3AKCA

Crystal structure of cmp kinase in complex with cdp and adp from thermus thermophilus hb8
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Cytidylate kinase
total genus 78
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akcA00
2JATA 4GNKA 3PV0A 1EK0A 1Z2CA 3CKLA 2IEYA 3GFTA 4XTCS 1W5TA 1ZC3A 3FE2A 2QPTA 2QAGA 5HE8A 2QP9X 4JLKA 3GP8A 2MMGA 5DHFA 1YZQA 3GLFA 4TTQA 5AJVB 4NBSA 5AJXA 1XDBA 2A2ZA 1J90A 3GLHB 1E9RA 1L8QA 2WVJA 2ZAOA 2IUUA 4GOJA 2YWGA 4XD7A 1F48A 2R8RA 5FPHA 1PLLA 5FR2A 5GJWC 3GJ7A 1COWA 1XFAA 4OQMA 1JQJC 3LRPA 1UKVY 4RJLA 3RNLA 4KSCA 2CE2X 1KHTA 2X77A 4BWYA 1U8ZA 4BUJA 5BYKA 5KNDA 4XVQA 1E2KA 1NMZA 5JSZA 1P62B 2JGNA 3GLGE 1UEIA 1X1SA 1ZINA 3IGFA 2P65A 2VP5A 1EFTA 2REBA 3WP1B 4ACAA 4PHGA 3IO3A 4XSGA 5DYGA 2IEZA 4RZ3A 5JJKA 3NBFA 1SXJB 2ERYA 3I72A 2ZS7A 3Q7QA 1OXXK 4PHFA 2OCAA 2ZUCA 3SN6A 1VCNA 4BLRA 3UMFA 2C8VA 2OLKA 4Q9JA 1NJGA 1RYFA 2NO9A 2N1BA 4R98A 2F9LA 1R4AA 4QM6A 5K8LA 2W2TA 3WYGA 4E03A 1KKMA 2ODBA 3CONA 4M1WA 3WMEA 4QKQA 1VHLA 2IYTA 1E9FA 3L0SA 4HYYA 3UANA 4KCGA 1L4UA 4I1OA 2GILA 3ZYCA 3VTKA 1XMVA 4JIMA 1DPFA 5DYIA 3B13B 4US0R 5FOUA 2V8OA 1S9DA 1ZU5A 1NBME 1UF9A 4A92A 4TLDA 4A36A 2ZPTX 1GDDA 4A6XA 2ZU6A 5ELXA 4Z8XA 5CYPA 5FOXA 3UMSA 3MFYA 3T1QA 2QMOA 1SQ5A 1E98A 1Q1ZA 4P0TA 1S1MA 4HSEA 3PUZA 3PITA 3FMFA 3CRVA 4M0LA 1T0JB 4CDGA 2HUPA 1IJFA 1N5KA 1U81A 4HUQA 1CS4C 4C4PA 3A36A 2ZRGA 4LJAA 4KXFB 5SZHB 4ZDJA 1N5IA 4HDQB 1YKSA 4TZ6A 4KODA 4LY6A 1G6OA 4OBEA 4BEBA 2GNOA 1N5JA 5DN6A 4LGMA 2ZYTX 4G5GA 3GMTA 3L82B 2KE5A 2WKRA 1GIAA 3Q72A 3MG9A 3AF0A 1H8HA 3FMIA 1NSTA 1F2UA 1TPZA 2VPPA 1WCV1 1ZVQA 1Z08A 1CTQA 4GFDA 1XPRA 3PEVA 2FGJA 4Q7KA 3RSOA 1AJEA 2OESA 1W2GA 4U00A 1RRGA 1S8FA 1X8LA 4HUQB 1A1VA 1S1CA 5C1BA 4IJMA 2GK7A 1E2LA 4ZI2A 2UZ3A 1Q3HA 1ZYUA 5GJVC 1ZC4A 2XXAA 2D7DA 4LSGA 5IF9A 4XVUA 1T9HA 3THWB 1J2JA 2JJ1D 2XJ4A 1IAQA 1ZU4A 4Q4AA 1XJCA 1PUJA 3ZJYA 1S96A 1AGPA 4IW3B 3THWA 3EA5A 4EIWA 1W49A 2Z4RA 4Z1MD 2KBFA 2BWJA 2G77B 3CPHA 4TMWA 2ZRIA 3I32A 1KTVA 5EP2A 4A0HA 1E2FA 4HB2A 3U4QA 4UQOA 3D8BA 1AS2A 2JDID 5BN4A 2ZRBA 1WMSA 3GFPA 1MRNA 3QXSA 5KDLA 3SJBA 2W0MA 4PQFA 2J0SA 2GXUA 2NTYC 1DAHA 3CH5A 2K5UA 4XWKA 2O8FB 2WBLC 2WWWA 4C0BA 3TUIC 2ZYVX 1JR3E 4Q48A 4TSFA 1RE0A 1JAIA 4CZ2A 1BYIA 2BCJQ 2QGNA 3FOZA 1OPXA 3AQ4A 5JEDA 2LKDA 5M04A 3CR8A 4KBGA 3HPQA 3KKPA 2HXYA 1EX7A 3ZIAA 4EUNA 4OHWA 1G5TA 2ANBA 2VA8A 2ZRKA 5EE9A 2FZLA 2SHKA 3A58B 2GKSA 2C2HA 4BECA 2VBCA 2AD5A 3K0CA 4Q21A 4GPTA 1CU1A 3C8UA 3K70B 4F4IA 2BDTA 2RAPA 3AUXA 4IEEA 2YZ2A 4U02A 4CW7A 3K9NA 4IDQA 2VP2A 3OAAD 2QT0A 2ZU0C 1JJ7A 3RS4A 1KI3A 1FQKA 3QKUA 4LHVA 3AP3A 1I4TD 1TF5A 3PQCA 1KDRA 4LYAA 4OK3A 1QHIA 2ZJYA 4TMTA 5CLQA 2ZRJA 1VHTA 1ZUIA 1IN6A 2CCJA 3A1SA 5CJPA 4DDWA 4BRUA 1DTSA 1NI3A 1JECA 5KSPA 5FL7D 2ZS8A 4Q1EA 2C98A 3IHWA 3OEHD 1W36C 1JR3D 3FMOB 4Q4JA 1XRJA 1SXJC 5FL7A 5JI2E 4XWAA 3UK6A 2VYFA 2WWFA 1SVSA 1TF7A 3ZVLA 5JBQA 1XJ0A 3CNLA 1F2TA 2AL7A 2WM9B 5EE1A 2J87A 2YVUA 3VU9B 3FWYA 4QBGB 5DO9A 4DUGD 3NHBA 2WV9A 3TSZA 3DHWC 4LZZA 3RS2A 1SZPA 2ZRFA 4WOPA 2I1VB 2WWGA 4LYFA 1ZM3A 3EX7C 4LHYA 1NNEA 4MDEA 5KDDA 1MO6A 4FXPA 3QVUA 4RD0A 2FG5A 4B32A 5J5CA 4PX9A 1AS3A 1D2NA 3ZLJA 1EFUA 1U8YA 1S9HA 1KNXA 2QI9C 2ERXA 3B5JA 1RC8A 4A8JB 2V1XA 1HYQA 1EESA 2P0EA 1XWIA 1C1YA 1WF3A 3WRYC 4M1YA 4D0LB 1S3SA 3GQBA 1FMJA 4IXMA 3E5HA 3CRQA 1OT3A 1RFLA 2RGBA 3KQKA 1IN7A 3LO5A 1JI0A 1LFDB 3K09C 4JVLA 1W44A 4C7OB 2ATXA 2H17A 3VAAA 1JXMA 2F43B 3V00A 4U5XA 4JLVA 5JECA 1VECA 4OI0A 4IDHA 1QHYA 4JL8A 3AV0B 4DLRA 1KDTA 1M2OB 1IY2A 1JQLB 3U60B 1EXMA 4E09A 4DB2A 3DL0A 2OFXA 3ZH9B 2MSCB 1G17A 2WJHA 2QUZA 2R2AA 1A5TA 3KZ1E 2R6AA 2F1RA 2NQ2C 3EZFA 3W8NA 3TVTA 3IIJA 2C9OA 1G19A 4TYPA 4YONB 4RD1A 3K70C 4W5HA 2H16A 3PEWA 2EU8A 2PCJA 2VHJA 3BRWD 5HTKA 1NF3A 2XAUA 2ZRLA 3EC1A 4NE2A 3RRYA 3LNCA 1P2UA 3M4YA 4LC1A 1ZM4A 4LX0A 3U4QB 3AVWA 1QVRA 1IOZA 1XTKA 1GRQA 2GJAA 5CB6A 2H8KA 4B71A 3NG1A 5CIWA 2F55A 2ONJA 3RC8A 4TTRA 4BFUA 4LCBA 3K0FA 2O0KA 4HAZA 1CBUA 3UXMA 1XF9A 3W5JA 2AXPA 2XNDA 3OIYA 1W36B 2YHSA 2X2EA 3F8TA 4LOAA 1DARA 2EVWX 4NYJQ 4A2WA 2BOVA 3SEAA 4Z1MA 1MRSA 3AVXA 1BMFA 1P9RA 5L3RA 2Q3MA 3PXGA 4M2LA 5FBRB 3PEUA 1KAOA 1L7VC 3VR4A 1N2CE 2IL1A 2HJGA 2IT1A 2O5VA 3JVVA 1QHGA 1Z6XA 2QAGC 1GSIA 5A5GA 5HZKA 4PQYA 4WW0A 3KUDA 2QL6A 1G7TA 5LD2B 4MRSA 3VR6A 3R9WA 1KI7A 2G9NA 1LF0A 1XMJA 3K0FB 4Q1CA 2FA9A 2ORIA 4ASUA 2PX0A 3TUJC 4DSOA 4MA4A 2P2LA 3SNHA 1QDEA 4AYTA 3AVYA 4WVFA 1ZRHA 4CEJA 1IQPA 2IHBA 3I73A 3B2EA 3DOEA 3MUFA 3FGNA 4AKGA 1W5SA 1BO6A 4WZAE 1JNYA 4URXR 4ZKEA 4FIDA 3X1ZA 4A0GA 1G64A 4WZBE 3H4MA 4DIDA 2C5LA 3CX6A 4LBZA 4O2LA 4X8MA 4YMUA 1KK0A 4YXWA 2ECKA 3NHAA 1AS0A 2PEYA 4XIGS 1SVIA 3VX3A 1P72A 4G1UC 1Q3TA 8OHMA 4V0ME 5FL3A 4YXWD 2V54A 2GHIA 3FKQA 2AK2A 4CF7A 2IXEA 4P31A 3BFVA 4DCSA 3O47A 2AHOA 4KLNA 5K8UA 1M7HA 1OXUA 3ECCA 4D82A 4O3MA 4Z8YA 3CX8A 2R6CA 1XEFA 1R2QA 4B2LA 3RVBA 1RVDA 3B7GA 3RS3A 4ABYA 4MDFA 1KDPA 4D2IA 1JEEA 1N0WA 1G8PA 2V6IA 2LKCA 1FP6A 3ZGXA 4UNRA 1XTQA 4GI7A 5CK4A 1KNQA 2EYUA 2GAAA 5KHOC 4PO1A 4V0KA 5FTJA 3IPXA 3UPUA 3ADDA 1U90A 