVA 4PSVA 3N05A 1Q0ZA 2C4MA 2ET6A 2X4GA 3B6JA 3P4XA 4PRLA 3UK0A 3VZDA 3JTMA 3L05A 3TUIC 4ZDKA 4OY3A 3U9TA 2C4VA 2DBQA 2ZWOA 4WV3A 2HLDD 3EH1A 2PUFA 1NJGA 4EB8A 5AM1A 2IUUA 2BN4A 2AJ8A 2W6CX 2YJNA 4BL5A 4FIDA 3I9NA 4F8JA 1Q44A 2VDVE 1EFVB 3EFOB 3ZR4B 4EENA 4D41A 2P65A 2Q4TA 1QKJA 3IO3A 4PLPA 4TLAA 2GH1A 2L2QA 3IAEA 5A0TA 1GXSA 3CEPB 5ALHA 5L7TA 2XMCA 3BULA 4ZQBA 4WEQA 5HZKA 4LC9A 4M1EA 3D8NA 1E9BA 1G2OA 4AUEA 2AOXA 5KAPA 3FCSB 5BSFA 1SM4A 3LC0A 1GTG1 4MV4A 2CD7A 4PYNA 2QI9F 3BD7A 4QUBA 1F48A 4RM3A 2NV2B 3PR1A 1PJ4A 4ZOLA 4BLPA 4QEZA 1H0HA 4RDHA 3ZHZA 1KMHB 1Z2DA 1TUGA 4QU5A 1GYPA 5EHQA 3T1NA 1S2MA 4AJ2A 3TSAA 4DKJA 3PC7A 3QF7A 5I8PA 2WTEA 4I55B 4BVFA 2B37A 3P0RA 2ON6A 4BVGA 3D1VA 4GXRA 4ENQA 4ACBA 3R3VA 3G2HA 4X6XA 2QBYB 1K0UA 1MJFA 5EP4A 4FFPA 1DLJA 3H42B 1ZQ1A 3KXDA 4FWIB 1EH5A 1HQYE 1QFSA 4KYTA 4UEJA 1L5NA 2BCJQ 2FI1A 2VT6A 3P0FA 1OUMA 3CLKA 3FE2A 3UMVA 5EA2A 3TBFA 5EHXA 2J3JA 1F6DA 4XA8A 4E5MA 2I7XA 2NU7A 1GTRA 2QN6A 3VR6A 2P9JA 3MAJA 1RJGA 1V5EA 4EG1A 1W93A 1CUWA 2IW3A 2EATA 1TGVA 1Z88A 3Q3EA 1XTBA 2XVMA 5GIOE 4HDOB 3FAZA 3VOBA 3DS8A 3ZBPA 4ND8B 4YJFB 1NRIA 4AJIA 2WB2A 1P1IA 3Q98A 4YHHB 3GRPA 3QUSA 4D5EA 8MHTA 1DAKA 2CLFB 4YO8A 4OIFA 4BWFB 1GDHA 3NT2A 1I2CA 1UOEA 3SQLA 4ZZIA 1W0JA 5TMPA 4QM7A 4BHTA 4ZT7A 5H4HA 1F20A 3VO2A 3U3XA 2F3SA 2ZJ3A 3KKLA 4XGRA 4MMZB 1O8CA 2A9VA 2PRJA 3QW2A 2YHBA 5D5QA 4E15A 2RH4A 3PC8C 5HGXA 1ZMRA 1H3FA 5H9VA 4A92A 1DJQA 3BRQA 3JWHA 3QLEA 1Y34E 1JWLA 1V6SA 1Q16A 3E15A 4KQEA 2Z1DA 4DA6A 3UGJA 4X0EA 3P2YA 4MWOA 4YGXB 3RS3A 1FQKA 1SUWA 4BP9A 2UZAA 2J5XA 4BECA 4DIMA 5CMLA 1KJWA 2Q9CA 4DBZA 5JJ5A 4MQ5A 5AOBA 1G8JA 1G9XA 1FBTA 4J90A 4AZWA 2PIDA 4FDAA 2VNAA 5ESRA 2PFGA 4JHXA 1CC1S 4JLJA 5AWFC 5K3OA 1KEWA 1IWPB 2PZBA 4JC4A 2IXGA 3EXHB 4EHJA 5AUNB 4L6IA 4Q18A 4KJXA 2D1TA 3B7GA 4TXHA 4YUXA 2DFPA 2Y92A 4XGNA 4Q4JA 4F7DA 5FJIA 3QVWA 4B3SB 4EVSA 2GEDA 5E8RA 5T8KC 1GTL1 3SZRA 1W34A 4KOAA 2QTWB 5GV7A 1AQNA 3PQFA 4OQMA 5BVHA 3VKUA 2GFIA 5ALRA 4DJFC 3D0OA 1Z33A 4LS3A 2QPOA 5E7QA 4HNUA 3QK7A 4KL8S 1A9YA 2H0RA 2IC5A 5AI6A 4KUHA 5K8VA 1ZU5A 2XMGA 2EZ4A 3VPAA 2HRRA 4AKTA 1OXVA 4WL0A 3DYBA 2AX3A 2WV9A 2I6SA 1G8SA 5GM1A 5ELXA 3E1SA 3K20A 4WLEA 2CVHA 2WDPA 4IUDS 4OIMA 3HB7A 2DULA 2CNBA 1JMYA 5BSUA 3D8TA 2VDWA 3IVMA 3RT7A 2XTZA 3IP9A 1G17A 3F7NA 2ZIEA 1J1ZA 2OCBA 1Q17A 2W93A 3JQ6A 1TLFA 3SU8A 3GL9A 3M7IA 3ZIAA 3WQRA 1YOVA 2CXHA 1A04A 2XF2A 1Z6PA 2IZOA 5BNFA 5A3QA 1V7QA 4GPIB 3AIMA 1Y48E 1DXYA 2AS0A 3PQ6A 5D5HA 1XA4A 3JV7A 4HAZA 3FGOA 3OQMA 3I72A 1A9ZA 3AERB 2NM0A 3GCDA 4I5IA 3L0DA 3GK3A 1KYXA 3Q2IA 5DX1A 3THYB 3C43A 3C6MA 4XYMA 3AL0C 5TQ0A 3SEZA 4JT8A 4P0QB 1LRJA 3ZC3A 5KI6A 5HZHA 1KRXA 5JFOA 1O95D 4FSXA 1QS0A 3KLOA 3TPFA 2HJVA 2BKLA 3BIXA 1ZPDA 4ZO4A 4IUCS 4KDEA 3HEBA 2A5JA 3ZZ1A 4RK1A 3FX2A 2KE5A 4BJ6A 3UXHA 1R74A 2AFVA 2YRFA 4G8BA 2MYNA 1JXAA 4I4TB 5FORA 1U4OA 4PZAA 5ITVA 4Y2YA 1L4NA 2ZJ5A 4PG8A 5JAIA 1MAAA 2G80A 1ESNA 2ZI4A 4X45A 4RCVA 3K0SA 1T2VA 1OJ7A 1SBNE 4PQYA 3BL8A 1C14A 3TRIA 1OH5A 4WBNA 4IYJA 7YASA 5L3SB 1E5DA 1I1NA 3UMRA 1ZJJA 4D0GA 2FSIA 2HA6A 4ZT5A 3DBHB 1Y5MA 3IEPA 4M9RA 1Y4AE 2D5AA 4Y1RB 1F4PA 5KCMA 1JVSA 2PWBA 3U7QA 1SC3A 2R8EA 2VUTA 2VTBA 3OA0A 2Z2YA 4FNMA 5IBQA 3K09C 2EV9A 4ZV9A 4EEZA 4C5CA 4PLCA 1EWKA 2QRVA 1NQVA 3Q15C 4G9BA 4LNUA 5K0SA 4HDCA 5E4JA 1WZ2A 2BH9A 1A77A 1LV8A 3RUHA 1N0WA 2X0RA 3H8JA 3FSJX 3OPMA 4H6WA 4FM9A 1HDCA 4MINA 1G6Q1 3QVGB 5HNKA 3ELBA 1K8ZB 4TQ9A 1RAHA 2HH9A 2PAAA 5CNMA 5C3MA 4MVJF 3S5JA 1RTKA 1EVIA 2BY4A 3DA8A 1W30A 1T3LA 1II8A 2GBLA 2YYSA 3WGVA 4MRRA 3DZFA 1U80A 3QOYA 4NTZA 1P7WA 1SC9A 3M4YA 1OLOA 5IAAA 1EKXA 2XE7A 1GITA 2WJZB 2WJVA 3MWJA 5LIRA 3N58A 1J8QA 1CJBA 1Q7EA 3EYWA 5DVZA 3Q88A 