2FRVA

Crystal structure of the oxidized form of ni-fe hydrogenase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
261
structure length
261
Chain Sequence
KKRPSVVYLHNAECTGCSESVLRTVDPYVDELILDVISMDYHETLMAGAGHAVEEALHEAIKGDFVCVIEGGIPMGDGGYWGKVGGRNMYDICAEVAPKAKAVIAIGTCATYGGVQAAKPNPTGTVGVNEALGKLGVKAINIAGCPPNPMNFVGTVVHLLTKGMPELDKQGRPVMFFGETVHDNCPRLKHFEAGEFATSFGSPEAKKGYCLYELGCKGPDTYNNCPKQLFNQVNWPVQAGHPCIACSEPNFWDLYSPFYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMIC HYDROGENASE
publication title Structure of the [Nife] Hydrogenase Active Site: Evidence for Biologically Uncommon Fe Ligands
pubmed rcsb
molecule tags Oxidoreductase
total genus 75
structure length 261
sequence length 261
chains with identical sequence C, E, G, I, S
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 1997-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 2frvA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 2frvA02
1WULS 1UBJS 4KL8S 4UE2A 3ZE6A 3UQYS 4UPEA 5JSHA 4U9HS 3AYZB 4UCWA 4TTTS 1H2RS 1E3DA 5JRDS 1YQ9A 1FRFS 5JT1A 1YQWA 1UBLS 1YRQA 4KO3S 4UE6A 4IUBS 4UQLA 3ZEAA 3RGWS 4C3OB 1CC1S 3USES 2WPNA 1WUKS 4KN9S 1FRVA 5JSYA 4KO1S 4UD6A 5A4FS 1UBUS 4URHA 2FRVA 4UE3S 3ZE8A 4KO4S 4UD2A 4CI0B 4UCQA 5JSKA 3H3XA 5A4IS 4IUDS 3ZE9A 1WUHS 3CURA 4UCXA 1UBMS 3ZE7A 4UPVA 1UBTS 4GD3Q 1H2AS 4OMFG 5D51S 4IUCS 1UBHS 4UEQA 1WUIS 3USCS 1WUJS 5ADUS 1UBRS 1UBOS 4KO2S 3CUSA 4UQPA 5JSUA 1UBKS 4U9IS 5A4MS 3AYXB 4UEWA 3MYRA
chains in the Genus database with same CATH superfamily
2EFDB 1QMGA 2C4NA 3QKUA 4HBGA 2XEDA 5M3BA 3G0CA 2IXEA 2PZAA 5F2EA 4S35A 4JASB 2XMQA 3QXSA 4RQUA 2B8NA 2Q2NA 5FI0B 4B47A 1KC3A 1UXGA 1FTYA 2BWJA 1XALA 4COOA 5MN6A 1ZR2A 2KHZA 4KI7A 3Q3VA 1V0JA 2OKGA 3LX4A 4CDRA 4H7KA 3HWSA 4FGUA 2JZOA 5H82A 2QVLA 1GL3A 3X2FA 5BSGA 1K66A 2AN4A 3MFQA 1HA3A 2V7QD 3MUFA 5LQUA 5JNVA 3QX8A 2WA2A 3WSWA 1NG9A 1PNOA 1DHRA 2JJ1A 1QDLB 2Z1DA 1R10A 3H42B 1HEIA 3A7DA 3MS4A 1T1GA 4NMWA 2RAPA 3PD7A 2G82A 3R7DA 2VNJA 3AVQA 2I3ZA 2I0FA 3REGA 4U5QA 3ZV7A 2WE7A 1Q14A 3VOSA 4DLVA 1OU0A 1FB5A 4MI6A 7REQA 1GFZA 2ONJA 4W8GA 5LXTB 1QV6A 4WFIA 5AO9A 5F7ZA 2H1LA 1NVTA 4ZZ2A 4JWKA 3WL7A 4A1OA 2ZVPX 1AUQA 2RJNA 2AN9A 2J5BA 1XTPA 4I9FA 1UBSB 4LYHA 5EPEA 3JRXA 2IY9A 1C7RA 4HT3B 3KDSE 4FI3F 1NBMA 1E1DA 5I9TA 5FYDA 2WIBA 2QEQA 3ONWA 4KO3S 3HN6A 5KVVA 1A2BA 4W5TA 2ZJ4A 2IBMA 3B6ZA 2FCRA 3CEAA 3IJEB 5AKGA 5JPDA 3SC2B 4UATA 3BIWA 1D1QA 5KTRA 4Q4HB 3JTMA 3SHWA 3LWDA 3NCTA 2UXBB 3TOVA 4FCTA 2GK6A 3NT4A 3DR3A 1V45E 2PSJA 2V7GA 3CF0A 4YJFA 4EYQA 3W5AA 1UPUA 2RHDA 3USZA 1DCFA 4INZA 3BCHA 3HYRA 1HORA 1QYIA 4RWZA 1F8UA 2XITA 3IAAA 3JQ6A 2NSYA 4KQXA 4YDSA 1XE3A 1N9KA 5BQOA 1F51E 1SXJD 4E2XA 4ESHA 4NPCA 4QGAA 3EDCA 1IBRA 3D8TA 5JQGF 5JO0A 4H4CA 5JQGA 1ISJA 1VRVA 3AZPA 1P77A 1Z68A 4FDAA 4MX8A 5J2UF 5J2UA 1OYWA 1XZLA 2Y8EA 1TYEB 1F3OA 2X42A 1QFXA 1GAXA 4KR0A 3O38A 3ZOKA 5HWSA 1YAJA 3RVRA 1PFKA 1UP7A 1H8HA 2HY7A 2WZCA 3F3KA 4FOPA 1M1ZA 4LV5B 4E5NA 3TVTA 1FLAA 1MV5A 1Z88A 1LPAB 2LDBA 2J08A 3P4UA 2F8MA 3GLKA 4YAEA 3ZY4A 3BMNA 1FC0A 4M9RA 2A84A 2WAOA 4BGVA 2CFIA 5CK5A 3PA6A 4OU5A 2D5BA 3LSYA 4JP1A 5IT9A 1NM5C 3BSWA 1YUMA 2W6CX 3CEMA 1HURA 4ZV4A 2B8JA 3PXAA 4JUBA 2JIQA 2P2DA 3B6EA 4LYJA 1U31A 4XSHA 5EG5A 2IUUA 4BNGA 5KSZA 1P33A 3U49A 4I36A 2EZ4A 4PFJA 2FPOA 1IOWA 5E0OA 3RFTA 3TVYA 3HFSA 5DMHA 3IEUA 3KEQA 1VMIA 2EBHX 4GZ5A 5IBCA 1YZHA 3ER9A 2WWWA 3R3UA 3P9IA 4ZZ0A 3IE0A 2EFGA 1EBFA 2Y1OA 2GZSA 3DNPA 3EIXA 2NU7A 3F2IA 3EGWA 4Q02A 1CRWG 1RBYA 3TGLA 1PAUA 2IW1A 3N2YA 3OIUA 3QTTA 2GBLA 4LYAA 2WG0A 2GYWA 3VC2A 1V3TA 3F8TA 4F4UA 3DC2A 1WCXA 2GAJA 2OT3B 2MMCA 3MS2A 3B9RA 4HQNA 1JKJB 2PX2A 4Q05A 3BTVA 5PGMA 5FWYB 2XV1A 2FI1A 4X1IA 1E2PA 3BZUA 1LU9A 2WYIA 2POCA 3K9BA 3EW9A 1DZ3A 4IFEA 5JAPA 4R54A 1QE5A 2PGNA 1DOZA 1N92A 2JK1A 5ITZA 1QONA 2ZIAA 3FAZA 4CM9A 5ISMA 1E1LA 4FTWA 3ADDA 1II9A 3L6DA 4OQPA 1Z12A 3H16A 2XYPA 1U1GA 3PICA 3QVGA 1UAYA 1T2AA 3D7KA 3QLEA 2BFBA 5DF1A 4ERXA 3TFQA 1BIFA 1QIDA 4FE3A 3OPYA 4C1BA 4NZZA 3O4IA 4RK5A 4G4GA 1T8RA 2WHQA 2PZMA 1NP6A 3V4RA 5AI5A 5TE9A 4J8PA 1MTOA 1Y8QA 3QE2A 3AIKA 1FDRA 3WGVA 2JLWA 3B78A 1FL9A 1XNHA 2VC2B 4NU0A 5F9HA 1D0IA 3AB3A 3AC0A 1GPDG 3E9EA 1NN3A 3O8OA 3IAS6 3PPYA 3UQZA 3NALA 3EC2A 4RHUA 3HKEA 2PD3A 4R6WA 5KVSA 4HD8A 4B75A 1TZCA 4P0TA 2C95A 4B5KA 1ESEA 4LF6B 2X8LA 3T61A 2ZIFA 1Z6YA 4OGWA 2RGYA 3ZV3A 1TTQB 2P2YA 2CWWA 3LVRE 3PC8C 4QYXA 5AIAA 5DSXA 4J0IA 5EIFA 1H4TA 4E1AA 2WMOB 2IHKA 2VTDA 4Q47A 2V7EA 2ZEJA 5FEUA 1QYRA 2FUCA 4GKBA 4EDFA 2FPKA 5ALWA 3QV2A 4R8RA 2CXNA 4CIWA 1JR2A 4JCOA 1J70A 3NWJA 5CNIA 1C3LA 3RYHB 3QYFA 1Y42X 5FA8A 1R00A 3N2EA 3S1AB 1JHAA 1DKPA 3THOA 4WINA 3CX6A 5LKRA 4NECA 1PLLA 1TYBE 1K98A 5FPTA 2UZIR 2GN1A 4YN3A 4P7JA 4JVOA 1P6QA 4RLHA 1BX3A 1H5UA 2G9VA 1AY0A 3T1YB 1RE1A 1ZA1A 4OTZA 3Q7TA 1G5PA 4BB5A 4E21A 1TF5A 1IMJA 2JAPA 3Q7IA 3OCUA 1TVMA 5H80A 3HJBA 2OP1A 5JJ5A 3IO3A 3R0VA 5CM9C 4GLJA 4MKGA 4Q4CA 3SS8A 1T3LA 2QDKA 2C9MA 1U11A 2Y9PB 3E18A 3AZQA 2RJ3A 2FVXA 2TECE 3MOGA 4QFMA 2O3QA 1ORWA 2PWAA 4TZKA 5CNKA 5CP8A 3ZWBA 1IJFA 2RHTA 3MQFA 3K16A 4ARBA 3W77A 5CFRA 4N49A 1XDSA 3U44B 4LFBB 4GMKA 1SOWA 