2X8WA

The crystal structure of methylglyoxal synthase from thermus sp. gh5 bound to malonate.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
MRALALIAHDAKKEEMVAFCQRHREVLARFPLVATGTTGRRIEEATGLTVEKLLSGPLGGDQQMGARVAEGRILAVIFFRDPLTAQPHEPDVQALLRVCDVHGVPLATNPMAAEALIPWLQSLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLGLYOXAL SYNTHASE
publication title Crystal Structures of Methylglyoxal Synthase from Thermus Sp.Gh5 in the Open and Closed Conformational States Provide Insight Into the Mechanism of Allosteric Regulation
rcsb
source organism Thermus sp. gh5
molecule tags Lyase
total genus 44
structure length 125
sequence length 125
ec nomenclature ec 4.2.99.11: Transferred entry: 4.2.3.3.
pdb deposition date 2010-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2x8wA00
1THZA 1C3OA 1CE8A 1C30A 2IU0A 2IU3A 4EHIA 1CS0A 2XW6A 1IK4A 2B1IA 1PKXA 1BXRA 1WO8A 1P4RA 1KEEA 1M9NA 1VMDA 1B93A 1OZ0A 1ZCZA 1G8MA 5H3LA 2YVQA 1A9XA 2X8WA 1JDBB 1M6VA 1S8AA 1EGHA 2B1GA 3ZZMA 4A1OA 1S89A 1PL0A 1T36A
chains in the Genus database with same CATH superfamily
4DNQA 1E2IA 4E32A 3D4PA 3ENNA 4YASA 1I7DA 1PZHA 1XVAA 4DEVA 1OFHA 3LVBA 5HILA 2IYTA 5F1OA 5FFMA 5I7FA 1R50A 2ZUVA 4Q82A 5AM1A 3H97A 3PYMA 2XUOA 2OFFA 5KX5F 4V2UA 4ARBA 1G1MA 4N3NA 4BLWA 5IU6A 1Q6YA 4UDYX 2HJGA 2V0NA 1WO8A 1YUNA 3SSAA 4BFWA 2AMVA 2ECOA 4E15A 4L5IA 1NXOA 1P4HA 1CDDA 4FHEA 4NZYA 5FI1B 4P2GA 1GKKA 2QRVB 2BFBA 4WEOA 3KB2A 4PRLA 2R6GA 4FHDA 5F7JA 3W9BA 3UQZA 3UHAA 5L51A 1DAFA 1W44A 3LLUA 3ZGXA 4ALLA 3WGIA 1RPNA 4V0SA 4CMIA 4KQJA 2X9VA 3PQ7A 4JI3B 1D9XA 2CMFA 2ZRKA 3UJDA 2PL1A 1X7YA 3V48A 4AF7A 4L0QA 4P3KA 1KSHA 2YH2A 2GBFA 3BGVA 4EA9A 2QF7A 1Q92A 2P68A 3E2IA 5MFZA 4WKPA 4EJ0A 1FJGB 1P29A 1PZMA 2YOFA 1JQJC 1MUUA 3IVAA 2NU9B 2FZGA 4Q9JA 3D7NA 4IGEA 3MIIA 1ZN8A 2Q6VA 2O57A 2EZ4A 4HNHA 2IPOA 1DJOA 1DT5A 1VM6A 2CB0A 2Y1LA 3L1VA 3R1IA 4CT0A 1JQLB 3RT1A 1N7GA 2BR3A 5AHOA 1YBVA 1JYFA 1NW8A 1DBVO 1G9SA 1IUPA 2YUTA 1NBAA 4JYCA 4NZMA 3A4IA 2HU5A 3ID6C 2UZ1A 1KFKB 5JU6A 1I14A 1GPBA 3IMCA 5HP4A 3FHTA 2P67A 5IS2A 1E3SA 2ZXEA 5F2OA 1AG9A 4PSDA 4D99A 4KUEA 4WBSA 2VR1A 1KARA 4YI5A 2DTDA 1TVMA 3G59A 4JFRA 3OICA 4L28A 1ZXLA 3OUUA 3VH3A 5IN5A 3K9BA 1GQ2A 2HLHA 2NYUA 4I4LA 5ED0A 2GCEA 3RFCA 3SFZA 3V8EA 1DQSA 4QATA 4LE1A 5A5VA 1G9XA 3K71B 5LIRA 1DCTA 2G4VA 4P38A 3DL4A 1C8VB 2BDTA 2QTLA 2VT3A 2MYPA 3I4FA 2P9FA 1DV2A 3SF8A 4CL3A 4RHEA 3A6LA 1VPEA 2HCBA 4HUQB 3UA4A 4D9NA 1GO2A 5LQUA 1NC1A 5DLYA 1QIDA 4G24A 1T5OA 2G04A 1ZX1A 5CIWA 4CCYB 2N42A 2OYRA 1CDEA 2EEZA 2WPDD 3E84A 4UUAA 3SFTA 4C05A 5FV4A 1CF2O 1J90A 4JEUA 3IAHA 1YZTA 3CRW1 1G3QA 2ZS8A 1UIMA 4E94A 4QXQA 2XI4A 1I2ZA 3BTSA 4TT3A 5G53C 5EESA 1D03A 2IBSA 2C8VA 4MKIA 2V7GA 3O93A 5IBPA 1C0PA 4FOLA 3TR5A 5KJ6A 3M6AA 3B60A 3FPJA 4E3WA 3ZBTA 5CDSA 3A6PC 4FGZA 5HK9A 5L40A 1ENYA 1P2BA 2HF7A 2PTGA 2Y99A 4M1ZA 2OFXA 4DIBA 1W46A 2C5LA 3HKEA 4OK5A 3JQAB 4XB6B 5TXGA 1XNJA 4DKXA 4C4YA 4EEZA 4CGZA 2GN4A 1KY4A 4UXJA 5JJLA 2A88A 2CUTA 1R88A 4XVHA 1ADFA 2JI4A 3Q3EA 5IHPA 3GO4A 1R27A 4EKIA 2LR0A 5JSFA 2ATVA 4RZHA 2GD0A 3L1IA 1JH9A 4D9BA 2WTUA 2OBYA 2PD3A 4CQMB 1L4LA 4GGPA 4F11A 1NF9A 4BO2A 1N6RA 1MX1A 1SUSA 1U0SY 2GASA 4G0XA 3GWZA 1A7JA 1CPYA 3SKVA 2G1PA 1EJ0A 2CD9A 1QKIA 5IXJA 4AJ9A 5JHGB 2GD6A 3KZVA 4BFZA 3SDSA 1GWNA 4OHUA 3KXPA 4KKXB 5ESXA 1L4YA 3TSCA 5C7LO 4EDFA 3OQIB 1YMUA 3RU9A 4CTNA 4E4YA 4B76A 1FJHA 4BNZA 2WUDA 1E1CB 2JVKA 4LF7B 1YB7A 1IN4A 3EIHA 3AX6A 2FFJA 3X1XA 3IEVA 2XCUA 1QX3A 1WMDA 1PJAA 2W48A 4GLLA 3WLJA 2BI4A 4WY5A 1A8QA 1ISIA 2NWQA 3IHKA 2YZKA 5EE1A 4Q47A 3DXXA 4N7RA 1J56A 2IH5A 1XXHB 1NUUA 4X6LA 2I2CA 4YGXB 5JJCA 3I01M 3VR3D 3DV2A 4HDAA 1QF9A 1I2BA 1VSBA 4KUGA 3TO5A 3ZE6A 5CM2Z 5B4VA 1UXHA 4NXNB 5D3MA 2QD4A 3S7ZA 3CNQS 1GILA 1ZK1A 3VI3B 1JA1A 4E2YA 2WJPA 1PLLA 2BFNA 4XX0A 3UJ3X 3BF7A 2BGMA 3Q3CA 1E60A 2PZAA 4C2TA 5KJ1A 1CIJA 2A9KA 1IE3A 4K3VA 1N0WA 4NBKA 1QQAA 2IS4A 5KVCA 4U5QA 4HJXA 4ZZ1A 5BNTA 2GZ2A 5CH3A 3ECSA 1BDHA 4XDZA 1KEPA 4AN4A 4J6FA 4IILA 2O2DA 4MQLA 4IX1A 5J1TB 1Y4SA 3QW2A 4JB2A 4AZWA 3INGA 1UP4A 4F46A 1NV9A 4RMNA 3ZE7A 2Q50A 2EV9A 3QYFA 2BFEA 5C7OO 3EFBA 1VG1A 2C88A 4UOQA 3T5CA 3EPLA 1K68A 4MWTA 5IVKA 4HEA6 2FEOA 1E1QA 3OY7A 4XM2A 3ADOA 4OQDA 4QNMA 5CDYA 4DIUA 5LLTA 1Q91A 4DAOA 2YZMA 1QLHA 5AJXA 2I0FA 1EVKA 4OHYA 1W36C 3AHCA 1CXZA 4B6EA 4M89A 4XLLA 1XROA 1TAUA 1Z4JA 2D59A 2UUOA 2VVTA 3QEKA 4FYVA 4UBOA 4URZR 3NEAA 4EHDA 1KZ7B 4DDWA 3CZAA 1N3IA 2PX5A 2A14A 2PK3A 2GNAA 3O95A 1FS6A 4HY3A 2P5YA 2ODNA 1T2NA 3AHEA 4ZAWA 2IEGA 4RELA 3O82A 2A5YB 3OZAA 2ODBA 4KSYA 4ZARA 5REQA 1W36B 2CD7A 3J81A 1N2ZA 3EIOA 5HXAA 3GARA 3IQXA 4BLPA 2VF5X 3N8NA 4O0LA 1G7RA 4YQEA 3NV9A 1GG8A 4X3PA 4GAEA 1TCAA 1TVKB 2FZCA 2AEMA 4LV5B 1KBZA 3OEED 4G0QA 1I51A 3SYTA 4EGJA 1QK5A 1IFXA 4OGKA 1JLLB 4NYIQ 3H5AA 4Q4HA 1IOZA 1RE0A 1XTPA 4ED9A 2ZR7A 2FDCA 5K2MA 2QNIA 8GPBA 4B3GA 4TYWA 2DFVA 5I9LA 2V8BA 1D8TA 4M88A 4X8OA 5KREA 1RXIA 4DYDA 4BMCA 1UXJA 1YC5A 1TNDA 1HYBA 1C7QA 1JLMA 3NIFB 3PIDA 5BNFA 4HNTA 1BA3A 2BFDA 2G4LA 4IIFA 1TFUA 1UOOA 2G7ZA 2NN3C 1Z37A 3EIFA 3N9IA 4ZYTA 4XWOA 3UJHA 4B84A 1AU9A 1RW4A 3BL6A 3U0VA 