2X8WA

The crystal structure of methylglyoxal synthase from thermus sp. gh5 bound to malonate.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
MRALALIAHDAKKEEMVAFCQRHREVLARFPLVATGTTGRRIEEATGLTVEKLLSGPLGGDQQMGARVAEGRILAVIFFRDPLTAQPHEPDVQALLRVCDVHGVPLATNPMAAEALIPWLQSLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords METHYLGLYOXAL SYNTHASE
publication title Crystal Structures of Methylglyoxal Synthase from Thermus Sp.Gh5 in the Open and Closed Conformational States Provide Insight Into the Mechanism of Allosteric Regulation
rcsb
source organism Thermus sp. gh5
total genus 44
structure length 125
sequence length 125
ec nomenclature ec 4.2.99.11: Transferred entry: 4.2.3.3.
pdb deposition date 2010-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2x8wA00
1A9XA 1THZA 1C30A 1VMDA 2IU3A 1ZCZA 1OZ0A 1KEEA 1G8MA 1PL0A 2IU0A 1EGHA 1IK4A 2B1GA 2X8WA 2YVQA 1PKXA 1CS0A 1T36A 2XW6A 1WO8A 1S8AA 1BXRA 4A1OA 3ZZMA 1C3OA 2B1IA 5H3LA 1M9NA 1M6VA 1P4RA 1S89A 1B93A 4EHIA 1CE8A 1JDBB
chains in the Genus database with same CATH superfamily
1LPMA 4NK4A 1CUHA 1NL3A 2JZNA 2VT7A 4AFNA 3HCBA 3NJ4A 4TGLA 2BZ0A 1E4VA 1FS5A 3DMDA 1C0PA 2Z1DA 2IZ5A 2OO7A 3ZY6A 2A0FA 4RZQA 3N0XA 5KU1A 1CLUA 4B48A 1G20A 2JCSA 2OBBA 3AC0A 4PRKA 1ZINA 2EBWA 1YHYA 4HATA 4JSYA 4E3WA 3IOMA 2WW8A 5K45A 4FWTA 1V6AA 3KAKA 4RIGA 1R4NB 1WP4A 4FEYA 5LQKA 3CUKA 5BQPA 3P9XA 1AE1A 2H7YA 1VBMA 2PK3A 4O4JF 4DN6A 2C2OA 3OZDA 1ZHFA 4K46A 5KREA 2WHPB 2HA6A 1PUIA 4E1VA 1FP6A 4OHVA 2YRXA 4X0EA 4ZVMA 3PRJA 2FDCA 3I45A 1RM0A 5CBPB 4NJEA 1R9JA 4UUPA 2EWVA 2G63A 2JLQA 3E8SA 3H1AA 3NCHA 2A0XA 4GPIB 5ER6A 3I5YA 1B0UA 3QX7A 3FMPB 3DZ8A 3IDOA 2R1VA 2GBIA 4RD1A 1AZLA 1E1RD 3ZWAA 1YFLA 3P8ZA 1SJ9A 1HMPA 5CAEA 5DT2A 3FCEA 4WESA 5E7JA 2FSPA 1XAHA 2VLBA 3HNPA 1DAIA 4H1UA 4BMSA 4PGGA 1UBRS 4UOEA 2GWRA 5L95A 4XGIA 3VVLA 1E8NA 1Y0BA 1TCVA 2AX3A 5DVZA 3SQXA 1NRXA 1B74A 3LG2A 2Q4EA 4G37A 4AJ1A 5HXAA 1UM8A 1M8JA 2OZLA 5EQDA 3GIWA 5KVCA 3KT3A 3PENA 1RP7A 2R8OA 3VC1A 1YBFA 1OVGA 3DL0A 5EJAA 1KSFX 1IM2A 3C3MA 1VKHA 3RVDA 4G25A 1IBSA 1VYUA 2BGLA 2WM9B 2O8EB 3T41A 5MFPA 4L3WA 3HR8A 1A1VA 4DIEA 4ZZ2A 1OXBB 4ZC8A 3VU9B 2IX3A 5D7NA 5ADUS 5JAZA 1B0PA 5F64A 2OM2A 4NYIR 2I71A 3MW8A 3AUKA 4Q3NA 5IDXA 1HL7A 4MCHA 1OLSA 2XY4A 3LP8A 3M0EA 3VNBA 3H6GA 4HUQB 4J8PA 2OM6A 1B7GO 3AX6A 4HH0A 4UBKA 3THYB 3GN2A 3EIQA 3RVLA 1ODKA 3QNMA 4CGYA 2FQYA 4XIFA 3TCXB 4TYPA 3WBJA 1I4DD 1NNI1 1Z0SA 1ZD1A 2G9ZA 1KH2A 2QRZA 3DTTA 3MSCA 3ZI4A 2C3PA 1YRWA 3H2SA 2QRKA 4OJQA 2DH6A 1KSGA 3ZIAD 1VCIA 5GOTA 3DEJA 1L4MA 3MBIA 2FPGA 3PJDA 4NZ9A 4RKQA 3RJ5A 1GG2A 5A4KA 2CT8A 2PX6A 4HNGA 4X64B 2GXAA 1VKJA 3GL9A 3K0CC 1P1CA 1CUYA 4QUHA 3PHBE 3VX4A 4EO9A 1MG0A 7REQB 5AVTA 3EXEB 4PO9A 1BC5A 2PM8A 1P19A 4L72A 3DH0A 5C8YB 4GR5A 3UWKA 1Q44A 1UWVA 4A6PA 1RW4A 4I50B 5LDDC 1XHEA 3Q4GA 4OYYA 5DHTA 4INZA 3OLZA 1BEZA 3ED5A 4ZT3A 4D02A 1GNSA 4R2JA 2XWPA 2A59A 3BAFA 5LYJB 1U2PA 3AHCA 4BFWA 4HUJA 1DB3A 3SC4A 2IPXA 2H6EA 4HDOB 3UATA 5ILOA 4Q3KA 2WIKA 3VKFA 1I7PA 4RHYA 1QDUA 5EPEA 5IBCA 4K9OA 3U6KA 1JDBB 3A6DA 2XCLA 3PTAA 1O58A 2BFOA 3DKPA 3RT1A 1Z83A 3ELUA 1M6HA 4NZOA 2OQ2A 1Y6RA 2J7PD 2YFKA 3SOZA 4RGVA 1WXQA 1B8UA 3E1SA 3H1EA 1A04A 2JNWA 1M5TA 1XK6A 2OBXA 2X22A 4WECA 4WKCA 1AQNA 3L8FA 2OCGA 1YQ9A 2NUAB 5JZVA 2WE7A 3OAAA 1ODTC 4Q03A 5EI5A 1TAUA 2X23A 3PF8A 5GAJA 2G17A 3K0AA 1DT3A 3W90A 5GZ3A 1HDXA 5FA8A 3L01A 3UHOA 4OXQA 2WMYA 3HQ4O 1F6BA 5A06A 3K9NA 4XR9A 4MW7A 5JG7A 2O0KA 4QXRA 3RU7A 4BVLA 2C4KA 3K32A 3E48A 4PNZA 3UHJA 1O5OA 4K40A 3PSHA 3DDNA 3O1LA 4MWGA 1XPOA 1ZIPA 2NTJA 3CHYA 3E3AA 4NZPA 3ENKA 2XSZD 1CJMA 2JFQA 3GFTA 4ON9A 5COQA 5BMVA 2OY0A 2V03A 3M6WA 3ZQUA 1GXSA 3ON5A 2IS6A 2DHDA 3IUMA 1T0IA 1N2XA 2CWWA 1W85A 1T3GA 3JWPA 1VHWA 3DOFA 1PT6A 2ZTUA 2VTKA 3KKKA 4JQOA 4QEKA 5ALOA 3X1YA 5CFQA 1TTPB 3GLHB 3VVBA 1NM5C 4AIIA 1N1MA 2I91A 2FP3A 3FHLA 3JWEA 1IK4A 5F1PA 1SHLA 1HZJA 1PQWA 4ETMA 2ZXEA 4HP8A 3GLGB 2Y2UA 5EL0A 2CJWA 3NVMB 4HD8A 4CL2A 1OX4A 1ONPA 2XR1A 2MYUA 1QRUA 1E3JA 4R51A 2FPXA 1OH7A 1Z0IA 3ASUA 3N7TA 1KYYA 3K0EA 4CL3A 2Z3ZA 3THXB 2QMEA 2YTZA 5BP7A 5BMVF 2OV8A 1H1LA 4PC1A 1S02A 4B0OA 3L0OA 3Q7SA 3SYLA 2IHBA 2BKEA 4IYJA 5H68A 3IT2A 5DH9A 4BS9A 2O2GA 5CK4A 4NEHB 1Z29A 1W1WA 4G0YA 1J7KA 1QOPB 1N6NA 1M2FA 3ZW7A 5AW8A 4JD5A 5EEHA 3QF7A 3CBGA 3BGDA 3ZWNA 3TNDA 2CGEA 3D8NA 3UJPA 4E09A 1E9SA 3FVQA 4JT2A 4N7MA 2B20A 4RH3A 3VYTB 3MPUA 3I4CA 3BTSA 5JDCA 3M81A 3PIDA 3BGSA 4U7DA 4Q39A 2PUDA 1JU9A 3ICWA 3L9XA 2VWGA 4HN9A 4JODA 3IUEA 4D9KA 2XYVA 5EXDA 4Z51A 4FYXA 5JNUA 1YVDA 1NYTA 3V1YA 4EBBA 3WIOA 1QGUA 3FCAA 3UTDA 1VPEA 5HFJA 4QOEA 1FRFS 1Y1TA 3QW4B 1GPYA 2ZJ5A 2PL1A 1N92A 1G5PA 1U98A 2LIPA 1LBHA 5KQRA 4OM7A 1KMHA 1IZYA 1K3FA 1Y7PA 4Q12A 1QOQB 5SY9A 3BD6A 5F7OA 2ZJBA 1M67A 3FWYA 4XQEA 3FDFA 3OEHA 1QFXA 2XUOA 2VDVE 5IZCA 4CI0B 1PAUA 4FYWA 4KP7A 4O5AA 2VDLB 5LB4A 5DYYA 2OQVA 1RKVA 4UU7A 1KDVA 4KR0A 1E59A 2QEQA 3A7DA 4LHYA 3FTPA 1ZKMA 3QG5A 2ISQA 1M34E 1T4GA 1LSUA 1J0EA 3WLPA 1FBNA 4A0FA 3KOYA 4HG2A 5BRJA 1R0KA 1MJGA 5F5NA 1MUUA 2GD1O 1KNQA 2GCOB 2NT4A 3UF0A 2WWGA 4I8IA 2J1LA 3KQLA 2FLKA 2PUVA 2X8LA 