4J0IA

Tannin acyl hydrolase in complex with 3,4-dihydroxybenzoate
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
470
structure length
452
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 165
structure length 452
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0iA00
1MTZA 3W06A 4C88A 3C8DA 2PU5A 4G8BA 1XROA 5ALUA 2XUGA 3MUOA 4WY5A 5C7YA 1M33A 2XQIA 5AM4A 2FX5A 2DSNA 5FOQA 1GKKA 2BCEA 4X92A 1ZD3A 2HA2A 5EHXA 4X6YA 4N5HX 1LNSA 4QDUA 3WYDA 1MPXA 4LYEA 1H22A 1Z68A 3WKCA 5AIBA 5AK4A 1SCIA 5C8VA 4BCDA 3HC7A 5ALSA 2PU7A 1EXWA 5JASA 1EB8A 1HPLA 5ALQA 5HFAA 1DWPA 1EA5A 2XUAA 1VKHA 3C8HA 4FWBA 3DYVA 4DSZA 2CB9A 1E8MA 1XLVA 4FDMA 1R9MA 3V1NA 5CH8A 1IZ7A 3AIKA 5FV4A 1UKBA 4UFOA 2XUIA 2ES4A 3O4JA 2V9ZA 1XZEA 2GZRA 3MGAA 3IUQA 3WKAA 4BAZA 2QUAA 4Q05A 4HTAA 3EBLA 4MJ3A 1CUAA 4PV7A 3AILA 2ROQA 3FCXA 1JT2A 2QJRA 1CUZA 1K6EA 4J03A 1CVLA 3FWHA 1I6WA 4CIAA 5CXUA 3H17A 1LPSA 4JEIA 4A23A 3WMRA 1LZLA 3LS2A 4B7ZA 4XWGA 3WI7A 4UUQA 5DWDA 2H7CA 2EEPA 4Y2YA 4H18A 4E11A 3I2KA 4E46A 1DWOA 2X8BA 2WUGA 2BAGA 5K3DA 5AKHA 1JFRA 5HF5A 1EH5A 1XQXA 1TIBA 4KAJA 4DNPA 2DHEA 1QIIA 4P93A 2GBCA 3STVA 1CQWA 5FXMA 3QPAA 1BS9A 2HA6A 7YASA 3WWCA 4NMWA 3AZOA 4C4YA 1LZKA 3OPMA 4BVJA 2Z8XA 3MUNA 4BB0A 1ZI9A 5HQ3B 1EVEA 2XLBA 3DL4A 4Y2VA 5E4TA 1UK8A 1XZIA 4YX9A 3C5VA 3WIBA 3L1JA 1CIJA 5C8ZA 1ACJA 3DQZA 3R40A 1WB4A 5DTJA 5AKYA 1CUYA 3HSSA 5ALOA 3CXUA 1EINA 2WHQA 5AH0A 5E4YA 4FFVA 1UKAA 4I3FA 1TQHA 4CCYB 5D6OA 3STUA 2GBIA 2H9YA 1JMYA 3FOBA 4PW0A 3H18A 1K4YA 4NZZA 1GKLA 2HFKA 5FP0A 5K3CA 1K8QA 4OUKX 3F67A 3LIIA 4GXNA 4B81A 1BE0A 1CUCA 1CFJA 1JU4A 1QIKA 3AFIA 4LXGA 4FTWA 2XT0A 3QPCA 5AOAA 5ALKA 1QIGA 5HK9A 4UPDA 3T52A 3R3UA 2WFLB 4PSUA 3W9UA 2ZYRA 2O7VA 4PSDA 4WFJA 2QXUA 3VJLA 1ZD5A 3D0KA 5I8PA 5EIHA 3VVMA 3FSGA 1CUIA 2JGEA 1BCRA 1VA4A 1K5PA 1W6RA 3H04A 5D3ZA 3I6MA 2IITA 4AO6A 3B5EA 1HQDA 1CPYA 1ZD4A 3D4LA 5AK6A 3E0XA 5AO9A 1JMKC 3OM8A 4QE3A 1XRQA 4DYHA 2B4KA 5HQ3A 2WIGA 1CUEA 2PM8A 5JARA 1R4ZA 3M83A 4F21A 3HABA 3C6YA 1ACLA 4X00A 5AKZA 3ZWQA 2HDWA 2Z5GA 2RAUA 4OPMA 1CUVA 4Y9SA 4AQDA 5A6VA 4OYLA 3G0IA 5CT6A 4IQ4A 4W1PA 4CCWA 4CCYA 2XDWA 3C5WP 4QZVA 5CT5A 1VZ2A 2JEYA 1XZKA 4Y2TA 2XI4A 3C87A 3WK6A 2PBLA 2PSEA 4EY7A 2WQZA 3HRHA 3I2FA 2VT6A 2WFLA 2AJCA 5ESRA 2AJ8A 4GW3A 2WJ4A 4B0PA 4G8CA 2OQIA 2X5XA 5ISMA 3DYIA 2QT9A 5IVHA 3KWFA 1BEZA 3WWOA 4KJXA 1JJFA 2VSQA 3RK4A 3CCCA 4EHBA 4OB7A 4I4CA 4FBMA 4Y2UA 3PFCA 1TKRA 3SC2A 1ZOIA 4H7EA 2HHAA 4LHEA 2OG1A 4EA6A 1VA5A 4KR0A 2BUAA 4UFPA 5LZ2A 3VXKA 1ODCA 3RKSA 2I3DA 3F8SA 3WL8A 3OC0A 4KYVA 4KRXA 4X71A 1EK1A 2ZYIA 1HL7A 2OAGA 5H3HA 4UBNA 4BDTA 5A7FA 4H7KA 1TRHA 4AO8A 4H7HA 4Y2QA 1O6GA 2RIPA 3X3HA 3HLKA 2PSDA 2QR5A 4KRYA 4DGQA 1FFDA 1P0IA 1UT6A 5CH5A 2J4FA 3WKBA 1LPNA 3NUZA 3HEAA 3EIOA 2IX9A 1SCQA 1DU4A 3DNMA 3DKRA 4BE4A 4MWTA 4HXEB 1ZICA 1B41A 1RP1A 1L7QA 2JGMA 4LIPD 1UXOA 4AN0A 5AKIA 3KOOA 4WJLA 2HA5A 4WDQA 3OURA 1QO7A 2XMCA 4QWMA 5LIPA 3WK8A 2QXTA 5A2GA 2PPLA 3IDAA 4EB0A 1UOQA 3FVTA 4DMKA 2UZ0A 1QIHA 1XRRA 3G7NA 4RPCA 3TRDA 4NVRA 3QBJA 4EZIA 2HU8A 4DTCA 2WG1A 4XX1A 1N5RA 3G02A 4XVCA 2DCMA 3VJKA 3PE6A 2VTVA 1CUXA 2P8SA 2I03A 3S2ZA 4RNCA 2BUCA 4F60A 5DNWA 1ZI6A 2RHWA 5CURA 3FLEA 2ZYHA 3A6ZA 5AOCA 5DJ5A 4NS4A 3EF3A 1H2YA 4GBGA 3N0TA 1XFDA 3I1YA 2NW6A 1SC9A 5AM0A 2XMDA 2WU3A 1EI9A 4ZV7A 2XUDA 5LKAA 4E15A 2HFJA 3H1AA 4AO7A 1ZJ5A 3BIWA 4HVTA 1VJ5A 4QLOA 3ICVA 1THTA 1W4LA 1YA8A 3QVMA 4B0OA 3AINA 5AM1A 3UUEA 2BUBA 4QDOA 3R0VA 1PJAA 1UFOA 4HZGA 4MEBA 1QFMA 4Y2JA 1KU0A 2HA7A 1YB7A 4BC0A 4FFWA 3WYNA 1E3QA 5DYYA 2CMFA 3BL8A 2WILA 5JAOA 5SYMA 2DR0A 3FYUB 4GHWA 2QS9A 2WUDA 2DHDA 1DT3A 3QYJA 1LGYA 5FUMA 3C70A 5ALDA 3WLAA 5C81A 2WU4A 1WPRA 2BKLA 3KDAA 4DMHA 4K2AA 2FJPA 3HACA 5CRIA 1MAAA 3A2NA 1XZFA 2FUKA 1CUUA 4B84A 3PFBA 5HKBA 4IH4A 3D3NA 4QNNA 2FJ0A 2V97A 3H2IA 3H2HA 5T4FA 4LKOA 1Q0RA 3E3AA 5AKJA 4UBLA 2XMGA 4BCBA 2W6CX 1CUWA 3AZPA 3N2ZB 3ZLTA 2GYUA 1IMJA 3GBSA 4E14A 2G5TA 4CG1A 5AP9A 1BROA 2VQ6A 4KE8A 3IUJA 3F98A 1WB5A 5LZ7A 1AQLA 4G9GA 3R3ZA 1R50A 1R3DA 1E8NA 4UBJA 3STXA 3WL6A 3IA2A 3BJMA 4Y2PA 3C43A 1X70A 2HA3A 3STTA 1C7JA 3SX4A 4MYSA 1QFSA 2HU7A 4ZV9A 1UOPA 4U2BA 5FRDA 3C45A 1XZMA 2OGSA 2WFMA 1XZDA 4N8EA 5CXXA 1AC5A 3ICWA 4AZ3A 3QM1A 1UK7A 3L1HA 1LPBB 3O95A 4EUSA 3O9VA 4B6GA 2DHCA 3FYUA 2RGUA 1TCAA 1NU8A 1YR2A 2JGLA 3WKEA 1EVQA 2DQYA 4X94A 1QIMA 2BFNA 4WCVA 3OTQA 2PSFA 3DDUA 4S0XA 1LPMA 5KREA 2OCKA 5DYWA 4BTLA 1FFCA 1XKTA 1ZD2P 3BF8A 2XUHA 5A62A 2ZJ7A 4K6KA 3QMMA 5AI8A 5E4JA 5LZ5A 1Q0ZA 2RONA 4HRXA 4Z49A 1MO2A 4PO3X 3B3QA 3WA7A 3ILSA 2WHPB 4QWWA 1ORWA 1XLUA 3STYA 3WJ2A 1X2BA 4B80A 4MWSA 1KU6A 4PSCA 1MJ5A 1QO9A 3BXPA 4B85A 3WIOA 2OAEA 1XZGA 4J7AA 3DOIA 4J0HA 4BBZA 2OLEA 1N8SA 5BWBA 3DCNA 5ALVA 2VJDA 2CEKA 4FHZA 5JIBA 3DLTA 3DD5A 1BEEA 2WUFA 1N1MA 5AI9A 2W22A 4W1RA 3H2KA 3G9XA 3WZMA 1AMNA 2HA4A 1ODTC 4JH0A 5AJHA 2C5GA 4ARBA 4PNZA 4FNMA 4JYMA 4WFKA 4UBIA 3GUUA 3F96A 1DX6A 3JW8A 1R1DA 1MNAA 5D7BA 4CIBA 3IBTA 5JAHA 3I2IA 1EHYA 4KAFA 2JEZA 5T4BA 4ZWNA 1CQZA 1BN6A 4YK7A 5KBYA 4G9EA 5JD4A 5IH7A 4U2CA 2HRQA 1WHSA 4BE9A 4X85A 