3AKCA

Crystal structure of cmp kinase in complex with cdp and adp from thermus thermophilus hb8
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDERDKAQSAPAPDALVLDTGGMTLDEVVAWVLAHIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 78
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akcA00
4JYBA 4RFSA 5HE8A 2EFDB 2FSIA 5JWOA 3I73A 2QORA 3DOFA 3TQFA 3VKWA 1VKJA 3AF2A 4KBGA 3W6OA 5J4LA 5D3MB 1U8AA 1J7KA 1NMZA 1VG9B 1E9EA 2Q9AA 1OB5A 2IBMA 3Q7PA 3DKPA 3IIMA 4N0EA 3SBDA 2WWYA 2CCGA 4QHSA 1XDBA 2YWGA 2A5DA 5SZKB 4DSTA 5AUQA 3W6PA 2OT3B 4DZZA 4QC2A 3R7WB 2GJ9A 1OSNA 3ONWA 5JBQA 3O8RA 3D7MA 5SZIA 1FFHA 3QG5A 5A0FA 3SJZA 1XX6A 2FOLA 3NH6A 4NYIQ 1RRFA 5D3MA 5FPTA 4LGMA 1R2QA 4XD7A 3Q72A 3AH8A 1P75A 3CONA 3P27A 4O3MA 1OXVA 5C46F 3CX7A 1VECA 4GDFA 1YR6A 1RYHA 1II0A 3CKLA 2ZJ5A 3ZZUA 3DMNA 1TQ6A 2OSBA 1M7HA 1DARA 1FQKA 1A7JA 4DDUA 3H4MA 2KJQA 2GJAA 3A37A 2VPPA 3T34A 5BYJA 1IY0A 1YR8A 4GOXA 2ZJAA 1FZQA 1GP2A 1N2CE 3QBVA 4MA4A 2VF8A 4QHTA 4R2HA 1Z22A 5E7IA 1ZAKA 3T15A 1ZM2A 4DLRA 5J4VA 3UPUA 4MDEA 4QBIA 1RPZA 4W5JA 3RANA 5FH9A 1C9KA 2O52A 4NCNA 1WCV1 1MT0A 2WWXA 3CRVA 4V03A 1PJRA 3RABA 1BOFA 5CDFA 1CJVC 4D6PA 2AXPA 6Q21A 1DVRA 1P9RA 5FPHA 4QGHA 4EPXA 2HT1A 1ESMA 4OHZA 4W9MC 1E2DA 3TK1A 521PA 4FCVA 3GJ4A 4BFSA 2ZRAA 4E03A 1XF9A 2OBNA 3LXRA 1DPFA 4NYIR 5FUXA 5C1BA 1L4UA 2CL0X 2WJIA 3WXMA 2YZ2A 5TARA 1KI7A 3A1SA 3AKEA 3WP0A 2O8CB 2Z83A 1COWD 1KI3A 2J59A 3CW2A 4GRAA 1NN5A 3HU2A 1GRQA 1TL7C 4QL3A 2G0TA 3Q9LA 3QKRB 4OJQA 4DCTA 3LLMA 2BJVA 1R0XA 2QAGC 2RH5A 3PV0A 1EESA 1KKMA 1VPLA 3K9NA 1G41A 3BB4A 1NJGA 2OAP1 2OILA 5TY0A 4Q7MB 3VHXA 1QBKC 3KKPA 2FPLA 3IQXA 5KDOA 3UANA 3BAFA 2O8CA 1XXHE 2QAGA 4Q03A 3VKHA 5JWRA 4Q1AA 4M1KA 3KDSE 1A82A 4A0HA 2IYSA 4XSGA 3PUZA 4U00A 3GJ7A 3CX6A 2VYFA 2J7PD 1UDWA 1LS6A 4KYIB 3PG5A 2YJTD 1IJFA 5DYIA 3QKRA 1YR9A 3B8HA 1H8HD 4QFMA 4C4PA 1QVRA 1M34E 1ZCAA 4RZ2A 4DB4A 2GJSA 2I3BA 4UQOA 2VP4A 3E2IA 3QOFA 1RE0A 3RLFA 4TT3A 1E9RA 4J0QA 3M1IA 1IN4A 4JLDA 2ZI3A 3CM0A 3X1ZA 3PQCA 1OFIA 2PT5A 3RSLA 3HPQA 1FP6A 4B74A 4DEXA 2XZLA 1T6NA 2G6BA 2YINC 3AUYA 3CRQA 4Q1FA 3QVVA 3VQTA 1SVSA 2IA5A 2W00A 3GJ5A 4EDHA 5FBRB 1U0LA 4Q4JA 4D26A 4LC1A 3RS7A 4LYHA 1VCIA 2ZYWX 5E4FA 1Z0AA 1JPJA 3X1DA 5AUNB 1AS0A 1F6BA 3LNCA 4TTQA 1EFRD 5CK5A 3CBQA 3DM9B 4BE7B 4TZ6A 5FTKA 3K0FB 4WW0A 1G7RA 4DJTA 1OW3B 2YHSA 4UNSA 2GCOB 4XVQA 1HA3A 3ZVNA 1E2NA 4JL8A 4A1FA 5BN4A 2QPAA 3SJCA 5FL3A 2G0NA 2QE7D 3CRRA 4EFNA 4Q9KA 1FUUA 2EW1A 1U8YA 2VP6A 3WHKA 2V3CC 2EQBA 1WA5A 3VAAA 1QRAA 1T3LA 2B92A 3A4LA 3THWB 2ZROA 4TN1A 1S2MA 4C9BA 1LB1B 2GEVA 2VP2A 2Z4RA 1EFTA 4GBMA 2GK7A 2DHRA 2F9MA 1E2JA 3A1TA 4JBXA 4BGDA 5KSOA 4ITRC 2QP4A 3K0FA 4HLUA 1TADA 2A2ZA 1H8ED 4LJAA 5FOUA 5J4KA 3GLGE 2GJKA 3QEJA 2R62A 2OEPA 3CUEF 4MUAA 1OB2A 3QPUA 5GJVC 3KB1A 2H8KA 4HUTA 3K53A 5L3SB 5JZVA 4P3YA 5EUMA 2QTHA 1SKQA 3PXGA 3GJ0A 1XTJA 3THWA 2BKEA 3AVTA 4BRUA 2GRJA 3IUYA 1KNQA 2IYXA 2ZRIA 2R6CA 3IO5A 5EE5B 4ACBA 5E95A 3EIHA 1ZUIA 1US8A 3QIAA 1GKYA 1Q3HA 4UNPA 5CM9C 3MWLA 1G7TA 4URUR 5FOXA 4ZCLA 1UJ2A 5GVSA 5L3SA 5FTMA 1JAHA 2ZRMA 5HKKD 1NMXA 1CP2A 2V4ZA 4M53A 1QHHB 2A9KA 1OE0A 2GVDC 3A4MA 4I1UA 3EAQA 4DLWA 2PH1A 3ADKA 1DEKA 4M9ZA 4HYYA 4A15A 2GHIA 1XMIA 1WDTA 3B78A 2H17A 1IXSB 4A92A 1GL7A 1DAHA 2NO7A 3FMFA 1XEWX 1EGAA 2WWHA 4M1WA 5IRCD 4URWR 1E2HA 4HB2A 4B2PA 4IDOA 1QHHA 4HLQB 3UWKA 4M1SA 4RCZA 3KQLA 2WWFA 5CDFE 5KUTA 1W0KD 1Z08A 4YMWA 4B2IA 2ZUDA 1JPNA 2B21A 3DZDA 3N70A 3ICQB 3AGPA 2MSEB 1SVIA 4C3ZA 1QZXA 4EPWA 1L2TA 2C8VA 1AM4D 4CVNA 3WMEA 4GFDA 1CJUC 2V1XA 4LRWA 3OAAD 5CB8A 4RZ3A 2V7QA 3CIOA 1XZQA 1W44A 1Z0JA 1QF9A 1G20E 3KUDA 4TQAA 1VYTA 4OI0A 4H1UA 1WXQA 2FWRA 2J87A 2VHQA 5DE3A 3WBJA 4GP6A 4TTRA 5TMPA 1KMHA 5FL7A 3U3OA 5JCZA 4PO1A 4NYJQ 4TSFA 2BC9A 5KSZA 4MKHA 2GXQA 2WWIA 2RGXA 2AFHE 4PZLA 3X2SA 4QXAA 4OK5A 1V43A 1A2KC 2QM7A 2ZTSA 1AZTA 2ZM5A 3DEFA 4LJ7A 4PAQA 1Z6AA 3LVQE 2MSCB 3K70D 3C5CA 1ZW6A 3PUWA 4Q02A 2ZR7A 4CYMA 1MRSA 3UG6A 4JBYA 2R6DA 4ARZB 4I1SA 1GKUB 2VH5R 2ZPTX 1OXUA 4KVGA 4XWAA 2QT1A 3BRWD 3ZDQA 2HYIC 5F98A 3KJHA 3L82B 1U0HC 1Z47A 3QE0A 1QHGA 4BLQA 4M21A 1ZD9A 2RMKA 1E9CA 5KNDA 1D2EA 3M6AA 4PC3A 4KAXA 4B3GA 1VMAA 3CZPA 5EP2A 1XNJA 2JJ1A 1P7CA 3SE0A 4Q1CA 2CXXA 3KXLA 421PA 1IBRA 4NYJR 1Z8FA 4ARZA 2VSFA 2QMEA 2VLIA 5EE9A 1E2LA 2NMVA 4LHZA 1YRAA 4D4MA 1M2OB 1J90A 3AP1A 1J8YF 4L8GA 3C5HA 2GF9A 4PSVA 1FL9A 2CVFA 3U7EB 1ZBDA 1SVLA 4R7ZA 4OJKA 5GADl 3WYGA 4C0JA 1CJMA 1E1RA 1U9IC 2W0SA 2ZSDA 5KYKA 3GLIA 3CO5A 2UVQA 3HYTA 3TNFA 3LVRE 3BFXA 3GQBA 4Q4LA 2WPDA 1SXJB 4TLDA 1UKEA 1NIJA 5LDDC 1E2MA 121PA 1UBEA 1U9IA 1Q12A 5BN3A 4LX0A 4YXWD 4GI7A 1TF2A 2QM8A 1N6OA 5JECA 3VNVA 2B7BA 2BVNA 1S0UA 4JZKA 4TMXA 3SFZA 2NOAA 4BEBA 1T8UA 4IXNA 3VR6A 1AN0A 2X1VA 1X8JA 2W6JD 4NTZA 4C0AC 5M04A 4B44A 4RVCA 4FMBB 1CJTC 2UZIR 2VEDA 3EZFA 2IHBA 4I1OA 1SXJA 2R65A 2ZI6A 2HEIA 1W48A 2ZRCA 2PT7A 2GF0A 4JMPA 2J0UB 2NPIA 1XD2B 1N6IA 1WBDA 2OV2A 1NIPA 3K09C 1G8GA 1TMKA 2FFQA 1AQYA 1C1YA 4CT4B 4ZI3A 3B60A 1A2BA 4XOIA 1RKBA 5HCIA 1E9DA 1ONBA 1UKZA 1BYUA 1VHTA 1Q57A 2ZJ8A 2QY9A 1UBCA 