1TPZA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
402
structure length
395
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
total genus 147
structure length 395
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tpzA02
1VMAA 3B82A 5CDFE 4XIGS 1R7RA 2D7DA 3VR3A 2BC9A 2IT1A 5J4YA 1U98A 3GEEA 4PC1A 3H1TA 2BDTA 5AJYA 4GOXA 1XFAA 1AKYA 3QENA 5E95A 4DCNA 1E32A 2C77A 1HYQA 4NYJQ 2WJYA 1MO3A 5A4JA 1E9SA 1Z8FA 2AHOA 1EFHA 2IS4A 3LX5A 4G1UC 4KLZA 4YXWD 2CNWA 2ODNA 4TMXA 2JLWA 4Q01A 4AKEA 3EC2A 1II9A 5EUMA 2IF2A 3W90A 1G6OA 3FPAA 4GPTA 3BERA 4DCVA 1S1MA 3TJZA 1JALA 3CONA 3E1SA 1U81A 5B57C 4GFDA 2BJVA 3NIBA 3DKPA 4BFZA 4BZQA 1LY1A 1NSTA 2VL7A 2WSSD 4KBGA 4QGFA 4JVLA 4DRZA 1E9RA 4DIEA 3V9PA 2O0JA 1MRNA 4RZ3A 1QHHB 5J47A 4Q18A 3RC3A 1QVRA 2QAGB 2OFWA 2ZYTX 5FI1B 3BBPA 2VEDA 4AURA 2P67A 2BMFA 1XEXB 4C2TA 1FTSA 1G8YA 1DADA 2GRJA 4LPKA 2LWIA 1AGRA 2ASEA 4DC9A 5J4VA 1O3YA 1OIVA 4TQAA 2PBRA 4FN5A 1Q44A 2IS1A 3W9YA 1DO2A 5CK5A 1N3BA 3FKQA 4TQ9A 1CR1A 1SXJC 2KBFA 1GFIA 1N5LA 2DWOA 2IL1A 5AUNB 1SVOA 4LUCA 2N42A 1SKYE 4LX0A 1N6HA 4MUAA 1Z0AA 2CBZA 3GP8A 4Q1AA 1EFCA 1KJYA 4MKIA 2RGAA 3L8ZA 1NN3A 2ZREA 1KSJA 2JASA 4FWIB 2GTPA 3A1VA 3R7WB 1KIMA 3SEAA 1VCIA 1DAMA 3VX4A 4V02A 2F7SA 1E9EA 4U5XA 4R2IA 4MRNA 4NZYA 2FNAA 1XTRA 1IN8A 5TXGA 1OW3B 4QM7A 2EYUA 1P7CA 2PCLA 3SYLA 2D74A 1KSFX 2ZRJA 1GITA 2A9KA 2FFQA 3FMFA 2ZRMA 4YMSA 2A5FA 3BFXA 2ZIAA 3E2IA 4LV5B 5JWHA 5KDOA 3NG1A 1QHSA 3EPHA 3IO3A 4EFMA 2CVFA 1XTKA 1N6NA 5JEEA 1OHHD 4CZ2A 4AKGA 3I62A 1MT0A 2P6NA 2VP9A 3B13B 3IUYA 3B78A 3BB1A 3GFTA 5CIWA 1AS0A 4IFBA 4DLVA 3EA0A 4RD0A 5JCZA 1NRJB 1RFLA 2ZPTX 4JYCA 4X8HA 3R9XA 1JXMA 4FI3C 3NBFA 4PHTA 2FSGA 1RW4A 4XD7A 1EWQA 2GBLC 4CVNA 1WBBA 4OK6A 3FMPB 4Q9LA 1YKSA 3GJ7A 4BRUA 2GAAA 3K9NA 4P33A 5B64A 2X1VA 3UKDA 5KSYA 2WTUA 3ZGXA 4B74A 3DVLA 4D0NA 2X77A 1CU1A 4FCTA 3ZJYA 2OXRA 3BH6A 3QI2A 4BFYA 4DSUA 3OZXA 2X8AA 4B3DA 4B3BA 2A5JA 1A2BA 1NBMD 5L3SA 3IIKA 4RFSA 4AI6A 4P4TA 4KO8A 2IYWA 4URZR 1QDEA 4GMDA 4LHYA 5FBRB 3VHLB 4C3ZA 4F91B 2OBLA 4PZYA 4FIDA 3ZZTA 2Z6VA 1VG1A 4Q21A 2DY1A 4QBHA 5EP2A 4IJMA 4TZ0A 1G18A 1XZQA 1IY0A 3IHLA 3SS8A 2PJRA 2WAXA 3I8SA 3OF5A 5JHHB 5F9HA 4WZAE 1YZQA 5G3YA 4E09A 5E3HA 4B3XA 5KUTA 2I4IA 2Z4SA 4GRAA 2BBOA 2ZRAA 4W5WA 3U6BA 1GSIA 1EFRA 4WAUA 1NN0A 1Q22A 4L5BA 4C7OB 1OHHA 2QMUA 1E79A 4OHVA 4M53A 1D9XA 1W0KD 4KU4A 5L3QB 4CEIA 1W5SA 3RHFA 1UDWA 3KZ1E 5SZJA 4GZLA 4G3XA 4WOPA 2ZUCA 1VYTA 1YZUA 1KK2A 1XDBA 3FHOA 4OQXA 1EXMA 4GOJA 1JEEA 2GK7A 1M34E 2J0VA 2X2FA 3LVQE 5B58C 4LDJA 3KTAB 2XB4A 4BFSA 1KNQA 1U0LA 1QF9A 2GXUA 1M7HA 1KAGA 2VP0A 2Z83A 4RCZA 2OFXA 2J0UA 3CH4B 3RDPA 3W6OA 1ELOA 4K8OA 1G3IA 4MGZR 1AQYA 3TRFA 2ODWA 2XTNA 4IW3B 1WF3A 3NDBB 2B7CA 4JKIA 3LX8A 3I73A 4X8MA 3C5HA 4DSOA 4NCJA 1G17A 5JJLA 1E1QA 3CF0A 1K5DA 3JVVA 3T1QA 3CX8A 2J0QA 4QJ4A 4JVMA 1IJEA 1XEXA 1E0KA 2VTKA 1NLYA 4GMXA 3N2IA 1SHZA 3BE4A 2CXXA 3BB4A 1PZNA 1GM5A 3ZLJA 2CK3A 1FP7A 5E7JA 5EP4A 1E1RD 3UG6A 3KB1A 3B1WA 4P31A 3U7GA 2GZAA 1FP6A 2F43B 3CRRA 3CRW1 3CF2A 5FL7D 1T3SA 2GJ9A 2ZAOA 3KXKA 1AZSC 3MG9A 4URUR 3NTUA 2DR3A 3PEVA 2ORVA 4P4UA 3VR6A 2O8CB 4QHTA 5FOVA 5EE9A 1E79D 2ZJ5A 1UAAA 1DBSA 2VPPA 4MDEA 4PPGA 1KSGA 4FXPA 1T6NA 4DLSA 2C03A 1BMFA 3ZQ6A 1G8FA 5DISB 1KKMA 4NYJR 4QHSA 1P9WA 1NY5A 4MRSA 3RRYA 4CIDA 4LJ5A 5CB8A 4BZXA 2FFHA 4C4PA 5DE3A 1G7TA 3KQHA 1ZD9A 3KFVA 3BIFA 1CS4C 1H8ED 2E1RA 1Z07A 2NZJA 3M6AA 4BZPA 3A58B 4JLPA 1GAJA 3CX6A 1KZ7B 2GCPA 4A6PA 5CM8B 2NO1A 3W6PA 3N5CA 3VAAA 2BV3A 1AKEA 5GJBA 1ZIPA 5HZHA 1T91A 4IOMA 5DIFA 3SI7A 3TK1A 3OE7A 3VKHA 2FPMA 1S9HA 4AKIA 2YKGA 4JVNA 1OFIA 3D31A 2IHBA 1BO6A 2ZUDA 4WIAA 4C0HA 1IAQA 1R5OA 1V5WA 5TARA 3U2QA 4N1AA 4KI0A 1XBTA 1P73A 2A5YB 2AWOA 2G1KA 2YINC 2ZE5A 3EZ2A 2IEYA 5K8IA 2B8WA 2RHDA 5FPYA 1E2IA 2HJVA 3IBYA 4L15A 3GLIB 2WWGA 3FWYA 3KB2A 5DYGA 4A82A 4E03A 3WHKA 4JLVA 2HYIC 5GVRA 3ZVNA 2A5DA 3LAWA 5C1BA 3LW7A 1VHLA 4B35A 4PANA 3A4LA 4HAVA 3H0KA 1A4RA 3TW4A 1L4UA 5JECA 3MWJA 1MR3F 8OHMA 2QPAA 3PUVA 1J7KA 2WKQA 4ON9A 2V8OA 2V7QD 4QFMA 1U8ZA 4OJKA 4YC7A 1YZKA 1F3OA 3QBVA 3DOEA 2WKPA 3TR0A 1UEIA 4C0SA 4C0JA 4IXNA 2IA5A 2JIZA 4NYIQ 5CJPA 1UKVY 2FA9A 3TE6A 2OBMA 2JLXA 1WDTA 4HAUA 4MGIR 1X1RA 1YZLA 5FPHA 1DO0A 3T34A 4A2QA 1T5LA 3K9LA 3DO6A 4ZDWA 4NHOA 2P5SA 3OEED 4RSGA 1NG1A 1K6MA 2PX3A 2R2AA 2OHFA 3R7WA 4B76A 5AWFC 2ZRDA 1XEFA 3JZAA 3VHXA 1CJMA 4IDPA 2YC4C 4H9GA 4OL0A 4PC6A 4F93B 2WWIA 1OFTA 2OCPA 3N2EA 4ILEA 1DAIA 2G77B 5BN4A 4O2RA 1JR3A 1B23P 3MD0A 2QE7A 4RZ2A 3TQCA 4JBWA 2W2TA 5H68A 1HV8A 2REOA 2WPDD 1OB5A 4BLQA 2GA8A 2VP5A 2OE2A 3KTAA 3GLGE 4L16A 1XPUA 1UBCA 5CB6A 5HZKA 1L4YA 3LQQA 4HUQA 5KO2A 1IM2A 3NEJA 3SYNA 4JLKA 2OT3B 1RVDA 3BRWD 3P26A 1RPZA 1N2CE 4ZCIA 2QP9X 2G6BA 2YWFA 4ZI3A 1H8EA 3SJZA 3CWQA 1AA9A 5JJKA 1G291 3IHWA 4KAXA 1PLKA 2HCBA 2J3EA 1U90A 3PJRA 1G64A 2YWGA 4NU0A 5KNDA 2WZQA 2ODEA 3VR4A 1B0UA 1OXXK 3OIUA 1T4GA 1KO1A 2OCBA 1X3SA 4KVGA 4ESVA 2FV8A 2XSZD 2VF7A 1FX0B 4JZKA 2P3SA 2GEUA 4B3FX 1LF0A 3AVOA 1YR7A 4AK9A 1XCMA 4OHXA 3D8BA 1EK0A 3QXCA 3TAHA 1U2RA 4N0EA 1IQPA 