2FRVA

Crystal structure of the oxidized form of ni-fe hydrogenase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
261
structure length
261
Chain Sequence
b'KKRPSVVYLHNAECTGCSESVLRTVDPYVDELILDVISMDYHETLMAGAGHAVEEALHEAIKGDFVCVIEGGIPMGDGGYWGKVGGRNMYDICAEVAPKAKAVIAIGTCATYGGVQAAKPNPTGTVGVNEALGKLGVKAINIAGCPPNPMNFVGTVVHLLTKGMPELDKQGRPVMFFGETVHDNCPRLKHFEAGEFATSFGSPEAKKGYCLYELGCKGPDTYNNCPKQLFNQVNWPVQAGHPCIACSEPNFWDLYSPFYSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMIC HYDROGENASE
publication title Structure of the [Nife] Hydrogenase Active Site: Evidence for Biologically Uncommon Fe Ligands
pubmed rcsb
molecule tags Oxidoreductase
total genus 75
structure length 261
sequence length 261
chains with identical sequence C, E, G, I, S
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 1997-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 2frvA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 2frvA02
4UCQA 4UCWA 4TTTS 3USES 2FRVA 1FRFS 5A4FS 5JRDS 4UD6A 4GD3Q 3USCS 4C3OB 4IUDS 3ZE7A 4UCXA 1UBUS 3AYZB 1UBRS 1UBOS 4UE3S 3CUSA 4KO4S 1WULS 3H3XA 5A4MS 3UQYS 4KL8S 1WUKS 4KN9S 5JSYA 1WUHS 1YQ9A 4UPEA 4URHA 3ZE9A 3ZE6A 4UD2A 4UEQA 4U9IS 1UBLS 1E3DA 4KO1S 3ZEAA 5JSUA 1WUJS 4KO3S 3RGWS 5JSHA 4U9HS 3MYRA 4UQLA 5JT1A 4CI0B 1YRQA 3AYXB 4UE6A 1YQWA 1WUIS 5ADUS 4OMFG 4KO2S 4UEWA 4UE2A 3ZE8A 1UBJS 4IUBS 2WPNA 1UBHS 3CURA 5A4IS 5JSKA 1UBTS 1CC1S 1UBMS 1H2RS 4UPVA 5D51S 4UQPA 4IUCS 1UBKS 1H2AS 1FRVA
chains in the Genus database with same CATH superfamily
3QFSA 2DCMA 4KODA 1UBNA 3TH5A 5CM9C 4LF5B 3SQDA 1KVUA 4MQBA 3NO4A 3G8BA 2F62A 4K88A 1JE1A 1SXJC 4EG3A 5CA0A 5KWSA 1FDIA 3B60A 3K09A 2ZYWX 5DLQC 3LXMA 3MN1A 1J8YF 1TO1E 1MENA 2DUNA 1RCFA 1EK2A 1V43A 1F8FA 1N6PA 2GD2A 2WF6A 3LQFA 3KB2A 3N2GA 4KU4A 4ZVOA 4NJEB 5LXTA 2FQXA 3EGDB 1HNNA 3L93A 3TW4A 4JJZA 1DTSA 3FOAA 1E4YA 5FTLA 4MVWA 3THXB 6ABPA 4Z3OA 3PGMA 3RHFA 2QE7D 3K0BA 2KPOA 2ZSHA 1BXRA 3EUFA 4OQPA 4RZ3A 2B4RO 2DBQA 2EP8A 2E49A 4N65A 3BIOA 2ZJOA 3FSEA 5FOTA 3E22A 2H52A 1QG2A 3F96A 2VDNB 2YJ4A 4MQMA 3DLPX 2AFRA 4GP6A 4GX1A 1DXHA 4ZZ1A 2AFHA 3CSUA 2QPLA 1DG3A 2WT9A 4A9AA 2JLZA 2X19A 3QQ5A 1XPUA 3NM5A 3OJFA 3ENQA 3S1SA 3DT6A 1Q50A 4WNAA 5EIAA 4QFDA 2UZ0A 3KJHA 3WO1A 3KKPA 1BWPA 5F12A 3UFXB 2OUKA 2ZUBA 4MB6A 4D4MA 4XGNA 1QVZA 1K66A 4KH0A 2G80A 2POQX 2ZBUA 2GQ0A 4PYQA 4RTSA 2IOFA 4JH0A 2B99A 3GT4A 3BZWA 2OD2A 3VR0A 3OQHA 1C0IA 3UAOA 3LOPA 2JCVA 5AW8A 5IVHA 3L7BA 5CVDA 1IN8A 1WUJS 1NF9A 1FX1A 1TYZA 3KKZA 2GN4A 2WU3A 2X86A 2W2OA 3L7JA 1WVGA 1A9PA 1SN7A 1OWOA 4KGXA 1FL9A 1N57A 1CY2A 3RSQA 3ZQKA 3VSEA 4E1BA 2AFIB 1L9KA 4R8LA 4Z3KA 3AY3A 3P4UA 3ASUA 2RARA 3WL4A 3EIXA 5J2UB 4OH7A 3I1YA 1IYZA 3KQVA 4TOIA 4KQ1A 4MRVA 5TT1A 1BMQA 4R1NA 2WAMA 1RAIA 2GX6A 1N0HA 3N70A 3NC0C 4CIXA 2ROQA 3FUXA 4HWOA 5CJJA 2QNIA 2QJWA 4P0QB 5L7WA 5HWSA 5DW3A 5LCXA 1H2YA 2ZSFA 2BM1A 4FE7A 4DLAA 1PP4A 3LWZA 3IDZA 4RHCA 4CF7A 4X65B 4RLSA 3G0GA 5BRNA 3IUJA 1QIEA 5BQPA 4AKGA 4G0PA 3AGPA 3AEUB 4QOEA 1JFVA 4REQB 5CIQA 4FZVA 1T0JB 2OV8A 8MHTA 2A1IA 4OD0A 4TQAA 1E94E 1LBIA 2Y1CA 4L7VA 3DZKA 3FMGA 3IV7A 3W5JA 1H9CA 3RG2A 1ZJYA 2F9FA 1HTWA 2R8EA 3CIFA 3JQGA 1W8IA 5AUOB 2C4NA 4EB3A 5JNVA 4I9GA 1ISPA 2C96A 3INNA 3UT6A 4PC2A 1VB5A 2H31A 2G25A 1OHHD 4PFSA 3IUEA 3SIPA 2CJYA 1Z16A 3BRWA 2X3YA 5MDHA 5FLXA 1RI3A 4GMGA 3ZY5A 3ORHA 2QJOA 2X2EA 3ASYA 3CRVA 4GOND 3RYFB 1ZI9A 1IZ0A 2I4LA 2CUZA 4ARZA 2GBLA 1DX6A 1LDGA 1XTZA 1U7OA 5E8RA 3KAKA 4RHXA 4WN9B 3B9RA 2B61A 3A1FA 1RZVA 5DMXA 3Q0IA 3R5HA 5BNFA 1NX6A 5DYNA 3Q7IA 1WY7A 3O0DA 3U56A 1PQPA 4YP6A 4GMHA 2HF2A 4I14A 4O6VA 1Y6GA 4I8DA 3LUFA 1AUOA 1HE4A 2J59A 2VAMA 3GJ0A 3SXJA 4AXXA 4C1NA 4X7BA 3AU9A 4S2EA 4TTJA 4C5AA 4HN4B 3IILA 1Q11A 2B1IA 3MNFA 3PPWA 1Y8QA 4PXYA 1WULS 3U9SA 3LKBA 2QRPA 1QOPB 5CYOA 3G7SA 2OHFA 4KJZA 3TUIC 2AG5A 4ZOEA 1TK9A 3GYGA 1EFRD 1K5GA 2PXAA 1DBPA 2Q3MA 3D6MA 3D0RA 3NM6B 1MJFA 1P6XA 5J1SB 1YRLA 5H8WA 2B2NA 5C7YA 3RSHA 3ITDA 1KARA 4KAJA 3MT8A 3EY4A 4WLVA 1P1BA 1WXEA 2CNOA 3WZMA 5CBKA 3IC5A 1YZKA 5FA5A 2ECQA 1X80A 1DTWA 1SGWA 3A6DA 3C5CA 5IG2A 2PKYX 1U8YA 1JJAA 1U9IA 1WR8A 1C3LA 3IDFA 4KLCA 4MHOA 4RFVA 4ZEWA 5CA0B 1VE3A 521PA 1G2OA 1PJ8A 2QGNA 3CEAA 4X1KA 1QORA 1U2EA 4ZV7A 5HRCA 1JIXA 3E7PA 1VC2A 3KPVA 2WVJA 4OKSA 3N2GB 3T06B 3DAHA 2CJFA 1WU8A 3BCRA 1WDLA 3GLHA 2B98A 3SJ7A 5LXTB 3FUTA 2DTXA 5C3MA 4X84A 3ADOA 1CTQA 2ZT5A 4PQRA 5F64A 5A3SA 4B75A 1K7FB 5IF3A 1GM5A 2QQGA 1XPRA 4H1TA 1A4RA 3SQLA 3ETDA 1PR3A 4F4UA 4RA9A 2JVIA 3E27A 4KGZA 2CK3A 3I72A 3I9JA 2ZGVA 4LC9A 1BEZA 2P0YA 4PCVA 3WRYA 2DJ5A 2IPXA 3LECA 4Q02A 1AMNA 1PZEA 2AFHB 1ILEA 5HHTA 1Y3HA 3R4CA 3R5FA 5CXSA 5KREA 1NT2A 3Q88A 2BMEA 1OYWA 3KTFA 4BLSA 5LWHA 4WNAB 5HTOA 5KVAA 2AXNA 1KQNA 4BLRA 1EK1A 1VCIA 1AU9A 4GBJA 4P08A 2W2LA 3OZFA 3OU7A 4P3NA 4O2BF 3F97A 2QZ9A 3PPIA 2W5UA 3E7WA 4DDHA 2QLFA 3VU3A 4XGRA 4DNQA 1MP0A 5EOVA 1TQ8A 3ADPA 4H7IA 4IUBS 1TIPA 3FDXA 3KUXA 1NQAO 4QPJC 5FUBA 3K0EA 3RV4A 5A1JA 4G26A 2G9RA 2XYPA 1E1KA 1N5OX 1F20A 2H0RA 1SBQA 4MOWA 2WV9A 4O1MA 6YASA 5BOSB 1G3UA 2ZBRA 3UJDA 3OPNA 5I45A 3U16A 1JPJA 5DTIA 1YFJA 3ZDCA 1CJVC 4RPHA 3PRKE 2K2WA 3MWLA 1T8RA 