3QF4A 4OQLA 3L0OA 2QAJA 1T5IA 4DIEA 4F4JA 3F8TA 4M9QA 2W0MA 1YRBA 3SU8A 1MO4A 2GKSA 1CKEA 2X8AA 3QNUA 5J4HA 5K8TA 3RS0A 1GRNA 2I1QA 4HDOB 2J1LA 4KU4A 4F93B 2L0XA 3I1FA 1ZC4A 1E6CA 5EP3A 3MD0A 1E79D 4Q5IA 1UPTA 4OI4A 1IN6A 2W2VA 1JJ7A 4P32A 5UKDA 4K8OA 3AF1A 4PSKA 3RVBA 3B82A 3OEHD 5TV2A 5EXXA 3A1VA 4NHOA 4RKEA 1VG0B 2VO1A 3W3AA 1UFQA 2XB4A 1KJYA 3OESA 2D3WA 2HLDA 3OZXA 1X86B 3PCRB 3PUVA 1RJ9A 5KDLA 4DT1B 1W36D 2O8FA 3CH4B 4A6XA 5K8LA 2VBCA 4WZAE 4ZIRA 2F6RA 1A5TA 4TYNA 5JHGB 2A5JA 3EPLA 2FPKA 4MRRA 1G17A 1JXMA 2BHRA 3MWYW 4ON9A 4YMTA 2G83A 1GAJA 4ZCMA 3KQKA 1E3MA 4XTRA 2VP9A 2QT0A 3I72A 4RD3A 1XCGB 2PL3A 2KBFA 2Z43A 3U3JA 1BMFA 3DL0A 3N2EA 3HYRA 1DG3A 2ODNA 5BWMA 1G4UR 1I2MA 2CCKA 8OHMA 1E2FA 2G1JA 3EA0A 2LKDA 3AF0A 3RNLA 2D7DA 1LF0A 1KTVA 1TUIA 5DHAA 3T35A 1VYUA 3NTUA 3TIFA 4A0FA 3RDPA 1X6VA 5F9HA 2OBLA 5EXTA 3HWSA 4B76A 3P20A 1MKYA 2C5LA 3NEYA 1HEIA 2VIIA 2IWHA 4Q48A 2BDTA 3HJNA 4A82A 2IW3A 2CNWD 5JRZA 1AS3A 1W0JA 2XOKD 1X8LA 2C95A 2YC2C 3W5IA 5C18A 5HR5A 1Z6GA 3CPJB 4M1OA 5EZ5A 3I3SR 4L15A 1IONA 4GOKA 3NHAA 2YOGA 1EFHA 3K9LA 4RSGA 1G8PA 1GWNA 4PZZA 4UNQA 1YZQA 1F60A 1W5SA 5KU1A 1SKYB 2J7KA 4QM7A 3VMFA 1J70A 2AWNA 3ZQJA 1TTTA 3VR5A 3MGCA 2W6IA 4OQFA 5EZ6B 3NBYC 1FW6A 2ZVPX 2V6IA 2P6RA 1P3JA 3MUFA 4UJ5A 4ZDIA 2GEUA 4G3XA 4UXIA 4B47A 2N1BA 2ERXA 3E70C 4EUNA 3UMSA 4TZ0A 1U0JA 2FEMA 1NP6A 2HXYA 4EQ6B 4XVUA 2AD1A 2KE5A 3R9IA 1TNDA 4RKFA 1KJZA 3PFIA 5KTYA 3ZD7A 3MJRA 5HPYB 3P26A 3GFTA 4B75A 1EFCA 2HDNB 1KAGA 1XTQA 2DFTA 1OJLA 2WAYA 4Q9IA 1YR7A 1ZU4A 2QTVB 4II7A 1W36C 3IEUA 1FTSA 4US1R 5FBLB 4WA7A 4KFRA 4HB4A 3V00A 1RW4A 1FTNA 3RYTC 2ZRLA 1H65A 1AIPA 4B43A 4EQ6A 5JMTA 1NLYA 5KPJA 5EQTA 2J0QA 1R5BA 1II8B 1MO3A 4XD7D 5HZKA 2WV9A 4A2PA 2IYYA 1S96A 5BN5A 3O47A 5JRJA 3Q5DA 3VX3A 1AGPA 1UM8A 4ZDKA 1KI8A 1SHZA 4X8LA 5K8IA 5JEDA 3AB3A 3GLIE 3CZQA 1ZD8A 3EXAA 3SJAA 5AJVB 3SQXA 1G8YA 4DCVA 5JLJA 2ZVQX 4DLZA 4PPGA 4B3BA 3X1XA 4JBWA 1I4TD 3TUJC 1LY1A 4US2R 1TU3A 2P5TB 2ZUBA 4JYCA 5DGXA 1Z07A 1KI6B 4IVRA 1VDZA 4PQYA 3ZVLA 3GMTA 5AUPB 2XZPA 1ESNA 3WY9A 4QBHA 1OKKA 4CEHB 1KI2A 2DB3A 1TPZA 5HE9A 1BIFA 3LXXA 1F48A 1U98A 2ZIAA 2XZOA 1W5TA 1NVWQ 2HCBA 2C77A 5FR2A 4A36A 2C04A 4LOAA 1LNZA 4V02A 3BWDD 1Y63A 1LW7A 2AK2A 4DSNA 2W2TA 1KI6A 4PXAA 821PA 1X8KA 2REBA 2WJGA 1P62B 4IKEA 5JFGA 1OH7A 4LJ5A 3GFPA 1W4BA 3UXMA 3QKTA 2QSYA 1NRJB 4CEHA 1NY6A 3F3YA 3SZRA 1ZD1A 2ZE6A 3Q7QA 3UATA 2QP3A 3FHCB 5JHHB 4PC2A 4NZYA 1KDOA 3BE4A 3Q5EA 4C0BA 3QEOA 2BMDA 4DXAA 2BV3A 2JLZA 1Z0IA 5DI3A 4MYTA 4XIGS 3AEZA 1SVWA 1ZP6A 3SJBA 1OXSC 2EYQA 2RB4A 3TJZA 3A36A 2FN4A 5C4GB 1EK0A 4ESHA 4GNKA 1GNQA 5DYGA 3IIKA 4AD8A 5A4JA 1XCPA 2BKUA 2ZE8A 5AR1A 2IT1A 2H57A 3SFVA 4C2TA 2F55A 1UEJA 1KK2A 4HB0A 1W4AA 5H70A 3UWOA 4RD0A 4LV5B 1D9ZA 3FKQA 2QSZA 4TT3D 2DY1A 1N0VC 4A2QA 4RY2A 1VIYA 2WKPA 2J45A 1WB9A 4D0LB 1S3GA 2CDNA 2IHYA 4PC6A 1ELOA 2BEJA 3R7WA 3QG1A 3VR3A 2IYLD 4XWKA 2QMUA 2CLDX 2BOVA 3RS3A 1F2TB 1WF3A 2GXSA 4YDSA 4DCUA 4MUBA 4WXPA 4OHYA 1F5NA 3AF3A 3DKVA 3KTAB 2DBYA 3RRZA 2GA8A 2CVHA 2C78A 2TMKA 3FKSA 4A2WA 5DNYB 4F91B 3H0KA 2JLRA 3AVWA 3TVTA 1CR0A 1N6RA 1UBGA 1PVOA 3BGWA 4GSYA 2FG5A 4OHVA 3LW7A 1KJWA 4NP6A 4IFEA 1BYIA 4TYYA 4N3NA 1XTSA 3QENA 4LJ9A 1CU1A 1EXMA 2FA9A 2Z6VA 2WHXA 3FVQA 4OK6A 2C98A 3H1TA 4IVQA 5JSZB 1NVUQ 4OI2A 4BZPA 2PZFA 3DPUA 3ZGXA 2YOFA 2LCFA 2WWWA 3WMFA 2JLVA 3QY0A 2IL1A 2OXRA 3EARA 3KTAA 3U44B 2FGJA 2LKCA 1X3SA 2C03A 2C9CA 3HR8A 1N6PA 4U02A 2AK3A 1F3OA 2X77A 2IS1A 1T9HA 2XNDA 2Z5FA 3RRYA 3BFVA 3T1TA 4TLEA 3R8FA 4Z51A 5D3QA 3NHBA 1XJ0A 1MV5A 4IFBA 4WZBE 4GZMA 1HTWA 1QHNA 3LX5A 2XB2A 3BH0A 3OE7A 4K46A 4JL5A 4LBWA 1A1VA 2NO6A 2RGDA 4HAWA 1U99A 3AVYA 5JSZA 3ZQ6A 1OF1A 3TKLA 2Q21A 5GVRA 3B85A 2RHMA 3L8ZA 3SBEA 2VTKA 4HAYA 3U44A 4JVNA 3TW8B 2RGEA 1SKYE 1YQTA 2ONKA 2BMEA 2ZJ2A 2IC5A 2IYUA 2P67A 2FX3A 2OFOA 2NPFA 4POAA 2A5YB 2GCNA 1KKLA 1CBUA 1GILA 4CW7A 1OIVA 5ANRB 4MQBA 1CRQA 2AR7A 2DWPA 3IBYA 1AS2A 3ADBA 5JJLA 1KI9A 2XTNA 1WRBA 1P2SA 2MSDB 2JA1A 3LBNA 1YZGA 2HYDA 1RRPA 1P2TA 2GAAA 3QXCA 4R98A 3GJ6A 5L8VA 3AM1A 5E3HA 4HEJA 4PO8A 5LPNA 1NJFA 1K5GA 1GIAA 4V0KA 3A58B 3REGA 3QPWA 5CYPA 2FF7A 2VA8A 1BS1A 1Z83A 4IOJA 4PPFA 3WP1B 2IEZA 3C14C 1M1YE 4O0MA 1GNPA 4AKEA 3ZZTA 1TF7A 4HB3A 3OF5A 5HCNA 4D25A 4R2IA 2JDIA 2WICA 4X8HA 4OI1A 2C9YA 4B33A 3AKYA 4HAXA 1G3QA 1P61B 3EPJA 1TX4B 2YYZA 2YV5A 2G1KA 2DR3A 2VHUA 4IOKA 1ZNZA 1EX7A 3FPAA 3THOA 3C4JA 3CH5A 4HLUC 1NBMA 2D7CA 3B5JA 3AP2A 1J2JA 1JALA 2V7QD 1E9BA 3VHLB 5G3YA 3EZ7A 2VP5A 3KFVA 3GEEA 4WBSA 4CRWB 3NBXX 1HH4A 4G01B 1XP8A 3GLHB 2GCOA 4PC1A 1BO6A 1KK0A 1RRGA 3LX8A 5FL7D 3ZS8A 3X1WA 1ODFA 1NG1A 2QGZA 1MR3F 4GZLA 1G6OA 4TSFD 4A4DA 2O8DB 4YQFA 1KHTA 3ZH9B 3KKOA 4BPBA 4C0SA 4UXHA 2QZ4A 3SR0A 3GJXC 1T0HB 2NO0A 2ZR9A 3NDPA 3NIBA 1E99A 3NEJA 2PJRA 2HCJB 1Q1EA 3OEEA 4Q1BA 4P31A 3RC3A 1KO1A 4DLYA 5FPKA 3M4YA 3T12A 2RGBA 2ZR0A 3FYHA 4IOMA 5B30A 4C2UA 2F1RA 4LHYA 4D82A 2G88A 3GLHA 3AV0B 3HP1A 1T91A 5EE1A 1GZSA 3BOSA 4NKRA 5DN6A 4KLZA 2ZRKA 4LY6A 1DE0A 1XTKA 2WSSA 2ZRNA 3IO3A 2XXAB 4BFWA 3FDIA 5CYOA 1MOZA 2QL6A 