3AKCA

Crystal structure of cmp kinase in complex with cdp and adp from thermus thermophilus hb8
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cytidylate kinase
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 78
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akcA00
4RZUA 1AN0A 1WQ1R 2MSCB 4YDHB 4YMSA 3HU2A 2YHSA 1KKLA 1P7CA 3W90A 3GCGA 4KAXA 3OFNA 2QE7A 1PJRA 3QF7A 2WZQA 1GFIA 1WRBA 4RCZA 4ZCIA 4PO8A 1DELA 3GJ4A 2BMDA 1KIMA 1BKDR 4KYUA 4P4UA 1F5NA 1W36D 4DSOA 4A0GA 1XEXB 1U81A 1XTJA 3FMFA 4CEJA 2PCLA 4KBFA 2Q6TA 4MITA 3U3MA 2F7SA 3P32A 2QQ0A 4IHQA 4JSTA 4L15A 4AI6A 2V54A 2CHVA 2VHJA 5BQ5A 1F48A 4K81B 5FPKA 1U0HC 3AH8A 2O8FA 1BO6A 2GF9A 3B8HA 4NU0A 3BH0A 3UKDA 2BKEA 4TMKA 1GG2A 2XJ9A 1NKSA 1ZUHA 3DOFA 3EZ9A 2X1VA 4WBSA 4LGMA 3CBQA 4NONA 2FJUA 4YDSA 2A2ZA 2CJWB 3D3QA 5EUQB 5JS7A 4DJTA 2GK7A 3QNUA 4ON9A 1MRNA 2IYSA 3UATA 1XCGB 5GJWC 4LJAA 5IK2D 3IO5A 3B1XA 2X2EA 1FP7A 4IRUB 4A8JA 2V1UA 2YC2C 1NP6A 4MGZR 1G9XA 1ZM7A 4URUR 2WWXA 3SDZA 3V9PA 1UKZA 1NSFA 2REXB 2VHTA 1E9SA 2ZS7A 4CIDA 4LK2A 3LW8A 3QXJA 2ZI4A 2O8CA 3VAAA 2DWPA 2GAOA 2QM7A 3TSOA 3AVQA 3FPAA 4TQUS 5DGXA 3GFTA 3LNCA 1XNJA 3SFVA 5D3MA 5JI2E 1WMSA 3CUEF 3FKQA 1KMHA 5CM8B 5DHFA 4YMVA 3BAFA 5BWMA 1G5PA 3U7GA 2H5EA 2ZE7A 4ACBA 1YZNA 1WBBA 2I3BA 2JJ1A 5BN3A 3L8ZA 2P2LA 5TY0A 1PZNA 2XTNA 2JATA 3AVPA 2D74A 1S3SA 1E0SA 5EP3A 1D8TA 3TMKA 2QP9X 4PO9A 5EXSA 4BASA 3FOZA 3LO5A 2V1XA 3K9LA 4XWAA 3U44A 2GCNA 2QZ4A 2JLVA 4ERNA 2Y8EA 2PT5A 4Q02A 1KSHA 3U4QA 3LWNA 5DI9A 2ATXA 2OCBA 4URVR 2DFKB 5JSZA 3NC0C 2ZI3A 2IS2A 1N6NA 1WF3A 2DCUA 3A4MA 4GI7A 2ZE8A 3H0KA 1W1WA 2JLYA 2AR7A 3CRRA 2YV5A 3GEHA 4D4LA 1GVNB 1VYVA 4UNRA 721PA 2RMKA 2EYQA 2ZUDA 2ZRJA 1U9IA 3CRVA 1T6NA 1Z3IX 3QG5A 4LRWA 1E2JA 2JGNA 3J81k 1T9HA 2E9SA 2Z5FA 3KB1A 5CIWA 5KPJA 1NNEA 2CLSA 2IHYA 1XXHB 1T3SA 2H1LA 3QJYA 4JLAA 4US2R 2BJVA 1YR8A 2YZ2A 2ZRMA 2ZYWX 4HUQA 4BLSA 2UVQA 2NIPA 3BD9A 3ADBA 2C99A 2JJ2D 2VA8A 4WXPA 2GVZC 3RABA 4EFNA 3X1DA 4I99A 2N1BA 3ZH9B 4GP6A 1SXJE 1IXRC 4MYUA 1EFCA 5DSZA 4B3GA 2QMOA 2PT7A 1UJ2A 2V55B 4R98A 4UJ5A 1FQJA 4EPRA 1TNDA 3VU9A 2J41A 3N5CA 4OQLA 4CEIA 4OL0A 4C0BA 2IK8A 3U3RA 1LTQA 4JVSB 2OHFA 1P60A 3ZVLA 2ZSEA 4AKIA 1FOEB 1SXJD 1EWQA 4NCHA 4B48A 2EFHB 4C0KA 3OESA 4LHVA 3TGPA 2XZLA 4WOPA 1UKVY 4CEJB 1W49A 2OESA 4NYMQ 4R71A 4UJ3A 4KODA 2QGNA 1J7KA 1DAMA 5H70A 3UPUA 4MKGA 2O8FB 2VP6A 3Q5EA 2Q9CA 3OEEA 5FOUA 4F92B 1X3SA 3T1TA 3U6KA 1NVWQ 1Z22A 2G0NA 2LKCA 4Q01A 4W9MC 1I2DA 1XMVA 1G6OA 2IHBA 3GPLA 2BIFA 3BS4A 2IXGA 1Z07A 2ZR0A 3X1WA 3IDQA 3OAAA 5BN5A 3LQRA 4EJSC 3LD9A 3QPVA 3CZQA 1JAHA 2C03A 2GZHA 1KZGB 4A8JB 3EWAA 4QJ4A 3SJZA 1Q20A 4TLCA 1KI6A 2BKUA 1Z63A 5KO2A 2BV3A 2ZU6A 1G3UA 1DEKA 3R9WA 1DG1G 2D7CA 3AB3A 1KI8A 2W58A 1UADA 4CYMA 3O8CA 1R10A 1G7CA 3TSWA 2QT1A 4II7A 4C9BA 1QHIA 3WNDA 5C4MA 5C18A 5ELXA 2BDTA 1E98A 3HJNA 5IF9A 2OEPA 4QJ3A 3CRQA 5D3MB 4QBIA 1KZ7B 4DCSA 1X1RA 4DRZA 1NLYA 4URXR 3W6OA 3IIKA 4JS0A 3KJGA 1KMHB 4F4JA 3T5GA 1BMFD 1MO6A 1DAGA 1JQJC 4EPTA 5BXQC 1FPMA 1ZW6A 4G5GA 4YXWD 1SHZA 2JLWA 1Z6XA 4KO8A 4Z8XA 1H8ED 1RRFA 1DAFA 1T3HA 2O0HA 1ODFA 3OIVA 4BLRA 1N6KA 3QUSA 5B58C 2W6IA 3DM5A 3U44B 4P4SA 3U4QB 3CM0A 3MWLA 4JSYA 2QAGC 3L82B 3M6AA 3KFXA 4Q1CA 2CE2X 2QRZA 4WZAE 1D9ZA 4HAXA 2QP4A 4CEHA 2LCFA 2EWVA 1KAOA 1Z2CA 4B74A 4DDTA 5HKKD 3AF4A 3WRYC 5B64A 3GEIA 1CR2A 1JJVA 4LJ6A 4QGGA 4E5UA 2ZS8A 5KUTA 3U3OA 2I1QA 1Q3TA 4B2LA 4Z51A 3R8FA 4PQYA 5EQTA 1ZAKA 2WJGA 3DVLA 3TR5A 1D6JA 3AP1A 1QHXA 4LX0A 1F3OA 2JIZD 4HATA 4HLQB 3K0FA 2EW1A 2F43A 4LUCA 1MOZA 1M7HA 3R8CA 1X8KA 3M4YA 2VSOA 2ZRKA 1YJ5A 4BZXA 4GOKA 3A1VA 3GLFB 4P0TA 3VMFA 1KO5A 4OHWA 5AUQA 1F60A 2PBRA 2H17A 3K9GA 4Q00A 4F4IA 1Q21A 621PA 3C5CA 1JB1A 2CK3A 4ITRC 2FX3A 5LD2B 4B2IA 2OSBA 1OH8A 3RVBA 3GJ0A 121PA 3B60A 2OFWA 2BVNA 3CX7A 1IONA 4JLOA 4P31A 4YMUA 3I32A 1XXHE 2XNSA 4KLNA 2YWFA 1JEDA 3RLFA 5FUVA 4PANA 3T5DA 3SHWA 1FFHA 4DKXA 1E9CA 3B13B 4ZI2A 2XAUA 3A1TA 2CCGA 3IKJA 1TQ4A 3A58B 4U02A 1DOAA 4D0GA 3P27A 2WIBA 3RS2A 3AKYA 1L8QA 1COWD 4TQAA 1ESNA 2IYXA 2W2XA 4M4SA 4NL4H 1II9A 3R9IA 1HYQA 4D82A 2Q3FA 3OZXA 3HDTA 4Z1MD 3O8DA 2ZR9A 5KSOA 4FXPA 1ETUA 1GAJA 1QRAA 1KSFX 2X77A 4NYMR 4WAUA 4F4CA 3FGNA 1GM5A 1OXSC 5L3RA 1KI4A 2BOVA 2Z83A 4O2LA 4GBMA 5G3ZA 5AUNB 5DIFA 5DISB 5BYJA 5GADl 5CIQA 5EE5B 1PLKA 2MMGA 4H1UA 1E2HA 5FL3A 4RD3A 4AURA 3P20A 5FPYA 3NWJA 4KBGA 3RS5A 3VX4A 1T3LA 3OFND 2QE7D 2HXSA 3TKLA 1GRRA 4Q4AB 1I4DD 5IK2A 2Q21A 1K8RA 4AIIA 1WDTA 4PZLA 2Z6VA 1SVIA 5EZ5A 4B32A 4TWZA 4GNKA 1KI6B 4MRRA 4Q1FA 5ANRB 5SZJA 3UMSA 1GRNA 5E7MA 4PPQA 2ODBA 1P75A 2J7PA 1R0XA 3H84A 3KQKA 3EPHA 3PEVA 1Z5ZA 1KKMA 4B2PA 3PUWA 1RFLA 4RZ2A 4BLPA 3ZS9A 4L9SA 2EVWX 2FFHA 1O87A 4A4DA 1FNNA 5J4LA 2EYUA 1NJGA 2F55A 1Q1EA 4UXJA 3IO3A 2CHGA 2ODWA 4IOJA 2ATVA 4IW3B 5B57C 1B0UA 1M7GA 2C2HA 3A1SA 3U6BA 2A78A 1E9BA 4PFSA 2O8BB 2HLDD 3T06B 1MO4A 1W4AA 1CS4C 4NKRA 2ZI7A 1EGAA 4B76A 1ONBA 3BH6A 4P4SB 1EWRA 4Z54A 2F9MA 1SKYB 2F1IA 1Z08A 3GLHE 4PX9A 2Z0MA 4JJZA 1DAEA 1EFHA 4OJQA 3NBXX 1QHGA 2RGDA 2K5UA 3W3AA 4OYHA 3WYGA 1LS6A 4WZ6A 