1IJKA

The von willebrand factor mutant (i546v) a1 domain-botrocetin complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
199
Chain Sequence
b'PPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRVSQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords von Willebrand factor
molecule tags Blood clotting/toxin
source organism Homo sapiens
publication title Structural basis of von Willebrand factor activation by the snake toxin botrocetin.
pubmed doi rcsb
total genus 67
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1ijkA00
5HJ2A 2VDMB 1SHTX 2I6SA 1Q0PA 1N3YA 3K6SA 4DMUB 3PPXA 1NA5A 1U0NA 1SHUX 1YVPA 3FCSB 4FX5A 3IBSA 1RRKA 3NIGB 1FE8A 1ZONA 4CN8A 5E6UA 1ZOPA 2ICAA 3NIFB 3EGDA 1QC5B 4O02B 1OAKA 5KYYB 2WW8A 1DZIA 1JEQA 1T6BY 4UM8B 1UEXC 4HQOA 3BN3A 1AOXA 2NUPA 1IJKA 1MF7A 2WINI 1L5GB 1MQAA 3ZDYB 1ATZA 5E6UB 1JEYA 3EH1A 1MQ8B 2VDNB 1MHPA 2QTVA 1PT6A 4IXDA 3ZE0B 3ZQKA 1M1UA 2VDPB 4M76B 2IUEA 2VDRB 3K6SB 5E6RA 3TCXB 1JLMA 3N2NA 1FNSA 2I6QA 2ODQA 3EH2A 1YVRA 4IHKA 4C29A 5ES4B 4XW2A 5KYXB 4JDUA 1IDN1 3QA3E 3HXOA 3TXAA 4HQLA 3ZE2B 1M10A 3EFOA 3V4VB 4HQKA 4F1JA 4G1MB 3VI3B 3VI4B 5KYNA 5KYWB 3EOBI 1DGQA 4HQFA 4CN9A 3K71B 2X5NA 1PD1A 1ZOOA 2VDKB 4WK0B 2VDQB 3PPVA 1TYEB 3F78A 4NENA 4NENB 1M2VB 4Z7NB 1LFAA 4NEHB 1JV2B 2XGGA 3PPWA 4C2BA 3TVYA 5E6SB 3HI6A 4WJKB 3HXQA 1U0OC 2NUTB 2ODPA 3EG9A 2ADFA 4MMZB 3IJEB 3K72B 3T3PB 1IJBA 3EGXB 5KYUB 3EOAI 4C2AA 3F74A 4PN7A 3E2MA 1IDOA 4MMYB 3RAGA 4F1KA 4WK4B 1BHO1 1N9ZA 3Q3GE 5KYUA 3EGXA 5HGJA 3ZE1B 3BQMB 4BJ3A 3EG9B 2I91A 2NUTA 1RTKA 1MQ9A 1M2OA 5E6SA 1XUOA 1CQPA 1XDGA 2VC2B 3ZDXB 4UM9B 2VDLB 5E6RB 1M2VA 1MJNA 1SQ0A 4WK2B 2M32A 3M6FA 4G1EB 3GXBA 4Z7OB 1T0PA 3PPYA 4HQNA 1RD4A 4CNBA 3BQNB 4WFQA 1JEYB 1BHQ1 4UM9D 4A0QA 5KYWA 2NUPB 4Z7QB 1V7PC 4IGIA 1JEQB 1XDDA 3EFOB 4MMXB 3FCUB 2XWJI 3NIDB 3T3MB 2O7NA 1QC5A 5BV8A 5KYYA 3EGDB 1PCXA 1RS0A 1U8CB 2VDOB 1AUQA 5LN1A 3TW0A 3V4PB 1CK4A 1QCYA 3ZDZB 1PD0A 5KYXA 1AO3A 2B2XA 5HDBB 2NVOA 2XWBF 1M1XB
chains in the Genus database with same CATH superfamily
2MYTA 2FMKA 5C5CA 2CLSA 2GILA 3TMAA 1BW9B 1XOIA 4JI2B 1LZLA 3HG7A 4J0QA 2QVYX 2Q99A 2ZE7A 3RIGA 1XPJA 5U4QA 2O8BB 3DHEA 1COZA 1YO6A 4UOEA 2FPPB 4M21A 4ZGBA 3GZ4A 2C9CA 1SQFA 1ZH6A 3DPUA 2AVNA 1E64A 1RYMA 3F7MA 1K66A 3LDGA 1G5PA 3CHYA 2VNSA 1LPSA 2IKQA 3P20A 4U2BA 4KR9A 3PXBA 5DWDA 5SV2A 2IYYA 4LZOA 5ILGA 1JG7A 3I9LA 1G6HA 5DTIA 1KYIA 3ASVA 4BBPA 2PH5A 4ZVOA 1VTKA 2GK3A 1RBZA 5FAXA 3AM4A 3M7IA 2NZVG 3QOYA 1HMYA 1T4CA 3U7JA 4H18A 1XFAA 2J9ZB 1FYEA 4BE4A 5E7QA 1JLRA 3X43A 4BFVA 1B6TA 4ZCRA 2E21A 5CPBA 4MV7A 3DTVD 4TYYA 1EGAA 1O5TA 1OOEA 5JPCA 1R4NB 5AW3A 2X0JA 2EIHA 2PZEA 3ZNOA 1AQJA 3CLUD 4AG6A 4KR3A 4N8EA 3LC0A 2X2OA 1NRJB 5DX8A 1WPGA 1XU9A 1VL6A 1P3Y1 4Z8YA 1QQTA 4TM7A 2JLCA 4E13A 1XQVA 4MUHA 3TKAA 1QMGA 3S4YA 3E58A 5JYDA 2C5AA 1JDVA 4HWTA 3T52A 5L4NA 1UZNA 4L72A 3NP9A 1M0EA 2XX3A 4XQCA 1W5TA 3NBFA 4W1QA 5C32A 2IXBA 1Z28A 1ZGBA 2EX4A 2MU1A 4P0PB 4YPVA 4NFLA 1IUNA 4NECA 2VHUA 4AN1A 1BVUA 4TSKA 2WIKA 5JVDB 2Z57A 2Q5EA 4NPAA 1XAJA 2NVBA 1EWKA 2EWMA 1C7IA 3EXIA 4MTLA 5FFMA 2OFOA 2C8JA 1W36D 1OW3B 1UXIA 2ZANA 4A0RA 2O4UX 2HBRA 4WPGA 5F2NA 4EJMA 2BM8A 1JU3A 4O4HA 3ROEA 1QX3A 4R8KA 4Q1FA 1L5LA 5B30A 4FE4A 1AGRA 4LI0A 2ZJ0A 1E2DA 2DHQA 1DU4A 1UJMA 3O7MA 4PHHA 2O3TA 4X85A 3T5AA 3IQXA 2IHYA 1PIWA 3M8KA 3PI7A 4XUDA 1XZQA 4KMSA 1UIRA 4B6PA 1OPRA 4FFNA 3ER9A 2HPVA 1R8SA 3MJCA 4WNIA 1ZJJA 2GD2A 1Z8DA 3RVQA 4BP1A 3PDIA 2G70A 3I61A 4AO8A 1XZNA 1N36B 3AQIA 4XIJA 3DOJA 1MD9A 3OC6A 4LGYA 2VHCA 1O87A 3FPLA 1XZIA 3GA0A 1ZN9A 3GJSA 3NCTA 4KDCA 4B7ZA 4ATNA 2ZLBA 3A9RA 1NLUA 4ZMRA 1Z6AA 3BXOA 3RKRA 4CTKA 3MRSA 2ZSIA 4FGZA 3K31A 4M55A 2IYQA 1KYVA 4P33A 1Y3BE 2AZMA 3EFEA 4BN4A 2A94A 1AV6A 1IBMB 3ID6C 3K2BA 3KJZA 1ND5A 1O97D 3BIJA 2NMVA 1PCXA 2XXJA 3LF2A 3UJ6A 3FDZB 3UN1A 5KOYA 3TLJA 3L7LA 2PMBA 2F67A 2XCLA 1E9EA 1F8FA 1K3UB 4IIXA 4KVGA 1H6BA 4E70A 4KIJA 4DN6A 1HXHA 3R0XA 2YQ4A 1NUUA 5IU6A 3SFVA 3EMDA 3GMIA 3KAJA 4XUGB 1R50A 1AE1A 1KBZA 1Y8CA 2FP4B 3FTNA 3LPDA 3O4GA 4AKGA 2IOQA 1V2HE 2AR0A 2CKDA 3KLOA 4S3MA 1QXSA 4HAOA 4X92A 4J29A 4BO0A 1V3UA 4C6TA 2BFFB 1PR6A 3JQ6A 3VR6D 1P2SA 5AUQA 2CL7X 2E4YA 1U2TA 2K2QB 2WHYA 2YMLA 1OSNA 4G07A 1DO2A 1KAMA 4QU5A 1GXSB 4NYIR 2NU9B 1NQVA 3THSA 1RXUA 2VSOA 3BGSA 4A2PA 1IL0A 1AOXA 4RJIA 2KYRA 1XRSB 2WFLA 3NQ41 4IR7A 3W4KA 2RDMA 4GR5A 4TLAA 3PQ8A 2EVWX 4MQMA 2X0KA 1QV9A 2VEOA 3GZNB 4GMKA 4F4HA 3K7EA 4G85A 5F12A 3K8YA 2PZBA 3ENNA 1EQUA 5ALHA 2HU7A 4W99A 5ALFA 2Y2VA 2HXSA 1ZPDA 2PO7A 3HBMA 1B7GO 3H4VA 2CXXA 4MVJI 1TRKA 4S1WA 1QRDA 1NUQA 3A9CA 1VE1A 3A9SA 3IAXA 3LL4A 4G84A 1XROA 4AMGA 5BOSB 1R88A 1P0FA 2DOKA 1TD1A 3OOWA 5FT9A 2X42A 3BHJA 1NI5A 1RYFA 4JHLA 4C6HA 3HYTA 4LYGA 1R64A 3DL4A 4FKBA 4M7RA 5EE9A 3KJFA 3HKDB 4HV4A 1NVMB 4TN5A 1K5HA 1VE6A 3PVSA 1GYRA 3EQ9A 2PR2A 4NU5A 1K7EB 1RHMA 2DF8A 1KE2A 2ZDGA 4HQFA 1GLVA 3UT5A 5F9HA 3W6UA 2RCNA 4KI7A 4X00A 2OD2A 1Y4ZA 4EG0A 2PXHA 4FR5A 4EH1A 4QUJA 1QH9A 1FB5A 1NBOA 2G1AA 2P35A 3IOCA 4RPCA 2CVQA 5DCUA 1Y63A 4XDYA 2B3TA 1EI9A 4ARUA 2J0UB 3L7BA 2L18A 5JAPA 1HA3A 