3TW8B 2AKYA 4U02A 1HA3A 3BFVA 4OQNA 221PA 3B5JA 4XVUA 4PXAA 4ZIRB 3THWB 1KMHB 5HKKD 3LD9A 5CYPA 4URWR 4JVSB 2O0KA 4UJ3A 2AFIE 2EFCB 4RZXA 4Z1MA 3UATA 1W44A 3HPQA 1JAIA 5KNCA 3IIMA 1ZCBA 3QKTA 4HI0E 3UWOA 1N6PA 2ZRGA 4CEJB 2A78A 5LBIA 1HY3A 4KLNA 1FQJA 1NMXA 3U7HB 2DYKA 4IKEA 4P4SA 3WYGA 1OFUX 3SDZA 1RIFA 1E2QA 1E99A 2I1VB 1TU3A 1GNRA 2V6JA 4QC2A 3KXLA 4Q7MB 4TT3D 1AK2A 2OILA 1VPLA 4QG7A 3TMKA 1H8HA 3EWSA 3GLHA 4B33A 2W58A 2VSXA 4OQLA 5E7MA 3G82C 3B1VA 3S1AA 3AVXA 3U4QA 4PAMA 2ZM5A 2QUZA 4Y0VA 1KAOA 3IILA 3W34A 1CLUA 2D2EA 1Z83A 3QXSA 5JSZB 3L2OB 2O8FA 4XSHA 2V6IA 3CX7A 5EXSA 3D7MA 4MKGA 2GVDC 3N70A 2JDID 1X8LA 2I3BA 4C0KA 1OXVA 1TMKA 1W1WA 4Q1BA 4DB2A 2HF8A 4YQFA 2ORIA 3CWZA 3ZS9A 4DDUA 1DS6A 2A2ZA 4JLNA 1R5BA 4PZZA 2RGBA 2ZANA 5M04A 4TTPA 4I81A 4EFNA 1Z22A 5D3QA 4Q1CA 4RCYA 4PFSA 2GVZC 5F98A 1MO5A 4TMWA 5AJXA 3F3YA 3LFUA 2EVWX 2KJQA 4NPHA 5FFMA 5DN6A 3OAAA 5FUVA 1UKEA 4URYR 3EPJA 1OH6A 4MGKR 3LXXA 4V0NA 3P1JA 3ADCA 2OXCA 3KKQA 2JJ1D 4URXR 2IYXA 1F48A 2PMDA 1TL7C 1AJEA 2GETA 5FPKA 2HLDD 5JS7A 5LD2B 2F1RA 2J46A 2PMKA 3QKRB 2BKUA 4EUNA 4OI0A 1YE8A 4M8NE 4R98A 4EKDA 1U0HC 2WIAA 2VLIA 1G5TA 3PG5A 4EPTA 5HCNA 3W8NA 1CF4A 2QG6A 2QGZA 3HU2A 3BK7A 3DM9B 3UXMA 2NPFA 4M1MA 4IOLA 4D4MA 4M1OA 4C0BA 1E69A 2IUSA 4PQRA 4QL3A 3KUDA 3QOFA 3TQFA 1Q3HA 4G5QA 3KDSE 2Z5FA 2PT5A 4V0ME 5IRCD 1U9IA 3LY5A 1XJQA 4XWAA 5FTKA 4D25A 1WMSA 1UBEA 5CITA 2O0HA 3RRZA 2CJWA 4V0OA 4IVPA 5EZ5A 4L8GA 1HUQA 2G88A 3B1ZA 1N6LA 1KKLA 4GOKA 4BFXA 2IX3A 2ZI5A 2XAUA 1CJUC 4G5GA 2HEIA 2FFBA 4DIDA 4LV8B 2FEMA 3MWYW 1A82A 3T12A 4XSGA 2DFTA 1P2VA 4UNRA 4W5HA 5AUOB 4BPBA 3TUZC 2DFKB 5JI3E 3Q3JB 2ERYA 1TNDA 1XJ0A 3GEHA 4HUQB 4JYBA 1R6BX 4A0RA 1PV4A 2OLJA 3QF4B 2FF7A 1D6JA 3B7GA 3AVUA 1BKDR 3C14C 1ETUA 1E2JA 4OQFA 4DSNA 3MRSA 1SKQA 1CP2A 1GKUB 4Q47A 5KHOC 4GDFA 1EFTA 2C8VA 2Q21A 4ZKDA 1NLZA 4CEHB 1IBRA 1ANKA 1MO6A 4IVRA 3UIEA 5TMPA 3KQUA 2HLDA 2GILA 3ZIAD 1NP6A 4M2LA 4QM6A 3DPUA 1T3LA 2FEOA 2FU5C 4PC7A 2XXAB 4NTZA 1TEXA 1E2DA 3WBJA 1VCOA 4O25A 1JPJA 2ONJA 3C7KA 1XNJA 3UPUA 1FNMA 3DL0A 4M9QA 4ZIRA 3THWA 1KMHA 1FOEB 1S4QA 3QBTA 2QBYB 4FMBB 3M1IA 2GCOA 1Z5ZA 3QKSA 4A0HA 1MOZA 2QAJA 4MRRA 4JSYA 1NSFA 4R2HA 3CO5A 3VMFA 2QMHA 2OLKA 4CEJA 2ZJ8A 1ZW6A 4Q4AB 4KJZA 3GLFA 3QQ5A 1EX7A 3I1FA 4PSKA 2ZRIA 4MRVA 1NIPA 1PUIA 4UXJA 1OIXA 4YMWA 5FOUA 4PPQA 4TWZA 1W4BA 2VQSA 3OFNA 5JBQA 2RGNA 2KE5A 3KFXA 1JQJC 1WB9A 4ASUA 3RWOA 1YZNA 1A2KC 4IDOA 3SBEA 1ZM9A 2C2HA 4ITRC 1S2MA 1Z2CA 3TSWA 2HDNB 2BMJA 5GJVC 3REGA 4TYQA 4IFEA 1E94E 2ZI4A 3K0AA 3B9QA 3BWDD 1ZINA 4W7SA 5EXTA 3GD7A 1JECA 1IN7A 1E1QD 1QBKC 2NO9A 4NDZA 2WWHA 3AF4A 4HLUA 1G7CA 1N6RA 1YZGA 2CHVA 2CMKA 5DO9A 2QTHA 1E4VA 2F3TA 4A8JB 2O8BB 2OZEA 2PL3A 2ZI9A 3ZD6A 5P21A 1JPNA 3T5DA 3ZIAA 1FFHA 4LRWA 3ZVLA 3GLIE 1G7RA 4JLDA 4OI2A 1R10A 1ZC4A 3BFKA 5F9FA 2BCGY 3CRQA 1MV5A 3LO5A 2A3RA 3T1OA 4KFSA 3WRXC 1QHYA 3CZQA 2G9NA 3RS3A 3CLVA 3CNNA 2H17A 2VP2A 2XEXA 3B8HA 3K0EA 4Q1DA 4OJQA 4MITA 4RKEA 4JL6A 2J45A 2QTFA 2OO7A 3AH8A 3R8CA 4PC3A 5KPDA 3KQNA 5FBWB 3TLXA 2XOKD 1RYHA 1P61B 3TGPA 1I2MA 4Q4HB 3TAUA 2ZR0A 2AN9A 3ASZA 3RS2A 2ORWA 3CUEF 5AJVB 1OYWA 1UDXA 3LBNA 3RSOA 1KI6B 2J87A 2PCJA 1KNXA 1C9KA 2FJUA 4NCKA 3L0OA 1VG9B 1YRBA 2Q3HA 4XVQA 2HYDA 3PFIA 1A7JA 2ZS8A 2WSMA 2QP4A 2ZRFA 2BCJQ 3MGCA 2LKCA 5DI3A 4NONA 2FGKA 3KJHA 3EXAA 4M1SA 1D2MA 3AKDA 2XZLA 1E9FA 4D4LA 2F55A 2W2XA 3FE2A 2WWYA 3GQBA 1XEWX 2IC5A 3EPLA 4DCUA 3HU3A 5HE9A 4Q9KA 1R0ZA 4HB4A 4M9XA 4JL5A 2CCKA 2CL6X 4Q4JA 5AJZA 1G16A 2ZSEA 4O0MA 3X1XA 4TL6A 4Q5IA 2ZYUX 2W0SA 4Z8YA 1TQDA 3A1SA 4D2IA 4PX9A 1QZXA 2PEYA 5C4GB 3U3MA 1EESA 2R6DA 4DT1A 3AV0B 4G5OA 3S1AB 2IYYA 1XXHE 3FOZA 2WJJA 1XJCA 1Z2AA 3EIQA 1Q1BA 4BASA 2DPXA 3TR5A 4DLWA 4LJYA 3R9IA 3BH7A 2J7PA 4HDOB 3THOA 5FH9A 3VU9B 4OI1A 2RMKA 5EE5B 3X1YA 3PR1A 2CCJA 3P4XA 2NZ8A 3CRVA 3WMGA 3PUZA 1DOAA 1N5KA 1Y63A 3QXXA 4US0R 4YDSA 4BLSA 1NBMA 1XPRA 1E2NA 1HH4A 1KI9A 2GDJA 4KFTA 1F6BA 3SNHA 1F5NA 5DSZA 3R8FA 4WA7A 4TTQA 4EJSC 1IN5A 1US8B 2CL7X 1YZTA 1Z0DA 2PLFA 1O87A 1OJLA 2IXGA 3EX7C 2HCJB 4LYFA 2ZU0C 4NKRA 1EFUA 1M8PA 1DE0A 1OF1A 1HE1C 1A1VA 4IDNA 3MFYA 2DFLA 3U60B 4A2WA 1ZM7A 1OV4A 1TUEA 4KV9A 2WJIA 2BIFA 2WWFA 3K70D 2QM8A 4M1WA 5CJ2A 2IS2A 4EIWA 4U7DA 3AVPA 4OK3A 2HF9A 5EXPA 3ZVRA 2CNWD 2YYZA 4NBSA 4Q4AA 1G3MA 2GAOA 4OKSA 1SVLA 1IN4A 1T0JB 2H1LA 4DJTA 2CLSA 1LW7A 5KNBA 3GCGA 4FD2A 2WJHA 2FWRA 4DSTA 1R8QA 2R8RA 2LCFA 2JJ2A 3V4FA 1XTIA 4B73A 5KU1A 3K0CA 1L7VC 2F1HA 2C04A 5B30A 2D4HA 4A0FA 2UKDA 4JLMA 3CRMA 4YMTA 2GKSA 1F2TA 2DB3A 3IBGA 2RKOA 2V55B 1RKBA 4E07A 2V3CC 1XTQA 1Q0UA 2NIPA 2J7PD 3C15C 4KHZA 3OIYA 1H65A 1JJ7A 1SZPA 2QTVB 5J5CA 1JB1A 1ZUNB 4URVR 3BOSA 4HATA 3SHFA 2FN4A 4QBFA 4ZCLA 3OE7D 1ZNWA 2XSZA 1Z47A 1UJ2A 2NGRA 1WQ1R 3M0EA 1I4DD 5CLLA 1JR6A 5D3MB 4M0LA 1E2PA 3W6NA 4YDHB 3KL4A 3FMOB 2CDNA 4NYIR 2WHXA 3U3RA 2IEZA 2GXAA 4LHWA 2QRNA 4RD2A 1NI3A 3R9WA 2XNDA 4UKDA 2A7QA 1ZAKA 3ADKA 3U3JA 4Z1MD 1J8MF 1XRJA 3VNVA 4P32A 1BYUA 1SHKA 4LJ8A 3MSXA 2C5LA 1GNQA 2C9CA 3Q9LA 3RABA 1TTTA 3TSOA 2GZDA 2GCNA 2ZSFA 1OE0A 2YOFA 