3IHWA 1JQAA 3GR6A 3K09C 1BH2A 4R2LA 3RRBA 4J2OA 4ZYLA 3TXYA 3N70A 3NIDB 4HSEA 5IEBA 3TW8A 5CD9A 3WAKA 3FOFC 5INTA 1AKMA 1ZINA 1JIXA 1QH0A 3EVNA 4C4XA 4B3MB 1ZQ9A 1IEWA 2GHQA 1NT4A 1D1TA 3FYUA 1H23A 5AM3A 1SCDA 4HDCA 3IDQA 3BWBA 2DHQA 3AK4A 2NPOA 3CF4A 3JWEA 4MMZB 4AFNA 1FJ2A 2IT1A 3HR8A 5H3HA 4YPVA 1CUFA 4KR6A 5K4HA 4CM9D 2VZLA 3ILYA 3SNHA 3VMMA 2IIQA 2WJIA 2W71A 3HBAA 1MNQA 1KTIA 1A3CA 2X76A 3GLRA 3IYLW 3P9XA 2GEUA 2HWYA 1V8OA 2A3RA 2NXNA 2ZDQA 3TRKA 1P7VA 1JEEA 4O2AF 3EG5A 1BOOA 4O2AA 3ANXA 4F9FA 2B78A 1U5CA 3KBBA 4DLZA 2XXJA 1Y7LA 3KKOA 1C0KA 1ODCA 4ND4A 1D4AA 2GJKA 1X9GA 4RQAA 5JAUA 4TZ6A 2C7RA 3KAJA 4Z7QB 1PDOA 3UK7A 1LTHR 2QROA 1LPPA 2XGOA 1QNLA 4R1PA 5M5BA 3AYZB 3HKCB 3WP0A 5ALNA 3WK8A 1PT9A 1JDNA 1NGSA 4YWHA 2QTCA 1C7EA 2J3JA 3O83A 4RHCA 1LC0A 2KI5A 1N7HA 2CMGA 3L1IA 4LIPD 2ZT6A 4JJ8A 3RTAA 4CLXA 1TMGE 5HYVA 4MV7A 3WHPA 5LQMA 1PG2A 4X6UA 2Y93A 1C8BA 3G6KA 3HVIA 3TO5A 4NXNB 2PCJA 4AKIA 3RVBA 3X1DA 3TJZA 4O5AA 1NW7A 5AM4A 3PGVA 3PP8A 1N0HA 2YWBA 3WLSA 5KYXB 1R16A 5HIIA 1NXWA 4BFCA 2Y1XA 3OJFA 2AKYA 4OX9B 2ZJZA 4MUGA 1LPNA 3K0BA 4RLQA 1SKYE 4I19A 4JN6B 4KSYA 2R66A 3HYNA 1KEUA 1NMSA 1UJ2A 2ZI9A 2NVBA 3E2PA 1QIJA 4QYIA 2CXQA 2V6GA 4EYOA 4ENWA 1LLDA 2PUCA 2AKEA 1SOAA 3AU9A 1SN7A 3CEHA 2G7MC 4K6HA 1MHTA 1QQAA 1Z4OA 1RAAA 2HBQA 2VAXA 4Z9FA 4Z3KA 4U7WA 1PQPA 1NLMA 4A73A 4D9IA 3AKDA 4HLNA 4JJ4A 2GYVA 3PBKA 2IKSA 3CY6A 1I4OA 3I8OA 3DKPA 5ECYA 4CBVA 1CYDA 4G1EB 5CLLA 4YRSA 1SRRA 5A4FS 2IPOA 2G40A 4FYIA 4IDEA 4WOPA 4FT4A 5ER9A 1OFUA 3A9WA 3WICA 3QSYA 4UOZA 2C00A 1AKUA 4ZFNA 4GWLA 1JTVA 3DFIA 1Y9AA 2OECA 3W04A 2EERA 2W8ZA 1C1XB 3X0DA 2L18A 2IHNA 2C3PA 1TECE 3OU7A 1TPZA 4XQ0A 3MCWA 3PI6A 3LUKA 3DLIA 3EXFB 4AWXA 1WUHS 3SM3A 3DL0A 1SG9A 1KFBB 2JGAA 3AWDA 4P5PA 3SZRA 2BHRA 5HJ7A 1U6JA 1DEXA 1MJGA 1BDJA 3FUXA 4W1RA 2PNFA 1N9GA 1HI9A 1YDGA 4GLLA 1AQ6A 3L8YA 2BJVA 3RUHA 3TZ6A 2FMKA 4G23A 2IA5A 2XCRB 2F9MA 4N6GA 4GPZA 3DE5X 1KK0A 1N5MA 1K5DA 5IF9A 1YS9A 2QRZA 4EPYA 2BMFA 2XAAA 4BCCA 3HZOA 5ESXA 4KR9A 4JXXA 4EF6A 4IDNA 4AZVA 1C81A 4FFNA 3FY4A 4ND1A 5JWHA 3VTAA 3CA8A 4UFPA 3TZKA 5ALTA 2J5XA 5F3WB 1GSAA 1W49A 5A62A 4ZQEA 1D6JA 4H15A 2ATXA 2X8WA 3ICWA 1LTKA 1VCMA 3NTUA 4OI1A 1MAAA 3C3YA 3IMGA 3SFTA 4EX7A 3NO4A 2G9RA 2KYRA 2WU3A 1G8HA 2VPZA 2O7NA 3ROGA 3VX4A 2C5SA 1U7ZA 3O1HB 3MJDA 1VJDA 1IIBA 4E15A 4ZHQF 4ZHQA 4TTPA 1JLHA 3ZIAD 3QLTA 1PR5A 3FB1A 1Z22A 4CHGA 2EJBA 2OCYC 5C5DA 2JGJA 1YA8A 4JJ7A 1YQTA 5H9VA 1W36C 1LX6A 4QBHA 3ZKWB 1E4EB 2REQB 4W6QA 2Q7XA 2YXDA 4LXGA 4ZDWA 4U7FA 1XPUA 3JASB 5CB6A 1NF2A 1EFKA 5AVKA 4J1SA 1OFTA 4FGZA 3U7FB 4EGSA 5LZ2A 2PXCA 2CUNA 5L3ZA 4OSEA 3AONB 3AIOA 2EQBA 1YRHA 2XNCA 1AK1A 2H59A 3RS4A 1LQUA 2YHSA 3AKCA 4WFJA 4XGNA 5B1HA 1BJRE 3U4MA 3BEOA 3RYIB 3F7NA 3SEZA 4JSTA 4BE4A 2WWYA 4GC9A 4MV3A 3TUZC 4B6FA 1JBKA 2ZJ8A 2HAEA 3JQFA 4EG0A 1L5ZA 2P4EA 5JASA 2CZGA 3D4LA 3N6VA 4XSGA 4JL8A 1DG9A 1YIAA 2EBUA 1ZVQA 1D07A 4QBFA 1WEHA 5LL6P 4MPDA 5J23A 5T6BA 3O4GA 5LU9A 2AVDA 3GMIA 1BJKA 4XARA 3FTEA 3CPEA 4N0MA 2B61A 1SCNE 5LZ7A 4E7PA 3BHJA 2IJGX 3GU3A 4P80A 3SOZA 1EZ4A 1C4XA 2XHEA 4TKZA 3VYRB 4GL4A 4KNYA 3ZHVA 4RZ3A 5E9AA 2VNAA 1ZN7A 4S2UA 1FJXA 2MSDB 4MXDA 3MD0A 2J6BA 2OB1A 1Z6AA 4ZXPA 3SBXA 1FZTA 2J30A 2W8BB 4JOSA 3T7DA 3LX8A 5EINA 1IWBB 5K0SA 4IIEA 2CHEA 4V24A 5CXUA 4DHEA 4EVRA 5KTSA 3F7MA 1OROA 1TKBA 2Q2WA 2RHGB 3EDOA 4DMKA 1U8YA 1KMQA 1L4BA 1P9NA 2HBZA 2OCKA 1HQKA 3E84A 4KE7A 2IHUA 3AHDA 4G5XA 3JQCA 4OGFA 4OYLA 2QZPA 1Y3BE 2VAPA 2Q21A 3GMSA 3MBIA 1OKKA 5AFSA 3F5DA 2JFBA 3HY3A 3VHXA 1L5FA 5CAEB 4D0NA 3AEQA 3H5WA 1T35A 2AC4A 2WUWE 2R25B 1XFDA 4KHZA 3OG9A 4DOMA 1TO1E 2I4RA 2O8BB 1HSOA 3DFZA 4CI0B 4WZAB 1CPYA 1MOSA 2HDOA 2OBYA 2Q27A 4U6SA 4ZODA 2VSNA 2N47A 2X5JO 3AVOA 1CUZA 2BEWB 1P8JA 1LDNA 2FFJA 2Z9CA 2NO9A 1T91A 1YHYA 4RAOA 1TUBA 5DXAA 2C2KA 3L4BC 1UBMS 3W8FA 3UWOA 4UHKA 1SVLA 1SKBA 2IFTA 4DSAA 5AXAA 4DLNA 1J0BA 1RLMA 5K8IA 1E7YA 1GU1A 3QP9A 4J0DA 5EMJA 2FKNA 3HQ4O 5BQ5A 4GM1A 4QVIA 1NLFA 2ZBRA 2INGX 1NATA 1PWZA 1SHJA 2CKDA 2I78A 4NR0A 2E37A 1NXTA 5AW3A 3BG5A 4DB2A 5BXYA 5H3LA 1Z0IA 3E0QA 1V8DA 3F73A 4CM1A 4BIMA 1KYTA 1L4NA 4N7JA 2YS7A 2A58A 2D7CA 2JS7A 2NYVA 2O0JA 2WC1A 1RWMA 1SHKA 4K9LA 3S1AA 3WNCA 3QF4A 2WSSA 4YRKA 1VDMA 1U99A 2GXSA 3GRUA 4WKGA 4KRFA 3GAZA 4ESVA 5KOJB 3LNTA 5FQOA 1R8JA 2CFRA 2FFHA 5FPQA 3JZFA 2DBQA 1WKVA 3OT1B 4RKFA 3MRVA 2B2XA 2NU6B 2AC7A 3SQDA 3PE4A 421PA 5AW8A 4MQFA 5FV7A 2VSOA 3DMRA 1Z2CA 3SU8A 1OLXA 4UU0A 3JW8A 1G8AA 1XDGA 1MR3F 5GONF 5JXWA 1UAAA 2C3MA 4WZZA 5GONA 3HR7A 4IMPA 5JFOA 1H3EA 2PZBA 5B58T 3UQYS 1F0NA 4CMCA 4D5EA 3WDMA 1TA0A 1E3IA 5HQ3A 2EJUA 2X9QA 4OQZA 5EMMA 4D57A 3C0KA 2V4UA 4LDNA 2NUPB 3LO5A 3O4JA 4IHKA 1FU8A 2VJAA 4RZ2A 2XH8A 4WLEA 4R0MA 2CT8A 1GPAA 3IKLA 5L7WA 4JKYA 1WZEA 4NBUA 5FOTA 2X8AA 2G80A 3SZGA 4F60A 3PCTA 1LNZA 5DASA 5T5QA 1RWPA 5H7XA 4E3WA 3UFXB 4AC9A 1ZRSA 1WO8A 1DIBA 5FL3A 4TYMA 3RVDA 3UKOA 3WGKA 2J59A 2BM0A 2K7FA 3ESZA 4YJGB 4DB4A 2XOEA 4N18A 1KHTA 3ZY2A 6REQA 3P4YA 3UKJA 2FW0A 1SUWA 5DBOA 3LK7A 3AM3A 3PPWA 2FHPA 3OLZA 4JDUA 1Z0SA 1DCKA 4Q5IA 5HBGA 3L6EA 3JR3A 2WVJA 3EIWA 1W2GA 1CUCA 2PFGA 4PXSA 1M76A 4WK2B 3RUFA 4IDPA 