2C5FA 3CN7A 2DQZA 3JYHA 1XQWA 1J1IA 4MQMA 1XQVA 5BWCA 1ZIYA 2WJ6A 1U65A 3HJUA 5ALJA 3JWEA 3QZUA 2AJBA 3G0BA 4ZI5A 5EGNA 3WQHA 1E5TA 2H1IA 4TGLA 3A2MA 4KACA 4FLFA 4CG3A 1WOMA 4AMZA 2ECFA 5FDFA 3W9BA 4M0FA 3B12A 1G66A 2R8BA 1J07A 3A2LA 2ACEA 3I2HA 4UBKA 4EY6A 1W1IA 5ALFA 1THGA 5K5EA 2GZSA 3GZJA 3TJMA 5AOBA 4BTVA 1YASA 5AM5A 3C6XA 5FPQA 5ALLA 4K5QA 1H23A 1C4XA 1A8SA 2ZSIA 1BRTA 1J06A 3QH4A 5ALYA 4U2EA 4G4JA 4N8SA 3G9UA 2XUFA 2OGZA 5JATA 1GZ7A 4H7DA 4A5SA 3V48A 3PUHA 1J2EA 5CT4A 4TPKA 1EK2A 4G4IA 1VE7A 3ESCA 1XZHA 3BE8A 4X6XA 2AXEA 4RE5A 1XZCA 3Q8WA 4GDMA 3H19A 5EHZA 1TK3A 3IURA 5CMLA 3SWWA 4P92A 1YA4A 3WWDA 4HXFB 3I2GA 4MXDA 3WZLA 3K6KA 5K3EA 1EX9A 1WCYA 1MX5A 4CG2A 5CH3A 5AK3A 3BF7A 2JF0A 4EY8A 2JGKA 3PF8A 4X3CA 2C7BA 1ZGBA 4UBMA 4OSEA 5A7HA 1B6GA 2B9VA 3TGLA 5BV7A 1DX4A 3RARA 4C01A 1YAJA 3LLCA 1OILA 3DOHA 2BJHA 5HF9A 3G0DA 3VJMA 5IVIA 2XMBA 4H7JA 2WIKA 4OYYA 1GPNA 3HYSA 1QIDA 5CT9A 2QMQA 2D5LA 1UK6A 4X90A 3HZOA 4JNCA 2ZVDA 5AI5A 4OD0A 1T4MA 2Y1KA 1DINA 1QLWA 2I78A 4J3JA 3WK5A 4DIUA 5ALXA 1MX9A 3IVMA 4N8DA 3G9TA 4K6GA 3F9CA 2ZYSA 1E8DA 1EDDA 4M0EA 3PI6A 3EQ7A 3K9BA 3C6BA 5FKJA 5JZBA 3ZI7A 1YSCA 2B20A 2VJBA 3GROA 5YASA 2XMSA 4DMCA 5K3AA 3U0VA 4GECA 4OB8A 2J3DA 2HM7A 5EIAA 1G5FA 2E3JA 2G4LA 5AK5A 4Y2XA 4DNFA 5LZ8A 4DMFA 6YASA 1WPXA 4W9RA 5EFZA 1XRPA 2QRUA 1QONA 1UK9A 1LBSA 5ALPA 3F97A 5AKEA 1MX1A 4B82A 1F6WA 3VVLA 4KEAA 2CBGA 1JKMA 3G0GA 2QJWA 1XRNA 4U2FA 1A88A 2C58A 3IULA 2Z8ZA 2PUHA 3RM3A 2QVBA 1CUFA 1C7IA 4J0GA 4Q82A 2VT7A 4UHDA 5A71A 5LKRA 2XB6A 2XUQA 2PKYX 1H2XA 2LIPA 3WK4A 4X6UA 3UMJA 4YASA 3PF9A 1U8EA 5ALHA 1PV1A 5HCUA 5ALWA 1ORVA 1XRLA 4QDZA 2VATA 3O0DA 1F8UA 5CTAA 4GI1A 1CUDA 4XJVA 1Y7HA 1E89A 4IH9A 4BCCA 4BZWA 2OCGA 5AI4A 4BATA 1XRMA 1L7AA 1Y7IA 3WWEA 3ZLUA 2J3QA 1QOZA 4ARAA 3I6YA 1QGED 4U2GA 4QDXA 3GELA 4UHFA 4DNQA 2AJLI 1IUPA 3PUIA 1IUNA 4BAUA 3K2IA 1E66A 1TCBA 4I19A 5BOVA 1Q83A 3I6ZA 2H7XA 5AI6A 2PUJA 3WKDA 4L3WA 3S8YA 2J4CA 3BJRA 2WG2A 1F0NA 1MU0A 4INZA 4JUIA 4MYDA 1AGYA 5C8XA 5JADA 5HKAA 1TAHA 2HU5A 4MEAA 1DT5A 5DNVA 3H2GA 2VEOA 2V98A 1IUOA 2XUPA 1JJBA 4UHHA 2PVSA 1A7UA 1ZIXA 1AZWA 1RWQA 3BIXA 1XZLA 4G4GA 2WIFA 4L0CA 5ALIA 3FLBA 1HKHA 1XKLA 3LCRA 4Q1VA 3BDVA 5JAUA 2Y6VA 3NOXA 4DNOA 1SFRA 5FLKA 3ZPXA 4YPVA 3FAKA 3D7RA 3W04A 3WK9A 3KXPA 2VA9A 1ZJ4A 1UKCA 1JI3A 1FSSA 4RE6A 1JJIA 2OQVA 1SOMA 2OCIA 5K3BA 4WY8A 2JGIA 5AKKA 4FBLA 5JD5A 3PDCA 3GFFA 1ETHA 4IO0A 3WJ1A 2C4HA 1XZBA 4DM7A 5HF6A 3O4IA 4AX4A 4J0JA 3DJYA 1GXSA 2GBFA 2ZJFA 4ZGBA 4J0DA 5DNUA 4UFNA 1XZAA 2CUTA 3AIMA 3GA7A 3SK0A 4B83A 4AXBA 3P2MA 3D5EA 2R11A 2H7YA 3V1LA 5EHNA 2QKYA 3WL5A 4W1SA 2O2IA 3ED1A 2K2QB 2VF2A 5AM3A 1EB9A 3BDIA 4OB6A 3H1BA 2B61A 4TVKA 5T4EA 4H35A 2WKWA 1K63A 5JYCA 2WIJA 4OU5A 2YASA 1G4HA 3DEAA 4FLEA 2CKMA 2QZPA 2OGTA 3OG9A 3YASA 4KE6A 4BRZA 1PFQA 4H0CA 1IZ8A 4HAIA 5JZ9A 1T2NA 3G9ZA 1XQYA 5A7GA 3V1MA 3CN9A 4P9NA 4Q3KA 5EI5A 4D9JA 4BVLA 1ZI8A 2QM0A 4AN1A 5KWJA 2XLCA 2VAVA 1SCKA 1ISPA 4RGYA 1P0MA 2WIDA 3ESBA 3DL7A 2YYSA 2RHTA 3QMVA 3EQ9A 1U2EA 1DWQA 5KWIA 5T4HA 5JANA 1W52X 2XQFA 1YS2X 2C0PA 3AJAA 3D2AA 3IB3A 4KE9A 3G8YA 5DYTA 4H7FA 1GPLA 5JAPA 3HXKA 4P08A 1JU3A 4X7BA 3ESAA 4K6HA 1LPAB 1P0QA 4GLBA 5ALRA 2EDCA 3O4GA 1N5MA 2ONCA 3WK7A 3V1KA 2O2GA 4FOLA 2Z3WA 1IVYA 5EIEA 4GEGA 1AUOA 3AUKA 4ROTA 4C4ZA 4ZRDA 5I7UA 3QITA 2RI6A 2XUKA 1BN7A 2ZSHA 2WHPA 5LLSA 5LZ9A 2O2HA 2ZJ6A 3NWOA 4QLAA 3L1IA 2OCLA 4QDTA 3E4DA 3FYTA 1LBTA 4U2DA 4QEKA 1FFBA 5ALMA 4O08A 3I28A 4J0KA 3R3YA 1QJ4A 1TCCA 1MNQA 3VDXA 5ALEA 2WHRA 2PL5A 3R3VA 2HADA 1OXMA 4G8DA 2BGRA 2WSLA 3CCBA 3O4HA 5HF8A 2X76A 4BC1A 3T4UA 2XUOA 4Y2SA 4HXGA 3ESDA 4AZ0A 5D3KA 1DQYA 1U4NA 4BAGA 2QOEA 3BWXA 1DQZA 1ODSA 3KD2A 5LYYA 5EHQA 2WG0A 3WA6A 5I9IA 5ALTA 5DTIA 1A8UA 1YB6A 3O9MA 2HA0A 1QTIA 4C6HA 1DTEA 4GWLA 1UOOA 1CUBA 4A16A 1WB6A 4UBOA 4PF1A 2DFPA 2CJPA 1GQSA 3V9AA 3QMWA 1MN6A 1OCEA 2O7RA 1A8QA 1D07A 1ZGCA 3QPDA 4HRYA 2QUBA 2WM2A 5IKXA 1Y37A 4BYMA 4EBBA 2V96A 1AURA 1W76A 5IVDA 5AKLA 1H2WA 3FVRA 1WM1A 3ANSA 1Q84A 2GYWA 3W2TA 2XQKA 1EDBA 2D0DA 1CV2A 2YH2A 3UUFA 4N5IX 5SYNA 4Q3LA 2WLSA 2ORYA 1KEZA 3EQ8A 3FYUC 3E1GA 2XQGA 1R9NA 2ACKA 3FNBA 1W75A 4ZXFA 2VJCA 4X91A 4L9AA 3FCYA 1MT3A 1CRLA 3FLAA 4H77A 4XIIA 4J0IA 4CI9A 1P0PA 4W1QA 3DKKA 4LXIA 4BP8A 1GPKA 4W63A 4M0MA 3PICA 4H7IA 4J0CA 1FFAA 1QTRA 1O6FA 2PSHA 1BU8A 5AICA 5J3JA 1QIFA 1VXRA 2JGJA 1VE6A 3LIPA 1YS1X 1BCSA 5JZSA 4PQEA 3R41A 5CBKA 4Y7DA 2OXEA 5JALA 1CR6A 1VXOA 1QZ3A 2Y2UA 2WTMA 4G1FA 2Y2VA 4C87A 4IHAA 1USWA 5DLPA 5K3FB 4UHBA 5AIAA 3W05A 1EDEA 4ZREA 2WUEA 4WDRA 1CUGA 2VAXA 4DSAA 4AMYA 4OU4A 3ANTA 1QIJA 2XMRA 2G5PA 2PX6A 3STWA 4UHCA 1QIEA 4LYDA 4F5ZA 2WFZA 3I2JA 5ALNA 4WFIA 3AZQA 1LPPA 3R3XA 5AKGA 4F0JA 4V2IA 1VOTA 1FFEA 1R88A 5FPPA 5ALGA 3WL7A 2JGFA 1UWCA 2HRRA 3D2CA 3ZV7A 3H0CA 1RYYA 1XLWA 3LP5A 4ETWA 5LP1A 3NGMA 1HDEA 4OCZA 3U1TA 1UZAA 2XUJA 1XZJA 2EDAA 2Z3ZA 2XQJA 3M3DA 1YCDA 3RLIA 5JD6A 2HL6A 2AJDA 4ITVA 2WTNA 2GYVA 5CW2A 4FKBA 4EY5A 2OPHA 4B9EA 3WWPA 4HS9A 3G0CA 5F4ZA 3IUMA 5AKXA 1S8OA 1CUHA 5ALZA 1CLEA 2Q0XA 1X2EA 3ZLVA 3A70A 4FNGA 4L72A 3Q0TA 1CUSA 2PSJA 2Y6UA 1L7RA 4Y2RA 1MAHA 1F0PA 1AKNA 4Q3OA 1LPOA 2BGNA 4Q34A 3HI4A 1NU6A 5CT8A 2XMZA 5K3FA 4BVKA 4C89A 4X95A 1AX9A 1LLFA 1HBJA 2QTBA 5E2IA 4CFSA 3I1IA 4X97A 2C0QA 1G42A 3M81A 2XMQA 4JYPA 3D59A 3C6ZA 4FMPA 2XE4A 1VZ3A 4AB1A 3FSGD 4BZZA 4BRSA 4BDSA 1GT6A 4C4XA 5AHXA 4KE7A 4BP9A 4IH1A 4QA9A 3M82A 5HK8A 1YAHA 1WHTA 4LXHA 1VLQA 2YXPX 5HZGA 1QE3A 4UHEA 1H2ZA 5AM2A 3H2JA 4DLNA 2HIHA 2IIVA 3VKFA 1GQRA 4X93A 2WJ3A 4B9AA 3IUNA 3R3WA 2JBWA 3KWJA 4MQLA 2I3ZA 3FBWA 3MVEA 3AIOA 4KAAA 1CUJA 2G63A 3KSRA 1CEXA 5LZ4A 4G5XA 5AI0A 1GGVA 5IVKA 4EY4A 3DS8A 3OOSA 3D2BA 2VJAA 3IIIA 3TEJA 2GBGA 2CZQA 5HFNA 1FJ2A 1HLGA 3VISA 4FLMA 1NX9A 2JIDA
