1TPZA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
402
structure length
395
Chain Sequence
b'NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLKLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interferon-inducible GTPase
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 147
structure length 395
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tpzA02
4WZAE 1E9FA 4B2IA 3RDPA 4B44A 4GSYA 2BEKA 4DJTA 1T8UA 3GP8A 1P2SA 1G9XA 1KMQA 4Q9KA 4PSKA 1FNNA 2YC2C 4QXAA 4D0LB 5JI2E 3HYRA 4Q9IA 3WHKA 2QN6A 3FDIA 4IDPA 4Q00A 2J1LA 1CF4A 1F6BA 1FFHA 4HB4A 3K0EA 3AF0A 5IHPA 1FMLA 5IK2D 2YOFA 3E2IA 4MRVA 4XTRA 1AQYA 3GJ8A 4DRZA 4B34A 4X8OA 4QBHA 2JJ2D 2ZI7A 4LC0A 1NMYA 3L2OB 1I4DD 2JIZA 1ZM9A 1HT2E 3BIFA 5JJIA 1DAKA 1Q3HA 4O2RA 4HB3A 1NN5A 2EWVA 2FSHA 4TMXA 1G8HA 2A9KA 2DWQA 1ANKA 4L15A 4JVSB 3RS2A 3RSLA 3K53A 4ASUD 1GDDA 5AJXA 4E03A 4OK3A 1G8FA 2OFWA 3NBYC 4B71A 2W2VA 5KSZA 3SC3A 4CEHA 4A9AA 1MRNA 1P9WA 1RPZA 1U98A 2OFOA 1VG8A 3IIKA 1V5WA 2QY9A 2W6ID 3SBEA 3MD0A 1DO0A 1VMAA 3TE6A 3RS7A 4RZXA 1TF5A 2F55A 1RC8A 2CL6X 1XCPA 4Q4JB 4JVNA 5FPYA 3VR5A 4QJ3A 5JEDA 1IN6A 5FOWA 4OJKA 1TAGA 3QPWA 3MMPA 3VX3A 3OEED 4OI0A 1Q20A 2OAQ1 3VNVA 2R6GA 1IN7A 5C4GB 2UZ3A 3GMTA 1XCGB 2O0JA 5KDLA 5J40A 1FPMA 3FFBA 4E22A 1T4GA 4NKRA 4M53A 2ZSFA 4M1KA 2CVHA 2VIIA 3ZD7A 1CR4A 1G18A 4PXAA 3K0CA 1P4SA 2R2AA 5CYPA 1KYIA 4DSOA 5L3VA 3R8CA 2OUKA 2BBOA 5JRZA 2FFAA 4Z8YA 2J0SA 4RFSB 1J8YF 4YMWA 3FMPB 1XEFA 1FTNA 4GPTA 5AUPB 4PQRA 1OYYA 1R0YA 3AUYA 3BE4A 5FH9A 521PA 3GLGE 4NDZA 3B1ZA 4BGDA 1N6KA 1JPJA 4TT3A 3LRPA 3D31A 3CKLA 5TVKA 4ITRC 5J4YA 3SYKA 1PLJA 1R5OA 2JLQA 2LKCA 1KO1A 4BLPA 5GJVC 4F7WA 3AF3A 2QNRA 2XZOA 2LWIA 4M1YA 5FTKA 2BMJA 4BEJA 3D8BA 2B8WA 1XEXA 4MKGA 1JEEA 1VG9B 4HAYA 3K9GA 1E2JA 1KY2A 4JLVA 3VQTA 2HT1A 3I92A 1NLZA 4DEYA 3KKMA 3C14C 1QHHB 1ZNYA 3F8TA 3BJIC 3OF5A 4G5RA 5J4HA 1FL9A 1O3YA 3RHFA 3QQ5A 2C2HA 5FL7D 4DKXA 3T34A 5FBQB 1VYVA 2RB4A 1P2TA 3BERA 1IN4A 1Z63A 1Q1ZA 3B7GA 4AWXA 4B6FA 4NCJA 4BFSA 1DEKA 4R7ZA 1P61B 5EE5B 3THXB 4FIDA 4AY2A 3RRZA 4EPTA 1WA5A 2ZM5A 3KTAA 3U7GA 2QTFA 4Q19A 3A1VA 2ONJA 1UPTA 3AQ4A 4EPXA 1G6OA 4W9MC 1Z8FA 3K0SA 1XD8A 2J45A 2IF0A 3U3RA 5HKKD 3BRWD 2QENA 3GJ6A 3QENA 2VO1A 1C4OA 4RKFA 4QNMA 4V0MA 4M0LA 1G7TA 4ZIRB 3LX5A 1SKQA 1AKEA 1J70A 3EA0A 5EXSA 5EXTA 2GZAA 1KMHB 1ZIOA 2BOVA 2WIAA 2YC4C 1OIWA 3B78A 3CNNA 3NC0C 4UNSA 4EDHA 5E3HA 1UF9A 2G9NA 3U60B 3VR4A 1KI6B 3WYGA 4QFMA 2OZEA 3V9PA 1IXZA 3OESA 2Z4RA 4LHXA 2IBMA 4MQBA 1U0HC 2DWOA 2D06A 4MRSA 2X19A 1YZLA 4I99A 1G21E 2VEDA 3PITA 3TK1A 5C1BA 1F2UB 4WBSA 1OIXA 3PUYA 3SNHA 3HU1A 1IN8A 5CK5A 4BWYA 2YOGA 2ZU6A 3W3AA 2CK3A 2X2EA 3P32A 5IT5A 1D9XA 2ZUDA 2GTPA 3EC2A 4JKYA 3VR2A 3NHBA 1JXMA 1Z28A 1TQDA 2R44A 1YQTA 3K0AA 3LW7A 3TR0A 3P26A 1HE8B 4Q4AA 2FDCA 4DLUA 2ORIA 2XGJA 2RGEA 4TYYA 4JBYA 5CITA 4AG5A 4D81A 3ZQ6A 1L8QA 3ND8A 3QKRA 1PLKA 4MUBA 2XNSA 2FGKA 4ERNA 1P60A 3T5GA 1KOFA 1TQ4A 2XNDA 4JBWA 4Q1AA 4RD3A 4FINA 4TMKA 2YJTD 2WJJA 1MR3F 1OHHA 2RAPA 3UPUA 1YZGA 4IFBA 4IOJA 4XVQA 1PLLA 5D3MA 3GPLA 2D2FA 3QE0A 4P4TA 3MRSA 1T91A 1OKKA 3SYNA 4E5UA 2EW1A 4NCHA 3EIQA 1IY1A 2VH5R 3CW2A 4CEIB 4EPWA 1KO4A 1DAEA 1YR8A 4Q1BA 1X6VA 1E9EA 2P3SA 3CWZA 1RW4A 1ODFA 2IWRA 2UVQA 4JL8A 1GL6A 3KQNA 3UWOA 1P62B 5EE0A 3ZZUA 1KDRA 2A5YB 1E0AA 1JQLB 4XOIA 4KHZA 2IS4A 4C0AC 4LPSA 1SXJA 4G01B 4X8HA 1COWD 5CLLA 3TVDA 2OCPA 2QE7D 1FZQA 2RH5A 4KXFB 4CVNA 5TV2A 2BKUA 2DBYA 1S8FA 1CJMA 4GRAA 4OI2A 2ZI5A 3SYLA 3QF4A 3HU3A 3RWOA 3B5JA 2CHQA 2F9LA 5JWHA 2AFIE 4F4IA 3MFYA 2H5EA 3A1SA 2IW3A 4D4MA 2ZR7A 4B32A 2QUZA 3ETLA 2EQBA 2F3TA 4RD6A 1YZUA 2J87A 4YC7A 5EUQB 4BEBA 2C8VA 1KTVA 1MT0A 1NBMD 3K09A 4MUAA 2YWGA 1OXUA 2C9YA 3UKDA 4D82A 1M74A 2HF8A 4MRNA 2V7QD 2CHVA 2JLZA 4TQAA 2FSGA 3DDCA 3FTQA 2JCSA 4TL6A 5HCNA 2A5FA 4LHYA 1DVRA 1GL7A 2G77B 1RIFA 3TBKA 3THWB 3UMSA 4MDFA 2QMOA 3GCGA 3RRNA 2QAGC 2CE7A 2WJIA 1QG4A 1WP9A 2ZU0C 5LB4A 3U6BA 1T0HB 4TL7A 3CRRA 1E2MA 1AK2A 1W2GA 1JB1A 1A2KC 3AKCA 2IS6A 4JL5A 4Q7KA 3ADCA 5FTLA 4C2TA 3K0FB 2GJ8A 4R2IA 4XWKA 1FUUA 1ZIPA 3NBFA 1ZM7A 4CEHB 2ZJAA 2GRJA 3RS3A 2BMFA 2JIZD 1Q1EA 1N6IA 4LBVA 4TLAA 2O0KA 3U6KA 2FZ4A 4M9QA 2RGBA 5AWFC 1KSGA 5GADl 1Q1QA 4I1SA 3AUXA 2GZDA 3GJ3A 1KDTA 2F1IA 3U3KA 3EZ9A 1G4AE 5CK4A 4WOPA 5JS8A 4EUNA 4MYCA 3VU9B 2R9VA 1JAHA 2D3WA 2IF2A 4ACBA 1XP8A 2BBTA 1Z6YA 2CNWA 3TUIC 2XTZA 1II8A 3L82B 3WBJA 3B2EA 4DLXA 1W36C 3TSWA 2QPAA 1E9RA 1W49A 4KAXA 5J47A 3L0IB 3QJYA 4OQMA 1JAIA 4C3ZA 2ECKA 3B1XA 1AS3A 3A6PC 1QBKC 1Z2CA 1U0JA 1KDPA 2ZJYA 3IBYA 3QI2A 1QG2A 2FV8A 3SHFA 3W8NA 4KODA 3IDQA 4OJQA 1XJ0A 1ZU4A 1LW7A 4NCNA 1S3GA 3NBXX 5FI1B 2XZLA 5L8VA 1E2DA 2JASA 1R0WA 4JLMA 2G3YA 2QAGB 4URZR 2RGAA 3KKPA 1V43A 2ZRCA 2QSYA 4HAZA 2FU5C 1TUIA 2FPMA 3WBKA 1SKYB 3DHWC 3W3ZB 1IJFA 4NYJR 4NH0A 2QT0A 1HEIA 3FVQA 2Q9CA 2IUTA 4AYWA 1MKYA 2D4HA 1H8HA 1ZNZA 1OF1A 3H1TA 4C0HA 1DE0A 2GBLA 2XJ9A 2J41A 3W5IA 2P5SA 1FX0A 1LFDB 2JLSA 4I81A 4LHZA 5BW8A 4QRHA 3BB4A 2WKRA 4V0LA 1HURA 3IO5A 4NL4H 4Q4JA 2JLVA 4OYHA 3ADKA 5AUQA 4PO8A 1W0KA 1NVVQ 5SZHB 2NQ2C 1XEWX 4EFLA 