2DFNA 4NCHA 2FSGA 2FDCA 4IJMA 1ZMXA 4KI0A 2R6FA 1J8MF 5B64A 2Q9CA 3GEHA 2GZAA 3EWSA 4B35A 3LW8A 2IF2A 1K6MA 2AXNA 1B0UA 1S8FA 5A5GA 1WBBA 2BMJA 4AG6A 2JJ1D 1KDTA 2KSQA 5KSPA 3BH6A 4DDWA 4LC0A 2ZQ5A 1DAEA 1SULA 3HR7A 5KNCA 3N2IA 4EFLA 2RCNA 3AUXA 5LB4A 1P73A 2XXAA 2B8WA 3LQQA 4Q4HB 3TSWA 1G19A 2JIZA 3G0HA 2O8EB 2ZJYA 2PZEA 1E1RD 2Y8EA 1XEXB 1CJKC 3B1XA 3PUXA 4L9WA 5AK0A 4IXMA 1RRCA 4FCWA 2WPDD 3TRFA 3QF7A 2FZLA 1G8FA 4OBEA 2J0SA 1UKYA 2GNOA 2KBEA 2ZYTX 4UNRA 1N6HA 4FD2A 4LSGA 2K5UA 1OH8A 4M22A 2W2XA 3SOPA 4BFTA 4AYXA 2YOHA 1NL3A 4RZXA 1OIXA 1GL6A 4HDCA 3ADCA 2QENA 1ZNYA 3SYNA 2A3RA 1W49A 1M8PA 4NE2A 4QJ3A 3S1AB 4GL2A 2NO9A 4DSUA 1XMSA 3ETLA 3B9PA 3FFAA 1PUIA 3LA6A 3W3ZB 1E69A 4DEYA 3V4RA 1D2NA 2OLKA 1XMJA 3B13B 1SXJD 3TSZA 5EP1A 4KBFA 3B7GA 4F7WA 1XBTA 2NIPA 4DC9A 1FNMA 5HTKA 1OLOA 3GFOA 3LD9A 3LH5A 3O8DA 2BM0A 3U6BA 2ZI9A 3ZVMA 2ZRGA 4QNMA 1Q1ZA 5HZHA 2QEQA 4Z1MA 1W2HA 3FTQA 4V0LA 3KJEA 2GDJA 2ZI4A 3UMRA 4HATA 4LI0A 1OXXK 1DO0A 3DO6A 4JSTA 1JEDA 2QRNA 2ZRJA 4XVRA 3LAWA 4FWTA 5JCPA 4A6PA 2GAOA 3ZLJA 1NG9A 2CLSA 2OO7A 1O87A 1R5OA 3QVUA 4ZDJA 2JGNA 3LQRA 4H1VA 4KFUA 3B9QA 3TGPA 3EPKA 2QBYB 2WOOA 2ZS8A 4GOJA 1PZNA 4LHXA 3KB2A 3I92A 2O5VA 3CPHA 2CLCX 2JJ8A 1L4YA 3ECCA 4LJYA 5CLQA 2IS4A 1OT3A 3JZAA 1YJ5A 1TQDA 4L9SA 4A0RA 2QU8A 3CNNA 1LV7A 1P2VA 3R8CA 2WAXA 3DVLA 2GETA 2YNMA 2GESA 4DKXA 1M74A 3AVVA 1IXZA 2OLJA 2HLDD 3EZ2A 4PHGA 3GLFB 3MJHA 4KITB 4AURA 3U4QB 4PPQA 3C16C 3THYB 2HT6A 3OIUA 4BASA 2HJVA 4RD1A 1HE1C 1VCNA 4JLBA 3VTKA 3AF4A 4ABYA 1E96A 3I32A 1YE8A 1ETUA 3WRYC 3ZJYA 2B8TA 4LPKA 2ZS9A 3WMGA 3JZMA 3B1ZA 4M1YA 4UJ3A 1M6NA 4AIIA 2JLXA 3CWZA 4MKFA 1BMFD 4ZO4A 4QKQA 4O25A 2QQ0A 1NN1A 3GLFA 3QSYA 2OZEA 4B6EA 5C4MA 3U4QA 1WP9A 1E4YA 2FZ4A 3THYA 4PANA 2J5XA 2ZSFA 4DRZA 1G5TA 2JLUA 3LDAA 3PENA 4DVGA 2F1HA 1SXJC 2YWEA 1NBME 2DPXA 1YZKA 5TXGA 1E2IA 5G3ZA 1FMLA 5FOVA 5AJZA 4PTLA 4Q9JA 2DWOA 3B2EA 1SQ5A 4R9UC 3VNUA 1GVNB 1YZLA 2FFAA 1JB1A 1SVKA 2D4HA 4LJ6A 1W0JD 3K9GA 5AWFC 3G5UA 5CJ2A 1LTQA 3FOZA 4NYMQ 5FOTA 4C0QC 4QNRA 1CXZA 4B73A 4LHVA 3SS8A 5LD2B 1ZM9A 3X1YA 2R6AA 1FOEB 5FPSA 2ZE5A 4IRUB 4Q18A 2PEYA 4Q7JB 1Q3TA 1YU9A 1N5KA 2W6ID 3MAAC 3NBFA 1L7VC 2CCJA 2X19A 2ZRPA 2IXFA 1GDDA 3OFNA 4JLKA 3MMPA 4PSAA 2P3SA 4XJXA 4HLDA 5GJWC 4D2IA 4CZ2A 5BXQC 5BQ5A 5IK2A 1VCMA 4M2LA 3KQNA 3TR5A 2J0UA 4DCSA 1XD2A 2P6NA 3W34A 3H86A 1VYVA 3WBKA 4LYJA 1IY2A 1JR3A 1TEVA 2A30A 3TVDA 4FXPA 3PJRA 3ND8A 4LYFA 2G3YA 5AJXA 5G53C 3P1JA 1N0UA 2QP9X 2E1RA 2XSZA 3OIWA 2DFLA 2A5FA 1R0WA 2CEAA 1E9AA 3A1WA 3WNDA 2WVJA 3DM5A 1G3MA 3D31A 5IF9A 1E0SA 1G3RA 3L0IB 5FOSA 4OQXA 1HUQA 5DLQC 2WJVA 1PLKA 2FSHA 4NYMR 3UIEA 3D3QA 3PEVA 1R5NA 4IVPA 3I8SA 4ZI2A 5GJCA 3ZIAA 5JEEA 4GT1A 2J46A 2BBWA 4Y0AA 2AWOA 2HXSA 1U90A 4L5BA 4BEJA 2FU5C 3GP8A 3G82C 4LCBA 3A8TA 3AVXA 1I2DA 2RAPA 4CEJB 3PEYA 2EWWA 1Z6YA 1E2QA 5CB6A 3J81k 1AZSC 2NO1A 4DT1A 4ERNA 5AUOB 1NF3A 4PPNA 1KI4A 3BK7A 1R8QA 1R6BX 1SHKA 3LBHA 1S3SA 1O3YA 4PHFA 5IDVA 2VRWA 5L3VA 1G8HA 2ORVA 2FFBA 1W2GA 2HF9A 3EIEA 3GD7A 4LWZA 5FI0B 2OBMA 3K8YA 1QVAA 4QJ5A 2PCLA 4XSHA 4NCIA 4S35A 4URZR 1E2EA 1NLZA 2H7VA 3U3RA 1OHHA 1Z2CA 4KO8A 1OKKD 4QBFA 3REFA 2AX4A 2CL7X 2V54A 2W83A 3FWYA 3IEVA 4U7DA 2B7CA 4IDQA 2QGNA 2XX3A 2WJYA 5E7JA 2FSFA 1QG2A 1DELA 1NVXQ 3ND9A 4MRVA 3CR7A 3KJGA 1P4SA 1CTQA 3O8BA 3KL4A 1LFDB 3EZ6A 2XNSA 2ZRHA 3KQUA 2PMDA 1IN8A 3UMFA 2Q3HA 1XPUA 1ZM3A 1X1SA 5KDDA 3UKDA 3EPHA 3DZ8A 4TMTA 1OYYA 2PX3A 1G7CA 4RD4A 1JAIA 1FPMA 4B32A 2PX0A 3BH7A 2ECKA 3C15C 4D81A 3VR1A 1VCOA 1KSHA 2D2EA 5JWHA 4Q1EA 1S9DA 2WTUA 4WXRA 2JLWA 4KXFB 4YMVA 2H5EA 5KNBA 2FJUA 1YZNA 1G21E 2VP0A 4WAUA 1ZIPA 1ZM7A 3KXKA 4TQ9A 4F4IA 1QDEA 4FN5A 4IEEA 1BH2A 4TL7A 4DDVA 3ZYCA 3L0PA 4AI6A 3JVUA 5EXSA 2HUPA 3CB4A 3A1UA 3QXXA 3SHWA 3LV8A 1MH1A 4CIDA 3QUSA 2A78A 4PX9A 3GPLA 1OFHA 2ODWA 2ZYUX 3VFDA 4ASUA 1DAMA 3CLVA 5TVKA 3EWAA 4QGFA 1YKSA 3K0CC 2ZUCA 3FHTA 3R9WA 2O0KA 3VR4A 1Q0UA 1K8RA 4PQFA 4U5XA 4EJSB 3GJ3A 4G5SA 1G1MA 4Q7LA 1KNXA 2IYRA 3K0CA 1X1RA 4B3FX 2XTMA 1P9NA 2O0JA 2AHOA 1KY2A 1TQ2A 1YHNA 4IDHA 3DMDA 2H16A 4FI3C 4B3CA 1DAKA 4B2LA 4B3XA 4EFMA 3KKMA 1HY3A 4OL0A 1II8A 3RAPR 1XD9A 5DHFA 3D8BA 2ZAMA 3FKSD 2D06A 2CJWB 4ILEA 1HURA 1GSIA 1YVDA 3FMIA 4G5GA 2X2FA 4EJSA 4ZCIA 1IM2A 2PCJA 4BLPA 4IHQA 3FGNA 1KY3A 3TAUA 3RHFA 1PUJA 3MCAA 4X8MA 3NBZC 3U2QA 4BLTA 2UZ3A 4G1UC 1HT2E 1SXJE 2NQ2C 2IWRA 4I99A 1Z29A 1IJEA 5BYKA 3MWKA 1TAGA 3U7GA 4JJZA 1W7AA 4BWYA 1T5LA 2DYKA 3BXZA 4DIDA 5FTNA 5DO9A 2WKQA 4RJLA 3EIQA 4DHEA 4DLTA 1KSFX 3QKSB 4WIAA 1U2RA 3LRPA 3U7FB 2CJWA 2KB0A 3GLGB 4RFSB 2XNDD 3MG9A 2RGCA 4MGZR 2BIFA 4MYHA 2WOJA 1GOTA 4XWOA 4JT2A 3OE7D 4BFZA 4BFVA 1ZYUA 4TYWA 2FPMA 2IUUA 4OQMA 5DSZA 3Q3JB 2GZDA 4FINA 5EE0A 3AP3A 1OH5A 3TBKA 1OFUX 4LV8B 1JR3E 4AK9A 2EWVA 3I61A 1JQJC 3QKSA 4TLBA 2ZS7A 3GLGA 4YLGA 4FW9A 5EP4A 3BB3A 4KYUA 1DS6A 1NI3A 3SQWA 4UKDA 1NVVR 2XGJA 5LB2A 3W9YA 4OYHA 2F7SA 3TMKA 4WOPA 4PQRA 2C99A 3U7HB 3GJ8A 4RFVA 3ASZA 3QQ5A 2QI9C 1E2KA 1SVOA 1XTIA 5KSYA 4Q1DA 1N0WA 1UBFA 1II9A 4CEIB 3CRW1 2QPTA 2AKAB 2JJ2A 4M4SA 1GITA 1CRPA 1G7SA 1HV8A 