chains in the Genus database with same CATH superfamily
1MAUA 2HNKA 4Q3BA 1PR5A 3C8DA 2PU5A 2GCOB 2X77A 3WLHA 2B34A 2B99A 2OR3A 4DADA 3THWB 3RR2A 3A7EA 4ARUA 3EGCA 4PIVA 5LR6A 1JPNA 1X7YB 1DC3A 3MUOA 1YZQA 1M0TA 4FHEA 2HN9A 4PZ9A 2H31A 3DR3A 3BAZA 3Q8KA 3CWQA 4YJ2F 5A6SA 4HFJA 2XB2A 2X0RA 4FIZA 5FWDA 1U0JA 4D4JA 1I4WA 4XRGA 3FTFA 2WTEA 5T3YA 2AXNA 4A8PA 4E0BA 3WQSB 4AMGA 3ZW7A 4GMGA 4FJ2A 3ABQB 3FRHA 4I1YA 4LRUA 4ND7A 4O8CA 5HP4A 2DSNA 5FOQA 1JFLA 4X92A 1SJ9A 1T2AA 3RV4A 1YACA 5IM5A 1UEIA 1JL3A 1LC3A 2HUPA 2PT9A 1U3VA 2XOXA 3OOYA 4NH0A 4ENTA 5EHXA 2V5VA 2NVWA 1DC4A 1D8TA 1E4VA 3R5HA 1NXQA 4NFSA 4ER0A 4QUKA 1ES9A 2JGAA 3OU6A 2WJHA 1PR0A 2A5YB 1J9EA 1L4NA 4J43A 3JRXA 3QELB 5ICEA 2OV8A 3DJFA 3GQBA 2Q4OA 1W85A 3A31A 3G2NA 4G37A 2PUGA 1A77A 3H5AA 5FORA 2E82A 5MF6A 2V1UA 5DKFA 1E5XA 5AK4A 5EZYA 1RAEA 3D0QA 1XXHA 4N0DA 1LCIA 3DWEX 3ZZ1A 5ALSA 1SPXA 4JYZA 1OZ0A 2JJMA 2JZOA 4ECEA 2O0MA 3SYLA 2GTIA 3VPXA 4G86A 3JASA 4OQEA 5JASA 1HPLA 3P4XA 2ZT6A 4JXXA 4BLTA 4J91A 1V71A 4K9NA 1DWPA 5HJ5A 4HQNA 3I01M 1VKHA 1RQPA 1XPUA 2B3DA 3C8HA 4BJHB 3VKGA 3CINA 1XMIA 4PS0A 2HBZA 4BLUA 1QPZA 2C2GA 1OX4A 5JJCA 1RDFA 4O5AA 4Z4IA 3H16A 2BSQA 5EPUA 3UVEA 4P0PB 3M6UA 1LD3A 3BXZA 4OHVA 1FP4B 3A9UA 4JELA 3RFUA 3RTGA 2XKKA 3HCAA 4LJ7A 4ROSA 1E6WA 5CH8A 2O7SA 2Q07A 1QHHA 3FNEA 4CQNA 2CMDA 3M3PA 3ADDA 1O5OA 1VLHA 5JCOA 1IZ7A 3GJ3A 4LMPA 3WLEA 5FV4A 1Q11A 3CNOA 4FNAA 2HLPA 3SS9X 4S1VA 1VL0A 2ZETA 3BICA 1ZJZA 2NU7B 5HHTA 4AKTA 2AS0A 3CMMA 4GKVA 4CR7A 1XZEA 2GZRA 1RXUA 2JIRA 3IFSA 2D1FA 2FEWB 1ZUHA 3KTDA 1TQ8A 5H9VA 1QBGA 4BAZA 1ZK0A 4Q05A 1GTVA 2RC5A 1JHAA 2V7UA 1B2LA 2HBRA 1E2MA 3AJ9A 2VR1A 121PA 5BSRA 1KR2A 4P7BA 1C81A 1GUDA 4OXIA 4RETA 4ZCQA 5KJ6A 1RC8A 1Z88A 1BXRA 4GR9A 3NDBB 5IK2D 5IBPA 2RCYA 3KEQA 2H0AA 5IXJA 2VHUA 1NJFA 1GUFA 3FWHA 4ZTBA 4D3XA 1TJ5A 1NQUA 2DWQA 2H2AA 4MAAA 3H9BA 4FYKA 3H7IA 4S1OA 5JAQA 3OETA 1AGXA 1LPSA 3I4FA 3EVZA 4UTRA 3ZVNA 5KTPA 3LS2A 5F3DA 1D2AA 1Z6AA 4B7ZA 2VP5A 2ZSBA 4I4IA 3N8KA 2ZRDA 4KV9A 2GK4A 1NNI1 2IF0A 1GGHA 3OM0A 5DWDA 4JBIA 2H7CA 3IAM6 3K94A 2CL6X 3QWBA 4O4JF 4Z51A 1YXMA 3TFOA 4E11A 1R0KA 1PQYA 4E5KA 4A73A 1Z5NA 4V0QA 4HB0A 1JR3A 4EEKA 2HREA 2Y1GA 1KIAA 3RO7A 5AKHA 4AUKA 2HHLA 3JR7A 2V7XA 2ATXA 2OXRA 1C8VB 2QTMA 3G2PA 3LBNA 3RBVA 3I30X 2DUNA 1XQXA 3RBAA 1TIBA 4KAJA 3BD8A 2W6JA 1UPXA 2JANA 3ONWA 2JK1A 2FE1A 4I1VA 4Z0TA 2ZUWA 3T4PA 1UBUS 2YWCA 4XI9A 4RV5A 5HM8A 5HUHA 5K03A 2O0JA 3COYA 4E09A 2W4QA 4OREX 4D8VA 2GBCA 3K71B 3PHJA 4IXTA 5BWNA 1P5JA 2F1HA 3QPAA 4MB6A 4I8XA 4R81A 1JZSA 4OHBA 4N1AA 4TYNA 2FPKA 1J49A 4X54A 2RH5A 2O14A 1R0YA 3VSEA 2M98A 4NMWA 1BVRA 1ZXLA 3Q1LA 4JJ6A 3S8MA 1U7UA 1XVIA 2FP4B 2ZRKA 1IHXA 4BQQA 1KTIA 1LZKA 2WA2A 1PKEA 2FX2A 4BVJA 1MO3A 2Z8XA 3WGIA 2YFKA 1ZI9A 3ICEA 3JQ8A 2XOKD 4Q4JB 3BMCA 4D9CA 3AK4A 2ZOSA 5AJTA 2F64A 3SBOA 5B4TA 1EPUA 3DUFB 4C3UA 5EGSA 4WZAA 1KVRA 4MUEA 1KSHA 5C8ZA 3ZGVA 3R40A 2F3QA 2Q6OA 4ZP1A 4RK5A 3SVZA 4YNBA 1ZMXA 4OAOA 4I2NA 4Q5IA 2FZ5A 3VZQA 2W6ZA 3TZKA 4YAIA 4Y6SA 5B58C 3AERA 1N3YA 3ND9A 3HYLA 4C0SA 3PB3A 5H83A 3GEPA 1ODKA 5C7OO 3GUZA 5KU7A 3QEMA 5CM8B 4YUVA 2OFFA 1L7MA 5L7TA 3VHXA 1KH1A 2NQ8A 4AYXA 1EINA 3WQQA 1Q16A 4KOAA 3L2OB 5GINE 1BA3A 4URXR 1EJ6A 4KJZA 5DTQA 1AKWA 2GOYA 5KAMA 4KI7A 1J42A 3CNNA 3QSGA 3UJHA 1Z06A 3EGDB 3U1VA 4PEVA 2CDRA 1BHJA 2DWOA 4I3FA 3AFGA 1C8LA 4O4HA 3NTOA 4CCYB 2D5IA 4A26A 2OCXA 3A4VA 4XSHA 4AN4A 4X63A 4DB4A 1Z6PA 2GBIA 2H9YA 2VOEA 4HQOA 1VM6A 2XYVA 3BL6A 1J0AA 2O8FA 4EHHA 5DHRA 2R1ZA 1GKLA 5I7SA 1XBTA 4BX2A 3GR6A 1AB5A 1THZA 3L93A 2AN9A 3HCBA 4OUKX 4GXNA 4B81A 2FEMA 4RYDA 5IJ9B 3K16A 3CG0A 3L6OO 1W6UA 3L4EA 4NV3A 2MYNA 1CFJA 3CUKA 3L7KA 5TMBA 3AM3A 3V1TC 2LDBA 3QPCA 1IHDA 5A3RA 5AOAA 3JQFC 1W29A 1QIGA 4I5FA 3IOMA 2PWBA 3LL7A 4XQ9A 4D82A 1XTPA 1PSWA 4QVIA 1NVFA 1OB5A 2HJ9A 2RGRA 3O3NB 2WSSD 4RSGA 1QTQA 4NAVA 3H5LA 3T8YA 2ODAA 4IS2A 1NW3A 1EFTA 2PMCA 4M37A 1YCGA 3W9UA 1V37A 2D1RA 4HDRB 1A2BA 2ZYRA 3JWJA 1SKUA 1SUFA 1XX6A 3BWBA 2GXQA 4GPTA 4PSDA 1RRFA 2X5OA 4WH0A 4W5HA 3I4LA 3UO8B 4Z1MA 1DGQA 3Q9NA 4R1MA 4DJJA 4MRRA 1N5OX 3D0KA 2FDRA 4D92A 7AT1A 2NZYA 2NZVG 1SBYA 1L8OA 5B2EA 4IVNA 3D2LA 5A02A 3FSGA 3NHSA 1MW8X 3KPUA 4J7XA 5KCZA 3H5WA 4UTVA 4TKVB 1DAGA 2B1GA 5REQB 1ZIPA 1RM5A 1F1BA 5GOZA 1K5PA 1GL6A 3H04A 2VPTA 3REQA 3W5IA 2AI3A 4ENSA 1BC5A 4Z0HO 1I5EA 2JLCA 1CHNA 1TZ2A 3IXQA 1OAAA 3AHHA 2GK6A 3OZBA 3C39A 1X80B 