1UJCA 2YRXA 2YZ7A 3QUCA 4G41A 3RC9A 4ETWA 5JRJA 4CW7A 2TMGA 2QJRA 2J6CA 3QENA 4LXHA 4EWLA 4BL5A 4LGVA 1Z15A 1GTZA 1DBSA 1KYTA 2DPGA 2CCKA 1DAHA 3F3MA 2Y1WA 1U1CA 3P9QA 2UUPA 4JLKA 4B40A 1H94A 3H2YA 3EVNA 3A9TA 3CZ5A 2FX3A 3GWGA 3RFUA 5LNK6 2V8OA 1K9VF 3EVFA 2L82A 4U2GA 5AHXA 1AS2A 2X0FA 1X7HA 1XNRB 3K1TA 5JSQA 4MWDA 3UC5A 1XMXA 1UDWA 4JJ4A 4KKVA 4PSAA 4XYGA 4EPRA 1HDXA 5GIOE 3IAAA 4WNYA 1SU4A 2INGX 2RGAA 1RPJA 4G85A 4RH0A 3OT4A 1N9GB 4ZQGA 3GCWA 4CG1A 4DLAA 1JEQA 2A5LA 3ZCRA 2RG7A 1HKHA 4AYXA 2JEOA 1NN5A 4TKMA 3VR2A 4CKZA 2I6GA 1H69A 4QTZA 3KKQA 5AI9A 5EUBA 3A1DA 4R1TA 2YS6A 4MQ6A 2QVLA 4IF6A 1ZGCA 3EGDB 6Q21A 1BXRA 4AWXA 5KNCD 1C14A 3AP2A 1S9DA 1LTKA 3OHMA 5EWJB 2X86A 2XE4A 3F6PA 3P2EA 4KQ9A 3BIXA 5F2EA 3SR3A 4H77A 4CV0A 4XD2A 4EB6B 2JJ8A 2W4IA 2JL1A 2QI9C 1JDNA 1MO2A 1LS6A 3LKVA 1ZS9A 2IUFA 3EWSA 3NVDA 2O59A 5TGTA 4OGGA 1XQXA 3SZMA 3GJ4A 3KPUA 2H59A 2C5FA 2GHIA 4Q1EA 3VDXA 4AF6A 3U5ZB 4EAAA 4WNIA 2XDYA 1HDCA 2H29A 1A5BB 3LJKA 3NHUA 4DR2B 1SWVA 3LT4A 4IFIA 4DXDA 4DQLA 3LXUX 2WQ7A 4PZDA 4IDAA 1CP3A 1GQOA 4MITA 1H4TA 3R5JA 1JTEA 4HDSB 4M86A 3DTYA 3WICA 1TI7A 2R68A 3R7BA 2KB0A 1K4KA 3IB6A 3FYTA 4M1MA 2ZM6B 3L3BA 4P08A 1KDTA 2MSWA 2YC2C 2H08A 2EJWA 4CLRA 3K4HA 4QBFA 5HYVA 4PEVA 2LTAA 3IUEA 4TXHA 1ZGBA 5TMEA 5B3KA 3UFXA 1PK7A 2XVMA 3HK2A 3KV3O 5TQ2B 5GONF 3EH2A 1B14A 3AUYA 3LHIA 4MVJA 4AURA 2JGDB 2V5UA 4PYLA 3V8MA 1KORA 2BE9A 3EE6A 1HTBA 3LV8A 3QI2A 2CXUA 4QX6A 5HCIA 5DM0A 1WB9A 4EHFA 1MQ9A 1D7OA 2JLBA 4FR0A 5G1PA 2QX4A 5GINE 1E1DA 1YR6A 3BBPA 1A9OA 2ISQA 4JB8A 4OGLA 4EHJA 2GXQA 2VLBA 4EW3A 1Q3HA 1NLMA 4OLBA 3HNRA 5L4NA 1SCAA 3U9TA 1VCMA 2G9ZA 3SLRA 1P5RA 2WM2A 4JQZA 4QYSA 3F71A 3U3MA 1H2EA 3EOAI 2QP4A 1XZPA 2HHJA 4P2BA 4ZCRA 3IUYA 5K09A 1LQUA 2FJ0A 4ECEA 2YXDA 3OM0A 1AUOA 2B7BA 2Y68A 4IMIB 5E2AA 4JKIA 5J4VA 1CY4A 2PN1A 1ATIA 1DJQA 1WB4A 3JW8A 3G5MA 4GOJA 4N7MA 5FR2A 4EI9A 1CNEA 3UN1A 3Q5EA 1J8FA 3SS9X 3ZXUB 2RK6A 1YHYA 2J46A 1S2MA 4L02A 2AOVA 1OIXA 2P3OA 3HZRA 3GRVA 3QFSA 4JSTA 4MV8A 3ZNQA 4Q1CA 4WASA 4BS9A 2XMCA 3ZDCA 4IIHA 1XMVA 3CZMA 2Q3CA 3FDJA 3N5CA 4QDTA 4JXXA 4AP6A 4GMGA 4F2HA 3DZJA 4KRGA 4MWOA 2JRLA 4U7FA 2J0VA 4XIFA 1RWBA 1KJ8A 1CJSA 1BDBA 5IAEA 3U4QA 3PF9A 3CZ9A 3DTVA 4U00A 5D1HA 1V39A 1MGPA 1Z6PA 3KQHA 1QGDA 1JILA 2GNOA 4N1AA 5AJVB 1LBIA 2F2TA 4KMMA 4D9GA 3NV7A 4FFBB 2X41A 1KVQA 1E5DA 1T6XA 3ND7A 1BROA 1SUDA 4K87A 5K1ZA 3H3JA 5IUNC 1C3OB 3I1FA 3TZHA 1EK1A 2PT9A 3TJRA 4URHA 4YAKA 3C1UA 3T7TA 4RMGA 3VR5D 1KI3A 4YMLA 1USWA 2IYNA 4IICA 3A9UA 3EXIA 3TJMA 5H81A 1PZNA 1ZNZA 2HV9A 3QXXA 3W2HA 1F6BA 1XZEA 2WIJA 1DX4A 2QTAA 3OJXA 5H7XA 1Q0QA 4CR6A 4XD7A 1A5SB 3N2GB 1W6UA 3C39A 3I6YA 4U7JA 2W6JD 1Z5UA 1OFIA 1P4RA 1YACA 2O2ZA 4I7EA 2XMGA 4RZSA 4ENRA 3A1WA 4J76A 3MSXA 2HO4A 2GKGA 1OV4A 5JG7A 3RG2A 3V80A 3W5JA 4ENWA 5K8CA 1S3IA 4MKZA 4BMOB 2CC2A 2Z43A 1BTOA 5K0LA 4BP1A 2ZTSA 2CLKB 1Y89A 4OK3A 5U1PA 4CVNA 3EZNA 1FFYA 1ZOLA 4MVJP 3WGKA 2ZE8A 2QN3A 3E05A 3RABA 4BRZA 4WGGA 5DJ5A 2R8PA 3LFHA 5LSAA 1ZVMA 1CJBA 1R15A 1IB0A 2E6UX 3DF7A 4C21A 5A62A 4LVUA 4GMHA 2QUZA 3AR7A 4OHOA 1L4KA 3K72B 3TDKA 3UPTA 1UPCA 2IWRA 1B8NA 2ZJAA 3RWMB 1KEEB 4LYHA 4R1QA 3VO8A 2C83A 1W93A 1JZSA 4HDMA 4PYNA 3M4XA 1JIJA 1HMPA 4GW3A 2BRUA 4QOIA 5JPCA 1Z08A 3FZEA 1IWPB 4B4OA 3Q6NA 4FZ3A 4UE2A 4Z0NA 4NEHB 2Q27A 3DOIA 1IZ7A 1PUXA 4LGYA 4D5GA 4J0CA 3H0EA 5DO9A 3RPEA 3Q8KA 3RIMA 5DNYB 4UJ3A 4FYMA 3ZDQA 3HQ4O 3SS8A 2NT3A 4WV3A 4B7CA 2BMWA 5JXHA 5L3VA 2HK9A 4F45A 4YRPA 5CEEA 3O8OB 3GUYA 4XR4A 4EVQA 1RHQA 2WVGA 3GNLA 4Y2RA 1ZI9A 3TGWA 4HMOA 4LRWA 1HL3A 1XDSA 1OH5A 2Y2UA 1J9GA 1C9EA 1OX6A 5BUZA 1FVXA 2QY6A 2CDAA 2ZSAA 3Q7IA 4M22A 4UTRA 4KNYA 3H4TA 2NOAA 1T6BY 1Z2AA 5EXEA 3UFBA 1KYWA 3JASB 3NATA 1NVWQ 4CLOA 4QLOA 5ECDA 2QUHA 3HDVA 5F52A 1MDFA 1YZNA 5F7ZA 4R2LA 4M0FA 3W7AA 2AKYA 2Y1XA 2FA9A 1JI0A 3ZWKA 2J0UB 5KSZA 1F0NA 4Y9TA 1GTSA 5LUBA 4QQNA 5DHFA 1W0KD 5EJEA 3SU8A 2O06A 3CH5A 4LQDA 4J0JA 3KRTA 4Z4QA 1L4HA 1EA5A 3TL2A 3KXDA 4R9VA 3UXMA 1HLFA 1PL7A 3W6NA 3Q3IA 5JDIA 1KMMA 3BK7A 1ID8A 1IIBA 4PGFA 2OCAA 3D1VA 3OU2A 2CNNA 5TVGA 4OP2A 4EUHA 2FMFA 4TGLA 1BXZA 2CL6X 10MHA 1E2KA 4KXQA 3ZXIA 1IHPA 1WD5A 3EXG1 3HKDA 4MINA 2G88A 2VHZA 4X3CA 1G5RA 4M7WA 2OFWA 4EMTA 5C34B 1R16A 3T4UA 1XRLA 3SQLA 2XX3A 5LZ7A 3LTEA 1XNHA 2FZWA 4TWBA 3HBLA 4QTTB 1FQWA 4C04A 3ZWVA 2IODA 2FP4B 2ZTVA 1SELA 3AJRA 3ADBA 3BQMB 2JDID 4P4NA 5TT1A 4B3RB 2G17A 4M1KA 3UAWA 5GY7A 2Y6UA 2EW8A 3FR8A 3IPXA 5DXJA 4MVJI 2G3YA 3QWIA 4HVTA 2M2IA 2JA2A 1KO1A 3WWPA 3WLQA 3GUHA 1ICEA 5BUSA 1YE5A 4M46A 4DLPA 4M1YA 5DI3B 5J63A 2XTMA 4DJTA 4P58A 3V8NA 5EIEA 3T9FA 5JYDA 2EGGA 4U39A 3DEIA 1GZ7A 3QPAA 2PL5A 1PNQA 1UT5A 5CT5A 2WY2D 4CTJA 2QTHA 3BVPA 4CDGA 4DS3A 3ABQB 3O47A 1KTVA 5FX2A 4Z53A 2NSDA 3TW4A 1FNNA 3A4TA 4YN3A 3ZEAA 1WF3A 2WE7A 4S0XA 2Q4EA 4L4XA 3JYNA 3SD7A 4OY3A 4QWWA 5BT9A 5ALEA 5DYGA 3HNOA 3OZ7A 3HU3A 2CV2A 3AILA 1U9YA 4I0WB 1SBIA 3ICVA 1MBZA 2Q2OA 1USGA 2IU3A 2V7PA 3HXMA 3R3UA 1XB2A 2JJYA 3WGLA 4BAZA 4RA9A 1DAKA 1GKYA 3K8OE 2AE2A 2H1HA 3TNLA 3S4YA 3P2YA 1NF8A 3R9WA 3TRJA 1SIOA 4DAEA 1QORA 4O4JF 3WLTA 1JIVA 1NQUA 3QHQA 1KR2A 4ZU3A 4YRJA 4DSAA 3BERA 2RI1A 3NDPA 