2PZFA 2QG6A 1VYVA 1DO2A 2WAYA 1G7CA 3HYRA 2NO0A 3MWKA 1XMSA 3QOFA 4I99A 5E7MA 1KI8A 4Q19A 1X86B 4LUCA 3T12A 3BGWA 4LC0A 1XXHB 5DHAA 5GJBA 2ZSEA 3HU3A 3P4XA 3BH0A 4EPTA 4A0FA 2O8EA 2ZJOA 3SJAA 1NVWQ 3AUYA 2BBTA 1JR6A 3RWMB 4JVNA 3FTQA 3BB1A 4EQ6A 4ERNA 2O8EB 2PBRA 1UJ2A 1ZMXA 2X19A 3B6EA 3LWNA 1CR4A 4POAA 3QEJA 3GEHA 2OLJA 4W5JA 5KSYA 3BXZA 1JPJA 3CUEF 3N2IA 1E2PA 1D2MA 3QKTA 3M0EA 3TIFA 5BN5A 2A9KA 3Q5EA 3K9GA 1E0KA 1EWQA 4CRWB 4XJXA 5AJWA 2GJ8A 2XB4A 1VMAA 3B82A 1P61B 5EZ6B 4OI1A 3SU8A 1OXVA 5HKKA 1E2NA 1ZUHA 2G1JA 4HZIA 4URUR 2FNAA 4JYCA 4Q4HA 2KBEA 4AG6A 3U7EB 1F3OA 3CZQA 4JLJA 4PC7A 4M4SA 2OO7A 4LK2A 4TT3A 5JEEA 1T3LA 1KSJA 1AGRA 4LI0A 3NBZC 5DSZA 4FWTA 3AH8A 2I3BA 1WQ1R 4EAQA 1WE2A 2YWFA 4KLZA 4FCWA 4JT2A 1H8ED 4Y0AA 3BK7A 1G8GA 3U61B 2CJWB 4PHTA 1TQDA 1FPMA 5JWHA 4JBYA 1E79D 2IW3A 2HCJB 2OCBA 2WPDD 2XTZA 1K5DA 3V9PA 5P21A 2ZITA 4Z51A 4EPXA 1E79A 3PVSA 1EWRA 5CM9C 1Z47A 5FUWA 4MGZR 3Q7PA 4XD7D 3P4YA 4URZR 2CHGA 2FOLA 2GRJA 2H18A 4P3YA 1ESMA 1UADA 4AG5A 1KSHA 1FUKA 2EWVA 2RGCA 2JEOA 3HU1A 3GLHE 3T1TA 3CRMA 2DFLA 4HDOB 1HA3A 4AURA 4AYWA 1IONA 1HQYE 2HLDA 4TQAA 2Q0HA 3CM0A 4L9SA 5J40A 3B8HA 4R2HA 5EE0A 2P6UA 1E69A 2LWIA 3EZ9A 4DT1A 3PG5A 4IDOA 721PA 2ZM5A 5B57C 3V4RA 3PJRA 2J0QA 2KJQA 1UKYA 1P7CA 1KO7A 2GJKA 2ZRAA 4NMMA 1XD2A 3QBTA 4MYTA 1E2EA 4MQBA 5DI3B 1GRRA 2XOKD 4HLDA 1W2HA 4TQ9A 2ZJBA 2AWNA 2IF0A 3K8YA 3QPUA 1DG3A 1N3BA 1KZ7B 2A3RA 5L3SA 2IYWA 2DR3A 4RFVA 4S2EA 1P60A 1HE1C 1OIWA 4XOIA 4K46A 3I62A 3LDAA 1Z22A 1P4SA 4DHEA 1VCIA 3G5UA 4GMXA 2W83A 4DCVA 1FUUA 5AWFC 2FMXA 3EPJA 4CGZA 2Z4SA 3EPLA 4B34A 3BB4A 1OLOA 4QHTA 2VP4A 4LJ9A 4KVAA 1QHSA 2J46A 3OZXA 3FHCB 1V43A 2OE2A 1NLZA 2IXFA 5CLLA 1OB2A 1HE8B 4DSUA 1SVOA 5KU1A 4CEHB 1QHHB 3VQTA 2FFHA 2BM0A 2UKDA 1XPUA 4EJSA 3K1JA 1OYYA 1X8KA 3VMFA 4KFRA 3H2YA 3WHLA 4DDVA 5CJ2A 2NPIA 2QQ0A 3MAAC 3RWOA 4GOXA 1M74A 2PH1A 3FKSA 3RRMA 2HT1A 2FF7A 2WHXA 3I8XA 4PR0A 2CL7X 4M9XA 3K0SA 4QGAA 5CB8A 3FKSD 1RZ3A 4AKEA 3VX4A 2VTKA 1Q0UA 1DEKA 3OE7D 3K9LA 3MMPA 2ZE7A 3C5HA 4NCJA 1LNZA 4MGIR 2O8CA 4AYXA 4NZYA 3SHWA 3THXA 2OBLA 2IWRA 2ZRDA 2JDIA 4KU4A 3IBGA 3M6AA 2VRWA 1JB1A 3HR8A 4B3GA 1GKIA 4JLNA 121PA 5HE9A 3GCGA 1D9XA 1G3RA 4XH9B 2VLIA 5GVSA 1N25A 3TH5A 4LJYA 2BMFA 4DSTA 1NY6A 2PX3A 3RC3A 2WSSA 2EQBA 4B2PA 4DDTA 1U9IC 4MKGA 3C16C 2AWOA 1Q57A 1G291 5E3HA 5EUMA 2QROA 1KMHA 2JCSA 1KZGB 1MV5A 5A0FA 4EPWA 3IDQA 3IQWA 4O2RA 1UKZA 4ZIRA 3KL4A 4NYIR 3WYFA 1ZNZA 1P6XA 1MOZA 3EWAA 5EXTA 3AGPA 2PMDA 1G41A 3U6BA 3TSOA 3MRSA 3RS5A 4G5RA 5HZHA 1T3HA 2MMCA 4GP7A 4M21A 2P6RA 1COWD 4M22A 2ZE6A 2DWPA 4OHYA 1LTQA 3KFXA 3AVOA 3DZ8A 3DKPA 1LW7A 3TW8B 1VKJA 1Z6TA 2GESA 2QPAA 1R5NA 2ZS9A 4Q9KA 2H7VA 2B8WA 1YR9A 4DJTA 1KI2A 2CE7A 2GZHA 1CR1A 4R9UC 2WTUA 1PV4A 4UNSA 3K0CC 3CBQA 3ONWA 2C04A 4RY2A 2QRZA 5TARA 2ZSAA 2V1UA 3A1UA 1J70A 1E1RA 2FX3A 2RMKA 1XEWY 3AKEA 1H8EA 3EASA 5H70A 3DZDA 3VKGA 1G1MA 1UBEA 1UFQA 4H1VA 4IXNA 3QKRA 2GCPA 1RRPA 3AB3A 4TLBA 4D80A 1EFCA 3Q5DA 3FVQA 4UJ5A 1HEIA 3B1YA 4DUGA 5JRJA 4EFNA 2P6NA 2YINC 2IF2A 5JZVA 4JVSB 3QENA 3GEIA 4KSBA 4CT5A 2FE4A 3ND8A 1AZSC 2YKGA 4OQLA 1E96A 4CEIB 1ZM7A 1FOEB 2ZE5A 1M8PA 1XD2B 2KI5A 3U3OA 5A4JA 3EC2A 2X1VA 1XCMA 3LLUA 1OFIA 2BMDA 1KAGA 2ZUBA 2DBYA 1IY1A 1KO8A 2I4IA 3AVPA 4GZMA 5FOSA 2ZSBA 3QIAA 4C3ZA 4O0MA 2GETA 3IILA 5E7JA 1OH8A 3GJ5A 5E7IA 1FX0B 4X8OA 3FMPB 3SE0A 5JI3E 2QQEA 3B1VA 4JLAA 2ZRCA 1T5IA 4DIEA 6Q21A 1Z83A 3REGA 3W6NA 2VF8A 4QL3A 4OHVA 1AN0A 1TEVA 2E1RA 1DAEA 3L8ZA 3OFND 3PR1A 4JS0A 3UWKA 4BFWA 5KUTA 3U7FB 5EP1A 3ZZ0A 3I4LA 3P27A 3GLFB 4F91B 1GUAA 1VG1A 1NN5A 1N6PA 1IN5A 2Q21A 4TMXA 4JLDA 4L8GA 1ZP6A 1YRAA 2PL3A 4OYHA 3WNDA 4W5WA 3MWYW 3W9YA 3I5YA 1D8TA 2W6ID 1X1RA 2FGKA 3UG6A 2WJGA 4M1OA 2A5FA 5G3ZA 1Q22A 1VG9B 3BFXA 1KO4A 5SZIA 3B1WA 4LJ7A 1R0XA 3NBYC 3FFAA 2F1JA 3WBKA 1NLYA 3A1TA 4G5OA 2ZI9A 1Q20A 3CF6R 5BN3A 4TYQA 5FBVB 3SBEA 5L3VA 2IS2A 4WXPA 1YJ5A 2DCUA 1WBDA 4W9MC 2BBWA 2G0NA 3HJNA 5FI1B 1EFRD 1R5BA 1S2MA 1IJEA 1Z06A 3H86A 5L3QB 3A8TA 4MH0R 1UBGA 5SZKB 1OKKD 2BKEA 4RSGA 5TV2A 4MYUA 1XEXB 3FYHA 2ATVA 4LYJA 3E70C 1OKKA 1LVGA 4D6PA 1XEXA 2AN9A 4JT4A 4PAMA 3U44A 2R6DA 5CIQA 3SYLA 1BMFD 1Z0FA 3O8CA 4PC3A 4NHOA 4Z54A 1H8HD 4KFTA 4TL7A 1R0WA 3CF2A 5G53C 3O8RA 4C0QC 4JLOA 2OBNA 3PUYA 5CDFE 5JLJA 1NVXQ 1U9IA 1VYTA 2CK3A 4Q1AA 3VU9A 2J0VA 3ZD6A 4UNNA 3NIBA 5DH9A 2EW1A 3N5CA 4Q1BA 4LBYA 1G3IA 5FH9A 3KDSE 3K9HA 1Z6GA 3D31A 1GVNB 1E1QD 1CJMA 3K70D 4M1TA 3AP2A 4TMVA 4RZUA 2QMHA 1A82A 1E1QA 4AY2A 1LS6A 1DBSA 2YWEA 4NONA 1W47A 3I8SA 3SJZA 4KVGA 3ASYA 3P20A 3S1AA 1JBKA 2VP9A 4JL5A 1RPZA 2QP3A 3TJZA 1GTVA 2XB2A 5BYJA 3LQQA 4HB4A 2P67A 1D6JA 1O87A 2BVNA 2CLSA 1RJ9A 2ZETA 4M8NE 3WY9A 1KIMA 3CB4A 3FB4A 4KJZA 2F6RA 2QTHA 1RJ9B 3IUYA 2QRNA 3R8CA 2XEXA 3H84A 2Q9AA 1LY1A 1Z3IX 3NXSA 3GLIA 4FMCB 5KDOA 3X1DA 3DPUA 1YHNA 5D3MB 3DEFA 4MRRA 2OAP1 4PANA 3SOPA 2CLCX 4IEIA 1WP9A 3QXJA 4CEIA 4EDHA 1P2VA 2GK6A 4QHSA 1U98A 3GJXC 5D3MA 5EE5B 1II9A 1KOFA 2XXAB 3A4NA 2A78A 4TQUS 4RFSB 1P2TA 2RHMA 4RD4A 4WXRA 4B75A 2PMKA 3W3AA 1ZIOA 2YOHA 3CPEA 3LW8A 