3AF2A 2WAYA 4A2PA 3ICEA 4MKHA 4B47A 2J0SA 3ONWA 3HYRA 5JHGB 4CDGA 3K70C 1BS1A 4NYMR 4D0GA 4QOSA 3FGNA 5FUXA 1QVAA 3IDQA 3RC8A 1GRNA 4HUTA 4XH9B 4DUGA 4PSAA 2AD1A 3HWSA 3QPUA 2NG1A 2NPIA 3UMFA 3T06B 2O8EB 4OYHA 2QQ0A 4KODA 2O8DB 2JLRA 2RGCA 2REXB 4LV6A 1ZCAA 3GLFB 2QSYA 1A5TA 1P62B 3GMTA 1NVXQ 2YHSA 3AP1A 3GJ4A 4AWXA 1ZNXA 1LS6A 4Q9HA 3ZD7A 3QY0A 1PLJA 3TSZA 3O8CA 3CPEA 1GRRA 4OQMA 3A37A 3IO5A 4XWKA 4QGGA 1U94A 3REFA 3W3AA 5EXXA 2XJ9A 1EFRD 4M22A 3NC0C 3ADDA 2DWQA 5IDVA 4C7OA 1E98A 4IOJA 2ZE7A 2ZR7A 4RD4A 5DHAA 1Z63A 4FMDB 4KBFA 4FINA 3I5XA 3K0AB 3NVAA 4EDHA 2F6RA 1CEEA 1AN0A 3FKSD 2IYVA 3IPXA 1XTJA 5DN6D 4ZCMA 4WXRA 1UF9A 1GL7A 1N25A 2NO6A 4IHQA 3VU9A 3WMEA 3RS0A 1G1MA 1MKYA 2ZS9A 3MUFA 2ZI7A 4NYMQ 1D2EA 4UNNA 5IK2A 4R7ZA 3NH6A 3ZS8A 1OYYA 3QVUA 1E0AA 3WNDA 1DVRA 1F60A 1ZD1A 1EG7A 3NBXX 3R20A 1I4TD 5AUPB 2GBLA 5KYKA 3DEFA 3LVRE 2GK6A 2N1BA 4UQOA 3QVVA 1US8A 2PJZA 3EC1A 4M1TA 1Q1EA 5GJWC 4IEIA 1YVDA 4JMPA 5H8WA 3WRYC 1KTVA 4H1VA 4WZ6A 3RVBA 5EP3A 4B34A 4Z54A 2ZJYA 4O3MA 4B6EA 2NO7A 1DG1G 2ZYWX 2FSIA 1G20E 4ACBA 2ANBA 1XPOA 2SHKA 4JJKA 2H57A 1F2UA 4YMUA 1QRAA 2QA5A 3GLGB 4WZBE 1VKJA 3B2EA 5FL7A 2PEZA 1N0VC 4QNMA 3PV0A 1WP9A 1HT2E 1KO7A 4ACAA 1R0WA 2VA8A 3P27A 3TKLA 2IXFA 4HDCA 3W5JA 3NKVA 4AYXA 3QSYA 4DLUA 3WMFA 1FUKA 1WXQA 3GJXC 1Z08A 5BWMA 1Z6TA 3RRNA 1GRQA 1NVWQ 1WBDA 3PCRB 1YR6A 3A6PC 1KDTA 1E2LA 1UM8A 3FKSA 1Z6AA 4HAYA 3TBKA 4DDWA 1ZC3A 3NC1C 3GPLA 2Q9BA 2BBTA 4HLQB 4DT1B 3V00A 2IS6A 2FSFA 1SULA 2ZROA 3OIVA 4CEIB 1EWRA 1E1RA 2C9OA 1YR9A 1GP2A 3K53A 4W5JA 4F92B 1OKKA 3DM5A 1M1YE 1YRAA 3AKYA 4MKFA 1P9RA 2A5GA 3F8TA 1VECA 1RRCA 1NVVQ 4AG5A 4GI7A 2VSOA 2DCUA 4LBZA 4E5UA 1DEKA 2ZRCA 4QBIA 5FOSA 3LLMA 4B32A 5HE8A 1KK1A 3LW8A 5EZ6B 2ZJ2A 4BLTA 1W2GA 4ABYA 1W2HA 5E4FA 5FL3A 1MH1A 5L3RA 2P6RA 1D8TA 2YC2C 3RSLA 3PITA 2QEQA 1CULC 4IDHA 1X86B 4ARZA 2GESA 2C99A 1SXJD 4BECA 5H1YA 1P9NA 1Z06A 4P3YA 4I1SA 3DHWC 1FL9A 4AG6A 4IVQA 1M6NA 1G8PA 1Z0KA 4JS0A 2ZRLA 2HT6A 1S3SA 1J99A 2AK3A 3CPJB 4BFUA 1ZBDA 2BWJA 4A36A 2FG5A 3LLUA 3VFDA 3HR8A 1QG2A 2HXYA 1RRPA 4C0AC 5FBVB 4QKQA 3LQRA 1GWNA 4K81B 3VKGA 2QORA 3X2SA 3THXA 3KJIA 3CW2A 2RGNC 1YU9A 2J7KA 3ND9A 1FMJA 2D06A 4MQBA 1SVMA 2PT7A 4V03A 2C9YA 3H4MA 1EGAA 4BUJA 5FTLA 1II8A 2QN6A 3L0IB 3C4JA 4US1R 4PPNA 3AVYA 2BEKA 1T3HA 2K5UA 1XWIA 2ZJBA 4RD6A 2R6FA 3O8RA 4GL2A 2YNMA 3NHBA 2JLZA 3KKPA 2D3WA 3FFBA 4PHFA 1TEVA 1W36B 4F38A 1XMVA 3DDCA 4XD7D 2F1IA 2GNOA 4D4JA 1XZPA 2R62A 1U8AA 2EFEB 4DZZA 1S9DA 1NJFA 5C4MA 2Z4RA 3ETLA 3K0FB 3HDTA 4TYWA 2YWHA 2QRZA 4RVCA 1Z29A 1G5RA 1HQYE 1XMIA 4HDQB 4A92A 2QMEA 3U44B 4NCNA 1LTQA 4XVRA 3K9GA 5FOXA 2P2LA 1Q1QA 5BN5A 4IOKA 3MJHA 2OFOA 3PENA 3A1UA 4EJSB 3IEUA 2J5XA 2VRWA 4EPYA 1AIPA 1VCNA 2JIZD 1RC8A 1KJZA 3GLHE 3G0HA 1GNPA 3QUSA 1GG2A 3K8YA 4TLCA 5C2JB 4GNKA 4G01B 2WOJA 1HEIA 1OT3A 4UNSA 1OH8A 1C4OA 3RS4A 821PA 5K8TA 1KMQA 2QU8A 3GFOA 4IDQA 2FH5B 3A1TA 4TLAA 4XOIA 1Z6XA 5KPJA 2JAQA 1M74A 1R5NA 4TSFD 3NHAA 2RAPA 3FDIA 1RRFA 3ZVMA 4B71A 1RYFA 2ODBA 1P2TA 3EW9A 1AQUA 1NMZA 4A4DA 3VNUA 2ZQ5A 5J4LA 4KITB 1ZYUA 4ZV4A 2JCSA 5BW8A 3ZYCA 3P32A 3AP3A 4Q00A 3VTKA 2HJGA 2TMKA 4OHWA 2NMVA 2IYTA 3C16C 5LD2C 4BLRA 2O8DA 4D26A 1YQTA 1T0HB 1R4AA 2EW1A 4LZZA 4Q19A 2HT1A 4LPSA 2J1LA 1VHTA 1UBFA 1W47A 5GJCA 1IOZA 1GUAA 2H92A 1D5CA 2RHMA 4PO9A 2OCYC 4HAXA 3O8BA 5FTNA 4BLOA 3MWLA 5JEDA 4DEXA 1NMYA 1KDOA 3RS7A 1W36D 1NLFA 1N6OA 3BXZA 3U7FB 3EZ6A 2JJ8A 1G19A 4I1UA 4LJ9A 4D6PA 1GIAA 3IEVA 2W6JA 1I4LD 1XTSA 4DWJA 4I4LA 1BOFA 3AGPA 3DOFA 5JSZA 2AD5A 1CR4A 4OI4A 4EQ6A 3WYFA 3EARA 3AP2A 1E9BA 3A36A 2VF8A 4Q66C 3U61B 4L9SA 3OESA 3NBYC 4MH0R 1DAGA 3TUIC 4BFVA 2GJAA 2W2VA 4DLXA 1OXSC 4MYHA 2AWNA 2F1JA 3LWNA 4C9BA 1W4CA 2CCGA 4QHYA 2XB2A 3O8DA 4WVFA 3W5IA 3ZDQA 5AK0A 1ZVQA 3W3ZB 4I1VA 4B75A 4UNPA 1KI3A 1KJWA 4RKFA 3FTQA 4QGHA 1CXZA 1QHHA 2CL0X 3PEYA 5J4KA 2GXSA 4GP7A 3PUWA 3K09C 3QPWA 2IYUA 4Q1EA 4R9UC 5DI9A 1ZUHA 1R0XA 3PQCA 5ELXA 4Q7LA 4S35A 3TH5A 1NBME 1UKZA 3SJAA 3FHTA 1E0JA 1T9HA 2MSEB 1FPMA 3L82B 4B2PA 3MCAA 2CLDX 4RZUA 4NP6A 3SC3A 4WW0A 1JAHA 5JCPA 3BB3A 4IEEA 4RY2A 4JLOA 2YOGA 3PXGA 2NTYC 3GLGA 1E4YA 1JI0A 1UKYA 2OESA 2B21A 4M9SA 4YXWA 3LDAA 4I99A 1KI1A 2IHYA 4RJLA 1HTWA 2FMXA 4LY6A 3FHCB 5FR2A 5JZVA 3K0SA 2QAGC 1NNEA 2FX3A 4A8JC 3ZQJA 1E96A 2YV5A 3QNUA 4LSGA 4QNRA 3EIEA 5EE1A 1W4AA 4MUBA 3EZ7A 4PO8A 3RAPR 4PTLA 1Z0FA 4AYWA 3CM0A 2ATVA 3LV8A 4ZDKA 2ZS7A 3HU1A 2H7VA 4JJZA 4NMMA 3OAAD 2MMGA 5CYOA 3GFPA 4HAWA 3Q72A 5HCIA 3RANA 2EU8A 2NQ2C 2ZETA 3D3QA 1P6XA 4US2R 2B7BA 4HLUC 3GLHB 5TB5A 3WNBA 2O52A 4LYHA 1VIYA 2KWIA 2VHJA 3U4QB 2R6CA 2WBLC 3GEIA 1CJVC 3FB4A 2P6UA 2R44A 3LH5A 3RWMB 3Q5EA 3NEYA 3Q7QA 5KOYA 2CVHA 3CNOA 3QF4A 4O2LA 1TADA 3UG7A 3SBDA 1YJ5A 4XTRA 2PZFA 4LJAA 2P5TB 3GJ8A 1CKEA 1XD9A 2W6JD 2PX0A 1E2FA 4Y0AA 3I72A 2W83A 5FPSA 1D9ZA 5EUQB 5BQ5A 3WHLA 2VHCA 3KKOA 3M4YA 2W6ID 5TDHA 4KSCA 1RRGA 1NIJA 4AYTA 4ESHA 1S1CA 1II0A 2QAGA 1OFHA 1G4AE 4TTRA 1ZU5A 3SU8A 3CF6R 2CLCX 2WJVA 4DLYA 5GADl 2IUTA 1VYUA 1KDRA 1L2TA 1JBKA 4C0LA 5L3SB 2RGGA 5JWOA 1DPFA 1TAGA 