1KSGA 5ADVA 1B1CA 1JXOA 4PZLA 3GPLA 1HYEA 4QAQA 1M1YA 1ZOSA 1B1AA 4D4HA 5A6VA 1E79D 1U3CA 1IOLA 2WJJA 1FQWA 2FMUA 3TTXA 2OAEA 4FN5A 4JMPA 3HCOA 2TMGA 5K0FA 4HB3A 2GXQA 2OXRA 2HA5A 1AQUA 4UD6A 4Z5XA 5LNK6 3ZGZA 1QVRA 4CL3A 3VR4A 2NZVG 5CK4A 5DX1A 3SQOA 2XSZD 3Q3EA 5B12A 3SDBA 2QN2A 3KEOA 3N2KB 3EXG1 4PX5A 2JIBA 1C1YA 3OQIA 3S27A 1I6KA 2ZYTX 1J42A 3BDIA 2BCJQ 2XR1A 3T7JA 1XUOA 2YJTD 4H1VA 3IP3A 3HACA 1LVHA 4L5IA 3C1OA 3UH1A 5FX2A 4FW9A 2YIVX 1HDEA 3EGOA 2NV2B 4J1TA 5TB5A 1QNFA 1AOXA 3ORFA 4PN7A 2JEZA 4AJNA 4BVJA 1TVKA 2EL9A 2Y1EA 3V8MA 4NBTA 4D4JA 1QDUA 5ARBA 1RVV1 1DXOA 1L5SA 5TY0A 1Q6YA 3PNMA 4HKTA 1J06A 3VU9A 1W85A 2JC3A 2FG6C 4O2BF 2BSXA 2GBCA 1JWAB 3M5DA 4O2BA 1HQCA 1PKEA 4J3FA 4MQ5A 4YAFA 3KJIA 1T15A 1GUZA 2ONZA 1XTRA 2X6QA 3E82A 3SC3A 4EUFA 5FO1A 4CEHA 2CCGA 4D6PA 3GRCA 2ZPAA 3EFOA 3CC8A 3CMCO 3CUSA 2L17A 5DXJA 1YOVB 3ICPA 3TR5A 1Y4DE 2ERYA 2V1UA 4K9RA 2IIVA 1ZMBA 1N3IA 1RKBA 2BTOA 3A05A 3EE6A 5D3KA 3HH8A 3RBAA 5AVXA 4L4XA 3SWWA 2H9AA 3ZZ1A 5IP5A 3IPRA 1VCOA 4LOHA 3EK2A 4YS6A 2I8AA 5H4HA 2NUAB 3S99A 3M1AA 4D80A 1ESNA 4C08A 4YRNA 1VYTA 3ZVLA 5L3QA 4RSRA 3LPMA 4FHFA 1BQ4A 1KQFA 2TMYA 4KX5A 2Z58A 3H1PA 3C43A 2QQGA 1UOQA 1P18A 1ST3A 3M1IA 4UM5A 3HHPA 5ED0A 4JV5B 2O0MA 2Y05A 4Y6GB 3O93A 1ZK3A 2VJKA 3UGQA 2KQUA 4OJKA 1QRTA 4I55B 1EIZA 4EHKA 4DS3A 4PSUA 4JBYA 4A6DA 1A5TA 2YZGA 5CA1F 1XT6A 2ERCA 4WXRA 1J20A 3R7FA 3VKWA 1IG3A 3DBRA 1NRWA 3DNMA 3GDOA 1JHDA 1EPUA 1ISHA 2ONCA 2WG1A 2YIMA 2OCXA 4J16C 4V0MA 1NMXA 3RUAA 2G8LA 2Q3FA 4XA8A 1YCHA 1T2DA 5TQ0B 1IHDA 1R88A 2CXTA 3TBKA 3TQHA 1ADGA 3KEGA 4YCBA 3VR6D 1HMYA 2EW1A 1JLRA 2UV8A 3LUHA 2D4AA 2D5CA 2PIAA 3GEPA 1IWPB 2DRIA 1G17A 2LIVA 2D6FA 1B76A 2WHPB 1NBOA 4E5DA 3PXDA 2J5RA 1RI4A 3IR5A 4U02A 3THYA 2ODNA 1E77A 3O8DA 4OP2A 2OUKA 2R84A 1JT9A 3QMPA 3B1XA 1EJ2A 3RSGA 2D2XA 3ADBA 5CA0F 1P44A 2HB6A 4LHWA 4HBZA 3F5QA 3GP3A 1E1RA 1KYXA 2PX5A 3PXXA 4TMFA 3JD4A 4NCAA 5DM2A 3OP4A 1SEVA 1NLYA 3FNFA 4JH0A 4QVGA 3KOXA 2JD1A 2MTBA 3K8QA 2ZYRA 4K6CA 4UE3S 1YJ8A 4JCCA 4YV2A 5BSWA 2CW5A 5MDHA 3OLVA 1PRYA 4JKIA 2COEA 3KJHA 4BX2A 5KSWB 5JADA 4CV1A 4BXOA 1NU6A 2DZDA 5KNDA 2HV9A 5EIEA 1EK2A 1GG9A 1NSFA 1RPTA 3K8ZA 2AFRA 4M99A 1ZX1A 1JFVA 2OC9A 5EQFA 2V54A 2NTYC 2YY5A 1Z5GA 2CY0A 4DMFA 1BXZA 4FX5A 4U3JB 3K8YA 5JCJA 4FHCA 2FJUA 4PSDA 4Q03A 4G1FA 5FBVB 1IHUA 3LFUA 4DNQA 5FP0A 4FINA 2P67A 1NPDA 1O03A 1G0OA 2NACA 3BQ9A 3T3EA 2VDWB 3WJAA 4DJFC 1LF0A 2GJAA 2E85A 3OEYA 3R20A 1JA1A 3AI7A 2BBSA 3M9WA 4MVJP 3X1XA 3CZRA 4G0YA 4DE5A 4G9BA 2YKGA 2JL1A 2OHFA 2LCFA 1PS8A 1G20B 1FYFA 3M49A 3QKSB 3R6LA 2HHHB 2A86A 4I3FA 3CIOA 1X1EA 2DBZA 3RD5A 4QT0A 1MC4A 5LQNA 4B32A 4RJKA 4LMAA 5DMXA 4PO3X 1AF4A 1XDBA 1V4VA 4HQFA 4XWYA 1W0KD 2VN8A 5JS1A 4PC2A 3OE7D 3IL2A 1QIHA 2VQEB 1HX7A 3NTXA 3A3NA 4HNSA 1E4OA 4OP3A 4U8HA 1JP7A 3I05A 3I45A 3WB1A 2QG9A 2CZQA 3FWHA 1BGXT 4UE2A 4BBAA 1JQ5A 3B85A 1N0VC 2P6MA 1G9SA 3JV7A 5JD3A 3F3SA 5CU7A 1Z8NA 2AA3A 1ZVKA 2JIZD 3GJSA 4KV7A 3UH0A 1O89A 1N1EA 2B30A 2DJ5A 4O4JB 3G85A 1E6EA 5T6MA 2XVZA 4D5GA 2Q5FA 3O0TA 3CLVA 1WBBA 3NM5A 3HGMA 2QWXA 1PX2A 1LRLA 3MTJA 5H81A 3M6VA 1MB3A 1SCUB 3TOZA 4D9NA 3EBLA 4NBWA 4PPGA 3EEQA 3KVVA 2V3VA 2PX0A 2ONKA 3ENNA 3K2EA 4LGCA 5JZOA 3UOWA 1CJMA 1H2RS 3COYA 4CMHA 4DCMA 1SUIA 3HEMA 4ND5A 3R8XA 2DH5A 1U7UA 1FNSA 2BMDA 2ZK7A 3LZDA 4RY0A 1VXRA 5C8ZA 10MHA 1NQXA 1CX9B 4M60A 4NFHA 4REMA 1BROA 1WMEA 1VQ1A 4K0RA 2SNIE 3GAMA 3WB2A 2I7TA 2Q0QA 3AKYA 2JBAB 1YRWA 1T2CA 2XMPA 3WQQA 2RGBA 1QTRA 3H2ZA 4IS2A 3I28A 4GR4A 2E5WA 5KYGA 4ZU3A 2VHCA 3RIMA 2NUPA 4G63A 2RCYA 3DO5A 3FPGA 1Y3DE 3G6WA 1E1RD 4K26A 2Y68A 5KOIA 5DB4A 1YONA 1VI5A 1DQPA 4DV3B 2VH5R 5C51B 4LX8A 2AF4C 2BRUA 5DX8A 1DBRA 2D2IA 3MB5A 4Q1AA 2C7QA 1CJTC 1LV7A 1Y5MA 3TZCA 4JR0A 3NTLA 3A4NA 2JG3A 4A92A 1JBEA 1UPFA 1B6GA 4Q4AB 1FNCA 1M0TA 2FDRA 2GCGA 2OHOA 3QKRB 3U4QA 3ICEA 3WRXA 1WD5A 1TYCA 3IEVA 5KNDD 3IUJA 4CRWB 1EFLA 4U5XA 4WKOA 5AUPB 1UWVA 1XEXB 1ZFNA 2JCVA 7AT1A 3INTA 1IZYA 1HE4A 1EJ6A 3THSA 2CUKA 1OOEA 1V3UA 4BKPA 5IF3A 5JCJD 3BTOA 2XYVA 1DEOA 1SGWA 3UHOA 5BR8B 1XCOA 3HG7A 4E31A 1AE1A 1AXRA 1CLEA 2EFJA 2IP4A 3KB2A 3OUZA 1G7RA 4TLEA 5CMLA 4R1UA 4TT3D 5KNBA 3EGVA 3RWMB 1SKAA 1B8OA 1XRJA 4IQ8A 5JFGA 2YCBA 4WGFA 3QNWA 1Q1NA 3PXEA 2FFQA 3C6KA 3C4VA 4GXRA 1GG5A 1V3VA 4XWOA 3B51X 4TRMA 1U0SY 5DRYA 1B0AA 3TLEA 4D99A 1AZWA 1JIUA 1NLUA 5EJ8A 1BVHA 4P4SA 4A27A 4QTXA 2H0QA 3CKMA 5HE9A 4BP9A 3N0WA 1NVMB 3L7NA 4LXQA 1EFCA 3SC6A 3ELUA 3TUIC 4B79A 4CFYA 5KYTA 1A9ZA 2QE6A 4HDRA 4LMRA 4B71A 3K9QO 2QI9C 2XVXA 2DQSA 4QJBA 4N5NA 5K2OA 2IODA 4M0LA 4ARVA 2D62A 2PN1A 2GA9A 2BZGA 1TK9A 2ZJ0A 4DBLC 3LQRA 4RDCA 2M6KA 3HJCA 4NYIR 4RVNA 1RWVA 1X19A 2X5NA 3MTBA 4NMXB 5D8DA 2A9FA 5J2TB 3C87A 2V65A 2XCOA 3AVWA 1A2OA 1JLSA 1PJ2A 3GRYA 1XZQA 4NCJA 2PR2A 5SY4A 3EC1A 4FNOA 2NNWB 4LKRA 1SBHA 1A9XB 3VSBA 3I01A 1TAHA 1JH8A 3OM0A 2YH2A 3F3YA 3PT5A 2G4CA 2EWMA 3OJWA 4IJ5A 4MCJA 4Y9TA 1L5LA 2EKLA 4FLMA 4MVXA 1MX5A 2ZYHA 4EMSA 1TT7A 3DNFA 3IP9A 1M2OA 5ICCA 2WJ3A 5CYOA 4K9DA 1YOVA 2FUNB 2LNDA 5CVTA 5JS7A 5LP6F 3AVUA 2GLUA 2E49A 3OLQA 1MB9A 4N9QA 2CBZA 4WCDA 2HHAA 4UOQA 4Z9YA 3ZH9B 5K8JB 4EVIA 1VL8A 5KVQA 2V9PA 4IHQA 