1GKUB 2X2FA 5F3WB 1M34E 1NJFA 3LA6A 3T5DA 3LBIA 1RRFA 5TVKA 1WBBA 3GLIB 1YZUA 1ZCAA 4C0LA 3BH6A 5KO2A 4US2R 3EIQA 1U8AA 2VQSA 3UKDA 2QP4A 1KDOA 4QJ4A 4BZXA 2O8BA 2J0UA 4IFBA 2EWWA 3W3ZB 3K09A 2HYDA 3NC0C 1W0KA 4N0DA 3L0PA 1CF4A 4FMBB 3GEEA 3ZVMA 5FOWA 3P26A 4QJ5A 1XD9A 4QC2A 1KK1A 1NKSA 1TL7C 2F9MA 3ICQB 4DC9A 1P2SA 3THOA 2UVQA 1G7RA 5BQ5A 2VHCA 5KTYA 2CHQA 3EG5A 2JLUA 3QEOA 4GRAA 4Q4AB 2GBLA 2OV2A 3K0AA 3TSWA 3EXAA 2ANCA 5CITA 4DDUA 1G20E 5FUYA 2GCNA 3FPAA 3RHFA 1SVKA 1CJTC 1UKEA 2UZIR 3JZAA 3W34A 2PT7A 4US1R 1AM4D 1DADA 4PC6A 3OFNA 3RLFA 5CDFA 1KI1A 3T34A 1TUEA 4L15A 4ZCMA 1HTWA 2NO1A 1X3SA 3ASZA 1UM8A 4BFZA 1MT0A 4OQNA 3UATA 4BQSA 3LX5A 4JKYA 2VH5R 3VR1A 3QQ5A 3F5FA 4MYHA 3HWSA 4KO8A 2DYKA 5EXPA 2EFCB 1XPOA 1XU4A 3IIKA 2A5JA 4RCYA 2XX3A 1ZNXA 2VSOA 4RZXA 521PA 4BLPA 2ZUDA 2FPKA 1W48A 4XTRA 3SC3A 1K6MA 4URYR 1ZCBA 1MO5A 4QBHA 2GJ9A 5DISB 1WB9A 4HAXA 221PA 3B1ZA 1KSGA 1AKEA 2HF8A 4LHWA 3RYTC 2QTFA 4PAOA 4P4TA 4NYMR 3GJ4A 1DO0A 1GWNA 1OF1A 4IHQA 3UG7A 5KSOA 5H8WA 1P9NA 2XTMA 4YC7A 4FMDB 3ZZUA 3OESA 2VSFA 3OEEA 2GEVA 3UMRA 2D7CA 1PVOA 3B85A 3W6OA 1E0AA 4GMDA 3LLMA 4I1SA 1US8B 4Q9HA 3ZDQA 4ZI3A 4PQRA 4FN5A 3U3KA 5AUQA 4EFMA 3PFIA 5FOVA 1TQ6A 3RANA 4MUBA 4TL6A 3R9XA 1CKEA 2FPMA 1AQYA 1R0ZA 3TBKA 1FNNA 1LB1B 4C9BA 3VKWA 3BS4A 3TUZC 2XOKA 2RGNA 1NG9A 3G82C 4OHZA 2JLZA 4A82A 2CBZA 5G3YA 5EP4A 2GXSA 3QJYA 3T35A 3S1AB 1X6VA 2CK3D 5EJEA 1YVDA 1KY2A 3THYA 1YE8A 1DELA 2GAOA 2YOFA 2NZ8A 2WWXA 5FPKA 1US8A 3CWZA 4YMTA 4AD8A 2W0SA 1HY3A 1N6NA 1TAGA 2BMJA 4LPSA 5FOTA 4DEXA 1GRNA 1U2RA 3ZZTA 4OJQA 1T6NA 4IRUB 3T61A 5B64A 4A1FA 4DLXA 1Z0AA 1DG1G 2WICA 1XZQA 4V02A 3SFVA 1TTTA 1SULA 2D2FA 4YMSA 2ZJ2A 1E9AA 1OV4A 3NKVA 4FCTA 1YZGA 2NO6A 4BFXA 1DAKA 1TNDA 3FDIA 3HR7A 1ZM9A 1E0SA 4A8JA 1W0JA 2AFHE 2XTNA 2ZJAA 4R71A 1KYIA 4PPFA 1TQ4A 3LY5A 2QSYA 3B60A 1R6BX 3PUVA 1WDTA 2J5XA 1OHHA 1W0JD 1W46A 2RCNA 5J4LA 2JLXA 4I81A 3CZPA 3VR5A 4M9ZA 1K5GA 2WOOA 3R7WB 3AKCA 1W4BA 4LDJA 1ZJ6A 1Z0JA 3AVVA 3D7MA 3JZMA 5DIFA 1CXZA 4C0AC 3MJRA 3KTAB 2J0UB 1GKYA 3SQXA 4HLUA 1ZM2A 1JR3A 1P75A 4KFSA 1E2IA 1P9WA 1ZD1A 5JS7A 1TU3A 1D5CA 1SGWA 2FPLA 3LVQE 3MWLA 5FTKA 1N6RA 2RGEA 2W6JA 1CEEA 1II8A 2JA1A 5J4HA 4WAUA 5DLQC 1NN1A 4BEJA 4OQFA 1ZNYA 3T1VA 1E2HA 2IK8A 4GDFA 4TL8A 1J99A 2W58A 3IEVA 4MRVA 4TL9A 2ZRNA 4HAVA 3TQCA 3CIOA 1Z0DA 4DLZA 1H65A 1AZTA 1OXTA 2CCKA 2FSGA 2BMEA 2PCLA 1C9KA 1VDZA 4FWIB 4PC1A 4Q5IA 3BJIC 4FMCF 4MYCA 4PTLA 3AF4A 1TADA 3J81k 4YDHB 3U7GA 4JKIA 1WRBA 2J9RA 3QF7A 3U6KA 3I3SR 4WA7A 4Q4HB 2D4HA 4B35A 5ANRB 3QXXA 1NKTA 5JWRA 4JSTA 4PO8A 3GLGA 3BE4A 4BFTA 4ZCIA 3TQFA 4PFSA 4UNPA 5IK2D 3W90A 2D06A 1EGAA 1VCMA 3U3MA 1PLKA 4RD3A 4OHXA 2QY9A 4L9WA 2C03A 4HAUA 4DB4A 3ZD7A 2GF0A 2BJWA 1VCOA 2AKYA 2QE7A 4LWZA 2FZ4A 2V55B 4NYIQ 1SKQA 2WKQA 3L2OB 4Q7MB 1GNPA 1XNJA 1E2JA 2AFIE 1Q1QA 3MWJA 4K81B 2ORWA 4N1AA 2GVZC 2N42A 4ZV4A 5DN6D 4CIDA 2YWHA 5BWMA 2C77A 2J7PA 4IOMA 3MSXA 1AQUA 2H1LA 3QG5A 4LJ5A 2J7PD 2FSFA 4M1KA 2FN4A 1CLUA 1W7AA 1FNMA 4UJ3A 1YZTA 3RS0A 1CIPA 2P5TB 2Q9BA 2ZI4A 1NY5A 2O0JA 4Q7LA 5EQTA 2ZI7A 1JXOA 3H1TA 2VIIA 1BH2A 4TLAA 1DS6A 4DLWA 3HPRA 1OW3B 4C2UA 1KY3A 2PZGA 1NBMA 3T1OA 4HB0A 2IYRA 4QBIA 1ZUNB 1IM2A 4H9GA 3OIUA 1PZNA 2WSMA 2ZI5A 4I1UA 4JZKA 4KAXA 5FBQB 4DLTA 1C4OA 5B2ZA 1D9ZA 1R8SA 4DCTA 1FP7A 3CRRA 4PHHA 5G40A 5KOYA 3GLIE 2V7QD 2B21A 1KJZA 4ILEA 4FINA 1S4QA 3SHFA 4CEHA 4PZZA 1J8YF 3AF3A 2C9CA 3B9QA 2ZR7A 2ZVPX 5AUOB 1S3GA 4AI6A 2BHRA 1F60A 3W6PA 3IHLA 1E2MA 4B48A 2BM1A 3CLVA 4NH0A 1Z29A 3QKSA 3A6PC 2OT3B 3TNFA 3GFOA 4HATA 2FH5B 1FFHA 5BXQC 4FD2A 1E0JA 4BZPA 5G41A 1Z63A 1RRCA 2NO7A 2Q3HA 3EA0A 2D3WA 4V0NA 5JFGA 3QPVA 1U99A 3DMNA 3U2QA 1BIFA 1NRJB 2QZ4A 2NOAA 3PUXA 4YDSA 2V4ZA 3LAWA 1UDXA 3A4MA 3PENA 4N0EA 2PLRA 3R7WA 1LV7A 4A8JC 2VHTA 2B7CA 2RHDA 4NDZA 1DAGA 4PZLA 3SS8A 3KUCA 4B2IA 1E3MA 3L8YA 3T15A 4PSKA 4M9QA 4D0GA 4A2PA 4EJSB 2VHQA 4ITRC 2A5YB 2C78A 2GCOA 3HP1A 1JALA 2J1LA 1U0LA 3C15C 3PEYA 3OAAA 1OJLA 1WA5A 1E2DA 5EXXA 5F98A 4YQFA 1YR8A 3A4LA 3BB3A 1OHHD 2ZR0A 1UPTA 3KXLA 3X1WA 1M7GA 2I1QA 2J45A 2OHFA 3NWJA 1KKLA 1F6BA 4RKFA 4UNQA 1MABB 2V6JA 3GJ6A 3Q85A 4ZIRB 2J7KA 3BWDD 4ARZA 1XZPA 2FFQA 2ZVQX 3MCAA 1NG1A 2O8CB 5C46F 4WBSA 1I4DD 4BLQA 4BE7B 3LBHA 2FWRA 3GLFE 4A0RA 3QXCA 4ARZB 1T5LA 1OXSC 1E9EA 4ZO4A 1G7SA 4HDCA 4URWR 5AJZA 5FBWB 4N3NA 4DBLC 1QHXA 1A2KC 4HAYA 3CW2A 2ZANA 1W36D 2HJVA 2AD1A 1E9BA 4M1MA 1MR3F 1NP6A 2GF9A 4PZYA 4IVRA 2WSSD 1NIPA 2WOJA 4IOKA 4TMZA 2XSZD 3KJGA 1QBKC 3FHTA 4KHZA 1D2EA 4ESHA 1HH4A 4ZCLA 1YU9A 1R7RA 3KKOA 4JLBA 2YNMA 3SJCA 2QSZA 2ZSDA 2JIZD 1T3SA 4BFYA 1QVAA 4B73A 4QGFA 3TMKA 2H57A 2ZREA 4M53A 4B44A 3RAPR 4MKFA 2CL6X 3HYTA 1NIJA 3VFDA 3VKHA 1G8YA 5JRZA 5DGXA 1BS1A 4AIIA 3AM1A 1P73A 1ONBA 3EZ7A 2CDNA 4GBMA 4L4UA 4NL4H 5EE3A 5HR5A 1SVLA 3G0HA 1LF5A 4II7A 2Z6VA 3QG1A 4X8HA 1P5ZB 3LXXA 3IO5A 4I1VA 1G4AE 1RW4A 2BEKA 1FL9A 3ZQ6A 3BAFA 5IT5A 1NSFA 1N6KA 3IPYA 2WWIA 1W4CA 4RD6A 3H0KA 1ANKA 4QGHA 1OSNA 2ZJ8A 1E1RD 3B1XA 2ZTSA 3SZRA 1XB2A 2WWHA 4DLYA 1Y63A 2IWHA 4BPBA 5KPJA 5AK0A 4MGYR 1KK2A 1M7BA 