3P2EA 3ZV3A 3WIEA 3NHMA 3Q12A 1CEQA 2R62A 5KDLA 4LJSA 2G0AA 3JZAA 4ZQGA 2C96A 1P7WA 1UBRS 3HCEA 3M33A 4NBUA 3U81A 4KQJA 1MTOA 5JFTA 3RHZA 1KERA 4BO6A 2A8YA 4ALKA 2QTNA 1E60A 4D3ZA 4HBGA 1PUXA 1XTRA 1U5CA 1CQJB 2ZB7A 4WNYA 1CRWG 4O5OA 1Z0UA 1NZJA 4OYRA 4YV0A 2B8JA 3VPHA 1U2SA 2IF2A 3VHXB 5IT9A 4IFTA 2ZUWA 4YDQA 5IAAA 1RKUA 1U3GA 3O0TA 3DE3X 3NP7A 5CEEA 4I8DA 4D56A 4NPCA 4ER0A 1F3OA 3ZDXB 3IA7A 1N7IA 3VNUA 3ORHA 1MG0A 1BX1A 3ZHCA 4L78A 1K9SA 4V1CI 3WLJA 3G23A 4EDFA 1OLSA 1YC5A 4C7JA 1J9ZA 4GL2A 4XLLA 4RK0A 4XIGS 3QPAA 2QLJA 4CNBA 2CDNA 1AB6A 5C34B 3C2QA 2JG3A 2CT8A 2EJCA 1NBWB 1PZNA 3BZWA 2EZTA 2WA2A 4J0GA 3L8DA 1LA2A 1EM8A 2C4MA 3OP1A 3F3YA 3W2TA 1IBRA 1NVTA 1CUXA 3S2FA 5IFLA 1L8QA 2VCHA 4PHGA 3VH4A 1YS1X 3IHLA 4L6CA 4BP8A 3FR7A 1POWA 2ADOA 3II6X 4PM4A 3S27A 3JWEA 3MBOA 3CX4A 5G40A 1VI6A 4LOKA 3B3AA 2BONA 1H6DA 2PLNA 2PO5A 3H2GA 2GPTA 2H51A 3ILSA 3KB1A 3LOQA 4RJ2A 3TD9A 5DLYA 2PJZA 2VT3A 4G5XA 4DV5B 4J91A 2PQ6A 4GQAA 3KWJA 4X6XA 4BLQA 4QLBA 4Z4GA 3AB3A 4LWPA 1WG8A 2VYFA 4RKQA 2B36A 2DUJA 1DMRA 1UFVA 1YDFA 2MJLA 2PZKA 4A23A 5HPYB 4MI9A 3OLCX 2ZTUA 1Z37A 1MQ8B 4WVFA 2COKA 3LY5A 1U2QA 4TRJA 5D3KA 1A8HA 1DL5A 2DZDA 1IATA 2JCVA 4REQA 5E6RA 1OFGA 1QG0A 1FMFA 1CJVC 2W6NA 4PPYA 3R3XA 1IHXA 3W34A 4G0VA 5B5SA 4HADA 1F17A 4EENA 3KEOA 1KJ8A 1ZSNA 1MABB 1RZ3A 1Y3AA 3C3CA 1N5OX 3IX7A 3V7WA 1F0PA 2E55A 1XWWA 3SQNA 5L9AA 4HQLA 3KQWA 4Q18A 1VPVA 1J24A 1I10A 2BBSA 3PNYA 4ISBA 2E7ZA 2JIQA 5FA8A 5IZ4A 1TZ2A 3HB9A 3QENA 4GKVA 4IDCA 1VRVA 1ZWKA 3ZCPA 4YRDA 4MUMA 3EFBA 3JYHA 3K71B 3TBFA 4XGRA 2CDAA 2QLMA 4PBRA 4UPVA 3O84A 1BHJA 1ODIA 1P81A 1NZFA 3BE8A 1DDOA 4PANA 1CZUA 3MRVA 3V80A 1TYEB 1RLJA 1KXJA 2B69A 1OXVA 3IBGA 1S3SA 2JFVA 1US8B 3WJ7A 2EU8A 4ACAA 3H4IA 4RS4A 3VKVA 3EW7A 3PNPA 5FYDA 3PRKE 4YJHB 1TCUA 2ADFA 4D92A 2IHKA 3VVBA 4CQJA 3O8OA 3LYUA 4D74A 3P1JA 2WJJA 1R5JA 2IEIA 5SY4A 3HNRA 3FPEA 3NTXA 1KH2A 4YV2A 2QB5A 1TT5A 4HKTA 5FBVB 1RAGA 2CFRA 3HKDA 4R2IA 3CEAA 2FW8A 3NBUA 1TEZA 1KRWA 1N34B 2QR5A 1U2DA 2V3WA 1OBCA 1RKBA 1SBTA 13PKA 1Q50A 4KGZA 2I91A 1G8MA 4HI0E 2ZYAA 4UEOA 1CR0A 4PYLA 1GGNA 2FPIB 2KW5A 2OVFA 3FFBA 2F8LA 3PTZA 4URYR 1NURA 5E6SA 2FEWB 5ENVA 2PX4A 3S99A 4E4TA 4DV7B 4OAOA 4JUDX 3X1XA 4XUEA 3HWRA 1S2DA 1YCDA 5TARA 2HV9A 3DFUA 2JGRA 2TSYB 3IR7A 3V7YA 3PGA1 4UNSA 4LF5B 1YVDA 1SEPA 3GEDA 4BFZA 4UOZA 2CJWB 7MDHA 4TS9A 5LR6A 3LGXA 4O4IB 4L0MA 3DOCA 5ER6A 5BURA 1F7UA 4WZAA 4GWKA 5FPQA 4JXXA 3WL5A 1E9AA 1PWYE 3EODA 2PRJA 3WL3A 4EA8A 5TQ2B 2QT9A 4KZKA 5AHKA 1E6KA 1CQIB 2D4AA 1QCDA 2OQ2A 5I8ZA 3WSVA 4FHGA 3VOBA 2W2OA 3F6PA 3OZGA 3SHOA 1CNEA 1LKZA 4DMFA 4IJWA 2YBEA 4RHEA 1EHCA 3OEEA 2RI6A 4K88A 1J23A 1Q17A 2GETA 5KWJA 4EJFA 3BA1A 4MYUA 3KWMA 3LP5A 2ZJ4A 3EGCA 3IIIA 4TXLA 5LMNB 3QE2A 1DCKA 4PG8A 2QSJA 4CR6A 4DIEA 3E5NA 4DAOA 5LJIA 4CDNA 4XTCS 1DWUA 4MGIR 1JJVA 5TJHA 4LMBA 5CEFA 4FOLA 1DDGA 1VPEA 1X2BA 1ZD1A 2B4KA 2DKOA 2EGHA 4MEAA 4ZVRA 5H1YA 1FRNA 2XVAA 3C4QA 3KYDA 1PQYA 3OQJA 5FNZA 5LBUA 2A33A 2Q1XA 3RGWS 2P5YA 3B82A 2EKPA 5L3QA 2QT0A 4U5XA 5KNCH 2VDWA 3B6IA 3I3OA 1QTQA 1V7CA 1EJ0A 1KMNA 2RJ3A 2LIVA 2O0JA 2V7VA 4U8HA 2WZDA 2R84A 2VZ8A 1UKYA 1HLFA 5JTTA 2OO5C 3SJZA 4ZI7F 5K0JA 3PJGA 4B75A 5HKAA 4PYNA 3I72A 3BGOS 4IDQA 3G02A 4JYMA 2PG3A 1OLUA 1T1IA 2FN4A 4HY3A 4MSUA 3U9SA 1OZAA 4PCAA 3PLNA 4F3CA 3T1NA 2OCBA 2BEUA 4DUZB 4N0DA 1CY6A 1EZZA 2XB2A 2ONZA 3AI2A 3BOSA 5H9WA 3C1UA 5DYTA 1VDMA 1R0RE 3UOWA 1JVNA 2JBAB 3GRUA 3RBAA 8OHMA 2AS0A 4ER7A 2IH4A 2DBVO 3ZDBA 5BN1A 4IDAA 1LV8A 1P9LA 5TR9A 1ZU5A 4MWDA 3C3XA 5L3SB 3EZ9A 5JAUA 5LCXA 1P2FA 1GEEA 3DA8A 9LDBA 2VPWA 3I2GA 4GOJA 5AVTA 4JLUA 4UM5A 5CAEB 2FFJA 3VPXA 1JKJA 1X1DA 3DB1A 1COWD 1P62B 3U56A 1MU0A 1U7PA 3FDJA 4J0IA 721PA 4AY6A 2J31A 1FK8A 3ANMA 1SBYA 2CVZA 5EQTA 1XIVA 3SHQA 1RWBA 1P2BA 3FNGA 1WMAA 1O89A 1ORRA 1HRKA 4FT4A 3H1PA 4MDYA 5I4BA 1IQRA 3TIXB 1Y6JA 1T9KA 1PSWA 1T0IA 1JECA 5D6NA 3L6BA 3IUEA 3Q7PA 3WLPA 3NIBA 5A5GA 4TZTA 4Y2VA 3SYRA 3MPUA 4ZT7A 2P1RA 2ZBRA 1GUBA 1MB3A 3TTVA 4G36A 2Q7OE 2R6R1 2AEFA 1YDEA 3U3MA 4J4HA 3UUWA 2LUOA 2X3YA 3T1TA 5FPTA 4RA9B 3RYCA 4BQPA 1F4PA 4QXMA 1OYYA 1SB9A 3MJTA 4RK4A 4PFJA 4YCNA 3PQ4A 4KOEC 3MC1A 3ZGYA 1GA4A 2FSUA 3RIYA 4C2UA 2C59A 4HS9A 1C7RA 4Y9TA 2QXTA 1JL3A 1Z12A 2ZRDA 4ZA2A 3ZHRA 5FO1A 1DE0A 4OHMA 1M6VA 2UUCB 4TTJA 4XYMA 1SCBA 2YVKA 2FYTA 1BW9A 1SULA 1KL7A 4M36A 3VNVA 3WFJA 3TLXA 3V33A 3AEQB 3OT5A 2J7KA 4N47A 1T2UA 4NMHA 1I4OA 1QHGA 3P7MA 4NG5A 4G41A 2RGWA 3SX2A 4N3NA 1Q5PA 4RVHA 4IDPA 2C2YA 4BTVA 2QPOA 3AKCA 3H0EA 3I0ZA 1QWSA 4US2R 2BGTA 1G2QA 3BJMA 1G3MA 2IEGA 2A5DA 2HO4A 2YDYA 3O3MB 4W7HA 2DUWA 4CR7A 2R1TA 2I4RA 4B0PA 1RAIA 3TTWA 2G82A 2IHUA 4AXXA 2QUAA 1XB2A 3KQOA 4MCAA 4RGBA 3VYWA 4CCSA 4ZCIA 2AI2A 4DV3B 4QEKA 2J9XB 1TX4B 4M54A 1XZFA 2KM1A 2C5EA 3C85A 4IIUA 4V0KA 3UTDA 5A2GA 5I7UA 4FFSA 1WUIS 4D99A 5LL6P 4H7PA 3K6SB 1SZDA 1Q7RA 1T6XA 1BDJA 2BLNA 4RDIA 4TUYB 5FADA 4EY5A 5ED0A 3WI7A 2GCPA 4I3FA 2NNWB 4P7GA 4EUHA 4PPGA 1HF3A 4NAHA 5G0VA 4IYRA 2JGEA 5HQTA 4IX1A 3DCNA 2PGIA 1Z7GA 4E15A 1J33A 2O7SA 2H16A 2ES4A 4U0KA 4GOXA 1L5NA 3I9MA 1SXPA 2ACVA 3PUWA 1PR2A 4YALA 