2H8KA 4L8FA 1DAPA 3LZ6A 2VJBA 4UVIA 5H1YA 5FOUA 1X14A 2D1YA 1SMKA 1LRJA 2VLIA 4KWIA 3CB2A 4PYIA 4KGDA 1H9BA 1VPVA 1GLGA 1AGYA 1D09A 2ETVA 3W3AD 5BWBA 3O3NB 5TGTA 2NZUG 3ZU4A 3AF2A 3BIOA 2C3YA 3MJ4A 3D4IA 4PYMA 2IP1A 4DLZA 5GZ1A 3CLSD 1WXWA 2BFAA 2C2YA 5BMOA 1YD7A 1FVXA 3HLTA 4L8VA 3O6VA 5TB5A 5SYNA 3SHWA 5L3QB 2BI7A 1EVJA 2Y1KA 1K98A 3FWPA 1MEEA 4MICA 2G8NA 3T0GA 4D8YA 4DJJA 4TQ9A 4XVCA 2XHEA 2OBMA 2PU5A 5F3DA 3HJFA 5AHXA 3ZU2A 4G5QA 3EASA 3I9NA 1F9AA 1I01A 2AC4A 3BEDA 3FA2A 5JRJA 4NNOA 1MH1A 3DV2A 1IZ9A 3PD0A 1ND5A 1FL9A 2C00A 4TV9B 5CPFA 5DCYA 3D81A 1RM5A 3WOVA 4XDZA 3U0BA 1P60A 4XWKA 1D7AA 3HDGA 2XKAA 1JEYB 2PFSA 2EKQA 2IYFA 2AMYA 1P1FA 3QXHA 1WUIS 3SJZA 1AHPA 3S8YA 2ZTLA 2EDCA 4G0XA 4W9RA 4WLNA 5CGQB 4D8UA 3OU6A 4RY2A 2ATEA 3U3KA 3WFZA 3TZEA 5JZ9A 2AEEA 2RMKA 3M34A 2QZ4A 1SIOA 4QNMA 1C7EA 3JVDA 2Z2JA 2A9JA 4JI5B 3JD1A 2DFDA 4PAQA 3TD6A 4RTQA 1E3DA 2YYZA 5EIOA 1DBQA 1V45E 3DKVA 5HKBA 3AGQA 4R41A 2VPYA 1I6KA 5L4SA 3WMWA 1YCHA 2VPTA 2D1SA 1N0VC 3I73A 4ZHSA 3I62A 1XNQB 1IBMB 4LY3A 3Q98A 3TRJA 1DRUA 1EK1A 3D31A 3GRVA 3KEMA 5E1BA 1XZHA 4UQLA 1IM8A 2EX0A 1I2MA 2B4KA 4AF7A 1EIZA 3SLGA 3MELA 2JHAA 4OGWA 3TZBA 4MWEA 3EGIA 4WADA 4S2UA 4D82A 4P0TA 3VU1A 4URHA 2B7CA 4XSVA 4MMZB 3HCOA 4BLOA 1UBCA 4I1PA 3UMSA 1D0VA 1U0EA 1YDGA 1Z0UA 3IAS1 3KYDB 1SVKA 4W9NC 3VGPA 4N49A 1R8JA 2FXVA 3HFJA 1B76A 3OPXA 2RHOA 2ZPUA 3EH2A 5LFAA 3KEQA 4MV3A 2JIZD 4RSHA 2GZRA 3QVSA 5AM3A 2D7DA 2G8LA 2J3IA 2IEZA 2C4NA 3WZMA 1D2NA 3UH0A 1IY9A 2Y1WA 3MA0A 2AYXA 2GN4A 3AP1A 4MRSA 4UEWA 3WAGA 3PVSA 1RYEA 2VKQA 3HKEB 4GOOD 4Z1MA 1XZMA 2ZETA 3S2EA 1DELA 4Q1FA 4BO1A 4EELA 1IY1A 1TA4A 4D8XA 3F4BA 3CG0A 2WMDA 4M99A 3W79A 1Z35A 1W88B 1YJQA 4EFDA 4GKJB 1R3DA 5JBQA 1U7TA 4EUSA 1GA6A 4WBSA 1FDOA 2FZCA 2XMZA 4E5KA 2P2CA 2Y1CA 1ETHA 2UYQA 1JEDA 2YHSA 3L6OO 5KTKA 2JJ1A 4W5HA 3CNEA 4H59A 5I7RA 4EGQA 1W59A 5K3CA 2VZEA 4FYYA 4HLNA 1FSZA 1GDDA 3OT5A 1JJVA 2O1XA 4DSZA 4LDRA 1N77A 5EQJB 4Z8XA 2AIRA 2WLSA 1TUEA 4LSWA 4BFSA 4CQMB 4UDNA 3EAGA 5HOQA 2HIAA 3KT0A 4M9SA 3FI9A 4RKYA 3WNQA 2PH3A 2A9QA 1Z4KA 2Q9AA 3IB3A 3SJ7A 2PBLA 1DV1A 3HKCB 2QPAA 1WU7A 1IDN1 3GFQA 5KYXA 5F9HA 4GZ3A 5KYVA 1S01A 3A6ZA 4TMXA 3QLVA 4GP9A 5E9QA 3ZLVA 2G5CA 2FPRA 3G7UA 5ALKA 3ZHXA 5KO2A 4YUWA 5BPHA 1I2BA 4RVHA 4BNDA 4D45A 1EXDA 1N0WA 1NW7A 3ZS9A 1X6VA 3VJMA 3QY9A 4RTRA 3K3PA 3CXUA 2X4GA 3UOGA 2HK9A 2DCUA 2JDIA 5JJKA 4ZCMA 5JWHA 3WFJA 5LU9A 5FKJA 3V42A 4KAAA 2ZB4A 2DPHA 1LK0A 2BM8A 1UAYA 2ZBRA 3HG7A 4L75A 2I4OA 5AK5A 2BCEA 1AVTA 1FDWA 2EFYA 4MGEA 2FFJA 3H99A 4C4SA 2AFHB 4D9CA 2I6UA 1PS8A 2O1EA 4HRYA 4LOHA 2O8FA 1C30B 4YQEA 3FNRA 1U1IA 3RC7A 1K66A 1SU7A 2QTHA 4U9IS 4WACA 4KO3S 1FVOA 4YT2A 2D74A 5HF9A 4URXR 5ADVA 4BWYA 4JXZA 1YZQA 1IN7A 4LOKA 5CPBA 1BA3A 2X9GA 3GGJA 4K7JA 1NF2A 1JTFA 4QM6A 2P5UA 5KDOA 1E1RA 1QE0A 1PJLA 4MQ4A 1G1MA 1EX6A 5E9WA 3VKGA 1JHYA 4J0HA 1H2WA 3PPVA 3IP5A 1VE5A 5IXSA 3WYAA 1Q3HA 1EP3B 4CCYA 3OESA 2JI9A 3LIPA 4QDXA 3O4FA 4N76A 3NXKA 4N9QA 4GBGA 2C61A 3HEBA 4HX2A 4TKVB 2Z6VA 4F4FA 3X1WA 1I4TD 3UCFA 1XQ9A 2QQ0A 5HNKA 3U13A 1MABA 3QVGA 4W1PA 1O08A 1R0RE 3I6MA 2NAPA 3SQDA 3FDXA 1ZH2A 4ZV9A 3PUIA 2F8TA 2HSGA 2MSWA 1FMLA 2C88A 5E9JA 4AWAA 1Q3KA 1G5RA 3D54D 3E5HA 4OBWA 5ES3A 1L5HA 1SBTA 4LCJA 3CW8X 5I7AA 4CG2A 1GVNB 4GSLA 4EEKA 4IV0A 1P6UA 1XN4A 4AG6A 3SK0A 4DQDA 3ZE1B 1CDDA 2YIDA 3RS8A 1Q83A 3AUFA 3FCCA 3ZDYB 4JLDA 5CVVA 3EVNA 4CKEA 4D7AA 1A4RA 3ZIAA 4B71A 1EWVA 1OMOA 3F90A 3BC1A 4Y6PA 3RLIA 2G1PA 1B3RA 3HI4A 3T3PB 5AVSA 3HO6A 5EKSA 4LA4A 2OA0A 1AKMA 1L4NA 3RAJA 4F93B 1W4BA 5CB4A 1DWOA 4R1NA 1X8KA 4HJRA 4R83A 1OQAA 1MX1A 2J48A 1VHDA 2Q1UA 3DEKA 3OVMA 4IMRA 4D57A 4D0NA 1NNEA 1TW2A 3FTCA 1IATA 3HJCA 2E85A 1AX9A 4JBYA 1NBIA 3UJ7A 4HLUC 2NU7A 1K6MA 5EMKA 3G17A 3WK4A 1CQPA 4QGGA 2CVFA 3N1UA 1ADYA 4JOSA 3QH4A 3UXYA 3AEQA 2QVYX 3C6XA 4ERXA 3ZCQA 3DBRB 3T9FA 3BZWA 1VSQA 1D2HA 2G1UA 2HA3A 3IEXA 1IAVA 3OOYA 4J0IA 3TOZA 3WKBA 1A9YA 2H1RA 2IZZA 3A8TA 5CURA 1GA1A 2FW0A 1Y9ZA 3HVJA 3GLFE 4B3MB 4CMBA 2AI3A 2AOUA 3AT1A 3OLVA 1CK4A 1U9IC 3G8BA 4UC0A 1ZVVA 1CD5A 1JT9A 2J87A 3AESA 3D8TA 5I4KA 2CMGA 4A8JB 1NE2A 3ZK7A 1AQLA 4NZMA 1YONA 5CB4F 3QPBA 1ZRNA 2ZM6B 2Q3BA 3KEFA 1RBMA 4XCVA 1B42A 5G4KB 3PNKA 1AH2A 5DNVA 2XXAA 1JW9B 3GO4A 3ISJA 4RZ2A 4RDXA 2XMSA 1F5SA 2OV2A 5JAOA 1XCPA 3KS9A 1B26A 2RFLA 3B3QA 4AYTA 1P1RA 2HXSA 2WLTA 4EVSA 1JNXX 3OCJA 1KRXA 3NB0A 4Q93A 4S1TA 3D1VA 2OHVA 4E94A 1KA9H 3NHBA 3E35A 2BFPA 2J6BA 3WMFA 4AD8A 4PPFA 4A2PA 2X2PA 1OBOA 4ZO9A 1V5WA 1KO4A 2OCAA 2QAGB 1X80A 1SEVA 2Q4BA 3H1GA 1DG3A 1Z7WA 2B8WA 4WKNA 1AG9A 1Z6YA 2CLSA 4DMRA 1P4JA 1PFWA 2ZJ1A 3W3ZB 2QSJA 3CRZA 4X45A 4CV2A 1G66A 4OP1A 4CM8B 3WYFA 3QTTA 1C4KA 1NPYA 1TO2E 4HQOA 1H0SA 4QBTA 3PRHA 3G2NA 1XCGB 2J9FB 4RXTA 1CCWA 1I2CA 2J09A 1CEEA 2AQIA 3IULA 5EKTA 1LV8A 3C3YA 2F64A 2BCJQ 4BNGA 4U0JA 5EE5B 1A1SA 1GPJA 4NE2A 4P92A 5HIMA 2PNJA 2H9AA 1SB9A 4KX3A 4Q9LA 5EVJA 3PNMA 4JENA 2RGNC 3HWX1 2PQ0A 5CCEA 3C1UA 2GRAA 2I87A 3N6XA 2P2ZA 4PSVA 3CF6R 1U11A 3CX3A 1MH9A 1ZRHA 4N82A 2HCRA 4QO7A 1WXHA 3M6UA 1Q1NA 4IS3A 1V37A 3H1TA 4X92A 1JI3A 5AJYA 3MBKA 4JA0A 1U2RA 3MJEA 4A91A 2FRVA 3KBOA 2X2FA 3DP9A 