1ISMA 3FOBA 3FXAA 5CDFA 4PC6A 1LSUA 1L1QA 2FSVC 1GNSA 1J00A 2LE0A 2YN4A 3CSSA 3GFPA 1CLUA 5G0TA 3U09A 5FOQA 2ZZMA 2GFIA 3W5UA 2O0HA 1AV6A 3CF0A 3RFFA 1FNDA 2IKSA 2ZCUA 4XQGA 4F9FA 1YB4A 2JKYA 3MRVA 4PAOA 2O05A 3WKCA 3C7AA 4Q01A 4AZSA 2SECE 3PG5A 1RC8A 2NZXA 3VTFA 1KKUA 1U1GA 2Q45A 1UDRA 5K6TA 2RH5A 3HHEA 4LVOA 3SZGA 4MIYA 3A4NA 1MJGA 2WIBA 2ZRJA 4OQYA 1KAGA 3CXRA 4P92A 1Y1SA 2JATA 4YRCA 5EWLB 5HBRA 4YXFA 1PV1A 5IVIA 4ABTA 1N6KA 2IW1A 1COWD 3PQ4A 1T3SA 1QNFA 4G8JA 1E2BA 3EWIA 4URXR 4AQ7A 4O2LA 4QXPA 4D79A 3AETA 3EPPA 1WP9A 3KXLA 2B4KA 3AUFA 4FS3A 4HT3B 3RHZA 1CERA 3IUMA 5DMXA 4B4WA 4EEKA 5BSRA 3F5DA 1ZUIA 5F51A 5LBTA 1FS5A 2VSFA 1Q0ZA 2W71A 1QS0A 1AHPA 5EP1A 1M5RA 2XDQA 2WABA 4RA6A 4M0LA 1KI6A 3LQFA 4DLLA 2VIIA 1R5BA 1T8SA 5DGTA 1FU7A 1I7PA 3PZBA 1C4XA 1SQSA 4BNHA 1P2UA 2VP5A 3F9IA 3FWYA 3K30A 3L0DA 3MJTA 4HP8A 4HRVA 4AG6A 4BVLA 4EITA 4OBBA 3VDMA 3ZCPA 2X42A 1CDZA 4I3FA 3VU0A 5MGNA 3WQBA 1IHDA 2QJOA 1RBYA 1JHUA 4UM7A 4CIDA 1D4ZA 4NOLA 2IRWA 3GV0A 4BKMA 3BJEA 3RCBA 3VSBA 4CHGA 5HQTA 2ZIFA 3U37A 5CBKA 3KNZA 3VO1A 1A7KA 3OE5A 1NYTA 4C3OB 1T3ZA 5HDQA 4O4IF 4IF4A 2WM9B 1BDJA 1JSRA 4OAOA 2FR8A 4UNNA 5U4QA 4QDXA 4P4LA 1KKLA 2HXYA 1H2AS 2C4KA 2FW9A 4OFWA 1KJJA 4LSMA 4ZZ2A 2CV1A 1NQWA 3N2NA 2ZKIA 1G0OA 3OZBA 3TXYA 1XTUA 5ALKA 3OZUA 1SULA 5GV7A 4BQSA 2A5JA 3ZN2A 2AR0A 4U1RA 1MJNA 4LF6B 4OMUA 2V6GA 1T13A 4Q3DA 4EPYA 4JXJA 3VSDA 3SVLA 1VB5A 4XGNA 3R23A 5J23A 2PX6A 1P39A 4WNAB 2BKVA 1KXJA 2YRFA 4QXAA 2Z9DA 2X4DA 3G8BA 3I2GA 4QBHA 5CXSA 2A1TR 4MGEA 4MV9A 5JMWA 3GP8A 3EBLA 3NOOA 3LSTA 2YVAA 4BN0A 4R71A 2F3TA 3P9KA 3GNQA 4Y9UA 3GLRA 3OTWA 4IXNA 3LIIA 4NF2A 2BFAA 4J43A 3STHA 4DCTA 3DZFA 5EHXA 1D2CA 4QJIA 2YFKA 3D0KA 3AJ8A 3EGIA 2X9GA 3LPDA 2NZVG 1MR3F 5M34A 5IM4A 5CW2A 4ZQHA 1C50A 4LRYA 3WDKA 3DT6A 4MGHA 1IUOA 3EG9A 2C82A 5K20A 1TEZA 2IDJA 1O8BA 3PD1A 4BFXA 1Y4UA 4DWOA 3ETHA 3UPDA 4XJSA 3FDZA 4I5FA 4UTVA 3CVUA 4ZREA 2XUJA 2G9NA 4NJEB 3AR5A 1H8HD 3ACBA 3K3PA 4M6WB 5BMVF 2B1JA 3ASUA 3FVRA 3NOXA 4QUBA 1DO0A 2AZ4A 2QTRA 3TPZA 2E48A 4ZICA 2DBQA 1BXGA 3CPJB 4UQPA 4UTXA 1QZZA 1JKIA 4N0EA 4YWJA 2Q0XA 4NMMA 1ZR2A 5A0FA 2BBTA 2PIAA 3WLOA 4B8WA 2XLCA 4YPOA 4BFVA 4ADSG 2PV0A 3C70A 1JJVA 3UH1A 1E4YA 1YOBA 2LCQA 1ZL0A 3CISA 4KIGA 5DXFA 4DG5A 1Z7WA 4LOKA 4DT1A 2DKFA 2FFRA 1JHQA 2WUWE 5TPZD 5J40A 5E9QA 3OCUA 1NBME 2BHTA 3TZCA 3WOVA 2NNLD 1JG1A 1JA0A 1R5JA 2A0KA 3K16A 4B44A 3NI2A 2IGBA 2QJTA 1GRVA 3PDJA 4UNPA 2PZMA 3TZKA 1WSWA 4P3XA 1ES9A 3VM6A 2VJQA 3SYNA 1OX5A 3O4VA 3HYRA 3P32A 4R51A 1PKEA 1BKYA 2BVNA 4Q5IA 2XCTB 1ADGA 1ISPA 1H2WA 1Y6ZA 2P9TA 3TIFA 2G5TA 1WZUA 2GF0A 1TUBA 1FQJA 5ECGC 1J7JA 3CWZA 3NC4A 3V6LA 3HCFA 1BE8A 1OWLA 3OAAD 4MDHA 1KOLA 1I33A 2CT8A 3G9TA 5HR5A 4CEHA 2P90A 4MUEA 3ZVKA 1TIPA 1UOPA 2BFBB 2WJGA 1IXKA 2OWEA 3LT2A 1RYZA 2CVHA 2HI0A 2Q3EA 5AKEA 5ALYA 4ZVSA 2GVDC 1XWIA 3B85A 1Z6GA 2PRKA 3AQIA 4Q24A 4HYTA 5ES3A 3ZBPA 1HURA 1QWOA 4CMIB 4KYIB 5K3OA 4RXTA 3PGLA 3SZUA 2QYTA 1Y33E 2HYDA 1X7YB 4CMBA 4CODB 1NYRA 2AXNA 1ZD8A 1VHDA 4DIEA 3HH8A 4HDKB 2JJ1D 4WGFA 4XGRA 5KO2A 2IXFA 2V7WA 2QV7A 1AC5A 1L8AA 5KTRA 1D6NA 1EFKA 1PG2A 3DEYX 2H4YA 3FSJX 5AD1A 3MWGA 5SICE 4FNMA 4B4DA 2DQKA 1SO8A 1TZBA 5HRAA 1B6SA 4LZLA 5HKOA 2W8BA 2BISA 1N0VC 1NUQA 3FOWA 3WWDA 2P5TB 1WUHS 1G38A 1MPXA 3PDWA 5KSWB 2WQ6A 2B34A 5CD9A 3T95A 3TR0A 2NU8A 4RMIA 2MCFA 5J1SB 2O50A 1J09A 4FX2A 1E2PA 4CG3A 1YRAA 2UZ1B 2XKBA 1YS7A 3TRFA 2CLHB 1P62B 3AW9A 4GPBA 2O3UA 2XUKA 4NPAA 4URFA 1VJ0A 2ZYAA 4OV6B 2P77A 3UUFA 2XZOA 2RGRA 4Q1AA 2G4CA 3RSGA 3PHGA 3LO8A 3GJSA 1XK7A 2RKOA 1FJXA 5L6MB 1IAVA 3KZOA 4B3BA 4HH4A 1N7IA 4R16A 3MJ4A 1KZ9A 1M7GA 1MAHA 3NH6A 1RI4A 4JP8A 1JZQA 4R2XA 4KQ2A 3HFRA 1DOAA 2PX4A 3SF8B 1EHCA 3JSXA 3V1LA 2LD4A 4AIIA 5ITVA 2OHGA 1A97A 4BBJA 4Z7QB 2QL9A 2V9ZA 2ZYHA 2WVAA 3AM1A 1OV6A 3HXQA 3DEAA 2XJ4A 2AFRA 1Q95A 2AUTA 2JIZD 5F33A 3QUBA 1E2JA 4GZLA 3G2HA 2IXBA 2W98A 2XZPA 3LPMA 4UASA 3V55A 1AKWA 5L3ZA 2B4TO 2FN3A 2HU2A 3ELUA 3OM1A 2P7IA 4P5EA 1GFZA 1A98A 5H9WA 3NHLA 2R60A 4HYQA 3ZE1B 3LD9A 2NUBA 3LKDA 1H8ED 1M83A 2QP9X 2F90A 5ICEA 2P0YA 3FCAA 2MWMA 3TQIA 1LQ2A 2VYFA 3ESYA 4Z9XA 3ZCSA 5KEIA 3LUAA 5CXXA 3K15A 2NUPA 1R6DA 1MB4A 4R7GA 5IK2D 5T7BA 2W42A 1NWCA 4N0MA 2AQHA 1YB2A 3HKEB 4B6FA 2D5IA 2RHRA 3NRCA 4LHWA 1B3BA 1HZZA 3RAFC 3MMSA 2M9MA 1V95A 2ZJ3A 3B3QA 4JVSB 5FP0A 3IE2A 1HWYA 4IJQA 3FFXA 3VPAA 1OBOA 4LY6A 5FLEX 3X1MA 1BDMA 1TUEA 2AJCA 3CUWA 4WOKA 2QD1A 3BSSA 3QVXA 2ZSJA 1SVUA 4M49A 3AIMA 4PWYA 1MH1A 1LSOA 5TF0A 2W2MA 1CQPA 2EBHX 1LSSA 5EE0A 3MXOA 5JVDF 1IPFA 3INRA 1CRLA 3AJEA 4Y8VA 3JQ8A 4ITVA 2QRLA 3I42A 1U1DA 4R2WA 2FZLA 1FZQA 3BM5A 1F7UA 1H3FA 4CU5A 1TT5A 1WMFA 2ECPA 4H08A 1YV9A 4FSDA 1U7UA 3KJXA 5KJFA 4BY9E 1ZC4A 4PR3A 2Q3LA 1XZLA 2WKRA 5H4GA 1XD9A 3L6RA 3AKCA 3DFUA 4PYMA 4INPA 1NATA 1JKMA 4BGIA 3UANA 3VJMA 4OH1A 1B3RA 1UP6A 2JAWA 1J2TA 5D01A 5TPWA 3UA3A 1B6RA 3ANLA 1Z6ZA 3CU5A 4D9KA 5BMOA 3P0FA 3G8AA 3RVKA 3REFA 3C6MA 2FEPA 5C8ZA 2WTNA 1PGOA 1ZOPA 1G291 2GPWA 4C4AA 2ZUEA 4MPTA 3GRYA 4EUFA 2Y92A 3L6UA 4OP1A 3GPLA 4FJ1A 1K27A 3I8XA 5DYNA 5BXQC 1M7BA 2PMFA 2QTBA 3S6JA 3ZJYA 4E5NA 5KNDH 2FGJA 2PBZA 2FI1A 4LVNA 