3SIRA 3PRYA 3JALA 1KGDA 2WWXA 5TB5A 3MW8A 1VSQA 2B4AA 4B34A 5F2NA 2LIPA 2W2VA 2BHLA 1SB8A 4B2LA 4JL6A 2QT0A 3H19A 2P9EA 3RSLA 1JXMA 3N0XA 4UEOA 1QP4A 1GG9A 3NLLA 2B20A 3I42A 2QZJA 1VYTA 2O8DA 1OILA 3IE0A 3OTGA 5E2AA 4ZYVA 2F59A 1IIRA 1SC4A 2Q0HA 1KDOA 5JNUA 3CZAA 1PFUA 3EBPA 5CLLA 4XWYA 1SHUX 4PGFA 1X86B 5I7VA 1S3GA 1G5FA 2RC5A 3DNMA 1CE8B 1GUZA 2NUBA 2EFYA 4AWBA 3X1JA 2PSEA 3VVMA 4BQIA 3CVOA 1E7MA 1N2CA 4ND2A 2IYZA 2R1VA 3CN7A 3PIIA 5CU7A 4C07A 4YRZA 3DF9A 4YJ2F 1VHTA 3IKLA 4JWTA 1NW6A 3T9BA 5IMBA 4PICA 5CPBA 5B2FA 2ZI7A 2Q2QA 1YJ8A 2VI5A 2H52A 4PLWA 3T7RA 4CM7A 3EDRA 4DDTA 1ZNQO 4R68A 5DHRA 3HKCA 1Z0DA 1XZJA 1YZLA 2BM1A 2ZR9A 2R62A 2REXB 4OXNA 3AOGA 1O08A 5CGQB 4HATA 2A0WA 1OLUA 1LLUA 4K6MA 3LGSA 4IDOA 4WPGA 4MW9A 2RJNA 3PGA1 1G9TA 2HEIA 1TUBA 4FEGA 4DANA 1TJNA 4JP3A 2AFHE 3DFZA 4YROA 1A9XA 3A9RA 3T3PB 1YUBA 2P1ZA 2ILVA 1RT9A 3TN7A 2HHHB 1NYQA 1XEFA 3LF1A 1JLHA 4YA6A 1JQBA 3KU1A 3LUDA 2FRVA 3I9V6 1EBBA 3F0TA 1R16A 3BJEA 4MUGA 3BGVA 3AR5A 3FJ1A 2E82A 1LZLA 3DTYA 1M0EA 2ZUCA 4UPVA 3UJ3X 1M2FA 5C7YA 4NU5A 2IZ7A 1PJCA 1Q0SA 3VZSA 3N3AC 1I3OA 4BRWA 3BA6A 3WIOA 2O8EA 2CLOB 1QGED 1WUKS 3STXA 1I4TD 1ORVA 3CSDA 4E1AA 4YJGB 3W5UA 4NMWA 2RHDA 2V8BA 3DP7A 3HSYA 4N5LA 4TMYA 3SIXA 1AB5A 2EP7A 4KH0A 2W90A 4YCDA 3T4XA 3ZWVA 5BN1A 1YJXA 4C7MA 3NORA 1X1AA 3ILYA 2IVZA 2BM8A 4QQKA 5B53A 4UUNA 1V16B 5A71A 2RG7A 4LMRA 4XDYA 4CGYA 3F4LA 5CBPB 2O2JA 1XD8A 4D79A 1K68A 3B60A 5EKDA 3VNRA 1L5FA 1VG8A 1LF0A 1PWHA 3RI3A 5J2TB 5EJ4A 1DO0A 4I1PA 2J45A 4O4IA 2AL7A 1KZYC 3LLVA 3HP4A 1YMVA 4YRIA 1P2UA 2B1QA 2HCRA 2XHZA 1P0PA 2H51A 3INNA 3M9WA 3QE4A 2NXNA 4OGWA 2A5YB 1QZUA 4NV0A 3AP1A 3HN2A 4IJVA 1KDTA 2V7QA 3F1LA 1YB7A 5ALJA 4FGWA 4H0FA 1A50B 3P9ZA 4PC6A 1R4MB 2DOKA 2AWNA 1HZZA 1LK0A 5SYAA 3W5JA 4E46A 5BVGA 3HBFA 5I7SA 4FMDB 1N33B 4WOCA 3KIPA 1N6KA 1KVQA 3DL7A 4TV8B 4W9MC 2PZKA 3JQ8B 4BPBA 1Z25A 3TKAA 3FZYA 1SXJA 1N2IA 5IW8A 2R8YA 1UBJS 1UMCB 2XZTA 1SUPA 4MJXA 2RBGA 1C50A 2BP7B 2ORWA 4Y7DA 3O3MB 2IOFA 5JNWA 1ND5A 2ZJYA 1X2BA 5CDFE 5IABA 4AY5A 3HKEA 5JCPA 2HD4A 4JOQA 5CRIA 2IE0A 2RKWA 1RCFA 3A6JA 4ZRMA 4EHHA 2RGYA 1QH8A 4JEUA 1GLVA 1EFCA 1GU1A 2FSVC 2GHRA 1ZNZA 1VPLA 2P6PA 4G1VA 4NENB 4YECA 1C7QA 5BOVA 4E3WA 2XDQB 4EHLA 4NMXB 3PUHA 3K8OE 1BVRA 2B0CA 2ZYRA 5B1SA 3HDTA 1HTBA 5LP1A 1SZDA 2B21A 3VISA 4FYIA 2WG2A 1F5NA 1XU7A 3L79A 4UXHA 1E2BA 4FWBA 1DDIA 3RTEA 4UFPA 1KVSA 1J00A 4FHCA 4MV5A 5BMVA 3BT7A 4N8DA 5KYUA 1E59A 3RG8A 3USCS 2GXSA 4MPRA 3EOAI 4YUZA 1OI2A 2NYRA 4FYKA 1EGQA 2C2KA 2H31A 2Q6KA 2XUKA 1U8TA 1UKZA 3AIIA 4UQOA 2IXFA 3CO5A 4YCCA 4ZV4A 3U7EB 3BFXA 2PU7A 1F2UA 1L4GA 1LTKA 1ULAA 3OF5A 4AY6A 3F46A 4HADA 1NW3A 2O2IA 3TZBA 2UYHA 4DDVA 1NUTA 2FSFA 2DJIA 5AVSA 1J33A 2E49A 3VR1A 4LQLA 5I9SA 1FY2A 1HLGA 1D2NA 2VK1A 2X77A 4TT3A 3UTCA 2QLLA 2NYUA 3TSWA 4TQGA 2CLEB 4ZZ2A 1T3ZA 1WMFA 3AEQA 5L40A 1IMOA 1U3TA 2ZVDA 5TF0A 4RA9A 5EL0A 5FULA 4TUYB 3U7RA 1XDBA 4HPWA 4IOMA 5B36A 1DIRA 1E99A 1TAHA 2P5TB 2ZTVA 2VZ8A 3PT5A 4TYMA 4A27A 5ILOA 4KWTA 2C9DA 3LLMA 2VF7A 5EIBD 4OYRA 4TLEA 2FFQA 3WL6A 1HBJA 2PGDA 5M04A 3H8WA 3P2JA 3TXAA 3A8TA 3NHRA 3FDXA 2LZ0A 3HVHA 1PL0A 1YZGA 4X7MA 2H8GA 4B74A 3G0GA 3R9KA 1XPOA 5BV1A 4WXHA 3E9CA 3FCYA 3BFPA 3KR1A 5FADA 4YY3B 2B1IA 3K8ZA 1YCFA 5F33A 4ZI5A 5FFMA 1KPGA 1RLMA 3IEMA 3BXPA 4YEDA 5DH9A 3TOVA 1JFVA 2C5BA 4QXAA 3R40A 5AT1A 3IILA 3JYHA 4JB0A 1OA0A 1NW7A 2VNSA 1QTNA 4JP5A 3UW3A 2R3SA 1ATIA 2X15A 3L9XA 2IZ5A 4IH4A 4Y0VA 2VHUA 4ZKDA 2Q3HA 4RTJA 4ALJA 3BWCA 2QZPA 3FYTA 1MH9A 3M6UA 1QQ6A 3EW9A 4J0EA 1GGEA 1J21A 4U00A 2Z6AA 2NZJA 3EBOA 1NQWA 1DARA 4UU0A 5CJPA 2EVWX 1JFRA 4UEKA 3D2BA 5BUQA 2CYAA 5E7IA 3RBXA 3O8RA 3RVNA 3I9FA 4U6NA 4AN0A 3IUQA 2PVSA 