3VZQA 4FXPA 1NVGA 2ZVQX 5GGXA 1IOZA 3SE7A 1D2RA 4DDKA 4DCTA 4J6FA 2P0YA 2QX4A 3FBTA 2PUEA 1UPAA 2ZRJA 2LZ0A 1ZOOA 1ITZA 1ZP6A 2FJPA 3G9QA 3GYGA 3LH5A 5B1HA 3WQHA 2G06A 4DDUA 3QXJA 2FPWA 3VH4A 5JJCA 4PIPA 2G88A 2XTNA 3LQ2A 4FDMA 4BV8A 2FLWA 4EEZA 1Z47A 2VUUA 5F33A 3QNWA 4HMOA 3NIWA 4LBYA 5I8WA 4NH4A 1ZO8A 2GT1A 3EXIB 5ALWA 3WICA 4LJKA 3T1NA 5JBIA 2C9MA 1T1RA 2R7NA 2D13A 2Q45A 1QRAA 3NAGA 4YLYA 1IB0A 3AUAA 4LI0A 3C43A 1JQ3A 1YAHA 5A9RA 1QZUA 4MVJI 3CUEF 3ZD9A 4OJKA 5TVKA 1V8BA 2WVJA 1S9HA 4HRVA 1PRYA 2D00A 4S1NA 3U7FB 4RS4A 3I01A 4ERNA 3UK0A 2ZAMA 4NBKA 4H0NA 5P8WA 4MIYA 1KR5A 3HU3A 5DBIA 1WNFA 1QZXA 1XZIA 2Q4RA 2H29A 4M1KA 2ZIGA 4RSGA 2P79A 2F67A 2H2AA 2JCYA 4ZYUA 1SKYE 3G88A 3UJ9A 5AWFC 1IJEA 4AZWA 2E4WA 1D5WA 4CIWA 3TI9A 5J2TB 2F3SA 3AETB 3SSOA 2CFIA 5K3SA 1AV7A 2F62A 1Y5RA 2MYPA 2ZUUA 1FU8A 3K6KA 5TC4A 4DADA 4ESEA 4EKDA 3W3AA 1CY4A 2F1JA 1KZHA 5B36A 4X3PA 4QDUA 4ALKA 4ZP1A 1K88A 2N3ZA 5AM5A 3VH2A 4C0WA 621PA 5FA5A 1IWPB 1RZ3A 4XIJA 4MYSA 1K6JA 1ZXLA 1NATA 3TVDA 4Q7JB 3E5RA 1V6CA 4DCPA 2L69A 3QQPA 2CBXA 5LA6A 3DYVA 2PD4A 4PTLA 1ODJA 1NKSA 4AKHA 3WE7A 3CZQA 5M34A 1DFGA 1SXHA 2M1XA 2FN9A 2HT1A 4OFXA 1U2ZA 5K6TA 3MCTA 3WNCA 1G3QA 2ZZMA 5IWAB 2JLZA 1ISPA 1WHSA 1WOYA 2Q6TA 3PQFA 4JL5A 4DQKA 2BP7A 5EJEA 3TWOA 4QODA 4QQRA 3MMZA 1GNTA 4ZCPA 5HJ5A 2EQ5A 2Z8XA 2FX5A 1N1EA 4NYMR 2RGDA 4DSNA 5FA6A 2C5HA 2E1PA 2JFUA 1L7DA 2PVCA 3A4TA 4EW2A 2AF3C 2WJGA 1E2JA 1VFPA 2XNCA 1XZAA 1U3VA 1V5IA 1G9SA 1SKUA 4UJ5A 5CVUA 3UMVA 4MGHA 1C3XA 3ZZ1A 4CMIA 1NLYA 1JL3A 1TRKA 1ZEMA 3ZE2B 5LKAA 5FOWA 4AXBA 3VJLA 3SLKA 3JSXA 4KU4A 5LA6F 4QXOA 5EJGA 3T3IA 1UKZA 8GPBA 5CCDA 4AT1A 2YV4A 4KLZA 3FNEA 3IUYA 4P33A 1NY5A 3D8UA 1T26A 1U2EA 1Y8RA 2OD9A 4DAOA 4KWTA 2H0AA 3RUAA 2WKWA 4EZEA 5K4GA 1D1TA 3IAM1 1THMA 2R86A 2R2AA 4JLOA 1Z4IA 5TVGA 4HWKA 4WASA 1OZFA 3F3MA 1IVSA 4GDFA 5JS8A 3GJTA 4GBJA 3HYNA 1ML3A 2ROQA 3GRRA 4CEJA 4GC5A 1V11A 1DRKA 1EJ0A 1NV8A 2NU6A 1XHFA 2QR3A 4NNPA 4UAGA 4HDMA 3O83A 4FOTA 4DANA 1IUOA 3ESRA 4YBRA 4RM3A 5HMLA 4RTNA 4C14A 3LY5A 4K0KB 2C84A 1I4OA 2JIZA 2LVBA 2FPUA 3TE6A 1ENOA 4DYVA 3LDUA 1R16A 1AKQA 5KI6A 1U9JA 3AK4A 3WOHA 4AS3A 3U1BA 1RI3A 4KSYA 9MHTA 3CS3A 4XCXA 1LC0A 1XZGA 1WB9A 2H4JA 2C8JA 1SKMA 3LCJA 1JDTA 3NORA 2VUHB 4RF5A 4KC0A 3VJRA 1ZJZA 4BX2A 1ZGBA 3JQBC 3UK1A 4OJNA 3ZD6A 3HXPA 3RARA 3GMIA 2FN7A 4BX9A 1JQLB 4ZRMA 5FL7D 1RVDA 4YCAA 1UXOA 5JD3A 1WSDA 3TZLA 1G21E 1KU0A 1TFUA 3IHTA 4TQUS 2W2LA 1WV0A 4U8GA 3K09A 1XRPA 1NRJB 1ZSYA 2EW1A 4H4EA 1Y8AA 4IR7A 1J49A 3GUYA 3HL4A 1MAAA 4NFYA 5B3AA 5G41A 3T0FA 5K2MA 1M0EA 1I0LA 5KWIA 2G04A 2YXPX 3ZCUA 5TE9A 5CFNA 3Q8MA 1BG6A 5HW0A 1H65A 3AP3A 1VJ5A 4BWGA 4FZVA 2DUMA 5REQB 2I9PA 3GVCA 2OVFA 5ALZA 4FU0A 3ZV5A 4N5IX 4ZFNA 2IHVA 4R3WA 1ZHOA 3RTBA 2TRSB 2ECQA 8ABPA 2ZIZA 1NKTA 5EHNA 3EDCA 1YR3A 4YRAA 5LQNA 4H0FA 4KDFA 1XYVA 2YMMA 4MWSA 1SKBA 4I1UA 1OJLA 4K8OA 3K6RA 3WZ2A 1EESA 3QZUA 4H6XA 4F97A 2BRUC 1KZ9A 3BK7A 4UCFA 5JSQA 4EMTA 4TXJA 1Z08A 2VJKA 4PN3A 4G9GA 1E7WA 1V7PC 1RPJA 1Z6ZA 1RC0A 2PIDA 2XQGA 4KQEA 4KHZA 2PV0A 5HSGA 1X7WB 3PEUA 4QREA 3ETGA 1E8DA 2AN5A 3LRTA 4I1IA 2RC6A 4JLWA 4MR7B 3DC7A 1O97D 3OCXA 5ULLA 2F7SA 1EG7A 1KOLA 4K1XA 1P2SA 3WLFA 4QGAA 2DPXA 3BKWA 3KLMX 3O2JA 1NJGA 4I66A 4UKDA 2LNDA 1LF0A 1A76A 3KQOA 4R40A 4OHRA 4Y9SA 3UZUA 1PYOA 2FW7A 2GJ4A 3GT4A 3VR1A 5LD2B 1DTEA 2QORA 4P08A 4FNOA 1EE2A 1DKNA 1MFZA 3ZLBA 4O2BA 2W43A 1R5BA 4X7BA 1VYVA 2OHGA 1HFWA 2GAOA 3WDKA 1CEQA 1LLQA 2HOQA 4C0XA 3BM5A 3K1ZA 2EYQA 5J59A 5KDDA 3COYA 3HWWA 2WZCA 4X1YB 1X7XA 3MCVA 1N5KA 3H5RA 2PGNA 2J08A 2Q3JA 1O1YA 4OHZA 3FDZB 2H5EA 3AF0A 1PWHA 3RBZA 1NP7A 1CS4C 1Y3FE 1TZBA 2H1IA 1QYVA 5IJAA 1BX1A 2B9VA 1TTHA 5E3IA 4H16A 4OFBA 5LP6A 4YXWD 5K0JA 2P4EA 3JQ6A 3MTGA 4TM8A 4L4UA 2OFFA 2GVDC 4PLGA 4NJOA 1IN6A 3CUYA 2PYDA 4WZBB 3CO5A 3TZCA 1WR8A 1OC4A 1JXMA 3HU2A 3WC4A 2BSQA 1QKIA 3MWDA 1UM9A 4P7BA 1E1DA 2W6NA 4J2TA 4O2BF 2BC9A 3ABIA 3EISA 4ZVNA 3RROA 1GQQA 3MB8A 4O2LA 1O0CA 2PZFA 3UPDA 3CBQA 2HDWA 2RHDA 2O2DA 4TLBA 3RS5A 3VSDA 2WKRA 4S3MA 1YR2A 4OQPA 4TKLA 5DK6A 2IBTA 1K8RA 3QVOA 3OT4A 3SD7A 3R3JA 3OWHA 4ZO8A 2KW5A 3IJ5A 4X6LA 3NYIA 4MUEA 1JDPA 1JHDA 2CLHB 1Z6TA 1RMTA 2VJQA 4JWTA 5JMWA 1F06A 2QZJA 2NNLD 1SOMA 3CVJA 3GRUA 5DW3A 3W3AH 3VPSA 5LP6F 2JASA 1KYZA 4PR0A 4RHXA 1G5FA 1M5UA 1D2EA 2PWYA 4NOKA 4DCUA 2JCBA 3TNJA 1UBEA 1HYQA 2VWPA 2WJ4A 2PGJA 1SOUA 2JIPA 3AEKA 4LHSA 5EWLA 5F76A 4BO9A 2CXNA 3NIGB 1SXIA 5KIAA 2B7LA 3DZCA 3MHTA 3LPCA 1BZYA 3KG2A 4ME6A 3L8DA 1G6Q1 1C9YA 1Q3TA 1KI3A 3D8SA 2CXHA 1K7YA 4DWWA 1M2EA 4M54A 4FYHA 1RHQA 4LAFA 1TPZA 2VDUE 3HUDA 5DO9A 1RIFA 5F78A 4JEUA 3CV3A 4PHCA 3CR8A 3IILA 3PGMA 2RB4A 4QAJA 4I5GA 1AZSC 2FEMA 3LX5A 3UO8B 3UUEA 4Q3BA 3HBNA 4QBKA 3RIMA 1A96A 2C9YA 2HJ9A 2UZ0A 1U65A 4YRCA 5EERA 1DARA 3Q11A 1RP1A 1B6SA 3IOYA 5JR3A 4DEXA 4BIIA 1F7UA 4LYDA 5LMUB 2VPXA 2GX6A 5AI0A 1NA5A 4O3FA 5BWCA 4UEKA 5AKZA 2I2FA 1PW5A 1H66A 2UZ1A 4FHDA 4ZVQA 4YPOA 2GPYA 4A8HA 5AUOB 5BSFA 5ALQA 5MGNA 1FQWA 2Q2WA 1WA5A 1C1YA 4P8RA 2Q5EA 1A3CA 1JQJC 1RPTA 1XVTA 2CJYA 1OXTA 2ODBA 3B6KA 3ODGA 4BB9A 3U60B 9ABPA 2H5IA 3EDQA 2HN9A 4I36A 2BWJA 3KTFA 2VR1A 1K06A 