2PNJA

Crystal structure of human ferrochelatase mutant with phe 337 replaced by ala
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
359
structure length
355
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAATSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
publication title Altered orientation of active site residues in variants of human ferrochelatase. Evidence for a hydrogen bond network involved in catalysis
pubmed doi rcsb
source organism Homo sapiens
total genus 135
structure length 355
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pnjA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pnjA01
1DOZA 4MK4A 4KLRA 2PNJA 4F4DA 2XVYA 2JH3A 2H1WA 3HCRA 2HRCA 1LD3A 1LBQA 2H1VA 3HCNA 3M4ZA 2Q3JA 2C8JA 2DJ5A 2XVZA 2XVXA 3W1WA 3GOQA 1N0IA 4KLAA 1HRKA 2PO5A 2Q2OA 2Q2NA 1L8XA 3AQIA 1AK1A 2PO7A 3LYHA 2QD5A 4CCSA 2XWPA 2QD1A 1TJNA 1C9EA 3HCOA 4KMMA 1QGOA 2AC4A 1C1HA 4KLCA 2HREA 3HCPA 2HK6A 2XWSA 2QD3A 2QD4A 2XWQA 2QD2A 2AC2A
chains in the Genus database with same CATH superfamily
4CMJA 3ORQA 2IZ0A 4I46A 1PGPA 3W78A 1XTIA 3B36A 2G72A 2Z1NA 4K9OA 2UVQA 3H99A 2APJA 4ZEXA 1IN1A 4E1VA 3HB4X 5CH5A 3RT1A 1FS4A 1UF9A 4WACA 1T5SA 2R6JA 3NZEA 2ZULA 1S7GA 3FG9A 2G88A 3AJAA 2OXRA 3DXZA 1KYXA 1MZPA 4JVLA 5HE9A 4D4MA 1VJ0A 2C9BA 4KHZA 1VB3A 1SXPA 2F3TA 4NKRA 3OUUA 1B23P 4UM8B 3OE7A 3ORSA 4J43A 4NG4A 2VLIA 1HUQA 3I2FA 1PFYA 1YU9A 4BRZA 3SGLA 3F4BA 3PUZA 4KU4A 1HT2E 3KPYA 3FLBA 2O0KA 4K2HA 3EIEA 4QOIA 4TS1A 3UPTA 2QTFA 3WL7A 4ALKA 5AH0A 2XMQA 3P2EA 1GQFA 4I6GA 4NDAA 3L0IB 4CKWA 4N82A 3QLVC 4QU9A 1O6GA 1GZHB 3PHCA 4KAXA 2FUNB 3E0QA 3EIFA 4Y6PA 3D6AA 3W5VA 3AR4A 4N3NA 1Z08A 4Q03A 1DRWA 3JTMA 1ESEA 1V6AA 3ET5A 5AOCA 4WNAA 4WKGA 2ZB3A 3ZTTA 4HVCA 2YR0A 2WD7A 3UFXA 3H8SA 3KT3A 3OQ6A 3WYNA 4LY0A 4IUDS 3VHXA 1UCFA 4MR7A 2EX0A 4GEGA 2F2TA 3AWDA 3KHTA 3SM3A 1SKQA 4PPQA 3ZZNA 4J0HA 1OBHA 2G5CA 3WP0A 2XSZA 1C7ZA 5I48A 1QO9A 3FUWA 4F3KA 4F11A 3P94A 4J94A 2GK6A 3ORHA 4DA0A 5B4UA 4S24A 2HK8A 3AG6A 4J2OA 3W1EA 1UMDA 3PJGA 1B6TA 3R7WA 4PZLA 2X9GA 3DO6A 4HQ6A 4D98A 3NIFB 2GAFA 4AJHA 1SHKA 3RWOA 4QFDA 1K98A 4CM6A 2F43B 3HA2A 2L0XA 3IQHX 3K16A 3KJHA 4J1NA 4QJIA 1TUEA 4ZCIA 2DPGA 4EUKA 1C0KA 1HTWA 4DCTA 1E59A 2LDBA 3AILA 1QGDA 1U3WA 4B3SB 3SFZA 1W73A 4EBBA 2Q5EA 3B85A 1P2DA 3RFUA 1VJCA 4YRPA 4R1OA 3GFVA 5COAA 4RADA 4EFNA 1PTJC 5KSOA 3MHTA 2ORWA 3WR5A 3GDGA 1RPTA 1ENZA 1Q15A 4NNPA 3L8GA 1QQ5A 1LB1B 1N2GA 1UQRA 1UJ4A 2WA2A 4GOLD 4HWPA 5CLIA 4GMDA 5CBPA 4GGMX 3W7BA 2AN5A 2J4DA 3FRJA 4UE3S 5DHUA 3WFZA 5DLQC 1YUBA 4U6QA 5HZGA 4GLLA 5JMOA 2ADOA 3QTTA 1X1CA 4CTKA 1DXQA 5ILOA 2HSWA 3E48A 4DJDC 4E3WA 1GTMA 1GZUA 4U0JA 2DQYA 1GZVA 5JNWA 3D2LA 3I9MA 5AK4A 2X1HA 5KDOA 2P5TB 1EHIA 1T4CA 4QPNA 4YJHB 2W6NA 3JVEA 4CHGA 4B3FX 1AT1A 1FFGA 1N2JA 1OTXA 2FE1A 2SBTA 2NU8A 3QX3A 4BYGA 3FF1A 2VF2A 4I2NA 4TV9B 3C1OA 1EA7A 2A9RA 2WU0A 4CL8A 1TAQA 3T52A 1XTQA 5DB4A 1FXWA 4IHQA 4DPKA 2DFKB 1RWKA 3SQLA 4MI3A 3PJRA 1W8DA 2K7ZA 3SLGA 5FEUA 4LGCA 2EDCA 2GEJA 4EJSB 2BE9A 1GGMA 4CMHA 3RYCB 4JH0A 4AB1A 1E3DA 1F12A 5DHPA 3M6AA 5BSKA 4P5PA 2CFCA 2FSUA 2VK4A 4FDUA 4I81A 4CF5A 2Q9BA 1DIRA 3U7QB 1KC3A 1H1TA 4I5IA 3W3ZB 5JZVA 1EFRA 4NBKA 4DRXB 3OZAA 3GT3A 1VBMA 1VHLA 3DMDA 4XCVA 4FQ8A 4F3YA 4ZYUA 1D2GA 1U6JA 2FF5A 3L4BA 3WV5A 1B1CA 3WG9A 5AK0A 2YUTA 1PGQA 1BDMA 1J06A 3D3KA 4DSNA 1FJXA 2HX1A 5H81A 1T0JB 3BIXA 4J9UE 2QIPA 4BJ1A 1JEQB 3NVMB 3R6DA 4LDRA 1NVAA 3GAMA 4X3OA 1M6VB 1EWRA 4IQ0A 4L76A 2AYZA 4MAMA 1RXVA 1QIDA 2CYBA 4FNAA 3V7FA 1NQ5A 5LLDA 4LE2A 3CUSA 2C58A 2FGKA 3B13B 1EWTA 2NN3C 1N6RA 3MT9A 1FA9A 1E89A 1PV1A 1T13A 1ZD1A 4MZDA 3K4HA 5A3QA 2VAWA 4LFBB 4NH4A 4NXMB 4IS3A 1Z2DA 2FVYA 1G19A 3FLEA 1HQDA 1TUGA 1VSUA 2PX8A 2VP3A 3TJZA 1H3EA 3EAGA 1FP1D 4S1TA 4ZT3A 5BN3B 3GLUA 1IRXA 1CY2A 1Z62A 2H00A 4H0NA 1V1RA 4JYAB 3V4SA 3VJRA 3QV2A 2CMDA 3D59A 3PD7A 4PSCA 5H82A 1T1JA 4QX6A 1NT4A 3NNNA 4AJ2A 1C4OA 1RWBA 5IYZF 5D1HA 5F7ZA 1JEDA 1YQEA 1Z2CA 3FB1A 1OUMA 2BFBB 2FI1A 2VF5X 1NM5A 1KOGA 2E89A 2QROA 5IUKC 3QVGA 1K7SN 1ZN8A 2Z08A 3HKDA 4LHZA 2MHCA 4DUPA 4CR8A 2PV0A 1P1RA 2VPYA 4XW2A 4XQ9A 4EF4A 1YUNA 3MYYA 4LVNA 1C9DB 4UREA 4V0LA 3WMXA 1IPFA 1IOVA 3DEYX 4BWGA 5JS1A 4ZPJA 1G1MA 3HXPA 3KAKA 3NWPA 3T3DA 3AV0B 1E2KA 3HO6A 3A9RA 2AK3A 1JJVA 3BXPA 3LL4A 4W82A 1X8KA 5ICEA 4D0RA 3SNKA 1DG9A 2A0WA 2QD4A 1ECGA 2JCGA 2V7QD 3A36A 1KORA 3DMHA 1Z6TA 1IG3A 1HNNA 5EWLB 4KQEA 4TSFD 4ZVUA 4U2CA 4J9VA 3BWVA 5EIXA 1QO0A 4P31A 1ZOLA 3T1OA 1A5BB 1ZZGA 1M1YE 3AJRA 4LKRA 3DTVD 3KQPA 1GUDA 4ZIRB 1U28A 1EAYA 1PR5A 4QBFA 1OROA 3D8NA 3OX1A 3WGZA 1ITZA 2PWBA 2WYOA 3NYRA 2FX3A 3Q5DA 4EGJA 2PU7A 2ZJ7A 3JD3A 3DAHA 3RTAA 3KKQA 2VDVE 3MNFA 1PN3A 2ZUUA 3RF7A 1QYCA 3ECSA 3L49A 5IZCA 3BFKA 2BEUA 4P0QB 1QHFA 1ZR4A 1FU4A 1RBQA 3PZRA 1YS4A 3CKLA 4KQIA 2C8KA 4KLCA 1CQJA 2FYTA 1P4JA 4LJ6A 1NX6A 4KV7A 2QM3A 3UTCA 1CB7A 4NJMA 4B4KA 1DIBA 4UW9A 4D6YA 2ZUCA 4TRRA 3K1TA 4F5ZA 1NJ6A 3O6VA 4DR4B 3HCRA 4LWZA 4ZYVA 3P0FA 1SELA 2FW8A 1SC3A 2E55A 1GQOA 1G64A 2O3JA 2ZR0A 4C0AC 4CVNA 3KTFA 5K0GA 3OECA 4AJIA 4KG7A 4HI0E 5IDXA 4KH1A 3BHJA 1YU6A 2BFDB 1JEYB 