4MW6A 1W85B 4OHKA 1V2HE 1E2BA 3VR3D 1JEQA 4RZXA 4RMJA 2AUNA 3G8DA 3GVPA 1B1CA 3IJEB 2X8WA 3IGFA 2OZEA 3Q98A 1O97D 4GSLA 1O77A 3VGJA 3ZR4B 1YA8A 4WZZA 1NMYA 2G07A 5GQSA 5DNCA 2YJTD 1B7GO 4QVIA 2C7BA 3W34A 1AV6A 1SB9A 1X8KA 2PKXA 1ULAA 3QE4A 4IIXA 3BD6A 3TAUA 5K3DA 3TZ6A 2NSYA 1RBMA 2Q0SA 2WIKA 3W2FA 2IH2A 3CPHA 2J33A 4DR5B 5TDHA 4BVBA 3B89A 5EP3A 5AOAA 3VNSA 5WRFA 1RC1A 3W8NA 1UKEA 1YHNA 4KE9A 3URKA 4MMYB 3B9PA 1K86A 2NACA 4UE3S 4Y6SA 5I9TA 3UWKA 1VBFA 4L7QA 3UGTA 1J7KA 5AHXA 5ALWA 4FZRA 2QMQA 3C5VA 3N74A 4RD0A 1ECLA 2YHUA 2FW1A 2GZRA 4YGXB 1ML3A 3I01A 3ELBA 4IS3A 3AW8A 3C4JA 5FI5A 5KKCA 2FQWA 1JFFA 1WPGA 2PL1A 1WMBA 2ZATA 4LCEA 3PIDA 5ELLA 3WFZA 3JQGB 3VV3A 2P69A 3W7AA 3PUXA 4OB7A 2PZEA 3GFQA 5KOIA 1XCJA 4CHTA 5F76A 1E99A 2DBYA 1Z35A 3NV7A 4O4LF 2Q41A 1NVGA 1W0JD 1X9HA 2G82A 2IODA 4UZEA 4OI1A 4PAQA 5FDFA 5IDWA 5I9NA 3UPUA 3A3PA 5LOVA 4U2EA 2AZTA 2WEKA 4PFJA 5U4XA 4MGIR 3H65A 3HJRA 3PA6A 3IPCA 3LY8A 4WPGA 4ARZB 2FA9A 4MW0A 3ILXA 1HDZA 2Q8NA 3H1PA 1K8XB 5FBWB 4DZTA 3OZWA 3B5IA 4HAWA 2Q6IA 3QBEA 2BCEA 3ZH9B 1VL6A 2WE7A 4OYYA 1AXRA 3R09A 1M7BA 4JITA 3P9IA 2YYAA 2V58A 2GWRA 5TF0A 1JW9B 4LRWA 1X9IA 1G64A 2Q2WA 1HURA 1EDEA 1EX7A 1YBFA 2XGMA 4YJ2F 4YNBA 4BLVA 1IJKA 1L7PA 4R69A 3ZV4A 4C20A 1X92A 1IPFA 3OZDA 4E03A 2I6UA 3UWDA 2XGOA 4L51A 3PDJA 4PFKA 4CM8A 2VT7A 1OH7A 1U9ZA 4WOBA 3KKQA 2OESA 3QOXA 5E1MA 1B41A 3RC1A 1MABA 2VJLA 2BFNA 2PPLA 2V8BA 2Z2IA 4ZKEA 4HRXA 3T41A 1UPFA 2Q5OA 4UCFA 2KYRA 4Z7JA 3L7KA 3F71A 3GEEA 1KO1A 1F0KA 1OLSA 1QCDA 4MV4A 5FTKA 5CRIA 1X80B 1JI3A 1AZWA 3NT5A 4J1SA 4F71A 4JI7B 1NLFA 5DHUA 1O6CA 1FDWA 4BVLA 4BYGA 1D2GA 4HWPA 3F4LA 3ZWQA 2QKYA 1MRZA 1DKQA 3GY0A 1JFRA 2V65A 2ZS7A 4LIPD 4X1KB 2J9GA 1XKTA 5LMZA 2HK9A 2IXDA 4JLBA 3K6KA 4J0EA 3GLHB 1SOWA 4AUKA 1CUIA 1D5WA 3SDBA 2IWRA 3I6QA 3PQ7A 1P62B 4HAZA 4IIEA 4QYXA 4FNGA 4D92A 3UFBA 1JR6A 4GX5A 1O94C 3K9BA 3QXGA 5B36A 1BEEA 2RHJA 3RLIA 2FUCA 2LCQA 1WBJB 3Q3VA 1FZQA 3BMQA 2IQIA 3IVCA 5J4KA 2WTBA 4RA9B 4TZ6A 2UYQA 3OMXA 5JJIA 3KQYA 2PZJA 3NV9A 3CHYA 1ZIXA 4D56A 4MDEA 3IO3A 2VKQA 1GN8A 3RTAA 4BNVA 4P36A 4ZMBA 4FPXA 5AD1A 3OHMA 3KV3O 4QGHA 4GOMD 2YYSA 3GJ3A 4GLLA 3AWDA 3FAKA 3PUIA 1ACMA 1EP3B 1KK2A 1XDUA 4MLDA 4QLBA 5IJ9A 2JARA 1Z4PX 2PVCA 1KJIA 3FB4A 3QOWA 3QI7A 2E18A 2G76A 1XHFA 4AECA 3GLFA 1JTVA 4DIBA 2C9MA 2P4QA 1WZNA 2OILA 4ZI7A 3NEJA 1ST2A 2W6OA 2ZAYA 1UJNA 3TLYA 3RYTC 5D00A 1CUXA 3UUWA 1Q0TA 3R40A 1F14A 3V2IA 4EHDA 3ED5A 3CTMA 4J3FA 4IF6A 3JZFA 3CZMA 2WABA 4YHHB 4M21A 3IIMA 4Q1VA 1ZISA 3L0SA 5AICA 5THKA 2NU6A 4L4XA 2E89A 1RU3A 1C2TA 4R68A 2JLXA 2EF0A 3FPJA 2CFIA 2VHYA 2OHHA 3QEJA 1I5OA 3OCWA 1E1LA 2HWXA 2Z57A 2HNAA 1ESCA 5JWHA 1CS0B 4OP2A 4WA7A 4HFRA 4OGKA 4GUDA 5IK2A 2DHCA 3TE6A 3ABRB 1PL0A 1TU3A 2IRWA 3HV2A 3MWEA 3R24A 5AI5A 3TFWA 2PUAA 3FTNA 4LE1A 1OXUA 4YV0A 5K99A 4JASB 3VJKA 5HE9A 4AKHA 4FR2A 2ZSDA 5AKKA 1A1VA 2CMFA 4GNKA 5AK5A 1Z83A 2QIPA 4R1UA 1U3CA 2BJHA 4R9VA 3P9KA 3UTDA 1CV2A 2NO7A 2IJGX 1GGEA 3WMRA 4HQOA 4LTDA 1L2TA 1N5JA 5EN4A 4XB6B 4AKSA 1T4DA 4IOMA 4F8EA 3S2SA 3ONVA 1L4MA 3T6KA 3GP5A 2B34A 2ZWIA 5EVJA 1F1JA 2YN4A 1MR3F 4M8SA 3HBLA 1O96A 1R9MA 5DN6D 1DI0A 2BFFA 5FL7A 5ALZA 3RREA 1OLOA 3Q8WA 5THXA 1JFFB 5DF1A 5K01A 5BT9A 3TXYA 4C7MA 3MW8A 4G0WA 2YV1A 1V7ZA 3ZEIA 4BVGA 4X6XA 1OWMA 3N5CA 4L15A 2PUDA 5DRTA 3E9QA 3VR2D 4QUAA 1YQUA 4OBBA 3RKSA 1LBQA 2X0RA 4KOEC 4JV5B 3O1LA 4MRAA 4RKFA 4M1MA 3QE0A 3A31A 3SJBA 2F3QA 4EARA 2PTGA 4YQZA 4LXYA 2QPAA 2Q45A 2F9MA 2HJHA 2R96A 1TKAA 5FULA 2OP1A 4ZAVA 4OQXA 5IT9A 3WO0A 3NDBB 1X3LA 3VR1A 1QYXA 1WKBA 4NULA 3P4YA 1GHTA 2G77B 3DLTA 1BGVA 3QF4B 1H94A 1MV8A 4G0QA 1R8SA 3O31A 2ODWA 3MTIA 5K0ZA 3KPYA 1G9TA 3NWPA 2IW3A 4OXIA 1K7YA 1WG8A 2IEIA 4IMPA 3CF4G 1M66A 4ZOBA 4NCKA 2OO5A 2GN8A 3UBMA 1WOYA 2APJA 2B37A 1HNXB 3QMVA 3ORYA 4ZOCA 2CLIB 2YJ5A 4B6FA 4PCLA 2VYCA 1M2HA 2IU0A 1Q14A 3JWPA 3ET5A 1HH4A 3KVRA 1DUIA 2R1VB 3GEHA 4K1XA 5EJMA 1IN5A 4CM8B 3O4VA 4FHGA 2HOQA 4YFVA 2IYWA 2I5PO 3I6MA 5A4FS 2ZZKA 1TZ2A 1TVKA 2FN8A 2MJLA 3NMUF 4XI9A 1Z8FA 3C1OA 5AJYA 4B2PA 3UOWA 2PV7A 4BVHA 1KI2A 4DIOA 1FTYA 3DSRA 1I0ZA 1N1DA 2QSJA 2QRUA 5CDFA 4CMEA 3TDKA 2NX2A 1OIWA 4WFQA 3IIKA 1J6UA 1U1FA 4DCCA 1E2LA 3DLCA 1AUVA 3BSWA 3AHDA 3VDQA 1DL5A 4LOLA 3E5HA 4JYAB 2UUOA 1DAGA 1FZTA 4UBLA 4KB5A 1A2OA 3H3XA 1I14A 2CYBA 3O1JC 4NNJA 4FZ5A 4M1TA 3P9ZA 4Q1DA 5C5DA 3EOBI 1RD4A 2WM2A 3E4CA 4UARA 2LWIA 3F3MA 4AD8A 4LCJA 4U2CA 3GHHA 2ODQA 3DQQA 1Q1BA 1H4VB 5FL3A 5JNUA 2XUAA 2RG1A 4BNUA 3JR7A 5I7RA 1JG1A 1V4BA 3BCHA 1QKJA 2CFOA 3FYTA 4MVJP 3QNMA 2Q3CA 1L5OA 4BAZA 4MMZB 3R41A 1HL3A 1I6LA 2O4UX 4LHYA 4DA0A 1XMOB 3A6ZA 2FMFA 4C1BA 2A9QA 3EH1A 1NDHA 3NBZC 4HY3A 3ZNQA 2GTHA 2DETA 2HDWA 3GH1A 5ABPA 1MKYA 1JECA 1ODKA 8LDHA 1UT5A 3CWQA 5G4KA 3RSCA 2JFQA 2Y0DA 5BQ5A 4BN4A 5JNSA 2ZVQX 1DO0A 1YCHA 4RXMA 2OWDA 3ID6C 3IP7A 5HIJA 3FPSA 4Y2SA 4A26A 5HZKA 2FSVA 4FD3A 1SUFA 3RUEA 4B47A 3ROKA 1DQPA 2V0CA 3GRVA 3RYHA 1IHPA 1CY7A 3E1GA 1L8LA 3ND9A 3QMWA 1GZDA 1U9IC 3B1JA 3OO1A 1EFCA 4R6WA 1EQAA 1KQ3A 3BIWA 4UZSA 1XZHA 4FOSA 4TMKA 4GOJA 1PI3A 4WGFA 5TPZA 3GCDA 1QAQA 3GRFA 4J94A 1Z45A 1Y82A 3GELA 3QTBA 4DCNA 1V11A 2WIBA 4YUZA 5HFAA 