4D4KA 1SHKA 4MGKR 3OIVA 4TTPA 1MKYA 4EJSC 4GT1A 1NN0A 1E2QA 4NPHA 1HQCA 1AKYA 2QT1A 1U0JA 3PUWA 2GJSA 5KSZA 1K8RA 2ASEA 5CYOA 1SXJD 1SVMA 3WRXC 3LQRA 3DMDA 4NYMQ 5JHGB 2FDCA 4IDNA 5AJYA 4OK5A 5L3QA 3VR3A 4Q02A 3MD0A 2OM2A 2OEPA 5CK5A 2WIBA 4P4UA 4JMPA 4OKSA 4HAWA 1QHNA 2ZEJA 2ZYWX 4ON9A 1W4RA 1YZKA 2GWHA 5EP3A 2FV8A 4P4SB 4TMKA 4KFUA 1KMHB 1B23P 5C4GB 1Z8FA 2NG1A 4BGDA 2FSIA 4BLSA 4XWOA 4LHXA 2PZEA 3WMFA 2E87A 2QAGB 4PPNA 4E07A 2OCYC 4LYHA 1DAIA 3TK1A 1G5RA 1GM5A 1EX6A 1UBFA 3A1VA 4ZKDA 3CNNA 5FPTA 2J3EA 4W7SA 1W1WA 2IYUA 1FTNA 1TUIA 2G3YA 2WJIA 1SKYB 3AP1A 1GNRA 4MKHA 4PPGA 1CRPA 3EZ6A 3R8FA 1ESNA 2YOGA 5F2EA 5BW8A 1NLFA 1Q21A 4A6PA 3WYAA 3L43A 5JCPA 3SR0A 2DHRA 3W5IA 4NKRA 4K8OA 5FFMA 1U94A 1CP2A 1W0KD 2BC9A 4Q9IA 4V0LA 2NGRA 4JSYA 3QXHA 3BORA 3KJEA 4Q47A 2IHYA 4LBWA 4B6EA 1GAJA 3KKNA 2O8FA 4HI0E 2QA5A 4ZPXA 2HYIC 3EARA 3HU2A 3AKYA 2H92A 1NMYA 1M1YE 3RRNA 5FUXA 4AWXA 1EFHA 4S35A 2FJUA 5JWOA 1GOTA 3QNUA 5C18A 4IFEA 1ZBDA 4JLPA 5JSZB 4TT3D 1G4UR 1IN4A 3OEED 1GL7A 2BCGY 2NPFA 1OFHA 3I61A 2D2EA 4DWJA 3N2EA 2XZOA 2JJ1A 1OB5A 1DAFA 5FI0B 4BZQA 3NEYA 2BBOA 2ZQ5A 4BLTA 4NP6A 1OH7A 1GZSA 4DSNA 1XTJA 1KK3A 2MSEB 3GJ3A 1A2BA 3AGQA 3UIEA 2WPDA 1MO4A 5LB4A 4TZ0A 2HDNB 3KB1A 3OE7A 4QBFA 4NU0A 3EPHA 4Q9LA 2A5DA 4DRZA 1X8JA 4UXIA 4I4LA 1FX0A 3AVQA 3EAQA 2QM8A 2ZE8A 2BBSA 2JLRA 1F2UB 2JASA 1TU4A 4HEJA 1BYUA 3LXRA 5DNYB 1W4AA 2XSZA 1KO5A 4Q4JB 1L4YA 2GTPA 2ORVA 3OHMA 3QUSA 3TE6A 3MLEA 1AA9A 2AK3A 2FEOA 3SBDA 2JLSA 2HLDD 2IS1A 2OAQ1 3ZIAD 2IBMA 3X1XA 3P1JA 1E2GA 1G18A 1Z5ZA 1G8FA 2KSQA 4B76A 1Q12A 5KNCA 5LPNA 5C4MA 4C7OA 4NYJR 1KI6A 1KMQA 3R20A 5LB2A 3VNUA 2R9VA 4JBWA 1S0UA 4A4DA 5IRCD 1KJWA 3BD9A 4C0JA 2WMOB 3KQNA 3QVVA 2OSBA 3CWQA 1G9XA 2OXRA 1KI6B 3AF2A 4HLCA 4AC9A 4EFLA 3DOFA 4R7ZA 3ICEA 4Q7JB 5HKKD 3VNVA 4B3CA 5TB5A 1TF2A 421PA 3DKVA 4QOSA 1T0HB 2P5SA 2Z0MA 2HXSA 1XMIA 4DLUA 1TQ2A 3E1SA 2V9PA 2CXXA 4EPVA 5H1YA 2ZR9A 4RFSA 4OI4A 3R9IA 4D0NA 3TR5A 2F3RA 3OF5A 1E9DA 4H1UA 4QGGA 1J7KA 3N70A 3PIRA 4IOLA 1N0VC 1DVRA 1Z0IA 5GVRA 4LHZA 4C0KA 4YMVA 3GJ0A 2RGXA 2FU5C 3LFUA 2ZJ5A 4MKIA 5HPYB 2VSXA 2F1IA 2ZRMA 3KKQA 5EXSA 1FW6A 4KI0A 3AKDA 3C4JA 5HCIA 3CPJB 4P4SA 3MGCA 4IDPA 2O8BB 3Q8XB 4NCIA 3WHKA 2ZIAA 5DE3A 2AKAB 4D25A 1P3JA 4FI3C 3KXKA 2JLYA 3M1IA 1A4RA 4GZLA 2A30A 1Z0KA 2AX4A 2B7BA 2DFNA 2RH5A 3IQXA 3B9PA 1G21E 4NCNA 3SI7A 3VHXA 4QNMA 4V03A 4RD2A 3ADBA 2QM7A 3SQWA 2EFDB 4L5BA 4UXJA 3ADCA 3KB2A 3NDBB 3WP0A 3L0OA 5TY0A 1ZAKA 4FW9A 5C2JB 1BKDR 3BH7A 4B3XA 4NCHA 2IX3A 2WMNB 2ZI3A 1YQTA 2ZI6A 3LH5A 5JJIA 2GDJA 1E99A 1JEDA 3DM5A 4A9AA 2ODNA 4QJ3A 1RIFA 3ZS8A 1AK2A 1NMXA 1XBTA 2W2VA 1E4YA 2G88A 3CX7A 3V4FA 4DZZA 2O8DB 2QU8A 4LPKA 2CCGA 1N6HA 3U44B 3WNBA 1GP2A 2E9SA 2L0XA 2NIPA 2OBMA 5E4FA 2IYZA 3SFZA 4B74A 2AR7A 4LJ4A 4LJ6A 1SXJE 2GBLC 2QMEA 1CJUC 4PO9A 1AIPA 1IHUA 4KYIB 5LDDC 1VG0B 4J0QA 4ESVA 1DOAA 4D26A 1V5WA 3NEJA 4TLEA 4B3DA 2RGDA 2YC4C 2ZYUX 2Z43A 4PPQA 5IHPA 2OXCA 3F3YA 1QZXA 2GXQA 2QENA 3BC1A 3WXMA 2R44A 4B3FX 1VPLA 2W00A 4JYBA 4G5SA 1Q1BA 4U7DA 1T91A 2OILA 4GOKA 1XTRA 3NVAA 2W6IA 3KQLA 4CT4B 2CNWA 2NZJA 4ZDIA 2VEDA 1ZD8A 4MRPA 2CEAA 4PSAA 1G3MA 3X1YA 3FFBA 2C95A 4XSHA 2CNWD 1NVVQ 3AEZA 3HDTA 2AXNA 4OI2A 4RKEA 1IXRC 4G5QA 4Y0VA 3THYB 4Q1FA 5UKDA 2WIAA 3CRW1 3QI2A 5FTNA 4RZ2A 1PLJA 3EIHA 4JJKA 1OIVA 1XX6A 3KX2A 5LBIA 1E9CA 2GZDA 1XP8A 1GFIA 1UEJA 4PAQA 2CMKA 4M1SA 3O8DA 4WZ6A 5IK2A 4D81A 1II0A 2RGGA 1UAAA 2F43A 2XJ9A 3EPKA 4EPYA 3P32A 4TLCA 2IYVA 3SYKA 2VL7A 2R65A 5GADl 4TN1A 3RSLA 4B6FA 2QEQA 1F2TB 4F4CA 1UBCA 5FR1A 3GD7A 5L8VA 4CYMA 1FZQA 4TYNA 1N6OA 3IBYA 2B92A 5E95A 3LD9A 1Z28A 3D6TB 4Q00A 3T06B 2FFBA 1HV8A 3C41J 4MRNA 1IXSB 2FFAA 4ZDWA 3K0AB 5J4YA 1PJRA 4OQXA 1M6NA 3I1FA 1NVVR 2C9YA 4OL0A 2O0HA 2PLFA 4ASUD 1ZNWA 4BASA 3LW7A 3BFKA 2IYXA 4C0HA 2CLDX 3LVRE 1FMLA 1CR0A 2ODEA 3NC1C 4M9SA 2XZPA 2IS6A 3C5CA 1Y3AA 2B6HA 4HZUB 5F9HA 2WJYA 2IYSA 1ZIPA 1XXHE 2YYZA 3ZS9A 1Z2AA 2QNRA 1I4LD 1MH1A 1IXZA 2XNDD 3W8RA 3WBJA 1EG7A 1FQJA 3EW9A 3NH6A 3RRZA 1II8B 1E32A 2J59A 1E4VA 5JHHB 1XXHA 4BFSA 2C99A 2QPOA 1KO1A 1QRAA 3CR7A 2R6FA 2ZSFA 1ETUA 5LD2C 2ZJZA 5B58C 5KNBA 4C2TA 5JCZA 2Q9CA 1PUIA 3KQHA 3NH9A 4WIAA 3SDZA 1R0YA 2FEMA 2X8AA 1G3QA 1GITA 4R2IA 2JJ2D 5TXGA 4EPRA 1GILA 1QG4A 4C30A 1J8MF 4HZUA 4TSFD 3OEHA 2CJWA 4F7WA 1U0HC 2VHUA 3ADKA 3C7KA 3QF4A 2BIFA 2G6BA 2PT5A 1NL3A 5FUVA 4DEYA 621PA 2IYYA 4BFVA 2YV5A 5D3QA 3QF4B 5JMTA 3PCRB 1JPNA 4LV5B 4D4JA 5FPSA 3GLGB 1OYWA 3K0EA 1KI9A 4CVNA 4X8LA 2GEDA 2F1HA 2YC2C 4QXAA 2V3CC 1G16A 2RB4A 2Z83A 4HLUC 3REFA 1G5PA 1BOFA 1XCGB 1LS1A 4TYWA 2XNSA 1E94E 2O8DA 2OFWA 2ODWA 3CNOA 4MITA 2WAXA 4DCUA 1FTSA 5FTMA 1I2MA 1Q1EA 2HT6A 1Z6AA 3AVUA 5FTLA 4DT1B 2OZEA 1OH6A 1NN3A 2HEIA 1ZD9A 1JAHA 2DFTA 2HV8A 2NMVA 3TRFA 2YJTD 2BJVA 1N6IA 2IYQA 3I92A 2GXAA 4F93B 4KV9A 3Q9LA 5L3SB 1XEWX 1XCPA 3DM9B 1XTSA 3TAUA 1YR7A 2HCBA 4LJ8A 4UKDA 3WMGA 3EZ2A 4FCVA 4AK9A 4JLMA 1CR2A 4TWZA 4Q18A 1B0UA 4B33A 2IYLD 3LBNA 4BRWA 3KJHA 2JAQA 1R10A 3FHOA 4Q03A 4DVGA 2IXGA 5H68A 2WWYA 2WKPA 2Q6TA 2PJZA 4CEJB 2QORA 1OFTA 1Z6YA 