4GS5A 1XJ0A 1CRWG 2KSQA 1GEGA 2DHCA 1ZM3A 5GGXA 1QK3A 2Q2VA 5FOUA 4EL5A 4LS3A 1XNGA 3BERA 4D82A 4WKPA 3BSSA 4KQCA 4B7CA 1QGUA 1C41A 2WAXA 4NCBA 3RUEA 2WD8A 3LUAA 4Y2SA 2N1MA 4YCCA 1JAYA 3SJZA 1VL1A 4M83A 2H9YA 1SK8A 2CUNA 3B8EA 2VDWA 3KLBA 4RKFA 1NR1A 1R0XA 3GAFA 4CKEA 1G21E 4KO8A 3V7UA 3E1GA 3IBTA 4LBYA 4QJ5A 1O96A 3ICEA 1DT3A 1GT6A 3FJ1A 2NU9B 4KPEC 5EE9A 1SXJD 4WY5A 1BYUA 3KL2A 3B5IA 2H2IA 2ZCUA 2QP4A 4Y2JA 2JLAA 4WNIA 1TU0A 2F48A 2I1VB 4MVJA 3MUNA 1L3IA 4FHFA 1KQGA 4LXTA 3ZV3A 3ESCA 3UK0A 3UMSA 2VHEA 4W5RA 4JA0A 3PTLA 2H9IA 3K09A 5FT9A 5CCXA 1JBKA 1L9XA 3L8YA 4JROA 1K7EB 2NO1A 1G3QA 3C3BA 1KDZA 4NAHA 2PH5A 4DOMA 2ZCJA 4QNNA 1TA9A 4HDMB 4QLOA 1TVCA 4BE4A 4K26A 5CT5A 5KSZA 4J1SA 3DLBA 2QOEA 1HC7A 3QF4A 1E6UA 1OXTA 2VHJA 3ZXSA 2E1RA 4RYLA 4FM9A 2C4TA 1W1UA 3BRWA 3EIXA 2JD2A 3KS9A 2Z3ZA 3ZPXA 1E1YA 3L0DA 4LQ4A 4ZTBA 3SJBA 2NPIA 3B1YA 5D7NA 3QXHA 5K6TA 3LZDA 1QYWA 3GI1A 3QG5A 1DKQA 5BR7A 4IRMA 2BMFA 2H4YA 1O95A 3QXSA 4HLUA 4DDHA 1D9XA 1IUNA 3QELB 1WKCA 4P33A 5FRDA 3I0ZA 3REOA 5JBIA 3TLBA 1N2IA 2ZQYA 3VDNB 3HDVA 3HZRA 5DI9A 1T3TA 2CNWA 3EAQA 1EUYA 1EVIA 1DINA 4JGIA 5EJAA 3TSOA 3K9LA 1ORVA 1YS7A 3OOYA 3E5RA 5B37A 5IEBA 2AG0A 3O31A 2PX4A 4BNXA 5L45A 1KI3A 2E2WA 3K5WA 4PTYA 1YR2A 3OT5A 4RDXA 5AVRA 1YHZA 1EU1A 1TMKA 3W5HA 4Y30A 2ZR7A 1TIPA 4LCJA 3UHAA 1MQ8B 4BEJA 3BWBA 4O4IB 1JJBA 1CY1A 3GZTB 3L4BC 2R6CA 1E2UA 4CM9A 3F3MA 1N2SA 3DHWC 3N39C 3KO8A 3MZ0A 3ND8A 5FV7A 2R48A 3VAZA 1P18A 2QRVB 3MT8A 1SOMA 2YWDA 5JNTA 4B5KA 1D4ZA 5JXHA 4BNZA 2BBOA 4RD6A 3CPSA 4QOEA 2WUVA 3L40A 3KOWA 3VISA 4HSGA 3ABZA 3G2NA 4RABA 1Z6PA 3MA0A 4L8FA 3R5SA 1ID1A 5KOJA 4Z49A 4AN0A 1YQDA 1U2RA 5T7BA 3G2HA 1L7PA 4RKYA 4L3VA 3K9WA 4OLHA 3RLFA 1H6DA 3EAFA 3ZH2A 3FYUA 3U60B 3UWMA 1AGNA 2QJWA 2R5NA 3M3PA 4LZJA 4DL9A 3HACA 3Q0EA 2A1UB 5KZMB 2BFOA 3QIAA 1OFVA 5BYJA 5IF9A 3WS7A 3R8XA 1MFZA 2DFLA 2VDRB 3QWFA 3GRUA 4LHEA 1DEAA 1DKNA 2ZJ6A 4JCCA 3BH7A 1K66A 2QMYA 1BC5A 1KRHA 5CVEA 3LT5A 3A9SA 2V97A 3MJFA 4PW0A 3NT4A 3B2NA 4X90A 1OX4A 4JN6B 1O94A 3I8OA 5B2EA 2IF2A 2KS6A 4X95A 2X58A 3OX4A 3I2IA 2VYVA 3UT6A 3GFPA 1O6BA 2W4MA 2ZI9A 3DMTA 4PYRA 1XZFA 3LNCA 1FFYA 5TNXA 4UU0A 3TLZA 4GR9A 2O2SA 1G6OA 1GIAA 2V6JA 1OMOA 4HDCA 5DM4A 4BMSA 3HXQA 3C3MA 4TTPA 5CVJA 2BTEA 2CCGA 1U2TA 2AQKA 1KO4A 4ZEVA 2VQSA 1WCIB 3OURA 4P3NA 1JIVA 1SH7A 2Q8QA 3AR3A 3NP7A 4MQ6A 4D25A 2M6KA 4KIGA 1T1EA 3GPBA 2PD6A 4Q3OA 2QAJA 3O2QB 2WTUA 1D0VA 2PLRA 3DBHA 3FKSD 1LVHA 2A9KA 4MUMA 2BMEA 2P65A 2VDMB 2Q5JA 1BKSB 4Z9XA 4XVCA 5C2JB 3BCHA 4MW9A 1TUIA 3B70A 3ICVA 3QSYA 3DZDA 5HIKA 4NG5A 1ADFA 2QMEA 1YBMA 4BFWA 2PIDA 3K15A 2XRFA 2RHMA 1TEXA 4K9NA 4LPSA 3RUHA 3WADA 4ZYTA 1Q20A 3RANA 1DIAA 1U28C 2GILA 4YXFA 1KKLA 9MHTA 3W8FA 4F9FA 3PLNA 1CFZA 4DQVA 5IX8A 2PKQO 1UZLA 4Q3AA 2VHZA 4B4OA 4BB0A 4XWKA 3UMVA 1RU3A 2ZYWX 3R3ZA 3UJ7A 3LYUA 1VFPA 1E1NA 5IZCC 3ZJTA 2XYRA 2VH1A 4DIMA 3D4OA 5ALSA 4GD3Q 3ICPA 4RGVA 1GILA 3GJTA 1ATIA 1VLZA 1V43A 3O8LA 3R7DA 3UWKA 2PT6A 2WYIA 2JI7A 1XRMA 3A11A 4MV7A 2CVQA 3PX3A 3PE4A 4AULA 3IERA 1VL5A 4U2KA 2B98A 4C1BA 1VBKA 4B4WA 2F00A 5JANA 2MMGA 1FL9A 1VG9B 4LYFA 4QUDA 4JYCA 5A62A 5JVDF 2HQRA 1I13A 5DXJA 4QT4A 1NVVQ 5FWNA 3IQGX 1X7YA 4ZCSA 4BFXA 2XWBF 2Z83A 4PEVA 2B8WA 4E22A 3E22A 2IBMA 4IF4A 4WTOA 3RADC 4BMYA 2QX8A 2YIDA 3COSA 4K1LA 2Z6UA 2J09A 4FYMA 1K06A 1K5GA 3AJEA 3WKCA 3ZWKA 3ZJVA 2JK0A 5ARCA 2YY6A 2GF2A 3QY0A 2DR3A 1UZUA 1R50A 5CDFE 1LQUA 4X41A 4O2AF 1WCWA 4QGFA 2XA9A 5HM6A 3TUJC 2C7OA 2QORA 9LDBA 1FTSA 4AO6A 2KW5A 5F3RA 1M6NA 1W1IA 1XMJA 2BKUA 2FFBA 2OOKA 1X7GA 3EIWA 1W87A 3EXIB 1TK2A 1T0HB 3SXJA 4FT4A 5CXSA 1EUQA 1ZKMA 3ZV6A 3CSDA 4BNUA 3GRYA 4XARA 4WBXC 4DS3A 1P44A 3FX2A 4XVUA 4OB8A 1U94A 2DAPA 3H8VA 4MR8A 4RWZA 3W1WA 3SZGA 2N47A 3DWEX 1PX0A 3LQRA 1J5XA 2FAXA 4DJ5X 5B3LA 5IK2D 2WB2A 5I9IA 2C4MA 1XCBA 3A4TA 1Z15A 3IAM1 4E5PA 2DX7A 1Y8RA 3K09C 1OAAA 1XEXB 5ICSA 1TJ4A 2GEDA 1JT9A 2QRMA 1J07A 3FNEA 3K9HA 3E81A 5JS6A 3RRYA 3OOHA 2C61A 4Q7JB 1IZ8A 2ZT7A 3D7KA 1P3DA 4BUZA 5TGZA 4LX0A 4DILA 2J30A 4NBVA 4LG1A 2XF2A 2B7LA 5KHLB 4QXOA 5C0OE 4HFNA 2DUWA 1WIWA 3QPDA 3BCSA 3CX6A 2JC3A 1V7CA 1U5BA 3OSZA 1NA5A 5FUYA 4C06A 2F7SA 3AZQA 4DREA 5G2OA 1IG0A 1GPBA 4BAGA 2XB8A 1A2QA 1M2HA 2D1SA 3G2PA 2OHHA 1C0IA 1P33A 4U8GA 2ZVPX 3RM3A 4RFVA 1P39A 2I3GA 3QVLA 1F8GA 2GYUA 3CZ4A 3JYQA 4HLUC 1BXRA 1TXGA 3GRZA 1MJGM 1P8JA 1P7WA 3K05A 1QNFA 3I52A 1QHIA 1WSAA 3B89A 3E9MA 5HF5A 5H7XA 2C2GA 4ZMSA 5E2IA 3UJPA 1B93A 1XJ5A 1O6CA 3WSVA 5JS7A 1YZVA 3UQZA 4EFLA 2ONYA 4UTZA 5B2ZA 3DLHA 2C7QA 4NPHA 2OQ2A 3R74A 2IPMA 2NNWB 1TC2A 1TVKA 2HJRA 4LCEA 4RANA 3TAXA 4GEKA 1DEHA 2AI1A 2XNDA 2Y76A 5HX7A 3ENNA 4YO8A 4ZPXA 1TUBB 2YZ7A 3OKPA 2ZYTX 5E4YA 1CS4C 4OG2A 5DMHA 1IBRA 1URPA 3GJRA 2ZK7A 5IKPA 2E6UX 3V7YA 1R0ZA 1R5BA 1XQ1A 1V9SA 2X4GA 4LMBA 3T9AA 3ZE7A 2RE8A 2A5FA 3K9QO 2C0CA 2Q9CA 2XNCA 3IBCA 3OMXA 2LR0A 3RK0A 4CM4B 3JQCA 3UMCA 4Z4FA 2DPLA 3T6KA 4JOBA 4WW0A 3TRJA 2FF7A 3RNOA 1XVTA 1ZVMA 2FW6A 3QFFA 4GBMA 1LSJA 4CV3A 4F4IA 1GVHA 5B6IA 3F2IA 2WM9B 1SVWA 1BE1A 3LLVA 1EINA 1Z18A 2B37A 3ONDA 3DZCA 4FBMA 1PJLA 2FZCA 1CVLA 4II2A 1JX6A 4O08A 3TBFA 