1TPZA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
402
structure length
395
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
total genus 147
structure length 395
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tpzA02
4HAZA 1E96A 1KJWA 1FMLA 1XEWX 2RHDA 3KUDA 4JYCA 3EWAA 4RVCA 2ZRGA 3GLFA 4JIMA 4XWAA 4UXIA 2G83A 4ASUD 4Q7JB 1NG9A 3WNCA 1Z0KA 1Z0FA 3EZ9A 1IBRA 2JEOA 1VCIA 3CNLA 3I1FA 4D0GA 4LPKA 1W7AA 1E0JA 4IOJA 4NPHA 3GLGE 1R8QA 1M7BA 2FSIA 1WRBA 1KSJA 2BBWA 2IA5A 3F3YA 3OEHD 1YKSA 3B82A 4BE7B 2QP9X 3KXLA 2JGNA 3KKMA 1E9SA 4GOKA 1ZD1A 4C2UA 1TF2A 1ZUHA 2IHBA 2NOAA 4UNSA 3ZS8A 4DLZA 4DLTA 3VKWA 4Q1AA 1ZC4A 4B75A 4Z8XA 4ACAA 4P4SB 4AG5A 4B6FA 1E9CA 4FW9A 4FWTA 1Z06A 1UEJA 1Z3IX 2HDNB 5LB2A 3RWOA 4CW7A 2EFEB 1CJKC 4ON9A 3FOZA 1KY3A 5EE5B 3WMGA 1LNZA 3TVDA 3O8BA 1VG0B 2QQEA 4ZI3A 2X2EA 4AYXA 3ETLA 1GNPA 1QHNA 3AEZA 4ZIRA 4PZZA 1OW3B 2BHRA 1ELOA 1JJ7A 3RAPR 1E2FA 2OV2A 1E0KA 4POAA 2ZS7A 4LJ4A 4LPSA 2D74A 2IXGA 4OI1A 4EPVA 3BB3A 1TF7A 5HKKA 3KQLA 1EXMA 1OKKD 3MWYW 2PEYA 1Z6AA 3SI7A 3K0AB 4IDNA 3K0AA 4GT1A 2IYQA 5HPYB 1GSIA 2GEVA 5JHGB 1W4CA 2FNAA 4PZYA 4W7SA 4D0NA 1OYYA 4JKIA 1NIJA 2J7KA 1IN4A 2VQSA 4MKFA 3UMRA 3TH5A 1KI9A 3W6PA 4BGDA 5JMTA 3GMTA 1YRBA 5TB5A 4A82A 1AA9A 3GLGB 3GLGA 4PHHA 1NP6A 4NYMQ 4Q1CA 4OL0A 3QUSA 3DPUA 2O0KA 3JZAA 3P4YA 2FMXA 3HP1A 4UNRA 4A8JC 2CBZA 5FTJA 3NBYC 3Q72A 1A1VA 5DYGA 5EXXA 1G6HA 5G40A 4TYWA 2QQ0A 2G88A 1OH7A 4NYJQ 3OEEA 3I61A 3L2OB 1Z2CA 4E09A 4LBVA 2I1VB 4EPYA 4Q03A 1WMSA 1RJ9B 1RJ9A 4FMCB 1COWA 3ZVMA 4JLBA 1OF1A 2OAQ1 2YYZA 2GETA 1E6CA 1KK2A 3GJ7A 3G82C 1GRNA 1XZQA 2KI5A 2QT0A 1VIYA 3B8HA 4OI4A 2VO1A 1W0KA 2XOKA 2JJ1D 2WV9A 3CO5A 4HB4A 4TLDA 4DCTA 3EXAA 2V1UA 1MRSA 5FPTA 1SVWA 1H8HD 1ZVQA 2J7PD 4QBGB 1PV4A 5CDFE 1IXSB 2ANBA 3B9QA 1SXJB 1SXJA 2XZLA 1A2KC 4LC1A 1DG1G 2GJ8A 4HLCA 4I4LA 1SVOA 2IYRA 2PT5A 3SYNA 2RGNC 1AZTA 2BC9A 2XNDA 2B21A 3ZVLA 2ZRJA 1P3JA 5CJ2A 5SZHB 1RRGA 4J0QA 4PPGA 3I4LA 1N6PA 3EIQA 3FFAA 5K8LA 3O8RA 1IJFA 1JNYA 4F91B 2TMKA 2DHRA 5IT5A 2OAP1 4Q9HA 1CU1A 2ASEA 1UBEA 4KYUA 4DVGA 1BYUA 4KVAA 3FWYA 1II9A 1MKYA 5L3SB 2ZE8A 1F6BA 4DLVA 5L3SA 2CEAA 2IS6A 4Z1MA 2NGRA 4AC9A 3N5CA 3DO6A 1XJQA 4UNPA 3DKVA 1W5SA 3KQNA 5F9FA 3L0IB 2QL6A 1ZIPA 3IGFA 3SJZA 3I72A 3B78A 2IHYA 3AF0A 4TLCA 5JRZA 2WPDD 5HTKA 4P32A 4A0RA 1KI2A 1X8LA 3MMPA 3FHOA 4CF7A 4ZPXA 3TIFA 3RS5A 4DCSA 1G7TA 1KMQA 1S2MA 4NBSA 1ZNYA 2E9SA 4WVFA 1S9HA 3RANA 4GBMA 2A78A 3RHFA 3OE7D 2R62A 1MV5A 3EG5A 5KOYA 3PEYA 2IYYA 1T9HA 2J1LA 4QHYA 4LJAA 2QAJA 3V00A 1UAAA 2EFCB 2V1XA 3U3OA 3A6PC 1TAGA 4MGIR 3U7EB 5JI2E 5HR5A 3WYAA 2IX3A 2P6UA 3W3AA 4RCZA 5CDFA 1KIMA 1IXZA 4QNRA 1Q3HA 1XX6A 3G5UA 4DDVA 2D62A 2GILA 3LXXA 5B58C 5FOVA 4MDEA 1HYQA 2VSFA 2RGDA 4Q4JB 2GXSA 4Q4JA 5DIFA 721PA 1IM2A 3WBJA 4GP6A 3WYFA 4TT3D 3KXKA 3RRYA 2WMOB 5KDDA 1NN5A 2KSQA 5FPHA 2ONJA 1XCGB 1MO6A 3M6AA 1X86B 4CZ2A 2QMHA 4MYUA 4FMDB 4RY2A 1E79A 5DYIA 2EFGA 2FZ4A 3RS7A 4EIWA 2YWGA 2OT3B 4PC3A 4PAQA 1ZM7A 2ZRAA 3NH9A 3SJAA 4Q1FA 1WQ1R 5F3WB 2FE4A 3EASA 4LHYA 4CT5A 2EWVA 1HY3A 4C9BA 2XJ9A 4HDOB 1OIVA 4M4SA 3SN6A 2ZUDA 4N3NA 4ASUA 4RZUA 4EPWA 3V9PA 1YZTA 1VG9B 4JLNA 5DO9A 1FQJA 1ZNWA 1CJTC 1DG3A 1RKBA 3X1ZA 3QI2A 3PIRA 2XB4A 3ADBA 1O87A 4XTCS 4Z8YA 1TNDA 3VNVA 1IHUA 1MT0A 1QHYA 5HE9A 1RFLA 3C5HA 4ZI2A 1E9BA 3OEHA 3QXCA 5IRCD 2RGXA 2J45A 2YNMA 3PEUA 1G8YA 4DRZA 3LBHA 3ZZ0A 2ZRFA 1OH8A 2ZM5A 2C96A 2ZYWX 3DMDA 3HU1A 3BK7A 3K0CC 3TR0A 1GITA 1EFCA 4B33A 1JR3E 4B43A 2D7DA 5HZKA 5FFMA 2F7SA 2CCGA 1G1MA 1UKZA 4FCTA 4LDJA 3VR3A 4B3DA 4YC7A 1DAIA 4PPQA 1G21E 3BAFA 2FDCA 1GWNA 3CKLA 5E3HA 4DSTA 4JVLA 5BQ5A 1NBMD 1CF4A 4AKGA 4WZAE 3SEAA 2QE7D 1OIWA 4N0EA 2OBLA 4M1KA 1FOEB 3V4FA 2UKDA 1IN6A 3SJCA 1Z29A 2WKRA 1AGPA 2GAOA 2PX0A 1YQTA 4TL7A 3GD7A 1P9RA 4PPFA 4Q47A 4XWOA 3VTKA 1E2EA 1QDEA 1OKKA 4CT4B 4MITA 2QNRA 1SVIA 3T35A 4BWYA 3Q5DA 4MRNA 1A2BA 4PC7A 2C9OA 5J4KA 3MSXA 1AIPA 1D2MA 2FX3A 4GZLA 1GVNB 4JBYA 1IONA 2OBMA 2H17A 2R9VA 2AK3A 5KUTA 4OYHA 3U44B 4WAUA 3AGQA 4KO8A 1T0HB 3U44A 1Z63A 4QJ4A 5KO2A 4DDTA 1N5JA 3FDIA 4R9UC 3HPQA 5AUOB 1S3GA 1P7CA 2FWRA 3B9PA 3WRYC 2F1IA 2FGJA 1RYFA 3FYHA 3QQ5A 3BD9A 2Z83A 2BBSA 3BRWD 4IW3B 3JVUA 3SHFA 1RRCA 1JR3A 3RRNA 2VF8A 4CEJB 4CEJA 1QHGA 2VA8A 1JJVA 4BLPA 2I3BA 2WJJA 3EZ7A 1V43A 1F5NA 2ZI6A 4NONA 2RAPA 5LD2B 2WBLC 3H2YA 3Q8XB 4NL4H 4XD7D 3RSOA 2ZAOA 3MJHA 4LOAA 1JBKA 4QHSA 5DNYB 5LDDC 4BFUA 4DDUA 4PANA 2WWWA 3OZXA 3W6NA 2JJ1A 2HUPA 1P4SA 3NDPA 4B44A 2OE2A 2FZLA 1H8HA 1RW4A 2J7PA 4F7WA 3CF0A 621PA 4GRAA 3QNUA 5E7IA 4TTPA 3UXMA 5KNBA 3H84A 3MD0A 3CR7A 4F93B 2IXFA 1KMHB 3O8DA 1KMHA 3BXZA 4EUNA 3ASYA 3QY0A 3OFND 3PUYA 4G3XA 4XIGS 3EA5A 2C5LA 3GLHE 3T06B 3FHTA 5DISB 4BRUA 2ORIA 1LF5A 3GJ5A 3BORA 2RGGA 2PEZA 2EQBA 4M1SA 1GAJA 4NP6A 4OQMA 4RKFA 4MKIA 4Q9IA 1RC8A 3L8YA 2JCSA 3IUYA 1VCOA 1TTTA 3AVYA 2AKAB 4KBFA 5EE9A 2ZETA 1ZCAA 3IO3A 1E9RA 5BYKA 4Q4HB 3NH6A 1ZU4A 4Q4HA 2WPDA 2C9CA 3BGWA 1AZSC 3EA0A 1I4TD 2V55B 1KOFA 2ATVA 5FBWB 4JLMA 3VHLB 5EJEA 1AS0A 5L3QB 5L3QA 3CLVA 4DLRA 4R71A 1M7HA 1GRQA 4HDQB 4GMDA 