4Q4LA 2QGZA 1GL9B 5DI3A 2J41A 1E6CA 2JIZA 3KFVA 1GG2A 3SYNA 3Q3JB 1UDWA 2KB0A 2XGJA 2HF9A 2GEUA 2DWOA 3QPWA 4LBVA 3UWOA 3KXIA 3QSYA 2XZLA 1F5NA 2CHVA 3EIEA 2IS4A 3BIFA 2W2XA 3RABA 5J47A 3DVLA 4Q66C 2JJ8A 3F0TA 2F3TA 4EKDA 1G3UA 1TEXA 2OFOA 1WXQA 4DLSA 1HT2E 1YZLA 1VTKA 4HB3A 1N0UA 2GVDC 1OFUX 4QM7A 3EWSA 2PJRA 2GCOB 3T5GA 1YZNA 2XITA 1R8QA 1EFRA 4XVRA 1T4GA 1QF9A 1YR6A 3U3RA 1YRBA 5AUPB 1XTIA 5CM8B 5TDHA 3L0IB 3D3QA 3U3JA 2DY1A 2IUSA 4DXAA 1TMKA 2WZQA 3ETLA 1Q44A 4JJZA 3RS7A 4DKXA 4G0NA 3A37A 4ZDKA 3TAHA 2QBYB 4NTZA 1VIYA 5J4KA 1N5LA 3A1WA 1O3YA 2QE7D 2OCPA 1VYUA 2BV3A 2CVHA 1E9SA 2V7QA 1T8UA 3GLHA 4AKIA 1I2DA 1IN8A 2FSHA 3GJ8A 821PA 3IEUA 4L16A 2ZROA 2BEJA 4EQ6B 1HUQA 3CF0A 1GNQA 1ELOA 4YMWA 2CVFA 2C96A 3QKSB 3VR2A 3KTAA 2EYQA 3IIMA 4O25A 3ZVRA 3U5ZB 4LRWA 4F38A 3I5XA 1VIAA 2Q3FA 5KPDA 1G8HA 4JL6A 2ZXUA 5EUQB 4C0SA 1MABA 3ZVNA 3O8BA 4Q01A 2BKUA 4RCZA 4V0OA 2QBYA 5J4VA 2JLWA 3BBPA 4UXHA 3BOSA 1CJVC 1SXJA 5K8TA 1NBMD 3NTUA 2A7QA 3LV8A 1DAMA 1JJVA 2ONKA 4QFMA 2IC5A 3AVTA 1XD8A 2VF7A 4KITB 1N6LA 1R5OA 2D62A 2A5GA 1DE0A 2VP0A 3TGPA 3VHLB 3TLXA 2EFGA 1ZW6A 2QN6A 3B78A 1KJYA 4G01B 4E5UA 4P33A 1SHZA 3TKLA 2EFEB 2VP6A 1KGDA 3E2IA 1OIXA 2REXB 4JVMA 1A7JA 4BLOA 3TW4A 4KYUA 4G3XA 4IVQA 3WNCA 4FMDF 4DLVA 4HUTA 3CO5A 3KQUA 3KJIA 4KBFA 4MUAA 4JBXA 3GPLA 3ZQJA 1RKBA 2VO1A 2GZAA 5K8IA 2JJ2A 3TVDA 2LCFA 4B47A 4PSVA 4A2QA 2D74A 2QTVB 5GJCA 4AKHA 1ODFA 1VG8A 3JVUA 4B43A 1HURA 5SZJA 4ACBA 2MSDB 3BERA 1HT1E 3QY0A 2N46A 2QMUA 4PXAA 1T8TA 2G1KA 2TMKA 3AF1A 5HCNA 2ZAMA 3C14C 3MJHA 1MO3A 2KWIA 2G83A 4QNRA 4YLGA 2OG2A 4P32A 4IKEA 4D4LA 4OK6A 1SVWA 2QAJA 5FBLB 4GL2A 2Z5FA 1OH5A 3LX8A 4D4MA 1QG2A 5JJLA 4NCKA 2F7SA 4F92B 2RGNC 5FPYA 5JS8A 2W6JD 2REOA 1KSFX 2DFKB 4V0MA 1CRQA 3RDPA 2EFHB 5KYKA 1IY0A 3CH4B 4QG7A 1NVUQ 3KKMA 3QKRB 3DDCA 3NDPA 2RKOA 2OUKA 3QBVA 4QHYA 5AR1A 3X2SA 2R62A 2DWQA 2ZRHA 1KI4A 1RYHA 2R6GA 1SKYE 4IVPA 5DI9A 4E22A 3OIWA 3U7HB 5EZ5A 1XJQA 1IBRA 3K53A 4DCNA 2WJVA 5IDVA 5F9FA 3ND9A 4Q1DA 2JLVA 4OJKA 3TR0A 4TYYA 1L2TA 4HLQB 4A15A 1G6HA 4LV6A 2RGAA 1OE0A 3IKJA 3NBXX 2DB3A 4B3BA 3QE0A 5TMPA 1TX4B 2ZRPA 1CJKC 3THXB 2IA5A 4GSYA 2Y8EA 2PEZA 4LV8B 2B8TA 1CULC 1GL6A 2CL0X 2G0TA 2O52A 2IUTA 5B30A 3DO6A 1Z07A 4GP6A 4QRHA 1QHHA 4F4JA 2P3SA 4IOJA 4RVCA 2JLQA 2DPXA 4PC2A 5AUNB 4URVR 2H5EA 2GA8A 2WJJA
chains in the Genus database with same CATH superfamily
1PJ2A 5FWXB 1SXHA 1ETHA 4DCOA 1IPFA 2XIQA 1W5TA 1ZC3A 4RTKA 3QWAA 4G0PA 5IAAA 1OTYA 2QAGA 2OSVA 1QP0A 5HE8A 4BE4A 5F52A 2MMGA 1NJ6A 2X5NA 2O2YA 3I39X 3RGGA 4YRNA 1SXQA 3IP8A 5E2IA 5EJ4A 2A2ZA 1V6AA 2WVJA 3PGA1 2ZAOA 4FBLA 3NGMA 4BO9A 2WHQA 3ENZA 1F48A 4ESEA 2VHVA 1PLLA 1U80A 2XT6A 1WCYA 3GJ7A 5GJWC 1W94A 4QQKA 1JQJC 3RNLA 3NW9A 4KSCA 2AOUB 1LPAB 2R6ZA 4WZAB 5DEIA 2ICAA 2V6BA 4PZAA 1UODA 5TPWB 4CM4A 4BQEA 2K4MA 2JGNA 3AFGA 5IUNC 3FI9A 4XRRA 3PTLA 4C7KA 1PZGA 2PVPA 2CDAA 3GRPA 5EIOA 4ACAA 4FOPA 2Q5QA 1GGVA 3IO3A 4NDNE 4Q24A 1JIJA 5A9SA 1K0UA 1MF7A 3FTNA 4FOSA 1GFWA 2JHCA 4LFCB 1L4BA 5JJKA 2DPYA 4Z4QA 1F8YA 1A5BB 3EXFA 4PTZA 4QULA 3NUQA 4ZHQA 4WINA 3SN6A 3QYJA 4OI0A 5JAHA 1XYVA 2J9GA 2Z2KA 4DLBA 2CV0A 2C8VA 2O07A 1TFUA 3DXYA 4Q9JA 1RYFA 3VPBA 2YRXA 4ZT5A 1R4AA 1H66A 4QM6A 4HT3B 3L7YA 5K8LA 4TT8A 3CJRA 1F9AA 4B1FA 4DIMA 4U2BA 4ZQIA 2FPWA 3FBWA 4IIFA 2R4TA 4PTYA 3W0LB 1NYTA 2J6BA 3Q4GA 1FP4A 5HIJA 2A0XA 2NYAA 2YXBA 1XRLA 5A4IS 2BN4A 3D1LA 2Y1EA 3IR5A 1JGTA 4HWSA 2C9BA 5FOUA 1LCIA 5B6IA 5K0BA 4MUYA 2A7XA 3RYFA 1CD5A 1S9DA 1BGVA 3LXMA 1XL0A 1NBME 1UF9A 1YNOA 4P54A 1QYRA 3C70A 1QK5A 1RE1A 1YCGA 2ZPTX 5L7TA 5CUQA 2G67A 1BG6A 2QX7A 2ZU6A 1B74A 1P91A 4MTCA 1O1YA 4LVOA 4LGYA 5FOXA 4CR7A 1NMSA 3HFGA 5BR4A 1SQ5A 2VK8A 4MCIA 4YI5A 1V7QA 3UUEA 3C3WA 4P0TA 3W5VA 2HQOA 1F8XA 3JXEA 3TIGA 3EVTA 3MQFA 2IYOA 4Y9TA 1JG7A 4O5AA 3CRVA 5J63A 1J97A 1T0JB 2BTQB 2PYDA 2HUPA 4MUXA 4CDGA 3M6XA 6PFKA 1SEVA 4JP5A 4C4PA 3ST7A 3JTMA 3GVIA 1VJTA 3AEUB 5EKTA 5LOVB 4ZDJA 4OH7A 5ETJA 1BQEA 5KWIA 2X7XA 3VSDA 2EKZA 5F1PA 4JYAB 5DWDA 4LY6A 1ZWKA 5K0FA 3HKBB 3OIFA 4GZ5A 4IIXA 3TD9A 3ZV5A 5CDSA 1FIUA 2HL6A 1GL3A 2IODA 3GMTA 3OHPA 2R8PA 1UMBB 1V35A 2KE5A 4FILA 4IJQA 5C32A 2WKRA 2Y2VA 3Q72A 1TZJA 4FYVA 4JI5B 3VTAA 4C20A 1YD7A 1TC1A 1E1KA 1F3LA 1H8HA 3W77A 1IZ9A 1MQAA 3BIOA 3JWGA 4PONA 1FUEA 1ODLA 4ZYXA 3KWMA 5HGXA 2MDTA 1WCV1 5KVVA 1CTQA 1UQTA 3O4RA 3ED1A 4MVWA 1FK8A 4BC0A 1EGMB 3TXAA 5FO0A 1S8FA 1X8LA 3EA4A 4DE5A 4RJ2A 4NE7A 1FFBA 4R4JA 1CX9B 3HO1A 3JVIA 3AYZB 2A0UA 3SDSA 3ND5A 4BRZA 1T9DA 2PQ0A 1R6UA 3V33A 1ZYUA 2CMFA 4N3CA 2O3RA 5GJVC 3GU3A 3JVEA 2D7DA 4Y9RA 2AV6A 3KQQA 4JD5A 1GNVA 1TIBA 3WLAA 4BTLA 4J2OA 3HQ4O 2JVIA 1IAQA 2XVZA 3R5FA 2HOQA 4F56A 2I1LA 3RBAA 1LDMA 3ZPXA 1ORDA 4X0EA 1P1BA 2KBFA 2BWJA 3CPHA 4KQCA 4M0EA 4TMWA 3I32A 4FP9A 2UUAB 1E2BA 2BFAA 3BF8A 4ZOBA 1KAQA 1XCLA 4P35A 3RIMA 3SWWA 1AS2A 1W34A 1B73A 2JDID 2O5CA 1E8MA 3GFPA 1WMSA 3QXSA 3C8DA 3WWCA 4H3HB 2J0SA 4POOA 2F64A 1FDIA 4CNBA 1NV9A 1ZK4A 4FYPA 1ZSVA 4J6EA 4IXDA 4NFSA 4AN4A 1VLJA 4MPJA 3ZGZA 3KOUA 2ZYVX 4Q48A 3RYCA 1PFKA 4NPCA 3E3AA 3E0XA 1JAIA 