2P9YA 5CW1A 2RK6A 3IULA 3K0FB 3HXPA 1DCMA 1E3DA 5ELLA 3Q3JB 1T2FA 4QATA 5M2QA 3OZDA 4WK0B 2BR3A 5I4BA 3C41J 5AHXA 4YTEA 2D2EA 3GLIB 5AR1A 3NBKA 3EUAA 3VBCA 1N2OA 5B7NA 4JSYA 4M6WA 4WIAA 4RDHA 4PBTA 4TWJA 4WKBA 4I5IA 9GPBA 1JDVA 4EGQA 2BI4A 2W00A 1BD3A 2XNKA 4LXUA 1J90A 1WXIA 5BSMA 5F1KA 3IRVA 1NDQA 4MP6A 3WWZA 3TEMA 5K45A 4M1EA 2G07A 4DDWA 1PT8A 4MVJD 1WY5A 4I55A 3FPCA 1QQBA 4R2JA 4KG7A 5J58A 2YHIA 3S2UA 3ZYZA 3G82C 5KI6A 1BX1A 1TU0A 2YCLA 4AJOA 1EVZA 2R1TA 4JHLA 4NS1A 4CYMA 4YYEA 1J2RA 4QGGA 1O57A 1KQOA 3JQ9A 2FK7A 4L0MA 2Q50A 4I5FA 3RS2A 2IV3A 4BV2A 1SBQA 3QUTA 3WIDA 4K5QA 4TL7A 5EWLB 2WT4A 2NZWA 4EG3A 4HVLA 2MYPA 5EXTA 2BV3A 1H05A 1PVDA 1ML4A 2WSYB 3C3AA 5EIOA 3WK7A 1AZSC 4OXNA 3NHMA 2P1DA 4UFNA 1XEWX 3PUHA 5JJLA 2XNSA 2ID9A 1CUAA 3UT6A 2IIPA 4LSWA 2P9JA 4DR5B 2DPLA 1MB2A 3L77A 2NZ2A 2R6FA 5DI3B 4P3XA 5TV2A 1H4QA 3L5KA 1EUDB 5CEEA 2B3TA 2WD7B 1UBTS 3VNSA 4FSXA 1M8KA 1A5ZA 3KKPA 4JLUA 3GJ3A 3N86A 4OI4A 1DTWB 2BIFA 4BAGA 1XV5A 1CEXA 1NNI1 4M9XA 3DQQA 3UCEA 3VZBA 2FVYA 4ZARA 3ZU3A 1YASA 3JVVA 4I3GA 2QAGA 3HYCA 4LRWA 2A1TR 1HH4A 2QLNA 4F5EA 5L45A 2K6GA 3C14C 1X1TA 2IS6A 4PS0A 1VC2A 1DBIA 4FMDB 1U1DA 2ALJA 1X1DA 2JW5A 2RH9B 4M7OA 4G24A 4KOEC 5HNKA 3WMRA 2AOTA 2GRUA 1GKIA 2KM1A 2ZIGA 4G4SP 5EUBA 1DBPA 1T4BA 2Q6TA 1Q3HA 3PGLA 4A0SA 1P7ZA 3MYRA 2FSVA 2IS4A 2RHHA 3R5FA 3CUTA 4QQ8A 2M6LA 2VQDA 3HVRA 4O25A 3I9V6 4H1UA 3FLEA 5CDHA 2YJNA 5ENVA 3B89A 4OHUA 2EG5A 4IQGA 2DR0A 1G42A 1KVUA 2GN8A 4MARA 5FPKA 5HW0A 1EDZA 1EUCA 1KFCB 5BR7A 2VAVA 1POWA 4XB1A 4QEDA 3ROFA 4IRMA 4FKZA 5T57A 2CVOA 3LWBA 4OHZA 3DBLB 2BGMA 1TCUA 4DMCA 2IOFA 3BH0A 3G0DA 3BBLA 5CVCA 3GEEA 2EIXA 2P6RA 1XXHB 3QUAA 1FBNA 1LLCA 3D6NB 1T5SA 1P1JA 2DUUA 1N2CE 1R66A 3E5NA 3QKSA 4YT4A 3LW8A 3OQOA 4TLBA 1W29A 4HF7A 4RIFA 5CBPB 1R15A 3AY0A 4U7TB 4C7OB 3H1EA 4X65B 2G71A 4BVHA 1E3TA 4GX5A 1F2UB 1L5QA 1C7ZA 3IPCA 4WLOA 5FUYA 1ND5A 1XQXA 4B40A 3UC5A 4Q3BA 3WA6A 2BHLA 3CSSA 3DVRX 1TADA 3AR9A 4YJDA 2GILA 3ZD6A 3ZQKA 2ANCA 4H18A 2A1IA 4ZI3A 1QHXA 1F0KA 3DBOB 3MUOA 1X1RA 4YJKA 1JG7A 4H4DA 1CQJB 2QD5A 1O6ZA 3LFHA 1AU9A 4QUDA 4O4JA 1I4DD 1WNFA 3CB4A 2BEUB 1Y7TA 3L7JA 4WCFC 1ATIA 5C34B 2GM9A 1H1LA 3DEZA 2ENWA 1DMRA 3UMBA 1U0GA 1GNTA 5CLJA 1NUQA 1UWKA 3CT6A 5EHGA 5BW8A 1KBOA 3DCIA 2HW8A 4EAAA 3IILA 3V6MA 1G6OA 1WXHA 5DGDA 3ASVA 4GPAA 3W9SA 2RH4A 1SK8A 3LH5A 3LAWA 4PE5B 4D4GA 1S2LA 2QPLA 1F7VA 1PX0A 1TMYA 3LTEA 1Z83A 4M98A 4C4TA 1GQ2A 4EGFA 3RUIA 1Y8ZA 1DLJA 1S8NA 4F46A 2VP3A 3F9RA 3A1WA 1N6IA 1B74A 2JBAA 4RXTA 3ZIUA 3FW1A 3PZRA 1KPHA 2EHJA 5A9SA 3ZCSA 2WJ4A 3SM9A 1JDPA 1I1OA 1XJCA 2CDAA 3S5UA 4F3CA 2W48A 3UTDA 1M8FA 9ATCA 1M1UA 1SEPA 2OHVA 3AR5A 4UVGA 2J3DA 3ZE7A 1F48A 2Y76A 4ZYUA 3TINA 2IZZA 1HNXB 4BBJA 5B3JA 3N75A 3DOFA 3GPCA 1E9CA 4HDMB 1SVSA 1Q0TA 4K2HA 4R1MA 3L8ZA 4WNYA 1U2DA 3SGLA 4NCNA 5B6IA 4D8XA 1KP2A 2B2CA 3RRJA 1HEUA 1DJPA 4HX2A 4Z2YA 1Q1BA 3SXPA 5AVOA 4MI3A 4R1OA 3KSAC 1QH9A 1Z37A 3K9GA 1G2OA 3E58A 3ODGA 4RORA 4JAVC 4X45A 3AFIA 3QELB 4NFLA 5DEOA 1Z35A 2ZB3A 3EVAA 1AGNA 4CQJA 1K3FA 1VJ5A 1UBOS 4C04A 3KETA 3LHFA 4PRKA 2VJOA 4QDXA 5LQSA 1CR0A 2ZQ5A 4QJ3A 1L1RA 2H2DA 3OTGA 5BUSA 1FSPA 2DGDA 4JX8A 1KQPA 3G2PA 2PWYA 2CB0A 4RF4A 2ESRA 4P58A 1MH1A 1JH9A 3BGIA 4X66B 4BGIA 3KL2A 3KOOA 4I4NA 5B53A 4GYWA 1U0LA 2Z2JA 4X3PA 1XZDA 1OJLA 2P77A 1L7XA 3FOEC 1NHWA 4W63A 521PA 1YJAA 3L8EA 2BM8A 2IKQA 1GDDA 1SIOA 4E4YA 1ZISA 2A92A 3B9BA 4DKJA 4BE9A 1AS0A 1Z0FA 2H4HA 3S4YA 3TZQA 4BCDA 1FUKA 1AZLA 4XX0B 1K2WA 1A27A 1EDOA 5EP4A 3WLJA 1KGSA 4JB3A 3BE8A 4MQEB 4I0WB 1E2QA 1M6VA 1JUDA 1G8GA 3EOAI 1NWHA 4HZUA 4EJ0A 1AUOA 3C5WP 4O33A 3ZDFA 4CIYA 4CL0A 3JQ7A 4V39A 3ZZMA 3OD1A 4M8LA 3EIEA 3DONA 3COWA 5AOVA 4A4DA 2W4IA 3IQHX 3A3YA 4C9BA 1TU4A 4C78A 4CQMB 4ZEWA 3VDNB 5E2AA 3P94A 3O3OB 4G4IA 2IYPA 4X6LA 1YZFA 3TNLA 2WABA 1YS4A 3CUVA 3ESBA 1R0XA 2V98A 5AK4A 4ARUA 4PAOA 5CIQA 3CTMA 3WWDA 1DPGA 3VO8A 1T4DA 2YYYA 1YVPA 3SHVA 2HCJB 4LTMA 4FFDA 2Y3IA 3L02A 4LW8A 4DCJA 3L6CA 3BD7A 1SKMA 2O0KA 2QTVB 1ZUNB 3WAGA 2X0NA 4D9GA 1NUTA 5G4KA 2AE2A 3DMTA 4DLUA 3Q85A 3FHOA 3MCVA 4AKTA 1BW9B 1OCEA 1PO7A 3W9BA 4DTCA 1JSCA 4C29A 1E9VA 4M7RA 3COJA 4RXMA 1I1QB 1WVGA 1ZZEA 4TV9B 1M75A 1P7WA 1TCAA 2ZRJA 4KMRA 2JLZA 2WJWA 2OEPA 2AB0A 1O58A 3R3WA 3UGTA 4B9EA 4RKQA 4CCWA 4DJEC 3NCHA 2ZUEA 2HZBA 3DGEC 2Y1KA 2PGAA 3I6BA 4NAHA 1CUHA 4NESA 3OQVA 3IQEA 3W5DA 3NBYC 1IDN1 1SXJE 2PE5A 2V0NA 3LC0A 3QW4B 3OTHA 2IDZA 1JNXX 3QLUA 1VGRA 5FH9A 1U3WA 5FIUA 3GLIA 1N6OA 2I1VB 3HCEA 1G8PA 1IN4A 4PM4A 4PSCA 4AJLA 2OSVA 1DB3A 3TIXB 3I2IA 4NEGA 3D1LA 4B31A 4PGFA 1COWA 4Y2RA 2YC4C 3AO0B 4HG2A 1NG1A 2R7KA 3IXQA 3WO1A 4YALA 1O4WA 3MWDB 4V1CI 2VBFA 3K8OE 4D0RA 3HVUA 1J1UA 1C3XA 2J1LA 2PUTA 5ALRA 1VJTA 2ATVA 8GPBA 4P9NA 3FF1A 4O0MA 4G0OA 1M2FA 4HNGA 1I9CA 3AFMA 2EZUA 2IHTA 5B64A 4RULA 1Z36A 3OLXA 2I2BA 2AL7A 3T4XA 3H5IA 3FYCA 3R9XB 4BX3A 1KETA 4ETNA 1PZXA 2B1QA 3EMKA 3RKUA 3VHQA 4JJEA 1R6AA 3VVCA 3ZGVA 3MCAA 5HJEA 2IYRA 4JFRA 4G0ZA 4O02B 1AQLA 3V2IA 3GVCA 3HA5A 3CKKA 3BB1A 4UFOA 5IYZB 4ALMA 2H1OA 1XWIA 1UBEA 3FZGA 4M0DA 1I2BA 1YS7A 4MYCA 3QU9A 1NY5A 2HZ7A 4BUZA 2XT6A 1QGZA 1GPMA 3GLHB 1LDMA 3SLKA 3DBHB 4EYGA 