4J0IA

Tannin acyl hydrolase in complex with 3,4-dihydroxybenzoate
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
470
structure length
452
Chain Sequence
b'SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
molecule tags Hydrolase
source organism Lactobacillus plantarum
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
total genus 165
structure length 452
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0iA00
4FFWA 2PU5A 1XZLA 1AC5A 4HAIA 4JNCA 3LLCA 1O6FA 1TK3A 3OPMA 4DSZA 2H7XA 1N5RA 4OYLA 1H2YA 3KXPA 4AMYA 1EXWA 4EA6A 1QONA 4OU5A 4JH0A 1D07A 4U2EA 2HIHA 3IUNA 3A70A 5E2IA 4KE7A 5E4JA 2GYUA 1WB6A 1A88A 5AK4A 5ALMA 5C81A 2XQIA 4J0GA 3LIPA 5LKRA 1DINA 5LZ2A 1SOMA 2WIDA 2PX6A 1XROA 5LZ7A 2WJ3A 4C4ZA 5LKAA 1CUBA 3FYTA 2PSEA 4J0JA 3FAKA 3H2JA 5ALNA 3SWWA 4RPCA 4CI9A 2G4LA 5K3FB 5T4EA 3PF8A 4U2CA 2WQZA 1DQYA 1XKTA 3C43A 4G5XA 5ALSA 2AJ8A 3FYUA 4JYPA 2W22A 4I4CA 5AKZA 4WFKA 1R4ZA 3BIWA 2JGJA 2WKWA 4Y2RA 2ZSHA 1DU4A 4LHEA 2OG1A 2LIPA 2FJPA 2WSLA 5JZ9A 4DNPA 2B20A 3BWXA 4X6UA 1EDDA 1JMYA 2GBIA 2WUDA 2PKYX 3H04A 3IDAA 4M0MA 3EQ7A 2WJ6A 3IUJA 4G9GA 4K6HA 1W4LA 5IKXA 1AX9A 1LBSA 1CUYA 1XZHA 1TIBA 1JMKC 1EDEA 4UHBA 4P08A 1DQZA 1MU0A 2BUBA 2ZYRA 3E3AA 1RP1A 5ALZA 1LPSA 3G0BA 2OGTA 1A8SA 1J1IA 1K6EA 4FLEA 1LGYA 2DHCA 2PPLA 2Z5GA 3FSGA 3MUNA 4UBNA 3STYA 4UHHA 4XVCA 5EIHA 3ZPXA 1L7QA 3H1AA 3C8DA 1G42A 2XMDA 4NMWA 2XMQA 4Z49A 5ALLA 1K5PA 2WFMA 4Q34A 3TEJA 3WK4A 4HXFB 2HADA 2WILA 2ECFA 4B85A 3HJUA 1G66A 3MUOA 5K5EA 4XIIA 1EINA 2WIGA 5CRIA 2OLEA 5EHQA 5AKXA 1TQHA 4X6YA 2ORYA 3SX4A 3WWOA 1CUDA 1Z68A 4JUIA 2VT6A 2QVBA 2QUAA 3VVMA 3F8SA 3KOOA 5ALKA 2XUHA 3FCYA 4BAGA 3V1NA 2WUEA 4UFNA 4B82A 1MJ5A 4X6XA 2GZRA 5JD4A 2CUTA 1QOZA 1H22A 3IB3A 4PW0A 4U2GA 3QM1A 3D2BA 3HABA 2OAEA 1QO7A 4ZV9A 4UBJA 1X70A 4BAUA 5EI5A 2O2GA 5FLKA 4P9NA 3C5VA 5K3CA 5AKGA 5JARA 2XLBA 3JYHA 2AJBA 2FX5A 4F60A 1XRMA 3X3HA 2PSJA 4A23A 3FOBA 3PI6A 2BFNA 4HXGA 4S0XA 4NZZA 2OXEA 4OCZA 5CT4A 1R9NA 2FJ0A 3HI4A 1CUEA 2V98A 3IULA 1YA4A 2GBGA 2H7CA 2J3DA 1EB8A 2H1IA 5AKKA 3GFFA 4YK7A 3EQ9A 1X2BA 4AN0A 3QBJA 1YS1X 3B3QA 1IZ8A 2XB6A 1XRRA 1HKHA 5LZ9A 4G4IA 2VQ6A 4IH9A 4BCDA 3VXKA 4G4GA 5CURA 3WKAA 2CZQA 2XUKA 1UFOA 1THTA 4HTAA 2WIFA 2GYWA 1MT3A 4W1RA 3WKEA 5AM3A 1GKKA 1T2NA 5AI9A 3HEAA 5HF5A 1JFRA 3G7NA 3G0GA 5FDFA 3O9MA 4X93A 4EB0A 1CUSA 1F6WA 