5JRZA 1UBEA 3MLEA 4LYAA 2DFNA 4FCVA 3K0EA 3ZS8A 1YZUA 2PLFA 1G3QA 5K8LA 1P6XA 2J0SA 3L2OB 1RRGA 1FUKA 4AG6A 2Z43A 3LDAA 2F1RA 3DL0A 1IN4A 5L3QB 3QPUA 3NKVA 3K0FB 2F43B 1G3MA 4POAA 3BORA 2IUUA 4OK5A 1ELOA 2JJ1D 4O2RA 1NL3A 1HUQA 3IIJA 1TEVA 3B9PA 1SULA 1K5GA 2GK6A 2W6JA 1ZP6A 2FZLA 3UXMA 1AKYA 2ZRDA 4RFSA 4Q21A 4EFLA 4Q7LA 2GXQA 1S0UA 3TUZC 1DAIA 1UDWA 2BBWA 2ZSFA 3CNOA 4Q5IA 1TQDA 5SZIA 1W48A 3KXLA 3W8NA 4JMPA 4AKHA 4PSVA 4A92A 2WPDA 4IFEA 3AF2A 4AC9A 2FMXA 3K70C 4KJZA 4BFYA 4F93B 4FW9A 2QBYA 2ZSDA 1E1QA 4PQRA 4D4JA 4URYR 4B34A 2R6AA 2HF8A 4PHGA 4Q03A 1JR6A 1G3IA 5LB4A 5BW8A 3LV8A 2GCOA 4DHEA 1K6MA 1FUUA 1DO2A 4UNPA 2QORA 2F1JA 4JIMA 3S1AA 4DZZA 1NLFA 4G0NA 4LI0A 2B21A 4C0QC 4PSKA 5DYIA 2WHXA 4DLVA 1R4AA 5KHOC 4IXNA 4QFMA 1AZTA 2MSDB 2G3YA 2QI9C 5FBQB 2D2EA 1L2TA 4JKYA 1OXUA 1H65A 3WBJA 3LW7A 4EPVA 2HUPA 4EPYA 3GEEA 3W34A 4AKEA 3ZVRA 2FGKA 4IEEA 3HU3A 3NDBB 2VHQA 4CVNA 3ZQJA 4HLCA 1TUEA 2FEMA 1SVKA 1UFQA 4OI1A 4HB0A 2J1LA 2IEZA 3Q72A 3EC2A 1FMJA 1U2RA 1KNXA 3KB2A 1A2BA 4QGHA 2JJ8A 4R2HA 2ZPTX 1E32A 2FH5B 1UBGA 1IBRA 4GPTA 3LXXA 3WMGA 2G9NA 1E2DA 2ZI5A 1WCV1 2WVJA 4B43A 2PL3A 3MMPA 2BEJA 2FFQA 2B8TA 4QJ5A 3GFPA 4TZ0A 2JCSA 3WNCA 5LDDC 4LYJA 5CITA 4EFMA 3VQTA 5IDVA 3PUYA 1RVDA 3OEED 3SQXA 3SU8A 3I3SR 1J70A 1EXMA 1ZM4A 4B73A 1JAIA 3ZLJA 2NO7A 3LVQE 4CGZA 1W47A 1Y63A 2CJWA 3WP0A 1GNQA 1GIAA 4KSCA 3KQUA 2ERXA 1E9DA 2REBA 5EE9A 1N6LA 3OAAD 4IJMA 2IL1A 2E87A 3BFKA 5KNBA 3RANA 3TW4A 3HYRA 1ZJ6A 1G7RA 2ZE6A 3EPJA 4TMZA 3KUDA 4DSNA 2ZYUX 1VG0B 4IVRA 1G5TA 4NH0A 1ZIOA 2GXSA 2P67A 2AK2A 4JLVA 2P6UA 4TMVA 2J0VA 2RAPA 2EFCB 3KL4A 3FHTA 2OCYC 4EJSA 2FOLA 2PJZA 1R8SA 4Q47A 5FOSA 1R7RA 1ZD1A 2IS1A 3A1WA 4D6PA 5FTLA 1RZ3A 1TU4A 1I4TD 4DBLC 2GHIA 1KK2A 1M8PA 4URWR 1W5TA 1P4SA 4TTQA 3WMFA 3PUVA 1M7BA 4QXAA 2WAYA 3WP1B 3NXSA 2PMDA 1SKYE 4PZYA 1CF4A 2IYUA 4YMTA 1OW3B 5FTKA 4YMWA 4OK3A 3C41J 3EA5A 1XD8A 1XCPA 2RH5A 3DM9B 3KJEA 3K9NA 2A7QA 4OBEA 3L0SA 4N0EA 4MKHA 1UAAA 2BBOA 3GQBA 2GZDA 3PJRA 2EU8A 1QVRA 2XITA 4I1SA 2W6ID 4NCJA 3IGFA 4QHSA 5LBIA 2ZJZA 1S1CA 1NY5A 4HAYA 4LV6A 4GMXA 4G1UC 3VR1A 4A0RA 1TQ6A 5FTNA 2ORVA 2QA5A 3DO6A 1CJMA 1BOFA 2G88A 2HXYA 4FWIB 2BMFA 3SI7A 3CPEA 2ODNA 4M53A 5CJ2A 2QBYB 5GVSA 3P4XA 2J0UA 4Q9JA 3AVXA 2VSXA 4B3XA 2JLXA 5AUOB 3K0AA 5M04A 1GDDA 3T15A 2V4ZA 3RS0A 5FBRB 4EQ6B 1E4VA 1YZKA 5EP1A 4MDFA 4N3NA 3Q9LA 2GCOB 4HLUA 3SR0A 5FOXA 4YQFA 2CNWA 3I61A 4Z1MA 5BN4A 3S1AB 2WWFA 3NH6A 5FFMA 5KPDA 1ZU5A 3Q5DA 2R9VA 5FPTA 4CT4B 3B9QA 4GT1A 3T1VA 1YQTA 1GL6A 3NC1C 3QOFA 4U00A 3R7WB 2CK3D 5CLQA 4H9GA 4JLJA 4QBHA 1Z0DA 4M1OA 1VHLA 1E94E 1KK0A 1HEIA 3THOA 1YR9A 4V0NA 1QHSA 2MSEB 3C16C 5A4JA 5J4KA 4ACAA 3UG7A 1NRJB 3CZPA 5KOYA 3A4NA 1YHNA 2YJTD 3W3ZB 3QSYA 4TZ6A 1XFAA 2ZAMA 3T12A 1JBKA 2WWWA 4DSUA 4MH0R 5JMTA 4ZCLA 4MRPA 4LV8B 2QQEA 2WKRA 2YOGA 4US0R 2OE2A 4LJ5A 2N46A 4LJ9A 4LJYA 3SC3A 3CH5A 1W44A 5KSPA 3MJRA 1KO7A 5L3VA 2NPFA 1KAGA 4M9XA 4Q4JA 2BCJQ 4Y0AA 1KI2A 1R0YA 2OXCA 4LYFA 3HPRA 2Q9AA 4D81A 3R9XA 1LF5A 1PVOA 3KQHA 4JLBA 3TJZA 2IYYA 3WYAA 4DDUA 2PZGA 1KSJA 2J5XA 3IUYA 2VP4A 3CH4B 2W0SA 4WZBE 1AGPA 2EFDB 4OI2A 3KUCA 3MSXA 1ZYUA 4L5BA 3I4LA 2HLDA 2ZE5A 2QNRA 2BCGY 4LHZA 5SZKB 5DI3A 3CRW1 1QG2A 2CMKA 4NHOA 3AF1A 1ZIPA 5HCIA 2DYKA 2IYWA 2XSZA 2PX3A 3E70C 3KQNA 3DEFA 1L4UA 1TADA 2B6HA 5JS8A 4EJSB 2FGJA 2J7PD 4AKGA 3CF0A 2GILA 2O8BA 4CZ2A 2OAQ1 2OFOA 3TE6A 2PZEA 2VL7A 2XX3A 4KV9A 2REOA 4KFTA 2R6FA 4OQNA 4KITB 4LJ4A 5KSYA 1P2UA 3B7GA 4R2IA 5CJPA 4NMMA 3UANA 3R20A 3KJHA 4WA7A 2WM9B 3GJ3A 3LXRA 3EW9A 1TX4B 5JLJA 1R8QA 1XPUA 1H8HA 4MUBA 2WWGA 1VYTA 2IUSA 4HAWA 2FPMA 5AR1A 4PR0A 2A5JA 4QHTA 2FSFA 2ZRLA 3FFAA 3C15C 1GP2A 4QM6A 2RGGA 2CL0X 2XNDA 5J47A 4GZLA 4WW0A 2ZRPA 4XWKA 5KTYA 5JEDA 3KX2A 2NMVA 2UKDA 4TQ9A 4BFVA 2ZRCA 5KDDA 4V0OA 4KCGA 3AVWA 4M22A 1CBUA 3NG1A 1PLLA 4G01B 4JVNA 4XSHA 1NN0A 2ZETA 2CHQA 3IQXA 3KKMA 3RAPR 2D7DA 1E4YA 1NVVR 1U0LA 2J0UB 1E2EA 2QP3A 3PUZA 3GLIA 1TUIA 3K0AB 4JL5A 1EG7A 2A5FA 2NG1A 2QAGB 4MKIA 4MYHA 4ZV4A 1KY2A 3EZ7A 4R9UC 3BH7A 4KXFB 1NVUQ 1YVDA 1IOZA 3TNFA 3TUIC 4D2IA 1DADA 4O3MA 2NGRA 5GJCA 3THWA 3JVVA 4DCVA 1FTNA 3CPJB 3MJHA 2PJRA 3LLUA 1LF0A 3PCRB 1TEXA 3PIRA 5DO9A 6Q21A 1NMZA 1I4LD 4P4TA 2BWJA 2QPTA 2W6JD 4QNMA 3Q7QA 4IDHA 4LPKA 1NVXQ 1Q12A 2ANCA 4U7DA 2ZYTX 3G82C 4RD1A 2VPPA 3MAAC 3UMRA 3OE7D 5AJZA 3WNBA 4F38A 3TVDA 3LRPA 3QG1A 4JL6A 1W5SA 1GRQA 2BMEA 4DB2A 3ETLA 2WPDD 1SVWA 4V0LA 4B44A 3OHMA 5JHHB 1NMYA 1E1QD 3Q3JB 2VF7A 1DE0A 3D6TB 3DPUA 2WOJA 1NN5A 1XTIA 2IT1A 3MD0A 2RGNC 3OIUA 3QXHA 5FR1A 2ZRNA 2AXNA 3PEUA 4UNQA 2N42A 1P9NA 4US1R 2CLDX 5HCNA 4C0AC 2OLKA 2R44A 1KMQA 3I73A 4Q4JB 1ZRHA 1CEEA 3NH9A 4NTZA 2GESA 1T0HB 4OI4A 4C2UA 2CBZA 2CE7A 3D7MA 4PTLA 1QF9A 4RD6A 2GXAA 3EXAA 4FD2A 1KI3A 2YNMA 4G5QA 3C5HA 4JLDA 2D4HA 1P3JA 2R8RA 1E0JA 3RSOA 4PC2A 2AD1A 2VRWA 3BFXA 4Y0VA 1T5IA 2ZI9A 4NZYA 5GVRA 2P5SA 2P6RA 5FOWA 2A5DA 5DI3B 4Q4AA 4Z8YA 2WKQA 3ICQB 1SQ5A 5FUWA 4A2QA 1ZVQA 2GA8A 2YWEA 5KU1A 3SFZA 1QHNA 3SJAA 4GZMA 4BEJA 4FI3C 4OJKA 1YR6A 1R0WA 1JECA 1E2MA 5F3WB 3EG5A 4RZ3A 3RRNA 4FINA 