4F84A 1V1MA 5G3YA 3GJQA 2VIIA 5DW0A 1QCZA 1N2CB 3PQEA 3U4IA 3WNVA 5K3CA 5C18A 4KAJA 5AKIA 5F3DA 1XWFA 1W4BA 2GN2A 3WK4A 3KQHA 3O7WA 1XLTA 4RL4A 4QRIA 3DD1A 4U2DA 4AJJA 4F5EA 3ZWWA 3SE7A 2NUAA 4A8HA 4Q4JA 4ALIA 1EFRD 4BWVA 3FOFC 3PTLA 4JUFA 1HY3A 2DTXA 1YE5A 5AK3A 5DHAA 1OZHA 1RLMA 1USWA 2IPOA 5A71A 5A3JA 3H8VA 2Z2ZA 4BHTA 2HA7A 3O26A 1F3LA 4OQ4A 1HFJA 4OJKA 3U4CA 3U7GA 1UKBA 4MW6A 1WV1A 4GMDA 1QGZA 1RAFA 3DL0A 4IJ5A 1CRQA 4PO9A 4NFSA 4WBXC 5LXTB 3V4OA 3M3PA 4CMEA 3R1IA 5E1BA 1UBKS 1OVMA 1U9JA 4YCJA 1Z5WA 4NY1A 4Z3OA 3I5UA 5AW5A 1UBMS 5GP1A 4QJBA 2A84A 1KK3A 5H16A 4Z0TA 1ODCA 2FFBA 4R01A 3WZMA 5HW0A 2F00A 5A2QA 1LF0A 2PYZA 1KDPA 1N9GB 1SRRA 1VIDA 3JZFA 4LYHA 3OSUA 3SYNA 1U3CA 3IE0A 4L8FA 1NX9A 3UXMA 1VSBA 2VP9A 4P4SB 1AIPA 1PJ8A 2VDUE 4KQGA 4Q1BA 3ADDA 4XWKA 4KE9A 4ZHQB 5IJWA 1LDYA 2P91A 3WMGA 1AZSC 1L4LA 2MSCB 4J90A 4RH1A 1F60A 3CMMA 4OKIA 1OE0A 1CWUA 3GAZA 3BTVA 2HCBA 3CRW1 2B2XA 2X8JB 3HABA 4B6JA 2C77A 1AHHA 3DEZA 5CDHA 3NOQA 3GFSA 4NHOA 3A9VA 2BTEA 4YUYA 3HXLA 2A4KA 3VOSA 1NN5A 2VRWA 1C1DB 1Z88A 3GP3A 1WMSA 4NONA 5IBPA 1DQPA 4ZAZA 4BEJA 6ABPA 5KAPA 2X2PA 3ZPXA 3ZCXA 2IYUA 2IY8A 2W0SA 3SGLA 5JNSA 3FWPA 3E27A 3I2IA 5AI4A 4ZCPA 4V3CA 1UMDB 5EEHA 2IU0A 1FJXA 2QRVA 3TQQA 2VTDA 2IYEA 3DL2A 3OZCA 4PTZA 2C94A 4MYCA 2XDWA 4Q66C 2FFRA 2R7AA 3A36A 3M89A 3JWPA 4QDOA 1AMNA 1XD2B 4HN2A 4IO1A 1NBME 2HMTA 2REQA 3B5IA 3B1XA 3QJ5A 1Q15A 5BQXA 2ZJ7A 3NYWA 3V4LA 3ZGLA 3F96A 2XCQA 1R0LA 4IDEA 3ZGNA 1FFCA 4EL5A 1XKLA 4EGJA 2GCIA 2G80A 5BV7A 4N5IX 1KORA 2ZM5A 4QYIB 2C0CA 2AV6A 5ALRA 1RP1A 5F9MA 2HI0A 5C4IA 5ENZA 1N77A 4MQEB 3M5CA 1U2RA 2FWAA 2GPSA 3PXXA 4JOBA 1KARA 1ZK0A 4U3JB 3QBDA 4FI3C 4XCVA 5CR9A 4JBYA 2GFHA 4M9UA 4D82A 1JHXA 1Z4NA 2AN9A 4LRXA 3ZHZA 3JQGA 4KDRA 3W5AA 2FGKA 1K68A 3EMVA 3GX1A 3LVRE 3QVJA 2I6TA 1U7OA 5B6IA 3EZ6A 4B32A 2AJLI 4YCCA 1TJNA 3N59A 2XUAA 2A5FA 4DGQA 1BWSA 4G0XA 2WZCA 1KMCA 1QTRA 2D4HA 3O6VA 3U3XA 3ZH9B 4IDOA 5CVTA 3QRWA 4YMVA 1GA6A 2Z5GA 1YA8A 4HDNA 2NU6B 4M0EA 3VHRA 1Z6GA 2PFSA 1E9SA 4I1UA 4X60A 4KXWA 4C5AA 4JFAA 2GN6A 3ZCUA 1UAAA 1U3TA 4MYSA 3W6OA 4RYDA 2HIGA 2FOXA 5AJHA 1RWOA 3LNTA 3HBFA 3ITEA 3SC2B 4KO2S 5TEWA 1UEJA 1J06A 1XDZA 2D3TA 2PUCA 3LRPA 1G9XA 3TLMA 4NSNA 5K3FB 1KVRA 1DS6A 1X9IA 4MS1B 4CU2A 2GHIA 2JFQA 3FKSD 2NW6A 1FOEB 4YCLA 2BFWA 4LOHA 5K4GA 2IS1A 3DHYA 1WBJB 5B7PA 5IVHA 1GIAA 3QUCA 4K0RA 4LXYA 5BXQC 4KRGA 4HDAA 2QX6A 3HWX1 1IY9A 3H8WA 1THZA 3IQFA 3R6GA 4PRKA 4RIFA 4L0CA 3PVZA 1SUIA 4ZVQA 5KX5B 5JZBA 2CZGA 3FZGA 4C7OB 3E4CA 3G13A 1QGUB 2IDMA 2Q2OA 2XSZD 5IZCA 1JDNA 1G5TA 1WAMA 6LDHA 5KNDH 5DNYB 3ENQA 1D2CA 3C6ZA 3WLLA 4Y3UA 1XHLA 2P5UA 2NTYC 3UFXB 3L6UA 4FXPA 1OF1A 1B41A 2CVPA 3K8ZA 4XZ3A 4CKXA 1CK4A 2C9OA 3DMGA 3F3MA 3BQ9A 2O8BA 4TMZA 2NVOA 2YXLA 4PZAA 1XTZA 1SXJA 1PFVA 1SKAA 3BSWA 1QQBA 1HE8B 5JZOA 2YJ3A 1M6WA 1QS0B 3DC7A 3KPUA 4OHFA 4IRUB 3S44A 3JWGA 1N5DA 4NJMB 4OJQA 1XF1A 3FVRA 5KMGB 2ZSAA 1R0SA 3NONA 1N92A 2C54A 1RVV1 1Q77A 1CZHA 2KBEA 4JU9A 2J9FA 3I0NA 3K53A 2CV0A 5ICMA 2J3DA 5K0GA 2BF4A 1L8LA 5CYPA 2ERXA 3V9AA 5KCZA 1T0HB 2VJPA 3SHFA 4NBSA 4DPMA 3COZA 2PLFA 2VTKA 1M0TA 5G3ZA 4Q1VA 2WMYA 3MRTA 5KVSA 1WR8A 4YAGA 1KYZA 1CKEA 1YJBA 1SC1A 2HTEA 4IY1A 3RVBA 5T3UA 2ZUTA 1QHEA 2O8FA 1DCTA 2NIPA 1S3GA 2C0PA 3PE3A 1EG2A 1Q6YA 4GZ6A 1GY8A 1SU4A 1ZN8A 1BEUB 3CUEF 3EY9A 2P11A 4L9RA 4ZVLA 4ZEOA 5HKBA 1Z34A 2I87A 5KOHA 4PO1A 4QEDA 2P9EA 4D81A 3R9XB 1MAAA 1JP7A 2E85A 3IKLA 2FXVA 5IEBA 5CB4F 3Q7RA 4HNAB 2W6ID 3ZE6A 2VH2A 4B7UA 1I4DD 3CXUA 4AJHA 3H9BA 1L7MA 3A9TA 4TKMA 5L3VA 4OX9Y 1KHHA 3BMOB 3I2JA 1XRNA 1AKMA 3PVCA 4L85A 5JI2E 4WZAE 1WZNA 1N32B 5ITZB 3I76A 4YMIA 5LQKA 3JU3A 4EZBA 3TF5A 2Q8PA 2NAFA 2P30A 3V2HA 1Y5NA 1VE5A 4HNHA 5FOUA 5A9TA 4I46A 3TAXA 5AJTA 2R8PA 4YR9A 4QVGA 1K92A 1WCYA 3FPKA 3IMCA 4NXMB 2IJGX 7AT1A 4PSUA 3H0KA 3AF4A 5CT8A 1NRWA 3DZKA 1FXSA 1HNNA 1F5SA 4QBGB 5G02A 3UJ7A 1AHNA 4R6XA 4BMVA 3GA7A 5JG7A 3UWDA 1CP3A 2YWBA 4R9VA 5M5BA 2NO5A 3O82A 4Z99A 2AFIB 5B64A 4Y1RB 5L95A 3G0IA 3GPCA 2LV8A 1RMYA 4BTLA 5I8PA 2W2TA 3SR4A 4FFRA 4Y6OA 1UADA 1NVVR 3KXDA 4HQRA 3JQAB 2DECA 2C78A 1GTVA 2IITA 1KAQA 2HL6A 2QVXX 2ZIVB 1UJ6A 3ANYB 2FMUA 3HR4A 4PNZA 5DNVA 3F0TA 3UG7A 4GI1A 4AX4A 1Q0TA 1A98A 1UDAA 1QRUA 1NXTA 2Q21A 4QXQA 4YP0A 4E33A 4IGEA 3C3AA 2XGJA 4D98A 3H2BA 1HT2E 3K15A 4QGAA 5ALLA 5GM2A 5KSPA 5JRJA 1FP4A 1MRZA 1K88A 2AEJA 2VCYA 1AQNA 4MRMA 3ADOA 3MQ4A 4X1KB 1HTTA 3EVNA 4R41A 3EF3A 4Y6SA 4F92B 2GBCA 4PV7A 2P27A 3MS7A 2B83A 4DJFC 1P1JA 3EUWA 3BWVA 4PYOA 4TT3A 3AR8A 3WWEA 4IP0A 1EVEA 1QQ5A 4MKXA 4D8XA 2UVPB 5B7QA 2XYVA 3L3BA 3H83A 1T5HX 1FF9A 1NE7A 5EMLA 5EIWA 4CCWA 2C3OA 2VP3A 2BH9A 4HQ6A 4UJ5A 4TV8B 2RB5A 2DFVA 4E6EA 5JAHA 1H3EA 3G7NA 2ZUEA 1KEEA 3SQWA 4I4LA 2WIDA 1EZ4A 3H6HA 4IZOA 3PK0A 3R5HA 2DULA 5CTJA 4Q4CA 1KY2A 4YFVA 1QAOA 3D3JA 1V39A 5IW8A 2XMQA 1RI4A 1QZUA 2JARA 3AP1A 5EZQA 1SHLA 4M37A 2Q9AA 4WH0A 4TV8A 3S55A 3OP4A 4EHAA 2WRZA 1X1RA 1N4DA 3DNMA 1ZR2A 3PUXA 2ICAA 5M34A 3MTDA 1M5TA 1ZUD1 4FGSA 4IFBA 3LK6A 4IG9A 5D01A 2CNBA 1PVVA 1OASA 4NESA 3WZ2A 1QH0A 2NUBA 2Z6VA 3NNDA 2EBWA 2X0EA 2AN1A 1SVUA 1QF6A 2WG2A 1E1NA 