5JNUA

Crystal structure of mouse low-molecular weight protein tyrosine phosphatase type a (lmptp-a) complexed with phosphate
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
153
structure length
153
Chain Sequence
GSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Diabetes reversal by inhibition of the low-molecular-weight tyrosine phosphatase.
pubmed doi rcsb
source organism Mus musculus
total genus 60
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jnuA00
2IOYA 2PKXA 4YGXB 2CHEA 2JB9A 1DC7A 2FLKA 3H6GA 1DBPA 3HM9A 2FMIA 3URMA 4Z0NA 3OO0A 2DRIA 3LKBA 3OO1A 2WJWA 3LTEA 5EWJA 2VUIB 2R4QA 4RK5A 3JPWA 1EWKA 1P2FA 2FW0A 1CHNA 4KVFA 2PE5A 2PUAA 3LOPA 1M2FA 5JS1A 1Z18A 1APBA 4PICA 3MA0A 5CHYA 4Z4CA 5IBQA 4MS1A 4S04A 1LBHA 3ILYA 4MQEB 3HDVA 2NT4A 1DRJA 2RDMA 3OLXA 3RVKA 5CNKA 3CNBA 3I45A 2WY2D 2VK2A 1GCGA 3GWGA 2MYUA 3MF4A 2VUHB 4LX8A 2WWVD 4EYKA 4YP9A 2RJNA 4YR7A 2PMCA 1AB6A 2IPMA 3HSYA 5IULC 2HJ9A 1L5ZA 3QLUC 2FQYA 4NQRA 3O1JC 3QEMB 4F12A 4RXTA 4QYMA 2N9UA 3O2QB 5BRAA 1TMYA 4MS4A 1ISSA 3DGFC 1CEYA 2YHAA 4XAQA 1FFGA 3GYBA 2QXYA 4RS3A 4TMYA 3HDGA 4TLLB 4NICA 1EAYA 1RXIA 1RZRA 1TLFA 4N0PA 3C3MA 2QVCA 4MR9B 5KQMA 3DZDA 5TQ0B 3I42A 1DCKA 2IPAB 1ZVVA 2PUCA 5FWYB 4NCAA 3LUCA 1P6UA 3LFTA 3HXMA 5TQJA 4OBBA 3QELB 3UK0A 2PL9A 3GRCA 4WT7A 4ETNA 4OLAA 4EYQA 3EQ2A 2JK1A 1DBQA 3O2JA 1EWTA 2NUBA 1D1PA 4WUTA 4D6XA 4RSMA 2FVYA 3HJFA 3T38A 1U2PA 4LE2A 1R8JA 4RK7A 4YV7A 3KYIB 3N6VA 4FE7A 4GNRA 1LJUA 1BVHA 4G0OA 3OLWA 5JNRA 4JB2A 3IPCA 1D5WA 3N0XA 1YMVA 4G0ZA 1ISRA 4EYGA 1QO0A 4MS3B 4MGEA 4G0QA 1YS7A 5JNUA 2HQBA 1SXGA 5TQ2B 3VNAA 3FFTA 4RXMA 4KPYA 2JVIA 3C97A 1LK0A 5FBHA 4EVRA 5EWJB 4RXUA 3BBLA 3NNSA 4EVQA 1QPZA 2PUEA 1ZH2A 3RVPA 5BQ3A 1BDIA 2QVGA 1K68A 1F51E 2TMYA 3EQZA 3EULA 3KG2A 3A3KA 4O5AA 4W5RA 3F73A 1M5UA 2FEPA 1RZRD 1Z15A 2B1JA 3QLVC 1JDNA 1QP7A 3LUHA 3H5WA 1MIHA 1YK0A 3LUDA 4DADA 2FN9A 3DLBA 2P9HA 4O1HA 4JASB 5GOTA 1ZAYA 1NXOA 1PEYA 3MIZA 3KCNA 5KQPA 3Q7TA 5FWYA 3H5IA 5C5EA 1YMUA 4QYWA 3KKEA 3LMKA 1JWLA 3BRSA 3E3MA 2E4YA 3KS9A 5KC9A 4IMJB 4XARA 4NCBA 4L85A 2IKSA 2O20A 3NNDA 1FQWA 2HQOA 4KMRA 1BA2A 1GUDA 4XASA 1M5TA 4F8JA 3CG4A 4MR8B 3EJWA 1YS6A 4MS4B 2A9RA 3CG0A 4JB0A 3N53A 1JDPA 2L18A 2E4VA 4YS6A 4Z4FA 3CKMA 3M9XA 4EY3A 4NV3A 4D6YA 4MS3A 2E4ZA 4F06A 1DC8A 3H75A 4Q7EA 5TQ2A 5HSGA 2F8TA 2YHBA 4TN5A 1P8AA 2LBPA 4IF4A 2M98A 1NXPA 4RY9A 3MM4A 1NATA 4UHJA 3QX8A 1JYFA 4ML3A 4YWHA 1Z17A 3FFXA 4HNRA 3H5LA 4P98A 4WXEA 1QMPA 4YCSA 3GT7A 3OLZA 2PUFA 4ZMSA 1K66A 3DGEC 3UUGA 5CNIA 3CTPA 3SM9A 2E4UA 6ABPA 5EWLA 2VYCA 5CNMA 4E7PA 2ZAYA 1SD5A 3TD9A 2QW1A 4YO7A 3IP5A 1J56A 4XFKA 3CLKA 4MPTA 1MVOA 2H0AA 3IDOA 1KGSA 2A9OA 3LKVA 1ABFA 2PAFA 2MSKA 2FLWA 3I5AA 3O2SB 5PNTA 3T95A 1GLGA 4N41A 5DTEA 3RVJA 3D02A 1C0EA 2FEKA 2OENG 4IMIB 5FWXA 5TE9A 2HQRA 3F6PA 2LUOA 3IPAA 4N03A 1ZESA 1E2BA 4MR8A 3CZ5A 4IILA 1BDHA 3I09A 1C4WA 3KYJB 1ZY2A 1MB0A 2Q5CA 2JVKA 2GI4A 1MAVA 1JFVA 1XHEA 1JX6A 2PLNA 4XXHA 4N47A 4ZYLA 5T7BA 1VPWA 2AYZA 1URPA 1NXXA 2MYPA 4GPAA 3BRQA 4S05A 3SQNA 4W5QA 5GQSA 4G0YA 5JNWA 2NT3A 1E6LA 4MR7A 2FSPA 1ABEA 1D4ZA 2FN8A 4MRMA 5FBKA 1JFSA 1QNLA 3QLVA 4EVSA 1H9CA 4WWHA 2KYRA 1KRXA 4MQFB 1ZN2A 3H1GA 3UKJA 5CNJA 5IC5A 2R48A 3QX9A 1ZGGA 5JNVA 3O75A 3CHYA 1DJMA 3N0RA 2FMKA 1MB3A 1DZ3A 4KK4A 3ROTA 3CU5A 2IDMA 1B00A 1I3CA 1Z2DA 2CWDA 2I6FA 3GV0A 9ABPA 3M6MD 4MLCA 3O1IC 2NZUG 1D2AA 1USIA 3JTEA 3N75A 4RY8A 3RH0A 1NY5A 2XDYA 2NZVG 2PUDA 1RXEA 2FEWB 5IUJC 4YLEA 5D2CA 4LE1A 1JFTA 1USKA 3ILHA 4KFCA 4QICA 2FQXA 3P9YA 3H1EA 4KQCA 4OLBA 3SY8A 7ABPA 4FE4A 1U2QA 1U8TA 1A2OA 4OTZA 2LIVA 4H3HB 1TM2A 5JNTA 4Q6WA 1AB5A 4IGAA 2JRLA 1PNRA 1RPJA 5B3JC 2W42A 1Z2EA 3G1WA 4ETIA 4LZLA 1D1QA 4PE5B 3HS3A 3NNNA 4W5NA 1E6MA 3RQIA 4RK6A 3IP9A 1HEYA 5JNSA 1GCAA 3HVRA 3OLVA 3KJXA 5HQJA 2MYTA 1EWVA 2AYXA 2PJUA 1PHRA 1WETA 3H5OA 2ID9A 2LPMA 3BREA 3EAFA 2QR3A 1QKKA 3QK7A 4KK3A 4KZKA 5EWLB 1JF8A 1F4VA 3MYYA 3N0WA 5TPZA 4MQFA 3FFWA 1M2EA 2IPLA 4G97A 2MSLA 1SRRA 5KWSA 4G0XA 3TMYA 3C3KA 3NBMA 3T8YA 2FMHA 3IP6A 1DBWA 3IP7A 4OG2A 3H5VA 5I4CA 4RY0A 1DCMA 5FWXB 1JH9A 3HZHA 2QSJA 3QLTA 4JP1A 3TO5A 5BRJA 4EGSA 4W5OA 4TLMB 5KC8A 3QLUA 1Z16A 1BDJA 1NXWA 3RVRA 3FGZA 8ABPA 3MQ4A 3ROFA 4Z4EA 3BILA 1FFSA 2P4UA 4OATA 1KRWA 3RVMA 1USGA 2H3HA 4DQDA 3KTOA 4MR7B 4RDCA 1QP4A 3LUAA 4MRMB 4FB4A 3RVOA 4RKQA 4MAAA 2MSWA 2WMYA 4ZMRA 4Z4GA 2JVJA 4MYRA 1ZHHA 4H60A 2R47A 3H1FA 1Z12A 3K4HA 2LP4Y 3N8IA 1YVUA 4H3KB 4Y9TA 4D74A 2IYNA 3Q9SA 1E6KA 1XWWA 4QPJC 5DKFA 3KHTA 2R25B 1A04A 5TPZD 4LRQA 1JYEA 2HSGA 1NTRA 5JS2A 1FSPA 4B09A 5DGCA 1LJLA 1ZDMA 3SNKA 1FFWA 2WRZA 4EUKA 2IPNA 3NHMA 4G0MA 4JA2A 2RGYA 3LUKA 4KRFA 3R0JA 1JLKA 5IUNC 3HEBA 4W5TA 4KQ9A 1EHCA 2A9PA 3GA5A 4Z4IA 4KV7A 2QU7A 3JPYA 4XLTA 4UHKA 2HPHA 2JBAB 5EWMA 4RWEA 2X7XA 2ID7A 2JCGA 3L49A 4N0QA 4EYOA 1DP4A 4G0PA 1T34A 1W9HA 3T6KA 3L6UA 1TVMA 4RU1A 3JY6A 5HKOA 3DLHA 5B3JA 1Z25A 3FDFA 2PL1A 3Q7RA 3KLNA 4MLDA 1OXBB 3EDCA 2FKAA 4YRZA 5BR1A 1DCFA 2FQWA 1PUXA 1A0OA 1DG9A 3OQOA 5KQGA 4RK0A 3HK2A 3Q41A 3CFYA 4P1ZA 3LUGA 5TPWA 3G85A 1U04A 2CD7A 1UDRA 3LUJA 3KLOA 