2ZAIA 2XJ9A 3AGPA 4NY1A 4D44A 5IG2A 1U8TA 1YE5A 4G81A 5KDLA 4ZI7F 4JXXA 2EX4A 5JC1A 3U6BA 5LMUB 4KGXA 3QKRA 2O7QA 3Q7IA 2ONZA 2ECOA 3NHAA 5EPOA 4RZ2A 5IH3A 4MV0A 3RUIA 3ZE2B 3ST7A 1O94C 3MWEB 4XCXA 5T8KC 1E69A 1YK1A 2XTZA 3WDMA 1R74A 1DU4A 3GFSA 2Q5OA 1JLRA 2IZ7A 3DMTC 3I5AA 3MXOA 4RHXA 4W9MC 3HV0A 4WBNB 3NGLA 3H2ZA 4OM7A 1ABFA 1ZOOA 5JQGB 2QE6A 4FXOA 4L51A 4F3CA 1NY6A 1CRPA 5HIIA 5EXTA 3U4QB 3OZCA 5JSQA 2W2TA 1YR6A 4G8DA 3C6YA 4B17A 5CRIA 4MW5A 4HEA1 5C35A 2WF6A 3NOVA 4C3OB 1I94B 3CV3A 4BUCA 3G7UA 2ZIWB 4F2PA 3OFSA 3A4MA 5LLTA 1T0PA 4R51A 2CHEA 2XQJA 1HORA 3LXMA 1L5HA 1M2NA 3F0TA 3ONFA 4ID9A 1HMPA 2YUIA 5E4FA 1XZJA 2AYYA 2YV2A 3ETDA 3H4VA 4RVOA 5D5HA 4WA8A 1R9JA 3VR6D 1KJYA 1QHNA 4RVUA 4RTNA 2AKAB 2WT8A 5P21A 3BK1A 3PE3A 3BE5A 4YGXB 2QRPA 3AFIA 2UYGA 5TJ9A 3CCCA 2B2CA 2TMGA 4G25A 1Q0SA 4O2BA 1BHO1 3KWFA 4NDZA 2IEGA 3NTRA 3WLFA 2JA2A 2Z5GA 1B2LA 1SKYB 3Q72A 2XADA 1T3LA 3GFGA 2WKPA 5EJ2A 2Q0QA 2W0SA 4CM8B 2BYTA 3ZWDA 4PX5A 1H6CA 4PQEA 3ZQUA 2QQEA 3OY2A 4C9BA 4FOTA 5B7NA 5LZ2A 4F9GA 3L93A 2G4CA 2Q41A 3HVJA 4W8GA 4N49A 1J9EA 6GPBA 3GNTA 5EQDA 2IOYA 1T8RA 1X8JA 3DBIA 1OH8A 2PT5A 4EOGA 2RG7A 2A35A 2JFNA 4L28A 4YAJA 3HNRA 5DWDA 2O1WA 5C53B 1NVTA 1KO7A 1P7ZA 1ADBA 3H8WA 5DHAA 1HQKA 4Y1FA 4B82A 2VH5R 1IK4A 1W59A 2Z98A 3MCAA 5B5SA 3VZQA 4DDMA 3M3HA 3A10A 3LT2A 3AF5A 1CP3A 2AFVA 4ZZ0A 2FPUA 2OD2A 5CLHA 3W9YA 2H1IA 1DRKA 2EFGA 1BGWA 5BV1A 1BD4A 1UBSB 4EEKA 4L7QA 4FHCA 4QYIB 4O4JB 3RDPA 4OFBA 5G4LA 1HLFA 5FB3A 2JD1A 2HRQA 1DS6A 4NCJA 3G7NA 3PEUA 1YDMA 3UWPA 1KEVA 5JJBA 1EK5A 3F96A 2JAWA 1F38A 5LDGA 2QXUA 2Q1TA 4UOQA 2JFUA 1A71A 3AVPA 4FE4A 5CVTA 8OHMA 1GLNA 2GJKA 1XZLA 1UC8A 3CN7A 4ETIA 1FMFA 1MR3F 4L6IA 4I4LA 3UPDA 1FDWA 1KJQA 3N0VA 4R0NA 1M1YB 3UG6A 1A2BA 1RVV1 3JATA 4NF2A 3D3JA 3VSEA 2VXCA 1GG5A 1H1DA 1W0KD 5K4GA 4EF6A 3G3EA 3EISA 1I4EB 1W29A 2I54A 2EHJA 4B7AA 2FUG6 3O95A 2CZCA 4NX2A 4B3JA 4NZOA 4ABTA 2C7PA 3O1JC 2D0IA 1KYIA 3KUXA 1X1BA 2OCYC 1JHZA 1UR5A 3R3WA 4GUDA 2VH2A 1C1YA 5AI4A 3ZHQA 5IDWA 2BLLA 5EFOA 2DUJA 4XX0B 1XZKA 4G4SO 2WJHA 4QSMA 4QM7A 1U7HA 1MX1A 3A6KA 2BEVB 3SICE 2PAFA 3JQFA 1IEQA 4EY6A 2FE4A 4YJGA 1IXKA 4QD3A 3P19A 4IBOA 4YJ3F 5G1NA 2GRAA 4DLAA 3P71T 3HE3A 4E2FA 2LPMA 3JQ9A 3DT8A 4PRZA 1JEAA 4RIEA 3RS8A 4C0WA 3DW1X 2B1JA 1E7SA 4WZAE 4Z5XA 2QWXA 2D0OB 3DEHA 2FA9A 1ZP6A 3KFXA 4EA9A 1L4YA 4RHEA 3FOFC 3K8QA 3E5HA 3UYLA 4EY8A 1TLFA 3BTVA 5K2OA 1US8A 4O4LA 3SHOA 2V3CC 1XPUA 3JS5A 5ESRA 3NHMA 1TGYA 1WXIA 2IC5A 4UPVA 3A2KA 3W8EA 4LZLA 4OKNA 3PPYA 4EABA 2UU9B 3BE6A 4NZNA 3T12A 4LDPA 1OBOA 3LP6A 3LECA 4W99A 2QRJA 1N8TA 2YRWA 4O1MA 1N3LA 2ZRKA 16PKA 3DMYA 5P8WA 3WV4A 4RM2A 4IGIA 1G21B 1NVGA 3QI2A 4UTRA 4B2YA 1PDOA 4PG5A 1J8MF 4FYIA 5LP6A 2GWHA 2ICAA 2PAAA 4JA2A 3FNIA 2XQGA 2PU5A 1WY5A 1O9HA 4Q9HA 1SBZA 3TR0A 1JWLA 3THWB 1IWOA 1Z4OA 3L8FA 2WVAA 2YVLA 2R87A 5SZIA 4AICA 1E5TA 2GZHA 3FLMA 5GONA 3LDFA 3IMFA 4WK0B 1J23A 5H4GA 1SUAA 2PJUA 2JGEA 1XHEA 4X54A 4HB3A 2VTKA 1LVUA 2GN1A 2HADA 3D3WB 4TWAA 4UXIA 4U3JB 5FWYB 4C05A 1YNSA 1JILA 1C80A 4MW6A 1P9LA 5FTMA 4YPFA 1ZFNA 1ETUA 2XR1A 3DDCA 2WHYA 3H16A 3I9V6 4BE9A 3I5XA 3FDFA 4IWXA 1ULAA 2D74A 1RQ2A 1DIOB 2QENA 2H0QA 2ZBQA 3E8XA 4K9KA 4QXPA 1M1NA 1MO4A 3FHLA 3ITDA 4RA9A 2A9PA 2I2WA 4MB0A 3U3KA 1GUAA 3BE4A 3W2IA 2HJ9A 3DBOB 2HBYA 3DZFA 3HUEA 3CPHA 3BL8A 4GR5A 4PSVA 4XVQA 1C7IA 3ULKA 3K71B 1JG7A 3EFBA 3BAZA 4XSVA 3WOHA 1EXNA 4M22A 1Z2EA 4MIEA 1QQ6A 2HBQA 1AGPA 5CFZA 1P5ZB 1OH6A 2NV6A 4IXNA 1JWAB 3P9IA 1E20A 1ZHHA 4M55A 4OB6A 5I7OA 1U8YA 1SRRA 1QIFA 1KJZA 1Z7YA 4FHZA 2IYSA 3DOOA 2XCIA 4LJ5A 2B0CA 5CTJA 2H2AA 1ZLXA 4JOQA 2ODPA 2R47A 4JP3A 3ZEAA 1F4LA 5IKXA 4FQ7A 1OE0A 2PGLA 3RS9A 3V8QA 1DC4A 3KJIA 3CE9A 1QUFA 4RD1A 1VE6A 3GJSA 2P8SA 2XKJE 5FO1A 1GPKA 3I6QA 3DTTA 3NFRA 4DMMA 5FIUA 1WBJB 5BRNA 4GYYA 4O5OA 1L4UA 1W4RA 4M36A 2HNBA 3N59A 4Y9RA 5D86A 4E1AA 1GA6A 1C3OA 2CSUA 4J0KA 4WLFA 2PUBA 1U0JA 4IKPA 2VK1A 2FOLA 3PC8A 3ZDQA 5B3JA 1ZGCA 4QUIA 4QTXA 4YP5A 3TIGA 5DHQA 5TJHA 1V45E 3AF4A 3O5AA 4L5YA 3UT0A 1YOVA 5E2BA 3RV4A 3FBGA 4AJ1A 2ACWA 4IHJF 4KWEA 4QYTA 5F76A 1KWKA 4BASA 2HHLA 3AY3A 5BR1A 3CEAA 4CLDA 2OFOA 5BQFA 3Q10A 3ZWYA 1T1SA 1YKFA 3GDFA 3VGPA 3N86A 1E2MA 2QT0A 3Q6MA 4IDNA 1PD1A 1YAHA 1PJ4A 3D5EA 3QYFA 1A1SA 2Q4TA 4OJNA 4P7GA 4Z53A 4AN4A 1LQTA 5EJ8A 2XCSB 4LXXA 1U7DA 5ELXA 1ENOA 2EKQA 2ID7A 2HPZA 5JSZB 5LNK6 4EA8A 1XU4A 4CXMA 4IJVA 1HOTA 3FGZA 5FI0B 2FMUA 1AQ6A 2Z2JA 1NFQA 4A03A 2XCUA 4JWTA 2O2EA 4KIWA 4RTQA 1E92A 2V7QA 2O0JA 1V8BA 1ICEA 5TQ0A 3E3MA 1ADYA 2ZBUA 4TSFA 5I51A 3I12A 1J6UA 3DTVA 1TECE 3JQ7B 5HUJA 1L8XA 3TN7A 2NVBA 4KXMA 3WK8A 4CYMA 3PT5A 4HLNA 3B3QA 2WFZA 3VYUB 1O0SA 2OBYA 4OQNA 1G5HA 5AM0A 3V1LA 5IU6A 2GLUA 5KOIA 3KOYA 2G7MC 4LJ4A 2DU8A 5EWMA 4HWTA 3HB5X 4Q82A 5E8RA 2C5EA 1G8FA 2ZRBA 3PXCX 1XL0A 1V48A 2H4WA 2VP0A 2JL1A 1SUFA 3I09A 2NQ8A 3AEQA 3KXPA 3MXTA 1TQDA 4KRYA 4ASUD 1H23A 2WHQA 2FPKA 1TIBA 1JIIA 4EPTA 4PSDA 1A7KA 3N2GB 4OXKA 2V9CA 4MKXA 4Q1BA 4WINA 4YO7A 1ENPA 4CT5A 2CDRA 2E4ZA 2NYRA 3I37X 5IXSA 5FLYA 4H1WA 4RPJA 1DQSA 2O54A 4Y2RA 3IJPA 4UHBA 1EFPA 5J1SB 3E15A 3NNSA 3INYA 1WSBA 5K03A 1Z8HA 