1BROA 3HXLA 2JF0A 4F5DA 1S1MA 2IOFK 2RB4A 4FN5A 3T5AA 4AIRA 3QXSA 1DZ3A 1SU4A 3ZZNA 2NU6B 4MI6A 5CHYA 1Q91A 5I7FA 5C51B 2IS4A 1EPUA 1KK3A 4KIFA 3TX6A 3URMA 1PDWA 4DLRA 2P27A 1KJJA 2PZMA 1KI8A 1T0IA 2V7EA 1HFJA 2W7TA 4K46A 5E6SB 2IYNA 2XWJI 3FI0A 3SHOA 1PV4A 1G8YA 1BCSA 1QCYA 4KXFB 2V3VA 2CD7A 2G72A 4OG2A 1Q2XA 5EJFA 4NV0A 1E3QA 1XRMA 3FSJX 4GLOA 1TAQA 1N6HA 3WNCA 2W22A 1BFKA 1FNSA 4HC4A 3MWKA 3T95A 2JHGA 2ZIAA 3WLJA 3KYIB 1F4LA 2Q3HA 4CQNA 4FYKA 4EGCB 3ORFA 3PENA 4LQLA 1O0CA 3TM5A 4ENPA 3CQ9A 1CUJA 3EMKA 1E7WA 3EPRA 4Q5IA 4Z4QA 2GPAA 5MGNA 4JZKA 5KWJA 1XE3A 3KR9A 4IQ8A 3U4GA 4ENUA 4QXOA 1CDDA 4TQGA 2XB6A 4QQNA 5PGMA 2GKOA 1IN4A 2O0HA 2QZSA 1O96B 2B8NA 2VP0A 1N2EA 1NBWB 2A2ZA 1ZFNA 1O6GA 2BFFB 5JCOA 3QKUA 3NNNA 1Z6TA 3EF3A 2YASA 3A4LA 3RGGA 5AVXA 3Q40A 1KDZA 3HSKA 3WFJA 2ZU6A 1XVTA 2XJ9A 4OL0A 3TK1A 4RIFA 2XMDA 3B53X 4LS3A 4PZEA 2CGEA 4JLKA 4LRUA 4UUOA 5C1IA 3ZU2A 5KC8A 3N8DA 4MKZA 1GSOA 1G5FA 1XZLA 2EEZA 1IM5A 2DBZA 2QX7A 2R87A 1SG6A 3SDSA 3V8VA 1U2PA 1FXWF 1NJ1A 3W9SA 3WIEA 4CKCB 1TKRA 5JC1A 4V0RA 5CTJA 4A5SA 1CQIA 5IBQA 4DQ0A 1SC9A 3LWBA 4WLEA 4F92B 4RHYA 4G67A 2JZCA 4II7A 4V0OA 3M82A 1AQUA 2ANCA 3LLSA 3P19A 4G1FA 4H2DA 3GRZA 3C4VA 4MAAA 3PKIA 6Q21A 1ILWA 4DUZB 5BSRA 3RIHA 2W6CX 1MPXA 3WSWA 2J5RA 1OB5A 2JKVA 1O0SA 1OAKA 1QNFA 2ORYA 3QWBA 4GL4A 2J41A 3K73O 4S12A 2Z8XA 2JASA 4BS9A 1E7SA 1E6UA 1UZMA 3GHYA 1YGYA 1AS0A 4I36A 4IX1A 4JGBA 3LCVB 3EHEA 3CUEF 4GE0A 1ISJA 1OREA 4PX2A 3NHWA 1RHKA 3SJUA 3GCGA 2XSZA 2O2DA 3M4YA 4MUJA 2EFCB 3HB7A 4Z7QB 1TVKB 2W00A 3P0JA 4NNPA 4NP6A 2UUBB 4RDHA 1TZBA 3WA6A 4WOCA 4Z2AA 5JNTA 4WCDA 1J2EA 2AMYA 5FF9A 3ENKA 1NW9B 1KQPA 2JRLA 4QEDA 4OI4A 3L1IA 5FBQB 5KVQA 4PRLA 3ZUGA 4K6MA 1GGMA 1WQ3A 3KLOA 5DCUA 1TA9A 3M6AA 2OGTA 2VJYA 1F5SA 3G17A 1MF7A 2WD8A 5D86A 3WB2A 1LVUA 3E3MA 3IJ5A 4NJMB 4US2R 2FY8A 4FSDA 5AKIA 4MCHA 4AT1A 3QEBZ 1CHNA 1N6NA 2LKDA 2VUHB 3T4UA 4OTZA 4GI5A 4IDQA 1EFKA 3NBQA 1KEZA 2NVWA 1PG5A 3IKMB 1GADO 1HYGA 3C3YA 3IQIX 1AHNA 2MINA 3J80A 5T3YA 1EFTA 1XWIA 1JG6A 2CNNA 1FFSA 2C8VA 5CD1A 2QRKA 1KMHA 4YJKA 3IRUA 4BNIA 4HN2A 3UV7A 3OCYA 4LNUA 5LLDA 4TL9A 5EHNA 4F3KA 5NULA 3OPXA 3UHOA 1XV5A 2HIGA 3BB4A 3U3MA 4BNJA 5JYBA 2QY9A 3Q1KA 3BD7A 4BO3A 4H3SA 1KEUA 4KR7A 5IKXA 2CWWA 3K8QA 5B3AA 2HNBA 4GZ3A 3ES9A 2OMKA 1VKHA 5CVJA 1BMFA 3KKNA 4PAWA 3GNSA 4D45A 3OFNA 4LXHA 5DHSA 4LTNA 4ZOLF 2ENUA 2B82A 2P2GA 3EDMA 3PNVA 4E11A 3GAZA 2XF2A 2H2DA 3RYHB 3IH5A 1HT2E 2ABWA 3WP0A 1Z63A 2BFMA 3WMXA 3WB1A 1CRLA 4OQEA 2A3RA 1RKVA 3L77A 1RJFA 4OLFA 2BMAA 1MC5A 4FFLA 5P21A 1JI0A 2KJQA 5EHGA 3F8TA 4BJ5A 2H1LA 5AJVB 1V11B 5BNIA 1KJWA 4TV8A 2HJ9A 5GZ1A 3WA7A 1SAYA 1FRFS 1G41A 3KS9A 2ZUEA 4Z4FA 1HDXA 5DISB 3RS3A 4J7UA 3UPDA 3TIGA 1MV5A 1NYLA 3H5WA 4UU8A 1W4RA 2C94A 1QWOA 2Y92A 5AMXA 2XE6A 2AHOA 5J5CA 1GGKA 3DH0A 4WLOA 1GKIA 1RYMA 1C7FA 1VOTA 4C78A 1SQSA 4KAFA 1BCSB 4BP1A 4LYFA 4G0ZA 1UBGA 4DEXA 4RY0A 5C7OO 3CV3A 4MAFA 4A2QA 3FTQA 3HL4A 4P92A 1C8BA 4TL7A 3ZCRA 5LM3A 3SF8A 4NCAA 4MEAA 2HQOA 1QH8A 2IUYA 2WJPA 3HYNA 1KJQA 4TMTA 2HRRA 1DBWA 2IKSA 2P9GA 2PWYA 4KL8S 3NORA 2QY6A 4AP9A 2G4LA 2VZ8A 3ZE2B 3LDHA 2YBDA 4YAJA 3ZU5A 4P93A 3T5BA 4WLNA 4F3NA 4PN7A 3WRVA 1T2NA 2R3SA 2VBCA 4X1YA 4AXBA 5TV2A 5FD8A 3UXHA 1E92A 3GZNA 2BMWA 3M5PA 1Y4UA 3EZNA 5EKDA 4AROA 1SK8A 2E4VA 2VS1A 3LUDA 1LQUA 2BM0A 2JH8A 4KLRA 2ETVA 3JD1A 4EX7A 3MOSA 4U7DA 4NYJR 5L4NA 4Q3DA 3UKDA 3BWDD 1V0JA 3HYTA 3T34A 3ZHOA 1F7VA 3BMNA 3DV0B 5CFNA 4X20B 4CCWA 2QMZA 1GDDA 5SY4A 2IHJA 3A6LA 4AIIA 1LI7A 2QW0X 2EJWA 4XR9A 4W5OA 3FLEA 3GNLA 2BIFA 3L01A 3ETCA 3I1FA 3T8YA 4JUBA 3O2QB 3A1UA 3PEWA 1JB9A 1S8OA 2P41A 1R8YA 1LSUA 1BDBA 2JCSA 1Y5NA 4FCCA 5IVIA 3OC6A 4OJTA 4U9HS 5BR4A 5J4LA 1TECE 4AKTA 3VQTA 1PFVA 1SBNE 3JARB 2F90A 3SK0A 1PGJA 4UM8B 3TG8A 4UU1A 5KNDH 1KSJA 2HUNA 1NRWA 3HVHA 2AG8A 2XRYA 1EB9A 3H8VA 2XOXA 3MAJA 3MQFA 3RVRA 4I46A 5CYFA 4IXMA 3RFUA 2FZVA 4R2HA 5D3MA 1N33B 3U7QA 4RIEA 1NYQA 3VPAA 2H3EA 2W90A 2HA2A 3CNEA 2WIAA 4ZDJA 3HVUA 3QW2A 5LD2C 9MHTA 2VP4A 3AKZA 4BKOA 4D4JA 1YBAA 1TQHA 2F9LA 5B1HA 1BX3A 4KXQA 4LGYA 2Q1WA 2I99A 2K7FA 2I03A 4NHOA 4PO3X 2ZZMA 5ALOA 2VWGA 2GYUA 3MS4A 5G40A 4F7WA 4HUTA 2R5FA 1JQAA 4V3BA 4HZIA 1A5SB 1N5KA 2CL5A 2FLVA 1DAIA 1ULBA 1HRDA 4MHSA 1SXIA 2O3TA 1UXKA 2LIVA 1XA0A 4EJSA 4EATA 2J3QA 1G20E 2D1FA 1KDOA 3I1JA 5BWOA 4Y6GB 3G9QA 5DU2A 3WICA 4HDQB 4DN6A 1I7PA 4PIMA 3ILVA 3I5UA 2IEDA 5T4BA 2CC2A 5CT6A 1SUDA 2AJLI 5CMLA 1U5AA 1II0A 2D5IA 1H1DA 5FTMA 4WWHA 1LRLA 2IEZA 3LUJA 3SKXA 4ENSA 1WO8A 3ABQB 4AYTA 2IYSA 2P3LA 1P39A 3C98A 4Q7KA 4G5YA 4FYVA 5DT9A 3DCYA 1T2DA 2OO5C 4DNPA 3CF6R 2ZSIA 5EJ4A 1Y3CE 1AO3A 2CUKA 3FWKA 5FI0B 4CMCA 1BTOA 3WK9A 2MINB 1NR1A 1VRWA 4L28A 1XVAA 4D9FA 4N6GA 4OYLA 2HSZA 2PZBA 3INYA 5EMJA 5M3BA 1MIOA 3BTSA 3EAFA 3BREA 3Q11A 4IDEA 3ZYCA 4DB2A 4YRQA 1W59A 2I2CA 3PWZA 1K3UB 5SV2A 1QZTA 3NUZA 1OX4B 3B5EA 3SR4A 1EHIA 2GETA 3FVQA 4V0LA 2B35A 4CDNA 4H16A 1P0CA 1SULA 5CIYA 2FG5A 4UM7A 3TW0A 2FR8A 1DJNA 5COBA 3IAS1 4HWTA 1T5DX 4Y67A 1A9ZA 4X71A 1NP6A 1V37A 2OSVA 3RQIA 3FR7A 5IEBA 2QLLA 2C5BA 4D9IA 3IBTA 2C2OA 2Z6AA 2BBTA 2PVSA 4LZOA 3JATB 5H5JA 5K0CA 1GWNA 1CK4A 2D5BA 2H4FA 