4FIDA 4DWJA 3SYKA 3CX6A 2ZUCA 1HE8B 4Q19A 4Q9IA 1S8FA 3BK7A 1M1YE 4C0LA 4ZKDA 1E2QA 1ZU4A 1W0JA 4TSFA 1QBKC 3VR3A 2ZITA 4HB2A 1X8LA 2HT1A 2XZPA 1LB1B 1Z0JA 1BIFA 1JEEA 2KBEA 4NCKA 4MGKR 3QKTA 2ERYA 2G77B 4E22A 2IX3A 4TL6A 3L0IB 4M21A 3JZAA 1SVLA 4B6FA 1WA5A 3PENA 4DLTA 5J4YA 2GBLC 3QVVA 3KZ1E 3HR8A 1LNZA 2WWHA 2GZAA 1DAKA 2W83A 4JVMA 4QRHA 2EFEB 4DLSA 2YWHA 4W5HA 2IEYA 2WMOB 1US8A 4TLBA 1SVMA 3NEJA 4KVGA 4X8LA 2BM1A 1JXMA 5F9FA 1EX7A 5EUMA 3TW8B 1LS1A 1E2IA 4BWYA 5L8VA 3E5HA 3QY0A 5FPHA 2XEXA 3GLIB 1MV5A 2AWOA 2HEIA 2W00A 1NG9A 3Q8XB 3EX7C 3BE4A 3BB3A 2YINC 1OH7A 5L3QA 3VTKA 2O0KA 3THWB 1AK2A 1VDZA 1YRBA 4HDOB 4TL8A 1E3MA 4D0NA 2C78A 3RS4A 5HZKA 4IEIA 1NN1A 3BC1A 3I5YA 1QG4A 2H57A 2IF0A 3WXMA 1SKQA 1TF7A 1YZTA 3FKSA 4LC1A 1XEFA 3UMFA 5E3HA 3NHBA 3MFYA 5C1BA 3IQWA 4YONB 5JJLA 4LDJA 4IDPA 1N6PA 4DIEA 4DLXA 1FNMA 1XD9A 2DY1A 2BMJA 5K8UA 3ADKA 3KKOA 3LBIA 3KDSE 1U8AA 3FHOA 5JEEA 2FSGA 1Z6TA 1CP2A 3HP1A 4QM7A 1Q1BA 2HV8A 4NYJQ 5J5CA 4GOJA 1FX0B 1QDEA 1OYYA 2PEZA 4P3YA 4M9QA 4KI0A 3ZQ6A 4LHXA 2BBTA 1ZBDA 3CB4A 1E2KA 3ZZ0A 3NTUA 2CNWD 3QIAA 2B7CA 2NOAA 3K70B 4M1MA 4RCYA 1CTQA 1KYIA 3EIQA 3ZIAA 2BHRA 1II8B 3UWKA 2JLQA 1IHUA 1L4YA 4BRUA 1O3YA 3ZD7A 2AFHE 2FFBA 1TF2A 3SS8A 4BFWA 1KSGA 1RRPA 2GJKA 3KFVA 1R2QA 5C46F 1KHTA 2P0EA 2W2TA 4JLNA 4PAOA 1W4BA 5JZVA 1N5KA 3A1UA 2F6RA 1IY2A 5TVKA 4HSEA 3RHFA 3H1TA 2AKYA 1Z28A 1E69A 3DKVA 3T35A 3AQ4A 4LCBA 2G6BA 3MWKA 4S35A 2NZ8A 1DAHA 2V6IA 1RE0A 3HWSA 4AK9A 2X8AA 4NP6A 2C77A 4HAUA 4Q1BA 1FL9A 3K53A 1J99A 4TL7A 1W2GA 3ZVNA 2C9CA 2LWIA 4RVCA 1TF5A 4A8JC 3IEVA 4D4MA 1FTSA 1SGWA 2ZTSA 5JWRA 4LZZA 2R6CA 3C8UA 4D0LB 2ZM5A 1VMAA 4K46A 1RC8A 3KXKA 3C14C 2QG6A 2QSZA 4J0QA 4JT2A 3W6PA 2FV8A 4L9WA 3G0HA 3X1ZA 1U90A 3FTQA 2OZEA 3MUFA 3EARA 1IJEA 2FSIA 5TDHA 1HH4A 1UF9A 4EKDA 1KY3A 1T0JB 2JDIA 4PPGA 3F8TA 1VCIA 1FW6A 1XPRA 3RC3A 1F6BA 4N1AA 1XTRA 2XJ4A 4GL2A 1P2VA 4EPXA 1LY1A 3UK6A 1NG1A 2VIIA 5DE3A 2FNAA 1KO4A 4FCTA 4V0KA 1VG8A 1ZM2A 2V7QA 2RHDA 2GEDA 1N6HA 1GKYA 2XSZD 3CIOA 2QGZA 1US8B 1KK1A 4ESHA 4C7OA 221PA 1OFIA 2MMCA 3RC8A 3BXZA 4TL9A 1K5DA 3EASA 1XJCA 2LKDA 5AJWA 3PUXA 4HUTA 4JT4A 2VF8A 1XX6A 2OO7A 3AKCA 3ONWA 1E0KA 3VKWA 5EP4A 1ZNZA 1E2LA 4I81A 2WOOA 1HA3A 4IOKA 1E9FA 3DMDA 1M6NA 4M2LA 2OCPA 1XTQA 3FFBA 2ZXUA 1ZM9A 3GLFA 1VECA 1KDOA 2GKSA 1VCNA 1E9RA 4DEYA 1U9IC 4NBSA 1D2EA 2IS6A 1QVAA 1VG1A 3B5JA 4AD8A 4DIDA 1H8HD 3CW2A 1Z0KA 1EFRA 2ANBA 2JAQA 3FYHA 2ORIA 4C2TA 2IXFA 4V03A 5JJKA 4RFVA 2FN4A 5EP2A 3LAWA 1IAQA 2V9PA 3GLIE 5TMPA 2O5VA 1GNRA 2XNDD 2WV9A 1AS3A 2IBMA 2YC4C 3QI2A 4PPFA 2GJSA 3OE7A 1M2OB 1RYFA 5FOTA 1XMIA 3SZRA 3AGQA 4B3BA 1KI1A 3DMNA 3JZMA 2F3RA 1D2MA 3I92A 3PG5A 4TYPA 2DPXA 4C3ZA 2DBYA 4GFDA 4R7ZA 2GEUA 2NO0A 3M1IA 4FMCF 1Z6AA 3H86A 4DCTA 5FBLB 2BC9A 5CB6A 2IYVA 1G4UR 4EQ6A 1XDBA 1AA9A 4NYJR 4TYNA 3U3JA 1OIXA 2ZRBA 3Q7PA 3A37A 4Q7KA 1G3RA 3B1VA 3AF3A 3PVSA 4B71A 2FE4A 1GSIA 4C0HA 4M1SA 3FWYA 3QEJA 5J40A 4F7WA 1G64A 1OHHA 3R7WA 3GJ6A 4XWOA 5JCZA 1IN6A 3VKGA 4KFSA 4EPWA 2QENA 4LY6A 1IN8A 1NJFA 4B35A 5EJEA 4ARZA 2NZJA 1WP9A 5G40A 3SOPA 2GETA 3BB1A 2FDCA 4TMTA 1E2NA 5AK0A 2CVFA 2SHKA 1DVRA 3X1YA 4O0MA 2J87A 1JI0A 4JBYA 3V00A 2QUZA 1ZNWA 4G5SA 4Q1AA 1HQYE 1YZGA 3BBPA 5TARA 3QQ5A 1E9EA 1Z2AA 2B8WA 2A3RA 4BFUA 1DG3A 1LV7A 4I1OA 1NI3A 421PA 2R65A 4LBYA 4GDFA 2R62A 5JJIA 1OSNA 4GSYA 2CCKA 1S96A 1WXQA 5J4HA 4RJLA 1N5IA 2BM0A 2J3EA 3CRMA 1EESA 4XIGS 4MKFA 3K70D 2WBLC 3ZJYA 5JCPA 1NF3A 1ZUNB 3DOEA 1E0AA 2ZROA 2RGBA 1NSTA 4ESVA 1IN5A 2RGNA 5EE3A 2Z4RA 1JPJA 2Q9BA 1Q22A 3VX3A 3A4LA 3LBNA 2WJVA 4LHWA 1TAGA 1WBDA 2XTZA 4ASUA 4LYHA 3CKLA 4C4PA 4Q4HA 1JR3A 521PA 1JXOA 4XH9B 1NMXA 5G41A 1Q1QA 4BE7B 2D62A 1R5OA 3TSZA 4CT5A 4TYQA 1TL7C 3F0TA 3TAHA 4M9SA 1OB2A 3WHLA 3K9HA 4C7OB 4TYWA 2O8DA 4LSGA 1P73A 4C30A 3EIHA 5FL7A 3IBYA 3B1ZA 1RPZA 2D3WA 1UBCA 3FHCB 2ZAOA 5HZHA 4B3CA 5EXXA 3C4JA 1UDXA 1MT0A 3KTAA 4M1WA 2OXRA 2AD5A 1W0JD 4TSFD 1YZLA 4BRWA 2PMKA 1U8ZA 2JA1A 5G3YA 3ZGXA 4E03A 2UZ3A 5DN6A 5FPSA 1VYUA 5C2JB 3OEHA 2GAAA 3FB4A 1KJZA 3NDPA 1XJ0A 2ZRGA 3AP3A 1AKEA 1XZPA 4FMDF 4L8GA 4Q1EA 4TT3A 4PC7A 1EK0A 1XBTA 5CB8A 5A0FA 4BZQA 4A36A 1N6IA 1IJFA 3CF2A 4MRVA 2OUKA 4TMWA 4Q9HA 1D2NA 2P3SA 3IBGA 1E9AA 4FWTA 3MWJA 1T5LA 1TPZA 1XF9A 3AVYA 2B7BA 4UQOA 4JKIA 1P9WA 3IHLA 3CX8A 2XZOA 1F2TA 2GNOA 1BS1A 3NHAA 2WICA 5GJVC 3WYFA 3QBVA 3RDPA 3EIEA 1HV8A 1R5BA 3U7EB 4ZKEA 4XVQA 1ZC3A 2AHOA 3RS7A 4DB4A 2GBLA 4TLAA 3DKPA 3KKPA 1P2TA 3O47A 4QGAA 4DLYA 5FI1B 4JLKA 4MGIR 5KNCA 1G291 2QU8A 5EXTA 1IY1A 4OQMA 5JI3E 2DWOA 2G1KA 2QAGA 4IDNA 3ZD6A 4DDVA 3SYLA 2Q3HA 1CR1A 4DC9A 1S4QA 2VEDA 2AWNA 2R6GA 2GTPA 3K09C 2ZJ8A 3KJIA 3N2IA 2RGEA 3RS3A 3MG9A 2P65A 1E2FA 3QPWA 4DLRA 3MGCA 4QKQA 1W36C 4GP7A 1ZUIA 4ILEA 4OHYA 4KU4A 1IQPA 2E1RA 4BLOA 3EPLA 3AV0B 1II0A 2WMNB 4OQFA 1IY0A 1OXTA 2YOFA 3ZDQA 3T34A 3FKSD 2KSQA 1D5CA 1Q1ZA 2PH1A 4BFZA 1XMJA 1CRQA 1KDPA 4BUJA 2PZFA 1KI7A 5D3QA 1NLZA 3TUJC 1AIPA 4ARZB 2OBMA 2G83A 1OJLA 2KB0A 2AK3A 2QTFA 2RGCA 3PXGA 1FQKA 3U2QA 1G8PA 4OK6A 1CIPA 4HDCA 3NBYC 5FTJA 3ASZA 3TVTA 2IC5A 3K1JA 