4EB6B 1KZ9A 4HBZA 4XWGA 3IP6A 2F9MA 5GGYA 4GYJA 2QQ0A 4D6PA 1AQUA 1LPBB 4DUGA 1K6IA 3ZE0B 3M9XA 2XUKA 3OFSA 3ILVA 1BU8A 5FBLB 1XLTC 4RPLA 3JRNA 4K5QA 5DFAA 2G5PA 2DT8A 3PSAA 4K46A 1AUPA 1D2AA 4PRYA 2O9JA 2CK3A 4B7CA 2ID9A 3ZTTA 3IKJA 1SUWA 2I1QA 3Q2KA 4QHYA 4UDYX 3M81A 1TIKA 2YHBA 3RC7A 2IH2A 5DCLA 1V8OA 4MW4A 3SYMA 1RQRA 1W2GA 4HUQA 1X9HA 2QW8A 4O2BA 3RQSA 3GN1A 3FY4A 3DBRA 6AT1A 3G9XA 1V7ZA 4YAIA 4FBMA 5J3JA 4EUFA 4NRDA 1FSGA 3T7TA 4R98A 4JZYA 3DMPA 2POCA 3MTIA 2KJQA 4BCCA 4IOJA 5HQ3A 4RTRA 1OH6A 4S24A 3HTXA 1DJQA 2DWCA 4B71A 2CLLB 1PSZA 4GPAA 4HF7A 4R2HA 4GH5A 2VDKB 4BNIA 2D5CA 1FFXA 3PGKA 3GLGA 1EDDA 4IEIA 4M8LA 2IBTA 1PZFA 1ZDMA 3D02A 3FZQA 1O95D 1Y48E 5J2TA 3D0KA 2FQWA 2RK6A 1BWQA 1GA1A 1U99A 1Q1NA 2UYQA 4TVSA 4YMTA 1MX3A 2X0IA 4KXYA 1WXIA 2GTPA 2N3ZA 4B48A 1HE2A 2ZJOA 1KEWA 4HQ0A 2WAXA 1GT6A 3F8TA 3ILXA 3G8BA 3HWSA 4IIJF 4R31A 4Z86A 5FBQB 5ILQA 3BX1A 4FFDA 4ALLA 3MS2A 1Z3IX 2AK3A 3ZZUA 3MPOA 1WCV1 2RHJA 4UMDA 5CFQA 2AN4A 2PYDA 4WBSA 1U0GA 4ZOBA 4GQIA 2G07A 4FDTA 5HGJA 3L04A 3AR9A 3PKJA 6NULA 3DBHB 4TUYF 3ULKA 4A6XA 3FRJA 1HYGA 2QMEA 2VC2B 3OMWA 5K8IA 4PC7A 1DCMA 4LJ6A 1G63A 3NC1C 4F46A 1JEOA 2RGGA 1WRBA 2DPHA 1RM3A 2PLAA 3ETJA 3NVMB 4FJ2A 1R8YA 3QI2A 4BP3A 2BJHA 3D7SA 3CF4G 5CX4A 3UAWA 1M8PA 4Y2UA 2GHTA 3BD9A 3DH0A 4KK4A 2WJZB 2WKSA 1JPNA 3CJRA 4A73A 2G9ZA 2C4NA 2IP4A 1QONA 2BMEA 2EFGA 3L4BA 1OLUB 2ZYHA 3UATA 4C21A 4TKVA 4ZPXA 4RVCA 3MGGA 1Y1LA 5CA1A 5EIAA 2G1PA 5E0KB 1DI0A 2CLOB 1FP2A 4II2A 5F1PA 1SCNE 3BZUA 4G01B 3H2JA 1XD9A 2W4IA 4PG4A 2PTGA 2KI5A 4HDKA 4U7WA 4EF6A 1AXRA 4DRXA 1Q2XA 3PJEA 3RI3A 3UA3A 4M1EA 5GV8A 1SIWA 4BQFA 2F1JA 2AZ4A 3WL6A 3SXUB 4A6DA 1JYFA 3GGPA 4P80A 4PGMA 1XVTA 3LBNA 1ZVMA 2I29A 3OA0A 3AUAA 5A05A 2CB0A 2PH7A 1YQEA 4OFWA 5KJCA 4DADA 2IS6A 2P8JA 3PGMA 3ZK7A 4AULA 1F5NA 1LNZA 4WUTA 4OI2A 5J2UB 3VX3A 4JQSA 3BMQB 3NGMA 4B45A 4IDBA 4KC0A 5DPMA 4FUTA 5E3IA 1M2JA 2WYOA 2COUA 1MC8A 5A0TA 4GLLA 4TKUB 2I5PO 2P8SA 1GV0A 2AYYA 2X22A 3I9NA 4RC9A 1EK6A 1EU1A 1T1EA 2NZYA 2XDQB 3B3FA 5DTMA 3YASA 2WE7A 4BLWA 4DLWA 2R1VB 4F4FA 2QIPA 3H7IA 4FGKA 1RI3A 3VZDA 1BQ4A 4YMGA 4C03A 5CT4A 5AJWA 4II3A 3CRVA 1E61A 1VFPA 2IBMA 1NJ8A 3N2NA 2OQRA 3DLTA 3GDWA 4H35A 4E11A 3HN6A 2J41A 1Y9DA 2AWNA 2CMDA 3U19A 4BB5A 1E1YA 1UANA 2GN4A 3AVOA 3MM4A 2EG9A 4QHTA 2GDJA 1NLFA 4I3GA 4OLFA 4Y0NA 4J43A 4R1UA 1U9IC 3EB9A 5LM3A 1J8MF 3L7CA 5BSTA 2YMMA 3L06A 4LTDA 3GJTA 1QFYA 4MWBA 2TECE 3H17A 3I8OA 4TLCA 1Z4PX 4DNFA 4FZJA 4HFJA 4KV7A 1GQOA 4RTKA 1ACJA 2OZEA 1RI5A 4ENPA 4WDRA 1UBNA 3NALA 1MKYA 4B5LA 3LD9A 3F7NA 1YIAA 2AHRA 2HA6A 4U9IS 2CUKA 3STXA 1NIJA 2XZLA 4GICA 4WNAB 1HSZA 2ZSBA 3OU6A 3MJ4A 1TCVA 2ECFA 5BR8B 3R0VA 1IY0A 2Z0MA 2JL1A 4B3HA 3IEKA 4W5NA 1HLDA 2QZJA 1Q0SA 1AKQA 1WTAA 1G60A 2BUAA 5JHHB 2YHAA 2YUIA 1NATA 4EPVA 4TMVA 2IRWA 1VLHA 4O0MA 5L3ZA 2GBLA 1PUIA 1A7AA 2ALJA 1OZGA 2D2IA 2MINA 2NVUA 4RIHA 3WB9A 4B4UA 4DNQA 2R48A 4MGZR 1E94E 1CUEA 5CGQB 1A0OA 1OPXA 3R09A 4ESEA 3R5JA 2WUDA 1PSDA 4C43A 1BRMA 1M3SA 2JGMA 1XU4A 1U6IA 2FRXA 4CPDA 3V4FA 3ASYA 4KR0A 5EKXA 4H1WA 2R97A 2VSQA 1KK0A 1ZU4A 2FPLA 1EQAA 3AI3A 1PR5A 2WR8A 1O95A 4ZWNA 1K86A 4REOA 1CZNA 3E18A 5I7SA 5AK5A 5JEDA 4NS1A 3DVLA 4LXIA 5F9FA 2HA2A 3Q9UA 3DEFA 1LUAA 4LV5B 4CDGA 4Q47A 2G4CA 2V3VA 3TQOA 1L7AA 4F38A 2B8WA 2BT4A 5EVJA 1VIYA 3AFOA 1KO4A 3I4CA 2DKNA 3RVLA 1TL7C 1C4OA 5I7WA 4KTVE 4NVRA 4ZT5A 4Y9UA 3RIMA 4FYIA 1FPMA 4Q7KA 2OQVA 1R0KA 1JT2A 4GD3Q 2WVGA 5EGNA 2QMHA 1TF5A 3F4KA 2HDWA 4DEXA 2RGEA 3HL4A 4PPNA 3E2PA 2J7PD 4HEA1 4L9SA 1ZA2A 4B4OA 4CJXA 2ATCA 2X8AA 3I30X 2IX3A 2WSLA 3V6LA 1AKVA 1LDBA 3OCVA 1NM5A 3LQ4A 3N6VA 3VSBA 1E3WA 1H42A 1Q22A 2UXDB 4KYUA 5LZ4A 3IHKA 1YZTA 3DFFA 4TTTS 2OXCA 2W2VA 4ZJPA 2JJMA 1KVTA 2PSJA 3EAGA 3OFVA 5REQB 4ARZB 3EFHA 3HXTA 4K0KB 1WTCA 3DOFA 3KR0A 5BUSA 1P73A 1SD1A 2I4TA 3AHCA 1BQ3A 4IIJB 1QB7A 4WY8A 1SEVA 4FD2A 4HNGA 1K6XA 3NLLA 3KE8A 4IVRA 5T5QA 3TYXA 2QLLA 3L0CA 4BNZA 4CTMA 4LWZA 3QSGA 1ZM9A 1FXWA 1U8YA 1DV1A 2R96A 1W4LA 3BBLA 1H4TA 5JS8A 2IYOA 3H19A 4M76B 4MW0A 3SVZA 4UHKA 1QO0D 3TUIC 2JK0A 1Q74A 3FI9A 5BSWA 1NXOA 3FFAA 4MKFA 3INTA 3EISA 2IQIA 3LX6A 3N39C 4RJKA 4B80A 3QVWA 4OL0A 3TTUA 4XRGA 5MFPA 3I9KA 5KNDA 1HX7A 5REQA 3HXOA 3AB7A 1I13A 3OCWA 2D5AA 3C3DA 2PE5A 1OHHA 3QVKA 4Q9KA 3A4TA 4QUEA 5LOVA 4ZVSA 4LTMA 3TINA 2CZQA 2GUGA 3UPTA 4M1OA 4DMLA 2GO7A 1M74A 3SSNA 4BNUA 1BE0A 5BN3A 4FFVA 3W06A 4WERA 1EK5A 4U6NA 1JF8A 4F2DA 1T4BA 3JAKB 2ZQ5A 5JWHA 2WQZA 2YYZA 3FNHA 3UUEA 2CN1A 1R27A 1W30A 2RG7A 4RMHA 3AWDA 1GYQA 2D0IA 4GQBA 4MR7A 4GZ3A 3RTDA 5I7VA 1BCRA 2A0KA 4NL4H 4X6LA 3R3JA 4ZVKA 4CM1A 1QTIA 1UPAA 2A9PA 3H6GA 4P0QB 1ZUNA 3MCZA 3DBHA 4Y6QA 5DN6A 5DIZA 2YJ4A 1H0KA 2B8EA 5K3FA 5IHPA 3EEIA 4URFA 1KZHA 3ND7A 3ZOZA 2E4AA 3A1FA 2P78A 1RRCA 3OQPA 3CLTD 1EH5A 2ZJFA 4RIIA 4Y7CA 1FTQA 5GQSA 3GPLA 3CLSD 4P5EA 1W4AA 5P8WA 4AECA 1JA1A 1DOHA 3WQBA 3RM3A 3AC0A 1XZGA 3E9EA 4TXMA 3OG9A 3FSGA 1EYZA 2XB8A 1EGVB 3UTCA 2QTHA 4GBED 5I01A 1CUIA 2IXEA 3OJOA 1XNRB 2WIGA 4LRTB 2VP5A 2DJIA 3KZMA 1OI4A 3QHPA 5TQJA 1CU1A 1B42A 3PQ3A 4M8NE 4MI6A 1YQXA 3IELA 1IEQA 2VJYA 4RPKA 4UCFA 