2QM7A 4O5OA 4HNTA 2D7CA 1G2QA 1M6WA 2EC5A 3D5TA 4K40A 1T8TA 4YRNA 5JHGB 4BMCA 5DHRA 4RQAA 1FRQA 3WYNA 1XEAA 1NDQA 5ESRA 4CI9A 4RHEA 2C59A 2CXQA 2QWXA 4H60A 4QQFA 1QWSA 4ILEA 1EP1B 4RV9A 3UAVA 4TV8B 4NBKA 1GJRA 3HY3A 2XCTB 1UBLS 4I1OA 2NT3A 2PYZA 5M04A 3Q0EA 1POXA 2YICA 3UG7A 3T0FA 2BZSA 2A5LA 1MFPA 2JAOA 4LX0A 1VQ1A 4NESA 3VH3A 3OTOB 1MHTA 1XALA 3HSYA 4RFSB 1G9SA 2W0MA 2FF5A 3H86A 4KFRA 5CXQA 2OHXA 3KP1A 4HEA6 1TEZA 1ZCBA 1SBHA 3H0KA 2FUNB 3SF0A 3HWSA 3TD6A 4C03A 5JW6A 2JBAA 4Q4HA 5LQJA 1PGOA 3H1EA 3EC1A 4LBZA 4XXHA 4RV5A 1PSWA 5LQUA 1JDBB 1K3TA 4PC1A 3I61A 2H00A 4US1R 1ENYA 3CTPA 3OQIA 2PHZA 1QH8B 1YR9A 1D9XA 5C2JB 1M2FA 4N41A 2Y2UA 4P34A 1PQWA 3JX9A 4DUGA 4RZUA 1TM5E 4X1YB 2DM6A 2X8AA 3OD1A 3RSSA 4I5FA 2G0AA 2ZQYA 3GZNB 1LK7A 3I52A 5IAKA 1T8SA 5AVRA 3LC0A 1ZZGA 3NIDB 1NVVQ 3N0VA 1IVNA 3LBFA 4F60A 2ZJ6A 4PE5B 4YCSA 3BMNB 4QNNA 2QMHA 2E4ZA 4FNAA 1E64A 5A4IS 1R00A 3PHCA 2YW2A 2IF2A 3IUBA 3PNPA 3OU6A 2IVFA 1EXNA 3O8BA 1NPDA 5KTYA 4Z9FA 1QR2A 5JD4A 5KHOC 5ALXA 5JAOA 2CEAA 5LR6A 2FZKA 1QRRA 2GYWA 3EC7A 3QQPA 3HQ4O 4RGBA 1P0PA 5ALSA 3EDCA 1USIA 4DCVA 3QP9A 4BASA 2OM2A 5JC8A 4M0EA 5A02A 4FZ3A 1SU6A 4RSMA 5TQJA 3F1KA 1R0WA 3CZCA 2P2CA 5D3MB 4RY9A 1J5XA 1XC7A 3HO6A 3DEHA 3O8CA 5KHLB 3WIDA 4DA9A 4U0KA 1QRSA 2D1TA 1UDRA 1NWHA 1UBUS 3ICWA 3UK6A 4I4NA 2EARA 5ALKA 5K0NA 3U31A 3D7KA 3G89A 1RYHA 5DCYA 1JBKA 1KAOA 1LDMA 4I9FA 5DIFA 5BW4A 5AKHA 4HYTA 3M81A 2FWIA 2HADA 2J9XB 3L43A 3ZS8A 4YCAA 1L7QA 1PKXA 4IHAA 1ONOA 5K0EA 1MOPA 1H3NA 2Q46A 4P33A 2KHZA 3IULA 4LOAA 3ZBPA 1JEYB 2ZYIA 2A92A 2UUAB 5ICMA 4MNTA 1H85A 1MAVA 1MB0A 2DFTA 4EJSB 1CZHA 4E5KA 4EO4A 1P8AA 3WGGA 2G9QA 4JJ8A 5AH0A 1SC6A 2ZP1A 1ZEMA 4NEHB 4BNFA 3RODA 5EJ5A 3HZZA 5I6DA 2V97A 2AF3C 3P2MA 4MYSA 3SQWA 4ZDKA 1E9BA 3FPHA 4LXGA 1LXCA 1VKOA 1XLUA 5JADA 3DMTC 1IHDA 3G0HA 1DG1G 3JR3A 3GA5A 2DQYA 3RV3A 4BFUA 3KQLA 2X1LA 3VAAA 4NIMA 1QB8A 3VR5A 1U1CA 2P5UA 4I5GA 3SS8A 5K45A 4CMBA 2QAGC 3ZWAA 2IV7A 5FADA 5CA1B 2FE4A 4PG4A 1W2HA 3I2JA 5FKJA 2FEPA 4HGZA 1R6BX 1BFDA 3L0PA 3QYFA 4N47A 1SQ6A 3V2GA 4DSOA 2ZUFA 2ECFA 3BXGA 2GJ9A 3SQOA 2FWBA 2UZ3A 4CIAA 4KPEC 1M73E 1QRAA 2P0EA 3CINA 1CB0A 3G6WA 3IELA 4X5OA 5JVDB 1MGOA 3UC9A 5JTUA 4II2A 3JYNA 4J90A 3OQ6A 1NAHA 3RASA 1UOQA 1GPMA 2MSDB 2PRSA 2ZYRA 2IYXA 4WTOA 1JAIA 1U3GA 1YQWA 3OAAA 2AN3A 3O8OA 3UMFA 2V5UA 2IS6A 2VSNA 1GGJA 4PSVA 4RTRA 2D7JA 2QTAA 1NBEA 3VYUB 4JJGA 3ESXA 2ATCA 3CIOA 1KMQA 2C9DA 2RAPA 2UV8A 4QDUA 4QVGA 2DBVO 5EXEA 1GKYA 4AMZA 4CW7A 3MSXA 5SY9A 5KOYA 1ZXXA 3TZLA 2YVUA 4EW1A 2GOYA 2PUVA 1VIVA 4XQCA 1U3TA 5HOEA 4R8SA 3JV7A 2JEYA 2DTDA 5AW0A 4GI7A 2ERXA 2QRVB 3WJ1A 1W73A 2A0XA 1WXGA 3MILA 4WEQA 3AETB 3X1DA 1TPYA 3TVYA 1SBTA 2P4HX 1FP1D 3JALB 2BFDA 2PX5A 1M2KA 3QV2A 1N2JA 4QUDA 3GFGA 3PD0A 4PZYA 3U3OA 3WG9A 2JBAB 4Q4HB 5EHZA 1SOAA 2Q9CA 1QP8A 4ZT3A 3OZRA 3P9XA 5LKAA 4EENA 2GNAA 2QTGA 3AEXA 5A71A 4Z7OB 3GGDA 5E8JA 5ENVA 3OQIB 4KV7A 4U2DA 3H18A 1CSEE 2GBIA 4YH1A 4LE2A 1E0KA 1V8BA 3PR1A 4IXTA 4PC3A 4JQCA 4R3NA 3N75A 3HVIA 4UFPA 4R5MA 1E1DA 2WTAA 3FVRA 3LDGA 1UM8A 2D5LA 3Q2OA 1BVHA 3PC3A 2F55A 4EY7A 1C7RA 3VNUA 2QG9A 4BGUA 2P77A 2ODEA 2WZQA 4MUFA 1NP7A 4ZRNA 4ES6A 1LLFA 3TOSA 5MGBA 1T6ZA 2H1RA 1RBYA 2GN0A 2PSDA 4YVFA 1Y5IA 3INGA 2BBSA 1IXZA 1YKFA 4QQKA 4R01A 121PA 4DUYB 4P3YA 1Y4DE 2FJ0A 5CCDA 4YCBA 1J0BA 4R2JA 5KQRA 5B58T 3TGLA 1RRCA 3ER9A 3R6GA 4IVPA 3DE2X 3BGIA 2E48A 4GOKA 4CM6A 4LF7B 2EW8A 5F2NA 1Y7PA 1WDMA 2DC1A 2H17A 2WTMA 2WZCA 5ARDA 4E5PA 5HS6A 2H29A 5TVKA 3COSA 2ZT8A 4IJQA 3BE6A 4ZZ2A 3HCFA 4FGJA 1S1CA 1A5TA 1XZBA 1VMIA 5I47A 2ZANA 3CF2A 1EWKA 5K09A 4ER6A 5IVKA 1TADA 4FCWA 4BNHA 3QYAA 2X4IA 3FOZA 3ZIAA 4FFMA 1VIYA 1P77A 5IBRA 4QUGA 1GIAA 3NJRA 1Y98A 3ZW9A 2KB0A 3FF1A 4OGGA 1SCJA 2ZDGA 5B1IA 4KKXB 1R8XA 1TJ5A 1FTQA 1DJLA 3AY7A 1IOLA 4D9NA 2Q9AA 2NU7B 3PV0A 3UAYA 2WM3A 4OFBA 5EPEA 4AN0A 1SBCA 1GYRA 1OA0A 2GEDA 2IP2A 3CCCA 1T25A 3MOIA 4KZKA 4LI0A 5FUYA 4CIVA 2XNHA 3NW9A 1EFLA 3CLTC 1WP4A 4M3NA 3WL3A 3W6UA 2BWJA 3ZZMA 4S04A 4Q00A 2EJVA 2J7KA 2EATA 5CH3A 2C20A 2J7PA 2UYOA 1NXXA 3AOEC 4J4BA 1LF0A 2Q28A 4LJ9A 4OUKX 1E63A 3EVBA 4X63A 3V1UA 5K2OA 4LF9B 3TJMA 4B35A 5MN4A 3JYLA 2PJDA 1ODTC 4CODB 4HKTA 2W98A 3ITKA 3TOZA 5KUTA 1BJRE 5KSOA 3LNTA 3EQ8A 3R9IA 2DFKB 4FU0A 4RD2A 2PJUA 1B73A 2JFGA 4HFMA 4MVJA 4GSKA 4OVKA 2CVFA 4DBLE 4BJ6A 1TM7E 4Q15A 3TBHA 1XAJA 5EFZA 4B79A 1MO6A 2VSXA 2ZB3A 2EGHA 1BNCA 1P73A 2OYSA 2PXHA 2JAWA 2Z08A 2FSFA 1EFPA 1RVDA 2ZPUA 2YX1A 3DBHA 3LX8A 4OQLA 4RF2A 3T7KA 2BGKA 2TRSB 4J2OA 3FYSA 3LT5A 1CW2B 4MWGA 5EP2A 1UBHS 3AERA 5EEGA 1BN7A 3R7AA 2LE0A 3V42A 4AZ3B 1N6RA 4UC0A 1TMOA 4MV3A 1LLQA 2UU9B 1UJBA 1X70A 3ST7A 4FIZA 3HU3A 1JSZA 3HKDA 4OF4A 3EXG1 4GRDA 4DZRA 1JE0A 3GLTA 3K6SB 2B30A 3ZGZA 2I2WA 1W0KD 3W79A 1DJMA 5ALEA 5FPTA 1XNQB 2ZUCA 2Z3ZA 3QX7A 2JLVA 4WL0A 1AHPA 3CUUA 2NPOA 2VRCA 4WCFC 3P0RA 1Z75A 5CDTA 4UCWA 1JQEA 1CY1A 3DFMA 4LG1A 4DJFC 5BQXA 5AW1A 2NXCA 2O6LA 3LVFO 2CB0A 4JENA 2ACKA 3QBTA 4RHUA 2WTNA 3ZHQA 3CXUA 2C03A 3C1UA 3I04M 3O8OB 1GR0A 1RXUA 5EJ7A 5G0TA 4F46A 3HA3A 2XODA 3IOCA 3NIFB 4YXWA 4RTPA 2FMIA 5HGJA 2ZUVA 3LRTA 5GAJA 4F2DA 3FA2A 4YAEA 2Z0MA 4RCVA 3BCUA 1NURA 