5JNUA

Crystal structure of mouse low-molecular weight protein tyrosine phosphatase type a (lmptp-a) complexed with phosphate
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
153
structure length
153
Chain Sequence
GSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Diabetes reversal by inhibition of the low-molecular-weight tyrosine phosphatase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 60
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jnuA00
3JPYA 2PUEA 4W5OA 4Z4IA 3RVJA 4EYQA 1RPJA 3SNKA 2GBPA 5TPZD 3A10A 3H5VA 2PUCA 2MSKA 2PUGA 3QLUC 5KC9A 2RJOA 1RXIA 2FEPA 3RVMA 1QO0D 1Z16A 5CNIA 3T6KA 3P9YA 5D2CA 4Z4HA 4MQEA 5KI6A 1DZ3A 1U2PA 3ILHA 3QEKA 4EGSA 1JDNA 3CFYA 3O74A 3OLYA 3QLVC 4ZYLA 3EJWA 3H1GA 2FN9A 3QEMA 5TPWA 3BRSA 4D74A 3I09A 3RVPA 2IOYA 3CU5A 5JNRA 1YK1A 3Q7SA 3ROTA 1TM2A 4KREA 1MAVA 1DC7A 3CLKA 3CNBA 1GUDA 4HYEA 5DLEA 4YP9A 1EWVA 1EFAA 5TQ0B 3F6CA 3KYIB 2IPLA 1DRKA 1MB3A 4G0PA 4MPTA 4JB2A 3T8YA 4H3HB 1D1PA 2A9QA 5B3JC 1RNLA 4EVQA 4FE7A 4RK1A 3MMNA 2B1JA 4OATA 5FWXA 1GCGA 4OBBA 3BILA 1Z26A 3M6MD 2GX6A 2YHAA 1QP7A 3I5AA 3MA0A 4Z99A 3FFTA 5IX8A 5TQ0A 3VNAA 3IP6A 2FLWA 4HNRA 4F3TA 2CHFA 2FEWB 4NICA 4WT7A 3OQNA 5EWMA 1ZGZA 3LKVA 5C5CA 2MYNA 1DJMA 4RSMA 3DLBA 1JHZA 4GPAA 4HNQA 4RXTA 3H1EA 4JAVC 4KK4A 3JPWA 4KV7A 4TLLB 4MS3A 2GWRA 2F8TA 5DKFA 1TVMA 4Z4FA 5T3YA 1RXEA 2Q5CA 3D02A 3LUCA 3LUHA 5KC8A 3TMYA 6ABPA 2M1ZA 4IMJB 5FWXB 1ZN2A 4RXMA 1QMPA 4Z4EA 3BBLA 4LE2A 2XDYA 1NXXA 3OLZA 1PNRA 1Z13A 3IDOA 4KVFA 3H6HA 5TPZA 1DCFA 5IEJA 3FDFA 4NV3A 4N47A 5JNVA 5JNUA 5C5EA 4DADA 3D8UA 3H5OA 3OLVA 1EAYA 3JVIA 1QP0A 1QO0A 4LE0A 2CD7A 1L5ZA 1W9HA 4UHJA 3NNSA 3OM0A 4KZKA 4RKQA 5FBKA 2R47A 1GUBA 2MYPA 1E6KA 1T34A 2FQYA 5TQJA 1NXPA 2QZJA 2P4UA 3QLTA 2JRLA 4G0MA 4XLTA 3HEBA 3HUUA 3L49A 4MR8A 4MS3B 4RV5A 4WWHA 4XARA 2F8SA 3ILYA 2NZVG 1GCAA 2E4YA 4W5QA 1LJLA 1ISRA 3GBPA 3CZ5A 5EWLB 3UKJA 2X7XA 3W9SA 1QPZA 1ISSA 1FFSA 1JYFA 3K9CA 3LOPA 4IMIB 3EULA 4MS4B 3C3KA 3H1FA 1JL3A 3QX9A 4RWEA 3TB6A 3OMXA 5JNWA 3JTEA 1FSPA 1JFVA 2PKXA 3CS3A 2HQOA 4ZPJA 3OLXA 3K4HA 2AYZA 2QR3A 2FW0A 3GV0A 4JP1A 2PL1A 4O5AA 1U0SY 4G0OA 1DC8A 1Y1LA 5DGCA 1ZITA 4E7PA 5HM6A 5IULC 1E2BA 1NTRA 3MM4A 3Q15C 4RXUA 1Z15A 1MB0A 4RY9A 3KSMA 1ABFA 1TLFA 2IPAB 4Z9BA 1JF8A 3G1WA 4WUTA 4Z4GA 2TMYA 4EYOA 2NT3A 1USKA 1NATA 5BQ3A 3B2NA 2HQBA 3IP5A 1U8TA 3O1JC 2MSWA 1U2QA 2FMIA 1A2OA 4YS6A 2W42A 4EYGA 2FEKA 2L17A 4KFCA 2JBAB 5HSGA 1AB5A 1VLZA 1BDHA 1ZAYA 2E4WA 4G86A 5CNKA 2L19A 3URMA 5EWJB 4JA2A 3EAFA 3TD9A 1LJUA 1AB6A 4YWHA 3H5IA 3KKEA 4B09A 3RQIA 5PNTA 1E6LA 1K68A 2B4AA 4KK3A 2NT4A 3JVDA 4OLBA 4RDCA 3HDVA 1F51E 4LDZA 4KMRA 3KLOA 4H60A 2WMYA 4XFKA 1EWKA 2QVCA 3N0RA 4TLMB 2P9HA 4KQCA 2FN8A 1DBWA 2JK1A 2E4ZA 3N0XA 3KHTA 4P98A 4YV7A 2ZAYA 3F6PA 2PE5A 4KRFA 2FMFA 5JS1A 3A0RB 1DRJA 3LUGA 3T95A 4ZMRA 1YK0A 1ZESA 3GL9A 1JH9A 1Z17A 3KS9A 1XWWA 3C3MA 5GQSA 4KPYA 1CYEA 2OENG 5BRJA 1RZRD 1KMIY 3RVKA 3GBVA 3HXMA 1JFTA 1DBPA 2R48A 4PICA 3HJFA 1FFGA 6CHYA 5JNTA 4PYRA 1YTUA 1GLGA 3I45A 3Q7TA 3HK2A 5KQMA 1YIOA 3DGEC 3HV2A 3RVNA 3IP9A 1ZY2A 3BREA 5ED4A 3LUFA 3S99A 2ID7A 1KRWA 3HZHA 2HPHA 3VNBA 4NCBA 1NXWA 3A3KA 4MQFB 1P8AA 1FFWA 2FQWA 1Z25A 4RZSA 4S04A 1PEYA 2MYUA 5ABPA 3C97A 4PEVA 1Z2DA 3OQOA 4YGXB 4W5NA 2JB9A 1LBIA 5EWLA 3HO1A 1BVHA 4G0YA 2QV0A 4F06A 1M2FA 2RJNA 4QPJC 2PUDA 4MS4A 5KQLA 2CWDA 2VUHB 1DP4A 3OLWA 4KNYA 1YVUA 1VPWA 1BA2A 4D6XA 2PUAA 3NNDA 1QKKA 3IPCA 4MAAA 3O21A 1OXBB 2FQXA 5HQJA 1NY5A 3NHZA 3OM1A 4PZ0A 2A9PA 1ZDMA 5TQ2A 4N76A 4EY3A 2IKSA 1M2EA 3RVRA 1APBA 5JS2A 4O1IA 1BDJA 2WRZA 4RY0A 4N0QA 4F11A 1ABEA 2WJWA 1TJYA 4ML3A 2QVGA 5FWYA 1VKRA 3R0JA 2IDMA 1A0OA 3A0UA 2VK2A 2A9OA 2QXYA 4RY8A 3FFWA 2R25B 4Z0NA 1ZVVA 2H0AA 3TO5A 2JBAA 4EYKA 4OG2A 3IP7A 3EGCA 3NHMA 3O2QB 4EVRA 5BRAA 3MIZA 5EWJA 1KGSA 2ID9A 1W25A 2IYNA 4N03A 3H5WA 4Q7EA 4MLDA 5HKOA 1VRVA 2LBPA 2FSPA 4MR7B 1DCKA 3F73A 1RZRA 2VUIB 5TQ2B 5CHYA 3EODA 3KLNA 2L2QA 3H6GA 4JOQA 4IRXA 5TE9A 2QW1A 1K66A 2WY2D 4E7OA 4Q6BA 4WXEA 3E3MA 3QX8A 2E4VA 1KRXA 1U04A 1CHNA 3NBMA 3KTOA 4IGAA 2FVYA 3MQ4A 1L5YA 3SAJA 2GI4A 4F12A 5FWYB 4UHKA 4RS3A 3N0WA 3O1IC 1JBEA 4MR9A 2WJAA 3HCWA 1QQAA 3CG4A 1M5UA 1JWLA 2AYXA 1SD5A 1P2FA 5JNSA 4QICA 3SM9A 3Q7RA 1JX6A 2WB4A 2PUFA 5GOTA 2KYRA 2NUBA 2PAFA 5IBQA 2WWVD 1NXSA 5T7BA 3I42A 4MGEA 4MRMA 3C6QA 1EWTA 1C4WA 4FB4A 1B00A 3N75A 4RU1A 2LUOA 3DGFC 3CHYA 3CZCA 4QYMA 4ETNA 3LUKA 3IPAA 2L18A 4RK5A 3M9XA 1WETA 2HQRA 2QU7A 2NZUG 4HNSA 3RH0A 1YS6A 4MQFA 9ABPA 4RKRA 2HJ9A 3GYBA 2MYTA 4XXHA 2I6FA 2JVIA 4MR9B 4N41A 3QLUA 4LRQA 4RK4A 1BAPA 2RGYA 2MSLA 4DQDA 3HUTA 5IUNC 1NXOA 3KCNA 1SXGA 1QP4A 3EQ2A 4EVSA 1DG9A 2FXIA 4TMYA 3QLVA 4L85A 2ZWMA 3QELB 4NQRA 1QNLA 3CKMA 4MRMB 4P1ZA 3SQNA 3L6UA 1LBHA 1EHCA 1USGA 4GNRA 3GT7A 2YHBA 5IC5A 3MYYA 4XAQA 2PLNA 4KQ9A 1Z18A 2RDMA 3CG0A 3JY6A 4IF4A 4Q6WA 2M98A 5DTEA 5FBHA 4G0ZA 3HDGA 2FMHA 1DCMA 3H5LA 4ETIA 3LKBA 4JASB 2FMKA 3F7NA 3N8IA 3NNNA 4G97A 5B3JA 2HSGA 3RVLA 3ROFA 5F64A 4TN5A 3LUAA 3C3WA 3Q41A 2IPNA 1C0EA 3UK0A 7ABPA 4MQEB 1YS7A 3EQZA 5I4CA 5E3JA 1XHEA 1ZHHA 1TMYA 4MLCA 