4A1FA 4B8WA 4ZO4A 1F6DA 1WB5A 1O2DA 3AQ4A 1IHPA 4A15A 4J0EA 4L0QA 4OMDA 4AC9A 3RWOA 3NV7A 1KFKB 1I30A 1BHQ1 2D7JA 2KLHA 4LPSA 3PA8A 3DO6A 1SVLA 3RD5A 3L05A 4EHFA 2JIZA 1UXHA 2IYRA 3AI1A 3DBRB 4LSMA 4MCJA 1HOXA 2CYAA 3PWSA 1EFLA 4MK4A 1YB5A 3LXUX 2ZM6B 2WV9A 4LE2A 5JSKA 4BC1A 3UJNA 5C8XA 5H68A 3GEEA 4CF5A 1VL8A 2VUIB 2H2FA 2X1HA 3TQIA 1L8AA 2Q5HA 4GOLD 5H4HA 1MX9A 1U94A 1ZGZA 3ON5A 2JI4A 5JHGB 1Z07A 2D54A 4WA7A 4E4RA 1N0IA 3RW9A 3NO4A 4LYEA 5L3QB 2V0CA 1EIWA 3V34A 5JAQA 3F5MA 2HWWA 5A62A 4XLTA 3VMFA 2WTBA 3IBCA 2OFPA 5LBTA 3MFQA 4Q4HA 3WHLA 3GPIA 3B8EA 1QK4A 1E3SA 4FSXA 2OM2A 1JG2A 4A10A 5ES4B 3AI7A 3OPYB 3DVQX 3U9TA 4YP7A 1C3VA 3NOVA 2W98A 1B2LA 2A67A 4HK4A 1ECPA 2Q0QA 3RCBA 4C6TB 1NX6A 4WSOA 4D9KA 2XCUA 3PFKA 1JLLB 4CG3A 3G9ZA 1RWWA 4DLUA 4QASA 3TIFA 4MB0A 4YQEA 2FP4A 5LP1A 1ORTA 2NSJA 3K0CA 5C2JB 2DWOA 3KHUA 4A36A 4ARAA 4U00A 1WM1A 5GJVC 2ZG6A 2GD0A 1U98A 2WM8A 4J1TA 1TU0A 3AIOA 5HK8A 5A7GA 2CLHB 1EDOA 5HS6A 2HCTA 1Y7HA 5SZHB 3VHXA 3RG8A 1N78A 2EW2A 3JQQA 3KLPX 3KAKA 4AO6A 3P9SA 4X20B 4J2OA 4BX2A 3QLVA 3QEKA 3PNQA 4CM6A 1X8KA 1ZGGA 2OBFA 3KYBA 1V4NA 4PRLA 1B6RA 3GLRA 1PGNA 1SCUB 5F1OA 3VR5D 1UP7A 3T0IA 1H2WA 3H5AA 2G36A 3BD6A 4JXKA 4G26A 5HTKA 4DBLC 9LDTA 3I1FA 5AK6A 5DU2A 1LX6A 1ZH4A 2XDYA 1E1QA 3FPHA 3K0SA 1G2PA 1T24A 2W4MA 1W0KA 3EIOA 5KS2A 3WGQA 2P68A 1HETA 2QLBA 3ITDA 2RGUA 4C3VA 4XOUA 5FYQA 2WSMA 3D5QA 3HVUA 5KQSA 2BP7B 3ZNQA 4RO0A 3ZK9A 1Q0ZA 5B1DA 3WYGA 1JUDA 3MTAA 1SAYA 1TMKA 4YAWA 1EBFA 1GNRA 3HZZA 2O23A 4F6RB 1EDZA 2CL6X 2KSQA 4L16A 4RAOA 4CUKA 1J0CA 1NIPA 1IDOA 1YAHA 2G04A 2HJVA 3BWYA 4DR4B 3DMTA 3WGLA 1A2BA 2N42A 4DSZA 2CD9A 4HAWA 2XMCA 3HPRA 4Q6WA 4TS4A 3HYLA 1J7KA 4U3JA 4UTZA 3WHIA 1G3RA 4DJEC 2JD1A 4TLMB 3USZA 3GPDG 4ND3A 3STUA 3CKKA 1TYAE 3PIRA 2MHCA 4CTNA 4P3XA 4O3FA 1J8QA 3ET4A 4Q9DA 4F2HA 1TM4E 2H4YA 3B9RA 2OFXA 4P2GA 1XALA 4O4LB 1PT9A 5JEEA 2FRVA 2OAEA 5IM4F 3T7EA 1JNYA 4BS9A 3N8HA 4DCTA 2B1IA 1B6GA 4LHSA 1JEYB 3RC8A 1V26A 4TLDA 3QXCA 2NYRA 1FJHA 1YJQA 1JDBC 1V7PC 2QNIA 2I67A 3BMOA 2H1CA 3PC4A 4FNAA 1KAHA 4QODA 4Y6LA 2G09A 8GPBA 3EGDB 2PSSA 1HG1A 1USIA 2NO6A 1D2NA 2Z98A 3OE7A 4NJEB 4PG6A 3R7WA 1XMXA 3C3KA 1HGXA 4HTAA 5KDDA 5HF8A 4F7WA 4W63A 4UVDA 1GCGA 2WT4A 2YVUA 4QOEA 2NO9A 3RUFA 3L43A 5EKDA 2ZSDA 1YOBA 1K27A 2GM9A 3F5SA 3KWLA 4GGMX 5ALKA 3HLKA 4BNTA 4LX0A 3A6ZA 3QEMB 1RQ2A 1Y7LA 2FPWA 2FN8A 4G5RA 2YIDA 1JDTA 4KQ6A 2HJHA 4W9NC 4M0LA 3I5XA 1WXDA 2XBLA 1SZPA 1TKRA 3ETHA 4RANA 4ZDJA 4POAA 2XY4A 3D6HA 4F21A 4BB6A 3HR8A 4E2WA 1JEQA 3IV7A 4P8RA 3ROMA 1ECBA 3WLEA 3BN3A 3KEQA 4FMCF 1QP0A 3AX6A 5CCDA 3N7AA 1ATZA 1U0LA 1KP2A 1X3SA 4KMMA 2PL1A 3UQZA 1CDZA 4BX3A 2BHSA 3DZHA 3X2FA 4U7JA 5HKKA 2VK8A 3EH1A 3PHBE 1TGVA 3PXDA 3A14A 4G1FA 1UMCB 5CDFA 2C2BA 3AG6A 3R7BA 2IYXA 3NWOA 2R1UA 4U6SA 1I4LD 5BPFA 3PDIB 4QDXA 3VO1A 4WN3A 1YRQA 2P7HA 1MJHA 5HX7A 3OAAD 3I32A 4MS4A 3IAM1 2DCUA 2WP8J 1LW6E 1EXVA 1EM6A 4MRAA 3DGEC 4U2EA 1H2BA 5SY9A 4HEJA 8MHTA 2JAQA 1SG9A 2OZPA 4WZBA 2OXFA 2IIQA 3H11B 3HA5A 1NKVA 3KQYA 4RF4A 3ZE2B 2UYGA 1A5BB 5T64A 2P7IA 3W8FA 2QRLA 1KYQA 2K87A 3LBFA 4OJTA 4A1OA 5FPKA 4LF8B 1GGFA 1GQQA 3UZUA 1N6RA 4D97A 3ZLVA 2IDKA 4LQCA 4P86A 4HPWA 2H11A 4BYMA 4LJ9A 4M60A 2J6BA 1N8SA 4PSKA 3MTBA 4A8JA 5CLHA 4FCVA 5C8DA 1NF3A 5G41A 1F2DA 2RGCA 1TB4A 1UXGA 5A3VA 3G0OA 3M6VA 5E7MA 1GVNB 4Q7MB 4WLFA 3MAJA 3EG9A 4KO1S 4LXTA 5IYZF 3WMFA 1QH1B 1EBBA 3LUBA 4MS1A 3UB3A 3ZIAA 3TG2A 5KJFA 1PI3A 4LECA 1RI2A 5I8WA 3F3SA 5KSYA 4TXHA 1C5KA 2B20A 3RHSA 5AP9A 1N9ZA 3DZ8A 5T4HA 1LLUA 3AZOA 1ESEA 4G1BA 3IEMA 1FU7A 4AICA 2Q5LA 2XBUA 4MQ4A 3M70A 2EC5A 2PT6A 3FLBA 4UCWA 3BZBA 3K73O 3PGVA 3TW8A 5A4FS 3U3JA 4UXJA 4ZXFA 3NHPA 1EXWA 1UMBB 2QK4A 3C0KA 1EXMA 1J90A 4X5OA 5HNKA 1X1CA 3HP4A 2WUWE 4MVJP 4CNQA 3WNZA 3ZI0A 4YT5A 4S1PA 3DB2A 4YV1A 3UK1A 2ZB8A 3DMFA 3VR6A 3VJLA 1NT4A 2CL5A 4FD3A 2B99A 4PLGA 3B7PA 1J0XO 2J0QA 2B4RO 1KQOA 2AEMA 2JGLA 2ZS8A 4O2BB 3I1IA 3F4LA 3Q10A 5K7SA 2AD1A 3I9FA 3OJ0A 2PAAA 3HU1A 4AJLA 2PUDA 2BEVA 4N48A 5CLQA 3V97A 4DT1B 3MSCA 3ZV5A 2X7JA 4W4TA 2XVMA 4NJMA 4D8UA 3SXUA 1IMJA 5DBEX 1Z6PA 4BWGA 1EHYA 1T9DA 4G4GA 4DRXB 4OQXA 3GEIA 1NXPA 1YRHA 3EIXA 1CUDA 3V55A 3HADA 5K0ZA 4E5YA 1SQ5A 1YVPA 3LZ6A 1U02A 4TRMA 4Q3KA 4UD6A 2GPNA 3CW9A 1RJFA 3NBAA 3CNQS 1KS9A 1QGOA 2XNSA 3HBJA 1TUIA 2VWGA 3MT9A 3PC8A 4WLEA 4TMKA 4CM9D 3LXMA 5LNK6 1RC0A 3AVUA 4QDJA 3NRJA 4QPPA 4FS3A 3NC0C 3DMTC 5IDQA 1DAIA 2VHEA 3FLMA 4HDSB 3WY9A 3DEAA 4Y2PA 3MD9A 3RYCB 4UUPA 3V1MA 4CG0A 4AUKA 2AMJA 4TTQA 2EL7A 3RFCA 3U37A 1O96A 3MA0A 1NV8A 1U2GC 3W7BA 5EIHA 2C4KA 2D1TA 2EF1A 4ED9A 5WRFA 4AW9A 3RHFA 4DIDA 2XTNA 3LXRA 2PZ8A 3IALA 1X7WA 5ALPA 2ZWPA 1ZFNA 5HKOA 3ABSB 2GLXA 3MWJA 1P5HA 1Y1QA 1G4AE 3TW8B 3OZDA 1KEEB 5BSVA 3MINA 3Q1LA 3NUQA 1N2BA 4H1UA 1A9YA 5KOHB 2EHJA 2GCNA 1HC7A 3TLBA 2WHQA 1OWLA 4OFZA 4B84A 1PDVA 4JYZA 1RXYA 3WICA 4RQBA 4JSTA 3SK0A 3LK7A 3UIEA 1OYVA 2HRBA 2PRZA 2V9ZA 5BN4A 5CXSA 4IOLA 3VBEA 4P34A 4BNVA 2WWYA 1CP2A 3IAS1 1OJLA 1TAHA 4FYVA 3D8HA 1ZEJA 3HFGA 3RRNA 5C4MA 3C6XA 3K9GA 3D1JA 2WTUA 1W1WA 1QP4A 4PPFA 1UWCA 2Z4SA 3L6OO 1ADYA 2FSHA 4MZXA 1G5HA 3TL2A 