1L5KA 1KYXA 1Y8RA 3EVNA 2HQSA 3EJWA 1FU8A 3A06A 1VG9B 4OY3A 2FDCA 2G04A 1TW3A 3GMIA 1BS1A 3R74A 5A6SA 3COYA 4I4CA 4MKXA 1C3OA 4XEUA 3KR1A 2QJFA 5CHEA 3U7EB 5T7BA 4ARCA 3UYKA 4LDQA 1XKXA 2UYYA 4PLPA 2P9YA 3F73A 1V3VA 2B1JA 2B92A 4MGKR 2BFDB 2GPJA 4F9TA 3NKFA 2I91A 4B3JA 4WJZA 4PYIA 3HDGA 4OQ4A 3TLGA 5KAPA 3HA2A 3M0EA 3H1GA 4B31A 1CWUA 3WIOA 1MO2A 1T4GA 3F2VA 4G4GA 1F06A 2FR8C 5I4BA 3UAGA 3SP1A 3MT0A 5JHHB 2EP7A 2ASEA 3PCTA 2DLNA 4JI5B 3PUHA 3SC4A 3TX2A 5BMVA 1GG5A 4CCAA 2ZRLA 3BHJA 1QK4A 3F6SA 4RVOA 3Q5DA 1KQOA 4NZOA 4TLEA 4Q7LA 3JTMA 3WLKX 3EXG2 4PFQA 3EIWA 5EY5B 5EZSA 4LWPA 1CVLA 5AK3A 2JBWA 5CURA 7MDHA 1AO0A 3TECE 1A98A 2R6ZA 2A5JA 3GPDG 5EG5A 1YCDA 3VZDA 1WPXA 1GAJA 3NNDA 4YRIA 3WMGA 1ESEA 1PNQA 2F3SA 5DLEA 4MA5A 4ZZ0A 1LV7A 4AJEA 2GD0A 4KE8A 4OJMX 1VMDA 2Y0BA 3FMVA 2OD9A 3QU7A 4L50A 5JO0A 2XBUA 1NZJA 2HUPA 4HAYA 2VF7A 1PSDA 3PXUA 4K6OA 4PAGA 3GGPA 1R0CA 3UB4A 2VJKA 5C18A 1BVYF 1PJLA 3EW7A 2VT2A 2GCOA 3K9LA 3DE1X 1AUXA 1NC1A 1U11A 1W9HA 2PRYA 3TSZA 4E33A 2RHGB 4LYHA 3A37A 1A27A 3AUTA 3H5TA 5DGHA 4R84A 3L7MA 2D0OB 3OTWA 5IH7A 1QAMA 1MW9X 2BVNA 3JVIA 2RGNA 5HQJA 3A7EA 3EGWA 3IOEA 3RROA 4V1CI 1T15A 1ZUWA 1G8GA 2J3KA 4IP0A 1LSOA 2AZ4A 3AV3A 2BHTA 4WZAB 2WWHA 4CCYB 4AP5A 5BNTA 2WM8A 3QENA 4URYR 4KQ9A 1C7JA 4G24A 4M55A 1JALA 3CSSA 4B9AA 1UL1X 2VYFA 3JSXA 3QYJA 5KX5A 1V35A 1HWYA 3B78A 1GO2A 2R0QC 4EHLA 1E5LA 1C2YA 3PDIA 4QU5A 5EP1A 1SC1A 1TQ6A 4POAA 5DKFA 1P2TA 1IATA 1YZFA 2WMDA 2DXIA 5JFGA 4E5NA 5H3CA 1JLSA 4PEVA 1X3SA 4GGOA 1JV2B 1T0BA 3Q7SA 1VI6A 2Y9PB 3RK0A 2QIOA 4F4DA 1M34A 2BM8A 3IOBA 1BA2A 5AVJA 2C07A 2HU7A 3JVDA 1TC2A 2RKOA 4BO7A 5DYGA 3FHJA 3EPHA 1KY3A 2F67A 4K0RA 5D8DA 5EKUA 1XZFA 2ZAOA 4HK4A 1E1CA 4C4ZA 2OUIA 4K9MA 5BSHA 4TXHA 4C4OA 3T61A 1ZC3A 4U6QA 1YZ3A 4Y2RA 1EFPB 3L7YA 1U31A 3JPYA 5DBOA 4FB5A 3ER8A 3MHTA 2AG1A 4OSPA 4RXTA 1FYXA 4ID3A 4LRTB 3GJ7A 3MA0A 4B3IA 1O95D 3E1KA 3L02A 3H1AA 1KI1A 2VYNA 3ROZA 4CEJA 2N42A 5FLKA 1X0XA 4PG8A 2EGUA 3Q3JB 4QYWA 2LP4Y 3FHCB 1S9DA 1DQNA 2Z5VA 4M6WA 4A10A 3L1HA 5GV8A 3AG5A 1U0LA 2P2NA 1K6EA 3QMPA 4M7RA 5DPMA 4JP3A 3JQ7A 3GARA 2JKYA 2OFFA 4CKYA 1SKYB 2FETA 2I3BA 4JS0A 1T8UA 2O1SA 3K1YA 3AESA 2YBEA 4MYUA 5HQ3A 5TT0A 1LJLA 1V5WA 1ZSYA 3ZHBA 4A7PA 2PG3A 4ER3A 4Y2UA 1FJGB 4JIMA 5B55A 3I62A 4U9IS 1JXQA 1IK6A 5CH8A 4AK9A 1SXJE 1Q0QA 4DM3A 5LZ2A 2YTZA 1WV0A 2XMSA 3L8HA 3EISA 1NVAA 1S2DA 3L0CA 1QO7A 2IPLA 2J09A 4NY1A 6GPBA 1JJVA 4XUGB 2O2XA 2CVPA 3KFXA 4RO0A 5EZQA 4D4LA 1ATZA 2CCKA 1VHQA 5JXIA 1XP8A 1NI3A 3ZJUA 1DBSA 4ENTA 3UJHA 3QE2A 1Z6PA 5GADl 3SQXA 3UNXA 1TEVA 1R0ZA 1WD7A 1VJDA 5ALUA 3AY6A 2W2NA 1UDXA 4O4IA 1KYQA 1FFAA 3PX7A 1JQJC 3RUHA 4RC9A 5A6SB 1KMIY 1C3OB 2XEDA 5CLFA 3VKGA 5ADWA 2C8LA 5FLEX 4K0KB 3QOFA 4FYPA 3Q3CA 3KO8A 1WOMA 2ZYVX 1J8FA 2QGZA 3KYBA 5TXGA 4CG1A 4HQKA 4IS2A 3LKVA 5J9FA 3N5KA 4XRRA 1VHLA 2WD9A 1ECPA 1FQWA 4HDOB 5HXAA 4I6GA 1V4VA 1QGYA 1U1DA 2XY4A 1YZLA 3IDSA 4MUIA 3CKLA 5GPBA 4BLTA 2HN9A 3WLLA 3SZMA 4WBNB 3O8NA 4GYKA 3FMOB 1JKJA 1GQOA 3FR8A 4LOJA 3SEQA 3HCPA 5BMVB 4BBZA 3AKEA 3T1QA 1QG0A 1EMDA 1XYVA 2ZXFA 2CFTA 4RULA 2VRBA 4P4NA 1QUEA 4QBGB 1D2NA 3EWSA 4JB2A 3IVXA 3K4HA 3KT6A 2J0UA 3WGZA 4N0DA 2NVOA 3TJRA 1V8PA 2ZR7A 3RFXA 4XWYA 5GVRA 4M46A 2ODTX 1QUFA 3FYUC 4GPZA 4UQPA 4QYIA 4BNTA 3AZOA 3C48A 1G60A 1JQ5A 1FMLA 3AUJB 3ZY2A 3RVDA 3O90A 3QFCA 3E9RA 2QYSA 4FJ2A 3LHKA 3L8GA 3W05A 3ZVLA 2FX5A 4JL8A 4EY8A 2NQ8A 3USCS 1UFQA 3CRW1 2CHUA 1SPBS 1OV6A 4M2LA 1IJEA 1NDUA 4D80A 2EKDA 2GCOB 1CBUA 3LW7A 3MWGA 4ZYLA 5BR1A 4ARSA 3GUZA 3M3PA 3X44A 3KNZA 4Q3EA 5K1ZA 4LNAA 2CDBA 4Z3DA 3W5DA 2E6KA 2OBFA 2HGZA 1ZX1A 2AC4A 1SQ5A 2ZIEA 3MGGA 3PUYA 5EWMA 4EB0A 2NTNA 4FYXA 2C5GA 4LJKA 1FTSA 2HWUA 4IWYA 1AN9A 1SCUB 3GWZA 5GONF 1ENOA 1SCQA 2F3PA 4MWCA 1O94D 1GAQA 2AMVA 3CZAA 5JXJA 3PUKA 1PG2A 3F6RA 4QX6A 3FOWA 3B7PA 1RLTA 5EE1A 5A9SB 3RM3A 1WM1A 1JNYA 1WW8A 3NH6A 4C4XA 1T43A 2C95A 4AAYA 2PX4A 3ZKWA 3OQBA 4FWBA 4UUNA 4AUMA 3JWJA 4CIYA 2MTBA 3HVKA 4DWVA 4PHFA 3EFOA 1ZD9A 3WY9A 5KX5B 1H0RA 4MPDA 4FDUA 5LQSA 4AN1A 3PDIB 3VU8A 3W06A 4RJLA 3OQJA 2I65A 1CR0A 1RRMA 2H63A 5L3ZA 1S2NA 2DPHA 3BA6A 5DE3A 3RWMB 1Z5NA 4F21A 3M4NA 1M34B 1YQDA 2W6IA 4K6HA 4B7UA 4UTZA 5JQWA 3O8QB 2HLNA 4MLZA 3PNKA 4DA8A 2D0DA 4LHWA 1GGNA 3F7MA 3LVQE 4KJXA 1FMJA 3LUGA 3DWFA 4ZVRA 1GQQA 1DBIA 3I9OA 1IXKA 4FFVA 4XX1A 5EJ9A 3B3GA 1IHXA 3UWOA 2C92A 4Z54A 1DC4A 3WFIA 5C37A 1U7DA 2O8FB 1PLJA 2P9HA 3FJ1A 4QM7A 4XWTA 4G6ZA 4W1RA 4CTJA 4TSKA 3EMDA 4Q6BA 3D6VA 1W96A 2B8JA 1JR4A 2JFUA 3FFAA 1RSZA 1FRNA 1IXSB 2WINI 4MDFA 2JIZA 1G19A 3CUTA 4HAIA 4JR2A 4NYMR 3W9BA 1LBEA 4PYOA 4M6WB 4C4YA 2WYIA 1QZUA 1UK9A 2YMPA 1SEPA 2GCEA 4P3PA 3W7VA 4MV9A 1RADA 5IT5A 4PZCA 3L82B 3A6KA 1Z39A 2FWPA 3JQ7B 5CT9A 5F3RA 1LNSA 4AO7A 2PUEA 4O8ZA 2KLBA 2EXXA 5IJXA 3AESB 5IJZA 5HQ3B 4JEHA 4BKQA 3RNLA 1UJCA 2QXTA 1OXBB 1JHOA 2PYDA 3AR5A 3DQZA 1PD1A 3ML1A 3PJRA 2VWHA 1Q1AA 1YSCA 3N3AC 5K3FA 1RI1A 3GGSA 3FIJA 1E79A 1YZTA 2VHCA 3KALA 3JAMA 4KWTA 3D2CA 1HEIA 3L8FA 3M6XA 2MSLA 4IDFA 2F48A 3B1VA 3DE3X 4FK8A 1XDZA 4DIUA 1EP2B 2VDWB 4B48A 4ZJUA 5CB4F 3N76A 3K71B 2YKGA 2HO5A 1RXVA 1PYGA 1A2QA 3M3HA 1F3LA 4ER0A 2PFSA 2W11A 