2C3OA 2I34A 1U8ZA 2X13A 1FXWF 3G88A 4XPIA 3WB0A 1ZUNA 4DIBA 4EUFA 3PVSA 5K05A 2G67A 2GN2A 1GLGA 1J0EA 2IV2X 2NYUA 2X76A 2ZYGA 2OWDA 4FMPA 4KAAA 2XKAA 3ESRA 4HQLA 5FJIA 4V0OA 3JQFC 4COKA 1H0KA 3BFVA 3LRXA 3OT1B 2KQUA 2ONJA 5A04A 3IPCA 3JQ9C 2I67A 3TVTA 1UK6A 4HWRA 2E49A 4K6OA 4QJ3A 2OL4A 4A9AA 2QUAA 3D3EA 4OD0A 4KJZA 5EUQB 3U4CA 421PA 1CB0A 2G80A 5A2GA 3LBYA 1I51A 3LBFA 3UENA 3DE3X 3NKVA 1SXJA 5JPDA 1CZLA 5KJCA 3K6RA 2B7CA 1PZMA 1V8DA 2GJ9A 2PLAA 1SUSA 5EIBD 4UOZA 4JP1A 1HI9A 5AJZA 3P0EA 5A4FS 1QG4A 3II6X 8ATCA 5A9SB 3S8YA 3L8DA 1WU7A 2GPTA 2IP1A 1SC1A 2D5IA 1R5OA 1QU2A 2FR8A 3EFEA 3A3YA 1BHSA 3DZGA 3KBBA 3O93A 3NC4A 3OIYA 4AYTA 2FPLA 3I2HA 2G76A 3RC9A 1SG0A 4JWKA 3U9LA 4E7OA 1Y6QA 2V1UA 3MG9A 2DBVO 3E0XA 3VJMA 3ABQB 3AKCA 4BEWA 3GDHA 4KR6A 1SCAA 3BG5A 2PL1A 1FB5A 5ILGA 3GT7A 2ALJA 2V6FA 3WL6A 2IGTA 1OBFO 1XLVA 2BR4A 2XUAA 3P2YA 4HS4A 4KR9A 1CEEA 1DAPA 2CFTA 3F3SA 2IELA 5KYVA 2GZRA 4K6MA 4D0GA 4XA8A 2BI8A 1E7MA 5UKDA 3VO2A 2CFOA 4FB4A 1HPLA 2AN1A 3QE0A 3FI9A 4N3CA 5ALIA 4IFTA 1TZKA 2COEA 3A0UA 1NBWB 3AIKA 3DMPA 3H87A 4R7TA 3V4OA 5CXQA 3PHIA 1P72A 1IAQA 1T6ZA 1R6TA 3HEAA 3HRHA 1GG8A 1C3VA 1T9KA 3IBYA 3WLNA 1KJNA 4GW3A 3DV0B 2OXEA 3U1VA 3O94A 4YACA 1K6XA 2EC5A 1NXPA 4EZIA 4OFWA 1NIJA 2D0PB 3JQRA 1B14A 1XZCA 3AI1A 5DHRA 1IHPA 5IULC 3SWWA 1A69A 2M6SA 4KQMA 1L5OA 3S2EA 3SEAA 2ISQA 2XCOA 3AC0A 3LHFA 4V0KA 3UK6A 2R11A 4MMYB 4IMRA 3WFJA 2ZIXB 1J2EA 5CCBA 4U5XA 1ZH8A 2O4UX 1E3EA 4B33A 3H7IA 3PC3A 1K3FA 2OZLA 4P0TA 3TXYA 1XN1A 1C7JA 1JEJA 4MROA 5B7PA 3C43A 1M34A 1A9YA 3QKIA 2P4UA 1KEUA 4D81A 1BMQA 1J8YF 3IALA 2WAYA 3KPUA 4XPZA 3PUYA 5KSWB 1QGED 1JU9A 2D2XA 2J59A 3UT5A 4F3RA 2PR2A 2A0FA 2LGJA 1WF3A 1NMZA 1Q0TA 3TBKA 4FI3C 4YEDA 2DR0A 2VN8A 3UVEA 1OFUA 1EVYA 5A5FA 1N0IA 1TKCA 2WVHA 3TQIA 3N53A 1WY7A 3EF3A 5FPPA 1W6UA 1JPNA 3HN6A 2IXBA 4M9CA 4CCYB 1U3TA 2MSNA 3AF1A 3AHCA 1WDKA 2XWPA 3GARA 1B3BA 3KJXA 4KXWA 4TRNA 1V3UA 2RCYA 2VEOA 2VJPA 5B3JC 5CK5A 1X3LA 1P0IA 2ZFUA 2MSKA 5IVDA 2I7XA 1L1RA 3RYHA 1EP1B 5K0JA 1B1AA 4G1EB 4RFLA 3KHKA 2O4CA 1XVUA 3K73O 4EX6A 2GPBA 4G0QA 2OXTA 4F60A 4ZK6A 4CIBA 2D2FA 5JMWA 3KJNA 3ZS8A 4FWTA 1CHNA 5IC4A 1LVGA 4OIFA 4LA4A 1Z4PX 1NRXA 3P4YA 4RZIA 1L8OA 4TTQA 4I50A 1SAYA 4MS4A 4U39A 4E88A 2CNOA 3IDZA 3BRCA 1W88A 2DECA 1P7PA 1QQTA 4K6GA 5A0TA 4KREA 1BFUA 3A2NA 3NJ4A 3S99A 2VK2A 1FUYB 1F6DA 2QT1A 4TMYA 4DCPA 4HH0A 1J8VA 2G25A 1E6MA 1LA2A 5DHTA 5L6MB 2DKNA 5B55A 3GJ7A 4Y2XA 3FKSA 3ITNA 3ZTYA 4ETNA 1Y7TA 5EKDA 1X0VA 1MVNA 1AXEA 2ZW9A 3F1KA 2A5LA 3GY0A 2VDLB 4KNWA 4MVJF 4G0VA 2BZGA 3CY6A 3PL5A 7ABPA 3CEPB 4AKIA 4G63A 4LBZA 4OXQA 3PDWA 4GXQA 3ZXIA 4CQMB 5JSUA 2DPMA 1X39A 1M8JA 5ALQA 1LPBB 3UA3A 4GGOA 4WUTA 3W2EA 5HBRA 1BAPA 1VLJA 5IDQA 2Y1LA 3IBSA 2GKOA 3VYTB 2ZIEA 3GGJA 3HLTA 3I23A 4HYYA 4U5QA 1RYEA 1BH6A 1QIHA 4B83A 1RE0A 1UMBA 2E4XA 4F6CA 3QUAA 2J08A 4AG5A 4BKOA 4ZAWA 1Y82A 3R3SA 4PWZA 1UDBA 1HDRA 4L9WA 3NTOA 2JLUA 1E2HA 3FHTA 1YJ5A 3E9QA 2NVUB 2IWHA 3S44A 5CITA 1A95A 5DK4A 2BJWA 4P80A 1N6KA 4K2AA 2GPSA 4RVHA 3G68A 4W4TA 2OXCA 4F2DA 4DCOA 2WU8A 4BATA 1LZKA 4DNFA 2BZ0A 1SU6A 2AJCA 2WBLC 4XVRA 5F64A 4EEZA 3SIPA 3U19A 4IQGA 2NOAA 2PZAA 4GUAA 2LZ0A 3B5JA 3BD9A 4XLTA 4BQSA 4K03A 1JS1X 1NXXA 4C29A 3KYCA 3L1HA 2CB0A 2I8LA 2X5NA 4DV1B 4DC1A 2MSLA 2WWIA 5K3EA 1ZITA 1YDEA 5A4MS 4BO6A 4ENWA 1Q0LA 1OLXA 1N0WA 2GBCA 2P62A 4MV9A 3H18A 1Q3KA 4E21A 4ARSA 5TS3A 4B34A 2PM8A 1QAMA 3HP1A 3W2HA 4TYNA 1GKIA 1PJAA 4BXOA 1O8CA 1SKAA 5BN5A 2OKGA 2X0KA 5J3JA 4RL6A 1U0GA 3BDIA 4KXXA 4RVGA 1GXSA 2B82A 1A3CA 1MV8A 1R6XA 1WZCA 3ETHA 2AYXA 1NJSA 1KYTA 4IS2A 1ZMRA 1NVWQ 2HO5A 4EWLA 3RH0A 1DXYA 1RC8A 3KR9A 2VUTA 4L0MA 3WLHA 3P9ZA 4N01A 1DADA 1G7SA 5C8YB 4R5MA 1P2BA 3REGA 4JLKA 4TWIA 2JEOA 4M87A 4W1QA 4ZCLA 1J1UA 2ZANA 3H75A 1P6UA 4CI9A 1HDOA 1WDTA 1ZCBA 2C2ZA 3NH6A 4MVJI 4Q4LA 4US0R 5IK2A 3MWYW 1TT5B 3GR6A 2XTJA 4JBIA 3AV3A 1FX0B 1QPGA 5LDDC 1K6EA 3QQPA 1QG0A 2GTPA 4EDFA 5JPCA 1UBOS 2J5BA 4BX0A 4G5OA 2ZB4A 4URYR 4N4AA 3C5WP 4EKGA 2X2FA 4J0GA 2COUA 2R86A 1ZCJA 2V74B 4WSOA 1XVVA 3AHEA 3EF1A 1YZTA 2QDKA 1SCBA 4H3HB 4PPYA 4WESA 5AKZA 2EZ9A 4L95C 3WO0A 3JALB 2WD9A 3G9ZA 3HCNA 3M2TA 3A4LA 3MMZA 3PF8A 4N3AA 1SHZA 1E7YA 1SC6A 1TEVA 3OCYA 4TM7A 2OV6A 5D2CA 1K89A 3Q5GA 4LZOA 1PUXA 1AA9A 3N3BC 4NE9A 4Y2HA 1OV4A 1Y63A 3KT8A 5CA1A 4DMCA 1A4IA 2E82A 2OM6A 3RASA 4C4YA 3IESA 4ND8A 5BOSB 1T5HX 4E3ZA 3UUGA 2WLTA 1B6RA 3UJCA 1JSXA 1XF9A 1RAHA 3DZ8A 2I76A 2QU7A 4PAOA 4YCBA 1KEEA 2W8BA 4TYYA 5D1NA 1NQTA 3GMDA 3UPUA 2GUWA 2YQ5A 4HDNB 4LNAA 1NFFA 4DGSA 3QI7A 4FONA 4JC8A 1CEYA 2WU4A 4HRYA 5A3JA 4AQ7A 1UWKA 1V4NA 3GEEA 3SP1A 2PEYA 4BMCA 1Y7LA 1X1AA 3N07A 1P2FA 4I4NA 4V39A 5EIWA 1JV2B 4PY2A 4URVR 5EHZA 4IIUA 4X7MA 3U9SA 3SQMA 1BH2A 4BX8A 3WL5A 4WZAB 2QJTA 3F8TA 4QBGB 3H42B 2ZE5A 4UU7A 2JI6A 4ENVA 3LKDA 3PUJA 4MJXA 3SEQA 1NWCA 3GP8A 3NJ8A 1YS9A 1Q19A 1VJRA 1UQTA 4ZO7A 2ZSEA 3ENWA 4C5BA 2XOEA 1Q95A 5FA6A 1AKUA 3QVUA 2DFVA 4BKMA 2BKEA 2CE2X 5KJ6A 1V35A 2BELA 2JGRA 5C81A 3C3AA 4FLEA 1R4ZA 2VHYA 3LVQE 5JDIA 1JRLA 2Q4BA 1TQ4A 4K0KB 1GGNA 3ZW9A 5FUMA 1EFDN 2PWZA 2VHCA 3FZGA 3PU6A 1NBME 2OV1A 