1TPZA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
402
structure length
395
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
total genus 147
structure length 395
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tpzA02
1ZD9A 2FN4A 4IOJA 1VG1A 4NDZA 4HDCA 2AD5A 2QE7D 2GKSA 2ZUDA 1XMIA 3EIHA 3DOEA 4LC1A 4QHTA 5JMTA 1MABB 4RCYA 3EPKA 4IFBA 2VSXA 4PAQA 1FUUA 4KVGA 1SHZA 5JS7A 1KMHB 3T15A 1G41A 5EUMA 4IOLA 3ADKA 2IWHA 1Z63A 2P5SA 2P67A 1OV4A 4Q1BA 2PJZA 2L0XA 4HUQA 3LDAA 1QVRA 4URYR 5FUXA 3QBVA 2QA5A 5LBIA 2WWWA 1NLFA 2VEDA 2QRNA 1IHUA 1TUIA 2FFHA 4IOKA 3RS5A 4M1KA 2AXPA 3AF2A 1Z0JA 1A1VA 3VFDA 1JI0A 1N5JA 4XWAA 5HE8A 4B3XA 1D9ZA 1YR8A 4O3MA 2ZVQX 1IY1A 3ZS8A 1L2TA 1M6NA 5DN6D 3K70D 2W6ID 2Z4SA 3VNUA 2IYSA 3ZQJA 3KUDA 1SQ5A 4DLTA 1GVNB 4LOAA 3EPHA 4WIAA 1QHIA 1E9BA 5JSZB 1NKSA 1M7HA 4XSHA 4XTRA 3CPEA 2AKAB 4R2IA 4EQ6A 1KY2A 1GP2A 3HDTA 1WE2A 3SR0A 2X2EA 2X77A 4TT3A 3RANA 2JLUA 2KI5A 2ODNA 4CRWB 1UKVY 1TU4A 2HCJB 2IYXA 4ASUD 2V6JA 4UNNA 1P9NA 2Z0MA 4TYQA 4Z54A 2ODEA 4DRZA 5JWOA 1G8PA 4RCZA 1M7BA 1KI3A 4QKQA 3KJIA 2ZYVX 2HT1A 3KL4A 3LQQA 2P0EA 3CPHA 2C04A 1ELOA 5BW8A 4LGMA 1TPZA 2GJ8A 2JLXA 5HE9A 1ZD1A 1KJWA 5F2EA 2DWPA 1LW7A 2AKYA 1G1MA 2Q6TA 5A0FA 4AG5A 1S0UA 4PC7A 5E7JA 1CRPA 2GETA 4Q03A 1U2RA 4DCTA 4NCJA 3BIFA 2P2LA 1JECA 1S2MA 1N6RA 1TTTA 4MRRA 3HR8A 4LBYA 4Q9IA 5EJEA 5EE5B 2G1KA 2OLKA 3TR5A 2EYQA 2NO0A 1G8FA 1P60A 1E94E 4URVR 2BBOA 2PMDA 1JR6A 2ZETA 1FFHA 3MAAC 1CBUA 4RZUA 4F38A 2IS4A 1TL7C 3K09A 3MWYW 1XPOA 5G3YA 1KO1A 4A4DA 3QEOA 1OH8A 3VR2A 3IGFA 5FOTA 1XX6A 2JIZD 4UXJA 4G1UC 3NBYC 2BCGY 2Q9CA 2C99A 2PCJA 1DPFA 2QGZA 1S96A 3A4MA 3IBYA 3D31A 4G5RA 1M7GA 2ZPTX 2HCBA 3K70C 3K0AB 4JKYA 1ZD8A 5KSZA 3B78A 5G53C 2R6FA 4ZI3A 4FN5A 2IS2A 5H68A 1ZNWA 5FFMA 4A9AA 1XTSA 3R8CA 1XTJA 4KFUA 2OM2A 4LBWA 5JLJA 2MMCA 3MRSA 4M2LA 4JZKA 5GJVC 2QENA 1IM2A 3O8DA 2RCNA 3TQCA 2VP5A 5J4KA 4N0EA 2VSOA 4HLCA 1OB2A 5JFGA 1GFIA 4PSVA 2R65A 2ZI9A 2SHKA 3LH5A 4NYJQ 4TMTA 1RYHA 4D82A 3KQKA 3AVXA 3GPLA 4RD2A 4IRUB 3VR5A 4KV9A 4C0LA 1YQTA 3UMSA 3BXZA 3RRZA 5HCNA 4M9ZA 4MKIA 3ASYA 3TUIC 3VX4A 2RGDA 4DB2A 1TF7A 4GOKA 2K5UA 3PFIA 1MO4A 1YJ5A 5K8TA 4P32A 4JLPA 4URZR 3AF4A 1KK2A 1XEXA 3B1YA 3CBQA 3K9LA 1ODFA 3GJXC 4Q5IA 4NYIR 3C41J 5L8VA 4Q01A 2QRZA 3ADDA 3U44B 1E6CA 4PHGA 1OFHA 1S3GA 2W6IA 4B71A 3C7KA 1ONBA 2NO7A 4I1OA 3R7WA 4JLNA 2IUUA 4DWJA 3LBHA 4QL3A 2QP3A 2JLVA 1S1MA 1G7RA 2OILA 1N6LA 1T5LA 3N2EA 4UJ5A 4KITB 5TMPA 4GPTA 1DE0A 1QHHB 1W0JD 2I1VB 4HDQB 1HT2E 2H18A 2R9VA 3M1IA 4Q1AA 4Q02A 2LWIA 1T6NA 5CLQA 3O8CA 1L4UA 5C2JB 3OIUA 1EFHA 5FTNA 2OBMA 4KSBA 2IF0A 1KI6A 2H57A 2RGXA 3SU8A 1W49A 4A0RA 3QKSB 1E2IA 3FMPB 3NC0C 2ZJOA 4C3ZA 3AVPA 5CM8B 3BFVA 3D7MA 4MKFA 4KSCA 4OYHA 2FGJA 5EP1A 5IRCD 3E70C 3QJYA 1QHSA 4I1SA 5IK2D 3HP1A 1D5CA 1CU1A 2F6RA 4OHVA 3KFXA 3KUCA 1E2JA 2EYUA 4D80A 3EPLA 5JJLA 1Z0AA 1E79A 4RFVA 4GL2A 2IXGA 2JAQA 2QZ4A 1OKKD 1GM5A 3BFKA 3ZLJA 1CR1A 2W00A 3K0FB 5HR5A 1P75A 3OEED 4QBFA 1UKZA 1Q1ZA 2HEIA 3QKRB 4Y0VA 2WVJA 4IFEA 1B23P 3CZPA 4N3NA 5DISB 1EG7A 1HY3A 2ZEJA 2GJSA 4QJ3A 5K8LA 3EW9A 2KBFA 2CL7X 2ORVA 1AM4D 3NBZC 2F3RA 4JLDA 2ZJ5A 3BS4A 4CEHA 3CF6R 4YMTA 4XVRA 2QU8A 4JLKA 3RS4A 3FFBA 1COWA 4ACAA 1HEIA 2DFKB 1BOFA 2QROA 3OAAA 3VKWA 2NMVA 1M2OB 1W36C 5J40A 2W2XA 4CF7A 3U6BA 1P72A 3L0PA 1Z47A 3NH6A 3QKSA 3ZIAA 2ZJZA 3NBXX 2ZRHA 2QT0A 2DPXA 1H8ED 1KDOA 2FZ4A 4TLEA 4BLSA 3UIEA 1II8B 1NBMD 3WMGA 2VL7A 1DADA 5EZ6B 4YMUA 2GTPA 3EASA 521PA 1G3MA 5L3SA 4NE2A 3OESA 3B82A 2QSZA 4M1SA 3UG6A 4LYFA 4PANA 5LB2A 5KSOA 5M04A 5KNBA 3I4LA 4DIDA 3L0OA 3FOZA 1OH7A 2I1QA 1AQYA 2ZI4A 4LBVA 1AQUA 5P21A 3Q5EA 2GAAA 3SYNA 2C9OA 4BFSA 5KNDA 2FF7A 1OT3A 2J9RA 1MRSA 4LJ4A 3H1TA 2FOLA 3VAAA 5CLLA 1AN0A 1UBFA 3KXKA 3PEVA 1NKTA 2AFIE 1AIPA 5UKDA 2CNWD 5EP3A 1EGAA 2QTVB 4TTQA 2PEZA 4CW7A 3F0TA 3MWKA 4JLOA 3QF4B 4YDSA 4BRWA 1OYWA 1VYTA 2AWOA 1GL7A 4CEJB 3BK7A 1YZKA 4EPYA 2VP2A 2RGNA 4CVNA 5EQTA 2X8AA 4A8JB 5FBRB 3F8TA 3QKUA 3QPWA 1NMYA 4UKDA 3ONWA 1RPZA 4BFUA 4JL6A 3D8BA 2W0SA 2H7VA 1KI4A 4EFMA 1DAMA 4LUCA 3FVQA 4KO8A 2CVFA 2YJTD 2HT6A 2OFOA 5KDDA 2EWWA 2ZI6A 4MITA 4B3BA 5GJCA 4Q18A 1D9XA 3EAQA 2FJUA 4LX0A 2BEJA 2P6UA 2VSFA 4LC0A 4DLZA 2V9PA 3N70A 4BGDA 4F92B 1X1RA 3MWJA 3AVTA 5FUYA 5FR1A 3ZZ0A 1AGPA 2VRWA 4H1UA 5CYOA 4EJSB 3U5ZB 4XTCS 1GRQA 1T8TA 1BO6A 2Z6VA 3A1UA 3NG1A 5HKKA 1KY3A 4OQMA 1W36B 1XRJA 1KMQA 4LCBA 2ZSBA 5EUQB 5FOSA 4DT1A 1DAIA 4IVRA 2PX3A 3AP2A 1JR3E 3CRW1 2GJ9A 5C46F 3U44A 4DJTA 4LK2A 1EK0A 4TMVA 2OFXA 2QPOA 4ZKDA 2GILA 1C1YA 4PSKA 4YC7A 4QJ5A 1TADA 3MCAA 3P20A 4OL0A 2PT7A 4JJKA 3HYRA 4DSUA 1D2NA 1S9DA 4CIDA 1N0WA 2YC4C 1NMXA 4LRWA 1N5IA 2JJ2A 4HZIA 3ZVLA 1M1YE 3B5JA 1AKYA 3KTAA 4MA4A 5JWHA 4Z8YA 4LJ9A 4BASA 4LZZA 1WF3A 4TL9A 1MH1A 1N25A 4PZZA 4ACBA 3THOA 1HE1C 2GJKA 3MLEA 1D6JA 1G8HA 4N0DA 1XD9A 4IXNA 4RD6A 2ATVA 5IK2A 4POAA 4W9MC 4LJ8A 2GVDC 2Q21A 2WWXA 1DARA 1GZSA 4GMXA 2DFTA 1X1SA 5L3RA 4MH0R 3CX6A 3N2IA 1XJQA 3A58B 2QGNA 1J99A 2IYRA 1E99A 4US1R 1G8GA 4I1VA 2BIFA 2RGCA 4PHFA 4RD4A 4D6PA 5DI9A 3KXLA 1WRBA 