2P90A 4W6ZA 4RY0A 3DEKA 5H80A 1RMQA 2X5JO 2DFVA 4MWBA 1F8XA 1XNJA 4ZVSA 3ROGA 2ZYSA 3A4MA 4B7CA 4Z2AA 1EFKA 1OXXK 4TS1A 3VR5H 4MDHA 1OAOC 4QGHA 621PA 1O8BA 1AE1A 4C7OB 4NWIA 1TM5E 4KLAA 1GY8A 1QLHA 3BHJA 3SYLA 2EHDA 4RETA 4OQPA 2TYSB 1SWVA 1RXEA 4I8IA 3K1AB 4KBYA 5EMNA 4CLOB 3ZWDA 1QU3A 2XNCA 3V55A 4B3DA 5A5EA 5L53A 1KEKA 1D2AA 2RHTA 4DSZA 1W9HA 1EK6A 1NI3A 2NSDA 1QOQB 2CBZA 1JBEA 3LIIA 3ZU5A 4CTKA 2HWYA 2O1XA 2H1RA 3W3ZB 3NZEA 2QTLA 2MSDB 3HJAA 2HUNA 1T2UA 4Q4HB 1EIZA 5I9NA 5C8DA 2EKLA 1Y4UA 1IEVA 2JHPA 4I08A 1XCPA 3TX6A 4LCJA 4EITA 4WCFC 4WA8A 1KI8A 2E6KA 1OX6A 1EVLA 2PCJA 4K7JA 2KJQA 4CG3A 4DR5B 1AV7A 4L4ZA 3GJ3A 1UC4B 2PD6A 5FV7A 3TLBA 3V8QA 4ZYYA 2AQIA 2OECA 1BN6A 3UAZA 3V8VA 4MZDA 4ISCA 3FGNA 3AFOA 4OLBA 5AUOB 3OZDA 4DA9A 2BIFA 1RC0A 1TC1A 3GQBB 3S4YA 3EAQA 3I8SA 4W9RA 2PUEA 5CJ2A 3AP3A 4TSRA 2I2XB 3OU6A 4J0HA 1X1RA 1KMNA 2VHCA 3AG5A 3LCRA 3F4KA 4ND5A 2WK1A 2JBWA 4O4IF 4DC0A 1PZNA 4Q1AA 3U3OA 2ADFA 2ASEA 3DFKA 1Q14A 1XMSA 2CB9A 1PIWA 3DE2X 3E61A 4EH1A 1PNRA 1L4UA 4ZVMA 2P30A 2PH3A 2OO5A 3BWXA 3CW8X 3FUUA 3EQ8A 3CVUA 3EPHA 3NUQA 3FTNA 3L7YA 3PFIA 3TTUA 1CV2A 2YIMA 2D13A 3V33A 4PSDA 1VCNA 4BUZA 4C20A 1M2NA 2V1XA 4P86A 4X3CA 5TVGA 3Q8LA 1Z82A 2GEBA 2VWPA 3X2EA 2JAPA 4X8HA 5IF9A 4B3RB 1T5DX 4RGQA 1KK0A 3P0JA 2C77A 2XKBA 4XUDA 1JTEA 4RXUA 3LLSA 4JLAA 3HCOA 3TQCA 4QQRA 3ZHXA 2HQRA 3TVTA 1UZAA 2ZYWX 2DG2A 3IERA 4WOPA 4TN1A 4TYPA 1SIWA 1NA5A 2HJHA 2N0SA 2Q3MA 4W63A 3LY9A 4MUKA 3MPUA 1WBJB 2OC4A 1T3HA 1EJ0A 1IHOA 1TLLA 3B78A 3G0CA 1KJQA 3JAWB 1L8OA 2Q0SA 3GARA 2CNWD 3DEAA 1CFZA 4RAQA 3GZNA 4TWJA 5FL7D 4BO6A 2ZIAA 3NYIA 1B43A 1Y63A 3UO8B 1GSAA 4QGBA 3A1DA 4DWWA 1ARZA 5E38A 5JCJA 1KBOA 4M9SA 1T3GA 1I4OA 5EQTA 221PA 4G86A 3SQDA 3VJMA 2X3UA 4TRJA 1MB9A 3PT9A 4P35A 4DV6B 2J7PA 4D42A 2ACKA 4GQAA 5F9MA 3IUPA 1EG2A 4AYXA 1KOFA 3EEYA 3KZNA 1D6MA 3Q85A 1LJUA 4PIPA 1Q83A 1ZMXA 4FOPA 5HCNA 3FUTA 3E3NA 1NM5A 1REQA 5LZ7A 4F5ZA 1AHPA 1UKCA 2MSWA 1ZNYA 4AMGA 3ODGA 2UUOA 2IXEA 2NUPA 4XCXA 2PUCA 1THZA 1N0IA 3W9YA 4CMJA 3UT5A 3JR3A 4QU0A 4LIPD 2RD2A 4BFVA 2Q9AA 1W0KD 2F43A 3KKOA 4OHCA 5F5LA 3J81A 1XZ8A 2HLNA 1VBNA 3SJZA 2KYRA 3P1JA 3NRBA 1Y89A 3N7AA 2C9OA 4GZ3A 3TLYA 1BFKA 1DWQA 3RYTC 3O1HB 4M6WB 4B6EA 4CM5A 3KSBC 4D8VA 1IB0A 3OPVA 2XKJE 3VNAA 2FWRA 5J2TF 5CLIA 4DYVA 3JQQA 1SN7A 3P19A 3LUBA 3PVZA 3LFHA 4G25A 4L5IA 4EVIA 3ESRA 3R77A 1DKQA 1RDFA 4O1HA 3V1KA 4WK4B 2ZBEA 4QBFA 3ZXIA 4C0JA 4EPTA 1W25A 1TL7C 2YJZA 2JLXA 9MHTA 4DJAA 5C18A 4KWEA 4ZD6A 2ODQA 3AVPA 2BYTA 4R8SA 1M5UA 1QKIA 4R41A 1L7DA 2BR4A 1U2ZA 3K1YA 3MM4A 3VDQA 2ZDQA 1U7HA 3D2AA 1XKTA 4CKZA 1NGSA 1ZMBA 4CQMD 3A9SA 4JJIA 4DPLA 1AHHA 1VJCA 2E4VA 4V02A 2FPWA 2IEBA 2WU0A 3FJOA 1TKBA 4MUEA 3ZS8A 1BCRA 4LZLA 4F56A 5AW5A 2EBFX 3QEOA 1EFUA 2WYOA 3N8GA 4G8DA 1MJHA 2DWOA 3UC5A 3HBMA 1TI7A 4JUFA 3N0WA 5AO9A 3KJQA 4DQDA 1UINA 4IHQA 4NV3A 3OJOA 2VZEA 1V2GA 2BE9A 5HG0A 3VC1A 1H8EA 3DAHA 2BT4A 1YQUA 4BOYA 4LJKA 5BSEA 2YRXA 3FVTA 1BDMA 1F6WA 1NKSA 5FL7A 3JQAB 3IIJA 4IWXA 5ALKA 3VH4A 3KSDO 3M49A 4DABA 1IBRA 7GPBA 5JSQA 1SCUA 1U1EA 1TAQA 4RKEA 3OE7A 4BYGA 1A3CA 5ER6A 1M1YA 2W58A 1XMPA 1OU4A 4YRTA 4U3JB 2CZCA 3JQAD 3MILA 2J0UB 1JA9A 3IVAA 3REQA 2CXRA 1NIPA 1RYFA 4CNBA 2WFLA 4ZQFA 3WFIA 4Q7KA 2Y9PB 1GA6A 5ADHA 3A25A 3EEIA 1RVDA 1C9NA 3VPFA 5AW8A 3BB3A 1R4NB 3WK9A 2CC2A 3CLRD 3HJBA 5BR8B 1CUDA 5FNVA 1PJ2A 2BDUA 1MPTA 1F4VA 3BXXA 2I67A 4KZKA 1WU8A 3QE0A 1UBSB 1O6GA 1Y5LA 2VJQA 2VR1A 3TQSA 5FWAA 1OF1A 1SB9A 3CJTA 4TVOA 4UTOA 2QB5A 3HXTA 1DKLA 2Q2VA 2VQSA 5AKHA 1LLQA 5A4AA 3ICVA 3P0IA 3NDBB 5AXBA 5BNZA 4ER7A 1H4VB 1INLA 3WIDA 4GL4A 4LV5B 4II2A 2ZRIA 5DEIA 4BMYA 5D86A 2WF5A 4ZCTA 2WJJA 1IY8A 3HRKA 1KKUA 1BE6A 5FBKA 4L8LA 