4ETMA 4S05A 2FTKE 1LK0A 4EUKA 1D4ZA 3DBIA 3H5TA 4MYRA 3FGZA 3RVSA 3QEMB 1D1QA 1FQWA 5TPWB 4W5RA 4LX8A 1ZH4A 4PE5B 3RVQA 3JS5A 1I3CA 3OQMA 2J48A 1ZGGA 1E6MA 1NXTA 4YO7A 3LFTA 3O2SB 4D6YA 1JDPA 1PNTA 2PL9A 4MR7A 3FMVA 2PJUA 1PEAA 3HSYA 2GKGA 5DCLA 3N6VA 2JVKA 2V0NA 3H75A 2O20A 1YMVA 2JVJA 1CEYA 1D5WA 2FLKA 3DZDA 4RK6A 3OO1A 2PMCA 4OLAA 1ZH2A 4W5TA 4WZZA 1MIHA 5KWSA 2BGGA 2LP4Y 3HM9A 3RVOA 3G85A 1IIBA 2FKAA 3O1HB 1H9CA 1UDRA 2LIVA 3E61A 4N0PA 4LZLA 3OO0A 4O1HA 2DRIA 3CTPA 2CHEA 1BDIA 1D2AA 4IILA 4RK7A 4DN6A 4Y9TA 4NCAA 3GA5A 4ZMSA 4Z4CA 3O2JA 1PHRA 4FE4A 4LDAA 4QYWA 5EWMB 4CBVA 5BR1A 3GWGA 4YCSA 3LUDA 4WXMA 8ABPA 4ZJPA 1R8JA 1SRRA 2OQRA 2QSJA 4MS1A 3TX6A 4M88A 2N9UA 4H3KB 2JCGA 4F8JA 4YLEA 1P6UA 3O75A 4Z9AA 1JLKA 4G0XA 1JFSA 1USIA 3KYJB 1OXKB 3DLHA 3EDCA 4RK0A 1JYEA 5KQPA 4YRZA 2PUBA 1PUXA 5CNMA 2E4XA 4L4UA 3SG0A 2VYCA 2A9RA 3M9WA 5IUJC 5KQGA 3LMKA 2H3HA 3MF4A 4XASA 3N53A 5CNJA 3Q9SA 1A04A 1SXHA 1XHFA 2LPMA 3HS3A 3CRNA 1M5TA 3T38A 3KJXA 4OTZA 1J56A 1HEYA 3LUJA 1SXIA 5IUKC 3LTEA 1DBQA 1F4VA 2R4QA 1S8NA 1MVOA 1Z12A 3HVRA 3QK7A 1P6QA 1YMUA 3GRCA 5IEBA 3BRQA 3QELA 3SY8A 3OMWA 3KG2A 2E4UA 4MS1B 3UUGA 4LE1A 4JB0A 3FFXA 2IPMA 1NXVA 1Z2EA 1URPA 4MR8B 4YR7A 1QQBA 4G0QA
chains in the Genus database with same CATH superfamily
1F20A 3K20A 1L9XA 2WIAA 1SUFA 4HLUC 3L4BA 1I13A 4J16A 2BFNA 2XB2A 1J2YA 1C81A 3LT2A 2ZEJA 1NR7A 3TZQA 1L3CA 5KJCA 1QLJA 3U4QB 2PUGA 2XNDD 2VTDA 4QATA 3DV0B 4LBYA 4LRYA 2YV3A 3G2NA 4P3XA 1CJVC 2GZ2A 2HRBA 3M4YA 1RYYA 2BFPA 4HH3C 1UPTA 4Z4HA 2P1DA 3GLGE 1R4NB 3WGHA 3BORA 3ABOB 3LC7O 4R0NA 4R1NA 2W2MA 1RDFA 1XNJA 3JX9A 1ZLXA 1WABA 4P58A 1YZNA 5EJIA 4BTLA 3QPBA 5KJ1A 3UWDA 2WB2A 1O4WA 3IQDB 3QG5A 4NX2A 2YXNA 1CQWA 1LFDB 3RR2A 1SIUA 1U5CA 3CLKA 2WJYA 3W5SA 2VF2A 1NFFA 4CCYA 4PYIA 3SFZA 1AXRA 2GD0A 4X1KA 1CJTC 3NZEA 4DJJA 1SVOA 1GGMA 3UWKA 4DLWA 3I9JA 4KUGA 3GELA 3W78A 4CF4A 5B3JC 3LT5A 2GM5A 1R4ZA 1U0LA 1W5TA 1DJPA 4RHUA 3QNWA 3SF8A 2OD2A 3GJSA 4CM4A 5ESWA 3KVRA 3IHTA 3IA7A 5HE8A 3CPHA 3ZW9A 5HKKD 3B6JA 3MA0A 2HA0A 5CDFA 2VSNA 5A0FA 1X7WB 2B1GA 1PFKA 1L5GB 2YWFA 5FV7A 1R88A 1QHFA 4CM9D 1TKRA 2PH1A 1EEHA 3KOUA 4JVMA 4RELA 4R7GA 4EO9A 5KHLB 4DC1A 2OZLB 1JEYB 2W11A 1RVV1 2PL5A 4J0EA 2HDNB 4EWLA 2Q1XA 1I36A 3F5SA 7MDHA 3G6KA 4RLHA 3U80A 2CJXA 5HF5A 5AVOA 1RQGA 3TINA 3U16A 3HTXA 4CEHB 1DI0A 3PTLA 2VQSA 3UJ8A 2AQIA 3BB1A 3FCXA 4TPKA 4EHFA 4Z8YA 4UDNA 4G23A 4KV7A 5CA1A 1WBBA 3CX7A 1MLDA 4YRIA 2RHHA 4ONEA 4ZYTA 4FIDA 4DG5A 1KERA 4KFUA 2ZPTX 4PG5A 4Y2QA 1WKVA 3QP9A 1NSTA 4XOUA 4PSDA 1G8AA 3MCWA 1TYBE 3EXAA 4QWWA 4QLOA 1Y42X 1YRYE 1VHJA 2YWRA 3CUKA 4JWKA 3GLUA 2AJDA 4DIFA 2HC9A 4JQZA 4GUAA 4C6TB 3BBLA 4MCJA 4RETA 1L3BA 3UWOA 2EFGA 1A3CA 1EVQA 2W6CX 1H2ZA 4GG1A 1QHXA 1ZU5A 3UGTA 1QR2A 5CD1A 3QXHA 1K06A 2F9FA 1LQ2A 2PKYX 3A2NA 3A6FA 3F5QA 4IJWA 3HJHA 2OXFA 5AVYA 3Q7IA 1U7DA 3MS4A 1ZNWA 2QRVA 1B2LA 2SKCA 3JVIA 4KEAA 2Q6KA 5TEVA 1M8JA 5FNVF 2YN2A 1OX4B 1KAHA 3VO2A 4CM8B 1PP4A 4IHKA 2R1TB 3C24A 3INNA 1G7SA 1FLAA 5L8VA 4FKMA 3V55A 2FQYA 4NDAA 2J0UB 5D8DA 1MMFB 2H0QA 1SEPA 2GJ8A 1MZVA 1XCBA 2IZOA 3CH4B 3QTLA 2W22A 2OWDA 1OBFO 5B5SA 1DELA 3O6VA 4RV5A 1IFXA 3HRIA 5JPDA 1GCAA 1QZUA 3D0QA 2DFPA 3T9BA 4CL3A 4W5QA 1Y6RA 1L4KA 2GOYA 3USZA 2OTCA 2JDIA 1Y4SA 2PQ6A 2VHJA 3AFIA 1ZM3A 1QOQB 3IRUA 4BUCA 3IESA 5J63A 1E4EB 1M7BA 3L8MA 4J29A 1SCUA 1U8UA 3A9SA 2Z8YA 4UPEA 2SECE 3DW3X 3SQWA 5D1NA 3HDHA 1XZBA 4QPCA 1OI4A 2WD7A 2G08A 2H3EA 1SM4A 3I76A 4MV0A 4LUCA 3TX2A 2O7RA 3OU2A 1GXSA 1XP8A 4NCXA 3DMPA 1H2EA 3UHAA 2GAOA 2UXDB 4XM2A 4PO8A 4OHKA 4CMEA 1WXEA 3B9PA 3CISA 1WMSA 1Q1ZA 4DIMA 3A9WA 4HNHA 5BOSA 4QGGA 3U09A 1CUWA 1KAMA 4EX6A 3U6KA 4BXOA 5AW5A 5KYKA 4CF3A 4IW3B 1PFUA 2YWCA 2H1SA 4LC0A 3C3XA 2G0NA 2FKNA 3EC7A 1YJBA 3N2YA 3OKAA 3P0HA 3T7DA 1P5HA 3DFKA 1RBZA 4IVPA 3BS4A 3W3AD 5IZCC 1EHYA 4NV1A 2FEMA 5EYPA 1A2OA 2CVZA 1KVRA 3CWQA 4D3DA 4E5MA 5JU6A 1TUGA 1FMFA 4BDTA 3UUWA 4EBFA 3LHIA 1DKQA 1ZAYA 1QK3A 4OM8A 3A9TA 4NOMA 3EAFA 3SK0A 5IS2A 3IFSA 4KMOA 2REXB 3GP3A 5AI4A 5DEIA 3VAYA 2OG2A 4Q19A 4MXDA 3TS1A 2A0YA 4ATNA 2H1VA 1SKYB 4ARZA 4CMIA 3THXB 1N6OA 4DCVA 2P8JA 2FPPB 4YAWA 3RS4A 1QGZA 4H7PA 3GLQA 4X1IA 1EVIA 4O59O 4DG8A 1N1MA 3N0RA 2R6GA 2XA9A 5AKKA 5FIUA 2JK1A 3NEAA 4P5EA 4OQDA 1JEJA 3UJPA 4X9XA 5B6PA 3VDRA 3AEZA 3IALA 4AZ0B 5AVQA 4RIEA 1OX5A 1G5TA 4XUDA 5AK6A 4ROTA 2F4NA 3E84A 1JVBA 1RWVA 1V95A 1AC5A 4RD1A 5CCDA 3LY5A 2BM1A 8ADHA 1W581 1H8ED 3DVRX 3G9UA 3DBHA 3PUIA 4ZXFA 3ZQ4A 2ET6A 2ZT7A 1B3BA 3GDFA 2PS1A 3U9TA 1Q50A 3PGA1 3DE6X 1KYTA 3FWHA 4ARBA 4EDFA 5A1JA 3IOEA 3JATB 1P2BA 1G5FA 1MNAA 3DE5X 1IB0A 2Q50A 3LBFA 3N76A 4B48A 3HJFA 2IYLD 2P9CA 5JNTA 3JU3A 4G5YA 2YINC 3EPPA 4H6VA 5I9MA 3VU8A 3ZXXA 1MQSA 4YY3B 2ZDQA 3Q7TA 4D9GA 4HXYA 1NE7A 2QG9A 4PTYA 2BFCB 4OH7A 4QJBA 4TROA 3O2NA 4IGKA 3HLKA 3RREA 1EM6A 2ODWA 4D2IA 4LFCB 2WHYA 2QYOA 2R4TA 3DMDA 1VXOA 3ENKA 3H4IA 1CUHA 2JD2A 3HY6A 3NC1C 4PR3A 4Q4AA 2NQ2C 4X61A 5E7IA 4B7ZA 1ENPA 1KNXA 2GCOB 2XMSA 4XB6B 5AHKA 5BUQA 1AX9A 5DRYA 5DHPA 4ZEVA 4WN9A 4AQYB 2W71A 4NULA 4OI0A 3PYLA 3IQIX 2JB9A 1P3Y1 4Y2GA 