1JZQA 1NJ5A 2DG2A 3THXA 4DDKA 1DTWA 4GVXA 1GPBA 3VPGA 4X62B 4D8TA 3VKGA 2XYQA 2C0PA 2JLBA 1PL7A 4XM2A 2MYNA 4FXOA 2EV9A 1GPJA 2O7SA 4ALLA 3WZ2A 4W5NA 3QFRA 2HV8A 3N1UA 2QRNA 3Q2KA 2XKBA 3AFHA 3I42A 3JWPA 3QHAA 3CINA 2FZKA 2WU0A 1VA4A 3W5SA 5IUKC 3VR2A 5DYNA 1QORA 1MJGM 4M0UA 2F55A 3C6BA 2PAAA 2NAPA 5CJJA 4EPXA 5HIAA 1ABEA 1P1RA 4OXYA 4C6TB 3RI3A 1TYZA 4BO0A 2G1UA 2QMOA 3CX7A 3L49A 4PRLA 2ZIVB 3FCYA 1E60A 4KQGA 1ZM9A 4QUEA 4KQWA 4DMGA 3G89A 1D1SA 1VTKA 5H0IA 4GI1A 1BCRB 2NO5A 4GRAA 4JGBA 3CVXA 2XD9A 3A4YA 3UMVA 4PZPA 5TRTA 3WQBA 3NX4A 4F5ZA 4RPCA 4ALKA 1NURA 1QRRA 2VNHA 1CR4A 1HG0A 2PL5A 5ECDA 1GNQA 4F8EA 3V55A 3EF3A 4PXAA 3W1VA 4YMGA 3ZXYA 4LHXA 2QN6A 4ZIRB 5B4VA 2P5TB 1CJVC 3VPSA 4DGQA 3MQ2A 3GLQA 7ABPA 5DHQA 1RYDA 3SCZA 3TM4A 1R5BA 5IKXA 2QU7A 4FLFA 1GSOA 4EO4A 3I64A 4G0UA 3T9BA 3LKVA 1L5MA 1U7OA 1PEYA 3K0AA 3R7BA 2XADA 3SQWA 1O95D 1VGVA 2VDUE 3PX3A 5KPJA 2WB4A 3NEAA 3TD9A 2W6JD 2XMBA 4GP9A 3DWGA 4D8YA 4AMGA 2HJGA 2GSDA 3R9IA 2ZBVA 1L9XA 5FLYA 1Y3FE 3HRIA 1OPXA 2BE9A 4KHPB 2NP6A 1NI4B 4DIFA 1CUJA 4Q3CA 4DZTA 2Q3BA 1OH5A 4RTNA 2QNIA 3ZCRA 2W83A 1I3MA 4GBMA 1G5IA 1CQJA 3MYYA 4FXPA 1DINA 3C85A 4G5GA 1LPOA 4LE0A 4LQ4A 4PINA 4ZWNA 3ZE9A 2A5YB 5L53A 2VDMB 1CP3A 2W43A 3IBGA 3AI1A 3PKZA 2HFKA 4I66A 5KTTA 3GWZA 1CF4A 3ZQ4A 1PJRA 3EVBA 4W8OA 5AW1A 2GD0A 4MEBA 4IG9A 2BFPA 4PCLA 1G8FA 4QWMA 2V6MA 5H68A 2YXLA 5IBRA 4IYJA 1RKQA 5EXDA 4NX2A 2CNNA 2HTFA 3UUFA 1SXGA 2GAIA 3MF4A 4S04A 1ZHOA 4FDTA 4QFBA 2JD2A 2VWPA 5HGJA 2G9NA 2D74A 1KKMA 4FYHA 1WMBA 4Q7MB 1GZDA 1V8BA 3CZ9A 3LQFA 4UUAA 5GTDA 3L7YA 5DBEX 3AJ9A 3N59A 1QC5A 1UM9B 2XA9A 4UTVA 1Q3TA 2VUUA 4FEEA 3JQDA 3PEVA 4R98A 3S70A 1T1JA 1W8DA 3PQFA 3U1BA 3UJNA 3KYCB 1JHXA 4YREA 4PNEA 4DLKA 5AM2A 3BZWA 3G9QA 3QY0A 3EWNA 1QGYA 4B4UA 4G0VA 3LDHA 5H02A 2QLLA 4Z2AA 3ZBUA 1W4ZA 1JDBC 2NT3A 1RCTE 5KX5F 5TT1A 1K7YA 2H9IA 3FTCA 1J49A 4Y98A 1E0DA 2Z2IA 1TK2A 1T24A 1T2NA 2ODPA 3AOEA 3ANNA 4LCEA 4ZYVA 3LQYA 3RTBA 1M2HA 4MGKR 3OPYI 1VLZA 5E7IA 3ISTA 2X1MA 1KJ9A 1ONBA 1CJSA 2AG8A 3I37X 3MELA 1U81A 3NJ4A 4P2GA 1EWTA 5AJZA 3W1WA 2N1BA 4PPYA 3RBVA 4L8GA 5KTYA 1YTLA 2A67A 1QIIA 3BWDD 3ETJA 1QH8B 2HSEA 1Y3AA 1CQIB 1O4VA 3R23A 4HPWA 4KWCA 4UAVA 4YAWA 4YXWD 1WDMA 3AMVA 1NTRA 3E3OA 5KQMA 4KGZA 3AY7A 2ZU0C 2B7BA 2GVDC 1P2FA 1Y9ZA 2F43A 2OG1A 4Q4HA 3TYXA 3TTYA 3T3MB 1ZJ4A 4L5AA 3FLBA 1XKQA 4QLOA 1G19A 3MWYW 4IMJB 3B5IA 3NZEA 3QBDA 4PQGA 3CXRA 5ADWA 2XB8A 1NKVA 4IO0A 3SXUA 5HJ5A 2P9ZA 3QPCA 3JAWA 4TKVA 1EU1A 4ZJYA 3DXXA 4FI3C 3DFFA 1CG6A 2C2ZA 3DMYA 1DP4A 1MNAA 1XROA 2EF1A 2B0CA 3AF2A 3K7EA 2WSMA 4L57A 3H83A 4QDTA 4B44A 1T8TA 1T9HA 1XCPA 2ID4A 1UEXC 3C24A 1BCSB 2HCTA 3CR3C 3DW1X 4QO8A 1HDXA 4BWYA 4ER0A 2ZSAA 3GFTA 5FHRA 2GUWA 2EJTA 1W96A 4GSKA 2ORIA 4TVOA 3IIJA 5E8RA 4RK1A 1Y3HA 3ICQB 3NGLA 4DIMA 4UVEA 2Z04A 1THTA 1ADYA 4ZPJA 3HI4A 1TNDA 4UBLA 1LPSA 4DCTA 3ZXXA 1GCOA 1IJEA 4WQMA 5ALZA 3AEUB 1E3WB 2K4MA 5C35A 4K0KB 2NUTB 2SBTA 3A3OA 4KO1S 4MV9A 2R7LA 4JP2A 4FYYA 2P9CA 4M76B 2WIKA 4Z1MA 1KJJA 3OJXA 1R0LA 2AYXA 2WICA 3JQQA 3SS7X 3TCKA 2B8TA 2EC5A 4WZBE 3EEFA 1O5OA 2ZTHA 3I1FA 4RTOA 2AMYA 1QWSA 3D8BA 3KR2A 4QTZA 1Q0HA 4X3OA 5CH5A 3UJAA 1TJPB 1MB4A 2X1LA 4RCVA 2VJDA 3QVXA 5H4GA 3IB3A 5I4KA 5AW2A 4A6XA 3CGWA 3BRSA 2O8CA 1SELA 2QTVA 3TJRA 3D8HA 5IFKA 2A0YA 2PX6A 3UKDA 5KQLA 4FFBB 1PW7A 2AYZA 2HRDA 1RS0A 3DYIA 1KBQA 5G4LA 2OKCA 4NDNE 1N9ZA 2VRCA 5KHOC 2ZAYA 2OG2A 1Y6GA 2NTEA 5BV2P 2YDYA 1OGYA 1F12A 1XZKA 3MN1A 3UV6A 3VV2A 4TL9A 3W3AD 4DDMA 1EINA 2WFMA 3WC4A 1H3FA 2CXPA 2E87A 2WIAA 3NVKI 3VPCA 4XSVA 3RSFA 3EG9B 1ISPA 2EKDA 2ZI5A 2WJGA 5CEFA 3TS1A 5JNUA 5DGIA 1FX0B 1PEKE 5ALPA 4A7PA 1WUJS 5B58C 5GZ3A 1C2TA 1P5ZB 1L9KA 2OK7A 3JX9A 2QLTA 3RS5A 3FPSA 1GLGA 1Z28A 3FG9A 1WAMA 4R2KA 2LPMA 4BMCA 4PIMA 5MN4A 1UP4A 1T4CA 4FFRA 5ED4A 1G8MA 1NNLA 3Q1KA 1EK6A 1BHQ1 4J9VA 4Q15A 2RBKA 1ES9A 4NV0A 3Q3GE 1UMCB 2HBRA 5E9QA 2QSUA 3L1HA 2E82A 2MSCB 5BRAA 5DM1A 2F8TA 3CZMA 5K6TA 2YFYA 4BNXA 2QPTA 1R6TA 4MHOA 1EQUA 3GYGA 4M8KA 4XXHA 3STUA 3OCVA 1C14A 1JG2A 4HAOA 1E7WA 4KQFA 4PNZA 1W35A 3BFPA 1X70A 3LT4A 4ILKA 5CT6A 5BPHA 3GA7A 1VPWA 3B2QA 3I12A 4AUKA 4YPOA 5DNCA 1KI6B 5IAEA 4RY2A 1C0IA 2P62A 4IL5A 3H2IA 4MHTA 1ZH8A 4GPEA 1VIDA 4ND6A 3E23A 1GDTA 2VCHA 5IYZA 3A9UA 3LUCA 1H9BA 3ZCVA 4JLJA 2EW8A 3CG4A 4RZSA 5A1JA 3KL4A 1EQAA 1A9SA 1GQRA 3AM4A 3GRPA 5JG7A 5F76A 3RYFA 3PDIB 3EZ9A 5AVUA 4EPTA 2WLSA 1LLFA 1HLDA 3IP5A 5JXHA 2O5VA 3GRZA 3H1FA 2FEKA 4WASA 4MWCA 1OTXA 1J1ZA 1MRZA 4HEA6 5HHTA 3AEKB 3FZQA 4G1VA 3FDFA 4RS3A 2GHRA 5IK2A 5I5GA 4O4LB 4CQMD 3WV4A 2C77A 1NZDA 3C1AA 2FZGA 2HNAA 1NVBA 4PTLA 3HKBA 3MHTA 5C7OO 3SFZA 2GZRA 1G5QA 2Q5IA 4Z9AA 4UHCA 4ABYA 2FY8A 3D8SA 2JI8A 2L2QA 3P45A 4C89A 4DQUA 4YRQA 2GPBA 5ITSA 2VPPA 3ZGOA 4C01A 3T38A 4LJAA 2V0CA 3PF8A 2B5OA 4FBMA 2AW3A 1RAEA 3MOIA 4AN1A 4URUR 4D9CA 4C6TA 3HABA 4XD7A 1N5DA 3HYSA 1VIVA 3NONA 4H0NA 4DCOA 4ZO6A 2YASA 3OLWA 4ZT7A 4LAFA 4PCVA 4M0KA 5AM0A 1FP4B 2ZIZA 4K46A 2Q9AA 1BCRA 5CX1A 1W6UA 2ZRMA 2H4XA 4R4JA 3EGDB 4XB2A 1UAGA 2DUNA 2VRCD 4WFKA 4XGRA 4UVDA 2F3RA 4EG1A 2UYCA 4XDHA 4PSVA 2BZ0A 1U7XA 2QUAA 3ZJYA 3R4CA 3DA8A 1B00A 1N2SA 3GMDA 5IZ4A 1E3SA 