4AY4A 3PHLA 3OC6A 4OFBA 2YDXA 1NURA 4IO0A 2J87A 2XZPA 2FLKA 1M34B 2I2BA 3IT0A 3EXG1 5KQSA 4IZHA 5DIFA 1COZA 3ZJYA 2QUJA 2YWHA 4B2YA 3B3FA 4CUKA 4Z1OA 2D0PB 3VR4A 3EK2A 4D98A 2V97A 1RWWA 2X2PA 1JT2A 4OGKA 3I2KA 3W8EA 1PTJA 3GJ8A 2Q6LA 4D8UA 1BYUA 4YRGA 2E7ZA 1WPXA 3O4FA 4Z7OB 5D85A 1ISJA 1FQOA 4ZIRB 1RSZA 2AXPA 2JPDA 3GLGB 2C2XA 3ISVA 2AZ4A 3MJRA 3OIVA 4KAFA 3VJKA 4AMBA 4ERNA 3UJAA 2C2WA 2UYYA 4MV7A 3FROA 3AKCA 3DCIA 2VPIA 1QYXA 2CVZA 2J3EA 1P8AA 1C7IA 3GR6A 1U2QA 2XNDD 1BOFA 2IP2A 1RAGA 4NNPA 1EJ2A 4XE5A 2YV2A 5C8YF 1Q7BA 4URXR 3RBAA 4P3YA 4CG2A 4KO1S 4DAEA 5C31A 1ZUIA 3NKVA 2HRQA 3KJHA 1S3SA 4M22A 2HBQA 2J6IA 4K6OA 3V9PA 5PNTA 4AO7A 2Q2WA 1LFAA 4DDUA 1QHEA 4PYQA 1IZ8A 2BSXA 4QDTA 2O50A 2XQJA 3G2QA 3O4VA 5LBIA 5TQ2B 5IANA 3AJAA 1LWNA 3TL3A 2BF7A 1B7GO 1ZJ6A 3IP3A 1CVRA 4KREA 1KXZA 2D4HA 5GONF 3KJXA 1E5XA 2XQKA 4YRSA 1NNEA 2AVDA 2VSQA 3NBQA 4M9QA 2VAPA 2C92A 3FG9A 4RIFA 4DLYA 3GZ4A 2L42A 4XM0A 2IV3A 3DBLB 4P81A 2GPYA 5B6IA 1PD1A 4CKCB 5JYEA 1WP9A 1V11A 1R8SA 3K9HA 4Y1FA 4CGZA 2R7MA 4V0ME 1N5IA 1O5TA 3Q6MA 4GPD1 4PHGA 3UQYS 4DIDA 3OESA 1A9PA 4J1TA 1J24A 4G5YA 4N0QA 5FI0B 2FTKE 2O14A 2AFIB 1PQWA 2P35A 1WNFA 4OQEA 5LQRA 1JDJA 3T3HA 2G0AA 3A14A 3ZDFA 1C9KA 3GFOA 5AW9A 2Z08A 4CTNA 3S40A 2YUTA 4Z4EA 1DI0A 3HDHA 1QV9A 4M83A 2DSTA 2FSGA 1QQBA 2VJBA 2Z9BA 2EJVA 5KNCA 2V7EA 5LQJA 2RJOA 1TA4A 3BHNA 2A9RA 3L6UA 4MTCA 2FWIA 4IIFA 1G9SA 4IVNA 1OB2A 1CJTC 2BGUA 4OJNA 1QFZA 2J08A 4HTFA 1ACJA 1RLIA 5FOSA 4XWOA 1SQ0A 1QHXA 4OYLA 4P38A 3ZWQA 1JVBA 3FGPA 1LNZA 5GM2A 3WIUA 1FP7A 4UBMA 5JCOC 1FUKA 4B32A 1E77A 2ZWMA 4DM7A 2QE6A 4E94A 3N1UA 2WJWA 4R1UA 2H3HA 1T9AA 1EP9A 1ULUA 1TM2A 2AKAB 3QMVA 2OO5C 2VFAA 3AEUA 2F9LA 1AZWA 1ZOOA 3CVJA 3N5CA 5EJMA 1D4OA 1PV2A 5E7MA 4EKGA 1A5ZA 4CV2A 2LDXA 2O3JA 1F1JA 2VAXA 1IVYA 1NQTA 2PT6A 1XRRA 2TSYB 4HDKB 4QIHA 4PPGA 5JS6A 3QSYA 4NONA 3W05A 3SDSA 1K5HA 4HOYA 2CXOA 1RAEA 3UEOA 4EY5A 4IF4A 3FZGA 2J46A 2FMUA 4YQEA 3EMDA 3U7FB 5IEBA 5H9WA 4Q16A 3NH9A 4M7WA 5ECDA 1R6UA 3OKPA 5THQA 5TPZA 1SZPA 3EC2A 3VSEA 4XD7A 2FPIB 4DNFA 1XZMA 4EAAA 1JDSA 1GAEO 1VIYA 3JCZA 4R5MA 5F5XA 2MSCB 4A2PA 5KQMA 3AOEA 1UDXA 2Q6IA 2QQFA 4OHOA 4OI0A 1E5TA 3RARA 1XZAA 5BSKA 2B7BA 3GVIA 1BXGB 1YCDA 3L8MA 4WUVA 5DNDA 1XTPA 1O77A 2K4MA 1AY0A 3K2EA 5LD2B 4GXTA 3WVNA 4I1RA 4EJSB 2C3OA 3ABSB 1IATA 3GLFB 4JDUA 5F3DA 5F7JA 1EVEA 2B2CA 3BAFA 2VJLA 5KYWA 2JFGA 1F38A 4F72A 4B71A 2H1OA 4BMSA 3EWAA 4G5GA 4FD2A 4NY1A 1DSSG 3AUSA 3FB1A 4LRXA 4F7WA 1M34E 3L5KA 3LY7A 4LW8A 5JNLA 2D3TA 1UM9B 1W85B 3PG5A 4TM8A 1OLSB 3BIJA 4FBMA 3D3QA 3MJFA 4QUKA 5GTDA 5KJ6A 2B9EA 3HXOA 1G4AE 1PGNA 3NPMA 5FIUA 1NQOA 1SD5A 4LQ4A 4DPMA 4IYRA 2VJYA 3SG0A 4A10A 3K0FB 2A0KA 2VHEA 4JVNA 3KRTA 4UUAA 1A69A 1ZR2A 4Z5XA 2Q1UA 3HGTA 4QUEA 2ZBVA 3HSKA 1OPRA 3RIEA 3WV5A 1A82A 4YV7A 5B7GA 3H11A 3I2JA 2WD9A 3VA7A 1AIPA 2O3RA 4BB9A 3VZBA 1M6HA 4MW4A 5DLEA 3IBTA 2RH5A 1FMTA 2I2AA 3VRHA 2CXUA 1B4DA 4M0CA 4BQOA 1P2FA 1UZUA 2CMDA 4ER0A 1NMYA 1P7ZA 1J0CA 1PR1A 3QPWA 4P3PA 2G9RA 4LVNA 2HV9A 1O4VA 1UEXC 4G1EB 3SHOA 5F2KA 2ZJOA 2UV8A 3IAS1 3KLBA 4HGRA 2Y2VA 2OSVA 3CF4A 3L0PA 1VXOA 5TXGA 5CCXA 1M2VA 1NXOA 3ZCTA 3QJGA 3GG9A 5EVJA 4E4TA 1RTTA 2V6JA 4NBUA 1T29A 3RRYA 4HYEA 1U1DA 3PR3A 2P2LA 5DGIA 4ZCSA 4YJ3A 3CG4A 5HBGA 3AVOA 3GELA 4GSKA 2VPXA 1VSTA 2F90A 4IVPA 3V34A 5C80A 4G5SA 4XASA 2VDNB 4PSAA 1W73A 3Q0IA 2PNJA 4AC9A 1RWOA 3GPDG 3R5HA 4HUJA 4J0JA 4ME6A 1KOGA 4U0JA 1CB7A 2XB6A 2H1CA 5GJBA 3G5MA 1W4AA 2O52A 2PHZA 1PRYA 4H7KA 1GGHA 3F6SA 1VMEA 2IUFA 2QHXA 4H3VA 1XNRB 4RH3A 4CL3A 1Z2NX 1TJYA 3SMVA 4H3SA 1JXQA 3KV1A 3SPXA 4R2HA 1X1EA 1C8KA 3PKZA 3EARA 5CLHA 5AHKA 1QQ5A 1NVGA 2WVJA 1DT3A 3VGJA 3VU1A 3VH1A 5CVTA 4QYSA 