1IJKA

The von willebrand factor mutant (i546v) a1 domain-botrocetin complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
199
Chain Sequence
PPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRVSQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords von Willebrand factor
publication title Structural basis of von Willebrand factor activation by the snake toxin botrocetin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/toxin
total genus 67
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1ijkA00
1LFAA 3NIFB 3RAGA 3EH2A 1MQ8B 1NA5A 1SHTX 2WINI 4JDUA 1IJBA 1MF7A 3T3MB 4HQLA 3PPYA 1Q0PA 5E6UA 2ICAA 3HI6A 4C2AA 3EGXB 1N9ZA 1PD0A 4M76B 5KYUA 4F1JA 5KYYA 4NEHB 3V4VB 5KYWB 1U8CB 1FNSA 5BV8A 3ZQKA 3BQNB 1BHQ1 1RRKA 1XDDA 3EOBI 5KYNA 3V4PB 3K6SA 4HQKA 5E6RB 1M1XB 4WK0B 1U0NA 1XDGA 5KYXA 1M2VA 1T0PA 1AO3A 2NUPA 5LN1A 2VDLB 1AOXA 4XW2A 1IJKA 1JEQA 1JEYB 1MQ9A 3EFOB 3EG9A 5ES4B 2B2XA 3HXQA 1IDN1 1AUQA 5E6SA 1TYEB 2VDRB 3FCSB 3E2MA 4Z7QB 2VDKB 4WFQA 3K72B 1MQAA 1OAKA 3EH1A 3EOAI 3IBSA 3N2NA 3PPVA 4NENB 3Q3GE 1CQPA 2I6QA 5HDBB 3NIDB 2ADFA 4MMZB 1T6BY 2I6SA 1M1UA 1SHUX 1MJNA 1QCYA 4BJ3A 4CNBA 1ZOOA 3T3PB 4IXDA 2ODQA 1V7PC 4G1EB 1QC5B 2XGGA 4HQNA 5KYXB 4WK2B 3EGDB 1DZIA 3EGXA 1PD1A 1JLMA 2VDQB 4DMUB 5HGJA 5KYWA 4PN7A 3ZE0B 3PPWA 1DGQA 3ZDYB 5E6SB 4G1MB 3TVYA 3K71B 4CN9A 4Z7NB 3ZDZB 4C2BA 2NUTA 1YVRA 5E6UB 3F78A 4MMYB 1UEXC 2VDPB 2VDMB 3ZE2B 1IDOA 2O7NA 4IGIA 2ODPA 5KYUB 4HQOA 5KYYB 4MMXB 4UM8B 1PCXA 1JEYA 2NVOA 1RD4A 1N3YA 1FE8A 4FX5A 3GXBA 1RS0A 1RTKA 3BQMB 1L5GB 4Z7OB 4F1KA 1M10A 1CK4A 4C29A 1BHO1 4WK4B 1SQ0A 3K6SB 3ZE1B 1M2VB 1M2OA 1XUOA 2NUPB 2VDNB 3NIGB 3VI4B 2XWJI 3F74A 1ZONA 2X5NA 4UM9D 4NENA 1JEQB 4IHKA 2I91A 1MHPA 3EG9B 2QTVA 4WJKB 4UM9B 2VDOB 5E6RA 1ZOPA 3TW0A 3HXOA 1ATZA 2VC2B 3IJEB 4A0QA 3TXAA 3PPXA 3TCXB 1JV2B 1YVPA 2NUTB 1QC5A 1U0OC 4CN8A 3EGDA 2WW8A 3BN3A 4O02B 3EFOA 2IUEA 3QA3E 5HJ2A 3VI3B 3ZDXB 4HQFA 3M6FA 1PT6A 3FCUB 2M32A 2XWBF
chains in the Genus database with same CATH superfamily
2YNMA 2PQ0A 3OECA 4DZTA 1HLGA 3EIFA 3IB3A 5J2TF 4AROA 2YVQA 2OQ2A 3I2YX 1EFVA 1NUPA 2Z1DA 4UCWA 1K27A 3I8OA 4JJ8A 4QO8A 2DWOA 4HR7A 2J5XA 1OROA 3HVUA 5GOTA 4BO8A 4HYQA 4IVQA 2JIZA 4RDXA 2GEFA 1HPLA 1G2IA 1UXKA 1KYZA 1HR0B 1AF7A 4AP9A 4V0SA 2VAXA 1UFQA 1GTZA 3RK0A 5LD2C 4KQ2A 4A23A 3MWDA 1MC8A 4O2LA 5BSGA 2VTVA 1RRVA 4OUDA 4W5QA 3Q3JB 1F8XA 4J07A 3DWIA 4KFRA 4WNYA 1RABA 3LK7A 5B4TA 5E95A 1M72A 2G63A 3K1JA 4NABA 2JCYA 5LD2B 3JQFC 1HKUA 1RIIA 4K28A 1Q15A 3IMFA 4H3VA 3TI7A 3G2OA 3E2IA 1IVNA 1SVSA 3NDIA 1XQWA 4MH0R 1H85A 4Q9IA 3MT9A 2PUFA 3V42A 1ZGJA 4CV1A 5C7LO 1C30A 5A3JA 1XCMA 2LNDA 4EFNA 1NG1A 3DZ8A 4OBXA 4ZHQF 3GLFA 2XNDD 2QSYA 2PEZA 5LQSA 3U3RA 3MOIA 1J20A 3T0IA 1E98A 1T5HX 1NFQA 2FWMX 1M1YB 3BMXA 4R8VA 1XCOA 3RWBA 3TIXB 1MXFA 2R5WA 3HCCA 3BDVA 1I30A 2MHCA 3NJRA 1J07A 1EFHA 3FOZA 1COWD 3DZBA 4CODB 5FBVB 2VWQA 4MR8A 1A9QA 1ZQ9A 4F84A 1JL3A 1MG5A 3H42B 3WK5A 4AKIA 1QK3A 2A5FA 4Z1OA 1M1NB 2O06A 4ZARA 1QZXA 1DZ3A 1RCFA 1AHNA 1KAGA 3TM4A 4AW9A 4I6JA 2QVXX 1UH5A 2GGSA 3M4YA 2OHGA 5K6AA 1XQ9A 2V0CA 3KIPA 3KPVA 1NRJB 2X9LA 1D6JA 2UVPB 5D6OA 2O1WA 4I55A 1B73A 1KS9A 2B0CA 2GD6A 1FUKA 2OBYA 2W6QA 3PDJA 1V11B 4LRTB 4OKIA 3AUFA 4QJ3A 3GH3A 4TTPA 3PLRA 2JGDB 4E03A 3MAGA 2GN6A 3W2TA 5KQSA 4MVYA 2AOXA 4UTRA 3VR2A 3ICVA 1L1EA 1ZNWA 2RB5A 2IYWA 4FMCF 1FFBA 2QX8A 3N6VA 4JVSB 1JEEA 3CVJA 3BVPA 3GWZA 4R05A 3P9QA 2FN4A 1XD2A 4EVIA 2AHOA 2YH2A 4XQ0A 4UU0A 5IAGA 3OWHA 5DHRA 1IBMB 3JATB 1OWOA 1ID1A 5A7HA 1LBSA 3IAM1 3TIGA 4A6PA 2G9NA 2NYVA 4PR3A 5IMSA 2E2WA 3P9IA 2YZMA 4UHJA 2BKXA 2XE8A 1TM4E 1OAOA 3GP3A 3Q87B 4RXMA 1MW9X 1EB9A 3MS7A 2NUAA 2RDMA 1ZXLA 4LMPA 5A5EA 2HJHA 1JQKA 2H5LA 3FI0A 4DLSA 1GGVA 3NBQA 1X7YA 4ZYTA 5CYGA 2EATA 4EENA 4QOJA 1GXSA 2X5JO 2IW1A 4RPCA 5I4CA 3OLVA 3GLIA 4WMLA 1KIAA 5BSWA 3CB4A 1M2KA 4F9EA 3D4NA 3ECSA 1JXQA 4ZQFA 3CE9A 2JHAA 1HRDA 3V8MA 1KE1A 3LP5A 1W87A 4WBXC 1M8GA 3UMVA 2P2DA 5E9AA 1GL6A 4Q1CA 4BLRA 4BVHA 3W8DA 1Y82A 3NIFB 3STVA 4I1YA 3T6KA 1AKNA 3TQFA 2CSXA 2WQ6A 3TAHA 3V7YA 3DG9A 4JS0A 1G4AE 1E1MA 1SAYA 2X5XA 3AF2A 3PDWA 1C4XA 2FE4A 2ZYWX 1M34A 1L4HA 3DGFC 3O3MB 2B21A 1B00A 2HQBA 3EMBA 3WL7A 1KGSA 1K08A 2IHKA 3F4LA 4TVSA 5KQPA 3EDMA 2O19A 2YHBA 2F59A 4UULA 4TTQA 4YI3A 3NHPA 4HVAA 1BJRE 5A4MS 4S12A 4F6CA 1QFSA 2YIJA 3F6YA 3I05A 3PFKA 1MX9A 2YV4A 4RBNA 5GVSA 5HS4A 1FP4B 3RJZA 1RKBA 1F0KA 2JHFA 4HQKA 3F7OA 4MPDA 3BCSA 5IUJC 3I61A 1ZOIA 1U1EA 4HY3A 3U13A 3DBRA 4A0GA 1E3TA 3CPEA 1KZ9A 2ZTHA 2DQSA 2ZREA 2F3PA 4OQLA 3O4JA 2P35A 3A9WA 2WSLA 5F98A 3F5DA 4WV3A 4F3YA 1HE8B 3MTIA 1S2NA 1ZM3A 5FUQA 4CRWB 3K35A 1O5OA 4D25A 4RGQA 5HIAA 2I34A 2O8NA 1J0BA 3AY7A 4B3BA 5JUWA 3GYGA 2VHTA 1I1OA 1MCZA 2R6R1 4WH0A 3TD9A 1SM4A 1U1CA 2PUEA 2Q4EA 4WD3A 5AP9A 1CSEE 3IQGX 4IIHA 3W5CA 1V0JA 2RCNA 1RRCA 3L8GA 1SIWA 1B1CA 4AO8A 3ORRA 2QTVB 2AOTA 3NASA 2QRZA 4BFWA 3OZCA 3PL1A 4PZ0A 3PLNA 2XTNA 4ETWA 3V6MA 1QHEA 2VQ6A 1OA0A 1UWVA 4B7XA 1SXIA 4Q47A 1UMDA 3QVTA 3EVDA 2CK3D 1LF5A 1NNSA 1DZIA 2WHQA 4TMKA 1A3CA 2V3VA 3HA5A 4K6MA 3FYCA 2FK7A 3OPYI 3AHJA 5AVXA 