3AKCA

Crystal structure of cmp kinase in complex with cdp and adp from thermus thermophilus hb8
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 78
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akcA00
1CR2A 3G82C 4EPVA 5DO9A 1D2NA 4MRPA 2ZRFA 2FJUA 1E98A 1N6RA 2GBLA 3KKQA 1M7GA 4Q00A 1YZKA 3RLFA 1IY0A 2BC9A 2IHYA 3QSYA 3FHTA 2JLRA 1OT3A 2ZEJA 3LNCA 1EFRA 1JR3E 2DWQA 5KSYA 3N5CA 4QJ5A 1E2QA 2EWVA 2OG2A 3ETLA 5L3VA 2YWFA 3QXHA 4P0TA 3Q5EA 4KAXA 3KKNA 3R8CA 1J99A 1XPOA 3FWYA 2NGRA 1E2NA 1SVMA 2EFGA 1COWA 3AV0B 1RVDA 1KO7A 1ZUHA 1JR6A 1GP2A 4KSBA 3GJXC 3K09A 2RGCA 4L5BA 2EW1A 1DAEA 5EE9A 2J7PA 2H7VA 5A0FA 3CLVA 4DRZA 2ZROA 1D5CA 3L0PA 1YR9A 3CONA 3QBVA 2QMUA 1QVAA 4MKFA 2FSFA 1CR0A 4EPTA 1ZYUA 3RDPA 1FTNA 1US8B 4LBZA 4QBIA 1NF3A 2ZRBA 4BLPA 2C98A 2AWOA 1JI0A 1E2GA 1OIWA 1U98A 1VHLA 2F9MA 2HXYA 2VBCA 5EUQB 1KI9A 4TSFD 2GJKA 3X2SA 5TXGA 1GOTA 4OHWA 1UKZA 3ZD7A 2H57A 5C4MA 2QA5A 3THXB 3DKPA 3U7HB 3SOPA 5B58C 4L8GA 4NU0A 4G5RA 4C0JA 4TMWA 1NBME 3B78A 1X8LA 4C0KA 4MITA 5TB5A 4JLOA 4FWTA 4LJ6A 4TQ9A 3KB1A 1E2HA 1W47A 3CKLA 2IUTA 2PZGA 3O8CA 2R2AA 1AQUA 2X2EA 3CPHA 2WZQA 2FV8A 3A6PC 1T3SA 4RY2A 3SC3A 3UPUA 1KZ7B 5KPJA 2ERXA 4F93B 1ZUIA 1LW7A 2W00A 3I92A 4PHFA 5IF9A 2NG1A 2IYRA 2JIZA 3IIJA 3ICQB 1EFHA 1RFLA 4DDWA 4WAUA 3RRNA 4GNKA 3SN6A 2BEKA 1MRSA 3AKCA 2WJHA 1OFHA 4D4LA 3NWJA 1X86B 1OW3B 4V0OA 4JL6A 3V9PA 4WZAE 4B32A 2CCJA 4BE7B 2ZETA 1J7KA 5BWMA 1LS1A 2QMHA 4OK5A 4TT3D 1VYTA 1KO5A 4DLUA 1AS2A 5JHHB 2GZDA 2VF8A 3PUVA 1SULA 4LYAA 3W3AA 1GKUB 5CYPA 5HKKD 4F4IA 3IILA 5E7JA 1QF9A 1SZPA 1DOAA 1WCV1 2PMKA 4GOJA 4GSYA 2ZXUA 3SFVA 2RGNA 3JVVA 4PPQA 1EX6A 2BBOA 4LV6A 4TTRA 3RVBA 1DAGA 1G8HA 4NHOA 3ND8A 1VCOA 4Z1MA 2V6IA 2YOFA 1XB2A 4P4SB 3A37A 1U8ZA 3BB4A 4PAOA 4LZZA 1SXJC 1GL7A 1J90A 1R2QA 2HCJB 5SZJA 4I1SA 4W5HA 5DE3A 1FNNA 2YC2C 2G0NA 2QG6A 3PQCA 3AUYA 1E2LA 3U44A 3P20A 1UFQA 3A58B 3T1TA 4DBLC 1FNMA 4V0LA 4JJKA 3REFA 3D6TB 4HZIA 2JLUA 4MDFA 2R9VA 3VKWA 2DCUA 1HT2E 3SHWA 5B30A 3AEZA 4JLKA 4D0NA 2QEQA 4TYNA 3U7GA 1M34E 1TPZA 3KUDA 1N6PA 5EZ6B 5JMTA 5TMPA 5FH9A 5FTJA 4FMCB 4US2R 2OM2A 1XU4A 2VHCA 2WTUA 2O8EB 1QHSA 2F43B 4AIIA 4DLTA 3IHWA 4NYIQ 1KTVA 1FUUA 2N42A 4G5OA 1AM4D 4QC2A 1MO4A 1NVXQ 1OH7A 1NIPA 3E2IA 4C7OB 1IN7A 1ZNYA 2J41A 3EZ9A 4FI3C 4RD6A 1E2EA 3CRW1 1ODFA 1VMAA 3HU2A 3OFNA 5JS8A 2B7CA 3P32A 4M1OA 3CF6R 3GPLA 4EUNA 1GNPA 2GTPA 5CM9C 1E9EA 3FYHA 2ZSBA 4HYYA 4A0HA 1TQ6A 2ODWA 5JLJA 5F9FA 1UEIA 3AVQA 1UBFA 3H2YA 5BW8A 1KKMA 1DG3A 4Q01A 2VP6A 2XSZD 4KODA 3U2QA 4TYWA 3LBNA 2VP0A 5B2ZA 2WWYA 1RC8A 3D7MA 1CLUA 2ORVA 2QAJA 3TQCA 2YWEA 2XZOA 4DB2A 3KL4A 1D9XA 1TADA 2EWWA 1R0WA 2IXGA 3C5HA 3CRRA 3EZ7A 3NC1C 4H9GA 4QJ4A 1CJKC 3VMFA 3ICEA 2EYQA 3D31A 2ZE8A 2OXRA 3OIVA 2Z4RA 3QXXA 4TL9A 3PCRB 5DNYB 2JATA 4F4CA 5JSZA 1F60A 3V00A 3QKSB 3F8TA 4DT1B 4F38A 5DYIA 4OQFA 1W1WA 4FMBB 2OSBA 2QBYA 4PO1A 4I81A 4IVPA 2WWHA 4Q9KA 2XTZA 2GXQA 3NKVA 2W6JD 5DHAA 4LV8B 4F92B 4M1YA 5FPTA 1GL9B 1RE0A 2ZI7A 3KJGA 2IYXA 1D2EA 3HU1A 1Z0DA 1Z0FA 3CH4B 2ZJ5A 3A36A 2VP9A 3OFND 4L9SA 5F9HA 1U0JA 1PUJA 2WKRA 3FKQA 3F5FA 5DHFA 2QM7A 2IX3A 3CR7A 4UXIA 3QF4A 4H1UA 4A0RA 3LVQE 5GJBA 1E9AA 3ZZTA 3AVUA 2J0SA 3FMIA 4NCHA 3ZS9A 2AK3A 2FGKA 3FGNA 2ZJZA 8OHMA 2PJZA 4P4UA 3B9PA 1SXJD 1N5KA 3IEVA 4X8OA 2W6ID 4NCJA 2HUPA 3BC1A 4YMWA 4LHWA 4OQMA 5CIQA 4YQFA 1KSJA 1M74A 2O8DA 5TARA 1SVLA 2QSZA 2IEZA 4YMTA 3U6KA 3TR0A 1CJMA 1TQDA 1IJEA 2WOOA 2VTKA 3HDTA 3DM9B 3VTKA 3FKSD 4NL4H 2B92A 1CJTC 2BBWA 1G8FA 1QHIA 2OAP1 4AY2A 4M4SA 5KDDA 4Q18A 1O87A 2ZYTX 3Q8XB 4IFBA 3NHBA 1P4SA 2D7DA 4TYYA 4R2HA 3L0SA 3PEWA 4TL7A 4MDEA 4M1TA 3D8BA 3GLFB 4OHZA 4E03A 2XOKD 5JECA 4Q21A 3THWA 5IK2D 3NDPA 4ZV4A 2R62A 2PJRA 1Z0KA 1Q12A 4NYJR 3WBKA 2O8CB 2CCGA 2W2TA 2VLIA 5H68A 1MO5A 2YV5A 5KTYA 1DTSA 1OB2A 2QN6A 3CO5A 4PQYA 1KI6B 4TYPA 1WF3A 4NYIR 1FW6A 4A0GA 4A36A 1JPNA 5DI9A 4EAQA 2XXAB 4C0SA 1IN6A 2VA8A 4IFEA 421PA 4WOPA 3TSZA 5P21A 3TUIC 4B47A 4CDGA 1D6JA 1GRRA 1E2PA 1YJ5A 4PC6A 4JT4A 4ASUD 1U0LA 5KSZA 3L2OB 1N6HA 2QRNA 5JCPA 2HDNB 3THOA 4B73A 1OB5A 3QI2A 1YR7A 1UAAA 1HUQA 1NIJA 2ZUBA 5FTNA 2P6NA 3QEOA 1Z6GA 5D3QA 1G16A 1IOZA 4GDFA 3AVVA 3CB4A 1ANKA 3I62A 4IOMA 3Q9LA 4FWIB 1QHNA 3U61B 1VG1A 2VIIA 1Y63A 4U00A 3UK6A 2C8VA 2GNOA 3H1TA 4AWXA 1KK2A 3OEED 4F91B 1P60A 5FUWA 2FPMA 1E0SA 3QXJA 1G5TA 2GVDC 3G5UA 4PHGA 4BZXA 2VSFA 4YMUA 1NLZA 2CDNA 4B48A 2KBEA 2ZU6A 2CEAA 4O0MA 1Z83A 1XNJA 4ZDKA 1EGAA 2CL6X 4BLSA 3ONWA 1R6BX 1EFUA 4OL0A 1R5BA 1SXJE 2WICA 3SI7A 3GLGA 4UNNA 3C16C 2OZEA 2ZREA 2FSHA 3DOEA 1ESNA 2IYVA 1L4YA 2BJWA 2OBMA 4KBGA 4Q19A 2GJAA 2BV3A 4OJKA 2WJYA 2QRZA 2IWRA 4UNQA 4ESVA 3LQQA 1IN5A 3K0AA 1TQ4A 1N5IA 2EFHB 1H8ED 3DMNA 2DR3A 2BHRA 4P32A 2PCJA 2VYFA 1XJCA 3ADBA 5JRZA 3CRMA 4LPKA 1DVRA 1UM8A 2F43A 1X6VA 4YDHB 3IIMA 2N1BA 2WOJA 2ZR9A 4CRWB 4ZDJA 3EPHA 5FOTA 1NRJB 3I3SR 1E2DA 1YZQA 2ZRMA 2R6DA 5JEDA 1XEXB 4C7OA 3LV8A 1ZVQA 4O2LA 2O8FB 5EP4A 1AKEA 2HJGA 3BB1A 1LV7A 3WNBA 4KLZA 4DEYA 3GEHA 4QGGA 3RAPR 1SKQA 4R98A 4OBEA 1YZTA 2IF0A 2PCLA 3HP1A 4JLDA 1I4TD 3RS7A 1WB9A 