3FMOB 3K1JA 1Q22A 1FP7A 1EX6A 2QTFA 4O2RA 1UADA 1GKIA 1CF4A 3THXB 5CIWA 1KDRA 4JVSB 3AVQA 3CPEA 2CE2X 1FX0B 4LPSA 3U3MA 4BECA 3PEWA 4FMDF 3UK6A 5FI1B 4P33A 2Z4SA 4M1TA 4F4CA 1FNNA 4PAMA 4HZIA 3L8YA 4CEIA 2F3TA 3TSOA 4ZDWA 2JDID 3BS4A 1NSTA 4L16A 4DUGA 4BZXA 3WRXC 2DWQA 4DLSA 3O8CA 4JLMA 1R7RA 4Z8XA 2D2FA 3CNOA 2BM1A 4D0GA 2LWIA 4JLAA 1F2TA 3THXA 1FQJA 5TB5A 2R2AA 5FTLA 1FX0A 2GWHA 1NBMD 1E1QA 2G77B 4P0TA 4LJ4A 1QHXA 2BWJA 1KZGB 4BFXA 4RZUA 2Q0HA 3IQWA 4PR0A 2CE7A 1ZRHA 2CHVA 3AVPA 3NXSA 5FBVB 2VL7A 2ORIA 5F9FA 2IS6A 5JJKA 1FMJA 2ATXA 2O0HA 1XMVA 1TEXA 1N6LA 3NC0C 1W4CA 4JLJA 2ZSAA 1ANKA 2A7QA 4NCKA 1P2UA 2BJWA 3QJYA 2BBOA 2I4IA 1W1WA 5CIQA 5SZJA 4DWJA 5B57C 2JLYA 2XTZA 2XEXA 3KXIA 5K8UA 1JNYA 1TQ4A 2GK6A 5P21A 1T0JB 1AGRA 4G5QA 1MO6A 2CK3A 2QAGB 2QRZA 4B34A 4D4KA 1IN5A 1ZUHA 4B71A 1T4GA 3OEED 3LFUA 1SGWA 2HV8A 1W4RA 5H8WA 2NGRA 1GG2A 1U94A 2XJ4A 4MGKR 1G4AE 1RFLA 1G5PA 3SNHA 4E07A 2BBSA 3CNLA 5AJWA 1Z63A 2GZHA 1CEEA 3WNBA 3NWJA 1EWQA 5J4YA 5DN6D 4LZZA 4BZQA 4KVAA 2WSSD 1V5WA 5EXPA 3DHWC 3EC2A 2XJ9A 1M7BA 1E98A 2OUKA 4URXR 4IEIA 3ZZ0A 1Q20A 3NDBB 1N25A 3T5DA 3CF2A 4RCYA 4QHYA 2OAQ1 1CULC 4P4SB 1RVDA 5L3RA 1G64A 4EIWA 2Z0MA 4JSYA 2JATA 4G5RA 2G9NA 3IPXA 1RIFA 4Q4JB 1IAQA 4X8OA 3I8XA 5GJBA 4TYQA 3WYFA 3P4XA 5FR1A 721PA 2D74A 2WMNB 1GTVA 3K9HA 2J9RA 3ICEA 3BBPA 4GMDA 4Y0VA 3TW4A 3U5ZB 4RD2A 2JIZD 2FH5B 2H18A 1OIWA 2FGKA 4Q21A 4P4SA 4AKHA 3QXSA 2EFHB 1Q1BA 1Z06A 2O8BB 4DLUA 2ORWA 3EG5A 4GP7A 3TUIC 4WVFA 2WKRA 3M0EA 2ZRBA 4PZYA 2J3EA 3N5CA 1NN0A 4TLCA 1RC8A 3MFYA 2YVUA 2JEOA 1VHLA 2EVWX 5FUYA 4ZKEA 1NKTA 1TUEA 2QN6A 2VF7A 5AJYA 3C7KA 3NKVA 3VX4A 1XJCA 4C0HA 5IT5A 3OIVA 4TL6A 2JAQA 5FBQB 4ESVA 2O8BA 1WQ1R 1DAIA 1S1MA 1IY1A 1YZTA 2Q9BA 4MRNA 3PEUA 1W46A 3TH5A 2ZXUA 4BFUA 4V0OA 5JI2E 5G40A 1D6JA 4Q66C 1N5LA 4Z1MD 4JVMA 4MYUA 3W6NA 2PLFA 1MABB 2UKDA 1COWA 3T1VA 3W90A 1HYQA 3P32A 4AKIA 1I4DD 3V4FA 2CBZA 1CIPA 1D9XA 1US8B 3SI7A 4D4JA 2OM2A 1UDXA 2OESA 4HAVA 1ZM4A 4G5OA 3SEAA 2GILA 2FFHA 1UEIA 3KZ1E 1QHIA 4FMDB 1IOZA 4QG7A 2MMGA 5CJPA 2O8DA 1OYWA 5L3QB 5B2ZA 2CHGA 4A9AA 3QXJA 3W8NA 4URVR 5ELXA 3MSXA 3L2OB 1KOFA 5JJIA 3BORA 1G6HA 2Q3MA 3EZ9A 3PR1A 3T61A 1Z6TA 4R71A 1W47A 1KMQA 1LS1A 2IUTA 4KODA 4AY2A 1MABA 5C2JB 2ZSEA 1VTKA 4V0NA 1RZ3A 1A4RA 3HU3A 3ASYA 5CLLA 1XJQA 2F1IA 1XFAA 2J7PA 2ERYA 2Q6TA 1D5CA 1R0ZA 2J0VA 2JASA 5KO2A 3FE2A 1GM5A 1NSFA 4BRWA 2EFEB 1H8HA 1KK3A 5J47A 5KHOC 2IYTA 2ZAOA 3I4LA 1P9WA 3T1QA 4LHWA 3MRSA 4ZPXA 2XITA 2OCAA 2QMHA 4KV9A 4MKIA 5L3QA 3EA5A 2WBLC 4XH9B 1Q1QA 1T3SA 1E0JA 2ZETA 2IUSA 2QG6A 2ZU0C 221PA 1R10A 4MGIR 4M8NE 1Z28A 1D2MA 1ZUNB 1G5RA 2HF8A 1U81A 3FMPB 2QROA 4P4TA 3BC1A 4XTCS 1T3HA 4EPTA 4I81A 4QM6A 1XTRA 4YDHB 3F0TA 2V9PA 3ZS9A 3H84A 3BJIC 3FHOA 4MDFA 1Z0FA 1KO8A 4DDTA 1XWIA 2P6UA 4P4UA 5DIFA 4URYR 5IHPA 1EFRA 4JJKA 3BIFA 4B3DA 1LF5A 5FOWA 4H9GA 1R4AA 1XEFA 1JECA 2NZJA 4IDNA 4Q4HA 4K81B 4HSEA 5H1YA 4C7OB 4QOSA 1VG1A 2IS2A 3PUYA 2O8EA 2ZITA 3KKNA 1KMHB 2RKOA 2OXCA 1XEXA 2QE7A 4LBVA 4V0MA 1CR4A 1BKDR 4LBYA 4OHXA 4W5WA 2R8RA 4M1MA 2B6HA 4LUCA 1Q21A 2P0EA 1Y3AA 4TMVA 2QPOA 2ZI7A 1E0AA 3A4NA 2EFGA 3QI2A 2REXB 4GMXA 5BW8A 4W5HA 1HT1E 4HI0E 2REOA 4C7OA 2FNAA 2WM9B 5F3WB 2C96A 1H8EA 3S1AA 1KI1A 3OFND 2WWGA 3OIYA 1CS4C 1G291 4HUQB 3K0EA 4JVLA 2ZSBA 2EFCB 1DAFA 4LK2A 5IK2D 4C0LA 1B23P 2QQEA 5FFMA 1R8SA 3CF0A 1N6NA 2BBTA 4BLRA 4QGGA 1ZNWA 1NNEA 3GEIA 1JQLB 1AKEA 3W5JA 4Q00A 1JR3D 4DCNA 4Z54A 5J5CA 1IHUA 1ZNXA 1GL9B 2ODBA 4TTPA 3U6KA 2XSZD 1UF9A 5KOYA 3QKUA 1ZJ6A 2YWFA 2X2EA 4MYCA 1DBSA 2OCYC 4FCTA 2QA5A 4HUQA 2QUZA 1NLFA 4MGYR 5FTJA 2GBLC 4JS0A 2DCUA 2VSXA 3KFXA 4KCGA 5HKKA 3KJIA 3CF6R 2QBYA 3QXHA 1Z2AA 4NBSA 3RRMA 2QMOA 4PAOA 3T5GA 1XRJA 3BB1A 4LDJA 1HE8B 1MRNA 2BCJQ 1MO5A 2GBLA 3LY5A 2R6GA 4HAZA 5F2EA 3RWMB 1ZU5A 3VU9B 2FEOA 1CR1A 3GLIB 1Q44A 2XAUA 4O2LA 5EJEA 4PFSA 3QPVA 1PLLA 4C0KA 4Z8YA 1KO5A 1KYIA 2VHCA 4W7SA 4B6FA 1XD8A 2AFIE 1J99A 1DTSA 2GXUA 2IF0A 4MRPA 4PC7A 4ACAA 1HQYE 1G3IA 4KHZA 5LBIA 3B1VA 2IXEA 1E4VA 1KGDA 4CT5A 1DOAA 4F92B 3WYAA 3IDQA 1D8TA 4S2EA 2P65A 2ZE7A 1PV4A 1IXRC 2BEKA 3IBGA 2YC4C 2SHKA 3VU9A 3ZVRA 1W0KA 4UNNA 1ZVQA 5EE3A 3AKDA 4N1AA 1UKVY 4NMMA 1QG4A 2ZI5A 1Z3IX 3P4YA 2ATVA 3CR8A 4EPYA 1GRRA 1OHHD 4NU0A 4PO9A 2YKGA 4EPVA 4Q47A 4BQSA 3CX8A 3K0SA 1KAOA 4L4UA 1S1CA 2ZJBA 3DDCA 3FB4A 2ZRFA 3OAAA 3RS4A 3LO5A 3RWOA 4M9XA 4DBLC 3I5XA 4MRSA 5DISB 4QJ4A 1VIAA 3K70B 2F3RA 1OFTA 4ZKDA 2I1VB 4MITA 2J41A 2OE2A 3EW9A 2F1JA 3QF4B 3LLUA 2WSMA 4D0NA 3NC1C 4JL6A 1DG1G 1L8QA 2RGNC 4WZ6A 5FBWB 2YWHA 3NH9A 3CWQA 3K70C 3GLHE 4DLXA 4I4LA 1AK2A 5LD2C 4EKDA 2IYQA 4DB2A 2ZRDA 4TMKA 3KQHA 4JT4A 4NONA 1EFUA 5FUWA 2RGNA 1OPXA 2BMFA 3BFKA 1JEEA 4HZUB 4Q9HA 5TDHA 2ONJA 3BERA 5J40A 3AVOA 2EU8A 2KI5A 4AYWA 3IHWA 3K09A 2IXGA 1AKYA 3TE6A 3L43A 2AKYA 2H92A 1Z6XA 1AA9A 4OK3A 3FFBA 3PITA 1AQUA 4Q4AB 3T06B 3TR0A 3LWNA 3SYLA 2AL7A 2ZEJA 1QHSA 2FE4A 2IYZA 1NN3A 4E22A 1EG7A 2RHDA 4E5UA 1RJ9B 3BD9A 2O8FB 3AGQA 3EX7C 3QBTA 4LJ8A 1G3UA 4ZIRB 4JIMA 1XB2A 4ASUD 2ASEA 1U8ZA 2ZJOA 4QGAA 3U3KA 1KO4A 1P5ZB 5JS7A 2QNRA 