2XJ4A 1JEDA 3B1YA 3C5CA 1E9CA 1NN5A 2HUPA 4MYCA 2ZUBA 1Q3TA 2EFDB 3NH9A 2JLQA 2WVJA 5CIQA 2XNSA 4LJ4A 2QM7A 1TX4B 2Q9CA 3IKJA 1KO8A 4POAA 3JVUA 1W0JA 1II8B 3X1ZA 4OBEA 2I1QA 2O5VA 5IF9A 4B3CA 1N6IA 1OPXA 5AUQA 1QG4A 3HP1A 4ZDJA 3MLEA 3FFAA 3OIWA 1S8FA 2OAP1 4FMCB 2MSCB 2V1UA 3AKEA 5K8LA 2FPKA 2V9PA 1NVVR 3CKLA 2CJWB 2XITA 4ZO4A 1P75A 2AR7A 1KO5A 1JJVA 5DLQC 3SOPA 1E2KA 3U44A 3ADBA 2B6HA 4NCHA 1U99A 1N5JA 4N0DA 1KY2A 2ZXUA 4CYMA 4QJ3A 2EFHB 4A8JA 1Q57A 1R0YA 1CIPA 1JXOA 2E9SA 4NH0A 1X6VA 3BC1A 3FYHA 1Z28A 1NKSA 4G5RA 2ZJOA 4Q02A 1G21E 1DAFA 3HYTA 5F3WB 1K8RA 4X8OA 4DLZA 4TZ6A 2ATXA 3L0PA 1WE2A 4LGMA 4DKXA 2GF9A 4PAQA 4TYPA 3NBZC 2WV9A 2IBMA 3F5FA 3VQTA 1W36C 4CEHA 3T1TA 3DKVA 3QEJA 1N5IA 1E9AA 2FOLA 1OXUA 2ZAMA 2YJTD 2BM0A 4FWTA 1NL3A 1VCMA 1W4RA 1ZRHA 2DHRA 1ZNZA 2Q9AA 1VG8A 2OG2A 4BEBA 2CE7A 2WPDA 1G9XA 2JJ2D 3QKUA 4V0MA 3AF0A 3QG5A 4HAZA 5CM9C 1VYVA 3VR2A 5K8UA 1W49A 4FCWA 2W6IA 3IPYA 1J8YF 4BLPA 2ZJZA 2J59A 1IN6A 1GL6A 3CB4A 2L0XA 2ZTSA 1LF5A 2Q6TA 4WXPA 2F9LA 4FCVA 5LDDC 2G83A 4Q9JA 1OKKD 2GJKA 4DCSA 3CR8A 5AJWA 3OHMA 1AGPA 4DLRA 1MABA 1U9IC 3GJ5A 4BEJA 4JT2A 5JFGA 3J81k 3DMNA 2RGEA 4LHXA 1ZM4A 1ODFA 4TYYA 3AF1A 3WNCA 3SHWA 1KHTA 5CLQA 1COWA 1GILA 2UVQA 1LVGA 3IGFA 2IF0A 3FVQA 3LBHA 4Z51A 1W0KA 2OV2A 2ZSBA 4QXAA 5L3QA 1JNYA 1SXJA 2BJWA 2BBSA 1XXHA 2ZRPA 2ANCA 2A30A 3WY9A 4YONB 3A1WA 3SE0A 1DELA 3X1DA 3K0CC 4EQ6B 2QI9C 3EAQA 3K09A 4D80A 2WMOB 1KI2A 4TMVA 2O8BA 1VDZA 1GZSA 4YMVA 1E2GA 3JZMA 5EJEA 3DZDA 3OEHA 4H1UA 5TY0A 1G7SA 4UJ5A 4DBLC 4UXIA 3U5ZB 2ONKA 3PIRA 2FZ4A 4HB2A 4KYIB 1X8KA 4NE2A 4ZPXA 1GVNB 4B44A 2BKEA 1BMFD 2MMCA 2NO0A 2RB4A 2QZ4A 3GLIA 1X8JA 2AXPA 2QPOA 3KUCA 2ZRNA 5BYKA 5KDDA 2P0EA 2AFHE 4PR0A 3SZRA 4V0LA 4XWOA 2UZ3A 3CPHA 3MMPA 4B2LA 1FZQA 2HXSA 1DAKA 3BD9A 4BFTA 1UFQA 4HZUA 1GTVA 4TMTA 2ZVPX 3QF7A 4LYJA 4TMZA 3QJYA 3I3SR 4Q7KA 5C46F 2FE4A 4MYTA 1XB2A 3KKNA 5UKDA 2P65A 1R8SA 4FW9A 5G40A 4DEYA 2H8KA 4AD8A 2YZ2A 4PZLA 4TLBA 2QSZA 4PSVA 1GDDA 2VIIA 1CJTC 1IXRC 1CJKC 1XEWY 4LC0A 2O8CA 2FSHA 1NKTA 1KZGB 1L8QA 1OLOA 5JWRA 1KI8A 1E2EA 1CTQA 1M2OB 1E9DA 1NJGA 4DHEA 721PA 3V4RA 1HQCA 2H16A 1NVUQ 1T8TA 1FQKA 4W9MC 4Q4JB 1CBUA 4UXHA 4X8LA 5ANRB 1E2HA 3QE0A 3DMDA 3O47A 4KVAA 3BORA 2BHRA 2C98A 2AKAB 4FMDF 1N0WA 1DAEA 3I92A 5L8VA 4TL7A 1E0SA 1HURA 3AF3A 4B2IA 1VG0B 3B85A 1IJFA 2W00A 1J70A 2IWHA 3AVTA 3AEZA 3TIFA 4GT1A 1XD2B 1XX6A 1COWD 2N46A 2ZU6A 4YLGA 4PC2A 1EX6A 4GSYA 4LJ6A 4II7A 3RRMA 4Q4LA 4LHZA 1Y3AA 2QNRA 4FMCF 2HV8A 2IUUA 4KFUA 3HJNA 4MA4A 2GF0A 1W5TA 1BH2A 1SXJE 1W48A 2ZRHA 2QP3A 1UBGA 2XGJA 1JQLB 2IYQA 2VHUA 4GZMA 2IWRA 5B2ZA 1GKYA 4LOAA 2CHQA 2G1JA 1AM4D 3EPKA 1I2DA 1XF9A 4LWZA 2OUKA 2J9RA 4Q9IA 3UANA 1IY2A 2BM1A 5LB2A 1SVIA 3LA6A 3T35A 1FX0A 3OFND 1DTSA 3LBIA 5A0FA 3LXRA 2ZSAA 3SYKA 3SN6A 1PUJA 3RS5A 4BRWA 5EP1A 2JA1A 2W0MA 5FUYA 6Q21A 3ICQB 3HPRA 3Q8XB 5JRZA 2QQEA 4OK5A 2ZRBA 4F4IA 2WOOA 3CNLA 1D2NA 2PZGA 2RCNA 4HLCA 3B6EA 2QGNA 2WSSA 1P60A 1DG3A 4PHGA 4TLDA 5H70A 4ZKEA 4C0QC 3A4MA 1KOFA 2ZVQX 3EA5A 2VBCA 2WM9B 4LK2A 4P0TA 3WYAA 4B43A 3D6TB 4DB4A 4HLDA 3AM1A 1JR3E 2OAQ1 3QPVA 3QXHA 2ZI6A 3B9PA 2XNDD 2D62A 2WIBA 5FUWA 2GEVA 4HB3A 2OSBA 4XJXA 4JBXA 4EFLA 4B48A 2WWWA 3UWKA 3U6KA 4A9AA 5TV2A 1QHIA 4JIMA 4M4SA 3OEEA 4AIIA 4EPXA 1PJRA 4KYUA 1F2TB 3AB3A 1LNZA 2D2FA 3RYTC 2QT0A 3AGQA 3T5GA 5SZHB 3SQXA 1FUUA 1ZM3A 4PPFA 1WRBA 3T1VA 4MRPA 4EPVA 3P4YA 2X2EA 3LNCA 4C2UA 2ZR9A 2XOKA 1XXHB 3GLFE 1RE0A 1XP8A 3U7EB 2QE7D 2H18A 3EWAA 2VP6A 1KI4A 4F7WA 4CRWB 1TPZA 1S96A 4WBSA 1Q21A 2O8FB 2XZPA 5JI2E 1AS3A 4G5SA 4TMKA 5A5GA 1Q20A 421PA 1U0JA 1OH7A 4DXAA 2V4ZA 4E22A 5D3MA 5EE3A 4ERNA 4AY2A 3K1JA 4HEJA 1Q1ZA 2VP4A 1WA5A 1IXZA 3BS4A 1SKYB 1S3GA 5HR5A 4CT4B 2QMOA 2IYSA 4S2EA 2EWVA 5KSZA 1QHGA 3KJEA 5FR1A 3L0SA 4KXFB 1TUIA 2JLVA 2EQBA 3AVVA 1NY6A 1UPTA 2V54A 5BYJA 5TVKA 3ZZ0A 2VHQA 1SQ5A 3SJBA 1RJ9B 3DZ8A 3WBKA 1H8HD 2QY9A 3RLFA 4MYUA 5F2EA 1VIAA 3B60A 2ZEJA 1M7BA 1CR0A 1IONA 1OSNA 4HZUB 621PA 3FMIA 1ZMXA 4BWYA 3I4LA 3QKRA 4JSTA 5HPYB 1K5GA 4EAQA 5JJIA 1F2UB 5HKKA 3AUXA 1KSHA 1LB1B 1Z3IX 4PQYA 1FMLA 3ASYA 1PLLA 2PH1A 2F3RA 3AKCA 2FFAA 2O8EA 4M1YA 1G3QA 1C1YA 2XTZA 3X1WA 5FOWA 2Q3FA 2H5EA 4P4SB 4RFVA 1OIWA 1MABB 1SVSA 3C41J 3MAAC 4CF7A 5J4HA 1Q12A 3E5HA 1FTNA 4M1KA 1UADA 3ZZUA 2KI5A 2CE2X 5JMTA 4IRUB 4QJ5A 4RD1A 4NCIA 3HR7A 2D7CA 3KQKA 2WMNB 2JGNA 2C95A 2X19A 1CR2A 4JKYA 1MO4A 1ZNYA 2ZE8A 1SXJB 1X1SA 1ESNA 4LBVA 4U00A 2BEJA 4LHVA 1FNNA 3E70C 2B8TA 2GJSA 1BYIA 2MSDB 1M7GA 2VH5R 5KSOA 2F9MA 1Z6YA 1XD2A 3CH5A 2IYLD 5FTMA 4BFWA 4I1OA 3MWKA 1MRSA 2JDIA 4J0QA 1NG9A 4HB0A 1SVWA 3VKWA 2DBYA 5CK4A 4TSFA 4L4UA 4R71A 4BQSA 4KSBA 1Z6GA 4BE7B 1JR3D 5J40A 2V1XA 2FZLA 2R9VA 4ARZB 1UEJA 4F4JA 3GJ0A 2KSQA 1N6KA 2JEOA 3BAFA 4V0KA 1T8UA 4JL8A 2BVNA 1KI7A 1IHUA 1P72A 4JBYA 2XZOA 3AVQA 1R2QA 4D4KA 2BOVA 5LB4A 4LYAA 1NF3A 1AS2A 4M21A 4L9WA 2XXAA 1KY3A 1TF5A 3Q85A 2OCAA 1P4SA 1ESMA 3PVSA 2GHIA 2REBA 2AXNA 1V43A 2ERXA 2GEDA 5DHFA 1HE8B 5L3VA 3T61A 4BGDA 1G8GA 2G0NA 1LV7A 5LPNA 1E3MA 4LCBA 4PHHA 1OH5A 3L8YA 3A4NA 5FI0B 