1QOQB 2XKKA 3D02A 1E0SA 2YR0A 5JFOA 5EERA 2YZ7A 3LV8A 2JJ2D 3WQRA 4LZAA 3NOXA 4ZYZA 3WAGA 1ZHHA 3BIJA 3K5IA 1YMUA 4XTRA 1JLRA 2BZGA 3ZDAA 1GPBA 3ZLVA 4NS1A 2QUJA 1EI9A 1VHJA 4HF7A 2PH1A 1J0EA 3H3FA 4KPYA 1FUYB 2ZWAA 2XXAA 1E2UA 4GOLD 2L42A 3MWJA 4YP7A 2PS3A 4LZZA 1QVWA 5FEUA 3JQ9C 4RKEA 2C2MA 2HIAA 1HL7A 2IP4A 3AB8A 2I29A 3HE3A 3HNOA 4HDMA 3R8CA 4D3DA 1OROA 6REQA 4IDNA 1KZ6A 1YJBA 4G0MA 4MP8A 4V0SA 1T5SA 4RZHA 3QLUA 2AI3A 2Y9MB 3RVJA 3SD7A 1JKJB 1VYHA 3WGLA 3OFKA 3MM4A 3V3TA 1EAYA 1KEVA 2C2HA 1VL5A 2R7AA 3THRA 3WX0A 4EVRA 4Q4CA 4KO4S 2OOKA 5IT0A 3ZD7A 5AW7A 3OCVA 3DZGA 4AMGA 5KTRA 4D79A 1CNFA 1JMVA 4CKBA 3ZLUA 1A8PA 2J6HA 3CT4A 1JYEA 4ZAXA 4MCAA 5JAIA 3ECSA 4IDDA 3WB0A 5ADVA 2J0UB 1EQUA 1TYEB 1U7HA 3HXKA 5LDHA 4ZT2A 1LEHA 4DDTA 2I8AA 1P7CA 1L7NA 4NZMA 1ZBQA 1X1AA 1JZQA 5KQSA 5KYNA 3R9XA 5I8WA 3KEMA 4MCIA 4ZGWA 3SSAA 2R6CA 1N4DA 1OTYA 1DGQA 1XF9A 2QSYA 2OE2A 2FPSA 4B8ZA 1T10A 5E2BA 4HEQA 2CLLB 1RZRD 1N4AA 4CJXA 2DFPA 1OMOA 4KQGA 3KBOA 3DMYA 4URVR 5I51A 2AW3A 2WWXA 3FBTA 1CEEA 3G5TA 4NFLA 1WW3A 4LJSA 2VFAA 1TZMA 5B7GA 4A8HA 2REOA 4UW9A 1XPOA 4C6SA 1A4IA 4WZAE 1SCDA 1GNLA 1UAYA 1J0AA 3ZX5A 2PMBA 1IBLB 1P9RA 3LSTA 1RMYA 4AS1A 5LDGA 5IZCA 2PVPA 3TLXA 1NW3A 2FQQA 2HMAA 3IDQA 5EWMB 3U2QA 1VB3A 4R2LA 4EWLA 3P5SA 1DEAA 1MJHA 3AXSA 3IE0A 4KX3A 1C9MA 1B8NA 3DTVA 4JXJA 2GH1A 2BFOA 1ESNA 1HORA 1R4AA 3F7NA 3QVWA 4IXNA 1WHTA 3K4QA 3LUPA 3TD2A 1F2UA 4Q3AA 3W5UA 2PPVA 3S28A 3SSNA 1RE1A 1L5SA 1BHJA 2I4NA 4G1CA 4YMVA 1BC5A 3FWPA 2YRWA 4J1QA 4O2BA 1ZNWA 1HKHA 1NRIA 5HRAA 4C7OB 3M3DA 1QP7A 1NASA 2OFPA 5HM6A 1WHSB 4I66A 1VCNA 2W6JA 2FMHA 2H4JA 2PR2A 3VDNB 4AZTA 4CNBA 4NS4A 3OTHA 1XLVA 2K6GA 1NVEA 2FWNA 3LIPA 1X7GA 5F35A 2H1OA 1YBHA 1DHRA 3JYHA 4EB8A 3P2JA 1KTIA 4QXRA 1J00A 3B1FA 3S4YA 2J5BA 4H9GA 4IWNA 4ZQFA 2DZDA 4LOHA 5J4HA 4DQXA 3A9CA 2ZIZA 1MO3A 2CHVA 1K4KA 2XAUA 3NGLA 1ORRA 4II3A 3GVIA 3WR5A 1Y4SA 5JMOA 2GXAA 1WXWA 3KPWA 4MEJA 2FEXA 4K6GA 4FEGA 1GUDA 1V1JA 3JW8A 4JT9A 4M1KA 2ZOSA 2TECE 3R3WA 2CXTA 1MBZA 1SVWA 1W35A 3AHJA 2ODBA 3CCFA 4ZDWA 2I66A 5F4BA 1C4XA 4TLBA 3HLYA 2JLWA 3MRXA 3QIVA 2XNSA 2YYYA 1G8FA 4AX4A 3ZK8A 1QSGA 2X5OA 4Q3CA 2X9NA 1NJ5A 2VQDA 5D1HA 1ZU4A 2Q2QA 3LWDA 4BQQA 3IRVA 1IM2A 4L8VA 3E0XA 2JFVA 3DXXA 2C88A 4BV2A 1EXMA 2IU6A 4LHSA 2Q3BA 4MVXA 4CLRB 4Z99A 4E07A 2VTBA 3LQYA 2GT1A 4JODA 2Y1XA 4UATA 3GAAA 1HZZA 3GPBA 4P3KA 3CEHA 1DJPA 3YASA 3ZGOA 4AKIA 2Y4NA 5BSTA 1JFTA 4BKUA 4GKAA 3QEMA 1W4CA 4BKMA 1P5FA 1LBHA 1TF2A 3EF0A 2QTHA 2AKAB 3EYWA 4OB6A 4Q24A 4B4UA 5DLDA 1XFDA 2GBFA 3NEYA 2JVKA 1MGPA 1ZK3A 1D6SA 2Y1DA 4EY5A 5KU1A 2XIJA 3P26A 4P4SA 1RCUA 2PLRA 5CB0A 2YV3A 4ZVVA 1KFKB 5LYJF 1H05A 1YB4A 1XT6A 1EGMB 3KIPA 4PQFA 3DL2A 1HSZA 5DOZA 3MAAC 5EHQA 4YRPA 1J7JA 4MW7A 2N3ZA 2JGMA 3W2GA 1WABA 3ZDYB 4BLPA 1ORVA 5CFZA 4I1PA 2N0SA 1BA3A 3IUQA 4PX5A 4Y2VA 5BUZA 5J2TA 1QBGA 1OGYA 2XXAB 4WVLA 2PMFA 5FYDA 1O54A 4JHLA 3T3PB 1XLWA 1JJIA 2H7YA 3CLUC 2GZHA 3EULA 4D98A 1QFJA 4HDMB 4YJ2A 4HXGA 6REQB 2XD9A 4BNDA 1IQ0A 1VZ2A 1E2IA 3IEMA 1WB5A 4OK5A 1L7AA 2HSDA 1OXXK 5HVNA 4R8MA 3KX2A 2A0YA 1ZCAA 4NXMB 3OMWA 1IVSA 2BGGA 4YMIA 3WGOA 4D6PA 1PJ2A 4J0JA 2XQVA 3B70A 4D8XA 4HSEA 2XMPA 4B73A 1ISMA 3KVNA 3L0BA 3LCCA 5B3JC 1G7CA 1CZLA 2PLWA 4F6LA 3GEDA 4JUIA 3MRVA 3BGWA 3CX7A 4CZ2A 1A9SA 2C1XA 3WL6A 1KP9A 3W8FA 1A76A 3N05A 4D2IA 1E9VA 2QVGA 3R9XB 1EB8A 3BOSA 1IQUA 3N53A 3RU2A 5KJ1A 5CLQA 1E79D 1SHUX 3UC5A 1CEXA 1FFBA 3EGOA 2OLKA 4WZ6A 3TN7A 2N46A 2QLMA 2DFDA 3NBKA 2RCNA 3CNLA 4NV1A 1ODSA 4TV9A 1XFAA 1CYDA 3P2EA 4J9VA 4FFNA 1VPEA 2Z8YM 4IFIA 4R1MA 2C42A 4Y2JA 5DHQA 4LN1A 1F7UA 1FA9A 1U0SY 1UJ5A 4MWEA 5JU6A 5CT8A 2X7HA 4GT1A 2YXLA 1HE2A 1E1MA 4DVJA 4XFDA 4JI0B 2WFLB 1Z7EA 4OUDA 1DADA 5TEWA 3IP5A 3CNOA 4OJYA 1FTGA 5FJJA 1DQZA 1MQ9A 1IHYA 2ZQZA 3X1JA 2PCJA 4LEIA 3SIRA 3DZDA 1I51A 4H6PA 5F4ZA 1FDOA 1P7YA 5DBIA 2WTXA 3AR6A 5HMMA 3C0KA 3M6LA 1HNWB 1KY4A 1B0ZA 4JBWA 3HP4A 1P4RA 5A62A 1TTTA 3OUUA 4FSXA 4MS3A 1PSZA 3USES 1WHTB 3WGVA 3W6PA 4E0BA 2PIDA 3A05A 3U3DA 1IXRC 1ZUNA 1P6QA 3AO0B 3GR6A 3KZKA 2VHVA 1PE0A 5CFLA 5JPCA 4O2BB 3LI2A 5I3ZA 2RGCA 1MB3A 1IY1A 5BQOA 1CR2A 4HJXA 1DC5A 1NBOA 3K70C 1J8DA 2C5EA 2XYRA 1GQFA 2AWNA 2D06A 2QI9F 3QWHA 2ATEA 3PGA1 4JB0A 1E60A 1UIRA 2FVYA 3DE5X 4FGWA 4M99A 1Z47A 1P29A 2PEZA 2GCGA 1MN6A 4OHRA 3ZBTA 1M5RA 2AX4A 4O4JF 4A3SA 1Z0ZA 3WYDA 4KWHA 3PVZA 3FCEA 2BGMA 4HSGA 4RA6A 2CNWD 1NV9A 3ND8A 3W78A 1KNQA 1LQTA 4A6EA 4OHZA 1RKUA 2HH9A 3HGMA 4HNAA 5B53A 2WWVD 3NHMA 4MKFA 1FLVA 4EBFA 5JJ5A 1I5EA 1ES9A 3CH5A 3L04A 3ZV6A 1V5IA 4PBTA 1DKRA 2BFPA 3L4BC 4JHXA 4YYEA 1JDSA 2XMGA 4KP7A 4PONA 2I54A 2VJOA 3VFDA 3E9EA 1HOTA 1TGVA 4UD2A 2GWHA 1W1WA 1P4HA 3K9HA 5JCZA 3DL7A 5KU7A 4KSBA 4CTNA 4C6TA 2CNDA 1IRXA 4DQDA 2UZIR 2Y67A 1Z0AA 1KZ1A 1YAHA 3W4KA 1KWGA 3EIQA 4GS5A 2O8FA 3L6UA 2G1JA 2IDKA 4BFSA 4MKIA 4B71A 5L40A 3T7CA 5IC5A 5LD2B 2VRWA 1YRBA 1YB5A 4GGPA 4HHEA 4OU4A 3KTDA 1C0PA 3FDFA 3WBKA 4J7XA 1ZIOA 4CNQA 1HO3A 3ZHRA 2CLEB 1Y1QA 2KE5A 4MA4A 1NXWA 621PA 3NYWA 4X66B 4XVHA 1OJLA 4F9EA 1S4QA 2RGEA 1DOAA 3LY7A 3BA1A 2VTBB 1W75A 4M9UA 1XMQB 1BX1A 4BPBA 2G5TA 3E35A 4NECA 4BDTA 4JVNA 5C4GB 2Q2NA 4QGGA 2X3FA 