1N0UA 3GJ5A 2VHUA 4MQBA 1A1VA 5HTKA 4HAVA 4G5RA 2GCPA 5HR5A 3VR5A 4BECA 2HYDA 3EAQA 1RW4A 4H1VA 1L7VC 3NIBA 3B82A 4NE2A 1J8MF 3WMEA 4IOLA 3UG6A 2B92A 1W4RA 2CXXA 2ZIAA 3AVOA 1V5WA 3P4YA 4OKSA 3ZIAD 4ZIRA 2IWHA 2VTKA 1GNPA 2ZU0C 2IYLD 3AP2A 2KI5A 1TTTA 3IEUA 4QHYA 3HU1A 3OIYA 2JEOA 3B2EA 4GRAA 3VHLB 3EZFA 3PQCA 3GLGA 1N2CE 2R2AA 4CDGA 1DBSA 4LHYA 1G8HA 1M34E 3ND8A 4CW7A 4LV5B 3K8YA 4Q4HB 3BERA 3SYNA 2H18A 3THXA 1XU4A 1OB5A 4JJKA 3E2IA 1A7JA 3SNHA 2RGXA 4OQXA 2FWRA 1CR4A 2JLZA 1VG9B 3I1FA 1W0KA 2IYZA 3IPXA 3K0CC 2NTYC 4E09A 1B23P 2O8DB 3GFOA 3V4FA 4V0MA 2CLCX 2QTHA 2FZ4A 3ZVMA 1KJYA 1VKJA 1XMSA 1G19A 3GP8A 3KTAB 4PHFA 1AM4D 2O8EA 2FA9A 3ASYA 2V3CC 2XB2A 1FP6A 4KSBA 2JLSA 3AKDA 2ORWA 2ZJOA 5F2EA 4LC0A 2VHCA 5GJBA 3CNLA 2JDID 1XB2A 2GJ9A 3U61B 2EQBA 2WJJA 1RJ9A 1OKKA 3CR7A 3EA0A 3LLMA 1CKEA 3RRYA 3LH5A 4DLUA 3UIEA 4ZDIA 2H16A 5EE1A 1OXXK 1EX6A 4XVUA 5K8TA 1P9RA 1Q57A 3GLHA 4AYWA 1F2TB 1HT1E 2AXPA 2CCJA 2V7QD 3Q85A 4KLZA 3IILA 3CR8A 2CL6X 2ZRFA 2FF7A 1GL7A 3H2YA 3IPYA 4P32A 3L8YA 3FMIA 4C0JA 3VNVA 3GLFE 3TQFA 1P2SA 3AUYA 2VP0A 5FI0B 2PX0A 1QHHB 2VP5A 3REFA 2VQSA 3WRXC 2ZUBA 5FTMA 3U7FB 2KBFA 4PHTA 2GJAA 2OM2A 1CXZA 4D80A 2AFIE 1Z6YA 1SXJC 4KFRA 1Z83A 4BEBA 1C1YA 1GWNA 3CO5A 1AZSC 2J9RA 2RGAA 4BPBA 4NDZA 3AM1A 1AQYA 5CK5A 1BH2A 3M0EA 1EFRD 3DZ8A 1CJUC 3LY5A 1KGDA 1OPXA 2FU5C 1OF1A 1YU9A 2DFLA 2YWGA 3O8BA 4HI0E 5E4FA 4CRWB 2IWRA 1RKBA 4HZIA 4IDOA 1DO0A 1S2MA 3L0PA 1RIFA 3EWSA 3FVQA 3ADDA 1NBMA 1LW7A 4TMXA 4B47A 4I4LA 4LBWA 4QGFA 2ZJBA 4X8OA 4Q9KA 5TV2A 1F2UB 4JL8A 2XGJA 2FPLA 1HY3A 1N25A 2QMUA 5FH9A 1XTKA 4DT1A 2XXAA 2X19A 1MR3F 1EFTA 2OBNA 1G7SA 4TN1A 3I8SA 4M1YA 3B6EA 4TLDA 3B1YA 3MWYW 5HPYB 5DYGA 1FX0A 1CJVC 1N6RA 1XCMA 1MH1A 1A2KC 2KWIA 5DH9A 1E96A 2OLJA 2ZYVX 1ZNYA 1E2GA 3QVUA 4ZI3A 4UXHA 1VIAA 3D31A 4DXAA 1OLOA 5CM9C 5P21A 4A1FA 3VFDA 1A5TA 4HEJA 1II8A 4LJ8A 1PLJA 4ZIRB 1G21E 5AWFC 1GL9B 1I2MA 1DS6A 5FUXA 3OIWA 4WXRA 4IFBA 3W6NA 1YZQA 1E79A 2ZRAA 1NIJA 3SJCA 2WSSA 4PAQA 1E1RA 1G41A 2PEYA 1OHHD 2RHMA 5EXPA 4XTCS 3EC1A 4DCUA 3GLGB 3LFUA 4Q48A 4LBVA 3LA6A 2ZVPX 3AKEA 2ZVQX 3THXB 4Q7JB 4N0DA 1GOTA 1PUJA 2I1VB 3LBHA 4A15A 1YKSA 1ZC4A 4UXIA 4XVRA 5FOVA 1AQUA 4GMDA 3GJXC 3QKRA 1G8YA 5L3SA 2ECKA 5H1YA 3T61A 4HYYA 2KJQA 4XJXA 5H68A 3VR6A 1KO1A 1ZM3A 3QF4A 2C9OA 3MRSA 1KNQA 4BZPA 4MA4A 2ZR7A 3THYA 2QY9A 1UEJA 4DUGD 5H8WA 2O8EB 1IXSB 3AF0A 4XD7A 1IXZA 1J90A 3WY9A 1JR3E 4XSGA 2CDNA 4C0SA 3B85A 3OF5A 4Q7MB 1JNYA 4EDHA 2HT6A 5FBVB 2P6NA 1RRCA 1S3GA 2ZREA 4OI0A 4W5WA 3BGWA 3CWQA 4GOXA 4OHVA 4M9ZA 3I8XA 1FZQA 1UKEA 1KTVA 3GD7A 1RJ9B 1IN7A 1V43A 2ONKA 5E95A 4W5JA 3CPHA 5DLQC 4ASUD 1OH6A 2O8CB 3AGPA 1E2PA 2ZS9A 5DNYB 2CL7X 1JR3D 2ZJ5A 3L0OA 3U5ZB 2ONJA 2A5YB 4IVPA 5CDFA 5TXGA 4D25A 3RSLA 3GLHB 4NCIA 3QXSA 4MRNA 1JPNA 5JHGB 4G5OA 3T1QA 3QXXA 1ZNXA 4URZR 2VH5R 2WTUA 5IT5A 5FL7D 2JASA 3KXIA 2CEAA 4ZDKA 2Z4SA 3VNUA 1U99A 2KE5A 3PEWA 2D2FA 1G5RA 1J2JA 1GITA 1XZQA 4ABYA 5JWOA 4A2WA 5DN6D 1WE2A 8OHMA 4PC3A 2I4IA 2IXEA 3OEHD 3SBEA 4TT3D 4Q9LA 4FCWA 3KKQA 5JSZB 2X2FA 3PFIA 4HLUC 1UKYA 4IKEA 5F98A 4HLDA 1R6BX 5JRJA 4UNSA 2GWHA 5EE0A 1R5NA 1SVSA 2C98A 3VHXA 4FMBB 5E7IA 1S9DA 2HCBA 5TB5A 4DDWA 1TMKA 2OCAA 4F91B 3AUXA 2OILA 2HDNB 1UBFA 2QPOA 4A9AA 1CJKC 5JWHA 4TTRA 3ND9A 1MABA 1KK3A 2IYQA 1JALA 2GEVA 5B2ZA 5KYKA 2DB3A 1OFTA 3N70A 4IOMA 4HUQB 4DT1B 3U60B 4RD4A 4ZPXA 2XXAB 2ZQ5A 4P33A 5IRCD 2EFGA 3RYTC 1W46A 2VP9A 2XOKA 1N0VC 2IA5A 4RKFA 1VHTA 4JYCA 3LVRE 4YLGA 2GDJA 2FG5A 3BIFA 2G0TA 3QXCA 2J46A 5LPNA 5UKDA 2C5LA 2ZRHA 3NBZC 1Z47A 2HYIC 3AVUA 1G8FA 3W8RA 5HE9A 3VU9B 2BJWA 4U5XA 1VIYA 3O8RA 1GILA 4WIAA 4CEIB 3QEOA 3WHKA 3NVAA 1MRSA 3TH5A 1EFUA 2F3TA 4AY2A 5J4VA 1CJTC 2QN6A 5DHAA 3K09A 1YR7A 3SHFA 4BLTA 1GTVA 4RKEA 1G17A 5E7JA 2V6JA 1MO5A 2HCJB 2H92A 3TIFA 2H8KA 1MKYA 2ZANA 3RNLA 1G7TA 3I62A 3F5FA 3VR2A 3DHWC 1MO3A 3AEZA 1G20E 4LOAA 4PZZA 5AJXA 2WSMA 3A36A 4DLWA 1PUIA 2QPAA 3REGA 2GRJA 2IS4A 3QKRB 3FDIA 3QKSA 1D9XA 3NEYA 4MRSA 5L3SB 1GKIA 1ZINA 1G1MA 3BFVA 3QKUA 4A0HA 2JLRA 1UEIA 3CWZA 4V02A 3QF4B 1W7AA 1IM2A 4HZUA 2WIAA 3GLGE 4NYIQ 3ZZTA 2IF2A 4B3FX 3THYB 2AX4A 4QL3A 3T1OA 4KHZA 1Z0AA 3BWDD 1AS0A 5JBQA 4JLPA 4O25A 3SEAA 1T8UA 4LJ7A 3P1JA 2IYRA 2IW3A 4DLZA 4DVGA 1C4OA 2EWWA 4PHHA 1AGRA 4M0LA 4MUAA 3QE0A 2OV2A 5CLLA 3W5IA 1N0WA 1Q3HA 4DCNA 1OIWA 1XWIA 4HAZA 2OAP1 1KOFA 2DHRA 4V0ME 4QBGB 3I72A 3TQCA 4PXAA 1OYWA 1C9KA 2VYFA 2C8VA 1LVGA 2J59A 4A0FA 3CNNA 4Q4LA 4XTRA 2WJIA 4QNRA 5CYPA 2GVDC 3TK1A 821PA 5SZHB 2QMHA 4IXMA 1NIPA 1W0KD 5BYKA 5IHPA 1T4GA 1QZXA 2GJ8A 2VSFA 3C7KA 2H7VA 4BQSA 3AVVA 5KDLA 1N6OA 2HJVA 5C4GB 2O52A 2YOHA 4W7SA 2R6DA 3FMOB 2WJHA 4DEXA 1J8YF 2F1HA 3BB4A 3D8BA 3RWMB 1S1MA 4NCNA 4LWZA 1KDRA 2W0MA 1ESMA 3K0CA 2XTMA 3TR0A 1TU3A 4MYTA 4BLQA 4FMCB 2YYZA 1OE0A 1E99A 1ZD9A 2ZSAA 4AWXA 4PC6A 3I5XA 4CEHB 1X6VA 2ZI6A 1OKKD 4BFXA 1U8YA 2GF0A 2Q3MA 1CRPA 3CLVA 3QBTA 4A6XA 2HJGA 4KYIB 4AYTA 1ZCAA 2C96A 4E07A 1AJEA 1PV4A 2J45A 2IUTA 5HE8A 2AN9A 2WAXA 2FFAA 2QT0A 3U7HB 3NBFA 2OFXA 2JLUA 2NO9A 2RKOA 1MABB 3SBDA 4PPNA 4JBWA 3KKNA 5A5GA 