4JOQA 1OXKB 4LDZA 3O74A 4RZSA 3SAJA 2CHFA 3CS3A 3TX6A 1VKRA 3S99A 6CHYA 4HNSA 4Q6BA 3OQMA 3LUFA 3DBIA 4ETMA 3JVIA 3KSMA 1QQAA 5DCLA 1QP0A 3RVNA 3GBVA 1S8NA 3CRNA 2FMFA 4DN6A 2PUBA 3JVDA 3SG0A 3C6QA 3GBPA 2FTKE 2MYNA 3HV2A 5ED4A 3M9WA 4RK1A 4LDAA 1JBEA 1SXHA 5DLEA 5HM6A 2B4AA 3OM0A 3JS5A 5IUKC 4N76A 1TJYA 3A0UA 4F11A 2JBAA 4PEVA 4CBVA 3HCWA 1QQBA 2L17A 4Z99A 1RNLA 4G86A 4MQEA 4WXMA 3RVQA 2WB4A 5C5CA 1JL3A 3MMNA 2E4XA 3QEKA 2QV0A 3EGCA 1Z13A 4PYRA 4WZZA 1ZITA 4Z4HA 3F6CA 3OLYA 4IRXA 3GL9A 3HUUA 4M88A 4RV5A 3A0RB 3CZCA 3VNBA 5IEJA 5IEBA 2ZWMA 2F8SA 3TB6A 3OM1A 4O1IA 1YK1A 3B2NA 1U0SY 1CYEA 1L5YA 2M1ZA 3QEMA 1XHFA 4L4UA 1ZH4A 2BGGA 5E3JA 2GBPA 1VRVA 3F7NA 3H6HA 3H5TA 4Z9AA 3RVLA 1LBIA 1VLZA 5KQLA 2V0NA 3OMWA 4LE0A 3RVSA 4ZPJA 4HYEA 5EWMB 5ABPA 2FXIA 2L19A 1EFAA 1Y1LA 3Q7SA 4HNQA 1SXIA 3Q15C 1PEAA 4MS1B 3O1HB 3W9SA 3OQNA 2A9QA 1DRKA 3E61A 1JHZA 1W25A 2J48A 2OQRA 1Z26A 4MR9A 4Z9BA 1P6QA 5F64A 5TQ0A 4F3TA 1KMIY 1NXSA 1NXVA 4PZ0A 3C3WA 4JAVC 5T3YA 2RJOA 3OMXA 2PUGA 1IIBA 2WJAA 3FMVA 5IX8A 3QELA 1PNTA 4ZJPA 1BAPA 4RK4A 2L2QA 4KNYA 3D8UA 1ZGZA 2GKGA 2GX6A 2QZJA 3NHZA 4KREA 1GUBA 2E4WA 5KI6A 3EODA 5TPWB 1YTUA 1YIOA 3HUTA 4E7OA 3HO1A 2GWRA 1NXTA 3O21A 3A10A 4RKRA 1QO0D 3K9CA
chains in the Genus database with same CATH superfamily
4KN6A 1XEAA 3FTNA 2X6TA 3OLQA 5EHGA 5F3DA 2J30A 1UIMA 3P9NA 4WKCA 5KTRA 4EB6A 3LM8A 3FYUC 4GL4A 3DHYA 3N7TA 3BBPA 3TQRA 1DGQA 1TIBA 4KH1A 5EMKA 1T5SA 4E32A 3EIEA 1EWKA 2V55B 3BRWD 5LP6B 4HBGA 1U0TA 1DPFA 1KAOA 1OT3A 3DYVA 6REQB 1ZVJA 1YRHA 2ZSIA 1ZNYA 5G41A 5TT0A 3KKPA 3D3QA 1TU3A 1N36B 2XZOA 2TECE 3EWAA 1HLPA 4UVDA 1F1JA 4FDVA 4MWSA 4F21A 4AI6A 1CQXA 1Q3HA 2P6MA 3MXTA 1XTPA 4BDTA 2ZTUA 1N2XA 3ZLUA 1LPAB 2UYHA 1P7WA 3ZVMA 1KVSA 4KI7A 2QN7A 3SKXA 1SR8A 2GRJA 4ENTA 5K0FA 1TTTA 5K4AA 3HEMA 5DNVA 3UAXA 4YP9A 3RNOA 4R8SA 1PR3A 4OXNA 4ZAFA 1U8FO 1C8BA 4H16A 4Q5IA 5DIZA 4PFQA 3B9QA 2Q9AA 4DE5A 2CUTA 1HK7A 1NN5A 1Z6QA 2V6IA 2WTMA 4L5YA 4IVRA 4DRZA 2WD9A 3HY3A 1N1EA 3HRKA 3OJFA 2BN4A 4JH0A 2PANA 5HZHA 5D6NA 4DMCA 3PC6A 2H08A 5BRAA 1R0CA 3G2PA 4XQGA 4C7VA 1TUEA 2HUNA 1Q20A 1JDBC 4JSYA 2H59A 5IAAA 2XQKA 4Y2RA 1ZYUA 1P2GA 2C3MA 4X5OA 4AS1A 2O2HA 1EB9A 2OFOA 4Y7DA 2Y6UA 5AK6A 1K7CA 1JJFA 1OROA 1OW3B 1RXIA 3ZWXA 1TLFA 3OHPA 3HI6A 5EAIA 4D9FA 4NY1A 4PTYA 2AWNA 5DSZA 3DEJA 1WDWB 1X15A 3LG2A 3M81A 4MR9B 5TQ0B 3SE0A 3UGTA 3CEJA 4WDQA 3ZI0A 1UJCA 1CCWA 3DNMA 1T8RA 1WOYA 4KLCA 3ZU4A 2DWQA 1ICEA 2ZWPA 1WULS 3K0AA 3L0SA 1XR3A 4FONA 5DDIP 1P72A 5CA0A 4OHPA 3EG9A 3U9TA 3K70D 1K9SA 4KAFA 4EYQA 4WBXC 4X71A 4WL0A 3JWGA 4RWZA 2ZSUA 1XRMA 4CIAA 2YN2A 4DDVA 2HRQA 1K6JA 1ZCFA 2AVNA 4KQ2A 1MUUA 3MRVA 4RA9B 4U2BA 3T38A 4CPDA 4YX9A 4HNUA 1IOVA 4RKEA 4TSFA 4UAGA 1C1XB 5DLYA 1EFDN 1U8XX 1JU3A 2GRUA 2QYOA 4X8OA 4E11A 5KYKA 1IBLB 5JXHA 4AJNA 3HLTA 3GCGA 4GE0A 4V1CB 1NRXA 3NKFA 2BL4A 3H86A 3JQBA 2EJWA 1E2QA 1X80A 6NULA 1C81A 1L5OA 1Z4MA 1XL1A 4B6JA 4OX9B 3GVPA 2JAXA 3R44A 4FHCA 4EVRA 4KXYA 2NO1A 1K5HA 4HOYA 4URUR 5EWJB 3BBLA 2BSQA 1GGVA 2VHZA 4HRVA 3PXAA 1DAEA 3D0RA 5BQ3A 2EJBA 1EQ2A 3A4YA 4MDEA 1OD6A 2DBYA 1TX4B 4UM9D 2REOA 1NNUA 3SM3A 4D2IA 2JL1A 4PGFA 3PF8A 1M8KA 4HDKB 2ARKA 3PPWA 5LBTA 3S2GA 1RZRD 3DEKA 4HNTA 1LI4A 1U9ZA 2XMGA 3EJ6A 2A7QA 2FN9A 5ALTA 2WQZA 4FMDF 5T64A 1PEYA 1TF7A 2H1RA 3TPFA 4A0HA 2Q3BA 4OFWA 3O95A 1XCOA 4O0LA 4UTXA 3H9BA 1NQXA 5E7QA 2XEDA 4M1TA 3H2BA 5DMHA 2OBBA 3K6KA 3LMKA 1CJUC 3NRJA 3VYUB 2GZ1A 4AD8A 5KOHA 1ID8A 2Y2UA 2CD9A 2Z8ZA 3CUUA 3PGKA 1NWCA 3V4RA 1L4MA 4D96A 4TTVA 3SP1A 1TC2A 3JWJA 5BV1A 1FRQA 4BB9A 1P7VA 3LPDA 4B6GA 3BWVA 1IVSA 2J6HA 3ETDA 3PTLA 5BW6B 3GLKA 3JQ9C 3ZDYB 3M70A 4KITB 2P79A 3CG0A 1R50A 4PQEA 5CB6A 2DQZA 4X65B 2HBQA 4H0FA 2IXEA 2Z43A 3PVSA 4LJLA 3KQPA 3CKMA 1MX5A 1TD1A 4MVJF 4YJGA 4BE7B 1RIIA 3A14A 1GUZA 3M7IA 3EZLA 4FYWA 2BV3A 4J07A 1YCDA 4PYOA 1D1TA 4NCKA 2JJ2A 3NAGA 1ENZA 3GPLA 5D01A 1UMDA 1J2YA 4WH0A 5M34A 5MN4A 2EJCA 2XCLA 3IAM1 3PRKE 4QUJA 1CNMA 2KMLA 1YTLA 1JYFA 3MGAA 1G18A 2VXYA 3DSRA 4DLWA 5LPNA 1PLJA 1SD1A 1ND6A 1PG2A 1RXYA 4TLAA 1H9AA 1R0KA 4QWWA 1R2QA 4RAOA 1LW7A 4JT9A 2NVWA 3FNHA 3RW9A 4CM1A 2IYZA 5DRTA 1R6UA 1JB1A 4NFSA 5E1DA 4LFAB 1L3CA 4TMTA 4NBSA 4DC0A 1HQYE 3ZXIA 2R8PA 1H6DA 1JQJC 4PRKA 3PVCA 1OLXA 2G8LA 4P4SB 4D3FA 4TTAA 4BO1A 2FZGA 2VYCA 1E32A 4E7PA 4HCJA 4DCJA 3VHQA 2QK4A 2QR5A 2QW1A 2IHJA 5COAA 1IXZA 1Q22A 2G88A 2AN3A 2WICA 3PQ5A 2ZBDA 4J91A 3L6DA 4MIEA 3A6GA 3RUDA 3OTGA 2B5WA 3E9YA 5GOZA 1QRUA 2QG6A 3PYLA 5FT9A 4MV4A 2FZWA 4WLFA 4NG4A 1ZQ1A 1ADYA 3F6PA 3MWLA 2OYRA 4X64B 4I1UA 2C3YA 4GGPA 4U6SA 4R2MA 1EVQA 1YDFA 2FN4A 3AESA 1E9SA 3E70C 5AXAA 1U8EA 1I30A 3KSDO 4D4KA 4MIKA 4LZJA 1OR8A 3E81A 1X1AA 1NXXA 4Y30A 1JHVA 3TZ6A 2Z56A 2WPDA 3NGXA 3RIMA 1VCNA 1TJ5A 2H16A 1E2GA 2GM3A 3IFSA 4IO0A 4F04A 5KREA 2WWFA 1R8QA 4F9EA 3HCCA 2ZUSA 3JQFA 4JQZA 4WERA 5DW0A 3UAYA 4EVSA 3I05A 3BIXA 3IEMA 4DN6A 2YFQA 3K73O 2CL5A 1HZZC 4KO1S 3IKMB 3R1IA 1OIXA 3QX9A 4RW0A 3KLBA 4A0QA 2C5HA 1K75A 1NQ5A 2GCOA 2X40A 1MO2A 4JI5B 2QTVA 3HJGA 2YRFA 1CUWA 3UMVA 2D06A 4LAFA 4DJ5X 1NNI1 2OBMA 2GDJA 2VRCD 3R40A 2BEVA 