1R1DA 3ZC3A 1BVHA 1NV8A 4O4IB 4KXMA 1YR2A 4MICA 4B74A 5AVSA 4CKYA 1S02A 4YMIA 1WCYA 3T3NA 3QH4A 3GROA 1GSOA 1YVUA 2VUSA 2WFLA 4LNAA 4OGFA 3NDPA 3DCNA 3AF6A 3RSCA 4X66B 2ZDGA 1VSBA 2YJ6A 3NHZA 4HFRA 3U7RA 1COWA 2CXOA 1ZXBA 3QMWA 4Y30A 5I4BA 2G1JA 2UVDA 3DKIA 1M2EA 4LOKA 3VKVA 3L8YA 1QVRA 1FS6A 3QEBZ 1K7CA 4IFBA 2FRDA 1S2LA 6NULA 3QPVA 1XEWY 3KQQA 1JEQB 3VHQA 3DHWC 5AW0A 4BV8A 1MB4A 3D3WB 3RB8A 2OAQ1 3BTOA 5FLEX 3AY7A 5A2GA 1VLQA 1XHLA 1VKRA 3MGCA 4Q9NA 4B2PA 1PNQA 4CEJA 1N2CB 1RM4A 2VDQB 4CGYA 2CZGA 2XZDA 3EDRA 3WA6A 3P26A 5HGXA 1L0BA 1NFRA 2WMOB 2XWSA 1QHNA 3B1XA 3BPSA 1A82A 3COYA 1DMRA 3GJRA 3NJ8A 2D1TA 4K9PA 4PHFA 1BVUA 1DWQA 3FB4A 1O5IA 2JBAA 1LSSA 4ZVSA 4QUEA 5T67A 3QI2A 5JAIA 1UKEA 1A9RA 2JCVA 3HWX1 2X1HA 5E8RA 1C4OA 4WKGA 4QUGA 4WHMA 1G98A 3RABA 3QHQA 2FZWA 4U2CA 3KVYA 1AA6A 3KB8A 5BT8A 2CLEB 4BC0A 5ARCA 3WQBA 5K99A 3OPNA 2J3IA 4CGZA 3NATA 4P3YA 4YLYA 4WBNF 4OHYA 2VNSA 1RQXA 2GDZA 3H6GA 4JOQA 3ZGNA 1K66A 3OOSA 2Z4RA 4UMEA 1CIPA 1CHNA 1M76A 3D7LA 3PQ8A 2CJPA 2B0CA 2YCLA 3DFMA 4N49A 3TYXA 1ADCA 1KF0A 3KFVA 3CVXA 1N0HA 1MAAA 1NVKA 3WK5A 4RW0A 3AW8A 4DJ5X 1KH3A 3C7TA 2O1WA 2PIDA 1KYXA 2GAAA 5G40A 3DVSX 4I5GA 4F3YA 1FK8A 3P9NA 3HB7A 1PDVA 4MKXA 4N0MA 4MB6A 1RYEA 3L1KA 3M83A 3CLUD 4FYHA 1RWNA 3LM8A 1RE1A 2AVNA 5DHAA 3UB3A 1Z73A 3AEQB 3ECAA 5T7BA 4U02A 3HEMA 2PVPA 2WABA 3IODA 2DOKA 3N75A 4HTFB 1WZ2A 1V3VA 1Q20A 4E15A 1LLDA 4IKOA 5CT8A 2ZIXA 4H4CA 4I50A 3TIXB 5EXDA 1TT5B 4QYMA 4V24A 4P0TA 2GSWA 2GN9A 3IPAA 4M9RA 3UMSA 2JFFA 4ZI7B 3SS9X 5I9IA 3IHWA 4CNQA 2ZRIA 3E48A 5JPIA 1VYUA 2ZBUA 2IF0A 3QNUA 4PGMA 4R6WA 2VJLA 3OOWA 4GOOD 4PYOA 5B2ZA 4DLXA 1SKMA 2YC2C 2IXTA 1PG5A 4OJQA 2A1TR 1QHEA 4PZLA 5B4TA 4F97A 3CUTA 3DOHA 2VXCA 5E2IA 2OCDA 3ZJUA 2VQEB 3PUYA 1F8UA 4GLFA 3IT0A 1SXGA 1AF7A 2HV9A 1NJGA 2PGDA 4YK7A 5BQ5A 4WZ6A 4Y0NA 5FJJA 5FH9A 1QP4A 1YR7A 3Q87B 4JI1B 3QLVA 3GAFA 3M4NA 1GSAA 1JHPA 3NO4A 1HLGA 1MPTA 4F9TA 2Q8QA 1KOLA 1XA3A 2ZUWA 1ZUNA 4MVJM 1DEOA 3EIUA 2VTBB 1RJEA 3Q7PA 1CY4A 2IZ6A 5DHFA 5DTEA 1E2QA 1QVVA 3QU4A 4ZHSA 3B9QA 1LUAA 2CMDA 2QT9A 3E4DA 1MQ9A 3BX1A 4LGVA 4O29A 4LIPD 3TSZA 2D62A 2O3UA 4FJ1A 5IKMA 4Z2AA 3H11B 4IZIA 5DM2A 3HA5A 4JEMA 4QG3A 4KPFC 5F64A 3D9QX 2RGNA 2WICA 2XKAA 2VPQA 3G5UA 3M49A 4WOBA 5KOJA 1QFSA 4NYJQ 2V3VA 3H3XA 1CUXA 3PDHA 3QKSB 2Y1XA 3JWPA 1F17A 5EJ7A 2DTEA 1CERA 2N3ZA 3EQZA 2F17A 5IT9A 2RD2A 2UXCB 2I3BA 1EP2B 2YICA 1LK0A 1XCMA 3GVCA 5CLIA 3UK1A 1FZTA 5E9QA 2J09A 3K5PA 2P35A 3KYCA 4J76A 2Z43A 5B58C 1QG6A 1IQ0A 1M1NB 2GAFA 3K9HA 1PZXA 2BZ1A 4BRUA 1GCUA 1VBFA 4GIBA 4LHWA 4F85A 4AJOA 4ZICA 1AQJA 3NOOA 4CHGA 4ER5A 2BTOA 4NZZA 1CR0A 3B6IA 2GK3A 4RWZA 1G9TA 2D0DA 4ZT2A 4UNNA 4PLGA 2G40A 2O0LA 1DAGA 1HORA 2NYVA 3MB8A 1U8YA 5CK5A 4XD7A 5B2FA 1LC3A 1WVGA 3T4UA 4E5VA 3CY6A 3WFIA 3HCAA 1AKWA 1E18A 2REQB 4XGKA 3T7TA 4EG5A 5ADVA 8MHTA 3A1TA 4M7RA 3ZJYA 1E1YA 1Z6ZA 4YCJA 4EPXA 3HBNA 4Y0VA 3OTWA 1C80A 2H51A 2QTWB 1RRKA 3G85A 5EJGA 4YFVA 1CQIB 2FUG1 2HRCA 2WTXA 4HV4A 2H2GA 2WK1A 3AUFA 3WK6A 3E5MA 4HEA1 4CLOB 3M1LA 3D3JA 3CTPA 1O2DA 1ZOIA 4N7RA 2L42A 4Q4JA 4LRXA 3OE4A 1IQRA 3E2IA 4Y9TA 1XF1A 5CH5A 5JFGA 2F6RA 2GYYA 3CH5A 4M8NE 4D4JA 4Z4CA 4E4RA 3ONDA 5CIQA 4G0UA 1N34B 1ODJA 5DSTA 3F8WA 4ZJPA 5EPUA 4NCHA 1GCOA 2BONA 3QJ5A 2I6UA 3SR4A 3BXOA 1S8AA 2EHDA 1J8MF 3I9NA 4ZVNA 1DAEA 1EFVA 1Z0ZA 2BR3A 2YV4A 4CMKA 2C7BA 2WNSA 4CCAA 2V0CA 1DADA 5CJJA 4Z9AA 3TNLA 1BOOA 2R2AA 1WIWA 4G0XA 4AJIA 4QQRA 1X6VA 3DLHA 1E79D 2VRBA 4KR3A 1I2DA 3TR6A 4E2ZA 5KQPA 3O84A 2HDOA 4MW1A 3RYIA 1CUCA 3GGJA 1QH8A 1JAHA 2E4XA 3KE8A 1Q77A 5A7FA 1DDOA 1U2GA 4MWCA 4QOSA 2J3KA 3GFFA 2DWUA 3DV0A 2J5RA 3RFUA 3F2IA 4C2AA 4V3CA 2BMAA 4HRYA 721PA 2F43B 2Y76A 2OBXA 3D2AA 4R8SA 3GJZA 3MILA 5C1OA 1HEYA 5DISB 3SS7X 1ADGA 1JPJA 1ZFNA 1P6QA 5EIAA 1NJ8A 2BISA 3GRCA 2OOKA 4MZDA 4AJKA 1QNFA 2EFDB 3Q72A 3QFFA 3WIUA 2FAXA 2HOQA 1MAUA 2W37A 1DKRA 3A31A 1HSOA 3DMNA 3UBMA 2C7PA 2P5SA 3ZXUB 5B1EA 4KL8S 1EUDB 5LP6F 3V9PA 2PUEA 3QZUA 4PYJA 1ZGHA 2WSYB 3L0ZA 3EZXA 3ZU3A 4Z4IA 2IHYA 2X0RA 4UPVA 4YV2A 1RRCA 1E99A 5F12A 1TVCA 5K0LA 3UTCA 3DP9A 3SE0A 1MKYA 1DAPA 4UE3S 3H5VA 1DUSA 3EDMA 2EJTA 2RJOA 3MD9A 2EEPA 4U00A 3RTBA 4MA0A 1BWSA 3RVMA 4KLZA 5IM4A 1TAUA 1JBKA 4RSHA 4YAOA 3RHSA 2RK4A 1UPAA 1OGYA 3D8RA 3BEDA 4L5AA 1ADBA 1X7WA 2J46A 1DZ3A 1G20A 4MWOA 5BSFA 5JO0A 5LYJA 2ZRQA 3W4JA 1N8SA 4NVRA 3E9QA 4OXQA 1BYIA 4ZYLA 1LD3A 4R2XA 4JH0A 1AZWA 2BP7A 3IDQA 4BU0A 2DTXA 4ZHQB 1UK9A 2F1JA 4CU2A 2HUPA 2Z5LA 3Q3EA 4CEHA 5C8YA 1IRIA 1CKEA 1KU6A 3LF2A 5FLXA 4AKHA 3SXJA 4CLHA 1T5OA 4ZO4A 4YP9A 1U63A 3DNPA 1JJAA 2CSUA 3PL5A 1RBYA 1P7VA 4LRUA 1A1VA 4ESEA 5EIBC 4MA5A 2RMKA 3WNDA 1XR3A 2ILTA 2Y9MB 4UUOA 3EDYA 5HIKA 1WTCA 3HA7A 4KCGA 3PVSA 2H5EA 5D87A 1DZIA 1NUTA 1XZAA 4KO3S 2JKZA 2GX6A 2BFOA 3WA7A 1UBGA 4X65B 4HEQA 2XT9A 4HBZA 2WWHA 5IX8A 1A4XA 3ESXA 4ZVTA 3WISA 3D3KA 5EMMA 3IRVA 1N2SA 3AUSA 1NUUA 2IY7A 3X1MA 1QZZA 3DL7A 2FPXA 2GCPA 1G41A 1RKQA 2P75A 4EIWA 1OX4A 3VVBA 4CM8A 2IYZA 3ES9A 1M72A 1DLJA 2R1TA 1C7IA 1BMQA 2VWGA 3FZNA 5I7FA 1XRNA 1R00A 4P7KA 2J0UA 2OSVA 3H13A 4TLAA 1V39A 1BWQA 4LSZA 1BFDA 