1E1RD 4HLUC 5G41A 3OE7A 3ZJYA 4OHYA 2WWXA 1TADA 1P6XA 1ESMA 2DFLA 4KBGA 1G16A 3R7WB 3VX3A 3R7WA 1AKEA 1GM5A 1G17A 4LI0A 4LHVA 1E69A 3OAAD 3SYLA 3TQCA 2R44A 3Q9LA 4JT4A 2OFWA 2V9PA 3R9WA 3IPYA 3N2IA 2IYVA 4KXFB 1PLKA 4QM7A 2G6BA 2F6RA 4LY6A 3J81k 1NSFA 5D3MB 4QGFA 5D3MA 3RS2A 2QP4A 2YWEA 1YZQA 3U6BA 3ZH9B 3W5IA 4TT3A 2CHVA 1EK0A 3CONA 1QHHB 2V6JA 3NIBA 3TVTA 1QHHA 4TYYA 5EP4A 2BKUA 4XVQA 2ERXA 3GLHB 4FCWA 3GLHA 5GJBA 4Q01A 1EWQA 1SZPA 4ZDWA 4KLZA 5AJVB 1U98A 3X1YA 1DO2A 4ESVA 5GVSA 4XOIA 1CR0A 4TMVA 1G19A 2IF2A 2QU8A 1WF3A 2QN6A 2YHSA 4ZCLA 3KL4A 1JI0A 2VPPA 3MGCA 1T3SA 1TUEA 5KDLA 5FOTA 3WP0A 3CH5A 2OILA 2GXQA 2BCGY 3AGPA 2HF8A 3ZVNA 1E94E 5HCIA 2H8KA 2BDTA 1VIAA 5CITA 5JS7A 1OXSC 5B64A 4L9WA 1KZGB 3ZZTA 5BXQC 4KI0A 3U3JA 1WBDA 4Q7MB 4A4DA 2OEPA 3ZD6A 2XXAB 3X1XA 5UKDA 4DLYA 4LJ6A 2XXAA 2GKSA 5J4LA 1RIFA 3WXMA 4A92A 1E9AA 1NN3A 4YQFA 2VHTA 4LHWA 1UADA 1XB2A 4DLWA 1CJUC 3BFXA 4IHQA 1XDBA 4DEYA 1HT2E 3KJHA 2DFNA 2NPIA 3QF4B 4IDHA 1N25A 5JEEA 3U5ZB 4OI0A 4U7DA 3R9IA 1AJEA 1QHXA 2QP3A 4PSKA 4BRWA 1TU4A 5KU1A 1UFQA 6Q21A 2JDIA 1NBMA 1U90A 3BH6A 2EWWA 1SHZA 3D8BA 3DDCA 4D6PA 2Q0HA 4A0FA 3W8NA 521PA 5D3QA 4IEIA 1HT1E 2CE7A 3U2QA 3PUVA 5KPDA 1RE0A 2FSGA 3HPRA 2PJRA 3CX6A 2A5DA 4E03A 2ZRKA 5E95A 2QEQA 3B7GA 5AJXA 4WXPA 5TY0A 2XTMA 1OH6A 1NL3A 2DWOA 5J5CA 4A6XA 1U99A 1KDRA 4AY2A 4OJQA 3KB2A 2FF7A 3ND8A 4TSFD 3N70A 1US8B 1I2MA 1NKTA 1P9NA 1US8A 1SVKA 4IKEA 4LCBA 4Q1EA 5J4HA 2JLZA 4M9QA 4LV5B 3ZD7A 2HF9A 2OFOA 1W0JD 5KSPA 2GVDC 1N6OA 3GLIE 5JI3E 1ESNA 2V8OA 5KSOA 1OV4A 1G7CA 1G8GA 3CW2A 2J0UA 2XNSA 2BKEA 3A8TA 1JECA 2HJGA 5KDOA 2H92A 1XMIA 1W47A 2O5VA 2MSEB 2WTUA 3E2IA 4JLVA 3E5HA 1J70A 3GJ3A 1BIFA 4EPXA 5FUWA 1QHSA 1DPFA 3T5DA 3AUXA 3KDSE 4WZ6A 2HCBA 4CVNA 4DCVA 4YMSA 4QGHA 2VIIA 3LQQA 2YKGA 1WXQA 4UJ5A 4UJ3A 3U7GA 3MUFA 5SZKB 2IF0A 1BMFD 2QI9C 4DDWA 3UANA 1TU3A 3EARA 3KQUA 2QTHA 3TR5A 2PZFA 3IQXA 2DWPA 2NIPA 2PJZA 2H5EA 4C2TA 3B1ZA 2VRWA 2ZI4A 1R2QA 5TV2A 3GLFE 5CIWA 1ZNZA 3QKTA 1C4OA 4Q00A 1FNNA 4CDGA 4LZZA 1OFHA 1XCMA 3LW7A 2W2TA 4YXWD 3WP1B 4AD8A 1Y3AA 2QPOA 2YWFA 4JL8A 4LHXA 4F4JA 5KHOC 3IO5A 4CYMA 4MYHA 1FUUA 2X77A 4C4PA 1CBUA 3I92A 2RGEA 1F3OA 2ZJYA 3GLIB 2WWFA 2QM8A 4KODA 1HH4A 1H8ED 2ORWA 3P26A 1EG7A 1IJEA 4CEHB 1FFHA 3M0EA 2HYIC 4TMWA 4KFTA 4CEHA 3FB4A 1NN1A 4S35A 2R65A 3HU2A 4M9XA 4UXJA 3PXGA 1ZU5A 2OSBA 4D4JA 2VEDA 2IUUA 1L2TA 2QA5A 4K8OA 2Z43A 4DSUA 3LBNA 1OIXA 4FINA 2OZEA 4A0GA 3T12A 4W5WA 4B74A 1D8TA 1IY2A 3T34A 2QROA 1QVRA 2IEYA 1Q12A 1M74A 1VYUA 2BCJQ 2XZPA 3QOFA 1DAKA 4AK9A 3N2EA 1X1SA 4MRPA 2ODWA 2EU8A 2Q3FA 2N46A 1XTKA 1E1RA 3OIUA 2G3YA 5FBLB 5H70A 1D2NA 4LJ9A 3GLFB 2JLWA 3WRXC 4A8JB 4R7ZA 1NNEA 4A8JA 1Z2AA 3CB4A 4Y0AA 4GP7A 1G3RA 4JLPA 5G3YA 2ORVA 1VMAA 3NWJA 1V5WA 4LK2A 3OAAA 2HLDD 2D7CA 5AUPB 3LRPA 3ADCA 2CJWB 4UKDA 2ZPTX 2CJWA 2HCJB 4MH0R 3ICEA 5J47A 2I1QA 4HLDA 1S1CA 1W5TA 2VP2A 1LV7A 4IOMA 5TVKA 3SOPA 1N6HA 2ZU6A 3B60A 1W4BA 1GKIA 1LY1A 3THXB 3ASZA 1W4RA 3THXA 3FE2A 1UBGA 1XEWY 4C7OB 4C7OA 1JXOA 4LBYA 1J90A 2IXEA 2C95A 4FMDF 4OBEA 1E3MA 1IOZA 2CMKA 2Q9CA 4YMWA 5L3VA 2FA9A 4ZCMA 3I8SA 3IIJA 3V4RA 3E1SA 1KI6B 821PA 1KI6A 1N0VC 2BJVA 1Q57A 3U60B 4B3GA 3CPJB 2FFBA 1K8RA 2X1VA 4JLOA 3UWOA 1KI3A 1D6JA 1E1QD 3GCGA 2RGNA 4ZIRB 1BH2A 2IYUA 1XD8A 1IXRC 4DLUA 5EUQB 2XB2A 4MYCA 5FBQB 2O8FB 1NVVR 2O8FA 1GFIA 1S8FA 3TSOA 1KK3A 3AP3A 4IFEA 5BYJA 1E4YA 1Y63A 2ZEJA 1KK1A 1KO5A 1SXJE 1T3LA 3VR5A 1W44A 2ECKA 4JLAA 2O8CB 3RVBA 4OHZA 2O8CA 3GJ0A 1DARA 1II8B 2AWNA 1II8A 3CR8A 2ZQ5A 4MYTA 5JSZB 4O2LA 4WZBE 5JSZA 5CYPA 2Y8EA 1SULA 2ZIAA 1CTQA 4B48A 3VR1A 5JWOA 3L43A 4GI7A 3IIKA 4V03A 1IAQA 1UBCA 1U8YA 2BVNA 2Z4RA 3BH0A 3RS3A 2NZJA 3QPWA 3WMEA 2AFHE 2NO6A 2WWGA 1ZUIA 3A1VA 3BWDD 2NPFA 1LVGA 1CLUA 1DELA 2A30A 2ZXUA 2ZJBA 3FMIA 2G77B 2IK8A 3QIAA 4YMTA 5CLQA 4NDZA 1OXVA 4IDPA 1CULC 2WICA 4RFVA 4D25A 2GNOA 3TSWA 1XMJA 5E7JA 1FPMA 3FMOB 3LW8A 4BFWA 3DZDA 3LFUA 4TZ0A 2A7QA 1DBSA 4YMVA 2KBFA 4TSFA 1PUJA 4YDHB 2AHOA 3AVUA 1JEEA 1SQ5A 3I5YA 4RD0A 1L4UA 4H9GA 4Q9KA 4EJSC 2DB3A 4BFXA 2VHQA 2OBNA 1NLZA 4LV8B 1Q1QA 3LY5A 1U8ZA 4PSAA 5GVRA 2CL6X 2D06A 1LTQA 3THWB 1N2CE 4QJ5A 3VKGA 1G291 4AYTA 3THWA 2OCBA 3AKYA 4DSOA 3CZPA 1YZUA 2ZJ2A 5JEDA 1XF9A 1KHTA 4BFZA 4BQSA 4FI3C 2REXB 1T0JB 4PQFA 3TMKA 4DC9A 5LB4A 1XBTA 5JBQA 4B2IA 3I8XA 4ARZB 5FOSA 4ARZA 1OHHD 1Z0JA 5L3RA 121PA 2FEMA 2CVFA 1GL7A 3D6TB 1TQ4A 4P0TA 5AJZA 1YR9A 4G5QA 1AGRA 3W8RA 4AWXA 1BMFA 3PV0A 4II7A 3U3RA 1KJYA 4L15A 2A5GA 1SKQA 1VHLA 4PC1A 5AR1A 4BFVA 2FG5A 2KB0A 5E4FA 4DCUA 2JLSA 1F2UB 4YMUA 1F2UA 3F0TA 2IBMA 4HLQB 3RS4A 4RKEA 3EC1A 2JASA 3KX2A 4QBHA 1E9DA 2CNWD 2QGNA 4S2EA 4U02A 4TLBA 3K0CA 2WHXA 2QSZA 1A7JA 4YXWA 3GJXC 4DWJA 1ZMXA 4GL2A 2VHJA 5ANRB 5JJKA 1EGAA 1P2SA 3EIEA 2QMOA 4C0BA 3FGNA 4P33A 2DCUA 3CF2A 4NU0A 4CGZA 2ZREA 1KDPA 3ZZUA 2Q9BA 4QOSA 4BLQA 3KZ1E 1H8EA 1IN7A 3IHLA 5FOUA 2BBTA 4Q18A 3IDQA 4RFSB 4RFSA 4O0MA 1G20E 4P31A 3HWSA 1KTVA 3E70C 2ZS9A 3SU8A 4XSGA 3VR4A 1T5IA 4UQOA 4AI6A 3DL0A 5L8VA 4HATA 2Q9AA 5GJCA 3KB1A 5SZJA 1N6NA 1G4UR 3K9NA 1OT3A 