1MENA 2NZUG 1LKZA 3F6SA 4MYRA 5AVOA 4YYZA 2XZLA 5D3MB 1YE3A 4AKGA 1M2VA 1VHLA 2VSOA 1GCAA 2ZJ8A 5D84A 1N75A 1JIXA 1XFDA 2Q1WA 4OFXA 3Q9LA 3TLXA 3JAMA 1RXVA 4HR7A 2G25A 2IHZA 3KR0A 3CYFA 4KXMA 1L5QA 4RAQA 4DC1A 5LWQA 1KFEB 2C7RA 1C8KA 3T1OA 1BQEA 1OBFO 1XG5A 1T6ZA 2J87A 1VE9A 4V24A 3AEUA 4Q48A 5CB4A 3U4GA 1NJSA 3E9DA 1JALA 1ID1A 1UFRA 1A04A 1KU0A 3VOSA 2OYCA 1ZAYA 1UBSB 1JR3E 1PFVA 3DE7X 3EY9A 5JBNA 2PQ0A 3TNFA 4D57A 5I01A 1ZQ1A 2OV3A 2BFEB 3FVTA 3H9CA 3IRUA 3EUWA 1EWVA 2O2EA 4FINA 1F12A 3KKMA 3SLGA 1QQ7A 1LPBB 1TU3A 3CH4B 4CL0A 1V2GA 1MN6A 1P9NA 3RM3A 5KQMA 1DAGA 4S24A 2W4MA 3ITKA 1ADCA 2GF9A 1JAHA 4LA4A 4LYGA 3WA6A 2QE6A 3MUOA 3WAKA 1OAKA 1ZM9A 4DV4B 3WK9A 3GJXC 1DEHA 2X19A 3G82C 4C0AC 1UT8A 2EW1A 3N59A 4R0NA 4DQXA 4P7JA 5TE9A 3ITNA 4GM1A 5IUJC 2HDOA 2Y9PB 1DIGA 4RVDA 3IUNA 5CMLA 5DN9A 2X0EA 3ZGVA 1UDXA 3OMXA 3HVHA 5REQB 2I2WA 2YJ6A 4E6EA 4EM6A 5KQRA 1MC4A 2YY7A 3KUXA 4FGSA 1E62A 2REBA 5T8KA 1VPWA 4IDPA 2C84A 1HQYE 3LGSA 3FZYA 1FRVA 4WADA 3PHCA 2QLTA 2B83A 3IP1A 4FNAA 4YMUA 2HHHB 2ZT8A 1CUGA 2PFKA 4JJ6A 1NW3A 4DA7A 3L0CA 5CGZA 1ESMA 2VPTA 4F3TA 3N3BC 4I50A 4IW3B 4DM7A 3EH1A 4Q4HB 3A10A 2FSFA 1W52X 3AVOA 3U7EB 2F9LA 1NZJA 5DI9A 3RTGA 4OIMA 5C46F 5J43A 3LBIA 1YRHA 4RF3A 5E9WA 3E23A 4ZTZB 2UZ0A 1VP3A 1JXOA 1N1EA 2BFDB 4I6JA 3SZRA 1SUFA 1ULSA 2G5CA 1OZGA 4QU5A 4X6UA 3USES 3B8EA 1P91A 3DT9A 2IOFK 4H3VA 1LDEA 4IR7A 1Z39A 2G28A 4KVAA 3TXAA 2C07A 4FYPA 3AERA 1XCJA 1H2XA 2LKCA 3N2KA 1AZSC 5EUCA 1T9DA 4GPAA 1NXQA 5AQEA 3NX4A 3C43A 3GG2A 4E12A 2FPWA 2Z9CA 1F51E 1L7RA 4C89A 1E9VA 1K8XB 1XXLA 1GARA 2FWRA 3UHOA 5B58C 3HYSA 2WB4A 2HIAA 3QHPA 4NABA 1W29A 4CKXA 1Q1GA 1XEFA 1PQWA 3TI7A 2VQ3A 4BGEA 1GUFA 1WV1A 2PMDA 1PT6A 5FWDA 3K0BA 1W5SA 4Q0MA 4XZ3A 2CHFA 1KYIA 1KF0A 2QRJA 2N9UA 5FCDA 4FFSA 1QG0A 4QLBA 5CA0F 3RRFA 5CT8A 3WNDA 2L18A 2VOEA 3BWMA 3DEHA 3DMFA 1GKUB 3TAXA 2ZRGA 3B2EA 4FMBB 2NQ8A 1NNSA 1HBJA 2FP3A 5TX7A 1JEQB 1N2EA 1ZNYA 3VC1A 1I2AA 1T4GA 2DUWA 3HUTA 4HZGA 4MMYB 4M7RA 4EJFA 1RMQA 1UWKA 4MAFA 5AJWA 4KPYA 3KHKA 5ICMA 2AX3A 2NVBA 4OG2A 5FPQA 2ZI3A 3OLZA 3D6AA 1W4CA 2G1JA 2GQ0A 3P26A 4DYVA 3PHIA 2NO7A 1Y8QA 1BXRB 2A4MA 2BE7A 4LXXA 3Q3GE 4G4JA 3E58A 3C6QA 4TWJA 4L8LA 1T2VA 3HEBA 4BE7B 3CN9A 3HBNA 4AY5A 1V4NA 4WECA 1NBMA 1SXJD 2FPIA 5KVQA 2V55B 3QVJA 4RDCA 3E7PA 3P4UA 3KSDO 2VJMA 1ZVKA 1L5SA 1O96A 2QD5A 3KJGA 3LCUA 4HQKA 4Z4GA 4KFUA 4YP7A 3N75A 4IQFA 3D7MA 1N8NA 2NACA 3I3OA 2BKLA 3KDPA 521PA 1V5FA 4B2IA 4BZWA 4DGQA 4YAEA 2XMSA 4PLGA 4OQQA 3VR5H 1P3JA 1YFJA 3HM2A 3R3SA 5G02A 1B0UA 1XTRA 1EK2A 4O0MA 2GESA 3AU8A 3PFFA 4UNIA 4L0MA 3RROA 2HEGA 4CLRB 4FW8A 3NG1A 5JZOA 4KXFB 3EMDA 5A0VA 3V33A 1Z4LA 1I94B 4BNVA 3UFXB 4GRIA 3GOHA 4WK0B 1VC2A 2DPMA 5FEUA 2ZK7A 2J33A 1DWOA 4U8GA 1ACJA 3JYOA 3WBKA 5AW7A 2RBKA 1YK1A 2JAQA 1KOGA 4GF5A 3ACDA 4FDTA 3ZIUA 1WPRA 2A1UA 2HNBA 4AN0A 1Y6JA 3MCAA 3HJBA 3ND9A 4V2IA 4KXLA 1XTQA 2VJKA 3DDZX 3LY7A 2KBEA 1VL2A 2CKDA 2C4HA 3RTEA 4BQRA 1QRSA 3KR1A 4Q7QA 1IUNA 4II2A 2XKJE 2XMQA 2B8EA 2YNMD 3RS2A 3TLCA 3CKMA 4PLTA 1EJBA 4J0EA 4Y3UA 1J8VA 4MUXA 4WQMA 3P0RA 4GR5A 4MS4A 3RBXA 4QM7A 1KA9H 4F8EA 1Q2XA 2W2QA 5B7NA 5C3UA 5TVKA 4YQZA 1BS1A 1DBWA 4HDNA 4X84A 1B93A 1BVRA 4GWLA 3QOXA 3X1KA 3AKDA 1WKCA 1YQWA 4CUKA 1O0SA 2HN9A 3Q7PA 4M1QA 2P69A 5G0VA 1G8FA 4MWGA 6REQA 1W8IA 1G3RA 3NHKA 4NAVA 3SC3A 3BH7A 4AQDA 1D0SA 5ENVA 4COKA 2QM7A 2WSSA 3CO0S 4QYIB 2GLTA 2WWXA 3D3KA 1L5HA 4CGYA 5J4HA 1S2NA 1RI3A 1Z6AA 3SR0A 2YXLA 1CUAA 3BFXA 1KDOA 2HWXA 4S1WA 3EQ8A 1JLRA 2C5HA 3LP8A 1KY5A 1E6MA 2NYAA 4PRZA 5MHTA 1BC5A 3AKYA 1E9FA 4OHXA 2PAAA 2TMDA 4C7JA 3U4QB 3VVMA 3DTVB 4ARCA 1VKRA 2QYOA 3AIOA 3RS4A 3AIKA 4R9SA 1TQ6A 3ZLTA 1INLA 3O2QB 1DC6A 3CVXA 1BE0A 2XGJA 3W04A 1FP2A 4KO2S 2I9PA 4FHFA 3MS2A 5AVZA 4GMKA 4HOYA 3RV4A 3L8ZA 4QOSA 4OX9Y 1NR7A 5LYYA 3FKSA 2WG2A 5CNIA 5IDXA 4UU7A 4WVFA 2WE8A 1JFVA 1L6IA 3EXIB 2W2LA 4P3YA 2QZZA 3AHDA 4UVGA 3RRNA 2PUDA 4MP6A 4PZEA 4BATA 2IOYA 5B2FA 3I9NA 1SG0A 3V00A 3V1UA 1GR1A 1SY7A 2P2NA 3Q41A 3TRHA 4NTZA 1WBJB 4FDVA 2WICA 2XT9A 5DNAA 4JZYA 3U7JA 5GP1A 3C16C 2F3PA 2G9UA 2ENWA 5L95A 4K26A 2I33A 2CYBA 4E4RA 2YY5A 2XNSA 1Q19A 2ZDQA 4KLAA 4Y2UA 2XTJA 1B2LA 1L5VA 2FEWB 2B61A 2YFQA 3FCCA 3H6GA 4HGPA 3T38A 3W7VA 4AY3A 3I8OA 4F4FA 5JROA 3D0QA 2OQIA 5IAOA 4H1HA 3CLVA 1B2RA 2JHAA 1DTWA 1U6IA 2PZLA 2Z1DA 2BRUC 3CB4A 3GX1A 5CYFA 3VYUB 4E03A 2VWQA 1J6UA 2D8MA 3B2QA 3KS9A 4UJ5A 3GH3A 2P5SA 4F4DA 3F90A 3MBOA 1PZXA 4GC9A 5JMOA 1ULZA 1Y6RA 1PT9A 2E85A 1BIFA 2I87A 2V58A 2EEPA 1QHNA 2WDPA 3PXBA 5G4KA 4BB0A 1L6RA 1YJAA 3DONA 4G5XA 2OHIA 3X1JA 4DV0B 4RK1A 3I30X 3QOFA 3GZNB 4HDMB 4LC9A 3UICA 1YMVA 4NYJR 1VMIA 3W34A 3U7GA 1XU4A 4YP6A 5AVQA 2ZYUX 2UXCB 3WWEA 2ZSFA 5HIMA 2EKZA 2O1SA 3K0SA 3PFCA 4CWAA 3CX6A 3GRKA 5AOAA 1L4BA 4GECA 1M6VA 2DU8A 1A0OA 4B43A 4JQYA 4ZAVA 1FDWA 2O1WA 4HCJA 1GP2A 3U4IA 2AFIA 3K9QO 2ZSIA 3FFTA 1TM3E 3OCZA 3HSKA 2H1IA 2ZYDA 4FQ5A 1PGQA 4Q18A 3IP7A 4RZXA 5TF4A 4X92A 4YT4A 3T1HB 2HIHA 1GPLA 3QQPA 4U6NA 4EF5A 1LRJA 2FKAA 1CC1S 1Q7CA 1ZUWA 2B21A 1XQVA 2PKYX 4MS1A 2YV5A 5DULA 3TEFA 3U9LA 1CIPA 2Q6LA 5DYYA 2BMVA 2GM5A 2Z5LA 4R8SA 4RQTA 3LL7A 1W75A 1P17A 2EBWA 