2IXEA 4ZKEA 2WWWA 4HZUB 1CR1A 2P5SA 1NP6A 2QY9A 5FL7D 2GF0A 4XSHA 1SGWA 2NZ8A 1KI1A 3UATA 1G4AE 3BH7A 3Q7PA 2D7CA 2BBSA 4DLVA 2KB0A 5KUTA 3CR8A 5EP2A 2IYTA 2VH5R 2YWHA 2AWNA 2GCPA 1KI7A 1KKLA 4PPFA 1GL6A 3EWAA 4DLYA 5C18A 3QKSA 1TUEA 4NP6A 1L7VC 3WP1B 3FMFA 4DT1A 2GK6A 4DLWA 4MRRA 2XZPA 4ZI2A 5LPNA 2CK3A 4C2TA 1EFCA 2K5UA 2OFWA 2FGJA 1JEEA 1KZGB 1TL7C 4M1KA 1QHGA 4MGIR 4O3MA 3RHFA 3EW9A 3EA0A 2QZ4A 4TTQA 1D9ZA 2VP2A 3Q5DA 3DL0A 2AKYA 3NG1A 3AF2A 1S96A 1GG2A 1BKDR 4IOLA 1LFDB 1XD2A 2RHMA 1QDEA 3AGQA 2NO7A 5AJYA 1EXMA 1BYIA 1U2RA 1S1MA 1F3OA 1G7RA 1WDTA 3OE7A 4ILEA 3W6OA 4BQSA 4B2LA 2CLDX 1CJUC 2P2LA 2NQ2C 2OFXA 1QHYA 4RJLA 2ZRAA 1N6OA 1JXOA 2N46A 3K0CC 3UKDA 4M1SA 2WKQA 1SVIA 2EFDB 4YDSA 5K8LA 1VYVA 4IHQA 3QKTA 1XDBA 5FPYA 4LX0A 5IT5A 1KK1A 1Z06A 1ZBDA 5JI3E 1FQJA 2GJSA 2UKDA 2DFTA 5JBQA 1G5RA 3O8RA 2CHQA 1R10A 1I4LD 1D8TA 1OHHA 5EE1A 3WP0A 3HPQA 1ZIPA 1SVKA 2GCNA 3QBTA 4D4JA 2I1VB 2W58A 4D25A 2CJWB 2GXAA 4IEIA 3C41J 3OIWA 821PA 1PVOA 5B57C 5IDVA 1DAIA 3REGA 4G5GA 1NVVQ 2ANBA 3O47A 1ETUA 4OQXA 1KSHA 5BQ5A 1AJEA 3IPXA 2XEXA 4JVLA 5KOYA 3NHAA 3W6PA 2L0XA 4HB0A 2G1KA 2GJ8A 2FPKA 5AUQA 3T1VA 4BGDA 1FMLA 2Q9BA 4EPWA 1OF1A 3Q7QA 3A1SA 1L4UA 4ARZA 1LF5A 2HYIC 1TEXA 1Z6YA 2A2ZA 2H92A 2GEDA 4JLVA 1F5NA 2QPTA 5E7IA 1LTQA 3U3MA 2OCYC 1KI6A 1TTTA 1L8QA 4M1MA 5CLLA 1JJVA 5EZ5A 2XXAA 4QGHA 1OHHD 5ELXA 1W36B 2ZYWX 3MAAC 1M1YE 1RIFA 2IEYA 2JJ2A 4MGYR 3KB2A 4GP7A 3TH5A 3PVSA 1E1QD 2BEJA 3R20A 1TNDA 1UDXA 1DELA 3RSOA 1JEDA 4PXAA 5FOSA 4LC0A 1A7JA 4E5UA 3L43A 3V4RA 3NEYA 5LBIA 5K8TA 2W2VA 1NVWQ 2ZRCA 2A7QA 4XD7A 2C03A 1FQKA 2FMXA 4E09A 5J4VA 5L3SB 2OLKA 3B85A 1HE8B 1VCMA 3W90A 2KWIA 4NKRA 1P2SA 3KQNA 1R8QA 4JSYA 2AD5A 2KE5A 1NJFA 3JZMA 3VR6A 4LJ7A 3I32A 3OAAD 1AK2A 1RJ9B 1I2MA 3WMGA 1N6KA 1WBBA 3LAWA 1AGRA 4YXWD 1LNZA 1W44A 4LHZA 2D3WA 3T1QA 3A4LA 5CIWA 1NVUQ 4BASA 1UKYA 2HF9A 3NIBA 4QKQA 1TEVA 4RFSA 4QBFA 2GBLC 1Z5ZA 1BMFA 1N5LA 4FN5A 1CRQA 2ASEA 2FNAA 2BMJA 3WXMA 4DUGA 1MO6A 2G77B 4HAUA 5GVSA 2A5FA 5TDHA 2F1IA 2Z83A 3AKDA 1E6CA 1RRFA 3BB3A 4Q4JA 4JVMA 221PA 1VPLA 5KNCA 1DAMA 2Q3FA 4QNRA 2BMEA 4A2WA 2ZJOA 2F55A 1JNYA 4WVFA 3C5CA 1AA9A 1T4GA 5KO2A 3BORA 3MUFA 4BLOA 2W2XA 3K9HA 5D3MB 4JL8A 1E96A 2ZPTX 5FTLA 3KXIA 1XEXA 2BBTA 1Q1BA 3NVAA 4KFTA 1P2TA 3DO6A 4B76A 3AVTA 1E4VA 5A4JA 4AKGA 1ZNWA 1VCNA 4Q1FA 1YR8A 4KHZA 2RKOA 4QM7A 3BJIC 4NONA 5KDLA 3W34A 4F4JA 4HZUA 2P0EA 1G5PA 3GJ5A 5JSZB 1A4RA 4W7SA 4TLEA 4PC2A 4URVR 4CZ2A 4R71A 3EPLA 1FTSA 1ZM4A 5CK5A 1NVVR 1VYUA 2QBYB 3X1YA 2ZE7A 2GJ9A 4KU4A 4KFRA 3K1JA 5H70A 3QY0A 3PFIA 4TLAA 3ASYA 1ELOA 3OHMA 2J3EA 1NSFA 1EFTA 2X1VA 3AF4A 1CRPA 3KZ1E 4S35A 1R5NA 4OK6A 3IQWA 3VR3A 1W4RA 2W0SA 5KHOC 2FFQA 3B2EA 1NY5A 1VHTA 4GT1A 3PUZA 4QOSA 2ONJA 1DAHA 3AQ4A 4AYTA 5EXSA 1M2OB 4G5SA 3QF4B 4CIDA 4US0R 2ZI9A 3CW2A 3P4YA 1GITA 2F1RA 2QQ0A 2VHQA 2QL6A 3AB3A 5E3HA 3GLFE 4MYUA 2IYUA 2PZFA 5HCIA 4URUR 2Z5FA 2C9OA 4RCZA 1JJ7A 4Q1EA 3BH6A 3LRPA 3FPAA 4GFDA 1N0VC 3K9LA 5K8IA 1T0JB 2PH1A 4JLJA 2O8DB 3ZYCA 2NO9A 2VSXA 2YYZA 4XVQA 3WMEA 4MA4A 2RHDA 1W36C 3DKVA 4BECA 3L8YA 3CF0A 5KSPA 4D0LB 1KSFX 5G40A 4NPHA 4M9ZA 5CDFE 3A1WA 3C7KA 5AJVB 2RGNC 2ZRIA 4BFTA 1KK3A 2BKEA 3A1VA 2KJQA 3SS8A 2F1JA 3IEUA 3K0FB 1EFRD 1OV4A 2RGGA 3KXKA 4XTCS 3RNLA 5CB8A 2NPIA 4EPRA 2CJWA 1KY2A 4ACBA 5B64A 2QM8A 3K9NA 1IY2A 3LDAA 3THWB 2ZANA 2BWJA 4MKIA 5SZHB 1G291 1BIFA 3MRSA 5KSOA 1COWD 1MABA 3BWDD 1OFIA 2PLRA 4CYMA 2QI9C 3KKMA 2RGBA 2J7PD 1Z0AA 3T5DA 3TR5A 1S9DA 4TMTA 2V1XA 2YJTD 4CEHA 2RCNA 2YC4C 2PX3A 1HT1E 3R9XA 3KQLA 1RPZA 3CRQA 2RGDA 4LWZA 4TMVA 3RRYA 2OE2A 1G6HA 4JYCA 4AKHA 2CCKA 4D81A 3VQTA 5J4HA 2C9YA 3PEYA 4NZYA 3VX4A 4DSOA 2WIBA 4LSGA 1YRAA 2FDCA 3PJRA 3LXRA 5KDOA 3LLMA 4FINA 3DZDA 2MMCA 4NYMQ 4KBFA 1G8GA 4YMSA 2FH5B 3MCAA 4JMPA 4KV9A 5DH9A 1EWRA 2DY1A 1DBSA 1U94A 2HLDA 1NJGA 2PEYA 4XVUA 3KQHA 5HE8A 4GZMA 5G3YA 2WHXA 4YLGA 3QJYA 4BFYA 2QORA 4OI4A 3PITA 4HLQB 3VR5A 2P6UA 5JWRA 4X8LA 3VHLB 1XTJA 5CM8B 2BMDA 1PUIA 5JFGA 2JIZD 4V02A 1S2MA 5L3SA 1XRJA 1XCMA 3EIQA 1KO1A 1U9IA 1OYWA 4URZR 3GLGB 3ZD6A 3M0EA 2O5VA 3PEUA 1RJ9A 3EX7C 4AG5A 2O8BA 2ZJ2A 2WWGA 4B3XA 3U7EB 5FFMA 4HLUA 1ZU4A 1Z3IX 1W7AA 5BN4A 1J8MF 3CNOA 1Y3AA 2IYZA 2OO7A 2QENA 4HB4A 1VTKA 1S8FA 1Z63A 4LBYA 3JVUA 1RKBA 2IT1A 1QRAA 3EXAA 3K0EA 3CBQA 3K0AB 1Z0IA 1ZP6A 2GZHA 4R9UC 3W6NA 4QNMA 2ZR0A 3ECCA 3OEHA 4V0KA 1W36D 4O2RA 2IS2A 4KYUA 2UVQA 4HSEA 3QQ5A 3AP3A 3N2IA 4Y0VA 3DVLA 4M9XA 3OESA 1E9SA 1RYFA 2OAQ1 4G0NA 1KDRA 1H65A 2ATXA 3UWKA 4FMDB 5BN3A 3AH8A 3HR8A 2GILA 2HF8A 1E2FA 4Z1MD 4Q47A 3GEIA 4PQFA 2ZQ5A 1OPXA 4F7WA 2W0MA 3VR4A 3CUEF 1XEWY 5AUNB 4HATA 3ZVMA 5D3MA 4PQRA 1R5OA 4M22A 1A5TA 5KNDA 4DCNA 4G3XA 2DFNA 2O52A 3LH5A 4A2PA 2HV8A 1G9XA 1HYQA 1GVNB 1OXUA 4IDHA 3UG6A 4D4MA 5CLQA 4MYCA 4LCBA 3SJBA 3QXCA 2IBMA 1OXSC 4DEXA 2JLQA 5AUOB 5JWOA 2G6BA 3A4NA 1CKEA 1N6NA 2A5GA 4C0HA 3MJRA 4ZDIA 3BS4A 4IXNA 1ZU5A 3OEHD 4QFMA 2QE7A 1KO4A 3QPVA 1RZ3A 2VQSA 2J7KA 4HDQB 4PSAA 4TQAA 4US1R 3ZH9B 4AK9A 3FOZA 1NKTA 2G83A 4EQ6A 4HDCA 2EFEB 3ASZA 1II9A 3IPYA 1G3QA 3CWQA 