4YAFA 3SC2B 1I33A 1ORRA 5TMPA 1YL7A 4RELA 2QROA 1IK6A 4OLJA 7GPBA 1A8IA 4MI9A 1MVNA 4LZAA 4GD3Q 4BJ3A 2ZJAA 2CXPA 3UKDA 3VYWA 4QE3A 4KFSA 5IABA 4Y1RA 3CRMA 3QEOA 5JMTA 1UJ6A 4EPWA 2JAHA 2AK3A 2PUDA 3CW9A 2ZB7A 4ZQIA 2R4TA 1DBSA 3REGA 4Z86A 5LXTA 1JXQA 3ISJA 1T6NA 2HJGA 2ODTX 2NOAA 4IQ8A 3EDCA 3JQ7B 1RMTA 4HB3A 4G5RA 4F21A 2CBZA 5F77A 1VHTA 1RWMA 3DONA 3WGTA 4B48A 3AKYA 4QDJA 1UBGA 2QYHA 5KX5B 1DRUA 5CCXA 1T5DX 3LHDA 3SP1A 4P82A 5KYNA 3L8HA 3RFCA 4OPMA 1LFDB 4BFCA 3ECAA 5KPJA 5IDQA 1L4UA 2AOUB 4AQDA 4HNAA 5D00A 3Q98A 2WT8A 4R0MA 3EAQA 2EEZA 1DPFA 2C7VA 4Q1FA 3BX1A 3DEYX 1VKRA 1WD7A 4W1PA 3DVAB 3NDPA 1ZISA 3BQMB 4QTZA 3U31A 2XDWA 3ECSA 3U3DA 1E3LA 4U39A 1XCBA 4QZVA 2D2IA 2M9MA 2O5CA 3KR9A 3NHMA 2RHMA 3AETB 3AY6A 1ZHOA 5CT5A 1VZ2A 2Q9CA 1WZNA 3VAAA 4OKSA 4B3JA 2DB3A 2CXRA 4EPRA 2RHDA 3LRPA 2PZLA 1UJ5A 2V74B 3HWSA 3JXEA 4EI9A 2XKAA 2O1EA 1GL3A 1Y3CE 1YB2A 3KOYA 3PLRA 1N6RA 3A6DA 3B9PA 4N3NA 3U49A 4YCLA 1O0BA 1N2GA 5JS1A 4JJZA 1JBKA 5L4NA 4MR8B 4IJUA 3K0SA 1IWOA 1PGQA 2WBLC 1L5LA 2WQZA 3HRHA 3OMXA 5EP2A 2CUKA 3TFWA 2J0EA 5DN6D 1IUKA 1O95A 1R10A 1SHZA 1XDSA 1JG4A 1C14A 2AJCA 2IHBA 3S5JA 3VSAA 3WYGA 2PUBA 3T3MB 4BO4A 1TT5A 2CDAA 3P9ZA 2FVXA 2PL9A 4F3RA 2VDPB 5BN4A 1E2JA 1KOFA 1MABA 3TQSA 4RY0A 2JB9A 3OC6A 4NZOA 4TTRA 4URHA 1E9BA 1SPBS 3W34A 2Z57A 1FJGB 1XQ9A 3M5DA 4TX1A 3KWFA 1OBHA 2HLNA 3HSYA 3O1JC 4OQPA 2A7XA 5TMDA 2QN8A 4CU5A 1X8JA 2R8EA 4MPTA 4TL6A 4KQKA 3UN1A 1FTYA 4GE0A 2ZBGA 1CRZA 3MQFA 3U37A 4E5SA 5EMMA 1CEYA 3EVAA 3IVXA 3T9CA 4ZPXA 3QW2A 4YGXB 5K8IA 2DECA 2P3QA 1E5QA 2H18A 3U7RA 4JLPA 1G3MA 4NYIR 1TKRA 3HXTA 3PYLA 4S04A 3FETA 5KQLA 2BI7A 4RCZA 4TTAA 4QULA 4LFCB 3R5JA 5D3MB 2OBXA 1DB3A 4NH4A 4O4IF 2BUAA 5LZ2A 1GILA 3IDOA 3OIVA 4IHQA 2H7VA 3OC0A 5LDDC 3UC5A 2R6GA 4LA4A 2FZCA 7ADHA 1ODIA 3RSFA 1KEEA 3KQHA 3VOAA 4ENRA 2N75A 4UM8B 4FZ5A 4ZYVA 1QV9A 3BGDA 2ZYIA 4YQZA 5H3HA 3RYFB 3LC0A 4DCCA 1I24A 2EGUA 2C3MA 4UEQA 1OX6A 3VPHA 4H7KA 2NU9B 4AO8A 1VHQA 5DSTA 3PPXA 4REOA 2HI0A 2QVCA 1U9CA 3VTAA 3X3HA 5CD9A 1BS2A 2QR5A 2C2BA 2AMVA 2IOFK 3SBXA 1DSSG 1Z62A 3ZD9A 4C4OA 1VSVA 2Y4NA 2VCYA 4YMGA 3GRUA 1WZ2A 1E1QA 5B1DA 1L8AA 2QR3A 2AA3A 4UCFA 3EYAA 4O2AF 4DABA 3DV0B 4KQHA 1VPTA 2R7LA 2QNBA 5JJKA 4GE3A 4Z4EA 2I8CA 3NCHA 2J5XA 3TG8A 2EL9A 4KNWA 3DMRA 2I62A 3KJZA 2GR9A 1JLHA 3EC7A 1XWIA 2J4FA 3KKZA 5A4DA 3MT0A 4RD4A 5U4XA 2JH3A 2PH1A 1FDVA 2WWIA 1T5SA 2ZI3A 3VKVA 2IX9A 3H5TA 2GJKA 2IDKA 3FB1A 4MUBA 3S0JA 4F6RA 1CQPA 4BE4A 2VDWB 5KPDA 1NXWA 1CQIB 1TYAE 4MEJA 1QLHA 1PQPA 1NVTA 3PXDA 1B41A 1RP1A 2P9TA 1Z5ZA 1ADJA 2QV0A 3QUSA 4N03A 4OA5A 3GCWA 3VNSA 3AYXB 1VGRA 4FJ0A 5LOVF 2FWBA 4B4OA 1DEXA 5EQJB 2GHRA 3BA1A 2EW1A 4UM9D 3THSA 5KYWB 1N6IA 3IVAA 2BHRA 1HFEL 3OURA 3EC2A 2H2HA 4IWNA 3RC7A 4CL0A 2VUTA 3KOUA 4DIEA 1ZDMA 5TPZD 3L8DA 2QW8A 2CMGA 2P9JA 3ZCTA 1D9ZA 3HJNA 3RHFA 2P9EA 6PFKA 1OE0A 1KEPA 3GL9A 3PC8C 3QRWA 3HB0A 1N8NA 3RIMA 1E9SA 1YULA 2QGZA 2UZ0A 5E1MA 4FMCB 5BPHA 1XHEA 4XGNA 3HB1A 1XRRA 4BS9A 3ENWA 3ZHRA 2EKDA 3W5DA 3PFIA 1G20B 3W9SA 1W1UA 4YWJA 3W0LB 3FJYA 4GM1A 4BMOB 1AXRA 1SCBA 3L4SO 3CT4A 4OHWA 2JKYA 3THYB 2GJAA 5CLGA 3EB9A 2I4NA 3FF1A 4HP8A 2PUVA 1PDVA 2WG1A 2FFJA 3E5HA 2FZKA 2DF8A 2EP7A 2LV8A 2MSWA 3E3LA 4FILA 2GQ0A 2C9DA 1KAOA 4FXOA 1DEAA 4Q00A 4AIIA 4XVCA 2FRDA 3TNDA 3BSYA 2F8LA 5CLLA 3VJKA 5FOSA 1KXJA 5TX7A 3VI3B 1UWLA 2X0EA 2CK3A 3L43A 1MOQA 2P78A 3KNZA 1CUXA 1XHLA 3PNKA 1BOFA 2I03A 2ORVA 4OXYA 4QBGB 3S2ZA 5F23A 5KHOC 3RAGA 1I0IA 3BTSA 3O75A 3SM9A 4OJQA 5DHUA 2BUCA 5FLXA 4BV8A 3E6AA 3FMOB 4N3BA 2OORA 3PCXA 3OP1A 4FFSA 5EE1A 2HH9A 2QA5A 3OUZA 1UF9A 2FOLA 4JKYA 1TADA 3IHTA 5CURA 1U0OC 2GZAA 2XITA 4RKRA 5LQJA 4RF3A 1F60A 2EFDB 2GESA 2ZYHA 3LLMA 1JXAA 3DE6X 4EUHA 2AHRA 3UWOA 2YRXA 3EF3A 4R54A 3ZCUA 2FFAA 1U7HA 2YVKA 2Z9DA 4GBGA 4QG3A 1N4DA 4EFLA 2QUIA 2WMDA 3ZDXB 1VFPA 3MTJA 4N41A 2QUZA 1E9VA 2H57A 1XFDA 3QBVA 1M8FA 3ME5A 1SC9A 3H8VA 4HEHA 1Y6JA 4LE0A 3Q88A 4XCVA 4R1SA 4DEXA 2CC2A 2C3UA 3FUWA 1EI9A 4ZV7A 4TLMB 2OZKA 3IMKA 3RANA 1HYEA 4G01B 2LKDA 3F46A 4WRRA 2PH3A 1CCWA 2JCXA 4CLXA 5LKAA 2NSLA 5LFAA 3H1AA 1A4XA 3VHQA 4DVGA 1DI0A 4DBZA 2IV2X 1Y82A 1EAMA 3E4CA 3ZE6A 2QBYA 4XGQA 1IDN1 2EF1A 3DZGA 3CVWA 4AW9A 4QLOA 4BO0A 1C3XA 1THTA 5DYNA 1QCZA 4HB4A 4DHEA 4BJ5A 2O8VA 4B35A 2GYYA 4XTCS 1ZSYA 4QBHA 4B0OA 1EMDA 1BDIA 3GLHB 4GX5A 5AM1A 3UUEA 2OD9A 3AFHA 4PLFA 3WADA 4UD2A 3WL3A 2X7HA 5AW0A 3R0VA 3GV0A 4J3FA 5G3YA 1NG1A 3FUTA 4P3OA 4UUAA 3NWJA 4TQAA 3HMKA 4Z0NA 9ATCA 3ZZNA 3CLTC 2X3YA 2Q5FA 4CQJA 4MEBA 3BS4A 4FDVA 4Y2JA 1Z5OA 4YAKA 3MRVA 1RU3A 2HMVA 1Z8HA 2NNLD 3RTCA 3SNHA 2G6BA 2HA7A 1YB7A 2KLHA 3WNQA 1CJVC 1PR9A 2J7PA 1NV9A 2MSCB 1PZNA 1E3QA 2OQ2A 4QU5A 3TQRA 1FNNA 2QTRA 5DX8A 5EUCA 4BEVA 5J2UF 3LUCA 3TZLA 4JMPA 3ZBUA 3DBRB 2I6XA 3GUVA 1AV7A 3IQEA 5HX7A 3CU5A 1Y1PA 4ESOA 4ZQEA 1KSJA 2CNLA 1JAZA 1C8KA 3DEFA 3SE7A 4I1OA 3DLCA 3OZEA 3TQTA 4IDBA 3H9JA 1CZLA 5HS4A 4CRWB 3QNUA 1NUPA 4RZUA 3SJBA 3QYJA 1N2EA 4R8RA 4CKWA 2IX3A 1LGYA 2O1SA 2VDUE 5ALDA 3OQOA 3ZK9A 3EY9A 2WU4A 2VTBA 2YKGA 4ZI7A 1WPRA 1O89A 2I2AA 1Y8RA 2XVAA 3GMSA 2VTDA 3F3SA 