3OQIB 4G5GA 2EEZA 3TZHA 3I42A 3GLUA 1IG0A 3KETA 2Q5OA 2PJRA 2B9EA 3ORSA 4J1QA 3Q41A 4N3GA 3IBTA 5DTRA 3JRNA 5EINA 2IUUA 2YDYA 3U1TA 3NVDA 3M3HA 1W52X 4LVOA 2MCFA 4V0LA 1EFKA 1V47A 3FW1A 3I1YA 4QECA 1KK2A 1U8AA 3HXKA 3H1FA 3EMDA 4MV4A 1MO5A 2QJFA 5DHQA 1RQXA 2ASEA 1EM6A 3HDTA 4NNJA 2RGYA 3DXZA 2GZAA 4AWXA 5A6VA 1MAWA 3RHSA 2JIOA 3SIRA 3KZVA 2M32A 3X1MA 1SFRA 4GYKA 1OI3A 5LM3A 3NS7A 3OCZA 1Y89A 5JS2A 3NNNA 1LWOA 2OAP1 1XQWA 4US1R 3OZEA 1NAHA 2BMAA 2UVPB 2W71A 3RIYA 5JCPA 1QU2A 1YL7A 2Z5LA 4BJ3A 2OT3B 1PVOA 4AMYA 1FUYB 4RK5A 5DMXA 1T2CA 4ZAFA 1PL6A 3DMFA 1Q0SA 2L0XA 3KKMA 2QW1A 2DP4E 2PJUA 3KL2A 3QKRB 1X86B 1EUZA 3MRSA 4QBHA 1T9BA 4MROA 4BLQA 1JR3A 1QIGA 3HVIA 3FNQA 3ROGA 3TRDA 3KXDA 4P54A 1TKCA 3GLIE 2K2WA 3NUGA 4JYMA 3QVKA 1SVLA 4QSHA 1YJAA 2SBTA 4R6XA 3RR2A 3ZWKA 1SH7A 2VATA 2XOXA 3K2BA 3PJEA 3AQ4A 2EKPA 4L5BA 2NSJA 3A4MA 5B1DA 1JKJA 5KX5A 5ESXA 3ZYCA 3AHDA 2IXGA 5JIBA 1S2NA 1TKBA 2XBLA 1NOKA 3GAFA 4XWAA 3B6MA 4M9UA 4U7FA 4YB8A 3SMVA 3X3HA 4US2R 1K5DA 1C2YA 1KI2A 2WWXA 3TAUA 5KNCD 4I3FA 1W94A 1YIDA 2P6PA 4BFVA 1K8XB 3X1KA 2R7LA 2ZPTX 3P97A 2IU0A 5KSYA 3O9MA 3BFVA 4O4IA 2YHIB 3LC1O 4WJLA 1YT5A 3D0RA 3L5KA 3RHFA 4TTVA 2ZQYA 2Q07A 2WJAA 4L3VA 5IAEA 2IQIA 5KNLA 1SEPA 2XTZA 5I8PA 3ILSA 2IBMA 1XDZA 4K9NA 4ARAA 1ZBQA 4E4YA 4XFDA 1THTA 1J07A 2EQAA 1DTWB 3DFIA 3UEOA 4DAEA 3KL4A 2V4ZA 1RXIA 2Q3CA 2VP5A 4CF4A 1CS0B 2H06A 2IW1A 5KX5F 2WQZA 4K6FA 4V2UA 4UMVA 4WLFA 4AUMA 4DJFC 5HQ3B 1F8GA 1PFQA 1UWKA 1WU8A 2QPOA 2RH8A 4LV8B 3G5TA 4Z9XA 1I3OA 4F60A 3FJYA 3UT5A 1W8IA 2GBLC 1OAOA 1T1SA 4B43A 2IPAB 2D2XA 1VKNA 1YE3A 1SCUA 4Q00A 2CYAA 2GF0A 3KZOA 3P45A 3SKYA 3V7FA 1OC2A 1BJRE 2QJOA 3C3WA 4J76A 3FTNA 4O4IF 4ZOCA 4A8PA 4DLLA 2H5LA 2QM7A 3IEUA 4HDCA 4P3PA 5I3ZA 3W9BA 5CA0B 3HJGA 3VPAA 2ERCA 1X74A 2NO5A 2MHCA 1OYOA 4C6HA 3IDAA 3L6DA 4YYEA 2CNNA 2E6KA 1N0UA 3IBYA 3SXUB 2O0LA 2HY7A 5IF9A 3DP7A 4KXXA 4LMBA 2Y0CA 3WLJA 1Z4NA 4WPGA 1ZXXA 1DEXA 4YMTA 1G291 4TLLB 1L7VC 5HCNA 5IJXA 1D1QA 3QELB 3PC3A 1EVQA 1E3TA 2IY8A 4E15A 2OBYA 2PGXA 3NHZA 3MS2A 1LS6A 3L0SA 1F0YA 4HKTA 5LZ5A 3UT0A 1Y80A 2XCIA 4UE2A 9LDTA 4LRXA 4BGUA 1U1DA 5DX8A 4CM4B 5K3FB 2WKPA 3NV9A 3E22B 4XTRA 5T67A 3VTFA 3VU8A 2PUFA 2BDEA 2WDPA 3UIEA 2NPFA 4A27A 5I9IA 3KQUA 2HIGA 4ND2A 1PDOA 1SUBA 4U6QA 2NU9A 1SHZA 2PD6A 2VBCA 2AUMA 4NDNE 5ALFA 2AXPA 4KKVA 4BE9A 1J0AA 4P7JA 2GEBA 1O94C 1KBZA 4FZRA 4K9DA 4X8HA 2WA1A 5JW6A 1CZHA 4O4HA 2PXXA 1AKWA 4MVCA 1RM4A 4R8MA 3PZBA 3QE0A 2ZDGA 1MB3A 2CLEB 4IIGA 3RT9A 1E3MA 2J5BA 3PJRA 2C2BA 4I5EA 2JGAA 1HE1C 1QYCA 2VL7A 4YCJA 2A30A 2E21A 1GQFA 4DV2B 1PR4A 2GESA 2ID4A 3A6HA 4PXAA 2FFRA 3V1KA 1QH8B 4KI7A 1YQTA 1C4XA 2BEUA 2HK8A 3FZNA 3MUEA 3T1OA 4AZTA 3IAM6 4IX9A 2C7GA 3HKDB 1V1MA 4KK4A 2CXUA 3D6MA 3DAPA 2Q6KA 2WVAA 3K4PA 3I83A 2JD0A 1T0JB 2O3QA 4G5OA 4LMRA 1O5IA 3IDSA 1NN1A 1SUPA 2RGBA 2VAMA 1Z39A 3PA8A 4D9NA 4O4HF 4FXOA 1X1QA 2YW9A 1VJCA 2QI9C 3K6JA 4ND8A 4DR4B 3QKUA 1NR5A 1T8UA 1R4AA 2CMDA 4GPD1 1K63A 3H8JA 2XRZA 3GDFA 2VK2A 3ZDBA 1CF2O 2DPLA 2WE8A 2WIFA 1JJIA 4F5WA 1PR1A 2VDPB 4NU6A 1U9CA 3OF2A 3GJ5A 1H5QA 1K6XA 4UFOA 3W4IA 5CVTA 3UJNA 3IAUA 4ZQIA 5JD6A 2I6SA 3ZC3A 2ECFA 5F7JA 4DR6B 3JARA 5TQ0B 5I4CA 4BKPA 2O2ZA 3LCCA 2PUWA 4IOJA 1AKRA 5AOVA 1WOMA 3VPXA 1QGED 1CUXA 4MW9A 4FMCF 5JC1A 3A7EA 3THRA 4EF4A 3CTPA 1X7DA 4PX2A 2HSZA 4UZFA 3ETLA 1QPZA 1ATIA 1J1ZA 3AFHA 2ORED 5FBRB 5FL7A 3PFIA 2NVUB 2I9KA 2XWJI 3X1ZA 3ZHZA 4ER7A 3L4BC 4TTRA 4XPIB 4DEYA 1ZJ4A 1ZSNA 5CLHA 2GCGA 4X3OA 2FWBA 5CXUA 4GKBA 3LBAA 5DGIA 3AV3A 2J5KA 2AMLA 5BQOA 1KZ6A 1KPIA 3RUFA 4O0LA 4KQ9A 1B0ZA 3CRQA 1B8NA 1YK1A 3IP8A 3N2GA 4ENTA 2F8MA 1XV5A 3LQ4A 3NBYC 3OG9A 3AZQA 3CEPB 3O8DA 3F78A 4GQIA 4WKPA 5EXXA 1L1FA 4ARBA 2JLWA 1ULSA 3JVUA 1LUAA 4F56A 4HC4A 1GSAA 3FFAA 1U2TA 1OHHD 2WZBA 5KWSA 1WDKA 1GPKA 2PGAA 2SICE 4G23A 2RJ3A 1FLAA 1CY7A 1PG5A 4ZGWA 3PP8A 3GXBA 3OKPA 1ZA1A 5ADWA 1NQUA 3TTSA 1X7ZB 3QSGA 2D5BA 2FGJA 2M6RA 2FWNA 1GPDG 2TSYB 5CFRA 4QVKA 1C9MA 3S2UA 4Y1FA 4Q3OA 3T7AA 4MJLA 2QGFA 5CX4A 5CDSA 1TTTA 1ZM4A 4RULA 4C1BA 5D3MA 2DUUA 1VM6A 3IX7A 3F0TA 1ZJ6A 2QTLA 4PQEA 5DNWA 1A2KC 2O06A 2YWBA 1IN4A 5EZYA 2SKCA 3ZHUA 5FO1A 1N6IA 3NV7A 4JASB 4ZQCB 1BU5A 2AXEA 4K6CA 1PEAA 5FWYA 1S2IA 4XYBA 2JL1A 3IDZA 5LNK1 3WHLA 3GJRA 4UD6A 2LIVA 1RFGE 2WSLA 3PVZA 3Q2KA 3GP8A 3GUCA 3LQQA 3VXKA 1VL1A 1CEXA 3PFWO 3L8CA 4ZTUB 3EMBA 2Y0BA 4EO4A 1F8XA 1TK3A 1QO0D 2ZXUA 4EYGA 1SXJB 3QU9A 4N1AA 3UWPA 4ZZ0A 3N8HA 1QE3A 4GYYA 4JT4A 3C4VA 4PAMA 3TLJA 2QUHA 2PTHA 4RZSA 1QYWA 2PQMA 3TMAA 1ZR4A 3AVYA 4ZVRA 3AJRA 3I9V1 4JNKA 5L51A 3UENA 4LFCB 1NN0A 1CULC 1GTL1 1UFRA 1VLVA 2D5LA 2H08A 1QS0B 2P65A 2DHEA 2ZB3A 4I2NA 3LZDA 1LZKA 3WL8A 2O2SA 2Q1XA 5EZYF 4BBJA 3NONA 1AUPA 4YH1A 2AMVA 4IKOA 1H1DA 4EDHA 4KRFA 3FYUA 4U3JA 1K97A 2OGSA 2GZ2A 2XPCA 4YV7A 1NFRA 1PTJC 3U7JA 5C1PA 3TUZC 2XCQA 4KXLA 2PEYA 1Z5ZA 4YR7A 3A9RA 1D2AA 4PTYA 3NYRA 1AA6A 2FWRA 1ADJA 2SHKA 4NECA 4QPDA 1E2PA 3NEAA 4PLVA 3VO2A 5B30A 1G6HA 3PUJA 3WADA 4OB8A 4LE1A 2J3HA 4M0KA 4BKQA 2O8EA 3L7YA 1WDTA 3B60A 1T35A 2ZR8A 3PKIA 2E6UX 2P40A 1C4OA 2E0IA 2H1SA 3MJVA 1I30A 3FYSA 3QEKA 4PSDA 4TV8A 3SZRA 2P8JA 3GNTA 3SAJA 