4U00A 5T64A 3PX7A 2XZTA 1DAFA 4JLBA 4HK4A 3FHOA 2BCJQ 4EI7A 2JCYA 2H1LA 3K6JA 3LDHA 2XE4A 3OOEA 3NEYA 4H7JA 3V8EA 3GELA 1DCTA 2NZ2A 5L40A 1IJKA 2VXBA 2P9FA 3Q6NA 2QNIA 3ZJ4A 1XALA 4CF6A 1YZUA 2F1HA 1INLA 4QDXA 1BCSA 3NHJA 3TE7A 4DLRA 4C7JA 2OO5A 1U98A 3H6HA 1OZFA 2VPWA 1X9IA 2VEDA 2WP0A 3USES 2VR1A 4MQLA 4O29A 2HPVA 1IB0A 3HXKA 4F12A 5ENZA 5H0IA 1ZN7A 3F6RA 4R9RA 3EPRA 3OQBA 4TMWA 1RTKA 1JNYA 1Q7BA 1QYIA 3I1JA 1B0UA 2CXTA 5KMGB 2Z57A 1OC4A 4JBGA 1ESDA 4ZJYA 3JVUA 3LDUA 5ALWA 1UQUA 1WR8A 2I4TA 5AM3A 1H9CA 3UAOA 4MVWA 4Z9YA 4S1NA 3E1SA 3FTEA 1V9LA 2ORIA 2XHEA 4AYXA 1NMXA 5EJ7A 1D6NA 2EP5A 2VQEB 1TT7A 1NW3A 3NM6B 2GZSA 4EX7A 2VDJA 1Q17A 3NBMA 1JUDA 5JJIA 2NQTA 3LZ6A 1GCOA 1ZIOA 3PPIA 2PKEA 2Q28A 2A0YA 4MZXA 2WWVD 4S3MA 3MTEA 5CH3A 3FDIA 4MW0A 4ARAA 2G9QA 3B9RA 2XMSA 4QDKA 1L4FA 4YQEA 2W6PA 4ZAGA 5I7RA 3AVUA 1CUDA 4LYGA 4Q93A 3LYAA 4TUYA 5BWOA 5JWOA 1GKUB 4RHUA 2HIGA 3A9UA 3I9NA 4A6XA 2DFNA 2XAUA 1U65A 1GL3A 1UWLA 1V7PC 4Q5IA 3RTBA 4UHKA 3B6ZA 4UUNA 1X94A 1DL5A 1SBNE 4C08A 1EFUA 4MINA 2Z2YA 3AXTA 1TJNA 1LF5A 1JKXA 2ZJ3A 1K4KA 3JR3A 1RI3A 4BYMA 3WMEA 2FPOA 4LVCA 5HTKA 3U1TA 2DEUA 1KSFX 3H4IA 3TNJA 4G09A 2VP5A 1RJ9A 3GUUA 4DGQA 5ADWA 1HE4A 4G0WA 5BSVA 1X19A 1S2IA 10MHA 1O3YA 1YL5A 3DFZA 1CERA 2GPNA 3ZDAA 2Q49A 5J4VA 1Z0DA 1NXQA 1QR2A 3WKBA 1MC1A 2HGSA 1KO5A 2VBGA 3O4RA 4CKCA 5CEJA 3LO8A 1G5RA 1OJLA 1FVHA 4MO2A 5EFZA 4ZCPA 3ZDRA 3K0FA 4CUJA 1T1RA 3PFCA 3GJZA 5F2KA 5TY0A 1M83A 3E05A 3GN1A 1J21A 4O0MA 2P9BA 4OUKX 1C4XA 1O9BA 2Y9MB 3ZGNA 1EP2B 2Z58A 3T3IA 2ZROA 2Q2QA 4Y3UA 5I8ZA 3BXOA 5EIAA 2FEKA 1F2DA 2HJHA 3NT5A 5BN1A 4IVRA 5BPFA 5IS2A 4X8OA 2P2SA 2VDNB 1IHXA 4KN8A 2QD2A 1M2FA 4N0DA 4NECA 3TLCA 3WHKA 1RKVA 2J0UB 3L6EA 1OZGA 2FP3A 3AHIA 3MBOA 2W6QA 3RVDA 3T4UA 3T7JA 1UBCA 3O7WA 4GSLA 4HFMA 4ZEMA 4MRNA 2J3MA 5DSTA 1F20A 2RKBA 2X0IA 3IR5A 4S04A 4JUCA 5KVQA 2ORYA 1Z07A 1E3TA 5IJAA 4BLOA 5ESWA 2B7BA 3T5DA 4H6VA 1RWWA 1VYVA 2ATIA 4QLBA 3WSWA 2IQIA 1PL8A 3T7RA 1W0KA 2HA5A 1OA0A 2FMHA 3CEMA 3QE3A 2G6TA 4JXKA 2VPIA 4XDZA 4BBPA 4PZEA 2V7GA 5DTMA 2AFIB 3ZW7A 4BGVA 1Z39A 1IXSB 1DIHA 1HFEL 2C20A 2JI4A 2WT9A 4HZUA 3ZLVA 3TW4A 4A0RA 4DIDA 2OHGA 5G1OA 2YQZA 5G4KA 3VVLA 1QRSA 2YWEA 3ME5A 2CXOA 3J80A 2XYGA 3KQLA 1BEEA 3W5DA 3TIXB 1K5DA 5HKKD 3QGMA 4QEKA 5I9LA 2F1KA 3NGXA 5SYMA 1L5LA 3BFJA 1ZINA 1D6MA 3TLGB 5LXTB 5GVRA 1WRBA 5LOVF 1ODKA 5E8JA 3RAGA 1DMRA 1MV5A 3Q3GE 3ZUGA 6PFKA 4FKZA 5FLXA 3UMJA 1FXSA 4L4RA 3LBNA 4L8GA 4FGKA 1MC8A 4AROA 4YRKA 4D9BA 2XGMA 3WGIA 4NCAA 4DA9A 1Z7GA 4FCCA 4ZI2A 3B7PA 2PJZA 5FAXA 2ZM5A 3DSRA 4G2NA 3O8DA 4GPBA 3OFND 1VCHA 3FYDA 3FBTA 1F1BA 2NXNA 2O7SA 3JYNA 4G07A 3RRJA 6CHYA 1IWPB 1P5HA 4FGLA 4J2HA 2FJPA 3QPWA 5EVJA 3T7SA 4QQFA 2J3KA 4D43A 1JJAA 2NG1A 3FUXA 3ISVA 2BHRA 4UBJA 4KODA 2YZMA 4R1TA 4MVJM 1R15A 2ZAMA 2HCFA 3N2ZB 4OHFA 3O26A 4RFSB 4XYLA 5FWXB 1QVVA 1Z5WA 4LJRA 4D41A 2R1ZA 3EA4A 1KBOA 5IZ4A 1M9NA 1Y9AA 4HLQB 5I4BA 1M72A 3U6KA 1GRNA 1Z26A 2F43A 5MFZA 1NJ2A 1E9SA 3GF4A 2QTCA 4FBLA 4C3VA 3U5TA 2L82A 1MUUA 2BGWA 4R41A 2FN4A 4BBZA 4EHHA 4LFAB 2X41A 1QXSA 8LDHA 1XYYA 4JNKA 4O2BF 4DFDA 1I3KA 2GBIA 4PFQA 2ZREA 2KB0A 1I4WA 5JDIC 1RQRA 1SQ5A 1YQUA 3QX7A 1MORA 2A9JA 3EZLA 1CUAA 2GAJA 4G86A 4NEQA 5SZKB 3O9MA 4I5DA 3RJ9A 3UA4A 4ZVKA 1DKOA 5EJ9A 3GIDA 4FFDA 1UT6A 1XK7A 3RSSA 4L3WA 2V54A 1FTYA 2C2WA 1U1EA 2GBFA 3H9EO 3EQZA 2ILTA 2Q45A 2WIJA 2GVNA 5IHXA 3AU8A 4GRIA 3QY9A 1H8HD 1Q83A 3ETEA 3H5OA 5DNDA 1C30B 1W44A 5KYXB 2BSQA 2PVSA 4GX2A 4CKBB 5C1OA 3UMFA 1ZNQO 1PFKA 4YJHA 1JQ5A 4G37A 5A0VA 3VHQA 2E0IA 4H7HA 2XDWA 5GZ3A 4P82A 1SB9A 5AUQA 3ZDYB 1IZZA 4MCHA 2GVZC 4MS3B 3UW1A 2QAGB 4PG8A 5FBQB 3VZSA 4LTNA 1AKMA 2B9EA 2OECA 4DSOA 1B0PA 1KY2A 3ESAA 3R0ZA 2CLSA 4IDDA 1YVPA 1OI7A 3I9OA 2PUCA 4NICA 4TMTA 1DO2A 4Y6QA 4EJSA 1IY2A 5FCDA 3LD9A 2XVZA 3RYCA 1M0EA 3EA5A 1SPXA 3HV2A 3A1WA 2R1UA 3LE8A 4KEAA 4RGQA 5JNUA 3PIDA 3M4NA 1JQ3A 1R0BA 4QQRA 3M2PA 4RQUA 4XYGA 3U7QA 4C03A 3NETA 1GTRA 3C6XA 3FXAA 4U2GA 4DRXA 1KTIA 2DYKA 2E4AA 2Q1XA 3I8XA 5FL7D 5C52B 4OIMA 3HYTA 4Q05A 3R6GA 3C70A 2IYLD 1XE3A 1E3IA 3BHIA 1NAHA 2VUSA 3TO5A 4BO8A 2EGGA 1DQPA 2GCOB 4C7KA 2C2BA 3A4IA 1VG0B 4PQGA 1OH7A 1YDGA 3GWZA 4R3UC 7REQA 5E9QA 4JL5A 1JEQA 3MTIA 1UC9A 1M6VA 3DXYA 3ZBQA 2WNIA 1U6IA 3CH5A 4KQKA 4ZKDA 2OE2A 1U02A 2Q3JA 3B5EA 1VSVA 3BREA 5KOJB 3S1SA 1F8FA 2Q2NA 2WFLB 2ZJ4A 2A67A 1YZNA 1IUKA 2YOGA 4UPEA 1DX9A 3ZHVA 4ECEA 4H15A 2M6LA 3TH5A 1T9CA 1W2HA 2MSEB 3BD6A 5BN3A 1YZLA 4ZAVA 1Z6XA 2JJMA 1XG5A 5D3QA 3T7EA 2BWJA 1U2DA 1UH5A 1SVLA 2XNKA 4FP9A 3Q1KA 1Q11A 1QPZA 5HK8A 1VGQA 3VPGA 2F1RA 4RF2A 3G0IA 3AL2A 4K9MA 4XM1A 4CW7A 1FNBA 2CFRA 1C9NA 1VHQA 2BFBA 1UFQA 2LW7A 3NBXX 4O4LF 5C31A 3WQHA 2QR3A 5I7EA 2K2QB 5JHHB 1IH8A 2VF7A 1G3MA 3TDKA 2C8JA 4FZ3A 1T3ZA 3CR3C 2GPYA 3PI7A 5CUQA 3KP1A 4OA8A 2XI4A 1U0TA 1ELOA 1NE2A 2ASEA 3MOGA 5HF8A 1GNPA 3CUEF 3L92A 4DNXA 2BSXA 1FMJA 2CJPA 4AZSA 1S3GA 3IS3A 3MTAA 4NCXA 5IT9A 2BEWA 4WXMA 2V3WA 3S5JA 3RAEC 2UUAB 3N75A 3DEJA 5JRJA 4JD5A 4MHSA 2ZVJA 4FX5A 1PR6A 5C7YA 2X5JO 4TTRA 5H3HA 3AF6A 1YMUA 1ZY2A 1NASA 3R20A 5EL0A 2XZLA 1IN4A 4OXIA 1WUKS 2NZJA 5EWLA 