3A2MA 1JILA 4DUZB 3RG2A 4N5MA 1XVLA 3NYIA 1GN8A 1E3WA 3OICA 1WAMA 3VSEA 5FUMA 1YR9A 3DMYA 2XEDA 2H06A 3NCHA 4B3GA 2GOYA 3N53A 1N0IA 2FU5C 3DFMA 4UQOA 1NXTA 1AQUA 2IYNA 2DJIA 2VNSA 1MBZA 1PTKA 4J94A 5EHQA 4C6SA 1RI1A 3DVSX 3PEVA 1NZDA 1JIVA 1Q12A 2AQHA 2ZWPA 2VQDA 4HUTA 3NM4A 1W4BA 4I1RA 5B3AA 2B69A 4XWAA 2E1RA 1F8YA 1MRZA 2CXSA 1DIBA 2G4LA 3C3JA 3H1AA 3JAWB 3QEMA 4HX2A 3DEZA 4RK5A 2ZIAA 3DOOA 1Q1AA 3GFVA 3OCWA 4BU0A 1NBHA 1PGOA 4EUHA 3NRBA 5EIXA 4H16A 3CH6A 4PTZA 1LK7A 3IIIA 3TIFA 2N3ZA 1OE0A 1S4MA 5F9HA 1EFTA 4WCFA 3CMMA 3PT5A 4RY2A 3RS9A 2QZJA 2CD7A 2OHVA 4J1SA 4CMIB 2CMKA 2EDAA 2P8SA 4M1WA 4NU5A 4FDAA 4WLFA 4Q4HA 1J5EB 1DC3A 4DUYB 5LXTA 3R5SA 4G81A 5ULLA 3C6QA 4UTNA 3QZUA 3F1LA 3HPRA 5CB0A 4A03A 3VNUA 1PZNA 1U0BB 2Q5FA 2YIVX 4J1NA 1E2NA 4EL5A 5GJWC 4LYGA 3EFOA 2CWDA 4TTRA 2QPAA 2MINB 4H1HA 4WJLA 3IAS1 1V25A 2EU8A 2HLNA 3S81A 3IR7A 1RMTA 2C9BA 2JA2A 2VNIA 3CU5A 3ZXIA 3R4VA 4Q7EA 2VBCA 4MJXA 5JBIA 2ZETA 4L6IA 1KQOA 3UJ3X 1XHFA 1JFFB 3QHQA 5C1PA 1FFWA 1B0UA 1YD7A 4HOYA 2J6IA 1IJFA 4BTEA 3T4EA 1FU7A 5AVTA 3OEYA 3BF8A 3DP9A 2JFHA 3QKIA 1VL6A 5AHKA 4EEKA 2RGUA 1QZZA 1W9HA 1THGA 2TMYA 3C41J 3E58A 4A91A 4TMWA 2WVAA 2VJBA 1RCUA 1J97A 4QTXA 3KJHA 4NOJA 1O0CA 1R18A 1ZL2A 2PNFA 1COWA 3NTXA 3OX3A 3G2LA 2EKPA 3D2AA 1DCKA 4TRNA 3GFPA 5CFLA 4KDCA 1U0SY 2HYDA 2B99A 5HDQA 4WN9B 3LGSA 5T64A 5F33A 2ZRNA 2B7LA 2C0QA 1PSZA 4O4HA 3IQZA 3UAWA 4CFSA 1JDBC 4TKUA 4QGSA 3I2HA 3V7FA 1FYWA 1ORVA 1R8YA 2JHPA 3HI4A 2FWNA 3PNLA 1XZNA 4HTFA 4DV6B 3VSCA 1LK0A 4ID3A 4N3AA 2P0YA 5FNVB 2XCRB 2I4NA 4AO7A 5SY4A 2QW1A 1JFSA 4KO4S 2J4FA 4HGNA 2Q5IA 2FCRA 2JAQA 3OOHA 2TECE 1JQAA 1NMYA 4JC8A 2IF2A 1C2YA 1QGAA 1ECGA 1Y63A 3P0HA 4QT4A 1JZTA 4P32A 4GWGA 3DPIA 4RH3A 1SQ6A 1TMYA 5COAA 4ZD6A 3IKTA 5F2KA 4MA4A 1GZ7A 5CX1A 4URZR 3PGA1 5KVSA 1VG0B 1BAPA 4WLUA 1HT3A 2PMBA 4RHEA 4B0OA 3MOSA 2NYAA 4OHCA 4CTOA 2R87A 4U2BA 1RBYA 1YQEA 1RMYA 5TRTA 4B35A 2JFOA 3GF4A 1IY2A 1U2PA 4ZVVA 5LKAA 2JBWA 5AW9A 5FHQA 3QK7A 1SBIA 1TD1A 2V98A 3PNPA 2X2EA 3LG2A 5AK3A 4YRAA 2FQWA 3PKIA 521PA 1AKWA 3FFXA 3BFXA 2P1DA 4WXRA 1YULA 2YWXA 3VDQA 1G8GA 2R25B 1C1DB 2E87A 2NVOA 1X1SA 4GX2A 2FFBA 2Q0HA 1KERA 4JLKA 4NP6A 3B6EA 4OL0A 3NDJA 4PHCA 5K3SA 3VGJA 1YCHA 2C5LA 2DFLA 2ENWA 3KUXA 2QT0A 1SRQA 2FE1A 5B55A 4ZGWA 3ZQ6A 4AKEA 2FDCA 4H1WA 2HKIA 1ADCA 2QQ0A 2ZE5A 1LLUA 2R6ZA 3LBIA 1TL7C 4I14A 2JLXA 2GCIA 1RHMA 3QSGA 4LWOA 3X3HA 1VKZA 2YIMA 1OIXA 3PA8A 1JEQB 2C7GA 4Z1MD 1L8OA 1KORA 2ZYVX 3LQKA 1R4NA 3HDHA 1JHOA 1LJ8A 1YDEA 1PT8A 3HWX1 4H4EA 1VECA 4RJ2A 3WLFA 1AQNA 4K6GA 1E1CA 3AQ4A 3E03A 3RUPA 3FDFA 4DR2B 1OXTA 3L8HA 3P9RA 4JP1A 1PYDA 2HXYA 1QFJA 3TCXB 4B32A 3F3SA 3RTAA 3AUYA 2C58A 5IJAA 1H8ED 1T8SA 7GPBA 1U7ZA 2JZOA 3FHLA 5C37A 1KDTA 1JSXA 1LX6A 5SY9A 3WLPA 1C7JA 3RVMA 3BYZA 9MHTA 2WM3A 1FTSA 2BFOA 4UHHA 1WU8A 3S5JA 4Y2UA 3L6BA 1TDJA 3RG8A 3NT5A 2EGGA 2QEQA 2ICAA 2FPRA 2PX0A 3KOZA 4H6XA 2I76A 4K9RA 1L1RA 2P3OA 2AJBA 4NG5A 5FV4A 4WASA 1ZJ6A 4WKPA 3HLTA 4GYYA 3P0IA 4UNRA 3UMYA 3QEAZ 3QELB 3C24A 1GA6A 3KQOA 2ZJ2A 3FF4A 3ND9A 4PFKA 2WA2A 3WBJA 2R8RA 1HH4A 1LBEA 3DE3X 4YJ3A 1QU3A 4EPXA 1XX6A 4MVJA 3VTKA 3HYNA 5LA6A 4I55F 2CXQA 1JEOA 4M1ZA 3LXXA 1JAHA 2HMUA 4TYYA 1ZINA 2XECA 2O20A 2R2AA 3QA9A 5LQMA 1E64A 2CK3A 2J3LA 4FGSA 3FGPA 5A2QA 4LOJA 4V1CA 3TI9A 2YTZA 4PANA 2ZSAA 2ZRIA 4ZOLA 3CNHA 1N32B 2H0QA 4A0FA 2DHDA 4CUKA 3ZK8A 3NORA 3FIUA 4QRDA 2BISA 1CBUA 2G7MC 3N0VA 3FTFA 1VMAA 2PUHA 4LY6A 2CFOA 4OXKA 1Y33E 4YJGB 1SUWA 3WLJA 1YL7A 4G85A 1PI3A 4C7KA 3GUYA 3UUWA 2KLBA 1QSGA 3JCZA 4WBNB 2FUNB 2XUIA 3WAGA 3NTVA 1F06A 1GUAA 2IITA 1DTEA 2QNRA 4Q3NA 1T8WA 3WIUA 1STOA 3C6ZA 4BWFB 1CV2A 4QOHA 1QIDA 2V6IA 2AR0A 3PRJA 4MRSA 3KXPA 3EZ2A 4NS1A 2ATEA 4F5EA 5JASA 4X41A 2AJDA 3OPYB 2XYPA 5DKFA 2ZRQA 3TOSA 3W5UA 2AFRA 2QMHA 1XLVA 4YRJA 4GI5A 5DW0A 3D7LA 4A8TA 1V2GA 2UV8A 3MTQA 4XCQA 3DXFA 3OURA 4FNOA 4QUHA 2ESRA 4IFIA 1RRMA 5ESRA 4CDRA 5ED4A 3NBKA 1X9HA 1VE9A 4KDEA 2E9SA 3RARA 2GD0A 1QPGA 5FH9A 5CX4A 3UAOA 3BAFA 4DV1B 1MJFA 1D0IA 1XRPA 1KMHA 4YACA 3RYHB 1ZJ4A 3BGDA 1UJ4A 5E6UB 3UT5A 2I9KA 4GG1A 4Q82A 2DAPA 2OP0A 4KXWA 2QRKA 4PGMA 3U17A 1WUKS 4ZO8A 1AXEA 1YIAA 2Z2IA 1JLSA 4UCQA 3CRZA 4XAQA 3WLIA 1NKTA 1YMUA 2R66A 3C1TA 2QRPA 1HDOA 2ZTVA 3AK4A 1S3GA 3LW8A 4FGKA 5TX7A 4LE2A 3SKXA 5IBPA 5AW8A 1EH5A 2VJMA 4TOIA 3RC3A 1GPKA 2W6ID 2QYOA 4RZSA 2QRVA 3UHAA 2QJTA 5B4UA 4J16A 1XLTC 3SQLA 4I8IA 5TQ0A 2W2VA 2XTMA 3PA6A 4WZAE 1PK9A 5IVDA 1JTFA 3NBUA 1IMOA 3LS2A 4IG4A 3MSXA 5B2ZA 5ABPA 3KSZO 2BLLA 3GLVA 4PR0A 2VRBA 2GO1A 5K20A 1J06A 1GRRA 3T7IA 4FSHA 2GH1A 5BR1A 3IPRA 5DI3A 5J4KA 2ASVA 1YB1A 2YASA 1GPDG 3CM0A 3HB5X 4NYJR 3TUIC 3U81A 4CQJA 1QUEA 4N39A 3PPXA 3TWOA 4F2GA 1MV5A 1NSFA 1U7DA 2WNHA 5FAKA 3O4GA 4DQ0A 4D4GA 1Z9BA 4DSZA 1VIYA 1NXXA 3OD1A 4UTOA 5I4BA 4GOLD 2Z57A 2ZB7A 3KTOA 4YXWD 1VJTA 3X2EA 1DEAA 4BNYA 1YFJA 3JYQA 3ANMA 3V46A 1DINA 2PRKA 4NE2A 5AJTA 3S70A 1W4AA 1P7PA 5HKKD 4XOIA 2RK3A 1KAHA 4JDUA 3MQ4A 2CL6X 3SICE 1XVUA 3IH5A 4DFDA 3CQ9A 4WLNA 2A9FA 3IOYA 5ITWA 2XRYA 2FRXA 2P77A 5EZQA 3WXMA 1EGHA 4EF6A 5HZKA 4F6RA 1JNYA 1P9NA 3H04A 1SQ5A 