3NATA 4D0SA 2CNWA 4YP6A 1E0JA 2J6IA 2Y66A 5I9BA 3DOUA 4MUYA 2Y3IA 2ISCA 2C88A 4JVSB 2WU1A 4K9DA 5CRIA 5FR2A 5IC5A 3TDMA 4RTNA 2G88A 2QL6A 2P1DA 2QE7A 4EH1A 1ISHA 2XA9A 2WHYA 2J3LA 1XNRB 3EF0A 1XK6A 3PFBA 1DL5A 1T13A 1T26A 2GNOA 4ODIA 3EWAA 3KSBC 1QK3A 2FZ4A 4K9RA 4X1KB 5KYKA 3FKQA 4NMMA 2I7XA 3H2HA 5T4FA 4V1CA 2L82A 3DOEA 3KKKA 4XFJA 1DQPA 4UMFA 5DP2A 3BERA 4LKOA 4TMVA 5DCUA 4KO4S 2IPOA 4QECA 1A5SB 4WK4B 4ZOLA 4A27A 1IN1A 3CISA 2C4UA 2CMKA 4M22A 1ZD1A 3RWBA 1IQRA 3HB9A 5DCYA 4PCUA 4S2UA 1Z6XA 4GRAA 3K5HA 4KBGA 3PPIA 4NV1A 2PD4A 3D6VA 2Y1XA 3GBSA 4PBSA 3VQTA 2BGJA 1HDRA 3WMEA 4DJDC 3C24A 1Q0PA 2VQ6A 3FUXA 3M1IA 3DTVA 4R1LA 1N8KA 1VHDA 4IOKA 3UCXA 2KB0A 1Z34A 3F98A 4B6RA 4F12A 4LRSB 5C3UA 3BXEA 4G9GA 2EJWA 4QOJA 4P32A 4H27A 5CNKA 1R3DA 1JHRA 4LYGA 3AF4A 3QA9A 1NT4A 5P8WA 2XODA 1IEWA 2C94A 5ESXA 2BN4A 3WL6A 4CKEA 3EZ9A 3IA2A 4D9KA 4DAEA 5IPFA 3W5JA 3VC2A 2NZJA 3LVQE 3W8DA 3PU6A 4YMUA 3P0HA 2FUCA 4MVJH 3D6JA 5FTNA 3SX4A 4MYSA 4E2YA 4LGMA 4KZKA 3F0TA 1UOPA 2EXXA 1YQEA 4BMZA 2BL4A 3F6CA 3WHKA 2Z2JA 1JZQA 4DS3A 5FRDA 5EJMA 4EABA 3D7SA 3EMVA 4BFYA 2ESRA 5J1SB 5CXXA 1AC5A 3AUUA 4KWCA 4MSUA 4DG5A 2ZAMA 4NWIA 5E9JA 1C1XA 1LRJA 5B7QA 3IPRA 4GC5A 1EK0A 3N2EA 3EGEA 4KUEA 3RVQA 4CDGA 1ABBA 3LQFA 3O31A 1N3BA 3QPVA 3U0BA 1AF4A 4EHFA 1G0OA 3QYPA 2OLJA 2OHXA 1RBMA 1RYHA 1JKJA 1YQDA 4GMFA 4JZKA 2OV3A 4FDTA 1VRVA 3P52A 5KMGA 1Y9DA 2F59A 2I2XB 2DHCA 3AL3A 4JL5A 3EG9B 2ZIEA 2PJDA 3FJOA 1GRNA 3KXDA 2ZRJA 1DAPA 1G8MA 5KQGA 1OOEA 1YR2A 1WB9A 4IIJF 5EMHA 3K3PA 4FYHA 3E1KA 1IXYA 3GJXC 2R6DA 5E3HA 2WM3A 4B4KA 5G0WA 5MN5A 5JEDA 2MYUA 4K9KA 1NTRA 3DVLA 2CHQA 4TUYB 4NQRA 1FUEA 4I66A 4BTLA 1AKEA 1GNPA 3B6ZA 1PJ3A 2JKZA 1B93A 5BT9A 3KM0A 4PSKA 1NI5A 4F2PA 3MCVA 1SXQA 1RQ2A 1YOVA 4JCCA 4F93B 5A62A 3PEFA 1RZRA 3ND6A 2ZJ7A 3HN2A 3KL2A 1MPTA 1P3Y1 1E5DA 2OCAA 2P6MA 2XB8A 1CIVA 3I09A 4IDQA 3CRW1 4V0NA 4CODB 2SCUB 5C7LO 4KN6A 5AI8A 3II6X 2AUTA 5DWVA 5E4JA 4NMXB 1Z2PX 3HLTA 4HRXA 1AV6A 3ZV5A 4Z49A 4P98A 2D2XA 2AYYA 3BJEA 1NF8A 4NG5A 4PTLA 3RS7A 3S81A 4NBKA 2W4MA 2DFNA 2AEEA 2O5RA 4M2LA 1ORWA 3UH0A 1IN8A 3W3ZB 3STYA 3WJ2A 4ASUA 3ELYA 5BMVB 4C0AC 4M1MA 1SRQA 1WSAA 2GZMA 5IVKA 3OEYA 2ZBQA 3RAPR 1KU6A 1RI1A 5BR4A 4PSCA 4CTOA 3EVFA 3WLPA 3BXPA 1U8AA 2UXBB 1G6HA 3Q3VA 1NZDA 2VLBA 2OAEA 3Q8LA 2PWYA 4ZAWA 3VPFA 2ZP1A 5HTKA 1DKRA 2ECKA 2VHJA 3C5CA 3NDRA 1MIHA 4NBVA 4BQPA 4EENA 5CLFA 5A0TA 4MK4A 3DOIA 2HSWA 4KQFA 3UK1A 4AY5A 4JVOA 1P6UA 3DBVO 3ZZMA 2OLEA 4C78A 3B3GA 3RVOA 1Q7CA 5DXJA 1HRKA 4ZV4A 1RSZA 1MEEA 3QU7A 1LI4A 2BDTA 5ALVA 3DMNA 3OLWA 4CFZA 1UM8A 2QPOA 2CLFB 1KQNA 2E4AA 2OILA 4FHZA 2LRHA 3DLTA 3KOXA 1SVIA 4O1MA 3OJEA 4RTPA 4LAFA 2IE0A 2NUPA 3VM6A 3R5FA 1TTTA 1P5HA 1XTTA 4PAOA 4Y1FA 3WNVA 1PT5A 5JBQA 5C32A 5KQPA 3IEUA 3RUCA 3CVUA 5BV0A 1NMZA 2ZAIA 2O8NA 1CE8B 1G6OA 2P9ZA 2CCJA 2W22A 3LOQA 4KIWA 5IF3A 5CJPA 3H2KA 2X0IA 3RD5A 2EIXA 4IUDS 1ORTA 4N6GA 1KJ9A 4G67A 2RGNA 4LV5B 4REQA 1G6Q1 1UOEA 2HA4A 1E20A 2PZBA 3TI9A 2GF2A 1TUIA 2JASA 2Q4RA 4LJYA 4AZ0B 1JVSA 1NVUQ 1Z6YA 3LW8A 4JH0A 5AJHA 4X7RA 4LHXA 4II7A 3R7BA 5DHFA 2BFFA 5HIMA 4BMSA 5G0UA 3HNPA 4PNZA 3DW1X 4IUBS 4WFKA 4U8GA 5IKOA 4AL4A 4RXTA 4IJVA 1HQYE 2X6QA 4KOEC 3TW0A 5H0IA 4FDAA 2PX8A 1R5JA 1UCFA 1XB2A 2QYSA 3AXSA 1GSIA 3C1AA 4GR5A 3IBTA 4JU9A 4RKWA 1KDOA 3NHUA 4CIBA 1YV9A 3O83A 4KAFA 3N8DA 5D3QA 2ZM6B 2JHGA 3I5AA 3PXUA 2W6PA 4BJ6A 4EW3A 1UDWA 2ZUVA 4W5RA 1X9IA 5LPNA 5HIKA 4C0XA 1MFPA 1VLMA 3O38A 2P5YA 2FPMA 4ABTA 1SKBA 3BMNB 2NVUA 3AR5A 3QBDA 4FYPA 3ZV6A 1GJRA 3OTOB 1RJWA 1VMKA 4DV3B 4LTNA 1MUUA 4L51A 1LSSA 5E2AA 2TMKA 3K5PA 1F7UA 4FHGA 4MWGA 1XVLA 5DGXA 1LBIA 1U9IA 1KVTA 2WZDA 1C9JA 3D8RA 2OGUA 4G81A 4X85A 4E88A 3U9SA 1XQWA 1J1IA 2GRUA 3ZLBA 4RTJA 2I2DA 2B98A 1JJ7A 1VBNA 3CRNA 3K20A 4IUYA 1XQVA 2ZSUA 4PS1A 4RDCA 5BWCA 4UW9A 2YWFA 3GQVA 2P2ZA 4WL0A 1YR1A 2UVQA 3VO9A 1V47A 2WW8A 3OCZA 2FUEA 2FY8A 1GGMA 2OOKA 1T0IA 1NLFA 3CM0A 2E5FA 3W8RA 4RTOA 4YI5A 2JJ1A 3O2NA 3HJUA 4RHTA 2EJUA 2DT5A 1T9GS 4S35A 1YBAA 5IDYA 3NRCA 3UATA 2H6EA 1RLOA 4EYQA 2I5PO 1OXTA 4A2WA 1HZZC 1ZRHA 2VP9A 2J33A 1Z6ZA 4ZI5A 1CB7A 2Y68A 3B78A 4EJ2A 2J3KA 4XGRA 1Y1SA 2OV1A 2XUZA 5GIOE 3V80A 4IQGA 1YNSA 2Y71A 4P5DA 4KQXA 4C4RA 1I9GA 1VBMA 4AKSA 1NAIA 4UEKA 2CLCX 3TLBA 1FU7A 2YJNA 5B6IA 4HV4A 4X65B 5DLYA 2HCTA 5D1NA 1QRSA 1TYDE 4MS1B 2ZITA 1BJKA 4RQTA 1RZUA 2NNWB 3LF2A 3S2UA 2QP4A 2GNPA 3S1LA 5HFJA 5KYTA 1HTTA 1QDUA 2IYFA 2TYSB 2GHQA 2DBVO 1Y4DE 4WZZA 1XJ0A 1TO1E 4NK5A 2AI2A 3MELA 2YBEA 4C14A 3R44A 4Y18A 4B74A 1XSEA 1SCDA 2XF8A 3BPSA 4DRXA 5BSGA 3GDOA 3KKNA 4MHSA 4PFSA 1PFUA 3OCJA 4XX0B 2OBMA 3DZ8A 3IMFA 2Q41A 2UUPA 4X24A 4WV3A 4F9EA 5K45A 2C2ZA 3IJPA 1W0KD 3GP8A 2XNSA 1IQPA 1IEVA 2Q1XA 1PQWA 4PLZA 1XN1A 3KT6A 2GK3A 3OECA 3LT0A 3HY4A 3ANLA 4NCIA 4WMLA 4A0FA 3VU3A 2YY6A 2AR9A 2F1RA 4L6AA 3S70A 3DLHA 4M1QA 1D0IA 3H9GA 1DVRA 5LN1A 4BTVA 1YASA 1QHFA 2BM1A 5FPQA 2PIDA 5ALLA 4MR9A 3OPQA 4YI3A 1FA9A 4MQEA 2Z5VA 2EL7A 1WLSA 1H23A 4JP5A 4BV2A 1GPWB 5JVDB 3V7FA 4LJ8A 3GYBA 4EW1A 1JLLA 2FDXA 4DLKA 3DFMA 1J06A 5I3CA 2RGDA 1YFLA 2G9UA 2GS9A 2EBFX 2YC2C 