1TPZA

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
402
structure length
395
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interferon-inducible GTPase
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 147
structure length 395
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tpzA02
2W6JD 2BWJA 3ZIAA 5JHHB 2B6HA 1Z2AA 4L8GA 5BWMA 4HAXA 3O8CA 2HF9A 4TYNA 3U5ZB 1J70A 1G21E 4GL2A 2RGDA 2A3RA 2CLSA 4JYBA 3B78A 2QAGC 3MRSA 2ZPTX 3LXRA 4A8JB 1AM4D 1KK1A 3B1YA 1WP9A 2FN4A 5JEEA 2GJAA 1E4VA 2RGCA 3NBFA 5IK2D 1XJ0A 2P6RA 4QM7A 2CL6X 2ZRCA 1XEFA 1VCNA 4CEIB 4W5JA 4ZDKA 2QUZA 4ARZA 3WP1B 1DVRA 1IXRC 4JYCA 4D82A 3Q5DA 621PA 3O47A 1NLZA 5KPJA 5GJVC 2WKQA 2OV2A 5CJPA 3AVPA 4NHOA 4RZ3A 2AL7A 2OM2A 3OFNA 2ZYWX 3KKMA 3VX4A 2QTVB 4CRWB 3BB1A 2G9NA 1FNMA 2NMVA 1KO4A 4Q47A 1TQ4A 4ZDJA 3DDCA 5EE0A 3AF2A 4DCNA 2ORWA 4TQAA 4RD3A 4A8JA 3A1UA 5FBVB 4YQFA 5FR1A 5J4LA 1GFIA 1NN0A 4FXPA 2HJGA 1CJVC 3N2EA 1CKEA 1C9KA 2QROA 2IC5A 1M7GA 4R71A 4CEIA 2RGXA 5CLLA 4I99A 3R9XA 2Q3MA 1UDXA 4HLUA 2I1VB 3VKHA 2XNDD 5FBQB 5LBIA 4A2PA 4QBHA 5FBWB 4FMCF 3V4RA 3T5GA 2B92A 4BFYA 5EXXA 1GRRA 3CH5A 4BFWA 5KSOA 4Q01A 2PL3A 5IDVA 3RS0A 3UANA 1S9HA 5L3SA 3NBZC 3OEHD 5FR2A 4OK3A 1HEIA 4WW0A 1E9BA 1GL9B 5L3VA 4TLBA 4TSFA 1QBKC 4Q7LA 4ZPXA 1LF5A 2H5EA 1I4DD 4LBYA 2ZRGA 3W9YA 1GL7A 2GJ8A 5JWRA 1DARA 5HCNA 5JI3E 2ZRIA 4WZBE 1HY3A 2FGJA 3QI2A 1PLJA 3QF7A 2CXXA 1P61B 2QMEA 4UNSA 1B23P 3CF0A 4QRHA 1XXHE 4M1OA 4KVGA 3T61A 3G0HA 1GAJA 2DBYA 3GLGE 1E2HA 4M2LA 1G6HA 1P2UA 2R6DA 2JASA 1K5GA 2UKDA 1DG3A 2Q9BA 4AURA 4XTRA 1RRCA 4LWZA 3C41J 1SGWA 4FCTA 421PA 1JI0A 1G3QA 4I1SA 3GJ8A 3FB4A 4ACBA 3K9HA 4URYR 2AXNA 2AX4A 4Z8YA 1GNPA 4RJLA 2IS6A 3RNLA 1G8PA 1KNXA 521PA 2GEVA 1KKMA 4C0LA 2WPDD 4IOLA 1IM2A 3LVRE 1II9A 1N6OA 2CNWA 3J81k 3EPKA 2JATA 4KCGA 5CK5A 2O8FB 4MYCA 1S9DA 3ADKA 3CX8A 3LDAA 4PC3A 3GLFB 2FPLA 2FE4A 1HV8A 2ZRAA 2ZYVX 1Z0DA 3B85A 5JFGA 5G40A 2C95A 2CEAA 4MGIR 4JLNA 4ZKEA 2P2LA 3TKLA 1G19A 5FL7D 4YMUA 2PLRA 1AIPA 3PCRB 3GEHA 4BZPA 3PJRA 1FTNA 4EFNA 2ZM5A 3GJ3A 3T5DA 2VLIA 1D6JA 1NF3A 3A1VA 4JLMA 1F5NA 3ZZUA 4QJ4A 1G3MA 2BCGY 2ZJBA 1IN8A 2CLCX 2E9SA 1E69A 3GMTA 5CIQA 5DHAA 1MKYA 1NI3A 1RRFA 4PPGA 3B13B 4MYHA 4U7DA 2GXAA 3M6AA 4KLNA 3CKLA 3R9IA 2QAGB 5DN6D 4BFSA 4QM6A 4B48A 1E9DA 1BS1A 1T8TA 2CLDX 1ZNXA 3JZMA 4XWAA 3T12A 1U0LA 1Z63A 2QL6A 3C14C 1G1MA 1UEIA 4HB0A 1RFLA 2DY1A 1NLYA 5FPHA 5JECA 3ICEA 3MWLA 3FTQA 3OEED 4A1FA 2GXUA 2YVUA 4QGAA 2HYDA 2IS4A 1PJRA 3U4QA 2V4ZA 1CULC 3DZ8A 1QHNA 4PQFA 1X6VA 2NIPA 1KSGA 5KU1A 1DO0A 3AF3A 4ILEA 4KFTA 2Q21A 2YC2C 2IYSA 1F2UB 1IONA 4XD7D 1ZBDA 4IXNA 2QAGA 2H18A 5GVSA 1NBMD 4GP6A 3U60B 2W2TA 1E1QA 3K53A 4JJZA 2DWPA 2JLSA 2JIZA 2NO6A 4WAUA 2F7SA 1RJ9A 3I5XA 1TNDA 4DDVA 3CO5A 1S1CA 4A0FA 4G5OA 3EZ6A 1JEDA 4P31A 3A1TA 1VG8A 1VIYA 2HEIA 4FMDB 1HTWA 1ZUHA 3I3SR 2ZI5A 1IY2A 4FD2A 2MSDB 5F2EA 1DAIA 2PZFA 1F2UA 3SBDA 2J0VA 1OYWA 1W4CA 1SKYB 4EDHA 1OJLA 1SVKA 3I4LA 1QZXA 2QQ0A 2L0XA 3OE7A 4P0TA 4AG6A 4Q4JB 1G3RA 4JLBA 2JJ1D 4ON9A 3W3AA 3D3QA 2ANCA 4N0EA 4TL7A 5CB8A 3SQXA 4WBSA 2W2XA 3HJNA 3NH6A 3P32A 5SZKB 1SULA 1KK2A 5FI1B 4V0NA 2EFGA 1JBKA 1YZGA 2NO1A 2P6UA 3EZFA 4E5UA 5KO2A 2X19A 2GCNA 3K0AB 1TMKA 3WNBA 5CITA 2ZRHA 1TU4A 1Z8FA 2OLKA 4A2QA 4DDWA 2Z83A 3OIWA 4XOIA 1S3SA 2FH5B 2UVQA 3BS4A 5G53C 3LQRA 4DZZA 1NY5A 4I1UA 4J0QA 4LHYA 1BH2A 3W5IA 4ZIRA 4TL6A 1HQCA 2PX3A 1AK2A 4JVSB 5D3QA 1CR1A 1AQUA 3QVUA 4RY2A 4B6FA 1E99A 4Q4JA 4RD0A 2ONJA 4LYFA 2XB4A 3K70D 2FV8A 4BFTA 5K8TA 4R9UC 3PUWA 1JQLB 4IEEA 1N5KA 2XZLA 3AP1A 2W2VA 1Y63A 1J7KA 2IYTA 1Z29A 2W6JA 4HAVA 4B3CA 2JLXA 4HDCA 4KYIB 1ZD1A 3AP3A 1NSTA 1Q12A 4BQSA 2O8EA 4PSAA 4DLVA 3HU1A 3GLGA 1XCMA 5EUQB 4JVLA 2VHUA 4KSBA 3WBKA 1XCGB 4MYTA 3TW4A 5IK2A 5HCIA 1VKJA 3QPUA 4B3XA 2ZE8A 4URVR 2JAQA 2ZR9A 1YVDA 3ZS9A 2KE5A 4HLDA 3FMOB 2ZREA 4CIDA 3RRYA 1XWIA 2OXRA 4YMSA 4DEXA 4TLAA 3CM0A 3QBVA 1TQ6A 4DJTA 2A5JA 2P5SA 4R98A 3ZVLA 5DISB 2V9PA 4ABYA 1U2RA 1E2PA 3I1FA 3NG1A 2GXSA 3RSLA 1GRQA 2RKOA 2V8OA 1DADA 5GADl 5AR1A 5DLQC 3K0FA 3FHOA 1DAEA 3GEIA 4DBLC 4OBEA 1VHTA 1D2MA 3AUYA 4DKXA 4IKEA 3CRQA 1CJUC 1Z0AA 1D2NA 2PX0A 1X86B 4II7A 2FJUA 1RRPA 3ZGXA 1X1SA 2XNDA 3KTAA 4G5GA 1P9RA 2QENA 1E0JA 4B6EA 1VYTA 2PCLA 1LTQA 4IDOA 4F7WA 1N2CE 2ZJAA 1QHXA 4A92A 2EU8A 4Q4HA 1KAOA 3TMKA 2ZI7A 5DI3B 3OEHA 3A4NA 4CF7A 3ETLA 3R8CA 1KDOA 1XP8A 1F3OA 2FG5A 4JT4A 1EFRA 2R6FA 3KKQA 4B73A 4NCKA 1NG9A 3SOPA 3QF4B 2ZE6A 1HQYE 1KJZA 4HUQB 3X1YA 4A6PA 1ONBA 4ZV4A 1OXVA 4BLSA 3U3OA 3GPLA 2NOAA 3W6PA 2AK3A 5EZ6B 4LUCA 5LD2C 4MUAA 2HT1A 3TSOA 3UMRA 1CR2A 1N6PA 3MJRA 1XTRA 4A36A 2QBYB 2V54A 1YR6A 2ZROA 2G88A 4V0MA 4XH9B 3MSXA 3TH5A 2BVNA 3PENA 1KKLA 5FPSA 2DFNA 2J0UB 4Q1CA 4QHSA 1YKSA 3RS5A 4JLKA 3DKVA 4I81A 4DRZA 2ECKA 2QA5A 2ZRBA 1PUJA 1SVIA 5EP2A 2NQ2C 5JWHA 3QF4A 1AZSC 3VR6A 4B3FX 3THYB 3CUEF 2LWIA 2ZRLA 4E22A 2W6ID 1EXMA 2WWFA 2RCNA 3OIUA 4LJ7A 5FUWA 5BW8A 1AN0A 1NVXQ 3WMGA 1Z6GA 2RMKA 4TTRA 3CRRA 2XXAB 3F3YA 1GG2A 2WPDA 3MLEA 2JLRA 3D8BA 1DS6A 1IN6A 1ZRHA 4TZ0A 1DO2A 3LY5A 2MSCB 2QBYA 3C5HA 2LKCA 