4HGRA 4KK4A 2DQKA 4QA9A 1XNHA 2UVQA 4B31A 2GN8A 3VHXB 3FMFA 3MWKA 1FW6A 4HAUA 3QQPA 4Y6QA 5T3YA 1YBAA 3LUCA 5H5JA 1S5PA 2O8VA 3VZBA 4NRDA 3HYLA 3WMFA 2YS7A 1KI6B 1XG5A 4LPSA 4EG6A 4UHEA 4C76A 1QIKA 4WMLA 1P2TA 1TU0A 3GZNB 3M3HA 5MGNA 3EN0A 1E4EA 1QMPA 1KSHA 3L93A 4LHXA 3U3OA 3MRTA 4HRAA 3ZLUA 4CIDA 4OJMX 5K09A 3IDOA 3NG1A 1C30B 4PZUA 5A7HA 5ALWA 1NT4A 4YP5A 2H1FA 4NV3A 3PITA 4Y9UA 4RKYA 1LV7A 2H2DA 5JNVA 1O96B 2PZMA 3RE1A 1I4WA 4IZ6A 2R79A 2GJKA 4X7MA 2AXNA 2P9QA 1M9NA 1VLHA 3G2OA 3IHKA 1KY5A 3NWEA 3DMTC 5BR8B 1E66A 3N28A 4X1YB 3K05A 2CXSA 2XHEA 2CL7X 1RHRA 1SHKA 3GIWA 1H4TA 5GJWC 4UOEA 4JI4B 4JBNA 3PFGA 2QF7A 4J7AA 2CGEA 2MMCA 1HYBA 3A37A 3BFJA 4P3PA 4TWJA 2AHRA 2F7SA 4OAQA 4XX1A 3T5CA 2P40A 1UF9A 4UNPA 3ENNA 3LWDA 1LPAB 1S7CA 3GR6A 2Z2XA 5ALDA 3R40A 4C4SA 2VH1A 4H7EA 4DMCA 5BN3B 4FFVA 3OFVA 5B30A 5KNDD 4YRKA 5JZVA 4KODA 2VHCA 1OCEA 1O94C 2CLDX 1Z36A 3CNLA 3QX9A 5AICA 4PM4A 3P2OA 2VJBA 3AWIA 3DM5A 5THKA 4EHDA 5JLJA 3QE0A 2AQ8A 1X7ZA 2JLYA 4DIOA 2Q9UA 3PLRA 1W2HA 3EXG2 2Q7DA 3GFOA 2ZAIA 1D0IA 2VPTA 4UXHA 4ZQHA 1YJAA 4ZCRA 3JRWA 2AFIA 4Q9KA 4O63O 3PDUA 3ZBPA 2C5SA 3E82A 2IXFA 2VRCD 2YWBA 1A2QA 4GP7A 3KSMA 5A3SA 2E5WA 2OO5A 3ZHQA 2JFQA 4L6CA 4JKYA 1N2BA 1BEZA 2EKPA 3A2LA 4TGLA 4R1PA 1USKA 3NT2A 4DV4B 1T3HA 4AZ0A 3C8DA 2VZ0A 1T9GS 2I71A 4L8WB 4FFMA 1YHZA 2C2MA 2LCIA 4FMDF 1ZWLA 5IW8A 3WMWA 2J3LA 1Y6GA 3FTDA 1T3TA 2YYAA 5KYUA 5T8KA 2WC1A 4PSKA 3B5IA 5DHRA 2OZEA 2YWDA 1KQNA 2E4WA 1LK7A 1ZMOA 1L4HA 4D56A 1T43A 5HIAA 1AD2A 4ZI3A 2YMQA 3R3ZA 4PC2A 4D92A 1ITZA 1YQGA 3ELBA 4QDUA 4KQEA 1SEVA 5LQMA 1NNEA 2EFYA 3PNOA 3QPWA 1LF5A 2WTEA 2XUAA 1ZJZA 2QRJA 3JVDA 1RHQA 4ASUD 2OVBA 2BFCA 4ZAWA 5B4UA 3FW1A 1RZ3A 4FX5A 3ID6C 3CYFA 3KR9A 1YT5A 1WM1A 3G49A 1KMCA 2XODA 2DYKA 1DC6A 3CRMA 3IVAA 3IVXA 1G59A 4JT4A 1XU7A 2JFXA 2OCGA 4QODA 4EKGA 3TXAA 1OAOC 1BSVA 5JJBA 2BSQA 3WHLA 4WD3A 1IJBA 2BFMA 5CDHA 3NR2A 4ZN6A 2HDWA 1HT3A 2NNLD 3OFJA 1RAIA 4O4IA 3MUFA 4AMBA 2ZB4A 2DR2A 2W2NA 1ONPA 1KMIY 1U6IA 5BV1A 3W5AA 4ODIA 5F7ZA 1BTOA 1THTA 3RRMA 3TTVA 2O05A 2QIOA 2V7VA 3NALA 3O8CA 4V2IA 4PYRA 2YDYA 3OJWA 1J7JA 1J8DA 1SVKA 3VH2A 3BKWA 3WLSA 3L0CA 3I45A 4EJMA 2A5JA 3IIMA 4BP3A 5LMCA 2ZRFA 3KXPA 4LZOA 4RIHA 1E1DA 2XXBA 1O0CA 4RL6A 3A28A 1WZNA 3S99A 1RLUA 1L5RA 2FSSA 3M81A 4GKBA 2ZSFA 3MAGA 4XLZA 4Z7OB 5IKXA 4TMVA 3H18A 1JEQA 4K1LA 5J4KA 4LZWA 2VHUA 3FVRA 3KP1A 2Z6QA 2Q4OA 4P34A 1YRBA 1TZMA 4WXHA 5AXAA 3VO1A 3B20A 5HWSA 5K3EA 1JHAA 3TZLA 4A92A 1N2CA 1KBQA 1RCTE 1GA1A 4BVJA 2B69A 3IMGA 1W85B 1P75A 1LBIA 4DARA 4CT0A 1GZ4A 5G1PA 3TN7A 4KQGA 4Z49A 1C3LA 4QPPA 3ZDEA 1E2DA 1E1QD 2OB1A 5LU9A 1GPYA 3EC2A 4KO8A 2Q46A 3KZMA 4IIHA 3IA2A 4DEXA 1ORRA 3DFIA 1FOEB 3NHJA 3WWCA 5HVNA 1GPMA 3ZWCA 3P9ZA 2NU9B 3EPJA 5LP1A 1N8KA 2EYQA 1EVYA 3CWCA 2FPGA 3CNEA 3DA8A 3EVNA 3GQBA 2VJDA 2R7KA 3HZZA 4GEGA 4GM1A 4PNZA 3TXYA 2FUKA 2VK4A 3O3MB 4C29A 5AVVA 3ABSB 2IHKA 2PJDA 1UQRA 5JBIA 4BV9A 3RVRA 2VO1A 4P92A 1E7RA 3HNRA 4HLNA 2Q1WA 2ATEA 2C3PA 2JJQA 2QL6A 4HL6A 1B6RA 5DT9A 2ZJ1A 1R0LA 1N78A 4BFXA 5DTMA 4Q18A 4P2GA 2HU5A 4BO4A 1F48A 5L7TA 4DB4A 2DR3A 1YB2A 4KVGA 4DWVA 2YKGA 2DUNA 1VGQA 4R1MA 2CFIA 2W48A 3GRYA 2WPDA 2PSSA 4MVJD 3NBUA 4C08A 2XB8A 1W5BA 2ID4A 3QPCA 3HU3A 4Z0NA 5G3ZA 4ENSA 4OG2A 2BHNA 1E1KA 1ECLA 1PWEA 3GCZA 3K6RA 3FY4A 3O2QB 2FZEA 4II7A 4L9RA 3AEQA 4H08A 1UWKA 2GD2A 1HV8A 2JATA 2B20A 4UMVA 3VAAA 3H5WA 3R4VA 5K1ZA 1CBUA 4P54A 1JG1A 4AX8A 4HTFA 4YMLA 2H7CA 2PTGA 2LBPA 2NX2A 1DXQA 3C0KA 3DJYA 4I6JA 5JQGB 1YTLA 3H83A 3W5UA 4GXRA 2XE7A 4MAFA 1WV1A 3BJZA 1QHHA 1TT5A 2VDKB 2IHUA 1A77A 3L7MA 4F8EA 3W1WA 1JIVA 3C14C 2QMYA 3QX8A 1RRGA 2VK8A 4E94A 4ZI7A 5LMZA 4YREA 3HXOA 2CSXA 2GBLC 1PBNA 1CUSA 1V7PC 3OIUA 3NYWA 5FWYB 5IASA 2VCHA 1QVAA 3FF4A 2M6LA 1C3OA 2V4MA 4PZ9A 4R2IA 2QX8A 1M5UA 1K6IA 2VJPA 2WVJA 4HXFB 4LC1A 4LSMA 1G5IA 1RJ9A 4QICA 4HVTA 4BKPA 2GMWA 1FNBA 2ZTVA 4JJKA 4X8OA 4YDQA 3DZIA 4KQ6A 2J9RA 1VPTA 2QTRA 4NPCA 4OMDA 5BURA 1P0MA 4IJUA 1NNUA 1NTOA 3EY9A 3R9WA 3E9RA 3TLMA 3WLHA 1LC0A 2PM8A 3U7QA 1NVTA 1JXQA 1YDGA 2VJMB 3ZEIA 4IJVA 3QU9A 4CV1A 3AOEC 4KWEA 4ZKDA 4OQQA 1QJ4A 2AMYA 5B1IA 1HURA 1B00A 1W88B 1PVOA 4XWGA 2AWOA 3PQEA 3U60B 2DB3A 3N8HA 3V8RA 5I9TA 4GU5A 5EP2A 3QV2A 4G89A 2I87A 2IEGA 2OFOA 3LUKA 1V7ZA 1UBRS 2Q1YA 4PRYA 3I32A 3H11A 1GA6A 2AZ4A 2QD1A 4YPFA 1YSCA 3TFQA 4OYYA 4KQKA 3Q0TA 1M34B 1XRJA 1EMDA 5CPFA 1V9CA 4MVCA 4B3SB 4GP6A 2BSAA 3TK1A 1XGKA 2Q3LA 2R68A 2CNKA 2IPOA 4KPUB 3TQOA 5KTMA 1NKSA 2B4KA 4YJKA 4EY8A 4IMRA 3QA9A 1JKIA 2J7PA 1OPRA 4F38A 1Y0BA 1Y1KE 4RULA 3G82C 2ZSKA 1E6CA 4MAMA 3PF9A 4Q7LA 4R83A 5DM60 2FJPA 1OD6A 1OI2A 3MQFA 2B7CA 4L85A 1GKYA 2H9IA 1S96A 4PFSA 3OIFA 4LZZA 3NCHA 3PD7A 1IDN1 1J42A 3OLCX 3RAPR 5AHOA 4EJSA 1E4YA 1F38A 2ZITA 1QYIA 1BRTA 2V59A 5E9JA 3WMXA 4EA9A 3QSYA 5BUCA 3LXXA 4Q4HB 4D9JA 2DQSA 1J0XO 5IDWA 1QTQA 5DNEA 4QUIA 4AKTA 1E2UA 3UPDA 1NRIA 4Y2UA 1VCOA 5BXYA 4M0UA 4S0XA 1YUBA 4LQLA 3EF3A 2EAUA 2JFOA 2X13A 3BK1A 2Z0MA 3IPRA 3ROFA 4Y6OA 3ZU2A 4TN5A 3PVCA 4K6GA 5EP4A 3WWZA 3C41J 2YVKA 3SZMA 4AZTA 3HJUA 4I81A 2VQ3A 4FYWA 4N5DA 3QIAA 1CQIA 4EZBA 