4JU9A 3G89A 4DAEA 1Y89A 1J20A 2LCIA 3QWHA 3HN2A 4F96A 3ANSA 1Q7TA 2B8NA 3CR8A 3K9CA 4KQHA 1T9GR 4BQNA 2FHSA 5K01A 3S2FA 1XBTA 2QI9C 1QV9A 4ZIRA 1QYVA 4JI7B 1S8FA 2YN0A 3WJ2A 3WWYA 2VHWA 5C4MA 2KLBA 3PC7A 3ZWAA 1AO0A 2YJZA 1P1IA 1SUIA 1E0DA 4ZODA 4FZRA 4JFAA 3AZPA 3HR8A 4UVGA 2YFQA 1XTRA 3D4BA 4TWJA 5BSWA 3CBGA 1FCJA 2AC4A 5CX1B 3S1AB 5EKSA 3DFMA 4JJ7A 1JR4A 1TZ2A 4X1IB 1B0ZA 3QXJA 1DELA 1THZA 1A4RA 1XMQB 5B2FA 4IDGA 1HYQA 1ZAKA 4H08A 3S6JA 3BK7A 2DH6A 2UZAA 2Y4NA 3IRUA 3SZ3A 1G16A 1QVRA 3C5CA 3GGOA 3CURA 4LHWA 4LE1A 5T41A 3N74A 2W6JD 4XWWA 5CLFA 2AOUB 4G0PA 4JKOA 4KRXA 4EECA 2HZ7A 1HT1E 2HLHA 4CFZA 1LV8A 5HE8A 2HTEA 1M7HA 1ZHFA 1CIJA 1E1LA 4UBNA 1VCOA 5KNLA 3AVYA 1JEYA 1KY3A 2BFDA 2RJ3A 1Z5PA 2ZWPA 2XNJA 4IOLA 5HF9A 5A7GA 3UNXA 3J81A 4EHIA 4E6EA 1Y1KE 1XCMA 5DBIA 3ZCPA 4Z1MD 2A59A 3WB2A 3UMMA 2I1LA 2FCAA 4JBWA 3L82B 2FXIA 4QVKA 5KQSA 5AMXA 2PX2A 4RJKA 1THTA 4AZTA 5KI6A 1TO2E 4FI3F 2P5UA 3FHCB 2QJFA 2X6TA 4QPJC 1E6CA 4M7RA 1LSOA 4LJ8A 5G41A 1W4AA 1QFYA 2JF0A 2NU9A 4OFZA 2QZ9A 5F1KA 1WUJS 4C07A 3CM0A 3FETA 2Q0HA 3NFYA 4IHAA 4UDXX 4W5JA 1T43A 1EBFA 1S2GA 1UZAA 1VE5A 2O50A 3A14A 3IHWA 4WK4B 1ZX1A 3QKWA 1P7VA 2PMFA 3OESA 1G9SA 4REMA 3I3OA 3WGNA 2ZJYA 5JW6A 3CFYA 3P26A 3VOTA 4QL3A 5A7HA 2INGX 3WGMA 3IT1A 1ONSA 2QB5A 3WWZA 4D02A 5DTQA 4GPIB 3BORA 3T7IA 1ZBQA 3Q3HA 1SO8A 1NSTA 5B1YA 2JFBA 3GHHA 5ALXA 5B30A 3FE2A 2H7CA 3PCXA 1JMKC 3RSCA 2KI5A 5CAEB 1JBQA 3D4IA 2L42A 3S2IA 1T15A 1NQAO 1HZJA 3RVRA 2AX3A 3USZA 1JAXA 2LXNA 4GMKA 2MSWA 3MVEA 5DHSA 1ZK3A 5JNLA 1QQBA 2JATA 2YJNA 1DAMA 1L7VC 3WQQA 2H5EA 3ZV5A 3OQMA 1Z34A 5KTOA 1YVUA 4AMZA 2QYHA 5DM1A 4DR7B 2VNAA 3P4XA 1F0KA 1OXBB 1TD1A 3N3AC 4MWEA 3GLFE 4FMCB 4RK6A 1XTKA 5FL3A 3QELA 4B47A 3VR4D 1OC2A 1QCCA 2C31A 4BQQA 4K5QA 3G8BA 5CHEA 3T7DA 1DG1G 1W34A 3ON5A 3PNMA 3RT7A 4EJSC 4MWOA 1E4EB 2GHQA 3MJVA 2O8BB 1FDVA 3UAXA 4ER7A 3Q7EA 1YR8A 3ZX4A 2NSDA 1Q7EA 4NESA 3GN2A 4GPEA 5EE1A 5JCXA 4F2HA 4HKTA 5JJCA 1W35A 1I3LA 1SA0B 3HJNA 1N6LA 2Q0XA 2IHBA 1NR5A 4CFSA 1YVDA 3BE8A 1LEHA 2Y4OA 3I6MA 2I8AA 1Y98A 3ZTWA 4BY9E 4AKHA 5ADVA 1QNLA 4BZPA 4KTVE 2OK8A 3JZAA 2QRVA 5AI8A 1ZEMA 1ZMBA 1P60A 1V6SA 4A73A 1MF7A 4HXEB 1Y1QA 3ZDXB 1AZTA 4RD0A 3IUSA 4IGFA 5L7WA 2C92A 1RLMA 1SVUA 1Z0AA 3WKEA 1WZUA 3LWNA 7GPBA 4M1YA 3WGTA 3RPEA 3TEFA 1G2OA 4FIDA 4PO9A 4NK5A 4KN5A 1T36B 4F97A 1PFQA 2EEZA 5IH7A 1V7QA 3Q7PA 2IYTA 2QLNA 4OYLA 4NMWA 3TKAA 1R0KA 2A1UA 5IXJA 4MCJA 3LQYA 4HNGA 3UGKA 1K7FB 1ZBDA 2YJ5A 1U2DC 5FLKA 1FP2A 1NHGA 5JAPA 5TDHA 3EX7C 2EVWX 3OLVA 4GOJA 4HXFB 3U81A 6Q21A 2DHRA 1BS1A 4EELA 4F21A 1P73A 2I22A 3FGNA 3M1AA 1AN9A 2F8MA 1B3RA 4QPDA 1BW9B 2HV9A 2DBRA 3A6LA 3PWZA 4PC7A 5DCUA 3OPYB 5KSYA 4Y6SA 2K5UA 2Z8YA 5BNZA 2CXUA 1J0XO 4UBLA 4I6EA 1KK3A 1RRGA 1XQ6A 2FKNA 3JD4A 2VZ9A 4NMLA 5F23A 3ZWCA 4AECA 5FPKA 3LL7A 2ZSBA 3BB1A 1KYQA 5AHOA 3DM9B 4PS1A 4H7PA 2XA1A 1BX0A 4ZCMA 1XVLA 4YJFB 4DLKA 2EKDA 2FZLA 3N76A 3PI6A 1P0CA 4IOKA 4YGYA 1AHIA 4TLDA 2QVGA 4XQGA 4DCUA 4J4HA 3DL7A 1U0RA 1U4NA 3OKCA 2V59A 5LYJB 4G8BA 3UKDA 3OKFA 4P5DA 1RRKA 1IDN1 3LPNA 3D6MA 1M1XB 2D5CA 2EZUA 3M6VA 3GCZA 2HWKA 5AVYA 4O33A 4G6ZA 4EFDA 1KI6B 2PMBA 2Z3VA 3CLSD 4BOYA 4CQMD 4PVDA 2VA8A 3OCVA 2RGCA 4RJJA 1W5FA 3EPPA 1O4VA 2J67A 4P84A 1M1UA 4OXYA 4WLEA 1B15A 4KO3S 1JALA 4BO5A 2R5FA 4JX9A 5AKIA 1NQWA 5DP1A 2I4LA 1GLVA 1R0CA 3KPWA 3KQWA 1GN8A 2CLOB 4J8PA 5K0LA 1N4AA 4EHKA 5TIIA 1VYTA 1XXHE 4J0DA 4MUBA 3IT0A 1UIRA 2G8LA 5CYPA 4C0JA 3MMXA 3MGGA 4XFDA 4OI0A 3D9QX 3R77A 1ZQ1A 1ORDA 3BSYA 4X20B 4MXDA 2QTHA 3F5FA 5AHKA 3KU1A 5CIYA 2GN4A 2R7AA 2Y1FA 2RAVA 4D5GA 4R8KA 1YO6A 4RUKA 2FCRA 3GV0A 4YRIA 2MWMA 1QH0A 2QVBA 3BD8A 3F98A 4HXGA 1RXEA 4EYEA 3KSAC 4R4JA 3PHHA 3DGEC 4P22A 2FTKE 3R9IA 1Y5IA 1H22A 2H2GA 1DEXA 1NBHA 2JJYA 3N2NA 4LNUB 5BXYA 5EIBC 4P93A 3TF5A 4I9FA 1S1MA 3SR3A 1EDBA 5TMPA 2GB4A 4YQFA 3D1LA 2EGHA 3NTUA 4OJMX 4UZEA 1M74A 1N75A 2BAGA 3H2JA 3FVVA 1ZO8A 2NO5A 4LIPD 1O87A 3ZDDA 4KE9A 3SXUB 1H2ZA 1Y4ZA 2CHQA 1FSZA 1P75A 4GBED 4OMUA 4DQXA 3JYLA 2WR8A 2VJYA 3PC4A 1XCLA 1PJBA 2HHAA 2ZSIA 4YWHA 1W4ZA 1D0SA 1H1LB 2VQ3A 2Z2XA 3N8NA 4HGPA 4DBLE 4JSRA 5JHGB 1O6ZA 2R60A 3MQ2A 5LBUA 1IZ9A 4HUQB 2RHJA 2FWRA 3GJXC 4HZIA 1UFKA 4S12A 1I2BA 4QA9A 5COQA 3VSAA 1OY1A 1STOA 1SOWA 3EUAA 2YWHA 1XEXA 4HBGA 1K8XB 3P0IA 4PE5B 3IIEA 2L18A 2MINB 2FFRA 2ROQA 1YS1X 2NTVA 2YZGA 4GP9A 1RLIA 3E6AA 5JASA 1Z4JA 1JHQA 1JMYA 1Q0PA 2HA3A 4I50F 4TZTA 5JLJA 5DFAA 1RJWA 1JJIA 2V8BA 3ZU4A 3LOUA 1YTLA 3Q2OA 3RRXA 4YMHA 1N34B 5DPMA 1ZU4A 1ZH4A 5EP2A 2PS0A 3NDJA 4X93A 4WCFB 4DV0B 5IBQA 1CY7A 2GM5A 3PFGA 1FY2A 1RI4A 4GI5A 5EXDA 4B9AA 1PO7A 521PA 4TS9A 4IGEA 4RHTA 5EMLA 1RM3A 1SIOA 4DAOA 1FFAA 3R3JA 2OHJA 3VR0A 1YRWA 4AX8A 3O4FA 3MB5A 4WFQA 1FQKA 3WGJA 2BL4A 2ZBEA 1BVUA 2CL7X 4ZZIA 1Y6ZA 5J5VA 4Z2AA 1MABB 1PDVA 3L07A 2ZUFA 4I1PA 2HLNA 2LKDA 1HYBA 1Z68A 4G89A 1ZXXA 1ZIYA 3B1WA 3IMCA 4PR3A 4QKQA 5DE3A 4BX9A 1A27A 1EXVA 3ZWMA 4NARA 4US1R 1GUZA 2ECPA 1YQQA 4D4LA 5AVXA 1Y6GA 4BC0A 1FYXA 3D8TA 3KZOA 5EPUA 3E18A 4JJEA 4PPNA 4WOPA 1V3VA 1ENYA 1PZFA 1TUBA 2BGRA 1Z88A 4KBFA 3SZOA 2HYIC 1H6AA 3C4JA 3OQHA 2PL9A 2WQZA 