1JHDA 3QEMB 5C7IO 1QVVA 1XCBA 1TCAA 4HGRA 1RRFA 3FXAA 1KJNA 2PNFA 3HY4A 4L2IA 3TMAA 1EFUA 3C39A 4Q19A 3RAFC 1IFXA 3EG9A 1USUA 1P4AA 1QK3A 1RRGA 3GEMA 5LZ4A 1OX5A 3E9DA 3BGVA 1AUPA 5L3SA 3QMMA 1FQJA 1K63A 1YVUA 1CQZA 4JI8B 1I3KA 1XOIA 2B7BA 1DIRA 3K1AA 2YOFA 4EELA 1JAHA 1A7UA 1D1TA 1ARZA 1OTHA 2DHDA 2FFAA 4ROTA 4EPRA 2P6RA 3HN6A 3VZCA 3P9NA 1Z34A 3H9BA 2D3WA 3IESA 3LSYA 4R81A 5ISMA 4ZAWA 3VKHA 2CLOB 3RTDA 3EXEA 5F5NA 4A6PA 2X4LA 3OKFA 4H4DA 1ADBA 3HB5X 4Q0MA 2FHPA 4R3UC 3ISJA 1XQ6A 3MWFA 4PN3A 1CKEA 4YJ2B 1W44A 2CFRA 2HX1A 2Q3DA 2V6GA 1HFKA 3T94A 1THTA 4LECA 5KOHA 1IE3A 4GW3A 2W2KA 1UPBA 2UVQA 2H11A 2X4DA 2ZCVA 3C1TA 3TI7A 1YD7A 3SZRA 4EMUA 1LUAA 3HV0A 3VVCA 5G1PA 3D7LA 2AK3A 4UFOA 2GRUA 3GBVA 2AQKA 1BXGA 3HNRA 2Q0XA 5ELXA 3P8ZA 3H3JA 4ZCQA 4F2HA 4HQ0A 2SHKA 3D3WB 4KG7A 4UCQA 3S2ZA 4ADSG 2O5EA 4JLOA 3HN7A 4R8KA 5EXDA 1XSEA 5CB8A 3G79A 4DABA 4NBUA 3D6HA 1E9CA 3NHJA 4AO8A 5K8JB 3IPXA 3PSAA 2VAWA 3N86A 2ZE5A 3EF1A 5AOVA 1NBIA 1BYIA 1K08A 2NTYC 1SU8A 3TMYA 4C2UA 4LGCA 1HLFA 3KAJA 2QM3A 4L0MA 4TV9B 1RCTE 1GRQA 4G07A 4WGGA 1XR3A 1YL6A 2AFVA 2ZRIA 4PX9A 5CP8A 5SZIA 1TLFA 4UVHA 2XNDD 1X7YA 4AY3A 1QVRA 2WF5A 3K4PA 1XQ9A 3ZCVA 3AHHA 4AJLA 2J0SA 5DHFA 1X8XA 4L78A 4S1NA 1E2JA 4DANA 1W0CA 5AI0A 3FVWA 4JX9A 5JYEA 2FN9A 4CM9A 2LD4A 3KLMX 1NXOA 4LCBA 4V2UA 2XUJA 2JGFA 3ZNPA 4ZXFA 1N6KA 1H66A 3GK3A 3AFMA 3GN1A 1YQ9A 3QLUC 1G6HA 1ECCA 4PSUA 3QWIA 4RDIA 2RG7A 3O5AA 5DBEX 2D1RA 1NKVA 1ZGJA 2BELA 1ZW6A 2JFOA 4AG3A 1AT1A 2VDUE 3AKCA 4N5DA 4OL9A 5A7GA 1D9ZA 2OHVA 4OHMA 5ICEA 1T2VA 3B1KA 4FDVA 4JA2A 1SVUA 1M10A 1NQXA 2BH9A 2DECA 4MS3B 2CXSA 4XOUA 4R1QA 4EL0A 5JD5A 3T3GA 3MD0A 3S2EA 4A0GA 1BCRA 1Z74A 3LM8A 4BZWA 2I2DA 4F5WA 4M7PA 5ULLA 1ZUNB 3KZVA 1CUGA 2ZJYA 2F8MA 3MTAA 5JATA 4KYVA 2NYUA 4PRKA 1UMDA 2YC4C 3LY9A 2QV7A 2PMWB 3HBNA 3CNBA 1DRUA 2YWFA 3R0VA 3KKMA 4JKIA 1U7UA 4IOLA 3HR8A 4JSRA 3ROTA 4Z4IA 3N0TA 2O8DB 2A7XA 3HJGA 3OA2A 3E23A 4EG1A 1DPFA 2VNAA 1UPUA 2F8SA 1BG6A 3IMCA 5IBPA 4ARUA 2AXEA 4RA6B 3HVRA 4OQNA 1XTTA 2D13A 4TLCA 4JBNA 4Y1FA 4I1IA 3I30X 3H9EO 4HNAB 4OBEA 4B6EA 4GQAA 3EWNA 1Q0LA 4TL6A 2HKIA 2IYQA 4DMHA 1JDTA 4NZYA 1MVNA 4WFJA 3TGPA 3AR3A 2R68A 5LDDC 4YK7A 1BWQA 3QYPA 1GPYA 1R9GA 1E59A 2GA8A 2JK0A 1J8VA 1URPA 4A15A 5HQTA 2AJDA 3DEIA 1SIWA 4M1EA 3KFLA 5EJGA 5IKOA 3LT0A 3PHLA 2EZ8A 4ND3A 5EUMA 5LBTA 4C22A 1F2TA 4EI8A 4JEUA 1RM0A 2FFRA 3GUUA 3VVBA 1L3CA 3UF0A 3F9IA 1EVIA 1S96A 3RUCA 4KQHA 2VEDA 1A88A 4UKDA 9ABPA 3EVFA 3ZDEA 4WI1A 5IM4F 4BWYA 3P2OA 4ALMA 1RWKA 1JDNA 1HI9A 4Z4HA 5HFNA 1K6IA 1YC5A 2QDKA 5AM4A 5AP9A 3UT5B 4EHBA 5G0VA 4ATNA 4BO6A 3E6AA 1K97A 2B0CA 3MUNA 3UMMA 3LC2O 2IYYA 2ONYA 3H2SA 1T5TA 1U3FA 3FM9A 3RAGA 3R5TA 4BMDA 1EUCA 1G3IA 2QSZA 1YVPA 3DJYA 3IT1A 4J1TA 1GNTA 2UDPA 3QPAA 4FOLA 4IIBA 1M1YE 3CW9A 4PYNA 5H9WA 4QDXA 4YWHA 3F47A 5AI9A 2PSSA 2B0JA 3BG5A 4L2IB 2CF6A 4LJ7A 1ZJ4A 4QBIA 3RJ5A 4D9GA 2XE7A 3V32A 3O9VA 1QX4A 2VHEA 1H5QA 3L1VA 2O4CA 3DE4X 3TEJA 2VWPA 4M0MA 3DLBA 4A2WA 1VJGA 5FBLB 5EWLA 2GHTA 1UQRA 5L95A 3QEOA 2HWWA 5L3SB 3ZVNA 3HACA 2P1ZA 4Q01A 1FXWA 1XROA 3K1AB 4LY0A 5TQVA 2GNOA 3V3KA 1M2WA 3U7HB 1LPMA 4XYGA 1VPVA 1RNLA 2C98A 3T4PA 4OXXA 4E15A 4EKGA 4E30A 3K2QA 3AQ4A 1UM9A 1DC7A 1L4LA 1P60A 4HH3C 3EXEB 3WLOA 3MTDA 4C0KA 3G0BA 3PQDA 2R8XA 1QYVA 4UVIA 2FZCA 3P4XA 4PLGA 2WY2D 1MC1A 5L6LB 2VH2A 1DO8A 2NAFA 4L8GA 5COQA 2N9UA 2W2KB 4EY4A 2Q0HA 4AJ9A 4F6RB 4JLUA 2NVBA 4LVNA 4QBTA 4ZDIA 2XXJA 5BN1A 5J58A 4OHCA 7REQA 4E5UA 1BXGB 1HZZC 1TTPB 2I6FA 4EO9A 2IP1A 1PDOA 2VP9A 1CE8A 4C04A 5AVOA 3COWA 4LJ4A 3ED1A 4B09A 4AJHA 2IYLD 4ZV4A 3M83A 1TE2A 3JRXA 2FGKA 1BYUA 1TJYA 3NDRA 3TRIA 4ED9A 3GC6A 3PXGA 5IWCA 3HUUA 1M0WA 2X76A 2XOKD 3LKDA 1M6YA 3DXYA 5HUQA 2KLHA 5L3RA 3RIMA 3I4LA 5JMPA 1EQ2A 1KZ9A 1U3WA 2NOAA 2PV0A 1Y33E 2SECE 2ST1A 1OH8A 2JZOA 2A9VA 4JLSA 4YV2A 1OR8A 1LSJA 2YY7A 2IT1A 2R4QA 3E3AA 3GU3A 5AKJA 3WGJA 3E1SA 4BU1A 3L0YA 3M8KA 4EI9A 1W6RA 2I9KA 3E9CA 1UODA 2WPDD 4LVUA 1GQYA 3WWOA 1CR6A 1O08A 3KQWA 5JALA 3CU5A 4Q34A 4DMLA 5K0FA 1C1HA 4O1IA 2VXBA 1C80A 1BX0A 1RRVA 3ZDRA 2DG2A 2Y68A 4WK4B 1PVOA 3IQGX 4C7BA 4TM8A 4BXOA 3TPCA 4FGZA 1LVGA 4D4GA 1XTVA 3SCZA 1O5IA 3GLFE 4G0OA 2M2IA 1VE5A 1S3IA 2IHNA 2E21A 4FOOA 1NA5A 2ATVA 1SVKA 1Y6ZA 2I2FA 5KSPA 3HB1A 3HP7A 3AEQB 4CM3A 1J0DA 1KZHA 5HW0A 1W36C 1A9QA 5ANRB 3C24A 5BSUA 3X43A 2X7JA 3H99A 3PJEA 5GM2A 4Z9AA 4JYPA 4DMKA 1KMCA 1EFAA 1DQYA 4EJ2A 5TR9A 2ZRPA 2PZAA 3ILSA 3NQ41 4MLPA 2C1EA 4LYEA 4EFDA 3NDPA 4FFDA 3P9YA 4BFCA 1V8OA 2H06A 1UMDB 2DFNA 1E2QA 2V9CA 4OQMA 5DSXA 3W3AH 4N8DA 4W5NA 1IB6A 4ETMA 2BGTA 2EZ9A 3NEPX 5F3DA 5K0LA 3VSBA 4ZC8A 2ECPA 1PAUA 2JGJA 3EGEA 3FLAA 4QPCA 4GSYA 4DCGA 4O25A 1X13A 2V0NA 5H0IA 2WJ4A 5HKBA 1YFLA 2CJXA 1G42A 4X54A 2J32A 1TT7A 2WB2A 2R6JA 3AIMA 2V9PA 3F67A 4FHFA 4MB2A 4U0JA 3THWA 4MVJH 4XOIA 3DV2A 2QG6A 1YA4A 1LZKA 4OP1A 4E5DA 1GNVA 1TRHA 2X77A 1E77A 2EKBA 3FFBA 3TXXA 2XF8A 4V24A 4XD7A 1P33A 1AQLA 4HUQA 5EMHA 5EJEA 1BGWA 1XN1A 4FYWA 2ZRAA 5KNBA 1F0YA 1HMPA 3HS3A 4XSVA 3W3ZB 4NMMA 3WGTA 4C0BA 4ZCRA 5I4CA 1COWD 1X77A 4NAHA 3CVYA 4FD2A 4OSEA 4WHMA 2Z6QA 2VTEA 1GGHA 4R1PA 4N3AA 2HLDD 1RJWA 2QQ5A 2KSQA 2Q3FA 2VHUA 