2Q1XA 2XWPA 5BOSA 1BYIA 2QGNA 1YJAA 1OPXA 3AQ4A 3NEAA 4LZPA 4Y1FA 3PGVA 5ED4A 3ZW9A 3P8ZA 1L7DA 3M3PA 3CR8A 2OQRA 3HPQA 4L6IA 1V7PC 4MDYA 4NBTA 4NARA 3PQEA 1GPH1 4XYBA 3ZIAA 4BE9A 1TCBA 2JBAB 3LSTA 2ANBA 2DHEA 3PTAA 3WFZA 5T8KC 5JSQA 4IUBS 2C2HA 5HGJA 1H2EA 2AD5A 2VBCA 4K6FA 3LDHA 4JJGA 4GPTA 4MVJD 2YWBA 5LZ9A 2XRMA 5FNVB 3AUXA 1QOQB 3ZWYA 1MX1A 3LSYA 2J3DA 4YT4A 3PSAA 2B2CA 4P0PB 4IDQA 1OROA 1H2BA 5KTPA 1GPDG 4J8PA 1OI2A 3MWGA 1JJ7A 2BP7B 3FAZA 4N6GA 3RS4A 3IPCA 1FQKA 4BTEA 2YFYA 4X3PA 4DADA 1I4TD 3PQCA 1PWXA 4DJDC 3FHLA 5FI3A 1HDCA 4LYAA 4OK3A 3OLQA 1D1TA 2ZJYA 5CLQA 2ZRJA 1VHTA 1FRVA 5ECYA 3ZHQA 2WAOA 5IM5A 1ULBA 4H7KA 3S8EA 4XWWA 1DTSA 1NI3A 1JECA 3GGGA 5KSPA 5KVQA 3BCSA 4S1PA 1XLVA 3OEHD 5D2CA 4QATA 3PT5A 3BL5A 1TOAA 3TBHA 1K1EA 3WSVA 1FP4B 5JH7F 1SXJC 3ZGVA 3P0JA 1PWYE 2FSPA 2NU7A 2FZ5A 3FPFA 2VJPA 4XWAA 3Q0EA 4YIKA 3UK6A 3OQOA 4KMRA 1SVSA 1JQKA 4WASA 1VIMA 2L42A 2SBTA 3CNLA 4DQUA 5C5CA 4NCBA 3DLIA 3QMPA 3QW2A 3ZHTA 1FSZA 5EE1A 3I01A 2J87A 2YVUA 4J75A 5EMLA 4N47A 4G0UA 1PV2A 4DM4A 1AXRA 1LBHA 5HDQA 3DHWC 3M4XA 1M2HA 3ZJ5A 4W5NA 4TUYB 3DDUA 1ZOPA 3GRUA 3SNKA 5CDYA 1M6YA 1RQNA 2WAMA 3AXSA 4ZC8A 4LHYA 1D4AA 3R5HA 4MDEA 2GERA 2LDBA 2A0YA 2HR1A 1LRJA 3RW9A 2F17A 2CL5A 2VQ6A 2R6R1 2FG5A 3ZHZA 1A7KA 4B32A 3CV3A 3QV1A 4Z9YA 4DJEC 1DC8A 1MNQA 3ZLJA 1OFVA 4ALNA 1PHPA 2QTRA 3OJEA 2Z56A 1OBVA 1U8YA 1FTWA 2F90A 4EWLA 3M70A 5AJHA 3WDKA 3WADA 3WLRA 3BJZA 3IOBA 4F4UA 4A8JB 3EHEA 3AETB 3NBMA 2F8TA 1XWIA 2HA0A 2RGYA 2QQGA 3OWXA 3WRYC 4BB0A 4JROA 4NENA 5IWCA 2C8LA 3BFJA 3WRVA 5BNZA 3UTDA 1IN7A 1OYVA 3A05A 3WIVA 4Y9SA 1LFDB 1ODCA 3AW8A 1NW9B 4UU1A 1HLGA 1WXIA 1W44A 2JCVA 5D5PA 2RH9B 2W93A 4C7OB 2F43B 2HU7A 4TTTS 1WKBA 3TBFA 3V00A 4Z3OA 3INRA 4DDTA 1BU5A 1GPMA 3CLUD 4GPBA 4NQZA 4ALIA 1KARA 3B3GA 5T4HA 1M2OB 3DBOB 4H7JA 1VPTA 2ZQZA 3U60B 2E0IA 4E08A 1U3VA 3DL0A 1MN6A 4R6XA 1LLUA 4Z53A 2E5LB 1TT5B 1A4XA 4QSMA 2ZJ7A 5AK4A 5IU6A 5JY1A 3IOCA 1A5TA 2R6AA 3EZFA 5C1PA 4N0MA 1QQAA 1ZR2A 2ZWPA 1BWPA 4KLAA 5TEWA 4HNUA 4Z4IA 1LZLA 3SC2B 3K70C 2MIIA 3ZYZA 1NJ5A 4E5YA 2A0WA 1JEJA 3RI3A 3RTEA 4NV0A 2VHJA 4HGQA 3HA2A 2ZRLA 3EC1A 2FQXA 1NWHA 2G63A 4NE2A 3RRYA 3EMBA 1P2UA 3LWBA 1F14A 1ISFA 4CFZA 2WT4A 4ISCA 3WI7A 3BMNB 3IQZA 5L40A 1UMDB 2CN1A 3RTAA 1CJCA 1J8QA 4MZDA 3LPMA 3VZSA 3MEQA 3BXOA 5CIWA 2J5QA 5IDYA 3O0TA 3RREA 1CBUA 1XF9A 3W5JA 3WDMA 5G0TA 1FZTA 2XNDA 3OIYA 4J3NA 3LT5A 4CL3A 9ABPA 2X2EA 3F8TA 2Z9CA 3HVIA 4Z1MA 1HDEA 1MRSA 2DQSA 1B8OA 1M6VA 2OCDA 3AM4A 3KM0A 4O2BA 5L3RA 3INNA 4JI3B 1RHUA 4M2LA 2B1IA 4ARAA 2BM9A 1Y8RA 1VKRA 1HMPA 1JSRA 3JVVA 1IVNA 2XBLA 3Q7SA 1ADCA 3R5KA 3WLFA 5KNDH 1Z6XA 5ISMA 2R84A 5KDDA 2Y4OA 5HZKA 1GN9A 1WB5A 1VL6A 3K8ZA 3A3PA 4WW0A 1DIHA 2QL6A 1JDTA 5LD2B 2N75A 3OE4A 2QD4A 3F6SA 1L5GB 4IV5A 3QBDA 4JR1A 1RZVA 8GPBA 3CE6A 3SICE 5LZ2A 2EZ9A 2QRJA 3SSNA 4YT2A 3VYRB 4EGAA 4ASUA 4L0QA 4ZJUA 4DSOA 3Q15C 4IX9A 4MVJI 3K70B 1Z34A 3BDIA 2A57A 1QDEA 3I2HA 3V4ZA 4BQFA 4WBNB 5E1DA 1YI0A 1ZRHA 4JQZA 1L4HA 5AI5A 4P83A 2DTXA 3I73A 1XZKA 4D57A 1I6MA 5LNK1 1YONA 4WZAE 3ZDFA 4DDKA 3BHMA 3F9RA 4A0GA 2Y0DA 1Y42X 1WDWB 4RDXA 2C5LA 3CX6A 4LBZA 3TTSA 1YQUA 4G9BA 4II3A 2BSAA 1A72A 3NHAA 2PEYA 4QEKA 3KQTA 3VX3A 2Y2UA 1GPAA 1OAOA 3FFTA 3FKQA 2GHIA 4TS1A 2AK2A 3ZHXA 2YS6A 4P31A 4F5ZA 3QGMA 4RVHA 1ZCJA 3DULA 1K06A 4KLNA 2HK9A 1OXUA 1JLHA 2TMDA 3IAXA 4HC4A 6AT1A 1FX1A 2WM3A 3G17A 3EE6A 1R2QA 4B2LA 4WLOA 3EEOA 1PSWA 2ZTHA 3W7VA 2WQZA 3E23A 5CT9A 1L4LA 3JD4A 1KU0A 4N9QA 3D3WA 3G1WA 4MDFA 2XGGA 3BXEA 3UB3A 1KDPA 3MYYA 4DV5B 3LU1A 3ZZMA 4N48A 5DGTA 2JVJA 1BCSB 4XYGA 1SURA 1S3IA 2PXHA 1KNQA 4AF8A 3SAJA 4DPMA 2QN8A 2GEBA 2QVZX 3ADDA 1U90A 1YK0A 3UMVA 2PZFA 4Z2AA 1J4AA 3EDMA 4F21A 1EEHA 1T2VA 3GUZA 2NO0A 3AY0A 1XMSA 3MWKA 3QOFA 5CNIA 1NW4A 1Y9EA 4Q19A 4TPKA 4DZTA 4R83A 1S01A 5CLHA 2C3OA 1R9GA 5DHAA 1PBNA 5A5EA 4TZTA 5CXSA 2BT4A 4L9AA 3SJAA 1NVWQ 1XN1A 3IAM1 3P0IA 4HGNA 1SHUX 1U3CA 4JVNA 3RWMB 1UXJA 5EIBD 2O8EB 1A0OA 4I4CA 1LZKA 2ECFA 4WXEA 1ZMXA 2AQIA 2X19A 4EARA 5JC1A 4MMXB 4GH5A 3KELA 3ZX4A 3EF1A 3MBKA 1IUNA 4POAA 2Q5IA 1K88A 4HVTA 2C7QA 4Q4DA 2HPVA 4ZRDA 3BXZA 3N2IA 1JU4A 4DMMA 2GN8A 2HC9A 5BN5A 5IEBA 1E0KA 3K0KA 1MFPA 3ZDEA 4CRWB 4PBTA 1E5XA 2GYYA 1DRVA 3AUAA 4QBTA 3TL3A 1T5HX 3AEXA 1ZUHA 4HZIA 4MIYA 2I6GA 2O3TA 2OYRA 4CTNA 3TO5A 1VFNA 3LBFA 2QRVB 2XB8A 1PJBA 2IPLA 3IVCA 4OYLA 3U7EB 1F3OA 2NSJA 4PC7A 4XPIB 1OXKB 1QM5A 4TT3A 3ZDAA 5KREA 3GRKA 3BRQA 3OO1A 4CM9D 5LYJA 4JI4B 4YALA 3WFJA 1HZZC 4DR3B 3BBLA 2I3BA 4Z0NA 3VJMA 2C29D 4R81A 1C0IA 2CHFA 1NASA 1WE2A 2Y1WA 4FCWA 3X44A 5LYJB 2WABA 4Y0AA 3BK7A 8ATCA 4MGHA 3BQMB 2EV9A 4OXNA 4X85A 1NOIA 4ZU3A 1OU4A 1DFGA 4PHTA 4URHA 1CVRA 5TX7A 4OLAA 4AJKA 4JBYA 3DMFA 4OX9B 2XTZA 2ZITA 3DC2A 4AKSA 4YB8A 2UVPB 4EPXA 1QH8A 4Z7QB 1QRDA 2QNBA 4QPDA 4R2KA 1X3LA 3KVRA 4BEWA 3OQMA 5FUWA 3G0OA 4G81A 4MGZR 2WUFA 3OTHA 1IIBA 3M6MD 3Q7PA 1O94D 1F1JA 4LYGA 1ZSYA 2CHGA 1XUOA 3M33A 2FOLA 3EXHC 4L4YA 4P3YA 5CPFA 2PUFA 3HU1A 1J5EB 4PO3X 1X1DA 1ISPA 3CRMA 1UP6A 2DFLA 3GFFA 3KTFA 4F8EA 3WIBA 3SKYA 1HA3A 2A9RA 4B84A 