5JT1A 4MJLA 4ND7A 4BATA 2FSVA 3NM5A 1C3VA 3WP1B 3M5WA 2WJ6A 5BQXA 4CLOA 5FEUA 4MLCA 3RU2A 3ZS8A 1NOKA 3JTMA 3RAJA 1RAEA 2PGXA 2YWGA 4KLCA 2EZ8A 4MYRA 3QX7A 4BO0A 4Z54A 1ODSA 1P9OA 3QUSA 3G0CA 1GQ2A 1YOVA 4QVIA 4U1RA 4M38A 1DOZA 3DLPX 4BAGA 1RKXA 2P9ZA 4FDVA 4URWR 4JL8A 3IKLA 2J59A 4KITB 4LZPA 3O2SB 4RA6A 3DDZX 5FR1A 4C04A 3AYXB 4DLVA 3HSYA 3O9VA 3QV1A 3DAHA 4FEGA 2ZTUA 5D00A 5DCLA 3Q8LA 4FEAA 3TOZA 2QYSA 2BHLA 2JVKA 4RF5A 2A5FA 2A78A 3B1KA 3H75A 2O20A 1LBQA 2OHFA 4K1XA 4PG8A 4RFSB 4ZGWA 3F74A 2C5GA 2GZMA 1Y8RB 5TMBA 4AYTA 3DMYA 4BFUA 1F3LA 3QEAZ 4CCSA 4HUQB 4UBLA 1BEUB 4JB3A 1PLKA 1WMAA 5IU6A 5EIHA 2FYTA 2DQZA 1NONA 5LP6C 2F43A 1MGOA 2OZPA 3V1YA 2GJSA 4XPZA 5I48A 1TU3A 5D5PA 2PZLA 2A86A 4PLCA 3NYQA 2EF1A 2AN4A 3DYBA 2PG3A 3PKZA 4HGNA 4YIHA 1BNCA 1HFWA 4O4HB 4POOA 4WXMA 3WK9A 1KYIA 3TQHA 5CDGA 3MT7A 2BZGA 1Q22A 3HKBA 5IK2A 1OFHA 3M6FA 3O4GA 1EX7A 2PD6A 1NYRA 1ONOA 2JCGA 2ARKA 2OD9A 1EUDA 1TM7E 1Z5NA 4NENB 1JTEA 3VV3A 5EI5A 1EB9A 2GARA 3R3UA 5KYNA 4NEGA 4IG9A 2HB6A 3D64A 3H9JA 5J2UB 2WJGA 2BEUB 3LVRE 1IDOA 2Z6UA 4UCQA 5KIAA 5KU1A 1MRSA 1SOAA 2J5KA 3AXTA 3KX2A 1D2CA 1OZ0A 2QPLA 1G3IA 2WD8A 1ZKMA 5J47A 3OJOA 2BF7A 2O2XA 3MGBA 3DUFB 3LNCA 3MF4A 1L7VC 2YIDA 3B48A 4FMPA 1XA4A 3UGKA 4MVJE 5EIOA 1EIWA 1RJDA 2IYVA 3S40A 4ITRC 3ZDXB 4KFTA 1A97A 1EFLA 4UVEA 5K3DA 1D1TA 1UPUA 2FRVA 2Q3EA 3NTLA 1YZ3A 1DAIA 2YJNA 1VG0B 2QN8A 3SZOA 5KKCA 3BRQA 3A4YA 1CZKA 2WMNB 3FLBA 5EGNA 4Y1FA 4MS1B 1KBOA 3KJIA 1SC4A 2B98A 2ZPAA 5BRNA 4DLLA 4GGPA 4ZDKA 3QPUA 1P4GA 3COWA 2IEBA 4B5LA 1XZNA 3RF6A 1EK0A 3B36A 1RACA 1SKUA 3HSKA 2KB0A 3EEYA 5IAJA 2A4MA 1JS1X 4CG2A 4K8OA 4ZKEA 5TMEA 4WXYB 1TJ5A 2D0IA 4ESHA 5K01A 1D1SA 4PN3A 3MHTA 4LZNA 3SX2A 3CZAA 2NZ2A 4JUDX 4N7JA 3SP1A 2ZWPA 1O8BA 4DCJA 2CBZA 2JJ1A 4GZMA 2ZANA 4LHEA 1E5VA 1A95A 1R9MA 1YE8A 2F3PA 3ILHA 5C4IA 2XRZA 4HG2A 4WX2B 4RVDA 2RARA 1DTWB 1SBCA 4N5HX 4KXUA 4C0QC 2A0WA 4RTMA 5JS6A 4I4TA 3STHA 1U1DA 1P2DA 2AV6A 5DPMA 1UIMA 3CU5A 2BFFA 5JNRA 4DA0A 3HNPA 5K8CA 4Y2TA 1YB5A 2E48A 4MVYA 1B7GO 3H84A 2JDID 3EEBA 4V39A 3SVTA 1VIMA 2HGSA 2R97A 2XOEA 4KDRA 2YR0A 2PKQO 4ZOQI 3IBTA 4HJRA 3IUSA 5AOCA 5FP0A 3VHXA 8AT1A 4ZP1A 3UICA 2FWRA 1JJ7A 3SE7A 1MD9A 4HS9A 4ZV4A 4FGZA 4MX8A 4JFAA 1ZA1A 2VIIA 4XPIB 5HJ2A 2C0PA 1NLZA 2WYIA 2PUFA 1P19A 2ZT6A 2ZQZA 2FPLA 2I78A 3GZNA 4OAOA 4WW0A 2PX2A 5FOVA 3RK0A 1T1JA 3MMXA 3KZXA 7YASA 4ITUA 3WE7A 4MDFA 1NQUA 3DDUA 4PC1A 5C8ZA 2H2AA 3AC0A 5JAOA 1TGYA 4FD2A 4IVNA 2Q3FA 2POQX 3MXOA 3OQPA 2CHFA 4DDHA 4CKCA 2CV1A 1NL3A 2XYRA 5BNWA 1RZUA 2D00A 2QEQA 1RD4A 4MRRA 2ZUTA 5JMOA 4FW9A 4ICIA 4J1NA 3EIEA 4JP2A 5C5CA 4C87A 1IXRC 3VPCA 3UAOA 4WCFC 2I2CA 2JLRA 2BGRA 3E70C 3WMRA 2C31A 5ALEA 5BW4A 3FBWA 4RD3A 1FRFS 4J3FA 3H1EA 3DDWA 5JROA 5LZ2A 1SKAA 3B38A 1OBVA 1O3YA 4ZCIA 2QLTA 2JPDA 3K31A 2XTJA 1B1CA 1U7ZA 4K9RA 1DGQA 1ISMA 1U0RA 1ND5A 3K8OE 4GWLA 1QOPB 3SEZA 4Q39A 3URKA 3UUEA 2E49A 5LFAA 3L8FA 3MMSA 4OA5A 3SIXA 1ZC4A 2XDYA 3A3NA 1D2GA 2WVHA 2XCUA 3RRZA 3WWEA 3P9QA 1FFDA 1N7IA 3N7AA 4OA8A 3NWBA 2ZVPX 4KGVA 4LDRA 2VA8A 4UBJA 4CL0A 2P67A 3KDAA 5AM2A 1XTBA 4E5UA 2ISQA 4A23A 1FS5A 1C0KA 2DKOA 3ZYZA 1T24A 4M8IA 3RWMB 2PH5A 4JV5B 3W8NA 2CD7A 1FA9A 4PRZA 1YL5A 4JLWA 4BEWA 4PX9A 4BHTA 2QZSA 4N5IX 1U80A 4OK5A 4CETA 3AJ9A 4EFKA 3AP2A 2XADA 4C89A 3HUUA 3ZGYA 3V8VA 4LJ4A 3LQKA 4KDFA 1SD2A 1WZEA 2I03A 3BFPA 3IR7A 1DWUA 2E4YA 3I2IA 1T1RA 1JA0A 1KWKA 3KD3A 2OGUA 1P1RA 2DTDA 3F97A 2HU7A 3A4NA 4HHEA 4E11A 2BVNA 2XOKD 1OY1A 1WU7A 4N3AA 1ISSA 1FFSA 1E7WA 4FOLA 4FDMA 4OPMA 2ZAMA 3OEED 4KUHA 1FE8A 4MS4B 3G2PA 4QG7A 5EOVA 2NAPA 2OHVA 2BWJA 2X5OA 2BZSA 3FRHA 3Q5EA 3DB1A 4A7PA 2HYDA 5FTMA 2AYZA 2QR3A 3SSAA 2ZRHA 3FYTA 4A0GA 2B4RO 1ZZGA 2JGMA 4ISCA 1KP2A 3VOSA 4O5AA 1ILWA 1NR5A 1Y1LA 2Q28A 2YJ4A 4JOSA 5HM6A 3FPBA 2YOGA 3SDBA 5BUSA 1G2QA 1SQ5A 3TZBA 1LTQA 4TT8A 2BGWA 1Z15A 1I6MA 1T25A 2YQ4A 4MV7A 5INTA 1EDBA 3LX4A 4PC3A 5A05A 4C6HA 1WXDA 2Q7XA 2O6LA 4QT0A 1ORIA 1Q0HA 4C3OB 3TF5A 2I6GA 2CBGA 1EM8A 1RJFA 5DN6A 2NQTA 4OHWA 1E3DA 2TMDA 4CF5A 3C4JA 3S1AB 4BU1A 1K5GA 1QCDA 4Q21A 3QUTA 1UK8A 5DYIA 1QYRA 5FHRA 2W42A 3OZFA 1YAJA 1R0CA 4BQRA 1HDCA 1COWD 2DM6A 2J3DA 1R5JA 4Q3EA 1E8MA 2WSIA 3MBKA 4YRFA 2EC5A 3URMA 2MSDB 3M5CA 1DFIA 4EHIA 1QSGA 2DHQA 4MYUA 3I6QA 3ZV6A 1RAFA 2ACKA 2X8WA 1EU1A 3OCVA 4OI4A 4BMXA 3V4RA 1L7AA 3BXHA 4HAOA 1VYVA 4NZOA 4L08A 2X0JA 1NJ5A 5ICGA 2VXBA 2J3HA 3ITDA 3ZE6A 4B3FX 4OLBA 3GJ5A 1E58A 2ATXA 4RHCA 1GZUA 2JFHA 4BYGA 2VJYA 1KPGA 4FN5A 3FPLA 1VJ0A 3PDCA 5C52B 1KJZA 2PCLA 4QUKA 2ZU0C 2C29D 2P9HA 2W2TA 2FN8A 3CEMA 1UL1X 3L4EA 8OHMA 3N0XA 1YR8A 5MFPA 4UJ5A 4FYJA 2ZQYA 3K9BA 4JI8B 1GPNA 1QFXA 5ES4B 1J5EB 1BROA 3LUGA 3Q2IA 4O4JF 3ANTA 2JCXA 3E8MA 4IOLA 4AY4A 1J06A 3D5TA 4IEFB 5JWRA 2G4VA 1CUYA 2QW0X 3GJTA 1XWWA 2C8KA 3OIGA 2BFDB 3U6BA 1F5NA 1AK2A 2EYUA 5DDIP 4PBTA 3ZD7A 4Z53A 1DARA 4ILEA 2FF5A 1JUDA 1S0UA 3LW8A 4JYCA 3H99A 4MHSA 1XLVA 4RV9A 5FPPA 3S81A 3VISA 2R00A 3VOTA 5FTWA 1G19A 2NU9A 4K6MA 3W4KA 3K0CA 2ZRNA 3TQTA 4BMSA 4QYTA 2IBSA 1NXQA 1PK8A 2C61A 2FZCA 3FPHA 4BNJA 4LGYA 3MCUA 1CUAA 2HT6A 4BO5A 4AUMA 3SR0A 