3D9QX 3R23A 1GU0A 3KOMA 4JWTA 4ZALA 2E7ZA 2NIPA 1P5ZB 4GZMA 5GJVC 2XUFA 4HGPA 4M1YA 2OOSA 3BSFA 3L0PA 2YFYA 1KH2A 3DAOA 3DDZX 5GP1A 1U6KA 5I5EA 4GL2A 4RK7A 1B0ZA 2G67A 5L95A 2GJ9A 3PUHA 4ZARA 2ONJA 1Q44A 3EDYA 4TPKA 4ZCTA 1EK2A 2BFCB 3I83A 1K08A 1RLIA 2WU0A 1CS0B 4C1NA 1SQ6A 3F4BA 4URVR 3LH5A 1X0XA 2XGJA 4OIFA 3FZYA 4C7MA 4BBAA 2DTDA 4L95C 4LKRA 3TXYA 3ESCA 3CVOA 3ETHA 5IAOA 3BE8A 1OVMA 1YHYA 3S68A 3D6NB 3ZHQA 1B1CA 2X19A 2AFRA 2BE9A 2BRUA 1XA0A 3L8YA 3WBKA 1NN1A 3LJKA 3PUJA 1D7AA 1HSOA 1QC5B 1B8NA 5EFOA 5EJAA 3H19A 4LYFA 3NHAA 1YKSA 5U9CA 4J1TC 3QEKA 4MIEA 5CMLA 1N2JA 1N9KA 3SWWA 1QPBA 1V5EA 2KBEA 4P3NA 2B7BA 4CU2A 3EWNA 3ZIDA 1XAGA 4IRMA 2HDNB 5LBTA 4CF5A 4RVGA 2WK1A 2G5GX 2Y4OA 5EZ6B 3VV2A 2F2TA 3DMDA 4TKUA 4AYWA 1SA0A 4YWHA 4MWBA 1E2PA 1IAQA 2GI4A 4QO8A 1MX5A 2C1XA 3EQ6A 4DBLE 5I7OA 3IAUA 3OZ7A 5CIQA 3WGUA 3EIUA 3JAWB 4LWOA 3KQUA 3AUYA 5IAEA 1JSXA 1ZUNB 4HX5A 1AF7A 1ILWA 4FGWA 4J16C 5H02A 3L01A 2C3YA 1JTFA 4AJPA 4PYKA 2XB4A 3RVKA 3KC2A 4AJNA 4B4DA 1IK4A 5IH3A 1VHLA 1Z82A 3AM4A 4ZPJA 4KQ9A 5IF9A 1GGNA 1Z2OX 5KTRA 5LWHA 1M5RA 3K2EA 3KQKA 3ITKA 2HV8A 4DBVO 5AVZA 5IT4A 4U63A 1TA4A 3RARA 1H4SA 4KNYA 4C01A 2J7KA 5F7XA 1GPJA 1G4AE 4TQUS 1OILA 1UZUA 1E7SA 1Z7WA 8OHMA 1JV2B 3DC7A 4TS9A 1D5CA 5L3SB 5C1PA 1OMOA 2JARA 3DLIA 1GTG1 2COKA 4MCJA 4MP6A 3WAKA 2F4VB 1FVXA 3T1HB 3F9IA 3NFYA 1ZSNA 2XMBA 5CAEB 4LNUA 4PX2A 2VNIA 4O33A 4CDRA 5HPYB 4US2R 3P26A 1QR2A 1GPNA 2YW2A 4D80A 3FPHA 1ECGA 3KJQA 2VNJA 4OP2A 1QO0A 4J94A 5LWQA 2H1RA 3KUXA 1R6UA 3VTFA 2YIMA 4YJHA 4FE3A 1E2FA 1QHSA 4AS2A 3VU0A 1I3MA 1ZHFA 2ZVDA 1KI2A 4RZHA 5AI5A 2E4ZA 2C82A 1T4MA 1QQBA 1PLJA 4XR9A 1E6MA 1JFSA 3UAWA 1FVFA 2E6KA 2VJLA 2Y1KA 5JO9A 3E3MA 4BFXA 2IP2A 4XQCA 1JQAA 1WUKS 1XD2A 3URKA 1WF3A 1L5FA 1MX9A 8LDHA 4G0OA 3QXGA 1G1AA 1OFIA 3GDWA 4W9NA 3H8SA 4ZXPA 1Z83A 4TWBA 1I7NA 2PZFA 1EDDA 1AGRA 4M0EA 2WIBA 4QGFA 2AC4A 5JQGA 3P2JA 4B79A 2VO1A 3T1OA 2RAFA 1XEAA 1URPA 2F8MA 3DO5A 4GLFA 2VRCA 3I64A 4I08A 4B73A 1XAJA 5IASA 3TB4A 2QZJA 4ND8B 4Q9DA 3M5CA 2IUEA 4DJ5X 4ZO4A 4BB5A 2WJWA 1DJQA 1TU3A 3I37X 4Q4HB 4G0MA 3ERCA 1MMFB 2RI0A 3O8LA 3JQPA 5FYQA 3UXYA 4DMCA 1QR6A 4D3YA 3UBTA 3EGVA 3ZDDA 2P7HA 1QYCA 1U8TA 2PRSA 2PX3A 3NR2A 4G63A 2H16A 4FI3C 4KH0A 4K28A 4F91B 3N0XA 1PFKA 1JNXX 1I80A 2HDOA 3MGKA 3OLXA 3Q5GA 4R0VA 4PQYA 1UMCA 4W8GA 2ZJ0A 3JZFA 3K1JA 2XCRB 1G5FA 1BE8A 1X7WB 1NPYA 4NDNE 2G4LA 3FSEA 3RTAA 2P67A 5IZCC 5AK5A 2NSHA 4IV5A 3S2GA 3BT7A 1BWQA 3NDIA 2IYZA 1R0WA 2G36A 2J3JA 2C3OA 1P7PA 5COAA 1TZBA 1OWNA 3L7IA 1Z5GA 4W9RA 3B52X 2ETVA 1RJGA 1XRPA 10MHA 4NDZA 2A9KA 4PRZA 5B53A 3QUTA 2DFDA 1RXEA 5GZ3A 4A6XA 3HDQA 1UP7A 4JGGA 2ECQA 4WWHA 1J2YA 1WSDA 1ZU4A 4XUEA 1L7PA 2PH7A 2FPWA 1X42A 4TS3A 5EPEA 4Y9DA 3GGJA 3IILA 5EKSA 5HCIA 3G0GA 1AHPA 1S0UA 2YL2A 2QJWA 5FUVA 2RKBA 2CXSA 1WW8A 5FUXA 2J6HA 4EYGA 4R9UC 3O8DA 3PRHA 2IXAA 2PWPA 1RYFA 5BR7A 3PFWO 4ADSG 3CPSA 4OJMX 3Q8MA 1CR0A 1UJ4A 2Z8ZA 2O8CB 3T0FA 4MPRA 2QVBA 4HNUA 4J0GA 2O54A 2GJ8A 4EZEA 2ZJ2A 5JECA 1KJYA 2KMLA 2NUTA 2Z04A 3QEJA 5FBRB 5A71A 1W5EA 3VUEA 4PYJA 5LKRA 2XB6A 4QUIA 3PA8A 3S40A 3SOZA 2ZJOA 1E79A 3IAEA 4FIDA 1OLXA 2WJPA 2NQTA 2E4WA 3FNHA 4LDQA 2AG0A 3GMTA 1P1IA 3OY2A 1E61A 3MTQA 1NPTO 3OAAD 4YYZA 5IYZA 3UMJA 13PKA 5BQPA 2Z6VA 4YASA 4OIMA 1Y6ZA 3I34X 5CB4A 1LBEA 2BFWA 2BKAA 3GJZA 4BEJA 3NRBA 2XRFA 3TRJA 5ALHA 2CV2A 4IIDA 1C7FA 5KOJB 2QTCA 4RFVA 5HCUA 1USIA 3VZPA 3LX4A 1ORVA 1YZFA 1NVBA 3IP8A 1XRLA 3STHA 1TFUA 2ZU6A 3QVJA 2BJVA 2A5GA 2GN1A 4UD6A 3IKJA 1TYZA 3H1PA 1Y8QA 3HJRA 4G1MB 5IX8A 3SYKA 3ZKAA 1KJNA 3LZDA 3EPHA 3H13A 3ZR4B 1GFSA 8GPBA 3G8DA 1Y81A 5ECGC 1RM3A 3ANMA 4XJVA 5FEUA 3KJNA 4AAYA 1NI4A 4YPFA 4CF6A 3FRJA 3SQOA 2YV5A 3U4CA 1Y3IA 1M1YB 1CZKA 2KLBA 3NFRA 4BZWA 2PUCA 1AZSC 1CZOA 1E4EB 1KEUA 2GEKA 1SC4A 2VH5R 4LZJA 4DZZA 5JU6A 3CJTA 3UJ6A 1GSHA 1XRMA 1L7AA 1YJ5A 4TS1A 1Y7IA 4I1SA 3WFJA 5B6PA 5IWAB 1SK9A 3BMOA 4QM7A 1TW3A 4B6SA 1ABFA 3DBOB 3GPIA 3PXBA 1TYCA 3I1JA 1OU4A 2XE6A 4FQ8A 5FPKA 2V6GA 2FWRA 4Q6BA 4U2GA 2I7DA 4XVRA 1JALA 3IAFA 1TEHA 1EM8A 1U8YA 1YNOA 4BBPA 3MYYA 2JBHA 2IEGA 3HA3A 4BVFA 3GELA 4UHFA 4DNQA 4HYEA 2GPAA 3UBMA 3VR1A 2FYTA 2RG7A 4R2WA 4MRPA 1RE1A 5BVGA 3OX1A 4LY6A 2V4MA 3K2IA 2B8TA 2ZIFA 2BMEA 1YJCA 4RKQA 2FKAA 3AG5A 4MB0A 3HKBA 3P4UA 1TCBA 2K7FA 4I19A 2C1ZA 4M38A 1UQTA 1FPQA 1H2AS 1Q83A 4R83A 3DOCA 3CLTD 3I6ZA 2Q4DA 4HLDA 4CLEA 2H7XA 2QE6A 5AI6A 4DA9A 1QKIA 2YFQA 3A4LA 2ZB2A 4GI5A 1G4UR 4JLOA 4UVDA 7REQB 3KUKA 4NL4H 1X1SA 4GS5A 4HLUA 2HAEA 3C8UA 4H1UA 3MK31 1KP9A 4R5HA 5TE9A 4BMNA 4MDHA 5EVCA 1CY0A 4J8PA 1V5FA 3BG5A 5JZMA 2FTKE 3EDOA 2VAPA 3MW8A 2R7MA 3Q12A 4MYDA 4QUGA 3T9AA 3VZSA 1PJCA 1U8XX 2IYWA 3KJHA 1P62B 3OD5A 2C20A 1Y1RA 4UHKA 1I9CA 5JADA 1CR4A 1TAHA 3MJHA 4OAPA 1DELA 2Y0EA 4OYRA 4A0GA 2VHXA 5K0GA 4HGYA 2GUGA 2JRLA 3L41A 5GVSA 3IJ5A 4JUAA 2R2GA 3H2GA 4L15A 4HUTA 2EU8A 4ZEXA 4C0LA 4QTYA 2VEOA 3GRPA 2CEAA 2QRPA 1XDGA 3OT5A 2HRZA 1A7UA 3CE9A 2F1OA 2C00A 3QLJA 2HF9A 1EDZA 1L5HA 1KOJA 1RWQA 2Q6TA 3AVWA 1I7QB 2C0CA 2QVGA 4NLLA 4XFKA 1XWWA 2YNMC 4FD3A 1Y3BE 1Z8DA 2OUKA 1QH0A 4DDMA 