1UM8A 1W0JA 3B1VA 2ZYWX 3GCGA 2OXRA 3FB4A 4UNPA 4MRNA 2BKEA 4Q4JB 1XMJA 3VX3A 1U8AA 4WXRA 4O0MA 2B92A 4OJKA 5E7IA 4XVUA 4GMDA 4BWYA 3KQUA 3QKRA 1Z3IX 4EJSC 1FUKA 1YR6A 4LI0A 2V54A 5EZ5A 1VYVA 4QG7A 2REOA 3RWOA 2ZRGA 1FW6A 1O3YA 4NTZA 1QHXA 4Q1DA 5JWRA 3QBTA 4IHQA 2GXSA 5EXTA 1IXZA 2ZE7A 1UAAA 2ECKA 1OHHA 2FZLA 1H8HD 3PEUA 2HXYA 3I5XA 3ICQB 4HUQB 2KE5A 1F48A 1NRJB 5LB4A 4UNQA 1XEWY 3VR4A 3OFND 1SXJB 1KMHA 1CTQA 2WJHA 4PQYA 4BFWA 1G16A 1N5KA 3IBGA 3L82B 2EFDB 3CWZA 3OIYA 4E03A 3AF3A 1G291 2FA9A 4MYCA 4RFSB 1E2HA 4OHZA 3W9YA 4Q7KA 2REBA 2ZUCA 4KODA 3HU2A 1GDDA 2ZI5A 2IS6A 2GCPA 3CR7A 2WBLC 2XTNA 3BBPA 2AX4A 1Q12A 2WIBA 1BMFA 3NEJA 4BZXA 5GJBA 1XNJA 3T1QA 4D4JA 1P2TA 1N6OA 4FXPA 3R7WB 1YKSA 1NF3A 3MFYA 2VYFA 2VF8A 5JJKA 2REXB 1JEDA 3TUJC 4HLQB 3OZXA 3K70B 1J70A 2PEYA 2Q3HA 1AGRA 1ZW6A 1GKIA 4QOSA 1L8QA 1OYYA 2BM0A 5BYJA 1P4SA 3AUYA 1Z28A 4HB4A 4HUTA 2BEKA 3SHWA 3THWB 3BD9A 5H8WA 3BRWD 3IEVA 4I4LA 2RHDA 2VIIA 4URUR 2MMGA 5CK5A 2VO1A 4HLUA 1JEEA 2JA1A 1SVOA 1T8UA 3K0CC 4JIMA 3N5CA 5E3HA 4M9QA 1D2EA 5A4JA 4C2TA 1NIJA 4CYMA 3C15C 3U2QA 2QM8A 3L2OB 5BQ5A 4CGZA 4H9GA 2O8CB 3GJ4A 4HB0A 1EESA 1L4YA 1K5GA 2IL1A 3GQBA 3W3ZB 2A5JA 2ZRNA 4B32A 1W44A 3OAAD 1TEXA 2IEYA 3MGCA 4AD8A 1E9RA 3CZQA 1OIXA 4M22A 1U9IC 1F60A 2CL0X 2BMEA 2HF9A 1XF9A 3KQLA 1RKBA 2ODBA 4B6FA 2ZS9A 1LB1B 4LJYA 4IDOA 1G8YA 4B3FX 1ZMXA 2XXAA 1CXZA 2KSQA 5E4FA 3SDZA 2BCJQ 2OBLA 2F1HA 1NI3A 4B48A 1RFLA 4BZPA 2AL7A 1OB5A 1XJCA 4FCVA 2B7BA 3QY0A 1NL3A 1JAIA 2CHGA 1E2GA 2X19A 4II7A 3Q3JB 1TQDA 1H65A 1UDXA 2PLFA 3BOSA 4KU4A 4PAMA 3TSWA 1BIFA 5K8IA 3TKLA 5A5GA 1DAFA 3LO5A 2BMDA 4J0QA 4AWXA 2A78A 4HLUC 2BBTA 3CF0A 5DGXA 1G64A 4HSEA 4WA7A 2GXAA 3EIQA 2G88A 5SZJA 4DHEA 3U3JA 2VHJA 1KK3A 2GCOB 2ZRAA 4CDGA 2BOVA 5JZVA 2DB3A 3TVTA 1OIVA 2TMKA 2QMHA 1DAKA 4BZQA 1KAGA 4NKRA 1KOFA 1G9XA 4A6XA 4HI0E 1OH5A 3DZ8A 1Q3HA 2BHRA 2GXQA 5AJWA 3REFA 4D2IA 4DSTA 1VCIA 4P0TA 2YWEA 1G5PA 1TF5A 3O8BA 2QM7A 3B13B 1IN8A 4Q1FA 3K1JA 1Y63A 1KI1A 3EIEA 1E3MA 1C4OA 1Z8FA 4OHYA 3C14C 3Q7QA 2VP9A 2YC2C 3NBFA 2QQEA 4R2HA 1XPRA 3LLUA 4HZUA 1JQLB 4BLQA 4LYHA 5FBVB 5LDDC 3GJ5A 3B85A 1OPXA 2JLWA 4JVLA 2B21A 2DBYA 1PV4A 2FG5A 4MKGA 3X1YA 4JT4A 5GADl 4OHWA 5JEEA 1IONA 2GF9A 3O8RA 4MQBA 4PO9A 3NWJA 3QI2A 2CEAA 1QRAA 1OSNA 1S9HA 5FBQB 2CJWB 2EU8A 3RVBA 4ESVA 4AKGA 1G4AE 1RYFA 4C7OB 2FEOA 1G3RA 2F9LA 1R0YA 3U3OA 1RRCA 3EZFA 1L7VC 3THXA 1GTVA 4Q48A 3LQRA 1E2QA 3IHLA 4P4UA 2KBEA 4B3DA 1ESNA 1X8JA 2OZEA 3W3AA 3IO3A 3ZZUA 3OF5A 2CE2X 2WJYA 4U5XA 3BGWA 1EWQA 3NKVA 3GLFE 1E0KA 4UXHA 2WOOA 3DMDA 5BYKA 2F3TA 3GJ0A 5B30A 1KJZA 1NY5A 1Q44A 3CNLA 1U90A 2IT1A 3SN6A 4DXAA 1XDBA 5CK4A 3OEEA 1EWRA 2XZOA 4PFSA 4IKEA 4C0QC 1JALA 4DCUA 5GVRA 3PITA 721PA 1NN0A 4NYMR 5G40A 4C30A 1FTNA 2DY1A 2UVQA 3IQXA 2ZTSA 4E07A 1YRAA 3CRRA 2O8BB 4GOXA 3FHCB 4R71A 4QBIA 3AVVA 2QP9X 4Q19A 1I2DA 1NSFA 4WXPA 2V1UA 1Q20A 4EPVA 2BM1A 2JATA 2FSGA 3CX7A 4M1WA 3IPXA 3R9IA 3PVSA 2ZR0A 3IIJA 3KDSE 2W2TA 2AFHE 2ERYA 1YZQA 2PMKA 3NHBA 3SBDA 3QENA 2YVUA 1PLLA 3VR3A 2E1RA 2WPDA 1SXJD 4OK6A 1E0SA 5BN4A 3EZ7A 4JBWA 3EX7C 4AIIA 2R6AA 1FZQA 4YMVA 2EW1A 1G7SA 3LWNA 4DLYA 2YWHA 5BWMA 3CIOA 3PEWA 2WZQA 3QXJA 5HTKA 4IVPA 2PJRA 3R9WA 3T1OA 3PUVA 4LPSA 3KX2A 5JBQA 3EWSA 2WJVA 4PZLA 1TUEA 1W0KA 4WZ6A 1XXHB 1Z0DA 3RYTC 5BXQC 4A8JC 2EFEB 4JJZA 4UNSA 4X8OA 3QKTA 4TQ9A 4RY2A 2VP0A 2JJ2D 1ZM9A 1M74A 3JZAA 3R20A 2ZRFA 4US0R 2ZS7A 4RD0A 4Q4LA 4JLVA 1RE0A 1SKYB 4TL7A 1GAJA 4M1MA 1CF4A 1E0AA 2CK3A 2XB4A 4C0BA 3FHOA 1FOEB 4DSOA 1J2JA 4Q66C 4X8MA 2IHYA 3RRMA 3I72A 3ND8A 1DBSA 3RC8A 4L16A 1UEJA 3NTUA 3Q7PA 1E2MA 1LF0A 4Q1CA 3QG1A 3V4RA 3X1ZA 4FI3C 4GOJA 3WYAA 4LBZA 1Z0KA 1BS1A 3E5HA 3CLVA 3OIVA 5F98A 1E2NA 1E2LA 1LNZA 2ZJYA 4RZXA 1Z6XA 2NQ2C 1U99A 2C77A 1GSIA 5KTYA 1G5TA 4ZDJA 3TSZA 2LCFA 3CX8A 8OHMA 3FMIA 3T35A 2VH5R 1NSTA 4DC9A 4DCNA 621PA 2OCPA 3VU9B 2QMEA 1IN6A 3T1VA 2PT5A 3KFVA 5FOWA 1E2PA 3HR7A 4K46A 2HLDD 4V0NA 4Z1MA 1S1CA 2AK3A 4EDHA 4M1OA 2B7CA 3FMOB 1KGDA 5GJWC 4C2UA 2VA8A 2NG1A 4NU0A 2J0UB 4GFDA 4DEYA 1CIPA 1LS6A 4NYIQ 4DSNA 2OV2A 4CEHB 5IT5A 5FL7A 3M0EA 5AUOB 1CR2A 2P3SA 1JNYA 3NXSA 1X86B 5DNYB 3T1TA 3RAPR 1F2TA 4B34A 3W8NA 1ETUA 1HTWA 4Q4HA 5EP2A 5FUVA 3DOFA 3AEZA 1SVMA 1ZYUA 5EE0A 3TMKA 4O2LA 1GNPA 2OHFA 4CEIA 3B60A 2V8OA 3AKCA 4XH9B 3GLGE 2W2VA 4P4TA 5FTJA 2GZAA 2QPTA 4B75A 4NCKA 1KKMA 3REGA 1KYIA 1JJ7A 3WMEA 4BLPA 3M4YA 4CT5A 1DVRA 3AGQA 4BEJA 3WBKA 3GJ8A 3X1XA 2A7QA 2A2ZA 2XITA 4FINA 4QJ4A 5JS8A 2J3EA 4OI2A 2UKDA 1ZRHA 2WICA 4A2WA 2NO9A 2IHBA 3QVVA 5TV2A 5AR1A 2ZXUA 3K0CA 1Z2CA 2XB2A 221PA 1R5OA 1YZUA 2YHSA 1GRNA 4BQSA 1KI6B 1YZNA 2W0MA 4AKIA 2FX3A 2A3RA 4TQUS 2O8EA 1VIAA 1FP6A 2H1LA 2ASEA 4TN1A 3OE7D 4GZMA 1I4DD 3A1TA 5EE1A 3RSOA 3TIFA 2J5XA 4TSFA 4ZIRA 3FKQA 3UKDA 3GLIE 3I62A 2GBLC 3Q8XB 3WMFA 4UJ3A 1JXMA 3LNCA 2CXXA 3VTKA 4V0ME 2ZJBA 3VQTA 2BDTA 5C4MA 1U9IA 4OBEA 1PUJA 2CL6X 5AJVB 1F2UB 4ZDWA 1TF2A 4TSFD 5CM9C 2P6RA 1P73A 2ZIAA 3UMRA 3RHFA 1Z83A 1W48A 2IBMA 2ZRDA 4D4LA 3B1WA 1A82A 1EFRD 3BWDD 1C9KA 2HLDA 2OCYC 3DM9B 2YV5A 4LJ7A 3TQFA 4D4MA 