2DWOA 5LD2B 1KAOA 3VHXA 1Z8FA 2YOGA 3L0IB 1FOEB 1UJ2A 3NH9A 3BERA 3I4LA 2A3RA 2F7SA 3NBFA 1GILA 3RYTC 1YZGA 1E9FA 1XD2B 2HJVA 2Z4SA 3GD7A 2WVJA 1ZD1A 4DLRA 4JLPA 1YRBA 4QHSA 1Q44A 1TF7A 4Q9JA 5C1BA 4JVNA 2FSIA 1SKYB 1Z29A 2FEMA 4TWZA 4FCVA 1UADA 4TL6A 1QHHA 3RC8A 4IOKA 1P6XA 4HLDA 5FUYA 4RZ2A 3AF0A 4KFSA 1NN3A 4JIMA 1G6OA 4UNSA 2G88A 2QMOA 5CJ2A 1G3UA 1YVDA 4NTZA 2BJVA 1R4AA 1VECA 4GRAA 3B8HA 3A8TA 1DE0A 4AC9A 5SZKB 2GAOA 4H1VA 3W3ZB 2QE7D 3K8YA 1BO6A 3IHLA 2F3TA 1T0HB 4EPXA 2ZI3A 4IOJA 2QROA 2Q9CA 3W8NA 1ZIOA 2IC5A 4DC9A 3SQWA 2CNWA 3W9YA 3KXLA 2CE7A 3QOFA 1Q21A 2VL7A 1P72A 4BFVA 4GL2A 3ZGXA 4BLRA 4B2PA 2B7BA 121PA 3SYKA 1FPMA 1KGDA 4QGFA 2XB2A 4U7DA 1SVOA 1G8YA 1Q1QA 3GLHB 2ATVA 1AQYA 1OXXK 3K0FA 4KVGA 2DYKA 4A6XA 5BYKA 5H1YA 1WP9A 4DLXA 1YKSA 3W5JA 1U8AA 1IXZA 2GRJA 2XTMA 1XTIA 2WAYA 2DHRA 3O8BA 1W4AA 2I4IA 4I1OA 1MOZA 3NH6A 1KDTA 4ARZB 1M6NA 4LUCA 4JBYA 1GIAA 3V4FA 3WHLA 3WHKA 1HE1C 1ZRHA 1W5SA 1IJFA 2AR7A 1OSNA 1QHXA 3IBGA 2NO1A 1TMKA 3R8FA 1YZNA 1NLFA 2QP4A 4PC1A 2O0JA 5FR1A 1DAFA 3FMPB 2J0UB 5E4FA 5UKDA 2RB4A 1V5WA 2D2FA 2R6FA 1EESA 3HPRA 1XJ0A 3X1XA 2EVWX 1PLLA 3T1OA 2H18A 3LA6A 1E1RA 4OYHA 3TIFA 3I1FA 5FI0B 4AKIA 1UF9A 1W2HA 2CL7X 4DWJA 1XBTA 2ZJAA 4HAYA 3GFTA 1KDOA 1QG4A 4LDJA 4AKEA 1ZD9A 5AUPB 2J45A 2QP3A 5EJEA 1F2UA 3X1WA 3TBKA 4QM6A 2XNDA 3HYTA 1Z08A 4WZ6A 3ADCA 4JVSB 1M7HA 1FZQA 1Z2AA 2OEPA 1ZJ6A 2QGZA 5CB6A 4RKEA 1EX7A 3Q85A 1XWIA 4FW9A 4V0MA 4BUJA 4PZLA 4UNPA 2D4HA 3GLIB 1FX0A 1P2VA 2GZAA 3LFUA 3LY5A 4HUQA 2VHJA 5AJXA 4RFSB 4LYHA 1S3GA 2UZIR 1JBKA 4C2UA 4I1VA 4LRWA 4Z8XA 3KKPA 4XWKA 4LC1A 1W2GA 2ZSDA 4RZXA 5LB2A 1TUIA 3NBZC 2ODNA 1VIYA 3DM5A 3C14C 4IDPA 4Q4JB 4K8OA 3T35A 4XWOA 2XZLA 5FOXA 5J47A 3DMDA 3I8XA 5LD2C 2ODBA 4MRVA 4QRHA 1VG0B 1N2CE 1AS3A 1JECA 5LB4A 4C0BA 4MUAA 3TVDA 2WIAA 3FB4A 2XNDD 3HWSA 3UMFA 4DCVA 1CULC 1T5LA 5AJWA 2BM1A 1GNRA 3U4QA 3X1DA 1Q3HA 3MFYA 2GVZC 1G8PA 1HQYE 1A1VA 4MH0R 1PV4A 4FMCF 5EP3A 1E2KA 1KDPA 1T91A 3AKYA 3T15A 3ZVLA 1ESMA 1MR3F 1E0KA 2XB4A 3AVPA 4W5WA 3B6EA 1S9HA 2NTYC 2V3CC 2FZLA 2G3YA 1H8HA 2FWRA 2F6RA 2NIPA 1Z22A 2GA8A 4MKGA 3WMFA 3H84A 2OHFA 2R65A 4GBMA 4C30A 2PX0A 4V03A 3CZQA 2ZIAA 5L3QB 2GCOA 2HT1A 5KYKA 3QF7A 1XXHA 1EK0A 3T5GA 1C4OA 4JLNA 2IUUA 1G7SA 2R6GA 1DO2A 1DPFA 2PT5A 4WBSA 5AR1A 4OJQA 4J0QA 2G1JA 2VP5A 1LF0A 4RD4A 1A2KC 4A8JB 3VKGA 2ECKA 3CZPA 2E9SA 2AHOA 3A4MA 2C96A 4DVGA 1HV8A 4PX9A 4GOXA 1K6MA 2GKSA 2ORWA 1MO3A 1DEKA 3SZRA 4JL5A 1T3HA 2E1RA 2QAGB 4GMDA 2FFBA 2GXSA 1W48A 3VNVA 3WBJA 2A5JA 2ZRJA 5HTKA 2BKUA 3KJEA 4Y0AA 2BIFA 3LVRE 1Z0JA 2V1UA 1W0JA 4HB2A 4ZPXA 2ZU0C 2FU5C 3HU3A 5FPSA 5F98A 2LCFA 4TYQA 4B33A 2P5TB 3NC0C 3T06B 4Z8YA 1OXTA 2JJ8A 4M8NE 3EC2A 4D80A 3IQXA 3SBDA 5J4LA 1KHTA 4FD2A 3U6BA 3BRWD 4HUTA 1XCPA 3A1TA 2CK3D 2EQBA 2JEOA 4R2IA 3IIKA 2ZJYA 1RRPA 2FF7A 1G4UR 3GEEA 4Q4AA 2J5XA 3F0TA 4JSTA 1Q20A 3MG9A 3DZ8A 1BH2A 5JHGB 4FIDA 1D2MA 4HAVA 1G20E 4URXR 1P75A 4P31A 2V55B 2JDIA 1MABB 4ABYA 3GLHA 5F3WB 1W0KA 1FFHA 4LPSA 4EFNA 4II7A 1OIVA 4V0ME 1XTQA 2DBYA 4XWAA 3VR1A 3OE7D 4PZZA 2IYWA 2QPOA 4ZCMA 6Q21A 2DFLA 3BXZA 4CEHB 4PAQA 4RZUA 3BFVA 1P2UA 1QG2A 4WZBE 3SJCA 3GLGE 3T61A 4PO9A 3BFXA 1T9HA 2ZE5A 2P3SA 1TQ2A 4DJTA 2PT7A 1CTQA 3EC1A 2EU8A 2BDTA 4OQNA 4IXMA 3BOSA 1AGPA 3SR0A 3GJ3A 4GPTA 1TX4B 1HH4A 4EFMA 2FSGA 2J0UA 2H1LA 4G01B 3TSOA 4RFVA 2FFAA 1Z2CA 3L8ZA 2ZRNA 2AK2A 1PZNA 2CMKA 3BK7A 3H0KA 621PA 1N0UA 5BN5A 1EWQA 2WJIA 3J81k 3GP8A 2WSSA 2CLSA 3RABA 1WRBA 2B8TA 3KUCA 2RMKA 3EIHA 5JJLA 3GQBA 2FE4A 3ZLJA 1CJVC 1TF5A 4KFUA 4JJZA 4P3YA 1A2BA 1I2DA 1W0KD 1QZXA 1E9DA 1N6IA 4Q9HA 1HY3A 2VF7A 2QP9X 1DADA 1GDDA 3IBYA 4FXPA 3QG5A 4AD8A 4LJ9A 1Z6AA 3SFZA 4ITRC 2GK7A 4CW7A 1X8JA 1N3BA 1PLKA 1G1MA 1GRNA 5DGXA 4JLAA 1GZSA 1P9WA 2OCAA 3VU9A 3P1JA 5JZVA 2O8BB 3LW8A 3QVVA 3TAUA 4N0DA 3PENA 3L82B 2CVFA 1NBMA 1AZTA 4KVAA 5FOUA 3VAAA 4BFSA 3GLIA 4WXRA 5FBRB 1Q22A 3B9QA 3H86A 4E07A 3WYGA 2XAUA 3U3RA 3LX8A 3SYLA 1NLYA 3ZVNA 2F9LA 4AYWA 3LWNA 3LLUA 5FPHA 1W5TA 3GFPA 3IUYA 4IVRA 3SQXA 3CX6A 4QBGB 3H4MA 3MMPA 3M6AA 2JJ2D 5EE5B 1TF2A 2GXUA 1YZUA 2D06A 3PUXA 3CIOA 4GP6A 5TY0A 3K70B 2REBA 4DB4A 1R0XA 4XJXA 5CJPA 4KO8A 1IAQA 2NO0A 3TNFA 1FP6A 4BFXA 3CH5A 2WWXA 2GEUA 2CVHA 1CF4A 2ORIA 4M0LA 1XMSA 2GHIA 4XTRA 5K8UA 4XD7D 2H5EA 4JBWA 4XVRA 3TE6A 4BFZA 5C2JB 5HR5A 2Q6TA 4JS0A 3P27A 4P4TA 5KU1A 1T8UA 5EXXA 4B2IA 1W46A 2OESA 2Q3HA 3EPJA 3KTAA 3KJIA 1NN1A 1XCGB 3FDIA 4LBVA 4IW3B 5AJZA 2C99A 1HQCA 1RW4A 1SKYE 2H8KA 2VPPA 4LYFA 1T6NA 1UBCA 5FBQB 4C0LA 2GEVA 3TK1A 3SYNA 4PTLA 3IO5A 1S0UA 2JAQA 5E7MA 3TLXA 2OBLA 3CNNA 5E95A 3B5JA 3L0OA 2CBZA 5TVKA 2IYSA 1LY1A 4Q1CA 1BMFD 1S3SA 1M8PA 4DUGD 3MWLA 4Q66C 2ZS7A 3BFKA 2AL7A 3ZDQA 2BMFA 5KPDA 2ONKA 4BLTA 4EQ6B 4L9WA 3TUJC 4GI7A 2ZYVX 2ZJBA 2NPFA 4UXHA 1MH1A 4RD1A 3ZJYA 4BRWA 2Q3MA 2V6JA 1G64A 5L3QA 5EE0A 3LBHA 3B82A 4DDVA 2R6AA 1KJWA 1I4DD 2MMGA 2TMKA 4YMVA 3EA5A 3WRXC 1MT0A 1G18A 4RD0A 3VX3A 2KBFA 4S2EA 1XEFA 4XOIA 2C77A 5IHPA 4BWYA 3GLHE 4HEJA 3LD9A 4A8JA 1F6BA 2RGXA 3UXMA 2V54A 1QHHB 1YZLA 2J87A 4PSKA 5DIFA 2QT0A 4TSFA 