4EIWA 3VC2A 1RBYA 3F7NA 2VRCA 2VNAA 1UMCA 1IUNA 1KY3A 1PZNA 3IJRA 5JQGB 3SHFA 4H4CA 4FK8A 1CU1A 3VNVA 2SKDA 4J94A 4IJVA 4PBTA 3ZDDA 3BSSA 1YJCA 2YOGA 2AJBA 3B6IA 3HUUA 3GFPA 3PDCA 3OTOB 3BJZA 2F3TA 2CLCX 4MW5A 2FFQA 1NV9A 2W2KB 4TROA 4JZYA 5BSRA 1GOTA 2WZQA 5JSZB 1WNTA 1Z8FA 1YKSA 1CNMA 3HY3A 2PL5A 2A35A 1M34A 3AVOA 4GPEA 4Y6QA 3EA4A 3LLSA 3MUNA 4G9BA 2R8ZA 4TV8F 4EKEA 5K4HA 2G9NA 2QQFA 3Q40A 1PJ2A 3CNOA 4ZU6X 4B17A 6PFKA 3PFBA 2A58A 1EXVA 4H08A 4ESVA 1OW3B 1EDOA 5ISMA 1R88A 4DV6B 1XTIA 5G0TA 5BT8A 2P2NA 2NYVA 2X5KO 4BLRA 2HSJA 4KO4S 5AIBA 3WTCA 1TZJA 1GP2A 3G8YA 4CM9A 5I7VA 4GYWA 1J39A 5BW6B 3ESZA 5BYAA 5ICMA 4LJ5A 2AE2A 2AJLI 4BV3A 4OX9B 1EFCA 4BTVA 4D42A 1BSVA 3FZYA 2Z6QA 2Q8QA 3MERA 1FDIA 3AONB 4MWCA 1BWSA 1T4CB 2AC7A 2H4HA 3PU6A 2PAFA 5BN5B 4JYCA 5FEMA 2W6QA 3WLOA 1L5MA 2B1RA 4MHSA 4F6RB 3KVVA 1L4YA 4FFMA 5DEOA 2GLUA 3TZ6A 3QMVA 4Q7QA 4C4XA 2GRUA 5EP4A 1KY5A 2FPPB 1KZGB 3L2OB 4L0CA 1MRNA 2CB9A 1VL6A 3M83A 3W2GA 1XXLA 2C8KA 1HYBA 2CDCA 3M4YA 5DRYA 4IUCS 4XUDA 1IDOA 3MZ0A 3EFHA 1DQRA 3ZNNA 3EH1A 4BNUA 1Z3IX 3G59A 2ZUSA 4Y2TA 1R0WA 4RYLA 3G79A 2QUIA 1IY0A 2ESRA 5HQJA 5SZKB 1M8KA 4Z86A 3RREA 3L46A 1OWOA 1XP8A 3TI7A 4YC7A 3F5QA 3GUHA 2P78A 2VF8A 4AQYB 5F51A 1UJ6A 3M6MD 3E4CA 4N7BA 4QU9A 4H1WA 2ZUTA 4RZHA 5AXDA 4AG5A 5CFOA 2JIDA 3B9PA 1NF8A 1Y4AE 3ETEA 3C5VA 4AURA 1TKAA 1Y7HA 1G55A 2AS0A 1Z4OA 3OSUA 4UCXA 4LC0A 4NLLA 2GBCA 4CF5A 5BW8A 4QEZA 3J81k 1NQXA 1QCZA 5FP0A 2H51A 3GEGA 1JA0A 3FLAA 2Z8YA 1MJFA 2YJ6A 3FPCA 3I0MA 4WI1A 3HO1A 2UZ3A 1W35A 2HHAA 1IZZA 4ZCLA 1FFXB 1XCOA 1XMVA 2D8AA 2DQKA 3KAJA 3RG2A 3WO0A 4BHTA 3DW3X 5T3UA 3DHEA 4F0JA 5IKEA 2HSDA 4Z4IA 2NO7A 1FRNA 5HS6A 3UG7A 5FADA 1ONSA 3T12A 1QGYA 3UQYS 2SCUA 1KQFA 5IP5A 1RJWA 5KNCA 4JP3A 5ALXA 1UPXA 5IJ0A 1TEHA 4QD3A 2EZ9A 2VF2A 2YWHA 3VO9A 5EJ6A 3AOGA 3ONNA 2QDKA 4YK7A 5GTDA 2AN9A 3V8VA 2YXDA 3F67A 3FDIA 3UXEA 1DKUA 3WQQA 1YMQA 2NZYA 2NO9A 3R23A 2RH5A 3RU2A 3A9TA 1GG5A 2A92A 2BMEA 4LIPD 5LQJA 4B4KA 4MDEA 3L7AA 3DT6A 4LKOA 4CLEA 1QIMA 2XA2A 3E8XA 3ZCPA 5JD5A 4LSMA 2B37A 9ATCA 1VGQA 4CTMA 3I34X 4G4IA 2ZP1A 2NWQA 1V1RB 5PNTA 1U63A 3V3TA 1CR1A 3FNGA 1RLUA 4MCAA 1J8FA 3EIUA 1PJ3A 5F9FA 1IU9A 4FFBA 1NQ5A 2R6R1 2PUJA 4BQEA 3L4KA 5FFNA 1SBQA 1ZK4A 4FN5A 3W6PA 1BXGB 1XVAA 3ZWMA 1GZ4A 1VTKA 1YL5A 1A7UA 2H11A 1N2EA 4R5MA 1NJ8A 1YR9A 1P81A 2GHQA 3H83A 3FPSA 4CFYA 1C7JA 4I4IA 4TTIA 2WAMA 1JAXA 3HYRA 4M0EA 3R7LA 4EF5A 2XQIA 4FGLA 1CIPA 3NT4A 5F9MA 3OIDA 1DC5A 1UBLS 2GCOA 1ZRSA 1T13A 3WGIA 4NULA 4RH1A 1SC1A 2CLDX 2WIBA 5AJVB 1R6TA 1GYPA 1UMDB 1Q16A 3DAYA 2DEUA 4RXUA 4CYMA 3RANA 2HBRA 4D3FA 4IFBA 2FZWA 1GPUA 1SUWA 2VI5A 4MTCA 1ANKA 1ZK2A 4R9RA 4Y2RA 3L6RA 5IXYA 2HZBA 1YA4A 3DB2A 3IVAA 5CFLA 3RNOA 4GMDA 4MTLA 3G2QA 4F4UA 2DHRA 3RSZA 4ZCTA 3EC2A 4UM9B 3AVWA 4K6OA 2PE5A 3DM9B 4PBSA 5DRTA 2ZT5A 3E9RA 4P58A 5FEUA 4TS3A 4Q24A 1ENZA 1DOHA 2I8AA 2W2TA 4WNAB 5HRAA 2EDAA 1JEJA 1U4OA 2XJ4A 4AULA 3JASA 5BWNA 2A0UA 3MTBA 1F0NA 5ALYA 3RVPA 3USCS 2UYYA 3CQ9A 4OOFA 3VR6D 3T3NA 3V8QA 1M0TA 2QVCA 1O87A 4ITRC 1BMDA 5HG0A 2AYZA 2UXDB 1OFUX 4TTJA 4YRSA 4TV9A 5EZ6B 2B78A 3CIOA 3GFVA 3JQ9A 3F73A 5C2JB 3SJAA 2XKBA 2E4VA 3KV3O 4F6LA 2R84A 4IRUB 1QHGA 5EJ8A 4Q48A 3Q3IA 5DNAA 1IVNA 3EFBA 2I1QA 1DUSA 4QLBA 4IMIB 2XTMA 2G5TA 1EFPB 1X0XA 3OP1A 2IV7A 3S44A 3BCRA 3HLYA 3ZDZB 3C1AA 3DMNA 4LYYA 2ZS7A 2ECPA 5H9WA 4C7MA 3B8EA 1NUTA 3EQ9A 1ZM9A 4L9RA 4WQMA 2X0NA 1O96A 4RELA 4XJSA 4HNVA 2UDPA 3SIWA 3RJMA 4R1UA 1MLDA 2H2FA 1RYZA 1DG1G 2D2FA 2BUAA 4Q9DA 1Q1EA 4H77A 4BGVA 1NMYA 5JI3E 4JR2A 1LPAB 2YVUA 3U3DA 3ZVNA 1SVIA 3RYTC 3FJOA 3AFMA 1OI4A 4TV9F 1DINA 3BPSA 4C04A 3LL4A 3RLFA 3B1FA 4EZBA 5J3JA 1SVOA 3ISVA 3NQ41 2PU7A 4J7UA 1V25A 3REFA 3DO5A 3ECSA 3USES 4S1PA 3O93A 1HLFA 2QE7D 4G89A 1DQSA 3NWPA 1UAAA 4AO7A 1LW6E 4GSKA 4Z7OB 4YRLA 2EF0A 5FUBA 3QEAZ 2I7CA 3R20A 3KKEA 6NULA 2VYND 1QG0A 3QKSB 1DADA 5CITA 2GEJA 1JXQA 4E5YA 5FX2A 3UYLA 5FOXA 2CB0A 3OA0A 3ZLUA 2B4RO 2WHYA 6LDHA 4F38A 5I3CA 4MRMB 3T3GA 5L3SB 4IDNA 4YFYA 3HBLA 3TPFA 3A9SA 1YQGA 3MB5A 5J2UB 4MDYA 3IUNA 3RYIA 5JMOA 1TZ2A 3IT0A 3H9CA 2DF8A 4DWVA 2LP4Y 3WDMA 4OSEA 3BDAA 1PNOA 4DJ5X 4QT4A 1UR5A 1Y9AA 1YR1A 2VG8A 4P0PB 1W34A 5DLPA 2Y0PA 4AI6A 2I4NA 1Q5PA 4C4TA 4JJ4A 2C7BA 1U8YA 2HWXA 4S0ZA 2HADA 1QFSA 2Q6VA 4UOQA 4GXTA 2V7GA 4JP2A 5DTIA 3WGNA 5JU6A 2O7NA 4M0LA 5K3AA 1RPAA 3ZCXA 1E2GA 2Y92A 4K6HA 3U4AA 5WRFA 4MYUA 4CLOB 3KSAC 1WP9A 3EARA 3GLFA 3N0RA 1YBVA 2JH3A 4PNEA 3CCCA 1OHHA 4B2PA 4MVJG 3UMJA 1UDAA 1A9QA 4RF4A 5ALDA 4MLCA 3VSBA 3B1ZA 4CQMA 4LXXA 2OMEA 1N2JA 3PXBA 5DLYA 4KLAA 3K1JA 5DDIP 2EJCA 1BJTA 2VOEA 1GGHA 1ZMOA 2XRYA 3BFJA 3X0DA 5A3RA 4DLRA 2C4WA 2FYTA 1GZHB 1K08A 4YCMA 1UK7A 1SN7A 3H2HA 4LRSB 5AESA 2I5PO 3RGGA 1G3MA 2O2CA 5BT9A 1H0RA 2FG6C 2DLNA 4X8OA 4AO8A 1ZMRA 4DR7B 4WXMA 2I78A 2P3OA 4GOND 5EP1A 4PZZA 3S5JA 5HKKD 4DDTA 3I2YX 3PC4A 8MHTA 2GPAA 2HSEA 2YNMD 3NH6A 3ZJTA 4EYKA 1Q0QA 1N9GB 2C9BA 2QY9A 4B2YA 4EATA 2VRWA 3IGFA 3ONDA 4AP5A 5KNCH 3FOAA 2D2IA 1IPHA 2TMGA 4QQNA 1IL0A 4P2BA 3FI0A 1I0IA 4RA6B 3OM9A 1AMNA 3A1CA 4B0PA 4JN6B 4F8YA 2G4LA 3JWHA 3GZ4A 4ZC1A 3CB4A 2RC5A 1RHKA 2AFHA 1R5NA 1WLSA 1ZY2A 3LMKA 