4IH4A 3C87A 1XZDA 4GLBA 3ANTA 3NOXA 2OCLA 4QDZA 5SYNA 1XZFA 4ZXFA 1WPRA 1XQVA 3ZWQA 4CCYA 4E46A 2G63A 4C4XA 3A6ZA 1QZ3A 3EIOA 4WFIA 2XQGA 4B80A 4KE9A 2VT7A 4BC0A 1LZKA 2HL6A 3M3DA 3PFBA 5F4ZA 5AK5A 1CIJA 4ZREA 5JATA 1XKLA 2DCMA 4UFPA 3IURA 4G9EA 5AOBA 2JGMA 2OGZA 2PVSA 4KE6A 3WI7A 5BOVA 1UKAA 2ZVDA 3R0VA 3F96A 4J0DA 4BCBA 2HA2A 2XMGA 1XRQA 1UT6A 1HL7A 4H0CA 1FFAA 4L72A 1OCEA 2I78A 1CEXA 1TKRA 2C7BA 4FHZA 5HK8A 1CUAA 5ALEA 3D0KA 4H7DA 1ZGBA 1UK9A 4ZRDA 3A2MA 1P0IA 2V97A 4OB8A 3C6XA 1DT5A 1HQDA 3W9BA 1EI9A 1ZI8A 3BDIA 1O6GA 4KAAA 5FV4A 5CH8A 1BN7A 1LNSA 4AZ0A 1J07A 1ODTC 2XUPA 4W1SA 2PL5A 4HS9A 3DL7A 4I3FA 3STUA 4DLNA 4DMKA 5JADA 2WU3A 5BWBA 1U65A 1W6RA 3PUHA 5AHXA 1VJ5A 2VSQA 4H7EA 2PU7A 5FKJA 5ALHA 3PF9A 1ZI6A 3OG9A 5LYYA 3VISA 2VATA 5FRDA 3ZLTA 3IVMA 4J3JA 1XRNA 1H2XA 4UBOA 2X8BA 1DT3A 3WJ1A 5ESRA 1RYYA 3U0VA 4K2AA 3VJKA 2WUGA 4BVKA 1BCSA 1GXSA 3QMWA 3ZLUA 1P0MA 1QIFA 4BE9A 1BCRA 4MXDA 3WWEA 1ZI9A 5ALIA 2XMRA 4RE5A 2D5LA 5EHXA 5EHNA 4ZV7A 5C7YA 2RIPA 3WLAA 1PJAA 4CCYB 1YSCA 2VJDA 2XUFA 4U2BA 1XLVA 3A2NA 6YASA 4CCWA 1ODCA 3T52A 1MO2A 3S8YA 4DM7A 3BF7A 1XZKA 4RNCA 3STXA 3UUEA 1VE7A 2GBCA 5KREA 4UHDA 1XZCA 1ZIXA 2WFLA 4FMPA 5AJHA 2QXTA 2WG2A 1FFBA 3TJMA 4ETWA 1XFDA 3G9TA 5JALA 3AFIA 1IUNA 4YPVA 4QA9A 2PBLA 3L1JA 1CUCA 4EY7A 2WG0A 2JIDA 2HRQA 5HQ3B 3DD5A 4LYDA 2JF0A 1MX1A 1EHYA 3S2ZA 1HBJA 1NU8A 2XUQA 3AZPA 4ZI5A 4HRYA 3AJAA 3WYDA 4XJVA 1HPLA 1QO9A 3L1HA 4LKOA 4QDOA 3PFCA 1WB5A 2Y2UA 1ZD3A 1CR6A 5AM2A 2XI4A 4J0IA 5AKYA 1SCQA 4BCCA 1QE3A 1LBTA 1KEZA 3D2CA 3GBSA 4EBBA 5CBKA 4G8BA 1UXOA 4AX4A 4B9AA 4AQDA 4Q3KA 4UHCA 3F67A 4BP9A 2QKYA 4DNOA 4W1PA 3O4JA 1J06A 5JIBA 1CUWA 1WCYA 1EDBA 2OCIA 3JW8A 3D4LA 3NUZA 2VAVA 3QMMA 1AMNA 2HDWA 3I6MA 2C5GA 5CT8A 2R8BA 5AM4A 1DWPA 3DOHA 1CUGA 2JGKA 1CUFA 1RWQA 1LPPA 3G9ZA 4M0FA 3RKSA 2BAGA 3FWHA 3LIIA 5DJ5A 1IVYA 2O7RA 3GROA 5JZBA 4IHAA 5AP9A 4Y2QA 4BRZA 1P0PA 4B81A 4MJ3A 2G5PA 5EIEA 1P0QA 5AI4A 4CG2A 2BUAA 5C8XA 2I03A 2OQVA 1AURA 1CV2A 1BS9A 4JYMA 5I9IA 1TCCA 4AO7A 1ODSA 3Q8WA 4FTWA 4BB0A 3AIMA 1E8MA 4QLAA 1MAAA 3OC0A 2WHPA 1X2EA 5A71A 4H77A 1C7JA 4AB1A 5AKLA 3AINA 1SC9A 2DHDA 5ALPA 4UUQA 2O2IA 1KU0A 3WZLA 2CMFA 4B83A 3L1IA 2B61A 3D5EA 3FNBA 2CEKA 1WB4A 4J0CA 4X95A 4BAZA 2XUGA 3HXKA 1BE0A 3C6ZA 5HKBA 4TPKA 3WL8A 5HF8A 1DX6A 1UOOA 1EVQA 2ZJFA 2DQYA 3D2AA 3N0TA 5ALWA 4QDUA 