3K70B 2D8MA 5H80A 4FX2A 3H11A 4UUBA 2I2CA 5ALIA 2JAWA 3FLBA 2R25B 1XV5A 2YFHA 4H4EA 1H42A 2ZREA 2NZUG 3A6HA 4L74A 4X8HA 2G71A 4E1VA 5AVYA 3OTIA 2QD4A 2O07A 4JT2A 4GI7A 4DDTA 4Q1VA 1JDBC 1QZTA 2X40A 3BDVA 4CQMA 1FJHA 4GOND 5KYXB 1L5ZA 3NOXA 3QUAA 4L4SA 1SFRA 2ODPA 1HF3A 3VFDA 2V3CC 4B09A 2IUSA 1TEZA 4YPVA 3E61A 3FAKA 4A6DA 3TMYA 2FW7A 3D7RA 3V2GA 1QQ7A 3W04A 3RAFC 3R0ZA 1N0WA 2VA9A 1P2BA 3RHZA 1DKLA 4B3GA 1UKCA 1MFZA 3A14A 4MB2A 1Q20A 5I7AA 5I01A 3O3CA 1YHNA 4MV4A 1FSSA 1S9DA 3IJRA 3SIRA 1LLQA 1RAGA 2ZRNA 1BRMA 1G7CA 1N5IA 4KN8A 1D2CA 1QVVA 4WPGA 2D4HA 2JGIA 1IXRC 1Q1ZA 3AFMA 3MWEA 3X1ZA 1PNTA 3CZCA 1XAHA 2YHSA 2F3UA 4FMCF 4MYRA 3LBFA 5E1BA 4RPHA 1ETHA 5SZKB 4A1OA 4BRWA 3D54D 1Y3FE 1XDDA 4IO0A 3LYUA 3WJ1A 2JAUA 3BYZA 3DXZA 4XYGA 1A97A 2ZJ4A 4PX5A 1J25A 5B57C 4ND1A 3K0CC 1XZBA 5DIFA 4DM7A 3SEQA 4F7DA 3BWDD 2VKQA 4JT9A 3OOEA 2HLHA 3ZTWA 4N3CA 1AIPA 3SBEA 2ENWA 2QT1A 4G0VA 4HSEA 4CLOB 2B1JA 2F3PA 2JLQA 5KVSA 2M6SA 4RPLA 1CERA 4UJ3A 5HRUA 3KSAC 4MDEA 4M49A 1EP3B 1XZAA 3IP3A 2BFEB 2CUTA 4KWIA 3PZBA 4P6VF 3L49A 3P97A 4B83A 3BMXA 2HSDA 3S28A 4JYAB 4AXBA 1CF4A 1SOWA 1ECLA 1DPGA 2H7YA 4XWOA 4M7OA 4RZSA 2XXAA 2Q1TA 5AW6A 1O7JA 4MS4A 2QKYA 1QHEA 1I2MA 3WL5A 2V54A 2FCAA 3AOEC 4KVFA 3WDKA 5BP7A 1JWAB 1EVJA 3KAJA 4L0MA 4KUGA 1BDJA 5FBKA 2O2IA 3DMYA 4KXMA 4D44A 1DDIA 4EB8A 2VF2A 1YZLA 4PE5B 4F5WA 5AM3A 1C0PA 1EB9A 3AY7A 3AJRA 3SKXA 4MLCA 3S2FA 4NHOA 3ZWCA 2BZ1A 4MICA 1Q7RA 5AW9A 4K86A 2POCA 5T4EA 2FR8C 1O58A 4Z7QB 3AP3A 2W37A 3BBLA 4GBMA 4DL9A 1DV1A 1XCGB 2IPLA 3WYBA 4GX2A 4WK2B 2GETA 3TLJA 4UVEA 3EZGA 5IDXA 1HE3A 3MLAA 3UWKA 4RPGA 1YGPA 2YASA 1G4HA 4FLEA 3VHRA 4UU0A 1NSFA 3OPYI 1XFAA 2EW8A 1JQEA 3EZFA 3JRNA 4JK3A 5DBEX 5B3AA 1XEWY 1W19A 5B7GA 1WMBA 3AR3A 2FMFA 4JI6B 4LEIA 4BRZA 1KWGA 5K2MA 2ID4A 1NW5A 3RS3A 3RSZA 5KJ1A 4DQDA 2YC4C 1YR8A 2L19A 3T1YB 1IZ8A 1LTQA 3DCYA 3O82A 3ZWNA 2VSYA 3SM3A 1T2NA 4DA8A 1XQYA 2FAXA 1KYYA 4NG4A 2M2IA 2RHOA 4Q9NA 1ZNQO 3CN9A 3F5MA 4Q4AA 3VKWA 1UBHS 4MKGA 2QZ4A 4WOKA 1JAIA 4MQUA 4ZZ3A 3UENA 2OY0A 1YQ9A 4LVCA 4JLDA 1ZKMA 1OIVA 1S7GA 2JZNA 1CWUA 1P4HA 2VL7A 3DE1X 2ZCJA 2AF4C 2CF6A 3EWIA 4MIYA 2QM0A 3PGXA 3Q6NA 1YQTA 3CH7A 2EHJA 3DKPA 3K53A 1RHRA 3KQMA 4HPJB 1ZNWA 4LBYA 1SURA 4MPPA 4RHFA 5KWJA 3VC3A 1RKQA 3L8CA 1PYDA 1XMVA 2XRYA 1UBNA 2ZCVA 3N1UA 3NANA 1DZ3A 2Q3HA 3LUAA 2DY0A 2RI1A 3B48A 2Q5OA 5TIIA 1E6KA 1D8AA 1P0MA 1QKJA 3ES9A 4P7JA 3DL7A 3GXOA 5FWYB 4M0CA 4Z5XA 3GGCA 4INPA 2IXBA 4K9SA 5JNUA 1V7PC 5DOVA 3SG0A 4O2LA 3EQ9A 1V1MB 4RZXA 3U9LA 3GLQA 2F9MA 1RZVA 4MLZA 3R3SA 1P1BA 2HK9A 4IFIA 1K6JA 2H1FA 2VJMA 4JLMA 1YZUA 4YJGB 3D8NA 1U3FA 3R7WA 5LIRA 1DOZA 3M4ZA 3EXHA 3TEFA 4KLCA 2C61A 2VZEA 2R66A 5MGBA 2R96A 1DAHA 2G0NA 3JQAA 3ZCXA 3L4JA 3AJAA 4KGDA 4YJKA 2C4VA 2D6FA 4ETMA 3PJRA 2F43B 4WZBE 4C0QC 3VDQA 2I29A 4LVOA 4DMUB 4K8RB 5B4UA 3GPLA 4QXAA 3SSAA 4EF5A 3AC0A 3GLSA 3AHCA 3WICA 4HMPA 2BPOA 4PSVA 1P9LA 1H0RA 3HXKA 2W2KB 4YACA 2ZW9A 3ZZTA 1INLA 3VC7A 1Z0DA 1LPAB 1POWA 1X8XA 1YIDA 1VLVA 5KKAA 1YO6A 5DEOA 1UBTS 4KDEA 4D3SA 1U4OA 1XMPA 4HDSA 2GJ4A 4WUTA 4FUTA 3OT1B 4NABA 3TBHA 3ADOA 4AJJA 3IP6A 2V7PA 3WV5A 1LBHA 2O2GA 3M5PA 4FOLA 2Y0DA 5JC8A 4EHAA 3ZXYA 4EA7A 1IVYA 3DMPA 1EE9A 1I7PA 4O3MA 3G0OA 1WUHS 4BNUA 4GEGA 1J2TA 5CB6A 4HZIA 5EIEA 2X8WA 1SXJC 2ZI9A 4FSHA 2FRVA 3PIDA 1KEKA 5DTMA 3LXMA 3CR8A 3AUAA 4P54A 1U5BA 4ZRDA 3UIEA 2ZZNA 3GFVA 1YFZA 1JEDA 1NR7A 1OFGA 1P9RA 3BHIA 4QU0A 4A36A 5I4KA 4JVMA 1Q3TA 3NM6B 1I36A 1XZNA 3U39A 3RI3A 1QZXA 1G8GA 1OI7A 2MWMA 1S6YA 1LBTA 2G0TA 5AWFC 3TAHA 3J81A 3CNLA 1FXSA 1HNZB 3W5UA 4KXXA 1L5RA 2V6JA 3LO5A 3KE8A 4I5DA 5CFLA 4EIWA 2P0AA 4J0KA 4PC1A 4R2JA 1MGOA 2OBBA 1KZ9A 4D74A 2AQHA 5LB2A 3QHPA 5HNKA 1J8YF 3A27A 1MNQA 4ZI2A 4EDFA 1DC8A 5LDHA 5K2OA 1JHUA 1W5AA 4B8YA 1DCFA 5CX1B 5AJXA 2LXNA 3USZA 2NTNA 5AK0A 3IAXA 1IBRA 3OF3A 4P84A 4PPFA 5DM4A 1ZGJA 3B1WA 3ROXA 2QN9A 3HJAA 5BXQC 1JDBB 2BZ0A 2GDZA 3CKYA 2ZB3A 3DGEC 3HFRA 4J7CA 4BLPA 3GLFA 1I0ZA 5E7JA 3WLQA 2A7QA 4BKQA 5FI3A 2PRIA 4WW0A 4EX7A 4D99A 1Z5VA 4KO8A 4M36A 2YHBA 4D43A 2BGRA 2PZJA 2BMDA 1B43A 3CCBA 3NTQA 4ISBA 4R8VA 5DNEA 2VXCA 1WABA 1XDUA 4CR6A 2P6UA 1GUAA 2WWGA 4Q1AA 4TMXA 1J8MF 4BC1A 4CN8A 1THMA 1BDBA 1ZVMA 4DV2B 4IQ0A 2FWAA 2I0FA 4AXXA 3CX4A 5HOEA 3NOQA 3ESDA 3T5CA 1VRCA 3GRAA 1DQYA 1OI2A 2O7QA 3ROZA 3T5TA 3T06B 5IUKC 4Q4DA 3ELWA 3QFCA 3BXFA 3BWXA 3BCSA 1DO8A 1ODSA 2HSEA 4N9WA 3AONB 4OP3A 5BQ5A 3OEED 4BNWA 1P4RA 4TUYF 5EHQA 2DZDA 3X0DA 5T67A 5DTIA 2VP3A 1V11A 3ZC3A 5EXSA 1YRAA 4BN4A 1T1RA 2X8AA 1YB6A 4F3NA 2B36A 2HA0A 4KSYA 4EELA 2WDPA 4GWLA 5DMHA 2OK7A 2V0CA 1F0KA 1CUBA 3KR1A 2PQ2A 3N0WA 4RORA 1WB6A 2JFXA 1G5IA 2P27A 1Q7BA 3FDIA 3PD0A 4QUDA 5BNWA 2QVLA 4CKYA 4RJJA 1EK5A 2E4VA 2PS0A 4HL6A 2Q8QA 1KZYC 3P4YA 5BSUA 3DULA 5D84A 5BMVF 1GQSA 1SVSA 3QYFA 1UBKS 3K6SA 1NYRA 4OFXA 3ZI0A 4DCVA 3A6LA 3GFBA 2NLOA 5SZIA 4DV1B 3C6MA 3QMWA 2DQKA 2AOTB 4HI0E 2DR3A 4Y0VA 4BKOA 1KYWA 1XDZA 4Q66C 2FHPA 4JUDX 3OZVA 2HCRA 1HRDA 1ECJA 3BC1A 1DKUA 2YHAA 1Q0SA 2ZSAA 1O77A 4MVYA 6ADHA 1D07A 1GL9B 3BK1A 2PTHA 5T41A 3KXIA 1NFRA 2QUBA 2WM2A 1QRRA 