4D4LA 2KI5A 4GOKA 4DVGA 2JDID 2J0UA 3TE6A 1Z22A 3RS3A 2VP5A 1R0XA 2QP4A 5FL7A 1QHSA 2DHRA 1Z06A 2BMFA 2GWHA 4JZKA 1Y3AA 1AGPA 4FN5A 5JS8A 1HT2E 3THYA 4YXWD 5FTNA 3CF6R 1SVWA 1G3IA 4LOAA 3SYNA 1E9SA 4F4CA 4L4UA 1RVDA 3D6TB 4G0NA 3NKVA 4JLDA 4PHGA 4B2PA 3NTUA 5FTKA 4PHHA 4M1MA 2VQSA 1XXHA 2IYQA 4PC2A 5H8WA 1CJTC 1SXJC 1KDRA 4U02A 4Q9KA 5DN6A 2E87A 3EC2A 3U7GA 1YR9A 1WB9A 3AVWA 2F6RA 3LX5A 4E07A 1Q22A 1J90A 1G9XA 1ZVQA 3VKWA 4JJKA 1FX0B 1FUUA 1TUIA 1ZUNB 3W8RA 3Q85A 1KSHA 1JXMA 2EFDB 1SQ5A 2OFWA 4HDQB 4WIAA 5TARA 2OCBA 4IVPA 4LCBA 1U8ZA 2BBOA 5KPDA 1G4UR 3R9WA 1XMSA 1OKKD 2BC9A 4DLZA 2P6NA 5KDLA 1FQKA 2IUSA 2X2FA 3BH0A 2ZEJA 3PQCA 2VYFA 2G77B 2GETA 1NJGA 3BFKA 2R8RA 3CB4A 4XSGA 1R5BA 1T9HA 3VHXA 4RSGA 1E3MA 1S4QA 1G7RA 4XD7A 3LBHA 3K9GA 1CXZA 2ASEA 2CE2X 1G3UA 3X1WA 3ZYCA 2OE2A 3CPHA 3W34A 1NBMA 5FPKA 1KO7A 3GLIE 3TAHA 4V0OA 4TMWA 4NMMA 3DKPA 4Q1FA 1ZC4A 2O5VA 2ATVA 2QPTA 2ZSBA 3OF5A 1KI2A 4GZLA 5A4JA 1IBRA 2IXFA 2J1LA 4AIIA 4UNRA 2Q9CA 3C4JA 3BC1A 4PHTA 2QN6A 4TYYA 2REOA 2VSXA 1Z5ZA 2ZI3A 3EAQA 4B71A 1UBFA 4XVRA 5EJEA 1AS3A 4YDSA 1ESMA 5KTYA 2IHBA 3KQUA 5FOTA 3LXXA 2IWHA 3PUXA 3M0EA 1KYIA 1NVVR 4YC7A 1XJQA 2DWQA 3PUYA 4UNNA 2JJ1A 4HLUC 4DCUA 3GLHB 4ZCIA 2ZJ5A 3A58B 4R2IA 3WYAA 2FMXA 2X1VA 4A82A 4PZLA 1XD8A 3ZH9B 2O8CB 5AJXA 2VHQA 3W8NA 4PXAA 1JR3D 2IS1A 5C18A 5LD2B 2WVJA 1JAIA 2YWFA 4IEIA 3TUZC 5EP4A 4P4SB 3EA5A 1R5NA 4K8OA 1BO6A 1CLUA 2WJGA 2OBMA 4AD8A 1KMHB 1ZP6A 1CS4C 1OFHA 4GDFA 2F9LA 3B6EA 2IXEA 4K46A 4GMDA 3AVXA 2ZE7A 1JQJC 3C8UA 3GLHA 2H16A 4WXPA 3TQFA 3EZ2A 2W58A 4Q5IA 4PO1A 5KSYA 2C78A 1GNRA 1NKSA 3C15C 3Q72A 4MKFA 3RWMB 3U3JA 2CMKA 2EFCB 4PPQA 1SVSA 5TDHA 5JJLA 4U5XA 1M34E 2PMDA 4GOXA 1J99A 4PFSA 4PQYA 2FFHA 4P4SA 4UXJA 1E32A 3WBJA 4PC7A 2IEYA 3VNVA 4BLPA 1NVVQ 1CU1A 1E2FA 1DTSA 1KMHA 1OH7A 1OF1A 5SZHB 3CRW1 2CJWB 3V00A 4DB4A 4NCIA 3IKJA 1QVRA 2O0HA 1P75A 5EE5B 3HP1A 5FI0B 3G82C 5AJVB 3UG6A 5FOUA 3NDBB 3W6NA 2HCBA 1SKYE 1NVWQ 2R62A 1QG2A 2ZANA 3IIMA 4NU0A 5AJWA 5F3WB 2FZLA 4C3ZA 3X2SA 4IW3B 3EPHA 4DT1B 1SXJB 1G8GA 5J4KA 1DPFA 1W5SA 3AVOA 4H9GA 1KZGB 5L8VA 4OHVA 4JS0A 2AHOA 4IDNA 4PSVA 4JSYA 1CRQA 1IY0A 4AC9A 4CEJB 3AEZA 2CJWA 4M9SA 3EG5A 4RKEA 2OAP1 4M1YA 1KI8A 4B74A 5J4VA 2WKRA 1Q1BA 3IHWA 4X8HA 4CDGA 2I1QA 3EWSA 2IUTA 4TYQA 3L8ZA 2XAUA 4CEHA 4IFEA 1A7JA 5JEDA 5KNBA 4TL8A 1W49A 2ZRNA 2ZU0C 4NCNA 2JLUA 2FA9A 2B8TA 4NBSA 4LC0A 4DT1A 1W2GA 2IF2A 5FOSA 4ARZB 2OCYC 2QTHA 2QZ4A 3AUXA 3SN6A 1VCIA 1G18A 4D4KA 4ZO4A 3QKTA 1H8ED 3WHLA 2QMUA 4CEJA 4HDOB 1YHNA 3U7HB 3MAAC 4D0NA 4C2TA 4BEBA 5JS7A 1XMJA 4RD2A 1CR4A 1J8YF 1V5WA 5F98A 1GKYA 1YQTA 4D26A 4KXFB 2QSZA 1T0HB 1GSIA 4QBIA 2IYYA 1P2VA 3FPAA 1ZJ6A 5FUVA 4AKEA 3K9LA 2C9YA 2GBLA 3K8YA 1MRSA 3NVAA 4NE2A 3FFAA 2AR7A 2AKYA 2OHFA 4AG5A 5IT5A 3EPJA 1VDZA 4KSCA 4Q1BA 2OAQ1 4D25A 2HYIC 4DLSA 2VHCA 2J0SA 2BMJA 3AF1A 1NL3A 3SZRA 4BPBA 3PIRA 1ESNA 4S35A 2V6IA 2P0EA 3QXHA 1COWA 1W4BA 4B75A 1RIFA 2W6IA 4DLUA 1TQ2A 1TEVA 3GJ7A 3ND8A 3U6KA 1KO1A 3BGWA 3SFVA 2Z43A 3LLMA 1Q0UA 2OLJA 5L3SB 4GOJA 5FOXA 1SHKA 4IDHA 4EPYA 1W48A 1RPZA 5EE9A 3FDIA 3TK1A 3VTKA 1G64A 4O0MA 5C2JB 3ADDA 3P20A 2JDIA 3RS7A 3N5CA 3AGQA 5DYIA 2ZETA 4Z1MD 4QJ5A 2JLZA 4BFUA 4MGKR 1A82A 4YDHB 3LD9A 4E03A 1IJEA 4YXWA 2QORA 4TMXA 1U9IA 4DCSA 3W5JA 1FQJA 3KQHA 1S0UA 1XZPA 1Z47A 1NMZA 1E0SA 2C9CA 1FUKA 1J2JA 4GPTA 2D2EA 2IWRA 1QVAA 2BJWA 2VF7A 4JSTA 2QE7D 3U7FB 2IYXA 2ERYA 2BEKA 3AV0B 1QDEA 1E2NA 3CPJB 3LW8A 1R5OA 3DOFA 3SJZA 3CR8A 3BD9A 4DDUA 2JLVA 5CYOA 2BKEA 5JRZA 4MUBA 2JJ8A 3A1SA 2REXB 1OKKA 4TZ6A 4GP7A 5BN4A 5AWFC 3LX8A 1EFUA 3T06B 1KI3A 2DPXA 2Q3FA 2UZIR 3P4YA 3ZVNA 1G17A 3DMDA 4K81B 4OHXA 1A1VA 4CT4B 2ODEA 4LYHA 3RAPR 2Z4SA 3KKNA 1EWQA 3AF0A 1Z0JA 3ASYA 1N0UA 5DO9A 3TSWA 1G7SA 1RZ3A 2PEYA 2IYZA 4BEJA 3VR3A 2ZAOA 2BBSA 2G3YA 2A5YB 1Q57A 4MRNA 1LFDB 4TN1A 3TJZA 2WSSD 1YZLA 2AWOA 2OO7A 4YMWA 3BIFA 1KI4A 3RWOA 1RYFA 1OW3B 5EXSA 4OKSA 1EX6A 1QHYA 5HPYB 2BCJQ 3SYKA 1U90A 2YOGA 1Z0KA 4D2IA 2C8VA 2Z0MA 4BZQA 4F92B 4JMPA 2H7VA 4ACAA 1VMAA 2WWWA 2R9VA 1IN7A 3EIQA 1T3HA 2OFXA 1AKYA 1E2GA 2AXPA 1AS2A 1XEWY 3U4QB 5HKKD 4DWJA 5B57C 121PA 3H84A 1KNQA 4EPTA 3IBGA 1S2MA 3KXLA 3KXIA 3ZQ6A 4ESHA 1JR3A 1FL9A 3RLFA 4F93B 1EX7A 3TSZA 5TB5A 3N2IA 1CJMA 3EIHA 1NJFA 4Q19A 4G1UC 3WXMA 5F9HA 2FFBA 4L16A 4DLRA 4F91B 1ZM7A 1HE1C 3ZD7A 1M1YE 3A37A 4IFBA 2Q0HA 4BLQA 4JT2A 2HXSA 1RJ9B 4DCVA 3C7KA 5CM9C 2BHRA 3KJEA 2YYZA 1XTQA 3LV8A 2G83A 3CH4B 1KHTA 1T6NA 1FP6A 3GLIA 1LF0A 2DR3A 2GZDA 4EFMA 3BRWD 3TUJC 1G8FA 2YWHA 4ZI3A 2QM8A 2QT0A 5FH9A 5DNYB 1UM8A 1Z83A 3FWYA 1U98A 1ZMXA 4KJZA 1GILA 1KGDA 2H57A 3B1XA 3FHCB 4MDFA 5FUXA 1OH5A 1KAGA 3FMIA 3SYLA 1JJ7A 1XZQA 3TIFA 1OIVA 1DAKA 1OFTA 4QNMA 4IDPA 4DLXA 1XPUA 1KI9A 4MA4A 1EWRA 2ATXA 1L7VC 2D06A 1E2JA 3DZDA 4UKDA 5LB4A 5J4HA 4OI4A 4PPNA 3E1SA 4PAOA 1YU9A 4N3NA 3P27A 2H17A 2WSMA 2HDNB 1WE2A 4OJKA 1R0YA 2J59A 1XFAA 4MRPA 4B3DA 1UBEA 3HR8A 4ZCLA 2ZSEA 1FNNA 3AM1A 4YMTA 3TNFA 2IYRA 4ZIRB 4BASA 2Z5FA 4YONB 4JKIA 1F6BA 4GZMA 2ZJ8A 2H1LA 2R6AA 1E94E 5EE3A 3G5UA 4IVQA 4BE7B 1XCPA 1G5RA 4HSEA 