2OFXA 2ZE6A 1NSTA 4BFTA 2IYUA 4GBMA 4B3DA 2ZRFA 5D3QA 2WSSD 3QG5A 2EFHB 3WY9A 1AGRA 1XPUA 2PT7A 4LHWA 2EWWA 2YZ2A 5JCPA 4WW0A 1WF3A 1DPFA 1M8PA 4PPQA 1EFTA 3VFDA 5HE9A 3EZ2A 1E1RA 3ZZ0A 2X2FA 3U4QB 4G5SA 2W58A 4YLGA 3IQWA 1U0LA 2CE2X 2GK6A 2GWHA 3U2QA 1OV4A 4RFSA 1XTIA 1Z0JA 1T3SA 2ZRAA 1S1CA 3Q7QA 4FW9A 3KTAB 2CJWB 1JPNA 2W2XA 3EASA 4V0KA 4IW3B 1RE0A 2RGGA 2WKPA 2V1XA 4I1OA 4S2EA 4IVPA 1TPZA 3A4MA 3LWNA 2ERYA 3TH5A 3CH4B 3CF2A 3THYB 3PJRA 4RD4A 1OW3B 4HLDA 2W6JA 1HY3A 2ZRDA 3Q5DA 2QGZA 1I2MA 4FXPA 4JT2A 2A7QA 4NYIR 2FEMA 3HR7A 421PA 4D25A 2BM0A 2WWGA 3FMFA 3GLHE 4AIIA 3CF6R 1XXHB 1JJ7A 2YV5A 1L4UA 1CJUC 1YVDA 4DLTA 2IYXA 3SJCA 4A15A 3C8UA 3Q72A 4XJXA 1W5SA 2RHMA 5EZ5A 2Y8EA 4RD2A 4EIWA 4DIDA 3DZ8A 4DWJA 1XZQA 3U3JA 2GESA 3ASZA 2D62A 3KFXA 2ZJBA 4QM6A 1N6OA 3ZVNA 5C18A 2P6UA 1TX4B 2CVFA 2O52A 2CCJA 4A92A 1I4TD 3HP1A 5HKKA 5EJEA 1E0SA 1UBCA 2MMCA 1Z47A 1U9IC 4XWAA 2ZR0A 4OQXA 2D7DA 1ZMXA 5GJWC 1BYUA 3THXA 4H1VA 4Q4HB 4LJ4A 4O0MA 1W47A 4JLPA 4Q4AB 4B33A 3RS0A 3TW4A 1DG1G 2EFEB 8OHMA 4OQLA 3QEOA 2AFHE 3QKRB 2VL7A 4LYAA 4X8MA 1K5DA 1KK1A 3IUYA 4IEIA 3SS8A 4RKEA 3R9WA 3FKQA 1T5IA 1UKVY 4BRWA 2WWXA 2CK3D 4A6XA 2WZQA 2BBWA 2QRZA 4Z54A 4ZIRA 2YINC 2EVWX 2P67A 1XTSA 1KMHA 1M7HA 3BH7A 3SI7A 4R98A 4HI0E 5GVRA 2MSCB 5FL3A 2XTMA 2ZSBA 1NSFA 4JYBA 3FGNA 2ZRNA 5DISB 4TYWA 4MYHA 1DAGA 2QM8A 1K6MA 1XD9A 2OBLA 2R6CA 3QKSB 4LC1A 3WP0A 3SDZA 5HR5A 2P2LA 2XNDD 4B3GA 1EFUA 1G3RA 3BC1A 3R7WA 3GJ7A 3EXAA 1AZSC 1PJRA 1QVRA 2BKEA 3L8ZA 2GEDA 1OHHD 2OCAA 1Q22A 3KJHA 2XJ4A 2BEJA 4JLNA 2ONKA 1IQPA 2CLSA 4O2LA 3HU2A 4Q7LA 3QF7A 1OKKD 4CZ2A 1OFIA 1T3HA 1US8B 2V3CC 1X1SA 1KSJA 1LS1A 2GXQA 5KHOC 3AVYA 3KQUA 2JJ8A 3UWKA 3N5CA 3QXHA 3S1AB 1U90A 4KFUA 2FH5B 4DSUA 3QF4B 3IPXA 1CXZA 1KO5A 4KSBA 4DBLC 3KQKA 1PV4A 2GDJA 5TMPA 4B48A 4II7A 1XMSA 4EQ6B 3DZDA 1W4AA 1SXJD 1CRQA 2RGCA 2VPPA 3LVQE 3NH6A 4CT4B 2WSMA 4KITB 5FTNA 1XTKA 3CNLA 2CMKA 4XIGS 1NN0A 4OHVA 1II9A 4LDJA 1ZINA 1ONBA 2HJVA 3EIHA 3T15A 2DYKA 5FUWA 3RS5A 1COWA 3Q3JB 2QE7A 2D2EA 1E98A 1SGWA 2VSOA 5FOXA 2P6RA 2ZRJA 4XVRA 3KXIA 3N2EA 4OK6A 2JJ1A 1W2HA 2BBSA 5CB8A 3GQBA 5A5GA 2VYFA 3LX8A 4G5GA 5KTYA 5DGXA 4Q02A 2IYWA 1MO4A 2H17A 2NGRA 4BLRA 1DAFA 4P4UA 3BD9A 4PSVA 4UNRA 4DCVA 5AUOB 1KKMA 1HQYE 5F2EA 3LA6A 2PX3A 2JLXA 1BS1A 1R0XA 2ZE8A 4LYHA 4B3CA 2XX3A 3A1WA 1XEWY 3SFZA 3FYHA 3R9IA 2PH1A 1MABA 2HT6A 3IBGA 1NKTA 3QSYA 2E1RA 4TSFA 5FPKA 121PA 3P1JA 5AK0A 5JJLA 5KPDA 4Z1MD 3RS4A 3N70A 3TRFA 3CZPA 2MMGA 3T06B 1GSIA 4IEEA 1DS6A 1L4YA 1T8TA 3PENA 4C30A 1X8LA 4YONB 3CIOA 1IONA 5JJKA 4XSGA 1II8B 1ZM2A 2HXYA 3SJZA 4ACAA 4OQFA 3BBPA 3HWSA 5HE8A 4LK2A 5JSZA 2AKAB 4JS0A 4MGZR 3CB4A 3T12A 4TYPA 2G0NA 2Z83A 3IILA 5EE9A 2IA5A 4TL8A 1RJ9B 3P4XA 2RHDA 3TW8B 4Q4LA 3THWA 3HR8A 2NIPA 3AVPA 3K1JA 3TSOA 4C9BA 4CRWB 4BLQA 2J0QA 2IL1A 2IYVA 2CNWD 4IXMA 1VCIA 3JZAA 4A0FA 2V6JA 1EWRA 3LQRA 3LO5A 1G19A 1N5KA 4I1VA 1E9AA 1KZ7B 2ODWA 4LI0A 2R62A 2DB3A 3K0FA 3W34A 5EXPA 1Z2AA 1U2RA 4B43A 2XOKA 2CBZA 5JBQA 1OH7A 3ZGXA 3QY0A 3TQCA 5DIFA 4CF7A 1FX0B 1GNQA 2YWEA 2LCFA 2KBEA 2JLUA 2J7PA 3BOSA 3QG1A 2GXSA 3VU9A 5E4FA 2GILA 3RC3A 3FPAA 3JZMA 2V6IA 2OT3B 3TQFA 1E4VA 1ZU5A 1CRPA 4A0RA 1HYQA 1KKLA 4PZLA 3WYFA 5FTJA 3VHXA 1SHZA 1H8HD 4NP6A 4B75A 2RGDA 1P75A 3QBTA 1XZPA 4QNRA 1SVWA 1EX7A 2E87A 2FFHA 2JLRA 3LD9A 2XEXA 5FBWB 1J2JA 1XTRA 3KKNA 4O25A 4OHXA 3ND9A 3KUCA 3ZIAA 4PO1A 2FG5A 2ZVPX 5KDDA 2FN4A 4WXRA 3Q5EA 2BV3A 4DT1B 1W0KD 4L9WA 3MJRA 1R0ZA 4V02A 1KJZA 2QAGA 4J0QA 1VCMA 1R8QA 1OXVA 2QAJA 2GCNA 3NG1A 5CJPA 4A8JC 3KX2A 4B2PA 2QA5A 4BZQA 3VNUA 1M6NA 1F5NA 2PX0A 5B58C 5SZKB 2X1VA 1Q1BA 3EWSA 3C5HA 3GJ4A 4CYMA 2BJVA 1EFRD 5AJYA 1E32A 4UNQA 1GRQA 3U3MA 2G88A 2WSSA 5JWRA 1UFQA 3JVUA 2HV8A 3CM0A 1E1RD 4QBFA 1XTJA 4HAUA 1JQJC 4N0EA 3G5UA 4D4KA 4URVR 1OH6A 4BFZA 2XXAB 4W7SA 5IF9A 1T9HA 4M4SA 4ARZB 5JMTA 1G8PA 3CPJB 2JDIA 1NY5A 2R6DA 5KYKA 4DB4A 3AF1A 3KKQA 3L0PA 4TN1A 3VKHA 3MWYW 1NVXQ 2VLIA 5G41A 1KK2A 1G5PA 2BJWA 4JVMA 1P9RA 2O0HA 3OAAA 1ZC4A 2OHFA 1EFHA 4HZIA 2LKDA 5B57C 4G1UC 3PUWA 4F93B 5TY0A 3CRVA 2HDNB 4KYIB 1E94E 1R5NA 1W4CA 1OB5A 4EAQA 2HCBA 3BFVA 2ZRBA 1EG7A 4ZV4A 1G20E 2W6JD 4Q47A 3PUZA 1I2DA 1UEIA 3U4QA 2Q3FA 3AKYA 3W8RA 1OJLA 2F1RA 2QT1A 4M9XA 4BASA 4TL9A 4PPNA 2Q3MA 3ZVLA 5JHGB 3UK6A 2IXGA 4A8JB 1JR3A 4OK5A 3X2SA 1CIPA 1Z22A 1NRJB 1ZNXA 1NBME 2VHJA 2FWRA 1BKDR 3GD7A 4S35A 2CJWA 4GMDA 3VR1A 4YDHB 5UKDA 2JAQA 4C0KA 2O8BA 2I4IA 2WTUA 3LY5A 3WNBA 1YR9A 4TTQA 4DIEA 1LS6A 1PVOA 2VTKA 2N42A 4LJ8A 1VPLA 3THYA 2UZIR 3M1IA 4DLRA 5IDVA 3V4RA 2V4ZA 2F3RA 2ZIAA 1CR0A 2REBA 1LY1A 2R65A 1GRNA 1VCNA 4FMCF 1XXHA 2Z43A 5L3QA 1GNPA 2ZJ5A 4PX9A 4JKIA 1X3SA 2OXCA 4Q03A 1Z5ZA 3FHOA 2QQ0A 5EP4A 4HUQB 4KFSA 3K9NA 4JIMA 3D6TB 4UXHA 4PC2A 2CCGA 4B47A 4AKEA 1KSFX 1J8MF 2QM7A 2AL7A 3I5XA 1CLUA 3R7WB 1N5IA 4WZBE 3GFTA 1LB1B 3IEUA 1E9BA 1E9SA 4Q9JA 2W00A 1OT3A 4YMUA 1ESMA 4LY6A 3C16C 3RVBA 4UNPA 3DM9B 1E4YA 4FWTA 1JNYA 2Q9AA 4C0QC 4AD8A 1WDTA 3CZQA 3QXXA 4NE2A 1UKZA 3BFXA 4Q66C 1M7GA 1W48A 2PCJA 4KBGA 1BO6A 4Q4HA 3LFUA 4CEJB 1YR7A 3FKSD 2GEUA 3MWKA 2NO9A 