4E33A 2ATCA 4J0JA 4B0PA 4F4FA 1HE1C 3C3PA 3DWFA 4C7JA 2SKDA 5ED4A 3VRHA 2CK3A 1W29A 3VSAA 2PH3A 1Q2UA 4PF1A 1A9PA 1F3OA 3PA8A 1M66A 4I1RA 3TTYA 1P7CA 2WM3A 1YI0A 3A36A 3DO8A 4WN3A 3RK4A 1OBOA 3N6XA 2R65A 3CKLA 2VDUE 3C97A 2WKRA 4IV5A 4P82A 4WZAA 3SR3A 3HCDA 3U3JA 3SPXA 1P4HA 4DT1A 4UBOA 1T9ZA 1XZQA 5DCWA 5B1HA 1MPXA 1J22A 4GOXA 5ANRB 1H4QA 3O9ZA 3JARB 4QPJC 4K6HA 3UAVA 5IT5A 1PL0A 2CWDA 4RTPA 1DP4A 1XMSA 2FPUA 3I6IA 3PNPA 2WYHA 4L4ZA 4Q9LA 1GILA 2BBTA 2XAUA 3WV5A 3OOHA 1K7XB 3BJRA 2CDRA 3GUCA 5JCZA 3O21A 2H6EA 5TLSA 4XRGA 1SXQA 1SCQA 2ZUUA 3NHBA 1M54A 3FBGA 2J41A 3AF0A 4QOGA 4UMDA 1U8EA 2XV1A 5CT5A 4DUPA 1TC1A 2NU7A 3HU5A 2IH5A 3QG1A 2BLLA 2ZKIA 1BE6A 5I5GA 5JS2A 3D4OA 1ZCBA 3NHWA 3MJSA 3WRXA 4RSGA 1K1EA 2AN1A 2JGLA 5C0OE 3FMPB 4BFWA 1OT3A 2FU5C 3KPJA 4L5YA 1VCMA 1WDMA 3BMNB 2CZCA 4QUJA 5FWYA 4I9UA 5K8VA 3HM9A 1AJEA 3O0TA 3R0JA 3WL6A 3G79A 1M73E 2IDMA 3HMKA 3K4PA 5I4KA 1BKSB 2JGDB 4RY8A 1DTSA 1F4PA 1ZYUA 3TLCA 1N92A 3N8DA 1T0PA 4MDYA 3SSNA 4ZK6A 3HR4A 1QTRA 1ZG3A 4LJ5A 4ZT7A 4HO1X 3TOVA 1ML4A 1W44A 2VJMA 2X9VA 4G3XA 4TV9B 4Y1RB 5JI3E 4U7PB 4YIKA 1JR3A 5JADA 4ZCLA 4QDXA 1C3EA 2CCKA 1FQJA 5AUOB 1HL3A 3AVPA 4M6WA 4MEJA 3QVJA 1MF7A 2IU4A 4ZOBA 1KSGA 1RYNA 1CY6A 1CZRA 1I80A 1BYUA 5F3DA 2PZGA 3KOMA 2RGWA 5F77A 1H6CA 3RUCA 4C0WA 5IHXA 5JDIC 3I9V1 3IOBA 3QBVA 3ZHCA 1DX9A 1ADYA 2NO0A 3CEPB 2EG9A 1HDYA 2FVYA 1L5YA 2W0MA 3KTOA 5CPBA 3VJKA 4ZHQA 2WWFA 2QVBA 2Z1MA 1MH1A 3KPWA 3O1IC 3VTKA 3V4LA 3EVBA 5MGBA 2PXXA 3B5JA 2GEKA 1HG0A 2FPIA 2NNWB 5I9SA 5G4LA 1U7PA 4KPUA 3FPGA 4EKNB 5DJ5A 1SD1A 3K2EA 2QV7A 3OFSA 1UJMA 3SM9A 3R3HA 1WVMA 1NYLA 2WFMA 4UQLA 4R98A 2QPTA 5EZYB 1N3YA 2D5BA 4N65A 5FUQA 4DABA 1S2MA 2BGTA 2AR0A 4DXHA 1KH1A 1JHVA 2P3LA 1P3DA 1MJGM 1SNYA 2G7ZA 4JOCA 4MQLA 3R0XA 1DG3A 4PXAA 4XD7D 3C6QA 4B3XA 3LWZA 4E07A 1W52X 2O4CA 3LLVA 2ODEA 3THRA 2LUOA 3RAFC 1BJTA 1I30A 1Y5MA 3U13A 4BO9A 1IXYA 5EIWA 4Q4HA 4CEIB 3A6GA 3HM2A 3KELA 4OGLA 3OX2A 1DIBA 4QARA 3TXXA 3EFHA 3NTQA 4G1UC 5KNCH 4EG7A 4IFIA 4RPIA 4NPHA 4YNBA 2WIGA 4OI1A 2I4NA 2ZS7A 4E2XA 2OZVA 2UYGA 4HXGA 4QTXA 4U7GA 3V4OA 3GMDA 4KBYA 4D8YA 1G3UA 1V8OA 4V03A 2JVIA 4B3MB 3U81A 1PEDA 3L6CA 1X7XB 1QRAA 1UM9A 3PJDA 5AI6A 3H8VA 3BH7A 3RG2A 4BB9A 1ZGAA 3MGAA 1VB5A 1CUIA 4KGXA 1SELA 3GLFB 1IOVA 4XIGS 4FZVA 3NI2A 3CH7A 4LI0A 4W1RA 5KJEA 2PFKA 3SZRA 3EQ2A 3QY9A 3I2GA 3GHHA 1KZ1A 4BCCA 5CYOA 1T5TA 4TZKA 3RLIA 3HLYA 4D82A 2R8PA 2IY9A 3ZD6A 3TR5A 4BAUA 1VI6A 1BMTA 1O89A 1E3IA 4HWTA 4JSTA 4MQ4A 4QO7A 5E4JA 1XQWA 5HKBA 2AN5A 5JBQA 4ARVA 1E1LA 4OVKA 2EFHB 4ADSG 5AW4A 4HGPA 1QANA 2H57A 2QLLA 1CNEA 2HMUA 4U2FA 1SB9A 3CLVA 3VR4H 4XD2A 3PK0A 2IYYA 2CJFA 3H5LA 4PS1A 2FMKA 4G97A 1RKUA 2JRCA 1Y8RA 1ZICA 1NBOA 1K6JA 1A9OA 2OPHA 4DYHA 2IYQA 3DFFA 4YAEA 1WPGA 2BFWA 3AM1A 4KV9A 2X3UA 3GPBA 2R6AA 3MAJA 2RH9B 3VMMA 4NJMB 2YFHA 1Z0JA 3TH5A 1TMYA 4UZSA 1JLHA 5B58T 3A05A 4D0RA 1DX6A 4FWIB 3EG5A 5EMLA 3LO5A 3FJ1A 4EFLA 3IUYA 4W5RA 2DWCA 3RJ9A 1KJWA 1KAOA 4C5CA 4U7JA 3ZNOA 4GW3A 2ZYGA 1L5VA 2P4QA 2RB5A 3CB2A 2GXQA 2GPJA 3FMOB 1CVIA 4YO7A 3LFTA 4GPIB 2X7JA 1TUBB 3H7AA 3QKTA 3E8XA 1SQFA 4U0JA 5AW7A 4LTNA 3ITNA 4L0QA 1DIHA 2VTVA 1XP5A 3OD5A 4DUYB 1M6NA 4PHHA 1A9TA 2ZSIA 1YZVA 3DS8A 2GEFA 2C2YA 4GBMA 3F6EX 5J2UA 1NASA 2B3TA 2BEUA 2R8ZA 4JUAA 4RNDB 2X0DA 3TZ6A 4DSZA 3E7WA 2W2KB 2QLBA 3W90A 1H9CA 3DUFA 4J0QA 2WQ7A 2RGUA 1R6VA 1GN8A 4ARAA 1PV1A 1H65A 2JI6A 4BVGA 3WYEA 5TQVA 3ESQA 4KR6A 2WKQA 1A1SA 1SFRA 4LCBA 4X00A 3W9YA 3M5PA 2YY5A 3GA5A 3QENA 3ZQJA 2XKKA 5EWMB 4W8HA 4OBWA 1L1FA 1FUIA 3HADA 2A4KA 4FT2A 3AR5A 4AP6A 4KSYA 2O5RA 1AKRA 1TAHA 4FZ3A 4MS1A 3RUEA 2Z6AA 1RYHA 3OICA 1HDIA 4OF4A 121PA 4OLFA 1KPIA 3MWYW 5EEHA 5SZIA 3HYCA 3EMVA 2H52A 4KKXB 2ODBA 1WR8A 4OJTA 2GEUA 5SV2A 3CURA 1K97A 4B6GA 4LF8B 3MJEA 3MWJA 1K27A 1ST2A 2JKVA 1UK7A 4QU0A 5JSFA 2AIRA 2GETA 2MDTA 5GVRA 4BPRA 1BXRA 3C8HA 1KDRA 5AK5A 1INLA 4NE9A 1OFTA 4RPHA 3PL1A 4KFRA 1X2BA 4GFDA 2NXWA 1ULBA 1FQKA 1KMHB 1NW9B 4RGVA 1NVWQ 3T5TA 4HGZA 3GDWA 3IUQA 1U7OA 1H9BA 3WOHA 2DUMA 3AF2A 5CA0F 3G9XA 4B6JA 3FCAA 3FROA 3R74A 5EHQA 4FGSA 4B47A 5KKNB 2O8BB 2PU5A 5E6SB 3JSXA 5IN4A 4FFRA 1W5EA 2HBQA 4HUJA 1QWSA 4FYMA 1NVBA 1D6JA 1HMYA 1MO5A 2W0SA 1HE4A 2EP8A 4HGYA 4EB8A 2QRHA 5J2TB 1LPNA 1P44A 4R2JA 3SJUA 3ZZTA 3N58A 1X8LA 3NOVA 4JJGA 4XJVA 4W5OA 2COEA 3B3GA 3PEEA 3SNKA 2GBPA 4B2LA 1U81A 1Z83A 2PX8A 3H05A 2IV3A 2VF4X 4KG7A 3C7DB 2NV6A 3BSWA 3PF8A 1JIKA 2PLRA 4UJ3A 3GB9A 2KHZA 1T4CB 3DL4A 2NV0A 5C51B 1N7JA 3GA7A 4TYQA 4WESB 5CDTA 1SG9A 2I62A 3PR3A 5ALNA 4I4CA 2IHVA 5JSZB 1E2PA 2GFQA 2R1ZA 4UTPA 3HI6A 2RHGB 1KYQA 4P38A 2IOYA 3OA0A 4F4HA 3T3DA 3V6LA 4CN9A 2I3AA 5AVZA 4AB1A 2PBRA 2PWBA 3CV3A 4LXIA 1EUZA 2DWPA 1G291 1DC7A 1Y1SA 1X7HA 3R7DA 4BNUA 4GI7A 4BNKA 1M8KA 4ZDJA 4X71A 2CXPA 4Q01A 3IR6A 4N0DA 3ZCXA 5TQ0B 1K7YA 3LYLA 2VZ8A 3PRKE 2WPNA 1XLTA 2OHHA 3H7IA 4MPPA 3RSHA 4BNWA 2XX3A 4EO7A 3L7KA 5EJ5A 1JSLA 4U39A 2M32A 4M9CA 2W6ZA 3OUTA 1N7HA 3T0IA 2ETXA 1QCCA 2DT5A 1GADO 4GDMA 4LF6B 2PUTA 2QVXX 2MMGA 4GOJA 1I9GA 2BM9A 3H9EO 3QU5A 4YA6A 1J1ZA 5ALQA 1JNXX 1VHWA 1ISPA 3FGPA 5KVSA 