1JB1A 3UANA 3THYB 5GJWC 2O0KA 3LX5A 1G19A 1JPJA 2ZSFA 4TZ6A 2IS4A 4JLBA 4HAWA 1E2MA 1G3IA 4HLCA 4IVQA 5EQTA 1ZM3A 4DKXA 2QAGA 1F48A 3QEJA 3EZ6A 3QG1A 2J0QA 2AX4A 2C9CA 4TMKA 1ZAKA 5EE3A 1F2TB 2V8OA 3TRFA 4MKHA 1V43A 4DDUA 1OE0A 2OCPA 1AS0A 1E9BA 2MSEB 3K53A 4G1UC 3NEJA 4LGMA 2XJ9A 1GWNA 2QPAA 3UMRA 1WXQA 1NY6A 4MRSA 5HPYB 1XTRA 4Q1DA 3KDSE 3UWOA 2QNRA 3MLEA 4BZPA 3E1SA 4M1WA 1OXVA 2WJVA 3ZZUA 1XTKA 4RKFA 2IS1A 1SVSA 3DDCA 2IF2A 3AP2A 4CT5A 4LJAA 2H17A 3TAHA 4QXAA 3IGFA 2WKPA 1U9IC 3B1WA 1G7CA 2BOVA 3I5XA 2XTNA 4BEJA 4C0AC 1U90A 3ADDA 3EIEA 2AXPA 4A0FA 4DLSA 4TT3A 3EZ2A 3LQRA 5JRJA 4LI0A 4NE2A 4HLUC 4CVNA 1E4YA 1FUKA 1WE2A 2YOHA 4JT2A 3TVTA 1S1CA 3UG7A 2UZ3A 3RS0A 5HKKA 3GLIE 1TU4A 1ZCAA 1NN0A 1R0YA 2QU8A 1FMJA 1KI8A 1FP7A 3QKUA 4Q48A 2ZITA 4B3DA 3S1AB 3WYAA 4LJYA 5A5GA 1UPTA 4EKDA 4POAA 2AD1A 1E2JA 4L4UA 4LK2A 4E22A 1AKYA 2QQEA 4PPGA 4UNRA 1P73A 4ZIRB 1KJZA 2FA9A 1Z6XA 3K70C 1J70A 1OKKA 4DSUA 4KITB 1K8RA 2AFIE 4IJMA 2V9PA 1GUAA 4V0NA 1KI3A 2Z43A 4DLZA 4JBXA 2QT1A 2WJGA 1F2UB 3RC3A 4KXFB 1R7RA 1SVWA 2PEZA 5BYJA 1AN0A 2GETA 4AYXA 1CP2A 4Q03A 4M9SA 5TV2A 4UJ5A 1NL3A 2I3BA 5J40A 3TQFA 3ZIAA 4D82A 4AI6A 2XJ4A 4JLMA 4PZYA 3M1IA 1JXMA 2NZJA 1VKJA 2JJ1A 3EZFA 1FX0B 1J2JA 3AVXA 4W5JA 2ODEA 3DHWC 2IYQA 1QVRA 1GRQA 1Z07A 2RGEA 4HUQB 4Z54A 4DCSA 3CPJB 2ZI6A 3PIRA 4BFUA 4CEJB 3I73A 3R7WA 1VIAA 4GOKA 3RS5A 1Q1ZA 2REOA 2ZRPA 4Q7JB 1G3MA 1K5DA 2H16A 2OXCA 3AKEA 3I72A 4Q02A 4DXAA 1X1SA 1DAKA 4Q4HB 1OKKD 1WA5A 3SEAA 4Q1AA 4CEIA 1XMJA 2A9KA 3ZQJA 1NKSA 2ZYUX 5L8VA 4JZKA 2BCGY 3PG5A 5J4YA 4IDQA 1UDWA 1PJRA 2HCBA 2EYUA 2IHBA 5DYGA 4X8HA 2HLDD 2Y8EA 2CE2X 1MV5A 1ZM7A 1Q0UA 1KY3A 2QGNA 2WSMA 2XSZA 3QKRA 3U4QB 4NCNA 1NMYA 1OIXA 3ZIAD 4Q7KA 5AWFC 2BVNA 1LB1B 2ZE6A 3O8DA 2JGNA 2OUKA 2HXSA 1X8KA 4PC3A 2JJ1D 1XF9A 3AP1A 2VRWA 5CITA 2IK8A 4IDOA 5HE9A 3MJHA 4NYJQ 2ZR7A 3EG5A 4ZCLA 1EG7A 1ZNXA 4RZ3A 5EXPA 3DPUA 5F2EA 3A1UA 3CWZA 1CXZA 2O0HA 1JAHA 1ZM9A 4HAZA 4PPNA 3TSWA 2PZEA 2ANCA 5FI1B 3TUZC 1W49A 4OI1A 3U3OA 1KJYA 2J46A 4ZI3A 5CK4A 3AM1A 2YNMA 4CT4B 1E9RA 2W6JA 2ZAMA 2GESA 2CLCX 2IXFA 3CM0A 5DLQC 5JS7A 4URWR 1R8SA 1LVGA 2J1LA 1KSGA 1GAJA 2AXNA 4LHYA 1WQ1R 3HR7A 2GCOB 3NBYC 2P6RA 4XSGA 2QTVB 1XXHB 3FVQA 4KLNA 5JWHA 3C15C 1E2IA 1ZD8A 2R44A 1GTVA 3TKLA 3K70D 2DPXA 1QBKC 2WBLC 4ERNA 1Q57A 4WA7A 3SHFA 1P62B 1T8TA 4FCWA 2Z6VA 4PHHA 3U7FB 4NCKA 1SXJA 5H8WA 2W6IA 2CXXA 4W9MC 1E79A 2IUSA 1KO8A 4JKIA 4DDTA 4EJSB 5ANRB 3BE4A 1NMXA 2Q9AA 4LHVA 3LO5A 3AVWA 1KMHA 3DEFA 3MWKA 3VKHA 3QPWA 5JI2E 5LDDC 4KSCA 1XX6A 4B44A 2WWIA 3FKSA 3THYA 3KQUA 4PAMA 4NYMR 2D74A 2OV2A 3E5HA 2FG5A 3WNDA 4D6PA 2QUZA 2J0VA 2R6CA 1NG9A 1U99A 2ZRDA 3PR1A 4Q5IA 2WMOB 1F2TA 1OJLA 1G17A 3U3KA 2ERYA 3GJ8A 1N0WA 4EIWA 2PBRA 3U60B 5HZHA 3MD0A 2XOKA 4Z51A 3TJZA 4G5QA 4MGKR 5IK2A 4Q4AB 5FL3A 2VSOA 2IS6A 1AZSC 1LS6A 2RH5A 1E0JA 3F3YA 1IONA 3RRZA 3B60A 2GF9A 3Q3JB 4OHYA 3LXXA 4DIEA 1E79D 2RAPA 3AVOA 5FUVA 4JKYA 4Q4LA 2QMEA 3CX8A 3X1ZA 5JCZA 3EWSA 4A15A 1XD9A 4PANA 1P3JA 3C4JA 3ZQ6A 1BS1A 1NI3A 3MWJA 1KI2A 1US8A 5J5CA 3RS3A 3VNUA 4YONB 2BCJQ 1J8YF 4A6PA 4L15A 1NNEA 1IXRC 2D2EA 2YHSA 4RCYA 2HEIA 4XIGS 1CS4C 1TU3A 4ASUA 2YWGA 4TLBA 4A82A 3UMSA 4B6FA 5FPKA 2ZS9A 2KSQA 1DARA 3THXA 5FTKA 4KI0A 1WMSA 4CF7A 2NMVA 2CL0X 3AUXA 1KIMA 4I4LA 3TW8B 2XITA 4TLDA 4QBHA 4LJ4A 4TL8A 3RWMB 4Q7MB 2AN9A 721PA 3RS2A 3FE2A 2ZI5A 1DS6A 1N6LA 1JQLB 3B1ZA 1IXSB 2MSCB 3IO3A 4IEEA 2GAAA 2FOLA 2HYDA 4M9QA 2CHVA 4Q9LA 5FBLB 1ZCBA 2WJJA 3S1AA 5GADl 4OQLA 4B75A 1YE8A 1JALA 2CNWD 2ZUDA 3N2EA 4OKSA 4ZIRA 1IQPA 4TN1A 2DWPA 3K9GA 3OEEA 3CPEA 4B6EA 3FFBA 1Z47A 1XTSA 4NCIA 3I61A 1T3LA 1SQ5A 1GFIA 5JJKA 2JLVA 3MWYW 4LOAA 4UJ3A 2C78A 5EP1A 3GJ4A 1ONBA 1UBEA 1KMQA 1N25A 1SHZA 1SHKA 5BXQC 1IM2A 2C2HA 2YKGA 3TW4A 2JLYA 1G21E 1K5GA 3AF1A 4FCTA 2OFOA 4C0QC 5EUMA 3VU9B 2ZRGA 2IW3A 521PA 3U5ZB 1B0UA 4D0GA 2ZM5A 2IYYA 4L16A 4BRUA 5DI3B 3SJZA 1E99A 2XGJA 1GKYA 2OCBA 2FZ4A 1H8EA 2X77A 2X2FA 2X8AA 4RVCA 3JZAA 2QTFA 2VO1A 4TLCA 4U5XA 3IDQA 3CRVA 5FOWA 2D62A 4ESHA 4OI2A 4BLQA 2HT6A 4CEJA 5FBVB 1HURA 4XH9B 2FEOA 4LY6A 3ND9A 4MGZR 2ZVPX 1U8YA 1KI4A 4RD2A 5C46F 2V7QA 5J4KA 4DZZA 1E1RD 5C4GB 5IRCD 1MRNA 3B1YA 4Q4HA 1T5IA 3B13B 4P4SA 1PLJA 1II8B 2IYLD 1W4CA 2ZTSA 3QPUA 2YZ2A 3TMKA 4ZCIA 3ZS8A 1Q3TA 3NXSA 1CBUA 4PR0A 1UKEA 2OT3B 5CYOA 5GJVC 1S4QA 1II0A 4EJSC 4HDOB 4P33A 1RRCA 4Q9IA 5FL7A 2I1QA 3FTQA 3T12A 1BYUA 3GJ0A 4OHVA 2ZUCA 3KTAB 4I99A 4N0EA 4AURA 1KNQA 2KI5A 1P61B 2WAXA 4PSVA 2J9RA 3EARA 1YU9A 1N5JA 4C3ZA 1KK0A 1VDZA 2QSYA 3GFOA 4K46A 3K0SA 3FFAA 5DISB 5GVRA 2IA5A 2O8EA 1ZNZA 1UEJA 1E94E 4FMDF 3MSXA 3AVYA 4IRUB 2OLJA 4DIDA 5EXTA 1RYHA 2V7QD 2GWHA 3SDZA 4C4PA 4WXPA 1O3YA 3TGPA 1U81A 3E70C 1XFAA 2JCSA 1GSIA 3QXSA 1G41A 4MQBA 2G9NA 3QNUA 1JQJC 1YQTA 3QENA 3ADKA 3RS4A 2PMDA 2JASA 4M2LA 3OZXA 2XX3A 4I1UA 5AK0A 2RGAA 2A78A 4U02A 3SE0A 4A1FA 4CGZA 4BFWA 1UBGA 4B3GA 4DCUA 2JLSA 2DFKB 1VG9B 3Q72A 4EPYA 3B1XA 4LJ8A 3T34A 2JLXA 4EJSA 3KKOA 1XPRA 4RSGA 1IBRA 1L2TA 3SU8A 3KQKA 1IHUA 4UXJA 1OYYA 4PO8A 1H8HD 2X19A 2ZVQX 4LJ5A 3CF2A 