2VNSA 1WD7A 3CZRA 3JV7A 5JDIC 3U48A 1NVUQ 1OZFA 1ZITA 1NY5A 4CLOB 4DYHA 5A5EA 1XJWA 1SXPA 2I6QA 1E18A 2XQKA 4FWBA 1I9GA 4K9LA 4R68A 5IWCA 2OHFA 5D5HA 1H23A 4J6EA 4GHWA 4D41A 1NVGA 1OA1A 1J1ZA 3AB7A 3NT2A 5HF6A 1JAZA 4MUGA 4WWHA 2Y4NA 2YCLA 2XUGA 1CUFA 4XRRA 4WN3A 5JO9A 4AW9A 1TDJA 1UAGA 1ORVA 3DDSA 4UDNA 1XQ6A 1AA6A 3HE3A 1JR3A 1SVLA 3BWVA 3RUFA 1Q74A 2B25A 4MO9A 1SR8A 1CZUA 3JQAD 4GXQA 1NKVA 4DM3A 2VJCA 4ZK6A 1KI9A 3GPDG 2P27A 1AB5A 2H16A 4D3YA 1NOIA 1S3GA 1S7GA 1WOMA 2JANA 3HKDB 3KYDA 4HI0E 1P0FA 4PO1A 4DBZA 5HOEA 5IYZA 4Y9DA 1C8LA 4AO7A 3R5TA 4N03A 2YICA 1IN5A 3H2JA 2O3SA 5U4XA 4BU1A 3OHSX 5IKPA 3FRHA 3O84A 2YJ4A 3GI1A 2DWQA 4K6KA 1KBOA 1ZK2A 1TYAE 5LP6A 3IRVA 3QVKA 2HA0A 5AJYA 4IDHA 4B09A 4CQMD 2WIDA 2YW9A 1WUTA 3WL5A 1IEXA 1R0WA 1V43A 3R74A 2L2QA 3X1WA 3E4DA 5I47A 4NZPA 1W85A 2PWAA 1UR5A 1UJ4A 2DCUA 3NHWA 3EAGA 3KLMX 1E9EA 2WJ3A 1C30A 2GSDA 3ENVA 2IHJA 3NTRA 3OF2A 4YCDA 4AMUA 3QI7A 4JIMA 2IXGA 4P1ZA 2C29D 5DT9A 3T5PA 1Q7RA 3D2CA 2EZ8A 1DADA 5BWNA 1XQWA 2COKA 2NVUA 3W3AD 2VHJA 4PONA 1OUMA 2VI5A 1BEEA 4HWSA 2DHEA 3UAGA 1KMHB 1M2GA 1V26A 3CVOA 3HCPA 3ZUPA 4Y18A 1X8XA 1PJLA 2KM1A 3DLHA 1X38A 2FPXA 3F5FA 3GIWA 3H19A 2ZCVA 1HXHA 1LPSA 2RONA 3DFFA 4MKRA 3P9CA 5E6RA 4B6SA 1J5EB 4MWEA 2IYXA 1XJQA 2PX8A 1PQYA 2WA2A 1P61B 2YFHA 3B12A 3B7WA 1XRJA 3MIZA 3NKLA 4UHDA 4BOYA 5IBCA 2ZCJA 4D8WA 1P1BA 3B48A 3U62A 2JHCA 1CRPA 3HP1A 4G1UC 3QVOA 1RP7A 2H3EA 4RJIA 3DZIA 4LHXA 2Z8YA 1DV1A 2QRZA 4R6XA 1WMBA 1OKKA 1W5FA 2R79A 4KDFA 3TIXB 4NZ9A 3QYAA 4RA9B 3ZHSA 1SD1A 2PUFA 3OQBA 3PPIA 5EJ4A 1IULA 3FROA 2H2AA 1RYFA 3BICA 2NW6A 1F60A 5HZMA 2VCHA 1ZRSA 2H6EA 2GBLA 3BSFA 4PZYA 4QJ4A 2OCBA 3NVMB 3EUAA 4H7KA 4MP8A 2V5AA 4B3HA 5FA8A 3STYA 2GZHA 4FNOA 1ESDA 4KODA 2YZGA 4TMXA 3HXTA 2E5WA 2BFOA 4LBZA 1NGSA 4GD3Q 1WETA 2C31A 1IN6A 4E2FA 4ESHA 3D1LA 2NO9A 4FJ2A 4O4LF 3NAMA 3W5AA 2QX8A 3LG2A 3CONA 4DA0A 5CD1A 5KHLB 4KN6A 4FUTA 5JECA 3ZJTA 2IYWA 3LF1A 3SNKA 4BLRA 4Z2AA 5CHEA 2WD7A 3PC4A 4DPMA 4K8RB 3UMBA 3EDRA 3IAFA 3IX7A 3KT0A 1R9JA 1DB3A 3OBIA 5BQ3A 1L5OA 5IDVA 5ELXA 5BN1A 2PH1A 5HIIA 3WWCA 5H8WA 3F46A 5FLXA 1UC9A 5HMLA 3ZU6A 3AETB 5KC8A 4CM8A 2JGMA 2PKEA 2VPZA 3BH6A 3K2QA 2GCIA 2BCJQ 1G2IA 4HMPA 3M1LA 1J2RA 1X7GA 3L0SA 1W36D 3BXOA 3RC2A 2LNDA 1QS0B 3CW8X 2XDQB 2XHEA 3WVNA 4RA6B 4BKQA 4C6TA 4LY3A 1KI6B 3ZNOA 3A58B 4NCXA 5AKKA 1SN7A 5EERA 3U7QA 1NTRA 3B5IA 3N6XA 1U9ZA 3GJTA 1PJTA 5DNWA 4FR2A 3KCNA 1AD2A 2YV3A 2Z09A 3GCGA 2C2YA 2QI9F 3IDSA 1J0DA 2YWRA 3HDQA 1JEAA 1U31A 1TU0A 2F00A 2FR8C 1FNCA 3GA5A 2CSUA 5THXA 1VMDA 1GLNA 3OM8A 3KEFA 4CKCA 3LY5A 3E0QA 4WXYB 2WTBA 3HEMA 1GITA 3WK4A 1T3GA 3BOSA 4IDBA 1DRVA 1ZM7A 3QEMA 4NFLA 5JZVA 2AD1A 3QJYA 3QPBA 1QVVA 4HFRA 3CGGA 1XLUA 3DLAA 3QW4B 1E3LA 2HJ9A 3EHEA 4BKOA 4F84A 1GOTA 1JAIA 1HF3A 1RKQA 2EGUA 2PXXA 2ZTUA 2YTZA 1ORTA 3CRRA 2PO7A 5AXBA 5I9NA 1RSZA 3GXBA 4X54A 2XWPA 2IZ1A 5K01A 3B1FA 5FTKA 4AS3A 1FQOA 3JTMA 1Y4ZA 3GVCA 3SXPA 1JTVA 3H8JA 1DLIA 2H3HA 1JKFA 2JEZA 4JMPA 1X9GA 1IZ9A 1ZYUA 3JD1A 1EWTA 2ZIWB 1HT0A 1N6OA 4RCVA 2UZ3A 4PQYA 1CV2A 2Z0MA 2ZE6A 3AHFA 3WGVA 4LEIA 1IPHA 1YS1X 1KKMA 2ERXA 3ETLA 1NV8A 3I9JA 4EYEA 2JLCA 1YJXA 3OZFA 2I2XB 4QGBA 2EG5A 2GWHA 3IMKA 3K4PA 2AC7A 3ESDA 4DIKA 5JUWA 5L7TA 1WZCA 1XD8A 2OCLA 4H16A 2E9SA 3V2UA 5D3KA 4L4YA 2CZCA 4MIKA 1LBHA 1TYDE 2IHUA 3M6LA 3JS5A 3HA7A 1D9ZA 3KSZO 3MTQA 4D4LA 4CUZA 1YRLA 2QY9A 4KP7A 3PXGA 1ODKA 4CM7A 3PQEA 1X1TA 1H5QA 1Y1LA 2CCJA 1Y5RA 2FETA 1YULA 2W93A 1HGXA 1Q84A 2CXQA 4WA7A 5DPMA 3DZ8A 1E66A 1RM5A 3H9EO 4YT2A 5BQFA 2QN1A 3L0YA 3PICA 4GEKA 1IHYA 1N36B 3WGNA 3EG9B 3VR1A 2C9OA 4UEJA 1L7XA 2IITA 4A6EA 4BNGA 5CFRA 1QUEA 2PT5A 3FOAA 4Q3NA 4BNJA 2ZUSA 4QASA 4PHCA 2V54A 3QPUA 4YDHB 3FDZB 1ESNA 1KYYA 4A2PA 4A82A 2VTKA 2BBWA 2B9VA 2YJZA 3G8CA 4RNDB 1SD2A 3IAM6 3I1JA 2ZYTX 4OK6A 4AJNA 2AEEA 2X8JA 5HZGA 1FYEA 1P4GA 1BXGB 1D4AA 1SQ5A 4YHBA 2SKCA 1UBRS 3PUZA 4LZZA 4U4AA 1O58A 2J3QA 1HQKA 3T4XA 2RK3A 2JZNA 2PUJA 4QOHA 3MZ0A 4AZ3A 4HF7A 1Z33A 3UHFA 3AL0C 1YQEA 2DUUA 3VO9A 4FK8A 4NONA 3EGOA 4BLTA 1FSFA 1DFGA 1CUXA 2VUHB 4LNUA 1I7NA 1N0IA 3F67A 2XTNA 1BU5A 4WZAA 4P0PB 2XYVA 3FNIA 3PNPA 4G01B 3URMA 5B64A 3BXGA 3BE6A 2JLXA 2WWGA 4ZI7A 4DJJA 4CV1A 2WWRA 3T3EA 3R0ZA 5KTNA 3BK1A 4FN4A 2J5RA 5KMGA 1CBUA 1UC5B 1SURA 1D2AA 3GRZA 3SBEA 3WV5A 4JK3A 2W6IA 3T1TA 3KZXA 5IABA 1MMFB 3UXEA 1QTNA 2OMKA 4CIXA 4DA8A 2WM8A 1Y6FA 3QPWA 1NFFA 3A9VA 3L77A 1VIAA 1TUBB 3BQNB 4ZT6A 1PR4A 2CHGA 1CK4A 2ZANA 3LGXA 3GUZA 3LZCA 4ME6A 3R41A 4MARA 4CEHB 2PGNA 2OGZA 3JWPA 2D00A 3KJEA 4DLXA 5DYTA 2VQSA 1U5BA 4PXYA 5H70A 5LQRA 2BELA 2ZUTA 3AVWA 2EWWA 3T15A 1X7ZA 2VJPA 1KEUA 4X65B 2J41A 1LY1A 1VMKA 1Z06A 3EA0A 3A27A 2C5AA 4HATA 4LTMA 5CX4A 1LFAA 3I1YA 4MVJM 4D02A 1I2DA 3UGKA 2YJGA 1XK6A 1KTIA 3KYIB 1LW6E 2LDXA 3ONDA 2AOWA 2E7ZA 3HO8A 421PA 3RSSA 1PE0A 3SXUB 4MXDA 3TAHA 1YTUA 2CMGA 3D7RA 5J2TA 4D74A 5JYEA 5ALTA 4PPGA 1JR2A 2A5FA 3LT5A 3T3PB 4OLJA 3R76A 3WGHA 2D5AA 4DJFC 1IXSB 5KNLA 2DETA 1I7QB 4FW9A 4J0QA 1FFGA 3PWSA 2QSZA 2WJIA 2W8BB 1OMOA 3MPOA 3TG2A 1X8KA 3JRXA 4BNDA 2IGTA 2FEKA 5LL6P 3PEWA 3IKTA 3QRWA 2O8NA 1BMFD 1H9AA 3LWNA 4LN1A 2NU8B 3ZXXA 