2HF8A 2YV2A 3VYVA 1A8IA 5SZHB 5TF4A 5GMOA 3EXHC 3LP5A 5HIKA 1U99A 4Y8VA 1X87A 4XFJA 4L07A 3TB6A 1VSUA 4XCVA 3D8RA 4CKWA 3C6ZA 3VYRB 1ZKDA 2WJWA 4MLCA 1HQKA 4KLNA 4GYJA 4JMLA 5K6AC 3DBRA 2JHCA 4J91A 4A8JA 1EUCB 1GILA 2IWHA 1D0SA 4M9QA 1J33A 5I7AA 4AF6A 4H6WA 1L4BA 4BLWA 4CIWA 5JXGA 5KYKA 5M2QA 2HQ1A 2DTEA 1PR1A 1RHRA 4EDFA 3ETLA 2XZTA 4BP9A 4XZ3A 3PEEA 5I48A 4MJ7A 2AN1A 1TC1A 2E37A 1V47A 2P5SA 4PYKA 4UBJA 4BNGA 5JSUA 3E15A 4UU7A 1QDUA 1NOIA 4DV2B 4R0NA 2R9VA 4ND4A 3BL8A 4MPJA 3ICPA 3PFBA 5JZBA 4DY6A 2QTTA 1Y1LA 1XDWA 1UM9B 2V59A 4RVCA 3QZUA 3SSOA 1U1EA 1NBMA 1KQGA 4TLMB 3TKAA 3R7DA 1N2CA 5FWAA 4E08A 4YONB 4LJ5A 4LTMA 5ALNA 3PJDA 5ARCA 4MR9B 3OCJA 5LU8A 3DVAA 1MDFA 1PBNA 4KQCA 4L02A 5DM0A 1MJGA 1LBSA 1DC8A 2IZZA 1RM4A 4M0DA 4URZR 4QGFA 4CDMA 5JY6A 1ISGA 4DMGA 4Z5XA 2J3HA 4PINA 1GITA 1ZSVA 3OZIA 3VHRA 7REQB 2EBHX 1XJWA 2WZDA 3ISVA 3JU3A 1CE8B 2QSUA 3AX6A 2W83A 4U7JA 1VGQA 1YDFA 1G5PA 1KI3A 5AR1A 1GZSA 4ZT7A 4TGLA 4JC0A 2JFHA 2QTLA 1V41E 4HNSA 2DU8A 4KDCA 2IL1A 5IP5A 1I4TD 3CLTD 1VA4A 1G8SA 1DP4A 3BJMA 2F3TA 3MHPA 3DDWA 4EZIA 5BSFA 2ZI3A 3R9KA 1VJ0A 1EEXB 3A9TA 1QE5A 2KBEA 3NC1C 2QN7A 4RKYA 3JQBC 1KOFA 2VT6A 2YQ5A 4FC6A 4HB4A 5KS2A 2ECOA 4JU9A 3LL7A 1QLJA 4YBZA 5ED4A 3OFSA 3M9XA 2QTVA 3DTNA 2WTEA 1D8AA 2L18A 2IS1A 1GCIA 1UC4B 3VSCA 1XNRB 5AM1A 3HUFA 1FDTA 3IAEA 3LS2A 2EBUA 3NVAA 4LA4A 2GBCA 1Q0UA 1UPCA 5DNEA 4UNQA 2J9ZB 5YASA 1KERA 3NHBA 2FI1A 2GPTA 3C8DA 4TZKA 1IN1A 2A59A 3T7RA 4KMOA 2IQ5A 4HUJA 5BXQC 4JA0A 1QV6A 1GPLA 1KDTA 2W6NA 3FWYA 3TBFA 2AX3A 2R84A 2Y3IA 2ZCUA 1YZYA 3GAFA 2CN1A 3H83A 1ZM3A 1CD5A 3NEAA 3OM9A 4PCUA 4PX3A 5LLSA 3RC7A 2IIPA 4NOLA 3VC3A 1Z5GA 3B13B 3JAKA 3DEZA 4YT8A 1P4SA 2CMHA 3IERA 1DCMA 2EX0A 2AL7A 3KKEA 1YS1X 1EBFA 4HFNA 4V39A 4ZOLB 1JPVA 3OCXA 1Z6YA 2YJZA 4D6XA 3HJAA 5KMGA 1OXKB 3SJCA 2B5VA 3LCUA 1PWXA 1FUEA 2CBZA 2VJNA 2ZYAA 3LFUA 1OJ7A 4TM7A 5IC6A 6ADHA 1OB2A 2CF5A 2ZI5A 3RFCA 2NO6A 3N0XA 4FI3F 2FE1A 5LP6C 2ENWA 2OXEA 5BSVA 3I6ZA 3R77A 3HCCA 5K0SA 5LWQA 2DT5A 4QICA 3FKJA 2H6EA 1Z5ZA 3P1JA 2QROA 4EDHA 2NM0A 3MC1A 4GMDA 3ACDA 5LYYA 5I7UA 2W2VA 4OOEA 3IAXA 1Z5VA 1RYNA 3U4IA 1YE5A 2WSBA 1GL9B 1OWLA 4P7FA 5DYIA 2XB4A 3EY9A 1FSSA 1XO1A 1D4OA 4F5EA 1AD2A 3FVTA 1YR3A 1JAZA 1ORIA 2ATXA 1P9NA 1MB2A 2GLXA 2Z04A 1GG2A 3JZMA 4FP9A 4HUQB 4W6QA 3W2TA 4DM4A 3RRMA 1C14A 3GJ4A 1L4UA 4PICA 2RBKA 1V3UA 3KSMA 4WX2B 5DMHA 2X23A 4QO7A 1RQ7A 3IKTA 5F9FA 2OK8A 4I5EA 2L2QA 2PO5A 5DHTA 1ADYA 3UJ3X 3RS8A 4JSYA 2JB9A 4DLKA 3PA8A 1WU7A 2QNBA 4X62B 1X7XA 1GQ2A 1W5EA 2X0KA 3SOPA 3FFXA 5CVTA 1NHGA 2PD3A 3GI1A 4CKWB 1WXQA 3BN3A 1J2TA 1E98A 1Y34E 4X85A 5EUCA 3U60B 4EBBA 2FPOA 4RZIA 3DBRB 1D2MA 2BEUA 3OF5A 5AJZA 2J3JA 2B1RA 1DUVG 3PRYA 4L4SA 4A8JB 5LMNB 1MNQA 4INZA 1NXSA 2R7NA 5I7SA 1F9AA 1O8CA 1VIAA 4DLXA 3NTXA 4MPRA 1JILA 3GF4A 1DWOA 5HRUA 3BH7A 1KNXA 4KHZA 4OXQA 4O08A 5CLGA 4B33A 5KKNB 1IY8A 1WX1A 1QIMA 2RHCA 2WPNA 1S7CA 4QYMA 3HDVA 1C1DB 1ADGA 3I1IA 3PFNA 3VR4A 1WMAA 4UU0A 2VF5X 5H1YA 4FKBA 4Q18A 5LSAA 4KQFA 5EZYA 3ZI4A 1PUIA 2GCPA 1CRQA 1VJTA 4HB2A 4PY2A 1FNDA 4C21A 3KDPA 9ATCA 3G8CA 1YU9A 3H5RA 1K5DA 2SCUA 1Y3IA 1RRPA 1I0IA 1V5EA 1ZVQA 2J3EA 4ZK6A 3IUNA 5BWLA 4OI0A 1GDHA 3LTEA 1T6XA 4ODIA 3NCTA 4TYMA 4YDHB 3ZTWA 1N2CB 2ADMA 4QVKA 2YJGA 5P8WA 2J9FA 1IH8A 2FQYA 4GL2A 2JRCA 2FK8A 4MUXA 2CUNA 4BFVA 1E58A 1HYHA 1X42A 2JD0A 3R6DA 5AW2A 4PNEA 1N3IA 1QQ7A 5JDCC 4BNYA 4LOIA 1KEPA 4EGJA 3VSAA 1YNOA 3HEBA 4JXKA 3TZEA 5LL6P 3KYDB 3IP9A 3PDUA 1WDTA 2IIQA 4G63A 2VKTA 4GOOD 3FNRA 5EE5B 5IYZF 3TQOA 2AZDA 1TCUA 2XDQB 3IKVA 3GXBA 1XAGA 2OAEA 4LC0A 5KJEA 4F72A 3L4JA 2I87A 4FR5A 1O5TA 1T3SA 5BWCA 1JFLA 1LTQA 1RMQA 3G3EA 4E88A 4PRZA 5HX7A 2FFJA 3TTYA 5F77A 3SC6A 1E4EB 3KDSE 4UTRA 1NT4A 2JLUA 1OC2A 2FPWA 2H1FA 2CCGA 1VG0B 2PDAA 5CNMA 4KMMA 2C2WA 4TTRA 4KK3A 3LTNC 3CLSD 1YJAA 2OHOA 1NLMA 2JS7A 1E2MA 1EYZA 2W4IA 2R86A 5DTMA 2I1VB 4CKEA 4RVUA 3QPWA 5DHPA 2VP5A 5IANA 1OI4A 4G01B 3BQNB 4ZARA 3A2KA 4AL4A 1W8DA 4OXYA 1WAMA 5JZSA 2G5CA 2QTVB 1OTXA 2J5KA 1EUZA 2OCIA 3TLCA 1EG2A 3BRQA 3D7NA 3NRCA 3GIDA 4Q4AA 4AS3A 3M2TA 3NHAA 3ZGLA 1YRWA 1BWSA 2QW1A 1YMVA 4TYYA 1FSFA 2Y99A 1SJ9A 4DLYA 3BWCA 3MIIA 5MN5A 2PKCA 3I4FA 5KIAA 2FQ1A 2HD4A 3HABA 4NPCA 1Y8ZA 3ENNA 5FO1A 5IEJA 3ONNA 1BXZA 1EXVA 1FDRA 4DRXA 2MSEB 2GF9A 3ZHCA 2OXTA 4FBLA 1OXTA 1HDOA 3PKZA 3R0IA 5ITZA 3DMGA 2P11A 4NATA 1R0LA 3FNEA 1OH6A 4YRTA 3KR2A 5TARA 5FOVA 4PBRA 3JAKB 3N3BC 1SVIA 1Z56C 4OPMA 2QZ4A 1MPTA 3CPEA 5TGDA 2VDKB 4F56A 5KMGB 4M4SA 1KPGA 1B8VA 3RVNA 2P8SA 1WKCA 2JD2A 4LMPA 5GOTA 1JUDA 3W1EA 4N7BA 1DBQA 1LW7A 4KQIA 3RTGA 4GDFA 4DWOA 4N76A 3SLGA 4KEAA 2FOLA 1D6MA 4M36A 5DTEA 3WHLA 2QRQA 2F64A 3HDYA 1XDGA 2CXOA 2DWCA 4JLMA 3HWWA 3TLZA 5BPFA 4MYHA 4JWTA 3WYBA 2HHAA 3O3CA 4G85A 1L5LA 4XCQA 3JVUA 4CR8A 5B6IA 5CTAA 1G5HA 1X39A 1G59A 4H7EA 3PE3A 4R1TA 5I9IA 4IHJA 1NPTO 4EPYA 1UKCA 3NTQA 4YRJA 3ABSB 1JXOA 1GV1A 4WKPA 5AXAA 3ZWPA 2C7PA 2C8KA 1S7GA 5CW1A 3LJKA 4RKQA 5B30A 1IJFA 1ACLA 1M3SA 1H5UA 4O4HA 4DF3A 4TUYF 4N40A 1JF8A 1R2QA 1YHYA 2WUFA 3A4NA 3COZA 2WAAA 2I3AA 3VO8A 1R15A 3VZBA 1EHYA 2CV0A 1UT8A 1X7XB 2SKDA 2CLCX 4QREA 3P2IA 1TJNA 3SBOA 3UMVA 2O2HA