4D81A 1XDBA 3EASA 3A8TA 2I3BA 3HDTA 4HZUA 3QEJA 3NC1C 3QXXA 4DEYA 2FSHA 3DM5A 3EARA 4IOMA 1G7TA 1W5TA 1X8LA 2F43A 2ZVPX 4JL5A 3R20A 3FOZA 1Z07A 1OB2A 3VX3A 2IT1A 4IHQA 5G3ZA 3RABA 3SJAA 2YOHA 4US1R 4DSTA 2XTZA 2BOVA 4Q02A 4B35A 2G6BA 4A2WA 2O8EB 2GAAA 3SS8A 3WYFA 2EYUA 3GLGB 2FNAA 1TF2A 2RGNA 4M9ZA 3AVTA 4LBZA 5TV2A 2GJ9A 2V3CC 1WA5A 2H8KA 1P60A 4QGHA 2J41A 4UNPA 4QHTA 4DIDA 1S3GA 1T5IA 1JJVA 1OH6A 3WRYC 2C2HA 1VECA 4M0LA 4C0BA 1HH4A 1Z08A 2BBWA 1H8EA 4M21A 2GNOA 2VBCA 4XSHA 3LBNA 5EZ5A 1DE0A 4LY6A 4DC9A 1GWNA 4M1TA 4BECA 4QGFA 4OYHA 1W36D 4W5HA 1Z3IX 2ZI6A 4G5SA 4RKFA 2X8AA 4JLOA 2JA1A 1E2MA 2CCKA 4Q7JB 1TQDA 1ZM3A 4L15A 2GA8A 2WWGA 3WP0A 1V43A 1IAQA 1XEXA 1MH1A 2HUPA 3MWKA 3SE0A 5EXPA 3K0FB 4QC2A 4HAUA 3TR5A 3WY9A 2HXYA 3Q8XB 2QI9C 4IOJA 1A2KC 2XZOA 2RB4A 1N25A 4QOSA 2A5DA 3GEEA 3F0TA 3FKSD 2AK2A 2WOOA 4PO8A 3VR5A 2ZRPA 2Q9AA 2NGRA 3BFXA 3CZPA 3KTAB 3L43A 2V1UA 2WWIA 5GJWC 1KSJA 1U0JA 4LX0A 3A6PC 1OT3A 5M04A 1ZM2A 4C7OB 4Q4HB 2FU5C 4BFVA 1G5PA 4M53A 3SQWA 3P26A 2ONKA 5HZKA 1K5DA 5EQTA 2ZJYA 1E4YA 4URZR 4HI0E 2B7BA 1M2OB 2WM9B 4QGGA 3I72A 4JBYA 3CW2A 2BIFA 1Q1ZA 1JALA 4CT5A 2GJKA 3KKPA 5JBQA 4C0KA 5J5CA 1BIFA 2JGNA 4C9BA 3FHTA 2DYKA 1NSFA 1ZU5A 1P72A 2ZRDA 3UG7A 2IHYA 3H86A 1GKUB 4C30A 4XWKA 1WF3A 4Z1MA 1W47A 4QBFA 1UKVY 2IYUA 2BKUA 2RAPA 4MYUA 4TYPA 3VKGA 3CLVA 3T1OA 4BLOA 3DVLA 3GFPA 1DAGA 2P67A 4C7OA 1E9FA 3FFBA 3AVQA 4LV5B 2CHQA 4CGZA 3TAUA 2WICA 5DYGA 2RGBA 1C1YA 2DCUA 2AWNA 2OCPA 1KDTA 5SZIA 2HLDD 1QHIA 1KSFX 3HU2A 2WWYA 2GEDA 1AS0A 2RH5A 4DSUA 2QE7A 2WBLC 4N0DA 3K70C 1G8YA 3JVUA 3RSOA 4BGDA 2W83A 4FIDA 3TVTA 1HUQA 2QNRA 2WV9A 4B47A 1JB1A 2IW3A 1TEXA 3L0OA 5LPNA 4A0GA 3GD7A 2ZSDA 2B8WA 1W36C 1K8RA 4GBMA 3SR0A 4BLRA 3RRNA 1Z6TA 2P3SA 1Z2CA 2ERXA 4OQNA 1W1WA 2CCGA 1P9NA 4TWZA 2QMHA 1KK0A 3AGPA 1T3SA 2VHJA 2JLWA 2F1RA 2OILA 3CX7A 1NIPA 4LYAA 4C0SA 1UAAA 2C03A 1L8QA 4DB2A 4FI3C 2CHGA 1OFIA 4S2EA 3T34A 4KAXA 2J45A 2ORVA 2WMNB 3LLUA 4BLTA 4FWIB 2OEPA 1NY6A 4TLCA 3CF2A 1R7RA 2ODNA 1DAHA 4HATA 1OHHD 1OLOA 2WSSA 3EX7C 3Q9LA 1XXHB 3FMPB 2BDTA 3I61A 2O0JA 2VSOA 2YC4C 4IVRA 1AZTA 4HEJA 4JLJA 3OZXA 3TW8B 1FP7A 3W3ZB 2O8BA 1I2DA 1W0JD 2F9MA 1VYVA 2C98A 3DOEA 4B2LA 4Q7KA 1HURA 2HF8A 4ZDWA 3R7WB 4LJ9A 2TMKA 3KUCA 4QXAA 3SHWA 2VL7A 3GFOA 3KZ1E 1A5TA 6Q21A 1G6OA 4JVMA 5FUYA 3ZZTA 4JBXA 3T15A 4P33A 2OT3B 2IK8A 4G5RA 5HKKA 1NIJA 4ZI2A 1U0HC 1ZM9A 4V03A 1EFHA 3QNUA 3I8XA 3FE2A 4LPKA 3U6BA 4R7ZA 3EC1A 1E2LA 2ZRFA 5GJBA 4EKDA 5TY0A 2NPFA 5JJKA 1M6NA 1LS1A 3BH7A 3R7WA 1FOEB 2QGZA 1R8QA 1II8A 1MO6A 1Q21A 2EVWX 2P5TB 4AYTA 1HE8B 5DI9A 5BYJA 3Q5EA 2XITA 1KY2A 2ANBA 1VG9B 3OEEA 4FCVA 1II0A 3B60A 1P4SA 1XMIA 4TLDA 3ECCA 1MV5A 3M1IA 3CWQA 3SU8A 2N42A 3W90A 4AY2A 5EUMA 2F1JA 5AUPB 4P3YA 5P21A 1P2SA 5EXTA 1D8TA 2GBLC 1VCMA 2ZQ5A 1E2QA 3BH6A 4PTLA 1Z0IA 2XJ4A 2ZUCA 4NH0A 5CM8B 4HB3A 1XNJA 3BORA 3T1QA 2FEMA 4ESVA 4UJ5A 5FOWA 5HTKA 2WIAA 3PV0A 2I4IA 4MKHA 4URUR 3DM9B 2A2ZA 4PHFA 4QJ3A 2NTYC 3F5FA 4MH0R 4PR0A 4JL8A 1VG1A 3AKDA 1N0WA 3AKCA 1TX4B 2N1BA 3QG5A 3K0SA 1UBGA 4IDQA 3GLFE 4KITB 1UF9A 3EPLA 2FGKA 3NEJA 1RRGA 2FEOA 3BK7A 1H65A 1BOFA 4Q4LA 2FF7A 4D0GA 3NWJA 3RANA 4KYUA 2GCPA 4H1UA 4I1VA 1T91A 4JVNA 4Q03A 3LO5A 1M8PA 3ZLJA 3LQQA 1EGAA 1OXSC 2FX3A 5B64A 2BM1A 2ZSFA 3QY0A 5TVKA 2VHTA 1JEEA 2J7KA 1ZD8A 2GZHA 4DDTA 5JJIA 2LKDA 3K70B 1YZNA 5B2ZA 1P2TA 2FZ4A 4L9SA 1U9IC 2FWRA 3QKUA 1UKYA 3VHLB 1Q20A 4GSYA 1NRJB 4NZYA 4ASUD 1W36B 4TTPA 3TVDA 3K1JA 1TL7C 1Q3TA 4HAZA 5JHGB 2HT6A 3ZJYA 2CL7X 1Q1EA 4DHEA 3RVBA 1WXQA 3IQWA 5J4YA 3K09A 4NDZA 3DPUA 4GI7A 4GFDA 1U81A 3NHBA 4P4TA 4H1VA 2WJYA 2QT1A 4XTCS 3QPWA 3O8RA 4D4MA 1XBTA 4RVCA 2QP3A 5AJZA 4B33A 3WNCA 5AUOB 3VMFA 1E9CA 2NPIA 5JSZA 1KMQA 1VIAA 3V4FA 2ZUBA 1E9RA 3FVQA 2IX3A 3ASZA 3LA6A 3WMFA 3S1AA 3M4YA 2ZJ2A 4LDJA 3UATA 1ZNWA 1WRBA 3H4MA 5FBRB 4C0HA 4KFUA 4ZDIA 2ZXUA 5DIFA 1UPTA 3VR2A 3H2YA 2VTKA 2WAXA 4HAWA 5CK4A 5D3MB 2AN9A 4RFSB 2EW1A 4O25A 1W4AA 3BOSA 4TT3D 3KQNA 4C4PA 2IYLD 4CZ2A 4TTQA 3NH9A 3PFIA 2GILA 4Q1DA 4BRWA 1XTIA 1T5LA 3FKSA 1I4LD 4NONA 4M1WA 4NYJR 4FW9A 5BYKA 4CEHB 1N6IA 5KDDA 3B7GA 2AFIE 2WJIA 4EPVA 4ZCMA 1DAMA 1IXSB 5B30A 3CX6A 2ZAMA 3PEVA 1E1QD 1XX6A 4GNKA 1E9AA 1X8KA 4KO8A 1E1RD 4EJSC 1QHGA 1M7BA 3KFXA 3IDQA 1OXXK 2W00A 1XPOA 2YNMA 5D3MA 4RFSA 2JEOA 3HPRA 3MGCA 3UWKA 4IOKA 1OH8A 3BERA 3D7MA 4HUTA 1T4GA 4Q7MB 3QJYA 4RD6A 2XOKD 1SVOA 1U8YA 1N6KA 2WWXA 4KFRA 4RD1A 1N3BA 5E4FA 3ZQJA 5JCPA 4DSOA 3NHAA 5J47A 1IQPA 1HT1E 2GDJA 1XJCA 2CVFA 1FTSA 2REBA 3PUVA 1W46A 4MKIA 5AUNB 2WTUA 3IEVA 3QKRA 4OHZA 1TPZA 1ZM4A 1G7CA 2ZSAA 4BZXA 1CTQA 2PT5A 3NDPA 1FFHA 3EA0A 2YV5A 4LJYA 1JXOA 2A5FA 1NKTA 5DH9A 4L9WA 3VU9B 1R2QA 2QQEA 4OI1A 4PAMA 1TF7A 4Q9HA 1IJFA 3D31A 5KNDA 1BKDR 1XEWX 2HLDA 2KBFA 3DO6A 4FCWA 2VF8A 4URWR 4LGMA 4LJ4A 5BN3A 2VRWA 2BBTA 4NYJQ 4US2R 1KDPA 3Q3JB 1EFTA 2RHMA 3FMFA 4CYMA 2F1IA 2ZVQX 4EPRA 4G01B 4MDEA 1US8A 3MCAA 2WAYA 1HYQA 5JWOA 4V0LA 1KO5A 2VP4A 3THOA 1GITA 4EQ6A 2KJQA 3B9QA 1GM5A 3HYRA 1N6LA 1R0ZA 1VG0B 1UDWA 2EQBA 1JAHA 3C5CA 3EZ9A 3BB3A 5FPTA 1R6BX 5FFMA 1JPJA 