1KZ7B 4GOJA 3WXBA 3REOA 4BN0A 1SCIA 2Y4OA 1R0BA 2R8BA 1P19A 1S3SA 2K2QB 2FMFA 2OCPA 2A0XA 3GRAA 2WZQA 3B2NA 1R0WA 1W25A 2OZVA 5K3SA 2I1LA 3RFXA 4F84A 1L8QA 5BP7A 1CVLA 2EARA 4M1OA 2IDJA 2CFSA 2G0TA 1ICIA 2I33A 2G0AA 3DV0A 1D2GA 5D6OA 4J03A 4WA8A 3A32A 4TYQA 4ND2A 1GXSB 1QR6A 2FRDA 4QXQA 4MLDA 1H93A 5F7JA 3T9DA 4P0QB 3GJXC 4TYYA 2O1XA 4TMTA 3BTUA 3FYUC 1BS1A 4TM7A 4ZT5A 2O4CA 1RVDA 1T0HB 1R4MA 2H2GA 5ECGC 3ZWDA 5IVDA 3ASUA 1ZLYA 3LIIA 1H9CA 3B12A 2G4LA 1R0KA 1JDZA 1F8GA 1YS6A 3CLTD 2ZRAA 5G40A 4EUSA 1YUNA 4EA8A 1NXQA 4AKSA 5JH7F 2BFDB 3AI2A 3I5UA 5JH7A 2JLCA 3R24A 1U0JA 1YH3A 3BDVA 3DQPA 3WNVA 5KSPA 3D6AA 4E2FA 1VFPA 1T9CA 4JP8A 4TQGA 4N6NA 3OCZA 4P1ZA 4FGWA 5AKEA 2X0DA 4Z51A 5IT5A 1NE7A 3OUUA 2C92A 4J43A 5IXYA 2IYWA 2GTHA 1N33B 2GASA 2ZSIA 5LB4A 1J8DA 1DMSA 2QMZA 1K6XA 1NN5A 1T5LA 4P4LA 4TXLA 5D84A 1AUVA 1NONA 3K5PA 5BWMA 3JARB 2XVAA 1OGJA 3M5PA 4D97A 3U5ZB 4NPAA 5BWCA 1TYAE 1MTZA 3MZ0A 1O2DA 4FT2A 4POOA 3BXHA 5DN9A 4BNKA 4ETMA 1X7WB 1MP0A 1NX9A 1YCGA 2G17A 1NDHA 3AF3A 1CUIA 3N9IA 1SU7A 2IS2A 2Q5EA 1AKVA 3LYUA 4KB5A 2FZ4A 3LXUX 5KU7A 4MWEA 2A35A 4HS9A 4FHEA 1RQRA 3ZY5A 2Q1YA 4N4AA 2QE7A 4OG2A 4LDRA 4DEXA 5LIRA 3J81A 1FMCA 4HXGA 3NBUA 2WIDA 3VKUA 2I6QA 3STXA 4F1KA 2EX0A 3W5CA 2IU3A 5T41A 3GT0A 5B1EA 1WUKS 3T3HA 1RJ9B 2ETXA 2H5EA 1S8OA 2QAIA 4S12A 3RSOA 1ZH6A 4V0QA 4AVYA 1F5NA 2O19A 1WSBA 4L4RA 4R1SA 3RG2A 1H8EA 3QBJA 4WESA 2PRJA 1J33A 5AVQA 1BWSA 5CFQA 1A5AB 1MJFA 2WFLA 1DAIA 3KLNA 4V3BA 2FQYA 4HMQA 4IQ0A 4J4HA 2RI6A 5T67A 2OD9A 2CLLB 3C5CA 4TMVA 2W98A 1AKQA 1CR2A 4XDYA 4FFVA 5KYVA 3TZEA 4HNTA 1A8SA 4W5RA 1BCSA 1P3JA 1PYGA 4GI3A 4R68A 1U5BA 2ZTLA 4JEHA 16PKA 4N40A 5TF0A 4PFKA 5F7OA 1T3HA 2BFEA 2IW3A 2C8LA 2XKJE 2HQSA 1A1VA 1Z82A 3JQGA 3T52A 2FP4B 1L5KA 2ST1A 1KBZA 3AEUA 3Q8KA 1PD1A 3P9KA 2PUVA 3GLVA 2NQ8A 1JQDA 2VHXA 1D0VA 3PZBA 3ICOA 3EODA 4UHFA 2R62A 1B43A 1RJEA 1UK6A 5AOAA 4EDHA 5DI9A 1CDZA 3PUIA 5DDIP 4MDFA 2PZJA 3M4ZA 4Q7LA 4R9VA 4WD3A 3LPDA 1ZY2A 1OUMA 1R9GA 3NC0C 1STOA 2YOFA 3WGJA 1E0KA 5KB3A 3PJGA 2IUYA 4M0MA 2E6UX 1Y1SA 2AFIA 2PY6A 4PV7A 3GLFB 5IVKA 4MPJA 4ND8A 1UUFA 3L46A 4GKVA 3WS7A 1JEDA 1TFRA 3GNLA 4Z0PA 1MDFA 5KJFA 3IDSA 3UF0A 4NMLA 4AO6A 2GO1A 3GLTA 2IU4A 3MJEA 4B3XA 1IB0A 3PFBA 4HPXB 1U9JA 4KIJA 1R2QA 3VU0A 4CW7A 2VHEA 1TU3A 2ZRHA 5G41A 4NHEA 1V11B 2J4CA 4MVJM 1SBCA 2R1ZA 3AVVA 3CO0S 2OFXA 4ZDKA 4LXHA 3JQEA 2QT9A 3IMKA 4FHDA 4QGSA 5F23A 4GIBA 4KRXA 4UDOA 1P75A 1W44A 3JQFC 5LD2C 3O21A 5HKOA 1D8TA 3EC7A 4PAWA 1DS6A 4MW0A 4ZOLF 4FSHA 4ZOLA 2QN9A 4Z3OA 2LUOA 1WF3A 2GGSA 4HUQB 5JCXA 1JHQA 3H2YA 3CX4A 1NXVA 4AYTA 5G53C 2JHPA 4WN9B 5G0SA 3ZGNA 4RIEA 4X91A 2BGJA 1NZFA 2R6AA 4HTFA 3F5FA 3DAYA 3MTEA 1NPTO 5BRNA 1I10A 4MB6A 3UO8B 1SVNA 121PA 4RZHA 3ERCA 1P1FA 2FKAA 5GIPE 3EQ2A 2CXRA 4IUYA 3CRRA 3G9ZA 3WMFA 2IZ5A 2ZSHA 1D4FA 4LGVA 4EFNA 5CH3A 3LKDA 2VYND 1L0BA 1P4SA 4LE1A 3Q7EA 4U2KA 3YASA 1CE8B 1KI6A 2KPOA 5HA5A 4Z7NB 3O84A 1YVRA 3UWMA 4F11A 4B09A 5LMCA 1UDRA 3CRVA 3R3VA 4EBFA 3GGCA 2WPNA 2FFBA 3K92A 4R9UC 2X5OA 3PC6A 5K4AA 3ND6A 1U2SA 1NRJB 2R86A 4OHRA 4ZAVA 2CKMA 5A5FA 3A8TA 3UT5A 4DDVA 3L79A 4JSRA 1ADJA 5U4QA 3FPJA 3ZNNA 4M1KA 3G7SA 2JJ2A 4MAAA 1TC2A 1F2DA 1TKCA 3AR2A 1N25A 1CSEE 3D0RA 5ERXA 1P4GA 3GLGB 2NV6A 1Z9BA 3I01M 3OO0A 3BKWA 4GRDA 4URHA 5DWDA 4XJSA 5F77A 3LBNA 3N74A 4O4LA 3PNQA 3D0QA 3U48A 3KZNA 4P38A 2NU8B 2XGGA 4EH1A 2N75A 3KPVA 3PTZA 4LZOA 1G0NA 2X5KO 4JA0A 3SDSA 2QR3A 3OC6A 2XBMA 2K7ZA 1MENA 1SUSA 2NSDA 3CZPA 1U3TA 4IDFA 1ZYUA 2D3WA 2WKQA 4DCNA 2X23A 4F5YA 4M87A 2GN4A 3PTLA 1MG5A 3OA0A 4E7OA 1FDVA 2IPAB 1IBSA 2GB4A 1Z8FA 1J7KA 3AUUA 4CG1A 5CW2A 3TNDA 3MJ4A 4EI2A 4D74A 1PZFA 4HRYA 4WLVA 2WYHA 3R3HA 3GUHA 4AUMA 1OIXA 3TSOA 3EGDA 3USCS 4OIFA 1T26A 1YT5A 2QQFA 3L43A 4ZJZA 5F2OA 2B4KA 4HAIA 1PWEA 3MA0A 3VSCA 5L7TA 4Q3EA 3ANLA 4L8VA 5C1BA 4PGHA 4AWBA 4BRSA 5H83A 2NP7A 1WSAA 2J9RA 3VOTA 2B34A 3ABQB 2MR6A 4Q9JA 2DKFA 3JYNA 1R4AA 5CFOA 4GVLA 5DHTA 3VXKA 3JY6A 5IUNC 2XPCA 2VWQA 2PWBA 4U00A 3A26A 4S1VA 2D1FA 3IT3A 5F5NA 4CF4A 3NM6B 1RBZA 4P82A 3BIXA 2FF7A 3NV7A 2H1WA 3OZGA 1QRSA 4DLWA 4R8LA 2ZUDA 4TMYA 1KDVA 2Z8YA 2REXB 2A9VA 4AY4A 3A4MA 3V7UA 1IZ7A 2PTHA 3EZ6A 3LT1A 2G9ZA 2CEKA 1LI7A 4WLUA 2DKNA 4DSTA 1TUIA 1QP4A 3U7JA 3JQAA 1A71A 3AR3A 3RF6A 3V1YA 1GXSA 2FG5A 2GZAA 3KOUA 3IAEA 4KDFA 1I7LA 4IY1A 4X1KB 1NUAA 1OH8A 1GTRA 1P74A 3GUUA 4J90A 2BY4A 2OK8A 3OT4A 2YZ7A 1MH9A 1FP1D 3Q8WA 1RQNA 4F9GA 2AG1A 4X95A 3ND7A 3RFCA 1U94A 3MOSA 2PUAA 4PZEA 4UNPA 2HCRA 3EPKA 2WU1A 4OOEA 4HFRA 3PHIA 4IXDA 4B7AA 5HM6A 2ZI6A 4OB8A 5B7PA 4RO0A 3T95A 1OHHD 3H2HA 1XDWA 2IXAA 1UDAA 3L7AA 4WLNA 2ZJOA 3VAAA 2GK3A 4BLVA 3C97A 3AP2A 3G9XA 1U2QA 4PAGA 4Y9RA 5ITWA 1R5JA 3MUNA 2AXNA 4QXPA 3NPMA 2Q3CA 2ISQA 4LV8B 5BUQA 2PQMA 1I7PA 2FHSA 3D6VA 1KYQA 1F8YA 4F6LA 3FXAA 2PH3A 4OHXA 4IKPA 3OSUA 2OESA 2CUZA 2ACEA 1KQ3A 1IOZA 3UXYA 3CGGA 3I6IA 3MWEB 4JKOA 3S8EA 3GC6A 3KV1A 4NAUA 1K7FB 3WISA 2QW8A 3CPHA 4Q16A 4IH4A 3O9MA 1XVLA 4I14A 1VL2A 2ODQA 4RZUA 1Q15A 4M4SA 4OSOA 3PHHA 3TTWA 5JYDA 5GOTA 3I8SA 2I66A 1TKAA 1V7CA 1ZNWA 3E03A 3LBYA 5B4UA 1RWKA 2L69A 3BMQA 2Q46A 3LKBA 1I9GA 2AVNA 1JTEA 3CH5A 2ZYIA 1E5LA 