4K8OA 2F1IA 2YTZA 1A9PA 1Q50A 3H5RA 1NX6A 5E6RB 4AJKA 1ISPA 1I24A 2X1MA 3OU6A 4M86A 3EVFA 4AZSA 3TOVA 4KWEA 1BQEA 4NLLA 5ESXA 4B9AA 3CWCA 2UKDA 3CLSC 1T3TA 3QKRB 2B7CA 4ND5A 4RGYA 4X44A 5DHRA 3QA3E 4ZA2A 3TOXA 1D9XA 1MAAA 1ZOIA 4QICA 2BKUA 1XVTA 3ZOKA 2JLWA 1IK4A 4KQCA 5HRCA 3V4PB 4OLBA 3LPAA 3E9QA 1F5NA 1Q1BA 2REXB 3FCYA 3IT2A 5AM0A 2LIVA 1L8XA 1KZHA 1K08A 2EFDB 3NHRA 1WB9A 3CLTD 2R97A 3W4IA 3W6NA 1L4EA 2HT1A 4Z7OB 4ZI2A 2VNHA 3D8NA 4PE5B 4BZPA 3T5AA 4KYIB 5JSFA 3B5EA 1C7QA 1PTKA 3FLMA 4JSTA 2A0XA 4YP5A 5AW0A 1L5VA 3C3DA 3OLVA 1OGIA 3KVYA 4X7RA 3S1LA 5E1BA 4CEHB 2ATXA 3KTAA 1U81A 4DPLA 4BP9A 4XIJA 3VTAA 1Z4IA 3RM3A 3VSAA 2V9CA 4GZMA 1ENPA 5HJ2A 1IBSA 4EKDA 4V0KA 4FYKA 4PG8A 1Z5UA 4AKEA 1FFYA 3BULA 2ZKIA 1ZM9A 2DG2A 5KWSA 1AS3A 2HHJA 2NUPA 4NZ9A 2D54A 4BKUA 3JAWA 3M1AA 2GZSA 4IWNA 4K46A 2XMSA 3SU8A 4FWTA 5HRAA 3H5VA 3GHHA 3N8HA 5DLPA 4O4HF 1DCMA 3DF9A 2Y99A 1K63A 5BRJA 3IUNA 4JYZA 4XWGA 3OIWA 1Y9EA 4IX9A 4UUQA 1BWSA 1OFHA 4DA7A 4ZVLA 3LDAA 1NIJA 4IKPA 1ZD2P 2XMCA 3CUWA 2RAFA 1VJCA 2XVMA 1R0ZA 2O4UX 5DBIA 1CY1A 3ZLBA 1EBUA 1T0JB 2LDXA 2GJ8A 3QPDA 4KKVA 5CR9A 3VH1A 2J3QA 1XMXA 4CNQA 1NVEA 3BFXA 2ZTHA 3DCIA 4AJLA 2EKQA 4FSDA 4PS1A 3ZG6A 4C7OA 4GG1A 2GOYA 2B8JA 5I9NA 4H60A 3IQHX 2X42A 4AZTA 3L43A 3L8ZA 5IF9A 5E0OA 1DTSA 1QFMA 4M0KA 3H8SA 4OIMA 1IY0A 1TPZA 4P4TA 1XEWX 1X7DA 4G1EB 1ORHA 3Q9SA 1LK5A 4F9GA 3CR8A 4LQLA 3ZKAA 3L6BA 2AN1A 1CVIA 2Y0CA 4TMWA 1JYEA 2VH1A 4Q47A 3D8HA 1LLCA 1NA5A 3JVUA 2PGNA 3SC4A 3ZHOA 3ZHTA 4EMUA 1CUAA 2P90A 1NL3A 4RABA 5FPHA 3MGKA 4BFZA 5C3UA 3O4IA 5GGXA 1JXMA 4LBWA 1YBAA 2E0IA 4G0MA 1VRCA 2NP7A 2E1RA 1XWFA 4JYBA 3KL4A 5C1PA 3R23A 5GZ6A 3L9WA 1WCXA 3N0VA 4I50F 1ZI8A 1C3OB 5ULLA 4ZEWA 1BS9A 1R0RE 1R0BA 4YROA 4FUQA 1PR4A 2V3WA 1BNCA 1VCHA 2A94A 3FHOA 3R7WA 2JW5A 3D3JA 3F7MA 4YK7A 2X8BA 1OWOA 2IHYA 5CM8B 5KVSA 1DP4A 1JIQA 3V8MA 3WBBA 4QG7A 2YXNA 4J1NA 3DZFA 1FYDA 1V6CA 2WWIA 4KEAA 3KALA 3TGPA 1AIPA 2BVNA 2PZKA 4ZCSA 2L82A 2XQGA 3AQIA 3KLNA 4GPZA 1II0A 2K7FA 2FKAA 3GLGA 5IN5A 3KHKA 2F59A 1D4AA 4YXWA 3KE8A 5AVYA 3R74A 3LP8A 4LQ4A 3T5CA 1E5XA 1HE8B 4G4JA 1L7XA 5E7JA 1UJ2A 1PWYE 3UV6A 4DLAA 4UNPA 4P0TA 3W5BA 4JXKA 3MCAA 4MV1A 5CVEA 4HX2A 3T3OA 1A98A 1E1CB 3PBKA 3A6EA 3DZCA 5EL0A 4MICA 2AEMA 2YZGA 3RARA 4B6PA 4F5YA 1GV1A 5BMVF 1KMCA 4DQXA 4FGKA 4O4IA 2RGNA 3T7KA 1GR0A 4PM4A 5J4VA 2DPLA 2O6HA 3IIIA 1RE1A 3F4LA 5J2UB 3LFHA 3NHKA 3PWZA 3RVNA 4MIOA 3HACA 4EHJA 1PF7E 4QJBA 1Q12A 4A0RA 1KMNA 2WUFA 3GGDA 1TCBA 3HV2A 5EQTA 5KNBD 5JXJA 4V0MA 4F91B 1FRZA 1U3FA 3D54D 2X3UA 4HZUB 4GMDA 2ZT6A 3AR3A 3LVQE 4ZQEA 4ZANA 4DCVA 4B48A 3B82A 4KQJA 1ZVKA 4XVQA 1PU2A 2WEKA 2BELA 2PZGA 5HG0A 3J80A 3QNUA 3R6GA 3Q5EA 4PYMA 3R7LA 1ADBA 1MBZA 3VGPA 1JPUA 3EBOA 5HYVA 1CIJA 3AHFA 5JPCA 4TRRA 2V03A 1DKUA 3TG8A 1B8NA 1FSZA 4WXMA 4AECA 5HM8A 5CPBA 2JHGA 1NNEA 2JLAA 3DVQX 1DKMA 4MDYA 8AT1A 2ZJ0A 3EDOA 4ARVA 4F2PA 2VHYA 3KYCA 4R54A 4JEHA 3RYTC 5TRTA 3NC0C 4HDRA 4RZHA 4YRGA 3BD6A 3BWDD 5BOVA 1C2YA 2Z5VA 4HNGA 4P08A 3WL3A 7AT1A 4CKWA 5DGDA 3I2FA 1CBUA 1NVWQ 1PFWA 2C2OA 2VYVA 3A1UA 2JD2A 4JKIA 5JCXA 2PWYA 3KJGA 1RYBA 4RESA 1CFZA 2QRQA 1G4AE 2GBPA 1C4XA 4C6HA 2IBTA 4DLKA 3PZRA 1NM5A 3KAQA 4EJ2A 3EE6A 2W2PA 1KA9H 4MKXA 3HU2A 3P9KA 4QWMA 5E4TA 5C8DA 2FXIA 1ZNXA 3VOBA 3WGYA 3QEBZ 3USCS 5KX5B 4RS4A 2V8BA 2CDRA 3RKUA 1ZMOA 1T8WA 2WC1A 1WY7A 3ILVA 5AJZA 4DQUA 5JVDA 1BE1A 2ONKA 5H4HA 1DT3A 1QGUA 1WHTB 3IVMA 5F64A 3T3IA 4HVLA 5LSAA 4NXNB 5F9FA 2XGOA 2CKDA 4V0LA 1MTZA 1W4LA 3WIBA 2QRVA 2JCXA 4OO3A 5C37A 5KYUB 1OJLA 3FMVA 1EXVA 3KT8A 1S9DA 3DPSA 5I9LA 1X7ZB 4OYYA 4R69A 3QZUA 4JFAA 1F7VA 2QZJA 3HFGA 2FSFA 4YR9A 3AI7A 3GWZA 1S2NA 3KZMA 3RAFC 3UVEA 3A4TA 4PANA 2G71A 3I6QA 4PZ9A 3GVCA 2SICE 5TPWB 1YIOA 2JBWA 2VLBA 2PUTA 3P27A 1JU9A 2VHVA 1PI3A 1KJ9A 1ZRHA 2EQ5A 3JQBC 4KSYA 4NAHA 4RKRA 5DO9A 1GLVA 2A59A 3RFVA 3UHPA 1P2VA 4CKEB 4JLKA 2OTCA 4ITVA 3M5CA 2UUPA 5DWDA 4JXJA 4AP5A 1SC9A 3R6TA 3FGPA 1I4OA 1XE3A 2IT1A 2X7HA 4Q4HA 1UBMS 1H0RA 2P67A 3BE6A 1UADA 1HI9A 5TF4A 3H9JA 4PV7A 2VUIB 3AEXA 2A30A 5G0WA 4I1SA 2PRJA 4KVFA 4L9SA 1O87A 2AFIE 2BFDA 5AESA 3OAAA 1Z18A 1UJBA 2DXIA 1H2AS 1G3MA 3M6FA 4QGAA 1X8JA 2PGLA 721PA 3GLFA 1SHKA 3VNVA 4NDZA 4CCWA 2OGZA 2IOHA 5IBCA 3ZCSA 2HY7A 3UH0A 1PJRA 3L4BC 4GDFA 2YBEA 4DVJA 4A1OA 4C30A 3RRNA 4YCMA 1WCIB 4NZMA 3R4CA 4YP6A 1YQWA 4YDSA 2WLTA 2H1FA 2PUJA 2FB9A 4LGVA 3RSOA 4EX6A 4I8IA 3ZK8A 5IWAB 3VDMA 5K7SA 4BEWA 4TYNA 4ZOBA 3G13A 1NYTA 3A6ZA 4L16A 4KXNA 2AJ8A 1Y1TA 2QZPA 4HG2A 4Y6OA 2F62A 2HJ9A 3FMPB 4OLHA 1G8FA 3L4JA 3G2OA 4UHCA 2HK8A 3QEMB 1AZWA 1HE5A 3PGLA 4IICA 1OBCA 3DAYA 3TDMA 3U61B 3LQ1A 4E31A 3RGWS 1WZNA 2RBEA 4XPZA 3AGPA 1Y7IA 2VOJA 4UMDA 3EZXA 5BN5A 1ZM4A 5BW5A 4IW3B 3TQHA 2ZUFA 1PQ4A 1YFZA 1G8KA 2XJ4A 4L2IA 3PG5A 1MQ9A 1EAYA 2OV4A 3NR2A 3QUSA 5A2GA 4ER5A 5JUWA 3ZDDA 1FTGA 2X3YA 3HBAA 4TPKA 3DZDA 2AR7A 5FWYB 1P9WA 3VH2A 4BIMA 1MOSA 1R0YA 1P6UA 1IHXA 4TL7A 1ZKMA 4FDLA 3PPIA 4QE3A 1JBQA 4Y1EA 3SYKA 3OIYA 3VM6A 4A8TA 3TX2A 3JZFA 2QPLA 2PL9A 4WT7A 1V35A 1FP1D 4HVCA 3RYIA 2COUA 4PFSA 1DIOB 1H2FA 4GPEA 1C8LA 2V4UA 3JALB 5CUQA 