4URVR 1BS9A 3W90A 4DS3A 1EWQA 1LJLA 4PHFA 3WO1A 4FYMA 3AHHA 1LUAA 2OBYA 3CF4G 4FHDA 1IUNA 3N87A 2ZRDA 4Q82A 4FQ5A 4FFMA 1N4AA 1M2EA 4JLBA 2WILA 1QCYA 4RVOA 2XOKD 3HXKA 1Z5PA 2PU5A 1SG0A 3O9ZA 5DYTA 1USVA 1A88A 1SCIA 3KALA 4EBBA 3T4UA 4E2YA 4F4UA 1JKXA 3MD0A 3QMPA 1FLNA 2F67A 3PBKA 4S0ZA 3VX3A 1V1RA 3CUWA 4TWRA 3AHDA 4MB6A 3RADC 3IUBA 4LDPA 5K2MA 4I5FA 2JDID 1JQAA 2JGNA 1M2WA 1CJSA 4CETA 1TW3A 4NIMA 4RMIA 2A9KA 4QOEA 5C8VA 1QIHA 4O08A 1XL0A 2I6XA 2OVBA 3PB3A 4H4EA 4DRYA 2DLNA 3VYTB 3E3LA 3ORFA 3WKCA 1UMKA 1IQ0A 3TFWA 3UOGA 5IASA 1WUIS 1L1RA 1HTWA 2HSJA 1Z34A 2AI3A 3F6CA 3LI2A 5EHIA 5CA1B 1RYDA 5CK5A 4IXMA 2IHNA 1E0KA 3F9RA 4D9GA 1K08A 4FDLA 3RH0A 2VCYA 3FD8A 4DV0B 3TL2A 4RLSA 2QZ9A 2Q9UA 3B3GA 5JXIA 2WRZA 4P4SA 3HFJA 1CR0A 2B3TA 2VJKA 4B17A 4IXTA 3VI4B 2OENG 4XX0A 4HLCA 4QXMA 4KLCA 1FJXA 1KJNA 2RHCA 1GZHB 5EE5B 4X7RA 5JXJA 1Q21A 5HDQA 1W5BA 2O0HA 2ZDHA 3AM5A 3TSYA 2E48A 2NUTB 4NBKA 3U80A 4K6FA 1PYOA 2I2DA 3MOIA 5DTMA 4EEXA 1UK9A 3C8ZA 3Q40A 2HJSA 4X97A 1SJ9A 4ZPJA 4Q3AA 1FFBA 3AYXB 1OSNA 1GWNA 2G17A 4LSWA 3ML1A 2RKBA 4CIXA 2CT8A 1W581 3EUAA 3D4NA 1HG0A 3L92A 3OECA 1V25A 2B35A 1ABEA 5EN4A 2NOAA 1ODKA 2EKDA 1E1MA 1I7NA 3G85A 4DCNA 3EVEA 5F1KA 4RIGA 1S0UA 4ZMSA 3VVLA 4KWCA 3K9QO 1C7EA 3HDGA 1MZVA 5TRTA 4X20B 1MJGA 4V2UA 5T6MA 2IOHA 4B73A 3FMIA 4KPUA 3NWJA 4M76B 4C08A 1VI5A 3I61A 1ZESA 1NI5A 3PUYA 4Z9BA 4BB5A 1KH2A 1ZMOA 1YOBA 2JVIA 2YYAA 3BS4A 3EXHC 4I50F 5AXCA 2PWPA 5KTSA 1D0IA 1JF8A 2IX3A 2PUAA 1E1CB 1U98A 1R66A 4FOSA 4PANA 1GG2A 4HDAA 4QLBA 3DFIA 1DC5A 3F5SA 2VA8A 1GG5A 2OFOA 3PNLA 3UAOA 3PNMA 3L0SA 1JHXA 1R0CA 2AOUA 1C8VB 3KXKA 2FX5A 1M1YE 3C5WP 3QWAA 4LXIA 3EG9A 4URYR 4DLBA 4Q6BA 2DQSA 5AQ1A 2HPVA 1ELOA 1MC8A 3TD9A 3S2EA 4D44A 5D3KA 2IS4A 1T2NA 2ZULA 1VRWA 2GT1A 4PG6A 3AC0A 4I5DA 1B6TA 1FTNA 1Z6TA 1UP7A 4QJ3A 5A9SA 3RWBA 3ZE2B 4PN3A 2C7RA 4URZR 4P3NA 2R1UA 3OMLA 4DGQA 5FA6A 2COUA 1UAYA 3ICOA 3ZK9A 1ETHA 3EVBA 4BNJA 3LE8A 1BCSA 2C7PA 1Z08A 3KQYA 3GDHA 2F8MA 5HF6A 4EMBA 2Y71A 1NVBA 4GM4A 4Q3NA 4ZDWA 4LC1A 3T41A 4JWKA 2WQ6A 5FA8A 2YMLA 4YLGA 1MGOA 5T7BA 4XPIA 3DL2A 3F47A 3FUWA 1T10A 4XCVA 3HB9A 2XXJA 2A58A 3FMVA 4HFRA 2EQAA 4E5PA 3H1BA 1HEIA 4E5YA 5KINB 1EX7A 2YQ4A 1EFRD 3NP7A 2FWPA 3SEQA 3F9CA 3A4YA 3U3JA 2GXAA 4LXTA 1N2XA 3HNRA 1QHFA 2QR5A 2XMZA 1LCIA 3MF4A 1N2SA 1QH1A 2Y4NA 3BWYA 3RUAA 5B12A 5ED4A 3MTAA 5H68A 2WJ6A 4JX9A 5CBKA 1AHIA 3HJGA 3L1JA 3M6FA 4TYWA 1PYGA 3TTXA 1L6IA 3NI2A 3TB4A 5AOAA 4BO8A 5E6RA 5ITZA 1KERA 2E87A 1L5SA 3N8KA 2KM1A 3DG9A 3IEVA 2E4ZA 2W2KA 3LT1A 3Q4GA 3W4JA 4M9UA 3OSUA 5ALLA 1YDWA 2ZTSA 3B85A 3CNHA 821PA 1QVVA 3E53A 2C3YA 1J9EA 2ZQYA 4NBLA 3K4PA 2C07A 1A1VA 1QB7A 2QMUA 2FETA 3GFPA 1FP4A 1WAMA 3ACCA 1UM8A 1V96A 1DOAA 2BUBA 3OLQA 1XYYA 3QGMA 3EY4A 4HLQB 4KNVA 3HCDA 1L4KA 3NNDA 1DEKA 2Q4OA 2IU3A 2PMDA 5IHXA 1C9YA 5LP6B 1FTYA 2JFPA 5EUMA 1M6EX 1VE9A 2J6HA 4PNZA 3BXZA 4IIXA 3KC2A 4QULA 1C1XA 2BRUC 1OXBB 2HFKA 3NDRA 3ZXXA 5DBHX 1FFXA 2DUJA 2P9YA 3UFXA 1KP9A 4NECA 4C05A 2RGNC 2C94A 3B48A 3OU2A 4PAMA 4QXRA 4Q02A 5FCDA 5IDVA 4ETMA 1IM8A 5SZIA 5H16A 1R9GA 2FMIA 1P18A 3CUUA 3VTAA 4BV3A 1GEGA 1PU2A 2G70A 2W9XA 2HQ1A 3H87A 3NIGB 4PINA 4XQCA 2IE8A 1UPBA 3UPUA 4JAVC 2YVAA 4G89A 1UDAA 3NHUA 4CFZA 1E4EA 3PDIA 4QNMA 3COVA 2V65A 3GB9A 4GEKA 4NKRA 4CF5A 3TCNA 3BH0A 3ZD7A 2X4DA 4KLNA 2C0CA 4L4RA 4CN8A 1LY1A 4PC3A 2YZ7A 4HP8A 4HWTA 4X85A 5AM3A 3C98A 3DDUA 2FEXA 5CVJA 4GOLD 1N1EA 4RK4A 4I1IA 4M37A 3VUFA 1CUBA 2AKYA 4IGAA 4Q3CA 3PGXA 5JZSA 2QROA 3E3OA 3G2OA 3MMPA 5I7AA 4AF7A 1M2KA 3NATA 2XYQA 1WIWA 4BV2A 2RGUA 2HAEA 4UOQA 3GZTB 4IIVA 1H1DA 4G4IA 5BN5B 3BJZA 3D2CA 2IRWA 5FOQA 5EP1A 3P2EA 3N8DA 1RM0A 5KVCA 3QSGA 5LXTB 3P97A 1XEXB 3VNSA 