1QZXA 3AVUA 4W5HA 2FGJA 4Q1FA 2GKSA 3EPLA 4PQFA 3B9QA 4GOJA 1DAMA 2OG2A 4Q1EA 3O8BA 3P27A 1GP2A 2DY1A 1GTVA 5K8TA 5DNYB 4DLSA 2C98A 5F9HA 2V1UA 2AK2A 4IDNA 3O8DA 1N0VC 3GFOA 2YYZA 5CM9C 4JLAA 5B2ZA 5CYOA 4R2HA 4US0R 2PZEA 4CT5A 1P7CA 4M1WA 3GLGB 3W9YA 3A8TA 2IS2A 5JS7A 3DEFA 2V54A 5DYGA 3K8YA 4M21A 4QJ4A 2IYRA 2Q0HA 2YWFA 4JJZA 2GAOA 1YR6A 2Z5FA 2XB2A 2ASEA 1NIPA 2WJGA 3QKSA 2PCLA 2NO1A 4WXPA 1LNZA 2GZHA 3FHTA 821PA 5EP3A 1SVKA 1NJFA 2NOAA 3NIBA 3U7EB 1Z07A 3OZXA 4PC7A 1ZJ6A 2ZJOA 3AGPA 2XITA 1AN0A 4JYCA 4OHZA 1FP7A 1R6BX 2OLJA 1GRRA 1Q57A 4NPHA 3WRXC 1SKYE 1US8A 2OESA 4OI4A 2B8TA 2O8DA 1MABB 1U9IA 2ZI6A 1G64A 3DO6A 2EYQA 3AVOA 3ZZTA 2CL7X 3OIUA 4D4LA 2V9PA 3NTUA 2YNMA 3S1AA 3T61A 3HPRA 1N0WA 2QTHA 2WWFA 2QROA 3H84A 1SULA 3NBZC 2G1KA 4UKDA 1OXXK 2PJRA 3RANA 1Q3TA 3GEIA 2JJ1D 3MWJA 4KFRA 1N6NA 4HATA 1ELOA 3H2YA 3T1OA 1SZPA 4MGKR 5FUVA 2J5XA 4QGHA 4TLEA 1QHGA 2KBFA 1HUQA 4ZCLA 3W6NA 4EQ6A 1WBDA 3VKGA 5FOTA 3H86A 4YDSA 5TDHA 3KUDA 2VRWA 3QIAA 1G8YA 3U5ZB 1FNMA 2B92A 3GLFB 4TSFD 4UNNA 4UQOA 1E2LA 1ZBDA 5JSZB 3PUXA 2WIBA 2O8CB 1S3SA 4ZCIA 5C4MA 2QP4A 4DZZA 3LV8A 1XWIA 2A3RA 1TNDA 3C15C 5BN5A 3B82A 5L3RA 1IAQA 1E79A 1ETUA 2QI9C 1ZP6A 3BORA 1A7JA 4Z1MA 3KJEA 3PVSA 4B3FX 1EK0A 4RZUA 4WAUA 1EESA 1QHNA 3F0TA 3B6EA 2IXEA 1Z0AA 1EFCA 2C99A 1ZUHA 2PEZA 3AVXA 1KNQA 4KV9A 5G40A 4ABYA 3J81k 5BWMA 4NONA 1RVDA 5FR2A 3GLIB 4DEXA 1A5TA 3OE7A 1JI0A 1JECA 3EPJA 2OBNA 1GILA 4BE7B 5L3SA 4XH9B 1LF0A 2R8RA 1Q21A 1P6XA 1TEXA 1OIVA 2OV2A 2ZE5A 3ASYA 4G5QA 3U7HB 1A2BA 3TAHA 4E09A 1E2PA 2ZS7A 3MSXA 4PHHA 3IHWA 3TUJC 1OLOA 1OXTA 4B2LA 4A0HA 4BQSA 3SQWA 4Y0AA 3I72A 1L7VC 4DCUA 2IXFA 4C7OB 4ILEA 3VMFA 1VCOA 4NCIA 2VP2A 4BFVA 5FBVB 1F60A 2UKDA 1P2UA 4G5OA 3SHWA 2ODNA 2H92A 3OIVA 2VF8A 3BH0A 1IBRA 4FMCB 5CM8B 2AD5A 1DARA 2O8EA 2FA9A 3A58B 4V0ME 4BLOA 1KI3A 1KJYA 4F4CA 1XX6A 5J4KA 2XOKD 2BCGY 2WWIA 1W7AA 4Y0VA 5HZHA 4DDVA 3MWLA 4MDEA 5P21A 2G83A 2J46A 5CJ2A 1SVSA 1RJ9A 2QQEA 1W0JD 4M1OA 4WIAA 4CIDA 1CEEA 4V0OA 2J7PD 1UDWA 1UAAA 4AKHA 4US1R 4LRWA 5BXQC 1UM8A 2CXXA 2FFBA 1GUAA 3PEYA 5H70A 2GCOA 1WCV1 1ZNWA 4TLBA 1NP6A 2HLDD 1A82A 1N6RA 2CEAA 2KSQA 3X1ZA 3V4FA 2XAUA 2GK7A 2J59A 4ZDWA 3KZ1E 3ZIAD 1Q0UA 2IX3A 1G4UR 5CDFA 2F1HA 2FNAA 3BXZA 5DHFA 3GJ5A 3SJBA 4GMXA 4R71A 4A4DA 1YRBA 2OM2A 1D2NA 3SZRA 3P20A 4DSNA 4R9UC 1HT1E 1YE8A 3CUEF 3NVAA 3FFAA 2D7CA 1P2VA 3PFIA 3KXKA 3KB1A 3MJHA 3O8RA 1XFAA 3THOA 4DCSA 1ZCAA 1TTTA 2OILA 1Y63A 2NZJA 4NYMQ 2QEQA 3ADDA 2IYYA 1VIYA 1E9CA 4L8GA 1W36B 4RZ3A 1XU4A 3EAQA 4DLYA 3B1WA 4GP6A 2WJYA 4OHWA 5KNBA 3AVTA 1CU1A 3AVWA 4QHTA 1VTKA 1EFRA 4WA7A 1F2TB 1XJCA 3LQQA 2JLYA 1H8EA 4JLDA 4DT1A 1XJQA 2WWHA 2IYTA 2JDID 4FMBB 1GKIA 3LAWA 2ATXA 3IO3A 3ZVRA 2ZSEA 3KJGA 3MUFA 5E7JA 1W36D 2CL0X 3FOZA 4CDGA 3OAAD 2X77A 2HF9A 1YHNA 3QVVA 3ZYCA 3SJAA 2NG1A 1SXJE 2G1JA 2HCJB 1YZTA 1B23P 4QBGB 4EJSC 2C04A 4TTRA 2ZXUA 3EX7C 2GF9A 2ZI3A 2BMDA 2JEOA 2NO7A 4B74A 2VP9A 1XTQA 2G0TA 3CBQA 2O8BB 2OLKA 3WP1B 1MO3A 1GAJA 3FWYA 2P0EA 4P32A 2BIFA 3F3YA 4TTPA 2XXAA 4PZZA 2FOLA 2WMNB 2ZROA 4A82A 1JR3D 4ARZA 3T1VA 1CR2A 1TADA 5FOSA 1RYHA 3NKVA 2ODBA 5M04A 4C0BA 3CX7A 4DHEA 5L3QB 5F9FA 4BRUA 2WBLC 2WOJA 1NJGA 2OO7A 4PO9A 4JLOA 2A78A 3VAAA 2VHTA 4IDOA 3TR5A 1K5GA 1XPRA 2A5GA 1RYFA 2BCJQ 3SR0A 1HH4A 3WRYC 1OYWA 1RRFA 4XVUA 2V8OA 3MCAA 4NCKA 2RMKA 3ICQB 4LBWA 2WPDA 4LBZA 5EE3A 1IN5A 1AS0A 2GNOA 5AJZA 1DBSA 3H4MA 2VSFA 2C77A 5DN6A 3WMFA 1AM4D 1S9DA 3AP2A 5E95A 1S96A 4LJAA 1NL3A 4A8JA 5CIWA 3U44A 1GOTA 3F5FA 3UMFA 1SVMA 4GZMA 1DADA 3V00A 3I61A 1A4RA 1XMVA 2YWHA 3HYTA 5B30A 4L9SA 1DO2A 1P72A 1I4LD 4DDWA 3PQCA 4U5XA 2B6HA 4AC9A 3B8HA 4H9GA 2CLCX 5JLJA 1E96A 1ZUNB 4LBYA 2OBMA 4KI0A 1RZ3A 1CTQA 1NI3A 1E2QA 3X1YA 1JJVA 2IYQA 1TQ2A 3U61B 4ZDIA 3IEVA 1E0JA 1KI8A 4ZI3A 2HXSA 4KCGA 4LJ6A 4QC2A 2EU8A 5BQ5A 2VHQA 4HAXA 2C96A 2NPFA 1GL9B 5KPJA 3EC1A 2FPLA 2H16A 4AURA 2X8AA 4TZ0A 4PR0A 4RVCA 3ZH9B 2DR3A 2GA8A 3BFKA 3LDAA 5KNDA 4HUQA 2QMEA 2OAP1 5DI9A 1KDOA 4YMSA 3UIEA 5DE3A 2ZITA 1LV7A 1XF9A 2NZ8A 3FKSA 4M1TA 4BLTA 2QRNA 5DO9A 2BMEA 2F6RA 1FTSA 4FMDB 4DLZA 5SZIA 1VKJA 2A5JA 3SE0A 4LYJA 4M22A 4NTZA 4PPGA 1E2GA 3DKPA 2GEVA 1SVIA 2ZS8A 2O8DB 5J4LA 1EXMA 2ORWA 2VP4A 3JVVA 4LJ7A 4BFUA 1ESNA 4NMMA 3NWJA 1KK0A 2GETA 1DELA 4CEJA 1LTQA 2VBCA 1EX6A 5CDFE 2YVUA 5AR1A 1XD2A 4A2QA 1ZD9A 4MRPA 2WHXA 4AYXA 5J4VA 1M34E 4MRRA 4Z51A 3TAUA 3MAAC 2A30A 1VDZA 4L16A 3K9HA 4IJMA 4Q9LA 1AKYA 1VG1A 1KO7A 3BB3A 4LJ9A 4PAQA 3B13B 2AWOA 5TXGA 2AXPA 1QHSA 3E70C 2ATVA 3CNOA 3LH5A 3GLGA 3NEJA 4X8LA 4QHSA 3QXSA 1OH5A 1JALA 5BYKA 4TYQA 2WAYA 2YOHA 2D74A 3BS4A 3M6AA 3Q7PA 4L5BA 4AKGA 2PT5A 1BMFA 2IYZA 1NN3A 5H1YA 4GT1A 4LPKA 3BWDD 4MH0R 1KHTA 1NVVR 1YKSA 2ZJ2A 3EARA 3NH9A 4QM7A 4P0TA 3OFNA 3I3SR 5L3SB 3KKOA 1HTWA 1T5LA 4IRUB 3ZS9A 1DTSA 2QPTA 2PL3A 4UXJA 1GWNA 1LF5A 1W5TA 5JHHB 5KU1A 2QPOA 1G3MA 4HSEA 3LBNA 2W0SA 3WXMA 5JFGA 1E79D 3KXLA 1XNJA 1HQCA 4QJ5A 1W1WA 1Z0FA 1F3OA 4YMTA 1WBBA 4CGZA 1E1QA 1S0UA 2WOOA 1F48A 2C03A 3TVTA 1R8SA 3R8FA 4QOSA 4KVGA 1RRGA 3RAPR 3UANA 4GZLA 1TUEA 3I8SA 3B85A 4LGMA 2NO6A 