3VZDA 1H6AA 4OX9Y 1O4WA 3O7MA 3S29A 1JG4A 4TQAA 5U4XA 3TRHA 1I2AA 3UMMA 2GAIA 3B8HA 5EE0A 2Z30A 3EZ9A 1E69A 4O1IA 1QWSA 3QUQA 1QCYA 3DWFA 2Q7XA 2PRIA 3O9MA 2D2XA 3PG5A 4GZ6A 4NMHA 4EMSA 3E2PA 1E9VA 1RBYA 1KO7A 2YFQA 1QQ5A 1VLLA 2ZRAA 3EOAI 4NMMA 4QASA 5EJIA 5FUBA 5K1ZA 1TRKA 1E2EA 2XQIA 3S0JA 2O5RA 5H7XA 4RKQA 3HVJA 1W2HA 4PR3A 4TQ9A 3K6JA 2AWNA 2ZWAA 1N9KA 2NW6A 4R8KA 1NW5A 1PT9A 3B3QA 3UV6A 3WISA 3LC0A 3KAKA 5SY6A 4S2EA 4CN9A 1HE1C 3C3XA 1IB0A 3CXRA 3K1AB 1BFDA 5K0EA 3CY6A 3I62A 3B6ZA 3LDAA 3ZHUA 3A9CA 1VCIA 4CLEA 2ZIZA 3QVWA 1UZLA 1PR3A 2OLEA 4GI1A 3U9LA 3RODA 4DCVA 1M67A 3TFWA 1FUUA 1U1EA 3EPJA 1EUCB 3QA9A 4MI9A 4RMJA 2HJRA 5EIFA 3R6GA 3AEQA 3T9AA 1B8UA 4LXUA 4UHDA 4YAEA 2ZDGA 3LZ6A 5JVDA 2I2WA 5JR3A 4ZQEA 1IMOA 1WXFA 1XP5A 4R7GA 4Q3AA 3IVGA 3OZXA 3ZE1B 4MP3A 2OE2A 1O8CA 1M2NA 3IBFA 4OJNA 5AQEA 3ZHBA 3OZRA 5HXAA 1NJ2A 3JATA 4PFJA 1OB2A 4ZYVA 5A9TA 1NONA 3TFQA 4JYPA 3VQTA 3AKZA 4NEHB 3EXG1 1OJ7A 1HEUA 4R2LA 3ZKWB 2YY6A 4O4IB 3NNDA 1UOEA 1NE7A 1OYYA 3GYBA 1RBZA 1SPBS 3SP1A 3IQFA 1BCRB 1QX3A 1QIMA 4N5DA 5TT0A 1J0CA 2TMYA 2QQ0A 3RWOA 4BGVA 2X4GA 9LDTA 2HT1A 3AY3A 2FF7A 2PWZA 3FZNA 4NICA 1B14A 5CB8A 2O2HA 3FKSD 3L6UA 4HQNA 5TLSA 1A9XB 4PWYA 1I14A 1T34A 2OD9A 2QW1A 3C5HA 3S2FA 2ZTUA 3USES 2ZB4A 1LNZA 3S8YA 4AYXA 1BJRE 3O5AA 2AJ8A 3TGWA 3KYCA 1R0RE 1XDWA 5DK4A 3LK6A 4KU4A 3TRDA 3IBGA 3M6AA 2QZZA 1Z56C 5K3AA 2O3QA 1JB1A 5DHPA 1QV6A 2QX6A 4JLNA 3PUIA 1B00A 5A6SB 3SLKA 3GCGA 1G3RA 4IHJB 3TZHA 2XUHA 4EHHA 4ZK6A 1A4IA 1IRIA 2VLIA 3H7AA 5GVSA 1N25A 4KR6A 3TH5A 4JFAA 3EGXB 4LJYA 3QVSA 4TKUB 2WSSA 1EPUA 5TVGA 4B2PA 3FYCA 3WIEA 4QNNA 1Q57A 2VRCD 3G1UA 1MDFA 1G291 1W59A 4DSAA 4KQEA 5I3ZA 5INTA 2QROA 4JT9A 3U48A 3WK7A 5KQMA 2H5IA 1RI1A 1QMPA 4ID9A 2JCSA 1MV5A 1GVHA 2JAUA 5GTDA 1H22A 2O2EA 3AO0B 1QC5B 4I0WB 4BV3A 3MHTA 3EK2A 2YQ4A 1SXPA 1OBFO 2MU1A 3EWAA 1P1RA 2LV8A 4OAPA 3AGPA 5CVCA 5EXTA 4KPUA 4L22A 1G41A 3BIWA 1TFRA 4MVJG 3DXFA 4HNHA 3TSOA 4MR8A 2F3UA 2JGEA 2EQAA 4R2WA 5G2OA 2GRUA 4M22A 4QOFA 5AKGA 3N3AC 5HCUA 4Y18A 2VQEB 1SBIA 1Q91A 1XDGA 3AVOA 1Z16A 4BAGA 4IG4A 1NDUA 3EQ7A 4F92B 3SPXA 1E6WA 4TROA 3MW8A 1VKJA 1AUQA 5LQCA 2E49A 2J9YB 4X1YB 4D9NA 4JNKA 4HQ6A 2XUZA 5DLEA 4AIRA 1UH5A 2EFJA 4DJTA 3OF2A 1ZGZA 1GQSA 2GD1O 3DAPA 1UBOS 1NU8A 1P6UA 3CBQA 3ONWA 2FFRA 4RY2A 1ISIA 2QRZA 5F3DA 3UHPA 2V1UA 2NVOA 3KKZA 4BUZA 1OWPA 2XWJI 2RMKA 2HSJA 3OQHA 2VDPB 3EASA 3VKGA 4JQSA 1UFQA 4H1VA 4IXNA 5C35A 3DB2A 1EP1B 3AB3A 1C3EA 1E7SA 2OGWA 4GMFA 3IDZA 5AHXA 3DXZA 3SC6A 3KLPX 3HXPA 2F48A 3OPQA 5CT6A 4LIPD 1M0TA 3IHKA 3CF4G 3CRNA 3L7JA 1PWHA 2P6NA 3F7MA 4QOEA 3T7JA 4EBBA 3L0DA 2F9FA 5J5VA 1GG8A 2DAPA 2ZZNA 4EY3A 4CT5A 2FE4A 3D4OA 4QAJA 2Z3VA 3NHZA 1ZM7A 2X6TA 3TN7A 4NPAA 1G9SA 1WV0A 3RYFB 3EC2A 2X1VA 1ZN2A 4ER7A 3WB9A 3OOHA 1WMFA 5HF6A 5B4TA 5I7VA 3MC1A 2ZSBA 4L5YA 1L5VA 4ND5A 4B5KA 2GETA 4ZV9A 3I6QA 4KNVA 1I0IA 2QLMA 4YAOA 4DLLA 4HN2A 3GJ5A 1SRQA 5E7IA 3NYIA 1O54A 5JYBA 1SOUA 3GG9A 1K9SA 3GLUA 4QTTB 3NM6B 1R0SA 3D5TA 3QSGA 4HMOA 1CDZA 2ZRCA 3E35A 4JLAA 1T5IA 1MJGM 1BE1A 1LA2A 5DGCA 3WX0A 1NNSA 1J5PA 6Q21A 5KYUB 1D09A 3JTEA 4U2GA 4HQRA 3NPAA 1QXSA 1JDPA 1DAEA 1R4MA 3L8ZA 1RWPA 2F67A 2RHLA 3PR1A 2Q6IA 3GVCA 5KUTA 1L3IA 3FLBA 3WRWA 3ZZ0A 2GD0A 2Z6AA 4BYGA 3F73A 3QVGB 3P27A 1WZUA 3RSCA 1GUAA 1O6BA 1VG1A 2EFYA 2BI4A 2VFAA 5U1PA 2RHCA 1TCAA 4OBXA 4EZIA 5AKLA 3TYXA 2QJTA 2GHQA 2D1YA 4GBGA 2PGJA 1LI4A 2W6OA 3SEQA 1EBUA 4CODB 3ISVA 4FGUA 4X71A 2YHIB 3NM5A 1C9EA 1Q6YA 5BR1A 5MF6A 1KXJA 1Y3CE 2P3QA 5MFPA 2R7NA 4YCNA 3I5YA 1I3OA 1VLHA 4KKXB 3TTUA 4CU2A 1HT3A 3UG6A 4M1OA 3UBTA 1CUEA 1RWVA 5GOTA 3ZBPA 1J33A 4U6SA 4ZZIA 3KLNA 5G3ZA 3SZMA 3HO8A 4I9GA 1AK1A 1KO4A 2HDHA 3DDWA 4IDEA 5JSFA 4QT0A 1JZSA 1QO0A 1R0XA 3HDJA 3NBYC 1L1FA 4BVGA 1NLYA 3L7BA 4G5OA 4JP2A 4YHBA 4Y2YA 3EBLA 4Y98A 4K9LA 1QF7A 3QU7A 3JYHA 4UM9D 3B53X 5IKEA 5FNVA 3W4JA 2XKAA 4EDFA 2DCUA 1NV8A 1T5DX 3KE9A 4ALJA 2BBWA 3R8XA 2R68A 1FFYA 1R5BA 3W79A 1D04A 5L3QB 3A8TA 2P6PA 4RWEA 3DMRA 4WOJA 3H3XA 2DJIA 2EX1A 4MH0R 4IO1A 3TDMA 1LRLA 4OJMX 3TKYA 2UAGA 5A6SA 4MYUA 1XEXB 3HBLA 3RPEA 4D8TA 1EP3B 1RHJA 2YW9A 2FWIA 2ZBEA 4HV4A 1LVGA 2XYQA 4XDGA 2WAAA 1XEXA 1XOIA 1ZQ1A 4GI3A 1UK7A 4R5MA 1ZVJA 4JT4A 4PAMA 4B31A 1Z39A 2FK8A 5CIQA 1X14A 3EW7A 1Z0FA 1D07A 3CQ9A 5IT4A 1PWEA 4CV3A 3P9RA 4Z54A 2C00A 1GZ6A 3CF2A 4BVEA 1TB4A 1KMIY 1YNSA 1T1GA 2CHUA 2FW6A 3ODPA 4EHBA 5JFOA 3DBRA 2FY8A 5JLJA 5IJ9B 4MWDA 1NVXQ 1VYTA 1CF9A 1WG8A 2CK3A 5G4KA 4C3VA 3T3MB 3ZI0A 1HE2A 1QV7A 3ZD6A 5EJAA 5DH9A 4FFNA 3FB1A 2GDZA 4HBZA 3CNEA 2B82A 1G3IA 3AXTA 5FH9A 2Q2QA 3RUPA 3DBLA 5IN4A 2Q07A 1NT2A 3PXEA 4K1LA 1U5CA 4M1TA 1OWMA 1AGYA 2JLBA 1FYDA 2VI5A 5F4BA 1GY8A 2QMHA 4MHSA 4HDNA 1VE7A 3QWFA 3GAZA 2XVAA 3B8EA 3WB1A 3PRYA 3JZIA 4F8YA 4KVGA 4DPKA 4DMCA 3P20A 4MUIA 2VP9A 2D1FA 3H6KA 4JL5A 4PZ9A 2YJNA 1GTVA 3HKBA 3LBYA 4WMLA 5BYJA 2FR0A 1P4AA 1XF1A 2P67A 1W96A 2RHJA 3ETDA 4IICA 1O87A 2E4UA 1RJ9A 1WPXA 3WY9A 4KJZA 3CB4A 4RO0A 5KTRA 2GD6A 1SC4A 3ISJA 5ENDA 4ZJZA 5M7EA 1QNFA 3Q2IA 1RJ9B 2FPIB 3EDRA 4D6XA 1WCWA 4YRKA 5JATA 5D7NA 