5D5PA 1PUJA 4BWVA 1ULTA 1W7AA 2PZLA 3BMOA 1TVCA 2G04A 2ZSEA 2Q3LA 4FW9A 1Y6JA 1LUAA 1A4UA 1P0IA 2BCGY 2X5OA 1LBTA 1U3GA 3IBCA 4UMFA 1N6IA 1EUCA 5DIFA 2FW8A 3ZYCA 4IH1A 3GJ8A 1UT8A 1M1ZA 2AE1A 3UTDA 3LC2O 1U8ZA 2XT0A 3AUUA 4R1OA 3CZ9A 4F93B 4DRYA 4FYMA 1LCIA 1F6BA 2C31A 3LCVB 2IEGA 1WXIA 2J32A 2WHXA 3QFSA 4RXUA 1QPZA 4W63A 2XT6A 5LIPA 1BDIA 2QVGA 3F5FA 2AD1A 3Q5GA 3WHKA 1AQIA 1ZNZA 1LK7A 2E6KA 2TMYA 2W43A 3QWFA 1P0PA 3BTOA 3JQFC 5K6RA 1H2YA 4JUDX 3T3HA 2H07A 2RC6A 1C8KA 3SHQA 3E7WA 5EZYA 3QQPA 2CL7X 3FNFA 3H1PA 5EQFA 2P9HA 5J23A 1LEHA 1EP9A 3HB7A 1NXOA 4FFVA 3LBIA 3RS5A 4JQOA 4MPRA 5CJ2A 1U9JA 5DM0A 4QBHA 1NZJA 1YMUA 4QYWA 4XB2A 1UBKS 2HLNA 3HBFA 3LWDA 4BQNA 1C14A 4GGMX 4AKHA 1PJ8A 3VSEA 2QLFA 1E18A 1XK6A 2HK7A 3RHSA 2BH2A 5BMOA 1BVUA 1FQWA 1GZ3A 4FE3A 5HMLA 1BA2A 1L7MA 3PC8A 2I5PO 3SJCA 1IATA 3M82A 4CQLA 1U7PA 5KVCA 2XMRA 2EDCA 1EFHA 2O3QA 4L76A 4Y2GA 2A9RA 5KDOA 1UANA 4Q9JA 2H9YA 2H0QA 3V1YA 3BAZA 5BOSB 1X2EA 3L0IB 3KD3A 4IUCS 3WLEA 1RVV1 4GC5A 1WDTA 1G3IA 2GXQA 2JIOA 4I36A 4OF4A 4X20A 2XHZA 3V1KA 1U7UA 1Z28A 3AVTA 1N7HA 5IJZA 5AHRA 1DELA 3ZWYA 2DECA 2FU5C 1VDZA 4TUYB 3UG7A 4RY9A 1SIWA 1PS0A 2ERCA 2H7VA 3PJEA 1R8XA 5CH5A 2V7WA 4H7IA 3KJEA 4HNRA 4AICA 2QN9A 2E85A 1CHDA 3KQQA 4WXEA 4QL3A 3HDTA 2XYGA 1BW9B 3NC1C 3OU2A 1K86A 3IEPA 3K2QA 1RC8A 5L4SA 2FH5B 1T2FA 5GINE 1AUXA 2RGCA 4IGKA 3T52A 1D2NA 4ZHQF 5CNMA 4ARUA 3DE1X 4CRWB 3ET5A 3W79A 2QY6A 1XA0A 1BCRB 4E4TA 4CTJA 1D03A 3GDWA 4RJTA 4WLNA 4LK3A 3FHJA 2ATEA 1VLJA 3ZOZA 1XKLA 3E7DA 1R18A 3EGIA 1E1QA 3LKVA 1Y7PA 1BQ3A 1PZMA 1RLOA 1Y1RA 2O3RA 2WIJA 4L0QA 5KAMA 4BFCA 1J39A 1CETA 1XFAA 3DAGA 2D7JA 4F4UA 1DTWA 1RQRA 2AJCA 1KZ7B 3RVJA 2JIBA 2QNIA 5CCDA 4KDEA 3AR9A 3ROZA 1Y5IA 1FS4A 1O03A 1NW9B 4P2BA 1RJ9B 5CVDA 3SE7A 1W0JD 4RHYA 2FMXA 5AW3A 3OZIA 2JFPA 2PLNA 4JU8A 4X7PA 2FR0A 3F2VA 1UFOA 3FYUB 1JYSA 1OBFO 4NU6A 3ENNA 2VZ0A 2G76A 1MO3A 3GRYA 5IHXA 3NWBA 1QV7A 2GTIA 2MYPA 3BKXA 3C3BA 4U7FA 3MTIA 3AH8A 4HQLA 4K03A 4MV0A 3E9DA 4Y98A 3RC2A 5HIIA 1CZNA 2NTNA 5FR1A 1Y4AE 3GFOA 2YWJA 3RLIA 1YUNA 4LJ7A 4JUAA 2VDQB 5FBKA 3OJXA 5LDGA 5G1OA 2J46A 4BV2A 4DYHA 1Z6TA 5AW1A 5LXTA 3JQGA 4H4CA 2JGDB 1OU4A 1VI2A 4Q9DA 3DKVA 4XVUA 4QYTA 1UBHS 4FWBA 5ENZA 5E2BA 3N0RA 1PE0A 2V7QD 2BFBB 4GICA 4KFRA 4QUBA 1DZ3A 4GWGA 1K5GA 2H6EA 1ZW1A 3CZMA 3KZXA 2UVQA 1GTMA 1XCJA 3KUKA 4DMMA 3NHUA 1QX3A 2XF8A 3M6MD 4MLCA 3P9IA 3SF8A 3ZV4A 1N3LA 5D5QA 3B1WA 2NZUG 1ECPA 1JEAA 2R1VB 4QAQA 2G36A 5A71A 1N7GA 1NYQA 2X19A 3B70A 5HWSA 1T2AA 2E1PA 1C5KA 2CDAA 1MC5A 3VPFA 4CMIA 2IDKA 4M1QA 2UZ3A 2X2FA 5BUSA 4UD2A 4DC9A 4LX0A 4RPLA 4ZCTA 4HH3C 2VRBA 2Q1WA 3S68A 2V98A 2C4VA 3OTIA 1OH6A 2CMKA 3P0FA 5C4GB 1LDMA 1TYAE 2IUEA 1T25A 4Q4DA 1JDBB 1PQUA 4DS3A 1PFKA 1Y1PA 2HEGA 2QLNA 1OYYA 4R4JA 4OHVA 1VB5A 5AW7A 4INOA 2Q49A 4MULA 1YRQA 1Y8RA 3NKVA 1TMKA 4GI5A 2J3LA 4UOEA 4LZLA 3OQPA 1XN4A 1KAEA 4XJVA 2D1RA 4YACA 4EMSA 2NZWA 4I9NA 1HEYA 3OSUA 1IN5A 1TM1E 1ANKA 5J58A 2JI6A 4O4LB 1K89A 1N8NA 3G5LA 4WPGA 1LDGA 2AYXA 4A03A 4CTNA 4RIIA 1KQPA 2RH9B 1QIJA 2NP6A 1RM4A 1SUCA 2AOXA 1X39A 2FSVA 1T9GR 2CXNA 4CMAA 4WACA 1ZCBA 4GYKA 4D9CA 2WTNA 3NEJA 1KZ4A 5GP1A 5EPOA 2C1XA 2WZQA 2P9FA 2O2SA 3KT0A 4S24A 5FI5A 5LZ8A 4HEQA 5BPFA 1G5HA 3DVLA 3ONDA 3LTNC 5I8PA 3SF0A 1VKZA 2WJHA 3BCSA 3WWZA 4QBTA 4ZGBA 1NW8A 1Q2UA 1X42A 3SKVA 4NDAA 5JFGA 1T3LA 4P5EA 2AOUB 5DEOA 2OLJA 4YI5A 5K51A 1ZFNA 1JIKA 3FSGA 3WQSB 4D43A 2P0AA 3GAMA 3ZGNA 1G98A 2JAWA 3A05A 1SUAA 1WXXA 2LKCA 4X7MA 2FWBA 3BILA 5JO0A 2QLMA 1LTKA 4KRGA 4RFLA 4OXXA 3H1AA 2OEPA 1T1JA 2GERA 4QOJA 2CDCA 4DQDA 2C7OA 3KWJA 2HEIA 1OYWA 4H0CA 1W85A 1WAMA 4LDJA 1IOWA 2AKYA 1E62A 4UUAA 2Z08A 4YMSA 3AF5A 3TW6A 2ZRDA 2YIVX 4Q7MB 5HIJA 3PQCA 1EH5A 5CFMA 2FPWA 2PD4A 4DV4B 2R84A 2GCIA 3S29A 3D81A 3PNPA 2A58A 1NPTO 2W9XA 4H3KB 4R98A 2ZR7A 1WXHA 2WK1A 1E64A 4PX2A 4CE6A 4EENA 5FOTA 3T7CA 5BNZA 1WTCA 4KHPB 5I7AA 3FPJA 1DRUA 2Y05A 3NU1A 4Q7LA 4UBOA 5JWHA 4F7DA 5LKRA 2IQ5A 3FPLA 4FNAA 3QTBA 3UNXA 2QUJA 5AVOA 5JIBA 1RKUA 1GPH1 5C5DA 3QBVA 4KQKA 1SWVA 3HDQA 1GUFA 4G67A 4F2DA 4M0FA 2ZSDA 4IAOA 4XD7A 3CPJB 3R0JA 4N48A 4L6AA 1GRNA 3QUQA 1GD1O 2OBFA 3E35A 2WAAA 1CR4A 2P0YA 3PGA1 2QG9A 1Q57A 3IE1A 4XLTA 3IUBA 1L5NA 4Q1FA 2X7XA 1W44A 4UMVA 2AXPA 1OYOA 2C4KA 1KJJA 3B20A 3VU1A 2GB4A 1L4NA 1F0NA 3VPXA 2PTHA 1TQ8A 5THXA 1YFJA 4S3MA 2GJAA 1QH8A 5EQDA 5TXGA 1Y33E 1M2VA 1GAWA 3HXPA 4QYIB 4UCFA 1FSSA 3WKAA 4RU1A 4F3NA 2PXAA 2GPAA 1VXRA 2AOTA 1EWYA 1RWPA 3ETLA 5ALSA 4ER7A 2NQTA 2J9XB 3UMRA 1QO9A 1N25A 1WXDA 3EDCA 3FUXA 1FF9A 4X00A 3SHVA 5BR1A 2FQWA 3V8PA 9LDBA 2BGWA 4IQ8A 1HNZB 1G5PA 4NNOA 1GCUA 1O8BA 1BX3A 2Z6VA 2PNFA 4RK0A 1E2NA 3K6RA 5H68A 4KQ1A 1M3SA 4AP6A 4B2IA 1TZJA 3CF4A 4MKRA 2CNDA 2UZ0A 2EBHX 4DDTA 3FPEA 1TYCA 2FQ1A 2P3LA 3TSYA 2NSDA 4E33A 4M60A 1XELA 2OSVA 3PEYA 1Q17A 2YJ3A 3UYLA 4F72A 3OQMA 4JB8A 1DPGA 2DETA 1SWWA 1TYZA 1U1DA 1A8UA 3JVIA 4N6GA 4PFJA 4ZO6A 4ZC8A 3RFXA 3K4QA 4FFWA 1WVIA 5JSQA 1YC2A 1M66A 4D9HA 2D2XA 2AKAB 1F2VA 3JD0A 4MUXA 2V5AA 2FLVA 2W2QA 3MJSA 4RK1A 5L3SB 3UMYA 1ZGJA 1GARA 2C7QA 3EA0A 1NN1A 2QUBA 3A1SA 3DBVO 3Q0IA 