1Y37A 4EBBA 3WDSA 2QRLA 1AURA 2EQ5A 3CB4A 3NB0A 1W76A 3FHTA 5CK5A 2FXIA 1DKMA 3E3OA 1NDHA 1L0BA 2G1KA 3FVRA 4I4LA 4Q7EA 4W8HA 3THXB 1FDSA 1PKXA 1Z22A 4BNDB 4F9FA 1XTUA 2GYWA 4EECA 2PZ8A 2TMDA 4AJ9A 1A2KC 1EDBA 1L8LA 2AL7A 3CB2A 4X44A 1JEYB 1BX3A 2E87A 2FB9A 2YH2A 4O25A 1YHZA 1QS0B 2VBCA 3HKCB 3RYIB 4N5IX 1OWMA 2Y1FA 1Q1AA 4Q3LA 3JQBA 3PQ3A 3U7QB 4DQVA 1Y80A 4CKCA 1GTRA 2NACA 2I6SA 4KWTA 4BB6A 1MAWA 3ESRA 1E2LA 2P91A 2D0OB 4LX8A 4A2CA 4ALJA 4B17A 3PT9A 1UT8A 3L6RA 2WB2A 1SIOA 4A0HA 1R9NA 3AKZA 2C98A 3U17A 5HIAA 2G06A 2IU3A 2O57A 4FE7A 2NU8B 5CA0B 1DC5A 4ZXFA 3K2BA 2EFJA 2VJCA 4WK0B 4Q9HA 4Y98A 2DETA 1MT3A 1IY2A 4I9NA 4J2HA 3WTBA 4ZOQI 2PRYA 4II2A 4ALIA 5EJ9A 2ATIA 1GDHA 2LE0A 3CWZA 4KDCA 2JGNA 4EYOA 4GNRA 5HKKA 2CNDA 2M6RA 2P65A 2OYCA 3EX7C 2Z2KA 4GKAA 2WWYA 4UUNA 1M74A 4M0MA 4H7IA 1PJBA 2BW0A 4J0CA 5GM1A 3CRZA 4LJRA 1AU9A 3N2GA 1QTRA 1QJCA 1MDBA 1P45A 1DX9A 3D8UA 3GEEA 4MUKA 3WBJA 4F4IA 3W3AD 1G8PA 1TUGA 1II9A 1PF7E 5ILOA 4K9QA 3JWPA 2GLUA 3T7KA 1C29B 4WXEA 2ZBUA 2JLYA 3B9QA 1TI7A 5KTMA 1PEYA 3PTAA 1BCSA 3PNVA 2AW5A 1YMUA 4GUDA 4PQEA 1K4MA 2ZI5A 3BE6A 3DP7A 3QG5A 4NSNA 1RJEA 4WLNA 1CR6A 1QK5A 2IA5A 1YJ8A 1ZXXA 2Y2UA 4MO2A 3DFZA 3AVVA 3NH9A 1D6JA 2JPDA 2I71A 2WTMA 2X5NA 3E9QA 3EXG1 3ISVA 4BO2A 4FONA 1GZ6A 4PAMA 4UU8A 3FD8A 4LDJA 1EWKA 4YV2A 4D26A 2D3TA 4J75A 1HT3A 2YWDA 1KI1A 2PIAA 3H1EA 3MHTA 4ZN6A 2GM3A 4MV1A 5TS3A 1FB5A 5F7ZA 3RBXA 3SLGA 5JCJA 1QVAA 1N5JA 3HB7A 2I55A 2ODQA 5DLPA 4EVQA 5AIAA 1PFGA 4B85A 1X9GA 3MJFA 1TUBA 5D86A 2A3NA 3FKSD 1J97A 2V7TA 3EPPA 3KAKA 3A1SA 1TL7C 4HHEA 2EZUA 2GAIA 2H4JA 1EXVA 2LD4A 4AMYA 2YJGA 1D1PA 1MOZA 3M34A 2Q7OE 1VC2A 4CQLB 4I9HA 3TFQA 4DSTA 3KQQA 4A15A 3MBKA 1MC5A 2PX6A 2VOJA 3TMKA 3T3OA 3STWA 3QI2A 5GJWC 2PO5A 1PJ4A 1QIEA 3E9NA 4HTFB 1CX9B 3EZ2A 4F5ZA 2P9CA 5L45A 2Q2NA 2WFZA 3ZG6A 4JUBA 5ALNA 4XW2A 4CM6A 1WBJB 3KT0A 3MAJA 1N25A 4JLSA 4LF9B 3A06A 4QDKA 2Y1CA 3WGHA 2BCGY 3R3XA 5AKGA 5CLIA 4E7OA 2H2IA 1CJKC 4R8MA 1TJNA 3QGMA 2MR5A 1R88A 3GFTA 1A50B 1CEQA 1MC4A 5A0VA 4WVLA 5ALGA 4DB2A 2F62A 4KLRA 3GIDA 3I72A 1UKEA 2JGFA 4KLZA 4LDRA 1F1JA 4MUGA 1MJFA 3WL7A 2A9VA 2R2AA 2HRRA 1PWYE 3AW9A 4BVAA 1MCZA 2EP5A 1RYYA 1WXIA 3IQFA 1JI0A 3E84A 4J9VA 5H82A 1JILA 1I2ZA 1ZNYA 3D7NA 4B31A 1HDEA 2RAPA 4EAAA 1X1BA 5T7BA 1FXWF 4DJEC 3NT4A 3T6KA 2GF9A 1FK8A 5DASA 1YS7A 4BYMA 1G0NA 2EDAA 2P9FA 2XQJA 4X1IA 2M1ZA 1SUCA 1FMLA 1X14A 3M3DA 4CETA 5AVSA 1NVGA 1KIFA 2O2JA 2WTXA 4FX5A 3H6KA 2AXQA 4DA4A 2C42A 2V5UA 4C2TA 4QD3A 1H4QA 3RVDA 3COZA 4ZIRB 2HQOA 3G2KA 1RRMA 5JVDF 1T0UA 5SYAA 1NYLA 5EN4A 3SIWA 1T36A 2R8OA 2C03A 3SMVA 2HCBA 3ICPA 2WTNA 3JZMA 4IJQA 2QRQA 5JSYA 4YPOA 2GYVA 1M0WA 3BDAA 5CW2A 1B1AA 1HEIA 2PE5A 4ESVA 5BN3B 1GARA 2OPHA 1P9WA 5CB0A 3SF0A 1R74A 3ND8A 4S1WA 5DF1A 2VTKA 3FPKA 1R8YA 3ELUA 3KZOA 3WWPA 4HDKB 1AGNA 3JQGB 4R7ZA 4R1QA 5J2TA 1ZH8A 2CY0A 1GG8A 1N5LA 2DJ5A 4ER5A 4IIEA 5C5IA 5IKPA 5JDIC 1N33B 3ZK8A 2HK7A 3JQ9A 2IW1A 1S8OA 2R1VB 3HKDB 3R77A 4PG8A 2W8BA 2VUHB 1S2NA 1XELA 4HVLA 3NBYC 3CVVA 3I73A 5IWCA 3MWFA 1D2EA 5GM2A 4M60A 1MG5A 3F2IA 2QN3A 4MS3B 5JZVA 1CUSA 3K4QA 4D5EA 1KS2A 2Y6UA 4GYYA 1T1JA 3R8FA 6Q21A 3C85A 2F1KA 5AW5A 2CMHA 4QYTA 3KLBA 4QUHA 2X5KO 4QRDA 3T4XA 4ESEA 1FUUA 4HEQA 4Q34A 3G85A 2VH1A 2QD1A 4QEDA 5JNRA 2C2XA 4EPTA 1C0KA 2FKNA 1LLDA 2HQRA 2AEMA 2H2GA 2JGDA 1ZK4A 3G1TA 5TT0A 5I7EA 2XA2A 1PCXA 1KTVA 1HBJA 5FFNA 1GY8A 5A6SB 4X97A 3X1DA 2FPXA 4RY9A 1BGVA 1Q0HA 2ADMA 1Z2DA 2PKXA 2BH9A 3P5BA 4FBGA 1LV7A 3M81A 2VCHA 4BZXA 3D59A 3WE7A 1T2EA 2XSZA 4LOHA 5FQOA 4CKXA 5JWRA 1QGZA 3C6ZA 5FR1A 1YR7A 4OBWA 3SYRA 3WFZA 1OF1A 3LPLA 3KVYA 2OECA 1T6BY 3ANNA 3MTGA 1W93A 4HD8A 4D9EA 2ACWA 1YF3A 1Y1LA 2QI9C 1H65A 2OFPA 5L3QA 1XKXA 1YZHA 3L7AA 2J0QA 4PN7A 4US1R 4PCVA 5KJEA 1ZUD1 2R44A 5C4IA 1YBMA 1DAFA 1WIWA 4BDSA 4LHSA 1FTNA 1GT6A 4QRIA 5DHPA 1CZHA 1W85B 5HJ7A 5LYJA 1YVUA 1SCJA 5H16A 4BNFA 1E5VA 3HJHA 4D8XA 2IV3A 3WBBA 4BP9A 1MJGA 2ZE6A 4QA9A 1BFUA 5EZYB 5HK8A 2P41A 3CGWA 3RYTC 3IH5A 4AVYA 1IN7A 1XXHB 2GD2A 4NTZA 1L1RA 1KKLA 3TRFA 4EFMA 1WW2A 4O4LA 3BIJA 2ATEA 2VP2A 4LG1A 3GRFA 1KDPA 1W44A 3JASB 3I9KA 3OF2A 3W5VA 4DT1A 2X22A 2NXWA 3QEBZ 3ZHCA 1H2ZA 1QZUA 1TJYA 3B8EA 3D1VA 1Q17A 3H2JA 3RRZA 3RVMA 4DLNA 2WAYA 3KR0A 4JI8B 2FEPA 4POOA 3C3PA 5K6AA 3ZOKA 1XXLA 2ZJ5A 1K88A 2C5LA 2QF7A 3KKLA 5AHRA 3UK7A 2Q29A 2WKSA 3VKFA 1L4EA 1RADA 4L85A 1OX4B 2B8JA 4QYIA 4DV4B 1GR0A 2Q3MA 3R8XA 3GLRA 2CLOB 4M9RA 4EL5A 4Q4LA 3R3WA 2EJBA 4RYLA 3H4TA 4ZYZA 3SE0A 4D41A 2JBWA 3MCZA 3LFUA 3B3JA 3MXOA 4WCFC 3UYLA 1GTZA 4MQLA 5BSEA 4RD6A 1QHHB 4HQFA 3SZRA 4L22A 5LLTA 3KVNA 2PYDA 2NADA 3FG9A 3G17A 1XNHA 2PANA 3AIOA 3H8JA 1JTVA 1CUJA 1WMAA 2O52A 3SZLA 2G63A 2IOFA 4X5OA 1QAQA 3Q9UA 1A4UA 4LX0A 3UAGA 3CWCA 3KJFA 4R1OA 4YMTA 1NNEA 3TRIA 1NZJA 1T15A 1UKVY 3DF9A 1UADA 2A6PA 4IMJB 2XX3A 4FSXA 5F9MA 4DHWA 4KZPA 3B1KA 2IUYA 5PNTA 2CXTA 3HA2A 3HVUA 2R6AA 4G25A 3CPHA 3PFHA 3D2BA 2VJAA 1PL8A 1XD9A 2XDAA 3B3AA 3TEJA 1YU6A 3W1WA 4DMRA 3JQ6A 4DDUA 1FJ2A 3VISA 3CH6A 1IY1A 1U11A 1VHJA 1BXRB 4LY0A 1ESDA 1SHLA 2HLDA 4QYSA 3COJA 2VWGA 3FE2A 3E9MA