1XCMA 3CUVA 2M6LA 5COQA 3EIHA 2XE6A 2BHSA 1VFPA 2EQBA 2H5EA 3CR3C 4YPOA 1YQ9A 1I01A 5CURA 5LA6F 1IK6A 1KAEA 5K3AA 5LDDC 2ZUSA 4WRRA 4X65B 1EUCB 3I9KA 3HH8A 3O9MA 1Y1TA 3D5QA 3FSRA 3OCWA 4EGSA 4F6RB 3U4AA 1LNQA 1PEYA 1RJEA 2WWWA 2RHHA 3DOOA 2C83A 4N7RA 5FBQB 1M2OA 3ZQJA 1HDRA 1N1GA 4M8KA 2BGNA 3HI6A 3AUJB 4HX9A 3I12A 5BYAA 3Q2KA 4GI5A 4B44A 1OW3B 2F7SA 2D54A 2FUEA 4L74A 3THWB 1EU1A 1N7HA 3U40A 5J1SB 1U0BB 3RB8A 3UWPA 4YT4A 2X9LA 1JJ7A 5BW6B 3AEXA 2R6FA 5G0TA 1SKQA 3T1QA 4DTIA 4DZZA 2R7LA 3ICWA 3PJEA 3L8GA 1ORRA 3C4QA 3FLMA 4L50A 4BDTA 1MKYA 2G7MC 1XXHE 4LTNA 1UBRS 1H9AA 2X1VA 5EE3A 1TO2E 5EUBA 1MAVA 2OXRA 2NN3C 5DYYA 1G41A 1B8OA 3OZTA 3RU3A 5THKA 1L5WA 4D4IA 2J7PD 3KT0A 2BZ1A 1RRFA 4YAWA 2N1MA 4NV1A 4PX2A 3OEEA 1ONPA 2QNIA 4L2IB 1HE2A 4JYCA 4MR7B 1FDWA 2D5IA 1J7KA 4LG1A 3TAXA 3T5PA 5DGTA 2XZOA 5MGNA 3U4IA 1H9CA 1J0DA 1BXRB 1P75A 1HYBA 5B6JA 1RLOA 4HNAB 4AKHA 3N76A 2V9PA 3BK1A 3KB8A 2EX1A 5AW7A 1KK2A 3BEDA 5CH8A 2VP0A 3PV0A 3PXCX 2XCOA 2KWIA 2FUG6 3E9ZA 1MD9A 2DP4E 2OGWA 4PZEA 5AP9A 4FXPA 1JDBB 2YIJA 3NJ4A 3RD5A 1XVTA 1YZQA 5H83A 4DMCA 3NHKA 1W49A 4AZ0B 3M4NA 1U9CA 2XB4A 2NUAB 3HB4X 2FZ4A 3IOEA 5HF5A 1MTOA 3JD0A 3OQHA 1W8IA 3FKSD 3IQXA 2IOYA 1JJIA 2G1UA 1I5RA 3H8SA 1JQ3A 2AQ8A 3KT6A 4RPKA 3LUAA 4BNFA 1IL0A 4PRYA 1ZVJA 1KIMA 3M9XA 4OHKA 2YBDA 2C9CA 1RFGE 3DFMA 2Z0MA 1PE0A 2DHDA 4HH3C 1T1EA 1IN1A 3FTCA 3PS9A 3QOWA 4D3FA 5GZ3A 4EFMA 2QKYA 4Q21A 4HV4A 4IKOA 1DFHA 1QIJA 2XHEA 1C4XA 2ZRFA 4O4LF 3WJAA 4RJJA 1W5AA 5FAKA 3DT8A 1IK4A 1FTSA 1K6IA 3PTLA 2LKDA 3BERA 2H85A 4RJ2A 1E63A 1PK8A 4ZEWA 3PA8A 4A8JA 1ZWKA 2XVYA 4KJZA 2OOKA 3KT8A 4PRZA 2Q99A 3AONB 3R9XA 3B38A 3O84A 4XUCA 3PC8A 2HNBA 1IRIA 4CDMA 1F0PA 1PHPA 4KDCA 1DTWB 4F60A 3QUTA 2QD3A 3ZWXA 3O1JC 3QQPA 5M29A 1PZHA 1RZRA 2FU5C 1WV0A 3Q6NA 5DDIP 4YWJA 4DR4B 3AY0A 3OQIB 4NMLA 4AQYB 1CLEA 3DTVB 4X6UA 2A9PA 4E5VA 2O1EA 2WAMA 4FHEA 1NUAA 2HL6A 3P9NA 3AT1A 1DP4A 3A26A 3L40A 3TPZA 3PJRA 4GOKA 1B26A 5CAEB 5A4JA 5DBFA 3UB4A 3TAUA 5CK4A 5LYJA 2B4RO 5CX1B 3AEKB 3FCAA 4J76A 5JWHA 4TMWA 4IVRA 2O7QA 4OMDA 3CX6A 421PA 4C5AA 4EA9A 4YR9A 4GZ6A 1U0SY 7ABPA 1Y8CA 3GWGA 4EATA 3H9UA 4N12A 2HCTA 3HZZA 1B0UA 2C2MA 3RS7A 3ZDYB 4TOIA 3NBUA 3ZWYA 3M6IA 1LDGA 2XT9A 2Z3ZA 1YS4A 2EFCB 2J7KA 2WHQA 3OCVA 2OHJA 1IY0A 1GNSA 2W8ZA 2XGMA 2P11A 3JPWA 4EECA 4L4SA 1GDTA 2RGAA 1QNFA 5EFOA 2X2OA 3BSWA 1WP4A 3KUCA 1MABA 2O3QA 4ATNA 4JBLA 1O96A 5F9FA 1UXKA 2FJ0A 4NZNA 2ZB4A 1W76A 3EPPA 1DDGA 1RYZA 1O3YA 3E7DA 3PWKA 3UXMA 1U7UA 2H48A 3WNQA 4C4ZA 2PGAA 4BMZA 5IUNC 1JIXA 3UG6A 3ZHSA 6Q21A 3BH6A 2CV0A 3NC0C 4FEAA 2AEJA 1EUQA 2ACEA 3HS3A 4K0KB 1C41A 1VLHA 3IDOA 3QF4A 4BVLA 3D4BA 3ZIDA 4WGFA 4RO0A 1BMFA 4TSKA 1DUVG 4ESVA 1WF6A 1WV1A 2V7UA 2WYUA 1EHCA 2WHEA 3UA4A 2R4UA 4DNOA 5LQNA 4R2WA 3W6ZA 5AM4A 1DG9A 1A8PA 2BGTA 1YAHA 3GUHA 4R0NA 2A5DA 5EESA 2H29A 1K86A 2IKQA 2X2EA 2J5QA 3FNEA 3R5FA 4KE7A 2KPOA 3GCZA 3GRRA 4EUNA 3IDZA 1NUUA 1OIWA 3T0IA 1NNI1 1IBLB 2JJ1A 4ENSA 3IEXA 5DWDA 1P5RA 4UAGA 1IPHA 2H1FA 1UFOA 3FPHA 5AKGA 3M1LA 1P9WA 4Z99A 5CLJA 4EUEA 3FOCA 1RXUA 4OL0A 3M33A 1BHSA 3I2IA 3EOZA 2X0DA 2W43A 1XBTA 3H97A 1I36A 4YRQA 5AFSA 5JD3A 3C85A 3X2FA 5C81A 2YY6A 1TEXA 1SCBA 2H4FA 3N3BC 4EG3A 4H6VA 4K0RA 1LS1A 2H4YA 2PVPA 2Y1FA 3V1UA 3SI7A 3VOAA 2YHSA 3KR0A 1QP8A 4QEDA 1E6CA 4H4DA 4LE2A 5LOVF 1WKVA 3V3KA 3ZS9A 4DA0A 3AR2A 2IY8A 4YJ3F 4KHPB 1FCJA 1JZSA 3VHXA 3KV3O 1CHNA 2YY5A 4OHRA 3C41J 3WBBA 4MS1A 4Y3UA 1IVNA 2XJ4A 1TIPA 2WM9B 4YPFA 2FGKA 4B87A 1V41E 3KPUA 4N7BA 1JG1A 3QKSB 2QGNA 4NSNA 1HGXA 2I4TA 4US0R 3V4SA 1UAGA 2XWSA 4LX0A 4E2WA 1H2WA 2PGNA 2VHWA 2ZROA 1Q5PA 2X2FA 1NUPA 3DP9A 4UD6A 5EIFA 5KDLA 3GLFE 4JQZA 1FIUA 1OVGA 1UPCA 2CLMB 3DHVA 