3WWOA 3ICEA 4CLOA 2Z8YM 1M6HA 1REQB 2WJAA 2E5FA 3IMGA 4D02A 4GUAA 3R6LA 4B74A 1QPBA 2VTEA 2X4DA 3CB4A 2C04A 4DPKA 2R6GA 3R0QA 4R3NA 1O57A 2ID7A 1GSIA 1QMPA 5DHUA 3QY0A 4XQ9A 1GUDA 4F3NA 1JQLB 1I9CA 1YZUA 4YPOA 1Q21A 3STHA 3ZU6A 4LZAA 4AP6A 3IGFA 1PHRA 4AMYA 4DM7A 1J09A 2WD7A 2ZB2A 3UUGA 2VHYA 1X7DA 4HWKA 3KLMX 3WGNA 2NPFA 5A4JA 5ARBA 5K6TA 5LQRA 3WBBA 2BGWA 1XC7A 1LU9A 2GASA 5A6VA 1TLLA 5DT9A 1XKXA 2IU4A 2PMKA 1ZP6A 2VRCA 1XEWX 2V6IA 3KQTA 4NMWA 4XQGA 5EL0A 3ZE1B 5CLJA 5KINB 2F3UA 4PG7A 2FSVC 2UUPA 1SD5A 1JHPA 2OENG 4MLPA 4P4LA 3SF8A 5IXSA 1K9VF 3FF4A 1D0IA 1OIVA 2QRQA 2FFQA 5EKUA 4GM0A 1BIFA 1VLVA 1Y6ZA 2NNLD 3MAGA 5CVCA 4Z9FA 3RS4A 3RU9A 3RU7A 2BKXA 5IJ0B 5BW6B 4DV0B 3R6WA 4G89A 3SLKA 3EPPA 3IT3A 1XEFA 2MDTA 4D4MA 2O8EA 4MVJA 2IFTA 3DTTA 1GGVA 2XF8A 4UFPA 5IKPA 3KCQA 3BFKA 3WK7A 5CG1A 3PX2A 4D2IA 1EK2A 3ZU3A 3IVCA 3GJ4A 1ZD9A 2D13A 3C8ZA 4HAYA 1KTVA 2F62A 2HR1A 3O1LA 2OPBA 4UMEA 4RD0A 1SELA 2J3HA 3QKWA 4OLJA 4ZMBA 1TU3A 5AW6A 1E1DA 4PN3A 3JQFA 2C1XA 2O06A 2Y1LA 4KNVA 2X9LA 1P7YA 3P26A 1ADCA 4V39A 3EUAA 5JQGF 3IP1A 2M1XA 2FR1A 4DHWA 3IBSA 5B2FA 2B8NA 4K6MA 1NZDA 4E88A 3SY8A 5C1DA 1BGXT 5HJEA 1Q84A 2ONYA 2DUMA 2XQIA 3WJ1A 4L5IA 3RUCA 4NJEA 1QG6A 2ZS7A 3OOJA 5AMXA 1PLLA 5FTKA 5HIAA 5DNWA 1G8HA 4G97A 3OQOA 1YFLA 2QZ9A 2ZJAA 4PC1A 2B5VA 2JGDB 3GJXC 4RBNA 1IJKA 1Z6QA 2V6JA 3E9NA 3IVRA 4CGYA 4DUPA 3N0WA 2AG1A 3P2KA 2PAFA 5FUXA 4WADA 3IYLW 1VKOA 3AKEA 3JQ9C 3C6QA 1A71A 1MHPA 3PICA 2I2AA 4O4LA 3Q9SA 1GR1A 1LJ8A 2AW5A 4X1IB 2V8OA 3VR6H 2EP8A 1ORVA 3WSTA 1N1DA 4ZMSA 1RPZA 3RIXA 5KJEA 3BXGA 4MGEA 4N7BA 5FNVF 2NXNA 5IDVA 2C5FA 2FZGA 2O2JA 1CE8B 1GZVA 1VMIA 1M2FA 3TLYA 1T43A 3W2EA 3BD7A 3EGEA 3ZCRA 5ELLA 1NAHA 4HC4A 1IONA 4C4SA 4M0KA 3RS9A 1G18A 1HZZA 4Q15A 3OFND 5E8JA 1PZGA 2ZDQA 3DP9A 4IVPA 1SA0A 3LXXA 1XN1A 4NE2A 2G9VA 3KX2A 4DCOA 3HC7A 4CN9A 4G5FA 3KZOA 3GUHA 3TI9A 4FZ3A 3LQQA 4IIVA 2GEKA 4O8CA 1QX4A 1S0UA 2OZKA 4QATA 3K70D 1XKQA 4XKJA 4GMGA 1YHYA 2Q4RA 4NBLA 1LFAA 2I71A 2QTAA 4YT8A 2B1RA 4ZQHA 1P4RA 4LDPA 4FTWA 2VT6A 3CFYA 2W2KA 1PP4A 2WSBA 3H9CA 3MD0A 3B1YA 3NH9A 5A0FA 3SC3A 3L7DA 1VECA 4UUNA 1JH9A 4ZO9A 3E22B 3L2OB 3L0DA 1TU4A 1R18A 1NJ6A 3RTCA 3VSAA 4FNOA 1O77A 1YMVA 3C7KA 3C16C 3MCAA 4HRXA 5IP5A 3F8WA 1VG0B 3DDWA 4ID3A 2FG6C 3NWPA 3CR8A 1BWRA 1TVCA 1JBQA 2DB3A 2A9VA 1H0RA 3RWBA 5BMVB 5EQJB 3R4VA 2VF4X 3ACBA 1M1YB 1DAHA 1SQGA 1UAYA 2UZAA 3I6BA 4FOOA 5AJVB 2P65A 4XSVA 1L4NA 1OBHA 2QE6A 3ZGVA 1RCFA 1XSEA 2CV2A 3WLFA 4DCSA 2GAJA 3FRIA 2KPOA 3ESBA 2RAUA 2QYOA 5AVJA 1EFHA 3U17A 1TI7A 1XK7A 5D8DA 4I9GA 3RC2A 5KVAA 4JV5B 2HMSA 3K8QA 1UBUS 1WCXA 4OP3A 1W49A 4MKZA 1P1FA 1IVNA 3DSRA 2ZSJA 4UUBA 3J7AC 2WJIA 3NJRA 2J09A 5JADA 3NATA 3R74A 2FR8C 1TC2A 3W90A 2QN9A 1T8PA 3MYYA 3TQFA 3ZZNA 2D1QA 4C4OA 3GRRA 4EJ6A 4Z4IA 3WKDA 4JC5A 1LJUA 3IUQA 3N8KA 2RIRA 4PO8A 2M6RA 1IZZA 1YV9A 3TR5A 2V7GA 3GGSA 3IT2A 1II8A 4DA7A 2OC4A 3WB2A 1EBUA 5SY6A 5LUAA 3NBQA 2BIFA 3ZQUA 2Y6UA 5AHXA 4AROA 2PD3A 1W5BA 1ZONA 3QJGA 1VP9A 5CYFA 3CZ4A 3KV1A 2UXCB 1XZKA 3WGTA 1OBOA 1XCGB 3OA2A 2IP1A 3UV7A 1I7NA 1L5OA 1VHJA 1Z0JA 3NHBA 5IVDA 1WY5A 1HE4A 1OGYA 1X7YA 2F3QA 3I34X 4JLKA 3AHGA 5LQAA 4ZDIA 1EWQA 3HZRA 1XTIA 4J4BA 1FXWF 3KM0A 1UC8A 2HT6A 2POQX 4R5MA 5ALDA 1X14A 2DWPA 2ZUSA 3RFUA 4TZ6A 1T3HA 4DQDA 2BFDB 2QVCA 3OZXA 1UCFA 1TTQB 4RD1A 2ODQA 2PNFA 4ZO6A 3S1AA 3G7SA 3ICOA 1SIBE 1BYIA 3L7AA 3GGCA 5F77A 1ULUA 1CQIA 3G89A 4AZSA 1VPDA 2IXAA 3OKPA 1F8XA 5I9MA 4E2YA 1CUCA 1JMKC 5EP3A 4WUVA 2RARA 4DCNA 1T2DA 2W8ZA 5IDXA 3LO5A 1XA4A 2O8CA 1QFSA 1WXQA 3QPCA 2GN9A 3KWFA 4QL3A 1VCIA 1KI6B 4S1OA 1VKNA 3RC3A 1DXQA 5IC5A 3NRBA 3LIPA 1YUBA 3BC1A 4RD2A 2DFLA 2Y0BA 2ZREA 3H99A 3OD5A 4ENTA 1SY7A 1R9GA 2PIDA 2G0TA 3A6HA 4XIIA 3FHTA 3S8MA 1GARA 3T7KA 3PS9A 5FOTA 5ICEA 2I4OA 2QJOA 3FFTA 4XWAA 4KOAA 3R8CA 2NTJA 3O8RA 3KFVA 4OQEA 5FOWA 2CJPA 3H1GA 3U7RA 3HU2A 3G0GA 4WLUA 1UIMA 2GYUA 4QNNA 1JQAA 4FE7A 5JSZA 3T3PB 2VYVA 3F7OA 4J16A 1CV2A 1CQXA 2IEAA 3N1UA 1Y7IA 1E8DA 3JASA 1JHOA 4E1AA 5H9VA 2X6RA 5FUYA 4RFVA 4CHTA 4EYKA 3IAFA 4ESOA 2GH1A 4DLRA 3H1EA 5TLSA 4UCQA 3JASB 4YRIA 1L5QA 2P4QA 1ENZA 1UBTS 3F6BX 4P98A 3UJPA 2GBLC 3EGXA 3NKVA 3SZMA 5AM4A 4KSBA 5JSZB 3RE1A 2OGUA 3G59A 3IJPA 4D3SA 2GN1A 4MS4B 1Z0AA 2Z83A 5C31A 3QV2A 1YVEI 1EE1A 1ULBA 1KSHA 1YK0A 2XAAA 3HSKA 3R23A 2YZ7A 4XGKA 1MX1A 1OXMA 1BXRA 4Q9AA 4NZOA 4K9MA 4AYTA 2RHDA 3HQ4O 1HV8A 4XSHA 1KJWA 4KQKA 1D8TA 1RQLA 2NV2B 1T13A 2II6A 4F8EA 4Q1DA 3ZX5A 3VO8A 3S81A 3T5TA 2HF8A 4KIUA 4PEVA 2YXBA 5MDHA 1P3DA 2O50A 1Z38A 2XEXA 4HX2A 2GN0A 3KVYA 2AOUA 3L8ZA 3PGJA 3VM6A 1VE9A 5LDHA 2BFNA 3N2GA 2H2DA 3DAYA 2IP2A 2XSZA 3T99A 1FQOA 3OPNA 3ZZTA 2UKDA 5LN1A 1UBOS 2I6UA 2O0LA 2R00A 1NW3A 2XMZA 4HNAA 1MABA 1QYWA 2CWDA 1RWNA 1JBKA 2QPTA 3DDHA 3SIXA 4DRYA 2FUNB 2YJ5A 1UFQA 3AR2A 4GZ5A 1IXRC 2QRKA 2BM0A 4MCIA 2DEUA 4BVEA 4BAUA 3NT2A 3CT6A 4DM4A 4OOEA 4IKEA 4D79A 2C4UA 4EY3A 2PXAA 1J1ZA 5DYYA 2ZRIA 1UEIA 2ACWA 4YRSA 3UK0A 4NX2A 4H1HA 1PE0A 1VG1A 3D6VA 4RX1A 1NI4B 2J3JA 5B1EA 1SBQA 3Q3VA 1R6VA 3NCHA 3MBIA 5FWXA 3I2KA 4KX5A 3WYNA 1L5GB 5A9SA 1KEPA 4ON9A 4MV9A 2HBQA 4D9MA 