3RSOA 1NKSA 4UXJA 2WMOB 4NPHA 4HLCA 4HZUA 3C8UA 4IOLA 4FMCF 1ZIOA 5KPDA 1ZINA 1KO7A 1EWRA 1XCMA 1P6XA 2NTYC 4HAUA 1WMSA 4JLNA 4Q4AA 3A6PC 1KDPA 3AVUA 3PVSA 1XU4A 4TYPA 1PLJA 1JJVA 2PLRA 3RRNA 4TQUS 1Z0KA 2OG2A 3TAHA 4EPRA 3PIRA 1JR6A 1KSJA 4M0LA 2NZ8A 1OH6A 3TLXA 1N5IA 2GXAA 3AQ4A 2IYWA 3CRMA 1CR2A 3SDZA 3I62A 4TWZA 1CLUA 4I1VA 4CGZA 1OXTA 5FPYA 4CF7A 2VSOA 3U60B 2OHFA 3V9PA 2R44A 3JVVA 4EAQA 3KUCA 3KX2A 4NH0A 2R9VA 1OV4A 4D80A 2GVZC 2CMKA 4Q9LA 2P2LA 4GPTA 2CL6X 4F38A 3TUZC 1G18A 4C30A 2E9SA 1JI0A 1HQCA 4KFTA 4V0ME 4YXWA 4CEJA 2PJZA 3R9XA 2IK8A 2OCBA 1E0KA 1WE2A 5CM8B 1M7GA 1VG8A 2WJHA 3T1OA 2JCSA 2W6JA 4KLNA 4DLVA 1NY5A 4Q7KA 1GFIA 1LVGA 3IILA 3RS5A 4YMSA 4NL4H 3AKCA 1XPOA 2DFKB 4BLSA 2CHQA 2OFWA 1Z5ZA 3DOEA 2IEYA 4IDPA 1ZC3A 2EYUA 3R20A 1DAGA 3IGFA 3ZIAD 3EC1A 2N46A 2AN9A 3HU1A 4NCJA 2ZYVX 4JKIA 1SZPA 1I4LD 3B6EA 3SC3A 1YZUA 3K0AB 4FIDA 4TMZA 1ZCBA 3H2YA 1XXHB 2JLSA 1E9SA 1IN7A 4TL9A 5JS8A 4IW3B 2PMKA 2PZGA 4BLOA 5DH9A 3SHFA 5CITA 3B1WA 4AWXA 2AD5A 4JLVA 4D4LA 1GNRA 5EUQB 2PBRA 4AG5A 5G41A 2GCPA 1QHYA 3C41J 1W36B 1E94E 2BCGY 2KWIA 3IHLA 4OQNA 2H1LA 4HDQB 2WIBA 1E79A 3IKJA 5E7MA 2V55B 3K0AA 2ZJZA 4KSCA 3Q85A 1T8TA 1XXHA 3I5YA 2ZU6A 3RC8A 4YMUA 3OEHA 3U61B 2IX3A 3D6TB 2FMXA 3Q8XB 2JJ2D 3HPRA 3VR2A 4A8JB 2V1UA 2JLQA 4JLPA 3WNCA 4Q01A 1XPRA 5SZHB 3NG1A 2Q3FA 2C2HA 4G0NA 4Q19A 2ZREA 1TU4A 1FUKA 1KZ7B 4KSBA 4QBGB 4EJSC 4JKYA 3GLFE 1DO2A 3IIJA 1DADA 2GJ8A 3VKGA 3E1SA 3L0SA 3EASA 4A8JC 4TMWA 1AJEA 2ZANA 3ZD6A 4NDZA 4M9SA 4PHHA 1P60A 4MH0R 4B48A 3HDTA 3OHMA 4LBZA 4A0GA 4AKGA 3B1YA 1G16A 2RGGA 4DUGD 2N42A 4A8JA 1NMYA 2NG1A 1NVVQ 1F2UB 2VHJA 4QRHA 2OFXA 1KSGA 1KIMA 5DI9A 3NVAA 1P72A 4OHWA 3W8RA 2ANCA 2F9LA 2WJJA 3E5HA 1K5DA 1UAAA 4AC9A 4MKGA 2V6JA 2WZQA 4KJZA 2MMCA 4US0R 4CDGA 4KFSA 2F43B 3ADDA 2V8OA 4JLOA 1G9XA 1N3BA 4YC7A 3SN6A 1E32A 1C4OA 1SVMA 3SYKA 2ODEA 4RD6A 2C9OA 1E1QD 1GUAA 1XEWY 2WIAA 3F5FA 4OKSA 3WHLA 5B58C 2IYVA 1KK1A 2FV8A 1E9FA 1N5JA 3MWJA 4LV6A 4TL8A 2CNWA 4N0DA 1N6KA 2XOKA 4TLAA 2VQSA 1S4QA 2GTPA 4BFYA 5JI3E 3MLEA 1R0YA 5CK4A 1F2UA 1Z0DA 4PHTA 1JXOA 4DSOA 5DI3B 1IQPA 2VHTA 1E2GA 2PEZA 4LYAA 4BUJA 1S9HA 2D62A 1XZPA 4FMCB 5FUVA 2ANBA 2HJGA 2RGAA 3RS2A 4AYTA 3GCGA 3IPYA 1RYFA 2F43A 4FWIB 4YONB 5H68A 3TQCA 2W58A 2E87A 3UG7A 4E09A 3KKQA 2A5GA 2OCPA 4ZV4A 2CK3D 1TF5A 621PA 3LBIA 2P5SA 1E2PA 1JBKA 2GEDA
chains in the Genus database with same CATH superfamily
3LU1A 1O9HA 1L6IA 1Q95A 2HSJA 2FSIA 1U7PA 3T7SA 1WOYA 1PDVA 2C2GA 3TQFA 1KFEB 3AF2A 3H1EA 5F78A 1HGXA 4D8UA 2PRYA 5D3MB 4ZGBA 3ISJA 5J4LA 3M3HA 3M7IA 5K8VA 8MHTA 1J21A 5TT0A 1MVNA 2J30A 3Q7PA 4MW5A 2E5FA 4YRTA 5BQPA 5CFRA 5A7GA 4LMPA 4D79A 2DUUA 3A31A 3H97A 1JTFA 3SBDA 3D64A 3DS8A 4J1QA 5JPDA 5LDHA 3EUAA 3K2QA 4EDFA 3VPBA 4LQLA 3LYHA 3QV1A 4UUNA 4DSTA 3ETEA 3RQSA 4QC2A 1VMIA 4WRRA 1UBOS 1YAJA 3R7WB 3MJTA 2ZIVB 3V48A 1U80A 4PAWA 5ALUA 5SZIA 3RFFA 1U65A 1WCIB 4E51A 5DW0A 2FOLA 3HY6A 4NYIQ 2COEA 4ALIA 1TE2A 3NCTA 4LGMA 3NHFA 4TV8B 3Q72A 4XD7A 3Q3VA 4IKOA 2QRGA 3SK0A 2C2OA 1CEYA 1OXVA 2FLWA 5C46F 4GDFA 2GYYA 1YR6A 1QE0A 1V8FA 2J3MA 3AJDA 1NF2A 1L3BA 1RYHA 1S89A 1WS6A 2GN1A 3CKLA 1F6DA 4FU0A 1EQ2A 2OSBA 4BU1A 2F64A 4CM4A 1IK4A 4CMBA 3NYQA 4P6VF 3OMXA 3GFFA 3MGBA 5BYJA 4GOXA 3KQYA 3P2EA 3A3PA 3M70A 1K08A 2VF8A 5DGDA 3T15A 5J4VA 4MKZA 3S2SA 1PZXA 1XKXA 4RPGA 2PGNA 1W4ZA 3RANA 3K6SB 2O52A 4K2HA 1MT0A 2YXBA 1N2HA 1QP4A 3QY9A 4FK8A 3RABA 3P2OA 1XDZA 5U1PA 5F7ZA 4CIBA 4FZRA 1U8TA 1P9RA 1SG6A 1ZEJA 3R3XA 4OHUA 4O4LF 2HCFA 4QGHA 1L9XA 4OMFG 5FPHA 3WNZA 3KQTA 2HT1A 2WTBA 4W9MC 4WLVA 3RF6A 3TK1A 3ZNQA 4FCVA 4R1NA 4FOOA 1BGVA 4BFSA 2ZRAA 3TRDA 4QPCA 1AMUA 3SQOA 5FUXA 1K7EB 3MTGA 4NENB 5DM2A 3IV6A 3RIXA 3TIIA 1RJGA 5JD4A 1WD7A 4Z4HA 5LQMA 3IT2A 3PCXA 1C8KA 1KI7A 3EK2A 1BXKA 4H3HB 1CQPA 5AW9A 3AKEA 3RJTA 3WP0A 4X6YA 1A76A 4D9KA 1Y9ZA 2DUWA 2VZLA 1UMBB 2Z83A 3N6VA 3IMCA 2WT8A 1XI2A 4YRZA 4J7XA 4IJWA 1KI3A 2GUWA 2X8JA 4KNYA 2CT8A 4O2AA 1SC4A 1XP5A 1OROA 2VPXA 1RAIA 3CX3A 3ABZA 2Q5CA 3ORRA 4I50F 4KPFC 5J9FA 2BEWA 4Y0NA 5FD8A 1U6KA 3Q9LA 4I36A 4JP8A 5CLGA 4JB2A 3SZOA 4J1TA 3UOAB 4DCTA 2OOSA 4WX2B 3RVRA 3LLMA 2I54A 3PV0A 2QAGC 3VUFA 1KKMA 4ZJYA 3PJFA 4J94A 5JYEA 1G41A 5ALFA 1RC1A 2Q6OA 3BB4A 4PFKA 4KRGA 4KACA 1IMOA 3CLRC 2OL4A 5TY0A 3VHXA 4Q7MB 3C3KA 1QBKC 2EZUA 2GYWA 1BE0A 3P96A 2FPLA 1P4GA 4UEQA 5KDOA 3HUUA 4OVKA 4KBYA 1OZAA 1RWOA 5J23A 2O8CA 1Q7EA 5JLAA 4OSPA 1SBNE 4D44A 1PSDA 3K73O 5JWRA 3KSAC 1W9MA 4WOJA 3AESA 3S28A 4A0HA 4WBNF 3ONFA 1OA1A 2PL9A 3PUZA 4RADA 3CX6A 3TN7A 4ICIA 2J7PD 5MN5A 2RHCA 1D03A 1DIOB 5EA2A 4EABA 7REQB 1MT3A 1IJFA 4O08A 5DYIA 1WXIA 4DMKA 4C0XA 2DEUA 4QFMA 1QVRA 4P38A 1ZCAA 1V26A 2FKAA 3I6MA 3NPAA 1HMYA 4RVFA 2VP4A 3MAJA 4L50A 1RPNA 5H9VA 1YCHA 3LHIA 5DGHA 4CCYB 3CJTA 2YMLA 4TT3A 1E9RA 4PZCA 5C52B 4RY0A 3JQ7B 5L9AA 5CHYA 2ZPUA 4JFAA 5DTEA 5LNK6 1ZSVA 2VHXA 4DEXA 1YGPA 4HQLA 5CFZA 2DHCA 1AC5A 5G4KA 4MIEA 2XZLA 1T6NA 3IEPA 2B34A 3Q7TA 4S1TA 1N5OX 4QRDA 4DQXA 5KQSA 3ZHQA 3R7DA 4NV1A 2OMKA 2JRLA 2V3VA 3W5BA 3GJ5A 4AJKA 3NVDA 5BV1A 1DRUA 3KBOA 5FBRB 