1LPBB 3OQOA 2NOAA 3TLKA 2QN8A 2C9YA 4TVKA 2GM4A 4P81A 3WIEA 3EY4A 5H83A 1UPCA 2BL4A 2K87A 4AX4A 2PD4A 2C5HA 5ADHA 3GDHA 1W30A 1J8MF 3TSCA 4MOWA 4MS3A 1WSDA 4GP9A 2JLAA 4JENA 3SFTA 4LNUA 3V33A 2EZUA 4FFDA 4ND6A 4AVYA 4GGMX 3ETEA 1QDLB 4Y7CA 3S99A 3EA4A 1W4RA 3H87A 4JJGA 2PD3A 3LJKA 3ZHQA 4GGPA 1SG9A 3O1JC 2I2DA 4X54A 3ZCSA 1NJSA 2QTAA 3AR6A 1AQYA 3HSKA 3NV7A 1WXFA 1MAHA 1Z4LA 3RIMA 1NE2A 3RSSA 4AMZA 1T5DX 2NVUB 4RD4A 1NWCA 1ULSA 3PQ6A 1O7JA 1SU4A 2N42A 3DTVD 3PQ3A 4P7BA 5H0IA 4CQLB 4DVJA 1OAAA 4YRTA 1XZFA 1V4VA 4ZN6A 2OFPA 5AIBA 3PQEA 1RXSA 1AC5A 2BM1A 3O38A 1WXDA 1RRPA 2I55A 3G9XA 1HZJA 2UZ1A 3B6MA 3OCCA 1PJZA 3J81A 3OOSA 4RGVA 2X9VA 3A05A 3D59A 1RFGE 3UWDA 3DAHA 3U44B 2C2OA 5BUZA 4Q0MA 1A5BB 2VWGA 4OREX 3K0AB 3UOGA 1NRWA 1XZCA 3ZJ4A 1YDGA 2HIMA 2Z9BA 2M6LA 1F9AA 1MA0A 3EN0A 3F4KA 5EIBC 5ILGA 4R1OA 3IIEA 2PXXA 2YWHA 1NONA 4FGWA 4UUBA 5AR1A 4Z1MA 1OFIA 1T29A 3UJHA 1GA1A 1KR5A 4HBGA 4HXGA 5TE9A 1B1AA 3TMAA 4WEQA 2HQOA 5JR3A 4ZQEA 1SVKA 3N8KA 1RKXA 4BMSA 4YRCA 4X7RA 4ZT5A 4L07A 4IPTA 4ZIRB 3BMNA 3S2EA 4TKZA 5I3CA 3HKBB 1KMNA 1H8EA 3R23A 1BOOA 1NP7A 1IHOA 2OT3B 3M82A 3ZTYA 5DM4A 1ZI9A 3PJFA 1SBCA 4AUKA 4XQEA 4EVQA 5DO9A 5A5FA 2IGBA 2IHUA 3K15A 3IVCA 1TYBE 1G8HA 4XJTA 1ILEA 4TTIA 3HO1A 4TMYA 1T9ZA 1JHAA 4P1ZA 2QKYA 1YQUA 1T2CA 3P27A 3HDJA 3T3DA 4R9UC 4HRVA 3ZNOA 1CZUA 3WL4A 3DJFA 3VR6H 3QE9Y 4OMFG 1XD8A 3VZCA 3GLUA 1QE3A 3IPCA 3HP1A 2Y1GA 5FLEX 4AYTA 4HXYA 4MKHA 4Z3OA 3V4ZA 2O8EA 2I2BA 1USIA 5BN5B 3GBSA 3CKLA 2BHLA 2M6RA 2XLBA 3ANLA 1E1RA 4K88A 4RE5A 1A9XB 1QE0A 2W0MA 2Z56A 4RIHA 1DO0A 5DNVA 1Q1EA 4U63A 1P1HA 1YI8A 4JR1A 4NJEA 2GBGA 3OQIB 4BFTA 3J80A 1DQRA 2J48A 3OF2A 1G4UR 1CZLA 1SQFA 4AXXA 1DTWA 4UOEA 2D3TA 1IFXA 3EVNA 1L5WA 3I5YA 3OT5A 3PRKE 4NAVA 5HE8A 3NOXA 3LC2O 4LFBB 1EFKA 2CHFA 3WK6A 1KYIA 2C61A 4RK7A 2OKGA 4K6KA 1JG6A 3CB2A 1JVSA 4FJ2A 4KACA 2ZIXB 4RVGA 2QY6A 4UVEA 3USZA 3SSNA 3VAAA 3T1YB 1NGSA 1RAFA 3CUVA 3R6GA 1SUDA 1GCGA 1F5NA 2F62A 4FGJA 4ZHSA 3WAKA 1CQXA 2OAQ1 2WJYA 2CLEB 5ALIA 3VTZA 4MLPA 3SDBA 2BLNA 4JXJA 2DFTA 2X6QA 2GASA 3NT2A 2OCAA 1WXEA 3IAEA 5SZJA 1ENPA 4AJ9A 3WNZA 3DF9A 1LI5A 4C7MA 4URHA 1A77A 1TEHA 4URFA 4DIOA 2V4ZA 4R9NA 2PS9A 3RUAA 3ZIUA 4X44A 1FFCA 1K4MA 4B6FA 1HI9A 5C8YA 3RTEA 5JALA 2GEKA 4NY1A 3R7DA 1HFKA 4GM1A 4DIUA 4NBVA 2P90A 1E5DA 1GWNA 4NX2A 2HJGA 4TQAA 1OFTA 1KFEB 2G4VA 4OVKA 3UUGA 5A0TA 3IEVA 5JOQA 3ZDFA 1GTJ1 2EEPA 4M4SA 4X95A 3BSYA 4B3FX 1L7PA 1C1HA 1PV1A 3WS7A 4TYQA 1QKKA 4IV5A 4BFCA 1PVDA 3BILA 4HAWA 1G60A 3FRJA 1QYIA 4LEIA 3FYSA 4KH0A 2KX7A 4XR4A 3SS7X 3UJPA 5C5DA 2RMKA 2VHVA 2YYZA 1RHQA 1NX9A 4FZRA 1S2GA 3BJZA 4OHRA 5HFNA 5LZ4A 1E1KA 1DXQA 2HJRA 4H1TA 3O93A 2FUG1 4C7OA 2QNBA 2E89A 4IFEA 3SVZA 2QL5A 1LQUA 5F64A 1OB5A 5GZ1A 2IS1A 2C2KA 3BXGA 3CVXA 1GKKA 1PE0A 3R0ZA 1P73A 5TLSA 3K53A 4Y0NA 3VR4D 3BAZA 5JTUA 3DLTA 1MAUA 2ZRHA 2ZBQA 3AESA 3DVQX 3F9CA 4LHSA 2F3UA 5EIBD 2VSQA 4ILEA 5HIMA 2D59A 4IILA 5ADWA 1PT5A 4JZKA 1NJ2A 1XZKA 3J7TA 2YBEA 2I4TA 2C4HA 2IC5A 3W3AH 5HSGA 4WCDA 5A5VA 2ZWVA 1VL2A 4M89A 5DYYA 4DBLC 4DT1A 5IW8A 3LT2A 4PX3A 3UV6A 3MUFA 2Q5HA 4FNGA 3U37A 1TMGE 5BW5A 2BFFB 4KE7A 4Y2HA 5FD8A 4FCVA 4NI5A 4AY2A 4G5RA 3V1TC 3G6KA 1RQPA 3ZY5A 4IHKA 2XHZA 2B36A 3BH0A 1A8SA 3FNRA 4GPBA 2C5BA 4MW2A 4LTMA 3LUKA 1WUTA 1GSHA 2FEMA 2XT6A 5JNSA 1Z15A 1KY2A 1R74A 3BHJA 1L2TA 3RRJA 4ZOLF 3VNBA 1GCOA 2EX0A 3HUDA 3HFJA 3PX2A 1I94B 3RU3A 3K9WA 4TQ9A 1FUUA 4RHUA 3ROTA 1GU7A 1NVMB 1TJ4A 3DVAA 4N41A 2X8WA 2B37A 4DTCA 4LWQA 1XZJA 3EGEA 3KWFA 1VLVA 4LY9A 2DBVO 3DV0B 3RVLA 1JIQA 1MIOB 1Z0DA 4GOJA 3EPPA 2WJ3A 3DAPA 1W2WB 5CBPB 1T4BA 1OPRA 3DTVA 2BEVB 2YJ5A 3EIUA 1IWPB 1TZBA 2JLRA 5FCDA 3T0GA 3PHGA 3WL6A 1L5RA 5JCOA 5INTA 3C8HA 1GQRA 1V45E 3P7MA 4L9SA 5CDHA 1CUAA 2H48A 2ILVA 4A4DA 4PPFA 1F3LA 3IUYA 2HWKA 5FRDA 3VX3A 1URPA 4IMRA 1JJAA 4IH4A 4GVXA 5IJWA 5JFOA 2H8GA 3WRYA 5JXJA 4BP9A 4A5OA 4DM4A 1PVVA 2AOWA 4QJ4A 1TJYA 3FWZA 3I2JA 3UWPA 2CVQA 2QM7A 4WXHA 1FXWA 1HDIA 1XWIA 1SIOA 1KH2A 1DOAA 1Z88A 2Q0XA 3E7XA 4URYR 2ZZNA 3S7TA 2B4QA 4Z8XA 3C3CA 5BT8A 4F4DA 1UAAA 4BU1A 3PGMA 1W1UA 4G4IA 5EWJB 5JMPA 3WB0A 3H9QA 4JODA 2JF0A 4EG3A 5ALJA 2I1QA 2G9QA 3N2NA 4O4JF 1JJBA 1K3UB 1U2EA 2HF9A 2HU7A 1Z45A 4TLBA 4L0DA 3FM9A 5CPBA 5AI0A 1SHUX 1SWVA 2AI2A 2X3UA 2C7QA 2EW2A 1LPOA 3T3PB 3AI7A 1CR0A 2I6TA 4B17A 3I1FA 4HH3C 4PXSA 3I32A 3RR2A 1EQ2A 1R8XA 5KOJB 1Q1GA 3I01A 4MZXA 2RH4A 3ENZA 2IXBA 3HKDA 1PL6A 1QAQA 4DV4B 3A4LA 1ZC3A 4EJSA 3V8BA 3ROQA 5CVDA 4CR7A 4B3IA 1N6PA 1TJ3A 1TK9A 1RQNA 2BVNA 1Z2PX 4IF6A 4LGMA 3ZI4A 1P8AA 3S6JA 3A6GA 3OJCA 2R3SA 4WNAB 1EJ6A 2HMSA 3MG9A 5AI5A 4DLNA 5D87A 3ZWDA 4HDMB 5AVQA 721PA 4UASA 5E3JA 4JLWA 1Z83A 3GAMA 1I9CA 1JH9A 1THMA 3KB2A 3HCEA 1T1RA 1J56A 1ZI8A 4TVBA 1EFPB 3QF7A 5FJJA 4U00A 3U0VA 4DRXB 2VOJA 4GX1A 1ODTC 4KUEA 4R3UC 2JGRA 4YJHA 2HK6A 1X2EA 4GMXA 1EG7A 1JG4A 1J5XA 4KE9A 1U02A 4UNPA 3R3JA 3T8YA 1EWRA 1KQNA 2OE2A 2O50A 2AI1A 2AN3A 5D2CA 4X63A 2X15A 3C1OA 1JA1A 5BY2A 2PR2A 1BX3A 1VA4A 2ADOA 2G71A 5EIEA 1AN0A 2CXPA 1E77A 2FEKA 1UC8A 3PC2A 1QZ3A 3M5CA 3AF5A 1T1GA 4E5PA 4N5LA 4OYLA 2HTEA 2QRLA 4DCCA 3LPDA 