3DFMA 2H2AA 3HKEA 1SURA 1I3NA 4QJIA 5LLTA 2CUNA 1KYIA 3FN4A 3V1LA 2GCGA 1U28C 2WYUA 4MKGA 3ZXUB 2QE7D 3TUIC 2L17A 3UYKA 4Z99A 2O8CB 2O7QA 4M2LA 3AUTA 3BERA 1Q7BA 4KR2A 1EHYA 3B13B 1E99A 1T6ZA 3AR8A 2VP0A 4U5QA 3TSOA 1YZQA 1GY8A 1PTJA 4JOCA 4JQCA 3ZI4A 1R74A 1E0AA 3KQNA 4PYRA 1Z2CA 3KFLA 2HU5A 1YQXA 4FEYA 4W6ZA 3V5NA 4G09A 3LV8A 3V2UA 3R7DA 4FGUA 4RV5A 2EC5A 4CUZA 4D98A 2P9QA 1GRQA 1XZCA 3BE8A 2A92A 2C9OA 2BTOA 3L7YA 3LH5A 1REQB 2ZUEA 2JFXA 1CQIA 1UKYA 3OX2A 4L51A 3WL7A 4BWFB 4DEVA 1MA3A 5JH7B 3CZ4A 1DKRA 2OGTA 3GJYA 1IG3A 4TQ9A 4FI3F 3DDSA 5HRUA 3OMWA 4KIUA 1Y8QB 2ONCA 1DQNA 1FXUA 1HLGA 1SELA 1CUUA 2CF5A 2EW1A 3E4DA 8ATCA 1MPXA 3W6ZA 1Y5MA 4JJIA 4H17A 3ACCA 5FEUA 1MGOA 1N2CB 1Z83A 4PSVA 5DCWA 1PEAA 4PPYA 1KVRA 1YZLA 2C29D 1BN7A 3D7MA 1UDXA 1GL6A 3G2QA 4E5YA 1LSSA 4FYIA 3WLNA 4B46A 4GKBA 3GUCA 3V9PA 5CDHA 4F3TA 2R1TA 1DLIA 2PUGA 2RCNA 1JRLA 1XG5A 5CEFA 5GGYA 3SQXA 2D5IA 1Z9BA 4YMIA 1Q2XA 1SO8A 3BIWA 3PU6A 4LI0A 2PUBA 1ZBDA 4D4JA 4KNYA 4HFJA 4E0BA 3AKZA 1P4HA 2YVLA 3I9LA 4NQZA 2X76A 2L42A 3AY0A 4EQZA 2VPWA 5LWHA 3IAXA 2IIBA 2XVXA 4X1KB 1Y6GA 2EVWX 3ELUA 5DNDA 2WV7A 4C7JA 1G6Q1 4H4DA 4Y2TA 5A0VA 3KWMA 3VZDA 3HUTA 4MUBA 3BEDA 4H35A 1DC6A 5EJEA 5JHGB 5CLHA 4W4TA 2H7XA 1A5AB 3EMVA 4EGAA 5I01A 2J7PA 4L4RA 3GLIB 2MINB 1W4AA 1RYHA 5CTAA 2JIZD 3I64A 5DGIA 4RZXA 2QPAA 1DC7A 2AZMA 4C0KA 1OFVA 2R6HA 2ZG6A 3T3NA 1W94A 1YIDA 1ZK3A 3H3FA 3ZHRA 2ZYUX 4Z49A 3MT9A 1T0HB 1BKYA 1PWHA 1OFIA 4RK5A 2I7CA 3CX8A 2YWRA 4L72A 1SU8A 5C8YF 1Q3TA 3B85A 1E5LA 4OLJA 3QI7A 3X2SA 4WASA 2QUIA 1WF6A 4OHOA 5KHAA 3GFQA 1U6IA 3DOEA 3MA0A 5CHYA 3TECE 2CBGA 4EB8A 1QCCA 1MQAA 3WRVA 1MGPA 5DISB 5B6IA 4JJFA 4XDGA 3UAZA 1YBFA 3IHTA 5J63A 1G38A 1NBMA 1W96A 1QF9A 5I3CA 1T9HA 2NT4A 1IHPA 4D44A 5LMZA 2RDMA 2DBRA 4Y0NA 5L3ZA 1KOGA 4YLYA 3FGNA 3GRKA 1E2PA 1EK0A 1WMEA 3PC8C 3Q72A 1ZWLA 3A4IA 4ZQFA 2WWVD 1HX7A 2PMBA 4R2IA 2WVHA 5DYNA 3T9AA 4MA0A 4ECAA 2UVPB 1QANA 1QOPB 2X9LA 3EBPA 5AQEA 1A4RA 1P5RA 3TLKA 3TR5A 2H2GA 1E3WA 4JJGA 4NK5A 1MT3A 2HTFA 3IAEA 3OX4A 4RPIA 3UFBA 1LPMA 1GEGA 2IU3A 1J2RA 1O77A 2JJ1D 1P2BA 3B38A 2NUAB 3D6NB 2GYUA 4JJ8A 2ZYIA 2FZ5A 3C16C 2NZXA 2YHAA 3B9RA 4POAA 3RFCA 1T1GA 2FUG1 2HIHA 2PM8A 3NIFB 4WNAB 3DEZA 3RS2A 3MMXA 3UW1A 5BWCA 1F06A 3MTQA 4EPYA 1QBGA 5HUHA 3DOJA 4NEGA 1PJSA 2Z9CA 4YT4A 2PS3A 3BG5A 1AV7A 1NTOA 1RQ7A 2A9VA 4FDTA 1YT5A 2OHGA 4RL4A 1NDHA 2P65A 2A84A 2I71A 4KMOA 4D9NA 1ZVVA 2NYAA 2I0FA 3K92A 4JUCA 3EVTA 2HSZA 5JADA 1DXOA 5TQJA 1ZIPA 5EJ4A 3M8KA 1XVIA 1YCFA 4LRYA 4LY3A 2CCGA 4FFOA 4PVCA 4FB5A 4HPXB 5TEVA 4EG0A 4WUTA 4OLAA 4BN4A 2CVPA 1UOOA 2GK7A 3W3AH 3DLIA 1KEVA 4QASA 4YV7A 3KYIB 4BO2A 1ZJ4A 2JJ8A 1YCGA 4DV6B 3TBHA 3UUFA 2IS1A 3N8KA 5CIWA 2YIJA 4HDNB 2IUFA 4YRAA 1PLKA 1E9RA 2WJ3A 1Z4PX 4G0ZA 4UUPA 2MIIA 1L5KA 1OTYA 2BFCA 1QO0A 3QJGA 4G0QA 3UJ3X 1EDDA 1Q14A 1UWKA 3INGA 2W93A 3FFTA 2BMJA 4LF6B 1XP5A 2A0UA 3P96A 3PTZA 4EB6B 3WLLA 3E2IA 3IA7A 1AN0A 3E0XA 1TDJA 1RP1A 1UXIA 1ZOSA 1ZX1A 2VT2A 3NBFA 1DXYA 2NO5A 3UTCA 3ZVKA 3W8RA 3JYNA 2ODAA 3A3YA 4BNYA 5ICMA 1X19A 5JZOA 2CFOA 1GU0A 1RVDA 3G5TA 2FPSA 2Q9BA 1CEEA 5T5QA 1OZFA 2LXNA 3VR4A 2YWEA 3LLMA 1XQVA 1YASA 1VECA 1JUDA 4GZLA 4UEWA 3RKSA 3KZVA 5KYNA 1ZR4A 1Z0KA 2QTHA 5TVKA 1JG2A 3BRCA 2I62A 4ZQIA 3P2MA 5HTOA 3FNQA 3VJRA 1HM5A 4PLCA 1EWQA 4Q1DA 3EOBI 4IMJB 3GQBB 1TRKA 4UCWA 2DHQA 1FDTA 1ZOLA 2IKSA 3NNDA 2BFFA 2EJTA 3H17A 5G3YA 4D02A 4KMRA 5IANA 3D3WA 5DSXA 1XX6A 5A9SA 4F7WA 1D7AA 4Y0AA 1G66A 5IP5A 3LXMA 3OIFA 3NTVA 1FFEA 4L08A 3I6YA 4HLUC 3ZNOA 2HWUA 3L77A 2E4VA 1BYIA 3I9KA 5ALIA 1GYQA 5ITSA 4Z4FA 4I4TA 4WLOA 4CF6A 1JSLA 3MTBA 3ZWWA 1MENA 3A6PC 1T0PA 5HSGA 1DAOA 4QUGA 3D6JA 2LBPA 4XX0A 4CLXA 2ZIUB 1Q0QA 1FU7A 1XMQB 4F6LA 3EPLA 2ZS8A 3TLCA 4ND4A 3X1YA 3CW9A 1XA4A 4QULA 5AVVA 3NMUF 4D80A 5F7XA 1DG3A 3K0AB 1LNZA 5CA0B 3C4QA 3UMSA 2F64A 4YRBA 4IDFA 5IDVA 3GFVA 3O4GA 3UOGA 1B1AA 3TM4A 2GN1A 1XVAA 1BTOA 2HJGA 4ARZA 4URWR 5TJHA 2O48X 4L6IA 4AQYB 5KKNB 1I7LA 2IHVA 4NMWA 1XTSA 2IXBA 3LLVA 1NLUA 3NTXA 3PKZA 3T7EA 4JC0A 4DRXA 7MDHA 2JLBA 2A33A 2QUHA 1KR2A 4HFMA 2IS4A 2I2WA 3C8HA 4YRKA 2PUWA 2Q6OA 2YVQA 3AZPA 3BCRA 4MGKR 1N5IA 5AJWA 3GJ7A 2AG8A 1IZ9A 1ADGA 3HADA 4OYRA 2BKLA 3RYHB 1Z0SA 3JD3A 2GAFA 4LSWA 4FD3A 5TQVA 4YRPA 3E1GA 3WTCA 3H8VA 3PNVA 4XOIA 2H1IA 1A5BB 3F3SA 5BVHA 5FOUA 3HVJA 1OIVA 1IRXA 4NZZA 1O97D 5FWXA 2NU8B 2C2XA 2HQRA 2F67A 3IMGA 4HVTA 1TTPB 3BYZA 3I0MA 1FVHA 3IAHA 1GZ7A 4MSUA 3HQ4O 4IILA 4PHFA 4U7TB 3ZIAD 2CE2X 4F96A 5KWVA 1YQEA 4PO9A 1MB0A 5AJHA 1RE0A 4XCVA 3T0IA 4J1TC 3E8XA 4G01B 3WYFA 2RHCA 4AZ3B 3AR7A 2FAXA 1MG5A 1PDOA 1XNGA 4FX5A 4EATA 1VE9A 4MR7A 4F84A 1VJ0A 2QR2A 2WVGA 3NYQA 3RVBA 5K8JB 4IWYA 3QXGA 4O2AF 5EP4A 5J3JA 3AKCA 4GE3A 3A3PA 1JDUA 3HJTA 2KYRA 4DCCA 1DAMA 3L06A 5C52B 3UKJA 4MW6A 3ORQA 4IYJA 3CR3C 3MJFA 4TQUS 4RA6A 4S1OA 4B7ZA 3D0KA 4OCZA 5KOHB 1MB3A 3TCXB 1P39A 1V9CA 1EHIA 3ZU6A 1ORRA 6PFKA 1UAGA 3OQJA 5ILGA 4FFDA 1B00A 2YXEA 3DOIA 4MWCA 3CO5A 3HVUA 4L07A 2GCEA 3O1IC 4C6TB 2WAOA 4NE9A 4N39A 1VA5A 1UAYA 1USIA 1NC3A 1FUKA 1PZGA 4RY8A 3RH0A 2XAUA 3U4QB 2PUHA 2MWMA 2KS6A 4YB8A 2VATA 