3NHWA 2PRKA 2ZRIA 3BM5A 3P9NA 4LW8A 1MX3A 1SMKA 2VIIA 2YJ4A 2GH1A 1WUIS 2JLZA 1LXCA 3T4XA 2D1RA 2V6GA 1WE2A 3D81A 4J75A 4YRLA 4Y2TA 2X0DA 1YMVA 4AJJA 1UPFA 4CM4A 4EO7A 1FMLA 4TYWA 3EMBA 1Z06A 1PQ4A 3CNNA 3I5MA 4L57A 4NP6A 1UOEA 2WA1A 3K9BA 1QYXA 2PZLA 5K0BA 2FRDA 1UBHS 2GD1O 1BX1A 4QIHA 4HAWA 5DF1A 1V11A 4GQIA 5CLJA 4RTMA 5EHNA 3KLNA 3X44A 5FR2A 4EA6A 3UV7A 3ROFA 1RI1A 5BP7A 5ICMA 2FJUA 2LCFA 5JJLA 4ZAFA 1J4AA 3ADDA 3IIMA 3RB8A 3LUBA 4PLTA 5T67A 3G6KA 2NXEA 1K27A 2ZM6B 4ZV4A 3RGWS 2AUMA 2VQDA 3M3DA 2IA5A 4MYDA 4D8XA 2GOYA 1VHJA 2QTTA 4D8TA 3PHBE 2PMCA 5DLPA 2NV0A 3PCRB 3MWEA 1A98A 1SR8A 4CCWA 5G53C 1TMGE 4C6TA 1JU4A 3E9CA 4RPHA 2D1TA 4D97A 3GLRA 4WBNA 3PHJA 1N2OA 4GWKA 3ET4A 3DOJA 3O74A 1F6WA 2QX4A 3I01M 1SCKA 5LB4A 3M49A 1RHQA 1KJWA 1WD7A 4PXYA 4ZU1X 5GZ6A 1A8PA 1B42A 1YQWA 4Z3OA 4FS8A 3VH4A 1OI4A 2VBIA 3UJBA 1T4CB 2GGSA 2FPIA 3UH1A 3UWDA 4DBVO 3JWJA 1DSSG 1NXVA 4NPAA 1GVNB 4M6WB 3R24A 2P40A 1RE1A 1VXRA 2WVJA 3GJ3A 1QMGA 5ULLA 3CISA 4RY9A 1QFMA 1Q14A 3UC5A 1DKPA 1BU5A 2YXNA 1SBIA 3SVLA 4H0CA 3LCCA 4LOIA 2ZJ5A 5HGJA 2PSJA 4ML3A 1NF8A 3KD3A 5CA1F 3NMUF 1SU8A 1V5FA 3E2IA 3M6WA 4RD4A 1ZHOA 3SE0A 1LK0A 1JQDA 2FG5A 3OM9A 1JKJB 4I99A 4MA4A 4MVXA 2RHDA 3GLVA 1VPTA 3ETLA 4RY8A 4EYSA 4MGIR 1QR6A 4BP9A 2QR2A 3EEYA 1JHAA 1T34A 1Z82A 1L5WA 1YJCA 4UBKA 4C7OB 1RS0A 3ZY6A 4KLNA 3FPEA 4M9RA 2QAIA 4BLRA 3QEOA 1ZSVA 3A1TA 2BT4A 4CM8A 4CV0A 3PPXA 4J6EA 1N25A 3WRYA 3F9RA 5HJ2A 5TVGA 4QM6A 3COWA 5LIRA 4IDAA 5TT1A 4CTOA 5CFPA 2R8YA 4A7PA 4C5CA 4ZDIA 1JNXX 2OFXA 3LUPA 4HQOA 2GEUA 1ZH2A 2WNSA 2ZT5A 3K0KA 4FGSA 1P1JA 4O1IA 4HUJA 1E5QA 1FDOA 4F4UA 1FJGB 3OETA 3BIWA 2PNFA 5AVJA 3I9LA 1MTOA 1JT2A 1Z6GA 1E4YA 1SCUB 2H59A 4ZQIA 1NPYA 4CT0A 4GI7A 5CXXA 2JGFA 2ZRAA 5G0WA 1WD5A 3HPRA 4NOLA 4O4JA 4QYIA 3ROQA 1HL3A 2FZVA 1V2GA 4UEJA 5D8DA 2PQMA 3BXGA 3DDSA 2WU1A 1ZOSA 5HQ3B 2RD2A 2M1XA 3U2QA 4OU4A 1Z63A 5LQKA 2XWSA 2H63A 2WAOA 1TU3A 3CF4G 4IFIA 4UZFA 3FDJA 4G8JA 3KWLA 2JIBA 3GLIE 1YB2A 3OU2A 4WOBA 4NSNA 3R7FA 1E7RA 3QVGB 1IB6A 2JH3A 1VJDA 4QGAA 2O2DA 2Q99A 3LHSA 4G1MB 2DMRA 1ZWKA 2H18A 3KQSA 4HN2A 4Q9LA 4ISBA 5BSTA 5IAJA 4BAUA 1JI3A 3IVAA 2FZ5A 4LHSA 5DT9A 1NGSA 4TXNA 3CE6A 1M1YA 5HKKA 2HMAA 1R9MA 2EL9A 2VO1A 3DB1A 3L7DA 5A4KA 2BM1A 3O2SB 4F8YA 5C7IO 3ZN2A 3HADA 1L7XA 2CHVA 4H1VA 5DVZA 4RL4A 1ZL2A 4HGOA 3Q98A 1JXAA 2GSWA 4FHDA 1ZJYA 2IPNA 1NLUA 1XVIA 3PQCA 4UNNA 5HM8A 1E6LA 2P8JA 5AI5A 2ZU6A 3HS3A 2PEZA 3ONNA 2O7VA 4C14A 2PA3A 1IE3A 1G5TA 2ZIUB 5AKXA 5K8IA 4BNLA 4AUMA 4H3VA 2GZ2A 3VVBA 2P9GA 1YV9A 4XX0A 5C7OO 1FFWA 2CZGA 5A1JA 1Z13A 3OFNA 5HIJA 4EJ0A 2BEVA 3JZIA 2I7VA 5LVAA 1WB4A 3ONVA 4L6CA 1Q1AA 2OD9A 4R9SA 2ZSHA 3IUPA 1R16A 4QQKA 3VO1A 5LN1A 1IXYA 3L1KA 4UVEA 3PNVA 3KQNA 1FLDA 2YQ4A 5FNVB 5FPYA 1MX9A 3NV7A 3ASYA 3PRJA 4CDNA 4MA5A 4U7TB 3LRPA 1WPQA 1BWQA 2HTFA 4PBSA 5HJEA 1SFRA 2FU5C 3E1KA 5ALJA 5KIAA 4JJKA 2RHLA 1TMOA 3GOHA 4CM3A 1J2YA 2WABA 4B3MB 3IDFA 1OXSC 4TUYF 4QULA 1WG8A 3F47A 2BISA 1XCGB 4J0JA 4G0XA 3B9PA 1FRFS 5TQVA 2CJYA 3VV2A 2IW1A 4OQ4A 5AW8A 4TMZA 1RHUA 2VJKA 3BMNB 4JI6B 5A9RA 3S81A 1W5BA 3CW8X 1IOZA 1ZAYA 2O8FB 2V98A 3OJ0A 1PT7A 1VCMA 2Q3HA 3OF2A 5D7BA 3DCYA 1ZC4A 2VP2A 2UVPA 3LS2A 1G21A 4QQNA 1RMTA 2B4AA 4YDSA 5IP5A 4C4ZA 1CQPA 3M83A 9ABPA 3H2YA 5E3JA 2WSBA 1O5OA 4Q9KA 5J2TB 1NMQA 1KXJA 1M0WA 1CG6A 1H8HA 4NNOA 4KI7A 1P0MA 4ZRMA 2PUWA 3F97A 5ALMA 3WLQA 3THWA 1E2LA 3IAM6 2ZETA 2VDWB 2FRDC 4WDQA 5BW5A 1RWMA 1NNEA 3D3WA 1YE8A 5FWYA 4U3JA 1TX4B 1XF1A 3HYLA 4PQFA 1M2OB 2VZ0A 1MPXA 3JASA 3OQVA 5HDQA 1P19A 2ZJ8A 3QPCA 3TRHA 4B7XA 1DNPA 3PITA 4QJ4A 4RVFA 3INGA 4M9SA 1RWXA 2OM2A 1BA3A 5BRAA 1G4AE 2Q2OA 1VLMA 2X9VA 3GGSA 1CV2A 3HJGA 4XIIA 4H6WA 3UHFA 1D07A 1YJXA 3CIFA 5FBZA 3WLMA 1L7NA 2GA8A 2ERXA 4YECA 2V8OA 2DVMA 2WG2A 4TKVA 3ER8A 1PZXA 2N0SA 3IUQA 1AVTA 2GAIA 3EK2A 2JH8A 3KK0A 4PXSA 4F56A 4FGUA 2CLKB 2DETA 2WAMA 1P2TA 5FL7A 3FTQA 1OI3A 1PWEA 4IUBS 3VVCA 1P61B 3GLFB 3H5TA 4KZPA 2DKFA 4AY4A 2Y66A 3C0KA 3IQZA 2GFIA 4DMRA 1EX6A 1QOZA 3PPVA 4Z4HA 5MGBA 3RVQA 2I99A 2UVDA 1QDUA 3FB4A 4YDHB 2FMTA 1R6UA 1XA0A 1EE1A 1XMXA 2GWRA 3QBEA 1FFDA 3TRIA 4FDVA 4E0BA 1RZUA 3COZA 4RKEA 2ETVA 3FJYA 4H4EA 1TJ5A 2HWYA 2HJSA 4EP1A 1NKVA 3EHDA 2P4EA 3B1XA 1R2QA 1MVLA 4P5EA 4MV1A 3LNTA 4XWAA 5ARDA 4MIKA 4QG3A 3F49S 1H42A 3AR2A 4JUAA 4P4LA 4A6DA 4RE6A 4F46A 4GKKB 2AC2A 2RHGB 3X1MA 3LZCA 4JLVA 3KQOA 5DGDA 5H68A 4NYIQ 5AOBA 4HBZA 4M53A 1UXGA 5DYNA 3M4JA 5ITSA 1WZIA 2DHQA 1E2DA 3AP2A 3ZLUA 3EUFA 3VFDA 3NTXA 2Q3EA 3GVHA 4OJTA 3EH1A 3CA8A 3KVOA 4YRRA 2MR5A 3FSGD 3R3XA 4YDQA 3B6KA 4N18A 1II9A 1QAOA 4I14A 3EXEB 3WRYC 1Y7HA 1NLZA 1LDMA 1L5VA 4LWPA 1Y8AA 2GCIA 2DHDA 1U0OC 2JGJA 2VZLA 4I1RA 4Z9BA 4CPDA 1CP2A 5HIAA 5JZBA 1VI2A 2FGJA 1AS0A 1XKTA 1LPMA 1ZUHA 2DQZA 1DQNA 1N2EA 2GHRA 2EFDB 2Q29A 3LOQA 4A1OA 4BZQA 4LGVA 5JSZA 3GFQA 2DPYA 1UKZA 1E3QA 1TJPB 4I8IA 5I5EA 1L4EA 3JX9A 4IIVA 1SD5A 3I5UA 1SEVA 4I1SA 4DNOA 1GQ2A 4OHVA 4R2MA 1XYVA 1LC3A 4UD2A 4IGKA 5H70A 5DX8A 2DJ5A 1ZNZA 1TM4E 3LTNC 1PR2A 2VWQA 2RHRA 3IPAA 3HTXA 2P9EA 3JQ7A 4KC0A 5TV2A 1L4HA 2JIOA 1TM7E 3E9YA 2TMYA 2O3QA 4ZVOA 1KAGA 2R8OA 2P2DA 