4K81B 2ZRLA 1VCIA 1RRGA 4M21A 4GZLA 4EFLA 1ZC3A 1HTWA 4MRNA 1OH5A 4N3NA 3G0HA 4B74A 4WIAA 2WM9B 3I5YA 4MYTA 3KJHA 2A5YB 3M4YA 4LBWA 2C95A 3FHCB 2F3RA 2QTHA 4QHYA 2P65A 3OIUA 4Q7LA 3HYRA 3GMTA 2VP4A 3KX2A 3N70A 4OHXA 4WW0A 2WWFA 4LYJA 2Q0HA 2AKAB 2B8WA 3AGPA 1MKYA 2WPDA 2A30A 3OF5A 3B7GA 2F1HA 1W4BA 3PXGA 2ZSEA 4C9BA 5HZKA 2C5LA 1UKVY 4NH0A 3QUSA 2WV9A 2EFCB 3PEVA 4OK3A 5FR2A 1KYIA 3BBPA 3VR2A 3BH0A 3ZZ0A 1X1RA 3PV0A 4LV5B 2JLZA 1ZC4A 2FN4A 3GJ6A 1Z28A 4A92A 2OILA 1ZW6A 4D26A 2E87A 2ZRKA 3MGCA 2BM0A 2G0TA 3U3JA 1AIPA 1W0JD 1E1QA 3BD9A 3GJ7A 1XEWX 1YHNA 3NDBB 2YINC 2A5DA 3RRMA 1G7TA 3R9WA 2J59A 4TQUS 4AG6A 3RWOA 1OLOA 1U0HC 1JR3A 2FPLA 4OI0A 1DO0A 1XD8A 2REXB 2C04A 4KCGA 4A2QA 2IWHA 3B1VA 1B23P 1CR4A 4TMZA 1XMIA 1CIPA 3HJNA 3W8RA 1XP8A 3GLFA 1HA3A 3VFDA 4B43A 4QL3A 3CNLA 2WMNB 3OAAA 4R7ZA 1NSTA 2IL1A 1P5ZB 5FUXA 4BPBA 2AFHE 3BGWA 1NG1A 1HEIA 2WPDD 5DSZA 1GKIA 1IN8A 2JA1A 1M7BA 2YVUA 4M53A 4B3FX 4YXWA 1JAIA 4BEBA 2O8CA 3AF3A 3SJAA 5M04A 1P7CA 3P26A 1Z6TA 1OH8A 1XPUA 4N1AA 2NO6A 2JDID 1DG1G 1E0AA 4MYHA 4URYR 1XMVA 4TMXA 4DHEA 4ACAA 3K0CA 1A82A 1XJQA 4KJZA 2V4ZA 2VEDA 5CDFA 4DSNA 5JEEA 5G53C 1IN4A 1NN5A 4UQOA 4A9AA 5JJIA 1R0ZA 1OFTA 4NMMA 3R7WB 1OFUX 3KFXA 5DN6A 5L3RA 3CX7A 5DI3A 2LWIA 2VHUA 1JR3D 1C1YA 3QVUA 4QG7A 2FFHA 4CEIB 1XZQA 1G3RA 4PHTA 1GM5A 4ZKDA 4B3CA 3P4XA 2GDJA 2Z0MA 2ZAOA 4B71A 2ZRHA 2JLWA 3BIFA 3D3QA 4TTPA 4B3BA 1XXHE 2PLFA 4D4KA 1P9NA 1WBDA 1IY1A 2NOAA 3U44B 2B6HA 3SNHA 2LKDA 3NBXX 3NTUA 2WSSD 4UKDA 1CU1A 5SZIA 3QKRB 1KAGA 1E69A 3DOFA 4A8JC 3EAQA 1II8A 4GMXA 5KNBA 4ON9A 4A4DA 3FMOB 4ZDWA 2P67A 2LKCA 4ZO4A 5G41A 4DSTA 1ZUNB 4YC7A 4RD3A 3W5IA 3IKJA 2DB3A 3WY9A 3I8SA 2MSDB 2QAGC 1FL9A 2OBNA 2ZI4A 4EDHA 2VHTA 3PUWA 2Q21A 4Q1BA 4DCTA 3PUYA 5DN6D 3C8UA 4NBSA 3EPKA 3WNCA 1NBMD 3EASA 1E3MA 4QJ3A 1KNXA 3UIEA 4QGAA 4D2IA 4TZ0A 1X3SA 2ZSAA 1E32A 1P9RA 1ZINA 1NMZA 3R9IA 1C9KA 4KYIB 2R8RA 1YR6A 4PFSA 3RANA 1CEEA 4HB3A 3FHOA 2ZJ8A 3K09C 3OIYA 2ZS8A 5GJCA 1TAGA 4JYBA 2XNSA 3GCGA 1ZMXA 4B34A 4X8MA 4LHXA 4B35A 4BZQA 1GNQA 2O8FA 2SHKA 4MUBA 3WYFA 4IKEA 5G3ZA 1OH6A 1XZPA 3LW7A 4QHTA 3SBEA 1SXJB 1Q1EA 2W83A 3QE0A 5FTMA 3ZVRA 3LBIA 2PL3A 3WRYC 1KOFA 3BAFA 3QIAA 1ZM2A 1E9CA 5FOVA 4PC7A 2B21A 4HI0E 5HCNA 4HAXA 1BOFA 5FBWB 1VG8A 2CHGA 4O25A 3RSLA 4IDNA 1KMHB 2FX3A 3KFVA 4NDZA
chains in the Genus database with same CATH superfamily
4ZCQA 1NXWA 3MT0A 4EPVA 4KL8S 4C4ZA 3UW1A 1D2NA 1U5AA 3L5KA 4I8IA 2GBLA 4CTMA 1W52X 3GRAA 1M7GA 3VTFA 2Q5HA 3T7TA 1J22A 1SC3A 2Q2QA 4UEOA 4WNIA 2IHYA 2C2OA 3PU6A 1OWMA 1QO9A 2IVZA 2VDWA 4FN4A 1PE0A 3O31A 5KU7A 5C8YA 4ZZ0A 4JNCA 2DWQA 5SYAA 4DC1A 3M6VA 3QMPA 1EM8B 2D1YA 3N5CA 1JIVA 1ZMBA 1EDBA 3IKLA 1JIIA 2YWFA 3FYSA 1E3WA 2PRYA 3Q5EA 4U8GA 3ELBA 4DPLA 3R8CA 1TQ8A 3JARB 3QEKA 4YRNA 4PCLA 2HCRA 2G63A 2JKYA 3FWYA 1SVMA 1A3CA 3ZWYA 1CY0A 3KHSA 1DMSA 4DYVA 4AZ0A 4YRMA 5BP7A 4MCJA 1R00A 1Y4SA 1TEHA 5EJ6A 5A0FA 3U26A 5BXYA 2HSWA 4GXRA 2UVDA 1HYEA 3C5VA 3DWIA 3IUBA 1U1EA 1TAQA 1AQJA 3CONA 1E1CB 3L3BA 1QVAA 4K05A 1CR0A 3EHDA 3WV5A 4ZOAA 3N1UA 5T67A 5EJGA 4RQTA 3WVNA 1OFUA 1US8B 3CRZA 1PGPA 5JDCA 1VPDA 4ARUA 4DNPA 1U98A 5EUQB 3GWGA 3WRWA 3GAMA 5LA6A 1CF9A 1KEWA 2FN8A 1Y9DA 3WRYA 4W1RA 5ADUS 5FWNA 5JAOA 2ZPUA 4AMYA 2ACWA 4BB9A 2H57A 4RAQA 1RMYA 2XUIA 2H51A 3P9YA 5C4MA 4AG3A 2VDNB 1C7EA 3ABQB 1P2GA 1NBME 2II6A 2QLTA 3JQGB 3SAJA 1FPQA 2G36A 5B6IA 1O94D 4LJ6A 2XLBA 3LFTA 4TQ9A 1E2HA 4BNFA 2ZVJA 1J20A 2QJWA 1XDZA 1AQUA 1XTZA 1PFWA 1JN0A 1YASA 2VG8A 2WZQA 4MVCA 3TGWA 1FDUA 3FFTA 3F74A 3ZJ4A 5A7FA 1P5HA 1SCUB 5JTUA 3UPUA 1QP8A 1KZ7B 2O2JA 2XGMA 3AESB 5KPJA 3T5AA 4JXZA 3U5TA 4IIFA 4PHFA 4J43A 2YFQA 3DVAA 3DB2A 1RFLA 3G17A 4ED9A 1UIRA 3O1HB 3SC2B 3DAGA 3VI4B 2B78A 2BUBA 2I6XA 3Q3GE 1YR3A 1QIDA 1VIMA 2YFHA 1MRSA 3KKKA 1Z56C 3CLRD 1TVCA 4D4LA 2C1XA 3NWJA 4WDQA 5DCUA 4FOLA 4GWGA 4V0OA 4CM6A 1BN7A 2O23A 1MAUA 4UMDA 4QSHA 3RBAA 3UNXA 2BYTA 4V0QA 3ERCA 4RABA 4HGNA 4H2DA 1LNQA 4RK7A 4Y2RA 5KOHA 4AQDA 3IPAA 3RWBA 2VDQB 1HC7A 2VF8A 2V7GA 3DEJA 3JAKB 1IBSA 4LYAA 4RFLA 3VPXA 2ZBEA 4OP3A 5HJ7A 3A1NA 5HFJA 3P4UA 1H4TA 1FS4A 2R1VA 3VKFA 2HCTA 4F4IA 1I10A 3IUEA 3GPDG 5JO9A 2EJWA 4FR5A 3CSUA 4R51A 4DLAA 4RQBA 1ZK2A 2IFTA 3ODGA 5A06A 2ZLBA 1WR8A 2ZZNA 1U7UA 4LV6A 2GCGA 4HNAA 4MYDA 5HM8A 2QW1A 1JZTA 5H4HA 5K9ZA 2H11A 3VO9A 3L7OA 2C7VA 1YACA 3ESRA 1NW3A 3H8JA 3OZEA 2GN1A 2V6IA 5AHOA 4NEHB 3BB4A 2XRFA 4LZZA 2QL5A 2J3HA 4YP0A 2HCJB 2PIAA 2EF1A 4HDKB 1JHOA 3SKYA 5DE3A 1K7CA 1S7CA 2CNDA 2PUJA 2QG6A 5F33A 3WGHA 4PCVA 1FVXA 1KF0A 3BWBA 3WGYA 2JRCA 2O2YA 3EF0A 5CFQA 3U44A 5IVHA 1NX9A 2Z1MA 3I1YA 1C7ZA 4DBLC 1QFYA 1QGZA 2CHFA 2OP1A 2ZSIA 3L7JA 2PE5A 3E5MA 4HZIA 3QVLA 4JI6B 5I7OA 4A26A 4M76B 5HUJA 4Q6WA 1B8PA 3AEZA 4HQKA 1RJDA 2OV3A 2FP4A 5A7GA 3GDOA 5DDIP 5BSHA 1M66A 4IIJA 5CCDA 1EJBA 4MKZA 5FH9A 2OM2A 2YHIA 5DWQA 1E3IA 1XU4A 4OUDA 2WTUA 2VDVE 4HFJA 2PO5A 1GR0A 3HA3A 2F43B 3MGKA 5HGXA 3NW9A 1NDUA 4KN9S 3W06A 1FUUA 2N42A 5DNEA 3QWAA 4QC2A 1MO4A 3KYBA 1NVXQ 1WB4A 3DAHA 4BQOA 1OH7A 1J1UA 4KX3A 4C7OB 3R1IA 2GZSA 4LOIA 3W6UA 