1ORWA 3ILYA 2PUBA 2ZRGA 3GAAA 3AB8A 3N5CA 1WUTA 3NEJA 3QU7A 3T6KA 2OV1A 4DLBA 1WE2A 3QH4A 4YROA 5EIFA 3GVIA 1KIMA 1LNSA 1TA0A 3CLKA 4UTOA 5ALTA 3RVKA 3JZMA 1FVHA 3HSYA 3UG6A 3H0CA 3FYCA 3MBKA 2FPIA 3EH2A 1Z2CA 3RJTA 1P1BA 5CFNA 2CFTA 4G63A 4M1YA 5AUPB 4B3RB 4I9NA 4LVUA 2Q1SA 2BEVB 3ZV6A 2I33A 5EZ6B 1IAVA 5C0OE 4JASB 4J3NA 2WWFA 3O2NA 2C9ZA 4IWYA 5ESWA 1WX1A 3RJ9A 3QYFA 1ZOIA 4IXNA 4Z0NA 1YC2A 2OG2A 1LLFA 2QY6A 3LWBA 1SU8A 2UDPA 1J2UA 4C9BA 1Y89A 4WAUA 3WRXC 1W2HA 2B2NA 2BPOA 3EBLA 3PKIA 4JKOA 1YUNA 2OHOA 2ZIFA 2G08A 2J32A 2VWHA 4LC1A 4BVJA 4QHSA 1RXWA 5A0VA 1E9VA 2X1MA 4EW1A 4PINA 4FS8A 1SCIA 2HHHB 4YJFA 3PPVA 5DM0A 2Y77A 4BNKA 5FLYA 4BQIA 3GT3A 1DEHA 1Z7BA 2XGGA 1CCWA 3VKUA 2CFSA 1TZBA 2FRDC 2HSWA 3KZXA 1ZUWA 1PF7E 4O1MA 4OQPA 5EMJA 4IIBA 3STTA 5L6MB 1GZDA 1YONA 1BE8A 2BCEA 3W3AA 4AJ4A 1T1GA 2OCYC 3O4JA 4QFBA 2BZGA 2ZCVA 1SC6A 1N0WA 4M1WA 3H2HA 3COYA 5CTAA 5E9JA 5ICSA 5IT5A 4K05A 2CSXA 4LCJA 1KI7A 5C8VA 3GP5A 3UAVA 2AXNA 4H3VA 1P4SA 1XD8A 4C0JA 2B92A 3PXUA 1STOA 2QUBA 1J99A 5G53C 2HC9A 4KVZA 3CTMA 3LUCA 3UMGA 3FUUA 2ZXUA 3ZVNA 4FQ8A 2NUTA 1RTKA 2DH5A 4ZHQF 1M2OA 1I7SB 1J21A 2PV7A 3GNLA 4URWR 5ECYA 5B12A 2YWJA 5DX1A 3F67A 2YNMD 3O74A 4UU0A 2MSDB 3A2NA 1PJBA 2AOTB 3E5RA 1A5TA 4GLJA 2XMPA 1YZLA 4IS3A 1BVHA 2CCJA 4FMDF 4FYXA 3OE5A 5JD3A 4B2LA 5LLTA 3K4PA 2QE7A 2WY2D 1RPTA 2GXSA 4C0XA 1CX9B 4GVXA 3WS7A 1ZZGA 3AETB 3CRZA 4IJUA 4Q39A 4FINA 3WADA 3ZXYA 1QE0A 4CMCA 1LSJA 3GFGA 2I4LA 4P32A 4URVR 5CH8A 5CDTA 4UFNA 3VDXA 5KSWB 4DLAA 3IVGA 2YL2A 1BG6A 3GCWA 5EGSA 3ZWCA 4INPA 1T5TA 5JECA 3EF1A 5DN9A 2JJ1A 3EZFA 3G2MA 1ZMXA 2K7FA 5BSRA 3UMYA 2IYSA 4DLNA 2CNWA 1M75A 4Q7LA 1JLHA 2OAGA 5LYJB 3G2IA 2CNLA 4NOLA 1S5PA 1MNAA 3ANTA 3KEMA 5C7OO 4EB0A 3TWOA 5BW5A 4AUEA 4AQDA 2FN7A 2XE6A 2ZETA 3N3AC 1VHQA 2PGLA 2Q3EA 3C43A 3NHAA 4R2WA 4D4GA 1Z0DA 5CT6A 3KFLA 1U1DA 2ZW9A 3T5CA 3WTCA 4TL9A 2FG5A 4M0FA 2AC2A 4H16A 3V3KA 4EL0A 4W7SA 3OUTA 4KQFA 1FZTA 4JP8A 3RC9A 5DM1A 2XXAB 2I4NA 4C4YA 4KXXA 4E5MA 3E8XA 5E7JA 3JQFC 3DZGA 4QBIA 5J4VA 1QV6A 2JLAA 4S2UA 4YA6A 5AT1A 2LNDA 2X13A 2E4XA 1UMBA 2XOKD 1G8YA 3D6FA 5AIBA 1J5EB 4PC2A 2WWTA 1X1QA 4Q02A 3UHJA 4DREA 2XUPA 4BCDA 4U7PB 3KPWA 3L46A 1Z6YA 4KPUA 5FA5A 3ZJ5A 4DDWA 4CKWA 4UBLA 3I62A 4I50F 1ISRA 1QZ3A 1V5GA 4EG3A 2BI7A 2AW3A 2C9MA 3EFOA 4D3YA 5J47A 2AHOA 5LZ7A 2UYYA 4DZZA 4HMPA 3VNSA 5JAMA 3DOUA 1GOTA 1MC5A 3D1VA 4H17A 1NKSA 3LT4A 2Y3IA 2H4FA 3AP2A 4HH3C 3AR4A 3K16A 3BEOA 5K0CA 4LJAA 1NNI1 2RBEA 3ZJTA 1P60A 3FPSA 4NATA 4TWIA 1NPTO 5TIIA 4BQSA 2N1BA 2ZWAA 3X3HA 5ALNA 3HYCA 2WBLC 5DI3A 2B6NA 4JEIA 4FSHA 2IT1A 3GQVA 3AM3A 3SX0A 4I4CA 5CLFA 2MTBA 2QXYA 3EUFA 1TYBE 4RSRA 5FAKA 1B93A 1P2GA 5HYVA 3C87A 1FFHA 3VPSA 4HPXB 3F49S 3DDSA 3PRYA 1ZOLA 2B1JA 2QD5A 3K1TA 5G4KA 2QENA 1YGPA 1CE8A 1RFLA 4LC9A 5DGCA 1NL3A 4F93B 1XUOA 1Y9EA 2H8KA 2X41A 2Y1WA 1XQXA 3BRWA 4EMTA 4CQNA 4JHXA 3PEUA 4TMXA 5FO0A 3DCJA 1N7HA 1OXBB 2M6LA 2AF3C 1C8LA 2QUZA 3ROPA 3MILA 3HKBA 2ESRA 3T15A 2I0FA 3AONB 4GRAA 1GQ2A 1QG4A 5H3CA 2JGAA 2QP4A 5HK9A 2CLKB 4YRPA 1DBRA 1E59A 1MP0A 3RRYA 5FFFA 4JQZA 1CS0A 3GZTB 4RESA 3JRWA 1U81A 3IKTA 1C7EA 1FFWA 2XUHA 4KFUA 2WJPA 3CR3C 1N2JA 2JVJA 3TW0A 3QXXA 3E61A 3M4ZA 4KPUB 4HGOA 2ORYA 4MAMA 2AI3A 3G68A 4B4WA 1P5RA 2WOJA 1Z8NA 5IVIA 4EMBA 1SMKA 2FZEA 4HMOA 1XJ0A 4UHJA 4BZXA 5KVCA 3WX0A 1NPYA 1L7QA 1FFBA 2ANBA 2RHTA 4ZK2A 3L8GA 2QTVB 4KX3A 3KOUA 2PU5A 3QQ5A 5E3HA 4KAAA 4HDRB 1QHYA 4Z1MD 3RS3A 4X7MA 1NBEA 2FMIA 5BSMA 3CIOA 3HFJA 4GLFA 4KGDA 3BFVA 1WXEA 3L8HA 3E7WA 3A6GA 3HRIA 4G0MA 4OVKA 3S2ZA 4KH0A 2IHTA 3TNYA 2LIPA 3NNSA 3T1YB 2Y68A 4HXYA 3SICE 1OAOA 1SRQA 5ERGB 1USUA 4MS3B 4NK5A 1Y5IA 3QVUA 2P9JA 2FPXA 3PNKA 4J8PA 4JP3A 4UTXA 4WT7A 2XMDA 4QFDA 5CT5A 4I6GA 2GPWA 5B1HA 2HU5A 1FU4A 3O8LA 3PFBA 1KVSA 2X6TA 3DE1X 3DOOA 4RVNA 5EWMB 2R3SA 3PFCA 3SDBA 5JAOA 1OI7A 5JMTA 3DD5A 2Y66A 2JLRA 1M0SA 5BSEA 1RI1A 1I3KA 4UMFA 1N2SA 2VXYA 2DPMA 3LYLA 4KLCA 1GFWA 2ABWA 3IBTA 3L18A 1ADFA 3QPDA 3S28A 1O1YA 1RAEA 2JHPA 4HVCA 4NCKA 1ZNQO 4G81A 4V0MA 3TCNA 4OBEA 3GC6A 4BFXA 5BNIA 4M1QA 5AW0A 1U1EA 2Z2KA 3E82A 1EINA 5FNVA 2ZIWB 3FJYA 3KC2A 4EY8A 1AY0A 2X5NA 3NOXA 1Y7PA 2QAGC 1PD1A 4OXXA 2C7RA 1NLMA 1MAVA 3D7KA 2OEPA 1IOVA 1NBMD 1L7NA 2YIJA 2YN4A 2WYVA 3CCBA 3ETNA 3FFXA 4TMFA 3TE7A 2EKZA 4Z7NB 2HREA 5DW3A 1Z7YA 3SYTA 3ZG6A 4EI9A 2QUJA 5BNTA 2BFMA 4AKSA 4EELA 1AV7A 1PO7A 3EVEA 5H3LA 2D5BA 5DCWA 1TLFA 5KYUB 2FSGA 3W8NA 3ZE7A 5H80A 3BRWD 3ERCA 3C45A 1QOZA 4GECA 5BN4B 3TUZC 2PS3A 4KXFB 2R751 4HNQA 1QBKC 3SHTA 5JPDA 4JYCA 4CWAA 1NF8A 5K3EA 4DV1B 1GZ6A 3AFNA 1DC6A 3HWWA 1E0JA 1DWOA 2QTWB 3IO5A 1XXHA 2DBYA 5JZVA 1A1VA 1K06A 3GCGA 3TTTA 3W3AH 4BQQA 4MXDA 4CKEB 4KUGA 3U4HA 4JUIA 4HLNA 2XLBA 5A03A 3DKPA 3IFSA 1DG1G 1DAGA 4L15A 4RSMA 2CLCX 1TAUA 2GJ9A 1R5NA 2OK8A 1CR1A 1H1LB 2OD7A 5TC4A 4V24A 3C5EA 1QORA 1D07A 1JHVA 3OM9A 2CFOA 3TVDA 3TG8A 3REOA 1TADA 3DLIA 4FDMA 1DNPA 2XPCA 5GPBA 3P0EA 4MWEA 1C0KA 1PJRA 1YBFA 2BHNA 4R8SA 1V4VA 1DQZA 4DMKA 2GSWA 4KXLA 2HIMA 2G25A 3HK2A 1S01A 2L82A 5BOSA 1V16A 3OQNA 4BECA 3RKSA 2FMXA 1GUZA 3BULA 3T38A 4D46A 5KWEA 3PITA 2BR3A 