1CNMA 1UPTA 4RCYA 3D7SA 3NBUA 1YI8A 1GZ7A 4FYJA 4X63A 2ID4A 2F3UA 3KWJA 4BP8A 5DSZA 4HEA6 1JA0A 1YS6A 2FR0A 3D8RA 4BB5A 4KXYA 3GHYA 1JPUA 1PJ3A 1MRNA 2C84A 3TSWA 4YRCA 2PH1A 1S3SA 2FG7C 2LKCA 4YT4A 3H0EA 2QMQA 2ID9A 1V37A 2CKMA 2RI1A 3DHEA 2XVYA 2YXLA 1G20E 3UMGA 2IVFA 1HA3A 2HR1A 3OIUA 3QBDA 3PQDA 3N2GA 2FOIA 4LXIA 4Y6OA 2R1TB 5REQB 2B2NA 2AG6A 3G02A 4NCNA 3RRMA 3I5YA 3MAJA 2DLCX 1CY0A 2W6JA 3DONA 2GCPA 3UG7A 1HR0B 3OIDA 4HEQA 2WQ7A 3OJWA 1SVIA 3KVRA 3MWFA 4LYAA 4P08A 1SUCA 4TT8A 4TV9F 2WTBA 3EDYA 3HCEA 4ER5A 4NI5A 4BN5A 4UHDA 2EG5A 2WT4A 4BECA 1JG3A 2X9QA 1P1FA 2XDAA 1OPRA 4HMOA 4LV5B 1PVVA 1AK2A 1ZEJA 1XXHB 5E9AA 3TB6A 5KX5A 1MDFA 3N6RA 2JCBA 2I4MA 2A5JA 2RHHA 1XZNA 2XLBA 3GMSA 3QXGA 3VKGA 1JBEA 1HX7A 4ICIA 1Z17A 2OBNA 3FMOB 3PGVA 4Z1MA 5BSEA 3I34X 1W6RA 1ISFA 3RFXA 2IS1A 4BMNA 3OT1A 3LBAA 3V8VA 1VM6A 1IZYA 3D0QA 1EXWA 4I1OA 1MAWA 1G98A 3WICA 2P4HX 3RGGA 1GUBA 3EE6A 4X60A 1Y9JA 1MQ9A 3OEED 2GO1A 2JCXA 2NVOA 2C9ZA 3FZYA 2J48A 2NV2B 3G23A 1F9EA 4JIGA 5H80A 2QRZA 3GMIA 3KVVA 4XLZA 4BN0A 4KR0A 3PLRA 1X77A 2ZEJA 2V3VA 4RMJA 4YRTA 4CCSA 1SC9A 2HFJA 1EEXB 1GNTA 3X1JA 4AZWA 4BRWA 3IAXA 3TI9A 5JWRA 1H3NA 3HUTA 1XNHA 4N47A 4BNTA 1Q1EA 3NC1C 3UHPA 5A9SA 5AJYA 5CDFA 2OSBA 1U04A 3R3VA 4MKGA 2D2IA 5F5LA 1AHNA 1DXOA 1S89A 2EZ4A 3S68A 2IHVA 2AVDA 3ZHRA 3AUSA 4ZU3A 2Q1WA 2QUHA 1ZNYA 4OQYA 2OHFA 4L6AA 1OIWA 1N1MA 4N6NA 4BNKA 3LUKA 2XECA 2JW5A 2YCBA 5AI0A 3X2FA 4BVLA 1CT9A 1D1PA 5AVUA 4U2EA 3VTAA 1N9ZA 4A6PA 5F73A 4MV8A 4LOKA 1LBTA 1V39A 2O5VA 3CTPA 1HE3A 3FA2A 2KLHA 4N0PA 5ICFA 3VZDA 5HOEA 4E07A 3PDIB 1DKMA 1S1CA 1WMSA 1GQRA 4CRWB 1FFXB 4YAEA 2HH9A 3VR4A 2VWHA 4CR6A 4N8SA 4IIEA 3O8BA 1ZXLA 4MV5A 1AUQA 1SZJG 3DV0A 3N0RA 4MR8B 4PRLA 3WHIA 3KJFA 3EN0A 2VZEA 1K75A 1CJKC 2TRSB 2YS6A 3F6PA 3L4EA 5K2MA 3FH0A 4M0EA 3V33A 5HKBA 5KOHB 1JQKA 1HT0A 1SBHA 3ADOA 2O2HA 3G8CA 2O3TA 3L7YA 1HE2A 4ND5A 5AKKA 3FNFA 1JHMA 4DIUA 1RHJA 4WNCA 2AE2A 5EXXA 2A88A 4KDCA 2C3UA 4LJAA 2PH7A 3TOXA 2EATA 1HDGO 2WLSA 1P5FA 2ZIXA 4ALLA 3KKLA 4YV2A 4B6PA 4D4KA 4HRXA 5HK9A 2OWEA 3SHQA 1NI4B 2V5UA 1U9YA 3CRW1 4DCNA 5EN4A 4Q9JA 2IJGX 3TYXA 2O7NA 4E31A 5M04A 1A4XA 1FJHA 1VPLA 3G2LA 4EHLA 3MGBA 3K70B 2GK7A 2B34A 3UCFA 3VPHA 3WIDA 3DUWA 2WJZB 1W19A 2C54A 1DBPA 1U3VA 2CXRA 3O2NA 2P41A 3RHZA 1WUHS 1TC1A 4ZHQF 3AR9A 5EI5A 4HQNA 4BFSA 5G0TA 3EGIA 5E0OA 2I6QA 4PQYA 1PJ8A 1I6LA 2WKWA 4RENA 1USWA 2Y1CA 4IRXA 3TGLA 3K0SA 4II7A 1EESA 4GT1A 4ZU6X 3OJFA 1KVSA 3QTBA 4CCYA 2YIVX 1R3UA 4R0VA 4EG4A 5F21A 2FSSA 1M2GA 1L3CA 3IOMA 4FJ1A 4OF4A 4V0QA 2Z56A 3DKVA 1QP7A 1JZTA 5KOYA 1T5IA 1QIGA 1A9SA 3LVBA 4Q3DA 3GJ5A 5CG2A 4X6LA 1TVKB 4WKCA 4LMPA 3SF0A 4DLVA 5L9AA 1NKTA 1X7DA 3DBVO 2D3WA 4PHHA 3WAJA 3VNAA 4KUGA 3ZCVA 2PGDA 3F6CA 3ZEIA 1KMNA 5D5PA 2H5IA 3KWMA 3G6WA 1NBMD 4A23A 3Q8KA 1HDEA 2X86A 4BO4A 3VNSA 1GZ4A 2GLXA 3DB2A 5T6MA 4AKSA 4ENRA 2QLTA 1GPNA 1J42A 1T4DA 2J8ZA 2ZE6A 3MHPA 4YCLA 5JG7A 5I6DA 1XAHA 1N6PA 2FZGA 2WY2D 3WYGA 2J5KA 4LKOA 3IRVA 4CKYA 2WSSD 1DHRA 4R0MA 5JZSA 4UM9B 1A0OA 1CUFA 3EFOB 3N8HA 3G0OA 4FBGA 3STVA 3C8HA 1M76A 1LLQA 2Q1SA 3AMVA 3WDKA 4AG6A 3I9FA 3BCRA 3G85A 4BTLA 1GM5A 2IV7A 4Y6GB 4J0FA 3SM9A 5E3HA 4E13A 2GXSA 2JBAB 4QICA 3JTEA 1KFJB 1YZFA 3RYTC 3W5UA 3ZXYA 2WSMA 3AVTA 4C5AA 3NJRA 2XAAA 1CDDA 3OA2A 3HLYA 4CQMA 2P9HA 2FEOA 2GN9A 4O3FA 2P6MA 1MGPA 5C5DA 1VE3A 3CU5A 3IR7A 2ZYRA 3DOFA 4OA5A 2QKYA 3T61A 4BFCA 3O38A 2IZZA 2NXWA 3N0TA 3JD2A 4FFMA 1XCOA 2R68A 3O1HB 4DB4A 3C5HA 1R9NA 4I2VA 3I04A 1NI5A 4RD2A 3WDSA 4MMXB 4DV5B 5KKNB 2R8XA 1VZ3A 3Q9UA 3QJYA 3T1QA 4U2BA 5LD2B 4N48A 1DXHA 2NU6B 3E84A 3NKFA 3WHPA 2J7PA 3DCIA 3N8IA 4QOSA 1EGAA 2XTMA 1WV0A 2WYVA 1V5IA 1NJ5A 2YC2C 3ZZMA 4Z7JA 4OXNA 1XZDA 1R6AA 3PEWA 4M89A 4O02B 2CB9A 3JWHA 4Q18A 4TWBA 2VDKB 2XBLA 1HH4A 1NFRA 3N1UA 1CJVC 5LQRA 4KXLA 1RLUA 2UXBB 1EB8A 1KI9A 1NXSA 3O8QB 4KQGA 4PFSA 1KE1A 4EMBA 1XZQA 1L4KA 1ZK4A 1C3XA 5HRUA 2WM3A 2ZRLA 2GKSA 4E30A 1EVQA 3NORA 4KBGA 1NYRA 3SBXA 1QIKA 1IHUA 1JHYA 2NU7B 4YASA 3DQPA 4JSYA 3EGEA 5TPWA 3TPCA 3THYA 2OBMA 3GP5A 2PUAA 2QVXX 4OBXA 4PCAA 1UK9A 5TF0A 3DL4A 1KZ7B 4O4IF 4NTZA 2BBTA 5L3QB 3W6NA 4JQCA 3VR5D 5SICE 1M2EA 2BFMA 3MGKA 4J16A 2Y1EA 3BICA 4RF4A 5JBQA 4LGMA 4OP3A 2EJVA 1YRAA 5AHRA 5E7IA 1KYWA 4G36A 6NULA 1N6HA 2NGRA 3RHSA 1KIFA 5IYZB 1QIJA 4B46A 3WGVA 2EJUA 2IHYA 5C8YA 2IYEA 2VPXA 4JLJA 5CDUA 1A2KC 4KI0A 3QJGA 3W1VA 1O58A 1IBCA 1ZIXA 2JJ8A 4L2IA 1LTQA 1TT5A 4MQMA 5JQWA 3OCUA 4LPKA 1Y4UA 4NQRA 3JZDA 4O59O 5IDYA 1OFUX 1OAOA 1FX0A 3OY7A 4RESA 4U0KA 2IXTA 2QTNA 3W8RA 4M0FA 2DH5A 1BROA 3FRIA 3HABA 1X8LA 2C2YA 3BXHA 3HL0A 1P91A 4B74A 3NEAA 4MB6A 3KIPA 4REQB 4WOKA 4LDJA 4JY7A 5TS2A 1LBHA 1JFFB 2C2HA 2QA5A 4RWEA 2HM7A 2MIIA 1ODFA 1I4LD 3SBOA 4I3HA 2ACEA 3JALA 2V0NA 4UARA 4H60A 3RS4A 4N5NA 1XLTC 1FOEB 3ZGVA 4Z7NB 2OBLA 3WGLA 1LJUA 4B48A 4EENA 5HQJA 4LGYA 5BOSA 4LISA 1X14A 2KYRA 4P36A 4UBIA 4DKXA 3TQHA 1DGQA 1K2WA 2Q5HA 1I2CA 3HCCA 1VMEA 1ZI9A 1TM5E 3RJTA 3DZIA 3T5GA 4NEHB 3E9EA 3D0RA 3W7VA 4KPYA 2ZBPA 3G5MA 4YC7A 1AS3A 3VO8A 1L1FA 3VU8A 3KE9A 3C2QA 2GAOA 4N40A 3SDSA 2VDQB 4B0OA 3NS7A 4UPDA 5E9JA 5H4HA 3VOS<