4RY2A 2OBLA 3A6PC 5LD2C 4A2PA 4QOSA 1AS2A 2IYTA 1ZMXA 2QMEA 1OT3A 2DFTA 4QG7A 4ZO4A 2JJ2A 1Z8FA 2FSHA 4L16A 3ADCA 3TAUA 2WWYA 2FEOA 4MYCA 1Z0FA 2C9YA 2CVHA 3RWOA 1SZPA 3X2SA 1OV4A 2UZIR 2ODEA 4PC1A 3WBKA 3LQQA 4QC2A 4ZDWA 1NBME 2C95A 4LPSA 4TTPA 2QEQA 3SE0A 1CLUA 2ZEJA 4Q1DA 2RCNA 3N2EA 4BFTA 5K8IA 3AVTA 2DR3A 1Z29A 2QROA 3HPQA 5FBWB 2BEKA 4PO1A 1SXJA 2BBSA 3KQLA 4B6EA 4PAMA 5LB2A 3LX5A 1W36B 4BGDA 1GKUB 5AJVB 1HT2E 1OFHA 4LBZA 4ZCMA 1NBMD 1GUAA 3VKHA 1Q0UA 3U3KA 3W9YA 4I1UA 1Z6GA 2NO6A 4HB3A 1QHYA 4B3DA 3G5UA 3SN6A 4EAQA 1HQCA 4I1VA 4B33A 1DPFA 2NO1A 4HDQB 5JECA 3V4RA 2QAJA 1ZCBA 2V8OA 2TMKA 1P72A 1FMLA 3QKSB 1DARA 1W2HA 3IIMA 4JVLA 4JYBA 1XD2A 2QRNA 4HZUB 2O0JA 2QL6A 4IDQA 1X1SA 1XEWX 1XEWY 2F9LA 1R0ZA 3RRMA 3EPKA 3B1WA 4JZKA 2A5GA 3UWOA 4DUGA 4NYIR 1CULC 4UKDA 1G6HA 1TQ2A 5AUPB 1OH5A 1OFUX 3MCAA 1NY6A 3BRWD 4IVQA 1A4RA 1OXVA 1VTKA 3A8TA 3PEYA 1KI9A 1E79D 2GXUA 3FE2A 3CONA 1NKTA 3EZ2A 3TBKA 2YKGA 2WSSD 1E1RD 4MGYR 1G18A 4QBFA 1UM8A 1XEXA 1HTWA 2W2VA 4OHXA 4FMDB 1M74A 1HE1C 1DTSA 4X8HA 1KDTA 4ZDJA 1S9HA 4DSTA 1Q44A 1XTSA 1GZSA 3ZZUA 3ECCA 4Q18A 2HF9A 2NQ2C 2PLRA 2J0QA 4K8OA 2YVUA 5FR2A 5F9HA 3TRFA 2D06A 2L0XA 1BMFA 3PR1A 2WWIA 3B78A 4RD2A 4RZXA 1G16A 4YXWA 1N5JA 1VCMA 4M8NE 1H8EA 5B30A 3X1XA 3BOSA 1E6CA 5CYOA 1X86B 4RD0A 2ZJAA 4A6PA 1P62B 4XD7D 5G53C 2G1JA 2Q0HA 4JLMA 1N3BA 2ZJYA 5AJYA 3DDCA 3RRZA 5CDFE 2WJYA 3GJ8A 5KNDA 3IHWA 4KVAA 4M1KA 2AL7A 4M1TA 4UNNA 1XPOA 3E1SA 5HKKA 4TYYA 1XRJA 5CK4A 4PSAA 3ZYCA 1RYHA 1W4CA 2OT3B 4KFUA 1G4AE 1P61B 2RB4A 4B75A 2VO1A 1KJWA 2FPKA 4D26A 1CU1A 4EUNA 3HR7A 3K0SA 3L43A 3BJIC 4AYXA 1A82A 2JIZA 2WKPA 4RSGA 3H4MA 4TLEA 5EZ6B 3ICEA 1JJ7A 1SVOA 4L4UA 4Q66C 4A82A 1U0JA 1Y3AA 2A30A 4CF7A 4WVFA 1CR0A 1XP8A 2ZJ2A 1QHHA 3EZ6A 1N5LA 4FN5A 3PITA 5KDOA 4S2EA 4YC7A 3W5JA 4NPHA 1VCOA 4G3XA 1NN3A 4RFSB 2NPIA 1BYUA 3QENA 5JFGA 5KSZA 1WB9A 3SQWA 2A9KA 3TLXA 2ASEA 3PV0A 4BFSA 4AG5A 1G8GA 2P5TB 5FUYA 3P26A 1HURA 4OHZA 2XB4A 2ZRIA 1BYIA 1NVVQ 1KO8A 3HYTA 2OG2A 2VBCA 1UPTA 3LX8A 2QSYA 2VP2A 1SXJB 2C04A 3DZDA 4XOIA 1SHKA 1T91A 3F3YA 3FMPB 2AKAB 4JBXA 1COWA 1Z0IA 2VLIA 2DWQA 2PCJA 3JVUA 4X8MA 1P5ZB 1U98A 2ZSBA 1YE8A 1F2UA 1XXHA 4D4KA 2J7KA 4EIWA 1XJQA 1ANKA 1JQLB 3CF6R 4HB4A 3GMTA 1YRAA 2QM8A 1OIVA 1ZD8A 1U94A 1LFDB 4PQFA 3SJBA 1T8TA 1VPLA 1Z06A 3GJ7A 1X8JA 3VR4A 4MDEA 2XOKD 1XD2B 2QTVB
chains in the Genus database with same CATH superfamily
2Y68A 4PIMA 1AN0A 1GGHA 1P8JA 1QKKA 2IU4A 2HIHA 4Y2SA 1LPBB 3T54A 2HC9A 2YHSA 3N8GA 4BCDA 1I14A 3GCGA 4TKLA 4O2BB 4KAXA 1OZAA 1EDZA 4QWMA 3W7BA 1V3TA 5CX1A 1PJRA 3ZVKA 3KTDA 1AC5A 3STXA 2Q1SA 1FU7A 4LMPA 4QXRA 2HMYB 3EXG1 1IQRA 3NANA 3GJ4A 1R9MA 4PZCA 3GNQA 2ZM6B 1JXQA 4DF3A 3W1EA 1ZXBA 2R79A 4XDHA 3JYOA 2N75A 2B2CA 2XEDA 2DTXA 3H97A 3Q3EA 4KBFA 4CEJA 4YT8A 4DNPA 4Q3LA 1Q74A 3P32A 2X9VA 2R1TB 1VI5A 2CHVA 5AM2A 3VR2D 5HDQA 3HM9A 1UPAA 4ZD6A 1T5SA 5IM5A 4GP9A 5EPOA 3KT8A 3RVRA 1U8XX 2O8FA 3UKDA 3B8HA 2NO4A 3BH0A 2HRDA 1YU6A 2BKEA 5K6AA 4YJHB 5ECGC 5HM6A 2QUAA 4QPJC 4X3PA 1ISSA 3J7TA 1LBTA 1MX3A 3WLJA 1IVSA 1G5QA 5I7VA 2FJUA 3DMTC 2A2ZA 1QJ4A 1HYBA 1YULA 2AXQA 1SUSA 1W5AA 2O0MA 3B6MA 2H5IA 3BWEA 1MRNA 3EDYA 4GLJA 3OP1A 5I7HA 2IXDA 4ENVA 5AVUA 5IK2D 2JFNA 4YRJA 5JG7A 2VPXA 4R1SA 4DWOA 5JAOA 1A9OA 5LZ8A 2CJXA 1ZM7A 2XUOA 3PFHA 3SDZA 1G0OA 2EFYA 3V9PA 5EZYB 4CKCA 3CF4A 1T2DA 1YWGO 2XKBA 1ODSA 1E9SA 1DOHA 3D59A 3EFOA 3MXOA 4LK2A 4Y98A 5TPZD 5IVIA 2F2TA 1RM3A 3VAAA 4ZAZA 2IHUA 1B0PA 2DWPA 2GAOA 5IT0A 3PPWA 1P1BA 3CLUC 5TEVA 3HE3A 4D45A 1FS5A 3SC6A 4EW1A 2YIJA 1UQTA 2LP4Y 1Q15A 4WZAB 3RUAA 2W4MA 2QVXX 3VJKA 4PLGA 2OBBA 3O4IA 2BEWB 4YMVA 5DHFA 3H1EA 2X41A 5BWMA 1G5PA 2JBHA 2PFGA 2ZE7A 1YZNA 3HB7A 2NTJA 3AR9A 4X64B 5BN3A 2P2LA 3T0FA 5TY0A 1PZNA 2ZIVB 3K96A 2NU7B 3KXPA 4PSCA 4UBNA 2JATA 4AO6A 3AVPA 1E0SA 1ZGGA 3NRBA 3NM4A 1IBMB 3LO5A 4FR5A 4ILKA 5G0UA 3AY3A 2PX4A 4ZOLF 2V1XA 3K9LA 3AEYA 4XWAA 2GCNA 4LZWA 4EW3A 3O4HA 2Y8EA 2PT5A 1H4QA 2Q3EA 1TLFA 2G7ZA 1E77A 4QQNA 2NVUB 5DI9A 5FWDA 4EHLA 4PNEA 5ITZB 2Y93A 1PYDA 1RAGA 1VBMA 3EQ8A 4P92A 2GPJA 4XIYA 3I9V6 1Y6RA 1K98A 1N6NA 2B37A 3A4MA 2GPAA 1P74A 3B3AA 4R9NA 3RAFC 3GEHA 2WF8A 3G0GA 1GVNB 1VYVA 4D4LA 1YI0A 4UNRA 3NP9A 2RMKA 5C8YF 1OR8A 2W8BA 3GGOA 3SBXA 3ZIDA 1V95A 2ZRJA 3S81A 3CRVA 4NBUA 2CZCA 3IUQA 2JGNA 4YBRA 3WLHA 4GI2A 2CLSA 1GR1A 2IHYA 5G4KA 5GV7A 2OD7A 2J4CA 3EODA 1COZA 1H2ZA 4HUQA 1EK6A 4YR9A 2UVQA 3O21A 2NIPA 3RUIA 5F21A 5F73A 3GFRA 5AOAA 2JJ2D 2VA8A 3HFJA 4G97A 5FBZA 3RABA 2J5BA 3PE4A 1U1CA 4X97A 3ZQ6A 3AIMA 4CFSA 3E3MA 3PXDA 5F5NA 2GHTA 5EGSA 3CW8X 3MHTA 5DSZA 3U19A 4P22A 2YBEA 4GR4A 1UJ2A 3BE6A 4GMGA 4PX3A 4UJ5A 3JQAB 2JK1A 2X8JB 2RHWA 4JC4A 3IA2A 4CEIA 1R0KA 4OL0A 4YXFA 4BNZA 1TE2A 4Q05A 2MJLA 2VCEA 3LYUA 3L6DA 3R3ZA 3U3RA 1I7NA 2OHFA 3HWRA 2NP6A 1SXJD 3R5XA 2E4WA 2GNPA 4B4KA 2UZAA 1QV9A 1O6ZA 2W9XA 2BGGA 1U6IA 4OY3A 2VZ0A 3ECAA 4PWYA 3TGPA 1U0OC 2XZLA 2JNWA 1UKVY 2ZZKA 2MCFA 3AFNA 3TW0A 4MR8B 1W49A 2OESA 4R71A 2PX5A 2I9KA 3UPUA 1UODA 4ZCPA 3FOAA 1J0BA 3QSGA 2C29D 2ZUWA 1A0OA 2AJLI 2RGYA 4NS1A 5LOVA 1E5VA 