2XUJA 4PSUA 5FPQA 1CUIA 4BBZA 4UBMA 4BYMA 5BWCA 1CQWA 1C7IA 1IUPA 4Y7DA 1QLWA 2D0DA 1GQSA 4Y2XA 2BUCA 2PSDA 3QPAA 4INZA 2G5TA 3C70A 4FBLA 3V1MA 5K3BA 2J4FA 4WFJA 1BU8A 2HU7A 4MQMA 3B12A 3H2IA 5AKJA 2XQJA 2PSFA 4HZGA 3PICA 4U2DA 5HK9A 3F9CA 4KACA 1VZ3A 4GWLA 5K3AA 5EFZA 4Q82A 3N2ZB 3GA7A 5CXXA 2DHEA 4XX1A 5ALUA 2EDCA 2PM8A 1ZICA 4Q1VA 4MYDA 1K63A 1ZOIA 3CN9A 3ANSA 4OSEA 2ROQA 4FLMA 2O7VA 5AI0A 1DX4A 4BVLA 1ORWA 2XMSA 3WL6A 1USWA 3CXUA 3FCXA 4YASA 1LLFA 4TVKA 1E89A 4H18A 3DS8A 4B6GA 4N8SA 2YYSA 1ZJ4A 4I19A 1MTZA 5AM0A 3WK6A 4QNNA 4D9JA 1ACLA 4DNFA 2DSNA 2K2QB 1YS2X 4DGQA 5JASA 1EA5A 1XZBA 3W06A 3QPDA 3YASA 2XUIA 3FBWA 2ES4A 3I2GA 1QIIA 5C8ZA 5AICA 3H2HA 4KRXA 3LCRA 4UBIA 5C8VA 1Y37A 2BJHA 2XQFA 1UZAA 5EGNA 1E3QA 4ZGBA 2RAUA 3K9BA 2ACEA 3D7RA 2BGRA 1UWCA 4X90A 3GELA 4K5QA 1H23A 4J7AA 3KWJA 5AI5A 3F98A 1CUVA 3H1BA 4FLFA 5ALVA 3I6ZA 1MPXA 3R3XA 4X00A 2ZYIA 2VJBA 4UHEA 4L9AA 3SK0A 2QXUA 3WKCA 1MX5A 1FFDA 3C5WP 4EZIA 1MNQA 1UK8A 1ZD2P 1VA4A 2DR0A 4J03A 2BGNA 1GPNA 3WK5A 3FSGD 3RLIA 1K8QA 3O9VA 4DTCA 4GW3A 3WK8A 5E4YA 3STWA 5CMLA 4J0HA 4BZZA 4HVTA 4Q3LA 3I1IA 4GHWA 1Y7HA 4ARAA 3GUUA 5LLSA 1N8SA 3C8HA 4GI1A 2QS9A 4G1FA 1XZAA 1A7UA 4AO8A 4M0EA 2DFPA 4ROTA 2RHTA 2HU5A 3E0XA 1CUXA 5DTIA 1UK7A 4YX9A 5D3ZA 1JI3A 3H17A 2Y6UA 3HC7A 5FP0A 2ONCA 2Z8XA 2QM0A 2RI6A 3W9UA 4KEAA 5ALQA 5ALXA 2Z8ZA 1MNAA 5LIPA 5AM1A 4P93A 5A2GA 5DYTA 5FUMA 2HFJA 5A7HA 5DLPA 4FFVA 5JD5A 4F5ZA 2ZYHA 3E1GA 2XUOA 4WDQA 2HM7A 3ICWA 2ZSIA 3W05A 4C87A 1LPNA 5ALFA 5HQ3A 3O4IA 5CT5A 4J0KA 1Q0ZA 3DKRA 1OILA 1KU6A 1ACJA 2WIJA 3OOSA 4EY6A 3V1KA 2Y6VA 3UUFA 2Y1KA 2HHAA 1GPLA 5KWJA 2JGFA 4MWSA 1S8OA 2O2HA 2JEZA 1QIHA 2GZSA 1Y7IA 4H7FA 3DDUA 2WG1A 3I1YA 4UHFA 2OAGA 1H2WA 2QTBA 4BVJA 3I2FA 4DIUA 4Y2SA 3BXPA 5AK6A 1E8DA 2RONA 3E4DA 1EVEA 3RARA 3WZMA 1ETHA 1XQWA 4PSDA 3I6YA 3R40A 4N8EA 3QYJA 5FOQA 3DNMA 3NGMA 3ICVA 4KE8A 3KD2A 3HRHA 5CH3A 1IMJA 5BV7A 3R3ZA 3FYUB 4FOLA 1YA8A 4DYHA 1Q84A 5A7FA 2EDAA 3PE6A 5AI6A 5LZ4A 1JT2A 4FDMA 1QFSA 3A2LA 4X71A 1XZGA 1HLGA 4H7KA 1DWQA 5DYWA 1QIJA 3O4GA 3OURA 4G4JA 2XDWA 2J4CA 3DYIA 1VLQA 3RK4A 2GYVA 1LPAB 1L7RA 5AKHA 4P92A 3DLTA 1A8UA 3ESBA 1GKLA 3PDCA 3QZUA 4PSCA 2IIVA 2Q0XA 3K2IA 3HACA 4W63A 3IUQA 2ACKA 5T4FA 5A62A 3AIOA 5JANA 4G8DA 5K3DA 4EY8A 4DMFA 4FNMA 2Y2VA 4K6GA 5IVKA 4U2FA 1AQLA 5CT9A 4DNQA 5JZSA 4JEIA 4E11A 4IH1A 5D6OA 