1NRJB 1V1MB 4QOSA 4DG5A 5B58C 3C3EA 3FTPA 1WUTA 2DR3A 4LJKA 4LHYA 3AI2A 4YJGB 3R8CA 4UMEA 3KOXA 3PR3A 2VDWA 3ROXA 4Q66C 4OTZA 3G9XA 2OCDA 1LD3A 1JFLA 1EXNA 1I7NA 2K7ZA 4B47A 2O2CA 2WJPA 3C7KA 4FZRA 1TQ6A 2RH8A 4UNNA 2OXTA 2ZAGA 4WLUA 3ZWVA 5FPPA 1AGPA 1Y80A 2YZ2A 4FN4A 2G5TA 1T8PA 2JRLA 2CXPA 3V8BA 2RGDA 1PD0A 2B4RO 4K7JA 4TMFA 2F3PA 1D1QA 3P8ZA 2HWKA 4LXUA 2K6GA 4IIXA 4IRMA 4OUDA 5A04A 2ZCJA 4WY8A 1H1LA 4X7BA 4BEVA 3LRXA 4BFXA 1FXSA 1FL9A 1EM6A 3DLCA 3HGQA 4D4LA 1A77A 1HO3A 4MWOA 4TXMA 1OLXB 1WP9A 4V1CI 4O5OA 4P22A 2R0QC 2GBGA 1LX7A 4HNVA 3MT7A 1DJPA 4WD3A 3VR5D 4R51A 3ZCXA 3AL0C 2PWBA 1AKQA 1F4VA 4GPBA 3VH3A 4MQFA 1RABA 1M2EA 5JCJD 3FIJA 2CB9A 2IYQA 4X91A 2HADA 3ITEA 2DUNA 2QTGA 4IUDS 4DZTA 1THZA 1U0NA 2CNBA 1QGZA 5GM1A 2UU9B 1T29A 3C1TA 3IJEB 1D2RA 3VR2D 1RCFA 1LS6A 3H2ZA 3M6UA 1FQOA 3C39A 3HZHA 1ONBA 3TDKA 3ZKWB 3P94A 1OI4A 3ELWA 4UUMA 1PJ3A 1U5BA 3ND7A 3DE0X 4DZZA 2C84A 3IUYA 3AESB 2HMAA 5KB3A 4L4XA 4K6MA 4AJ1A 4B8WA 3W5IA 3B6JA 1BRTA 3AM3A 4UFNA 3U1BA 4JENA 3RVMA 3WX0A 3AERA 3FTCA 2IYVA 4AURA 2WG0A 3OKCA 4HO1X 3VYSB 3GXOA 3IPRA 1GO2A 3EXAA 2ZULA 1D2GA 3KKQA 1Z8FA 2C5LA 2GTPA 3Q12A 4MQ4A 2Q5FA 4UAUA 4RKQA 5IS2A 4NYIQ 4Z0TA 1NKVA 3WMGA 4YCCA 1R5OA 1RDFA 1WBBA 1Q3KA 5AVJA 2XRYA 1X7HA 3M2PA 4I55F 4O4JF 3DFKA 4U7WA 2CY0A 4HYYA 3OCVA 3ODPA 2VXCA 3G8AA 4HP8A 4JLPA 4KAXA 5AKZA 2DY1A 5EKSA 2IYNA 4D8YA 4LGCA 2BEVB 2I54A 4K9SA 4Q3KA 2EP8A 2HU2A 4MROA 3WIEA 1EFPA 3UW3A 2R7AA 4MQ6A 4N01A 1QGDA 2P78A 3UB4A 1EE9A 2ID8A 3EH2A 1K7XB 3FCXA 4C88A 3MBOA 3RS7A 1EESA 1CK4A 1CT9A 1HL3A 3ENKA 4M6WA 3HDYA 2IXAA 3ZCPA 3CKYA 4Q7QA 2HJSA 2ZJYA 3EXIA 1G5RA 5HQ3B 3DOUA 3PX3A 3AM4A 1QORA 3K1AA 5CDUA 2FCAA 1V1RA 3AEQA 1CJMA 4ZV7A 5T4EA 5F5NA 1KQ3A 1U1IA 2XUZA 3OCJA 1KXJA 2JCGA 3L49A 5C5IA 4BJ5A 4BUCA 1B74A 3DMFA 2Q1YA 2X14A 2CT8A 3UGKA 3BXOA 3I8XA 4IDQA 5EZYF 2FG6C 5BSHA 3OESA 5P8WA 1UBCA 3H9CA 3TKLA 3DLHA 1R6DA 1BFUA 2I3ZA 1YL7A 1NF2A 3NOVA 2VH2A 1ODCA 3HB4X 1YD7A 3EVNA 3IT1A 4R8LA 4IQ4A 3OQBA 2PEYA 2BHLA 4K9DA 4F60A 5CFZA 4RIFA 1G19A 4RTPA 1B8UA 5D85A 1FDVA 1YUBA 3H9UA 3ZE1B 4BLOA 4DQLA 3HI4A 1NKTA 1Z08A 2ZI5A 3EZGA 3MQFA 2P9BA 5BWMA 4HF7A 3LUJA 2XNHA 4LHWA 3BF7A 4DSZA 4PQYA 1PT7A 1EJBA 2ZRPA 3JAWB 2B37A 3R5JA 4ME6A 3IAS6 4IOKA 5ELLA 5GJCA 5B64A 4KGXA 1EM8A 2CLHB 2ZDGA 1QH1B 4IRUB 3OZCA 1QJCA 4C4AA 5HNKA 4GI2A 1GFZA 1V7CA 1C1HA 2VHCA 3MAGA 4FDMA 1XQXA 1GLNA 1OY1A 5AM2A 5ED4A 3BH0A 3GA0A 4LRUA 2AFVA 2D2FA 3AWDA 4IDAA 4JJ4A 5FUMA 3GD5A 5IUKC 4EQ6A 4OK6A 1F7UA 3B52X 4LCEA 4ZHSA 2Q2NA 3Q85A 5D00A 5E6UB 4GM0A 4DEYA 5HCIA 2CJWA 3ADKA 3MLAA 3F8SA 4ND2A 3ILSA 5EE0A 5FTJA 3TSZA 4BNLA 1JLLA 4PBSA 5CX1A 4A2QA 2UYQA 4ABTA 2EKZA 4H7DA 4B8ZA 3DEIA 3MJEA 2CLLB 1T8UA 2VHXA 1QHNA 3ELDA 3FYSA 4B6QA 3ZNNA 4BQEA 3PA6A 3C7AA 3E2PA 3L0YA 4Y2PA 1XKXA 1UXOA 2LZ0A 2WFLA 1OXSC 3VNBA 4M55A 1GNSA 4NBRA 2OUKA 3B8HA 2N42A 4OOEA 4RENA 5BSRA 3RUHA 3B2NA 3KJNA 1CYEA 5LU9A 4C0HA 3B5IA 5L4NA 2AHOA 4M0LA 3H13A 1UIRA 2JKZA 5KQLA 2BEKA 1XA3A 4Y6LA 3EVCA 3R77A 1HDIA 2FDXA 2RHOA 1UPBA 4LE0A 1GCIA 2B36A 1WSWA 4U9UA 3F7OA 4ALKA 3EEOA 5J40A 1E9VA 1JLSA 4FS3A 1P9OA 3MS4A 4B44A 2FPMA 4N54A 2ZBFA 4RF4A 2QIPA 3MK31 3TFWA 4DNQA 5K3CA 4MVJH 1J9EA 1CUBA 3E61A 3U60B 1JHZA 1W25A 2OQRA 1L1FA 4BV3A 4Q3OA 1G20B 2I6SA 4BB5A 3ZTTA 1OWLA 2V6JA 4K6KA 3RRMA 1Z35A 4EG3A 1GKUB 1UBFA 1NW7A 2UZAA 3NAZA 4I1VA 1QIDA 3BGSA 4MVCA 5B7PA 2W2KA 2ECPA 4F5DA 5JAMA 1YZTA 3ZX5A 3VO8A 5BXQC 2L2QA 3GZTB 3GLGB 2IYXA 5TNXA 3ZWBA 4Z3OA 1KPGA 3ICCA 4Y8VA 3IBYA 3QUCA 3NHZA 3VR6H 3L7LA 1Z63A 4CQNA 2ATVA 2E4WA 1V37A 2EGHA 3GCWA 4M0DA 1SC1A 4KPFC 3HXQA 4E07A 2I34A 3RK1A 1QQ6A 3NLLA 1UXKA 1NXTA 3VNQA 3QE9Y 1M0SA 5CBPB 4M3NA 2GD2A 2JA2A 3HJRA 4RZIA 4BMXA 4B2YA 4PINA 2V6MA 4R2JA 3V7FA 2IXTA 2BFEA 1Z0IA 5BSKA 3S1AA 3CO0S 1SUSA 1JMKC 1U8CB 1E89A 4MCJA 4UU0A 2FMIA 1T9BA 5HKKD 3BEOA 3U44A 3UMCA 3OZTA 1FLVA 1QYRA 2BDUA 3H2SA 4CL0A 4U3JA 4M1YA 5LJLA 3G7SA 1LLFA 1Y9DA 3PJDA 2Q3FA 1EX9A 1J23A 1H8HD 2D7CA 2XADA 3CH5A 2RHHA 3IUSA 2PHZA 3UATA 5MGBA 2XW6A 2PFSA 3DKIA 1SOUA 1YRAA 4D8XA 1DOZA 4B5LA 1KC3A 3N05A 4CM8A 2SECE 4MS1A 3RT9A 5JS7A 2HV8A 3RABA 4EFNA 4FMPA 2WWXA 5FWDA 2P3SA 3MSCA 4S04A 4YV0A 2X77A 1Q0RA 4MW0A 4E30A 3HY4A 3ME5A 4CIYA 3G2HA 4ZEXA 4CETA 3J81k 3QE3A 3RAGA 1DRJA 1IZZA 2HRZA 2IITA 3K32A 2OD9A 4BQOA 2OV2A 2WY2D 4D3XA 3KT6A 2VK2A 3ED1A 4HDRB 4QXOA 2D3TA 2RJNA 2QTWB 4P3KA 5K3DA 1LU9A 1A9QA 2ID4A 4BNMA 4CKWB 1IN1A 1CWUA 5KOJA 2ZM6B 1E79D 4CV3A 4WVLA 1KH1A 4F12A 3E3AA 2VP4A 4BN5A 3CJTA 4TKUB 3Q3IA 3GN2A 3R0IA 2O57A 2I3DA 2Z6AA 2GAOA 3OKPA 3JD4A 5J47A 4X8LA 5CXSA 3KZ1E 4OQLA 1MABB 2H8GA 1VMIA 3UPDA 3SS9X 5A9RA 1FVFA 4M9SA 5IC6A 3U40A 1U80A 4ZGGA 1RYMA 3K96A 5JVDB 4BVFA 1VLLA 1NJ1A 3TL3A 2XLBA 1QGUB 1RWXA 5THQA 4YO8A 4Y9SA 1UC9A 2WYVA 3LL4A 5I7SA 1W36C 2FHSA 3LUCA 3TPZA 2QRVB 2W6NA 1GTG1 4HFRA 4US2R 3GLQA 4IQ0A 4ETNA 3BHMA 4S0XA 1VKOA 1B14A 3SS7X 3KKOA 2IV2X 2H8KA 5BWNA 1TL7C 2DUJA 2EAUA 5AJYA 2YOHA 3WB0A 3WDLA 4CV1A 2IBSA 3L6OO 4N7RA 2Z2YA 3A36A 1EFCA 5EUBA 5GONF 3T4PA 1TIPA 1M2NA 1C4KA 2BBTA 2DR0A 3E05A 4GMXA 4TKZA 5D5HA 4ARSA 