2Q9CA 3OEEA 1KORA 2G36A 3OX3A 1JIJA 1QGUB 3U6KA 1NVWQ 2G0NA 3S7ZA 1JT9A 2LKCA 3Q10A 4O4LA 1I2DA 3IAUA 4U3JB 4W9MC 3L8FA 3Q41A 3BWVA 1FJGB 2BIFA 1L0BA 3H0CA 4WN9B 1XL0A 3CYFA 3EVAA 3AOEC 2YYYA 2Q1XA 3L0BA 1VKZA 3X1WA 2R68A 5C53B 3GUCA 9LDTA 3SXUB 5LU8A 3F6BX 1LI4A 3MTJA 5K0FA 2GZHA 1OZGA 2OYSA 2ECQA 2Q6LA 3E5RA 3EWAA 3OHPA 4JFRA 4K6GA 3SJZA 2KLHA 2AUMA 3CXUA 1YGYA 4TLCA 5IAGA 1M9NA 5JIBA 4Q16A 2VTEA 3F3SA 3OMWA 3TAXA 1JSCA 1HEYA 2BKUA 3N2ZB 1U5BA 3W06A 4Z7QB 5BT8A 5AW8A 2R751 5LIPA 2ZU6A 1DBRA 1FVFA 1I3LA 3IA7A 3ITKA 4EA6A 4LF6B 2XOXA 1XVIA 2GR9A 1PJ3A 1FTQA 2WAMA 4TTSA 1H3EA 2Y66A 2G80A 2O8BB 5C18A 2NUPA 4QVIA 2YH2A 3JQBA 3TM5A 1XZAA 5LLSA 2W70A 2YRXA 4BNJA 1YQEA 1E98A 3HJNA 1UFRA 1JDUA 1U3GA 2JCYA 1TCAA 4QBIA 4DCSA 4EEZA 1QF7A 3DEAA 3QHAA 5IYZA 2Q1WA 1CZHA 1GCUA 2BJHA 5AXAA 2IP1A 4CTNA 3IIKA 3IOBA 1JFSA 4H4EA 4O02B 5EJ8A 4JBGA 4MI9A 5BXQC 4JXZA 2NM0A 1V1JA 4G2NA 3AONB 5FA6A 2IU6A 1SUEA 1VMIA 1JPUA 1W5EA 3DF7A 3SZ3A 3W2HA 1H8ED 3DE4X 4G1BA 2QLNA 4W9RA 1XK7A 1K1EA 1T3HA 3BF7A 4K40A 4D3SA 1UMBA 5BVGA 4P7KA 4V39A 5CXUA 2EEPA 3DM5A 3KYCA 3B3JA 1JHOA 4CMJA 4JBIA 4YAIA 4LJRA 4YRZA 5K0LA 4WY5A 5FDFA 5HXAA 3O8QA 3A27A 3MYRA 4I5IA 4JSYA 3KKLA 3MTQA 1UAGA 1AOXA 3BFJA 3L4SO 1U2DC 2QRZA 1DX4A 4B0OA 1JA9A 2Y0CA 3ZWQA 1K3FA 4V3CA 5L7WA 4QT4A 2BFAA 4JEHA 2LCFA 2EWVA 1B2LA 1KAOA 2FZWA 2X7HA 4PRKA 1QZTA 3KEFA 4X1OA 3SHOA 5HKKD 3MS7A 5B64A 4J1QA 1CR2A 1HDIA 4LJ6A 4EQZA 1BEZA 5KUTA 4B2LA 2I1QA 1Q3TA 2PVPA 5E1OA 4AZSA 4PZEA 4F5EA 3F46A 2WJGA 4E11A 4C5CA 3AP1A 3IH5A 1KAHA 4ZPJA 4H7JA 1YCHA 3B6ZA 4HATA 3HG7A 2F43A 4MCJA 1C9JA 4XLLA 4E4RA 3VDNB 2UYCA 1MOZA 3ZHCA 2GTIA 1MB9A 1VKRA 4IQ4A 2B4RO 1IK4A 1YJ5A 2FR8C 4GOKA 4JEMA 4P0TA 1E7WA 5HKLA 4BVJA 1KEEB 2EJVA 4TXLA 3VMFA 1KO5A 4PRYA 4UUMA 3A9TA 1L3CA 621PA 1H9CA 4RIEA 1UZMA 3RVMA 2CK3A 4EP1A 1I4WA 1NUTA 2FX3A 1E6WA 2R00C 5LD2B 4IIYA 1OH8A 3N0XA 4EKGA 3GJ0A 4HPJB 1YVUA 3JQPA 3RKSA 6ABPA 3B60A 4LA4A 2EQ5A 2OFWA 4AMYA 1XO1A 2BVNA 4JLOA 1IONA 1C9DB 1W34A 1AGXA 1V9CA 2BFNA 1XXHE 3DYBA 3JQ6A 3FZGA 1OCEA 4CTKA 3GZTB 4LF8B 2GX6A 4G0XA 1I30A 3H6KA 2I29A 4HH4A 2HI0A 3SHWA 4ZI2A 3LSYA 1EWKA 2W6MA 2XAUA 3H3XA 4K1XA 4MR7B 1QQ7A 4U02A 3IVGA 2AYXA 3D1JA 2QLJA 3S2YA 2C3UA 2W2XA 3VH4A 1P8AA 3OU2A 5B7QA 1II9A 1CUAA 2RAVA 3DNMA 4E2FA 3M6IA 2Z1MA 1NR7A 3HDTA 3M1LA 4KTTE 1KQOA 1ETUA 4WLNA 3B3FA 1KSFX 4AZ0B 3H04A 2HB6A 3QPAA 1GM5A 3O93A 2NQ8A 5K0JA 1J8VA 2BOVA 3KZNA 3PEEA 5G3ZA 1RACA 1RYDA 1TEHA 1GPBA 5DBGA 1YK0A 1GEGA 1PEKE 1S2NA 1U2QA 2O2XA 2DY0A 5A5EA 1XVTA 4B6PA 1IB0A 1JDTA 2QLTA 4H1UA 4AJ2A 1CY8A 4LZLA 3K32A 3GW8A 3JQAD 5BN5B 3UV3A 4KBGA 3VX4A 1I5OA 1VLLA 2WKWA 3EZYA 3L18A 2QE7D 1Y9ZA 1HOXA 3L7OA 1AF4A 2MOKA 1GA4A 1K8RA 5A04A 4E4TA 1HT3A 3G8YA 3M49A 3ORHA 2H2DA 3W3AH 1KPGA 4TWZA 2IGBA 2FP4B 3QKIA 1IL0A 4TUYF 2X23A 4PPQA 1JRLA 4DUYB 4DR7B 1S2IA 1NNSA 1P75A 2FN7A 2J7PA 2VDWB 1OBHA 4BBPA 3KQKA 1K3UB 3A3YA 3FUTA 1WNTA 2OFPA 1Z5ZA 3PFCA 2H2FA 5ALSA 5HBGA 4DV1B 1EK1A 3WMXA 1RFLA 1H0KA 2O6HA 2SICE 3L93A 3ZNOA 2O9JA 2NXWA 4B81A 1O87A 3GFGA 2EG9A 1FNNA 3FUXA 4HMPA 4I8DA 3D6NB 5KWEA 2F55A 3OC0A 4UXJA 1U0TA 2BGJA 3PNKA 4HN4B 4QUDA 2LCQA 4ZU3A 5A4FS 2PSSA 1S2LA 2PJDA 4B6SA 5C3MA 4ZALA 2Z6QA 2FZKA 1URPA 1FFWA 1W85B 3A1SA 1WL8A 1PJAA 4HX2A 4UHKA 5ELMA 3A6FA 1DDGA 1RLMA 2VHZA 2HLDD 4YJ3F 4E1BA 1GAQA 3WWYA 1MO4A 4GS5A 1CS4C 1PFKA 2Z8YM 2WFAA 4I55F 3EY4A 1VZ2A 2IPXA 3RG2A 4BBJA 2YN0A 2DKNA 3QBJA 4P4SB 4B09A 4KNWA 1WXGA 2I8CA 4LRQA 3UA3A 5KQGA 2F1IA 3GMIA 4PX9A 2PE5A 1TFUA 1WOYA 1FDWA 2P78A 2K5UA 4UVHA 3VBEA 3DW1X 4N4AA 1NNUA 4QE3A 4WZ6A 1L8LA 2H9AA 3IXQA 4JH0A 3CLHA 5JYDA 1RWPA 2BKXA 3QVTA 3QITA 3HCCA 5LJIA 1I24A 4D97A 1S7GA 4GAEA 2B5VA 5EVJA 2WG1A 3EBPA 1P18A 2IDJA 3GXBA 3TMYA 5L3QB 5CDSA 3DLPX 4RQUA 4C7XA 2EKZA 5KKAA 1L9KA 2R8PA 3C1OA 4IY1A 2HJ9A 4QREA 1YJ8A 1Z45A 3A10A 4OK5A 3EISA 3BDVA 5I01A 4O2RA 2JFOA 4RMHA 5BVHA 2JI4A 3E7FA 3B9PA 1IU9A 2W6JA 4XPIB 1BSVA 3RIHA 4WBNB 2R5FA 5KMGA 5DXFA 3UXMA 4MWBA 1ZGAA 2ZRDA 1ZWKA 4RFSA 1CEQA 3B38A 4RLQA 4Z9XA 4EFLA 1I13A 4URHA 3TUZC 2PO5A 4JHXA 3IP7A 2BBWA 3P7MA 1BU5A 3WGYA 4F2HA 3ZJTA 1YMUA 1KVSA 1RMQA 2XYGA 2VSQA 1G4HA 3A9UA 3NBAA 2BSAA 3S70A 3IQHX 3WRXA 1NVTA 3O03A 3KXLA 1WD7A 2GYYA 4HX5A 4JMPA 4CMCA 1WB5A 4PSVA 2TECE 5FQNA 4BY9E 2KQUA 1WXDA 3T3EA 4WY2A 1NVBA 3K70C 2XUIA 4TPKA 2QGFA 4BFYA 4EF6A 1V3QE 2ZAYA 2CNKA 3AEQB 4LJSA 1AH2A 1ND6A 1NUHA 4P7GA 1A98A 3QRWA 3PFNA 4FKZA 3SSOA 2I3ZA 3DTNA 3GZJA 1J8DA 2VFAA 5LB4A 3FCXA 2WFLB 4IHJF 4ARCA 1JR6A 4N82A 2JCXA 4DGQA 4L4ZA 4YP0A 2GCOA 4UTVA 1TO6A 2YNMC 5YASA 2F1JA 3E22B 1EDOA 5HG0A 2B21A 3OT1B 4NDAA 3B1FA 2WHXA 4DLVA 4K5QA 4X94A 3H19A 4WQMA 1RBZA 3DYIA 2G3YA 5FBQB 3ESDA 3VXKA 4O4HF 2UUOA 4JKYA 5MN5A 4WEQA 4M7PA 2FW1A 1QYRA 4FBLA 3LW7A 4EPVA 1MIOA 1I4OA 2HUPA 1SUWA 3WS7A 1CD5A 2A9PA 3NYQA 1SHTX 4DIFA 3F7MA 2GWRA 4EPYA 4XARA 4LN1A 2VHQA 4CVNA 3WJAA 4C2AA 5HP4A 3OZGA 1TUEA 2H52A 5EIAA 2HHHB 2G5TA 2J1LA 3KT0A 4BVFA 1JKJA 4IJQA 4JT8A 4BX0A 1DCTA 4Q93A 1L5RA 1FMJA 5K3CA 2A94A 1KNXA 3UK2A 1O9BA 5CH5A 3I64A 3U6BA 3IVCA 2ZPTX 1X9GA 