4ZPXA 3GLIA 3TK1A 3SYLA 1FPMA 1VPLA 4RJLA 2XNDD 1SVKA 3A37A 1HE8B 4ZDKA 4YXWA 3ADCA 1AKEA 5DHAA 2PZEA 3QPUA 1G20E 4C9BA 3W6PA 4GP7A 4A0FA 4NYMQ 1R8QA 3KB1A 1E2EA 3WY9A 2IS1A 1J7KA 4DEXA 2VHQA 3A36A 5EXPA 3WP0A 1E4YA 2A5GA 2WSSD 3T06B 1Z5ZA 3CRVA 2XTMA 2IYUA 3ZGXA 4XJXA 2CMKA 1VCOA 5KNCA 1VCNA 4R98A 2ZJAA 2AN9A 2R62A 4PQRA 1R10A 1JPJA 2CK3D 4DZZA 4A0HA 4TMXA 4C0JA 1W4AA 1ZP6A 2F9MA 1GWNA 1KNXA 4YQFA 3AVUA 3CUEF 3WP1B 2BKUA 2F43B 1RIFA 1XTIA 3LV8A 1KSGA 3DDCA 2OT3B 5ANRB 2IUSA 4M0LA 2O52A 4MUAA 1TQ4A 3MD0A 4QXAA 3VHLB 1IBRA 4HEJA 3AF1A 3VHXA 2ZRCA 3F3YA 1FMLA 1WBBA 3ASZA 4AYXA 2JASA 2R6GA 5AJYA 3QSYA 2J0SA 5DIFA 4W7SA 4V0LA 3PENA 1SVLA 2IYLD 5TARA 2O8DA 2EFGA 1HH4A 1WP9A 2ZU0C 2J41A 2CJWA 2OAP1 1YVDA 4WAUA 4W5JA 2PZGA 1UBEA 1W0KD 2ZSAA 4IW3B 2QAGB 2XZLA 4L5BA 1UPTA 4C0SA 5FTKA 3LX8A 2XNDA 3GEHA 2FPLA 1CLUA 2WJIA 5CYPA 2OESA 3NIBA 3SE0A 4MKHA 1CJUC 3RRYA 5L3VA 1QHYA 2J7PD 2N42A 1MRNA 2A5YB 4D4KA 5J47A 2B8TA 4KHZA 4QBGB 1E9AA 3W6NA 4KAXA 1GL6A 4ABYA 5CB6A 4ASUA 2YOHA 4ILEA 4P33A 1QG4A 2I3BA 2A9KA 3HU1A 2IEZA 3GLFA 2YOFA 4FWIB 3RRNA 2ORWA 4BLRA 1W4RA 2A5FA 4TL6A 4A92A 1OXUA 3PR1A 4XIGS 4FW9A 2G0NA 2IYTA 1NVWQ 1D8TA 2H5EA 3IHWA 2FFAA 1Z6YA 1A2BA 4YDHB 2GRJA 1Z6GA 2QMUA 3SOPA 4FCTA 2GCOA 2RGBA 3FYHA 3SZRA 2C2HA 3H86A 3IIMA 1KO4A 3ZQ6A 1OKKA 3W5JA 3TGPA 3TW4A 4B2IA 1GILA 3QNUA 4RSGA 3S1AB 1RVDA 2QTFA 4PC3A 4JSYA 1ZUIA 1ZBDA 2C78A 4C4PA 4KFTA 3FMFA 4BUJA 2WWYA 4OQFA 1R0WA 2ANCA 2NPFA 1JBKA 1NNEA 5FUWA 1VHTA 2GEVA 1PUIA 3PCRB 5JEDA 4QGGA 3A4NA 4OHXA 4YMSA 4WVFA 2YWGA 4PQFA 4WOPA 1HV8A 4LYJA 3K09C 4V0MA 3PIRA 2C8VA 3DEFA 4FMDF 4DKXA 2N46A 4DDTA 1G3IA 1TNDA 2IX3A 3KB2A 1F3OA 2IYVA 3NH9A 1OFTA 1RJ9B 2E87A 2G83A 3BERA 4R9UC 4DLRA 2H8KA 4B33A 1KO5A 3SYKA 1FP7A 5FL7D 2ZI3A 4B44A 1AS0A 1P2UA 2V7QA 4JLJA 3EA5A 2ERXA 1FQKA 2VP4A 4XOIA 2CCGA 4JS0A 1I4LD 2HJVA 2EVWX 4LY6A 1CKEA 1GRRA 2Z43A 4QNMA 2H92A 2ZVPX 1D2MA 5D3MB 1UBCA 5DLQC 5J4HA 1G18A 2O8CA 2ZRKA 4G5QA 2XSZA 1IY2A 1Q21A 1H8HA 1XWIA 1K8RA 1DG3A 1FTSA 1FX0B 1SGWA 4TZ6A 5DI3B 2OO7A 2EFHB 1NVVR 4DBLC 4D81A 5L3QB 3AV0B 3Q9LA 1XXHE 3B9PA 4V0OA 5FI1B 4B35A 1G7CA 1ZU4A 3IO5A 1W5TA 4TLCA 4ZCIA 2QNRA 821PA 3KQNA 1XCGB 4DIEA 3NVAA 3S1AA 2QI9C 2XAUA 3DPUA 3SFVA 2JLYA 3DL0A 3ZZTA 1AJEA 3B7GA 1WB9A 4ERNA 2D7CA 2XJ9A 3TSOA 1ZNZA 3NDPA 2GZHA 5JJIA 4S2EA 5L3QA 1U0HC 1ZUNB 5H1YA 2YOGA 1RRFA 1GOTA 3HYTA 3NHAA 4HYYA 1TEVA 2CCJA 2JGNA 2R8RA 1GIAA 3U3RA 1VIYA 1XP8A 5D3QA 3SJZA 3TR0A 1ANKA 3UWOA 1WDTA 3VNVA 4Q00A 2CNWA 1SXJE 1JAHA 1X8LA 2FSFA 4HAWA 4QRHA 3LLMA 4UXIA 1W5SA 1P5ZB 4U7DA 1Z0FA 3GJ3A 3V00A 3A8TA 1OXXK 4TL8A 3IDQA 4QGFA 2NPIA 4LWZA 2ZQ5A 1MT0A 3PUZA 1J8YF 4OQLA 2ZAOA 5KSPA 4OI1A 4RFSA 3TAHA 1YHNA 4KCGA 4DDWA 3LD9A 2RMKA 4ARZB 3U61B 1G19A 3BB3A 3UMFA 4BFZA 5KPDA 2R6DA 4MDFA 5AUNB 3R8FA 1RJ9A 3GLHA 4XVQA 4LJ6A 4F93B 1VDZA 2NTYC 2OE2A 4XD7A 3OFNA 4NZYA 2G0TA 4JLMA 2JCSA 4TMWA 2G3YA 4HDOB 4BFYA 5BN3A 1U81A 3P27A 5FH9A 5KDOA 1NJFA 3MWLA 2LKDA 3U7HB 3VMFA 1E1RD 1ZNYA 1FMJA 1FNNA 1Q1BA 1AK2A 2P6NA 3QEJA 4IDNA 3TAUA 1E9SA 2ZRIA 4GT1A 3FFAA 4RZ3A 3SBEA 5FPKA 2ZJ8A 4U00A 3WRYC 5JCPA 3TNFA 3WNBA 2ATXA 1B0UA 2D62A 4K8OA 1QBKC 3EC1A 4XWOA 2FMXA 3TUZC 4TMZA 5FTLA 4B47A 4Q4JA 1R8SA 3SJAA 1G7TA 2GA8A 1VECA 1E1QA 2ZRLA 4URWR 1KI7A 5CIWA 6Q21A 2F1JA 2WKRA 5IDVA 4E5UA 5E95A 1XCMA 2YYZA 2ONJA 1ZIPA 2GF0A 1NLYA 4Y0AA 3GLGA 3RS3A 2O8FA 3FPAA 2IW3A 1KZGB 4TT3D 1HUQA 1IOZA 3D3QA 1HURA 2WV9A 5TB5A 1E1QD 1Z22A 3GFTA 1II0A 5FTMA 1XMVA 2B6HA 3EG5A 4B2LA 4ZI2A 2F55A 2QEQA 4DLVA 1I4TD 1X6VA 1ZUHA 3HPRA 2OEPA 3O47A 4FD2A 5CITA 5LD2C 2D7DA 2QBYA 4Q7LA 1XTRA 2DHRA 5TDHA 4FMBB 5ELXA 1CJVC 2OG2A 1KKLA 2EQBA 4EPXA 2RAPA 3C8UA 4LHZA 1OXTA 1IXSB 1AA9A 4Q9HA 4E22A 1E98A 2X2FA 2AD1A 4GBMA 3B9QA 3G0HA 1YZLA 5KHOC 4PC1A 4NYJR 4ON9A 2ZR9A 2J7KA 1LS1A 1OIWA 4B2PA 2PX0A 1GITA 2CE7A 4LV5B 1ZC3A 2WJJA 5EP4A 4DT1B 1G4UR 2C96A 3SQWA 2HDNB 1XFAA 2HYIC 4MYUA 4FMCF 5AUQA 1LY1A 5F3WB 2PH1A 5B2ZA 1UBGA 2C9CA 4JYBA 2BC9A 2XZPA 1BH2A 4A6PA 1N6KA 2HXSA 3WHKA 3LAWA 4XWKA 1CRQA 1VG8A 3CR8A 1RRPA 3I1FA 3K0EA 3U6KA 1XB2A 5H70A 3WNDA 2GJAA 3GEIA 3RLFA 2Q0HA 2WAYA 3TH5A 4FMCB 3TRFA 3SJCA 3CB4A 2ZROA 5FPYA 2ZRJA 2ZUBA 4AKHA 4KBGA 3HU3A 3GMTA 2IK8A 4FWTA 4TWZA 3HWSA 3SS8A 4B73A 2FNAA 1KIMA 2W6JA 5DYGA 4QNRA 1IN4A 2FV8A 2ZSDA 1M34E 2QT1A 3UATA 4HAUA 1UFQA 1E96A 2KWIA 3PG5A 2ODWA 4LJAA 2HYDA 3GD7A 2WSSA 5DHFA 4DDVA 1JR3A 1E0JA 5FPSA 1OHHD 2ZRMA 4ZO4A 3DO6A 3GFPA 3DHWC 1ZINA 2OXCA 4FIDA 2V6IA 4DDUA 3EXAA 4M9SA 3TE6A 3AGPA 2FFQA 2XEXA 1F2TB 4QHYA 1PVOA 4MGIR 4I99A 3ZS9A 4AYWA 3GLIB 2QPAA 5KSYA 1EFCA 1WXQA 3GLGB 3ZDQA 1AS3A 1NLZA 4LHXA 4P4SA 2QG6A 1NG1A 3AP3A 3L8ZA 4I81A 4NBSA 1KO8A 2J7PA 1R4AA 2R2AA 2GEDA 2ZITA 1E32A 1Z08A 4LHYA 3OE7A 4KBFA 1SHKA 1Q3TA 2QTHA 1DELA 3NDBB 2ZE5A 2JDIA 1UF9A 1W46A 3G5UA 4JL5A 5TVKA 4KFRA 5JI3E 2I4IA 3VKHA 1KI9A 4NMMA 5FBLB 2RH5A 5J4LA 1OXSC 1NMZA 2IA5A 4Q21A 3EZ9A 5DSZA 5FL3A 3W34A 4PZYA 1F6BA 3KKPA 2P65A 2EFCB 1KNQA 4DLUA 4TTPA 1N0UA 3WRXC 1ZM7A 4C0KA 4JMPA 2FGKA 2NOAA 3JVUA 4EUNA 4ZV4A 4AY2A 2FFBA 