1CR0A 5JLJA 1Q3HA 4YMVA 3VU9A 3RC8A 5DE3A 4WZAE 5AK0A 4L5BA 1IY1A 3WRXC 2QGNA 1KOFA 1OIWA 1QG4A 4QBGB 3WMEA 1OXTA 2ZE5A 1CJKC 2BMEA 3GP8A 5CJ2A 4Z8XA 1N6HA 5HE8A 2O8DA 1E2IA 1OHHA 3QG1A 1XD2B 1T8UA 1G41A 2EFHB 3IPYA 4PSKA 1S1MA 2V6JA 5KSPA 3HR7A 3RC3A 2GTPA 2ZITA 1W0JA 2QPAA 4LHZA 1ZU4A 1E2DA 2WOJA 1TUEA 3EIEA 4LJAA 1OIXA 3TQCA 4URXR 2ZRJA 3PXGA 1IN5A 2R6GA 2QRNA 5C46F 3KB1A 4KI0A 3A1WA 4V0ME 4KBGA 1ZNYA 4KVAA 3F8TA 4LHVA 3QKSB 3AVUA 3RS2A 4NCHA 1VCOA 4RZUA 3HYTA 2RGNC 2PMKA 1T3LA 1XD2A 4CVNA 3CIOA 4M1KA 3VAAA 3KXKA 4U00A 1XTKA 1CEEA 2AD1A 3NC0C 4MRSA 2GF9A 2CCJA 2XEXA 3JVVA 3KKOA 4X8LA 3SJBA 1BYUA 4F38A 1GOTA 4PAQA 2JLQA 1SKQA 2QG6A 5CDFE 1GKIA 3THWB 1KZ7B 1I2MA 1VPLA 1X1RA 1G4AE 1OYYA 2QM7A 4KU4A 3TRFA 5CIWA 3U7EB 4MITA 1MO5A 4O3MA 2X77A 2R6CA 2RGGA 1KJWA 4A0RA 4LJ8A 1E9EA 2BV3A 3BWDD 1QF9A 4OQMA 4QHYA 1UJ2A 1G16A 3PR1A 4G3XA 3QKSA 4A4DA 4DLWA 1HA3A 2V55B 2KWIA 1YE8A 1ZIOA 4BWYA 1W0KD 1DG1G 1EFRD 4Q18A 2J3EA 1XU4A 3H0KA 4EJSB 4TLEA 1GL6A 2XTMA 3OHMA 4Q48A 3FYHA 1IN4A 4TMKA 5JRJA 4EUNA 3ZVRA 1ZINA 2GK6A 4DLTA 1ZIPA 2YZ2A 2IL1A 1AKEA 4YLGA 1CIPA 5CB6A 2GF0A 3THWA 3IQXA 1E96A 2IA5A 3CONA 3DEFA 3LNCA 3OIVA 4Q9JA 4POAA 5FTJA 4TYWA 1GUAA 2CVHA 3CWZA 4OQFA 4HLQB 2XSZD 3MD0A 3BJIC 2UZ3A 3UWOA 4Q1AA 4EIWA 3SHFA 1W7AA 1OPXA 2KB0A 2NO9A 5HE9A 5ELXA 1A4RA 2GJSA 1XB2A 3I73A 1NVUQ 1DEKA 4EJSA 1XTJA 1E79D 1YZTA 4WA7A 3VR4A 3DL0A 4JL6A 5IF9A 2D2FA 2AD5A 1KI1A 3AKYA 3V9PA 2ZTSA 3LAWA 3HU3A 1PV4A 1JR6A 1PZNA 2VH5R 3GLIB 3K0EA 4TQUS 2JJ2D 3A36A 3TLXA 3W6OA 1X3SA 2OZEA 4KFSA 4PZYA 1YRAA 2F3TA 2C04A 2CDNA 2DFLA 2PZEA 5A0FA 5E3HA 1H8HD 1Z6YA 1KK3A 2CK3D 3HPQA 5TXGA 3SI7A 4ASUA 2R2AA 1WDTA 4LBWA 5FL3A 1D9ZA 1NBME 4PANA 5GJCA 4FWTA 4Z54A 3SDZA 4Q21A 1F60A 2OFOA 4F4IA 2ZRMA 2WJHA 5UKDA 1P6XA 2IYWA 3CRVA 2ZIAA 1GP2A 3EWAA 4XJXA 1SZPA 4B34A 3ZZ0A 3WYGA 4RCYA 4MQBA 3GJ0A 3U61B 4AI6A 4GT1A 1CBUA 4LSGA 2PJRA 1QHHB 2PZGA 2Q3HA 2FSIA 2XTNA 3U3RA 2BJVA 4QNRA 4DLYA 2O8FA 1OFUX 4P4UA 2WWHA 5H1YA 3GLFA 2G0NA 3RHFA 2HJVA 4TMTA 1UKZA 1LB1B 1ZCAA 3O8BA 3CNNA 1CRPA 4DUGD 3EXAA 1AA9A 1Z28A 2SHKA 2A5GA 4HZUB 4US0R 2W0SA 5CYPA 4ZKDA 5BN5A 2J5XA 5KHOC 3MG9A 1LVGA 3OAAD 3ZD6A 1IOZA 1PLLA 2XNSA 3QOFA 4OK6A 2F43B 2V7QD 3L2OB 4TT3A 3TBKA 1WBDA 1Z0FA 4OL0A 5SZJA 1RE0A 4BRUA 4EPWA 4TMVA 2DWOA 1QHHA 2EYQA 2ZR0A 1NMYA 3ADCA 4ITRC 3QIAA 3PEYA 2NG1A 4V02A 4RZ2A 1E0KA 4BFZA 3A4MA 5G41A 1ELOA 4TQ9A 1P62B 2J87A 2ZUDA 3I5YA 3R8FA 1MRNA 3GLHE 1KJYA 2R65A 4R2HA 1E2EA 1E1RA 2IS2A 5E7JA 4X8OA 1G20E 5IRCD 5EP1A 4GMXA 2IF0A 3E70C 3TUIC 3AH8A 2KSQA 2VA8A 2K5UA 2XOKA 3LVQE 5G3YA 3QQ5A 1PVOA 4KV9A 4JKYA 4V0KA 2H92A 4W7SA 1NMXA 2D74A 2F3RA 4PX9A 5IHPA 2OESA 2XZPA 1N6NA 4NYMR 4W5WA 1X8JA 4DSNA 1NN3A 2ZRKA 2OSBA 2PJZA 1XEXB 4KODA 1UBCA 3P1JA 4MGYR 5JCZA 4RD4A 1Q1QA 4D6PA 1AQYA 2AKAB 3X1XA 2QY9A 3CNLA 3SJCA 4W9MC 4OI0A 3BXZA 2A7QA 3GJ6A 1ZUIA 4IRUB 3T1TA 2QPOA 4NKRA 5KSZA 2XX3A 4OQXA 3GJ4A 4PPFA 1NNEA 4O2LA 4NYIR 1ETUA 1GTVA 2C99A 1KY3A 1R0WA 3T35A 3ZVMA 1ZYUA 2YKGA 8OHMA 2G1JA 3B1WA 2QSYA 4A9AA 1ANKA 1D9XA 1P73A 1S96A 5BXQC 2VPPA 3IEUA 4AKGA 3E2IA 2OXCA 3MFYA 1RW4A 5E7MA 1XF9A 1PUIA 3KDSE 1JECA 1WBBA 3LBIA 2CE7A 1SHZA 2NZ8A 5H70A 1EFCA 4DXAA 3U2QA 2J46A 2PEZA 4LZZA 2YWGA 1BMFD 2BEJA 2C9OA 3PUZA 5LB2A 2PT7A 3NBXX 4LK2A 4WVFA 3K0AA 3UIEA 3L8YA 3ZS8A 4KLZA 1A2BA 1YR8A 1FZQA 2Q6TA 2GVDC 1SXJE 3NXSA 1OB5A 3SNHA 5F9FA 1J8MF 4NYMQ 1EG7A 2O52A 3ONWA 4N1AA 4OK5A 1XPRA 1GZSA 2J7PD 4IJMA 4M9QA 3BAFA 3KUDA 3BB4A 4JLVA 4I4LA 2ZJOA 3KX2A 1E6CA 4HB4A 5FPYA 4WZ6A 5E7IA 2VO1A 1P9WA 3QXSA 4B32A 2A30A 2IEZA 1AJEA 1T0JB 2NO7A 1UFQA 3H1TA 4NYIQ 1O3YA 3IBYA 3ZDQA 2GEUA 4NTZA 1SVMA 3KJGA 2G0TA 3GJXC 4HLCA 3X1DA 3WNDA 1N5IA 3KQLA 1TTTA 1L2TA 3AQ4A 1XRJA 4LC1A 1OV4A 2FSGA 3RRMA 4AWXA 1G291 2YJTD 4DCTA 4F4JA 2JCSA 2FFQA 5C4GB 3AB3A 4Q1EA 3IIKA 2IYVA 2IUUA 2C96A 3K09C 3U3MA 4Q00A 5DSZA 2ZS8A 3B82A 2GVZC 4EFLA 2CL0X 1N5JA 4G5QA 1VYUA 2FPKA 4LJ5A 3B5JA 721PA 1VTKA 4A6XA 4EPXA 2YOFA 2BMDA 4KHZA 1MO4A 4JIMA 3THXB 1E0AA 2A9KA 3I62A 4B3BA 1F2TB 2D3WA 4JLAA 4QG7A 1MABB 2J9RA 1ODFA 1SXJD 2VIIA 1Z6AA 2O8BB 1U99A 4LV8B 3T1VA 4M4SA 2GCOB 3IGFA 2V1XA 3AF4A 1GRNA 3PITA 3K0CC 1W0KA 4Y0VA 4AKIA 2GXQA 5C4MA 1Q44A 5A5GA 4B3GA 2WZQA 3IHLA 4TMZA 3VNUA 1GVNB 1M7HA 2MMCA 5EE1A 2J0QA 1ZNZA 1ZC3A 3ZIAD 1G8HA 1R10A 1ZW6A 2OG2A 3QEOA 4B76A 4MRRA 1RKBA 1MT0A 2QP9X 3BE4A 3THXA 4A0HA 3FGNA 3TGPA 1YZQA 2GKSA 3CBQA 1F2TA 2FFAA 4A15A 4C0AC 4FMDF 4HB2A 1MABA 2D7CA 2VEDA 2NZJA 1PLKA 3I92A 5DI3A 5DGXA 5FOVA 5CLQA 1FPMA 2PH1A 2XSZA 2GRJA 1DAFA 2GCOA 1E98A 2IXGA 2QU8A 4PZZA 2FOLA 3KB2A 4OJQA 2GHIA 1II8B 4JBWA 4LBVA 1NN5A 4RCZA 4CW7A 4HAYA 3FKQA 1COWD 2O0KA 1E79A 4HUQA 5LDDC 1OE0A 2HCJB 3QBTA 1N5LA 3QUSA 3OFND 3ICQB 1UADA 2QEQA 4UXHA 5GVRA 5CDFA 2WMOB 2JJ2A 3AP2A 3L0IB 4O2RA 3B2EA 4WOPA 1KI7A 2RHDA 3CRMA 1TAGA 1H8HA 2CK3A 2G1KA 5B58C 1UKEA 3U3KA 4FMBB 3LWNA 1YRBA 1R8SA 1Z6XA 4UXIA 1LY1A 1KIMA 1N0VC 1E2KA 1DOAA 1OSNA 2QTFA 1W44A 4ERNA 2RGEA 3HWSA 3SBEA 2R44A 1P3JA 5KOYA 2N46A 3Q7QA 2YINC 5KDOA 1TADA 4TL9A 4D80A 1VHLA 3TR0A 2B7CA 