1E32A 1LLUA 3I04M 2C7RA 1YB6A 4GPTA 3UJDA 4OEHA 3TEJA 3WMGA 2G4CA 5DX8A 4CCWA 1DFGA 2ECFA 4RPKA 2BEJA 2HFJA 2FFRA 3AM5A 2C2KA 3D7RA 3I2GA 5LDDC 3WNCA 1ZICA 4L4RA 4BUCA 1GV0A 1E1KA 5BSWA 1BJRE 3EDQA 1LDBA 1JXAA 2YJ3A 4LTNA 1GKLA 5IDVA 5JZOA 4KE9A 3DL2A 3H5NA 4OMDA 4OJNA 1T8YA 1IK6A 2A67A 3C3CA 4IIJF 1EXMA 4LHSA 2PQ2A 3PCTA 3EPRA 5B55A 1JAIA 1H93A 1UL1X 4YQEA 3BZWA 3NYRA 4JYMA 2WABA 3CC8A 4XB1A 3VNQA 3LJKA 4RV4A 3GNSA 4RK7A 4CMGA 1Y63A 4HS9A 3A70A 1T10A 2ORED 4IUDS 4LY0A 4CF4A 5DU2A 1ZK4A 5JZBA 5D84A 2E87A 5KNBA 4DR1B 3WGKA 1U4SA 4ETMA 1EFPA 3MQFA 1ZJ6A 4NJEB 2BZ0A 5JH7B 2ZE6A 1T5TA 4TMZA 4UU0A 3KUDA 5CURA 1QVZA 1C30A 1QFSA 2AC4A 4X1YA 1SRQA 4IDCA 3M6VA 1VG0B 2C2OA 4UARA 2O3UA 4FEGA 2OGUA 2VNHA 4XJSA 1YAHA 5HBRA 3S1SA 2AK2A 3IDAA 3RUPA 3SXPA 3T3MB 2WQ7A 2PANA 2DPGA 2EFCB 1UFKA 3KL4A 4F72A 2OCYC 3FHTA 2PJZA 2VCHA 3WV5A 1LWOA 4QDOA 1UR5A 5ARBA 1ZD1A 1PUXA 3G7SA 2R7NA 4CDMA 1TU4A 2Q07A 1J1ZA 1E9VA 1KK2A 1M8PA 4HAIA 5A1TA 1TZMA 4EFKA 1GG5A 1BMTA 3QEKA 2VRCD 3D6MA 3F5QA 1T3TA 4TTQA 4QXAA 2PDAA 3NXSA 3WP1B 3PNLA 4XYBA 4UPDA 3N6VA 3HJBA 4YMTA 5FTKA 2CFCA 4YMWA 2QX6A 1V16B 2HO4A 4P0QB 3WV4A 4BKRA 3KJEA 1BCSB 3OU7A 1UAAA 1GTZA 1XC7A 2BBOA 1OXKB 3LY9A 1KEPA 4R84A 4U1RA 4LJLA 4KFCA 2UXCB 3S8YA 3PJRA 2EU8A 4AIRA 1I3NA 1QVRA 2XITA 4I1SA 5LYYA 2DTEA 3FGZA 2RHCA 2Z9CA 3PA6A 2IXAA 3WZLA 1DQPA 3PF9A 2YTZA 2CLFB 4QDJA 2ZJZA 1S1CA 1NY5A 3KO8A 4G1UC 1TQ6A 4XKJA 3VOBA 5CNIA 1NVMB 5K6RA 4FWIB 2BMFA 1NQVA 2IV7A 3G5TA 4AROA 2VYNA 4LXQA 5HF5A 1A88A 1JU4A 2BR3A 2JHFA 1VHWA 3PC2A 1TRHA 5COBA 3ZHZA 4C87A 5CXQA 5GVSA 2EC5A 3VNBA 2VPWA 5C9ZA 1K92A 5JZSA 2DU8A 1XYGA 3E0XA 1D1QA 3D7NA 1L5WA 4UATA 1EA5A 2FW7A 1QFMA 1HEUA 2VDKB 4YQYA 1O8BA 3AUUA 4Y6GB 2X8WA 1EVLA 3AR7A 3OM8A 4FXOA 3LHFA 4QD3A 5A71A 4ARSA 5FOXA 2R4QA 2CNWA 2YJZA 2GLUA 4F6RA 5CCBA 4Z1MA 5BN4A 3FOEC 3I61A 1DWPA 3ZGZA 4YUZA 1LPNA 1OWMA 2GSWA 2QQFA 5KPDA 4IIHA 1N9GA 4JB0A 1EBBA 4C4XA 3E5MA 1EJ0A 4RMIA 5DFAA 3WWCA 5AVYA 1FS6A 3B9QA 4KMSA 3V1TC 4LX8A 1Q2XA 3UY4A 3M6LA 5CLQA 3N5KA 2XV1A 5I8ZA 1TJNA 1T0BA 2XMZA 1HEIA 3N75A 2OZLB 4G23A 5E6RA 2DKOA 3THOA 3Q0EA 4AY3A 3DTVA 4GLOA 4JWTA 1QHSA 3W77A 4R6WA 4RKRA 4XUDA 2EDCA 1VPWA 5A4JA 2NTNA 1E5DA 5J4KA 4PCAA 2VT6A 3RYCB 3TDKA 4QU0A 4O0LA 1Y8ZA 2AFHA 1BW9B 3LGSA 3ZZNA 3CZPA 3K9CA 5KOYA 3A4NA 1C29B 1YHNA 2QJWA 3LSTA 4KXXA 4MV6A 1XFAA 2FPUA 1X80A 3ECSA 2JAOA 4LYEA 4X92A 4Y2JA 5T67A 5JMTA 4MRPA 1B8OA 3KTOA 5ESWA 2WKRA 1NLUA 5JS2A 2NZVG 4LJ5A 3F7NA 3I5UA 4LJYA 4RF5A 3SC3A 2Q5OA 1W44A 3JYLA 5KSPA 4UAUA 4FR2A 3MJRA 4F60A 2C54A 5L3VA 3DTYA 2NPFA 1KAGA 2Q4TA 4D6XA 5G0TA 1TPYA 3VU8A 4Y0AA 1R0YA 3WLOA 4MUFA 4KDRA 1L5KA 4CWAA 4F2WA 3KQHA 3KLPX 2FI1A 1ZEMA 2VJAA 1YE3A 4JLBA 4M38A 4X3CA 3LHDA 4EZEA 3H2ZA 6ADHA 3WYAA 4DDUA 2PZGA 3QWBA 3DLAA 2QG9A 1JWBB 1VHDA 1T0PA 4I8XA 5GZ1A 5KYXA 3MLAA 4PFQA 5HWSA 4RH0A 2E37A 5LUBA 5I6DA 2BCGY 4F11A 1VKOA 2HXGA 4OTZA 1XMOB 3VSEA 4UEKA 2HGSA 4LSWA 3C3JA 1VL5A 3SQDA 5HCIA 3HV2A 1BG6A 3SICE 2X1LA 2DG2A 2J6IA 1L7EA 3V8NA 4GI1A 3G9QA 3L1KA 2PX2A 4ZOLB 3DEFA 1L4UA 4L3WA 2WLSA 4RULA 3LZDA 3ZV7A 3AOGA 1EDDA 3FRHA 4EJSB 3KSUA 1KRXA 2FGJA 4X1KA 3GUVA 4AKGA 3CF0A 4GO1A 2OFOA 5BNWA 2QR5A 4KV9A 2I4LA 2XX3A 4LYGA 2PXAA 2REOA 4N0PA 4JB8A 4KFTA 5ADHA 5KSYA 3OTOB 3ESXA 1OBCA 4FOPA 1BROA 4J29A 2NV0A 4HWPA 3R20A 1Z4PX 2P9ZA 3KJHA 5EEHA 3GJ3A 2JLCA 1TX4B 2P35A 1R8QA 1TDJA 4L95C 4MUEA 5AOVA 4B4OA 4D41A 5JDIC 1QIJA 3JD1A 2I7VA 4HAWA 2HFKA 2FPMA 3MZ0A 5L4SA 3GVHA 4DG8A 3GRKA 3QUBA 4IMRA 2FSFA 4L22A 2RHLA 1T15A 2Q2VA 4LRXA 5IM4A 2H3EA 4G9EA 1UJMA 4RF3A 1PZMA 2LUOA 2RI0A 2FWBA 1BRTA 2LW7A 4WW0A 1TK9A 1VE6A 2VSYA 2FPGB 5M3BA 4XWKA 5KTYA 1X74A 2UKDA 3A9RA 3N58A 2ZRCA 4TQ9A 3U13A 2AEJA 4V0OA 1FZTA 1GRVA 1L3IA 4G01B 1JTVA 1ZN2A 2P40A 4JVNA 2PLWA 2P2DA 1H6AA 2ZETA 4Q9DA 4CL0A 2AUTA 1K8QA 1P5JA 3I23A 3LKVA 4JI2B 3KQSA 2QUIA 2J0UB 1ADBA 1JBQA 2QP3A 4NAHA 1TUIA 3K0AB 1WXHA 2WQZA 3ZOKA 1E5QA 3O9MA 4C4AA 4CIBA 5IH7A 1HLDA 5J63A 2IKSA 4H6WA 4KXFB 1NVUQ 3TNFA 1IOZA 4O3MA 5G0SA 3GHYA 4YIHA 4WCFA 4J0GA 4AJEA 4HXFB 3JVVA 3RD5A 1YXMA 3CE9A 1GPLA 5TPWB 3G6WA 1TEXA 1DTWA 2VAXA 3EMVA 3CX4A 3EIOA 4F1WA 5DM70 2BWJA 3LZ6A 1SBQA 2JPDA 4OUDB 1AT1A 5K3SA 1IOVA 3BL6A 1X1BA 4PYRA 4C14A 3KLBA 1RXCA 4ENPA 1KF0A 3JZFA 2ZB8A 1U6JA 2JKZA 3DC7A 4JQOA 5CTJA 4U7DA 1A9QA 4L4YA 1Z7WA 1RYNA 2VPPA 3MAAC 1VA5A 1NQTA 3OE7D 3O8OB 2XHEA 1ESEA 3NFRA 4QTYA 1J49A 3QG1A 2WQ6A 2ZUEA 2DUJA 1W5SA 2F64A 2IYEA 3NOVA 1FXWF 5EUBA 1H0HA 1ZK0A 2BMEA 3VVMA 4GM4A 4GZ3A 2FSPA 2I33A 1JW9B 3VO8A 5CNJA 5HFAA 4FDMA 4MI1A 1NMYA 1E1QD 1M2KA 3F1KA 1DE0A 3C8HA 3DPUA 2WOJA 3AJ9A 4I50B 1NN5A 1QFXA 3QXHA 4M0CA 3VYUB 2ZYRA 4YO8A 2UZ1A 5KAPA 4E94A 1W35A 1PR0A 1ZVKA 2J9ZB 1Y6QA 1LRKA 3NR2A 3P9QA 5IZCA 5LXTF 3WMWA 3H16A 3OQHA 3FPKA 4EHBA 1GADO 1K3TA 2CLDX 5NULA 2OLKA 2A57A 3P9PA 4WTOA 2PKEA 1BE8A 1MQAA 4DVJA 2R44A 1KMQA 2IOHA 2XUJA 3TD2A 2VTBB 2AI2A 2AJDA 1EK5A 1ULTA 2GESA 2J48A 3WJ1A 2YY5A 3AEUA 3D6VA 1YASA 2CE7A 2HADA 3HB5X 4PTLA 4AG3A 3OD5A 5B3LA 5IABA 4NZ9A 3WLIA 1JEYA 3PHLA 5EQJB 1PTKA 3EXG2 4JX9A 4BE9A 