1CRLA 1OC2A 2Q7XA 4E94A 3PDCA 1VCIA 3WAJA 1Z0AA 2AUTA 1X1BA 4NH4A 4R2KA 3X1DA 1AS0A 4ZYWA 2PWYA 5AUNB 1VPWA 5ES4B 3G1UA 4LTNA 5E6UB 1JEYB 4CV2A 4QDJA 5DW3A 4HNVA 3ZU2A 3OQJA 4IBOA 2J67A 3DAPA 3OZAA 4PYRA 4KO4S 4WW0A 1FBTA 4QODA 4CF6A 2HBRA 2G1UA 4K1LA 2GCOB 1FS6A 1Z36A 4KR6A 2P79A 1USWA 4JL8A 3W5UA 4BNFA 4FFNA 1KR5A 4M98A 5BN4A 2GD1O 4ISCA 3QVKA 5ILGA 3WK5A 1SC1A 2QE7D 4DY4A 2P4UA 1J1ZA 2A9VA 4K6KA 1IZ8A 4AZ3A 1HNWB 4LNHA 3T5BA 4ZI5A 2QPLA 4ZOAA 2R3SA 1JA1A 4I1IA 1V3QE 3VAAA 1QRAA 3A4LA 2JGKA 1R0RE 4TN1A 4ER0A 2JGAA 3IP9A 2DUJA 2P9HA 1LB1B 1WSDA 1XQ6A 4JYMA 5AJTA 1D1SA 1YONA 3O4JA 3IOBA 3IODA 4RSMA 3WXBA 1P45A 1P3Y1 2YZ7A 3I2FA 4R9RA 4RTLA 3REOA 1TADA 2A2ZA 2PFKA 3U9TA 2R0QC 1M5RA 3MIZA 3PFBA 5J4KA 1Q74A 3ZK8A 2CXTA 2PMWB 3W5VA 1ZD2P 3CUEF 1GO2A 5DLDA 1B3RA 3F6EX 3TVYA 3CZCA 3ZCUA 5HUQA 1OB2A 1U3DA 2WFZA 3KB1A 3OLZA 1IQ0A 1G5IA 3BXPA 5AVQA 4IIYA 3IP7A 1ZHFA 3S4YA 4P3YA 3KSDO 2QTHA 1Q3KA 1SKQA 1WUYA 3RSFA 3GJ0A 3EOZA 2Z4TA 3FPKA 4PRKA 4BRUA 4DDHA 5GWXA 2Y1FA 3FNQA 3GZJA 3ZCTA 1YVEI 1CIVA 3A4VA 3FUVA 5KJ1A 4HMQA 1L4MA 2VQ6A 2VNIA 2ZRIA 2HNBA 5G0TA 3EGXB 1V3UA 3OLVA 5FQNA 1E62A 1IH8A 1V95A 2ZUVA 4I7EA 1GKYA 4MWOA 3ZTTA 1G8MA 4ZCLA 1UJ2A 3LYUA 1R50A 4ZC8A 4BNTA 1JFTA 2GHQA 1N2JA 5KB3A 1FDSA 1PSZA 3LZDA 1CP2A 2V4ZA 4FOTA 1CDEA 2WB4A 4ABYA 2GVDC 3A4MA 4AFNA 4DLWA 4YUZA 4HYYA 1DQYA 2GASA 4GLJA 4LMBA 3H17A 2O7SA 4IG9A 3SC6A 2EG5A 2WJ6A 1ST2A 1XMIA 3RYIA 3B78A 1G6Q1 2AOTA 4NBVA 1A27A 2Z56A 3LYAA 1ULZA 1FMTA 1PFUA 2P35A 1B8PA 2CLOB 3ODGA 1U1DA 2G9UA 2C2XA 2PA0A 2NO7A 3MZ0A 1UP6A 5AESA 1R12A 3O3MB 4M1WA 4YP0A 2EIHA 1E2HA 3PXDA 3QM1A 4ZVPA 5IAEA 2UVDA 1GDTA 4RA6A 4J0KA 5AH0A 4YRCA 2DKOA 5AXBA 2EFJA 1K98A 1YWGO 2P4HX 3FNFA 3D5TA 3GWZA 4HDMA 4JH0A 2YQ5A 5BSFA 1ZD5A 2X0JA 4OQYA 5EERA 3UWKA 3TFQA 3IDSA 5CTJA 4TMFA 4ZZ2A 2WWFA 5HF9A 1GQ2A 2NPOA 4MIOA 4PX3A 1NR7A 1RS0A 4B2IA 4ND4A 3I2KA 3DZDA 3N70A 4YXWD 1SVIA 1DXOA 3K1ZA 4N8SA 1L2TA 4DNQA 4X20B 2DH5A 3HP4A 4OQEA 2IZZA 1Q5PA 1SRQA 3OIGA 1M0TA 2V1XA 4FMPA 4QDZA 1NULA 3OAAD 4W6QA 3JQ8B 5DGIA 1Y80A 1C81A 2YWRA 3ESRA 4RZ3A 1XZQA 5C8ZA 5CB8A 2IKQA 2J8ZA 3EGIA 3ZI4A 1SCQA 2B1GA 4ND2A 4TQAA 3EXFA 3KLOA 1XNRB 4OI0A 3H0CA 2FWRA 3WDSA 1CUAA 3CW9A 5DE3A 7ADHA 1IU9A 2BL4A 2NSYA 4GP6A 5TMPA 1EP2B 1NV8A 3ON5A 5FL7A 5I9BA 4RF5A 4JXJA 2HGZA 4PCAA 1DBVO 2AYXA 1CEQA 2X86A 4I08A 1VKRA 2N0SA 3DDUA 1GEGA 4PZLA 3EWNA 3X2SA 2TRSB 3W5SA 5CBKA 3RTDA 1H1DA 2CB0A 2ZTSA 4LJ7A 2YY6A 4W8HA 2PHZA 3I34X 1OZHA 1VHJA 2UUOA 5EJ4A 1FBNA 5CYFA 3C5CA 3H1PA 1YRQA 3L4BC 1ZW6A 4G86A 2VRNA 2X5JO 3KJNA 3PUWA 1RQGA 4CYMA 5I7UA 3K6KA 3UOGA 2FPGA 3IEXA 3FCUB 2C2KA 3JRWA 2MDTA 3PQ5A 4HVTA 2JH8A 2ZPTX 3SOZA 4LKRA 4XWAA 2L82A 3KO8A 3HXMA 3BRWD 3CGWA 1V11B 3AYZB 2H2IA 1TK2A 4JOBA 4BVLA 1VJDA 1OMOA 1B8OA 4NNJA 3IL2A 2EP7A 3TMYA 1E6UA 2YFYA 1U0HC 4JQCA 1DP4A 5GGXA 5J2TA 1QHGA 1XA3A 2BFAA 2R60A 3OM0A 3V2IA 2QVGA 3L8FA 5KNDA 1I3CA 2C7VA 4KAXA 1KKUA 4R9VA 4B3GA 3MGGA 4R68A 5EP2A 3H16A 1T15A 3RU3A 3VO9A 2W2QA 3HDHA 3O1HB 1HDEA 2P9YA 5GONA 4ARZA 2QMEA 3P0FA 5BN3B 1E2LA 5IUJC 4L8FA 5AW8A 2NYVA 2O2ZA 1YR3A 3CQ9A 1GFWA 2NV0A 3G7NA 3C3XA 3H42B 4UQPA 2OAEA 2VAXA 1FVXA 3GRKA 4PGFA 1JTEA 4L8GA 1K0FA 3U7EB 3IAS1 4OJKA 5GADl 1ZGBA 3DLTA 3ND6A 1XTVA 5KYKA 1UH5A 4AJIA 1XDSA 3KEOA 1OD6A 4DCOA 4P2GA 4G9EA 2QYHA 4CKEA 4Q4LA 5CB4A 3PBKA 2H2GA 3MGAA 4KB5A 2BFCB 5CMLA 1KE2A 1KETA 121PA 2BI7A 3EQ8A 1LSJA 1ZH8A 3P8ZA 1UBEA 3B5EA 1Q12A 2X15A 4QNNA 4QREA 4E22A 5DPMA 1YDWA 3DZJA 1YKGA 3KELA 1TF2A 1R9MA 2QM8A 1OOEA 1USGA 1TK3A 3PUKA 3UN1A 4JZKA 1EFDN 4TMXA 1Z9BA 3HB9A 1SUEA 3AEKB 4CMCA 1V1RA 3SIXA 2W6JD 1J33A 2XH8A 3R4VA 4QGBA 1IRIA 2A58A 2UZIR 2VEDA 4FI3F 4R8SA 2O1XA 2PD6A 1QTIA 2R65A 2P2GA 3H11B 2PT7A 2GF0A 1PT9A 1VDMA 1QK4A 2J0UB 2VFAA 3RIHA 3D3EA 1N6IA 1O57A 1WBDA 1NIPA 3URKA 1G8GA 1AQYA 4MV6A 4CT4B 4NRDA 4M55A 2ILTA 1E9DA 4D3ZA 4X6LA 2M98A 2EOAA 1FFXA 2WT4A 1BYUA 3DOJA 1Q57A 3IPCA 5A5EA 3QF4A 2H4XA 3TZ6A 4DIEA 1TTPB 4PZPA 1ZVJA 1GDHA 1A0OA 4GLLA 3VJLA 3ZD9A 5BV0A 1TT7A 5I6DA 3PCTA 3NUZA 1A5SB 4OLBA 2GKSA 3L07A 3UM9A 4EW3A 1K5HA 2HZ7A 1QDLB 3IAHA 2QRJA 5A4FS 2BFEA 2I1QA 2H48A 4RDCA 4KU4A 4DLKA 1TO2E 2WT9A 3MD0A 4BQOA 1XE3A 3BGSA 4OI4A 2EF0A 3M9LA 1AGNA 1MG5A 3FZQA 3LQYA 4Q24A 2XVZA 3VM6A 3JQBA 3PHJA 3DV2A 4HPXB 3AF1A 3V34A 2VDLB 2IJGX 4PLGA 5FBHA 1CNEA 3B82A 3D7KA 2IH4A 2ZT5A 2N1MA 1XZCA 2VJNA 5U4XA 5NLLA 3RYFA 4DG9A 1VG0B 3WYDA 4FDMA 3G8AA 5DN9A 1W0CA 2I22A 1U0EA 3OESA 2HLDA 3OZXA 1ORHA 3ZHXA 2WWTA 4Q05A 3QTLA 1UBMS 1ADCA 1RJ9A 3Q3CA 1M1NA 1ZRSA 3I28A 4XQ0A 5HCUA 3ROXA 2O8FA 2VBCA 1RQ2A 4H31A 4WZAE 4YUWA 4ZIRA 2ACKA 1IULA 1S2DA 4N65A 1NJ6A 3OCJA 1FP1D 4TYNA 4U9IS 3T3HA 3F5DA 4FCCA 1UFRA 2WSBA 4NFHA 4OD0A 3NAGA 4FSXA 1SD2A 1TCCA 1FNDA 2OCIA 3CHYA 4MRRA 1IPEA 2BHRA 4ON9A 5A6SB 1GAJA 1E20A 2G83A 4OU4A 2ACEA 2JJQA 3HRKA 4L1KA 2QUIA 1E3MA 2HM7A 2RKWA 2YQ4A 4EQZA 1FY2A 1K06A 3HYRA 4N0MA 2JCYA 2QI9F 1W5FA 1CUZA 1EX9A 1DC5A 1YZYA 2CMDA 3JQPA 3KC2A 5JUWA 4Z3OA 3KVRA 1UK9A 2CVOA 1HQDA 3ACBA 3W8FA 4I9HA 1GG5A 5FJJA 1T9AA 2PXAA 1FYWA 3FUUA 1OU4A 1TUIA 