4Z4FA 3K6RA 4D9GA 3UOAB 2DMRA 5LQJA 3B6ZA 1EXWA 4R41A 1L4MA 1ODFA 1VMAA 1X7ZA 3HJRA 2OQ2A 3I1JA 4MW1A 4ROSA 5IH3A 3CF6R 3NWBA 4M8IA 4OGWA 1KH1A 3ES9A 4CM9D 1IUPA 5DM1A 1E9EA 1ZMRA 1SU7A 2ODWA 4UM5A 2TYSB 1E3LA 2DHCA 3MJ4A 1CETA 1UBFA 2OO5C 3NASA 1RQNA 1X1BA 4Q01A 4YI5A 1NRWA 1FFSA 5TQ2B 3RK0A 3ZJUA 1V8PA 3TNYA 1EUQA 2VP0A 2IRWA 4TRJA 5B2ZA 4KAJA 1MPTA 4RV9A 3TQCA 3Q1LA 5FWXB 3NLLA 1TADA 4QJ4A 3C5HA 2IXGA 3CRRA 5A02A 1VA5A 2M1ZA 2AZ4A 1YQEA 3ZLUA 2B1JA 4B0PA 3PRYA 2B82A 1CIJA 3H1AA 4MROA 4TL9A 1Y4AE 4F4CA 5KX5A 2FN7A 2CJXA 1ISPA 2GNAA 3F8TA 3CQ9A 3KAKA 1W1WA 4DLPA 3UFBA 3ISVA 1I2CA 3AL0C 1JR6A 4HK4A 3VSAA 5EZYF 1DPGA 1BW9A 3CYFA 3GRPA 4IVPA 1F4PA 1IVNA 2WWHA 3IP6A 2GXQA 3NKVA 4QYTA 5H3LA 4D98A 3QEAZ 2W6JD 3ZW7A 4O4LF 1RPNA 1ULSA 2E37A 3D6HA 5H3HA 2A59A 2ZWPA 2C8JA 2H2IA 3ZIDA 2J6IA 4G6ZA 4Y9RA 5T6BA 1RE0A 2ZI7A 3KJGA 3GRFA 3CH4B 4P7JA 5TPWA 2ZJ5A 3OFND 2QK4A 1ESDA 1U0JA 1NFFA 2CGEA 5C51B 3O8QB 2FZCA 1F8UA 3CR7A 1QRUA 1IFXA 1POXA 2CV2A 1YB5A 2MR6A 4EKGA 5LYJF 1R5JA 3B2QA 1SXJD 3DUFB 2J4FA 1SBYA 1HT3A 1RHQA 1V26A 2OV1A 3OT1A 4UHDA 4X8OA 5E7QA 4CODB 1L1FA 4RJKA 4YMWA 3WICA 3L07A 1PT8A 4G0MA 4L6CA 1GPMA 2P4HX 2VK8A 4RIEA 1VSTA 4UAUA 4YQFA 5AJHA 4HMPA 5DBOA 1QYWA 1SVLA 5TARA 2GR9A 4N48A 4MDHA 1ADJA 2IOHA 9ATCA 2BTQA 2X6TA 1TK3A 4K0RA 5AM0A 4I3GA 4KIFA 2IOQA 1DZ3A 3ZXUB 2I80A 1CZNA 4N0QA 3VTKA 4DR6B 3FPHA 3PXEA 2ZPAA 3OZVA 4YY3B 4OSPA 5BNTA 1G8FA 1QHIA 3F8SA 3CZ5A 4HHEA 5ALMA 3BT7A 5IM4A 3O1IC 2Z9DA 4XFJA 2WDZA 2AG8A 3DZFA 3HJGA 4R9SA 4C4SA 4TYYA 3CNQS 1O5IA 3EIXA 1D0VA 4UTRA 1AKMA 4E7OA 1IY9A 4Q05A 2R7AA 3AI2A 3VJMA 3GLFB 4GR5A 4ESEA 2EIHA 3UJNA 2YV3A 4M8KA 4RVGA 4KPYA 1Z0KA 1Q12A 2OB1A 2PZ8A 4RACA 4UZSA 3VI3B 1OX4A 3C8HA 5H68A 1MO5A 5DX1A 5KYWB 3LP8A 5KTYA 5EYPB 4L5IA 3U80A 1OB2A 4WCFC 2QN6A 3GCWA 1KI6B 4TYPA 1M54A 3ZV5A 4BMSA 4JUBA 5FI5A 4RIIA 4C0SA 1IN6A 5EJIA 4LEIA 4BNJA 2WW8A 1F0NA 3GHYA 3TUIC 4U7JA 5MGBA 4EKEA 1D6JA 1T2NA 1YJ5A 4PC6A 4NJMA 2AOTA 3WBFA 4MUGA 4L7QA 2FP3A 1N6HA 5A3SA 4FFRA 2FSPA 3HO8A 3THOA 4CF6A 4EGSA 4DVJA 2YICA 4PFKA 5LP6F 2I4MA 4OV6B 2C2BA 4JEMA 5K6AC 2P6NA 5DHRA 4ZOEA 1Z6GA 2HTEA 3CLTC 5D3QA 2NU8B 1G16A 3KQUA 1XCJA 3OM8A 1ADGA 2OUIA 2V4UA 4BVJA 2QD1A 3I62A 2ZB4A 1JG2A 1QHNA 1E1DA 2NO5A 1QOPB 1VG1A 2FE1A 1OWLA 2VIIA 3WLJA 1GAXA 5CB4F 2VATA 3P2KA 3QMMA 1C1HA 3QOWA 2C07A 2OAGA 1Z8HA 2ORYA 2Q4EA 3DXZA 3OEED 3T4EA 4L08A 5JPDA 2ZBQA 3G5UA 4YMUA 2VSFA 4B48A 2XGOA 1H0RA 1GGNA 3D3WB 1JR4A 2CEAA 3OMWA 1NULA 4O0MA 1Z83A 2PS0A 3C70A 4MAFA 3AEQA 4MIOA 4F3YA 5AW2A 5K3OA 4ENQA 1P1HA 2HL6A 3H75A 3KAQA 1ZOPA 1Q2XA 3PHIA 1R5BA 1M8JA 1IPFA 1SXJE 1XCLA 1GFWA 2A3NA 3F46A 4RMIA 5DEIA 5WRFA 3D2AA 3I2YX 4TXMA 4DJEC 1ESNA 3T5TA 1J2UA 3NPAA 3CS3A 1XRNA 2OBMA 4KBGA 5B7GA 4ZYYA 1P4GA 4CCWA 4P5PA 2I87A 5AI9A 1UAGA 2CFCA 3LWBA 1HXHA 3CCCA 2FF5A 1OA0A 2WUVA 3L8GA 1JDJA 2P9ZA 1IN5A 2VWGA 3GGPA 4E2YA 2VT3A 1O95D 3PE3A 2P9JA 2H4YA 2BHRA 1ISMA 2FPWA 1WDMA 4ZT3A 2PCJA 4X1KB 2HB6A 1H2HA 3A6DA 5TF4A 5LZ2A 1A4UA 2XDWA 1SD1A 3IXLA 2H54A 4ARVA 5JRZA 4RPKA 4LPKA 1PWYE 3PLAE 3HUTA 4N0PA 3ET5A 5HJ2A 4YDHB 4BB6A 2A57A 2N1BA 4CRWB 5FOTA 5IVPA 4X95A 4Y6OA 1ADFA 2NZUG 3CZRA 1TJ4A 1XEXB 2F3SA 3N8IA 1JWAB 1MAWA 3X3HA 1ZVQA 5HBRA 4C14A 2O8FB 3KAJA 1GHTA 1AKEA 1E77A 3E9DA 3H8WA 4C89A 2X9LA 2CEKA 3WNBA 1XCOA 4BZZA 2C4KA 2WIJA 4KLZA 3T0FA 1E2BA 4QGGA 1U4NA 1SKQA 4R98A 4EKNB 4H35A 1IIBA 1RXIA 2C88A 2JEZA 3WNVA 1FFBA 4PZEA 4CM4A 1I7NA 3WOHA 2HO4A 3HP1A 4JLDA 3WX0A 4UFNA 1XN1A 2WWWA 4QUDA 4HVCA 3JATA 1ENOA 4O4HA 4HYEA 2QN2A 2VDKB 3HGMA 1LQUA 4WSOA 3I5MA 1I6KA 5ALXA 1ZI9A 1KPHA 4OM8A 1N5RA 4C1NA 3NQ41 4MR9A 3Q7PA 3EXIB 1ZY2A 2FUNB 5HKAA 5IZCC 4DLVA 3EFOA 1WO8A 1E66A 4S2UA 5KUTA 2DZDA 2YY5A 5EP2A 1Z7GA 4V1CB 2ZIUB 5GOZA 5B12A 1AMUA 1KI7A 2ADOA 1QORA 1GL6A 3QYJA 4DR2B 2JH8A 2PXHA 5C18A 1TUEA 2HX1A 2OV8A 4NP6A 4U3JA 1L6RA 2WG1A 4ZRMA 4YYEA 2GK6A 5TGTA 1D0IA 3GNQA 4RVOA 3HB1A 4AT1A 2IY7A 3ZXIA 1DTWA 3M3PA 2FGJA 2VYND 1KZGB 1TL7C 3HI4A 2FFRA 2HIAA 2OM6A 4O3MA 1XZ8A 3LL7A 3EA0A 3GHHA 4TTQA 1B42A 1DJPA 2XOXA 1HI9A 1S2OA 2I66A 4B8ZA 2CHEA 4ZD6A 1SBNE 3U3ZA 1O9BA 3R5KA 3T5CA 2R7MA 2NO7A 1DFIA 2P2DA 3RYCA 1JAZA 1KQNA 1YBHA 4IMJB 3NHMA 3PI6A 1S1MA 1FJHA 4JXKA 4NR0A 1OREA 1NV9A 1WHSB 1G7RA 1WDTA 3NYRA 3O4VA 4I1RA 1XZMA 5ICEA 3TLCA 2OFXA 2XCRB 4RJLA 2IGTA 2ZIVB 3L1KA 2PR7A 4FJ0A 1XJ5A 4RSHA 5GONA 3RYHB 3K0CC 1QGED 3AIMA 1UJNA 4HBGA 4M1SA 2Q4BA 3S2ZA 2PX5A 4BO1A 5HP4A 1JHPA 1SVIA 3GZNB 4FR0A 4IQGA 4AUKA 3H4TA 1V39A 3K4PA 1GPLA 3N5KA 5DU2A 5K8LA 4JQSA 3GFGA 1CB0A 3E4DA 3K3PA 3C74A 4LXUA 3QUCA 2D0PB 3CUSA 2B4TO 4P86A 4QUHA 1UMBB 2DFTA 1EDDA 3IJ5A 3PX2A 1T8SA 2HMSA 4E5DA 1D1SA 3SYRA 2MU1A 4FGSA 4BP8A 3PYMA 5BYAA 1WCXA 3I28A 2OHVA 5KVVA 4G2TA 4D4JA 4RM2A 2I1VB 1SG9A 2EHDA 3PEEA 2XUQA 4O5AA 4PRZA 4BLUA 4DTIA 2R1TA 5K0ZA 1M1NA 4IHKA 3QA3E 3QVMA 4KDCA 3E7WA 5CXUA 4G5GA 1HYBA 4GM1A 1YVRA 2Y4OA 3H2GA 1Q0TA 4OQXA 3LX6A 1R16A 5F52A 2KYRA 2PY6A 1RLMA 3N0WA 5CHEA 1IEWA 2DY0A 5IDYA 5BQ5A 2PNJA 1AJEA 2PD4A 2F9FA 5IANA 1X7XA 3RU2A 1RABA 2CN1A 4ZOCA 4A5SA 2C2GA 