1E2MA 1LS1A 4HSEA 2KBEA 5HTKA 5SZIA 2Z0MA 2ZE6A 2Z43A 3THYA 1OXTA 2OEPA 2QT1A 4DDVA 1GOTA 1ZD8A 3CBQA 2IXEA 2AK2A 5BXQC 2OM2A 2V7QA 2YWEA 3WP1B 4Q7JB 1KK0A 2QL6A 1OB2A 3VR1A 5IHPA 3QG1A 1G6HA 1QHNA 1Z0JA 2CK3D 4K46A 1IXSB 2E87A 4EPWA 4TQUS 3ZH9B 4JLJA 3GJ3A 3L43A 3Q7PA 3EIHA 1KGDA 3KJGA 3UMRA 3KQLA 1PVOA 2IK8A 4PAOA 2IW3A 3I8XA 3Q5DA 3NXSA 2BMEA 4F4CA 2YOHA 2ZRKA 3EZ9A 3IQXA 1Z0IA 3K0FA 3MJRA 4QBGB 1DAHA 1P2SA 5CDFA 3BGWA 3KXIA 4ZI2A 5JLJA 3SFZA 1NN1A 3BJIC 2GJ8A 3GJ6A 5DGXA 1GL9B 4EPRA 5BN3A 1E6CA 5DNYB 2R6AA 2QPTA 2ZITA 4TT3A 5JRJA 3LRPA 2XTMA 3QIAA 2WKRA 3QEOA 5G41A 4GP6A 4DUGD 2UZIR 4AKHA 1P3JA 1TQ2A 2FDCA 1FW6A 4TN1A 3A8TA 3SJCA 4TYNA 2IYRA 2EFGA 5JS8A 1DARA 3G5UA 3NWJA 3WP0A 4ZDIA 1TF7A 2BBWA 3U3OA 1SGWA 1RJ9A 2Y8EA 4KFRA 4DVGA 3B1XA 4HYYA 521PA 2LKDA 1XD8A 2JLSA 5IT5A 4C30A 1SVKA 1W7AA 5FTJA 3TUJC 1TQ6A 1YR8A 3QXJA 3PEWA 4JLBA 4B6FA 1KK3A 5C18A 1W46A 2FGJA 4B3GA 121PA 1XMJA 4D0LB 2VHTA 1XCPA 1J90A 2JLYA 3K70B 2QBYA 3PUYA 3THXB 3AUYA 4DDTA 4QGAA 2GCOB 1ZP6A 2AL7A 3QKSB 5DYIA 2BMDA 1G8HA 5DI3B 2RGDA 1W0JD 2RGXA 4DLTA 4A15A 3KKMA 1P2UA 2CEAA 5G53C 2XX3A 1HT1E 3H86A 1IY1A 1WCV1 2AX4A 4CGZA 3TVTA 1ZJ6A 5AR1A 3I32A 4LC1A 4LBWA 3AVWA 2FPLA 3PEUA 2ZYVX 3CZPA 3W8RA 3I5YA 4N3NA 4QRHA 1G3RA 1ZIOA 2B92A 3P20A 1ZU4A 3CIOA 1TQ4A 1XMSA 4ASUD 3I61A 5FBLB 5KSPA 1BIFA 1CRQA 3CR7A 3OEHD 1S0UA 1T5IA 2QENA 5FBQB 4CW7A 2WJGA 1TF2A 4MDFA 1CRPA 2NOAA 4Q48A 5G3ZA 3SR0A 4JT4A 4A6XA 4TL9A 4M9ZA 4Z8XA 4NL4H 3SFVA 3WXMA 3H2YA 4D82A 1AZTA 2OBNA 2ZI3A 3PUXA 5E7IA 1LFDB 1G5PA 4EJSA 3SQWA 2KB0A 2DWPA 4TL8A 2Q0HA 2ZJAA 3U3KA 1N0UA 2J0UB 2EWWA 1VTKA 2R6GA 5FPTA 3TVDA 1G3UA 2CHGA 4CT5A 4UNQA 5DH9A 2WICA 2VYFA 3EZFA 5SZKB 1G41A 2EYQA 3T15A 1YHNA 4HZIA 4OHYA 4XTCS 2C78A 3F0TA 3NDPA 2RH5A 4RD3A 1KDPA 5GVSA 3ND8A 1KYIA 1RZ3A 3IQWA 3UK6A 3VX3A 5EQTA 2WWXA 4OHZA 4DCTA 4Q4HA 3BH0A 4A0GA 2Q3MA 4IXMA 4JLAA 1ONBA 3C8UA 1ZM2A 1XU4A 3H84A 4PO1A 4PQFA 2VSFA 2JJ1A 4RFSB 2QROA 1KI6A 2G3YA 3AQ4A 1P5ZB 4Q1FA 4MGYR 2GWHA 2F43A 2GZHA 4LI0A 5IK2D 2C96A 4LJ7A 4D81A 4TLEA 2DFNA 3THYB 2PZEA 5FOTA 5EE0A 5KTYA 3KX2A 1QHXA 4Q03A 1XCGB 2PLRA 2YVUA 3K9HA 1TU4A 2GXQA 3RNLA 2G0TA 1J2JA 3VR5A 2IYZA 3EASA 2R65A 4AC9A 4A1FA 2VO1A 4GBMA 2JLUA 2JATA 3UMSA 3ECCA 1GKIA 1U8YA 3EG5A 2ECKA 2J41A 2ZSDA 3TNFA 3IIJA 4LBYA 4G0NA 5KDLA 1KO4A 1ZUIA 4KCGA 1G4UR
chains in the Genus database with same CATH superfamily
4IDCA 4E5VA 2PZLA 2Q8PA 4XIGS 1R7RA 3G85A 3VR3A 2EP8A 4PYIA 2IT1A 2XDQB 3G89A 4IAOA 4PC1A 4D9IA 4JB0A 3TFOA 2BDTA 1SM4A 5LP6A 2X14A 3COSA 4U63A 1NE7A 4GOXA 1XFAA 3YASA 1XQYA 2XCSB 1HT0A 4LX8A 3ELDA 1LJ8A 1NHGA 5K51A 2Q3EA 3K9BA 2OUIA 2IS4A 1CQXA 1EFHA 2AHOA 3FSGD 3LX5A 5F1OA 2IIVA 1SPXA 4FFBA 4IJ5A 4TMXA 4QX6A 1KE1A 3N0XA 3TNLA 3I64A 2VZ9A 3RKUA 1KZYC 1MORA 1G6OA 1R12A 1MVOA 4UHJA 3JS5A 1GPKA 1K88A 3BERA 3VO1A 3MZ0A 4HBGA 5AI4A 1YK1A 4G0VA 2QS9A 2R1ZA 3C48A 3UA4A 5HFAA 5I9NA 4NWIA 3LBAA 3VO9A 1LY1A 1NSTA 1IMOA 4KBGA 4QGFA 3RJTA 4MDYA 4DRZA 1E9RA 3KBBA 1XU7A 4H6WA 3V9PA 5JALA 1PEKE 1SWWA 2R4UA 1MRNA 4E51A 4XPIA 1IZYA 4RZ3A 2GRAA 4OM7A 5J47A 1TA9A 2FP4B 2ZYTX 4MVCA 5FI1B 4DNQA 3W5BA 2X3UA 4RTSA 3BBPA 4D6XA 1U3GA 1ORTA 3RHZA 4C2TA 3DLPX 1UBKS 3FPEA 2XUKA 5I7FA 3EGCA 2ASEA 3C7DB 3HI4A 1V4BA 3OJEA 4ND7A 5DM70 1F1JA 1OIVA 3HCFA 2PKCA 1YIDA 3OY7A 2WQZA 3I2YX 2LCQA 2VJMA 3E7PA 4GX5A 1DOZA 1AUVA 4RTOA 4EG5A 1BEEA 4IDAA 5IF3A 1X39A 1SXJC 4GI1A 5CNMA 3PFWO 4UVHA 3HBLA 4U1RA 5K6AC 4JDPA 1E1YA 1E3DA 2JHGA 3O6VA 4LX0A 4BNIA 4MUAA 3FMGA 1F7VA 3Q7SA 4TQGA 4CQJA 1DWPA 4H60A 1M73E 1XTUA 4Q1AA 3WFJA 2CSXA 3VHQA 1PR5A 1BROA 3L8ZA 3FNHA 1BAPA 1NN3A 5DM4A 1KSJA 4K2HA 4FWIB 1LSSA 4FS8A 3ZWQA 3OJCA 4ZD6A 3IPAA 2C3UA 3CT4A 3R7WB 2JGIA 1LBIA 2P7HA 3NAMA 4IM7A 3SEAA 1V8DA 3DFZA 3RIYA 1X1EA 2BGNA 1E9EA 2H5JA 3Q0IA 1R4ZA 1LDEA 4U5XA 2E5LB 1RHQA 3RSCA 1MAWA 2FNAA 4UAGA 1OW3B 3UMGA 1PYOA 1XRQA 2EYUA 5FEMA 3AR2A 1EVLA 2GLTA 4CF4A 3KALA 1T3ZA 4AU1A 2FFQA 3FMFA 1SIBE 2ZRMA 4LK3A 3CEJA 3BFXA 4YMSA 5JFTA 1T1JA 2JVIA 4TUYA 5JAHA 2P2CA 3DT8A 1ACLA 5JWHA 4YRRA 2X8WA 5I47A 2EIHA 3IO3A 3RRJA 3ZHQA 4C5AA 4L76A 1SA0B 1XCBA 3JR7A 4KXYA 2QV0A 2AX3A 3EQZA 3PC2A 2IYOA 4HFJA 4AKGA 3FLMA 1QQBA 3GARA 3B13B 2BI4A 4N6NA 2CKMA 1DDOA 4D99A 3GFTA 2O7SA 2JLAA 5JCZA 3PS9A 1NRJB 1JEQA 3NDJA 2GM4A 1G6KA 3VNAA 1GNTA 5I48A 1LPNA 4X8HA 5JPCA 3EPPA 4FK8A 3R9XA 1JXMA 3DLTA 2OVBA 1J9EA 2PRJA 2VEOA 2Y1GA 2CVZA 4U6NA 3OC0A 4DCNA 3R0IA 5E1DA 2FW1A 4PF1A 1T4DA 2EGGA 4I6EA 4N3BA 4Q9LA 5AM4A 5GP1A 3C5VA 1XZNA 2HK9A 2PMEA 4YDRA 3MCTA 2WTUA 1WPXA 2NO4A 4WASA 4PS0A 5AK4A 4EY6A 2G6TA 2X77A 1VM6A 5E8JA 2OXRA 3QI2A 3GA7A 4NZMA 4B3DA 3QU4A 4QSMA 5IZCC 2ZQZA 3R23A 1ZHFA 4ML3A 4MS4A 4RFSA 5FJIA 2W70A 3OP1A 1EP1B 3RS8A 4BX3A 5MDHA 2PUJA 4IICA 3VHLB 4C3ZA 2ZSUA 4IVNA 1CT9A 4ZVNA 3ABQB 3JVIA 3HFGA 3ZPXA 3U9TA 4BNYA 1R5JA 4G0WA 2OK7A 4XJVA 4E4TA 1JHOA 1ZGJA 3UTDA 3H9EO 4BNLA 2DY1A 1U7UA 3D3NA 5FF9A 4AICA 1HDOA 3ZCXA 1L7NA 1KRHA 1PJ2A 1NPTO 3ONDA 4I4TA 5ALPA 4NXMB 1QRRA 4RK5A 3BA6A 1LLUA 5CT8A 1U9ZA 4AQDA 1V6SA 2CF6A 1HK7A 2B9EA 4GXRA 4YTEA 