3OE7D 3WYAA 1XDBA 3LVRE 5TB5A 2IS1A 1KI7A 1ZC3A 3KJIA 4K46A 2HYDA 4H1UA 4KLNA 4PAMA 4D4JA 2O8EB 4DLWA 4ZDJA 3GLFA 2O8CA 4QGAA 1E99A 4Z8XA 1PUIA 3VX4A 1VG0B 3L0OA 2AXNA 4LCBA 4JBXA 5CIQA 3I62A 1KSHA 4GOXA 5FUXA 4P4SB 1ZUIA 4MYUA 2OSBA 2ERXA 4OBEA 2O8FA 4F91B 1X1RA 1BYIA 1Z3IX 3K9LA 5JEEA 1IHUA 3FB4A 3LLMA 5EQTA 2GCOB 3GLIA 4BFYA 4IOLA 5BN3A 2ZYVX 4TMZA 3RWMB 1N6HA 1CKEA 2KJQA 1Z08A 1HA3A 2JATA 2IYLD 1WB9A 1XB2A 4JLBA 1B0UA 1M2OB 1N0UA 4HLCA 3D3QA 1Z0IA 3ZS8A 3ZLJA 4JSTA 3HJNA 1DAHA 4HLUC 2A5DA 3QPVA 1R2QA 2GVZC 3OEHA 4C7OA 3MLEA 4YMVA 1J99A 221PA 5A4JA 1W0JA 3VTKA 1AA9A 1R7RA 4QHYA 4HAWA 2PZFA 2I1VB 2FPKA 5C46F 3E1SA 1BOFA 3QNUA 4KJZA 2C95A 1RKBA 4B35A 1MV5A 3AP3A 2AHOA 1NMXA 4Q5IA 3I8XA 4UXIA 1ZAKA 2XB4A 3T1QA 2HLDA 3MGCA 2W83A 1QHYA 2C9CA 4U02A 1KK3A 2HJGA 1E2EA 3X1XA 4N0DA 1AZTA 4LYFA 3M0EA 4LV8B 1G5RA 3ZDQA 4TMTA 2RKOA 1NY6A 1G7RA 3FHCB 1N5LA 1DAIA 2ODEA 3HDTA 4YXWA 1E2KA 3EZ7A 3R20A 1GNRA 2EYUA 2PMKA 4UJ5A 2ZPTX 1DG3A 1SVOA 4LV5B 1R5BA 2WJVA 2ZRIA 4TZ6A 3X1WA 1UKYA 4EFNA 4BLSA 1E2IA 2AKYA 2F7SA 2QZ4A 4GNKA 4PC1A 5EZ6B 4DDUA 2Q21A 2YHSA 5K8IA 1GZSA 3A1TA 4KBFA 5KO2A 2ZJ8A 2F1JA 1H8ED 2V55B 1II0A 2QMUA 3NC1C 4U7DA 3UG6A 1G7SA 1NF3A 1Z6GA 1IOZA 2FF7A 2KI5A 5FTMA 5IRCD 4GP7A 1MOZA 1XMIA 3AVQA 3WNCA 2GXUA 2ZR9A 3DKVA 2RGNC 3FMIA 3PEUA 4A2WA 2PEYA 3T35A 4F92B 1FW6A 1G41A 3QXCA 4URXR 4G0NA 3AH8A 2CDNA 3RRMA 2R6AA 2RCNA 4D6PA 4DUGA 1D2EA 1EWQA 4D26A 1KJWA 4GI7A 4IDHA 4HZUA 4ZKDA 2H18A 1CP2A 2J0UA 1G17A 2O5VA 3W6PA 3EA5A 3AKEA 4URYR 2WVJA 3IIJA 1F2TA 4AG6A 3NDPA 3RYTC 3A4LA 1P9NA 4M9SA 1WE2A 1S2MA 3UG7A 2L0XA 3DOFA 3RRYA 1XCMA 2ANBA 2H57A 3GEEA 4RD1A 2GAAA 4V0NA 2CCKA 4ZKEA 1T0JB 2EFCB 2DFLA 3T5DA 1IXRC 5K8LA 3QVUA 5DYIA 5B64A 1N2CE 3U44B 2WKQA 2OXRA 2BC9A 2Z4SA 2ZRLA 4US2R 4M2LA 1ZVQA 4HDOB 2ZRGA 1XMJA 3Q85A 3TKLA 1Z0KA 3M4YA 2CHGA 4F38A 2EFGA 2WPDD 2VQSA 2QMHA 2IK8A 2OE2A 2BHRA 2N46A 2GJSA 2ZRHA 5FBLB 2OCYC 4BFXA 4PTLA 1FMJA 5DN6D 2QTVB 4MGYR 1E2HA 2B21A 4PHGA 2F43B 4DXAA 2TMKA 3EW9A 2AWNA 3WMGA 3ECCA 1IY2A 3ADBA 3Q8XB 3TMKA 2IT1A 3BH6A 3KQLA 4P3YA 3GLFE 1Y3AA 4Q9HA 5DI3B 3Q9LA 2AX4A 2GXAA 4BZPA 4C0SA 1QVAA 2FJUA 2VP5A 5KOYA 4HB0A 1N25A 2QP9X 4MKFA 1E69A 4QL3A 3NXSA 5DHAA 3PEWA 2E9SA 5F98A 3CRW1 4AYTA 1N3BA 1OPXA 4FN5A 2FEOA 2XTNA 5EE1A 2I3BA 4ZO4A 4NYJQ 2DFTA 2PZGA 3DMDA 4XD7D 2EFDB 5C2JB 2FSFA 3GLIE 3VHLB 3IPYA 1AS2A 1X8KA 3U7FB 1QRAA 1UJ2A 2ZUBA 3CO5A 1NLFA 2KWIA 3BGWA 3VR3A 4BECA 3K70C 4EJSA 4OKSA 5FOVA 2IEYA 1XD2B 2BVNA 1U94A 1W4RA 2QL6A 4A36A 3QPUA 4MITA 1TF2A 5JI3E 2W0MA 1D9ZA 3L8YA 3B60A 4JL6A 4URUR 1NMZA 5FPTA 1NVUQ 1N6LA 1W4BA 3BAFA 4LJ5A 4C0LA 1NNEA 1GKUB 4GL2A 4DDTA 3IGFA 1G291 3I73A 4DSTA 4JMPA 5ELXA 2DHRA 2GJKA 2WMOB 4BUJA 5AUNB 2GF0A 4TMVA 1HV8A 1KY3A 2FFQA 4RFVA 2IC5A 1G5TA 1KZGB 1G3UA 3EPHA 3LXXA 4NHOA 4LHVA 5FUYA 3AVVA 1G6HA 2KE5A 5KDOA 4IOKA 3AP1A 5FFMA 4L4UA 1YZQA 3WHLA 4ZI2A 4DB2A 1E2FA 5DLQC 1JBKA 4BZXA 3QKTA 1YRAA 5EP1A 3CH5A 4M1SA 5LB2A 3AEZA 4IVRA 3DPUA 1FQJA 5FOUA 4EKDA 3T1TA 3B1VA 2WWYA 1L2TA 1TEVA 1AGPA 2Z6VA 5JZVA 5H8WA 2CLDX 1MRSA 2OCBA 3QKUA 1YJ5A 4JSYA 5EUMA 4NZYA 1MO6A 1U8AA 1BMFD 3SU8A 1GVNB 1QHIA 3K70B 2A2ZA 1JR6A 3TIFA 2R6FA 4XWOA 2VP6A 4M8NE 2P5TB 3DM5A 3X1DA 1FP6A 1SQ5A 5CLQA 3OFND 4GFDA 5GVSA 1G7CA 2C78A 3EPKA 4RD0A 4NYIQ 3CLVA 3N2IA 2WM9B 1TQ6A 3IQXA 2QBYB 3R9XA 1E2NA 4B6EA 2AK3A 4TQUS 3ZVMA 3RC8A 3TLXA 1E1QD 4Q21A 1OFTA 1OFHA 4FWIB 3K70D 4GDFA 2REXB 4OHYA 2DWPA 1QDEA 1AIPA 4LUCA 2O8FB 2HYIC 2J7KA 3SQXA 4ESVA 4HYYA 3GLHA 1J90A 3VR6A 3FMOB 2J0VA 2XSZD 5G3ZA 1XPOA 4FI3C 3PV0A 2H7VA 1E0KA 3EWAA 4Q1CA 3O47A 4D0GA 1JR3E 1KI1A 2ZTSA 3ONWA 4HEJA 3QXJA 4GOKA 4IFEA 2OEPA 3AF2A 1MH1A 3DVLA 5J5CA 1O87A 4D2IA 3PUVA 1UBFA 4POAA 5JRJA 4KU4A 3K0CC 2GJAA 1IXSB 3AB3A 2YKGA 1OFUX 4AKIA 4QGGA 1M7BA 1OXSC 1GKYA 1ZCBA 2QORA 4PPFA 3DL0A 5KUTA 4LJYA 4WZ6A 1WRBA 4LWZA 1ZD1A 4CW7A 2ZJZA 4WVFA 4HUTA 3KL4A 1C9KA 1XXHE 3DMNA 5JECA 2HUPA 4P31A 1N6PA 3SFVA 4HLQB 5IK2A 3OEHD 3L43A 4ZDKA 3LLUA 1MO5A 1OH8A 1OE0A 1OB2A 1UBGA 2Q9BA 2WJHA 5SZJA 4ZPXA 3SEAA 1RRCA 4P33A 1VIAA 2JJ2A 1GITA 4IKEA 1KGDA 4P4SA 1PZNA 4RCYA 4TMWA 3PG5A 4KSCA 2MSDB 1ZRHA 1ZM4A 2XZPA 4DCTA 2DFKB 1P3JA 3I1FA 5H68A 1EGAA 1K8RA 1BIFA 2VA8A 4ZCMA 1TU4A 3TUZC 2F9MA 1GG2A 2QP3A 4FMDF 1PUJA 1E6CA 4IXNA 4ASUA 6Q21A 1FQKA 4LX0A 3CRMA 1DOAA 2GJ9A 1GFIA 2ZRMA 2SHKA 4OQNA 4A6PA 3CX8A 2P65A 3BB1A 4KFTA 2ZI4A 4YXWD 2W6IA 1KAOA 3LBIA 1ZW6A 1A1VA 3I32A 1ZYUA 3EIEA 2PLFA 4HDCA 2WWWA 4LOAA 2Z0MA 5F3WB 1KNXA 1TF7A 4N3NA 2B7CA 2W2TA 1C1YA 3LBHA 4KO8A 2BM1A 2ZS9A 4PFSA 2IYSA 4HZUB 5E7IA 1M1YE 4I1UA 3OEEA 2J0UB 5ANRB 4ESHA 2PBRA 5GJBA 1Z6TA 3A1UA 1IJEA 2QSZA 2VSXA 3WNDA 4FCWA 4PAOA 3U3OA 3AF4A 1D2MA 4Q18A 4KLZA 1Q12A 1W44A 1HE1C 1KI2A 4QGFA 4NU0A 5E7MA 2VHUA 3AKDA 4Q01A 4AI6A 2GCPA 2K5UA 2QG6A 4MA4A 4PSAA 4DVGA 4DUGD 2ZYWX 3EZ6A 1NLYA 2IHBA 2ZRKA 2C5LA 2ZSDA 4Q1DA 1NG9A 1AJEA 1U8YA 3IHLA 1XEXB 3W90A 3SN6A 2NMVA 1Z83A 3GEHA 4BFWA 4D0NA 1X86B 4UJ3A 2ZAOA 3C7KA 4EPYA 2FE4A 4AK9A 2FZLA 3EZFA 4NBSA 4TT3D 1NG1A 2B7BA 2RGXA 4EPVA 2J9RA 2H8KA 4TLCA 1D5CA 5LD2C 1T6NA 