2PWPA 3AUJB 4UUBA 5DHAA 3TRKA 3RDPA 1X6VA 5ENDA 3W2GA 3HWSA 4B76A 1TYAE 4P9NA 1N9KA 3HG7A 1PZGA 4M7OA 3OZSA 5FNVA 4B6PA 3MQFA 2G5GX 1OUMA 4RACA 4HWRA 2NWQA 4XGQA 1VKHA 2PZLA 2FQYA 5IZCA 2C95A 3ONVA 3W5IA 4CLOA 3S55A 2PGAA 1ZW1A 2G07A 4M1OA 3I3SR 1RHJA 3R74A 3OHPA 1SR8A 1YBVA 1RIIA 2YOGA 4RWZA 2OBXA 4YJHA 3U4AA 2DUMA 5KTOA 3QNMA 4AJOA 3GNSA 3WL8A 4BIIA 1YZQA 1F60A 1W5SA 1M2FA 1SKYB 2J7KA 4UBNA 1SHTX 3NT5A 1WJGA 3MGCA 3NBYC 3PQ6A 4K9LA 2YYAA 1FW6A 4K0KB 1LRJA 3MM4A 4WZBA 3E7PA 2I3AA 1T4CA 2WF8A 4D43A 1APBA 1DT3A 1IFXA 4S3MA 4MR8A 4G3XA 4B47A 4PG4A 3VR5H 4XRGA 4TZ0A 3PQ3A 4RK1A 1JQAA 3L6BA 2C9BA 1NWCA 3NB0A 1WUJS 1OAOC 5DHPA 4EQ6B 2FWBA 1QH1B 2C84A 2KE5A 3R9IA 1TNDA 4AJHA 1KJZA 3COYA 4KQ1A 3ZD7A 4HFRA 3BT7A 3L7YA 2ZB3A 4CBVA 4PPYA 1R3DA 3FNEA 3L8DA 5AM0A 2HDNB 1XTQA 3K35A 4UREA 5BSGA 1RM0A 4Q9IA 3P9KA 4FEAA 3MJDA 5AM5A 1KH2A 4HVLA 5BQ3A 1W36C 3IEUA 5TIIA 1FLDA 3W8EA 2VATA 4DIBA 3TTTA 1LI4A 1HPLA 4A8PA 5CVJA 1N1DA 3X1JA 4WKCA 3ENQA 2FWJA 2ZRLA 4IO1A 1AIPA 3GJYA 4K6CA 3VYSB 1FMCA 4CLXA 4WY8A 2GRAA 1NLYA 5K0CA 4DUYB 1V2GA 2EGGA 1X38A 4RE6A 1F0NA 1KMNA 1SHJA 1RTTA 1MO3A 1RKUA 2QE6A 3K2EA 5AW5A 5HZKA 1EXVA 1OWLA 5AKGA 4L6IA 3O47A 4UBIA 1LH0A 2AG5A 1IWPB 5JRJA 3WIBA 1P0PA 1KI8A 2Y27A 4WA8A 5B7PA 3K8QA 3VTAA 3F6RA 3ZBQA 3R6WA 3ER8A 1SCKA 2D1YA 3CZQA 5L51A 3MXTA 5DT2A 5JAQA 2ZVQX 4OBXA 5ESRA 1PV1A 4B3BA 4DLZA 3DEZA 2BRUA 5I9LA 3H5RA 2GTIA 4L74A 5C8DA 4PLFA 4IGFA 2BZSA 5LOVB 1SUSA 4G85A 2IBSA 4DIMA 1LY1A 3CLTC 1M1YA 1TU3A 3DCJA 3E53A 3KQQA 4LY9A 1KYQA 2ZUBA 5DGXA 1LLCA 5LQSA 3T6KA 4ZYLA 1V16A 2ZT6A 1VBKA 5LZ5A 2G63A 3U7QA 5K6AA 1XVAA 5AUPB 2HR1A 3WB9A 2H1CA 3KE8A 2ZATA 3VYWA 3WV5A 3AY3A 3WY9A 1JKIA 1FRZA 2B94A 3DBLB 4QBHA 1D7AA 4CEHB 2DRIA 1EGMB 1GZ7A 2HWUA 1R4MB 4K3UA 5KC8A 2ON6A 4INZA 4KDRA 2VOEA 1E4EA 3H83A 3NT4A 2FWNA 1NVWQ 4UM5A 2C77A 2IPLA 4Y2GA 3WLLA 1W85A 4CI0B 3GQVA 2MR6A 2H7YA 1U7HA 1RYNA 3FYDA 3EZLA 3DEJA 4GF5A 1CYDA 3KHUA 2FXIA 4ZO9A 2XYQA 3ZW8A 2XEDA 4ND1A 5KYUA 1VM6A 2HWYA 4OHOA 5JXGA 2W2TA 4FYHA 4PXAA 1WXEA 1MQ8B 4ZRMA 1F3LA 1IE3A 1U5AA 4QDUA 4XVHA 5B1DA 1OR8A 4IKEA 4E1AA 3IALA 1MJGA 3GFPA 5JFGA 5C81A 3CIFA 4B3JA 3QKTA 1XWWA 3DHNA 1MX5A 2F9FA 3Q7QA 2QP3A 3FHCB 4YO8A 2FVXA 3OC6A 2KLBA 3VNRA 3MHPA 3KL2A 1HZZA 1FDIA 1LQUA 1SQSA 1MJFA 5DNAA 2JLZA 5DI3A 2Q7OE 5LJIA 2CC2A 4Y1GA 3D0OA 4C43A 1NF9A 1ZP6A 1M1ZA 2AEJA 4N39A 2ZT7A 3IC5A 1USUA 1VGRA 2EYQA 5L7TA 3L41A 5K3FB 3AJAA 1X7DA 4U4AA 3TJZA 3W2EA 2EP8A 4MV8A 3RV4A 3SMQA 5KWVA 1F8YA 4C3VA 4ESHA 1SKAA 2PMFA 2VRBA 3E58A 3I42A 2YS6A 3Q1LA 4GNKA 4GQAA 4UAJA 5DYTA 2WWVD 4TWAA 5A4JA 4KXYA 2J5RA 1E61A 3WSWA 2CVPA 3W78A 2H57A 2OB2A 1R6DA 1YHZA 4S0ZA 3TSCA 4FLEA 2RH4A 4C2TA 1A3CA 1TA0A 1UEJA 4RTPA 1O94A 4BLUA 4HB0A 3PPVA 4BP8A 3PNLA 4ZCRA 4Y2VA 3UWOA 2F8TA 4IWNA 1RJEA 3JPYA 4QIHA 1D9ZA 3FKQA 2NU7B 4A2QA 1K7SN 2OHHA 4KYVA 4CJXA 4OOEA 3HFSA 3MF4A 3Q5GA 2WKPA 3G9ZA 1RI4A 2JHCA 3SSNA 2IHYA 4PC6A 2XCIA 1LJ8A 2WTEA 5K3EA 3PEEA 3ZHSA 1ZUD1 1DTWB 3EXHB 3OE1A 3B6ZA 3OU2A 2BOVA 1Q15A 1GZ4A 2GAFA 4PCUA 1UBKS 4DZRA 1ESCA 3AF3A 3DKVA 4AICA 1X8XA 1SU8A 4YALA 1YD7A 2CVHA 4IRXA 3UB3A 3W9BA 3ZOKA 5K6RA 1C8BA 3H5TA 2PSHA 5IPFA 2QX8A 4NY1A 4NCAA 2JAXA 1FEZA 3RREA 4P0PB 3DPIA 1TC1A 1N6RA 3FOEC 4H7IA 2FXVA 2YXEA 5IKMA 5GIOE 4NQRA 4IFEA 1E1DA 1BYIA 1LBSA 2AN4A 4FOSA 2ID9A 2WSLA 4LY0A 5BUSA 5C8VA 5KREA 1J0XO 1G0OA 1EXMA 2AGVA 3D5QA 3PR3A 3G2KA 3QLVA 2HWWA 4MW2A 1FUIA 2C98A 3H1TA 3PF8A 5EGNA 1LC3A 3HV0A 1YUNA 2PZFA 4AM8A 2C8LA 3HDVA 4YRDA 3QOYA 1THZA 2LCFA 2WWWA 5HBRA 1GLVA 4F1JA 2R25B 3EARA 5WRFA 5HF8A 1U2TA 2D5AA 2FGJA 2ZSJA 1X3SA 1P6QA 2GN9A 3WICA 4DMCA 3RRFA 5DWDA 1YCFA 2BAGA 4Q37A 3V7WA 3EOAI 4AF8A 5C5DA 1SCUB 3WBBA 1QYDA 4GMKA 4HDNB 1B93A 1LRKA 3IDOA 4F04A 1RCTE 5EMKA 4Z51A 3KPYA 5CCDA 1XJ0A 3LC0A 3EVZA 1HTWA 3LX6A 5LP6B 3BH0A 2QRHA 2A9FA 3OE7A 3R40A 4JL5A 2RGDA 2V97A 4FVTA 2FLKA 3H0EA 3D9QX 1PNOA 4TX1A 2PX5A 1BEEA 3F7MA 5FWYA 4YJ2A 5ITZA 3AVYA 1ZEMA 1DMSA 4J76A 3MUNA 1KAEA 4Y1RB 2CUKA 2GVNA 5JSZA 1OF1A 3A9WA 3PNMA 4WJLA 1JHDA 3O95A 4RY9A 1TPYA 2A1TS 4NARA 3H5IA 4KMSA 1IHYA 3PK0A 4HAYA 4I66A 4ZFNA 5JDIA 1PGQA 5JYCA 2RGEA 2VBFA 1DRVA 1SKYE 4GW3A 1C4XA 4M7RA 4LXHA 3D2BA 3SZUA 4F3RA 2O2DA 1CUDA 2O3QA 2WF5A 2ZJ2A 3HN7A 4P98A 2IC5A 2P75A 2IYUA 5IAJA 2FX3A 5FI3A 2OFOA 1DAOA 1VJCA 4J9VA 4POAA 2GCNA 2EFYA 4O2BA 3C70A 1VGVA 5IBPA 2CSUA 4CW7A 2YJ6A 5ANRB 2DXIA 3PX7A 2DWPA 3IBYA 5ED0A 1AS2A 1F7UA 1VKZA 2IPNA 1JU9A 4RAOA 3HNRA 4RX1A 4DAEA 1XZFA 2DM6A 1CUFA 4MAFA 5J5AA 1RZRA 1NVGA 1Z8NA 2CN1A 2HYDA 1P2TA 3TECE 1QFJA 1HDXA 3TW8A 4R98A 4YASA 5EHQA 2QVCA 4MQFA 5D00A 5K0TA 5L8VA 4HEJA 2X1LA 3HDYA 5C8XA 5LPNA 1Z2NX 1RRMA 2PKWA 1K5GA 1KQPA 1GIAA 1I7SB 5JJCA 3HR4A 4KLCA 2NXJA 1Q7GA 3A58B 4I6GA 5HOEA 1MJGM 1VJ1A 4BB9A 1A1SA 2FF7A 4MIKA 3WZMA 1MENA 4BP3A 1SPBS 4IOJA 3U1TA 1D2HA 2FYTA 4YAFA 2X41A 1GNPA 5IUNC 1CW2B 2YN4A 2A9OA 5I9SA 2LR0A 1WHSB 5THKA 1TF7A 2IGTA 1T34A 3OF5A 2O2HA 4QTZA 3G0BA 1TKBA 4GOLD 3OOHA 4IGKA 4DMGA 1MB9A 5DRTA 1N2OA 1D4OA 1SUPA 4V0QA 4OI1A 4HAXA 1YZHA 1P61B 2V9ZA 4RFLA 4KR7A 3DR3A 1PL0A 