3T52A 5BOSB 3HVKA 4PC3A 4U00A 4MOWA 4NV3A 1BQ3A 3KB2A 5ABPA 4MVJM 2IPOA 1XNRB 1T6XA 3D59A 4PCUA 4JB3A 4E7OA 2IL1A 1NONA 2FW6A 4GSYA 1KARA 3KQQA 1JX6A 3T5MA 5IT4A 4B3DA 4FYPA 3V4VB 1GUZA 3W7BA 3ND7A 1E0JA 2GAAA 4FGSA 2I0FA 1YCDA 2LCIA 4RY0A 3WJ7A 3SU8A 4TWIA 2V7UA 4JGIA 4RPJA 3LTEA 4BO3A 4RTJA 2JVKA 3PUXA 4YRRA 1BIFA 1V5EA 1Z2DA 3LLMA 3AKZA 1ISIA 4J0GA 1O57A 2R79A 3N7UA 4LI3X 5EMMA 4EBFA 2UUAB 1XLUA 2ZTSA 2V74B 1A4UA 3EYAA 2OORC 3MRTA 3P19A 4JUFA 1NW3A 1SQSA 3O1HB 3LECA 4ZI5A 4LF8B 4DMKA 2WB2A 1VGRA 3ZVKA 2WPNA 3R5KA 4KXVA 5C3MA 5KZMB 1M8GA 3AR6A 1U7ZA 3TW4A 1Q7RA 1VFNA 2XZDA 3ZE8A 4G67A 2QSUA 3OM0A 4G5HA 1GPNA 2W2VA 3A70A 3REGA 4R0MA 2VHZA 1PKXA 5AHKA 3B20A 4M76B 3UB3A 3EGXB 2DR3A 1BWQA 5AOAA 2OCBA 1LPBB 2EFCB 1HKHA 4L7QA 4BXOA 1COWA 3KYJB 5DM60 1A97A 1GZSA 1XTRA 2WHXA 1NJ6A 1VIDA 4WA7A 4H7FA 1XRJA 2PUHA 1CE8A 4WOKA 3VR5A 1VJTA 1OWNA 4PFJA 5T4EA 3LVBA 2HJVA 1M33A 2RBGA 4EW3A 3UJ3X 1T8RA 1B4DA 2I3BA 1P7VA 4QULA 3CZ4A 1M2OB 3VBEA 1EKXA 4RFVA 4B47A 4MB2A 1WPQA 4EG6A 1U31A 4LJ8A 5CGZA 2DR2A 4Z7NB 2JFFA 3UT6A 1LPPA 1NVMB 3C3JA 3GRAA 2QT9A 1PIWA 4P7KA 2Q4TA 4EG8A 4X65B 4C76A 1B8VA 3SYMA 1VDMA 2H1HA 2ZIUB 2POQX 3ZQ6A 1HC7A 4ZOEA 3F5SA 4XCQA 1ACJA 1L4GA 2EFEB 1L8QA 2C58A 4W7IA 3U4MA 2EP7A 3CEHA 1GRRA 5IDYA 3WGMA 2OL4A 1X1CA 3AZPA 3ZD8A 5A02A 2W90A 1C1XB 5KC8A 3UMRA 1EIWA 3LVRE 4IJWA 3VSEA 2CDBA 5DM4A 1P9RA 5IULC 2XE7A 1USKA 1ZCJA 4L5AA 4LFBB 1K8ZB 1PD1A 2AWOA 2PSEA 2E9SA 3O4IA 2P3QA 3GEIA 4HB4A 4M1ZA 4ROTA 2BMFA 1I5EA 3D0OA 3RYHA 4CM3A 1UP6A 2QP4A 3TE7A 1P3DA 1ZNQO 2HC9A 2Z56A 3MFYA 3ZGNA 3SVTA 3OICA 3ES9A 3LUCA 1EBUA 5B4VA 5I51A 2ZI3A 4G1UC 5CA1A 2CF6A 2QJWA 3A3PA 1EFAA 2V65A 3OCYA 2E48A 3WGQA 2J4CA 1DFIA 4ZVPA 4BNYA 4AJJA 5JNTA 4RTKA 2O0HA 5DHSA 4F85A 2G25A 4KR6A 1K89A 4YRZA 4BX8A 3BFPA 4PPGA 1JE1A 1HE2A 3T9DA 2FETA 3C6ZA 2YKGA 4RL4A 4Q3DA 3RADC 2VHTA 3A10A 4PGAA 4BCCA 3EWNA 1MG5A 4LZAA 1QDLB 1B3BA 1NDQA 4GXQA 2A5YB 3C24A 1YH3A 2VBFA 2X0KA 1EFLA 3INGA 3RVBA 5TMBA 1V5GA 4MI3A 2NLOA 3FETA 2JFGA 3PCXA 2R8RA 2AK2A 5EE3A 4N47A 5FAKA 2R5FA 5K3OA 1ZITA 1GPMA 2CMHA 1PQYA 2GAIA 1GGJA 1UDRA 3KAQA 3O0TA 3ZVRA 5KYWA 3P27A 1LXCA 3W0LB 4WCFC 4TRJA 2V1XA 1EX9A 3DL2A 1MAUA 5SZJA 5TJHA 3C70A 3QXXA 3TM5A 1GN9A 4R84A 1K7CA 2I6GA 4XGQA 4AZVA 4QGBA 1Z0FA 2LW7A 4NVRA 2AHOA 1HEUA 5DOVA 5H16A 3N2EA 3WG9A 1E2UA 3MS7A 4Q15A 2PANA 2WYIA 3MOGA 3WRXC 4BFTA 1MEOA 1EQ2A 4YA6A 4ADSG 1SRRA 2W6CX 3VAAA 4DILA 1HDEA 2B3DA 2WSYB 4RIFA 5KHLB 4JXXA 4DV4B 3IR5A 2H1WA 3QLTA 3BGIA 5KUTA 2P3LA 1A95A 3IV6A 3NR2A 2IS1A 4EMUA 1WTAA 3IJPA 4GMHA 4KITB 1JHVA 4A1OA 4Q1DA 1TM1E 1B00A 4MV7A 5IARA 1IBCA 2HZ7A 3ULKA 5JY1A 5JV5A 5DK4A 3U80A 1FYWA 1CF9A 3B12A 4Y6RA 1P4RA 3H7AA 1E9CA 1H3FA 3IXQA 4TYNA 4JI6B 1CVRA 1F2UB 1J8YF 4OOEA 2VJOA 3A1SA 4YLGA 1HPLA 3RC2A 1TM2A 2JAHA 3K8YA 5FCDA 3ZE7A 3GFRA 4DCOA 1HLGA 3L5OA 4FHFA 4OP3A 4HQLA 3ECCA 3TVYA 5IC4A 5EFZA 4D4GA 5JZMA 4E0BA 1OZAA 1NNLA 4B7XA 1WZCA 3GJ4A 2G08A 3ETCA 4M55A 1E2MA 2Q1SA 2ZFUA 3GG9A 1WD7A 5ALUA 2GZ1A 1JLHA 2IF2A 3GOHA 1G59A 3VDNB 5FNZA 2HLPA 2PMEA 3PI7A 3ZXSA 4AJEA 9GPBA 2W9XA 2B8JA 1MQSA 2RH4A 3E9NA 3R77A 4JU9A 1I7QB 4ZT6A 1N3BA 2O8NA 4RMNA 1HORA 1P74A 3OZIA 2GJSA 1NVUQ 1PF7E 3QKWA 2WPDD 3RYFB 5FTJA 2DLDA 4OXNA 1UKCA 3PC7A 2QWXA 3ZHRA 2C9DA 2WRZA 1E69A 5CW2A 1ZJ5A 3NBKA 3DBIA 1PUJA 4WXEA 1TA0A 1O95A 1NSFA 1AZTA 3NG1A 4GH5A 3DXFA 5ESRA 4BDTA 3AF5A 3O8NA 3GA7A 3IBSA 5AW7A 3W5DA 5TSDA 4JJ6A 1EHYA 5JS6A 3G0OA 3PFCA 1ODSA 2FE4A 3L92A 1SA0B 3W1VA 3U37A 5JRZA 1UT8A 2JPDA 4WIAA 1EVYA 1TF7A 4IXDA 2V3VA 3T61A 1DKPA 1Y98A 3FR8A 4UBJA 3R9XB 1EM8B 2F1RA 5DCUA 2GO7A 4DLTA 1QKKA 4KYIB 3VHQA 3H6KA 3KB8A 2BGNA 3NM4A 4FR0A 3D8HA 1I6WA 1NW4A 4IGEA 3QP9A 4MPJA 3P5SA 1IAQA 2C03A 2XVZA 4GECA 1KI6B 3F8SA 2P2GA 1A9XA 1K1EA 1C0LA 1W6UA 1U0JA 2LPMA 3FLEA 4IS2A 1J99A 2ECKA 4R3UC 2PBZA 1ZIDA 1TYZA 3LQKA 1UQTA 3TEMA 10MHA 1KP9A 3PD1A 1FTQA 3VR6A 2XA1A 1O8BA 2JI7A 1ZOLA 1E2HA 2OG1A 1K9SA 1NVAA 3PC8A 5C51B 1J1UA 2QTGA 4G8BA 5HIKA 5JAMA 3HDHA 4G81A 1NBHA 2NUPB 3RODA 4JYAB 1ISFA 3ITDA 3OZVA 3IIMA 4RK1A 3LCMA 1GTSA 1S2OA 1N5IA 3VR5H 5K0TA 4QOGA 2YS6A 5D86A 3ONEA 3TLBA 3V4SA 3AHFA 1E3WA 1GLVA 4POAA 4C5BA 4Y2HA 4HZUB 1W6RA 1JG3A 1XRNA 2JBHA 3A9UA 4LHXA 4X1IA 2D1RA 4PZ9A 3DYIA 1JHQA 3SJCA 4M36A 1GAQA 5KWVA 2JBAB 4W1RA 5LZ4A 5ALMA 1YFKA 2CHQA 3ZWVA 3WSWA 1PT7A 1KIAA 3Q3VA 1MA0A 3O2SB 1L5LA 3TAHA 4QQKA 2QBYB 1MJGM 4Q4HB 2L17A 1TJNA 2VDMB 2QRNA 2WF7A 5JJBA 1PX2A 2UUOA 1WDMA 3C98A 4NHEA 2FRDA 4WZAE 1OH5A 2O4CA 3PQ3A 3UG6A 1E1CA 5D1HA 3NJ8A 2PIAA 2JLUA 1JH9A 2UU9B 2HXYA 3SR4A 2R7KA 2WUFA 4EO7A 2QL6A 2Z4RA 2C5AA 1GKKA 3W5VA 2ODAA 2ZWIA 4CMEA 4DV7B 2NT3A 2C5LA 3PNVA 1G21B 4ETWA 1D2GA 1U2DC 3N5KA 3TRIA 4QPJC 3D6JA 3M4ZA 4B6GA 2OILA 2VYNA 4GBMA 2HQOA 4PX5A 3S1LA 3S68A 1YFJA 5F77A 1YC5A 5EQTA 3L79A 1WCIB 3HV2A 4U0KA 2YV2A 1DUIA 4J0QA 1Q7CA 2FUKA 3IV9A 1J9EA 1PS0A 3D5QA 3QVMA 1ZM2A 2R47A 4RHUA 4KDEA 1L9KA 4RD4A 1L7MA 2H2IA 2F6RA 3F5FA 4ZOLA 4YAIA 5HJ7A 5ITZA 3TINA 2JIMA 4WKOA 3LUPA 4BZZA 4DJAA 5B7GA 4DNOA 3AY6A 1FEZA 4GM1A 1OFUA 1R5OA 2QYHA 3D6NB 3HMKA 4ND6A 4OHMA 4TXMA 1ZAYA 1TK2A 2J3EA 2WG1A 3SG0A 2ZREA 