4LXIA 4NS4A 3TRDA 3WWCA 4A16A 3IIIA 1YASA 5CTAA 2XE4A 1WHSA 5D3KA 4FWBA 1FSSA 1XRPA 1IUOA 5CW2A 3CN7A 1JU4A 2WU4A 3STTA 4X92A 2WHRA 4OB6A 2XMBA 5DTJA 3M81A 5AIAA 5ALGA 2YH2A 1YB6A 4X94A 3K6KA 5DNWA 5AKEA 1EK1A 4KYVA 3VJMA 1E66A 2BKLA 4AMZA 1AKNA 5HF9A 4WJLA 1GGVA 2JGEA 3JWEA 3WQHA 2I3DA 1LPMA 1PV1A 2RGUA 1K4YA 4GEGA 5CT6A 5A6VA 1DWOA 3ED1A 1XZMA 4X85A 4L3WA 5K3EA 1SCKA 4GBGA 3H19A 3WL5A 1JU3A 1VA5A 5HFAA 4LXHA 2DQZA 1THGA 5I8PA 3G8YA 3VVLA 3WIBA 3FYUC 1M33A 4GDMA 7YASA 4UBLA 5I7UA 4TGLA 5T4HA 2OQIA 5IVDA 5JAUA 2QT9A 5DNVA 4LYEA 2HRRA 4F21A 3O4HA 3CCBA 1LZLA 3BDVA 1EB9A 3G02A 2QR5A 2WHPB 2XMCA 3QITA 4MEBA 5CH5A 1VXRA 2NW6A 3LP5A 3EF3A 5IVIA 3W2TA 4OUKX 1TCAA 4UPDA 3AILA 3BL8A 1N1MA 1CLEA 4F0JA 1B6GA 3ILSA 1YAHA 3DCNA 2JEYA 5ALRA 5EHZA 4QE3A 2OGSA 3BF8A 2AJLI 3CCCA 4AZ3A 1B41A 2YXPX 5ISMA 5HFNA 2CBGA 3G0IA 4Q3OA 1BRTA 4QLOA 5AM5A 4CG3A 3BIXA 2PUJA 1BN6A 1XRLA 3Q0TA 5HCUA 4GXNA 2WHQA 2WUFA 1VXOA 3WWPA 1UKBA 2HU8A 1L7AA 3FVTA 2UZ0A 4MWTA 3M82A 3I2JA 3IUMA 5AO9A 2B4KA 3H2GA 2W6CX 4LXGA 5HZGA 4B0OA 1CUJA 1JKMA 3C6YA 1EK2A 3ESCA 3NWOA 3WYNA 2ZJ6A 3G9XA 2XQKA 5J3JA 3ZI7A 1YCDA 3ESDA 1GQRA 4X7BA 1GZ7A 5CXUA 4C88A 2AXEA 1LPBB 3P2MA 3BJMA 1AZWA 3QH4A 4OU4A 1XQYA 1QTIA 4Y2UA 1VZ2A 1WPXA 4PO3X 4PQEA 3M83A 3QMVA 4CFSA 4X91A 3BE8A 2AJCA 1G4HA 2XMZA 5AK3A 4KRYA 3H0CA 4WDRA 2E3JA 1YR2A 4RGYA 4BDSA 4QZVA 4HRXA 4FKBA 1JJFA 4DSAA 3I28A 3ZLVA 1F0NA 3DYVA 3VJLA 3WMRA 4Q05A 1OXMA 3WL7A 4B0PA 1QFMA 4Y2PA 3DQZA 3DL4A 4CIAA 1H2ZA 3D3NA 4CG1A 2FUKA 1FFCA 4PNZA 3AZQA 1TAHA 4X97A 4BDTA 1TCBA 2IITA 5IH7A 3D59A 4PF1A 4OYYA 3KWFA 1FFEA 1U4NA 5DNUA 1SCIA 2PSHA 3V1LA 1ZGCA 1QIKA 5AOAA 2HA3A 2X76A 2VJAA 5ALTA 2XUDA 1IZ7A 3AIKA 1F0PA 2QJRA 1QTRA 4C4YA 3DJYA 2C58A 2PUHA 4IQ4A 2V96A 2J3QA 2CJPA 4C89A 1MX9A 1W76A 1QIEA 3G0CA 1W52X 4H7IA 4BTVA 4BZWA 1CPYA 1XZJA 4C01A 1XZEA 4QDXA 2VJCA 1MAHA 3HSSA 2C0QA 4WY5A 4XWGA 5H3HA 5T4BA 1C4XA 1E8NA 4KR0A 1XLWA 2WTNA 4UFOA 4ZWNA 3W04A 3OTQA 5AIBA 3HYSA 4MEAA 3C45A 3FLAA 3V9AA 1AUOA 3EBLA 4V2IA 1U2EA 1BEEA 3WIOA 1G5FA 5ALDA 5K3FA 1UK6A 1QIDA 2JBWA 2X5XA 4MQLA 4B84A 2GBFA 3O0DA 1PFQA 1CUZA 1XZIA 4H35A 4W1QA 2H9YA 4EY5A 2OPHA 2XLCA 2VF2A 1Q0RA 2HA7A 1TRHA 4Y2TA 4OD0A 2WFZA 4QEKA 2WLSA 3FLEA 2IX9A 4OB7A 3EQ8A 2VTVA 2WJ4A 3DOIA 4FNGA 4E15A 4BC1A 3TGLA 3WA7A 1R3DA 5SYMA 2HA4A 1YB7A 1UOPA 3KDAA 5D7BA 5YASA 