3EVCA 3INYA 3QU9A 4QPPA 3TMAA 4ZHQB 2YV4A 1FSGA 3C3CA 4TTAA 3U17A 2GCOB 1NLMA 4P3OA 3VNUA 3ZH9B 1N2OA 1GOTA 2ZCVA 4KXQA 3I9MA 4XWGA 2QRHA 3E5MA 4JJ7A 1I5OA 2BBSA 3SZMA 3OJCA 4KO4S 1CW2B 1KTVA 3NCTA 3FCCA 2DH5A 3HU2A 4KXWA 4UEQA 4WWHA 5AJHA 1P0FA 1VCIA 5AK0A 2P4QA 5DW0A 2FSPA 4JBHA 2Z58A 3E1KA 3QX7A 4RTPA 1I4DD 2EP8A 3V1LA 4LKOA 2QZ4A 3JQ9A 4DCTA 4ZCIA 1D03A 3ZBTA 3U1VA 2D0DA 3TJMA 1XDDA 1W4BA 3LIPA 2ZG6A 1FBNA 4UMEA 4N3BA 1RKXA 4C0LA 2E85A 3LVBA 3QFTA 3CJQA 4TT3D 3IPYA 1DKRA 1EVYA 1BEEA 3GOQA 4ZO7A 1E1YA 4KR6A 2A9QA 2H9YA 3R5KA 2D8AA 2OQVA 4RZHA 1SO8A 5J40A 4YV2A 3Q8KA 3HGMA 4R69A 3WXMA 3MT9A 1UT5A 1M3SA 2R8XA 2XE4A 2HM7A 3GJRA 4LY0A 5AHOA 2VRCA 4EYGA 5EVCA 5AMXA 3G49A 3SSOA 2QW0X 4R51A 4O2AB 2P2DA 3M2PA 4J49A 3EJWA 4IGEA 3SXPA 2UYQA 3KTAA 4AUNA 1CIJA 3RODA 2ALJA 4OI2A 3LYUA 2R1TA 3LQRA 4NEGA 4E5UA 1T0JB 2FZWA 4RFSA 1ZRMA 5SV2A 4KR7A 4HMOA 1DU4A 2HF9A 2AG6A 2FLVA 1NXSA 3ROXA 3CZ9A 1UBOS 1S6YA 2G8LA 4XD2A 3A1UA 2HA2A 4GOMD 3WMRA 1XZNA 2VBIA 5HE8A 4CKWB 3S68A 5IU6A 1FDTA 5KSOA 2HR1A 2JJ2A 4F96A 2R8RA 1EX1A 4QYXA 1FZQA 1WMSA 1H93A 3JTEA 5AJXA 2PZJA 1AOXA 4FMDF 1PKXA 4WNAB 2IELA 2C82A 2PKWA 3FCUB 4NATA 1SC1A 3HEAA 4OREX 1RHQA 4RMGA 1VZ2A 1JU4A 3L0BA 3LC1O 1DX4A 4HMQA 4YV1A 1N2ZA 2IS1A 4KVZA 3TEMA 2F17A 1JSXA 1K92A 1NXWA 2DVMA 1JHPA 1H94A 1HPLA 4XFJA 4D9MA 1V5IA 3CUEF 4JZYA 4LQDA 4C6RA 4CL0A 2GBGA 2JKZA 4QE3A 4Y9UA 3OZAA 2WP0A 5LVAA 3CFYA 1POWA 4PW0A 4X6LA 5AVKA 3RIHA 1GO2A 3STHA 4Q3LA 3UJ9A 3BX1A 4S2EA 5DMXA 5CNIA 1GV0A 1L4MA 3K05A 3ENQA 5DSTA 3V00A 2VC2B 1XTRA 4NCHA 2HA4A 2ERXA 2JAXA 1NIJA 2RJ3A 5CXXA 1P7YA 5KDDA 1FDIA 3Q0TA 3T7DA 1H1LB 3UMJA 1NBME 3ELYA 4E7PA 2O8CB 1IY9A 3VVBA 1FXSA 3QEKA 3PEYA 1GNTA 1MFZA 1Z2OX 3DUFB 1J2TA 2RBEA 3UB3A 16PKA 4S1TA 5FUVA 5LJLA 2X9VA 3O2SB 2LKCA 3TG8A 5CB4F 2BEWA 3OVMA 1OXTA 5K6AA 4QICA 1KEEB 4KLRA 4AD8A 4TROA 5AVWA 4OAPA 1JEAA 3IOBA 5JS1A 4V0QA 1KXJA 4W99A 3DE6X 1P9LA 1T36A 2AOTB 2B2XA 3KVNA 2VEDA 3SE0A 1Z5UA 2HT1A 1N1DA 1H85A 1WCXA 2OHGA 4H18A 4B46A 4PYMA 2ONZA 1CDOA 3FLAA 4TTQA 1WCWA 1GL9B 2QX9A 4UMDA 4LRTB 4RA6A 4D3SA 4JUIA 1TYDE 1TQ6A 3SE7A 2LIVA 3GRAA 4BEBA 5DNYB 3KDAA 3L8FA 3C8DA 1HWYA 2WHYA 4W8OA 3T6KA 1XRSB 4RTOA 5A4KA 4KQ6A 3EW7A 1THGA 1AQ6A 1CJKC 3HU5A 1KQPA 3LHIA 2OBBA 2WU3A 4KFRA 4KVAA 3JWPA 5JPDA 1Y8ZA 4I14A 1UDBA 5EWLB 3ZLUA 3DEYX 3B53X 1KDZA 1VLLA 1RMTA 1YD7A 1IBKB 5J4LA 2BRUA 3LUPA 2ZUUA 2AC4A 2AG0A 2FN7A 4Y8VA 4QYIA 3FHCB 3T1OA 3WGUA 4HDQB 1MA0A 3T5DA 4H2DA 5EHGA 4C4OA 2LV8A 5AVUA 3OOHA 2PGXA 4TMXA 2MYTA 2XDWA 2WU4A 1T2CA 3G1WA 2BJHA 2SICE 2GN0A 2FPMA 4YCAA 1A8UA 4KQXA 1W2WB 2GDJA 1IAVA 3H04A 4A0SA 3TBHA 1KEZA 2IK8A 2PA0A 3CH6A 1DWUA 3QEJA 3PPVA 4Y9SA 4YASA 3SHVA 3ZLBA 4ED9A 4EPXA 3A3NA 1W0CA 2XJ9A 2X0NA 2O48X 3BMQA 4N0MA 3ELUA 1PLLA 1AS2A 1U6JA 1QHSA 1T34A 1B1AA 3U56A 3OZIA 4G07A 1KK1A 4ZFNA 1MV8A 4P7JA 2LCFA 3I64A 4UHKA 4GWGA 5KX5A 1EFPA 1SA0B 4CKBB 3PC4A 1LH0A 1G8YA 5FWXA 4DHWA 3EC1A 1I32A 5NLLA 1Q6ZA 4K81B 1V48A 1H42A 1FYDA 1I33A 4BKMA 4E13A 3GVPA 1ZCAA 3FH0A 4D25A 1K97A 4M86A 2IHZA 1SRRA 2CNNA 4BLOA 3IV7A 1RWXA 1TD1A 1LDMA 3SM3A 4AP9A 5H3HA 4LHYA 4OSEA 1SBYA 1U3UA 3I3OA 4YVFA 3JQ7B 5EUCA 4Q7EA 1L8LA 4DBLE 4TLDA 3WYFA 3ZV5A 4HNQA 4BTLA 3K0AA 2C58A 3FW1A 4UE2A 1UJ5A 4DR1B 3ZCRA 2XNJA 3DXXA 3SM9A 3K0HA 4NCAA 3HCCA 1S1MA 4QLAA 2WWHA 1U63A 2H7YA 1U2TA 4JEHA 1MIOA 2IBTA 3CSSA 2D5LA 1I9CA 1XHFA 1XUOA 2BELA 2B5VA 2OUKA 2ZRJA 1N8KA 4GP6A 2EAUA 4XJSA 1CUEA 2H0QA 1Z63A 3I2HA 1NN5A 4WXPA 4WZ6A 3ZXUB 3ANTA 4UVIA 5HQTA 4PYIA 2Q5HA 2UDPA 2X6RA 1GZVA 4NRDA 2Z5GA 5FFNA 3GAFA 4D46A 4OK3A 4B85A 3QLUA 3MLEA 3RGWS 3L0YA 1P0IA 1LPBB 4RFLA 3IT1A 5JRJA 4JLWA 1KJIA 2OP1A 2QD4A 5F2EA 3UOWA 2GCEA 3R5JA 