4YLGA 5FI0B 1SVLA 5FR2A 3W6OA 2DPXA 2OXCA 2REBA 2V7QD 3T1QA 1N5KA 3EPHA 2GJKA 5FOWA 2RGCA 1M2OB 1XTQA 2WWHA 1DTSA 2AK2A 1UKVY 2XZOA 1C1YA 2IS2A 4LJ5A 2A5FA 4LBWA 4M0LA 1MO4A 4ERNA 2ZJ5A 1W1WA 2G1JA 3K09C 4LX0A 4US1R 2BMJA 3W3ZB 5C4MA 1QG4A 3IILA 3U7FB 1NY6A 2ZTSA 4PPNA 1LFDB 4YONB 4HI0E 3SZRA 1ZM2A 1E4VA 2ZYTX 3L8ZA 2R6DA 4A36A 5FTNA 3LQRA 4K81B 1SVMA 4PAOA 2NO0A 3S1AB 4NYIR 3S1AA 3CWZA 3CPEA 1NKSA 1VG1A 4JVMA 3C16C 4BEJA 4MRRA 4TZ6A 4FIDA 4G0NA 4DEXA 1TQ2A 3BH7A 4NH0A 3L82B 4PZLA 1ANKA 5KNCA 2W6ID 2XEXA 3DOEA 2FGKA 3AB3A 5DGXA 1KI7A 2W0MA 2GZDA 2YJTD 5H8WA 4B2PA 3KJIA 2FFHA 4JZKA 8OHMA 4I81A 4MRVA 1QF9A 3L0PA 4CEIB 2RH5A 5LPNA 5F98A 3CRMA 4CEIA 3W34A 3KKPA 4EFNA 4KCGA 5KYKA 4M53A 1G7SA 1KKMA 2NO9A 4BLOA 1EWRA 1E1QA 2PMKA 1P5ZB 3DM5A 3TRFA 3ICQB 2BM1A 3QXXA 3KKOA 3AH8A 4G01B 4ILEA 3QG1A 3DOFA 4JJKA 2O8EA 1CRPA 3CRVA 3EC2A 2ZVPX 3CUEF 3P1JA 2EYUA 2WOOA 4JVSB 2P6NA 4KITB 4WIAA 5JFGA 3CBQA 1KI1A 4JLJA 3KJGA 4M1OA 3AVWA 2XTZA 1WCV1 1M34E 4G5GA 1G8HA 5KNDA 1X6VA 4HAUA 2XX3A 5FBVB 1T8TA 2NQ2C 2QRNA 5CJPA 3U4QB 3WY9A 4QRHA 2BBOA 3DVLA 1MRNA 2R6FA 4WXRA 3U4QA 2MSCB 2VSXA 3B6EA 3D7MA 4U5XA 4HUQB 4HUQA 2RGBA 3DEFA 5EZ6B 2QTVB 5J40A 1HE1C 4X8HA 1G6OA 1Q3TA 2CK3D 1S4QA 4JL6A 3FVQA 1CS4C 3LLUA 4GOJA 4HLUA 3AVQA 1PZNA 3B85A 3A4NA 2FU5C 1MO5A 3RRZA 2QT1A 3RDPA 3THOA 2ZSFA 4M2LA 3PG5A 3RC8A 3OIVA 1HE8B 4URZR 5C1BA 1OFTA 1OH5A 1IN5A 4OK5A 3VU9B 3SFZA 3ADDA 4RD3A 2ZSEA 3VU9A 1AQYA 1L8QA 3LBIA 4TMXA 2W6JD 2GCOB 1KO8A 2QAGC 2GCOA 2MMCA 2MSDB 3REGA 1UF9A 1JPNA 1Z6GA 4DLXA 4E22A 1G5PA 2J5XA 3GFPA 4DLSA 4KAXA 2IYSA 4CIDA 2CLCX 3CPHA 1GDDA 4B2LA 4FWIB 2CHQA 1FTNA 2H18A 4M1YA 4KSBA 1BKDR 2FPMA 3KUCA 4BZQA 2VHUA 4JLDA 1XTIA 4TYNA 4EKDA 3H86A 1C9KA 5HZHA 1DAGA 4TQAA 2W0SA 2WIAA 4QJ3A 5EP3A 4P3YA 4WBSA 1HURA 4BASA 1OHHA 3NVAA 1L4YA 3RSLA 2JJ2D 2GVZC 1XTJA 5BN4A 1E2JA 4B3CA 1G3IA 3KFXA 4D4LA 3CIOA 2R6GA 2D2FA 2GZAA 3D31A 3KFVA 4HB3A 2YC2C 1OLOA 2Z0MA 5A5GA 4LRWA 3AKDA 4I1SA 3FFBA 4TTQA 3I62A 4D26A 2IS1A 3LX8A 2ZI9A 3AKCA 3TAUA 1N3BA 3WNBA 1WBBA 3AVVA 5CB8A 1VPLA 2A9KA 5AUQA 1EFRD 1VDZA 3AVXA 2ZRBA 4MUBA 2ZUBA 4AKIA 2Q21A 2CNWA 3EZ2A 1UM8A 2VLIA 5CM9C 1X8KA 1JAHA 4RD1A 4PHFA 3HJNA 2C04A 1JQJC 1DAHA 3GEHA 3T1VA 2VH5R 5DH9A 2ZJ8A 1NVWQ 4IEEA 5P21A 4A2WA 2LKDA 4V02A 1E2LA 2N1BA 2YOHA 5KSYA 1KKLA 1VKJA 3TSZA 4EFLA 1HEIA 4V0OA 5GJVC 2XJ4A 3RWMB 1Z08A 1AM4D 5C2JB 2V3CC 3O8CA 4IFBA 3CM0A 2BMEA 1W2GA 2JLRA 4TL9A 1KJZA 3DZ8A 4NKRA 5EE1A 3TAHA 4BZXA 2HT1A 4HYYA 1NBME 3AV0B 1JQLB 1XWIA 4M9SA 4G5SA 4NZYA 3O47A 3B1YA 1E9EA 4KHZA 1FUKA 2V7QA 2PH1A 2DFTA 5DI9A 4PHGA 2IYXA 2R2AA 1Z0AA 2BJWA 3ONWA 2QORA 3GJ4A 4TYPA 4LUCA 5F2EA 2OCAA 1OJLA 2OHFA 1NMZA 1S96A 1U81A 1TEVA 1FMJA 3HR8A 4NCNA 2J0QA 2P2LA 5EE3A 2P5SA 3QG5A 2P6RA 2IT1A 2PX3A 4JBWA 4D82A 4DXAA 1NLYA 2GXUA 2OLJA 4PO9A 1DEKA 4V0NA 2GEDA 3CX8A 1Z83A 4TQ9A 1UEIA 2EYQA 2IWRA 1XP8A 2ATXA 3AQ4A 2ZYVX 4DIEA 2ODBA 3QPUA 3ZLJA 1FZQA 4URWR 4CRWB 1XFAA 3B5JA 2BEJA 1TL7C 2G0NA 2ZE7A 3TGPA 3SDZA 2ODNA 3A1SA 1DVRA 3PUWA 1P2TA 4GSYA 2FOLA 2F3TA 2WJIA 3AF2A 3EIHA 3HR7A 5A4JA 2F3RA 4BUJA 5AJWA 2W6IA 2GK6A 1Z0IA 5FTKA 1CRQA 4HAWA 1EX7A 1N0WA 2PL3A 2WSSD 4WOPA 4HUTA 1KZ7B 1TPZA 3MWKA 5FBRB 5BWMA 1N6LA 1AQUA 4KYIB 2QE7A 4LHZA 1DAFA 3LD9A 2WOJA 3CRRA 4Q48A 1I4DD 4F92B 4US2R 2HXSA 3GQBA 2WM9B 4D0LB 2FJUA 1AKYA 5CM8B 1GRRA 3LWNA 1DAMA 2RB4A 4I99A 1XNJA 2D2EA 4R2IA 1NVVQ 1VHTA 4JS0A 3A36A 4OQFA 1U0LA 2D4HA 1TMKA 2GBLC 2ZU0C 4L4UA 2YV5A 4A1FA 4DIDA 5FPKA 4LJ7A 4KFUA 5DN6D 1Z0DA 2NG1A 2WKPA 4A6PA 2UZ3A 4JVNA 1E2NA 1NLFA 1HQCA 4PTLA 3SQXA 3X1WA 1R6BX 2A2ZA 3CX7A 1R0YA 2GHIA 3PUXA 2CE2X 1HV8A 2ZITA 2P3SA 2E1RA 3ZYCA 2J0UB 3BFKA 2CXXA 4BFSA 1TQDA 4ZCIA 3OEED 4G5OA 1VCMA 4JSYA 4B76A 4B3XA 4GPTA 3MWLA 4L16A 1R10A 3A1UA 3SJBA 2ODEA 2ZAMA 2CK3A 2FSHA 4QNMA 4ZDKA 3HYRA 4TL6A 2NZ8A 4TMTA 3U3MA 4DHEA 2ZROA 5EP1A 2B8WA 5FL7D 3ZIAD 1YR6A 3VMFA 4BLTA 2O8DB 2C99A 1KK0A 3HU3A 1YE8A 2O8DA 4C0HA 3K0EA 4QKQA 3EZ6A 3VQTA 5EE0A 4NMMA 4IJMA 4EFMA 1LS6A 4D80A 4FMCF 3QKRB 4OJKA 4XD7A 1XZPA 3C41J 2W6JA 2WSMA 1ZAKA 3QKRA 3SC3A 3Q85A 5AJYA 3SNHA 2EFDB 4B34A 2PLRA 1M7GA 4QM6A 4JBXA 5CB6A 3K70C 4BECA 4M22A 2CHGA 4URVR 1LS1A 1G64A 1G9XA 4GNKA 3AP1A 1CR2A 5J4VA 1B0UA 4P4TA 1BS1A 2V54A 4C0JA 1NRJB 3NTUA 1YZGA 4XWKA 3PEVA 3OHMA 4ITRC 5KPJA 1HA3A 2GDJA 2LKCA 4AKHA 2JJ2A 1W36C 4Q19A 2IUTA 3MJRA 4F4IA 4EAQA 3MG9A 2W00A 3OFNA 4ACBA 1AS2A 3IIMA 1UJ2A 1YR7A 2BOVA 4OKSA 3BC1A 3NEJA 4A9AA 3GPLA 3TW8B 2RMKA 3A58B 3H1TA 1KYIA 2AX4A 3QKSB 3WBKA 3QKSA 3KTAB 4B3FX 1R5BA 3KTAA 3IPXA 1E2IA 1Z8FA 1G7RA 3P27A 4FCVA 1XPOA 1II0A 3PVSA 3LXRA 4F4CA 1VYVA 4G5RA 1XU4A 2HT6A 2ZRNA 1UDWA 5FPSA 2P0EA 5TARA 4N0DA 1XEFA 4NCJA 1UBFA 2VHCA 2DWQA 3UG7A 4JYBA 1BYIA 4L8GA 1JPJA 1PUIA 3B2EA 2W2VA 3NBFA 1U2RA 4RZXA 1E2PA 3UPUA 3DHWC 4IOLA 3REFA 4M1MA 1F48A 3L0OA 3ZVRA 2DR3A 3C15C 2A3RA 3Q7QA 4KSCA 5AK0A 2BWJA 3CRQA 4KU4A 1Z07A 2NO7A 421PA 3TLXA 1WB9A 2ZRMA 1FQKA 1S3SA 3K8YA 3T1TA 3KJEA 1QRAA 4RD6A 3BS4A 1P2UA 4W9MC 3EX7C 5C18A 4MKHA 2IEZA 1PLLA 1Z47A 3TUJC 4B35A 5CK5A 