3I2HA 2QJWA 4DMHA 1BROA 1CUHA 5A7GA 1NU6A 4ARBA 1WOMA 3F97A 3GZJA 4QDTA 4WY8A 4MYSA 1GPKA 1CRLA 3WKBA 1QIGA 2AJDA 4O08A 3MVEA 1W1IA 1U8EA 2I3ZA 2VA9A 2Z3WA 1NX9A 2C5FA 1ZJ5A 3WWDA 4OPMA 3O95A 4BTLA 4N5HX 1F8UA 4BP8A 4CIBA 3IA2A 3WK7A 5JAPA 3DKKA 4BE4A 5LZ8A 4H7HA 5ALOA 4N5IX 3STVA 2C0PA 1Q83A 2HA5A 2JGLA 1N5MA 2H7YA 1JJIA 3WA6A 2VAXA 4BRSA 1CFJA 5JYCA 4KAFA 3OM8A 2ZJ7A 3SC2A 2OCKA 4UBKA 4AN1A 3U1TA 3G0DA 3I2KA 1VOTA 2QUBA 1QGED 5AKIA 1XLUA 5E4TA 4C6HA 1J2EA 3WKDA 1AGYA 1QIMA 3QVMA 3LS2A 5ALJA 3ZV7A 3VDXA 4H7JA 1R1DA 5JD6A 5LP1A 4NVRA 3R3YA 1W75A 3KSRA 1ZD5A 3ESAA 1DTEA 4PV7A 4L0CA 5DYYA 3T4UA 4GECA 3B5EA 1HDEA 1I6WA 3PUIA 1VKHA 3VKFA 1VE6A 1ZIYA 1R88A 2WM2A 2HA6A 5ALYA 2VEOA 4FBMA 1CQZA 4EHBA 1UOQA 4DMCA 5AOCA 2HFKA 4KAJA 1R9MA 3R41A 2P8SA 1UKCA 5FXMA 2XT0A 3HZOA 2WTMA 1SFRA 2QMQA 1CUUA 1YAJA 3R3WA 2EEPA 2RHWA 2XUAA 4BATA 1QJ4A 5KBYA 5FPPA 3V48A 4A5SA 4N8DA 4EY4A 3IBTA 2R11A 4RE6A 4QWWA 5JAHA 4ITVA 3G9UA 4B9EA 5AI8A 5AH0A 2B9VA 2V9ZA 2CB9A 3AZOA 2JGIA 5DWDA 4HXEB 1R50A 2Z3ZA 4QWMA 2WFLB 1WHTA 2CKMA 3R3UA 4Y2YA 3RM3A 1XQXA 3DEAA 2QOEA 4WCVA 4KJXA 5JAOA 3UMJA 4X3CA 1FJ2A 3H2KA 4Y9SA 1WM1A 1ORVA 3MGAA 5HF6A 3H18A 1ISPA 2HA0A 4K6KA 4Y2JA 2WIKA 3AUKA 2BCEA 1EX9A 1JJBA 2QZPA 4Y2VA 3WK9A 3FVRA 1LPOA 2OCGA 4B7ZA 5LZ5A 3QPCA 5IVHA 5KWIA 3HLKA 1CVLA 4W9RA 3WJ2A 4G8CA 3FLBA 1MN6A 1EH5A 3BJRA 1T4MA 2ZYSA 2YASA 1A8QA 1ZD4A 4EUSA 1GT6A 4AXBA 3C6BA 4E14A 4LIPD 3I2IA 5HKAA 1BEZA 2C4HA 3R3VA 5EIAA 4AO6A 2QRUA 1E5TA 4IO0A
chains in the Genus database with same CATH superfamily
1XDDA 5FJIA 2E1RA 3B9PA 1KS2A 4CQLB 1JQJC 5C32A 4YONB 1QDLB 1VQ1A 1R0CA 2CVZA 3QOXA 4Q9DA 2X42A 2RAVA 3HY4A 4EIWA 1XNQB 1SKUA 1QG2A 4RYDA 1PWYE 2ZATA 5DCLA 1O6FA 2Y0EA 1OV6A 1EX7A 4L73A 5JEEA 3AUJB 5T6MA 4EELA 2FR1A 1L8XA 5HJEA 1P33A 2IHVA 1FNNA 2H9IA 3DLBA 1X74A 1DKRA 3CTMA 2X2PA 4Z7NB 4EJ6A 5ES4B 3CW8X 2FZ4A 1TMOA 3NHYA 4OU5A 3B85A 2ZB7A 2YFKA 4NS1A 1LK5A 2ATEA 1NQTA 3FFWA 3FG9A 4S35A 1R16A 3LUBA 3FHOA 3O8DA 3NAQA 1E2DA 4HB3A 3GCZA 1YRAA 1L4EA 1C8BA 4KV9A 3IPAA 3IUNA 4LC9A 3JYLA 4RVHA 5K0LA 1U0LA 3BD9A 3RRXA 4ED9A 1E96A 1TGVA 3GP3A 1VIMA 1MRSA 1MXHA 1Y4DE 2YMMA 5EAIA 2G28A 1XTZA 1U28A 2N46A 4BMZA 2QQGA 4BGDA 2ZQZA 5K0JA 4Q47A 2GD6A 3E9CA 4EOGA 3BE6A 4G97A 5E4JA 2GASA 3CRZA 5J40A 5HGXA 1EE9A 1JHUA 1WB6A 2YVAA 1VMKA 4V0QA 2HIGA 2INGX 2XQIA 4AW9A 