1USGA 5D84A 5LPNA 3NYQA 4TS4A 2QVXX 2PZJA 2FE1A 3IEIA 3N0TA 4AC9A 3ZHVA 3TF5A 4BJHB 5FBKA 3DLBA 2WF5A 2XE8A 3BMOA 4HNAB 4LDPA 4Q0MA 1ZVKA 3LWZA 4Q6WA 3TH5A 4A2QA 4F1KA 2GK7A 2O5CA 2FZLA 3UWOA 2JANA 4FHCA 2LKDA 1AB5A 2C2HA 4TPKA 1DBWA 1GCGA 3L9WA 4M6WA 5JWOA 1F2DA 3Q72A 1N78A 4ZOLF 4A0SA 1CRWG 2PV7A 5DPMA 3CC8A 2DETA 1H3NA 1R9NA 1LWNA 3Q7TA 2CLOB 3UCXA 4BP1A 2PNFA 2X7HA 4I9HA 4Q7EA 4OI1A 1E3LA 4Z1OA 3DS8A 1C41A 1FJHA 2Q9BA 3EZFA 3W8EA 4DIDA 2R7MA 1TF2A 2ORVA 1NZJA 2ZVPX 4OMFG 3UKJA 1T36B 4V39A 4CUKA 1OBVA 3UCEA 1TYDE 2OMKA 1RRVA 3GH3A 3IVGA 3URKA 3ZGZA 1INLA 1NJ1A 1M1YA 1OIWA 2C3UA 3O3OB 5C1DA 2BN4A 2XNDA 2ZE8A 2QROA 2XZPA 1GGKA 3MGGA 4UU1A 3ZKWA 1LPOA 4DLUA 2JGKA 2HCTA 5CDGA 2JAPA 1E2NA 1S6YA 2WDZA 1ICEA 5EPOA 3U3ZA 4X62B 1VSVA 2W4QA 3DYBA 3MWEA 4HDRA 1FW8A 2I1LA 3GFSA 4CV3A 3PCTA 1BXRA 4DCGA 2XCUA 3EGEA 3K7EA 4CL8A 5T41A 2IYSA 1P0FA 1EI9A 3JD3A 2ZUVA 4P32A 5EIBC 3F5DA 1U3GA 4KJXA 2KSQA 3BA6A 2Z0MA 1CRLA 3ASVA 1QGDA 3DZJA 3NBQA 4REQA 4BE4A 3ZGYA 4IDHA 2YC2C 2ZDQA 1ZICA 2GI4A 1ML4A 4MDFA 1Z6GA 4AZ0B 1P91A 2E5FA 5IN5A 3EG5A 3WA6A 5MDHA 1MBZA 4M49A 3U19A 1JECA 1JPUA 3QWAA 2HMTA 2XECA 3ACCA 4C0HA 4R7ZA 1KAGA 1QLWA 2KI5A 2Q3MA 1S5PA 3KKPA 4LJRA 3L4JA 2H9YA 5I9NA 4YX9A 2PUAA 5DGDA 5JS1A 1WO8A 1EXMA 2PS1A 2RHLA 2HL6A 4CMKA 5HVNA 1CVIA 1HTTA 4RKRA 2AZXA 1ZRMA 5DWQA 4F84A 1VLLA 1ZGJA 3GI1A 3M82A 3E84A 1IHXA 1YZTA 1RQ7A 2FWAA 2PWPA 2XYGA 3TQIA 1TVCA 4MI9A 2XH8A 2Z95A 3CUVA 2OECA 2FKAA 3W8FA 1Z5WA 4DZTA 4MPTA 3GN1A 3X2SA 1W36D 4ZVLA 4M87A 5TF0A 3TL2A 1BD4A 2A57A 3MWYW 2EKDA 2NXCA 4NFHA 5DLDA 4BMDA 2OGZA 2PX8A 4N5DA 2O8BA 3Q7IA 1ORWA 2ZRNA 3NEJA 4OYRA 2FSIA 4DV1B 1XQ6A 3FDJA 4MRNA 4DQLA 3ILXA 1OE0A 1ABFA 1X1AA 4HI0E 1QUEA 4M7PA 5UKDA 4YRKA 2QOEA 3EOBI 4HEA1 4KQFA 2FUG1 3GUZA 5BW4A 3DC2A 4HQKA 5KOHA 4OGGA 4R0NA 4TWAA 2NO0A 1RWPA 4LECA 5KQPA 5HJEA 3ICQB 3CLRD 3JRXA 3SNHA 1NLUA 2ZBDA 4C4RA 3DNPA 4E5SA 1V41E 1ZI6A 2K5UA 2EWWA 1JFSA 4OI2A 3NHMA 3FNHA 1PEKE 1US8A 2NN3C 2PS3A 1C8BA 4N48A 3RC1A 1F8UA 3BXPA 3VR6H 2GASA 1LC3A 3OI7A 1YSCA 4AU1A 1XGKA 3VZPA 2R8EA 3WFIA 4BVEA 4HDNA 1XMSA 3S2YA 5CEEA 2UZAA 2WICA 4KAXA 1E4EB 2WZDA 1QZ3A 3IIJA 3OOSA 4JZKA 4Q6BA 3RI3A 4AB1A 5T5QA 4PPQA 2CKDA 4CQNA 4L95C 4QZVA 1S4QA 3P2IA 4RMGA 4EHNA 3NGXA 3WLSA 5BN4B 4INJA 2IE0A 2Y66A 3TSAA 2CUKA 2HT6A 1FMFA 5DHFA 2JJ2A 5AVXA 1OFIA 3FJ1A 5IHPA 2C4UA 1ESDA 4GIBA 3EODA 5TT0A 3CZCA 4FCTA 1IPFA 3G2JA 4KH0A 4LBWA 4NONA 4Y98A 2HLHA 3U4GA 2F1OA 1IEQA 1W9MA 2WJ3A 7ABPA 1QU3A 1YR7A 4Z0NA 5LMZA 2MR6A 4UUQA 3N8IA 2YASA 3KXKA 2QUJA 5FBWB 2PH7A 3M6VA 16PKA 2GPJA 4LQ4A 4ARZA 2XB2A 5B1SA 3LO8A 1XTBA 1YZGA 4ITUA 1PX0A 1GRVA 4QWWA 5BQFA 1YU9A 2A33A 2DOKA 1ESMA 5HZKA 3LWBA 1TMGE 2D5IA 3RTAA 2HX1A 2XW6A 2QIOA 3CMCO 3N70A 3R3VA 3EPLA 3ICPA 3K2EA 3RRJA 4RIIA 4DSUA 1CERA 3T7JA 1Y7LA 3UHAA 2E4UA 5H59A 3E15A 5IRCD 3GLIB 1SQ0A 4GICA 3B6EA 5EE0A 4OQNA 4X94A 5FYDA 5D1NA 4C0LA 1L5RA 1KS9A 4OSPA 7ADHA 3DAGA 4B3SB 1QVVA 4LK3A 4O63O 2AR0A 4M1EA 1AURA 4YWJA 2PMFA 4TKMA 4G5YA 1RRCA 4CEIB 1YTUA 4IKPA 1AKEA 3L6UA 3DPIA 4O0MA 2X4IA 5DM70 2HQBA 2CVPA 2M6SA 3AI7A 1XD2B 4R69A 1CUWA 4DCNA 1SCBA 4RU1A 4CIDA 3R75A 3TG8A 4UU8A 4KDCA 3IR6A 2M2IA 3FLBA 4JFAA 4QUEA 4ER0A 2QQ5A 2V7BA 4EYEA 1LLCA 1OR8A 3CE6A 4Y6GB 5KYYB 2XT0A 1I2DA 3EB9A 1I6LA 3I6ZA 4BJ5A 4FM9A 3CH4B 4CKWA 4GLLA 2IU4A 2JCVA 3QWFA 3ZGXA 4DA7A 2D2VA 1BYUA 2N9UA 1MB0A 1J2RA 3PUWA 5EYPA 4GG1A 5SYMA 3D43A 3CWQA 3LYUA 3TEJA 2PVPA 5GQSA 3TCNA 1DLJA 3GMSA 3DVAB 3H87A 3K71B 1ZG3A 2FH5B 5FLXA 3G23A 5LMNB 2OGTA 3KK0A 1NPTO 4KUEA 5AKEA 3F8TA 1XMPA 1KH3A 1IVYA 1HV8A 1B8OA 3JQEA 1NRWA 5C35A 5ERXA 3HN6A 2NNWB 1GL6A 3ORFA 1CJTC 1TT5A 3EBPA 3PXCX 4LJAA 1RM3A 5T64A 3W6OA 1GU1A 2CFCA 2O2YA 4C6TB 2PUBA 2CNOA 5MFZA 1RJEA 2Z2XA 2IWRA 1GV1A 5CH8A 1FTSA 3RQIA 1OFGA 2UYOA 4RFSB 2IYUA 3QBEA 1YFZA 2QDXA 4LJSA 2GAFA 3D7KA 4X60A 3C3DA 3STXA 1DWPA 4HMQA 4P4GA 2QSYA 2X5JO 3RFVA 4QICA 1U0NA 3QVXA 1QV7A 3OMWA 3R6GA 4AZSA 2ZI4A 4MP8A 2B4YA 4LXQA 3BA1A 3CVOA 1IJBA 1HT3A 1FSSA 2GJ8A 4D81A 3GD5A 4XRRA 2WPDA 3I9JA 4B2IA 4OO3A 4CQLB 1AZWA 1VB3A 1ODCA 3PEEA 4WBXC 2WU8A 1WTCA 1LDYA 2PMKA 5JFGA 1LPSA 2YQ4A 5E0KB 1BKSB 3W77A 5JDCC 3BRSA 3DEYX 5BVHB 3GWZA 2IHKA 1IHUA 1NJFA 1NSTA 1GCOA 1CZNA 1YNOA 3R8CA 4JBLA 1AA9A 1Z0ZA 4PX9A 4Q9NA 4PBRA 2LCFA 5C7OO 2EP5A 3FNFA 2JGIA 2IZ7A 3BBLA 3GFOA 5AH0A 2LBPA 3IR7A 1PW7A 2ZSFA 4RC9A 3SF8B 3A6GA 4TTPA 1AT1A 4FZ5A 4A3SA 6ADHA 4B82A 2REBA 4FW9A 2RHHA 3S1AB 3CIFA 2D0OB 3Q8WA 3V6MA 1AOXA 2C5SA 2UZIR 3JQ7B 1HQKA 1Z4JA 3GBVA 4QU8A 4BKMA 4CW7A 5IZCC 2HQSA 3R40A 1TU4A 4KQ6A 3CKLA 3DT8A 5DE3A 1VHLA 1LS1A 2X9NA 1GYQA 3E22A 4BQFA 5BV8A 4WK6A 1BE8A 5A7HA 2GN2A 4RJLA 2HHLA 3DMTA 5CK5A 3Q3CA 4E14A 2WG0A 4JP1A 3BJEA 4MUBA 2GOYA 4LJ6A 3U7QA 4EFLA 3ORQA 3RC3A 1JLLB 2GCEA 3QBTA 3EXFA 2QRQA 3M6IA 4BE7B 2X40A 4MV9A 4BFZA 3G8AA 4QM7A 4H6VA 1G20E 1VCOA 4C7OA 1MX3A 2IODA 2PKQO 5A0FA 2PXCA 4EB6A 1FNSA 2ODWA 3D2BA 3T7DA 1NFQA 2QNIA 3ELWA 5DSTA 1Y42X 3P71T 3WL6A 2XYQA 3EHDA 3OQ1A 3RW9A 1ESCA 3H5IA 4IDPA 1Z6AA 3VYVA 4EUEA 4EAAA 2GYWA 3BL6A 3FKQA 2L82A 3HABA 1M1ZA 3JZMA 4NBLA 3QBJA 4AKTA 3I01M 1BROA 3AV0B 4ZICA 1DJQA 