3QLTA 3E9NA 3FBGA 1OIVA 4IKEA 3DOJA 4UNRA 1GFIA 1U0HC 3L41A 3L7JA 4F91B 1PJ8A 5CFNA 5IKMA 5AKGA 2YOGA 1NBHA 1KZYC 2QYSA 1V3TA 1QFJA 3IVMA 1XRQA 1A3CA 3DO5A 1T4MA 3LCRA 4TLMB 4A5SA 4WKGA 2YYAA 1ND5A 1TEXA 4LQCA 2XMDA 1QB7A 1SXHA 1P2DA 2I5PO 2VAXA 2ZIAA 1JHRA 2CSXA 1HE4A 3QU7A 2HGZA 3WXBA 4RMJA 4HGNA 4RFSA 3TQRA 2I66A 4IWXA 3IBGA 5E0KB 5KNDA 2YVUA 1QPGA 4K1LA 3WZMA 2GX6A 2E18A 2OESA 2LUOA 1BEZA 1MB0A 1J5PA 3DKKA 4LW8A 1X87A 4AFNA 1TLFA 1QC5A 4LXIA 2PGOA 3I5UA 4JLJA 1QHSA 3I92A 2ZSBA 1K7YA 1V0JA 4NOKA 4DCOA 3S2EA 5GQSA 5FH9A 1HYHA 2WQZA 5LOVA 1B4DA 1CNFA 4N18A 1L4MA 4ONEA 4ZO6A 4O4HA 3UG7A 5LXTA 2OAP1 2CFSA 2ZWMA 1HZZC 1MRNA 5F7XA 2H06A 1CZOA 3JQ7B 4MUBA 4BMPB 3MMNA 3TZEA 3KU1A 3DZBA 4C0SA 3ZVMA 1L8LA 1RWKA 4LZPA 5EJ9A 3SOPA 3L4BA 1V5EA 1YCFA 3EVCA 4YJDA 3G7NA 5JC8A 1VMEA 2NUPB 1A82A 1A2OA 1E7WA 1VJRA 2A5GA 3A7EA 4IOJA 4TTTS 4AF8A 4Z6KA 2B4RO 3IVGA 3FA2A 5FPHA 2JHFA 5JZSA 1WB5A 2PCLA 2AJ8A 1Z8NA 1FLDA 2XUZA 1AT1A 3B70A 3LPAA 4UCWA 5FOSA 1UIRA 1XAJA 3TX6A 4GR9A 3MJEA 3CGWA 1ZO8A 1E7QA 4B80A 3SHTA 1F9EA 2ZBDA 3O91A 5BSUA 1NP7A 1RDFA 1NF3A 3EXEA 3VTAA 3ICQB 3CNNA 3RVMA 2GJ8A 4F5YA 1HNZB 4B3SB 1JXAA 3JQ8B 5F3DA 3ADDA 4LJ6A 1TT5B 4HAYA 3OD5A 1EJ2A 2V1XA 1US8A 3QPCA 5CFPA 1UDBA 1G3MA 2VPWA 1UEIA 2QHXA 5EI5A 2HA7A 2MTBA 3BRCA 3GF4A 4YRQA 2GJAA 3VPBA 4AUEA 4S3MA 1XUOA 3DCIA 5I9IA 3ANTA 4X6YA 4EY4A 3NS7A 1QG6A 5TPWB 2IZ7A 1NRWA 5JS7A 2XB8A 1HOXA 3R09A 2E49A 2FVXA 2J45A 2LVBA 4MEAA 4ZD6A 1X1BA 4IRMA 2BPOA 3NUGA 4GT1A 1UJ2A 2D0OB 3O21A 2WKPA 4Q9NA 1IDOA 3GEPA 4WUVA 2IUSA 2HAEA 4D0GA 2H7XA 2YMLA 3O3OB 4PC2A 5ADVA 2RHGB 3OQNA 4UXHA 2D06A 4NPHA 4YCMA 3W7BA 5BR7A 1DSSG 1UMCA 4ARZA 1T1GA 4Q4JA 1YGYA 1BX0A 1Q22A 1QH1A 1M2VB 4ARSA 4ZEVA 3LLVA 5KYXB 3I6ZA 1XO1A 1VHQA 1A9YA 3C3XA 4DUZB 4AKTA 2F8MA 3QFRA 3ASYA 2AW5A 1RFGE 2XJ9A 3AEUB 5CB4B 2VH2A 4J2TA 4KO3S 1S9HA 1YBMA 4HX2A 2FPRA 4MW0A 4LSGA 4LOAA 1ZINA 3L0PA 3QXSA 4ERXA 1SXIA 4L8VA 1GSAA 4RVGA 3FDIA 4MVWA 5CH5A 1AKEA 2WEKA 4F4IA 3NIBA 1AA9A 1VKZA 3GL9A 1HLPA 3ORFA 4BRUA 3M1IA 2JG3A 1VLVA 2VZEA 5JCJA 3BILA 4QUJA 1DAMA 3GA7A 1E2QA 3ZDRA 1HYQA 1KMNA 1Y63A 2H1CA 2ZUUA 3C5CA 2EHDA 4RO0A 4XYBA 4A2WA 5BORA 1IDN1 5F73A 2QUAA 2G0TA 3QXCA 2VDQB 4A3SA 4A15A 2PSSA 1TL7C 4ES6A 2Z1MA 3GN2A 1PJRA 3BMQA 1T0JB 4NCBA 5T8KC 4L08A 2PUGA 5E38A 1Z29A 2DFDA 2EFGA 4CL2A 3FFAA 4OAPA 2QAGA 4PZUA 4I2VA 1RYYA 2D2XA 2X5KO 1NVTA 5EA2A 5AQ1A 3FF1A 4CQJA 3OESA 2F48A 3TD6A 3CR7A 3OIGA 5BR4A 4PTZA 3GC6A 4H9GA 1POWA 4K2HA 4LRUA 4Q16A 1A5ZA 3FF4A 2R8BA 2P9GA 5G41A 4M2LA 1L3IA 3BYZA 1OBVA 3IVCA 3G2PA 1XMPA 5EWMA 3USZA 1OCEA 4RC9A 1SEVA 4YP5A 1DDIA 4G5QA 1D2RA 1JB1A 2RHOA 4JHXA 1WW2A 2ZWAA 4G0NA 1DCMA 1WQ1R 1JNYA 2EP5A 3GCDA 3GGOA 2BCEA 1Y37A 4WLEA 4YVFA 3VR5A 4M8NE 2IJGX 3VYTB 1SA0A 3QX8A 3TLMA 4EA6A 3KFVA 4I50B 2MSEB 5AW5A 3NCTA 1G6OA 1W2HA 2RAVA 3FBWA 4FTWA 2B37A 3KEOA 1JIIA 3DH0A 1E3EA 2R11A 2CN1A 3F47A 4YX9A 3ROQA 2HK6A 1ODTC 3CF4G 1RWXA 4YPFA 3KYJB 3B51X 4BASA 4DDVA 1XTTA 3TKYA 1K6XA 1Y8AA 2E4UA 2GAAA 1SC9A 2PBRA 1FXWF 4DRYA 5A2QA 4FI3C 1K3FA 4P7FA 1H66A 4WE3A 5FYQA 5HK8A 5EQTA 2E5FA 5DCLA 2CXHA 2GEBA 3IOYA 2K2QB 4G5FA 5BSFA 3UMYA 5KSYA 3AERB 2UUAB 3N2KB 4OKIA 4L50A 1SUBA 3AEKA 5CDUA 2UAGA 2Y1CA 1OREA 4K6CA 2QRPA 1G21A 3H0CA 3DQQA 2XMZA 3ISVA 3PJGA 5K8UA 3FWPA 1KP3A 3L8YA 5GJWC 4RX1A 3RFTA 2ZQZA 6LDHA 1GTJ1 2QR5A 4FT2A 4M9RA 4NHOA 4QYMA 5LQSA 3PFWO 3WL7A 4ZHQA 3GT7A 1XWWA 2P75A 1CRQA 2VDWA 1VIMA 3G2LA 3DD1A 4KX5A 3VBCA 2BAGA 1JDZA 1PR1A 3SXJA 5KQPA 1EA7A 4N12A 1YRQA 4CN9A 4P4GA 2DWOA 3F0TA 1N7HA 1RJGA 2FH5B 3VU3A 1WZNA 1O95A 3I0ZA 2VO1A 1E89A 1IXRC 1LK5A 1LJ8A 2F7SA 2ZYSA 4HLUA 1WAMA 1SK8A 4ANFA 1MOPA 3PNMA 3EZ7A 3HYTA 4YRMA 3L7BA 4FYJA 5ITZA 2QXUA 4B5LA 4D4JA 5F9HA 4FE7A 2FK7A 2VHYA 4FGWA 4EI7A 1UKEA 1Y8QB 3WYEA 1OXSC 2ZIEA 2EF0A 2RD2A 1GPYA 1LB1B 2VATA 5IJWA 4FM9A 2WBLC 5IAGA 1RQPA 2BHLA 4PN7A 5JATA 1ZA1A 3TTXA 3UMGA 2P4UA 3I6BA 2CLDX 4UAVA 2FPIB 3NT5A 2QTCA 3ODGA 3ZK7A 3TQSA 2I67A 3FZNA 3QU4A 3TTTA 3ROGA 2B5OA 2VJMB 1UODA 1O96B 1YZUA 1HT3A 4ZJZA 3EB9A 1M34E 4Q3BA 2OECA 2J30A 5EIBC 4OI4A 2FFAA 4YFYA 4FR5A 4OXRA 5E95A 1PRYA 3BHMA 2PFSA 4UKDA 3RBVA 3U31A 4UPVA 1I80A 5BVHB 1N92A 4GE0A 4R0VA 1CF9A 4C1NA 4YIKA 4Q03A 2VAVA 5KOYA 3FGOA 3VNAA 1KHHA 1EI9A 1SOUA 2OXFA 1MX3A 1QYWA 1RLMA 2I3BA 3DQZA 4AJIA 2ATEA 3THRA 3FMOB 1S7CA 4BTEA 1AK9A 1F20A 3D8NA 3V3KA 4F2GA 1ZK0A 4WXEA 1M8KA 1DKRA 3GDFA 5IAJA 4PXSA 2OLJA 2PH7A 4ZJUA 4AY2A 4H1TA 1NQ5A 1XPJA 5LFAA 3FPHA 3CLUC 1T9CA 3HU2A 2ZRHA 3NWEA 2FWNA 4KCGA 4NEQA 1OZ0A 2M32A 5KUTA 3GNSA 1OI2A 1L4NA 1U0EA 2A1UB 5D87A 4IZHA 1DXQA 2ZVJA 1SIUA 2ZB8A 3TIVA 3B7PA 1AKRA 4IJUA 4PIPA 3OP4A 2ZI5A 3EDOA 1XEWX 1QRTA 1PEAA 1DBQA 4KOAA 4LBWA 3UUEA 1KEWA 1VKOA 3AJAA 3EFHA 4LJ5A 5L8VA 3IQHX 3A9WA 4I1OA 1XCGB 4L1KA 3MFYA 4JY7A 1D2HA 5BSKA 4MS4B 3EZLA 5BO5A 3L4EA 2WB2A 1PAUA 3VKWA 4HGZA 4FDLA 4HDNB 2RH9B 4QEDA 4KRXA 3T7KA 2X7XA 4B4VA 4BQOA 4DDKA 5C1IA 2ISCA 5IXSA 5DE3A 3UXYA 6REQB 3I73A 3PSHA 3DXZA 4QQFA 4CDRA 4GQAA 2OV4A 2ZIVB 3MERA 1O6GA 3ZKAA 3W5SA 1L5HB 4FN5A 2YWHA 5HM6A 3ZJVA 5KYUA 2DQ4A 1PBTA 3MUFA 3WA7A 2OD7A 3O9ZA 1ORHA 3C1TA 4RKRA 2YMPA 5CNKA 