2NPIA 2NTYC 5CB6A 2AD1A 2AR7A 4HLUA 1GM5A 3CPHA 1UADA 1G3IA 721PA 5G3YA 2BDTA 3NHAA 5KSYA 4O3MA 3NDBB 3SOPA 3FE2A 4FD2A 1UDXA 3UATA 3AV0B 1VHLA 1NIJA 1G16A 1SVLA 2IWHA 1NVWQ 3OIYA 4LV6A 4PC6A 4FCVA 1T3LA 2DFNA 2VF7A 3KDSE 2IUSA 3ZQJA 2P6NA 2PJZA 1AQUA 3GJXC 4QKQA 3OHMA 2KB0A 2AN9A 3DOEA 1RRPA 2ZEJA 5G53C 4B73A 4IVQA 5FL7A 4B76A 3KQHA 1KAGA 2G6BA 3ICEA 4B3BA 3D7MA 3REGA 4ON9A 1GIAA 2IEZA 4IDQA 4OI1A 1KI4A 1BH2A 1U81A 3KB2A 4MKIA 4C0JA 4E07A 5KSOA 1FOEB 2ZRPA 5GJCA 2ANCA 4QG7A 4PANA 4RCZA 5LPNA 3I5YA 4DC9A 2VP0A 2Q6TA 1QHHA 5JWOA 4EJSB 1ZD8A 5EXXA 5LD2B 1YZNA 1CJKC 1UKEA 3TGPA 1FUKA 3B9PA 5LBIA 3ZJYA 2DPXA 4K8OA 3REFA 621PA 3TSZA 2F43A 1SXJC 1R10A 5EP2A 2RGNA 2ZAMA 1Q44A 1XBTA 5FR1A 4DLVA 3LW8A 1VYTA 4MYTA 4D80A 3O8CA 3LNCA 2PLRA 5HPYB 1ZM3A 4Q7MB 1H65A 2FSIA 1R4AA 4G3XA 3K0AB 4XD7A 4JJKA 4JLJA 5DI3A 3PR1A 1CJTC 2GHIA 4B3XA 1CJVC 1N5JA 5TARA 2NO0A 1P5ZB 3BK7A 1RFLA 1X8JA 2JA1A 4JLKA 2H1LA 2MSEB 4PQYA 3PIRA 1WQ1R 4IHQA 1JEDA 1TMKA 2IHYA 2WV9A 2ZVQX 4RJLA 2ZSAA 3K09C 1CBUA 3AM1A 3E5HA 3CPEA 4Q7JB 1S4QA 2FMXA 3TNFA 1JXOA 3P4YA 4KYUA 3B1YA 4HDQB 5A0FA 4KVAA 5D3MB 5FPHA 5AJVB 3OIWA 4MGIR 3C4JA 4U00A 4FCTA 3CR8A 1TU3A 3MG9A 2ZE7A 4JT4A 1KI6A 2ORVA 5JCZA 4TWZA 3UXMA 3GJ0A 4A1FA 1VECA 1CULC 1G8GA 1NN1A 2ZYTX 2ZI9A 5FI0B 4BPBA 4C2UA 1S1MA 2ZQ5A 4RY2A 3TJZA 3W6OA 2Q3HA 4XSHA 1YZKA 5HZKA 5DSZA 2QGNA 1Z29A 1KO8A 3L0SA 5BN4A 5HCIA 2QU8A 1F2UA 1KIMA 3GFPA 4N1AA 4Q48A 3C5CA 3RLFA 1IY0A 1SXJB 3IKJA 1UEJA 2J3EA 3G82C 3KFVA 1J7KA 5HTKA 1UBEA 5BYJA 1Z06A 3QOFA 3RABA 4C4PA 1QF9A 4TYNA 4TQ9A 1U8ZA 3RSOA 1CR1A 1TL7C 1E3MA 1W46A 4V03A 4DCNA 1OSNA 1G3QA 1QHXA 3G0HA 1WMSA 5K8UA 4JZKA 2GVDC 4W5WA 1SHKA 1S9HA 3PCRB 1YU9A 3SBDA 4M9ZA 4URWR 2ZYUX 1WXQA 3GLHB 3HPQA 4K81B 2DCUA 4PZYA 3NEYA 4HB2A 1KI9A 4W5JA 4A0GA 4NYMR 4MKHA 3QBVA 5FPSA 3QUSA 2WAXA 3IIMA 4YQFA 3A36A 5DH9A 4XTCS 1XRJA 1LVGA 4JVLA 3ZD6A 1U99A 5KNCA 1D8TA 4CEIA 4HAVA 2HEIA 3AGQA 3I4LA 4EPRA 3A4NA 3CWQA 4LSGA 4A2PA 3H0KA 2REOA 1D6JA 2JGNA 3CF0A 3CR7A 2C9OA 3UMRA 5FBRB 2JLWA 4M1MA 1G1MA 1Z0DA 4PC3A 3LXRA 2N1BA 3WMEA 2FX3A 1Z6AA 4RZ2A 1P73A 2PMDA 4I4LA 1VYUA 1Z6XA 5KSPA 2ZETA 2I1QA 1NKSA 3CONA 4PHTA 2IUUA 1NBMA 3RNLA 4IOMA 2QBYA 2XSZA 2ZREA 2VHCA 1IM2A 2ZUCA 4F4JA 1E9DA 1VHTA 3PEVA 1CS4C 5AJWA 3PXGA 2GBLC 2V7QA 3CRQA 2BWJA 2ZANA 3EG5A 4QBIA 2WICA 3C41J 4EFMA 3CX6A 3QEJA 4LZZA 3W5JA 3VKWA 4PHFA 3A37A 5LDDC 4RSGA 4TLDA 4OL0A
chains in the Genus database with same CATH superfamily
1E9FA 3P45A 1DBQA 3K32A 2BEKA 3P97A 4ZEWA 1T8UA 4MPPA 1JEQA 1IZ7A 4Q9KA 1JFVA 5MN5A 3HYRA 1AKNA 1UANA 3D6AA 1P3DA 3JWIA 3LY8A 4U2FA 3EVZA 4IDPA 3MTAA 4MINA 4O63O 4F2PA 5F7OA 4CQNA 1K8ZB 1L4EA 2YQ4A 2IY9A 4NBTA 4ZYUA 5IHPA 1LK5A 1OV6A 3EH1A 5IK2D 3ED5A 1AQLA 1EKXA 2QJFA 2AOWA 1RABA 2J9YB 2ZWVA 4XTRA 1E1CB 5FKJA 5BV1A 1M5RA 4B34A 1NXWA 3JQ9A 3ESAA 1JHDA 2BJHA 1F4LA 4WZBA 3BD8A 3L2OB 5B2EA 1I4DD 4DS3A 1ZM9A 3MT0A 3BIFA 5DGTA 5KCZA 4N3GA 5EZSA 4FZ5A 4HMQA 4M38A 1NN5A 2FSHA 3QELA 2BMVA 1MP0A 1WXEA 2RSLA 1EAMA 3FNBA 5EY5B 3KSUA 4YJ2F 1NW8A 1QRRA 2HMUA 1V7QA 4JVSB 4RS4A 3RS2A 5DVZA 3QMMA 2G6TA 1NM5C 3ZHTA 3ISJA 1CG6A 3AY0A 3GQVA 4EF5A 4ZK6A 2GM5A 1U2TA 4CEHA 1PP4A 3QWFA 1JHOA 1U2EA 1TIPA 1Q95A 1VG8A 1W59A 2C3PA 3KZKA 4X24A 4XJSA 2MTBA 2HHAA 3I39X 3IDZA 4DJFC 3B51X 1VMAA 2WSBA 1HTTA 3LF1A 3IJPA 4ZHQB 4MV0A 3VPGA 5B5SA 1TF5A 1RC8A 4NV0A 2CL6X 1RJWA 5JEDA 1W35A 3DAPA 4Z4QA 1IN6A 4R1NA 4L0MA 2EJVA 1TZJA 3GRCA 4OJKA 1NATA 2JD2A 4HTAA 1P7WA 5DCYA 1VJ5A 1W87A 3H5WA 4NLLA 2WU0A 4LISA 4NRDA 5D3ZA 5DCWA 3VUEA 5C81A 4DA8A 4B6PA 1H1LA 4IXDA 1KYZA 4KDEA 1SC1A 2OAQ1 1IBLB 5HCUA 2J6HA 1M2VA 3D7LA 2R6GA 2FW0A 5GMOA 4R41A 2IEAA 4JT9A 1MX9A 5BNFA 3BRQA 5C4GB 3G2OA 2JFHA 2UZ3A 2O0JA 3B1FA 3V48A 4BX2A 4LYEA 3A2LA 3IP3A 1VRVA 3UGKA 1GZ6A 4NKRA 1DKRA 5LNK6 5MN6A 3U4CA 5CT6A 1QWSA 5EXEA 2PWBA 2VIIA 4CFZA 3MHTA 3ZD7A 2BTQB 3O3MB 1Z5NA 1A9TA 2R2AA 4ZQHA 3TVYA 2HRBA 4EA8A 4X90A 5L3VA 4TTJA 2BBOA 2HBQA 2H4ZA 5L40A 1I24A 5FHRA 4FYIA 1J8YF 3FMPB 1FTNA 1GTG1 2QRPA 4TLLB 2M6KA 1UOEA 5DX1A 3AR7A 2QVBA 3BXFA 2EF1A 1ZH2A 3CU5A 5EPUA 4AY4A 1SHUX 4E88A 3WYDA 5KJ6A 1WWKA 1N6KA 2ECOA 3PJFA 1ORHA 1JPJA 1O6GA 1BS9A 1Z39A 5ARBA 3LRPA 1SKBA 4MWDA 4F86A 5E7QA 2JIRA 4E08A 4WK4B 1TRHA 1ND5A 5J4YA 2Z6QA 3SYKA 1PLJA 2LKCA 1U2GA 2R4UA 3GPIA 5AW9A 1GL3A 1XLTA 2QNRA 2XZOA 1W5EA 1J00A 2D5AA 3ZU4A 4DG8A 3OTGA 1H0RA 1C9DB 1TYZA 1F12A 2IEIA 1HFJA 3V46A 4EX7A 4ZQCB 3LWBA 4TXMA 4HAYA 3ABRB 3K9GA 2VP3A 1E2JA 1T6XA 2GA9A 3PX3A 4E2XA 3I92A 1NLZA 1ISGA 3LKBA 1K7FB 4PYIA 1VPEA 4AS2A 3INNA 2XH8A 3W77A 3KKMA 1ZNYA 3B3QA 4P5EA 2APJA 3F8TA 3HLYA 3OF5A 2P9TA 4G5RA 4X6YA 1T6YA 2AQKA 5JARA 3K2QA 3QQ5A 3F3MA 1N2GA 1YDHA 5HGXA 3T34A 4A91A 1SZJG 1Q11A 1QIHA 2P4EA 4X64B 3DWIA 1Q74A 3ESRA 1BCRA 3MFQA 4I19A 3A28A 4AWXA 3OUTA 4BFSA 1DEKA 1YU6A 2HF7A 3D6FA 1ZSVA 3NJRA 4MUYA 4AM8A 4PWZA 1AZWA 4ER7A 2FHSA 3N28A 1W9MA 5JMWA 3PX7A 5IKEA 2ZM5A 3C85A 5FF9A 1XK7A 3K9QO 2BEWB 3F4BA 3IBCA 4IIBA 2LIPA 1RBQA 3TOZA 4Q19A 1VE9A 4RH0A 5I5GA 2ONJA 3TPFA 4EPXA 1WQ4A 1FU8A 4CM3A 3PICA 3L18A 5HKKD 4L4ZA 