4RD3A 3CF0A 4LTDA 3SQOA 1U28A 1DBSA 5AJWA 1Z0JA 4BEJA 1A69A 4H18A 1U04A 1VSUA 4R1TA 3EGWA 4NV1A 4PIVA 2BY4A 5JD4A 4QRDA 3LXUX 5EWMB 1P7WA 3PUYA 4H1VA 5AJXA 4ZEVA 2JEZA 1NR1A 1YB6A 3IRVA 3MYRA 3D02A 4LCEA 2HV8A 4OQZA 4K6GA 3VTAA 5JVDA 3UFXB 4MO2A 5DYGA 2J85A 1ZOPA 4U2GA 4XM0A 4M8KA 3N0WA 5JSHA 1LJ8A 3ZCRA 5JI2E 4GQAA 4XQCA 3V32A 1RE1A 3T5BA 2FWPA 3ICCA 5L3VA 1IUPA 3OD5A 4WN9A 3BHMA 1VYHA 5EY5B 3RHZA 1KO8A 1Y8QA 1ZGZA 4GE0A 3IUPA 3EQ2A 1ZN9A 3EZYA 2PUGA 3TGLA 3F6SA 2GNOA 5BSHA 2VP3A 2Z43A 4M0CA 4X5OA 5FNVB 1XDGA 3BK1A 2N42A 5DTQA 3KJQA 5CLGA 1JQEA 1EZZA 3AKEA 4COKA 4WDRA 2QL5A 4OMCA 3KSZO 1XD9A 3U31A 2C2WA 3C3EA 3MMPA 3TLMA 1NE7A 2A8YA 2GBFA 4TKUA 5HIAA 1G41A 3BQMB 2XB4A 3JAKB 3SXPA 3BRQA 3ROTA 2V0NA 3GFGA 3OEEA 3D6UA 1XXHB 1GD1O 5JVDF 1CQZA 1DQYA 4GGMX 1GPBA 2D54A 4DSAA 3KKZA 4N6OA 3BXGA 2QUBA 4Y0AA 721PA 4Q18A 3AM1A 3SCZA 2QGNA 4LTMA 4JLNA 1BX0A 3CISA 3DL7A 3T5DA 4HGPA 4D26A 5FTKA 1ZH8A 4GMKA 4XPIA 4ZU1X 1UK6A 3SHTA 4BVHA 1EZ4A 2ZIAA 5DYIA 3PPWA 4LG1A 3GLTA 3L82B 3PPYA 4GEKA 4PX3A 1JVSA 2GILA 3EVBA 5B3JA 3TDKA 1M7BA 1P3JA 2ZUEA 2Z5VA 2OPBA 4OHKA 4F86A 2P0AA 1UIRA 5NULA 2ZATA 3J7TA 1H6CA 1KF0A 2LR0A 2XDYA 3CR3C 3G1WA 3OIUA 3P20A 3MJTA 4QLAA 4RV9A 4HCJA 3SFVA 4R2XA 3RAEC 4XYLA 1C2TA 4E33A 521PA 2V7PA 3FRJA 3M9XA 5HKOA 2X3UA 3OPYA 1RJ9A 2DQSA 3L77A 4B32A 4YEDA 4EA7A 2AW5A 2VNHA 2O2EA 2AG5A 3F9RA 4FVTA 1TCBA 1RMQA 2ZJFA 5E3HA 5JISA 1KJNA 1YS2X 3NHWA 4WRRA 3DEFA 3UUWA 3DF7A 4B09A 1X7GA 4QHSA 4IDAA 4GOMD 3N2YA 4J75A 3VBCA 1W581 4LMAA 1L5WA 3CZMA 1RWOA 3EPRA 3K2IA 3UY4A 2REQA 2RG1A 1DOAA 3NWEA 4FQ8A 1MGOA 4XX0B 5DBHX 3RTGA 1MNQA 5B1EA 2PX2A 3KUCA 4KQIA 1U7UA 4DGQA 1SUCA 3NBXX 4JMLA 4WBNA 2H17A 4Q9JA 3SZMA 1TPYA 5GOZA 1FRQA 2QRVA 4EB8A 4QJ4A 4ZAWA 3EXAA 1Y7TA 4DRXB 2PUCA 3EQZA 2PS9A 4MCJA 5HKLA 5K8CA 2UXBB 1EP2B 4D4KA 2XWQA 4C3OB 4J2HA 4C1NA 4IXWA 4GI2A 4NZYA 4EQ6B 4MVWA 3NVKI 3KTAA 4IH4A 1DAGA 1GAWA 1BJKA 1T0HB 1H2EA 2DYKA 1RTKA 2PLAA 2QPTA 4PFSA 2V4MA 2ZKIA 3JZAA 4W1SA 1YCGA 2FDXA 4ZREA 1P7YA 1RCFA 3TLGA 4HVCA 1JJFA 3JALB 3QLVC 1E99A 3ZWXA 4B45A 3D3KA 4BP3A 3HUEA 1FJXA 4ZQBA 5IJ9B 3H8VA 4ZO6A 2XEDA 1BMFD 1QS0A 1UXIA 1RWQA 5KSZA 5ALEA 2ZVDA 5CT8A 4X20B 1B2RA 4FNGA 2QNRA 3C6KA 2I8LA 3TW8B 4EJFA 1WJGA 2P4HX 2R11A 4EVRA 4LXGA 1I0ZA 1TZCA 2P9FA 1TQ8A 2WV7A 4G56A 4UDYX 2BHSA 3VISA 5C5DA 5KYTA 1FYDA 1TIBA 2W37A 3KR1A 1B6RA 3LBIA 4HEA6 3EEFA 4FNMA 2FUG6 2QD1A 3FPJA 3ZHOA 5AM0A 1RE0A 2GPTA 4E70A 4OHYA 1Z74A 2CVOA 2B5OA 2FFAA 2A84A 2FR8A 3C3PA 3PGXA 4TYQA 1H2XA 5B58T 1JE0A 2AR9A 2FMIA 2GYVA 3B52X 3U39A 2BISA 2V6MA 5DGTA 2GEUA 3BGOS 5FPTA 2IQ5A 5KKAA 1G19A 2QZPA 1D6JA 1G8KA 3H97A 1VE1A 3IE0A 4FDTA 4HRAA 5AO9A 2CXQA 3ZNOA 3AXTA 3DLPX 4QELA 1P0CA 1S8AA 3EQ8A 3L1VA 4I81A 4ZEXA 1E2EA 3EXG1 3M5DA 4I4TA 1HE5A 4AQ7A 1RAGA 2ACEA 5IM5A 4R1LA 2ZRHA 1LDBA 4KODA 2QAGC 1S9DA 4KE6A 2NGRA 3OETA 4QPPA 3AP2A 4TQAA 3R8XA 2P6MA 3GUVA 3IA7A 2FB9A 4NMMA 2QIPA 1R10A 1R4MA 2W2KA 3TK1A 1CJKC 2BTOA 2I3ZA 3ECAA 3FF1A 4Y2PA 5FTWA 3K1AA 3REQA 1JHXA 1WQ3A 1ZGGA 3H2BA 3KZKA 3NOXA 4RY8A 1GILA 2I7XA 1BA2A 2AN1A 4YJ3B 3W7VA 3MJCA 1KFJB 2ZYTX 3MGAA 3FOFC 4F21A 4J49A 3P9KA 4JJEA 3NMUF 1DTSA 4CODB 1TJ3A 2ZITA 4TXNA 2H85A 1Y1KE 4L6AA 3ZU3A 1AQYA 1VJRA 5D00A 3FVRA 1YZHA 2YBDA 3ZHBA 2IC5A 4EI2A 2XB9A 5AHOA 1SBHA 4ILEA 3O03A 1U3TA 3RCBA 2ZRIA 3MCWA 4R16A 1CR4A 5E6SA 4Q05A 4BIMA 1BE1A 2QYSA 2LCQA 2AA3A 2Q8NA 3EZ2A 2C4VA 4NYMQ 2J0QA 2I4TA 3TIXB 3F4LA 3W5JA 1QTQA 1JHUA 4DOMA 2O23A 3QYJA 1NBWB 2DTDA 3LX4A 4KZPA 4HOYA 4DUYB 2ORYA 1QONA 3OEWA 4QO8A 1NXWA 4CT4B 3KLPX 1T4CA 5FUQA 4EENA 1GNPA 3K70D 4NDAA 1XU4A 4IJ6A 3NBZC 3OA2A 1EFVA 1EP1B 4BC1A 4CEHB 3DLHA 1G64A 2QYOA 1LTQA 1Z6QA 3KOZA 4RLSA 4BASA 4MGKR 4AUEA 2OD2A 3BD9A 1ZZGA 3QU5A 4Q7KA 2FZEA 5DN9A 1R9GA 3E0XA 4FIZA 4AK9A 2HLDD 1AN0A 3C41J 1H9AA 3HSSA 1ICIA 3HBJA 3LD9A 4P9NA 4IIBA 2XJ9A 2C3OA 2IOHA 3RB8A 1NN5A 3BN3A 4HH3C 4BWVA 1N33B 2BGGA 1E5QA 2DFPA 2XIJA 3EUEA 4BJ1A 1JFVA 2H7VA 3HCDA 1LLUA 4KE7A 2MWMA 3DDWA 4NMWA 4CF3A 4EJ0A 4XEUA 1P9WA 2OBFA 1IQUA 2Q4OA 3BF7A 3L1IA 1DIRA 5ALNA 4ZDJA 3UKDA 3VI4B 5JO0A 4NBVA 5JROA 4HS4A 4X1OA 2WD7A 1K86A 3WGYA 1VP3A 3SVLA 4L02A 1BDHA 4I4CA 5AI8A 1ZC3A 3CRW1 4JBGA 5LOVB 3BRWA 2Y9MB 3KWMA 4UQOA 1XZEA 2Z57A 1VXRA 2JGDA 3BMXA 3NYWA 1BW9B 2PPLA 4HFNA 4Z4HA 1R27A 3H9BA 1J6UA 2P1ZA 3MGBA 2DQ4A 4YROA 1GY8A 3C8UA 3G5UA 2PL9A 3FX2A 4PG4A 1FVFA 2MSDB 4XM2A 4KYVA 5AI9A 4WLEA 1FFXA 4E88A 2VHCA 3QF4B 5I7HA 1VIYA 2D0IA 4EYOA 4J9UE 4ZRDA 5JCXA 3OZSA 4ICIA 1TE2A 5GIOE 3NH9A 2NQ8A 1QK5A 4F4HA 1RADA 4H4DA 4P4TA 2C1ZA 3CVUA 3OX2A 5CX1A 4TMYA 2F8LA 3A1FA 4QX6A 1TC2A 3O90A 4Y1GA 5HIJA 3W5AA 4W1QA 4WY5A 3KSUA 4GLBA 2I4MA 1CFZA 3LI2A 4G2NA 3QLJA 1OGYA 1XE3A 3BWDD 2X8JB 4A92A 1J00A 1QWOA 1G6OA 5E6RB 2D8MA 2QTRA 1SCJA 3KV1A 2LDXA 4U5QA 4MR8A 4JNCA 5CH3A 3VKUA 3MLAA 1ODFA 2V7XA 4OD0A 4BMNA 4D41A 2Q27A 4ETIA 4BO2A 2IUYA 3HI6A 3AR5A 1U3WA 2EJVA 2ZXFA 2C7QA 3E81A 3WSTA 2C2KA 2Z4TA 4UTZA 1CPYA 4TXLA 1LH0A 3LL7A 4PC6A 1UPTA 1MXFA 1Y6JA 1J9GA 2PSSA 3NAQA 3PKJA 1HTBA 3V5NA 2W8BA 1FB5A 2AG8A 2XGGA 4FFPA 3SIPA 3P0JA 2OO5A 1XKLA 4YDQA 1BXGA 4JJAA 4Q1CA 1J0BA 2C92A 4QXPA 3ZWO