2GK7A 1NP6A 1DBSA 3IO5A 4B44A 3AVYA 2FPMA 2XXAA 2WJJA 1YZUA 4OI2A 4TSFD 2OBNA 1WMSA 5HR5A 3QVVA 5FTLA 1TF5A 1JPNA 1L4UA 3ND9A 3REGA 1WQ1R 3P4XA 2Z6VA 3RDPA 1KO8A 4DUGA 3GFTA 4M8NE 2EFEB 2MMGA 1O87A 2OBLA 2ZYUX 3GCGA 4AYWA 1GNQA 3OAAA 3CR7A 4NP6A 1RC8A 221PA 3LH5A 1EK0A 1JR3E 4JLPA 5ANRB 2V7QA 2DFKB 2D62A 2E1RA 3GJ5A 5E95A 3SEAA 2ZU6A 2XB2A 5H68A 3WHKA 2PCJA 4OHYA 4B43A 3VFDA 3IUYA 3DMNA 3RRZA 2F55A 1C4OA 5L3RA 3K9NA 1LS6A 2OCAA 1NG1A 1RYHA 1LV7A 2ODWA 3GQBA 3B1VA 1GIAA 2VP0A 3QXCA 5DHFA 3RS4A 2D4HA 3LFUA 1FX0A 4NL4H 2A78A 3A4LA 4BFXA 5AUQA 4MKGA 5J40A 4XVUA 4EAQA 3VR1A 4FINA 5JSZB 2CNWD 1L4YA 5BQ5A 1NLFA 3UXMA 1UEJA 4NCJA 4XWOA 5JZVA 3KQKA 3SC3A 1BYIA 3S1AB 4A8JC 4D0LB 2B21A 3KJHA 4LPSA 3OIYA 2ODBA 1IHUA 3CNOA 4OQLA 3CPEA 4DIEA 3SFZA 4NPHA 1LW7A 3EW9A 2WJVA 2FDCA 2ZI4A 5FTMA 1N6RA 3MMPA 1D5CA 4UJ3A 2NO0A 2WHXA 2KBEA 3L82B 5K8IA 4MGZR 4LHWA 4PQRA 2OUKA 1U94A 4KBFA 1AGRA 3UKDA 1FMLA 2Z4RA 2ZI9A 3MUFA 1ZAKA 4PO9A 3U44B 3B1ZA 4HYYA 1XTSA 2BM0A 1XD9A 2VP9A 4Z51A 3QSYA 2WKPA 2VSFA 1F48A 3PG5A 5JMTA 3UPUA 1ZD9A 1ZCBA 3PEUA 1G5TA 1LNZA 3ADBA 1W4RA 3K0CA 2QRZA 3AKEA 5C1BA 4FMCB 4Q4AB 2GAOA 2F1HA 3E5HA 5KUTA 3IO3A 1P7CA 2Y8EA 1YZKA 2PBRA 4WXRA 4BUJA 2O8CA 2CBZA 3C16C 3JZAA 2D7DA 1KTVA 4C0QC 3DHWC 4XVQA 2P65A 2EWVA 1BMFA 3B8HA 3QKRB 4RZXA 1KI6B 3L0PA 3CZQA 1EESA 2CHVA 2VP2A 3U44A 2VP6A 5K8UA 2GZAA 4LHXA 4AYXA 5L3QB 4LJ6A 3KL4A 2J7PA 4QFMA 2JIZD 2MSEB 4UQOA 4B2IA 1OXUA 2JLYA 2QAJA 1NN1A 3QE0A 5TMPA 2RGAA 2C77A 3QPVA 4LYJA 3BFVA 2W0MA 2ZJZA 3UK6A 1TU3A 1U8AA 2QMOA 4Q4AA 1IXZA 5FBLB 2YHSA 4AK9A 1GDDA 1P5ZB 1YJ5A 3AVVA 3N70A 3I8SA 3KFVA 2IBMA 4LV6A 1US8B 4M1SA 4PC6A 4IXMA 3X1ZA 1WCV1 4LI0A 4PC1A 1B0UA 3PVSA 1KI6A 3Q7PA 1CP2A 4EQ6B 1FW6A 1S8FA 3OE7D 2XGJA 3MWJA 4I1OA 4UNQA 4C2UA 3IPXA 1DELA 5AJYA 4AKHA 3NIBA 2LCFA 5L3QA 2DFTA 1R4AA 1YR7A 4QL3A 1W2HA 2EWWA 3OESA 3KJIA 2YWEA 4E09A 3MWYW 2C5LA 4QKQA 4M9XA 4D4JA 2PLFA 4Y0AA 3UMSA 2HV8A 4Q9IA 2XJ9A 3EZ7A 1K6MA 4GRAA 1M74A 3QENA 4LRWA 4P32A 5JI2E 1FMJA 2FSFA 3B9PA 3IIJA 3O8DA 2ORIA 2AFHE 3L0SA 2ZS9A 5HZHA 4MRVA 3LRPA 3VQTA 1JNYA 2DB3A 5KNCA 2O8DB 2ZR7A 2ZYTX 1MR3F 3REFA 4C0JA 3I32A 3MJHA 4Q66C 3IILA 2ZS7A 4RFVA 1SXJA 1MOZA 4HZIA 5KYKA 3BBPA 2X2EA 2GESA 1QRAA 4M22A 3RYTC 821PA 3NEYA 3QXJA 3UMFA 3LW7A 1MO3A 1I4TD 4OHWA 4X8MA 1CF4A 3PEWA 3NBYC 5EP3A 4XIGS 5K8LA 4Q9LA 1D2EA 1SVLA 2WIBA 1XMVA
chains in the Genus database with same CATH superfamily
2W6JD 4CV0A 4MUYA 4Y30A 4I4TA 5BWMA 4JCCA 4KXXA 3M83A 2WU0A 3DMRA 4HH1A 2PX6A 2QE6A 4AO7A 4Z7OB 3LO8A 1UJNA 1G21E 2AMFA 4BNTA 3MLAA 2CLSA 3RHTA 3QXGA 3PI7A 2HSWA 4KQWA 1Q91A 3N8NA 2Z2YA 5CLJA 2FCAA 1YVEI 2B30A 3B1YA 5BR4A 5A3QA 4C4AA 4D9GA 3PQ7A 4K0KB 1NZFA 2RGCA 2W11A 3P2EA 3T9EA 3RAFC 4ZVQA 4QM7A 5LQRA 1OFGA 1XEFA 3RSGA 4H31A 4TYMA 4XCVA 4CEIB 3GEPA 2QUZA 4ARZA 1YJQA 1VP3A 3QPAA 4JYCA 4G4SP 4M98A 1T1JA 5JPIA 3X1KA 3R5HA 2GSDA 3O47A 4PYOA 5KPJA 5GJVC 2D1TA 1DIGA 5K3DA 1TRKA 3QMPA 4IM7A 1V1RA 5JMWA 3AZPA 3W5HA 2OM2A 1DFHA 3OFNA 4KK4A 5HJEA 1COZA 1Y7IA 3KKMA 1ENYA 3GQVA 3FPHA 3PI6A 2NU7A 2QTVB 4OREX 3BB1A 3VX4A 3X43A 3ZE2B 1AKMA 4FHFA 4BQRA 3JSAA 2ID4A 1IB6A 2NV0A 1U2SA 3CUTA 1E1NA 1THZA 5FBVB 4RD3A 3A1UA 5TQ2B 1JG2A 1B76A 1GFIA 1N2BA 9ABPA 3WRVA 4LJSA 4RPLA 4BO0A 1EDBA 8ADHA 2IC5A 4A8HA 2H2AA 4C4YA 4R71A 4LOIA 2Q5LA 2OGUA 3FCEA 3GVCA 3KPVA 4IGKA 5CLLA 4B82A 4HLUA 4PEVA 4CKBB 3R9XA 3VKHA 3TBFA 5LBIA 3UGTA 4A2PA 4FMCF 2YZMA 3QVLA 3V4RA 5KAMA 2ZKLA 2B92A 2H8GA 5KQRA 5EXXA 4AXBA 3CH5A 4REMA 3CVXA 1JX6A 1B0ZA 5ITSA 2VHZA 2PL3A 4YNBA 1MZPA 3ZI7A 3EGCA 1CY8A 3OLVA 1SWWA 1TUGA 5F73A 3UANA 4F04A 3OEHD 2AEJA 4OK3A 2RJ3A 2WTEA 1HEIA 3IKVA 4G23A 3GR6A 2V97A 1QBKC 4P08A 4RMNA 5IXJA 5JNUA 3BMOB 3RNOA 1NFFA 1XC7A 2XVMA 5BWNA 1GL7A 4NNOA 4WY8A 1W88A 2DY0A 1YDEA 5IM5A 5ABPA 5D5HA 5HCNA 1ZK1A 3F1LA 5JBNA 3F6EX 4NJOA 2AN4A 1V47A 3EMBA 3P9ZA 3QI2A 2YFQA 1D04A 3PQDA 4PAGA 1B16A 2CXXA 1EWVA 4UNSA 4IHAA 1JBQA 1RR6A 4HNQA 4BB6A 5CD9A 5DF1A 5GZ1A 4QRHA 4RIEA 4EY7A 1ENZA 1FSZA 1PN3A 1V3QE 2VF2A 3OZSA 4UDXX 4DOMA 1H9CA 3NOVA 1G6HA 1P2UA 2AMVA 2BGLA 4I4NA 1VPWA 2J6HA 1DIRA 2NXCA 2Q9BA 2FQXA 2OXEA 1SGWA 4RCVA 4UCXA 1E6EA 2Z6AA 3UGQA 4MQ5A 2A58A 4R8VA 5IASA 2RB5A 4M0PA 4GVLA 5KWSA 1I7NA 3O7MA 2L69A 3KWJA 1TIPA 1T2FA 2AXNA 3IOCA 1GNPA 1H1LA 5EMJA 2BLLA 1YZVA 3RNLA 4IHKA 3VR6H 1KNXA 4J3NA 2HOQA 2X9NA 3BREA 2CNKA 1WKBA 2FG7C 3JQAA 5KCZA 3WYCA 1IM2A 2CXQA 4YALA 3SLRA 1II9A 1Z25A 2CNWA 5GQSA 5JTTA 1EUZA 4MYCA 1O0SA 3ADKA 4YRBA 3GLFB 1K06A 1BXRB 1L4BA 3OCZA 3HB4X 2FPLA 1HV8A 1U8XX 3VBCA 3B85A 4XM0A 3O75A 2E4YA 5M29A 1K98A 2AUTA 4LOKA 4JLNA 4JOQA 4ZKEA 1O57A 1PO7A 3M7IA 3L1UA 3TKLA 4DGSA 1Z4JA 1XRLA 4DSAA 3OU2A 4F5ZA 3PJRA 3TM4A 2YJNA 4DG8A 1GA4A 3GJ3A 1IE3A 2VLIA 3ZE9A 3IAS1 4C4RA 1H1TA 4F6CA 4JLMA 2PKWA 5T64A 1DRVA 1F5NA 3BQ9A 3ND7A 4UTRA 3QWFA 1DAPA 1QXSA 3D8NA 5DN9A 1IN8A 2CLCX 5EEHA 5HKAA 2E9SA 1AU9A 3KBOA 4IS3A 5FFNA 3GVPA 4U7DA 2FETA 3DL2A 2GTHA 2NSDA 4W9RA 2OFPA 4RX1A 5B3JA 3DC7A 3R9IA 1KEZA 4HRVA 1MMFB 4P4LA 2YJ3A 5ARBA 1D1TA 3N2KB 2WSYB 1J25A 2IGTA 4K2AA 