3UMMA 1DX6A 5BOSB 3T5MA 4HFMA 4I3FA 3KEOA 3U6BA 1I2CA 2BBOA 4NBNA 2OB1A 4ZXFA 2CJYA 3IXQA 4ENWA 1S7GA 3R3UA 5FIUA 4WAUA 1NN0A 1R0CA 2BY4A 4JGIA 5F9MA 5B4VA 2QMUA 1E79A 3LTEA 5AHWA 1J2YA 4UU0A 1W0KD 1Q0SA 4KPFC 3SZUA 2CDCA 4CEIA 4BGIA 5T3YA 7MHTA 3RHFA 3KZ1E 2ZJ6A 1FSFA 4P35A 5SZJA 2WUGA 4HEHA 4GZLA 1KEKA 5TSDA 1YZUA 1KK2A 2I6QA 3D5TA 4MUYA 1EUQA 4OQXA 1EXMA 3IBSA 1UPXA 1U2QA 5LP6F 1JEEA 2Q07A 2JKZA 4FDVA 4MARA 1K63A 2NT4A 2OB2A 3T9EA 4BWFB 5B58C 1XVIA 2XE8A 1KYZA 4RGVA 2JANA 3RT9A 3L4SO 5AJHA 2VP0A 2Z08A 4ENUA 1KAGA 4OJNA 1KBOA 4DQDA 2OFXA 2J0UA 1EFDN 1U2DA 2R00C 1MEEA 2PWZA 1IBMB 3H3FA 2G40A 5JSHA 1ELOA 3ABSB 1RYDA 3GT0A 4K8OA 3TXYA 3BSYA 4RACA 4LNUA 5AO9A 4O4IB 4YRMA 1JU4A 4QUBA 3EIFA 2ZBPA 3K1AA 3PNPA 3SYMA 4BP1A 1JMKC 2B7CA 3CV3A 3U0VA 2I65A 5JG7A 2ISQA 4X8MA 4XPIB 2P41A 5DHSA 3UKJA 3CVXA 4LRUA 1E1DA 4BNGA 3L6EA 2BEWA 4F6RA 3KHTA 2MINA 2NQ8A 5IYZF 1Q3KA 1RWPA 1D2GA 5K0FA 1IJEA 2B61A 2GN1A 2J3LA 1LDNA 1IIRA 5CEJA 1KVSA 1VMDA 1GM5A 3ZWVA 3BB4A 5DXAA 1WY7A 2I34A 1XZIA 5E7JA 1X3LA 3TRHA 1E1RD 1KVTA 1SCAA 1K2VN 1PEDA 2AZMA 1AF7A 3TEJA 5TS3A 5DYWA 4ZAVA 4EHLA 3H11B 4JODA 1C0IA 4C07A 2NVUB 2Z1MA 3QX9A 2ONZA 2F43B 3A6HA 2VDJA 2DEUA 1USWA 3A28A 3S5JA 2I1LA 3IE2A 3I9OA 5NLLA 1XP5A 3IODA 2OKGA 4IDEA 4OXNA 4DADA 1T0BA 4B1FA 5JAOA 5TF4A 1HMYA 2QUAA 4JHXA 2DTEA 4N5HX 4P4UA 3RBZA 5CBKA 3K8ZA 2Z2ZA 2O8CB 1M8KA 2V7BA 1NZDA 2Z04A 2BGKA 1NTRA 3G9TA 4I50B 1UAAA 2VPPA 2P75A 1L4MA 3EVTA 4MDEA 4CTMA 3EOZA 5EGSA 4FXPA 1Z5VA 1Y42X 4YRFA 3ZQ6A 2QY6A 3HUDA 4ND2A 1G8FA 4IPTA 4NYJR 4V1CI 3GRCA 4QHSA 4XR9A 3WZ2A 1YS9A 1IRXA 2P9CA 3CUKA 3ZDCA 2ACEA 2WHRA 2ZWIA 1ZD9A 1C7QA 2XF8A 1XDZA 4MAMA 4OQ4A 3JQFC 2Q27A 1H8ED 4CFYA 1YCGA 1LQ2A 2EP7A 3C3JA 3DV9A 3HHEA 1BN7A 5JBNA 2OGZA 4I7EA 4JLPA 1D6MA 1G20A 2M9MA 3I0NA 1KZ7B 1OYOA 3QA9A 3S68A 2CYAA 4HF7A 1KZHA 4M49A 4ALNA 4PCVA 1JTFA 3VAAA 3D8NA 5IT4A 1CUSA 2BDUA 3H8VA 3WA7A 2XMGA 4IOMA 5CT4A 2QL9A 5DIFA 3SI7A 3MHTA 3TK1A 1DL5A 2BL4A 3R09A 1U0BB 1CUIA 2OCGA 1HE2A 1S9HA 2VUUA 3QWHA 4MQ6A 4EVSA 3P0IA 4UAVA 1XWFA 1XQVA 2I2FA 3SQMA 1GUZA 5HUHA 4Y9DA 1ZGHA 1U65A 2ZUDA 4C0HA 1IAQA 4IYRA 5TARA 3UFBA 3UOAB 3GDOA 1KYVA 1TLLA 4CM7A 1VPTA 4Z2YA 5B1YA 2ZE5A 3DMTC 1EMDA 2KQUA 4EF4A 1H2WA 1ISHA 2RHDA 4Q9DA 1E2IA 1RAEA 2C57A 1K75A 2QD2A 2H7YA 3IBYA 4DWVA 2RHWA 3L0BA 4P08A 3FWYA 4J0KA 3FUTA 4G25A 3C3MA 1GT91 3AR4A 3DR3A 4HHEA 4MVJH 4RSHA 3ZVNA 3LW7A 1VHLA 3WFZA 4C03A 5HYVA 2P3QA 4TM8A 1GAXA 2R4QA 1IQRA 1A4RA 2Y1FA 5KYYA 4HAOA 1L4UA 5JECA 1NXWA 1MR3F 4NOKA 1D5WA 4V39A 3I23A 3KC2A 1JW9B 4PLHA 1GFSA 1J7KA 3OTGA 4ON9A 2B82A 1WB4A 2V8OA 3OBBA 3PE3A 4QFMA 4ZYZA 1ZWKA 2MT9A 1F3OA 2Q1XA 3TR0A 3BXXA 1DT5A 4BAUA 4NYIQ 5CJPA 3LUJA 3FBTA 3CU5A 4FQ5A 1P0CA 3L4BC 4MGIR 2X0RA 1RPTA 1DO0A 4UDXX 5FPHA 1CQPA 5F1YA 3WLIA 4C1NA 3K9LA 5I9IA 2R6HA 1O5TA 5B4UA 2UUOA 2PZ8A 3DCIA 1FFYA 1CVRA 1GPNA 3LOQA 1NG1A 1K6MA 4B76A 5KDDA 1N33B 4LDQA 9MHTA 4EVQA 1F7UA 4QTUB 4BNVA 5L51A 1XEFA 3B3JA 2YWRA 1CJMA 4NECA 4OFBA 4YQZA 3LT2A 4H9GA 4OL0A 3UA3A 4CN8A 1YO6A 1RYNA 3EVZA 5CA1F 3OH8A 4CCYB 2IP1A 4RZ2A 2ZUUA 2REOA 3I76A 5L45A 1VE6A 2OFFA 4ZI5A 2GA8A 3N8NA 4QSHA 2VP5A 5JADA 1R18A 3AV3A 4RLHA 3WLSA 3PXUA 3BYZA 5F3DA 3WWYA 5CB6A 1FVHA 4QYXA 1ZJZA 1L4YA 5JDCC 5G4KB 1UBLS 2AFHA 2V58A 1IM2A 3B1FA 3TDNA 3PHJA 3CMMA 1HORA 1RVDA 3BRWD 4ZRDA 1QXSA 4I55F 5TIIA 3VA7A 5L53A 1Y5NA 2G6BA 2J9ZB 4HS9A 4I8DA 4NFYA 4WKPA 4NJOA 2FSVC 2YJNA 4JUAA 4N7RA 1TGVA 2VDRB 3Q88A 3TXAA 3OD1A 3EEFA 1HKHA 2HCBA 1JWBB 1U90A 2GARA 3CKKA 3U56A 2YWGA 2DU8A 1ZJYA 4FX2A 1R0SA 4F6RB 1RAFA 1LD3A 3VR4A 5E2BA 3WLKX 4B79A 4BV2A 3JQFA 4ER5A 1T4GA 2GTHA 1X3SA 1A76A 2OCBA 2C83A 3NYWA 5C3MA 2XSZD 1JVNA 3R5SA 3ZQKA 5IWCA 4KAFA 1W4LA 1YR7A 4NMLA 1XCMA 4FGZA 1EK0A 3AI3A 3OIDA 1U2RA 2P2ZA 4N0EA 2Z3VA 3TW8B 1Q91A 4U2BA 4EFDA 3G8AA 2RHOA 1BD4A 2FR8C 1SBCA 4XDZA 3WB1A 4ZIRB 1I4WA 5AD1A 4RW0A 4F96A 1NLUA 3VZRA 4QGBA 1I6LA 4ZVQA 4AX4A 2O0KA 3F5DA 4NDNE 1ESZA 2HSEA 1P1IA 2DULA 2E37A 5KNCA 3C5EA 4RHCA 4HI0E 4C78A 3QKTA 2PH5A 1N6PA 2ZRGA 3H17A 4PRZA 5BWLA 1Z5OA 4IZIA 1T2EA 1AK1A 2PR2A 2AG1A 3TKYA 2BGMA 2DYKA 4UC0A 4P4SA 1XYVA 5KBYA 2ZUFA 1X9IA 1E66A 2ILVA 1E2QA 2QUHA 3TLJA 1K4YA 1TU3A 1GNRA 2BFBA 3B3GA 4QC2A 3HLTA 5DGCA 4KQ2A 5GIOE 3FZEA 4LMBA 1CFJA 5IC5A 5IKXA 2V4MA 4UAJA 5LZ5A 3ADOA 5E7MA 3INRA 1GL3A 1MNQA 3AVXA 1J0DA 1N2BA 3VR2D 5BNWA 2JJQA 2QUZA 4PZUA 4Y0VA 4ZFNA 3H5NA 2D4AA 4X85A 3IV7A 1D8AA 4K9OA 3QXSA 5JSZB 3PGVA 3L2OB 1DNPA 1E62A 1WMEA 4XSHA 4LQ4A 1V41E 4OMDA 1WWKA 1F0KA 3A6DA 3CO0S 3N70A 3N3BC 4L4RA 1X8LA 4IIYA 4LYYA 4PNHA 4YP0A 3BDAA 3UB4A 4Q1BA 2HF8A 4ZRMA 1XZMA 1C2YA 1KAEA 2GQ0A 3NTLA 1T8YA 4UUNA 1MOSA 4WT7A 2A2ZA 2P9FA 4PSCA 1R5BA 3WDMA 3ZTTA 4CV3A 3U3XA 1EGHA 4IJKA 2PL5A 2A1TR 1H42A 3OPNA 1E77A 4Q1CA 5JCOA 1LC3A 3S27A 3AOEC 1TJ5A 4PFSA 4EX7A 1UBHS 5FFMA 4BUZA 2EVWX 5I4BA 2XVAA 2NZWA 5FUVA 1MB3A 4CLRA 2RH4A 4ZU1X 4GLBA 3COVA 1GGEA 1KXJA 3LXXA 4E15A 5JH7B 1GUYA 3ADCA 5AVOA 3M3DA 1X1AA 1PVVA 2JJ1D 1IRIA 2QYSA 4XYBA 2XADA 4EYQA 1ZS9A 2QTLA 2NWQA 1Z82A 3EH2A 2NXEA 5CVCA 2YRXA 