3W90A 3I32A 1Q1BA 5DE3A 3U3KA 2F9LA 1P61B 4RZ2A 1GZSA 4IXNA 2QRZA 2YOGA 4U00A 3LV8A 1YRAA 3Q5EA 2VP0A 3QPVA 4IOKA 4EJSB 2CL0X 2QSYA 2HJVA 2PT7A 4EJSA 1N6KA 1KDTA 2DBYA 5FTLA 1MR3F 2FFQA 2WWIA 1R8SA 2ZR7A 2ZJOA 2AR7A 3Q7PA 1KNXA 4AIIA 2YZ2A 4ZDJA 2C8VA 4GMXA 1RPZA 1D5CA 5JJIA 1XPUA 4US0R 1WA5A 3A1WA 4C0QC 2Z6VA 3ZS9A 2IYLD 3NC0C 3P20A 1H65A 4D81A 4L5BA 5DHAA 4Q9LA 4DKXA 4R98A 3I73A 3PFIA 4P4SA 2BEKA 1EX6A 3B13B 1KDOA 2LCFA 4NYIQ 1JAIA 1E98A 1GOTA 2O8BB 4XTRA 4KFSA 4RD4A 1MH1A 5C4GB 2WJGA 3SQWA 2O8BA 2ZJZA 2CL7X 1N0UA 1G4AE 4QGGA 3VKHA 1D9ZA 5M04A 3AUYA 4C0KA 2C78A 3LO5A 4OK3A 1ZBDA 4TMKA 1U0HC 4XSHA 1E2QA 2ONKA 2WSSA 2C77A 4HEJA 2RHMA 2CDNA 4KJZA 2JAQA 5EQTA 3LDAA 1KSFX 3B1WA 3U6KA 1CJMA 1IN8A 2VF7A 4PO1A 1ODFA 1U9IC 4OQLA 5B2ZA 1D9XA 2JLVA 3GEEA 3K9HA 2OUKA 3C7KA 4I1UA 1DE0A 3MWJA 5CK4A 1KO4A 4IDOA 1HTWA 2C2HA 1GUAA 2OCPA 2R8RA 4JJZA 5EXSA 4A2QA 2W83A 1JALA 1GTVA 4Q7KA 4DB4A 3TUIC 2IYZA 1W46A 3X2SA 1R0WA 5DN6A 1RVDA 3NG1A 1O3YA 1S0UA 4HZUB 4M1WA 4MRSA 2F1RA 4HZUA 3TJZA 1G18A 2K5UA 2VL7A 5FR1A 4B32A 4H1UA 2ZVQX 3GJ6A 2GJSA 1XCPA 3D3QA 2OG2A 3LLMA 3RS0A 4A2PA 1W0JA 5TXGA 1RYHA 2F9MA 3AVPA 4PQYA 4BZPA 1Z6YA 4NCKA 2IUSA 1MO3A 1XMVA 1JR3D 5GJWC 3R9XA 4GFDA 2WZQA 3FHCB 4D4MA 4QBFA 2B7BA 3BFVA 2F43B 4LSGA 2F43A 1TQ6A 3F5FA 3MLEA 1PLJA 2VSOA 4BLRA 5EUMA 3GEIA 4EDHA 2WJYA 1G3MA 1Z22A 4X8MA 1PJRA 1OB5A 5FL7A 3QXJA 2FH5B 2GF9A 3K09A 2GWHA 2PBRA 3ZIAA 3FMPB 4BFYA 3I5XA 4OHVA 2QTFA 1NJGA 5H68A 2J9RA 4F38A 2YOFA 3T1OA 2SHKA 1CP2A 4NTZA 3NC1C 4HSEA 1DO0A 4LYJA 1Q22A 4YDSA 2WWYA 3VNUA 1UKEA 1Z5ZA 3LAWA 4AKEA 2BIFA 3QENA 1RRPA 2E87A 3MAAC 2YINC 1IQPA 2W2XA 2KWIA 4HDCA 5TDHA 4IXMA 3HDTA 3OIYA 4PAMA 4ZKDA 3U61B 2ANCA 4UXHA 3Q3JB 4DB2A 1XD9A 2ZE6A 4Q5IA 2ZRPA 4WA7A 4TLEA 1ONBA 1VCNA 1DS6A 3BJIC 3FPAA 4RD2A 4DJTA 4IRUB 2GCNA 3P32A 1NSTA 4UNQA 1BO6A 3TUZC 1GP2A 3BBPA 3AP2A 2IC5A 1XTSA 2AD1A 1T3HA 4TTRA 1UPTA 5G3ZA 5FUXA 4B71A 4QC2A 1UDXA 4OI2A 4FN5A 2QPAA 1CXZA 2F1HA 1AN0A 3AVOA 4OK6A 3PUZA 4GOXA 3NXSA 3UKDA 1DOAA 4MGKR 2ZRIA 1GILA 4FXPA 4UNNA 2X19A 1LW7A 3LVQE 1E2HA 1R5NA 4BPBA 3M4YA 1OE0A 2AWOA 1AK2A 2HV8A 3NDBB 1JEDA 3LVRE 5EXPA 2RGAA 2XSZD 2VP6A 1XXHE 2REOA 3IBYA 3TQFA 1ZCBA 3WMFA 2QY9A 3NBZC 4QG7A 1M8PA 5SZIA 2OLKA 3AM1A 1VTKA 2C03A 2GF0A 3KXIA 3AF1A 1HQYE 4Z54A 3QE0A 1IY1A 1E99A 1ZYUA 1M6NA 4K46A 3GP8A 3C5CA 4PC6A 2HLDA 4V0KA 4DBLC 3CNOA 5TMPA 3MFYA 2XGJA 1W4AA 2C9YA 4RSGA 2RKOA 1YU9A 1SXJC 1F2TB 5IDVA 4BEBA 1F2TA 2J41A 1ZJ6A 4Q66C 1XPRA 2NMVA 2PCLA 3SHWA 2YC4C 1ZIOA 1K5DA 2WAYA 4JLKA 1L7VC 5JWRA 2QAGB 1E0SA 2ZR0A 2QAGA 4Y0VA 1RRFA 2QMEA 1CR1A 5JECA 5JCZA 3K70D 4HZIA 2JLUA 1J2JA 2J0SA 2ZS8A 2AFIE 4ZKEA 1I4LD 3FKSD 5AWFC 221PA 3RLFA 3QSYA 2IYTA 3FKQA 3OESA 1N6RA 2GJ9A 3DKPA 3JZMA 3QXSA 5JCPA 3ZQJA 1XMSA 1GL6A 2CCJA 1ZC3A 2CVHA 4IVPA 2FV8A 5IK2D 2PCJA 1W36D 1U8AA 1XXHB 2G0TA 1GL9B 1XXHA 1X3SA 1P62B 2GESA 2ZI5A 3SS8A 4X8LA 2VP5A 2QZ4A 3T15A 3ECCA 4TYQA 2O8EB 3CRW1 4NYMR 2P65A 3U7HB 4QGAA 1OPXA 1KNQA 4Q4LA 4LGMA 2A5YB 2JDID 3PCRB 3SR0A 2UZIR 5B30A 5B57C 3KKNA 4MDFA 5BN3A 1YZLA 2B6HA 2VBCA 3B1XA 5DLQC 5FUVA 2OFXA 1T5LA 3QJYA 5FH9A 1WDTA 4KFRA 4ZO4A 4ZDIA 1FW6A 4BFTA 2ZE5A 1W2HA 3K1JA 4NYJR 2O0JA 3SE0A 2ZSAA 4OQNA 4C0LA 1M1YE 4W5JA 1E2GA 4B3BA 3UMSA 2B92A 2QUZA 3VHXA 3L0SA 3GFOA 3QF7A 3VR6A 4LYFA 1T4GA 4KV9A 4C30A 3SBEA 1B23P 3UWKA 1X8JA 3BB4A 1KY2A 2AXNA 3X1DA 3PJRA 3TBKA 2QENA 4LYAA 3EPKA 1KSGA 2HEIA 3QBTA 1FP7A 3DM9B 3C4JA 1E2MA 3CH4B 4LWZA 5DHFA 4EPRA 5JHHB 5H1YA 5KSZA 3OF5A 1I2DA 2J87A 3ZDQA 3TKLA 1F60A 5FPYA 1P9WA 3RRMA 1KI4A 3EPLA 2W58A 3WHKA 1Q0UA 2YWHA 4XVUA 2WKQA 1YZKA 4L9SA 4M1TA 4DSNA 4C0SA 1TF5A 2ZRCA 2VYFA 2EW1A 4Q21A 4Q1DA 1FTSA 1OXTA 2G9NA 3BOSA 1DAEA 4HAVA 1EESA 4LC0A 4TMZA 3B1VA 3C14C 4M21A 2O52A 3TW4A 3W5JA 4BLSA 1K5GA 1XRJA 2A5JA 3EAQA 3NKVA 1ETUA 1JXMA 1P60A 1ZRHA 2XTNA 3CWQA 3H4MA 3R8CA 2YVUA 2H57A 2OXRA 1X1RA 2AL7A 3LNCA 4I1OA 2FEOA 2CLDX 1J99A 3PQCA 3K53A 5E7MA 1Q44A 3SBDA 3QVVA 3NHAA 3QEJA 4LYHA 4DUGD 3EWSA 1G5TA 4URUR 5HE8A 5FL3A 3IEUA 4DT1B 3A4LA 4PQRA 4DT1A 1E32A 1A4RA 1J8YF 2AD5A 2IL1A 4D4KA 4MA4A 1Q1ZA 5JRJA 3RC3A 4H1VA 4GZMA 5CLLA 4JL5A 3EPJA 2Q6TA 5C46F 5LBIA 3BE4A 3VX4A 1SGWA 2JA1A 4PR0A 1KAGA 1U0JA 2CCKA 5DI3B 1UKYA 2FFAA 5DI3A 1ZM3A 1ZM4A 3K9LA 1XEXB 1N5LA 1XEXA 2GK7A 3RNLA 4V0ME 1SKYE 2OCYC 4JSTA 3H0KA 1QBKC 2QGZA 2EFHB 3NEYA 2WVJA 3PITA 1NVXQ 3CF6R 2JLQA 3W9YA 1XJCA 5JZVA 1VYTA 3P4XA 2JIZD 2GTPA 4AURA 5J4YA 5FUYA 3QKUA 2QBYB 2Z5FA 2QBYA 2GCPA 1TX4B 4IVQA 1NMYA 2MMGA 4PFSA 2X8AA 1NF3A 2RCNA 2IWHA 2GEUA 1OFIA 2ZRHA 1XTRA 2ZSBA 5AUNB 2JJ8A 1ZW6A 2QG6A 4Q7LA 2AXPA 2GBLA 4RCYA 2CLSA 2O0HA 2VP4A 3I3SR 2H1LA 2HYDA 3MCAA 5EXTA 4NHOA 5DSZA 4LJYA 1GKUB 2ZRDA 3ZQ6A 2OO7A 2IYWA 1W48A 4PSVA 2AN9A 2OESA 3K9GA 1E0AA 4O25A 3G0HA 2XSZA 1A5TA 1GNRA 1FNMA 2AKYA 2ZUCA 4A0HA 1YZNA 2G1KA 4O3MA 2NO1A 1Q1EA 3IEVA 1MABB 1W49A 4HB0A 4URXR 1MABA 2GRJA 5LD2C 5JS8A 1Z6XA 4QFMA 5A0FA 5F9HA 4OQXA 3VR2A 3IBGA 2PZGA 4E07A 1R4AA 4FMBB 4MGYR 1OXXK 5ELXA 1J8MF 2FPLA 1SVSA 5IF9A 3AF4A 3SFVA 4HAYA 3UATA 2WJHA 