4Y3UA 1FQOA 4NBKA 3ZWVA 1L7PA 2FZ5A 3NUZA 3ICEA 4NJEA 3INTA 1A9XA 1BEUB 3JQ6A 3TNYA 1LBSA 1KJ8A 3LUPA 3SFTA 3UY4A 1NE2A 2RHLA 3KEQA 1C14A 2MSKA 1VKHA 2OBXA 2PFGA 2WVAA 3OMXA 4EHFA 1GNVA 2W2OA 1EK1A 2CC2A 2GPSA 5CA1A 1X6VA 1CUBA 2Q1YA 1U1EA 2NIPA 3AI2A 1H6DA 1DO0A 3EY4A 3RT1A 3UOAB 4J4HA 3OM0A 1R9JA 3ZV4A 2C2XA 3ICOA 4CLXA 2YC2C 1ABEA 4WKOA 2RHHA 3GUYA 1JKJB 2OCGA 2JI4A 4U2KA 1C7IA 1ZBDA 1XKQA 1FXWA 3LQKA 4GRIA 2AT1A 4H16A 3TQOA 1NBMD 4AJOA 1RDFA 1SG0A 2PKCA 1PHRA 3U60B 1NBHA 2H4WA 1VJTA 1E1QA 5FT9A 5ICCA 2AGVA 4HDMA 5ALSA 4WAUA 1FP4A 2NO6A 3W6UA 4KRFA 1JG3A 2BY4A 3PHCA 3VVLA 3UK1A 3HCPA 2PMFA 1Z6QA 3EDOA 1HE5A 4NQRA 4A0FA 2ZBPA 3N2GB 3E0XA 1VXOA 3HXKA 1WW2A 2P4HX 3OPYI 1J5XA 3S6JA 1BXGA 2WF7A 4GKAA 3RYIB 5I01A 1N7JA 1TJNA 1MFPA 3EIXA 1KDVA 3EXEA 2W4MA 1FYVA 4YCDA 3DVAB 4ZJZA 2XKKA 2PUFA 5F2EA 2PZFA 3CNBA 1T0PA 1A77A 3FDJA 5JBIA 1OJLA 1EUCB 1SVKA 1QZXA 3WWCA 2XUZA 4TS3A 1B2LA 1LLFA 2BFCA 3W3AA 3N1UA 4LVUA 2K7FA 2AVDA 3U0BA 1MAAA 4N0EA 4TL7A 2EHJA 4WBSA 3K3PA 2VDLB 4AZVA 1PK9A 3P32A 5LOVF 5H4HA 1L5HA 1KK2A 1ZUD1 5JLAA 3EZFA 2BKAA 3L79A 1R6DA 1TJ4A 3E81A 4G07A 2ZW9A 1G6KA 5IJWA 1G0NA 3Q8WA 3WISA 4CQLB 3QU9A 5CITA 4L51A 2YZNA 2ZRHA 3KSDO 2OLKA 4Z3OA 3JW8A 2Z83A 2GM5A 4FYYA 1NAHA 4RK5A 3P0JA 3G85A 1Q7GA 3MTAA 4HL6A 4J0QA 1N57A 2EZTA 4LHYA 4OJTA 1GADO 5FYDA 1G8SA 5JXHA 3DG9A 4HWOA 2H85A 5A9RA 1AK2A 2AFIA 1QGYA 1U2DA 1NPTO 1HO3A 3HJTA 4YCJA 5D3QA 4B4WA 3T3HA 1D6NA 4RO0A 1AQUA 2P4UA 3RPEA 3T9CA 4WBXC 3CCCA 4C4SA 1LA2A 4RD0A 1XQ1A 2ONJA 1VQ1A 2XB4A 1SQ6A 2KLHA 1UQTA 1Y37A 1FFXB 1Z0ZA 4HX2A 1I2ZA 3PUWA 5MGBA 4U7HA 2W2VA 1Y63A 4AFNA 4GG1A 1KL7A 1PV2A 4DNQA 5JH7A 3HJFA 4B3CA 1T5DX 2A1UB 1X7ZA 1BDBA 4HDCA 2XUAA 4PPYA 4QUIA 4UHDA 2C2ZA 4X6UA 5K4GA 1NSTA 2ID9A 3PTAA 2FXIA 1FSPA 3ND6A 2I3DA 4IGFA 1XCMA 1MGPA 1KFKB 5JT1A 5KTKA 3VOTA 1FTYA 4XI9A 4KR3A 3NUQA 3PPYA 3TINA 5CDSA 1MLDA 3ZJ5A 2VKQA 5JQGF 2ATCA 4OH7A 1MJ5A 2R84A 1UK9A 3PQ5A 4L8YA 1YFZA 3IAHA 4U7FA 1NP7A 2BFWA 4AW9A 5MFPA 2LRHA 2ZE8A 1S6YA 2JAQA 4S1WA 2VFAA 4WZAB 3IUNA 4JODA 5EWJB 1HTBA 2QX9A 3PXDA 2PRZA 4HLDA 1VJCA 4B6RA 4BXOA 3M9LA 5IN5A 4RTOA 5F2KA 3CM0A 3UA3A 4TXMA 2VS1A 4DJTA 5JYEA 4KWEA 1V2HE 1HFEL 4QTXA 5CX1A 3EH1A 2DT8A 4V24A 4YIKA 2V9PA 3LF2A 1USKA 1E2PA 1ADJA 1M6WA 1VIDA 1W30A 2GXSA 3NG1A 3THRA 1QTNA 1GRQA 5GADl 4JUDX 3M6UA 2OVFA 5DLQC 4YP1A 1XMPA 4YFVA 3CB2A 4HSGA 1VHTA 5IBQA 1C1DB 4R81A 3KZOA 1CJUC 2PX0A 1D2NA 2VJPA 3EG9B 4LXIA 4I5EA 3RI3A 2BFOA 2QUAA 4LOLA 1RRPA 4TX1A 2IV2X 3T0FA 3E3LA 3ZGXA 7YASA 1YMUA 3KTAA 3PICA 4ZEXA 4BJ5A 3G7UA 4F7WA 5ECWA 2ZJAA 2V96A 4Z0PA 2V65A 3GLTA 3UAYA 4A92A 5KJ6A 1D07A 4BQOA 1L4HA 1BQEA 5JS6A 4LN1A 5KNBH 5KNCH 1V1JA 2EZ9A 3T38A 1FVXA 3B20A 2NADA 3C7CB 4V1CA 1ID8A 4D6YA 1U5BB 3R8CA 1CSEE 4ER0A 1U28A 4JT4A 4W82A 3KKQA 4E6EA 3F1KA 4UEKA 2UZ0A 2XMCA 3R7FA 3SOPA 4H77A 5DDIP 3IP5A 2C5SA 3IIEA 4XA8A 3JWGA 2ZCVA 3X1YA 1ZRSA 1ONBA 4IKPA 3LUGA 5COAA 3ROZA 1WR8A 4BLSA 3U3OA 4ZV4A 5I47A 4LS3A 3OTGA 3W6PA 5AW2A 3OQ6A 3ABSB 1AQNA 3TLYA 1G5HA 1KP3A 1HDEA 3DE3X 4J0IA 2W2LA 4LUCA 1M0EA 1PJ4A 1DC5A 3PDUA 3UMRA 2HT1A 2M32A 4JENA 2NLOA 1JEAA 5LP6C 1LW6E 3CT6A 3FHLA 3FPCA 2V54A 3PFWO 4XJTA 4GM1A 2G88A 2VXCA 4XH9B 4G4JA 5IABA 5MFZA 2BVNA 2WD9A 3PENA 1J9GA 1UOOA 3WDLA 5K3AA 2DFNA 4FGZA 4L0CA 2QUJA 4DRXB 3UKJA 4XARA 3AZOA 4HDSA 2EG5A 4MR8A 5EIFA 3V7FA 3VAYA 1A5AB 1HQKA 3MRTA 4A2CA 4FS3A 1T1EA 1H0SA 2CDCA 1KYYA 1AO3A 4Y2SA 1SNYA 5JWHA 3QF4A 5IX8A 2QL5A 3L9WA 2ZRLA 5IVDA 1DQNA 1ULZA 2XF8A 1Q0QA 2HK6A 2WWFA 2RCNA 2IH4A 2R2GA 3I09A 3T3MB 4WOKA 4TTRA 1CEYA 2CVOA 3I76A 4H1TA 3F3YA 4JI1B 3QE2A 1DS6A 3TOCA 3UN1A 5AI5A 1PX2A 3F3MA 2WHRA 3QVTA 1X2BA 2BHNA 2FPRA 3IP8A 3LC2O 3LY5A 4HC4A 4I9FA 2B94A 3WHIA 2FRXA 1RWXA 4ED9A 2LKCA 1VRCA 4CFSA 4D4LA 3A2NA 1N2XA 4RH0A 1RI3A 3L6BA 1Z22A 1DP4A 2QP4A 3L8FA 1IATA 1R9GA 2DHRA 2GWHA 3N86A 3QITA 2ZBUA 1Y3AA 4MULA 4FR0A 3H6GA 4RPCA 1HT2E 2RIRA 4O2BF 5AM5A 2XCOA 1W75A 2AEFA 2JCVA 2JGLA 1NJ6A 1QGED 1ISPA 3HFGA 4RVGA 5B7GA 4QASA 3C74A 4WZBA 2OWEA 4G0NA 3C0KA 2ETXA 2D2XA 3LHDA 3G2JA 2XDWA 2IIQA 2VPTA 3IJEB 5A7HA 3FWPA 3ZIDA 2VQSA 2IYQA 4TV9F 1J0AA 4GUDA 1GPMA 3T5CA 3G59A 1T6XA 4GX1A 4J49A 1P4GA 4TS9A 2IV7A 3VBEA 1FA9A 5ILQA 3TTUA 1RXYA 2Y3IA 3EC2A 1LI7A 1SUFA 1G9XA 2DZDA 1X80B 4P35A 1V25A 3A9SA 3NB0A 3OFKA 1ZWKA 3PT9A 3VKWA 5BV7A 5JMPA 1EE9A 1JKFA 1ZUNB 3T5MA 1T4CA 2FAXA 5JDCC 1WHSB 3B3GA 4NOMA 1M1YB 5TPWB 4Q7EA 2VDMB 1EVEA 2NXWA 1KSHA 2YDXA 4WV3A 1V4VA 3TRIA 4DRYA 4LF4B 2EFDB 1SQ5A 1JGTA 5TARA 3T3PB 2OCBA 2OLEA 2BBOA 4OMDA 1X1BA 1XMSA 1OKKD 2BC9A 2JBAA 4BIIA 1PFYA 2P6NA 5AW6A 3R5XA 5KDLA 3ORFA 5ALHA 4KWTA 2NUAA 5IN4A 3Q1KA 1YB1A 3TIVA 3BXGA 4EUKA 3UH1A 4XSGA 1YTLA 1CE8B 5IAGA 2EZ8A 4XD7A 4R3UC 2OB2A 3K9GA 5E6UB 4W5NA 3HWWA 3I64A 3IAAA 3OQVA 1KBZA 4JJ4A 5ALPA 3ORRA 4R2JA 4N12A 5FI5A 4NMMA 3TW0A 1L5YA 4Q1FA 1ZC4A 1M6YA 3CEAA 2YXLA 2P11A 5CT6A 3VC3A 3TSAA 3K30A 3FTFA 1NHGA 3FYTA 3U7JA 2Q9CA 4YY3B 4B3SB 3BC1A 3QE3A 3HM2A 3EISA 3LG2A 3QFTA 4J0GA 4RF5A 4YRCA 2XCUA 5B2FA 1R0BA 1NATA 2VSXA 2Z30A 3A9UA 3EAQA 4NBRA 2OQIA 3IEXA 