3UW3A 3MMZA 2AC7A 1PR4A 6PFKA 1U2DA 1KP3A 4RKFA 4QNMA 2J3DA 4V0MA 4M0LA 1KR5A 3AWDA 1NKVA 5K8CA 3JYOA 4ZU3A 1VJTA 5EXSA 3EF0A 2GZAA 3QE4A 2H06A 2FJ0A 1QIGA 2YS7A 3NC0C 3O8NA 1C8BA 2G17A 2HLHA 2VJOA 1Y1QA 2W37A 2X1LA 3PC8C 5E3HA 4EO4A 4YAJA 2W2OA 4QYWA 1QSGA 3CF4G 1V11B 4RIGA 1DRUA 1ILWA 5AHOA 1V3UA 1FTWA 2C2KA 2OZEA 3FBGA 4Z4HA 3OESA 4RPLA 1DAPA 1WLSA 3NP7A 4ETIA 1J39A 4MQBA 2DWOA 3GELA 1PS9A 4YJ2B 4MRSA 2X19A 3ZW7A 3LYLA 1XLVA 5ICEA 2BUBA 1P4HA 4UBNA 4MWBA 4P34A 4IUCS 2G5GX 2ZU6A 5LNK1 3I8OA 4KPUA 2CK3A 2X2EA 1X9GA 4MCJA 3EC2A 4JKYA 2GTPA 3ROQA 1ENYA 2GNAA 3NHBA 3GDOA 2SECE 3EFHA 1JXMA 1TQDA 2KX7A 1CFJA 3QLEA 1YQTA 4A03A 2UZAA 3WGUA 3E8XA 4QA9A 1RQGA 3TR0A 4BBZA 3LZDA 1WX1A 3P26A 2IDKA 4DLUA 2ORIA 3NETA 2XGJA 5ESXA 2GPYA 3PNSA 4JZYA 3RF6A 4MUBA 4AG5A 1PLKA 2HQOA 4HXGA 2FGKA 1GAEO 1EJ6A 3RVMA 5HVNA 1TQ4A 4L3WA 1E59A 4X85A 3E81A 1V5EA 2B5VA 1R1DA 2XB9A 3DEJA 4RD3A 5E2IA 1CZKA 1L1FA 2YJTD 4IQ8A 1QP7A 1TLFA 1C41A 1YZGA 3OZBA 3SIPA 1YR1A 3O9MA 4KQXA 3GPLA 2RHGB 2D2FA 3K8QA 1P18A 2CVZA 2WIFA 1T91A 2HSJA 1RIIA 4J1NA 1HSZA 3ZGNA 1HYGA 3CW2A 3FSJX 1OAOA 1R0BA 3DNPA 5EHQA 1E9EA 4D8TA 4EF6A 2BW0A 2FRVA 1UR5A 3MN1A 5JC8A 2IWRA 3V4SA 2QTTA 4CKWB 4JL8A 4J2TA 4BNWA 3LPCA 3UWOA 2WABA 1SH7A 1Z82A 1KAEA 4RHYA 4U9IS 2PXHA 4R5MA 1E0AA 3H2JA 1A77A 1N2CB 5LQKA 4KHZA 4TSRA 1RAGA 2IS4A 5GM2A 1JF8A 4RV9A 3R5JA 5JNWA 1CUJA 1FJHA 1CZUA 1QM5A 2VWHA 3EQ8A 4QDJA 3CEJA 1FZQA 5ICGA 2WVGA 3H4IA 1GY8A 2Y93A 4TRJA 5TV2A 2R8OA 4EDFA 4I4CA 1Q7CA 1GQRA 4OI2A 2ZI5A 3RU9A 5K6RA 3KEOA 3SYLA 4MQEA 3RWOA 3DEHA 3B5JA 3HJUA 3K9BA 3F6CA 1RPJA 2NM0A 4F4IA 4W5OA 3MFYA 2IW3A 3R41A 3TJRA 2GPAA 1QAOA 4B32A 1LA2A 1F17A 2H0QA 3OHPA 2B6NA 5EVCA 3DV0A 5EUQB 3TEFA 5KIAA 1A9PA 4DKJA 4X1IA 3K09A 1T8YA 4C1BA 1K7YA 4F96A 2CSXA 1N1GA 3IOCA 5B3KA 3PT9A 3D6VA 1J5XA 3DDZX 4RA9A 4L1KA 1L4NA 2FSGA 2DLCX 3FTQA 4LWQA 4TL6A 5A02A 2X22A 4MI9A 4RHEA 3WIOA 7AT1A 1TEZA 2H1IA 5K7SA 3AB8A 4A8HA 1DVRA 3AEKA 3W4JA 3ITDA 4WZBB 2Q2NA 3UMSA 4ZVSA 2QMOA 1JZQA 3GXOA 5DN9A 1CB0A 2CE7A 1GV1A 2R6ZA 2GZMA 3H18A 4HGQA 4YA6A 1NOKA 1WP9A 1LDMA 1ZOPA 3EEBA 3DBOB 4QUKA 3QELB 5A04A 1W25A 3VU0A 3W3AH 3QLJA 1WZCA 2Y1FA 1W2GA 4F9TA 1JB1A 1V48A 2FSVA 5M29A 5DYYA 3OZDA 1IPHA 2EGUA 1TYBE 5HMLA 3D2LA 1VXOA 4JL5A 4WBNA 4YCNA 4F9FA 2JD1A 3FOWA 4R2IA 4J0GA 4WKPA 4XWKA 1DC7A 4MI3A 1ZD5A 2ZJAA 3VAYA 4CEHB 4ND3A 1JILA 3E53A 1SG9A 2PVPA 1YC5A 4GKVA 1HK7A 2FZ4A 4M9QA 2RGBA 5GADl 1T9BA 2X9VA 1VOTA 3GJ3A 1BE6A 2GHRA 1G4AE 3SEQA 4RZIA 2GN9A 2Z56A 1PFGA 1R18A 1Z7WA 2G04A 2OVFA 2IF2A 4L27A 3TB4A 4ACBA 2BBTA 1Z6YA 2CNWA 2OL4A 4Y2GA 3U3ZA 3ZDZB 3B2EA 2WR8A 2FSUA 4JN6B 5F73A 1W36C 2C4KA 2FMKA 1NDUA 2QPAA 3VHXB 2A67A 4C3ZA 5AQ1A 5AI9A 2ECKA 2KLHA 1CVIA 3Q0IA 1EVLA 4J0CA 5AKGA 1Z2CA 1AU9A 1U0JA 2GBCA 2ZJYA 3D7RA 2WWRA 2EBUA 3IBYA 3O9ZA 3TQHA 4KODA 3W8NA 2TMDA 3IDQA 1OTXA 3QUAA 2YHIB 4RFLA 3I04A 4FHZA 1D2GA 2VZLA 5ES4B 4ARAA 5L8VA 1XA4A 1QGZA 3IS3A 2EJCA 6LDHA 4RABA 2WJ4A 1YQUA 5HFNA 2XCRB 1M8FA 3HUFA 4L5CA 1TKBA 2ZRCA 2VA9A 2W22A 3EODA 5AI6A 2LRHA 5EESA 5KWJA 4LDRA 4UDNA 2ZSJA 1SKYB 1AK1A 1DC4A 3IODA 5ELLA 5IUKC 4NYJR 1WXFA 3ZKWA 4LF9B 1ZI8A 5JNUA 1FE8A 4QXRA 5IZ4A 2IUTA 3AX6A 2RD2A 4QEKA 4E1BA 1FXUA 1R88A 3KWLA 2W2PA 3CXUA 1WR8A 5C8ZA 5FWXB 3GJRA 4G63A 4MDHA 2GBLA 2GQ0A 1C0KA 2BDUA 3UNXA 1PG5A 1BQ4A 1W5FA 5M7EA 2JLSA 1R3DA 4QRHA 3RFUA 2VKTA 1YIDA 3ROXA 3ZD8A 1QPBA 3NHKA 5AUQA 3ZCSA 1XZIA 4QXMA 2YVKA 3F4LA 1G5FA 1ULTA 4XYBA 4EVQA 4HNGA 4YRLA 2R8YA 2JK1A 5I4KA 1XEWX 2D1YA 4EFLA 2OFXA 3V7NA 2D3TA 4I7EA 3LP8A 4WADA 3I2HA 2EQAA 4L95C 5LJLA 3MWGA 1TZBA 1DXYA 4J0DA 1J2RA 5D3QA 2WSSD 4O2AA 5TGDA 1I6LA 4X3PA 2EFHB 4RF2A 3S68A 2O54A 3WY9A 1ZD4A 4K6CA 3I6IA 1JHMA 4GGMX 2BTEA 1LNQA 3LBFA 2PUTA 2IZ7A 3H2BA 4S12A 4H0CA 1NURA 4LDAA 3I01M 1WF6A 3KFLA 3VM6A 4MUHA 5HBRA 3VTFA 3M5WA 2CV0A 3DKIA 3EZ2A 2DFPA 3WTCA 3ZZ0A 4UOQA 4N03A 1S2DA 4G5SA 3EZYA 5IPFA 3ZH2A 2O2GA 3SM9A 4YLGA 2PLNA 4MPRA 1EFAA 1U0LA 2CE2X 2C8KA 4UUNA 3WZ2A 2HSEA 3HUDA 2VJMA 3HCEA 3U2QA 2YY5A 3E03A 1J8DA 3JPWA 5K0TA 4MARA 1EXDA 1T3SA 1QYDA 3C98A 1KF0A 2CJWB 4XPIB 2FN3A 5C1OA 3LLCA 4EWLA 3AEQA 1FYEA 1JSZA 1ZO8A 4V0KA 4TVSA 1RE0A 2WKPA 3FVVA 3OWXA 4ZAWA 4ZYWA 1ECGA 4OGLA 5AW8A 3C4QA 1TPZA 3FGPA 4MA0A 3AZQA 3PJRA 2GUGA 4RD4A 1FSGA 4N0QA 2V3VA 3A05A 3CUUA 3AZPA 4IFTA 2QGZA 5F23A 2PSDA 421PA 4NYIR 2FEMA 2PKWA 4YR7A 1RAAA 5JTUA 1JHUA 2BM0A 3FMFA 4D25A 2AZDA 1MX1A 2H4JA 1RCUA 1CB7A 1XSEA 1XXHB 2PO7A 3CF6R 5EZQA 5CLJA 1OILA 2BI7A 2JFYA 1E66A 4U2CA 2WF8A 5H80A 1WP4A 1FCJA 3WLKX 1BX3A 2V9ZA 2BFNA 4G56A 2OA0A 3EFOA 1PCXA 1XF1A 3RU3A 1YL5A 2UUBB 1RLMA 2Z08A 4XJXA 1W5SA 3LCRA 2RHMA 4P6VF 4HC4A 2AJLI 4YEDA 1E7WA 1GN9A 4MWGA 2DQYA 1L7OA 2JKYA 4QREA 4DWJA 3EQ9A 1PJCA 2GESA 4G4GA 4KN6A 4U0JA 3RC2A 1O77A 2P3LA 5T8KA 1LBSA 1BAPA 1RPNA 2CUNA 1DEOA 2AEFA 2GN0A 4LFCB 1KY4A 1I4TD 4GQIA 4K9SA 5HKKA 1YTUA 1I9CA 1JT9A 4KYTA 2MMCA 4FYJA 4YCDA 4EA9A 5I7WA 1DFHA 4XWAA 1AO3A 4N6NA 4OQXA 3A9RA 1KVRA 1ZMXA 2D7DA 3KSDO 5LSAA 4H1VA 3TL3A 1N0HA 5IKXA 3AL3A 2ZT8A 5FP0A 2OVBA 4O0MA 1XKLA 2IZ6A 4UVHA 2V58A 