2Y9PB 2YYZA 3I04A 2GBPA 3OQPA 1SOWA 3AI3A 3PNVA 4H4EA 4KN5A 1DKQA 1XQ9A 1ZNZA 1O0BA 2Y0EA 1EX7A 5BSRA 3UJ9A 2I2WA 3C4JA 4IQ0A 2PVSA 1HRDA 3UB4A 5H4HA 2VPIA 1J5XA 2D7CA 2NUBA 2Z08A 1Y4AE 2V7QD 3OY2A 5IJWA 1DBRA 3C0KA 4Q6BA 4TVBA 1Z12A 5CXSA 3GARA 4C4TA 1MXFA 5G3YA 3HA5A 3RUEA 2HRRA 2R84A 1ODIA 3OU6A 3SZGA 5AK5A 4Y9RA 4BB5A 4UU1A 5KQPA 4YNBA 1TJ5A 3SLGA 4D8YA 4UBLA 1QZTA 4Q82A 1GUBA 1PWYE 4IUCS 1SCBA 3AY0A 1RRGA 4NBNA 1I9CA 1TM2A 4QUBA 4ZVSA 2PS1A 5CNIA 4NULA 5KJ6A 4FNOA 2FSSA 3I23A 1KHTA 5DBEX 2J08A 2NP6A 4CLRB 4BPBA 1NPYA 1TRHA 2WP8J 5I3CA 2GPYA 2NO0A 1TCBA 3CZMA 5F7JA 4K03A 4CIAA 3LT4A 3R9KA 2C7PA 4HH3C 3HE3A 5JD6A 4BY9E 2HCJB 2OSVA 2VAVA 1L5OA 4JGBA 2R11A 4N5IX 4P31A 2VYQA 3D6VA 2WY2D 5C7LO 5HIMA 1VMDA 2RGBA 1TLFA 1RYEA 1VE1A 1NBHA 1QONA 5HW0A 4C2UA 1SPXA 1UBLS 4O5OA 5TSDA 3AV0B 3E1GA 1ZMTA 3HP1A 4O4JB 1BXRB 1T91A 3A2NA 1GZSA 4L6AA 1ZOOA 2XADA 5C8YB 5KNLA 3QVWA 3HCFA 1Y4ZA 3GBPA 4EM6A 5KQRA 2IHZA 1YXMA 4RVDA 2FDCA 3KDAA 4DLPA 4MLCA 3N8KA 3RH0A 3GEHA 1CVIA 3MERA 2BGRA 3EWSA 4LZAA 4B35A 1M72A 1XMOB 2Q41A 5HDBB 1QIFA 3N3BC 2AXNA 4OXRA 3BTOA 3G0IA 4I0WB 2WYVA 4MPPA 1RKXA 1RHMA 2EKPA 4AG6A 3L7KA 1WBBA 4M7WA 1L7RA 2OGSA 3ZIDA 3AIMA 1KDTA 3AY7A 4WT7A 1XAIA 2RHLA 5KSPA 5IXJA 2YWDA 4DDWA 4PSDA 1DAEA 2W8BB 1Z6ZA 3HR7A 4GKAA 3AUXA 4TKVB 5LB4A 1TW2A 3PXCX 4KDCA 4KXNA 1P73A 4LEIA 2XXAA 3GEGA 4H6VA 3DP9A 3GFSA 3LQQA 3KUXA 1IHOA 4DM4A 5IAAA 1Z18A 1V41E 2O2GA 4O4LA 5TPZA 3SM9A 5KNCH 2JIZA 4BVHA 3G0HA 1O6FA 2ZBGA 3PTLA 1AH2A 4ITVA 1QTNA 4RTMA 3OLQA 4EO4A 3B1XA 1T2NA 3PUXA 4L9WA 2RHJA 4IXMA 4RF2A 3TRFA 3LNTA 5AM4A 4DQKA 1G8FA 2ZYTX 4UNRA 4H2DA 1KRXA 1BX1A 4M22A 3QMVA 3OFKA 2W2XA 3HZRA 4BFTA 3UAXA 3NWBA 3T9DA 4G41A 3EQ7A 5HP4A 3LHKA 4HDCA 1P77A 2BEUA 1TD1A 2OGZA 2C3YA 3IR5A 3NT2A 5H68A 5F2NA 1DDOA 2W2LA 4HYQA 5FUQA 4AAYA 2C97A 3C3AA 5HMLA 1RRKA 5IAGA 4YWHA 1JDBC 2PUBA 3U13A 2H63A 5JV5A 4DSUA 3AHDA 2A59A 3ETLA 2PO5A 3LA6A 1PUIA 1KPGA 3V4RA 4W1SA 2O14A 2WR8A 5DX1A 1D4ZA 1SXJD 5EP1A 5EMHA 3S68A 2VJMA 3U3XA 3ZE7A 1O58A 4JC8A 1OLOA 5HTKA 3DUWA 4Q0MA 4L72A 3LD9A 3LH5A 3OTQA 1YUBA 1FNBA 2DKNA 1UJ6A 4JU9A 4MSUA 4QAJA 9LDBA 3U6BA 1X15A 5THXA 1QRTA 4GNRA 3KJEA 4NXMB 4OA8A 4WBNA 1RZVA 4LQDA 2HLNA 2WYIA 4HATA 3E9YA 4BNGA 3OI7A 1SIBE 5AVJA 1OXXK 1YVUA 3DO6A 3EGDB 2QRNA 3BQNB 4YDRA 4XVRA 2ZUSA 1OYVA 4F60A 1WQ3A 1ISPA 5KHAA 5C0OE 4A6PA 5LKAA 3FZYA 3EGVA 2ZAIA 2NAPA 3O5AA 3B20A 4WDRA 3WLTA 3X44A 2H1WA 4RH3A 4LFCB 3QVUA 4ZDJA 5C5CA 4Z9BA 4H1VA 4IIEA 4OHMA 4WK6A 4Z0NA 4DV6B 1BCRA 2WOOA 2HQ1A 2ZS8A 1G21A 2XB9A 3K5PA 4GOJA 3KB2A 4DEVA 4ZVKA 2JJ8A 1L4YA 3ZI0A 2R4UA 4KQMA 2RH8A 1JFFA 3OFVA 1KAQA 1T9GS 3H5LA 1C1DB 1WCYA 4NU8X 2IS4A 4I55B 1DC6A 3K3PA 5F12A 4WVLA 3M34A 4XYLA 2H2FA 3CNNA 4U3JB 3IQDB 4CL0A 3BMQA 2O7NA 3DVLA 4AJ4A 1SXQA 3ZZNA 2O0MA 4FDVA 2AF3C 3EZ2A 3DAFA 4CMGA 1U04A 2WFLB 4PPQA 2CD9A 3C16C 1I94B 3THYB 2X14A 10MHA 2HT6A 3C5VA 1FYEA 2CLKB 3PXAA 1DEHA 4MJLA 4BASA 4E4TA 3DXZA 2YFQA 1MEJA 2W6OA 3G5AA 4L22A 3MYYA 4JLBA 1NV9A 1I33A 4FFOA 1E96A 4QPDA 5TQJA 3KPWA 3VTKA 2I62A 1YE8A 4YP7A 1ETUA 1MQ9A 3ZJYA 2ZS9A 3WMGA 3FPBA 3JZMA 2OM6A 4R1OA 4IL5A 3B1ZA 1RACA 2Q6VA 3BF7A 1MU0A 3K15A 4IV0A 1V9SA 2K87A 2JLXA 3CWZA 1DSSG 4IMRA 1H3NA 2R86A 4MVJH 4EI9A 3F73A 5T6MA 1XUOA 3Q9UA 3PL5A 3GJTA 3ZQUA 4EGQA 5E8RA 4QKQA 4B3TB 2QN7A 1JVSA 4S1NA 3S44A 1V8PA 4OA5A 3ZU5A 1F38A 1PK9A 4MHSA 4B6EA 1WP9A 1E4YA 3H8VA 1M2OA 3KTDA 3RCBA 1I2AA 4ZI7F 2WTNA 1G5TA 3LZCA 3P2KA 4HQ6A 4XJSA 5EJFA 2RCYA 3KOZA 5HK9A 2YWEA 1C3LA 2DPXA 2IQIA 3STUA 3G8DA 4GKBA 4UFPA 1H6DA 4H6XA 4BO1A 2Z3VA 4HNQA 3WGQA 1U7UA 5EQJB 2XHEA 5FWDA 3MYRA 1TMYA 1V71A 1B8NA 2FCAA 1QKKA 3QVLA 5ICEA 4IDEA 4MJXA 1JB1A 5BVGA 5CU7A 2VEOA 3CPSA 2NU9B 1PT6A 1YMQA 3OWHA 1I32A 1LTQA 2W48A 5EAIA 3TTWA 4NYMQ 1VLMA 4AVYA 1BFDA 4C0QC 3CVXA 2CJPA 3T5MA 2FZKA 4A10A 4XYBA 1ZM9A 3X1YA 1FOEB 3HB0A 1C7JA 1F14A 1Q3TA 3DE5X 1WW2A 1YU9A 3HGQA 3NBFA 4EVIA 2FLVA 1Z16A 2IXFA 1K0UA 2HY7A 1HSOA 4ZK6A 4PSAA 2P3SA 3QFSA 4UM7A 3C1AA 4LW8A 3GPBA 4CZ2A 2E5WA 5A1TA 1XRMA 1VCMA 1Z62A 1NATA 2JARA 3HCWA 3KT0A 4C0WA 1ORDA 1CDOA 1XKQA 1Y3DE 3FBTA 1RLOA 4G1VA 3SX2A 1QZUA 2J5BA 1XKLA 1BE1A 3IPLA 5DTRA 5EJ8A 4X41A 1ODTC 1WDMA 3H86A 5ICSA 3VKUA 3WBKA 2ZIZA 2VCHA 4LYJA 1IY2A 1JR3A 1K97A 1TEVA 2UV8A 2NXEA 4FXPA 4AUKA 3PJRA 3ND8A 5G53C 1Q0QA 5AJXA 4GXRA 5K3OA 3ZD8A 1L4EA 1N0UA 3CEAA 2CW5A 2E1RA 2XSZA 4KQ2A 3IP5A 3KSZO 1A9QA 2ZYRA 2CEAA 4PZ9A 3DBIA 3U7RA 4EPXA 4Y2SA 1XF1A 4BVBA 1UJCA 3DM5A 5IF9A 4NEQA 1E0SA 1SEVA 1WMDA 3TIGA 3K4QA 1VP3A 1HUQA 4CT0A 1PLKA 3PEVA 1ATIA 2VPWA 1SXHA 4X93A 3W3AH 3CU5A 3I8SA 5GJCA 2VR1A 1LWOA 4AN0A 1Y0BA 1SURA 1DGQA 1AURA 1L4NA 4HXEB 4C21A 1GCAA 2RHBA 1A71A 4QOJA 4K9KA 4RLQA 4ALKA 4BL5A 6REQA 5T7BA 5KKNB 1N2CB 3FX2A 4L5BA 4BEJA 5JDCA 2E1PA 3UJBA 1I1HA 4LCBA 3R0XA 4C05A 1I2DA 2GI4A 4EKIA 3C3JA 1IXKA 4FEYA 4OFZA 4RHCA 3AFNA 3PEYA 1SC9A 1Z6YA 1E2QA 3H8SA 2B2CA 5AOCA 3EUEA 3DBHB 3E23A 4H4DA 1V96A 1AZSC 2GH1A 2NO1A 5AUOB 5HJEA 1NF3A 4MEAA 2Q46A 1RYYA 2Q3BA 2X1MA 1R8QA 1R6BX 2E21A 6GPBA 2NSJA 3HU5A 5IDVA 3WGLA 1G8HA 5DWVA