2HZ7A 5DNAA 3UB2A 5EJEA 4UPDA 1GFZA 1J2YA 1ZCJA 1FVHA 1C3JA 1W581 2WF9A 2X15A 2XA2A 3K92A 1ZA2A 1PEYA 4YXFA 3CTMA 3CG0A 3SKYA 5F7OA 2BELA 3O2NA 2Y1OA 4YC7A 1ZO8A 1LX6A 4YRLA 2DWQA 4QXQA 4UNNA 3WK9A 4RVNA 4HLUC 3DJYA 2VK2A 3O38A 5AVKA 3LVFO 4QUJA 2VT6A 2ZJ5A 4R2IA 3WYAA 2GD1O 1B2RA 3ZHTA 3O4JA 1RC0A 2X1VA 1VKNA 1E4OA 1G20B 1V16B 1XD8A 3L8HA 2QGFA 3O2JA 2BW0A 4PZLA 4C3UA 1XCBA 3AEQB 2DVMA 3LXUX 2CFIA 2E4WA 3K1TA 1F1JA 4BO8A 5LQAA 2IS1A 5C18A 4LXXA 2WVJA 5F78A 8LDHA 5CAEA 4IEIA 3NGXA 5EP4A 5LP6B 5CNJA 4QBKA 4PCLA 1R5NA 4R68A 2O2DA 4C5BA 1FNDA 3D64A 3WGGA 4IF6A 1PJZA 1L4NA 1E2UA 1OFHA 3SZLA 2RHJA 4GDFA 2FMUA 3TB6A 1TCBA 3SXUA 1QAQA 4GMDA 4H6PA 4MW4A 2ZE7A 2VZ9A 3VPFA 4RLSA 2NAFA 3C8UA 1FFBA 1GEGA 2WKWA 3GLHA 1JG4A 2BEVB 2PT9A 4JUFA 4RZQA 1CUGA 3EZ2A 4Q5IA 4WXPA 5D3MB 1V5IA 4U6SA 1L5GB 2LVBA 1AKRA 3UJNA 1GNRA 1CJBA 2B4AA 2Q45A 3C15C 4YJ3F 2Q6IA 3AR6A 4PPQA 4GRDA 1YZFA 4ZC1A 4U5XA 1SA0A 1T26A 1UMCB 2XD4A 3GBVA 1M34E 1X7DA 5EOVA 1J99A 4TXJA 5JXIA 4Z2YA 1Q5PA 2QTLA 4P4SA 3T99A 4RZIA 3LDGA 4WDRA 3VNVA 2C7OA 5CVUA 3OQJA 2HWWA 3V97A 2D5LA 1E2FA 3R3UA 5IKEA 1C3OA 1GG9A 4F21A 5AM2A 5SZHB 2GAFA 4JYMA 5A9SB 4B8WA 1XKLA 3FSGD 4BGEA 3WYBA 1QIFA 1I33A 2H2GA 1VXRA 4NCIA 3PCTA 5DHQA 4LKOA 1BWRA 4Y6GB 1YR3A 3EUWA 2Q3JA 5EE5B 4EQZA 4GYWA 5FI0B 3G82C 4F5WA 3LMKA 4DMMA 2POQX 1LDYA 1RVV1 3V32A 5TGZA 1ICIA 1T5HX 1T1SA 3HA3A 2DE0X 2R62A 2DFDA 5KTTA 4NU0A 1PJ8A 1RI1A 2A5LA 3FH0A 3MYRA 3R4VA 3KTFA 3KOMA 1QYXA 2W2MA 4OXKA 3X2SA 4E31A 4X1IB 4AICA 3ZQ4A 4H9GA 4UDNA 4BO4A 4V3BA 1CCWA 5TS3A 4Y9DA 5LR6A 3WLIA 1VI5A 1IY0A 1PS8A 1RM5A 2Z2KA 1DRKA 1ZITA 2NAPA 2G9RA 3BUSA 4R3WA 4AWBA 4HWGA 2MYNA 1FFSA 1HE4A 2WTAA 3F2IA 1RAAA 2QI9F 2Y0DA 1W4LA 4PSUA 3U13A 2FG6C 4N8DA 1JDNA 1Q1BA 3IHWA 4X8HA 5HKBA 2I1QA 3EWSA 4KQHA 3CUYA 4CL3A 1ZH0A 1NBIA 4J3FA 4H2DA 4XZ3A 1BMQA 3L8ZA 4QOEA 1TT5B 2Q3EA 5D7BA 1OZHA 4ER5A 3FVVA 5B3JC 5JEDA 1JDJA 1T36A 3FPBA 4TL8A 3ROEA 3MIZA 3NM6B 2JLUA 3DFZA 2C4UA 1QYCA 1OLXA 3IQGX 4WXHA 3GGSA 2H2IA 4LC0A 1MX5A 1QPGA 1F4PA 2A94A 1RP1A 2XVAA 4KO2S 3QE9Y 1DEOA 2IF2A 1JH9A 4ARZB 3LT5A 3SN6A 1ULUA 2QTHA 2QZ4A 3AUXA 5F35A 3VNQA 3GV0A 1WXDA 3AK4A 3QKTA 4HS9A 4RY9A 4ZO4A 3RBXA 1Y5IA 6LDHA 5DCLA 1PL7A 3U7HB 1K4YA 3EGWA 1U7XA 3DDHA 4RH1A 1WAMA 1KBQA 1V1RB 5JS7A 2IVZA 2R48A 3WMXA 3NTOA 5TMDA 3UV3A 1SY7A 1GKYA 3LF1A 3JVIA 2B35A 4CF5A 1QP4A 1AUQA 5A6VA 2YRXA 3KB8A 3NHJA 1T0HB 4DAEA 3E9YA 2H5LA 3FPAA 1ZA1A 5FUVA 4C87A 1KJNA 1VJGA 2C9YA 2WUFA 4XX0B 4ZVTA 3AR3A 5C7IO 2W6OA 3PGLA 4NCXA 4D8XA 2EP8A 3FFAA 3WO0A 5AESA 4AG5A 2B9VA 4OHRA 3T1YB 4CF4A 4XQ0A 1E1KA 1GTL1 4EF6A 3A1FA 1Y7LA 1FDWA 2FW8A 4LGCA 2V7UA 1RAIA 2BMJA 3AF1A 1GG8A 1FNBA 1B6GA 3GRKA 4Q3LA 2VZEA 4XQCA 5FPPA 2Q6VA 1SD1A 3F5DA 4DV2B 4W7IA 3M2PA 1YRWA 2P0EA 5CLHA 1W4BA 4JEUA 1I3NA 2W6IA 3CG4A 2FDRA 5K6AA 1H0RA 4IDCA 1YDGA 1KJ9A 3EDMA 3IJ5A 3S2GA 3E22A 1QANA 1Q0UA 2EQAA 2H11A 1G8MA 1PL6A 2BGKA 5FOXA 1ZJ5A 1NJ1A 1SHKA 2P1ZA 3D0QA 3RW9A 1I5RA 3H0EA 3ND5A 2EKQA 4EPYA 3E05A 3GFVA 4UHKA 2C92A 4YAJA 2H3EA 3ROGA 3VTKA 4AJ2A 4O0MA 4E5DA 2PTGA 4RQAA 3GCWA 2FWMX 2WM2A 3H1FA 4BPRA 4GKJB 1I5OA 2VQFB 3HDYA 3JQ8B 2R85A 4AN0A 3EFHA 2YZGA 1CF9A 1O7JA 4N3GA 3ZV5A 3C5EA 4HVCA 4RS3A 4BATA 1VE7A 1IWPB 4PU0A 3FI9A 4MVJP 5I3CA 4MGKR 2MSWA 1UFVA 3WBBA 2QTCA 1UBTS 4V3CA 5AP9A 4L27A 4ZAGA 5SY4A 1XZMA 3W5JA 3WZMA 1N5MA 1EVKA 1ZH6A 3A25A 3KQHA 2BFEB 3M6LA 3SX0A 3LC7O 3MQ4A 1DHTA 1MAVA 1YRQA 5B7QA 1B8PA 2XCLA 3HYCA 4J3JA 1T2UA 1U2DC 3FTNA 3OCJA 1H2HA 5DVZA 1J7JA 2D2EA 4ZARA 4GSLA 1QVAA 4IDDA 3GG2A 2BJWA 2X6QA 4BNHA 1NX9A 1TIBA 3NJ4A 4HN2A 5DGCA 5K0LA 3IKTA 1JW9B 2ZYGA 1SZCA 2BEKA 3AV0B 2Z1MA 4YMHA 1KH1A 3PXUA 1CP3A 3C1UA 4U39A 1X7WA 2CVZA 4JJFA 5IUNC 4KR6A 3A4IA 4UBNA 1K08A 5KWEA 4CM8B 2HSJA 1J33A 2JLVA 2VYNA 3BKXA 2BKEA 2V59A 3UJ3X 2Q6OA 2ZSJA 5ADWA 4MUBA 1YQGA 3A1SA 4DLNA 5A4MS 1N2SA 4TZ6A 1BE8A 1NXXA 4E30A 2PKQO 3KM0A 4GYKA 4C5AA 3FW1A 1ZMBA 5THXA 3VOSA 3A04A 1G17A 3DMDA 1HSZA 2QSJA 3LWDA 2ODEA 3D8RA 2BI4A 4D3FA 1QRSA 1Z0JA 4FDVA 1RZ3A 4JUAA 4EHDA 4YLEA 3DGFC 2X7JA 3JYLA 4HQ0A 3RUFA 3DLHA 1QK3A 3JPWA 5LXTA 5E1OA 3I6ZA 5IT0A 1Q57A 1RYZA 1GG5A 4CMEA 4BDTA 2WSSD 3GOHA 2CNNA 3L7BA 1KI4A 3PHIA 1OW3B 3A6DA 5EXSA 3WRWA 5CG2A 3G17A 1LC0A 2QF7A 3DV0A 1VJDA 4OU4A 2BCJQ 5A5DA 1I51A 2YOGA 4D2IA 3WBFA 5K09A 4DV6B 1HT0A 2I3AA 2QHXA 4FFSA 1PZGA 2H7VA 1PFQA 5ALOA 1VMAA 4ZRNA 2R9VA 4QPDA 1Z7WA 3M82A 3PE6A 4H4CA 5DWQA 1DJLA 1A9XB 4ESEA 3VV2A 2AXPA 3R76A 2B20A 1IMJA 3C98A 4ROSA 5DM1A 1Z5VA 2W22A 5DXFA 4DY6A 1YQ9A 2X8LA 3L7JA 121PA 1EIZA 3H84A 3IUQA 1KNQA 1YB7A 3NTLA 4OKNA 2O1EA 4R1PA 5HS6A 3JD2A 3KXLA 4EF5A 4EPTA 4F4UA 3FSRA 1AA6A 9ATCA 1E8MA 3D2BA 4NS1A 1JR3A 3RLFA 1ZONA 4XPZA 1RWWA 2PGDA 3N2IA 1CQIA 4HR7A 3IV7A 1NJFA 1Z13A 1GZ7A 4G1UC 1H3EA 4ICIA 5AW7A 4L16A 1VSUA 4MKRA 4BLWA 2DBZA 3L1IA 4Y6LA 4KH0A 5CB4B 3LK6A 2QWXA 1M1YE 2ZPAA 3TEFA 4IFBA 5JQGA 1FP4B 2WT8A 2J5KA 4DCVA 3A3NA 3HFRA 1L4MA 5CM9C 5IW8A 3FFXA 3V1YA 5AM3A 3KJEA 2HHCA 1UBSB 5D3KA 4B3IA 5CH5A 1T6NA 1FP6A 3FUCA 4C1NA 4EJ2A 1WB5A 2DR3A 2CLEB 2GZDA 2IP2A 3BRWD 3GLRA 