1HUQA 2JATA 1XD2B 3ZGXA 4HB2A 1XD2A 1WE2A 1ZP6A 1XJ0A 2OM2A 1NY5A 3GFTA 1SKYB 4QL3A 4V0MA 4WW0A 2H16A 5CYOA 2X2FA 2ZI7A 4URYR 1WP9A 3AF3A 1E2DA 2KJQA 1IY0A 4MGZR 4MUAA 1FL9A 2FN4A 1ZM9A 2XITA 4JKYA 4DZZA 1G3UA 4ABYA 1OFUX 4PC2A 1QVAA 4JMPA 2R6CA 2ZYUX 1NI3A 2Z4SA 3EZFA 4V0LA 4XH9B 2UVQA 4NCHA 3K70B 1KGDA 1KI8A 1G8PA 2IW3A 3IHWA 4R2HA 3FKSA 1NVUQ 4EPTA 5K8TA 2GXAA 1ZINA 3A4MA 3QEOA 3VAAA 5HKKD 3AVTA 1R0XA 1T6NA 3THYB 1R0ZA 3RYTC 3THYA 2QMUA 1ZUNB 4TL8A 3NHBA 4B6EA 5K8UA 3NBXX 5IK2A 4B47A 3PENA 4TQUS 1W36B 1FP6A 5IHPA 3LH5A 1CKEA 2B8TA 2DYKA 2HXYA 4TWZA 2LWIA 1D2EA 1TEXA 2KBEA 4LV6A 1N6IA 3AKEA 3QF4A 4DCNA 1FX0B 1QG2A 1P75A 1FX0A 1Q20A 1G5RA 3UG6A 4W5HA 1GIAA 2WMNB 1PVOA 1QHIA 3WNDA 1ZD8A 1QZXA 2ERYA 1R5OA 1CIPA 1S1MA 1OYWA 3GJ8A 4EQ6B 1J7KA 1KO1A 1R7RA 4EQ6A 4C0AC 4ZV4A 2Q3MA 4Z51A 2B7CA 4FD2A 2C98A 2DY1A 1VG8A 3TE6A 3KQHA 4TLAA 3CNNA 2DFKB 3M1IA 1OXUA 4ESHA 2WIBA 1COWD 3PR1A 4E5UA 1NMXA 2XAUA 3BB1A 3HYTA 4RJLA 3VFDA 4OHWA 5JJLA 2JLYA 1Z6TA 2KE5A 3JVVA 3QXHA 4C3ZA 2I4IA 4P4UA 3ND9A 2V6IA 4O2RA 1DADA 1YJ5A 3K0FB 3F8TA 1T8UA 1W0KD 2XOKD 3K0FA 1JR6A 4QHTA 5EP2A 3UMFA 5BW8A 3IQWA 4G1UC 3WYGA 2R6AA 1EFHA 5BN5A 3TK1A 1A82A 4PHTA 3EW9A 4IDQA 1SXJD 4HAXA 1RZ3A 1KAOA 3QBVA 4QXAA 2PMDA 2H7VA 4B73A 1YR8A 5FTMA 1ZD9A 2BV3A 1NG1A 1E2KA 1KSHA 2XNDD 2GZHA 3KQKA 1CR4A 4X8OA 2ZRLA 2PLFA 2J0VA 4XJXA 5K8IA 2GA8A 1NIPA 1P2VA 4PXAA 2J3EA 1NN0A 3K0SA 1VECA 4NE2A 2ZSDA 2IS4A 1K6MA 4Q02A 2JLXA 5EZ5A 4TN1A 5HCNA 1YHNA 1YVDA 1OSNA 3DMNA 3BIFA 4MKGA 3A1TA 4N1AA 4KLNA 4AG6A 1KO7A 2NTYC 4M8NE 3FTQA 4Z1MD 3KKQA 5CIQA 2F1JA 4Q9JA 2BMDA 2PZEA 1GG2A 4A15A 2ZI3A 3T5GA 2VP9A 4MQBA 4DUGA 3PEWA 3CZQA 3QVUA 3ADKA 4IVRA 2FPKA 2FSFA 1LF0A 4AYWA 1Q21A 4XVRA 3UIEA 2F55A 4KVGA 1EFTA 3FMFA 2P67A 3C8UA 3TNFA 3UK6A 4D2IA 4I1VA 2GAAA 1EFUA 1NJFA 2QM7A 3T61A 1GNQA 1CEEA 1EFRA 3SYKA 4LJ8A 2L0XA 2N42A 1G41A 2WJVA 1G8FA 3IKJA 1CJVC 4Q4AB 1TUIA 1S9DA 2QPTA 4Q4AA 4QBIA 3R8FA 1SHKA 1LB1B 1AS3A 5GADl 4JT2A 2EVWX 3GLIA 3LX5A 3R20A 1OB2A 4GDFA 2ZJAA 2V4ZA 3OIWA 1BOFA 1N5IA 4Q1BA 3WHLA 2VTKA 1P73A 2WAXA 1E9FA 4OHXA 2P5TB 2GJAA 4M9ZA 2BM0A 4PX9A 5G53C 5FI1B 1U9IA 1G3QA 2JIZA 5JLJA 4PO8A 3MRSA 2ZANA 2J46A 3A37A 4LBZA 2Q3HA 1JB1A 2D3WA 2ZR9A 1MOZA 1ZNXA 3LA6A 5KTYA 1E79D 4RZ3A 3BERA 1U94A 1P72A 2BMFA 5JWHA 1T91A 2J59A 3RABA 1GKYA 1Z28A 4NCIA 5FOXA
chains in the Genus database with same CATH superfamily
1FP4B 3KYBA 4HAZA 3R7DA 3W9BA 1FP4A 3FBTA 3WI7A 1FMLA 2E37A 3ZWWA 4COOA 1SG9A 3HZOA 3O7MA 3B6MA 3EFHA 3EWAA 2ZRGA 3P0RA 1SXPA 5TC4A 4J1TA 4XWAA 4UXIA 1JQEA 1T13A 2Q99A 3C6QA 4BY9E 2XECA 3L0ZA 1JSXA 2FSUA 1Z0FA 3EZ9A 5EWLB 5EWLA 1IBRA 2JEOA 2O19A 3UAXA 3F9RA 4LPKA 3ZHOA 4D0GA 4MYRA 5EIAA 2V6MA 4ZAFA 2CNBA 1T3GA 4LVNA 1V4NA 4DIOA 3LKZA 1GARA 1VLVA 3OEHD 3DEAA 3FVVA 2YNMD 1NLUA 4BE7B 3FB1A 1Y7HA 4KQCA 2ECOA 3A10A 2XMCA 1GA4A 3KKMA 4BJ1A 5LCXA 4ISBA 4MICA 2P9ZA 3KCNA 4CMJA 4RHCA 1ZS9A 5DTQA 1JWBB 1QYXA 1OD6A 3ZS8A 4ZMBA 4YUVA 2P2DA 3L40A 4GI3A 2ZUFA 1WDMA 5H81A 1AOXA 5DVZA 1TAUA 3P0IA 1W5FA 1ZC4A 3EG9B 3EG9A 5DU2A 3L07A 1FFBA 3SQOA 3UICA 4Z8XA 2WTAA 4P4SB 2W6CX 4B6FA 2JH9A 5DSXA 3GO4A 5LB2A 3RWOA 3JSAA 3GYGA 1CJKC 2J5BA 3RYIA 5K0ZA 4I4IA 3QVKA 1MPTA 3PA8A 2H9YA 5DTRA 3WMXA 5D87A 3G8YA 1SUPA 4HYQA 3NT5A 4IYJA 2QQEA 3I9MA 3LOUA 4DUPA 1JUDA 1AVTA 4JUDX 5KYYB 4XEHA 3ZWQA 5KYYA 3V4SA 3QFCA 3C3MA 3RTAA 3AEZA 4ZIRA 1UC9A 3S2EA 3R3VA 5CNKA 5J9FA 4UFOA 3ERCA 4BTEA 4OI1A 4ER5A 3T7RA 3BB3A 3P9RA 2B4RO 4ZQCB 4ES6A 2V7EA 5BV8A 2IHKA 3O2QB 2PAFA 3KU1A 4K40A 1EXMA 1NE2A 3ONEA 4LTMA 2OV3A 4UCFA 4R7GA 3TQQA 2X7JA 4ZJPA 2K2WA 3IAFA 1BFKA 4IDNA 2UUOA 3O5AA 5FULA 5JHGB 3HBLA 3GQVA 4JX9A 1OYYA 1M2HA 3VTZA 4FHGA 4JKIA 2PSFA 3JTMA 1QO7A 1U4SA 5T3UA 2A57A 3K96A 1KI9A 2Q5FA 1N36B 5BSVA 5K4GA 1PV1A 1YRBA 1YZVA 2BUAA 4JOCA 5BNTA 3UUWA 1QFXA 1TO6A 3AIMA 2B20A 2VKTA 2WAMA 1JDZA 4LOJA 4PHHA 5ENDA 4PG8A 4IVNA 2P1ZA 4C78A 3BRQA 3OLXA 3QUSA 1RPAA 3DPUA 1B26A 5H3HA 4HNAB 4UNRA 4NV3A 4HNAA 1DSSG 1XN4A 2YY5A 4OVKA 5EZYB 5DYGA 5EXXA 2WR8A 4K6KA 4PZEA 1L5FA 5GGYA 5B2EA 2QQ0A 1KQNA 3MFQA 4JOSA 4M86A 3OLWA 4BYGA 2VAVA 4WASA 4AMVA 4CT0A 4NYJQ 1OH7A 2IX9A 3HUEA 3KLBA 3GAAA 3L2OB 4Q9DA 3AUAA 3WB9A 1OWNA 2I1VB 4GEGA 4GR5A 3PQ8A 3UK7A 1COWA 5F7ZA 4ER7A 1VKZA 4JLBA 5C8DA 1XNQB 3V4LA 3HCBA 1KK2A 1WJGA 1QTNA 1GTMA 1O2DA 1AHNA 1XVUA 2VJCA 3G82C 3LPDA 2WF8A 2QT0A 3B8HA 4ND7A 3Q40A 5DM2A 3UFXA 4OI4A 5CVDA 2H2DA 2Q5LA 3M3PA 4CFZA 3PRJA 2WV9A 4HB4A 4EG5A 2B4QA 3KQTA 4L8VA 1H8HD 4YV0A 2QV0A 3JYNA 2RB5A 5LLSA 3M83A 3B3JA 2ANBA 3GDWA 3WA7A 2XZLA 3BXEA 1XUOA 3ND7A 3DAPA 2GJ8A 4HLCA 4N6GA 1C29B 3SYNA 1PN3A 1RMTA 4DARA 2XNDA 1YTUA 4BN0A 2ZRJA 4BP1A 1LCIA 3Q10A 2YW2A 4CV1A 4XWWA 4HFNA 3FFAA 1TZJA 2EBHX 3IKVA 3DFFA 1IJFA 2ILVA 3RTCA 2WVAA 5KREA 4CR8A 3FGZA 2O20A 1EWKA 1L4LA 1XN1A 4NBTA 1II9A 2NXEA 3A4VA 5CHEA 3ZX4A 5BVGB 4L5YA 5BVGA 1D2AA 3KKKA 3HZZA 3T41A 2CEAA 3N39C 5KWVA 5AXBA 4Z7QB 2ZZMA 3OUTA 4IX1A 3DO6A 4CG2A 3DKVA 3DEZA 2AVNA 3DFKA 3VJLA 1XE3A 3G9QA 5F9FA 1XV5A 1XLUA 3FNGA 5FXMA 4A7PA 3FBGA 3IGFA 1GGKA 3I72A 