4JVLA 2P40A 5KOYA 1ZN7A 1HFKA 4KQEA 5EJ9A 2L0XA 2E4YA 2B0JA 4ZA2A 3T1VA 1RKUA 1IQ0A 1OF1A 1PFUA 1JFFA 1L4UA 4ARZA 1LF5A 2HYIC 1Y8ZA 2NYAA 1Z6YA 2WJ3A 1LLFA 4XIYA 1XZIA 5DLEA 2WA2A 5E7IA 1LTQA 4Q3NA 3U3MA 5A9SB 1CUGA 3RAFC 5B1DA 2P9HA 1L8QA 4M1QA 4M1MA 4PO3X 4D8XA 2C3UA 4R8MA 1L7DA 3AK4A 3MSCA 1LBSA 1OHHD 1W36B 3M81A 3IFSA 4HDMB 3ZD8A 2BLLA 3MAAC 3C24A 5JCXA 5REQA 2B1GA 4ND6A 1DHTA 2HLHA 3R20A 3BCHA 2JW5A 3SICE 4ENPA 1KEUA 1UDXA 2IDJA 1L4BA 4RHCA 4X1OA 3SR4A 5KTRA 3UUWA 3QYPA 4PNEA 4C7JA 1E1LA 4G67A 3NEYA 3GLVA 2W2VA 3L06A 3NO4A 1JFRA 2QQGA 5EWMB 4CKCB 5DNDA 5KWEA 5L3SB 3B85A 4EY8A 2VKQA 5THKA 2KWIA 4QREA 1H2XA 2J3LA 3OECA 4IRMA 4N9QA 5B1YA 1XTUA 2XW6A 3OAAD 5JYEA 1RJ9B 2HA7A 4NBTA 4J0DA 3NDJA 1JG1A 1NR7A 2OYSA 3GVIA 1WBBA 2AB0A 5H4GA 5FUQA 1AGRA 4KO3S 3RTCA 2HMVA 1X80B 2QRPA 4XWTA 4MO9A 1QQ6A 3PDHA 4Z9FA 4NZOA 2FW8A 3PFFA 3LA8A 3A4LA 5CD9A 1A76A 4YCSA 3HTXA 5I9SA 4BEWA 4DE5A 1Z4IA 2XEDA 1EE9A 5E0KB 1CNFA 2MSNA 4MVJH 5TRTA 1AA6A 4HRAA 3RROA 1Z5ZA 1HDEA 3TW6A 4LRTB 1IPEA 4YV7A 2FNAA 4JVOA 1LBQA 4YRLA 2JK0A 4PIPA 3CJQA 3B7WA 2R11A 5EMKA 2WWVD 4D9CA 2WSIA 1RRFA 5GVSA 4UULA 3K8QA 4BVEA 221PA 2VJNA 3U7QA 1OJ7A 3EODA 4JBGA 4B9AA 1E0DA 2Y71A 4ZK6A 1L7XA 3LCMA 1Y4ZA 4D4HA 2C7OA 2F55A 4P7FA 1HL3A 4V0RA 4WVFA 1FTGA 2CNOA 1FJXA 2R0QC 1JKIA 3HVKA 4E30A 2QD2A 5JDIA 1U7XA 2ADFA 3IT0A 5BR4A 5KO2A 1GY8A 2BGJA 2GPWA 3MUFA 3OM1A 2IX9A 2J9FB 3AR3A 2R1UA 3G23A 4R68A 1TCCA 3OT5A 5JG7A 2RONA 3WB0A 4W5RA 5FF9A 3ZLVA 1R3UA 2L42A 3AYXB 3R5XA 2B8EA 3PJEA 4CLDA 4AN1A 5FTLA 3KXIA 2IVFA 3STTA 3VYRB 1FMFA 4NNJA 4F3RA 1Q1BA 1X77A 3B3QA 1USVA 2Q3JA 4RTSA 1EUDA 3RJZA 4M60A 2W2KA 2P1DA 4Q7EA 4I1PA 3HA5A 2NN3C 2HA0A 3AVTA 1E4VA 1I7PA 1OASA 5A4JA 4BAUA 3ILXA 5A05A 4Q1FA 3O90A 3JALA 2YZMA 2RKOA 3MTGA 3JZFA 3SZMA 5KYUB 1NJ1A 2P27A 3BJIC 3MJVA 2WYWA 4NONA 3W34A 3U37A 4EO7A 3GJ5A 2ZSUA 1H69A 4QEDA 4BIIA 4TLEA 2PGIA 4PC2A 3FCUB 4URVR 3Q12A 5DRTA 3EPLA 4D8VA 1XZEA 1J5XA 3INNA 1ZM4A 2QBYB 3AINA 3E05A 4Y98A 2GJ9A 3OOWA 4MS4B 3TECE 1XWFA 5H70A 1T6YA 3K4QA 1WPGA 4BVLA 4RJTA 4ZMRA 1HX7A 4RZHA 3AF4A 2Z09A 4S35A 1R5NA 1DDIA 3JWHA 3GT3A 3IQWA 3OBIA 1PJLA 4OP2A 3FOAA 1IWBB 4H7FA 4QU8A 5KHOC 2FFQA 3TQOA 5AD1A 1DHRA 1K06A 1EAYA 2DQ4A 2X3YA 3B2EA 4DAEA 4GT1A 4QOSA 3AQ4A 4F3KA 2B4QA 2JCVA 2MSLA 4ALMA 4CIDA 3ASUA 3HS3A 8ATCA 2ZI9A 4R1QA 2F1RA 1H1LB 5IS2A 3HEAA 2C5AA 2V96A 4RZSA 2VHQA 3AB3A 3HSKA 3GLFE 2JIMA 4UM9B 2G09A 2P6MA 3LDHA 1PQYA 4X1YA 3KYDA 5E4YA 3RTGA 2Z5FA 3JYNA 2XCIA 4R6WA 4KN5A 1SEVA 3BH6A 3UO8B 3FPAA 4GFDA 5EKXA 3PQ7A 3NGMA 5K8IA 3TOSA 4RX1A 4WLFA 5FWAA 3IHTA 2NO9A 4V0SA 3JQFA 2GERA 3TJRA 3WIBA 4DCVA 1EFLA 1O89A 1CWUA 4Y2UA 1FA9A 1Z9BA 2Q2OA 1QQ7A 2YYZA 3Q3IA 4L28A 2C5BA 3R6GA 4MA4A 4MQEA 3WQQA 4CL3A 3T5BA 4F3CA 1MJGA 4MW7A 4BECA 2FPPA 3RQIA 5LR6A 4PRYA 1BU5A 3M33A 4M9ZA 3H87A 4NPHA 4JIGA 1MDFA 1Q1AA 3A1WA 3P97A 4R5MA 4C07A 5B6JA 1TEZA 1H9AA 3ODPA 2WC1A 5ILQA 2NYVA 1XT6A 3FCAA 2DTDA 4NFLA 1GU1A 2Z9BA 3IUJA 4LY9A 5E0OA 3QFSA 3S68A 4AY5A 2BKEA 4KQMA 3UBMA 4MWDA 4I4TA 2IHVA 3O4FA 3T7KA 2F1JA 3IEUA 4INZA 1EFRD 1OV4A 3BD6A 1HZJA 1KYQA 3NBMA 4RCVA 3RNOA 3L0BA 3RNLA 2CJWA 1RYBA 5LA6F 3MT8A 1PK9A 2QM8A 1NXXA 3DL4A 2P9CA 3K94A 2QUAA 3K9NA 1AT1A 4Z0NA 5KJEA 3F7MA 2ACKA 3BIOA 4JC5A 2ZANA 2BWJA 3G0DA 2JHPA 1T36B 4PNHA 5BOSB 1BIFA 3MRSA 5KSOA 4ER6A 4L8VA 1GUYA 2FTKE 1K4MA 4YS6A 3BWDD 4CYMA 1K3FA 4Q93A 1U0BB 4OATA 3KKMA 1KWKA 4QGSA 1GLVA 2R79A 2X2PA 3ZG6A 3AW8A 4ZAWA 1HDCA 3GPIA 5A5FA 2WTNA 4EYGA 4TMTA 4FT2A 1YHYA 3NVKI 5HTOA 4R1NA 2NV2B 1T2UA 1XI2A 3GA7A 3GFVA 2O4CA 1YFJA 5FJIA 4AKHA 3QTTA 1TMOA 3AUJB 2C9YA 2LDBA 1CB7A 2BKAA 2PZJA 4LXHA 4LSGA 1UMCB 1ZZGA 1ZBQA 2FDCA 5KDOA 2MMCA 2RGRA 4HTAA 1NNLA 3VV3A 2B30A 4UPEA 7REQA 5K3FB 4YMSA 4UUPA 2HK6A 4U2GA 1EXVA 1RXEA 1EHIA 2J4CA 2IPNA 3L6EA 4H0NA 4IO0A 5DH9A 2F62A 1ZESA 1U94A 4XVUA 1NJGA 3DWFA 3KQHA 1B74A 5HE8A 1JYEA 4GZMA 1USUA 4YLGA 4BFYA 1RC0A 4B0OA 1RQGA 4LZNA 3TDMA 3VR5A 2P6UA 3GRVA 1NF8A 2X5JO 1BS2A 2A8YA 2AIRA 2YUTA 3OQVA 4X8LA 5KI6A 4FCCA 4XUGB 3RUIA 2BMDA 4QOHA 1QM5A 3NHKA 4D9FA 1I7DA 2X5OA 5ALDA 1BMDA 5MF6A 1OUMA 1S2MA 3H5NA 2ZWAA 5ERYA 1PZHA 1Q2UA 1XRJA 4B7XA 1DBVO 1QG0A 1FRNA 4EI9A 1OYWA 4URZR 3GLGB 1QH8B 2VTVA 1EFVB 2P2GA 4CTJA 3EX7C 2NVUA 3PJFA 5HVNA 1LJLA 1G0OA 3S81A 1KH2A 2ZULA 1NU6A 2EJBA 2FFJA 3LC2O 2ZJ2A 4CCYB 4EZEA 4C7BA 3BBLA 3QVXA 2BH2A 2AE1A 1PRYA 1ZU4A 4FC6A 2GFQA 1X1TA 2HQSA 3ESXA 3GDWA 3QPBA 5K3DA 2H6EA 3IH5A 3OTWA 1T35A 4ZCSA 1TK2A 1YQXA 3B70A 1EZ4A 1QTIA 1USKA 5K4AA 2A7XA 4U1RA 3O3NB 3T9CA 3ZJ5A 4MMZB 1WF6A 3GJZA 2XTJA 1Z0IA 3EGXB 4H77A 5A4MS 1X7DA 3X0DA 3W6NA 3OEHA 3WV4A 3D3JA 2Z2ZA 4KLCA 1LJUA 1W36D 3F6RA 4O2RA 3C3KA 4HSEA 2IYEA 4NFYA 3QQ5A 3AP3A 3KWJA 4W1SA 1WMEA 2XGGA 2DBQA 1XLTC 5SY9A 1RYFA 1PQWA 3ZHSA 2XKBA 3OY7A 3DBIA 1THZA 4NS1A 2ATXA 2VUSA 4FMDB 5BN3A 3LTNC 3FY4A 1K92A 2P78A 1WVGA 3HR8A 3X1ZA 2GILA 1BC5A 1E1YA 3I1IA 4RKQA 1N1GA 2VYVA 4Q47A 1RJWA 2QUKA 5AVWA 2ZQ5A 3VSCA 4DTCA 4F7WA 4UEJA 3VKVA 2G76A 2FWAA 4NU6A 3W9BA 3M49A 2VDRB 1HWYA 3KJNA 2H0QA 3GC6A 2A92A 3N28A 