5JCOC 3LDUA 2VH2A 3HO8A 3KQTA 2PANA 1A8SA 3FOEC 2G9ZA 3L7BA 4G4JA 5HK9A 4JLVA 5CFRA 1GPUA 3KQMA 4HNRA 5C8DA 3QVVA 4L02A 3G1UA 1ZBDA 4Q93A 1MJHA 5G2OA 1XDBA 4OIMA 2AF3C 1NF3A 4F8YA 4O5OA 2NVBA 2WHXA 3FPJA 1Y3DE 2ZE6A 3LKVA 1QUFA 2YXPX 3VAZA 4BNIA 2XT0A 1LPBB 4FUQA 4MUBA 1B6SA 2MYNA 1GL9B 4RMJA 4UUBA 3EVGA 1GFZA 5H0IA 2B9EA 2CXXA 2QRQA 2AEJA 4LY0A 3T4PA 2Z3VA 1KY3A 4B84A 4JAVC 4DUGA 2ZCUA 1U7UA 3JV7A 2BKVA 1WMFA 3H4TA 3RFTA 3SF0A 4CMHA 5BMVF 4XX0B 3AI7A 1G38A 2OYCA 4A8JC 4GE3A 2QTAA 5JWHA 2QRMA 5B64A 4D4IA 2JZCA 3FM9A 2WOOA 2W6JD 1FFYA 3WADA 3CNQS 4A73A 2A35A 2QPOA 1J2EA 1JB1A 2GPBA 1MG0A 1N9ZA 3LPAA 4P4SA 2F2TA 3RWBA 3GZ4A 5C1DA 1N2HA 1VL0A 3K1TA 4XCVA 5KWJA 1PNRA 1A2KC 2CBXA 3AM5A 3D4NA 4NABA 5LOVA 4M83A 1LSOA 1IG3A 4M1MA 4GQIA 1KTIA 1NSFA 1I6KA 1YDFA 2HAEA 2J8ZA 2YRXA 4CQLA 1DRUA 4PZDA 5LIRA 3LA8A 1XV5A 5EE9A 3PUJA 1GUBA 1WXHA 2A57A 1NXPA 5HTKA 3MCVA 2XTZA 4FMCB 3G89A 4GPZA 1QVWA 1JZQA 1P1CA 3ITEA 4IP0A 1IPFA 1JU3A 2ZYDA 1R6TA 3HWWA 3NGXA 1G20E 1EHIA 1N1GA 3JAWB 3S1AA 3DQZA 5EWLB 3JASA 5IC6A 3QFHA 4OD0A 3LOPA 1RRVA 2I2FA 3E3AA 3BXZA 3ZWNA 1PZHA 1R4MB 3C3KA 4JDPA 4OHRA 1T3GA 4C7OA 3LT1A 1DG1G 3OMXA 4AZ3B 1V3UA 3AIMA 2HLDD 5KX5F 1U8CB 4YMHA 1VJGA 2WG2A 1GQRA 1VBMA 2XUHA 2YQZA 4YONB 3WKAA 4L7VA 3WGVA 5IJ9B 3N3BC 5HRUA 1YB6A 3C7AA 5JMPA 3UOWA 4YO8A 2PL1A 4MROA 1GR1A 1W75A 1X1TA 1DC8A 1UFRA 4B4OA 3DKVA 4B73A 2H1OA 2I55A 3ABZA 3FTPA 4IIEA 1OC4A 1K89A 2WWIA 5F7OA 5J58A 1SRQA 2CXNA 3KYDA 1H42A 2P9EA 5HJ7A 3K09A 2JC3A 3QRWA 4GSKA 4J7CA 1YCHA 4RJ2A 2G82A 4LSGA 1M3SA 4QDZA 1RS0A 1JN0A 2PD4A 4EB0A 1HT1E 1V1RA 1WQ1R 4XQ9A 4EOGA 3LK7A 4D9EA 3BHJA 5CHEA 3PZRA 3NMUF 3T1OA 3RS2A 1I1QB 4HD8A 1KEKA 1WNTA 1KEEB 1K0UA 1Q7GA 2X2EA 3INRA 4WJLA 1VPVA 4XVQA 1OWLA 1G7RA 4PZCA 4FOSA 2DPHA 1R0SA 3WO1A 1CTQA 3REQA 2H1LA 3A7EA 4H4DA 4DHWA 1KOJA 3S27A 2V6JA 4N39A 4WAUA 5EZ5A 4YWHA 3F67A 1ES9A 7GPBA 1O6CA 3G2QA 4D46A 1FP2A 2ROQA 2XD4A 1EFCA 2JA1A 1ORDA 1QG0A 4OXXA 4WECA 4QGFA 5IAOA 4BNXA 3KOWA 2DAPA 4GOND 5DXFA 3SMQA 4JLAA 1E64A 3ILSA 3QBEA 2EDAA 5GONB 5T3UA 3P0RA 4GQAA 4CNBA 3NC0C 3VZQA 4FKZA 4G01B 5NLLA 5C7IO 4X93A 3LPNA 2DE0X 1T8SA 1HPLA 2HFKA 5H82A 1BFUA 3T9AA 4D99A 4NU6A 1R6BX 1EX6A 1CQZA 4WIAA 4HH0A 3ZHBA 3G17A 3E9MA 2XQGA 3FRIA 1XQXA 2OENG 4J3NA 1G8JA 1E0JA 1THGA 4MRSA 4YUAA 1E3WB 1G6KA 3C5HA 4LJRA 5KYVA 2VYQA 5KVCA 1H5QA 3MUEA 1SUAA 5AXBA 2BEVA 1Y81A 2IHJA 4JHLA 5FADA 5FO1A 5JVDA 4Q1FA 5EJ6A 1PT5A 3GGSA 5L53A 2HGZA 4RA9A 1GRQA 5DIZA 5LLDA 1RIFA 5JALA 3CRVA 5JSQA 5IKEA 1YIOA 1EGVB 2QLJA 3OPVA 2R5FA 4AMVA 2XZTA 3P0FA 2C0QA 3IP9A 3AHEA 3Q40A 3OESA 4MKHA 5CEFA 1RP7A 2HCFA 3O3NB 4ZU1X 2Y3IA 3PQ5A 4FNMA 2VPXA 4MQFB 5D3QA 4PIPA 1AV6A 1H1LA 4E14A 3LCRA 1XO1A 4M8KA 2CNDA 3SYMA 3FHOA 2XE6A 4P83A 4HI0E 2Y1DA 2RB4A 4XYMA 4K81B 1ZSVA 3EXIA 4NBNA 3QEJA 2A9KA 3I37X 5BVHB 1W8DA 1ZUWA 1L7DA 4U9IS 1J21A 2O2SA 3L40A 2E37A 4M0DA 3WLMA 4DEVA 4HB0A 4MWTA 1WCIB 2IS6A 1N2EA 2QUZA 4AUEA 4CQJA 2VUHB 2AFIE 3IE1A 2XWJI 1QS0B 3GCWA 2Q41A 3GLSA 3HGTA 4I4LA 1MDBA 3KUUA 4Z1MA 2EQBA 5IT4A 2J0SA 1WXWA 2F8LA 3IPCA 2XZPA 1JI3A 3T12A 5EMNA 5K7SA 5FRDA 2HCJB 1CEEA 1OFVA 2V6GA 4MGYR 5GV8A 5GIOE 3THYB 1Q91A 3QWIA 1OC2A 2P2GA 3IPYA 4BMCA 3L8HA 3EXG1 3F6YA 1QQ6A 4JT9A 4PLTA 4R54A 5JXIA 1APBA 5HHTA 1IHUA 1OT5A 2C5LA 3IKVA 2HK8A 3QQ5A 1BDJA 4QXAA 4YGYA 3RC9A 3SYTA 4E1AA 2GLTA 2HBRA 4OHFA 4YJGA 1VJTA 1XZPA 5IANA 4C4YA 2J7PD 4LJ6A 5K8UA 1TTHA 4Q1EA 1L5NA 2EIXA 1XJWA 2BSXA 1HG1A 2Y1OA 1EE9A 3GH3A 3IAAA 3R41A 4FHFA 4Q3CA 4JITA 1WEKA 5JS8A 1TUEA 2COKA 3RHTA 4ALNA 2IE0A 2JI4A 3F4LA 2RE8A 3M5DA 3UEOA 2P78A 3BK7A 1QAQA 2Y93A 3Q1KA 4ALMA 4DQ0A 2BYTA 4BZQA 1E9FA 2IZ0A 2PFGA 2QGZA 3EGCA 2RAUA 2YYSA 3MTIA 4HDRB 5BRAA 5KNCA 3QMVA 5FL7A 3OUZA 3HU2A 4YCAA 1G64A 3GLGB 4MKGA 4Q24A 3WNBA 4M8SA 3I28A 1ONNA 2D7CA 2Q1SA 2QPAA 1BG6A 4MR7B 4P6VF 2QAIA 3ZCTA 3KQOA 5I7UA 1G55A 2VZLA 1GR0A 4DLZA 4BLPA 5HEKA 1SVNA 3ON5A 1JFRA 1B1AA 4IRXA 3GUUA 3DLIA 3TTUA 2WM2A 2VPPA 4BX0A 2VAPA 3O4IA 1WNFA 2MT9A 2D2IA 3MQ4A 3SKYA 2FX5A 2XNSA 2WA2A 5DH9A 1OZFA 1V2GA 1V3QE 2WJAA 1IRXA 4EHLA 1X7XA 3QW2A 2CNOA 3A4MA 3HXLA 1P4SA 1RQ2A 1UXOA 2P6MA 4QFMA 5BV2P 4EY6A 2NG1A 2RK6A 3Q7RA 2JGNA 4RE5A 3WZLA 3NBZC 3SZLA 5BOVA 1DEXA 2IW3A 1JDSA 3R6LA 4INZA 3GLFA 1WBDA 1YJCA 1WLYA 1NN0A 1A72A 4GVLA 4LZAA 5IZ4A 3EG9A 3IEXA 2Q07A 4D8UA 1UBFA 4S1TA 4O4LB 3I42A 2O8CB 4AO7A 4CQMA 2JK0A 2WHPB 1PJ8A 3FZYA 1CHDA 4URUR 3AUUA 3LX5A 3OCJA 3V5NA 1VQ1A 2XLCA 3A9VA 4MOWA 4PS0A 2ZJ7A 2TS1A 4BL5A 1PJLA 4DZRA 1JA1A 1N2CE 3VV2A 4IL5A 5IN5A 1GUAA 3HPRA 4BFZA 3HVKA 1T1IA 2CVHA 4LVNA 3FBTA 4QPZA 5FLYA 1UPBA 2E5FA 2WTAA 5DBHX 2FX2A 3KLMX 2Z4SA 3FCUB 3V6MA 3ZWMA 1T9HA 1ZJYA 3NTOA 3ZOZA 3SHQA 5DMHA 1JMKC 1G21E 2GZHA 3HYRA 1G1AA 1T2AA 5FYDA 2DPGA 4QVGA 1QE5A 4LRQA 2D5LA 2R5NA 3I2YX 4RK4A 1EESA 1MT3A 3NANA 1RSZA 3TE6A 3AV3A 2AG0A 2JFZA 1M10A 1KXZA 1WA5A 2YZGA 3DCJA 4FLFA 1DKUA 1GT6A 2EWVA 1GT91 3IQFA 1QQ5A 3EXEA 4UHFA 1E5TA 2KLHA 1JIQA 1LPSA 1RXCA 3EVEA 4MQUA 3NYIA 4R8MA 2ZWMA 3ZPXA 3QY0A 3CKMA 3QXJA 1DJOA 4OUDB 1DAOA 3GJ4A 5EE3A 1XCPA 2P0YA 4JC4A 4CL8A 2JFVA 1QCZA 2V7WA 