3B1XA 4G25A 3TSZA 1NMYA 3NHLA 3HS3A 1SOMA 2WIDA 2PTHA 1IL0A 1O8CA 1YULA 1Z3CA 2R1VB 3MWFA 4UAVA 5LZ7A 4C6TA 1YTLA 3KQNA 1FX0B 2BFAA 1UBMS 3D2LA 2PSEA 4JJ7A 4RK5A 4KH0A 4W5QA 3NHSA 4YQZA 1YJ8A 4GPAA 4J0JA 3DONA 5CX1A 5LSAA 4HV4A 1P4SA 1DIOB 3SWWA 5KVSA 4ZMSA 4MW1A 4Z4EA 3RCBA 3K8OE 2ZYTX 1HNZB 2VHZA 3K0AB 1OOEA 2QRGA 2X41A 2K2WA 3PF8A 4IQ0A 1GNVA 1D0IA 1ZRHA 1HDCA 2P4HX 3EISA 4R84A 4L85A 1TTTA 2V3CC 5DSZA 1M6VB 1DQYA 2H1WA 4MQFA 5DHUA 5ALSA 4F72A 3W2IA 3GGPA 1JIXA 1K7EB 4QO8A 2AJ8A 2O8DB 4HAXA 4QXMA 2CYCA 2V9CA 4YMWA 2A9OA 4NMXB 1R0WA 2JCBA 3A9CA 4MVJF 1T9GS 4ZRMA 1Q22A 4BNMA 6GPBA 3OIFA 3UT5B 4EK9A 2H92A 2HQ1A 5KVCA 5LUAA 5AKZA 3N0WA 3U4AA 1WABA 1MHPA 3X0DA 4WFKA 1CVRA 3GCXA 1X13A 2BBOA 4IQ8A 4XCXA 3GLIB 4CEIB 1NC1A 3WY9A 2DPYA 3EZ9A 3HJAA 4QUGA 3BIWA 4TVOA 3FFBA 4OGGA 3T34A 2JGJA 4RFVA 2IPAB 3FHCB 3R7NA 5G0TA 2H07A 2H4WA 2RBGA 2UYGA 3KSUA 4FGUA 1N3LA 1T9GR 5CDUA 2HC9A 3OU2A 3OMLA 2X7HA 2NO7A 3G82C 1WD7A 4HN9A 1N78A 3UMYA 2KWIA 4MVJM 4PLGA 4HLQB 3R44A 4DNPA 1L7MA 1RTTA 2QB5A 4C2TA 4N7JA 5KCMA 2ODQA 2PPVA 4PC2A 4KLRA 5FPTA 1ZSNA 1QH8B 3DO6A 5ICFA 3VR4A 3PNLA 4DA7A 1JMYA 2GBIA 3K0AA 4XQCA 3RT9A 4OHRA 1GCIA 4L7VA 4Y9DA 4M0MA 3EQ7A 2KHZA 5LN1A 5CA1F 3OZFA 1V7QA 4G9GA 4XR4A 2AA3A 3F1LA 1ADJA 3O8CA 3AOEA 4AWAA 4TYYA 2PEYA 2Y76A 2G82A 2Q6IA 3CH7A 1G17A 1OXVA 1JF8A 3UT0A 2WP0A 2MYNA 3OECA 1G7RA 1TIBA 2WHXA 1QCCA 3EY9A 1JMKC 4GE3A 4W8OA 4Q3CA 3KV1A 5BR1A 1W0CA 4P08A 4C5BA 1A1VA 1KIFA 2YXBA 2BUBA 1BSVA 1I6LA 3E3AA 2ZANA 3G0BA 3GJ8A 4RPJA 5CB8A 2ILVA 1KETA 3LC2O 1J1IA 2DOKA 2QPOA 4FLEA 2PPLA 3CZ9A 2Z5GA 1L4NA 3EVNA 2GEUA 4UBNA 4ECAA 3HA5A 1KDPA 5EIHA 2DWUA 1EYZA 1L7QA 1SXPA 2W37A 1L2TA 3IV6A 3HB1A 4XSVA 1OB2A 3PL1A 4D4MA 1B23P 2XMDA 1X1DA 1Y48E 1MV8A 2D5IA 3IOCA 2YIDA 2FB9A 3V4SA 4MAMA 4TRRA 1DBWA 1QQBA 2XMQA 4PCUA 1L5KA 3IPYA 5GP1A 5JECA 2Y0PA 1NA5A 1G18A 2XX3A 4YRDA 5FF9A 3RUEA 3ZEIA 3IXMA 5KYGA 1K5PA 2PO5A 4G2TA 4R7GA 4RABA 2HJHA 4FYKA 1T1JA 4LAFA 2I2XB 5FH9A 3WK4A 2O0JA 3GLVA 5DGHA 1V6AA 4JKYA 4MRVA 4D9KA 1WKCA 2WILA 4B85A 3LOQA 3HJUA 3WV4A 1OYWA 4FEAA 3S0JA 1MVOA 1VPVA 2COKA 4CODB 2UYOA 3FDZB 2XCSB 4KR6A 2HH9A 13PKA 1V9SA 1B93A 3FA2A 3MUOA 3PUZA 4L4SA 1PVDA 1E2KA 3AB8A 2XKAA 1ZUNA 4XA8A 1RPNA 1X1BA 4C0LA 4EW1A 4B3SB 4RH0A 2NU9B 1FP4A 1MRZA 2XVXA 5E3HA 1XCGB 1ODFA 2BHSA 3B48A 3LI2A 3QEMB 1TQHA 2VWQA 3CLHA 