3ETLA 3MJRA 1IAQA 1K5DA 1VHLA 2OCBA 3ZVMA 1SXJC 3W6OA 2MSDB 1IN7A 4D26A 1XZPA 1ZU5A 1U0LA 3BC1A 3K8YA 3BH0A 3P26A 5AWFC 4L9SA 3IEUA 1E2KA 2OUKA 2UZ3A 2Z5FA 1HYQA 2HF8A 5SZIA 1T3LA 1HQYE 4M9XA 3VR6A 4BLOA 5K8UA 1PLJA 2WWGA 3RABA 4N1AA 2PBRA 1G3UA 3AP1A 3ZVRA 2CLDX 2FPKA 4TYPA 1KJYA 1QZXA 3RS7A 4K81B 1ZNXA 1O87A 2FSIA 3CWQA 2HUPA 1KTVA 4PSAA 4V0KA 4CT4B 1RC8A 1ZC4A 1VMAA 3CH5A 1CULC 4JVSB 4WZBE 2Z83A 1R0ZA 2YWFA 3L0SA 1U94A 1BYUA 2AHOA 3BAFA 3B1XA 1QVAA 2BV3A 4KFSA 4P4SB 2ZM5A 1NG9A 2AXNA 3J81k 4QHSA 3W8RA 2QSYA 4GSYA 3NC1C 3OEHD 3DM5A 1SZPA 1BMFD 2D06A 3Q5DA 3QG5A 5AJXA 4HAZA 3G82C 3I8SA 4NHOA 3LXXA 4FCWA 3EC2A 4NCHA 3ZIAD 1NVUQ 4KJZA 1X3SA 1KHTA 3FTQA 5DI3A 2WMOB 4A82A 3RDPA 2X1VA 4Q4AB 2GK6A 1QHHA 4Q9LA 3IUYA 2UZIR 4QGAA 3A6PC 5SZHB 1LVGA 1AS2A 4U02A 1TX4B 4X8LA 1XCPA 4YONB 1LV7A 3H2YA 1G21E 5F9FA 4HLDA 1NBMA 2PL3A 3T61A 4EIWA 2WWFA 3DZDA 2WAXA 1HT1E 4ARZA 5IHPA 1OFUX 1YE8A 1OXVA 1XBTA 2IC5A 3CNNA 5KPJA 1KDTA 1ZJ6A 4P31A 3P4YA 4H1VA 2A5DA 1P2VA 2XJ4A 4JT2A 4OKSA 4JYCA 2IYZA 4D0NA 2J0QA 4QC2A 2VHCA 1FQJA 3SFZA 2A30A 2VPPA 2D3WA 5DO9A 1XD8A 3OIWA 3QXSA 3K53A 2PZFA 2BJWA 3KKOA 1OH6A 1HA3A 4EKDA 2IXFA 1CR0A 4V02A 4F4IA 1CJKC 1WCV1 2HJGA 3W90A 4AYTA 1P2SA 1E2DA 2XTZA 3THYB 1AZSC 1MV5A 3FDIA 3LXRA 4HAXA 4MGZR 4KXFB 3MUFA 2Z4RA 1JPNA 1P61B 2CDNA 2YKGA 4OK3A 4IDQA 5GVSA 1LFDB 1DS6A 1VG0B 2JLZA 2NO1A 3P32A 2Q3FA 4JSTA 2V55B 1KSFX 2V1XA 1MR3F 4HZUB 1LF5A 4IOMA 4MGYR 2KB0A 4RD3A 2GK7A 2WTUA 4LPKA 4DB4A 4C0AC 3ECCA 3AQ4A 1II9A 4PPGA 4YXWD 2BJVA 5D3MA 4DUGD 3CKLA 4D25A 4P3YA 1GKUB 4Q7JB 2QN6A 1EFRA 4NONA 4G5SA 1CJMA 1KK1A 1W4BA 1NJGA 1A4RA 1VTKA 4G3XA 4B3CA 5JRZA 1T0JB 1UKEA 1YR9A 4DUGA 2NZ8A 4BE7B 3LBNA 3DMNA 1SKQA 1VYUA 1WQ1R 3K9HA 3VR1A 1DO0A 2G1JA 3PJRA 1DOAA 2AWNA 5FI0B 1E9FA 1SVIA 4PPQA 5KO2A 3PEYA 2D2EA 3KJGA 4GRAA 1N2CE 4US2R 2ZREA 4ZDIA 3EARA 4O25A 1P3JA 2FH5B 2OLJA 2GZDA 3IPYA 4B43A 1KZ7B 2RHMA 3THXB 4O2RA 4HB2A 3ADBA 1R5BA 3K9NA 1SULA 5G41A 1M8PA 2QE7A 2FSHA 3OEHA 1X8KA 2ANBA 4PPFA 2FDCA 3RWMB 1VKJA 3BJIC 5KU1A 1Z06A 1R5NA 4GNKA 1N5LA 3FWYA 4X8HA 5J4VA 4JBXA 1QG2A 1NN3A 2GBLA 1R7RA 1IJEA 1CP2A 1GNQA 3JZMA 3K9GA 4IJMA 3WHLA 3X1DA 3SQXA 3FHTA 2ONKA 1W2GA 2ZJ2A 4A2QA 2XX3A 1W7AA 2F43A 1W2HA 3IKJA 4YLGA 5KDLA 4TYWA 5HZHA 1T3HA 2IUTA 4TLAA 1EX7A 3QE0A 1P62B 3U7GA 2BVNA 1OLOA 2CVHA 2JLSA 4PAOA 2G9NA 5JSZA 4OJQA 4I1UA 5LPNA 3C5HA 1MOZA 1W4CA 1N3BA 1MO5A 4IDHA 3GLFB 3LVQE 2QORA 5DYIA 5B57C 2ZS8A 4KYUA 4WZAE 3AKEA 1DAEA 3LA6A 2XGJA 4KI0A 3AUXA 3CONA 3Q72A 4KYIB 4Z8XA 3SNHA 1PLKA 2QP4A 1UDWA 2BMFA 1IQPA 2C5LA 2WSMA 3CM0A 3LRPA 3EA0A 4Q9JA 5EE3A 4GZLA 2ZYUX 1RZ3A 4MRPA 1NBME 2Q3MA 3GP8A 2GXUA 3KQHA 1RW4A 4OI0A 4EPRA 4G01B 4PC6A 2WPDD 1NVVQ 5DH9A 1N0VC 2JLQA 2ZAMA 4M1TA 2QAGA 3AKDA 4PX9A 3PUWA 1BYIA 1ESMA 3I5YA 1DO2A 3THWA 4ZCLA 1Q1QA 3ZJYA 2GNOA 2JIZA 1VCMA 2MSCB 3JVVA 1XTQA 3AVOA 3KJHA 4A0GA 1GKYA 3THYA 1U98A 5EE9A 1UADA 2O8DB 1Z29A 4L15A 1F2UA 1E69A 3E2IA 4NCIA 4PHTA 4PTLA 4G0NA 2GAOA 4Q47A 4BFTA 4DVGA 4Z51A 3UPUA 1IN5A 1AZTA 2FWRA 3BORA 4NP6A 2JJ8A 1LTQA 4NPHA 4F91B 1QDEA 3CRMA 4RVCA 3FKSA 3SHFA 2WKQA 1RRGA 1DEKA 3CPJB 4AKEA 4AK9A 1R2QA 4BRUA 4TTRA 5HPYB 4QM7A 1G17A 2WM9B 3UANA 5KYKA 5FOXA 3X1WA 3ICEA 1ZCBA 121PA 5CIQA 1ZCAA 4E09A 3U7FB 1ZM2A 2ZR7A 2R6CA 2YNMA 4RZ2A 4M53A 3B6EA 1QF9A 3TLXA 5EXSA 2DCUA 1GG2A 2WWHA 2ZRBA 4FMDB 1FNMA 2D74A 2DWOA 3QF7A 5JRJA 1SXJA 2QMOA 2F1IA 3ZVNA 1Z0IA 421PA 3IQWA 4XD7D 1E9CA 2G77B 4TMKA 1ZVQA 2RGNC 2QY9A 1R6BX 1US8A 4OQXA 1JJVA 4D0GA 2JLRA 3C5CA 2RGAA 2VLIA 2ZYTX 2NIPA 4Q4AA 3IILA 5B58C 1MKYA 2C98A 3QUSA 4LHVA 4KLNA 2OCAA 4PC2A 5FOUA 5AJZA 4F4JA 2J0VA 3CNOA 4A8JA 1JR3D 4AG6A 2J46A 3AH8A 1CEEA 4TYYA 4EPWA 1EFUA 3KXIA 1KDPA 2QAGC 4LV6A 1NIPA 3QF4A 2XOKA 4DLWA 2O0JA 5JI2E 1KO7A 1YR7A 3H4MA 3UXMA 3QPVA 2G6BA 1CJTC 5AK0A 4URXR 1NY6A 5DN6A 2J45A 3HJNA 5J4YA 4L9WA 2J0UA 3LVRE 3DVLA 4G5GA 4A15A 3WYGA 2NGRA 3LY5A 1KI2A 3C4JA 4JVMA 5CJPA 3EPJA 4IEIA 4EFNA 3U3KA 1MO3A 2J87A 3V4FA 2QUZA 2H17A 3U7EB 3UK6A 1WBDA 3VU9A 2O8EB 5CJ2A 1G5RA 2YINC 2CHQA 1II8A 1ZAKA 4TLDA 4PO1A 5CB8A 2W58A 4Z1MD 3HPQA 2WKPA 2DR3A 5JHHB 2DWQA 3KTAB 1CS4C 2Y8EA 2GWHA 2AR7A 4NH0A 1G6HA 2E9SA 2F7SA 2DFNA 5AUPB 3GFOA 4HATA 1W36D 3NEYA 1VG9B 2F1RA 4LSGA 4TYNA 2O0HA 1K6MA 3KKNA 1DAGA 3B2EA 4RKFA 5JECA 3U3MA 1KAOA 4ZKEA 3U4QB 2IYWA 4PR0A 1E2FA 2AK2A 2BWJA 1GL9B 3A1VA 4BECA 3AB3A 2VP6A 4IXMA 4DCSA 1NN5A 2GEUA 1FL9A 2WOJA 3BB4A 2WIAA 4QGHA 1T5IA 2IF2A 4Q4HB 4XSGA 1WMSA 1Q22A 4LJ5A 2H16A 3LFUA 4EJSA 1T3SA 4G5OA 4ESHA 5KUTA 2ORIA 2XOKD 3K0SA 4JKIA 3LX5A 2RKOA 1JQJC 1U8YA 1P9WA 2GHIA 1BKDR 2JEOA 3I3SR 4B6EA 4JVNA 4BLTA 3UG7A 1KSHA 4L8GA 2R44A 1J90A 4PO8A 3PV0A 3H0KA 5C1BA 4OI4A 4M8NE 3SEAA 4BFVA 2VF7A 3I8XA 1SKYE 3BFXA 4QM6A 1NP6A 1CR4A 3T5DA 2XNSA 1NN1A 3GLHE 4MRVA 2EWVA 1W1WA 4NCNA 3I92A 4M4SA 1ZM4A 3BB1A 3GJ7A 4CZ2A 3T5GA 5FPTA 4DCVA 2OSBA 1OW3B 1YZTA 2WWIA 2DFLA 3X2SA 2O8BA 1Q0UA 1UKYA 1N6IA 1XEWX 2Q9BA 2ZE8A 1OJLA 5F9HA 2P5TB 3T34A 4CEJA 4ZCMA 4IDPA 4R7ZA 4WW0A 2BBWA 4Q7MB 4OK5A 3P1JA 1SVSA 1W47A 4M1YA 3T12A 