5DZSA 3QU7A 5A1JA 3H5IA 3M49A 3QKRB 4N7BA 1QANA 4EUNA 1AF4A 3PI7A 1NT4A 3BKXA 1YE8A 1BJTA 2DLNA 4E4RA 4R98A 2WT9A 5BMVB 2WEKA 1U0HC 1RC1A 1G5TA 3R5KA 1NFQA 2Q1TA 3HU2A 3DM9B 3FCAA 2XKJE 4M1MA 1AKUA 3HJHA 4IOLA 2C2KA 2XY4A 4J91A 5DRYA 1UDRA 2IUSA 2VBIA 4QOFA 4C0BA 4EJ6A 3KUDA 1IBKB 2XVYA 4K40A 2IDZA 3TQFA 4HXEB 4G24A 4BVLA 4HC4A 3PTAA 5FLEX 4WLEA 2PT5A 2OVFA 3LY5A 4FDAA 4R9NA 4B8YA 4EUEA 4QEZA 2HW8A 1BMDA 1M34B 2FZ5A 1EUYA 4ROSA 1LDGA 2HLHA 3E8XA 3ML1A 4BP9A 5AVUA 1JEYA 2OD2A 1LSJA 4IV0A 1CY8A 4IVPA 3MM4A 4N5DA 2G88A 2A33A 1CUXA 1JDSA 1KKLA 2ZRQA 4BFXA 1HXHA 1KU0A 3R0JA 2ZI5A 1CJUC 4G5GA 4B6GA 3D2LA 1A69A 1WB6A 1DQRA 5HJ2A 3I2IA 4GC5A 1W2WB 1Q15A 2P2YA 3AFMA 3MWYW 4RPGA 1UKCA 1T9ZA 2DFTA 4CMHA 4F04A 1P2VA 4Z3KA 1JLLB 4WSOA 4W5HA 5AUOB 1Z56C 1JG2A 4HXFB 3PDUA 4HUJA 2G72A 3DOUA 4M54A 1HPLA 2ZWOA 4JYBA 2W71A 4XIJA 3DNPA 4DM7A 1T8RA 4ETNA 1BRMA 3GZ4A 4HXYA 1GU7A 3GT4A 4IKOA 3AVUA 4BMXA 3KCNA 4P34A 3C14C 2HRCA 1LQUA 1IDN1 5GOZA 3L7OA 5C0OE 3OEYA 4R1OA 4AS1A 4DSNA 2A35A 1GKUB 2D1RA 5KHOC 2C8VA 1T2CA 5CEFA 2PSEA 2B35A 1HYEA 1SRQA 5T4FA 2VK4A 3C24A 3SZMA 3TTWA 3BF7A 4N3AA 4YYZA 4Z7QB 1ANKA 3UIEA 5IUKC 2I6UA 3W2IA 3WI7A 1YS7A 3R6WA 4H18A 2O2IA 4OOEA 5CFZA 4QM6A 4C2BA 1T3LA 1YOBA 1CUEA 2FEOA 4YJKA 4YUYA 5BXYA 3U4DA 4UHCA 3E84A 3TDMA 3WBJA 2W8BB 3ZY4A 1QOQB 2FUEA 4KMSA 4EG7A 1JPJA 4HNQA 4O4JA 2Q6VA 2OHXA 1SXGA 3THWA 2NZ2A 4QPNA 4IKPA 1NQUA 5FO0A 2Z2JA 1PF7E 3GNLA 3WSVA 4RX1A 1MB0A 2QBYB 1GFZA 2HK8A 3DBRA 4ZRNA 3MTJA 4JSYA 3HBMA 2OV6A 4DA4A 3DMGA 1QIGA 2VJOA 4CEJA 1M2WA 4GEGA 4JASB 4Q4AB 4EUKA 3WLFA 3N2NA 3GLFA 3H3JA 2VDQB 3D7LA 1IG0A 4UXJA 2PZAA 4LGYA 4BCDA 2PPLA 3M1AA 4D9MA 2BFBB 1IAVA 3PA6A 4PPQA 4TWZA 1W4BA 4M99A 1YJQA 2W2KB 1T2UA 3E9CA 4DE5A 3T7TA 1WB9A 4DWWA 1WUYA 2CXQA 1YDEA 5CLGA 3DQZA 1YZNA 4ITRC 1MJGM 1Z73A 2C2HA 2I87A 2GN9A 2G1UA 2UVDA 3MOIA 3OFSA 3WISA 4C3UA 1YTLA 4PFKA 4DYVA 4EKIA 5BT9A 1N36B 1I9CA 2DUMA 2G82A 2Y99A 4NARA 4QRIA 1PQPA 2RGYA 3K0AA 3WX0A 3HO8A 1RM4A 1J00A 1JECA 3ANNA 4A0SA 2XD4A 3QLTA 1KL7A 2AEJA 1O0BA 1E1QD 2NO9A 5KNLA 2H1FA 3UT5B 4HLUA 3KTDA 5DO9A 1YZGA 5DP1A 2XKAA 5KEIA 1E4VA 2F3TA 4MIOA 4E6PA 3WYNA 2OZEA 5AM3A 5CIYA 3ZD6A 2AE1A 4TYMA 1G7RA 4OI2A 1GPMA 4RDIA 4XYGA 1R10A 2HGSA 3BFKA 3IAXA 1Y5IA 2FK7A 3CRQA 4DHWA 3ASUA 3LO5A 5EMKA 1MZVA 5FLKA 3LPMA 3PEFA 5K3EA 4KFSA 4MAFA 3OZCA 3CLVA 3CNNA 5C8XA 2Q6OA 4MLZA 5IANA 4Q1DA 4G65A 2FMFA 5AQ1A 4MGHA 1SBNE 2OGTA 2BFEA 4MITA 4RK7A 5EL0A 1EDBA 1EQAA 4JL6A 4QXQA 3L8EA 4E2FA 4PC3A 3BMOA 2XOKD 1RYHA 3OJXA 5L95A 1X0VA 2Z6AA 1JSXA 2JIDA 1JPUA 3TZEA 4E1VA 3ASZA 2A7XA 3FM9A 3MCUA 4JT8A 3IT0A 1JWLA 3S40A 1OYWA 3DDHA 2O7QA 2XZTA 4RLFA 5ALWA 1KI6B 1V8FA 3PPXA 4NCKA 3TSCA 3VPDA 1MU0A 1P7WA 1N5RA 1YRBA 3CSUA 4OXKA 1YKGA 2RK3A 2AFIB 2HYDA 3PFIA 2WYUA 2ZT8A 3MGCA 5EQFA 5CA0A 5B7NA 4Z0TA 1JHRA 2GPBA 3PYMA 1NJSA 5FNVA 1FQWA 1XA4A 3OLZA 5DI3A 3VVMA 3H75A 3AR9A 1YU6A 3HEMA 1D2MA 4M1SA 2BHSA 3JYLA 4PX3A 3JCZA 1E9FA 2QW8A 2JIBA 3NI2A 3VR5D 2F55A 2NT3A 4DCUA 3R0QA 1W76A 3HU3A 3R5HA 3I9NA 1ZEJA 2A1IA 2IHKA 4HB4A 4Q4JA 3FUUA 1VRCA 2GEFA 2Y68A 5AJZA 3X1XA 1ZEMA 2RJNA 4TL6A 1XZAA 4TS4A 1Z8NA 2OPHA 2W0SA 2O14A 1TQDA 3M81A 5I7VA 1H0HA 3GGOA 2YFYA 4D2IA 5K09A 5EWLA 4XWWA 1IHYA 1MC4A 3U3MA 4DT1A 3L0YA 3S1AB 1FSZA 5J58A 1FJ2A 2IYYA 4BE9A 4P0QB 1R6TA 2G5PA 4R0NA 4RJIA 3FOZA 4PVCA 3NBQA 1Z2AA 1ECJA 1PP4A 1RWKA 2VQDA 4YJ2F 4Z6KA 1QMPA 1TIPA 2FE1A 2CVPA 5A0VA 2PSDA 3THOA 2BGJA 4INJA 5A9TA 3U0BA 1FX1A 1U63A 4I55A 3PR1A 3G2KA 3HSSA 1JHMA 1V0JA 1PR9A 2PXAA 4L2IA 4MICA 4HGPA 4PX5A 2WJZB 3OUZA 3ZXSA 4CM4A 4D43A 1Y63A 2B98A 2WIGA 4AY5A 3WWZA 4F9TA 1LRLA 1I5EA 1HH4A 3RJZA 1LPSA 1NBHA 5EJ2A 3SNHA 5IU6A 5CD1A 5DSZA 3FETA 2F00A 4FR0A 1CZRA 1GYRA 4JUBA 5K45A 1IN5A 1B76A 5IAJA 1Z62A 2PLFA 2IXGA 3P94A 4L3OA 1SCIA 2HCJB 4DDMA 4LYFA 2ENWA 3HVUA 3NTXA 4RPLA 1OF1A 1DKNA 2DBVO 5BORA 4A2WA 4XOUA 2B1RA 2GAIA 1L7MA 2UAGA 3PCXA 2WJ4A 3NEAA 1SCBA 3QWIA 1OV4A 4TRNA 5F78A 2XQJA 3RGGA 5B3AA 4PN7A 3MELA 3WVNA 2B30A 1WCYA 4B9EA 3EN0A 2CV0A 1Z74A 4PM4A 1Z4IA 3INGA 2WWFA 4UM7A 4R2JA 1QH0A 2QM8A 3M7IA 3PVZA 2JFYA 4L8YA 2O1EA 1Y6RA 3GPIA 5CJ2A 2IS2A 3GEPA 2VJPA 1AURA 3AVPA 3BCSA 4WNAA 3QV2A 1NONA 3V34A 3EYWA 4DXDA 1USGA 1GZ3A 4AN4A 3DZKA 1KERA 2C84A 5C1DA 2GAOA 1SVLA 4EG1A 3CH7A 1LW7A 1W87A 4ACAA 5KNBA 4FJ0A 2FWRA 4ITVA 1L5LA 4NPAA 1HSZA 1XK6A 1E5LA 2XA9A 3C3EA 4KO2S 1HDZA 4WNCA 1ULUA 3M83A 4WERA 1IWBB 3SC4A 5IAKA 3OX4A 2D4HA 3DMHA 4WOCA 2GZRA 2W98A 3L1UA 4PZ9A 5JYEA 1NW9B 3IEPA 1IMJA 2RKOA 2V55B 5D01A 5ESRA 4LA4A 2C5EA 2J6HA 4BZXA 3BBLA 3DZFA 3ZJ5A 3D0KA 5T57A 1QRDA 2PUDA 1SZPA 5J5CA 4QREA 3S5UA 4AP6A 5ADHA 2ZVJA 1QG0A 4CI9A 3NHLA 1YJ8A 1LNSA 2GMWA 4AL4A 2BFNA 2OBFA 4QDJA 4AZWA 3O82A 2ZAIA 4FGLA 3U4AA 5CH8A 1F0PA 4XE5A 1DRKA 5COAA 3SHFA 1YB6A 4QBFA 1RWBA 5FWAA 1ZNWA 1XNRB 1RS0A 1QYWA 3VNSA 4U6SA 4C0XA 2NGRA 3CLHA 4BJ5A 1RXWA 5CLLA 2ZTUA 4OQDA 3O9MA 1E2PA 2C9ZA 3KL4A 4YDHB 3Q1LA 3SG0A 3V33A 4BDSA 3Q98A 4ZGWA 1P5RA 2WHXA 4JUCA 1QJ4A 3ZLVA 2VKQA 3L8MA 3PTZA 4KNVA 3H16A 3TX2A 4B7CA 2GXAA 4LHWA 4RD2A 