4KQ1A 4X6YA 3UTCA 2PUBA 2ORYA 3L8MA 3SX4A 3K9FC 3UW1A 1FLNA 4QGGA 4RNDB 3WWOA 1DAHA 1KMQA 1GLNA 2GCEA 3RAJA 721PA 3KR0A 2QUZA 4LV6A 1XC7A 4YUXA 2OO5A 4GL4A 1JLMA 3ZU5A 2QVBA 1EP2B 4JY7A 1WUHS 5IDWA 1KK3A 2BFDB 3I9JA 1OWLA 4YRZA 5SZKB 2XUHA 1D09A 4A6EA 2BW0A 4EJSB 1WV1A 4FE4A 5FWNA 4TKUB 2XD4A 2IOFA 3V1NA 1SRRA 3EXHA 4Q03A 2G7ZA 3CQ9A 1EK6A 1NW9B 2ZIGA 1YRLA 4B82A 5HZKA 1D2GA 4PZ0A 5E9AA 1AHPA 1Z5GA 3IQFA 1QO0D 3ZWAA 3EZ6A 5JMWA 1C9JA 1TU3A 4L3OA 1LKZA 1X80A 1CEQA 3OT5A 1B8OA 3BYZA 3HBNA 4Q4HA 2GZRA 2NVOA 3D7LA 2BHNA 2R84A 2A6PA 3PUXA 3S29A 2P4QA 3MOIA 1PGOA 5COQA 3X1WA 1BDJA 2Z95A 3C8ZA 2CCJA 1H22A 3FWNA 2VDQB 3OP1A 3CRW1 2OQ2A 3OZTA 4GM0A 1FUUA 1MFZA 1N2HA 3H86A 1V0JA 3KFVA 4PW0A 5DLQC 1ZSVA 3H16A 3LX4A 4U2GA 4ER7A 4E3ZA 1K98A 1SOUA 3QM1A 4AJ1A 2HRCA 1GKYA 4YJDA 5G53C 1JA1A 4GVLA 1QO7A 3L6CA 4KR3A 4ZV9A 3MOSA 4FFLA 4UBJA 3T4XA 4BGVA 5K0TA 1GUAA 1NN3A 2D2VA 4V0KA 3GCDA 1DMRA 3QXJA 5G41A 2GFHA 3ABZA 3BAZA 2MIIA 2YFQA 5IX8A 3GFPA 1RHRA 3JAMA 2ZP1A 1H0SA 1Z6GA 2VFAA 2E4VA 3GRFA 3H6KA 1EWRA 1X1EA 2PLFA 5E38A 2FG5A 2EWWA 5DCYA 3EBOA 1QZZA 3C5VA 4ZOCA 3ZHQA 4B4KA 2I6SA 2XNCA 1U3WA 5I45A 2O3RA 1JB9A 4DV1B 3JYHA 1MOQA 1SC6A 3LMKA 3ZXYA 2BGLA 3NC4A 3P96A 1F17A 4PNEA 4LRXA 4GMFA 1XRMA 4Z1OA 1X3SA 4KOEC 3OLWA 2O23A 2UZIR 5EZ5A 4IS2A 4WOPA 2O48X 4J6EA 4QLBA 3WLEA 3G5AA 4HS4A 5EMMA 3B89A 4MWDA 1EUQA 3IAS6 4UZSA 5AW0A 3N76A 4NZPA 1L3BA 4KBFA 1FS5A 2OXEA 3OZDA 1E3MA 1ECJA 1D0SA 4CLHA 1FW6A 2C1ZA 4MPPA 1BDHA 1JQ3A 2BC9A 3MT0A 2FZWA 1QHFA 3ISJA 5I4IA 1W4RA 3DEZA 5JVDA 3NHMA 3DAGA 1RMQA 1U7DA 4ARZA 3D4IA 1R5JA 5EKXA 3BBPA 3GK3A 4I5EA 1QRDA 2GBGA 2LNDA 1Z36A 2BONA 1JEDA 4QYIA 1ICEA 3IQGX 2C2KA 2CXNA 2J3DA 1EB8A 2GN6A 3QF7A 5LXTF 1J22A 5AKKA 4UCXA 3WYCA 2BZGA 2DBYA 2ISCA 4GYJA 4RORA 1VJ0A 2ZDGA 1T5OA 1K3FA 2H3EA 1YS1X 2AVNA 3B3QA 1NZFA 1OX6A 1XXHB 2C5LA 2GK7A 2MINA 2Y1DA 5FB3A 3IDSA 2LD4A 2CLFB 3JR3A 4JX9A 2FMFA 3QBTA 1DX9A 4KPUB 1XJWA 4MRPA 3TLXA 4P3NA 1R4NB 4G4GA 3CF0A 1EQAA 3IAUA 3KQPA 3PCTA 3PENA 4JP8A 1J09A 1YE5A 2A1UB 2PFGA 3KOXA 3QOWA 3SDZA 5JZMA 1BX0A 2O14A 1GPMA 4B79A 3BK1A 3CBQA 4I1UA 2XYRA 4LJ4A 4UKDA 1FYWA 3A14A 1UADA 1Y9ZA 2OORA 1W9HA 2P7HA 3N2GB 4C4PA 4CL8A 2CNWA 2WF5A 2JVIA 1LV7A 4QOEA 3V6MA 2JFPA 1LSSA 4W1RA 1WMFA 3ZN2A 4YNBA 3NH6A 3OJCA 4WNAB 3RRNA 1L7BA 3CG4A 2EG5A 3MCWA 3F2VA 4AICA 3KSDO 5AVJA 1T2NA 