3LBIA 3TJZA 4MRSA 2IXEA 3PUYA 1G6OA 2B8WA 2KJQA 5JCZA 4JLAA 1N6HA 1XMSA 2QAJA 2ZSEA 3FKSD 3IIKA 4S35A 2ZU6A 4TZ0A 4NL4H 4UNRA 4EFLA 2QL6A 3I73A 4MYHA 2OFWA 3WXMA 5HZKA 2JDID 1E9DA 4PPNA 4ZIRB 4HAVA 4MYTA 3L0IB 4UQOA 3CF2A 1Z2AA 3W5IA 5C4GB 2JJ1D 2O0KA 3KKQA 1N6NA 1SVWA 3WNCA 1J8MF 4ITRC 1XPUA 2CLSA 1IJFA 5L3SB 3QOFA 1XXHA 3TVDA 4C7OA 4AURA 3F5FA 1NVXQ 4IEEA 3RNLA 1XTKA 2VTKA 3RSLA 3I32A 2CCKA 3CRQA 3TBKA 3AVWA 5E7MA 3FGNA 2BMJA 3OHMA 1T0HB 2W6JD 3FE2A 2NZJA 5DE3A 4M21A 1U0JA 2BBSA 3A1SA 4GDFA 2O5VA 4HB3A 4JLBA 3EZ6A 4V03A 2V4ZA 3CO5A 3L8YA 3BE4A 4BFXA 3B8HA 1GNRA 4L4UA 3KZ1E 2WJGA 3SC3A 4W5WA 4EPTA 3AM1A 1E4VA 1Q1EA 1UJ2A 2IYYA 3SJBA 4JL8A 1S4QA 2FE4A 2GDJA 2D2FA 4KLZA 4OQNA 2IYQA 5TY0A 1XZQA 1JB1A 4IVQA 5J5CA 1KK0A 3RS2A 5LD2B 2QBYB 2WMNB 5EXXA 4CEIB 3MG9A 4B76A 4Q9KA 2ZSFA 4D0LB 2XSZD 2J1LA 1P9RA 4A1FA 2VQSA 2RB4A 1A5TA 2O8FB 4F4CA 3WBJA 1V43A 3A4LA 1YRBA 1XEFA 4QBHA 2NO6A 3U4QA 3R9XA 4AI6A 3EWAA 2VHTA 4GP6A 5FBWB 4KVAA 4DLXA 3H84A 2GVZC 2J59A 1XJ0A 2PLRA 2ZI7A 1T4GA 1TMKA 3AKYA 1IY0A 3DKPA 1DAHA 5FPHA 1N6PA 1A7JA 1YU9A 2N1BA 1PJRA 1TQ2A 4YMWA 1P7CA 1QHNA 3TW8B 4A36A 1UEIA 1V5WA 3RS0A 1YZGA 2RGGA 2CLCX 1S8FA 2MSEB 2FEMA 3MSXA 1KI8A 5SZKB 2OBNA 1A2KC 3V9PA 3D6TB 4Q1EA 3RC3A 3EZ2A 4A2PA 5G3ZA 3CH4B 3BH6A 1QHGA 1XU4A 5BN5A 3QXHA 5C18A 2C03A 2W83A 4RKEA 1KDRA 2C95A 1OF1A 4DLSA 2V7QD 3GEEA 1OFIA 2YZ2A 5HKKD 5IF9A 3AVYA 4PXAA 3ND9A 2Q9AA 4EAQA 3PXGA 1HQCA 3BH7A 1OE0A 3MJHA 2V3CC 2XXAB 3GLHB 2DYKA 2FPMA 3KJEA 2JJ1A 3B1ZA 1P6XA 2ZRPA 4WBSA 1KSJA 3L43A 4EQ6B 4LV8B 1XEXB 1U8ZA 5JHGB 1E9EA 2GESA 1COWD 1WA5A 3CW2A 1R0XA 3QXXA 4B74A 3A1WA 4LYAA 3QXCA 1I2MA 3GJ6A 3PQCA 2WHXA 3P4XA 4F7WA 4QFMA 5CDFA 2D4HA 3KKMA 3ZH9B 5TXGA 1ZIOA 2CBZA 4B3GA 1PZNA 1H8EA 3K0FA 3QIAA 1JXOA 1MO6A 3UWKA 4JBYA 4RD1A 5FOVA 3PUXA 3QVUA 4BEBA 1F5NA 3C16C 2HV8A 3E1SA 1US8B 3LW7A 1S3SA 3M6AA 5KOYA 1TQ6A 1ZM3A 4PHHA 3ZD6A 4BPBA 3I61A 4TLBA 1G3QA 5B64A 1GUAA 2C9YA 5CDFE 1DG1G 1T9HA 1TU3A 4MDEA 1Y3AA 1EX6A 1MABA 2CHVA 3Q85A 1DTSA 1Z07A 3DKVA 1Z6TA 2OAQ1 3K0AA 4GI7A 4TQAA 1IXRC 5FR2A 5HCIA 2VBCA 3SI7A 1T91A 2PCLA 3AF0A 1E1RA 2ZANA 2IWRA 4LHWA 4MGKR 3LW8A 3ZD7A 1FX0A 4HAYA 4AC9A 2VHUA 1XD2B 3QQ5A 1EFTA 2RGEA 3AVQA 3VKGA 4LDJA 3WYFA 2LKCA 1Q57A 2ZE6A 4W5HA 1Z6AA 2FU5C 2GCNA 1EXMA 1E79D 3ZYCA 2QQ0A 3MMPA 3U60B 1TAGA 1XD2A 4C0HA 4MUBA
chains in the Genus database with same CATH superfamily
2X76A 2FN4A 2O23A 4FYHA 3JQ7A 4BNVA 1X2EA 3ZC3A 3NW9A 3ENVA 2AD5A 1JEAA 3NGLA 2DGDA 4QQKA 2GKSA 2JIMA 1ACMA 3EIHA 3DOEA 3OJ0A 4P7BA 1X80A 2DBVO 5EZSA 4LC1A 4QHTA 2PV7A 1MABB 4ARBA 2YZMA 3L7NA 4IFBA 2QW1A 1FUUA 3CTPA 4CLDA 4DNQA 2ZXEA 4R2KA 5JS7A 1A9YA 3T15A 2G5GX 2PMCA 2QVCA 3ADKA 3QMVA 4IX9A 4IOLA 4AZ0B 2P67A 4DCCA 4KOEC 2A8YA 3HWWA 10MHA 3GVCA 3L92A 2PJZA 1YU6A 2PUTA 2XB8A 1E5TA 3QBVA 3GOHA 1NLFA 2BEVB 2WIGA 3TZCA 2PL5A 3I9FA 5JBIA 3LWBA 4FB4A 1BDHA 4Y9RA 3OLXA 2VZLA 2FFHA 1ZOLA 1LSJA 1ULSA 3A0RB 1A1VA 3VFDA 4XWAA 5HE8A 4M83A 1XVTA 4QASA 4O3MA 1BDMA 4N7BA 3ZS8A 3RVMA 1GGNA 4PBRA 4CEHB 1M6NA 4HNAA 4H2DA 4G86A 5IT5A 3P7MA 5H9WA 3KUDA 1POWA 2D4AA 3EPHA 3RTGA 5ELLA 3KSBC 3OKCA 3E35A 3JQBA 3E9CA 4C5CA 5BWOA 4DNOA 1M7HA 4PHCA 2VJDA 3LGSA 4R2IA 1CS0A 4EQ6A 1GKKA 4FONA 2FUKA 3NIDB 3ZWMA 3B3AA 2A0FA 2GT1A 4Y6LA 4KHPB 2X2EA 3NASA 4H6PA 5FFNA 5FEUA 1OYOA 3MYYA 4TT3A 4UBJA 2JLUA 1T36B 1B41A 5DV9A 2QNIA 4ZREA 2EP5A 3WJ7A 2PZMA 3HY4A 1ZK3A 1OX6A 2V6JA 1QDLB 1P9NA 3NM5A 4UCFA 4MI3A 3WIEA 1SUIA 3OWXA 4ALKA 1BXGB 2UXCB 1P2GA 2OKCA 1IN1A 2P9QA 2IOFK 1VJRA 4HPJB 1Q83A 4UPDA 1O5TA 4BMDA 1JWLA 3NS7A 1ELOA 4RK6A 1I6LA 3JASB 1VCHA 3KNZA 1TPZA 4II3A 3W79A 3PZRA 3DWEX 2JBAB 2JLXA 4MAFA 5HE9A 3BXXA 4DLSA 3JD4A 4EPWA 5A0FA 1JQ5A 2OGTA 3EDCA 4RH3A 2GETA 2BGKA 3RC9A 2CFOA 1DJNA 1U2RA 3VYRB 4DCTA 5HUQA 1YOVB 3CZ9A 2ST1A 1JECA 1MEOA 2NT4A 2ZG6A 1JHMA 3ENZA 1F8XA 4YRTA 4F0JA 3N0WA 3EQZA 1GR0A 1HRKA 1YOVA 3G59A 3HR8A 2C1XA 4Q9IA 3T7KA 3ZV6A 4V2IA 4Z4FA 3A11A 1O6GA 8AT1A 4RQBA 3TR5A 1Q5PA 2HU2A 2NO0A 4XLTA 2JFZA 1KAEA 1Y82A 2XADA 1P60A 1AV7A 1JDBC 3E84A 1L5GB 1E94E 2GZ2A 1G55A 2IHUA 1WV1A 1PZEA 1E1DA 1JVSA 3C3EA 3M4JA 3K8QA 3MA0A 2P62A 3QKWA 2O3QA 2BBOA 4URVR 5T4BA 5DF1A 2Z57A 3RLIA 2HQSA 1CE8A 3GJSA 3MAAC 1CBUA 2IU6A 1CQIA 3IH5A 4RZUA 4TKMA 1TL7C 3GGPA 5IJAA 1Z4MA 2YVQA 5CA0A 1XPOA 1KZ9A 1PWXA 2BP7A 1CY2A 1I13A 2O2HA 2VYND 2RB5A 3QEOA 4PONA 4FFDA 1PKEA 4H7DA 3IGFA 5FOTA 1B26A 1XX6A 1FEZA 1DFIA 5AYVA 4XB1A 1DX9A 4G1UC 5MFPA 3NBYC 2BCGY 2C99A 4EJ0A 4JB0A 1S96A 4DYHA 3QEMB 1DWQA 2AC4A 1M7GA 2GUWA 4B6GA 5B36A 3G2MA 3OCCA 4WNIA 3S55A 1A9SA 1ZICA 3CISA 1Z62A 3KPWA 1GYRA 1U7XA 4HMQA 5H68A 3HKEA 1XZHA 1ZESA 3MBIA 4FGZA 4P86A 4AT1A 5FFMA 4A9AA 4WE3A 2LIPA 4XQ0A 4AM8A 2UYYA 1URPA 2BZ1A 3BA6A 3OZVA 3O8DA 1TO1E 1N2BA 1VJGA 2ZW9A 2BH2A 2VP5A 2QD1A 1HE2A 2BZ0A 2DHQA 5E2BA 3ZBPA 1P33A 1N9ZA 2NUBA 3A28A 1YB6A 3NCTA 3NP9A 4HLCA 4R1LA 1OB2A 3BMQB 3HKBA 1V1RB 1CUFA 1P4RA 5B1IA 4B6RA 4NYJQ 3LH5A 3W06A 3KQKA 1RYHA 1S8NA 1PS9A 4U9UA 2JS7A 4GU5A 1GQYA 1UPUA 2HBZA 2QUIA 1GCAA 3FGPA 3IQDB 1U8CB 3JQFC 4TSRA 5AHWA 