2HCFA 1JAZA 3TINA 1YZLA 1NVUQ 1QC5A 2AC2A 2QTHA 1IQUA 2PKQO 2Z58A 2HK8A 1P60A 3LD9A 4JL6A 1FP6A 4LOAA 2CXTA 2AL7A 4RA9B 4RMHA 3KEGA 5ALLA 3QFHA 3BL6A 3R5XA 3OQMA 3G0OA 3JARB 1CHDA 3DR5A 3BA1A 3PYXA 3Q5GA 4KXFB 5P21A 3O8RA 2BFDB 1NHWA 4GOMD 4E33A 4MV4A 3EVEA 4JB0A 3V2GA 2BP7B 5DIFA 5JANA 4JLSA 3FPLA 4XIIA 1FDVA 3SU8A 4DADA 2GN0A 1WZNA 2V5AA 4H6VA 4M1SA 4DSUA 2UXDB 1A0OA 3CX8A 1U0GA 3DMTA 4M1KA 4A8JB 3ENQA 2VJPA 4K40A 5BRNA 1NBMA 3ZQKA 4WERA 3EEFA 3MINB 2MYUA 5A6SB 4ZALA 2VLIA 1I2BA 4B34A 4K05A 2XVMA 3KPJA 3N1UA 3GYBA 4BC0A 4CIDA 5KYNA 1KAOA 1VMIA 2IYXA 2XUKA 3QVKA 1NPYA 3COSA 4KLNA 4PC3A 1NLZA 5D3QA 3M3PA 4DBZA 3FUCA 4O4IB 2COKA 4E15A 3IB6A 2OEPA 4WY8A 3U7QA 4XDZA 1WXGA 2ZR8A 1A95A 1NNUA 1XTVA 3T5CA 3OX2A 2NG1A 3GGJA 4KRGA 1KR2A 2ZE8A 1GG9A 4YQEA 4ZHQB 1JEJA 5BORA 4KL8S 1ZRNA 3PHCA 1OWLA 2ZAMA 3RYFA 5IAKA 2YMLA 4EPTA 3GGGA 2XT9A 3AEQA 1DWUA 2WD9A 4R83A 2AN5A 2VTBA 1F7UA 1NASA 3LGAA 5DTMA 5KHAA 2ZJ1A 2A9OA 1VPLA 5C9ZA 3JS5A 2XB9A 5DF1A 3FPKA 4GE0A 4KN5A 5EXXA 1J0CA 3GRAA 5K6TA 2GLTA 1RIFA 4KN8A 4FLFA 5EIHA 5IDXA 4C9BA 1GPAA 3IP5A 1KA9H 3ZWWA 3GU3A 4U8GA 3EA0A 3RV4A 1AQJA 2OV1A 5JSFA 5C35A 4B3CA 1E1DA 4J9UE 2FWPA 4RQUA 3GOHA 3BOSA 3SYLA 1EESA 2A7XA 1XI2A 1X9GA 5DEOA 1JKFA 1D4AA 5I48A 4MW0A 3NONA 5EAIA 2ZI3A 1JR3D 3QPAA 1QH0A 3IBFA 2DQ4A 3D8UA 2Z43A 3QOWA 3ZWVA 1RVDA 1R37A 2AWOA 4BDSA 1ENOA 1OT5A 4EMUA 1ZK2A 3U19A 3K9QO 5CEFA 2Q4OA 1QG2A 4EA9A 3SJZA 3ZE2B 2LIPA 2R8YA 3CUTA 4WOBA 4B6SA 4YRBA 4BMDA 4LOLA 3AZPA 3PDIA 1I9GA 3CVVA 3Q10A 3IBCA 1M8FA 1V1RB 1E6UA 3V8QA 2O0MA 1NSYA 2BDUA 3G85A 3EUEA 5CT4A 5EE0A 4OA5A 4P22A 1QP8A 4WZZA 1CD5A 2QLMA 4E4RA 1TYCA 3R9WA 1EUDB 2V7QD 2CDCA 2QE7D 2D0DA 5H9WA 3D3JA 4BO4A 5K2MA 1MX1A 2H0RA 4RVSA 1UJ6A 2CXHA 3IXQA 2EOAA 3WY9A 1WLSA 3K8YA 5EESA 3EPLA 3FOWA 3AX6A 1CQIB 1XD9A 3JWJA 4EHHA 5DM2A 1N2CA 3N76A 2YFKA 2M6SA 3G0IA 3H4MA 3VSAA 5HJ7A 3M1IA 4RF4A 3HM9A 5H59A 3FZQA 2BGJA 1BS9A 1GOTA 2WPDA 4G24A 4DUGA 9LDBA 1IY0A 1SU8A 4TZTA 5BV2P 2J31A 2AD1A 4GH5A 4MQ6A 3JAMA 4GECA 4GVLA 1BCSA 1AG9A 2OGUA 3R9IA 3X1KA 5C8YF 3WGIA 5KU7A 5LNK1 1E2IA 1FNNA 1N57A 1U31A 1YL6A 3N5KA 3KE9A 3QKRB 4R9SA 4U0KA 3HWRA 1XZHA 3L82B 4N0DA 5KWIA 1HWYA 1UBSB 2H1OA 2ADMA 3I76A 1E2QA 3RKUA 1JFVA 5K8TA 4ERNA 1E6CA 4ZOBA 3ZWXA 1IXYA 4CEHB 1E2BA 1XNHA 1X7ZA 2ZK7A 3TUJC 1PWYE 2IOHA 3M6IA 2PS1A 4EGJA 4H9GA 2E21A 3WLKX 4EVRA 5ALKA 4V3CA 1I36A 4MR9B 1TAUA 4FONA 1C2TA 3GAFA 3TQQA 5MN6A 1NFRA 2IOYA 2IX9A 4MJLA 4AJ2A 2AVDA 3BHNA 1JVBA 2BRUC 4N03A 3G8YA 2WTEA 4ZCPA 3HRIA 2WZCA 3F3KA 4L7VA 5E6RB 4PINA 3O1LA 1TCCA 1E5TA 1V7CA 2E6KA 3G5MA 4M83A 5KJEA 3BIWA 1ZMTA 4B85A 1QRTA 1PQPA 1Q21A 4L9AA 3KKQA 5LBUA 4P5PA 1PKXA 4JR0A 1BDBA 4J2TA 2P3SA 4KAAA 1E2GA 2JBAA 3FFWA 2TMDA 3PWZA 3RASA 4Q9JA 3NVKI 3HA7A 1F0PA 4LC0A 4UHBA 4BKUA 3B5JA 4CM9D 8ADHA 1PJ8A 1E0DA 5B7GA 2V4UA 4ACAA 1LDBA 1KEPA 2FN7A 1S89A 1ZLYA 2DTDA 2ROQA 3DNMA 1X8KA 3F2VA 1YB7A 3OKPA 1GNQA 1CE8B 3ASVA 2D1SA 4NYJQ 4OB8A 4ZDKA 1J8YF 3ZZ0A 2BR5A 4F4CA 2GYUA 1HY3A 2K2WA 3ELDA 1DJOA 1X87A 3MQFA 4IUDS 4NBNA 1ZOOA 4JBHA 3LZ6A 3DBVO 3N6RA 4R2MA 1AB6A 3IO3A 4U7WA 2F4VB 3Q0EA 1QJ4A 2H2HA 3MQ2A 1TC2A 5IANA 4II2A 1TCBA 1P1IA 3CUUA 3B12A 1AQIA 4X8MA 2FSSA 1ML4A 4B4WA 3MTJA 1JSLA 5CG2A 1JHPA 2C42A 2OGSA 4MYCA 4F7DA 3WGKA 1UJCA 2R6JA 1HL3A 3MPOA 5C5IA 3SZRA 4PFSA 4V02A 4MTCA 1SD1A 3OTQA 4PLTA 2RAVA 1ZN8A 3QIVA 3BERA 4M22A 3TS1A 4C0WA 2B1JA 2IIQA 1F0YA 1JEYA 1DQYA 2BFEB 2PGAA 3SC2A 1V41E 2C59A 3VH2A 5PGMA 3MOGA 2AV6A 5TF0A 4Q4AA 2RSLA 2ZUWA 1HE5A 3DE5X 1VBKA 3EXHA 3MCUA 4XGRA 2WOJA 5DTJA 1LVUA 3H1BA 4MV3A 1KK0A 5EOVA 3KUCA 1VE6A 1NFFA 1NQXA 3BJMA 2PRYA 2M2IA 3RSLA 2HCRA 3SGLA 3C1UA 5JAMA 3ZY6A 1CRLA 2OZVA 4PICA 4OHYA 2GILA 1PHRA 2OUKA 3LLMA 2XMBA 2XB8A 5ALUA 4E7PA 3MGCA 3W0LB 1W59A 2ZM6B 1AZLA 2CFIA 4AJKA 4ENUA 3IP1A 1HK7A 2QK4A 2QW8A 1SD2A 2X8JA 3IEUA 3B3GA 1L4UA 1VE7A 3O03A 3BS4A 1ODSA 2QR2A 4Q7KA 5FFNA 1MQSA 4W8OA 3C8ZA 4BQNA 1UEJA 1A2OA 5HPYB 1ZJWA 3CRMA 4PAMA 5DFAA 1KDYA 1KBOA 2Z04A 3R3UA 4XFDA 5JLAA 3TQRA 3TW8A 4B43A 3CG4A 3D6HA 4YCLA 1AURA 3R7WB 1DO8A 5EYPB 1AK2A 1YFKA 1VMDA 1CLUA 3Q8WA 2B30A 5MN4A 4YRPA 2G1UA 3A9TA 2J3MA 1T26A 4EY4A 4S1WA 2NUPA 4NYMR 5DX1A 2C0CA 2O2SA 4B6OA 5I8ZA 4MWCA 2A9VA 1XC7A 1PDWA 2XZTA 5EL0A 3G7NA 3GBPA 4EOGA 4D6XA 1IOVA 1I13A 1ZEMA 3E53A 3Q3CA 3QTBA 3NTUA 3DLCA 4YI5A 3HXQA 1SOWA 1XYVA 2A78A 2AUMA 2G9UA 1M6NA 3LUHA 5DLPA 2G1PA 3KVOA 3AEKA 4NDZA 4QD3A 4ZZ3A 1QX4A 5EXSA 4ESOA 3IVGA 1GR0A 3NHYA 1X2BA 2P9YA 5JSHA 4LRYA 4R68A 2FWBA 4NMHA 3U4DA 1AV6A 1MJNA 1NVDA 5AW3A 1RAAA 4GXRA 3E27A 5CT6A 3TEMA 2B8JA 4G41A 1WDMA 3PENA 4JEMA 1NUSA 3D3NA 1C29B 2XBUA 5EFZA 4BO1A 1L4KA 2WYOA 4RY0A 5A4FS 1GP2A 1I3OA 1D03A 4UXJA 2MSNA 2BUAA 2W83A 3JQ9C 4MB6A 5EQDA 1W75A 1NIPA 3K8QA 2Q3CA 1BCSB 1C81A 1ICIA 2OWDA 3QBEA 3U4IA 3V2HA 2IL1A 2DRIA 2FP3A 3QPWA 4UUPA 3TEFA 4F5YA 3AFMA 4S2UA 5ELLA 3TSZA 3FOFC 1CRPA 5BSTA 4ZV4A 2DJ5A 2VP2A 2B83A 3SLGA 1EFVB 5K51A 2BMAA 2I3DA 4NOLA 3UB4A 4XYBA 1U7WA 4U2DA 4IG9A 4LDRA 4AF8A 4R71A 3GLKA 1N4DA 5CB4A 4K9QA 4GEKA 5DSXA 1E4VA 2WAYA 2WD7B 3MXOA 1U8YA 3A6KA 5CLQA 4WXPA 4YV7A 