4D7AA 3BFXA 2ZI9A 5GVRA 2P5SA 4NMWA 2A5DA 4OGKA 4Z8YA 2WKQA 3ICQB 1SQ5A 3FNBA 4G1FA 5FUWA 3TRJA 2OWDA 2NAPA 1ZVQA 2GA8A 1SG0A 1XDGA 3CZCA 5I7FA 2NYUA 2O2CA 4KXMA 4G0UA 3TQRA 2PKQP 5B6JA 2EHJA 1PR4A 4E5PA 1I1NA 5F3WB 1JECA 1E2MA 1IATA 1V8DA 3A9CA 4L7QA 3V6MA 2CWWA 2P9FA 3QK7A 3EG5A 3F4LA 4H0CA 2RJNA 4FIDA 2HPZA 3RRNA 3O1LA 3LWZA 3SYKA 4B87A 4DYVA 2IYFA 2IOFA 4X00A 4Q19A 1DJMA 2WT9A 1S8FA 4JGGA 1EFVB 2P7HA 3TLZA 3FYUA 1W0JA 1EX1A 1QBKC 4O1HA 3R6LA 2FLVA 4PRLA 2JIPA 5C51B 1U4NA 3CLKA 1YB5A 4DZTA 3ZDDA 3PLNA 2IRWA 5ESRA 1WG8A 4MGKR 4Q34A 1K7CA 3QKTA 3UTDA 3AETB 4PVDA 4PNPA 1QP7A 1QYCA 1ZKMA 2IX3A 4O5OA 3HCAA 4RBNA 3BZUA 1M8FA 1SVLA 3LWDA 3ZGLA 3PENA 4DLTA 2ST1A 1X70A 1AGYA 1QBGA 3ZE2B 4DM4A 3YASA 4A7PA 3EWNA 2WWHA 4BJ3A 3GJTA 5DW0A 2HSEA 4QRHA 3I34X 1YSCA 2YWHA 3GEGA 1R74A 2HSDA 2R87A 2XF2A 3PPYA 1ZSVA 1IZZA 3CLRD 4X90A 3S68A 3Q7EA 4TLBA 5IAOA 1KETA 4X8LA 2BM1A 2X0JA 5B2EA 3MWDA 1E4EA 1OLUA 4L8WB 2ZZNA 4X41A 1WZCA 2WP8J 4X9XA 4XQ9A 5FPHA 4KRFA 1E7MA 3FBTA 3B9BA 4KN8A 3WQHA 3O2NA 4UHBA 3D64A 2CYAA 1LKZA 1E62A 2AWOA 3Q3GE 2CSXA 3ZJ4A 2W00A 1GZHB 2Q29A 4GC9A 4IZ6A 4MB0A 5ECYA 1ZVVA 2D4AA 2XCOA 1SXQA 1IOWA 3PGLA 3OSUA 3NDIA 4TN5A 2YVAA 2YMMA 1JGTA 4U7TB 2IP2A 1A2OA 1CCWA 1QANA 1SHLA 2VT2A 4HGPA 1YIAA 4E7OA 1FP1D 4HNSA 3WYCA 1KZ6A 2O5CA 2J32A 4YAJA 1X9IA 4NJMB 4YN3A 4D0NA 5HZKA 1XVAA 3DB1A 4RY8A 1U7PA 5HIAA 1NN1A 1U04A 5IPFA 2J3KA 1K8XB 2IF0A 2ZJ3A 5PNTA 1SKQA 1JHQA 1QTRA 2DFDA 3CWCA 4LC1A 4OAQA 3ET4A 3W2FA 3S2UA 1VLVA 1NKVA 1L4MA 3K5PA 4C6HA 1LTKA 3PI7A 3V7UA 5JJLA 1GT6A 2ZW9A 1N6PA 4ENWA 1NT2A 4LHEA 3R0ZA 2QX4A 4D8TA 1XD9A 2CDBA 2DY1A 2BMJA 3DHYA 2EFJA 5KC8A 4B3RB 5K8UA 5CVJA 4MULA 1T8RA 4FEAA 1Q6YA 2D0PB 4RGBA 3E2MA 3ZQ4A 3OA2A 4F21A 5C8ZA 1U8AA 1T35A 4YJ2F 5KYVA 4Z7JA 3HP1A 4QM7A 1FP2A 1H1LA 1Q1BA 4NYJQ 1OLXA 3PRYA 1YRHA 2J3HA 4JQSA 1M76A 3EN0A 3G6KA 5L9AA 2VK8A 3QOWA 4EG4A 1Z5GA 1MFZA 5TVGA 5L45A 4QAJA 1C7FA 2HU8A 2VDOB 1A8PA 3LUGA 2B7CA 1V1MB 3MQ2A 2JZNA 3O9VA 4TUYB 1SOUA 3VPBA 2VK2A 3H5OA 4CM3A 4BMNA 2VG8A 3DEHA 3UWKA 2AI1A 2JLQA 1HETA 3PDHA 3SCZA 3TPFA 1U63A 1D6MA 1LGYA 1MDFA 1Y9AA 2HZ7A 3ELBA 3OJOA 1O3YA 1X7WA 2DH5A 4G8CA 4OXYA 5CP8A 5AW4A 1EP3B 2E85A 4D96A 1LJLA 3SS8A 4O2AF 1WEHA 1RRPA 2GJKA 3GR6A 4EKNB 1MOPA 1R2QA 5C46F 1KHTA 1PN3A 3MPUA 2Z2IA 2R8BA 4JLNA 5FORA 3F8WA 5JZVA 3WL8A 2F6RA 4ZYUA 3N2GA 1HO3A 3VVCA 4TXHA 3QVGB 1TA0A 1FRQA 2WJ4A 4UDYX 3WGQA 1ZHFA 3JQ8B 1LCIA 4LCBA 1H4SA 2G6BA 3NTVA 2NZ8A 2RKBA 2QXYA 4LXYA 2V6IA 1RE0A 1NW6A 6YASA 3Q8KA 1RAIA 2OFFA 3GRAA 3UHPA 4GGPA 3R0IA 3STWA 4CLHA 1M34A 3L7NA 2BP7B 2C9CA 3RC1A 3IEVA 2W90A 2VZ8A 3MOGA 4R1QA 4AF7A 4D4MA 2IDZA 5JWRA 3ENNA 1TJPB 1C80A 3C8UA 3WKCA 4BZWA 2ZM5A 3LT0A 2HCTA 2YWJA 3KXKA 1POXA 2I54A 3O2QB 3C14C 4IPTA 1NU8A 2QG6A 3CLSD 3WDMA 2CLLB 2NYRA 3SJ7A 3W6PA 4D9BA 3OZRA 4L9WA 4PCUA 3G0HA 1WBJB 1U1DA 4F3RA 3X1ZA 4CDRA 1B0ZA 3FD8A 5ENDA 5TR9A 4BN5A 4CPDA 1K8ZB 1IJEA 3CGGA 5GM2A 5U1PA 1T0JB 4PPGA 1F2VA 1R18A 3AY0A 1IBKB 3LCUA 1FYXA 1LPOA 1M5TA 1DC8A 3NWPA 4I1YA 1P0FA 1VKHA 4LQ4A 3RC3A 3KSBC 1ISGA 3D4LA 2XJ4A 1P2VA 3TD6A 2F48A 4L5CA 2VIIA 1ZA1A 4MQEB 4BNDA 3MGGA 1JHYA 1KO4A 4V0KA 5EY5B 3DLHA 1VG8A 3B9RA 1HXHA 2V7QA 2VLBA 3D54D 1DUIA 2GEDA 3HVKA 5F7ZA 5C3UA 3SYMA 5DNUA 4LNUA 2ZRQA 4G2TA 1K0FA 4CKWA 3DMTA 5A6SA 5KQPA 2Z6AA 4HY3A 2MMCA 3HCBA 3BXZA 3HWWA 3EASA 5IKXA 3PIIA 3PUXA 3PWTA 4HUTA 1XX6A 3AKCA 3GPDG 4NY1A 4K6HA 4PONA 5DCWA 1C3OA 2CLOB 4OHBA 1ILEA 2KM1A 4GWGA 2FXVA 2YIMA 4H17A 1KU6A 3S3TA 1YQXA 3AERA 1LZLA 3KHKA 1BGVA 5BMVA 2BFPA 3TJMA 2G72A 1V5GA 3A25A 4FCCA 3RVOA 1U9IC 4Q4CA 5K4GA 2GM3A 2RSLA 3G2MA 3G8BA 3H2HA 3MIZA 1PJZA 1N1EA 3WGMA 3CW2A 1W59A 1XCLA 1EFRA 1HI9A 1NXWA 1VIVA 2BEVB 2JAQA 2ORIA 2IXFA 2Q2NA 3M1AA 3R3YA 4HTFB 4IFTA 4Q3DA 2FN4A 4P86A 4RFVA 1AKQA 4KO3S 5KJFA 5H5JA 4U6SA 2V9PA 4Y1EA 1CNFA 5EPEA 3GLIE 4ZHQA 1IZ0A 1AXGA 2WV9A 4LGCA 2IBMA 2PKWA 4PPFA 3UJ9A 3OZ7A 4O4HB 3LCVB 1RYFA 2QN2A 1CC1S 4XOUA 3RUDA 3JX9A 4XGKA 2EF1A 5CEFA 1YBFA 3ZK9A 2G17A 3HCEA 1XSEA 3DMNA 1JKFA 3DO5A 3OJEA 4JLSA 4IIFA 4LGYA 2ONCA 5K0ZA 2PUCA 2B35A 1CUCA 3GPCA 4OX9B 1Y3CE 5GM1A 1VJ5A 2DBYA 4GFDA 8ATCA 4S2UA 4MV7A 3M1IA 4G86A 3STYA 2AMLA 3EHDA 2HTEA 5FBLB 4G36A 2BFEA 1YUBA 4JOBA 1XUOA 5CVVA 1BA3A 4EQ6A 1TUBB 3C87A 3IJRA 3KZMA 1RI1A 1XDBA 4MVJI 1PK9A 4QOHA 2I55A 4GXNA 3EVEA 3U3JA 1P17A 3VISA 1KFJB 2ZTVA 3Q7PA 2O4CA 3NIWA 4G8JA 1G3RA 1QP8A 1YKGA 3R5JA 3F9RA 4J1TA 3TQIA 2AR9A 3OF3A 4RH3A 3WISA 3JYQA 3OMXA 5IH3A 3IMFA 3LX4A 5BWNA 1OBFO 3D2BA 1FUIA 2CZGA 4MWCA 5AI8A 1TM5E 3QVLA 1WXFA 3WFZA 4FU0A 3EULA 4CMIB 3DDOA 2ZBFA 1A8HA 3GLQA 4NU8X 1IN6A 4KNVA 3MAGA 1FDOA 1ZN7A 4YV0A 4IIJB 4LRSB 1WOMA 2MTBA 1QIEA 4H3SA 4LY6A 1GDTA 3I2JA 1NJFA 5CBPB 1G21A 3SMVA 4Z0TA 1P7ZA 5G40A 2HNAA 3KK0A 1U7WA 3DZCA 2P4UA 1D04A 5AK0A 5K09A 3C3DA 4HGRA 2CVFA 4ND4A 1JA0A 1G8MA 4O0MA 1EG2A 1YO6A 1XN4A 3HBFA 2CDCA 1ZNWA 4DMKA 2JGKA 3UAYA 1HQYE 1QC5A 3MGAA 5LN1A 5TMEA 1E9EA 3B36A 3H2BA 2A3RA 2B8NA 4I1OA 1NRWA 4HPXB 4XSVA 3V4OA 4YYEA 421PA 3KR1A 4WKPA 4GDFA 1QZZA 1T2UA 4GSYA 5CXXA 2I3AA 3W1WA 4RJLA