1Y34E 4OQMA 2VRNA 1RHQA 3GHYA 4NLLA 3KELA 4GW3A 2GM5A 4BTEA 3ACBA 4KXVA 1GZ6A 4RMNA 5LOVB 1X9IA 1REQB 3D4PA 5DHUA 4X8LA 5IDXA 3JQRA 2C4MA 1IZ8A 1PSZA 1NLZA 4J1TC 1QBKC 2YXEA 1NV9A 5T3YA 1ACLA 2UZ0A 5ALSA 4G1CA 3C3JA 5CCXA 4QULA 4IJVA 3P5BA 4MMYB 4ZO9A 2EFYA 2OOKA 1RJ9A 2DR2A 2C82A 3M2PA 1HFWA 4WZAE 4ECEA 3ZDDA 1TIPA 4Q18A 1MGPA 4YDHB 1D4OA 4MWGA 4EIWA 1MLDA 2AOVA 5DT2A 1E69A 3K4HA 1U9CA 3SIXA 4NQRA 5AYVA 1Y3IA 2CDRA 5FPHA 2AD5A 3W4KA 2Y2UA 1VHDA 2BFCA 3H18A 2G5CA 3DZIA 4AF7A 5BURA 3TLGB 2CL6X 2WTNA 4EZEA 2W2LD 5FUXA 3SQNA 5I6DA 3RUEA 1KZ6A 4YP5A 5BO5A 5KJ1A 2UVPA 1UJ6A 1YKFA 2VJYA 3TPZA 1J0EA 2JA1A 3C98A 4FJ2A 4OQYA 4Q93A 3O4VA 3RJ9A 4D3ZA 5AIBA 3FOCA 4QEZA 2XB9A 2H31A 3PHCA 3DT6A 4WW0A 4KVGA 2IBTA 4PICA 4W5QA 2I2WA 1NXOA 1IQUA 3HXMA 1CV2A 3B60A 3CIFA 4BMNA 1PN3A 2I6TA 1A8QA 1R18A 5KWSA 4QQFA 4QQRA 3DD5A 3ZHZA 2PL9A 3T5PA 4U7DA 2IUTA 2C59A 1K68A 3QW2A 3NOVA 1Y4SA 3TSYA 1IPEA 5AKZA 3VNBA 3LA6A 4E5KA 4M1QA 3M6FA 1WXEA 3FDJA 3Q87B 5F64A 4Z54A 5IWAB 1B8UA 1L7AA 2WILA 3ZHSA 4BP1A 1XB2A 3WKDA 4H1TA 2HUPA 2CL7X 4YH1A 2F67A 4P2BA 3TB4A 4HCJA 3TM5A 3UHJA 1IY2A 2BGNA 2Q9CA 1KO4A 1GGHA 3R6GA 4JOBA 4GUDA 2CK3D 4N54A 1GADO 1FZQA 2V8OA 3GEDA 3LGSA 2QPAA 4Q1BA 4C07A 1IY9A 2FU5C 1E2GA 1RQGA 4JOCA 5KREA 1OI4A 2A59A 3TQQA 3O5AA 1Q16A 4R01A 4DHWA 3AQ4A 4EG5A 1ZK2A 5EIBC 1M10A 2HT6A 4F5DA 2XUFA 2HA2A 4ZYWA 1SUAA 3PC7A 4MVJI 3E70C 1B8VA 1AUXA 1SA0A 4NC9A 5GJWC 4OFBA 1YE3A 2HHCA 2H0AA 5JAMA 1WCIB 3GEBA 1MQ8B 1EYZA 4IVQA 1L8LA 2LDXA 4H17A 4J0HA 1U8AA 3BGSA 4DMRA 1AH2A 4MGZR 4BMZA 1FTWA 3IESA 1TM7E 4Q66C 4TV8F 3D8NA 2AFHA 2C5HA 2NWQA 4MVJE 1QHSA 3ZGXA 3M1YA 1MA0A 2X8JB 4O08A 5JMTA 1PBTA 2GPYA 1UMDB 3TLBA 1ZXBA 2QW1A 5KJ6A 3KC2A 4ACAA 4UMDA 2ICAA 2Q9UA 2ZAGA 1V35A 4DM7A 4UNQA 5J4VA 4ZI7B 2RG7A 3LVBA 5EJGA 1IY8A 2ZI3A 1O5IA 2GAAA 3A1EA 3VHLB 4EX6A 3PFWO 3FGOA 4ZDJA 3AF0A 3E7PA 5HZKA 3HNRA 4RCYA 4RTLA 1BDIA 4W5HA 3H5RA 3KTFA 3UFBA 1QHFA 1YFZA 3HADA 1NW5A 1Q5PA 4KDRA 1SJ9A 1RHRA 1TM1E 2EEPA 4PO8A 4UD2A 2ZIXB 5EMLA 4LY0A 3ABZA 4MYRA 1CE8A 4F97A 2IL1A 3IR6A 1VLVA 3U39A 5K3OA 5LC1A 3P0HA 1YMQA 1DT5A 2VSFA 2QX8A 5AKYA 4CL2A 2FUKA 4QC2A 2HF9A 2Y1FA 2GEFA 1DKUA 1G21A 4HH3C 4EUEA 3HSSA 3QE9Y 3MBKA 3BRQA 3URKA 5FUVA 3VHRA 1JMKC 3VYUB 1SCQA 2GXUA 4B4WA 1MUUA 4P3KA 3NP7A 2NXWA 2DHDA 3O26A 4M55A 3NDPA 2FETA 3M33A 4NL4H 4OBEA 1E9EA 2HJ9A 2PUEA 1HL7A 4PYMA 2V7BA 3FNGA 2VNKA 5IS2A 4Z8YA 3GLGA 3L7OA 2ID7A 3KKQA 4EHNA 3NPAA 2BM1A 3H9CA 3QVLA 4NTZA 3VNQA 1FEZA 2NU8A 1KPIA 5TGDA 4KE6A 3R5HA 2WPDA 4KFSA 4L95C 1IONA 3W4JA 1CIJA 5KQSA 3FCXA 4HZGA 1ISMA 4GO1A 3WB9A 2J3KA 5EI5A 2JCSA 5D3ZA 3AGQA 3ZCXA 1JJ7A 4ZEOA 4F06A 2L82A 4HDNB 4QODA 4LA4A 4ASUA 4CM8A 3ECSA 3FYTA 3KXKA 3TPFA 2C97A 3EEYA 5CEJA 3PRHA 1CU1A 1T4GA 1Z7WA 5HKKD 1B7GO 3WHIA 2WWHA 2HSWA 2XTNA 3NHKA 5TIIA 2NQTA 4CEIA 4IWNA 3GNSA 2OOSA 1GTZA 2YBEA 4ZAFA 4DN6A 1SD1A 2CD9A 1GTG1 1PWXA 4NBSA 2Y1LA 3O4FA 3OZXA 4W7HA 1R0ZA 3QUQA 3TD6A 1V41E 2BP7A 3T4EA 3O6VA 1ZI6A 4UZSA 2VBCA 3GEHA 1G8YA 1M2GA 1VKNA 1ZESA 1T9GR 3L06A 3RT1A 3U7RA 4IVPA 5FTMA 3D8RA 5IM5A 5BORA 1JQ3A 4RX1A 4ZV9A 4OJYA 1KK2A 1KQNA 3H4MA 4A6PA 4UU7A 4BB9A 1K86A 1K8XB 3D4BA 3P32A 4K8RB 3CF4G 3KU1A 4C7KA 5IANA 2DFDA 2J3MA 2IH2A 3L4KA 1O97D 5AJHA 4QT4A 2QL9A 3CRZA 4F2WA 1ONNA 5E2BA 1TF7A 1TO6A 2H1IA 3OC0A 3DLBA 1NVFA 3FHJA 1VJCA 3KOMA 5TQVA 2G08A 2VSXA 2EG9A 1KMHB 3LL7A 4UXJA 2O3SA 1EP1B 2NO0A 4ROTA 4ZAXA 4UHEA 4DPLA 2X86A 2AI1A 3AUSA 1J97A 4KUHA 3FJOA 2PL3A 1ANKA 4X1KA 1X80B 3G8CA 4EBBA 2OZEA 1EK0A 2BRUC 4QM6A 4RK0A 3DMNA 2ZYDA 2GPAA 4X1YA 1NVWQ 2AFVA 2XCLA 5CTAA 5I7SA 1Z8HA 2GS9A 2DERA 4UVHA 5FR2A 1BKYA 3WRXC 1RQ2A 1E20A 2A1UB 3H0CA 1WHTB 2QQEA 4TQAA 4A0QA 1IQPA 1NMEA 3BC1A 4NE2A 2P1RA 1SZPA 5FBZA 3WMXA 1YKGA 4ZU1X 2WTAA 1QAQA 5AQEA 3FWZA 1VLHA 3AJDA 3I04M 1LVUA 3HA2A 1POXA 1E2HA 1F8XA 2R00A 2YV5A 3NHWA 2IHZA 4ARSA 5BRJA 1Y1KE 2B37A 5A0TA 2WQ7A 4KO4S 3IP1A 1YDMA 2ANBA 3I2GA 1EA5A 1GY8A 1LD3A 2F4VB 3TB6A 2QL7A 2B4YA 3VGPA 1BYIA 2FSPA 1XRRA 3OUTA 3PQ3A 5K01A 3PYLA 4Y1RB 3LHSA 3VJKA 4IHJF 3WJ1A 3G2NA 4IHJA 2X2PA 1IHPA 3WWPA 3U7HB 2AR0A 1I1HA 1U9YA 1V1MB 2QD4A 3FX2A 3ZDZB 1II8A 1F4PA 2IXGA 2YIDA 3CISA 3JVEA 4XD2A 1XIVA 1AO3A 1EFVA 4NJEB 4E5YA 1BDHA 1V4NA 4JJKA 4IEIA 1K3TA 3KJEA 4HSGA 5T7BA 1OXUA 1RJGA 3RVOA 4OMFG 2Z6AA 3VPXA 1GZHB 1IVNA 1RI5A 2AT1A 2HRQA 1N8TA 3NYIA 4A8JB 4BFSA 2BJWA 1P7YA 4S1PA 4DYVA 5AHKA 3TUJC 3V8PA 2I2CA 1BN7A 3AXTA 3IAM6 4QHTA 5AW9A 1JIVA 4MR9B 4PCAA 1RABA 5FTWA 3RHZA 1PGPA 4OHCA 4JI0B 3V8BA 2X9LA 3A2MA 3EJWA 5L8VA 3AKEA 4DARA 1UT8A 1F1BA 5FA5A 3OZEA 3LQ4A 1PYOA 5HR5A 1FS4A 1ULAA 1GEGA 1YCFA 1F0PA 4MZDA 3CCFA 4IINA 1BE6A 1L8AA 4MS1A 1H2ZA 2VHVA 1XXLA 1NJSA 2E55A 4H0FA 5HMLA 1QCDA 5AW6A 3G7UA 1BDMA 3ET5A 4H3KB 3P0FA 4BPRA 3T41A 1G20E 1TKRA 1T8YA 2ODAA 1EFPB 3D6FA 2FSUA 4ZRMA 1ISGA 2H57A 4RETA 1P1HA 1RAGA 3VZPA 4B80A 3MIIA 3KYBA 5DK4A 1KEEB 3BQMB 1WABA 3W5IA 4IZOA 1VE3A 3RREA 1W4LA 4FYMA 1YFKA 4BFTA 2CSXA 1NBAA 4TX1A 2IP1A 3IB6A 4LTDA 5HZGA 1F14A 3JZIA 1GGMA 3B53X 1C3OB 4N3AA 4M9UA 4G5QA 1AIPA 1J0CA 2BEVB 1DI0A 3I73A 3L8DA 5EJ7A 5IDVA 2VAWA 3WBBA 1USIA 4O6VA 5AW4A 3SG0A 1ULSA 2FB9A 2G04A 4KTVE 