5CT9A 5K0TA 3MS2A 3RRXA 1FMJA 1YZNA 1MR3F 2ZB3A 3DL7A 2OCPA 3FNFA 3IC5A 3L7CA 3TLZA 1OBVA 4OK3A 3VH4A 3OLZA 4ZJYA 3MWFA 2BH9A 2PEYA 2OGZA 4PQFA 5D7NA 5DGDA 3JPYA 3ZBUA 1U3DA 1K8ZB 5HK8A 4OUDB 2BBSA 1ILWA 2K4MA 1TO1E 4I4NA 3CX3A 1GZ5A 4R1QA 4L7QA 4OHZA 3AEUA 1N8TA 3OUTA 3IGFA 2O14A 3A4TA 4BKRA 2B5OA 2O8BB 4M3NA 1ABFA 4RK0A 2DLDA 1BCRA 4Q7QA 1KXZA 4TRMA 4OQFA 1RJFA 1PW5A 4JB8A 1NWHA 3W5SA 1OI7A 2G08A 4DEVA 1B2RA 2VDOB 1C30B 3GLGB 1S8AA 4E51A 1KAMA 1L7DA 2WHPA 3GLFB 3K6KA 4P3NA 3E9EA 1T0BA 3DKKA 2AX4A 2O8FA 1JYEA 4C29A 1UKAA 1NAHA 3ZDEA 1A76A 4RTQA 1IOZA 1K9SA 2O5RA 2OQVA 3EUWA 2RHMA 1Z35A 4UBLA 5DNEA 4KI0A 1JGTA 4KDRA 4HYYA 2HBZA 4MR8B 1GNVA 4BTLA 3O2NA 3ERCA 2VUUA 4FYVA 1ECLA 2WIFA 4Y6LA 3ZDQA 3K5IA 4LHVA 3RAEC 3E9MA 3IAUA 2HN9A 3C5CA 3S5UA 4WINA 2RG7A 1FYEA 1Z7EA 2VT2A 3ED5A 3GC6A 3ONVA 1X1DA 1CRZA 1Y4DE 4I55B 3N0XA 3IEMA 1BE8A 2JCSA 2AG0A 3H19A 3NB0A 3P8ZA 4QARA 5J1TB 1M1XB 3EJWA 3UM9A 3DEJA 3DEIA 1YI1A 2RIRA 2GJ4A 3A32A 1RRGA 1XNGA 1P5FA 1P2GA 3KYBA 4WEOA 3DNPA 1CY6A 3SX4A 2H8KA 4F3TA 5T57A 3ICPA 3B6IA 4NTZA 3NUZA 4RFLA 2EX1A 1EAYA 5EIAA 1NXVA 3F97A 1AZTA 4PPQA 4QAQA 5CJPA 3H65A 4C6HA 4NICA 2FZWA 2G5PA 3JQEA 4RL4A 1TUGA 5EKTA 2QF7A 4PBRA 1W2GA 4ZFNA 5EKUA 2OSVA 4BO9A 2C4TA 1W93A 5IS2A 5C2JB 3DO8A 3W9BA 3H2BA 4CMKA 4ER7A 2PVPA 1YHZA 1GITA 4FTWA 2NUAB 1TUBA 3A28A 2QRJA 3QVJA 3HTXA 1E0JA 2JHGA 3QEKA 4FINA 1E59A 3A6DA 1X7YB 1OYVA 3PC7A 4L3OA 4B3RB 1YVUA 1RKVA 2VLBA 1WMFA 4TT3D 4QTUB 1GXSB 3DFFA 2FF5A 3GLIB 3TX6A 5GAJA 4TLAA 1V7PC 4A73A 1VP9A 3R9XB 3AHGA 3BH7A 1YWGO 5EUCA 4YMTA 1DUSA 3E7FA 4JJFA 1VYVA 2B9VA 5ECYA 4E13A 3AFHA 2YZ2A 2C2BA 2EBHX 5IAAA 2JL1A 1DKRA 1WV0A 2MSLA 3NI2A 4IS3A 2RI6A 4L73A 3PUWA 4ZDIA 1CB7A 1T8TA 2WHXA 3DDSA 3CH5A 3P4YA 1XZ8A 1C50A 2HQRA 1W6RA 1M34B 2YICA 3NDRA 2CZGA 4P2BA 1TK2A 3L6DA 5FR2A 1FFEA 1ECCA 3BSFA 3RYHA 1E96A 421PA 4L8GA 4BKMA 4E2ZA 5BR7A 4AYWA 1HT1E 5LVAA 2CLOB 4Q7MB 3ZKWA 3FKQA 4MIOA 1IHXA 4KQMA 5JJIA 3TW6A 5IFKA 1S8FA 3LUGA 2EIHA 5JNUA 4RPJA 4OLFA 4ZAZA 3LT1A 2XMDA 3H2HA 3NWJA 1P33A 3DNFA 3KOMA 4PZYA 2OFWA 2FW6A 1NPDA 2WUEA 3DBRB 5KYGA 4M8NE 4MVJG 4DIEA 4MVJI 3AVQA 2RK4A 4XM2A 3U4AA 2QJWA 4EB0A 4ZGGA 4P4TA 2MSDB 3GWGA 4TLDA 1N7JA 1XZAA 1X42A 3CNEA 3SR4A 4BMCA 1NJ1A 1SKYE 3WMXA 1MC5A 4B4VA 3KLOA 1AKUA 3AR2A 4BOYA 4V1CI 1PL0A 2ZBEA 4C5CA 5H3HA 1T43A 2JATA 1Y7PA 4ASUD 2PGIA 1DRVA 2D5IA 1G8FA 1F5SA 1U98A 1F0NA 2Z8ZA 3LH5A 2FLWA 3KXKA 4YDHB 4MJ7A 5IARA 1T5SA 2AMYA 3C85A 4ZT7A 3W4IA 1YB4A 6PFKA 1VDMA 4JP3A 2OBXA 2WE8A 2XE7A 2AOTB 4UPEA 4KFCA 1KC3A 2BRUA 3ML1A 4IS2A 2CFTA 4RULA 4MARA 3MCWA 3ETDA 4QNRA 2L19A 1SB8A 2DKOA 2QJOA 1UMDB 3C4QA 3EVFA 5BVGA 4Q3DA 2WABA 4WXMA 2RGYA 3RVBA 2QMQA 4O2BF 3PNKA 4MI9A 5FBHA 5KYUA 3URKA 3DKVA 1X1EA 2GJAA 4EW6A 3KWMA 3TPCA 5BV8A 4QG3A 3BE5A 4LDNA 4JHXA 4H7HA 3B36A 2AJTA 1E3WB 3P9PA 3CJRA 3WWOA 4L0CA 4EBBA 3OAAD 3E82A 4HWOA 2Z8YM 3UJAA 3TNYA 4BFUA 4OYHA 3H7IA 3ZWCA 4QYSA 2QD4A 5EA2A 2IY7A 5ALHA 5AOBA 2HR1A 1U3WA 2Z5FA 2RHJA 2Z09A 4IKOA 1H8HD 1H1LA 3KAPA 1IIRA 4G8DA 5EC8A 3QEMB 1GILA 1DT5A 3VPCA 1TFUA 1X7HA 1YIDA 2I5PO 2JIDA 2WM9B 3E5MA 4LQLA 4HRAA 2HFKA 2WSSD 1X94A 4YRZA 2BFMA 4WCFB 1QRUA 4QYTA 1X1RA 2APJA 4PYLA 2YMQA 3SN6A 4ZMRA 2JIBA 4F97A 3TNFA 2JGIA 4BIIA 3AR7A 4HMQA 1WA5A 4H08A 3GK3A 3COVA 3N2YA 4QXRA 1W7AA 4G01B 1RKUA 1W4LA 4C05A 3PDHA 4MWTA 1PL7A 1U1IA 4Q4HB 2QQFA 4RS4A 1KOFA 3JZDA 3H0EA 1YBMA 1HYEA 3ET5A 5LXTB 2NZ2A 3BORA 4A2QA 1OI4A 1EWKA 3MJTA 3RROA 1D1TA 1R4AA 5KYXB 4OV6B 1VJDA 2H7CA 2K5UA 3CVUA 2Q3MA 3RYIA 3WAJA 3QMWA 3TJRA 1QYWA 1DRKA 3RIYA 4IQFA 1SY7A 1W5AA 5ARDA 4EHIA 5HUQA 4W82A 1M5TA 2ORWA 3DJYA 4YEDA 5I9LA 4X3PA 2OYRA 3UJ7A 2HL6A 4CMEC 2CMFA 4MJ3A 4WI1A 1I7NA 1SOUA 4FE7A 3OM8A 3FCOA 4YJ2A 1BHSA 4TXMA 5FOVA 1T91A 1E5XA 2P4UA 1WLYA 5HKAA 4A82A 3IQXA 4DF3A 2JBHA 4MDEA 2Y0PA 4K2HA 4UVGA 2YN4A 4PLYA 3OOEA 3IQIX 3LI2A 4QPNA 3H5WA 4YP0A 3ZWYA 1CJTC 1OBFO 3CLHA 1I4DD 1X8LA 3HEBA 2V0GA 3WLAA 1E2KA 4OUKX 4QU9A 5ALSA 3UMJA 1L5VA 2XNSA 2GAFA 1EP1B 3N2LA 3IKJA 1ORHA 1B15A 3UGQA 3RKSA 3U9LA 5I3ZA 2NTEA 4O4HB 4M1YA 2Y4NA 1FEZA 1A8PA 3H1TA 2B8TA 4M7RA 4Q3BA 4TKUB 4LJKA 2W22A 2X1HA 4YASA 3TSWA 3ER9A 3FUTA 3ESBA 1ZOPA 3MS4A 1AMUA 3KYIB 3F2IA 4G3XA 3INRA 4TXNA 4HTFB 3R2JA 4M0PA 1Y3HA 2X9NA 2H65A 2NO0A 3QJYA 1YGYA 4XKJA 2WJZB 3KKLA 2JAUA 2JPDA 4JFRA 2ACEA 1T0IA 2CCGA 2Z1NA 3IPYA 2AX3A 3A2LA 4FGLA 5JZ9A 3BWVA 3C8UA 4DC0A 4OF4A 1HYQA 4R5MA 5KO2A 1IB6A 1YJ5A 1GAJA 3D54D 4WADA 4BC1A 5C80A 3G2PA 1XPUA 1S2OA 1YZHA 1N6NA 2IHYA 3RE1A 3STHA 3F7TA 3O8OA 3QX3A 4RADA 3AUTA 5CX1B 4J75A 2BCGY 1Z6YA 3GPCA 3ILXA 4TV8B 5TB5A 4BX3A 1KYQA 4F1JA 3UIEA 2BKUA 2I2XB 3ZD7A 3AY6A 4OQ4A 2PY6A 1UBHS 3MMZA 1SOVA 1B41A 3DS8A 5ALVA 2UUOA 3UKDA 1ZHOA 3AY3A 2XTJA 3DZJA 4YCBA 3I5XA 3R6TA 5IXSA 5FUWA 4UEKA 3RK1A 3TTUA 3ZZTA 3FZYA 4PSDA 4CM1A 3L1HA 4QFBA 2FLVA 5CEJA 3WWZA 3RSOA 1H2EA 1X1AA 1ZSNA 2B4AA 2GBLC 2PXHA 1O77A 3L6CA 3ND6A 3OE4A 2IZ5A 1GTG1 4IKPA 2BSQA 2AMVA 2WUWE 5DTRA 3A1DA 3VV2A 4EF5A 1SC4A 5JJ5A 3TFOA 1DCMA 2Y1FA 3PC8A 3ZNNA 4F21A 2OMEA 1ZN2A 1T9DA 1FTQA 3HNRA 2O6HA 5D5PA 3M4NA 2ZWAA 4HLUC 1SR8A 