4JT9A 3NVDA 3ZY3A 4P4LA 1RI4A 4L4UA 4CE6A 3VH2A 3KEMA 1NFFA 1SXJE 2FMXA 2CFTA 3TCKA 3NWEA 3O8BA 1J42A 1Y1LA 4YJ2A 1ORTA 1XLUA 4J9VA 3U7IA 4C2BA 3ZGYA 2WM2A 4HTAA 4ZYWA 1F06A 3FSGD 3OF3A 4GICA 3SBOA 4AULA 2VA9A 3GNTA 2QPAA 1DBVO 3JASA 4CMIB 3FDZB 4ESHA 4HUTA 1HDIA 2EX0A 4MLDA 5H3LA 2QT1A 3AUYA 1OH8A 3OICA 5TE9A 3IELA 4JROA 3OEYA 1Q19A 1ZIDA 4FUTA 1PR4A 1JEQA 4J16C 3RC9A 3LPDA 3RC1A 4D56A 4K28A 2PMCA 2FN9A 1TFRA 1WY7A 3AQIA 2ILTA 3N8NA 4GECA 4HLUC 4KFTA 4Q1DA 2WSSA 5INTA 5BSMA 5KNBA 1POXA 1QZZA 2J6BA 5GAJA 4B31A 2YXLA 2ZBDA 1G8FA 5TMDA 1YB2A 3OQNA 5BRAA 2HDNB 3QG1A 3ZVNA 2LCIA 3AP2A 3DV2A 1QSGA 4DR7B 1C7RA 3NVAA 3RRZA 5H0IA 2JD2A 3EGXB 1N8NA 1P6XA 2V6FA 5DHQA 2SCUA 1RRGA 4U2KA 5DHSA 2XXAB 3H2JA 1FA9A 3UJ8A 1VPWA 1Y98A 5H5JA 4KXVA 3FTEA 5EMJA 4UXIA 1A76A 5EJ8A 3I01M 4JLNA 2WTNA 2Y8EA 5LNK6 1N2BA 3GHHA 2ZYVX 1RPAA 1A5AB 3VHRA 3WSVA 2B99A 2Z83A 4FNGA 4PAOA 4V3CA 3G17A 1MOQA 3II6X 2C8LA 1EX6A 1K06A 1V43A 1Q1AA 1ZM9A 2E6UX 3JD3A 4YREA 4BU1A 3H05A 1WB9A 3UJHA 2QJOA 2HYIC 1JDNA 1ODFA 1CP3A 4K3VA 1M5RA 1RQPA 1R6DA 1FC0A 1PL6A 2D5BA 4DA7A 1VG1A 4HDNB 2P6NA 4BN4A 4NXNB 2QQEA 3L7KA 5EJGA 1QYDA 3GXOA 2GKSA 4UUQA 1NN1A 1ZEMA 3PU6A 1UBLS 1D9XA 3DT6A 4OXQA 4BE7B 5JW6A 1BIFA 1I2MA 2Q27A 4HAWA 3TLGA 5ALPA 4Q4CA 3M3PA 5DM60 1OWOA 2GTPA 4CRWB 1MB3A 3HL0A 1ZAKA 4AL4A 3D3NA 2GSDA 3GPIA 2Z8YA 4WBNF 3VPXA 3E2PA 4JXXA 3KQWA 4P31A 1A4RA 3ABZA 1Z7BA 3PQ7A 1DPGA 2WYWA 4ZK2A 2ZSUA 3GLHE 3L8ZA 3RJTA 2YXBA 3ADPA 2QTGA 4P36A 3UNXA 4B6PA 4EJMA 3TQFA 2OSBA 3LCUA 1KDYA 1MQ8B 3WL8A 1XSEA 1Y1PA 5FB3A 2O8FA 5HUJA 4MYTA 1MOZA 3AR6A 4HQ0A 3WIEA 3WL7A 4F1WA 1L5QA 4U7HA 4BMDA 2QOEA 3TLMA 1OKKA 4Q9IA 3ESDA 4AG3A 4D9CA 1GRRA 1KO1A 1YAJA 4C6TB 3D3KA 1UP4A 3ONFA 1XALA 5LQAA 2UXCB 4OQ4A 3HCNA 5IS2A 3MJDA 3VO9A 1SKYB 3BM5A 4OLHA 3WDKA 2R8ZA 3PGJA 4NZPA 3NPAA 3A6EA 1QNLA 5IYZB 4Q3DA 3IB3A 3MSCA 4BLRA 2CK3D 2PZMA 3M1YA 3U81A 3LP6A 1D5WA 3CMMA 1ZD4A 3ZQ6A 1T0HB 4RL6A 1T4GA 4WZZA 1H2YA 1CB0A 1NVWQ 3IJPA 1GVNB 5LBUA 4MAFA 2XT6A 3A9UA 1TE2A 4R8KA 3LBAA 5T8KA 1B8NA 3WNZA 3SFVA 2JGEA 5TR9A 2C5EA 4Z1MD 5FEUA 2WOOA 2QAJA 3V97A 3F96A 4TQAA 4RJTA 1NBAA 2O5EA 1WCYA 1QVRA 2BMEA 2CHFA 3DZBA 4LDQA 3R76A 4REQA 5LYJF 4PPQA 1DEOA 2FUG1 1TCBA 4G9GA 3ZNQA 4DJJA 3QOXA 4HX5A 3FOFC 2FP3A 1ENOA 1HTTA 3IEUA 3MWYW 2H2AA 3BUSA 3IPXA 3PFBA 4LX8A 1HQDA 1X8LA 1G7CA 2AMFA 4XGKA 5CITA 4TV9B 4MS4A 3QQ5A 4LWZA 2YIVX 4XUGB 2GZ1A 3T7IA 4JXZA 3VAYA 1X7WA 1CR2A 3T1TA 3QZUA 2FZVA 3HUEA 3VYWA 2QTFA 1QUEA 2DQZA 4U2EA 4R1MA 4B33A 4PAQA 1JFTA 5CHYA 2Z04A 2FG7C 1RR6A 4Z8YA 3OCXA 5IAKA 2C7VA 3NOVA 3L82B 3TLAA 2C2HA 4O1MA 5IN5A 3DLAA 4G1FA 2JGKA 4HR7A 3WIBA 2OM2A 2FCAA 3R75A 4Q1CA 1PHRA 4JHLA 1W5TA 2F3PA 1H4TA 1KYYA 4B0OA 1SUCA 3ITDA 3LWNA 3O82A 2V0NA 1QGUB 3VV3A 1WQ1R 3BK2A 2V4MA 3I32A 3JARB 1XLVA 2P2ZA 3KPWA 3O8DA 1QTRA 4TSFD 4FGJA 1WSAA 2FK7A 2FXVA 4JBGA 4NFSA 2QPLA 1Y1RA 3T99A 2BFCB 3IVXA 1QMPA 1VB5A 3SBXA 1XZFA 4MR9A 4NYJQ 4OI4A 4Z4HA 2W8BB 1E2FA 3DSRA 4Q4AA 1FFGA 1QIIA 2BFMA 1X74A 3PEEA 4WN9A 2J9FB 2E4WA 4JT4A 1QE5A 1FU8A 1X1CA 4NOLA 3N2IA 5HPYB 5GVRA 5LZ9A 3OH8A 3B89A 5J5AA 4OOFA 3ODPA 1YNSA 1Z4NA 4XAQA 2EFHB 1CF9A 4LGMA 4U63A 3GPCA 4TPKA 5DO9A 4AJEA 1LBQA 3EZ2A 4JGIA 5DK6A 1IJEA 3D1JA 1E96A 2BTOA 4F85A 1HNXB 4L7VA 3NDIA 2AD5A 2D1FA 1WSWA 1R4AA 4UOZA 4WX2B 4R1TA 5DI3A 5FBHA 3WB2A 5GZ1A 3MG9A 3R44A 3RFUA 1C9DB 3E4CA 4F4HA 1DBPA 4QJ4A 1IZ0A 1JA1A 1R64A 3LDHA 3S1AB 4JI3B 4I99A 3V1MA 2IY9A 4GLBA 1PR5A 2I6UA 2DTEA 4O0MA 1E1DA 2V3WA 2WTXA 1W59A 1UPFA 2WSMA 1FTQA 3AW8A 3LDFA 1PJAA 1AHNA 4RPIA 5AESA 5K0EA 2BHNA 1MJ5A 4EHKA 2IW1A 1V26A 1E1NA 4N5IX 1KU6A 1AN0A 1RM4A 4PTLA 4PZUA 5K2OA 2AKEA 5BUSA 1ATZA 1SVOA 3MB5A 1JEOA 2Q0QA 1CJVC