1A4XA 4BKUA 3R9WA 5HIMA 4YCMA 4UKDA 3ZI7A 2A7QA 1FFWA 1EBUA 1JHXA 5EERA 1P29A 2R66A 3DAGA 3R7FA 1J8MF 1PL8A 3R6LA 1XRJA 4Z1MD 3UAVA 1T9BA 2H11A 1ZW1A 1E8MA 2G8LA 2QRPA 2YHUA 1RYZA 1SHKA 4FONA 2LXNA 3E03A 2C5LA 3FFXA 3LX6A 3QBJA 4XEHA 1GNQA 2C9CA 4WI1A 3RABA 1S3IA 1YCHA 5CM2Z 1TTTA 3FLEA 1O8CA 1V7ZA 2GCNA 2QLNA 1N1GA 2ZSFA 3BIJA 2YOFA 3AF2A 3ISJA 3OETA 4TTJA 3S2GA 5HG0A 3VDNB 4A2PA 3CUYA 3LMKA 4B47A 2C92A 4M0UA 2OA0A 3DLAA 2GRUA 1WXDA 4F60A 1BS1A 2QXUA 2Z57A 3B6MA 1C81A 3RK1A 5HCUA 1M8FA 2FWIA 3M6XA 3W5AA 3IDQA 3RC8A 4OD0A 2FPGA 2GAJA 3G3EA 1Y7IA 2AFIA 3A1EA 1WY5A 2FI1A 3W6ZA 1DBIA 2J0SA 1V8PA 2AD1A 2WHPA 3HWSA 3SX4A 2GEBA 3UJHA 1J2EA 2NPIA 4FZ5A 3WIEA 4OYHA 2VS1A 5B6JA 2MWMA 4ARBA 2O8DB 2RGCA 3KKKA 4LV6A 1YRHA 3FIJA 3M89A 4AKTA 2P7IA 3C6KA 3J7AC 1K7FB 4PLPA 1NVXQ 2YHSA 3DFUA 1ZNXA 3GR6A 4Q9HA 5EIBD 3ZD7A 5CDSA 4RK6A 5K0BA 1JEOA 1GRRA 3RIXA 1G5QA 4Y2SA 1QYDA 3D0OA 3IO5A 4DSZA 4IP0A 2C5BA 4QGGA 4KTTE 3F3SA 5T6BA 3W3AA 4ZT7A 1EFRD 1JG6A 3LPNA 4Z5XA 1URPA 2AOUA 2WZBA 5DM60 2V6BA 2UZ0A 3KJQA 3QKWA 4RD4A 3IQZA 3QLUC 4H2DA 4FINA 1K68A 1QZTA 2F3QA 5EFZA 2XCTB 3NBUA 1EJBA 3ZCTA 1RXSA 1NC3A 5E2AA 3FYUA 4RY9A 1VKOA 1XTJA 2W4IA 3EOBI 3GX1A 4ZCMA 5DN6D 4QEDA 2JD2A 1UF9A 4WXRA 1GGVA 5CLIA 4D8WA 2I1WA 5CUQA 2R5FA 3VU9A 5BN5B 4MCIA 1G1MA 3MUFA 2ZI7A 1D2EA 4Z0PA 4DR4B 2EQAA 2G04A 5IDQA 1NMQA 1X1DA 4MINA 3ZS8A 1E0AA 2G9ZA 3WNDA 1JJAA 2P8JA 1F60A 1Z15A 3A6KA 3C5WP 3PRKE 2JLCA 1BHSA 2BP7B 3FPKA 1JXAA 4J2TA 4R31A 4FNAA 2GK6A 3O7MA 2AZDA 4TXHA 3ISVA 3ZY3A 3ELUA 4M1TA 1J2RA 3MJFA 1BDMA 1RJDA 2VT6A 2YVAA 3OTWA 4ZOBA 1SG6A 1M2HA 1YVDA 1Y6JA 4GUDA 4G5XA 5DGIA 2A0YA 1ZD4A 5CLFA 4S1NA 3JRXA 4GZ6A 3GEBA 3RVBA 1U3VA 1UKAA 4FS3A 1LBHA 2ZJYA 4H17A 5K5EA 2NO7A 1WOYA 1FUIA 1U0SY 3CINA 2EZ9A 1TT5B 3F3KA 3IUJA 3QV1A 3R8XA 3WDKA 4WJLA 4F4FA 3TJMA 1DBQA 3P19A 1ONPA 3BWBA 2NPOA 3OMXA 5A4IS 2QQ5A 3LL7A 3FDJA 1LW6E 3GLGB 3LSYA 2NVWA 4EY3A 5K4HA 2PEZA 1N0VC 2A14A 2ZT5A 4YACA 5FX2A 3CYFA 3GNQA 2Q1UA 1XAGA 1R0WA 3TKLA 4TWJA 4RTLA 1NUSA 4BVFA 2X0EA 4HDCA 2IEGA 5DEOA 3UKOA 5JO9A 2BFFA 4Y1RB 3EXG2 2W6QA 4U7TB 5AK5A 4EKEA 2QTCA 1RCFA 4X95A 1GRQA 1NVWQ 4XDYA 5C7IO 1RBZA 1WBDA 3EOAI 4PLZA 3S4YA 3Q3GE 4KR3A 1KDTA 1Y3DE 2I6XA 3OTHA 2VJAA 4M89A 1E2LA 3FKSA 1VSBA 3ZDYB 1I3LA 1B93A 2AR0A 2H1IA 4J90A 3EFOA 1ZC3A 2PQ6A 3BD8A 1GUBA 1YB2A 3ZV4A 5CFMA 4N82A 4B7AA 3K0HA 4QT0A 4JI3B 4ZZ1A 2O2SA 1EVIA 1TIKA 1V1RA 2O2XA 5FUBA 1BGWA 4YH1A 1DIGA 4QG3A 4KPYA 4KQFA 2D3TA 3OIVA 4TXNA 2V8BA 1YR9A 2XDAA 1P2GA 1QKIA 1ZX1A 4JI8B 1S2DA 5DGHA 2WF8A 4RH1A 4D7AA 5A6SA 1ABFA 2HXGA 5J59A 4LRQA 3F8TA 1TKAA 2GF2A 1RRCA 3ZX4A 4AG5A 4BKPA 4E5UA 2IE8A 5ECYA 3LLMA 1IHOA 3IEIA 5EZ6B 4GX2A 3VBCA 5JMPA 4L7VA 4J7UA 4R0VA 1Z33A 5DCUA 3HRIA 2M1XA 3KWFA 3AUTA 2YC2C 3GLUA 3N0RA 3ZLUA 1CULC 4TWAA 2GESA 4I1IA 2WABA 4GS5A 4ZVLA 2VZ0A 3LE8A 5H1YA 1AMUA 2FUCA 3EFBA 1P9NA 4WY8A 3O2JA 4LY3A 4O4LB 3VYUB 1YKFA 1Z06A 3KAQA 4KO4S 4ZQCB 3WL3A 3GVPA 1K7XB 1U9YA 3ST7A 3VO8A 2A84A 2ODTX 2JZOA 1B43A 4OSEA 1T29A 2ADOA 2ATCA 1G8PA 2LR0A 4JS0A 3TCKA 1XT6A 3CPJB 3KEMA 1EAYA 2BWJA 2FEKA 5C51B 2B94A 4C0AC 4DRYA 5IULC 1KC3A 3L5OA 2O3QA 1R6UA 3QEAZ 4K81B 3VKGA 3KJIA 2VF4X 4B40A 5GONA 2RGNC 1YU9A 3K73O 3ND9A 4AMGA 3VMMA 1E20A 1M5UA 1YB4A 5KVSA 1GTL1 2I4OA 1SURA 2JAWA 4BDTA 2ZPAA 1UBOS 1PQYA 5G02A 2XNKA 2HX1A 4RHUA 1QU3A 2G9VA 3E53A 4XYEA 5PNTA 4BJHB 1MQ8B 4C29A 5BSUA 4BUJA 5IJ0A 3JVEA 1II8A 1NBEA 3V4OA 3IP9A 4J0IA 4US1R 4YCNA 2ETVA 3LPLA 1J1ZA 2CNDA 2BEKA 3DE7X 2ZJBA 2J67A 3GP5A 4RD6A 5I3CA 2PKWA 2YNMA 3NHBA 3EGEA 1EDEA 3P97A 3AUKA 4JX9A 4MV0A 1C7RA 4PHFA 1TEVA 1U4NA 3CUSA 1VP9A 1UPFA 1Y3CE 1MA0A 1YHZA 2RH8A 3DDCA 2Z58A 1QVWA 5SICE 3V2GA 4YMHA 5KOHB 2R62A 2VLBA 3C4QA 1U8AA 3E35A 2EFEB 3WHIA 4ZK2A 5C4MA 1EP3B 3ETLA 4QDKA 5ILQA 1B8PA 2P9EA 2VJBA 4E3ZA 3MMZA 1LK0A 4MV9A 1NBWB 3RTBA 1Z29A 3PNBA 2J9XB 1XMIA 4HDQB 3U44B 1SUEA 3RVSA 3N0TA 2KM1A 1EFKA 1DAOA 2RI1A 4TKZA 4QBTA 3VSCA 4HNVA 5KWJA 3K9GA 3IHKA 1EZZA 2PSJA 1F2VA 1Q1QA 3ND5A 2V45A 5BN5A 1GGKA 3AFIA 3PENA 3NJ4A 3A1UA 1W9HA 2CB0A 2J5XA 2X1HA 2VRWA 1E6LA 4NATA 3CRZA 4C43A 4EPYA 4YCSA 2JIZD 3FZQA 4FZRA 5DHQA 4Z49A 1U8EA 2IXDA 1GGMA 1OWOA 3NOQA 3G0HA 2VHYA 1SC1A 1AE1A 1UOEA 3G2LA 3I2KA 1KMIY 4Y1GA 4PV7A 4TLCA 1XQWA 3OQMA 4LTMA 4B3TB 4BTVA 5FTWA 3IR5A 5H16A 3SVLA 4JQSA 3QOWA 4BCCA 2YXLA 1C4OA 5JXGA 5K8TA 4IWYA 4B09A 3G9XA 2FH5B 3CF4A 4R83A 2E18A 3EVCA 1HLDA 1Q6ZA 4U3JB 1NR7A 1U7TA 1ZVKA 1Q83A 1HRKA 1M74A 2P9JA 4TSFD 3BD6A 2IPXA 4EEZA 4DA9A 3NHAA 3QEMA 3KJFA 1RRFA 2W7TA 1P4HA 4RVGA 2ODBA 2WWTA 3K4PA 4OU5A 1H6BA 2FPOA 4A4DA 3TECE 3URKA 2Q4DA 4YRLA 2ZQ5A 3MWGA 3OU6A 3EDQA 2D13A 3CURA 4Z7NB 4KITB 5K7SA 1YACA 2QR3A 3MJ4A 1W581 2HB6A 2Y1DA 3G7SA 3P32A 4OQQA 3ZYCA 1HEUA 2VPTA 2HJGA 3TMAA 4PFJA 1FTWA 2TMKA 4OHWA 3ZV5A 1DTWA 5DOZA 2PGLA 3UJ7A 4F6LA 4U5QA 1AHNA 1YGYA 4KWEA 4Q19A 1GT6A 4ZAXA 5J3JA 4IV8A 4B4OA 4YJGB 2BFDA 2J1LA 3LYUA 1EIWA 1K08A 1BKYA 2JKVA 4IYJA 1QNFA 1W47A 1Q17A 4LOKA 3PGXA 1D5CA 2NUTA 5FTNA 4N41A 4BLOA 3MWLA 4EW2A 1QONA 4DEXA 1D4OA 3M5CA 2YS6A 1UODA 4B8WA