5B12A 2UYYA 1PYGA 3E05A 5DTQA 5HXAA 2ZUCA 1R4NB 4CMHA 1CIPA 1Y5IA 5CM9C 1VHTA 1JU3A 1PFKA 4I81A 3P9YA 6AT1A 5JXHA 1FNCA 1NRXA 1E1CB 3I37X 1R5JA 2V7TA 2CJPA 1OPXA 4PSVA 2R65A 3SJAA 2PH3A 2AA3A 2W2NA 4G0XA 4UHKA 4W4TA 1Q83A 4I9UA 4DHWA 3VKVA 1CX9B 1B3BA 1VCHA 4EX7A 2F1OA 2OSBA 4RUKA 4LXHA 4OP2A 4N5HX 2QLTA 1MMFB 5F1OA 4C21A 4Q1EA 4PCVA 1JAXA 3OZAA 1VL5A 3CX6A 4QJ5A 2I7DA 1QYXA 2Q8PA 3KZXA 3ROEA 3UQYS 5P8WA 4V0QA 3I52A 4RVNA 1U9ZA 2HHAA 2XOKD 4LDZA 1V8FA 3GROA 3VKWA 2HLDA 5T8KC 1RWNA 4RVDA 5FPHA 3QJ5A 4GP6A 4PLGA 1P44A 4FCTA 2ZS9A 2XE6A 2YZKA 4QTYA 4RENA 4PLCA 4XCVA 2B2NA 2VH5R 3F6SA 4GX0A 1P2VA 2WAXA 4YJ3B 5DIZA 5I9MA 3GLHE 4Q1BA 5LA6B 5U1PA 3LRXA 3CHYA 3SQOA 3TQHA 4JP5A 3DFIA 1ZD9A 1BEZA 2Z98A 3VH3A 4GYJA 1UBRS 3NPMA 2H59A 4YWJA 3EYWA 3FOBA 1GU1A 3A04A 2ISCA 2R1VA 2IEZA 3AG5A 4A2CA 1A7UA 2ZBFA 4E70A 3GNTA 4V1CB 5LOVA 3I0ZA 1OTHA 4ZOLB 2PV0A 2HEGA 3II6X 1UJMA 3EPJA 3ADOA 2QNIA 5CA1A 5DGCA 2YC2C 3PLAE 1U9IA 1YVEI 5EIWA 3Q11A 2O2ZA 3ZWOA 2FRDC 3VU8A 2GUGA 3AI3A 1SC6A 2JH8A 2CZQA 1T1SA 1T3ZA 3KSDO 3ZHBA 4Q37A 2YN0A 4CM6A 3PC3A 2R85A 3GZ4A 3L79A 1YTLA 3VKHA 3OCZA 4DM7A 4Z4QA 3AM4A 2YS6A 3EZYA 2BEKA 2EWWA 3HSSA 3L8MA 3OZRA 3HWWA 2IUYA 3R3VA 3D9QX 4BV9A 5B5SA 5F7OA 1RPNA 2JFVA 3TPZA 3CKYA 2WZBA 5TGTA 3L5KA 2GAIA 4V38A 1KEZA 4D9EA 3SE0A 5LQCA 1S7CA 2GXSA 5KYYA 4M9SA 2QAJA 2GNAA 3PFFA 4GXNA 4MVXA 3UHPA 4PZZA 4WKBA 1U8FO 2F1IA 2RAPA 4BYMA 1LDMA 2B4YA 4LZOA 2ZXUA 1BRTA 1L5KA 5J3JA 2BMDA 1ORRA 3UT5B 1KMHB 3JW8A 4EPYA 4E88A 4JASB 1BD3A 1CDZA 1HFEL 5JLJA 1TZJA 1GQQA 3ESQA 2MSWA 3AR9A 1P77A 4BCCA 2VDLB 3V8PA 2YWBA 4YN3A 1T9KA 5EZYA 4LZPA 3VTAA 4AF6A 2XKBA 2GNPA 1HZZC 4P54A 4Q21A 4YAOA 4D1YA 1Z5UA 1VL0A 1NOIA 3KVYA 1EZZA 4BFZA 4F2WA 2H5IA 1J2TA 1N2BA 4DNPA 1DDIA 1D9ZA 1M74A 3UZUA 2QRVB 5EZ6B 4CQMD 4DWJA 3E9QA 3N0RA 5KC9A 1E8MA 3TOCA 2E5LB 5TQ0B 1Z6GA 4FHFA 5JS7A 4YMGA 4NOMA 4K9PA 2D2XA 2SECE 5U4XA 3M9XA 5G1PA 1Q95A 2I65A 3KL2A 1EEHA 1RYEA 4YJFA 1PJQA 3IR5A 3FDIA 1GRNA 1XALA 1DKNA 2BUBA 5DI3B 3NMUF 1NBIA 1Y7TA 3PSHA 3IKMB 4XIYA 1QVZA 3ADCA 4CEIA 4OBBA 4D5EA 2ILTA 3KQUA 1RLUA 3OMXA 3E8XA 1QG4A 1FLVA 2XF8A 4NU0A 3GP5A 4C7BA 1DMRA 1PJCA 4K0KB 1LH0A 4MEBA 5CFOA 3SY8A 1MC4A 5K45A 4JLJA 2BGNA 3MUOA 3ZDYB 4IBOA 3EAQA 1NMQA 2JLYA 3FW1A 1LS1A 4BGUA 1G8KA 5A71A 3O3OB 4F6RB 2DC1A 4C3OB 4W7HA 3OZVA 4Q15A 3IHKA 3L6UA 4HJRA 4DIKA 1RD4A 2ZANA 1M3SA 1Q44A 4C4RA 4KMOA 4XVUA 4X3CA 3CF6R 5AVVA 4N76A 5CXQA 4LBYA 3D4BA 2DLCX 2EP8A 1F4LA 5TC4A 5ALNA 3RFXA 3OIVA 4MS3B 2VYND 5F5NA 1ST2A 3UOWA 4LNUB 1XUOA 3T9EA 1EVJA 2WKQA 4LG1A 4KX5A 5ENDA 3B3QA 5E7JA 1IBSA 3LFTA 4QQNA 2F43A 5FPQA 4CKWB 4UFOA 1D4FA 4OQPA 3WKCA 2YDYA 4CIYA 1PT9A 3PZRA 5AI6A 3CEAA 4JWKA 2G5CA 4H0CA 3EFHA 4MDHA 1RXWA 5G41A 4BVEA 3DSRA 4CI9A 3KYCA 4IFBA 4HFRA 4ZJPA 2IUFA 3TR0A 5AW1A 4BEVA 4W9MC 3ZHYA 4KN9S 2W2TA 1H3EA 4OLAA 5LQJA 2WWFA 3P2YA 1YO6A 3QOYA 4EW2A 1HDCA 3AMVA 3BN3A 5GM1A 2GTHA 1UFOA 2UZ1B 4OQXA 2V6MA 2FR8C 4JCOA 5CXXA 2CL5A 4LRXA 3G1TA 4K3UA 4KKVA 4NKRA 4AZTA 2J0SA 3M6VA 7REQA 1UKEA 2AKYA 4K9KA 3A1WA 1DHTA 5JPDA 1RYHA 5KWVA 3A58B 2DE0X 1WSAA 1JT2A 1XEWX 5LWHA 3FSEA 4B6GA 3EHEA 3DPSA 1P9OA 4NS4A 4UHCA 3U7EB 4N47A 3W1EA 4AG5A 4GAEA 4EZEA 3WG9A 4ZI3A 1ZA1A 3DOEA 3ZX5A 3ON5A 4K9OA 4B8WA 1JX6A 3VR6A 1C3VA 4JBYA 5DCLA 1EQUA 2A4KA 2H1CA 2IYLD 3PX3A 1KVQA 3LY8A 2JGJA 2W11A 1RWBA 2ZUDA 3H4VA 4X9XA 3VV3A 3LFHA 4B1FA 4C4AA 1RI4A 2DZDA 1ZRSA 2OTCA 4HAUA 3BMNB 1V8ZA 1RWXA 3NX4A 3CNQS 2AIRA 1COZA 2MCFA 4BLUA 1V1JA 3ECCA 2RAFA 5HMMA 3TH5A 4FHCA 4YHHB 2VF8A 3RJMA 2BMJA 3JQPA 3PWSA 1EKXA 3QX7A 4CM8A 1ZN9A 2J1LA 3ONDA 4FE4A 3STTA 4BRZA 2A5YB 3I1IA 3M9WA 3CR3C 3K16A 1RZRA 4RMIA 1TE2A 5CA0A 1UEIA 3BRWD 2ASEA 4DMRA 5JCJA 3RTGA 3WNVA 3PIIA 3GL9A 2XF2A 1KSJA 4JIGA 3VXKA 3X44A 2GBPA 4AJLA 2C0PA 1P81A 5JDCC 5IXYA 1W2HA 1CCWA 2HIHA 2G9RA 2O8EB 3B1ZA 3NOQA 4FFOA 1NQAO 1MTZA 2J85A 1SCKA 3IJ5A 1MOQA 3O5AA 4CHTA 4TKMA 5I7AA 3NBYC 5JISA 1QPZA 2ZSFA 3T5DA 1NF3A 4Q4LA 1RWKA 2P41A 3TGWA 4GMGA 1CEEA 3A4VA 2E4YA 4NJEB 3GHYA 2A58A 5EJMA 4ZVMA 2JFPA 1FSSA 1VIDA 5ILQA 2ZSDA 2FKNA 5G0UA 4IJUA 5AVWA 1XMQB 3RWOA 2CDRA 3PNYA 4I8XA 1E9DA 3HV0A 4HQRA 4ND3A 3RVNA 3F78A 4AZSA 3K0CA 4R3NA 4J0EA 2OCLA 2UZ4A 2IHNA 1U1FA 2H1VA 4C4XA 1QX3A 2VN8A 4I46A 5IDQA 3P0FA 6ADHA 4KH1A 5JAHA 2RHHA 3CNLA 4Q3OA 2ZJ6A 2K2QB 3A7DA 4BBAA 5AKYA 5F35A 5LSAA 4JWTA 4RE6A 4LAFA 1WBBA 2EC5A 3OHPA 2RH5A 4QUAA 1MO5A 2QA5A 1K8XB 5TGZA 2VTEA 5IT0A 1N6LA 5TS3A 1CEYA 1H69A 1M7HA 5JDIC 5KNCD 2CFRA 2JIQA 1HTTA 4HT3B 3VZDA 2HSZA 1VRWA 5CDFE 5E8JA 4XX1A 3SG0A 2A1UA 2CJWA 2NLOA 4RXTA 1Z34A 4O0LA 2AUNA 1JUDA 1ATZA 1FA9A 3ZHVA 2ZG6A 4GLJA 5CLFA 1RKQA 1NVGA 2PBFA 4RPIA 5C8YB 4GHWA 2Y1EA 3EGDA 3HACA 4MCHA 3LBYA 3UQZA 1CJCA 3WK9A 2F3SA 4PN3A 2VP0A 5AO9A 2IUEA 2UVQA 5EXDA 2VZ0A 3A1NA 3VR3D 1S8OA 1PT6A 1BC5A 2JFQA 3VDRA 1U7TA 2O3TA 4RFVA 3PUIA 5IAEA 4PX5A 1MQ8B 4UOQA 5DASA 1UCFA 1ZIPA 1F6DA 2L42A 3R09A 2IEAA 3M83A 4IX9A 1HDXA 2JDID 3W3AA 4MEAA 4MWGA 1FVXA 3KZVA 3H9GA 3MJ4A 4NU8X 1UAYA 3SDZA 2I6GA 2HRZA 3NNNA 4CQMA 1WXXA 4IQ4A 2NNWB 4LC9A 4LNAA 5CCDA 2IU3A 1KJWA 1IUPA 1N3BA 2ZP1A 5IN5A 