4KU4A 5HKKA 1TAQA 5F7OA 2R8RA 4LOJA 2CV0A 2BZSA 3VZCA 4MUYA 4P53A 3QITA 3QPVA 1IY2A 3RUAA 5AKJA 1OZAA 5JE8A 3QUAA 1ZCAA 4D9FA 2PJZA 2LV8A 4P32A 3AV3A 4NG4A 3T3NA 1CYEA 1NW4A 1YQUA 3HY4A 1Y9AA 3IEXA 4AXXA 2C1XA 1Y7PA 3P2KA 1TCVA 1JJ7A 1Z18A 3OCYA 5DMHA 2CEKA 1SB8A 1BHQ1 2B8WA 1GPWB 2OORA 2PGJA 5AI5A 4EPTA 2HPVA 3UTDA 2VF2A 4WEQA 5AWFC 4EG0A 1LXCA 2Z57A 1P33A 3KR9A 4O1HA 4EMSA 1AF7A 3WJ7A 2IEDA 2C4UA 2WSIA 4J3FA 1PGJA 4WKCA 2RC5A 1Q11A 1WB6A 2ZROA 1GUAA 5KBYA 1O77A 2C0CA 1VKHA 2ZYWX 4PBRA 1KHTA 3HBMA 3WQQA 4GI3A 5TS2A 1U0BB 4GKVA 1LDNA 1N2CA 3A1VA 4NI5A 4OA8A 2HEIA 1XKQA 3LCJA 4LY9A 4JL6A 4B6GA 5KTPA 3OZWA 3D8TA 5AW3A 3R5FA 1ISGA 1V1JA 2G5PA 4KITB 5JEDA 1MHTA 1E6UA 3AIIA 5LQDA 3OQOA 3EYAA 1U9IA 3BMOA 4ER6A 2Q5FA 1DIOB 5EZ5A 1M1ZA 2WP8J 1GTG1 3DFZA 1M5TA 1F48A 1VL0A 1A5TA 1TM2A 1COWA 1S2GA 3R5SA 1U0NA 1ZJYA 4FHGA 1DTWB 4KO4S 3ZPXA 9GPBA 3IILA 5LMCA 3IO3A 4NATA 3OZCA 2X6QA 5EE3A 2W9XA 4DLBA 3TTSA 2WYWA 4B7XA 4OI0A 5DBEX 2NTJA 4CLHA 3H1BA 3FMGA 3HWWA 2C7QA 3CA8A 3RTAA 5G4KB 3PTAA 3U3DA 3HHPA 1QO9A 2WJ6A 4MRMA 1CWUA 2HHAA 2NV0A 4N8EA 1B42A 4IFEA 1HTWA 5BWCA 4BFCA 3WQHA 4X90A 1T5DX 5G1NA 3F3KA 4EECA 1LVGA 3HI6A 4MA4A 4L5CA 1CY8A 2B1IA 3VMMA 1HLGA 5TLSA 3L18A 4LDZA 5LC1A 4PLVA 4JI5B 1J99A 4MW2A 5EXXA 1M6VB 4J90A 3DCYA 1FMTA 2NXJA 1Y5NA 2I71A 5AK5A 4FZ5A 4OQNA 5EPUA 2CDCA 2MHCA 2C8JA 4JZKA 2AFIB 1KOJA 2OILA 1M1XB 3NHPA 2HMWA 4PE5B 1V6CA 1ARZA 5EKUA 3TTUA 5B4UA 3PCRB 5JS1A 1BQ3A 1CFZA 1CP2A 4KZKA 4MS1B 3NDRA 4QUGA 5HPYB 3U4MA 1II9A 3H5NA 3K9LA 4IV8A 5EG5A 1T2AA 1P45A 1P2FA 1TZMA 1RQNA 3IBFA 3LQRA 1ZICA 3MJHA 1XP5A 4XCQA 2ICAA 4REOA 1H0SA 2HMVA 3U4DA 5K0EA 2VPIA 3AK4A 3LQQA 1CUWA 2Y67A 4TT3D 3WAJA 3OIVA 4HAIA 4EOGA 1Z5WA 3PXXA 3ZV5A 3ZWWA 3WNVA 4F60A 1KJNA 3ZDZB 3ET4A 1BCRA 5IAAA 1X94A 4XXHA 4J29A 3L04A 2QZSA 3AVPA 5EKXA 5JDCA 1CS4C 4JQOA 2EHJA 1CZLA 1OT5A 1U1IA 2QN6A 2ZJ6A 1UDAA 4HXFB 2CDNA 4ALKA 5I7RA 5I8WA 1KL7A 1WPXA 2Q3HA 4G1EB 4M99A 1QAQA 3KYDB 4Z9AA 2KMLA 4AMGA 2R8XA 3SHQA 5IYZB 2ACWA 1TF7A 2QVXX 4NFSA 4JGGA 2BI8A 4G1MB 1SU8A 3ZLJA 5C0OE 3K1ZA 2Q9UA 2JH8A 4RABA 5TY0A 2PBFA 4D7AA 2A9PA 4KR2A 4E88A 1E1MA 3OIUA 5EAIA 4ZV4A 4N3AA 1EX6A 2O23A 1EK6A 2JGLA 4R4JA 5HEKA 4CM4A 1NFRA 1PWHA 1R3UA 1T5SA 3U13A 2PUVA 1W85B 2M98A 3M49A 3MWJA 5LQCA 5KYGA 4NZNA 4YRGA 1NRXA 4R31A 1C30B 4OB6A 3U40A 4LX8A 5TQ0A 4HBGA 3JRWA 4OM8A 4Q1FA 1H8HA 2VFAA 4IZOA 5EJ5A 1P4SA 3E9YA 4U7GA 1E6WA 1SHLA 1VCOA 2MOKA 2EL7A 4L9WA 3CH6A 2QSJA 3V8VA 1ZL2A 5MGBA 3E3MA 2HWWA 3O4IA 2NVUB 3M82A 4BIIA 2PS9A 2Q41A 1JDPA 2RGDA 2Y77A 4Q93A 2PSHA 3C2QA 3Q2KA 4QBGB 4UHJA 3OP1A 1FBNA 3JATA 3N8KA 3VX3A 3ZZNA 1TCBA 3RU2A 3RARA 1PHRA 1XFAA 4BTLA 4MHSA 3WYNA 5KINB 2XDWA 2ZG6A 3LECA 2W83A 1YI0A 1FW6A 5E6RB 4DR3B 4YC7A 4JUFA 1X0VA 2AD5A 2GBLC 5MFPA 1KWKA 2R8OA 1NNUA 3FHLA 4ND6A 2Q1XA 3SYLA 3W6UA 1U8AA 1Z82A 1GG2A 4YO8A 4EL5A 3B6KA 1E9CA 3OQ1A 1PJQA 1UZNA 1ZLXA 2OXRA 4RY0A 4KQCA 2H9AA 4JWKA 2B6NA 3TPCA 3HDYA 4R1MA 4M7PA 1VFNA 1CJKC 3L4KA 2RGEA 2GK3A 4FFVA 3G02A 3IEIA 4I14A 1C3XA 2HFJA 5ALXA 2FLWA 5BN5A 3AF6A 3JAWA 2HQSA 5FKJA 3B78A 5HCUA 2HLPA 1ZRMA 1G2QA 2N46A 1P2VA 2VLIA 4I1VA 3TIIA 4UU0A 4O29A 4YMIA 4AKEA 4RZ2A 3T5TA 5I7WA 1T1EA 1ECBA 4IMJB 1A9XA 1AUVA 1S0UA 2JARA 2VAWA 1T6NA 3ELYA 4FEEA 2OT3B 2YJ3A 4MCJA 2HWKA 1T8WA 4V0NA 2AMYA 4X91A 3DM9B 1A7AA 1E1QD 2IYZA 3O4FA 4GZ3A 2CNBA 3IJRA 3JZIA 5A4KA 1SVNA 1HRDA 1SC4A 2XYHA 5CITA 2RGNA 3A0UA 3OEWA 1IY8A 4OOEA 3PDCA 3FNRA 4Y2PA 1XF9A 1C7EA 2GN1A 5LWHA 1ZXXA 1E5LA 2EDAA 4HJRA 2OPHA 2WD7B 5DIZA 1EJ6A 2K6GA 3SQDA 3OOHA 1PFQA 1PJCA 1CB7A 2NSLA 4DUYB 4EO7A 4MW1A 2GHRA 2A6PA 4P4UA 2DBYA 1GFWA 4Y9SA 1PK8A 1IJKA 4LNAA 3S2UA 5BVGB 1ZRNA 1XBTA 3WYCA 1JG6A 4UMDA 3K2BA 1E99A 1U98A 1RYNA 2X22A 3D02A 4XFKA 4CM8B 5AFSA 3PDIA 2AR7A 1B1CA 4ZU1X 2KLBA 4RIIA 3D54D 3G2JA 2IEBA 2J9RA 4GOLD 5EQFA 3LYAA 4TS9A 1IG0A 5GAJA 5CX1A 4C6TB 1VI6A 2A86A 1F5NA 3BXXA 4M0PA 2ZJ5A 4G0OA 5ANRB 3S2YA 2X2FA 4BDTA 3QX7A 4X24A 1P6QA 4Y6SA 1DG9A 3U7QB 4NSNA 2L19A 1O9GA 4FWTA 1ZJZA 4EIWA 1USKA 1ND6A 4IZIA 1Q57A 1ZD4A 2FVYA 2I76A 2VZ9A 3QX9A 4L57A 1TVCA 1M34A 2HREA 3WIDA 1VE5A 4JR0A 4DRXA 1GRCA 5FPKA 1PTKA 4OFZA 4CKCB 4EBFA 4PCAA 2NPOA 2ZJYA 4RPJA 2J3MA 3QEMB 4OVKA 2C3PA 3CX4A 1PDOA 4IVNA 4P36A 3VSEA 4CLXA 2X7HA 2RFLA 2VXYA 4MVJF 4RIHA 2D0DA 4MV4A 1O0CA 1M0WA 3DOEA 1U04A 1NU6A 1UJNA 5ICGA 3EDQA 5K8JB 5DU2A 4MB6A 3GJ8A 3G2IA 4KPEC 3DBIA 1OC4A 4ZTUB 2HTEA 1PSWA 1BN7A 5IVPA 1KNQA 2P35A 2K7ZA 5KJCA 3CCFA 3DZGA 5EJ8A 4C2AA 2YIMA 5IK2A 1Z83A 1NC3A 4I55A 1HDRA 4YLYA 4ZGGA 1G8JA 1KDPA 2CL5A 5CURA 1SU7A 5K0TA 5IDYA 1YE8A 1Z07A 4OF4A 1DXYA 4ZAFA 4GH5A 2VYQA 5JJBA 2FZEA 3EPKA 4ARAA 5JNWA 3Q8LA 1FSPA 1Z4OA 3GG9A 1Z16A 4N6OA 1LI4A 2NMVA 1SM4A 5D5QA 3R3ZA 2EGHA 1I5RA 1VFPA 1YQDA 4Q05A 4YWHA 2AMFA 5BW6B 1DKQA 2B98A 3UCEA 4MW7A 5KVSA 2VYNA 1KSJA 1WUKS 2F43A 4UHHA 1PR5A 3VR2D 3DYBA 3NCHA 4EAQA 5KB3A 3RAEC 2POCA 4L74A 3IR6A 1Z47A 4W5RA 4H3SA 3RDPA 1C3VA 3EFOA 1T0BA 4DVJA 1SZPA 2EJUA 3G0DA 4Q15A 4UUQA 1SVWA 3I0MA 3UMJA 2J32A 2R5FA 5KTSA 3BTOA 3T54A 1KPGA 2XA2A 1W4AA 1FMJA 3PR1A 3THXA 2YBEA 3GMDA 3PQFA 1O6ZA 2FAXA 3HFSA 4WLFA 4JELA 4FCTA 