1R8XA 1RIIA 3I9MA 2I80A 1BXGB 3LL4A 4FZ3A 4N76A 3BDAA 3OF2A 4IMIB 3FWYA 4IIGA 3V8EA 2UUCB 1U98A 4KJZA 5HK8A 5DHSA 3EXEB 1FYDA 1N3YA 3FOBA 1GDHA 3DTNA 1KVUA 1OH5A 3FMIA 3SYLA 1X9IA 3FN4A 2A35A 2LDXA 4KEAA 4C4TA 1DBRA 1OIVA 1HDIA 1L4LA 3RYHA 4KGVA 4AQYB 1BHJA 1ML4A 2GN0A 4IDPA 4QNMA 3BAZA 2JIMA 3V6LA 2BFCB 4S0XA 4FOLA 3KOUA 1XPUA 1ZFNA 5AHRA 2R87A 4MA4A 2P4EA 2JS7A 1H23A 2D06A 2OP1A 3RARA 1QSGA 4IH9A 4R2XA 4UKDA 5GONA 3K9FC 1AY0A 1L5HB 3D2LA 3E1SA 2G4LA 1Z2EA 2W8ZA 2GH1A 1YU9A 3BQMB 3E03A 3P2OA 4N3NA 3P27A 3WRXA 2PD3A 1O6GA 3CUKA 5DBFA 5KB3A 2J59A 5GP1A 2EP7A 3FVWA 3U1TA 1V5FA 4B3DA 5KINB 2YY6A 1OX4A 4N8SA 1P2BA 1UBEA 1JL3A 2JJMA 2PKQP 5ESWA 1JSXA 4EO9A 1BWQA 3OU6A 4ZZ1A 3TNFA 4BASA 3SE7A 5TT0A 1F6BA 1KERA 2ZJ8A 4GZMA 1HDCA 2FP4A 2FSVC 4IVQA 1XRSB 4KN9S 4TSKA 4HSEA 1CRWG 1CQXA 1RMYA 3LTNC 3A8TA 2I3BA 3FMVA 3BHIA 3RK0A 4AJ4A 4CM5A 1GPNA 3HEBA 3EY9A 3GAAA 3DM5A 1L1FA 4OVKA 1G9SA 1G7TA 1UT8A 3EVNA 3MUNA 4GBED 1P9LA 2F43A 2O0MA 2J67A 2HK8A 2VWHA 2X9LA 2ZVPX 3R20A 3V8VA 3FOZA 4LOHA 2IT1A 4IHQA 1C2TA 4LNUB 4UMEA 2ODPA 2WU1A 2ID7A 4YBZA 3VPGA 4D3ZA 3P94A 1NGSA 5JH7B 1V11A 3NM5A 1V9LA 4X1YA 2BOVA 3NT5A 2GLUA 2VOEA 4RULA 2AKEA 1UM9B 1DKOA 1NW7A 4A2WA 4RDHA 4F9FA 3RRBA 1LTHR 1RC1A 2RGNA 4MUNA 4EB6B 2F64A 3SZUA 4JH0A 2GJ9A 3NHZA 5G0VA 2ZATA 4DNXA 2XE7A 4RKQA 1YJBA 2H8KA 1P60A 4AUEA 4DIDA 1CNFA 2ZWOA 4QODA 4CM9A 3ZY6A 3HWRA 4G8CA 3WL4A 2C2HA 5EIHA 3V55A 4FS8A 2FQWA 4U0JA 1WLYA 1H8EA 2J3MA 2GNOA 2VBCA 4M21A 3LBNA 1JFFA 3H1BA 3NDIA 3WIUA 5BQXA 4BXOB 1X1CA 1KPGA 3G0CA 3BD7A 4QGFA 1ZOPA 1GAEO 1A7AA 2WUEA 3GBSA 1Z3IX 2ZI6A 4G5SA 4RF3A 5EZSA 2O23A 5ICFA 3ZIUA 4YRMA 2JFYA 3UKOA 5JD6A 1E2MA 3AEYA 5AI4A 3AW8A 1ZM3A 1DRWA 2GA8A 5CX1B 4QTYA 5ITVA 4DMLA 2FJPA 1WXIA 4XE5A 2OYRA 2WE7A 1AUXA 3F3KA 3MWKA 4QC2A 2JI8A 3TR5A 3HYSA 2HXYA 3Q8XB 3I6MA 3VTAA 2D59A 1A2KC 2XZOA 1DJMA 2RI6A 3ESDA 3G88A 3IKLA 3Q15C 3FKSD 4PICA 3L1VA 5A04A 5DGTA 1XZ8A 4JBHA 2NGRA 3I58A 1E7WA 3KTAB 2V1UA 3OX1A 4K40A 3DPSA 4EJ6A 4X90A 1LX7A 1KSJA 4LX0A 2IDJA 5GJWC 1K7EB 3BL8A 1EJ6A 2BFAA 3OP4A 1ZKDA 2FU5C 3OJEA 4M53A 2KX7A 1Y6ZA 3LZCA 2ONKA 1MA3A 4TV9A 4DDKA 2OWDA 2ZJYA 1CZOA 3QWIA 4OSPA 5C0OE 2EJBA 1RBQA 4URZR 2CXOA 2B7BA 1WX1A 3IUSA 1C30A 5FUBA 4V1CB 2C9MA 1KORA 4HVTA 2WTNA 3DAOA 3LECA 4JBYA 1MVNA 4H15A 1Q1ZA 3FWNA 1I6LA 3HA2A 3UTDA 4CT5A 5CB4F 1BCSA 3VV3A 1EXDA 3F6PA 1CZKA 3H4VA 3WFZA 2CT8A 5J5CA 5KWVA 1UK8A 1F0NA 1X94A 2JGNA 3PR3A 4TRRA 1G0OA 4XW2A 3GGDA 4PM4A 2IHYA 3SEQA 3RO7A 4QXRA 4C30A 4AAYA 3ITNA 4M1ZA 1W47A 1EGHA 3PPWA 1L3IA 1BQ4A 2BKUA 5B58T 3CLVA 2XKAA 4K9PA 1NUUA 1PFKA 5DHRA 3ED1A 1N75A 4GOND 1ID1A 4C7OA 3ICWA 4HVAA 5C7YA 1O95D 4TLMB 3SIPA 2C4MA 2XGOA 2I0FA 1C1YA 2RGBA 3AY7A 1UWLA 3W79A 5DTJA 3U7IA 1CIJA 2C94A 4HDSB 1UKAA 2XMSA 4MR8B 1Y3FE 4GWKA 4R84A 2Q62A 2DPHA 2G07A 3N0VA 3E58A 3OCVA 5GAJA 1G8YA 4MA0A 3MWDA 3JVUA 4FIDA 4K05A 2J5QA 2JH9A 3G8DA 1TEXA 1TJ3A 1VJRA 2JFQA 3K5WA 2ZSDA 5C3MA 2B8WA 2PL5A 1HQDA 1M67A 2P90A 4JELA 4YCMA 3DNPA 3CVWA 3ZQKA 4BLRA 3RRNA 2BONA 1Z6TA 3DT6A 4JQOA 1EXWA 3TSYA 4KPEC 1W1WA 2NT3A 4YAGA 5AVZA 1HNXB 2X5NA 1NNLA 2K7ZA 1X9GA 2XHEA 4HGOA 4MK4A 4TWZA 2QMHA 1DJNA 1GA1A 1KK0A 2PSEA 5CXSA 1A9PA 5KYXA 3K9BA 1T4DA 2VHJA 2GSWA 3LL7A 1C8KA 2UZ4A 3TGWA 1J22A 1HLFA 2F1RA 3CX7A 3PHBE 1GQRA 1W5FA 5F1KA 1UAAA 1H4SA 1QH1B 1RYNA 3MAJA 4JB8A 5IUKC 4FKBA 4UZFA 5AW4A 3AL2A 3EGOA 1OFIA 1U3TA 2VTVA 4CDMA 4L7VA 5ECDA 1A98A 3M3HA 1W87A 4PZUA 2ORVA 2WMNB 4WZBB 5AW9A 1RQNA 4H3HB 3ZV6A 4FWIB 4BLTA 4OUDA 3E7XA 3A2LA 3G8AA 3ILXA 2AJTA 4TLCA 3L49A 3ZW7A 5F4BA 3RQIA 1C0IA 2CNOA 4GZ3A 4AJ9A 3EX7C 3Q9LA 5CJJA 2I29A 2SKEA 3PUIA 4H7FA 2BDTA 4R9SA 1JA9A 1G1AA 1M1ZA 3OZXA 1GPJA 1K86A 1T24A 1CZUA 1W0JD 4WXMA 2C98A 3RKRA 4L72A 2ACWA 2R86A 3L8CA 4EA8A 5TQJA 1KYXA 3KUCA 3LPMA 2AJLI 4GI5A 5LZ5A 4PF1A 4MW9A 1T4CB 2C7GA 2J4FA 3GRUA 3KT3A 1C3XA 5FUYA 1AT1A 3OSZA 2JB9A 3T9DA 2RHRA 4AS2A 3A4VA 2JKYA 1XIVA 2VQDA 1JWBB 4TWIA 3UVEA 2AI2A 3ZWWA 4CJXA 5HKKA 4PRLA 1UP6A 1CB7A 4B9AA 1M2EA 4GSKA 4RM2A 2JBAB 3SHQA 3RJ9A 4OLHA 4K7JA 4MWEA 3RU2A 1XYVA 3WQRA 3ED5A 1CT9A 2MR6A 3O2SB 4GXQA 1EBBA 1PQUA 4OAQA 5HJ2A 5ED0A 3U19A 4OLBA 3NETA 2CD9A 1EQAA 1XZAA 3PDIB 2QUHA 3BDVA 4HYQA 1K75A 1ZIXA 2BGMA 1M6NA 5EXDA 2X9QA 5EJAA 5EYPA 1R8QA 1II8A 2EVWX 4EW3A 4NPAA 2OV3A 1OGYA 1UMKA 2XITA 3OOJA 2ANBA 1VG9B 3IA7A 1JQ5A 4FCVA 5JSFA 1G4HA 1P4SA 1DOHA 3R44A 4DA6A 3QLUA 1FNCA 2TRSB 4L57A 2PWZA 1W5EA 5EUMA 1JLSA 1SC4A 3KVNA 4P3YA 4G5FA 2PFSA 3S70A 1QU3A 5P21A 1P2SA 1RWQA 4D42A 4PTLA 3AYXB 3IT2A 1J49A 3U31A 5CM8B 1IEXA 4HB3A 2A84A 4X7BA 1SUAA 3BORA 4CF3A 4DYHA 4UTXA 5BSGA 4TMFA 4DEVA 3PV0A 2I4IA 4MKHA 5FADA 3DM9B 4PHFA 4QJ3A 2VPQA 4UUQA 3OQOA 5KO2A 4KBYA 3KJXA 3R0XA 5C31A 3IJPA 4UU0A 5LFAA 2EBWA 1TX4B 1DX9A 1MORA 3B7WA 3QG5A 3RHZA 5K6AC 3N05A 3WYEA 4LG1A 4B6QA 1D8AA 1UF9A 1E7YA 2NTEA 2V6FA 5CAEB 1RRGA 2OC9A 3AX6A 2YIDA 4ZAWA 3EXIA 3IQHX 4I14A 4EG0A 4DUPA 1BOFA 5HDQA 5EIOA 4D0GA 5BWCA 3DE7X 3W9UA 1F12A 4DTCA 3TTSA 1YR2A 3G8YA 5LQUA 2WUVA 4FJ2A 2C7PA 3NJ8A 1DMSA 1EP2B 3BG5A 3ZLJA 5DTRA 9LDBA 3SXUB