1EZ4A 2EGUA 2FMUA 2CLIB 3E22A 2D8MA 5H4GA 3N0XA 2P9JA 5TEWA 5MN6A 4ZCRA 1KEEA 3COJA 4BNIA 2ZJ2A 3REQB 2I4IA 2PY6A 1W4ZA 4REOA 4EUNA 3WLTA 5FA5A 5JNUA 1SXJA 4G23A 5AKLA 1ZK2A 3ZUPA 2QZZA 1EEXB 3JWEA 1ZINA 4WBSA 3OE5A 6LDHA 1SA0B 2G3YA 3E4CA 1I2AA 5B2ZA 2XIQA 1RFGE 3ORYA 2ZPTX 4GVLA 1BXGA 3VPAA 4RV9A 4Y6GB 1UC4B 2NAFA 3C3XA 2QTMA 3TQOA 1R3DA 3DEHA 1ECFA 5JD4A 1S6YA 3CH4B 3EG5A 3OQIA 2IVZA 3B8EA 4HAOA 4OP3A 3M6XA 4D9JA 4CLRA 3GLFB 4K05A 1OKKD 4EIWA 2VNSA 2ZRBA 3LLSA 1D2MA 1M0TA 1HDXA 1MOPA 5GOTA 5U9CA 5DJ5A 1DKPA 3GG2A 4EP1A 3QGMA 3CZQA 4KP7A 2G72A 2NU9A 2A5JA 3AV3A 4M7WA 5ECGC 3G7UA 4ALMA 3EWSA 3IGFA 3BRSA 2I55A 1P19A 1RWVA 2QN8A 3WQBA 3ZHXA 1OQAA 2WE7A 4DGSA 4XARA 4A23A 4WN9B 3C5CA 2ZJ1A 4Q3DA 1EVJA 1X0XA 1O6FA 2NXCA 1T13A 1G9XA 1I7SB 5E9AA 3GRVA 4BECA 4RHTA 3RV3A 4C78A 3ZDEA 2XOXA 3QE0A 1KQNA 5HCNA 2GARA 2R6R1 3X3HA 1GGHA 1CP2A 4L5BA 1FNCA 3OT1B 4QUDA 5BN5B 1LH0A 3RSQA 2VJAA 2UYGA 4NV3A 3GPBA 1OHHA 3E3LA 1H9BA 3JATA 3OWOA 3Q0TA 4MITA 1AX9A 1PFYA 4Q7EA 1B8OA 2FP4A 5I7WA 2W22A 2VQEB 4A82A 4P9NA 5H0IA 2PLAA 4R16A 3JVVA 1NATA 4O6VA 3HZRA 1DCTA 1TXGA 5JMPA 3PL5A 3WJAA 2RB5A 4G4IA 4RVFA 1ZVMA 5KU1A 1Z17A 3TEMA 3HG7A 2EG9A 1P4GA 1DC3A 2AHRA 1QMPA 3JXEA 4G5XA 2FSGA 3DO6A 4ZC1A 2PUFA 4OH7A 4GEGA 2R85A 2BPOA 4ZO8A 5C7YA 3GG9A 3DAPA 5HOEA 2IXDA 2ZIGA 2RG1A 5CNIA 2P75A 5JWOA 4MP3A 1K6XA 1XZPA 2GCNA 1XZBA 3IULA 3TZBA 2IEIA 4NATA 1G6KA 4JLVA 4MWDA 3ZWKA 3WDMA 3MTGA 4L5AA 5JRZA 4KACA 5AOAA 3BHIA 4KWTA 1L5QA 1II9A 2XMBA 3EY4A 3DZKA 3OZAA 5SZIA 3WGUA 1ZPDA 1GR1A 3RB8A 1NVGA 3L7NA 3UG6A 4HWTA 2JKVA 4KE7A 3GFTA 1EUCB 2G0TA 5GJWC 3T5PA 1QHSA 5JY1A 2POQX 1GCOA 1X77A 4CKZA 4BGEA 2YYAA 3DAOA 3MWEA 2VDUE 3GJXC 1XDUA 3LT1A 4I14A 1SUPA 4FCWA 3JAMA 3PDWA 1FW8A 1TAGA 2CJPA 4BFWA 1S4QA 3ZBTA 1MHPA 4K1LA 1TM3E 2LGJA 2QEQA 1Q7RA 4S35A 4UPEA 3CZ5A 4AW9A 2ZR9A 4G8BA 4MZXA 2QT9A 5CEEA 1XPUA 2JCBA 1E4EA 1VA4A 3C3PA 1Y7TA 4JZYA 3K0KA 5I4KA 4HFNA 5J4HA 3ZDFA 3QVTA 2AYZA 2XAAA 3V42A 3WP0A 3COYA 5IW8A 4CNBA 3NATA 5JTUA 4LYYA 3OCYA 4W5QA 2PFGA 3AXTA 4DAOA 1EUQA 2CNWA 5JNWA 1C29B 4LIPD 1GU7A 4KN9S 1V11B 4CJXA 2R11A 1R4MB 2O7RA 2W2VA 1RSZA 4NBVA 5BSWA 1QNLA 3QLVA 3TZQA 4DUYB 4REQB 1N6LA 1U2ZA 3Q7PA 4PRZA 4CODB 2O2XA 5CNJA 1SU4A 5FI3A 4X3OA 3F3YA 1U4OA 3ZWDA 4NAVA 6Q21A 1M8FA 1NJ8A 5EYPA 5KNBH 4OQMA 4N5DA 2PBLA 1KK1A 3D5QA 4RELA 3WYAA 2HNBA 1CUEA 3K9FC 2DUMA 1W87A 2OWDA 1VHDA 3OWHA 2RG7A 2ZRAA 3C4JA 3I2YX 4OGKA 4QODA 4BMDA 4EM6A 2CYAA 5AVQA 2AJBA 4WCDA 3ORRA 1CLEA 3PX2A 4O4LF 3NG1A 4EVIA 2ZBGA 3EGDA 4FEAA 4EMTA 2XDYA 3TJZA 3O8RA 3PEFA 2H57A 1IMJA 2H4HA 1YS2X 3Q3HA 2F4NA 1WL8A 4LE1A 1TZKA 1EP2B 2GZAA 3DVRX 2G9NA 3TH5A 2P4SA 1RLUA 2W8BA 3P9YA 4ENWA 5J43A 1OB5A 4HUTA 3SY8A 2KWIA 2R96A 1MFZA 1TUIA 1KMHB 1TMGE 3QHPA 3U3RA 5AXBA 1L7PA 1XB2A 3M6LA 4DSTA 1HQDA 1NMXA 4BV8A 3K1TA 2GSDA 1PFQA 4IGAA 2I4OA 4KX5A 4PX5A 3WK6A 3K0BA 4RLHA 1IAQA 2WU8A 1DAKA 3G1WA 1V95A 4J0JA 4WEOA 1L7OA 4IDGA 1IXKA 3W3ZB 2O05A 2BEJA 3CUYA 1XZIA 2PDAA 3HVRA 4AKIA 4Z2YA 2G1KA 2ZIVB 1E2FA 4E6PA 3U37A 5E95A 4L6CA 3CUKA 1D2HA 1W581 2IZZA 3H5OA 2C4UA 2YV2A 4KZKA 1J8FA 5DBGA 4CIXA 4D4IA 3RUEA 5H7XA 4XH9B 2PWPA 1YGPA 4H59A 4D8VA 3EC1A 5TPZA 4Z54A 3D2LA 1AK1A 2ZS9A 2BKAA 1T2VA 5IT5A 4UFOA 4A8PA 4G84A 2PQ0A 4BJHB 2FMHA 3L7DA 4CLOB 1SCUB 5JY6A 5D86A 3IXLA 3AJEA 4G1BA 4PGGA 1Y81A 3FAKA 1DTWB 1KEZA 2Q8QA 5AUQA 4GLLA 1CS4C 4WOKA 2WHYA 1RACA 4P86A 4BNDA 4BX3A 1ISFA 2C4WA 4MUKA 4L8GA 2XGSA 2WMDA 1NVFA 4FSHA 5IKEA 1SBQA 1UJNA 3B48A 1NP6A 3ROFA 4DUPA 4IQFA 1A76A 1FFBA 3MC1A 4LGYA 2J6BA 5IAEA 3JWIA 3VZBA 4H7HA 1USGA 2GR9A 1PYOA 2Q1TA 3TW4A 5A4FS 2EP5A 1XJQA 2H1OA 3LUAA 4GL2A 4QFBA 4AZWA 5E9QA 4MAAA 4QFDA 2WMYA 5K01A 5LXTB 3JQGB 2OV6A 4C4YA 3DUFB 4PQRA 1T4GA 3K9BA 1KJIA 1O95A 2ZRCA 4NU8X 4OFXA 2PBZA 3NJRA 2GXAA 2ZLBA 1GL7A 4JC4A 2EEZA 8MHTA 1IWOA 3NXSA 3LZDA 4MQMA 3RIHA 3TTVA 5KYXB 2J5QA 3D6TB 2GK6A 1E6KA 2R25B 3D6AA 3PIRA 3SF8B 1AXEA 3B1JA 3WP1B 3ZCQA 5HQTA 1IM8A 2PZMA 4UHBA 1RYNA 1P1IA 3HZZA 4TROA 3EWIA 2KHZA 2CNLA 4RTKA 4PAOA 2A0KA 3EW9A 3F1LA 1CRQA 4FHFA 4P3XA 1ZC3A 3P1JA 4LJ8A 3P26A 5HE9A 3LUBA 3SSMA 4GXTA 1G9SA 3O8OA 1EDZA 3OE7D 1ESZA 4EW6A 3GA5A 4MJXA 1XRQA 3HN2A 3C87A 3ASZA 4MDHA 2HPHA 3ROKA 5I7FA 1Q83A 4MUAA 3VC2A 4F2WA 1U3CA 3I0ZA 4AY6A 1S5PA 2ID7A 4Y1RA 4JI4B 1ULZA 1V6SA 1V47A 4ALIA 2CHVA 1H2BA 4DCSA 3WXMA 1SIUA 3N3BC 3DQPA 4LXIA 2NTYC 2PH7A 3EF0A 1ISGA 4RBNA 1GAEO 3SLRA 3ZV7A 2FE1A 3R3YA 4XA8A 2YWBA 3Q7RA 2V1UA 2WNIA 2F48A 4TXHA 4X54A 5K8LA 1FDOA 3RTGA 3AVOA 1H0KA 4L0CA 1PUXA 3DDCA 1W5BA 4I2VA 3WG9A 5BV7A 1ESMA 2LE0A 3AEYA 4OHYA 5AT1A 5L4LA 4DLNA 3DZ8A 2J5BA 1ILEA 4J0QA 3BQNB 3AUXA 5FTWA 1FPQA 1UDRA 1V5FA 1Z5GA 2FPKA 5BW8A 2YY6A 3BX1A 3LRTA 3ITNA 2P30A 3CLVA 3BFJA 1JKJA 4ZVUA 4RC9A 3FWZA 1BXRA 2QDXA 2ZCVA 1LPBB 2TS1A 4G6ZA 2I7VA 4HXFB 4NCIA 5AHXA 1UP7A 5IYZB 4DV0B 1DI0A 1W1WA 2A35A 3HY6A 4I4TF 1I3OA 1CW2B 3PFIA 5T4BA 2X5JO 1RJFA 2XUJA 4EKYA 1P7YA 3PC2A 2RHLA 4K8RB 5IT9A 2WM8A 4LDAA 1FYWA 3BCUA 2DFPA 1TFUA 2GT1A 4M4SA 1Z4QA 5JH7F 4Q1CA 2HO4A 5DXJA 2PL5A 1SCBA 3PFWO 5H16A 4R1NA 1Y8AA 3II6X 5DT9A 2BKXA 