5JRZA 3K94A 4DLLA 3ZDYB 2WPDD 2CLKB 3FPBA 1VSTA 1X8LA 3PXEA 3U09A 2VQ3A 1CIJA 4DE5A 3TIFA 3CJRA 4L72A 4PYJA 4DCSA 1COZA 2OBXA 1XZHA 1M9NA 1SBQA 2VDOB 4EY4A 1N9GA 2FN7A 4EY6A 3EZGA 3GRPA 2GWRA 2R62A 1IE3A 3VOAA 2BRUC 5BQPA 1Y8RB 4UEQA 5KOYA 3PEYA 1Y8RA 3FIUA 1FYDA 1W75A 1L4NA 1IEQA 3W4KA 3GRRA 4AS1A 3FW1A 3V00A 5BW5A 1YQUA 5BSEA 2EFCB 2V1XA 1N2CB 3U3OA 3A6PC 1TAGA 1N2CA 3U7EB 4C21A 2P6UA 4RCZA 5ULLA 1ZRSA 4K87A 2PK3A 1DU4A 3ZWBA 3H5WA 5DULA 2VT6A 1J97A 2YL2A 4IIDA 3UHJA 1J9GA 4B17A 1QYVA 3F6CA 1SKAA 4IDDA 3U4GA 4MDEA 2ZUEA 2RGDA 1BU8A 4BVHA 1SPBS 2GXSA 2QTNA 2RK6A 4MQUA 3WBJA 4A91A 1YS9A 2Y1FA 4TT3D 3OJOA 1T10A 1H9AA 1WW2A 2WMOB 4BMDA 5KDDA 1TM5E 5FPHA 4RQTA 3R41A 4C43A 2D6FA 2O7NA 3M6AA 1Y42X 2C8LA 4CZ2A 1ADJA 4AXXA 2E0IA 3RFTA 1A5SB 2EFGA 3LHFA 4YJKA 3U31A 3ZCXA 3DHVA 4WBXC 2OYRA 4W99A 2VDRB 5IBQA 4KDCA 3RIYA 3Q0EA 2ZRAA 4PAQA 5ILQA 3ROEA 1WQ1R 1WXIA 2FE4A 1SY7A 3DOIA 4ZVMA 1TIBA 2ZTHA 5JIBA 1ZJYA 1DKLA 1HY3A 2FR1A 4C9BA 3LTEA 3VBEA 3DLCA 3GFSA 4EPWA 3GUCA 3IP5A 1YZTA 1NJ6A 3HABA 4HK4A 5DO9A 2Y9MB 4EW6A 5BMOA 2VHVA 1RKBA 3DFZA 1P1CA 2QD5A 2FZVA 3QI2A 3ADBA 1O87A 5AKGA 5TJ9A 4Z8YA 1F06A 5TNXA 3UWSA 4OPMA 4DGQA 3VNVA 5HE9A 1QHYA 4ZI2A 1E58A 1U3CA 2H1IA 3C5HA 4FSDA 4NCXA 1CVIA 2PQ0A 1Y1KE 2QL5A 3Q7RA 2RGXA 2ADFA 2WIJA 4IZIA 5IRCD 1R0RE 1GRVA 2AZTA 3ZZ0A 4NY1A 4N8DA 5HA5A 2Z6AA 3IUBA 4RS4A 1D1PA 2QM3A 3M6XA 2ZYWX 4RK7A 1WHSB 5DEOA 2BKAA 1WHSA 2CMFA 3QVMA 4B33A 5HP4A 1Z5UA 3GLUA 1VPEA 3CSUA 1LRJA 3DLTA 5HZKA 2D7DA 4KWCA 5CA0A 4TGLA 1VPVA 4KQJA 2CCGA 4YNBA 3V7WA 4XQGA 2HZ7A 1F8GA 2X8BA 4DPKA 4LF9B 1PEKE 2C5GA 2EQAA 3F5MA 5C8YF 4V38A 1CF4A 2EF1A 3KSZO 1PZGA 3CZCA 2FXIA 3L05A 3SEAA 3ZXSA 5A5DA 1WETA 2R48A 3E7DA 2X2PA 4PRKA 3SKVA 1K0FA 3ZKAA 2OBLA 3KWJA 2BFDB 1NF9A 2UKDA 5LMNB 3I37X 2XYQA 4HEQA 2PR7A 3D1VA 2EBWA 4YACA 3GFGA 5BQ3A 2VZEA 4XEUA 3V2HA 5AUNB 1P7VA 4YUXA 2PUEA 1TTPB 2JZNA 2Y93A 2ZYAA 4PYOA 4RV5A 4YHBA 4ZOBA 4D8WA 4ENSA 2O14A 3F71A 3VTKA 5BWCA 4F56A 1E2EA 4UTRA 3TZEA 4IIEA 3VO8A 4WBNA 1T2EA 2I2WA 5E4YA 4BWYA 4MHTA 2ON6A 3BHIA 2J3JA 1THGA 5J4KA 1Z26A 2R6R1 3G1TA 3QYAA 1LSSA 2B4YA 4D97A 1ODKA 3C0KA 4ZOAA 5H02A 5LM3A 2OBMA 1D8AA 2R9VA 1DWOA 3OX4A 3H5AA 1BG6A 3IXLA 1XWWA 1FJ2A 4QJ4A 5DB4A 3TI9A 2YRFA 5BURA 1MTOA 2YR0A 4MVYA 2P6MA 2XCUA 1S3GA 3FF4A 3G17A 1I94B 3O73A 2H48A 4YRSA 4KQMA 2Q07A 5B6PA 2FGJA 3SKYA 3KSBC 2O2CA 2P9QA 3A06A 1AUXA 3EY4A 3D2AA 2HQSA 2OBYA 3QQ5A 1LDMA 4BKQA 4YCSA 2FW9A 3L1JA 5LU8A 3AOGA 1JVNA 5KTNA 1G55A 2XVYA 5LWQA 2VF5X 3TCXB 5KVSA 1HL3A 4LF4B 2Y71A 4EA9A 4ZRMA 1JR3A 3Q4GA 2XKAA 5JR3A 4DIUA 2JCGA 4HZGA 2YJ4A 3I52A 1JJVA 4XM0A 5KC9A 3F7OA 5FQNA 4ER6A 4CL2A 1V47A 2I3BA 1B42A 4RJKA 4JEHA 5AKHA 5E2AA 4FYXA 1E3IA 1ORTA 1E3TA 2IRWA 2W90A 4R83A 5A4MS 4CJXA 1UFOA 4J0GA 2C0CA 4Z86A 3TX2A 1XMOB 4RK5A 5DNYB 5IDWA 1NTRA 1EJ0A 5LDDC 4EHJA 2YWRA 1GPLA 2O07A 5JSQA 5EQDA 3C8DA 4FZRA 2BGJA 2WWWA 3PE6A 2HNAA 3TF5A 1KJJA 2HUPA 3EXG2 1KA9H 4WKPA 3BDAA 2FZLA 5G0UA 1TQHA 4KIGA 2J7PA 3A32A 5ALNA 3L7JA 4ND3A 1MEOA 3CF0A 3Q15C 5E7IA 621PA 3ONNA 3RF7A 5EAIA 2XE4A 3SM9A 4EENA 3RE1A 2GFHA 4PYMA 4CV3A 4PRYA 2C8JA 4G85A 3H84A 3MD0A 3KSRA 5AKKA 3ZHRA 1HX7A 1JHUA 4A6EA 4HQKA 5MHTA 4KXXA 1YFZA 5JOQA 4JUAA 4IJQA 2COEA 1NQWA 1VBKA 3ASYA 5B3JA 3OFND 3WVNA 1GZDA 2JZOA 2Q49A 1OBOA 1UPUA 1DEOA 1DC6A 4DV2B 1JN0A 4XCVA 4S1PA 1LLFA 4EVIA 1WXDA 4O59O 3L0BA 1QE5A 3GJ5A 3WK4A 2RGGA 4GOOD 2EQBA 3HWX1 4NP6A 3UW1A 4RKFA 4GYJA 4MKIA 3VRHA 3L8YA 4DIBA 2AW5A 1LZLA 2JFXA 3PYMA 1LPNA 4LYYA 4MUEA 1Y5IA 4MW2A 1VCOA 3BWCA 4Y30A 1TTTA 2JIPA 2H9IA 3RRFA 5EMHA 2HDOA 3G5AA 4J2TA 1FFYA 4LOIA 1XI2A 1E6LA 3AILA 4AMYA 3IO3A 3PIDA 4Q4HB 1ZU4A 4KQEA 4Q4HA 3WGZA 5CA1B 4PGMA 2VK8A 4AJNA 5LYYA 5CA1A 5A2QA 2WMYA 1WMBA 3DT9A 4IQGA 5ALDA 5L4NA 1L1EA 1PK8A 1U1IA 1BZYA 3T5MA 4EH1A 3C6KA 3UQYS 2IGTA 1BA2A 5T57A 4Y3UA 1YNSA 2B98A 3F1LA 4B6PA 3BHNA 4DLRA 1GRQA 4FXOA 4HDQB 3MRXA 4HLUC 4G5HA 3OE7A 1Z2PX 3ZJYA 4GKVA 2GA9A 2C2OA 4I0WB 2VBGA 3HYNA 1P6XA 4EHBA 1QGYA 4LY3A 3DHEA 3T3MB 1I10A 4KBGA 4DJAA 1O7JA 3VYUB 2HWWA 3TKYA 3A0UA 4J9UE 3M49A 4H6WA 2R44A 3TQCA 3UGKA 3AI2A 3O84A 4LAFA 2BT4A 4Z7JA 3IPYA 2JNWA 4MV6A 5HF6A 1QGED 2PG3A 3C43A 4UUPA 1I6WA 2G6BA 1GYQA 2APJA 3OJ0A 5EWJB 5EWJA 1KVSA 1NSFA 2YIJA 3SM3A 1DHRA 1JEAA 5HQJA 2QP4A 2EL9A 3EF3A 4JGGA 3DC7A 1Z13A 1E3LA 4RTMA 4J8PA 3K1AB 1D2RA 1LBHA 3FR8A 3L49A 1WVMA 3K1AA 1KZ9A 3CY6A 3V6MA 1NGSA 3W5IA 4PNZA 4R41A 5ALXA 4INPA 1TJ5A 5EP4A 1U28C 3E23A 3ZBQA 2BKUA 4YUZA 1ZL2A 3PDHA 4UCWA 4N8EA 5LA6F 3FPKA 4LDRA 4N8SA 1EFDN 5EMNA 1EWQA 4CLXA 4BC0A 1UWCA 3D3KA 4FPXA 2FQXA 1JVSA 4I4CA 3X1YA 5JY1A 3SBXA 4ESVA 2OCIA 1EB8A 4XOIA 2G8LA 1HDZA 4DLKA 4TMVA 1BQEA 1LA2A 3ABQB 2IF2A 3NETA 4U2BA 1VHJA 4EW1A 5CT9A 1DOHA 3KL4A 1JI0A 3WP0A 5KDLA 4BUZA 3BIWA 3ENKA 4K03A 5FOTA 3IBFA 2R00C 5AI9A 5WRFA 3S8YA 4EHKA 4D3ZA 1T2CA 3UC9A 5EHZA 3PFKA 3AGPA 2HF8A 3RVQA 1DJNA 1TVKB 1EDZA 3IQEA 1TVKA 2HQOA 3EVNA 5EIOA 2YWJA 4X64B 1VIAA 1XZAA 4CFYA 5JS7A 2NSLA 5B64A 4BNDB 3ISTA 4BNDA 1ZD4A 3F78A 1KZGB 1QF7A 4LXQA 4OQQA 2OEPA 1UOQA 4A4DA 4DLYA 