1NVKA 1X1SA 5IC6A 3N6RA 3NOQA 1XMIA 2W0SA 3M5CA 2O2SA 4RF5A 2X8JB 2VF4X 1R0XA 1XZMA 5L7YA 1QQTA 2RARA 3V2IA 1MNAA 1NSYA 1UZLA 2V4MA 3B1JA 3Q85A 3S3TA 3WXMA 4AZ3B 5ARBA 4G0UA 1DKLA 1Z2PX 2LKDA 4BNFA 2XRMA 2GPBA 2NZ2A 4LNUB 1AQUA 2G6TA 4WZAB 3GW8A 2FN4A 4GKAA 2ZVPX 5FADA 1W96A 3S68A 2XMBA 4NBTA 3IJ5A 3N2IA 2QNRA 1CETA 2OCXA 3AXTA 2W2VA 4N5DA 2G7MC 4QO8A 4ZI7B 4KXVA 3DYVA 1YB5A 3NRJA 2YCBA 4O2BF 1JV2B 4WLVA 1NXXA 3BSYA 1F1JA 5KMGB 1UK6A 4GS5A 3BXEA 4U7PB 1V4BA 2XHZA 1P6XA 3TQHA 1XL0A 4DQKA 4D4KA 2JLUA 3C8DA 4I3GA 1E9DA 1UUFA 2Q3FA 2QTNA 4KMOA 1OXUA 2PLAA 2FNAA 4KN9S 2I4RA 4MS3A 1LBQA 1U2EA 4FCWA 2ZREA 3UB3A 5F3WB 3HXLA 3NBYC 3QLEA 3ZX4A 2QX6A 2YKGA 1LBSA 3KQKA 4JLPA 1U5BB 2A59A 5HFNA 3MCUA 4UOZA 5LUAA 4MV6A 1SUAA 1CUEA 2PUWA 2XB6A 3GFVA 4J94A 4M87A 2UZ4A 1X7ZB 3DMGA 3W8NA 1UKYA 1U9CA 4H7HA 1DAEA 3SS7X 1M1YE 4YJHA 4JBLA 1XA3A 4R6WA 5B12A 2IXDA 5FWXA 4IHQA 2F62A 4L07A 3C6KA 2IBTA 3UIEA 3ZLUA 5BN3A 4BMXA 5BRAA 5BQ5A 2H4HA 2XY4A 2AVNA 4FDAA 1SFRA 1JXMA 1Z88A 2G5GX 3DFIA 1URPA 3DHNA 4TXMA 4CF3A 4NBRA 3VNUA 4DE5A 2HK7A 2J4DA 4NK5A 2H2DA 3R5XA 4K6FA 4QUKA 1N5OX 1AXGA 1BEUB 4NH4A 4PHGA 1BHSA 4GKBA 2HPAA 1G8HA 4M37A 4BE9A 1CULC 4TL9A 3OTGA 2X5OA 1DO8A 4QPPA 3M2TA 2Y0EA 1IQPA 2OY0A 3AUJB 3QBEA 2OFPA 5A7GA 4BNDB 1Z6TA 4FXOA 2D2EA 1SZCA 3DTVD 3KYCA 3L0IB 4F7DA 1M9NA 2A2ZA 1ZIXA 2OBXA 4UAJA 5GZ6A 2P9CA 5FTJA 3OEYA 1XCLA 2W90A 2OHHA 2YQ4A 2YIVX 2D0PB 2CXSA 4PFJA 2AL7A 4WI1A 4S1NA 3BD6A 3PUXA 1KVRA 4Q1VA 3TL6A 2HTFA 4TWRA 1NMZA 3EULA 4HS9A 4UZFA 5D00A 2E2WA 2C03A 3C6BA 4LRXA 5DWVA 2FWJA 2JKVA 2C4NA 2OQ2A 2O52A 2FOXA 4HDCA 4JGBA 3WB1A 1M54A 3VKGA 4JT9A 3RI3A 1CIVA 4MB2A 4RFSB 5K3EA 4XPIA 2AKEA 5IKOA 4F5DA 3FJ1A 4OXQA 4PTYA 4MHTA 1OFVA 3ASZA 4BVGA 3ZGZA 1EESA 1BO6A 3AM5A 1QC5B 2TSYB 4KAJA 3ZU2A 4BJ6A 5CDGA 5G3YA 1IATA 1HNWB 2QA5A 2AC2A 1K7CA 1BXKA 4RM3A 2Z5FA 1G19A 4XQ0A 3OWHA 3D8BA 4Q4DA 3QTTA 3MWDA 2ZQYA 1NJ2A 4QNNA 5LOVB 3HM9A 5CA1A 4O4HB 3AI3A 4HAOA 5LXTB 3CJRA 1H65A 1RQGA 1TM4E 1S02A 1JRLA 3PP8A 1ZGAA 1BVHA 1A8UA 1HE8B 5JAMA 4I4TF 4PG6A 3W05A 1QB8A 3LC1O 4FIZA 4MV7A 1LK7A 2HSGA 1ZD2P 3B3FA 3CSUA 3BWBA 5K0CA 2Q4RA 2VUIB 3FYHA 2Q5JA 3CQ9A 2FW1A 1BE6A 2GBPA 1R74A 1NTOA 1QSGA 5I9TA 1MKYA 2EX0A 2GUGA 2O7QA 5L45A 1CR2A 2A57A 4N0QA 1XMQB 1K98A 3RFXA 4JUAA 4KIUA 3BTUA 2A9JA 3RUEA 3A9CA 1O2DA 3EA4A 3BGDA 4JS0A 4DMUB 1DXHA 1JG3A 4N3GA 4IOMA 3CJTA 2HMSA 3M6FA 3OQ6A 4OO3A 1XTBA 3F2VA 3VR4H 1L1RA 1E61A 4TQGA 1STOA 1FDVA 5INTA 3GJYA 5KTYA 4NAHA 2XE7A 3EXEB 4XWYA 5DOVA 5ALZA 4EGAA 3ZH9B 4P82A 4D42A 2P3LA 4GI5A 4BWYA 1PFGA 4P5DA 4PZZA 3T4EA 1US8B 5JWOA 3JVUA 1RU3A 4B17A 2A9FA 3JU3A 4KQWA 3OU6A 2QQEA 3H5VA 3PRHA 3SBXA 1NJGA 4NH0A 4YEDA 3UOAB 3CRQA 4R2KA 3D7KA 5C8YA 2ZAGA 3KV1A 4K2AA 1F9AA 3LU1A 3LF2A 5U9CA 1L7PA 1SK9A 2G63A 2QR2A 3IBSA 3DHYA 4HVLA 4RSHA 2IHYA 2C2OA 1XTKA 3JY6A 4TTVA 1ZDMA 2Q7XA 2D2FA 2CJXA 3R8CA 4C87A 3IVXA 1R6AA 1N6LA 1U2QA 4EDHA 4EKNB 4X95A 2FUEA 4GLJA 3I23A 1HZJA 5LZ2A 3LPLA 1U8CB 3IEUA 4JYBA 2EERA 3MTGA 3QEAZ 1MB2A 2I99A 1BMTA 4QU0A 1KE2A 1BYUA 2PL3A 3CPEA 5ED4A 1ANKA 3ROKA 2DERA 4AP5A 1LSJA 1C2TA 1GGJA 1MX5A 1QDUA 2Q4OA 4U02A 1JPUA 4ER7A 2QPAA 5BWLA 1UMCB 4ARZB 3OJOA 1E3JA 3W5CA 4Q4JB 3KWMA 1QH1B 1RQXA 2C2GA 1VKNA 3OE1A 1MX9A 4F2WA 2XRFA 4YJGA 2WU8A 1R1DA 4K9NA 2IEZA 4LOLA 3UF0A 3U3OA 4PNPA 4L16A 4C0XA 1Z28A 3M6IA 3PVZA 3VH4A 3VKHA 1UXKA 3OETA 4HWPA 5DRTA 4FFWA 5DWDA 2QX7A 1KU6A 1QHHA 2DYKA 1YVUA 3A06A 5CFOA 1H3NA 3VPCA 1RMTA 1EVLA 3GBPA 5FNVA 2RHLA 1NDQA 3T9EA 3KOWA 2DUJA 2R25B 2H1WA 4FYIA 1XJ5A 3K92A 1RP1A 2C04A 4ZDKA 2C57A 4RHCA 3WDLA 5A9RA 1H6AA 2X8AA 4ETMA 4YR7A 2XXBA 2GFQA 3RYIA 2QAGC 3Q88A 1LZKA 2RE8A 5T57A 3WO1A 4JOBA 2AGVA 3OLCX 3ZY4A 3R6GA 4AZTA 8LDHA 3TFOA 1NLYA 2FPLA 1UKBA 1HEUA 2H2IA 3AWDA 4FOSA 3PA6A 4HX9A 5FBQB 1N5JA 4IJWA 4KLZA 1G5TA 3IBTA 4MLZA 3PFHA 3EJ6A 1RVV1 1N2IA 3BMQB 4ID9A 2G1AA 1Q1AA 2DUMA 3G0OA 2ASVA 2JBAA 3GRAA 3I53A 4NESA 1U3CA 4MLDA 2PHZA 3J7AC 3RSHA 4PVCA 1F38A 1RWVA 4GOXA 2JS7A 4EW6A 4EX7A 4LDAA 1XWFA 2QAGB 1EZ1A 2AEFA 1JQKA 2GZMA 4QT0A 2LP4Y 4EKGA 5M5BA 2P6PA 3K8QA 2UYOA 4YS6A 4OCZA 5I4CA 2A0WA 4UEKA 2WUVA 1ACMA 4NJOA 4DSNA 4ISCA 2XADA 3UMCA 3ZWDA 3GFOA 5FEMA 2PIDA 5EWMB 1ECFA 1QOZA 3GEDA 3FETA 4LV8B 2YDYA 5FPTA 1VL8A 2M6LA 5BY2A 4C1BA 2W7TA 3FUVA 4DREA 2J3KA 1Z56C 1D2MA 1YQQA 5FFNA 1XZIA 1EFPA 3T1NA 4P5PA 4Z86A 2GEUA 2X76A 1MIOA 2Z6UA 1PCXA 3CSDA 3ZI7A 3INYA 3EVAA 3LL4A 2XQFA 2GEFA 4MW5A 5EIWA 4PN3A 1SA0B 2ZVDA 4K1XA 1G55A 3K9NA 1K6EA 2IZ0A 2F9FA 3UAZA 5EJ7A 4GOKA 1W30A 4RZ3A 1NA5A 1V8BA 2X2OA 1NT2A 1U3DA 3HFJA 4K40A 2Z8YM 4PW0A 4R8VA 4DOMA 3FY4A 4TQAA 3FTCA 3SHWA 3DMYA 4GOND 4AT1A 1IVYA 4BRWA 4RVHA 1M6EX 3ZZ0A 3GRCA 2F6RA 2X6RA 1XP8A 3I05A 1BH6A 4OH7A 5CT6A 4DBLE 1RLIA 1L1FA 3ORRA 5A5FA 4HLCA 4AKIA 3AEKB 3TRDA 3L2OB 1YCHA 2UKDA 3SBDA 5T64A 1G21B 2HZBA 1VE6A 3H42B 2XQVA 4LVCA 1W4RA 4X66B 5HJ2A 4K8OA 1DZ3A 3TGPA 4DLWA 1P8JA 3HLTA 3F1KA 4IJKA 4R7TA 4MV3A 3V8BA 2AG6A 4ZHQB 1BW9B 5JMPA 1O95C 1ZSYA 3LUPA 4HLUC 5DBOA 5LCXA 4WOPA 3RBAA 5DGXA 3ZGNA 2OL4A 1XE3A 1E0DA 1XEWY 4UBIA 2VDWB 1IONA 4TMVA 1Z3CA 2XXJA 5JZ9A 3ANYB 1XD2A 4GXNA 3FOCA 3G23A 5ERGB