2HRCA 1N2GA 2P40A 3L1UA 4A8JC 2VEOA 4KCGA 1M34A 4PPQA 3LC7O 1IFXA 5IJAA 3ITKA 1MB2A 3FF4A 1A27A 1ZCAA 4C76A 5FQNA 3VH4A 1NUUA 3EUFA 4MKFA 1NUSA 4EKGA 2ZUTA 3NTRA 1DRWA 3OD1A 4N49A 2F8SA 4LV8B 3NB0A 3R3XA 4J1SA 1N2SA 1J2TA 4A7PA 1T10A 1TAUA 4M1EA 4U2EA 1F0PA 1VSBA 3H65A 3IJRA 5A6SB 4UCQA 5DM2A 3MINA 2QP9X 4HWKA 2RH4A 1NI4A 3JWPA 3O3MB 2AD5A 1O0BA 2JNWA 2L19A 4HEA6 4G0WA 1I5RA 2Z04A 2WDPA 2H65A 1WF3A 5TX7A 4LPKA 3VPSA 5FUQA 1CIVA 4LSGA 3N2KA 5HK8A 4COKA 4GZ3A 1AKTA 1DRKA 3Q7EA 4F85A 1QH8B 1VIYA 1I9CA 1Z26A 2BSAA 3W77A 4R1SA 4AJIA 4BX9A 4C89A 1FRFS 1FTNA 4E12A 1GRVA 3L05A 4MV7A 3BSFA 1KPHA 4I9FA 5JAUA 5KTSA 1Q0PA 4B87A 1IUNA 1FLNA 2Q4EA 2DHEA 3RHTA 4RTMA 2D1QA 4DC1A 2Q5JA 1XTBA 4J76A 5FADA 1T4CA 1RHUA 4DJJA 5KUTA 5BR8B 3DXYA 1RXVA 1N6OA 3ODGA 1ZGZA 3NYRA 4YRFA 5D6OA 3ICQB 1H93A 3VPHA 1UWCA 2QJFA 4KUEA 3LP6A 4YEDA 4BUJA 1GUBA 4U9IS 3DMNA 1IY1A 2XB8A 3EIUA 3LBHA 1QVWA 3NWEA 3JQAB 4BZQA 1PVOA 1V71A 3CF0A 2NU6A 1BXZA 1XU9A 3HPQA 3IKVA 3RUIA 4BXOB 4BO9A 5IKOA 5TSDA 3TIVA 5C8XA 1GM5A 2IYUA 5B12A 3GGOA 3AR5A 3FUUA 3DYBA 4UTRA 4EHKA 3CE9A 3DD5A 3OPYB 4YGXB 5DP1A 2Q0XA 3ROQA 3ZTWA 5HPYB 3LAWA 4KL8S 1B16A 5ALJA 4ZT5A 5KS2A 3MW8A 2OORA 4GYYA 4K9RA 1HC7A 4OL9A 1E8DA 5SV2A 4TL9A 2XA9A 4M8IA 1KH3A 2DRIA 2OLKA 3OF5A 1KARA 4WFIA 4EA8A 2YMQA 2PYZA 2GD6A 4CFZA 1W34A 2OFPA 5ECDA 4D8WA 5AO9A 1SZJG 3EQ7A 4HRAA 4OB7A 4RM2A 3W2GA 3DTNA 4DV5B 3RSLA 3HKEB 2NU7A 3MJRA 1BWQA 4HDQB 4OFZA 5IRCD 2GF0A 3IUJA 4YV1A 1BQ4A 2FZLA 1JEDA 3NUZA 1CDEA 1S02A 1TQHA 3KOUA 5BW4A 1U3WA 4I5GA 1G6HA 4K6OA 2UDPA 2NQ2C 3GT0A 3AF1A 1X6VA 3QXCA 5H70A 1WP4A 1F5SA 3EA5A 3UWKA 1UR5A 2BI4A 1HL7A 2WIKA 1O1YA 4KQXA 4F97A 4ZAYA 5AK4A 1I80A 2P6OA 1R9MA 2WVAA 1OZHA 4EO4A 3LKDA 1OLOA 1NU8A 1A9XA 3OTWA 1YRYE 2IU4A 3GARA 2HJWA 1RKBA 1WV0A 2XGGA 3GRFA 1I9GA 5CGZA 3HSYA 1ZRSA 5DI9A 3QFRA 4GOOD 1KE1A 1WQ3A 2OBXA 4C0BA 3ER9A 3ADDA 1CQIB 3E7PA 4M8LA 4RXTA 2XDAA 2VHWA 1EGQA 5FA8A 2ZIEA 4C6RA 4V38A 4HXGA 3O2QB 2GA8A 2BP7A 4BQIA 3OCCA 3HMQA 3KYBA 2EARA 4EJSC 2W6QA 2ZTSA 3GYBA 3P9PA 4HR7A 5LWQA 1M8PA 4OK5A 3J7AC 1BFKA 1SUEA 2O9JA 3N2GA 4JT2A 3A9CA 1GQQA 4BKOA 3BB3A 2XUQA 3HHEA 3KAKA 1Z2NX 4F86A 2HKIA 1X1BA 1ZICA 2EJUA 1JG7A 2QD2A 2V7BA 2VWQA 2YRXA 3NJ4A 4QDKA 2VA8A 1DCKA 4J0IA 2W4QA 3F5DA 4FC7A 1V3UA 1V48A 3PEVA 4N40A 4UDOA 3TW8B 4UOZA 4PZDA 4E88A 1GKYA 1Z6PA 3ESYA 1Z06A 2JFHA 4WX2B 2NO6A 1R3UA 2PBRA 3K8QA 3PNSA 3WDSA 4DDMA 2JK1A 2CXXA 2DAPA 1XO1A 4FFSA 2XE7A 3PPXA 3N2IA 4IZHA 4E2YA 1IB6A 2XQFA 4BEJA 3FPKA 4YUAA 2IW1A 4J6EA 2V59A 4C5CA 3RK0A 4JBWA 4FBMA 5JNRA 1ZU5A 1RJEA 4B3TB 4YCLA 1WCV1 1N0VC 3DF7A 3GGJA 3E9NA 4Q4AA 4DDWA 1JHYA 4BMSA 1AHNA 4DXHA 1I7PA 1K8RA 2QV7A 3QEOA 1NMZA 4QYSA 5KNDD 4ZZ1A 1TUBB 2R60A 1ZKDA 4Q34A 4YWJA 1TOAA 3UEOA 1B0PA 3SJBA 4DB2A 1A1VA 4M9RA 4MO2A 3OZVA 4Z3KA 5ALHA 4RSGA 4NX2A 4ZQBA 1SQFA 5KJEA 5M04A 1USUA 3RJ9A 2WB2A 5ALEA 4MTLA 3CBGA 4OQYA 3WMXA 4ZOLA 5H81A 3Q3CA 1PNVA 5A4DA 5CLIA 3LBYA 5BN3A 2C3OA 2HMYB 3TD6A 1Q7CA 3MCZA 2NNWB 3QLVC 4CIVA 2XR1A 5CA1A 1MTOA 2QYHA 1NFRA 3OPXA 5KVAA 3EXFB 2EKLA 4KO3S 4DNOA 1OZAA 3TTTA 3W2EA 1B41A 3KU4A 5JI3E 2AYYA 4DY6A 3VR3A 1VPVA 5ADVA 1K0FA 1BD3A 5C4MA 3AHIA 1PX2A 1G59A 3W2FA 2NV6A 3FY4A 3FHTA 1BMFA 3PS9A 4TM7A 5EUMA 1K27A 2D7DA 4Z86A 2I6TA 5JS8A 3NGMA 4J4BA 5KC9A 1C1DA 4L74A 2Y1EA 4B40A 2B2NA 4K2AA 4Z7QB 4IDCA 4N5LA 2HQOA 4WQMA 3I3SR 1LS1A 5IVHA 3UPTA 5CYPA 1GVHA 4TSFD 4WESA 5BQ5A 4NBWA 3VNRA 3EJWA 5FWNA 2PGJA 3T4EA 3A4VA 4XM1A 1RAAA 2YH2A 2FPOA 4PQGA 1G17A 1GDHA 3IP3A 1W48A 2JHFA 4G8JA 3RS9A 4IXMA 4JB3A 4G8DA 4FWIB 3NYWA 4ZCIA 5JLJA 4I9UA 3JQ8A 4FKZA 2Q0QA 4JGBA 4NC9A 1M2WA 4B6RA 5TQ2A 3FTFA 2ORWA 1PJQA 2WF7A 2F8TA 3EPRA 3MTDA 1G21E 4W7IA 4UHHA 3R8XA 3RD5A 3GZJA 1N4DA 5EPEA 1C8VB 2R6GA 5SY6A 3U1TA 5A4IS 2XT9A 5SY9A 4FDUA 4P98A 2GBLC 3U19A 5FUBA 2ODPA 5IBPA 3U3XA 1USWA 3IMCA 4ZMSA 3AY6A 2A7XA 3D0OA 3QXJA 3CTPA 4JGGA 3D43A 3SDSA 2WYHA 3I1YA 3OTQA 5MF6A 1WW2A 2ZI7A 1F12A 5TGDA 3SM9A 3C1AA 3THWA 3I04A 3HC7A 4RFSB 2WT8A 4UPVA 4FINA 4JT8A 5EWLA 2ZAOA 4EA6A 4CDNA 4ARCA 4AULA 4EFMA 5MFPA 2HIAA 1IOLA 3SHFA 1YNOA 3TBFA 3V8EA 5KHOC 1PAUA 3ZHSA 3S1SA 2ZT5A 4KAJA 3DD1A 2H0AA 2PT7A 3OTOB 1IM2A 2BFCB 4BJ3A 3G6WA 4Q1EA 3IDOA 1R6BX 5PNTA 2VKTA 1CUYA 5G4LA 1PKEA 1PDVA 1B3BA 4PNHA 2LUOA 5F1OA 1MX1A 2TMKA 3GRAA 4R1MA 3TAUA 3CA8A 1KPIA 1YVEI 4LDQA 4MAMA 5YASA 4TGLA 1AUVA 2G8NA 4UZSA 3G49A 4RZ3A 1XHEA 4ZEOA 3VV3A 3BAFA 2XTAA 2JJ2D 3GGPA 2BKEA 3EIQA 1HDYA 1IG0A 3PD0A 5EUQB 4S05A 3ABSB 5LUAA 5D7NA 3PQ7A 4UARA 3FPBA 4ATNA 2VP5A 5IFLA 3CNEA 2O2EA 5IFKA 2FSPA 3T1YB 1ABEA 2GPWA 4MRMA 2A4KA 2WSBA 3TIFA 2C59A 3SYMA 3I6MA 5JEDA 2ZE6A 5IC5A 3BWCA 1K3FA 5IJXA 5JNVA 5KNCH 3WHIA 4INAA 4NVRA 2FMKA 1J8VA 3MELA 3PDCA 4PLGA 3BS4A 1BH6A 2C2KA 3M4ZA 4MO9A 1GG5A 2AEEA 2C3PA 2BFFB 5GV7A 1HYGA 4YDRA 4YUZA 1UMCA 3SS8A 5A9SB 3RRYA 1IHUA 4RJJA 3P71T 3T15A 4BQSA 3SC3A 5C18A 2QLLA 4UVIA 5EKDA 3G0OA 3TQFA 1UFVA 5IJ0A 2FEWB 4CKXA 2PR2A 4QT0A 1JI3A 5ICFA 1JHOA 4BMNA 2ZETA 4Y6QA 5IKPA 5AM1A 1NVUQ 2APJA 1MX3A 1UF9A 2Z5LA 3LUPA 4GKVA 4P7FA 1Q0ZA 2OCKA 5FXMA 2WAXA 2XDQA 3ZHCA 3UQZA 3QVKA