1CJUC 2JIPA 3OFNA 5ALQA 2I2AA 3IX7A 4X6YA 1M0SA 1RJEA 4C7OB 1S1MA 3C6XA 3K4HA 3N75A 4FGUA 2DP4E 3H5LA 4RIFA 2OUIA 4G84A 2CLFB 3MILA 4HGOA 1H9AA 4LCBA 2OVFA 4O6VA 2G8NA 1RC8A 4UEOA 4DA7A 4URWR 2HQSA 4UW9A 4XRRA 3O47A 5CFMA 1YSCA 5CDGA 3AESB 2EYUA 2H4WA 1Q7EA 3HB0A 2PH1A 2W2QA 4HLUA 4UU1A 1Q22A 4Y9RA 5EEHA 1X13A 4RTLA 1I32A 2I7CA 2I6FA 1Q1BA 5DCWA 4RWZA 1A8UA 2CFCA 3DC2A 1Z73A 4G63A 4DT1B 2HRBA 2YJNA 2J5KA 4I1SA 4R2IA 3K92A 4Y6QA 2WYVA 1ZAKA 4WFQA 3MT7A 4EY5A 4ZXFA 1JHXA 3IIKA 4KMSA 5SZKB 3W06A 5B30A 2K7FA 3P94A 3QEJA 4NONA 3ESYA 3TLGA 4KQXA 3NWPA 3RUCA 3RYCA 3TF5A 3LUAA 1E6MA 2V7VA 1JQ5A 2NZXA 3GCGA 4XLZA 3GP8A 3NVDA 1CF2O 3IAAA 4G67A 1L8QA 3THOA 2PPVA 4RM3A 4ADSG 5BSVA 5LOVF 2OLKA 4HUJA 1N2IA 4IXDA 1Z0AA 2UUBB 4M7WA 3X43A 1AHIA 2GEBA 1E4EA 3RVQA 1P1KA 4ZU3A 1IM5A 1DJQA 2ZQYA 2BGGA 4GPAA 1DIHA 4GMDA 4S1VA 3ZG6A 4F3CA 3DVAB 3BDAA 2Z6QA 1DQSA 4I0WB 4RKYA 5CTJA 5ALFA 2XITA 3AR5A 2BR4A 1LKZA 3KRTA 3I6QA 3ZIAD 4EHBA 1M1YE 4MIYA 4C1NA 3LDHA 1ODFA 2F00A 1USUA 3KWJA 2VOEA 2Q4RA 4E1AA 4CU5A 1E3JA 3DTVB 3MYRA 4CV2A 1RJDA 1ONPA 5LMCA 3C5VA 2D7DA 1LPSA 2NIPA 3PU6A 3QYPA 2QD2A 3HL0A 3UJDA 2BHNA 3D8TA 4MR7A 3VHRA 5I47A 2J6CA 3DZDA 1JHVA 1YZVA 4HB2A 1X7WA 2VPZA 2I66A 4PSUA 4ND1A 2ONJA 4RHCA 1IAQA 1T4DA 4IDCA 1IHYA 1GNTA 1Z4PX 2GVDC 3BGVA 4TUYF 1R0BA 2NP6A 5A02A 2OFFA 2D13A 2O3JA 4D4HA 2RGRA 1NURA 2I62A 1IHDA 2Y1OA 2I2WA 4ZXPA 5HQ3A 1KHHA 3PD7A 4PO1A 2ZI6A 4ENTA 4HFMA 3JR7A 4BRWA 1DAOA 1N6HA 1YS1X 3E81A 5G0WA 2O4UX 4WXEA 5FI0B 1ZWKA 3SXPA 1OJ7A 4WZ6A 3T3IA 3TZKA 3ZDDA 1G3IA 5C5EA 1SKMA 4UHFA 3SZGA 2JA1A 3QGMA 3T52A 3LCJA 2B4TO 2J30A 3DAGA 3L4BA 2FOIA 1QLWA 2JJ1A 2YWEA 4QPZA 3ZX4A 4BX9A 1FRZA 3Q8MA 4QIHA 2IDMA 4LRWA 1XJ0A 2VDWB 4TM7A 3TD2A 3S7ZA 2AVNA 4Z9FA 4Z2YA 3VZQA 4F06A 1U6IA 5BSMA 3HCRA 3LUPA 1Q7BA 1CR6A 1XAGA 5DNDA 1K75A 4TLEA 3WI7A 2CN1A 4QASA 1CRWG 5AW4A 1GARA 2JCVA 2VF7A 2XYHA 3IEKA 4OJMX 4AS1A 1SIUA 3OQHA 3REGA 5FL7D 4LX8A 2IOFA 1K98A 1ZY2A 1XMSA 4MYSA 4CG0A 3DA8A 3EWIA 2LBPA 3NG1A 3V7WA 4BAUA 3HBJA 4WDQA 1L4EA 2X4LA 4LZJA 3HZZA 3HKDB 1TB4A 2HC9A 3UPUA 5IN4A 3OU2A 3PTZA 4X0EA 3DFZA 3SHTA 4QQ8A 3UWSA 4EJSB 4HH0A 2OD9A 1VHDA 5BP7A 1Z0ZA 3IS3A 4QNNA 3THYA 1CUIA 1HL7A 1I2ZA 1E7MA 4RD0A 2Q27A 3QHAA 4MKXA 3LHFA 4R98A 4R84A 3U4MA 1QLHA 4F91B 3MWYW 2EKZA 4Q7JB 2G8LA 5AHXA 3WGQA 1SUPA 1X1CA 5GONA 4V03A 3C98A 3QWFA 3BMOA 4GLLA 1FDTA 1U4NA 4OJYA 3GJ6A 3CS3A 1JKMA 2VKTA 1SCAA 4B6PA 3GRRA 1MAVA 4JXXA 2MWMA 5EP1A 4DSTA 2J08A 4YJHB 3EZNA 1TM3E 2QD1A 1N9GB 2RHTA 3O91A 4MKGA 2XUDA 2W6CX 2PV7A 2O07A 3B48A 5DN6A 5CYOA 3F5SA 3U5TA 4QBKA 2GZMA 4EEXA 2IBMA 3LC0A 2HY7A 3HUFA 3JQBA 1WXHA 3CIOA 3NQ41 1H0KA 2FSVA 4G07A 4X1YA 4YIKA 5G53C 1US8B 3CLSC 1JNXX 4MUBA 1A97A 4XIFA 1JJFA 1JE1A 2HDNB 2NXWA 4HL6A 4U7PB 4I1IA 4C2UA 3L7MA 1EIZA 4D56A 1IBLB 3QG1A 4WY5A 1H65A 2L0XA 1E8NA 2DPLA 2PGDA 4B71A 4FB4A 1HDEA 1QC5B 2CLSA 1GV1A 3HLKA 2QD3A 4LV5B 2J7PD 5KVAA 2IYSA 1O4WA 3PFHA 1FBNA 2DBZA 3R5KA 5EP2A 3B8HA 3MERA 3W8NA 2VCYA 1JQ3A 2YHUA 3ND7A 4R2WA 2B8NA 2G80A 4D3DA 4EG8A 1UZLA 1LCIA 1O6CA 1T34A 4I6EA 2C2YA 4PZUA 1NF2A 3ANSA 4UAGA 5AYVA 3T0FA 4JI0B 1LWOA 1KPHA 5A2GA 4LDAA 4MUAA 4D9HA 3R6LA 2QUBA 4DJTA 1ZJJA 1T0UA 2VUTA 1DIAA 1XRNA 2FF7A 2IKSA 3IE1A 3SZLA 1XZGA 1ZCFA 1C5KA 1CR4A 2EZ8A 2ZJZA 4B5KA 3A1SA 3MFYA 4HNGA 2FI1A 4X1OA 2X0KA 1Z2NX 4RIIA 2VA8A 3AB3A 3D31A 1WP9A 3VR3A 3ZGYA 3ZCVA 2NV2B 1E9SA 1F6WA 4UXHA 4DABA 3TKLA 1XCBA 2Y6VA 3GCDA 3OPQA 3IVXA 2F2TA 4H31A 1CWUA 5JD3A 1A2KC 3ENVA 4LOHA 3FTEA 1LQ2A 3GJ0A 4GKBA 1A9TA 1C0IA 1AH2A 1BW9A 1L4GA 2YRWA 4C6TA 3ESDA 4RJJA 4UM9B 3IAM6 1WB4A 5H81A 3V00A 4K2AA 3QKSA 2W0SA 1ZUNA 1SC9A 3Q9UA 2OV6A 5D3KA 3OFKA 4BPRA 3RYFB 5EJ5A 5BYBA 4KVGA 3AEQB 5CIQA 1Z6TA 4FR0A 4BX8A 4G2TA 3FVTA 2VP5A 2VTBB 1NHGA 4NESA 4JQOA 4JT2A 4CBVA 4QULA 3SJBA 1PRYA 1QMPA 4MUNA 1FU8A 3AIIA 1J0AA 2KQUA 4J4HA 4WKOA 1IC6A 2C4KA 4BZQA 3RHZA 3G5AA 4LZWA 3BIXA 1IONA 1O9HA 2EJVA 2MT9A 4M9XA 4TMXA 4Q9KA 1ZGBA 3G2JA 1K9VF 5M2QA 4X45A 2AYXA 3BJEA 5HYVA 3HBFA 3T95A 3FBWA 2JAXA 5K0GA 3A2KA 2FP4A 3FUWA 1K1EA 1N92A 3IBTA 5B7QA 5EKXA 5J40A 2VDJA 5K3DA 4L4ZA 2BZGA 3DFKA 2CDNA 2VPXA 3KBOA 4ZEXA 4AZ0A 5CFZA 1QPBA 4BCDA 5SZIA 3SBDA 2ZRDA 1PEKE 5K7SA 3L6RA 4WUTA 4IM7A 1C1YA 1I6KA 3CZPA 4LI3X 3JZFA 3O31A 3GEGA 4UDXX 5EQJB 3T61A 1YOVA 4ETNA 1O0BA 1IJKA 3PDIB 2EW8A 2WHRA 2I1WA 1RR6A 4UFPA 1QTRA 4GOOD 5CW1A 3Q7TA 1FK8A 2OCDA 5GIPE 1Z0SA 1L3IA 5BV1A 3K3PA 4RZ2A 5KUTA 3I4LA 4A92A 1Z6AA 2GJKA 4I4TA 5EERA 1DUVG 3EHDA 4RF3A 4YJDA 4BATA 2PSFA 3C7AA 3O1IC 3ZHZA 2FPLA 3EW9A 4CIWA 1SG6A 4J76A 2P9HA 1N1GA 1XMXA 3UG6A 1M0EA 1N2CB 5FWYA 1XZDA 3E3MA 2O2HA 3S2SA 2H08A 2I4LA 1BN6A 1W5EA 3I2FA 4L74A 3WQSB 3IQEA 4WZBA 2B7BA 2Y0DA 3RKRA 3EFBA 1PAUA 3CLSD 4YV0A 1MB9A 1EX1A 4JD5A 3O4HA 1IOWA 3R7NA 1PW7A 1C9NA 2SICE 4DLXA 4TWJA 3MRXA 2HEIA 5G0TA 1CUUA 3EARA 2P5TB 4IAOA 3ZWNA 3O4VA 3OIGA 3I0NA 2CT8A 1R0SA 2HBQA 3GARA 4M88A 3QTTA 3T7KA 1RZVA 3RUFA 4OJNA 1SRRA 3EIWA 4KLZA 3TVYA 1K2VN 5JSQA 4DC1A 5TGDA 2DYKA 3CUSA 1I3NA 1L7VC 3ZE8A 2PCJA 1Y8RA 1X7ZB 2HCJB 2PN1A 5FXMA 3HGTA 2ET6A 2Q3LA 4EI2A 4J6EA 3AGPA 3DTNA 