2FPKA 3L1UA 3M6IA 3O9ZA 5C53B 3H9JA 1L4EA 3OHMA 2A9FA 3T54A 3VU9A 3ZD6A 1HQYE 1RRKA 1R8JA 2YZKA 2C2OA 1ML3A 3Q85A 2HMYB 3LPAA 5EJGA 2QI9F 4I50A 1CUWA 4QQRA 5FTWA 3A06A 3C41J 4U4AA 4GMXA 1NJ1A 2H7XA 2IY7A 4S1NA 2J5QA 1H0SA 2CXPA 4C1BA 2X9QA 1OBFO 1MIHA 4CEHB 5ISMA 3BSFA 4D9FA 3SJCA 4AD8A 2YKGA 4WESA 4RWZA 5IBRA 4EITA 3NGXA 3DWIA 3GHHA 2XCIA 2PMFA 5T4BA 3AHJA 1A9RA 3B36A 4FYYA 3RVRA 3ZQKA 3E9MA 1M5RA 1RACA 2CHVA 5CA0A 5HZKA 3AP3A 3KZKA 3FBGA 1QK3A 1PX0A 1NW4A 1QGDA 4RH3A 4YQZA 2HSZA 3BMNA 4M53A 4EUEA 3RS7A 3SQLA 3QU2A 2OD9A 3R5FA 2VR1A 4RORA 5FQNA 1Q20A 1FDWA 2F1KA 3OTWA 3PEYA 5F4BA 1M6NA 2E6KA 2HW8A 2GTHA 2PX3A 4LBYA 4M98A 2BRUC 3RANA 4BFCA 2K2WA 1TCCA 2K4MA 4NWIA 3ZD8A 1C9YA 1J07A 3C6BA 4MQ6A 3OEHD 2WM2A 1DBSA 5B1IA 1HL3A 4DSOA 2V7BA 2QDKA 1EFAA 3OU2A 2HBZA 4GF5A 1FBTA 2H0RA 3BSSA 2BISA 4XB1A 3Q0IA 3CNLA 3TM5A 1AG9A 2PGJA 5JJKA 2RK4A 4JNCA 4LHZA 2X8WA 1PJAA 4G8CA 5DJ5A 5JCZA 3O95A 3L6EA 3UMRA 1KC3A 2G6TA 3THXA 4FR2A 4C4XA 3FXAA 2OV4A 2R00C 2WPDA 3C70A 1JPUA 5F7JA 4R2LA 2GXAA 4QDKA 4H4DA 2EP7A 3DYVA 1L4GA 1DELA 3CZMA 3K1ZA 1SA0B 1ACLA 2O3JA 1PTJC 1TT5B 3DAOA 1HWYA 3C3WA 3G1WA 4B87A 2OL4A 4NBRA 1TM3E 4MVJH 5EHGA 4BFSA 4R5HA 2CDBA 2BUBA 1DTWB 5ALSA 3KBBA 3WL7A 3PRJA 3LWZA 1H2ZA 1DEOA 1ZCBA 3DFMA 3EZGA 3UJ3X 2O5EA 4WK2B 3EDMA 4K9PA 3WLQA 3LBHA 4BB9A 4A91A 1LZKA 2FTKE 1CHDA 3OZVA 2Z8ZA 3TGPA 3O8QA 4M3NA 5IUKC 1KXZA 3C3BA 4ZGGA 2GKGA 1RR6A 2VHJA 4HQNA 4I4IA 4WFQA 1Y34E 4G5QA 5EUCA 2J45A 4AMUA 3TECE 2E6UX 3FTFA 3TLCA 3PD7A 3D6NB 4F2GA 4BNJA 4PBTA 5EOVA 2JIZD 4OHZA 4JI7B 2NU9A 2ZUDA 3OCUA 4GPEA 2OCAA 4Z9YA 3GFPA 3M5PA 3AM1A 2YTZA 1EJBA 1R8QA 4RSHA 2CC2A 3RWMB 4DC9A 1ST2A 1TKAA 4CIWA 1LK5A 5DGIA 5JY1A 3ILHA 3TAUA 3RSLA 1F4VA 1TFUA 2V7UA 2I76A 4DZTA 2FWPA 1AGNA 3GQBA 1JR6A 5H0IA 1JFLA 2VBCA 3GEBA 1SHTX 3WWZA 3ECCA 2W70A 3HGQA 3SXPA 2DERA 2PX5A 2ZVQX 3E5HA 3FM9A 1EIZA 5TDHA 3RRXA 1BC5A 1LK0A 1YAJA 2IZ6A 4TMWA 1AHIA 3KEFA 4GE3A 1J8DA 3UAOA 3EEQA 3RQIA 2V7PA 1V8DA 3IIKA 1XE3A 1JSRA 4U8GA 1DEAA 3DAGA 1QHHB 3PF9A 3B2EA 1OZ0A 4JX9A 4ZJYA 2QA5A 1D9ZA 1NFQA 3DQZA 5I5EA 5E0OA 4CEIB 3K4QA 5DCYA 3PXGA 1YHZA 2WQ6A 4IF4A 3OZBA 1YMQA 3QUTA 5ALMA 2JRCA 3O93A 4DCUA 1YF3A 5TT1A 4QRHA 3TPZA 5DWVA 4AIIA 5MF6A 4MX8A 4X44A 1QNFA 3IV6A 3FIJA 1SZCA 1PWHA 2ET6A 2WLSA 1YGYA 2BMFA 5CVEA 5SZKB 4X65B 2YUTA 3T5MA 1Y5MA 3LA8A 4DXDA 5DBGA 5AQ1A 2GNPA 1B8PA 4F5ZA 2XJ4A 1UZLA 3H97A 1DTWA 2QY9A 4CTJA 1DFGA 1X8JA 4F4DA 4UREA 5F5LA 3PL5A 2GR9A 5IJXA 4CVNA 2FX2A 2Q7XA 2XA2A 1VL0A 3RF7A 1Z62A 2WD7B 4IQFA 1R0WA 1OXTA 1ZI9A 3FNIA 3RH0A 1SKMA 2VQ3A 3OIUA 3LUDA 5KYVA 1NNEA 4MDFA 4W9NA 2DQSA 1L5HA 4CDMA 2GNOA 3RSGA 4W1PA 5JDIC 4QPCA 3RASA 1ZLYA 1QIJA 2PD4A 2XMGA 5FP0A 2O05A 2XBMA 1JN0A 1THTA 2VQEB 5JVDA 4AQ7A 3D3QA 4JIGA 3VBCA 2PX2A 4GNRA 3SF0A 3O4FA 1R16A 4D4KA 5IANA 2E48A 4YRNA 2IY9A 1XMQB 1QO7A 3A1VA 4BLSA 3IL2A 2EHDA 2PKRA 1XCLA 3L1HA 4PCUA 2ZBDA 3QY9A 4DA6A 1AN9A 2V7XA 3GUYA 8LDHA 1CT9A 5BO5A 4Z5XA 3RADC 4XYBA 5AVZA 1Q7CA 2JS7A 1IBLB 4WOBA 1Z08A 3SZOA 5D1HA 1KZ1A 1N7GA 3SCZA 1JNXX 4GRDA 2UVDA 5BV1A 3MINB 2AF4C 4QXRA 1PJSA 1BXGB 2I55A 3PWKA 3RU2A 3W8EA 1Z22A 3OMLA 1M2VA 4M6WA 3H4MA 3KPYA 5GJWC 3UVEA 2CV1A 2R7MA 1NFFA 1FRQA 2PMDA 3ESQA 3IQEA 5K3SA 4KPFC 3LPNA 3DCIA 3ZBQA 3ZWYA 2HJGA 2X40A 3BTSA 4P92A 5CFPA 5FL7D 2JIOA 4GS5A 1ZZEA 2NAPA 3S0JA 3W7VA 3L0IB 1P4AA 3W3ZB 3IMEA 4ZT4A 3L0YA 2VJDA 2LKCA 1T34A 2XKBA 4FC7A 2JFOA 3NT5A 3KIPA 4HNTA 1IG0A 2BFCB 3H11A 4RZHA 4W6ZA 4A92A 1A4XA 2ZWMA 3JYOA 4UE3S 4OYHA 1P0IA 10MHA 4Z4EA 3LW7A 5KMGA 2JHCA 5FULA 3SS8A 1CERA 1EFCA 5JS2A 2HDOA 3JCZA 4D43A 4YGXB 2MSEB 1OXUA 3U6KA 2QBYA 5TS2A 1ZUHA 1IZ0A 4J1NA 2I8LA 5DGTA 3DLCA 2DQZA 4Y1GA 4F72A 1KP3A 2QVLA 2ZT8A 1VL2A 3N86A 5CURA 3M34A 4GEKA 3IXMA 1CJCA 1XDUA 4AO7A 4D0LB 1USVA 5EC8A 4DDKA 3KQQA 2FUG1 4Q4AB 4G5YA 5I48A 4HAXA 3DJFA 4D5GA 1PS8A 2ZSUA 3BXEA 5FI3A 1EFPA 4NQZA 3A10A 5IFKA 1GXSA 3TX6A 1A3CA 2W48A 4YASA 5MFZA 1VKHA 1N2IA 2B4YA 4L8GA 4JI3B 5ALVA 4RL6A 1HDYA 1AN0A 3VZQA 3IAHA 5AVVA 2E4ZA 5AI6A 4DCMA 3FMVA 1WCWA 4MR8B 3SDZA 4DCCA 4G65A 2PMWB 4CV2A 4US0R 3TK1A 1KKLA 4N65A 5KU7A 2OCPA 1DC3A 3CUWA 3UM9A 4U6QA 1BNCA 4RPIA 4YDHB 1WXFA 3LUKA 1JMYA 2X77A 4RTLA 5M7EA 1CF2O 3PUVA 4ND2A 3SKXA 4QUBA 2ZUVA 1JZTA 3C3YA 3FCXA 4KYVA 3WLTA 4E0BA 2ZE5A 5BW8A 5EESA 1KF0A 3RYIB 1E8NA 1RPAA 2HF7A 4ZCMA 5JNLA 4I8IA 4L95C 5KZMB 3OZTA 4IXMA 2VXOA 2W2XA 3IQZA 5BVGA 2NLOA 3A6JA 1LS6A 3CY6A 4EEZA 1OAOC 2WKWA 4ZVUA 4BV3A 2XDAA 2P4HX 1DSSG 1DG9A 4LVCA 1JA0A 5LFAA 1RVDA 1I3MA 3I6ZA 1Y3IA 3S29A 1GVHA 3ZCTA 5FH9A 2Y1FA 4ZDWA 3DP7A 4LV8B 3ZNPA 1ZYUA 5JI3E 4ZEXA 3Q41A 2PPVA 1FYDA 1H0HA 4DUYB 2V6BA 3GELA 4NV1A 4MQLA 2EW1A 2QN1A 3PPWA 4S04A 2E9SA 1VB3A 4N7RA 1MQSA 2VYQA 4ARBA 4OU4A 1TK3A 3PDJA 1YSCA 3CNOA 4PSDA 3QXHA 1E4YA 4K26A 1QP8A 4IGFA 4WKOA 4QGFA 3HCAA 4G4JA 1R6UA 3Q3HA 1C7QA 9ABPA 4YRZA 1FA9A 2H9IA 4YYEA 4DYDA 3N6RA 3Q3GE 4Z4QA 3U1TA 5EWLB 3KUCA 4F85A 3JQ9A 3SQDA 1C1HA 2EQBA 2PCLA 4GDFA 2JATA 1M2NA 4FYHA 2PVPA 1CUUA 3WJ2A 1NY5A 4FEYA 4WFJA 3PE6A 3TZLA 1T3TA 3TMKA 3I8XA 3VTAA 3AUTA 2ZRNA 1U0FA 2J3QA 2QRNA 4LDJA 3ZDAA 3LECA 1JMVA