2XEXA 1M2WA 3BHJA 4D45A 4CIBA 3DMYA 3FETA 4UUMA 3BT7A 1GYQA 4RF5A 4IUDS 5B58T 1LY1A 3E84A 3NXSA 4Q12A 3GLIA 4I2VA 1PR1A 2CJXA 4KV7A 2FSVC 3FSGD 3DOUA 3MZ0A 3N9IA 3MRXA 2FR8C 4MRRA 3SOPA 2CLCX 3UB2A 5EJ5A 1JLMA 1PBTA 2EX4A 2YWJA 1QANA 3CUWA 1GZVA 4CEIA 5JBNA 1P2VA 3OFSA 1NXPA 1MJHA 2ZJ0A 3GJXC 4NBUA 1CK4A 4RADA 2CB9A 3DHYA 5EE5B 4ZVUA 5L7YA 4I46A 1BN7A 2GEJA 4KAJA 5LYYA 4F7DA 1U0GA 1ECGA 3FCOA 3RYIB 3VZQA 5FWAA 3FUTA 4WXRA 2WM2A 1N8NA 1RVV1 4X1IA 2C7OA 3IMCA 1M8KA 1ZUD1 1GKUB 2H00A 3FROA 2VNAA 3WGUA 2YN4A 2C5AA 2XIJA 1RRFA 1UBMS 1TM3E 1YBAA 3LBIA 1GNSA 4XASA 2OHXA 5AKKA 2FEKA 3OY7A 5BWNA 4WNAB 2VUHB 3QPCA 4C2BA 4PLZA 4AMGA 1PEDA 3TPZA 1VQ1A 2FOIA 3N05A 2J0UA 3T5TA 3WL6A 3W3ZB 2PX8A 2ZJ6A 4L51A 1X7XB 2HAEA 4TVSA 4N8SA 4O4HA 4FMBB 3A6HA 4N6OA 5FOWA 1CF4A 3VGJA 1LJUA 1Y1SA 1KZ4A 2JIBA 3P26A 3NOVA 4QC2A 1KK1A 4PZUA 3S55A 2DOKA 3IMKA 5K8CA 4EVQA 1V8BA 2R00A 2ZAYA 2PSFA 4DC9A 5BQ5A 4QDOA 3S2ZA 3HLKA 5KTYA 2JLUA 1CJBA 4W7IA 1DEAA 3TSWA 2ANCA 2ZVJA 1T6ZA 1G20E 2VJNA 3IQDB 3RHFA 1CC1S 3CINA 4L02A 2BHNA 4L07A 5DYTA 1LFAA 1K27A 3JZAA 4MQEA 2BMVA 2H7CA 1M2GA 2LD4A 2PT7A 5A5FA 1VC2A 1R50A 4PC6A 4ALMA 5CDFA 2G17A 3QJGA 2BR4A 4FFMA 1YT5A 4NG4A 4NJMB 1X3SA 1WZIA 1F4PA 1UM8A 2X8BA 3EMDA 3GMIA 4OQNA 4EG4A 4H77A 3HXTA 5I9SA 2VH5R 3VR1A 3QQ5A 3F5FA 4R84A 1DLJA 5EXPA 2DYKA 3P9PA 2OZPA 4TM8A 2EFCB 2EG5A 1EAYA 3HADA 1XU9A 3MT7A 3AB8A 4J1NA 3OCUA 3ZWPA 3JQPA 4JOSA 1XPOA 2D7JA 3G8BA 4BV2A 2FSVA 3BCUA 2HRBA 1NKVA 2JGAA 4LXIA 4HWTA 2IXTA 4RZXA 5B12A 1H2FA 4DL9A 1FDUA 2BRUC 4GMKA 2ZKLA 3PVCA 4BNKA 5IDQA 5LZ4A 5E1OA 2QTAA 4CUZA 4OL9A 1HRDA 1IDN1 1MO5A 1MB9A 2GJ9A 3WWPA 4I5GA 4DGQA 4F5EA 1FNBA 4YVFA 3L5KA 1NRIA 3UHOA 4W7HA 4B7AA 3B1ZA 1LQTA 2AG6A 2PBLA 3ZKAA 1Y5IA 5DOVA 1VJGA 2HF8A 3OCYA 5K4GA 2UZ0A 3NTQA 4DM7A 3AR9A 4PAOA 5BPFA 2Q62A 3G02A 3AR3A 3S27A 2C4TA 4G56A 3PC3A 5IKOA 4KGVA 4FMDB 5JJCA 3OESA 4FSDA 4X90A 2FW9A 1Y9AA 2R97A 4M99A 1VJ5A 3H8WA 3FUUA 1Y8CA 3B85A 1D5WA 3KJZA 1S3FA 3LLMA 1NXTA 1X7GA 3G79A 3O3CA 3ZDQA 4PQRA 3C4VA 4FN5A 1H05A 2OC4A 2X7JA 1MENA 3EHDA 5FWNA 3PFIA 1Y9ZA 4JU9A 1K97A 5FOVA 4DNOA 3CPSA 2IELA 2IW1A 4MUBA 2QRLA 1JIIA 1R0ZA 2ON6A 1LB1B 3WKBA 4AZVA 1M0EA 1X7DA 4H17A 3BS4A 4R01A 5IDWA 3L4KA 2Y99A 3O1LA 3G82C 4OHZA 1J42A 4A0QA 1D6MA 3QIVA 4A82A 5CHYA 5G3YA 1R64A 1PDVA 4EYKA 5EP4A 4F3CA 3BAZA 1ISSA 1QCDA 3PHLA 3R3YA 2BY4A 3T35A 4YX9A 1YVDA 4FKZA 4P3XA 1CDOA 1LX7A 1VB3A 4WFIA 3U7IA 2XLCA 1DELA 3W2FA 5BV7A 2YOFA 3MXOA 2WWXA 5KWEA 3F7NA 4U9IS 3OLYA 1US8A 5FPKA 2WZCA 1UXIA 1MVNA 2XYHA 4AD8A 1YIOA 4HDKA 1TAGA 5FOTA 4UW9A 2A1TR 1JSZA 3AZOA 3DCNA 3NTOA 4IRUB 5D86A 3T61A 3UOGA 3Q88A 4DLXA 4L6AA 5AXAA 2WICA 2WK1A 1F2DA 3DQZA 1TTTA 3LL7A 2D2FA 3L18A 4X20B 4BNFA 1QGZA 2ZJ2A 5HKOA 5JCOA 4E15A 3ZQ4A 3D6UA 1ODJA 3LUJA 3U56A 1DWUA 1Q0LA 4UNIA 2G80A 2I76A 3HR7A 2P4SA 2XTNA 3EZGA 1W1UA 2K7ZA 2VN8A 3PSHA 1U0BB 1I01A 4YAUA 3LY5A 5SYNA 1R6BX 3U26A 3ZV7A 2OBYA 1CHNA 3BA6A 3LUKA 4ZOCA 2P2SA 4NMWA 4IQGA 1Z5WA 5BT8A 2V6FA 3DV2A 4I81A 1WZ2A 1Z7EA 4G5FA 2PVCA 4WL0A 3R0XA 1W4BA 4D46A 2PWBA 3T4XA 4BKUA 4X6LA 3GAMA 5C53B 1DJPA 5DMHA 1M1NA 5TMDA 3D4NA 4KQ2A 4PY2A 1ZITA 3EFHA 1NBOA 5K3EA 2WWRA 3DTTA 2J0UB 3G2KA 1BJTA 4OATA 4I9HA 2FHSA 3QV2A 1KMCA 1NXWA 2C2ZA 2IEDA 4OU4A 4PG6A 4R51A 5AT1A 1I4WA 2FN7A 3WNZA 2OZVA 3TLBA 4QTYA 2XMGA 3HSKA 5JS7A 2B4TO 1SGWA 2FPLA 3MWLA 3NTXA 3MJDA 5EEHA 1UINA 4PEVA 1N6RA 2W6JA 1G55A 1ML3A 1NOKA 1ZIDA 2QRGA 2Q0XA 1NN1A 4BO6A 4BEJA 4FCCA 4NK5A 2ACVA 1SBHA 3C6XA 4OQFA 2BGTA 3SIRA 2H1WA 4GDFA 5LNK6 2W58A 3KUXA 3KOWA 2H1VA 3IEVA 4MRVA 1VKOA 4QBKA 5CFQA 3EPPA 1OXTA 2CCKA 2VJDA 2Y3IA 1C9KA 5EUCA 1XRPA 2JLZA 4MYCA 5A4KA 3AF4A 2B30A 2Q5EA 2OO3A 4YDHB 1WRBA 1XDUA 3BQ9A 4RABA 3UB4A 5BR8B 3NLLA 3QF7A 2BDEA 4DA4A 3VHRA 3EYWA 5CXUA 5ANRB 2XOXA 4TXNA 4C1BA 1W35A 2PKRA 3B70A 1NQUA 5C7IO 1XI2A 5JD4A 4DDHA 1V3VA 2YASA 1MG0A 3W9SA 3TQFA 5DRTA 4JI6B 1W9HA 1DCKA 3GV0A 1YL6A 3A31A 1O95D 2FCAA 1B15A 1EX1A 2YV4A 4P9NA 2H2FA 4V2IA 3U3MA 4AWBA 3M2TA 1TC2A 2GBPA 2GN9A 2NQ8A 1ZEMA 4UAJA 1TMGE 4RDHA 3F71A 2C03A 1XZNA 2VK4A 4DB4A 2BJWA 1VCOA 4NYIQ 1SKQA 1PFGA 2NZYA 5AP9A 4B7UA 3MWJA 4OHOA 1SD2A 2WYVA 4IYRA 4MUFA 5DN6D 3WZ2A 4EO4A 3GGCA 2JKZA 2C77A 4OP1A 2LBPA 1Z33A 4IFTA 4KH0A 1O03A 1NSYA 2XCIA 1AQUA 1EVLA 3QG5A 3Q2OA 4LJ5A 1O08A 2J7PD 1V16B 1QK3A 1Y9DA 2FSFA 2A5LA 3NHWA 5ICMA 3L4EA 1CLUA 1E1LA 3WTCA 3JAKB 2Q8QA 3WZMA 5AW7A 1Z5GA 3AHEA 5CFZA 2O0JA 2A1IA 5KTSA 3FNBA 3BWCA 5AOCA 2IY9A 1IHXA 1QFZA 1ZA2A 4GBJA 4K86A 4DLWA 3ZKWA 1WLSA 5ELLA 5GMOA 1P29A 2H4JA 4TV8B 4PS1A 3ONFA 1FP2A 1U2GA 3H97A 4HB0A 4NIMA 4QBIA 1N8SA 1GD1O 5LKAA 1I9CA 3FUCA 4KP7A 3KVNA 4JZKA 1ZMOA 1GRCA 1AKVA 2DMRA 3PQDA 4FC7A 3EBPA 4PFKA 2HLNA 3PD7A 2I3AA 5DM70 3VU8A 2R11A 4WESB 1R8SA 5EJ7A 1FP7A 1TYEB 1DXOA 4U2KA 1JFVA 4R2MA 1VPDA 2B21A 1DQSA 4JQYA 1KJZA 4ILEA 4FINA 2XMPA 5REQA 4DCCA 4AP5A 5JXIA 5HS6A 2PKEA 9GPBA 1PD1A 1J8YF 2D8MA 1ADBA 1E7MA 1VPEA 5B3AA 4CG2A 4HNVA 3K1AA 3H2BA 5E4YA 3VOTA 3DR5A 1F60A 4M6WA 5GZ6A 3BILA 1E2MA 3T9DA 4DR1B 1RAAA 3FXAA 2BM1A 1Z5UA 1QFJA 2V7GA