5E9WA 1IRIA 3V1MA 4DJJA 3RQIA 4M9ZA 4BXOA 5EEHA 4JI4B 4B3RB 2XCQA 3FPSA 3NTVA 3KYCA 4WCFC 1T9KA 4BNFA 4N5LA 3L7IA 2CNLA 1TF7A 2K5UA 2GPBA 1QTRA 3UFXB 4AULA 3DG9A 3CLTC 4URZR 4FOOA 4HH0A 1KK2A 3CBQA 3B1YA 3K9LA 4B1FA 1ECJA 3GJXC 5T4FA 3C41J 1T10A 2BYTA 2IEDA 3ADDA 4FC6A 2JGLA 3LQ4A 1LRKA 3T9BA 3X43A 2HSDA 3MILA 2WDZA 1P0QA 1G66A 1OAKA 3Q6MA 2NLOA 3R8XA 3TRIA 5BVHA 1XRRA 3UJAA 5AVRA 3JAMA 2GPAA 1EDOA 2NVWA 1JI3A 1Y4ZA 4FDTA 2R7MA 4PFKA 2IVFA 4I1OA 4N03A 3TRHA 3P9ZA 3R7WA 2II6A 2QMZA 2JBHA 1Z75A 2ZK7A 2V0NA 2HGSA 3CLTD 1G7RA 1XZDA 2O3SA 4KITB 2AFHA 1H0KA 2VPYA 4ZCPA 1NNI1 4GPTA 1ZN2A 1MB0A 1W0JD 3PQ4A 1EE9A 3PI6A 4H1WA 2I1VB 4IJVA 2FWNA 4HDQB 1HT2E 2R9VA 4Q02A 2UAGA 2H2AA 4UVIA 3O8CA 4GR4A 1E6LA 4EB6A 1EFHA 3F4KA 4LCJA 4EX6A 3U16A 3VA7A 2PWAA 3D4NA 2H57A 1JTVA 3KTDA 4RWEA 3H5IA 4DQVA 1BJTA 5DMHA 5EHNA 2V7WA 5B1DA 1Y1SA 2BFMA 3P5BA 4FKBA 4W9NA 5M29A 2BLLA 2DQYA 3AHCA 2FGJA 2H1VA 3UMJA 5EP1A 4DNPA 5IRCD 1FFSA 1AKRA 4JDPA 1ZXXA 1GPNA 2BM8A 5I5GA 3CZ5A 1E4OA 3W4JA 3IHKA 5ES4B 3L79A 4H4CA 3UB3A 3GPBA 4D80A 1NXOA 4BE9A 1NBIA 1Z0AA 1W5EA 2EL9A 1KE2A 1E79A 5LZ4A 3DAGA 1XAGA 3K32A 4NS1A 3X44A 5CHYA 4YCAA 1Y7IA 2ASVA 1P8AA 5JAPA 4RSRA 5DNDA 3BFKA 4IXTA 2LRHA 5KYTA 3BKXA 5FHQA 4TVKA 3V6MA 3E5NA 2ZYRA 3UK2A 4BFCA 1Q1ZA 2C92A 2VATA 1Y7TA 4KGVA 2Z3WA 4GLBA 1B23P 4N3NA 4IUCS 4YJFB 1EG7A 1HY3A 2JFPA 4WFKA 1FDVA 5K8LA 1XROA 4N47A 3WRWA 1RCTE 2GI4A 1U7PA 2GBCA 1ZZEA 2VRBA 5CBKA 1A9RA 1AM4D 5JJCA 3L8HA 1DL5A 3BTUA 4MYDA 2ODAA 1AXGA 2PANA 3JPYA 3KWFA 3BS4A 4JLDA 4CKEB 4ZJZA 5LYJB 1T1EA 2AZ4A 4JLKA 2OC9A 3U49A 3FFBA 4C87A 4Z6KA 1U0RA 1HEIA 3SX2A 4E7OA 1X38A 2JW5A 4Y7CA 2B78A 3SVZA 2NMVA 4OJMX 1M2OB 2V7EA 5CPFA 4DQKA 2QLFA 2ZIUB 2DFDA 2Q7XA 4PW0A 4BVEA 5KS2A 3I45A 3NJ8A 1Z47A 3TZBA 3RYIB 1V37A 1YAJA 3BXEA 3NAQA 4HQNA 1KDOA 1TCAA 4TLEA 4BLSA 3RTBA 4B6SA 1II8B 1Q0HA 4UUNA 4RDXA 2XGSA 3MMSA 3WMGA 4DW8A 1I0IA 2PRSA 2FWPA 4CMKA 2UYHA 2VNKA 4NARA 2GTPA 3MS7A 5L3SA 2PBLA 1JLLB 4QREA 4WADA 5G4KB 5LB2A 2VCEA 3VU0A 4EB0A 5A62A 5M04A 1VIVA 4QD3A 4I4TB 4XB6B 4J0EA 4DIDA 3W5VA 2Q2WA 3IKVA 2XQIA 3TG8A 5IU6A 3CR3C 4CQMA 1VGRA 2VDNB 2ZI4A 2XDAA 3ZE0B 3ZKAA 2GAAA 2ZCJA 2JVJA 2LBPA 1M2OA 4FHCA 2FX2A 4JJGA 5FWYB 3S29A 4DVJA 1TFUA 3VH4A 1OT3A 2VDQB 5AW1A 4B0PA 4LJ4A 5CLLA 3B1JA 1I7DA 2FW1A 4KBYA 4LRXA 4JENA 4HCJA 4X20A 3CA8A 4K9OA 2CNOA 2V0GA 4MJ3A 3EWIA 3KVYA 3MWKA 3V4ZA 1E4EA 4DR6B 4YDSA 4HRXA 5AW2A 2VDUE 4G6ZA 1J9GA 4QPDA 4YP5A 4MCJA 1WY7A 4MV4A 4DQ0A 1GL7A 4CEJB 3BK7A 1MIOB 2OZVA 1MJGA 3KZXA 4CVNA 5C80A 1AK1A 1CK4A 1PJQA 1V5IA 3QKUA 1GAWA 1IHXA 4AMBA 3TLGB 5C4MA 2P1DA 4ZK6A 2ZSKA 5JANA 1TVMA 1ESZA 3DE3X 1MFZA 3A6ZA 1DIHA 3L9XA 3EOBI 4K6HA 2W0SA 4FFLA 3RBVA 4BFUA 1EZ4A 3VYSB 5T8KA 4H35A 4OFWA 1KI4A 1DAMA 1FUEA 3SJUA 3EY9A 3FVQA 3VR5D 2PWZA 2V59A 1Q16A 2HT6A 2OFOA 5KDDA 2C0CA 1WMAA 1RBYA 2YHAA 4UTPA 2NV2B 1Q50A 3SC6A 5GJCA 3SYRA 2IV3A 4G67A 3W2TA 1E1MA 1Z5GA 3F4BA 3W9SA 3PE3A 1GHTA 3EAQA 3NT4A 1TDJA 5JAMA 4LX0A 2J8ZA 4HXEB 1QUEA 2P6UA 4MJLA 3PNVA 2I54A 4PGFA 1RLUA 5CCDA 5HWSA 5LKAA 4GBJA 3S1SA 2KM1A 2QTZA 3RF7A 4C4XA 5FR1A 3AVTA 2HJWA 4PLTA 1AGPA 3KKLA 3C6XA 4CQLB 4MMYB 4YAEA 4EA7A 1LK7A 5A4DA 1GRQA 1HDEA 1M9NA 1T8TA 2PZJA 3I05A 4J75A 4A5OA 3GRPA 4MYSA 4O4IF 4JP1A 2EFJA 1KY3A 4E5KA 1UWVA 4DBVO 3NHLA 1BWRA 4UMFA 1XRJA 4XWTA 3ZNNA 2PR7A 5GAJA 1UFKA 2A1IA 4MARA 4LCBA 4KN6A 2W6QA 3OCZA 5EUQB 1I5OA 4E5SA 2VXBA 3IQIX 3NWPA 2PX3A 1JR3E 4QPZA 1OX4B 1K6XA 3LYAA 4UHEA 5BRJA 1EK0A 1RQGA 3NLLA 1GGMA 3G68A 3RVSA 2DF8A 3IQEA 3D8NA 1HG0A 4HN9A 5K20A 4B9EA 2DUMA 2PTGA 1Y6FA 1AN9A 1TADA 2ES4A 2P9FA 3MCAA 4N7JA 4P36A 2PT7A 4JJKA 5AK5A 1RR6A 4ZEXA 1O0CA 4D45A 1F0KA 3AESB 3RTEA 3TEMA 1U28C 4YIHA 5AXBA 1N0WA 2YC4C 3U26A 4J7AA 3A7EA 5CFNA 1DQNA 1H6DA 1ODSA 3HH8A 1M1YE 5JWHA 1AKYA 4YP6A 3SC2A 4BXOB 3OC0A 4LJ9A 1IM5A 2CEKA 4ZT2A 2GKOA 1V16B 4AJHA 4BASA 1KQ3A 9MHTA 3DOJA 4JP5A 4NX2A 2X9NA 3M3HA 3N0XA 2QHXA 2WABA 1HM5A 2C1EA 1L7NA 3MLEA 3FNBA 3M1YA 4ZVSA 2AOUB 2BUBA 1XD9A 1K6JA 3HKDA 2YW2A 4IXNA 3CGWA 2PSSA 1XZAA 1TCVA 3AK4A 4POAA 4CFYA 1L4HA 2P77A 2VK8A 1S2NA 2Q21A 2VQDA 1T9AA 3CUVA 3QPCA 3HWX1 3B5EA 4N12A 1G20B 3B3GA 2PSFA 4ZU1X 3TJMA 1DTEA 1CEQA 2F4NA 2UXBB 1W35A 2AG6A 3HFJA 3HUFA 2OCLA 1J99A 4P7GA 1E99A 3U39A 2C2XA 3DVSX 4I1VA 2BIFA 2RGCA 3DDNA 2XYHA 3TLCA 4PHFA 4RD4A 2DR0A 4D6PA 1Q7RA 1JJAA 5IHXA 4D3DA 1RNLA 1VKHA 2IUEA 3TRDA 5A4FS 3MUNA 3RJ5A 5ADHA 1HMPA 5EIHA 1W5FA 3WNVA 1UXJA 1AXRA 1QO7A 2UZ1A 2GEKA 1JQBA 1JG6A 3FB4A 2ETXA 3DF7A 3I6QA 1RXIA 1TRKA 4EHJA 3VX3A 4Z4GA 1JDZA 3Q9UA 2QW8A 3LT1A 1B15A 4WN3A 3LSTA 1FB5A 5EMHA 3H65A 4BWYA 2CDRA 4EJSC 1DCFA 1FUKA 3DGEC 4LI0A 4AY4A 5EZ5A 3WWOA 4QG7A 2REOA 2Z2XA 3AR4A 3FZYA 4NIMA 4DQUA 3HP4A 4Q1DA 1C3OB 2HFKA 5LLTA 4RHEA 5JWRA 3KE9A 3KQPA 3WAGA 4JNKA 3WIUA 2M9MA 3KO8A 2GXSA 5EXTA 1IXZA 3ZJ5A 1DKMA 1PE0A 1PRYA 1E6WA 3QPBA 3CBGA 2HXYA 3PEUA 4HUQB 2KE5A 4LA4A 1F48A 1FPQA 4XLZA 4MQ5A 1PR6A 2P6MA 3PFHA 3SSOA 5U9CA 3HHPA 4KGXA 2O54A 1Q74A 1T9CA 2BMWA 4CM6A 2GPJA 2NW6A 4TUYB 3T94A 2FR8C 2OV4A 3EK2A 3CEHA 5A0TA 1W9MA 