4GOMD 4GYKA 4HATA 4JWKA 3A9TA 4PQRA 5D3MA 3UUGA 3ICOA 4ESOA 5KEIA 5LMNB 2C7RA 1VPEA 2O52A 4A2PA 3OVMA 1PGNA 4RXMA 1GVNB 4LW8A 1OVMA 3NEPX 1R6AA 1TKAA 4ZU3A 4ZMBA 5AHXA 1GLNA 4ALJA 1GCGA 1LRKA 4CM1A 2DWUA 1EVYA 4CI0B 4PN7A 2XNKA 1OXSC 2IHZA 2IXDA 2VJYA 3JW8A 2G6BA 4YWHA 4DEXA 1FRZA 1H3FA 1NZFA 1N6NA 2A5GA 3WGQA 1ZU5A 3SHTA 1QXSA 1KO4A 1ZDMA 4FQ7A 2EOAA 4UDXX 4XOUA 4YAWA 3TLAA 2JHCA 1XTBA 1ZVKA 4HDQB 1ONSA 3V7NA 4F1WA 1Q6ZA 5AK3A 5ALWA 1PJAA 1PSDA 4HDCA 1QJCA 2WHRA 4MV5A 3CVXA 3P9RA 4B45A 1G3QA 2YXNA 5ALVA 4NBUA 4NMWA 4J0KA 4RA9B 3J81A 1KAOA 2PAAA 1ODSA 2YOGA 3LL4A 3ZEAA 3NH9A 1UJ2A 1E1NA 3I4LA 3F90A 4W99A 3NBFA 4DILA 3VU8A 4AP6A 4YJ2A 2C3MA 5EWJB 2BFFB 4M36A 2Z4SA 3R75A 1CUWA 2HWUA 4YPFA 3DT6A 3OG9A 5CFZA 3K31A 4ZOLA 3TOCA 2W4MA 3D6MA 1Q44A 5L3ZA 5HJEA 2DE0X 4LZAA 1A98A 1Y8QB 1NTOA 2DLNA 4G85A 4KE9A 3UA3A 3RC8A 1XZJA 2CLHB 3EUAA 4IOKA 4CG3A 4L73A 5EY5B 3DEIA 3RIEA 3MK31 4NZPA 4P83A 5FUYA 4TKUA 4RZ2A 2H08A 1AUPA 2EW8A 2PL5A 4FHEA 3NVMB 1PQ4A 2YXEA 3IJEB 4BLWA 4D9KA 5CA1F 1V25A 4XPIA 5HQ3A 1LV8A 1MJFA 2G88A 3EFHA 2WAMA 1YVDA 5CJ2A 2BJVA 4G4GA 5FYQA 3DVRX 1I1OA 4HX2A 5JC8A 2F67A 4KRFA 1NF2A 1RI1A 1J0AA 1UQRA 2HY7A 2Y6UA 4QDKA 4R05A 2GAOA 3WSWA 5FNVB 5JHHB 2Q9UA 1BO6A 3K32A 5K0GA 2DUWA 1O95C 1T0HB 3MQ4A 3QW2A 1D7AA 3QW4B 1RWQA 3FNFA 2QROA 4NAVA 3SLRA 3RUEA 5ITZA 4G07A 4D9IA 1M5UA 2H1RA 5LBTA 4AMVA 2XMDA 3KXLA 4EFDA 4L3WA 1CFZA 2P62A 4RDHA 3COVA 4XWYA 3SG0A 3ZGXA 1DWPA 4K5QA 1KZ9A 3JQRA 1Y34E 2B7BA 4B2PA 1KGDA 2R8OA 5IW8A 1FP1D 2XB2A 2WMYA 4I3HA 1SVOA 3DBHB 1G8YA 2VJBA 3CLUC 3GMSA 4I5DA 1QC5A 4QU9A 4X0EA 4BMNA 3ZWWA 4J1QA 1FYXA 2NW6A 3VM6A 4NMHA 4A6XA 3HJFA 3JASA 2VTBA 2AYYA 1CD5A 1EFPA 4DLXA 1MXHA 1YKSA 3NYWA 4WFJA 1T2CA 3D6VA 4ZP1A 1Q83A 2WAYA 4XLZA 1MOZA 5FA8A 2CDBA 2AC4A 5IM4F 5LQCA 4UM9D 3NH6A 2QTGA 1GGHA 3IBFA 4N5IX 3FOWA 4XGIA 3OKCA 1GPJA 1M1ZA 1BFUA 5KIAA 1THGA 3T95A 3W5VA 1RQLA 4Y2QA 3ZY4A 1W5SA 3OMLA 3FWPA 4RJJA 2O6HA 2W98A 1SH7A 3ELDA 4QUAA 2DUMA 1X1DA 4FFBA 1NX6A 1W76A 1U2EA 3R8FA 1ULAA 1NLFA 2QP4A 4PC1A 4UMEA 5GM1A 2C31A 3HA7A 2LD4A 1G5FA 3KTDA 4EHLA 4KPFC 2OGZA 3T41A 2P9YA 1DKUA 1PCXA 1IYZA 2D2FA 2RB4A 2R6FA 1NW5A 3HPRA 4IZ6A 1V35A 4B8YA 4FUTA 2EFYA 2ZKLA 3T1OA 1TECE 1E1RA 2FPSA 4E51A 3NOQA 3PUJA 1UF9A 3G9QA 1XBTA 2ZUEA 2ZJAA 3OPXA 3QWFA 4AJKA 4DUYB 4AKEA 1WOYA 5KTNA 2FKNA 5AUPB 4XDGA 4M6WB 1E5QA 1F2UA 2RH4A 3V2GA 4QM6A 3SX0A 4ZCRA 4AZ3B 3SYMA 1Z2PX 3ADCA 4KQHA 5IBQA 4EVIA 1UH5A 4EH1A 4DIBA 5IWAB 3D0OA 1Z2AA 2AMLA 2QGZA 5CB6A 3KQSA 4FW9A 4RDIA 4GWLA 1YS6A 2JGDA 4V0MA 1V71A 3S28A 4B1FA 4BUJA 4CKWA 4UNPA 2RGUA 3O3CA 3EVAA 3OZTA 1IUKA 4X6XA 2GZAA 3LFUA 4D41A 3T6KA 3P9PA 2GBGA 3KQTA 3OLQA 1TYEB 2PLNA 4HUQA 1GDTA 4C5CA 4OBWA 1IQUA 3KPUA 4MP3A 4RFSB 4EZBA 1S3GA 3D8NA 3U3DA 2G6TA 1DQZA 2CBXA 2PQMA 2M6KA 5K0EA 3N53A 2G06A 4GQIA 3KKPA 4OAPA 4UM8B 2OB2A 4YJKA 4LC1A 5LB2A 4UUOA 1WBJB 1VIYA 2AFIB 3DM5A 4Q4JB 4ZYTA 3UMBA 5CDSA 3RG8A 5TGZA 4DC0A 2J32A 1WWKA 6AT1A 1ZSYA 2PANA 1TAUA 2ODBA 2R7KA 1RYDA 3NP9A 4MRVA 3U7JA 3W7BA 1VG0B 4C4YA 2WHPB 3H5IA 2VSNA 3W2IA 1I7QB 4C0BA 4MUAA 4MHOA 2FSVA 1O8BA 1DWUA 3BQMB 3TVDA 1LPMA 2WIAA 3FB4A 2XNDD 2G0AA 3DZCA 4W9RA 2I78A 4CQMA 3PI7A 5CVVA 2PH7A 5BNFA 2SCUB 3OA0A 1J25A 2BM1A 5LJLA 3GP5A 2GCEA 2DM6A 2B34A 4ISCA 3A14A 1CY2A 4YGXB 3WB1A 3N0RA 3ROEA 1NI5A 2WM2A 4MH0R 4AFNA 1C9NA 3CF4G 1KPGA 2QD5A 3EYAA 1E2KA 5BVGA 3RTBA 1RMQA 1R12A 3AKYA 3TX2A 1C9DB 5ALLA 3SCZA 4UEWA 1WZIA 5DB4A 1ESMA 1E4EA 1MR3F 3F5MA 2OYCA 1CVLA 3PQ2A 1Y5LA 1LLDA 2XYPA 1T34A 4J16C 4PX2A 4W5WA 4JP1A 4JEHA 2WFLA 3ZNNA 3CZ4A 4KR0A 3ZZMA 3D4BA 1EI9A 3IIEA 2NIPA 3B52X 1JXAA 1MG5A 2I03A 4HSGA 4ID9A 1W19A 2WT4A 3WK5A 1WZNA 3F5SA 2ATIA 3BWCA 3NXKA 2ODQA 3I83A 3KZCA 1L4KA 4J2OA 4P8RA 5H59A 2BEVB 2O7VA 2NAPA 2AMFA 2BR5A 1B15A 4U39A 1PWXA 1SUAA 2VAXA 4PG8A 2Z2YA 2X6QA 2CWWA 3IVCA 4GR4A 1EK0A 4NQRA 1IJKA 1M6VA 3I5UA 1MC5A 1C4OA 1F9AA 2IPXA 4NWIA 2IUUA 3BGOS 3WQHA 1I0ZA 1NPDA 4BVHA 5DGTA 1UP7A 3PS9A 5K3CA 1DO2A 1DPFA 1XF1A 1VJTA 4ZCTA 1BDHA 2DG2A 2P0AA 3CU5A 3HDHA 1WVIA 4A8JB 1JHQA 3PD1A 3EMDA 3VKGA 1IMJA 1ZCFA 4DMMA 4RTOA 4IFTA 5JJ5A 4RORA 1LXCA 5BW6B 2C7BA 1A97A 1B4DA 3G3EA 4UE2A 1C29B 1K3TA 1K6MA 4UUNA 3UMGA 4BCDA 4EB8A 3QH4A 3D02A 1IZ0A 1MO3A 4ETNA 4MP8A 1A8HA 2VYCA 4D8TA 3GN1A 4JL5A 1GZUA 3JXEA 1MF7A 4F4FA 4KPUA 3PUIA 2GXSA 3FSEA 2IPOA 2QYSA 4LDAA 4S3MA 4X7MA 3PFHA 4Y2SA 1OAOC 5HTKA 2C2KA 2OHHA 4ZVOA 4KR6A 3HCWA 1XWWA 4Y0AA 3GFRA 1M0TA 2OO3A 3DL2A 1KRXA 1W0JA 4ZPXA 4UVGA 3K7EA 5A3VA 4BO2A 3TLJA 1KEEB 3HU3A 3R5TA 5FPSA 4H59A 5JD3A 1OZHA 3B1FA 2A1TS 1JKFA 1ECCA 2H2DA 2LCFA 1G9SA 2YMPA 5TGDA 3V3KA 5BSKA 1I01A 2XBLA 2CUTA 3T06B 3VJLA 3E9MA 4IV0A 1NUSA 1JWLA 4CUJA 3SBDA 5J4LA 2QRHA 4QUKA 1KHTA 3ZGNA 4EMUA 2FWBA 4F9EA 2ZZMA 1OZFA 3A3NA 4GNRA 1QLJA 3MA0A 3BRWD 4J7AA 3Q8LA 1Y6FA 3HCPA 1DRVA 1XCPA 3A1TA 2CK3D 5JR3A 2FF7A 1JP7A 1LBIA 2J5XA 2BGTA 5A6SB 1M2WA 1Q20A 4JYMA 5HZGA 2C2XA 2X8JA 5JHGB 4FIDA 3VC7A 1P75A 3R7NA 4CMAA 3R4VA 1MABB 1GV1A 4WACA 4O4IA 1WTCA 1YUMA 3ZHOA 3OZUA 4LPSA 1RCFA 3A1DA 4II7A 1YJAA 2DR2A 1S02A