1KEUA 3OOEA 1HFEL 4LJ6A 2G07A 2OXIA 3WXMA 1T4MA 3E9RA 4A92A 3KVRA 4RULA 2IBTA 3JZIA 4JBIA 2ODTX 4CKBB 4WLFA 1C4KA 1U7XA 4CKBA 1YK0A 1WUIS 4FNGA 5E9JA 4DLWA 1VP9A 5FBHA 1HT2E 4HPWA 2E48A 2VHZA 2ZPUA 4OI0A 1NW3A 5KU1A 2W2PA 2YZ7A 4L78A 6Q21A 2HHLA 1KIAA 1U90A 2JFHA 1D04A 4P4LA 3BH6A 1SHZA 2QD3A 3D8BA 3G2PA 4JC0A 2Q0HA 4CDNA 1L7NA 4CMEC 3G2NA 5D3QA 4IEIA 4CM4B 1SPXA 2CE7A 2PO5A 3JRNA 4CM4A 2XIQA 3P9PA 1RE0A 2PJRA 1C80A 5K6TA 5CYFA 2ZRKA 4BNJA 2QEQA 5AJXA 1XXLA 4MARA 4BU0A 3MCZA 1NM5C 1CZOA 4KO2S 3C8HA 3QTLA 3L7YA 2WHRA 1IPHA 3GAZA 5CX1B 5ALTA 4MVJA 5CX1A 1GCUA 1KP9A 1YL6A 3ND8A 1DX6A 4OD0A 4R54A 3W2TA 1I2MA 4IG9A 2B69A 3NATA 4PSCA 1W9HA 1LBEA 3L5KA 4AUNA 1GCAA 4P22A 1X13A 4LDZA 2ZIUB 1KEEB 2XB8A 4O02B 3DE0X 5K3OA 2C42A 4WI1A 1KEEA 3L4BA 1SEPA 3O2JA 1BRMA 5JI3E 4ROTA 4DILA 1FDRA 1G7CA 1USWA 3X43A 1G8GA 3CW2A 2J0UA 3B8EA 3HH8A 2XNSA 3F67A 1QG0A 3QEMB 5ELLA 3HN7A 5IVKA 3QEMA 1XMIA 1W47A 4O4JF 2WTUA 4OHPA 3AFNA 3BRWA 3E5HA 5GQSA 2LXNA 2PJDA 3B38A 5L7YA 3OECA 5EZYF 1DPFA 3T5DA 1YCGA 2D0DA 1YDFA 2AG6A 3B1FA 4MLDA 2Z1DA 2H2WA 4G6ZA 3CNHA 1H2FA 4S2UA 1V45E 5TMEA 4ARIA 2FJPA 3D3EA 4PLWA 5EHNA 2MCFA 3QYPA 2DQ4A 2JKVA 4M7PA 2PSEA 1BMFD 2X5JO 5AESA 4DDWA 1RYYA 2CLLB 1AKQA 5FWDA 1TU3A 2BI7A 3GVHA 4MCHA 3L79A 4AZ0B 3KQUA 4KLCA 1FYWA 1A95A 4U6SA 4AZ0A 3CZ4A 2CUTA 1AO0A 3ETJA 4DM7A 4R81A 3B1ZA 4FONA 4OXQA 2VRWA 1M1NB 3UJ9A 1M1NA 1FFAA 2OD9A 2ZI4A 4TV8B 1FYXA 3Q8WA 3KYCB 3WIUA 3KYCA 4AY6A 3QKTA 4F4DA 1R6UA 3B6KA 1E6KA 4I1PA 3VNAA 3R0VA 3MOSA 3WP1B 2YWFA 4F4JA 4KPEC 3R76A 1R0LA 3IO5A 2I8AA 4TWIA 1F12A 1FUUA 1BFUA 3VPGA 4B81A 1CBUA 1CY6A 3I92A 5J2UB 5ICCA 4NVRA 5J2UA 2Z9BA 3ROTA 3SEZA 8ATCA 3BCHA 1ZD2P 4DMMA 2AVDA 2YQZA 2YXBA 5GP1A 4ZTZB 1TCAA 4OHCA 4EECA 3WK9A 1WQ3A 1H8ED 2NXJA 3P26A 1T5SA 1ZGZA 4KB5A 1EG7A 3M0EA 3KALA 1KJ9A 4TMWA 3VUEA 1ESEA 4B80A 1U11A 2HFJA 1NN1A 4S35A 4UTPA 5BR8B 4EP1A 3HU2A 4BO3A 4F06A 4UXJA 5HNKA 1ZU5A 4GYKA 1NVTA 5THQA 1E6MA 3ELBA 4K8OA 2D1SA 2I87A 3MT8A 4LE0A 4UUBA 3AC0A 2IUUA 4EB6A 4EB6B 2PX6A 1IBKB 2ZT6A 3KCQA 1N78A 1OIXA 3R24A 2EZ8A 2I2FA 3LQYA 4FINA 3KR2A 3QJ5A 3WKAA 3I9NA 4JASB 4YR7A 1D8TA 3OPYB 3RSGA 1IY2A 3T34A 2XQJA 3OPYA 3FCEA 3IAXA 2IEYA 1QV7A 2ODPA 2PX5A 4ZO6A 1K97A 4BFLA 2EATA 2WD8A 3NEPX 4OH7A 5TRTA 2QX9A 1EQ2A 3WGIA 4NLLA 1CF9A 2J0EA 2ODWA 5K2OA 4MK4A 1XTKA 2VRNA 2GBCA 3IV7A 5FBLB 5H70A 3GLFB 4BO1A 3C1TA 4D57A 4KK4A 1TLFA 3WRXC 2JLWA 2D4AA 3CB4A 4Y0AA 3WGKA 5G3YA 4LK2A 4J2OA 5E6UB 3KM0A 2HLDD 1EUDB 5E6UA 5A3JA 4Z4EA 1EUDA 1Y9EA 3LZDA 4BU1A 2WE7A 5H4HA 4MW0A 1POXA 2ZPTX 3CQ9A 4EKYA 5KEIA 3F4LA 1O0SA 5HJ7A 1IL0A 4HLDA 1W5TA 1R27A 3ZY6A 3ETHA 4YGYA 3B60A 4HGNA 1NJ8A 3QVWA 4KPFC 2H52A 3HB1A 1W4RA 3FE2A 4J94A 4C7OB 1WD5A 2D0OB 3INTA 2UV8A 4RDIA 2G9ZA 4O5AA 4EW3A 4C7OA 2PWZA 1YQXA 5KNCD 2WUFA 4AF7A 3AW8A 3P19A 3GGJA 2H2FA 4K9KA 2ZBDA 1M6WA 4EL5A 3KAPA 3NLLA 2CMKA 1IOLA 1H0RA 1NQ5A 4KE7A 4MQLA 3VZSA 3PYXA 1JGTA 5H82A 3WLEA 4EZBA 2FA9A 3AFGA 1OVMA 4HV4A 5AVSA 3V4RA 3OI7A 3Q9SA 4KJXA 3TLJA 1Z18A 2P8JA 1P8AA 2ZIXB 3EVTA 1XCOA 4K28A 2ZIXA 1CYDA 1LDNA 3U60B 5CIYA 3WL4A 4A26A 5GOZA 1XELA 3UWOA 4B6OA 1J06A 5HOQA 3OCJA 4R2KA 5FRDA 2RGNA 3T7TA 4PX5A 2XMGA 1U1GA 4DLUA 4ZAZA 5EUQB 4D8TA 3BL6A 4FGUA 2O06A 4XDZA 2VP3A 1S8NA 1N0HA 1S8FA 4OQEA 2VVTA 3U17A 3KQWA 3DOUA 4YWJA 3U39A 4IRMA 1HOTA 3O91A 1KU0A 1Y63A 2ZEJA 4HYEA 1AKUA 1EVJA 3FGPA 5JYEA 1T3LA 1YB1A 4MS4A 3VR5A 4EKGA 4JLAA 2O8CB 2DWCA 4MB2A 4AY5A 1LVHA 1Y3CE 4OHZA 2O8CA 3GJ0A 1MJNA 4BP8A 1EWYA 1Z6PA 4H3KB 2G04A 2Y8EA 3LUBA 5I9IA 2NN3C 3WGOA 2YUIA 4NE7A 5JWOA 3VR1A 1HNWB 4FHCA 4ZN6A 1TB4A 4RVGA 3WFJA 3EQ2A 1SQSA 3PC3A 2AFHE 2GSDA 2NO6A 2C3OA 3BGDA 2I33A 3Q88A 1ZISA 4L08A 1SC4A 2ZXUA 1DO8A 1KKUA 1PQ4A 3JQAD 4L9AA 3T9CA 3V1MA 1NWHA 4YMTA 3R6GA 4V1CB 4ZQGA 3EHDA 3GGSA 1CULC 4V1CA 2Y0PA 2DPMA 3NBMA 1QG6A 5IUKC 2GNOA 1XA3A 4DJJA 5EJ7A 2BGKA 2YBEA 1XMJA 3G02A 4URFA 5E7JA 4ATNA 3CISA 4DNPA 2AX3A 3EUAA 3LFUA 3DZKA 1UXKA 3ABRB 3KTFA 3PQ4A 4HY3A 4YO7A 1SBYA 4A6DA 5K0TA 4TZ0A 2WM8A 3AF5A 2ZBPA 5DM70 1P5HA 4KXLA 3KD2A 2MIIA 1FYFA 1M5TA 1MOSA 3VC1A 4EB8A 5GZ1A 1UANA 1DFIA 5CVCA 4DCCA 5H9WA 3I5YA 2DB3A 4IYRA 1M2VB 5FWNA 2Q9UA 1NLZA 2WVHA 1M2VA 1Q1QA 2YDXA 3MCWA 4O1HA 4PBRA 4TUYB 5KWEA 4TUYA 1EK1A 2CL6X 1NUQA 2IPXA 1OI3A 4YWHA 5JC8A 3THWB 5GTDA 4QBTA 3THWA 3AKYA 3OPMA 4IJVA 2WYIA 1HFKA 1BVYF 1XF9A 1KHTA 2HWXA 1UKCA 4FQ8A 4MVJG 2REXB 1PWXA 3TMKA 4DC9A 3I53A 2BZ1A 3PXDA 5AK3A 4ZU1X 3I8XA 4B2IA 4BOYA 2HSWA 3M9WA 5JV5A 2XA9A 3FDFA 4WNIA 3ACCA 1Z0JA 4WZBB 5L3RA 3PXCX 2B37A 4LE1A 2CVFA 2I2DA 3D6TB 4YPVA 1CQJB 3BQ9A 2H2GA 1CQJA 5AJZA 5ERXA 2IPNA 4LZWA 2CXHA 1PK7A 3NM4A 5KS2A 1OC2A 1XRNA 5MF6A 1C8KA 1DT5A 1MJ5A 2VJKA 3WO1A 2RAUA 3ZDRA 3ISJA 3PJGA 5B6JA 1K66A 4L15A 2AE2A 2A5GA 1IHOA 5EKSA 2R79A 3ZE6A 1AV7A 2FG5A 2IKSA 5E4FA 3AL0C 1M83A 1XTPA 2JLSA 2OGUA 2OYCA 4YMUA 2AT1A 3C7AA 1SM4A 3F0TA 5LUBA 4K6MA 5E38A 3UN1A 2PKQP 3IDZA 3EC1A 3FUUA 3E7WA 3KX2A 1UJ5A 2LDXA 2RHWA 2LPMA 1DBQA 1H69A 3ED5A 4R7TA 4U02A 2RCYA 3B2NA 1GG9A 1UZUA 4WWHA 4ZT6A 4BDTA 4MSUA 4L27A 1KYTA 