2EFDB 2IHTA 3OZDA 3S2EA 3OVMA 1YB5A 3GBSA 5HKLA 3U7JA 1G291 4MYCA 1VL6A 2YDXA 5K8VA 1FSSA 4O4JF 3PQ8A 4EOGA 1TK3A 1SQFA 4WASA 3WLTA 1KMMA 1DUSA 1F1JA 1GQQA 4CCAA 1NZDA 1HO3A 1E6UA 2QVXX 2VK2A 2PH7A 4FE3A 1BXGA 3BBPA 5ICGA 1DRJA 2JGDB 2WIBA 1JG3A 1NURA 3CUKA 3FHLA 5KSZA 3DBIA 5I9IA 5LQMA 5A06A 3WGYA 4DE5A 3MFYA 1TI7A 4QEDA 4QLBA 2WD7A 2VYFA 3E0QA 4E12A 5JJKA 3KHTA 2KW5A 3OT5A 1X1CA 3O21A 3TUJC 4FN4A 3OZXA 1JQDA 2PEYA 1L7BA 1AGRA 1ZW6A 3IDFA 2I22A 2YN0A 4UOZA 2EBHX 2BM0A 3PWZA 2JIRA 1T5OA 5AI5A 4E4RA 4HB4A 3GFGA 4HUTA 3SS9X 3M49A 3THWB 3AJAA 2HO5A 2QM0A 1AH2A 4L2IB 2P90A 2W2QA 1ZQ9A 4I4LA 4BJ3A 2VIIA 4C88A 3QJ5A 2NUPA 1DPGA 4XVHA 1VFPA 3UICA 4YJHB 3KTFA 4HNAB 2JA1A 3WIBA 1T8UA 1XQ1A 3L49A 5ALXA 1ISFA 1FYDA 4W7HA 1BZYA 1QIHA 2O9JA 1QXSA 3OFJA 4YTEA 3HYLA 4HTFA 1VLMA 2WSIA 4JUAA 4NECA 4ENPA 4WLOA 1DC6A 1D2CA 4OX9Y 4OQPA 1KRWA 1C0IA 3U2QA 1NI5A 1XK6A 1PQYA 1Y9AA 1NBAA 1UJCA 3LA8A 2GHQA 3WGJA 2HPAA 1QFZA 2BEUB 2IZ6A 2MSLA 3GJ4A 4UCQA 1QO0D 2PMFA 1L4YA 3CSDA 2EX0A 4RJKA 1QP0A 3GQBA 3W3ZB 1YJCA 3D1LA 4G81A 2QRKA 5ER9A 3KZVA 1TKBA 1L1QA 1TEXA 1N2HA 1W44A 3U9SA 1A96A 4AD8A 1IBKB 3TNYA 4M22A 4Z4EA 4A16A 1U1EA 4JQYA 4LZLA 4FHZA 4CL8A 4ZJUA 4HNVA 1CY7A 3JALA 4F2DA 4ZXFA 1DQRA 4LXIA 1XMQB 3O8OA 1L4NA 1XF9A 3KQLA 3SXJA 3RJTA 1RHMA 4XUEA 1FU7A 3UA3A 4RS3A 1LB1B 3S6JA 1OTHA 4HN2A 4IDOA 1G8YA 5TMEA 2Z5LA 4B80A 1C0KA 4X62B 1ZMXA 2FP3A 1Z5UA 2XXAA 3NVMB 1K97A 1ZUWA 3TCKA 1CXZA 5E4FA 1LPNA 3DF9A 5HF8A 4TKVB 1EFAA 2NP7A 4RF3A 1XC7A 2RARA 4RF4A 4C7BA 2RH8A 4HEHA 4TYYA 4BZPA 4E2YA 3M2PA 3O4GA 2GCIA 4AG3A 1ZQ1A 4AP9A 4MGEA 1IB0A 5JDCC 3WLNA 1ZH6A 3GV0A 1JAIA 3I5MA 1SXIA 4FVTA 3MB8A 2CHGA 2WD8A 3ZWDA 3NUZA 1E2GA 1YI0A 1MH9A 1Z2NX 1RJWA 2FPXA 1H65A 1UDXA 1N2OA 3HS3A 3TSWA 4MV9A 4PAMA 4BQEA 4V3BA 4EM6A 3PYLA 3BIJA 2IJGX 5K8IA 4FDAA 1KJ9A 3HNPA 3PNLA 3VM6A 2H4FA 2DZDA 2GA9A 3FUUA 2AVNA 4AWXA 3JWEA 4HLUC 2X6QA 1KY4A 3NWBA 4D9NA 3CF0A 2BGRA 1G64A 1SBYA 3F7TA 4WA7A 1X1DA 5DGXA 2G88A 1I80A 2Z30A 3ZJ4A 5C51B 2VHJA 4UW9A 4ZD6A 4CETA 3ROZA 4UC0A 1PHPA 3D4OA 2RG1A 1A4XA 1QYRA 4R81A 4CDGA 2PKWA 1N32B 3UMBA 4S12A 4UM9B 5E3JA 1JZTA 3EFOB 4FFBB 1ILWA 4RAOA 2B8NA 1KAGA 4BZQA 4FD3A 2Z6QA 1BHSA 1BN7A 5ED4A 1G9XA 1Z8DA 3BEDA 4COKA 3PXBA 2QS9A 1Q3HA 5AJWA 1HI9A 1W52X 2X15A 4DQLA 4MWGA 1LX7A 1XRSB 2CFCA 2HA4A 4OB8A 4P0TA 5I51A 4I6JA 1NC3A 1W87A 4G2TA 2QLLA 3O8BA 5GIOE 4OXQA 2MSKA 1SUFA 4P3KA 4ZCQA 4PVDA 4X85A 3K1JA 1Y3HA 2DKFA 4QQRA 3EIEA 4HBZA 1C4OA 1DUVG 1NM5A 4J1QA 1DUIA 2QG4A 1Z37A 3E1GA 3S7TA 3BF8A 4HJXA 1S2GA 2YC2C 2E4XA 3UV7A 1QP7A 1R00A 4JC8A 2AC7A 4OLAA 5TEVA 1X9GA 1A2QA 3VUEA 4HYQA 4XIIA 2E6UX 4CBVA 2NXNA 1Y1LA 3GJ5A 3B85A 1RLMA 1YIAA 2IOQA 3COYA 2B21A 1K7EB 4KXVA 4WNAA 1E0DA 2FG5A 1P8JA 2L82A 4HVLA 1IVNA 1EA5A 3WMRA 4PIPA 2F67A 2GEFA 4Q4DA 3O8RA 2QPLA 4RY9A 3WHIA 2BGIA 4GVPA 2CEAA 3V7FA 4HV4A 3PNKA 4LXTA 4QOJA 2I4MA 3NRJA 4CN9A 2CJWB 2CZQA 2QVLA 3IPRA 3MJDA 2H0RA 2OMEA 4P5PA 4ESVA 3IJEB 4YYEA 2ZJ7A 4OHFA 2F9LA 4LVNA 3KEFA 5E2IA 3U40A 1EFVA 1H85A 3JZFA 3EZFA 1L7VC 4XDHA 3H2GA 5M2QA 1OZAA 1TJNA 1E2QA 3BSFA 2XEDA 3LQRA 4P4UA 4JBGA 4D43A 1JSRA 2RAVA 1H2ZA 1X8JA 2ZUUA 3OIFA 4LOKA 4MW2A 3PS9A 4QBTA 3VC1A 2I6SA 1DXYA 3NTXA 5C8VA 1PWZA 821PA 3GLFE 1L5QA 3SEFA 2I99A 1PDOA 3AI3A 1J09A 4UXHA 3PNQA 4OP3A 4QE3A 4XDYA 4IDDA 3IV6A 4KMMA 1FXWA 2F3TA 3OQIA 1Y81A 3OT1B 3CU5A 3WL3A 1USIA 2RBGA 1U90A 4EA6A 4DTIA 3V7YA 1EWRA 4W5NA 2C4KA 3PICA 6PFKA 4DV6B 4EGSA 2AXEA 4IKEA 5DGCA 4CDNA 5CCEA 3BTSA 3OX4A 4LYGA 4PTYA 1NNSA 1JHYA 2VCYA 3GD5A 3ROEA 1NN0A 2WR8A 1UANA 1Z5OA 4C30A 4CKWB 2UVQA 3K30A 2ZTSA 2EG5A 3NTRA 4E07A 1J25A 1M1UA 5A5VA 1A76A 3V34A 3AG6A 3HC7A 4QBIA 4F45A 2PGOA 3FPGA 4L28A 3KEQA 5BQPA 2V1UA 3DZHA 1OX5A 3VR0A 4R2JA 2JVIA 2BM1A 1YR3A 2FSGA 3TX2A 3TLYA 1NJSA 4GX1A 4QYWA 3OH8A 3OX2A 4XIYA 3IIJA 4ABTA 3EPRA 4HMPA 1V9SA 2IODA 3IAHA 2E1RA 1S7CA 4JASB 1CT9A 2XCUA 3MD9A 2A86A 5L4LA 4I1PA 1U5CA 4AIIA 4EYGA 2R6AA 3ZUGA 1WDMA 2EW1A 4DLYA 4KMSA 2P9CA 4H77A 3ZIDA 3KJZA 5HTKA 4IG4A 2A1TS 2Q3EA 1HEUA 3KX2A 3EWSA 4BQNA 3LT0A 1OLSB 3ZEAA 1Q1NA 5I4CA 2AN1A 1ZAYA 2EDCA 4PZLA 1M34A 1H4SA 5BXQC 4A8JC 2GSDA 2VUUA 2ZT8A 3I9NA 5I7WA 4X8OA 1YE3A 3QKTA 5EPOA 4RY2A 3AF5A 2HI0A 3H3FA 1RPJA 5ITWA 1JLSA 1H22A 1CY1A 1WSAA 4P7KA 1G5FA 3JZAA 4M88A 1O1YA 2ZRFA 3R20A 4FFNA 3NHZA 5I7AA 2ZS7A 3O1JC 4RD0A 4BQPA 1SKYB 4TL7A 1E0AA 1GAJA 4J1TC 3I6ZA 3ED1A 5E6RB 1MIHA 3A9TA 1FOEB 1QH1A 4U9IS 4Q66C 3H2JA 4HDMA 3DEKA 1ECPA 4HSGA 3B6IA 3DLPX 3LMKA 1EUYA 4R7GA 4DMLA 5TC4A 4EY3A 4D9MA 3LC0A 1MA0A 1NULA 3NTUA 2Q7DA 1E2MA 4Q1CA 4M89A 2AUMA 5ERGB 1N9GB 4FI3C 4GOJA 4ZEOA 1XELA 3ZBUA 1ACLA 1K4YA 2P3OA 2PX6A 2P2ZA 1BS1A 3NKLA 4GXRA 4H1HA 1MW8X 3OIVA 5F98A 1E2NA 1E2LA 1LNZA 1Z6XA 1GGJA 2NQ2C 3L01A 4MB6A 1U99A 1GSIA 1H6AA 1UZUA 3ESCA 1QU2A 5F51A 2PKRA 1BKYA 1IHOA 4KPYA 5SICE 3KYJB 3IB6A 4QOFA 3RTDA 4DCNA 2FXVA 1XWFA 3RUIA 3T1VA 2ZKIA 3KFVA 5CVCA 2W90A 3HCCA 4YAJA 4YA6A 2HLDD 4Z1MA 4CKCB 3CX3A 1U6IA 4RF2A 3GCXA 1SOAA 5D1HA 3DL7A 4EDHA 1QYXA 2ZBRA 1LUAA 3FMOB 4P6VF 5GJWC 1APBA 3GMIA 1CFZA 