4QKQA 5AVRA 2Y0BA 2AFVA 3FKSD 4KWTA 4BQPA 5IULC 3KQHA 2XOEA 3WYDA 1Y5LA 4LNHA 4Z9XA 1UINA 1NVVR 2PA3A 3NANA 1T9AA 2CUZA 3M6WA 5DHQA 4EG7A 4K3VA 1OLOA 3L06A 4H3HB 1CK4A 4YQZA 3CZ4A 3YASA 2X77A 4PSCA 2C5EA 5FL7A 4D2IA 5IUKC 1J7JA 1E79D 1C7QA 2CB9A 4XPZA 3R3ZA 3AVPA 4UM7A 3VHXA 3PGKA 3P2OA 2PMWB 2DMRA 3WA7A 1FNMA 3ELWA 1WZUA 3HFSA 3TCKA 4EHJA 2HWWA 4E5MA 2ECPA 5M04A 2GD2A 2XCSB 2DQYA 4CQNA 2C9DA 3JSAA 3P4XA 1JYFA 4AT1A 4JLPA 4B09A 1JFLA 3RVSA 4IIGA 1WMSA 3D43A 2X1LA 1CHNA 2JFWA 4Q5IA 2XWSA 4F3RA 1E0AA 3LBAA 2PL9A 2XCQA 3FNQA 1JMKC 1GPMA 1C8LA 5FEMA 4C08A 4K6HA 3OCVA 1Y1SA 3E84A 3GEMA 3ZLJA 3THSA 2C07A 4C5BA 2XOXA 1CLEA 1OR8A 2O54A 1J70A 4R31A 5BQ3A 3DLBA 2HH9A 2OM6A 4P98A 3AW9A 3E3NA 1YQTA 3GMSA 4PGHA 1MPTA 3IAS6 1EXMA 4NHOA 4LJ4A 5ICFA 5A7FA 1Z6QA 4NNPA 5IAJA 4G6ZA 4AJEA 3K70C 2BZSA 5JIBA 3RUIA 1XLUA 5F1PA 1WPQA 4XB6B 2W6PA 3PL5A 5CITA 3MUNA 4MUMA 4R9VA 1ZMXA 3TTVA 3R3XA 3OJOA 2OO3A 1P2FA 1T25A 2XW6A 1KU6A 1XRMA 2F1JA 1JEYB 4FYJA 1Q0RA 1M2HA 2HSWA 2Q99A 4ND8A 3BXOA 2FPPA 4IF4A 3CLRC 2KWIA 4JGGA 5JWOA 3SR3A 1GUBA 3CRW1 3EXHB 2VJCA 5I8PA 1ORWA 4DCMA 1Z2EA 3E7PA 1JALA 3BCUA 1M2FA 2FZLA 2I03A 2QN3A 4RK1A 3PQ7A 1VXOA 3ICOA 2XGJA 2KI5A 4CE6A 1DAFA 3SBOA 2XDAA 3W04A 3ORQA 3LQ1A 1PK8A 1PZFA 2CDBA 4EECA 2CHUA 2I6SA 2OHOA 3LRPA 1V37A 3R24A 5FYQA 3T1TA 4H1UA 5ELMA 5FFMA 3B1XA 1S01A 1XWFA 1T0HB 3H3JA 3OZ7A 4XIGS 3BICA 2QAGC 4ZAXA 1CF4A 2VSYA 4M53A 2QZ9A 1L8LA 3GEEA 1Z5PA 4MYRA 5FO1A 3ORHA 2X8JB 2FFAA 4WGGA 3ZBPA 3OTIA 4LF6B 4HCJA 3OQJA 4UMDA 4CF7A 1KHTA 4R1TA 2FX2A 4YH1A 1TQ2A 5CGZA 1U81A 5HOQA 4ROTA 1LSJA 3X1DA 4OGKA 3UPTA 4TTAA 1DAGA 3K0FA 5FWXA 2PX3A 1P3JA 1CQWA 3PB3A 4NV0A 5GPBA 5LQRA 4NHEA 3P2JA 1KO5A 2P2ZA 5K8JB 3CV3A 4AUNA 1MB2A 4XJSA 2O2CA 1NP3A 3PBKA 1X80A 1WR8A 3A9VA 4YCSA 3TW8B 2NU9A 1Y1TA 1Y3CE 1RNLA 1I5RA 4DQLA 3MB8A 3WWEA 4O2AA 1RTKA 3PUHA 1OFGA 2ACWA 4F1KA 1JKIA 3HADA 3F5MA 2X76A 1FS6A 3K0EA 3KZCA 3RH0A 5IF9A 4C06A 3U44A 3H2IA 3R9KA 5ALYA 5JHHB 2NUPB 3CN7A 4QGHA 3RS3A 1T13A 1FFGA 1XA0A 3DXZA 1S96A 1I4TD 3BREA 4WFJA 1EU1A 1NBAA 4KLCA 3D1LA 2J9FA 3EASA 2FZCA 2P5SA 1P4AA 1XJ5A 4M1OA 4MPJA 5GONF 2CV1A 2R8PA 5ERYA 2R751 4M8SA 1ND6A 5F77A 3OBBA 2Z2ZA 3OPMA 1XEFA 1ULUA 2IELA 3AEKB 4HD8A 1Z2AA 4C4SA 4MW5A 3KJXA 1ZM2A 2H11A 3CUWA 4MUXA 1C9YA 4Q4CA 3WGNA 1E89A 3H3FA 2FXIA 3KR2A 4OLHA 2Q50A 5DNWA 2IEIA 3DBHA 3GJSA 5LMZA 3AB7A 3ACCA 5EGSA 5DXJA 3WRXC 3CN9A 3CH7A 4U9IS 1M83A 4X93A 1NYRA 2E37A 2ZCVA 3M34A 4TKLA 2IOFK 5ITZA 4WIAA 5J2UA 3ZKAA 1CUBA 2B25A 2H4YA 5CBKA 1U7PA 3OM1A 1YBVA 4QUDA 5TY0A 1SC1A 4X64B 5BMOA 1T35A 2E7ZA 3FJYA 1XWWA 3GDFA 3GXOA 2X6TA 5CIYA 3AHHA 1WP4A 3GT0A 2ORED 1G9SA 1U0JA 5J47A 1OXMA 3VKUA 1GUDA 5CEEA 4IDGA 5GINE 1Z47A 3K6SA 1I3LA 1LDEA 1QXSA 3NDPA 1ZVQA 2XSZA 1EE2A 1AKVA 1SZJG 2AR9A 1TK3A 2AGVA 3OA2A 3P2EA 4MNTA 4ZYUA 5CB4B 1OKKD 2P8JA 3K70D 1NY6A 1JR6A 1BE0A 2BZ0A 3ILYA 4L16A 2JHCA 4D98A 3L41A 4Y1RA 5HM6A 1PWHA 1PIWA 1P3DA 1RCTE 4JBIA 1H66A 1Y5MA 3B9QA 3BWXA 3TN7A 1J23A 3IMKA 3WKDA 1KI1A 3TLBA 4RACA 5J5AA 1BWQA 1NLFA 3QTLA 2XQKA 4YDSA 5LDGA 1CJSA 4LYYA 2ENUA 1XE3A 2MMCA 3FOCA 3JVUA 5HKOA 3GD5A 3AEUB 4KV9A 4L5AA 2I2CA 3S1AA 3Q3GE 3JQDA 4RIEA 1F14A 2IW3A 3DEFA 5AJWA 1MP0A 2R79A 1BCRB 1RPJA 2X2PA 4LSZA 1CZKA 3N0TA 3SF0A 1C7FA 2H17A 4EY3A 4FYIA 5TDHA 1BS2A 1CERA 2R6HA 3PD0A 1W5FA 2WHPB 4PC2A 1ISPA 3NWEA 2O8FB 2Q9UA 2NTJA 2NSLA 3L93A 3NGXA 3R3SA 3V1LA 1NKVA 1HQDA 2BE9A 2H54A 2HRQA 5LQUA 2UXBB 2J87A 4CG2A 1O6GA 1V5IA 3IP7A 1E79A 2A59A 1VJCA 1Z07A 1PX0A 1Q0ZA 3UC5A 5CCEA 2GXUA 3BGSA 4YAIA 1Y34E 3QFRA 1DEHA 5LMNB 1YGPA 1XZIA 2OGWA 1XYGA 2ECOA 4Q4DA 1V3UA 1P1JA 4C43A 1XKTA 3B2QA 4J3FA 4EY7A 1PJRA 3B85A 3RT9A 1MAWA 1JG1A 3SBEA 4NNOA 5HZMA 1O97C 4FP9A 1QIMA 4KYTA 3QXCA 3VC1A 2PDAA 2CE2X 2LV8A 2PH7A 2C4UA 1WJGA 2ORYA 2MR5A 3RANA 3JZMA 5C3MA 5DLEA 5IWAB 3GCWA 2IRWA 5KSWB 1I51A 1RPZA 5HKBA 3INNA 1H2ZA 4H7IA 1N36B 1GIAA 3FFTA 1JBKA 1UBGA 4JLUA 1YJAA 1K88A 5JE8A 1ZI6A 1UXIA 3FN4A 2ZB8A 4RJLA 5AHRA 3QENA 5IZCC 5LYYA 3P52A 1Z5OA 1P0CA 1WD5A 5IC4A 1G41A 4B83A 1JB1A 3LNTA 4HYEA 5FIUA 3WWDA 5JCPA 4EMBA 3IRUA 3VSBA 2J3JA 3H6HA 3SIRA 4A10A 2UKDA 1K0UA 3R7AA 4CIVA 2C7BA 4ZAWA 1CB0A 4CM5A 1TUBB 4EHLA 4LXTA 1QAOA 2O48X 3PE3A 2ZB2A 1VSBA 2FEAA 4IKEA 2VH2A 1IRXA 1U0LA 1DBSA 1HC7A 3A6FA 4GSLA 4XSVA 3PS9A 1ZVMA 2GCGA 3GG2A 1YQWA 4BWYA 4FMDF 4PO9A 2OP1A 2OY0A 1KDPA 1V5EA 1IN4A 2PKEA 5K0BA 2R8XA 2VK1A 5AKXA 2CYBA 3NAGA 5AOVA 1BMFA 3RDPA 3A6ZA 3HLYA 3KHSA 1IZZA 3H8JA 3L7DA 4RDIA 3ZCPA 4E6PA 1FNSA 4ZQCB 5KDDA 1ZH8A 3L2OB 3BQNB 3A1TA 4RNDB 4D0RA 4R3WA 5C8VA 3V1MA 4GR5A 1WDLA 4M21A 2CWWA 1EVYA 2PLFA 3CW9A 4GSYA 4OGFA 2QZZA 2P9TA 1P4GA 2YJ4A 4OEHA 4ARZA 1IWBB 5JD5A 4E14A 1J39A 2GZ2A 5FOQA 1YBHA 4XW2A 1QIFA 1U3UA 3ZKWB 2PO5A 2OZPA 2QGNA 3T4XA 1EUQA 4BEBA 3PHLA 4RHFA 2HNBA 2WWXA 4BQQA 1K7CA 3R8FA 5C7YA 3I39X 5L4LA 2H1WA 1ZH2A 4NPHA 1DO2A 1TMOA 3JALA 3AP2A 3LPMA 1RP1A 3NJ4A 4INZA 4Q9NA 3M49A 3T7TA 4RSHA 4J91A 3EH1A 3KB8A 2HPHA 3KU1A 3KUKA 4HH4A 3LUBA 4M8KA 1F20A 1LTKA 4PG5A 3RSFA 2R00C 4EUEA 1T6BY 1L7BA 1VE1A 2HK7A 2X22A 2RC5A 4FZJA 4QX6A 4I6GA 2JGMA 1R5BA