1N9ZA 2CZQA 3QKIA 1XWFA 5AI6A 4ENUA 3D6HA 3ROPA 3N1UA 2VHJA 3NR2A 3WLQA 4F2GA 1QLJA 2PDAA 2OZVA 3LY8A 1ML3A 3MTAA 4QIHA 2WKWA 1XAJA 4NU0A 3O9VA 3QPCA 1MHTA 2CFSA 4UTVA 2Q9BA 2CKMA 3INYA 4QOSA 3D4NA 3V97A 3IHLA 2OKGA 3L6RA 3EXIB 2BBTA 4XJSA 4FOPA 4RFSB 4FYKA 4RFSA 2ID7A 2H7CA 2NZUG 1G20E 3OC0A 4WY2A 3E70C 1BVHA 3GJZA 4WDRA 4D41A 3OEWA 4D9EA 1R16A 1PJZA 1T5IA 2AMJA 4UQOA 4CI9A 3S81A 3GFFA 3KB1A 4U9HS 3KHSA 1PQWA 5KNCH 3ESRA 2HV9A 3QVSA 3VYVA 1C1XB 1N92A 2HIHA 3JQ8B 3MJVA 1C1XA 2QJWA 1I2BA 3JQ8A 2V7QD 1U0NA 1OXBB 4C01A 3JQFC 3PNBA 4Y67A 5FOWA 1J39A 3HP7A 1QCZA 2AN5A 1M2OB 2Q2VA 3UJDA 3W8DA 1M2OA 4YV2A 5DOZA 2FTKE 2ES4A 3PTAA 1K8QA 1UKVY 1Y3BE 1C1YA 3PXXA 1N9KA 5TF4A 1IHYA 1SCIA 5K6AC 4AY3A 1MO4A 1JG3A 1OI2A 3C4QA 2AG0A 3K09C 2XGSA 1ZJ5A 1VA5A 1CFZA 3JD0A 1SBTA 4JROA 3M2TA 4H4CA 5DT2A 2WQ7A 4GKKB 1AQ6A 1MC8A 3CMMA 1PSWA 1NVDA 4YEDA 4P08A 4BAUA 3PL1A 3L8ZA 2QYHA 1Y8CA 2IIBA 3WGJA 3QU7A 4B4OA 4LF7B 1MFPA 5DLEA 1WCXA 1DBPA 1EPUA 4PAOA 3N8GA 1PZEA 1SQ6A 2AUMA 4QPJC 3UCEA 1A5AB 1UBNA 4NYIR 4YRIA 1G2IA 1ISPA 1VG1A 4YYEA 4C89A 4HWOA 1DJPA 2R1VB 4JJ4A 1LPBB 4MQ5A 4G0NA 1QM5A 4NH0A 1XHEA 2W6ID 4R9NA 3VVBA 4P3PA 2W6PA 4FFLA 2WNSA 2FGKA 1PDWA 4DTIA 2YJTD 2G6TA 4MW7A 1VC2A 1RBZA 3KJIA 1AN9A 1FU7A 5ITWA 4KWTA 1MJFA 5BRNA 4UNIA 2VOJA 3HEBA 1F7UA 1M2KA 2ODQA 4B7AA 4EFNA 1FDOA 3A6HA 3EDCA 3VOTA 4KCGA 2OAEA 1WCIB 3VSAA 4F6RB 4M53A 3QV2A 1WCIA 5IW8A 1E1QA 1XU9A 1BQ4A 2UYHA 1BW9B 3PGMA 2PMKA 1BW9A 4UUNA 3P5SA 2BM1A 1SG6A 2ZUVA 3KKOA 2PGDA 3QXXA 4GVXA 4EHFA 1PNRA 4ILEA 2BCEA 2YICA 3WLFA 5C53B 4JJKA 1XIVA 4B0OA 3JCZA 1NQAO 4ZO7A 1K5HA 4EG6A 1CSEE 1SCDA 1ZSYA 2P6NA 1IIBA 4WIAA 2EKLA 5AJHA 2OAGA 1R8YA 2R66A 4M0DA 2Z5LA 4KDRA 3L1KA 4FKZA 4YAWA 4NATA 4L3VA 1MAVA 3OQOA 3K30A 1M34E 2P30A 4HXFB 4ZVLA 3WQBA 3H5RA 5GM2A 1UBOS 3IKTA 1ZN2A 2NQ2C 1YA8A 5CJPA 1P0CA 3O3OB 3U4QB 4PGFA 1ICIA 1KAMA 3RW9A 3WY9A 3U4QA 4GHWA 3KZKA 3VH2A 4EHIA 2VSXA 4IWYA 2JEYA 3S29A 4DC0A 5JMOA 1RRKA 4G84A 4FFRA 3DEFA 3RC8A 2QTVB 2Z09A 2QTVA 3H0CA 4JL6A 1O95A 1P1BA 3FVQA 3LLUA 1C7FA 5F78A 1EA5A 2PS9A 2WLTA 5F5NA 1UCFA 3RRZA 4BVJA 1EDOA 3W9UA 3PE4A 2ETVA 2I6FA 4KOEC 4BNKA 1QH8B 4M2LA 5GZ6A 4F60A 3ZTWA 2YIVX 3OKCA 3T7KA 1YGPA 2JFWA 5REQB 1IN5A 4Y1RB 5REQA 1BFDA 4IY1A 1C30B 4Y1RA 1AQYA 1L8QA 5BNFA 1C30A 4KUHA 2ZIVB 3LBIA 4HWPA 3DHNA 1XRMA 1F0PA 2G8NA 1ZVMA 4OP3A 2MSDB 5ESXA 3REGA 4E22A 1JPNA 1QSGA 2ZBVA 5EIHA 2WTXA 2GPNA 4W8GA 3QZUA 4B09A 2MYNA 2ZTMA 4DLSA 1RQXA 4ALNA 3NRBA 1K3TA 2IYSA 5AOCA 2AN4A 4TLMB 4CKZA 1BKDR 4K9LA 1G63A 1CF2O 1K7XB 2CF6A 2YYYA 3NHLA 1D6SA 3H86A 1C9KA 3PNYA 4JYAB 1BDBA 1QH0A 4TQAA 1QDLB 4YJGA 2WIAA 4QJ3A 3OFVA 4F3KA 1T2NA 1ACJA 1X15A 3HBJA 1HURA 4XFJA 2P5UA 4ZVUA 3RO7A 5AM1A 2JJ2D 2ZYHA 1XTJA 4M9RA 1E2JA 4KSYA 1B0ZA 3DVAB 4EVRA 2PO7A 3CIOA 4N5NA 1YFLA 1RXWA 2GZAA 1JFVA 2QK4A 1ILWA 3D31A 2W6ZA 1YZYA 1OLOA 3AR3A 4IJ5A 2J9GA 4LRWA 3NTLA 2JGRA 4HWRA 3QW2A 2JAWA 1VJTA 4M54A 3KB6A 1CDOA 4DLNA 3F8WA 1HL7A 4KX3A 3AKCA 4LJSA 5B3LA 3AVVA 1VPLA 4IIYA 4L3WA 2GH1A 1EFRD 4HS4A 4RCYA 4TV8F 2C07A 2I6TA 2Y1DA 5BSKA 2OP1A 2Q21A 4YRFA 2VLIA 3DTVD 4MRAA 5LDGA 3OC6A 1JAHA 2XH8A 2VJAA 1JAZA 4PO3X 4PHFA 4BVFA 5A02A 4Y9SA 1DTWB 1LU9A 2BHNA 1JQJC 2DUNA 1DTWA 1DAHA 5F33A 4A8HA 3UJNA 5DH9A 1KZHA 3ZXXA 4GWLA 5M29A 1NVWQ 4A2WA 1NBEA 1T8RA 1P2DA 3G2QA 2XZDA 1NW5A 1E2LA 2N1BA 4V02A 1GTRA 1FTWA 1ZZGA 1JQ5A 1EFVB 1EFVA 4R8SA 4WHMA 3CVXA 3U4MA 3PK0A 3RWMB 3KEGA 2XJ4A 1Z08A 2ZR8A 3B1KA 4P80A 1Q95A 2I9PA 2JB9A 3BILA 3ILVA 5C2JB 4FNMA 1QX4A 2SKCA 4DR7B 3LDHA 2NW6A 1WTCA 1TECE 1I7LA 4R1MA 3NDJA 5CXSA 4R0NA 2BMEA 3Q6IA 3F3MA 5K7SA 2AR0A 4ZARA 2OQVA 4BWVA 4DAOA 3GRVA 4J0IA 2Y4OA 2CXTA 2QV7A 1V25A 2EV9A 2ISCA 5ALVA 3GRYA 2FWMX 1DRKA 4BO0A 1ENOA 3ZI0A 4HYYA 4QLOA 1NBME 1A5ZA 5DDIP 3ZCUA 2PXHA 3PXUA 2W2LD 1YJQA 4G5SA 4Y6SA 4NZYA 1E9EA 1F38A 3IP3A 4Q15A 4RU1A 2PH1A 3UM9A 1GA6A 4Z4IA 5K0JA 5J59A 4UVGA 1M3SA 2IYXA 4A16A 1Z0AA 5ALQA 4YT2A 3P9YA 4TTJA 4TYPA 1Z7EA 5KQLA 2GZSA 1X70A 4CDMA 2XUKA 4KGVA 3LM8A 1OJLA 1U81A 1S96A 2NZXA 5PNTA 3TSCA 4NZZA 4YXFA 2VWQA 3DOCA 1P3DA 5DNVA 5EE3A 1RYDA 1F2DA 1BH6A 2PX3A 4NBWA 4C0LA 3N7AA 3TLGB 4PO9A 1DEKA 4Z7NB 3TLGA 4QNNA 1Z83A 4Y2RA 1XNRB 1WABA 5B53A 4MVJI 1IVNA 1OWOA 1Q1NA 3GFBA 2HRZA 3OO0A 2HMYB 1FZQA 4URWR 4CRWB 1Q0QA 3B5JA 2BEJA 4ER3A 1JDVA 5EIBC 1N1EA 9ATCA 5H80A 2ZE7A 1MZPA 2NNLD 2NUPB 2NUPA 1DVRA 4AZ3B 1C9YA 1DEXA 1FTQA 2C1XA 3S3TA 1K6JA 4GSYA 4I7EA 2F3TA 4KIFA 4L50A 3WLLA 3ZZNA 2VCEA 2Y1OA 4KO1S 1WULS 2AXEA 2QRQA 3EVAA 5GMOA 2D2IA 1IM8A 1BKYA 4AZWA 3NIDB 4MPTA 3G5LA 3LWDA 3R0JA 1LPPA 3T7SA 3ZIDA 1AGNA 1N0WA 4N6NA 2WIKA 4HUTA 3A9RA 1F1BA 3K0BA 4PG7A 5DASA 1TPZA 5BUCA 1YUMA 5FBRB 2V0NA 1N6LA 5I6DA 4E31A 3MUEA 3ENWA 4HEA1 1DAFA 4Q16A 3H87A 1RQNA 4Q48A 3KYJB 2RARA 4YJ2F 2WM9B 1M67A 4CPDA 1AKYA 3C2QA 3EQ7A 1LBQA 4K1XA 3LWNA 4KMRA 4M76B 1DAMA 4D8YA 1O4VA 1F5SA 1NPDA 1Z5VA 1ZMOA 1CHNA 5DGCA 3WGYA 1VHTA 4ZYZA 2OL4A 4INZA 4R2JA 1XVAA 2D4HA 3VSBA 2ZU0C 2P27A 2YWBA 4YRJA 2OORC 2WJ3A 2YMMA 3OIFA 4PLZA 2FR0A 1W4ZA 2NG1A 5AT1A 3ZWNA 2UZ3A 4A6PA 4E4Y