5F12A 4NU0A 2XA9A 1ECBA 4GFDA 5DBGA 4J2TA 4NYIQ 3DTNA 1Q92A 5LQSA 5JMOA 3R3JA 2D5AA 4QUJA 1WR8A 2ZAIA 3UT0A 4A8HA 1CB0A 2IRWA 2PBFA 3BCSA 3CJRA 1I10A 3N74A 4OBBA 1PNVA 4GOMD 1BMDA 3ODPA 2VJAA 2UV8A 4LXXA 5IT0A 2D6FA 5DNYB 3C1OA 4M60A 3RUCA 4DY4A 4I3GA 3T1TA 2OV3A 1F2TA 2QRLA 3KQMA 1EJ2A 1ETUA 3AX6A 1JQ3A 2QKYA 4L4ZA 1Y7HA 2Q9UA 4OKNA 3AR6A 5FUVA 2JANA 4MB0A 4LTNA 1XTZA 2FP4B 1SVMA 3LL4A 4WINA 5EE0A 3TMKA 4DXDA 4UTNA 1LBSA 4JCCA 2QX8A 3B60A 5CT8A 2V8OA 1NQVA 2W2VA 1NFQA 2YJ3A 4E1BA 2WQ7A 3MW8A 2YXLA 4HGRA 2GZAA 4ZVQA 2QPTA 5KOHB 3H6KA 3REGA 3WMEA 5AFSA 5E7QA 3DOIA 1XZIA 3WYEA 4E4TA 5KAPA 2F1KA 2HNKA 4IFIA 2WJ4A 3T0GA 2A7QA 7MDHA 1MGPA 3VHRA 2ID4A 2XITA 4HVAA 4RIHA 4P82A 2OCXA 1X19A 3D2LA 4Q7EA 4H3KB 4B46A 5JOQA 5DX1A 1FTQA 2IHBA 2P9JA 3QVVA 5I47A 1HDYA 3DHEA 5AK6A 1RTKA 4YMHA 3TBFA 5BQOA 4ER6A 2GFHA 1KVTA 3KOXA 4CMGA 1L5WA 1B3BA 3WZ2A 4OLHA 4QDKA 4ZFNA 2J4CA 2XUDA 2A3RA 5CURA 1ZRNA 4DIBA 2PUAA 1VIAA 1JHUA 1FP6A 1QYDA 4I8DA 2IYAA 2H1LA 3QH4A 3GB9A 4JJ6A 5FUBA 4BBJA 5EJ4A 1RKUA 4QTTB 5AJUA 4KPGA 1XL1A 5TVGA 3R7FA 3A1TA 2O0LA 4MQMA 5EE1A 1V5FA 1Y98A 1JG7A 4WCFA 3KWJA 3UKDA 2VRCD 3C6QA 2GBLC 2DTEA 3IAS6 1JXMA 2CXXA 3VTKA 3O82A 5DNAA 5ITSA 1G42A 1K2WA 3G17A 5J2TA 1YWGO 1RHKA 3NTOA 1BVYF 1TF2A 2H31A 3H0CA 4DA4A 5IBCA 1NX9A 4F71A 5CYGA 4XCQA 3AL0C 1C9NA 1YA4A 1E5XA 2ZRDA 4EUFA 4KK4A 3HB1A 2YV5A 3TQFA 1G9SA 1PYGA 4MYRA 4H4EA 3GLFB 4HRVA 2QN3A 2XNDD 1WQ4A 4NJMA 4YV0A 5IDQA 5I9NA 2XRZA 2PTHA 1P6QA 2XKJE 4FTWA 4YXWA 4E46A 3ADCA 1H0SA 3RO7A 4CDRA 1P6UA 3TW0A 1N77A 3TXYA 1AHPA 3IP7A 1G20E 3S2ZA 1M2WA 1XVVA 1XALA 5F1OA 3T3PB 3LP8A 3W6PA 3P71T 2DUUA 1L8LA 1OVMA 1R8QA 4LF9B 2QTCA 2FHSA 1JR4A 4BN0A 5LLDA 1JKMA 1K75A 1J7KA 4IGAA 2GF2A 2IPAB 3ZDRA 4RTOA 5G0SA 4AZ3A 1D0VA 1ACJA 3T06B 4E33A 1E58A 1JEOA 1TVCA 4NAUA 1J8FA 2IYUA 3ENQA 2HA0A 3EY4A 3ZGXA 2EIXA 3CVUA 2C20A 1E63A 2B2NA 4GKJB 4DILA 4GR5A 1UDAA 1VCNA 4L6AA 2QY6A 3RC1A 1U3GA 3BD7A 1QX4A 4OQYA 5BV1A 1BS9A 3JQ9C 2CK3D 2CFRA 4MVWA 3I1IA 1ZIYA 4G5HA 4OUKX 5AH0A 3ZZNA 3PPIA 3MS2A 4AJEA 1IAVA 1KNXA 1W1UA 2A14A 1XQ9A 3LPDA 3PX3A 3LV8A 4LC9A 1NTOA 4UZEA 1EE1A 5LBTA 1KSGA 4X6LA 1DHRA 2CUTA 2OT3B 5ANRB 3DEHA 5A7GA 1NAIA 1WPRA 2IUSA 1SCUB 3NP7A 4M0LA 1ZJZA 1OTXA 1PG2A 1WMEA 1X7YB 1ISJA 4OHPA 5B4VA 4NCBA 3LZCA 1LDEA 4G2NA 3VYTB 3QVXA 2C9DA 3MIIA 2JEYA 4W8OA 3ESAA 1FMLA 2BI7A 4JELA 3ASZA 4E2WA 5K3OA 2JASA 3QSYA 1V2HE 4HNQA 4HWTA 5AJYA 4CU2A 3OX3A 4EW6A 5DIFA 1OCEA 3G9TA 1SVLA 2IYLD 3PENA 3EVNA 2B4QA 3PGVA 5ES3A 1HH4A 4BJ6A 3K20A 2JFVA 4LF8B 1GUYA 2QD5A 4MX8A 3AM3A 4WAUA 4YAWA 4NXMB 1K3UB 4XYEA 5IXJA 1ISIA 3HCPA 1DV2A 4UTZA 1UBEA 1W0KD 5D7BA 2QAGB 4UU8A 1RFGE 2VNSA 1SURA 4GLLA 2DC1A 4L5BA 4Q9AA 4AAYA 5FTWA 4BNJA 3LX8A 3VH1A 1GGFA 3K5WA 5JJBA 3L8CA 5ISMA 1B0AA 5FQOA 1OC2A 2BH9A 3OLQA 5CYPA 4DMMA 2OESA 2PRZA 5JDIC 5IM5A 4IWXA 1CJUC 4MKHA 3RRYA 4LISA 1QOZA 4YV7A 1V5EA 3OPNA 2FRDC 3DKRA 3IDOA 2J7PD 2N42A 4KLAA 2A5YB 4D4KA 5J47A 5GONA 3CMMA 1OWOA 3R7DA 4QBGB 2ZCUA 3BDVA 1XDZA 4KAXA 3O9MA 5ESDA 1CYDA 3OOSA 3QTTA 2DUJA 5CB6A 5AM0A 3OZTA 4ASUA 3P0IA 4ILEA 1JIKA 3HU1A 4XIFA 5HVNA 2Q6VA 4UU0A 4EMUA 3RRNA 1PL7A 3LY7A 2G6TA 4J4BA 3WADA 2EDAA 2O7SA 3NHJA 3K8OE 1EM8A 5JY1A 2IYTA 3Q7TA 3V1NA 2Q5CA 1TM5E 3JD3A 3NT2A 5KI6A 3IHWA 3VGJA 1IJKA 3GCDA 1Y4SA 3MTDA 1A2BA 2FLVA 2GRJA 4FUTA 4CR7A 2QT9A 3DW3X 4KV7A 4EHBA 1U8FO 2YXBA 1V48A 3FYHA 5BUSA 1YQGA 3SZRA 1OYVA 1Z0SA 5LDHA 3TGPA 2VJMA 1CZRA 2W9XA 4YCSA 3IUQA 2KQUA 2JKVA 4UM8B 5EQJB 1QTNA 1TXGA 3S1AB 3TNLA 3FSEA 3SX4A 3AHFA 2AB0A 1PSDA 4JSYA 5JSQA 1TRHA 2R4UA 4BUJA 2WWYA 1NNUA 1SCIA 1IK6A 4DC0A 3FLMA 1WD7A 1ZWKA 2NPFA 4HGOA 1JBKA 1IOWA 3BF7A 1NNEA 4FYJA 4JLSA 2HBRA 4HYTA 3VV2A 1EIWA 3A3OA 3OTWA 3PCRB 3DFIA 2H2GA 4N0QA 1MC4A 5T8KC 4LQCA 5JEDA 1R18A 4NOKA 4ALNA 1CZNA 2FUCA 2H59A 3A4NA 2HUNA 3G8DA 4HDKB 1Y33E 1Z88A 4QUDA 4WVFA 4PQFA 4WOPA 2C57A 3B38A 4BO4A 5AD1A 2BL4A 2JI8A 1GY8A 2C8VA 2GD2A 3DEFA 3NIGB 3KYBA 4DKXA 1JT9A 4DDTA 1TNDA 3T9DA 3GCWA 4ZPJA 3KPUA 2Q6OA 5L7WA 1SIWA 1FIUA 3E3OA 4WXEA 1X39A 2WILA 3BERA 2Z6UA 1UK9A 2CNKA 4LAFA 3DZCA 4C05A 1HOXA 4L3WA 4GC5A 3RVJA 1IQRA 1MPTA 3DXZA 4C5AA 1CZOA 1KO5A 3RK0A 3SYKA 2FMKA 3DDWA 4KNWA 1BA2A 2WUVA 3B52X 3A6GA 3Q0IA 1EPUA 1WUJS 2VP4A 4XOIA 1U0NA 5CFOA 1I4LD 3HDVA 1FX1A 4QQ8A 1CKEA 4XFDA 4FDUA 1QQ5A 1D2MA 1CZKA 2C4HA 3GWZA 1UDBA 2O2ZA 1C3VA 4D4IA 1J0BA 1NUPA 3OSZA 3VDNB 1G18A 5ALQA 1KFEB 1KPHA 3ZHTA 2XSZA 2J9FA 3NBAA 2OQIA 4DN6A 1DG3A 1XHFA 3ENKA 4H7PA 1CJBA 1QLJA 2OO7A 5EJGA 1O08A 4ZAFA 3CZMA 2QN8A 4QT0A 1FSFA 1YJBA 2GFIA 3L7LA 3LKDA 2C2WA 4B35A 1N0IA 3LUFA 1U7TA 1WB6A 2QNRA 3GGSA 1ZRSA 3NVAA 3B89A 1P0MA 3DPUA 3O7WA 3SFVA 1E77A 2RJOA 2WHRA 2EAUA 3WL8A 1CUZA 1X7XA 3ZZTA 7REQB 4ALLA 2AJ8A 5EMKA 1Z8HA 4ERNA 5K0EA 4H27A 2XJ9A 4WZBB 5C1OA 3LDUA 2GZHA 2LCQA 4QYXA 2EKPA 4KRXA 3WS7A 5GV8A 6CHYA 4S2EA 3OMWA 1U0HC 1V1MA 4YBZA 1NBWB 4TLMB 3T4UA 3ACBA 1GOTA 3HYTA 4PM4A 3FYUA 4I19A 1D0IA 3SR3A 1YS1X 3F6CA 1JHXA 4KWIA 4P98A 5CU7A 4AECA 3DFKA 4H7HA 3R6GA 1GIAA 1A5BB 3U3RA 3FWKA 5D3QA 1Z4LA 1KZHA 3W6ZA 1WZCA 3OF2A