5DF1A 5TGZA 1NTOA 1SKAA 1DG1G 4LRYA 1UZMA 2Q5HA 1NMQA 1X14A 3QEOA 5FT9A 2Y0EA 4X8MA 1FRQA 5JDCC 4KV7A 4RVHA 3SS8A 4XDYA 4PRLA 4ARVA 3R9WA 2Y1LA 3T3GA 2YTZA 1EVQA 2FUNB 2G71A 1T4CB 3W3AD 4CKYA 2BBWA 3TDMA 4GVPA 5KNBH 3VR2D 1B74A 1IL0A 1XTSA 1KMHA 1X13A 1L7XA 2P62A 2GAJA 1M7HA 2O6HA 3HBLA 4UUMA 3SI7A 4FYHA 4YI5A 1CQIA 3U31A 3MOGA 2B1QA 1X80A 1KPGA 3G7NA 4G4IA 5BO5A 4TYWA 4MYHA 4O2AF 2XBLA 2D1SA 5CFPA 3WP0A 3KQTA 3AIIA 3LVBA 3ROFA 2RG1A 3R7WA 1ZGCA 2O59A 4IX9A 3EXAA 1AZSC 3RO7A 3ODGA 4E3WA 1Y4ZA 4TGLA 1IY9A 1Q22A 3KJHA 1OTHA 2XJ4A 4NBRA 3S8YA 1VBFA 2EJUA 3F6BX 3MK31 1D2HA 2J3KA 3UA4A 2CLSA 1PJAA 1L9XA 4ID3A 3WTBA 4Q7LA 4C6SA 4CZ2A 3KD2A 3DT6A 4RZQA 1DLIA 1T3HA 3O90A 1LS1A 3O6VA 1FQOA 4J4TA 4G0XA 2GXQA 3SX0A 2VUTA 3UWKA 1P4RA 3N05A 5DYTA 1EMDA 2EF0A 2YS6A 5TQVA 3BSFA 3SQDA 2SCUA 3HUEA 3PUJA 3IPXA 5JATA 1Z25A 3OEYA 4G1FA 4DBLC 5KC9A 3I1YA 1V6CA 2AUTA 1YAHA 1P2FA 2JFXA 1U9ZA 4EY7A 2GDJA 3G0DA 3KQKA 4NJOA 1M0SA 2RKWA 4EQ6B 3DZDA 1JEAA 2QTZA 1W4AA 3DV0B 4M6WA 4ZAZA 4E6EA 1QKKA 4X1IB 3CZAA 5FTNA 1RMQA 3QU9A 3UXYA 3RODA 5G0VA 4XIGS 3M4JA 3H9UA 3IBTA 3D64A 4WFIA 2X7HA 3D2BA 1ZINA 1ONBA 2PSJA 5KVVA 3EIHA 3PHHA 1KDZA 1CJBA 3T15A 2KPOA 1TJNA 4C3OB 3AI2A 3HDGA 5A3VA 3LCJA 4I0WB 3EH2A 5B36A 4UUAA 4R2XA 3TG8A 2O8VA 3OX3A 3P9RA 3KTDA 1XE3A 1DINA 1JQ5A 4MLDA 1X7YA 3H0CA 3KXIA 3L1JA 5D8DA 4QAQA 3P2JA 4CETA 3O26A 3ONVA 3RYCB 3QVSA 4WJKB 4MRMA 2DC1A 1CZRA 4WCVA 1T0IA 2V7EA 5A5GA 1L4GA 2VYFA 4G5GA 1NVBA 4RHFA 4Q02A 1KAMA 5DGXA 1VLLA 4IY1A 5KTYA 2NXEA 4DQUA 4DCVA 3FPHA 2A59A 3ND6A 4YUYA 1FP4A 2UXDB 4CMEA 4RF5A 2XX3A 2HWXA 3LQ1A 3R9IA 2PH1A 2QJRA 2ZYGA 2CWDA 4PG7A 1T35A 4MR7A 4XR4A 4ZU1X 4TSFA 2CN1A 121PA 3P1JA 5AK0A 5JJLA 5CTAA 1KEPA 4X7MA 3RS4A 5AKLA 3AILA 3TRFA 3NYRA 3T06B 1BXGA 4HLNA 5TJ9A 1E1LA 4W82A 3NHSA 5I51A 1KZ9A 4YONB 1QU2A 2NU9B 1PGNA 2A9QA 1CYDA 2FXIA 5C5DA 2I7TA 2X1HA 3RTEA 1UMKA 1ZESA 1ZM2A 2HXYA 3MGBA 4EGCB 4ZD6A 4OTZA 1OLSB 1TM7E 5F4ZA 4JB0A 3N2NA 4LJKA 4MVJP 5T5QA 5IDXA 2DU8A 2EZ4A 2X5JO 4TYPA 3BEOA 5KYWA 2C0CA 3IKLA 2Z83A 3L1VA 2D5LA 2IA5A 5KKNB 3G9TA 2HPZA 3ILXA 1W30A 4Q4LA 1JQEA 1X38A 3M89A 5FULA 2Y1GA 3UO8B 3UHAA 3ITKA 4TWJA 4BLQA 2IL1A 3OLVA 4YMIA 4KGDA 4KH0A 2YXNA 3IE0A 4HGOA 3B5EA 4IXMA 4Y2XA 5ELMA 5F2KA 2VNSA 1EWRA 4MNTA 2YL2A 4C7JA 3S7ZA 1WXWA 4MVCA 4JP3A 3ZKWB 1IVNA 1NQTA 4V1CA 2BGMA 3K7EA 4DIBA 2DB3A 3IP5A 1WW3A 5MFPA 4J43A 3CT6A 1Z2AA 2W9XA 2QN8A 4OP2A 1PBNA 1PJ3A 2QNBA 2XOKA 3GRRA 3ORRA 1OZ0A 2Z5GA 1BMQA 3IAM6 1PG0A 2TSYB 2XYVA 3ZGOA 1R64A 2I3DA 3HCCA 1JR2A 4RDHA 3D6HA 3GH3A 4IL5A 2OXTA 3NTVA 1K68A 2LCFA 4IH9A 5KJCA 2BGKA 2I2CA 3VO8A 3ANMA 4BMXA 4OGFA 5AKJA 4XDGA 3VU9A 5KYGA 1YACA 3R6LA 4MUEA 4E4TA 5K0EA 7GPBA 3JZMA 1J0CA 3TQFA 5KX5A 3K9FC 2YQZA 3FMGA 1VI2A 3HKCA 2P4QA 1DIHA 1KKLA 4NPCA 4XEUA 4LSZA 5TJHA 3QA3E 4GHWA 3ON5A 1MA0A 4FFOA 2Q4TA 2NP6A 3JAWA 4QNRA 1O9GA 3SKXA 4O2AB 2FFHA 1OAKA 2XEXA 4N7MA 1J2JA 1O95D 3KKNA 3OURA 4OHXA 4MZDA 3L3BA 4NMLA 3ZIAA 2ZVPX 1J42A 1VFPA 2VDJA 1GRCA 5GZ6A 2EARA 2ZJ0A 3T52A 5JADA 2VK2A 3PDUA 1A9YA 2YJ3A 3ROPA 4J0QA 3J7TA 1OXVA 1QVWA 1VZ2A 5CJPA 4B7UA 1C0EA 4A8JC 4F11A 5IJXA 1RACA 2VJMB 3OOJA 4WXMA 2X6QA 4OJTA 2LCIA 1WAMA 4YH1A 1KEWA 5IXYA 1SY7A 2EL7A 4HX9A 2BJVA 3W5HA 3X2EA 3IBFA 1EFRD 5J43A 3NBMA 4MUKA 3E9RA 4UNQA 3LL4A 5IN5A 1IUKA 2WSSA 4N54A 1E7RA 3UBMA 1E1RD 2AVNA 1XTJA 1JFTA 1SXIA 3DP9A 2H4HA 2A84A 4L5JA 4KSYA 3C8DA 1U8XX 5IF9A 2X3YA 4XE5A 3CINA 4ZTBA 2DLNA 3EWNA 4LE2A 1G8PA 3EQ7A 3PX2A 1JEJA 1NY5A 2R6DA 4FB4A 4ZVVA 5GV7A 1STOA 3KKQA 1JU4A 1Q50A 3U4IA 2RHWA 4CKZA 3WGJA 4YHHB 2XUHA 2HEGA 3RIGA 3ZE0B 5KTRA 4F93B 3PUWA 4FYPA 4JFRA 5TY0A 3LYAA 3VSCA 2HDNB 4IGEA 1U28C 4PLHA 3WNVA 1FS6A 3H9BA 2NUBA 3FNIA 3Q8WA 4BVLA 2GCIA 3C6ZA 4EY5A 5D3KA 5B55A 5EGNA 3C5EA 4PNHA 4YCMA 2Q3FA 2R68A 3T1NA 4CIBA 1ICEA 2C7VA 3N2KA 3CVUA 3UKOA 2QT1A 2F1RA 2VPQA 3STHA 2VF4X 4TL9A 1A8HA 1JKJA 1H85A 2GTHA 2VC2B 4OHBA 4IWYA 5KYTA 4A8JB 4OK5A 1DP4A 2ZAYA 1CS0B 3TNYA 5H16A 5HGJA 2QD5A 2FEKA 4UAUA 1Y5RA 4TXHA 4ZCTA 2FWRA 3V4PB 4PZEA 1O6ZA 2C2BA 2FR8A 1GZDA 3VR1A 1MG5A 1L7MA 2XVMA 3GVPA 3U17A 3FW1A 3LY5A 4IH4A 4I5FA 4RVDA 2XOXA 4RHUA 4MULA 3GMIA 2PFGA 3GFRA 4BDTA 1W6UA 1VPLA 4LJ8A 5L6LB 3THYA 4PGMA 1MXHA 2UZIR 3D7SA 2XI4A 3M1IA 4DLRA 5LWHA 2V4ZA 3U56A 2CFIA 3VYWA 2W5UA 4JI2B 2ZIAA 3CNEA 5C3MA 1LY1A 4YX9A 3KD3A 1GRNA 5LKRA 3OT4A 3WGNA 5KQRA 1VCNA 4FMCF 2Z43A 3K16A 5ALMA 5KX5F 4WFJA 1GNPA 1UEXC 4PX9A 1NBOA 3JTMA 3CFYA 3H1AA 4U7TB 3E22A 5AH0A 5JPIA 4TKVB 1AF4A 1X80B 4WKBA 3NDRA 4YJ3A 3VR0A 1UINA 1A76A 1R6AA 2WUDA 3KWFA 4UXHA 4AKEA 2P78A 3PGJA 1DB3A 2DHEA 4TRMA 3I5XA 3EDMA 2WQ7A 1K6JA 3A31A 2I9KA 1WM1A 4LA4A 3R7WB 1QJ4A 5I4CA 1N5IA 3KYDA 3AU9A 3GFTA 3D5QA 4WZBE 4YT8A 2AHRA 4O08A 2WJWA 2Q3EA 4BC1A 1O89A 4LY6A 1H3NA 3KDPA 4LMAA 1WUKS 3HFJA 2EZTA 1E4YA 4JUBA 4C0QC 4FWTA 2AN5A 1UBKS 1USIA 3N0VA 2QOEA 3CJQA 3CZQA 2XMGA 4WOBA 4NE2A 2YW9A 4RLSA 3EYAA 1M7GA 1PVDA 1JG7A 4KBGA 4WXYB 5DTMA 4K6OA 3JAKA 1ZH8A 2FWIA 4R8LA 3ZQ6A 5CDTA 4CEJB 3QMWA 3OY7A 3MWKA 1U1CA 5IH3A 4INOA 4RKRA 3H2SA 5H9VA 3RRFA 3RWBA 3K73O 2C2XA 