2YHBA 3CT6A 1UDXA 4JBLA 4J0DA 4GWGA 4PLWA 2JAWA 1QC5A 3PFFA 3UXEA 4EFMA 4F60A 1YFLA 4Y2RA 2CLFB 1MGPA 3KJQA 3I04A 5JE8A 1IY2A 2F1HA 1D2NA 3QU7A 2O48X 4D0GA 1UXIA 3P9KA 1KC1A 2F1OA 4UNQA 2YY6A 4AP5A 1NLMA 2CNNA 2J9FB 5KDLA 1JPVA 1MV5A 5LL6P 2QTFA 3D7SA 2W2KA 2W5UA 1IBSA 4ZU3A 4BX8A 5LZ5A 4BFLA 3HCEA 6LDHA 2V6FA 5C4GB 3ZBUA 2E9SA 4XJXA 2CW5A 3VU1A 3M3PA 4ETMA 1QVZA 3H97A 4BVEA 5JI2E 2E85A 2FTKE 3O3OB 1OIWA 2VDWA 3DBIA 1LDYA 1KZ6A 3KQVA 1LRKA 2VP3A 5IFLA 3TAHA 1ZIOA 3GCXA 3M6XA 1L8QA 1J8YF 2JNWA 3FFAA 1Y33E 4N12A 1C1XA 4PE5B 5ALKA 3LW7A 4MH0R 3PI6A 5HE9A 1SOVA 5KAPA 1E6MA 3NOQA 1YCDA 2VT2A 1A8IA 2Z04A 1KI4A 1C7FA 2C1ZA 5D7NA 5GPBA 1X1CA 1B3RA 4LDPA 1I4EB 2DLNA 2WJ3A 2JJ1D 1SOWA 3COVA 2J87A 2QQ0A 3WAKA 1V47A 4LF7B 4DAEA 2A0UA 4AZSA 2UU9B 3BMOB 2R4UA 3HP4A 4P32A 4WL0A 1YBHA 3RGWS 1PZMA 4WASA 4MQBA 4CPDA 1TEZA 4TWIA 1KMHA 1F8XA 3KAJA 1IZ9A 1U3WA 4TZTA 3GRRA 3UO8B 2FWBA 4ESOA 2V1UA 5JSHA 5K0FA 2XUJA 5F9MA 3G0DA 2Y0DA 4IHJF 4TRRA 3PB3A 3WKDA 1RXVA 3AR4A 1Y5LA 1Q12A 4ZEMA 4FE4A 4HRXA 4WVFA 4QYWA 4AULA 4K5QA 4LWOA 3OX3A 1Z5VA 3V2GA 1YS9A 1GITA 4G5HA 5DB4A 4AMUA 2VPIA 2QD4A 4IDNA 5KWVA 3JQFC 3PHLA 3B1ZA 5J2TA 1ULUA 3FUTA 3LLCA 4R2HA 3VX4A 2GLUA 1JLKA 5BY2A 5GMOA 3N2NA 1G18A 1XCGB 1C7RA 4IX1A 4PZYA 4FR0A 1LH0A 1JLSA 1T10A 3IUJA 2PUBA 4L0DA 1GRCA 1Y7TA 2XF2A 3GC6A 2VUTA 2G36A 1ETUA 2G9QA 2D2XA 2CV0A 3AW9A 1Z28A 1AO3A 3HJTA 3R7NA 2XDAA 1KMQA 2C3YA 2XVAA 4QIHA 4B8YA 3KEOA 5J5AA 2CNBA 4KACA 4Y6SA 1TU4A 4LXUA 4Y2XA 2RFLA 2EFCB 4L4YA 1E5LA 2DGDA 2C88A 2HM7A 3K0BA 4HZUB 1EFHA 4ZTBA 4W99A 1ESCA 3KG2A 4HDCA 3UGJA 1TZ2A 3DVLA 4BP8A 5LXTB 1TVKA 3O9MA 4WSOA 4UBNA 3G5AA 4RS4A 3FFXA 4I66A 1BE8A 3RKUA 1ZXLA 3HH8A 2X3FA 2VSXA 5TQ0A 1P3JA 4HZGA 4BFCA 1KKLA 1AQNA 3FZEA 3IT2A 3EX7C 1AVTA 4KRYA 4DKXA 3T3GA 3MJ4A 4I4IA 1Q7RA 1IN5A 1CB7A 3SHTA 4X3PA 2JFBA 1BMDA 1EZZA 4B79A 1MX1A 3B78A 2C9MA 3F90A 3G5LA 3LF1A 3QLUC 4M1EA 5EMJA 1LS1A 3TECE 5M2QA 5CNIA 1P0IA 2A14A 3VOBA 1SUIA 4GAEA 4O2AF 1N9GB 4EA6A 3QWBA 1T5HX 1YQUA 3C48A 4OX9B 1U2PA 1CZLA 1FFXB 3SC2B 4RZQA 5JYEA 1KXJA 3O74A 3D0OA 2VK1A 4LJ7A 4W7SA 2ZR9A 1TCUA 1AQIA 1KU0A 2OXEA 4V0MA 4Q3AA 3WMEA 2Q3BA 4YAFA 2IJGX 3KBOA 4MB0A 3OAAA 1OXTA 4D3XA 2NAFA 1K4MA 3GLTA 4D9IA 5DLEA 3P7MA 5AJUA 5GM1A 3V7FA 3ROEA 4HAWA 4B82A 2NADA 3UK2A 4CDNA 3EPHA 4NBTA 4GPBA 3EVCA 3Q3IA 1JVSA 2QY6A 2BGNA 1MO3A 4M1WA 3ZCRA 5KTNA 3OF5A 4HC4A 1S2DA 5DW0A 4OBBA 2POCA 4FDTA 2B0JA 3DV9A 2WNIA 5F1KA 4WZBA 1UEJA 3ICWA 4PCAA 1RWBA 3JQPA 4LCJA 2D2FA 4Z9FA 2Q2QA 4CI0B 3F3KA 3OURA 3WY9A 2XUDA 1R12A 3UJ7A 3FXAA 4BP9A 4HDQB 3VNAA 1SO8A 2A7XA 3IP6A 2RHCA 4J0CA 4Z0PA 2J4DA 2XUKA 4E4TA 2P2NA 3EH1A 4JP3A 4ND8A 5FPYA 5ALTA 3IERA 1ZGZA 2V3WA 4GOLD 1PR6A 4HGQA 5G0SA 1ULTA 1JR2A 3JAMA 3K6KA 2R7LA 3OZIA 3DDOA 3FOZA 5JLAA 4PLVA 5DHQA 3ZDFA 1U28A 2VYNA 3M89A 4S24A 3OZUA 3JWGA 4RTSA 1TVMA 1NJ6A 4KDEA 3U48A 1A69A 4KOEC 5I7VA 4WFKA 4W7HA 1R0WA 3JAWA 1GL6A 3P4YA 3SBXA 2DUWA 5ARBA 3AI1A 4JC8A 1P7PA 3SQDA 1SIOA 3RUAA 4E46A 3ZCPA 1Q57A 1R4MA 1Z82A 5JRZA 1U1GA 3PFWO 4LE2A 4AZ3A 2JI9A 1DBSA 3DAFA 1CVLA 5CAEB 4KVFA 4YVFA 5F5XA 4LQCA 4R41A 2J9YB 4N47A 4RHEA 3M33A 1RIIA 2HZ7A 1K9VF 4OHPA 2I54A 1W2GA 4PIMA 3ZQ6A 4C0HA 1L4FA 3TGPA 4IDGA 4GBJA 3ZGVA 4D4HA 2IS2A 1LS6A 3B6KA 1W9HA 3EK2A 4EF5A 4L0MA 4EPYA 3NNSA 4B3TB 3TLJA 1QKIA 1FL9A 4MRNA 5CITA 4YJ2B 5B36A 4AO6A 2P4UA 3VU9A 2C7RA 5J3JA 1XXHB 2H4HA 1N6IA 1QBGA 2HNKA 3HJBA 4MUNA 2NV2B 1QIGA 5AUPB 1MAWA 4DLUA 4DDTA 1RP1A 2C58A 1N2JA 4COKA 4UDXX 4Z7JA 1AOXA 1KEEA 1QPZA 1QRDA 4HBGA 1O08A 4MW4A 3R7BA 3AIIA 5JNWA 3BXGA 3VH1A 4IQFA 4I46A 1L7QA 4LGCA 4BFTA 5JEEA 1IBRA 3C87A 3UIEA 4OK3A 2GKOA 4M0CA 1G5PA 4M76B 2RJ3A 1ECFA 3L84A 1R15A 3UCFA 2BW0A 4GUDA 5CH3A 3RC7A 2BD0A 1ZITA 1NI4B 1KI3A 5CB4B 1GVNB 1P0CA 5AVKA 1PZEA 4S1WA 2C97A 1EINA 2OILA 1ZUHA 3KR1A 1C1HA 2VDNB 1TA0A 3RANA 1V2HE 4JFRA 5HZMA 4U8HA 4UFPA 5GAJA 5AW9A 1DWOA 4E0BA 3DCIA 2OORA 5JY1A 1JHRA 3H2KA 1OJLA 3PUZA 3UTDA 2B8EA 5F9FA 1MQAA 4ZVRA 3W04A 1S2OA 3B2NA 3AK4A 4GMXA 3RF7A 4K2HA 2UKDA 2E0IA 3F78A 1U1EA 2FMIA 4EM6A 5AVRA 4C30A 3V1LA 1FX1A 2Z8ZA 1E3WA 4JYPA 4FR2A 3FIJA 4DB2A 2GN4A 2L19A 1RLIA 1X87A 2OYSA 2ZB8A 3IDSA 3JR7A 2R87A 5KOHB 5EN4A 2J33A 2XMZA 2Y92A 3GJ3A 3H5IA 3O92A 2AX4A 3U4AA 4B3HA 1VECA 1WKBA 3MTDA 4ZC8A 4V38A 3U5TA 1E6LA 4ZJYA 2J5XA 1FW8A 2ZRKA 4COOA 2SBTA 1PQWA 5ERYA 4M87A 4QTZA 2DG2A 1B76A 2FN7A 3HDVA 3LC2O 3RIHA 1Y98A 1KO7A 3WI7A 1EWKA 4A26A 3B53X 4TLMB 4CIVA 1RWWA 5CH8A 1R18A 4HMPA 4HN4B 3T1NA 2O0MA 2X4LA 4FYKA 4TWAA 5K8LA 4CKWB 4KRFA 4EAQA 2FMXA 1NUPA 3A26A 4PQYA 5AJYA 5FI1B 3T54A 3G9ZA 1Q7BA 3SN6A 5KSYA 2Q3JA 4QM7A 2FP4B 3IL2A 1UBHS 3FNRA 2OCYC 3NDRA 2GUGA 2E87A 1OILA 1V26A 1WCIA 2JZNA 2OD7A 1YQDA 3L6OO 4ZVUA 3RFFA 3SDSA 2AD5A 3F6BX 5DBFA 1G3RA 4BEVA 1AGRA 1T5SA 4BKQA 4L5IA 4J9VA 1J0BA 2I2BA 3WAJA 4D79A 1JFTA 3K73O 1IUNA 1KJIA 4J2HA 1NZDA 2EU8A 4YTEA 3EQ8A 1XK7A 3WOVA 4BN5A 5LLTA 1BU5A 3R09A 5FNZA 3ZV5A 4V0OA 1GPJA 1KY4A 1Y3FE 3PX2A 5DCYA 4HDSA 2WFZA 3T5MA 4IXTA 3DAOA 3RVNA 1T9KA 3LGXA 1YD7A 3VGJA 4DTCA 4YJFB 1SY7A 2XQJA 2IYAA 5A4MS 4A1OA 5FOUA 3IUNA