4B6EA 4DSUA 2C83A 1P9LA 2V74B 3AETA 4W82A 2XIJA 5DULA 4LZJA 3GJZA 1SD2A 4DDUA 4YMTA 1YBAA 1T9DA 2GZDA 4PWYA 4RY8A 1ZDMA 1NL3A 1YQ9A 3VISA 1JEOA 1KSHA 4MWOA 1XK7A 2GI4A 4M7PA 4UE6A 2X3UA 1KI3A 4LOKA 4Q7KA 4GQAA 4IG4A 4LYGA 4Q1FA 4NJMA 3QOFA 5EQJB 4EUHA 4HWTA 1UXIA 1US8B 1XZMA 3AEZA 5U1PA 2B8WA 3G2LA 4ETIA 5JYBA 4H60A 4A16A 4BVBA 3G0BA 5K0JA 1KO7A 4IBOA 4LWOA 1COZA 1CRZA 1RU3A 1SPXA 3M81A 3LDAA 3WMWA 2V3WA 4BLRA 4F4FA 1TAUA 3SPXA 3T0FA 4KWEA 4RJTA 3D8UA 4JEIA 1ILWA 2CNWD 1VYVA 2GPTA 2QX9A 1HG1A 5KYYA 3T99A 3H6GA 3R74A 3EXHB 4AWAA 4B6RA 4F3RA 1XZGA 3PKIA 4DWVA 1V9CA 2RGGA 4HNRA 1E3EA 2M9MA 2BOVA 1KVSA 2QM8A 4N9WA 1UBGA 1WCIA 4A3SA 3OHMA 1U2GA 3RV3A 4KE9A 2TS1A 3SYTA 2IV7A 1UKYA 5HP4A 2C2WA 3BWXA 5AD1A 3QNMA 4YO7A 2E89A 4NOMA 4UDXX 3KQNA 5JSZB 1PG5A 3BA6A 1PGJA 1SY7A 2O0LA 2OBNA 2OZLA 3FMPB 3KTAA 4XFDA 4FCCA 1QIFA 3LUFA 1NVUQ 2VTVA 1RRFA 3KSDO 5E6SB 3UAGA 5I8PA 4M36A 1OX5A 3H8SA 3NWBA 3Q6NA 4M3NA 4YBZA 2IOYA 4I99A 4PZAA 5DT9A 1TTTA 2PVCA 2A78A 4A1FA 2QAGC 2VHQA 4NBKA 1BEZA 4Y0NA 3ZVRA 4GXNA 3FCSB 4K7JA 4Y1EA 3X1MA 3HJTA 3C6XA 1RJWA 4UEQA 5E4TA 1ZGGA 3JYOA 1TJYA 4XVCA 1MVNA 4OHBA 1V4BA 3QITA 4IIYA 4Y1GA 1RHJA 4KAJA 4KAAA 1U4OA 2ZRQA 3AHCA 3KP1A 3PUYA 4TWBA 4MA5A 1RBMA 4RA9B 2QR5A 1JAXA 2DFLA 2ZIXA 1K6EA 2FSVC 2B8EA 2WWTA 2ZPTX 2W4MA 4G5RA 4PLHA 3SIRA 3UK1A 1TM5E 1OB2A 4F3NA 1DEKA 2E6KA 2EJWA 3OY7A 4M0PA 5JC1A 2Q6OA 2QENA 1MV8A 2JHFA 3GLUA 3BE6A 6PFKA 2XLBA 4MCHA 1ZKMA 2D8MA 2J8ZA 4QU5A 3CU5A 1E2MA 1GO2A 1VB3A 1R9JA 1U4SA 3H11B 4YP9A 4AJKA 2YWFA 1N6PA 2ZWOA 3IMFA 2C7BA 2DPHA 1ORRA 2I2XB 3GGPA 2JJYA 3BCUA 3OPVA 4BHTA 2Z9BA 2DJIA 2YN2A 3UMMA 1JMYA 1KO1A 1Z2EA 2XUAA 4QREA 1QB8A 2A9QA 5HJ2A 1MA3A 1OXTA 2WF8A 4V2UA 4AJIA 3KB6A 2WB2A 2FEMA 2JI4A 5A5GA 2UZ1B 4Y0VA 1RAHA 3FTDA 5I9MA 3IJRA 2BFAA 4ER3A 2PBZA 5DXFA 4BVLA 1QZTA 5HS6A 1WETA 3Q0TA 4EI7A 2WFAA 3DTVB 1XMSA 3COSA 3PNKA 1TQ8A 2X6RA 3CLKA 1Z6QA 2HJSA 3RFUA 2FSSA 2QP3A 3REQA 1T36A 1ZL2A 2O5EA 2MMGA 5JARA 5CDUA 4DBZA 2VLBA 3OFVA 4HDQB 2OD2A 4DV5B 2XDWA 2ARKA 5CDSA 4CMAA 3OJOA 4KIUA 5B7GA 2ZBDA 1QAOA 1O08A 4N1AA 1WXXA 2J7KA 4ZGBA 1FYXA 2BH9A 5K0TA 4I5EA 4ZICA 4Q7EA 3FVTA 1G8JA 1L7MA 2ODEA 3L6UA 4JT4A 5DCLA 4G1MB 1XVTA 3I5MA 3QNUA 2BGGA 3KAQA 2DPYA 3D3WB 5IDWA 1M6EX 3FPFA 5G0TA 3F6RA 4KJZA 2WTUA 1GP2A 1RADA 2C2HA 4EY3A 1KY2A 4UTZA 2V5VA 5BSTA 4IOMA 4MUEA 4ZP1A 5KKCA 5D85A 2APJA 1JR3E 2VHUA 2GRAA 2X7XA 5B30A 2QD1A 2IF0A 2KB0A 1OX4A 4YWJA 2D5IA 2BFWA 1J8VA 1H94A 5I7AA 1TL7C 4EA7A 3HUFA 4WOKA 4FZ3A 4QUAA 3WB0A 4ES6A 5FBLB 2COUA 3GK3A 2H07A 1WOYA 1Z4IA 3ZV5A 4JWTA 4B3RB 1Z2AA 2O57A 2Y1CA 1D7AA 3MINA 2HF7A 1VG0B 3RVQA 1G7CA 2JIOA 1ECJA 3FD8A 3N76A 4GH5A 1K8YB 3AEYA 3V9PA 2M32A 5EEGA 1JRLA 3MTQA 1DAFA 5GV7A 3JS5A 1MZVA 1XEAA 2IY7A 2RHMA 5BMVF 1UOOA 5B3JC 4Y2SA 5K3FA 5BMVA 2VEDA 1Q1AA 3ZQ6A 3P9QA 3V8QA 2PFSA 3KHUA 1U2DC 1QFMA 5I7UA 1E1QD 5EJEA 4OOFA 2COKA 3WQSB 5AP9A 1H2AS 5ERYA 2A1UA 2P3LA 2GHTA 4ZEVA 3Q72A 5L4SA 5AXDA 4DANA 3BZBA 2VA9A 2CLHB 3OTOB 4MAMA 3WYNA 4K88A 1ZR4A 2IYAA 2XA1A 4YY3B 2R3SA 2YBDA 3HWX1 1W1WA 4GI5A 2WP0A 3DD1A 5GM2A 1DWUA 3S3TA 2ZBPA 4UC0A 5K3CA 3VJLA 4UQPA 5JSUA 5CLQA 1HSZA 2GBPA 2XDQB 2YYAA 3ORYA 3GYBA 5TC4A 5EWJA 3SX4A 4Y9SA 4OLJA 3G79A 1KNXA 2VRBA 1O9BA 1P4JA 1VECA 2ZRBA 3NT2A 4K40A 3U9TA 5KAMA 4MLPA 3C48A 3QHPA 4ZYTA 1MO6A 1V8PA 4HWPA 1KSJA 1YJBA 4PY2A 1SC9A 4B9AA 4A03A 2HMYB 3DUFA 2GTIA 4FGJA 3VVLA 2IPNA 3OZCA 2GCOB 3BGVA 3H5LA 3KIPA 3EH2A 1DV2A 2G1KA 4CT0A 3EVGA 1ZJ5A 3EF1A 3QXXA 1SG6A 5C9ZA 4PO9A 3SF8B 1LQTA 3QG1A 4OD0A 3JYHA 3PD0A 4JUCA 4AF6A 5KVAA 2FUG6 2FX3A 3CLHA 3GEGA 4I2NA 2B0JA 4KE8A 4O2LA 3UHFA 3QMVA 4QA9A 4NYMR 1PJSA 4YACA 2VP4A 4MW7A 3KX2A 3VDXA 4BVGA 1TRKA 4C2UA 3FHTA 1GL9B 1TVCA 1Y9DA 3RAEC 4UNSA 3AL2A 2YFQA 4M9QA 1F0YA 5D87A 3NDBB 4WXHA 3KSUA 3IAFA 2OUIA 1XXHE 3UBMA 2H4WA 1MEEA 3FR8A 3LP8A 4UHDA 3ZK7A 1ELOA 3DEKA 3VR5H 1A4XA 4YNBA 1EEHA 4IIUA 4FYJA 4H6VA 3PC2A 3E7DA 1MFPA 4XLLA 5DZSA 3T54A 4BU1A 3MWFA 4HFJA 5IHPA 1GPNA 2JHCA 1PUJA 5U4XA 4G0MA 2HHJA 4FSDA 3NEYA 3KU4A 3KVRA 5LQRA 4CG3A 2NNLD 1XRMA 1NXXA 5DHRA 4CFSA 1JQLB 3KQMA 1TQHA 3F6EX 5EERA 1C3OA 5AHOA 1HWYA 3QJGA 2O3UA 4B6OA 2Z56A 4CUKA 1RTTA 1IB6A 4QUJA 2Q4OA 1P39A 1SO8A 5FT9A 1RBQA 5AJUA 1K4KA 3WXMA 2CBGA 2TMKA 2ZR0A 4WT7A 1JHUA 4D4KA 4J0JA 4QOIA 5CLGA 3NVAA 4BNFA 4TRNA 5FR1A 4QDOA 3QLUC 4BNLA 4FWTA 1XTSA 4LS3A 3WL6A 3BIOA 3W0LB 2BBTA 2V9CA 3QPVA 4D6YA 2QLFA 3P8ZA 3FOWA 2ADOA 4HI0E 1JDSA 4NENA 2H06A 1IBMB 4ZYYA 2FRXA 3KZKA 2Y9MB 2WV7A 2XUOA 3AOGA 1VMDA 2OYCA 3UGKA 4DPKA 3H3XA 4IKEA 4EYEA 3ZI4A 1TXGA 5F4BA 5CVVA 4FFMA 4FD3A 3GRFA 5LA6F 1X86B 5CB4B 4L02A 5LA6A 4QSMA 1W0CA 4EAQA 3H8JA 1XRPA 3B8EA 4RPJA 5LZ4A 1XLUA 2PXAA 2F3TA 1OMOA 2BVNA 1WZUA 1OV4A 2AJ8A 3CV3A 4F38A 1OWOA 1SD5A 5K9ZA 4YP1A 4FFSA 1QYVA 5EWMB 2BFOA 3FDXA 1RMQA 4ZT3A 2JAOA 3OCXA 5KTKA 5LZ8A 4EB6A 1DBWA 3S5JA 2FPIB 1CF9A 2RKWA 3ZWMA 4YQFA 4RD2A 4WL0A 4E5UA 3NB0A 1C30A 2DECA 1YZVA 2JFQA 4XPZA 1A7JA 1RRKA 1DDOA 3MLAA 4YROA 4FZ5A 5CVDA 3TRJA 3ZHXA 1WOMA 1N5RA 5AJVB 4XM1A 4RELA 2QJRA 4YJHA 1KH2A 1DRKA 4UEWA 1IMOA 4BMPB 1RZ3A 3HKDA 2P0EA 2DT5A 4GSYA 4R0NA 1BH6A 3E48A 4EOGA 3SR4A 1KY5A