1ZUNA 2FGJA 4XOUA 1HDOA 4Y1EA 4OM8A 3B9QA 3ET5A 4IIVA 3F90A 3V33A 4P3PA 1F0PA 4J0HA 2Z57A 3GO4A 2FLWA 5F9HA 2G9UA 3A3KA 3OSZA 3UFBA 2YYZA 3NJ8A 3GD5A 4JLAA 5FD8A 4Y2QA 3VPBA 3ZHYA 5CYOA 2CL5A 2OHXA 3D8SA 4I36A 3IJ5A 4R2HA 1AUQA 2DFVA 3D2AA 4LAFA 2TYSB 4AJ1A 2PZEA 2QTBA 5C51B 3GLGB 2P9YA 4NK5A 4CMHA 3D6UA 3RFFA 3DEFA 4H7PA 1Y8RB 3VYVA 5JVDF 3D3KA 4M21A 3ETJA 1VJRA 1QH0A 2IYRA 2Q0HA 3BZBA 4K88A 4ER5A 1BFKA 1UFVA 3WK6A 2XB2A 2YUTA 3ZE9A 1DXQA 3ZE6A 4WXPA 3FHTA 4CU2A 1P3Y1 2FWMX 4W4TA 4B4VA 1M3SA 3HZOA 4MRMB 3S4YA 821PA 3E48A 3UCFA 5EP3A 5C32A 1T9CA 4OFWA 2VDLB 3CX4A 1QUEA 4IHAA 3KAKA 1N2JA 5EJGA 4JI3B 3DULA 1H9BA 2ZJOA 3BTOA 3HRKA 3KOUA 4GI1A 4HVTA 5EYPA 5F4BA 5G1PA 1SBZA 2XZTA 1FP7A 3CUWA 4JYCA 3L7BA 5IJ9A 3KELA 3NEPX 1SKYE 2OESA 4OI4A 2B8TA 2I71A 3TI9A 3K92A 4QOGA 5FNVA 3U9LA 4CF5A 5SY9A 5AW1A 2ZBRA 4QDZA 4D4LA 1KZHA 1J8VA 1UBUS 3I1JA 3HPRA 1A69A 3O4HA 3NBZC 3AOEA 1RRKA 4MROA 2PJRA 1Q3TA 1VRWA 3RUEA 5YASA 4Z7JA 4F5DA 3OZ7A 3U62A 3JVDA 2IELA 4AZVA 3BDAA 4B4OA 1VKRA 2PT6A 3T1OA 4EA6A 1QC5A 4L08A 2H9YA 5FUVA 4U2DA 2ZSIA 1E92A 5DBGA 3PEFA 5AJHA 1HUQA 2L42A 4ITUA 4DJAA 3H86A 4YDSA 1HMYA 4LXGA 5TDHA 3KTOA 5BSMA 4Z4GA 4MGHA 2NQ8A 3GAZA 3GLFB 3OY2A 4ANFA 1S2IA 1QANA 4FN4A 4UNNA 4EUEA 3BQMB 3I2JA 3T7AA 2PSSA 1S3SA 4KUGA 5C4MA 2QZ9A 1P9OA 4K87A 3QOXA 2VZ8A 5D7NA 1X9HA 1SUAA 1LPAB 4CF3A 5BN5A 1FTGA 4EP1A 1WVGA 5D1NA 1Y98A 5L3RA 4GF5A 4YJ3F 1KIFA 4I8DA 3MS2A 4OL9A 1E5XA 4P2BA 4B3HA 2YX1A 5AW3A 5IC5A 1PR9A 4C5BA 3ZDFA 2WNHA 1B1AA 2PEZA 1K9SA 1E1MA 3PCXA 1G42A 4KV9A 4XWGA 4U2GA 5BWMA 1TCUA 1VSVA 3M5PA 4TZKA 3FH0A 5FR2A 1YCGA 3AR2A 2I2BA 2FEXA 1XDGA 5DYNA 5L3SA 1FDWA 1PJSA 1H2AS 2WQ6A 1SK9A 5E0KB 1TEXA 1ETHA 1IEVA 1J2UA 1P6XA 3Q2OA 4PQEA 4LZJA 4TVKA 2VBGA 2QWXA 4E09A 1PV1A 1E2PA 3LZ6A 3K5IA 3MRTA 2J9XB 3T3MB 1QAQA 1OXTA 2P2NA 1P5JA 4IWNA 4BQSA 2ZTVA 3QJGA 1ULHA 4TV8A 3UK0A 1V6AA 1L7VC 3GCXA 4Q37A 4YWHA 1ST3A 2IXFA 4G0PA 5T4EA 3GEDA 2PMEA 3VMFA 1CSEE 2VP2A 5SY4A 3GFVA 5KKAA 3UT5A 1RWWA 2QTNA 3P0JA 1NONA 4BGIA 1WV1A 4G5OA 4H0FA 4NHEA 4AS1A 1L5WA 3OBBA 4FOPA 3BH0A 3I0MA 4FMCB 4DZRA 2UUOA 1PYDA 1TOAA 3X44A 3HKCB 4C0XA 2O8EA 1XQWA 1UIMA 4JOBA 4V0ME 4QDOA 4ZYLA 4M8KA 2P6OA 1I4OA 1EXVA 2E49A 2FMFA 4FE7A 1WUYA 1F6WA 4RL6A 1UJ4A 5DYWA 5AHXA 1SUCA 3MGAA 4C04A 2GRAA 3MWLA 3ENVA 2X0JA 2G83A 3BXOA 2D59A 2X4GA 1SVSA 3PNVA 4R0NA 4G97A 1NQOA 2QQEA 3K5HA 4OXRA 3C6YA 3W05A 4AECA 4CIDA 3W2GA 2J7PD 4OP1A 3F67A 3PGMA 4GR9A 1UAAA 4AZ3B 2Z2XA 3FVTA 2W48A 4XLTA 1UM8A 3EJ6A 4DE5A 1PGOA 1GUAA 3A9VA 3VPSA 2XYGA 1NP7A 3GMSA 6CHYA 2NTEA 2GCOA 3DHYA 3G0BA 1EFVA 3QVJA 5DRTA 5I3ZA 2KSQA 4Y6GB 5J5VA 3W5CA 1LBIA 2XAUA 2VYQA 3ZLTA 2VAWA 1Q0UA 4OF4A 4CQLA 4Q6WA 5INTA 5JFTA 4JI7B 5FNVF 3X2FA 4XUGB 4G0VA 3DD1A 3GJ5A 3SJBA 1GDTA 2CDAA 2PYDA 3NGXA 3QFFA 2C42A 3GEBA 4JLUA 4A4DA 3TLGA 3SIRA 1D2NA 3N58A 4BVKA 4MYSA 1GNSA 3JYNA 3CUKA 1I1HA 2VJQA 2YJGA 4F7DA 3USZA 1B7GO 4D96A 3VDNB 2E1PA 1KEKA 1P2VA 3KXKA 4RF4A 3ZJVA 2EZ8A 1NF9A 3CRNA 3MYRA 1G4HA 2B78A 1A9QA 2Q4RA 4BIMA 1TTTA 1WUTA 1Y63A 1I3MA 2EGGA 3KJQA 2IYYA 3TM5A 1E9CA 4GX1A 3IFSA 1P1CA 4I5EA 5JVDB 4DIMA 1XU4A 3T4XA 4N41A 2ZG6A 3EVNA 4GP6A 3JQBC 4G65A 3BHNA 3HDHA 1GNVA 5D00A 3T4EA 4BKOA 2OHHA 1VTKA 1SUSA 1EFRA 3LS2A 4WA7A 2ZSHA 4KDCA 5CA1B 2FMIA 4K9KA 3D1LA 1V2GA 1I3CA 1SBHA 1OYVA 4HDNA 4P5DA 1WZEA 2QRHA 1F06A 3LM8A 1U3FA 3PE3A 3JQ6A 2IYTA 3EVGA 3DBRA 1I14A 1GKIA 2BZ1A 4GI3A 1DMRA 4R0VA 3ESYA 3RIHA 1YB7A 5A06A 4MJXA 2JI7A 1YDEA 3DA8A 3NAZA 1N4AA 1W36D 3BF7A 4WUTA 1CRWG 2HF9A 4RH1A 5AKXA 1W5BA 2WM2A 3QVVA 3ZYCA 4PGFA 4OIMA 4GZ6A 4E51A 3I6QA 1M5TA 4J7UA 4Z9YA 1B23P 4EKGA 3LT2A 4TTRA 3JASA 5KNLA 1EX1A 4O33A 3CVXA 3WP1B 1SOUA 3SHTA 4YMGA 4P32A 8LDHA 2VJLA 4TTPA 3L8HA 1ZOIA 4HWSA 3CEHA 2O1SA 4MJ7A 2NU6B 4JASB 3MAJA 3FM9A 3NKVA 3SFTA 3EEYA 1KJNA 2ODBA 1H4VB 2PA3A 4F9GA 5F78A 2G82A 5EMNA 4H35A 3AR9A 1GQOA 4PO9A 3T7SA 5D5PA 4JLOA 4B6QA 2VHTA 3OLYA 3QY9A 3VZBA 3PIIA 4IDOA 4ZANA 1F0KA 4BV8A 2W93A 5IUNC 1XPRA 2A5GA 2X7JA 3F8SA 1HH4A 1INLA 1L7NA 3WRYC 1XCJA 1Z73A 4U6QA 5ALTA 4XVUA 2V8OA 3HXTA 3MCAA 3A3PA 4LVUA 3SVZA 4FT4A 2AJBA 5EE3A 4BNIA 4LNUB 5JCXA 5AJZA 2IU3A 1VMDA 1GPDG 1TC2A 3U40A 3H4MA 2ZIUB 2VSFA 2C77A 4O5OA 1UMCB 5JISA 1HXHA 2MR6A 4L7QA 5E9JA 4Z0HO 5I45A 3AP2A 5E95A 1S96A 3GEMA 4Z4EA 1J8FA 2E5WA 5ALXA 5CIWA 3LPLA 3OOYA 4X1YA 2E7ZA 2QM0A 1N8KA 3UMFA 1DADA 4PVDA 3ABIA 4OAOA 3RGGA 1P72A 3OMWA 3OIDA 2BONA 1I4LD 1FJGB 3BULA 4GPEA 2B6HA 4YDRA 1YK0A 2GPSA 4AC9A 2IBTA 2CLCX 1ZUNB 5DV9A 3HYCA 3OM8A 5K6AC 3NOXA 4KI0A 1RZ3A 1NI3A 3H3JA 1E2QA 3NAQA 4L4YA 3X1YA 2IYQA 9ATCA 2YVAA 1WCIA 3HYSA 4ZYTA 1KI8A 1YCDA 3R23A 1W88A 4ZI3A 3QUQA 3GBPA 4LJ6A 2XYPA 4QC2A 2VHQA 5BV8A 2NPFA 1GL9B 1I6KA 1CUGA 3N8IA 5KPJA 2NVUA 2FPLA 1RBYA 2FZGA 1SURA 3GI1A 4LGCA 3H42B 2O7SA 4PR0A 3VNQA 1G0OA 1B8NA 3VR3D 1AHPA 4RVCA 2XBMA 4YRJA 3ZH9B 1J33A 1VYHA 3F5SA 3MQ2A 2FZVA 3OZSA 4HUQA 1YFLA 3GVHA 3DMRA 1ICIA 1V8DA 4YXFA 1NGSA 3A2NA 3HO1A 3UIEA 3BICA 3O7WA 5DE3A 1LV7A 1XF9A 5CX4A 3WSTA 3U4MA 3ELBA 2TMGA 4DV6B 3WJ1A 1AGYA 1OFGA 3PFCA 3VNBA 4YRFA 1VIVA 1IYZA 4RLHA