1IOWA 5A3QA 1P1BA 3HEAA 5HR5A 4JL8A 4MICA 2CDRA 4BGEA 3FTCA 4CV3A 5A3RA 1HV8A 3PDWA 3SG0A 2Q1YA 4BQRA 4YMVA 1NLFA 4EVSA 4MHTA 3AVUA 3H1GA 2P5YA 1FVFA 1NY5A 2ZRPA 3HFSA 1VCHA 3SS7X 3LL4A 4WCFA 3H1EA 3R9XA 4JELA 3E8MA 4LTMA 5KTMA 4R2HA 1XCPA 2ZJ1A 4OL0A 2VPPA 3N2KB 3O1IC 3NOXA 3VDNB 2OCLA 5IYZB 1RHKA 4G0XA 2YS7A 3KJEA 5TQ2B 1O2DA 3ZY5A 3CEAA 1PSZA 1XZFA 2DH5A 2VXBA 2QX6A 2AR7A 2Z2XA 1WPRA 3DV2A 3FYSA 1V47A 3HPRA 3P4YA 4NNOA 3RHFA 3FHJA 3DR5A 1JIJA 4FFMA 1UAGA 1HR0B 1GPDG 3WHPA 4CCYA 5FHQA 4E46A 3L7KA 4URVR 1PVOA 5CUQA 4PYOA 4C4XA 3GLKA 2IUSA 1L5HA 4WN9B 1DJMA 2V1XA 3EIOA 4WFIA 5EJMA 5DM2A 5HS4A 2OCXA 3TBFA 2P9YA 4E0BA 2P0YA 2EFDB 3N0VA 3HA3A 1GG8A 3QNUA 3SXJA 4BZPA 1LZKA 2HL6A 3NM5A 3WOVA 4B8WA 5AK5A 1F14A 1ONSA 1L4BA 4RY2A 4ZREA 3WIEA 5JATA 4IDDA 4OI0A 1ESZA 3HKCB 5I7WA 2V6BA 1LDMA 3QJGA 5C8YA 4PBSA 5ECGC 2WWGA 3IURA 2WMNB 1L4FA 1XAGA 1ZOPA 1H6AA 1ZD8A 3FZNA 2GAOA 1ZX1A 2RGWA 3W1WA 4KXVA 3AVVA 3OE7D 2QR3A 1ENOA 3C3MA 2XSZA 2PVSA 4JVOA 3KHKA 4HGYA 1U80A 1ZGJA 1M6WA 2HLHA 5INTA 1VIAA 4Q9KA 3R76A 2YY7A 3AESB 2RC6A 4J0DA 1Z5NA 1X92A 1B6RA 4BCBA 3WYBA 4S1TA 4L15A 1KJYA 1SD2A 1XRQA 3GX1A 4CMJA 5CD9A 2PUGA 3FTFA 5HJ5A 1N8TA 4H0CA 2X9VA 2G04A 3A9UA 1ZXBA 3TQSA 1TA4A 5M5BA 1ETUA 3F5FA 4BGIA 1IEWA 5HRAA 2AN5A 5I4KA 5MN5A 3M6UA 3ZZMA 3OM9A 4WKCA 1KFKB 1XTJA 3B8EA 1AMOA 4PX9A 1D2HA 2QE7A 2WPNA 5HK8A 3RK0A 2JI7A 1AZLA 4HFRA 4RF2A 4CDGA 2NZJA 1H6BA 1SUEA 1Z4JA 3R77A 1J90A 4K0RA 3P5SA 1Q16A 1ZGBA 4RMIA 4BFCA 4JR2A 3M2TA 2B3TA 2GKOA 3A2MA 4ALJA 3PXAA 1WW2A 2QRJA 3H2YA 4WJZA 3HFJA 3UJCA 4DAOA 5IDQA 5KNBA 5CCBA 2HGSA 1ZESA 2CFTA 3C39A 5KYUA 4M4SA 3RTEA 2F62A 4H1TA 1XKQA 2QJFA 4MW0A 3LPDA 5FOVA 5BN3A 1DT5A 2CDCA 2A9FA 1HQDA 1GQQA 5FL7D 3ZQKA 4BLRA 1JQAA 3WSTA 2C98A 3TW4A 3VO9A 4YROA 1P77A 3ZZ1A 1AA9A 2JFZA 3AEXA 3PDUA 1EI9A 1U2DC 1SZDA 4NCJA 1KBQA 3I52A 3ROKA 3VC2A 4RAOA 1CZRA 3MQ2A 1OFGA 3OCJA 4Q4AA 5AWFC 4E94A 2OXRA 4EI7A 5IJ0B 5HBRA 3ZKAA 1DQSA 1SEVA 3G89A 3OLXA 4FQ8A 2QV0A 1RHMA 4E09A 3RYTC 4I4NA 3V7WA 2J6IA 2PD6A 3UOWA 1SULA 1DV2A 1J07A 2SKCA 2QQ0A 1UF9A 2XUPA 3NNDA 3NCHA 1WDMA 5BW6B 2ON6A 5CA0B 4PQRA 1FYEA 4UARA 3MT7A 4FI3C 3HM9A 3THYB 2IDZA 4I3FA 2NPFA 1HORA 2VJKA 3S28A 3ZU6A 4EENA 3ER9A 3A3PA 3E2PA 3EA0A 3PPYA 1X7ZA 4RD3A 3WSWA 2WU3A 2RBEA 1Q15A 2W2LA 1Z4PX 4I5IA 3DCIA 4M0DA 3ZBUA 5BWBA 1A96A 3VX4A 1EQUA 2H2FA 2DSTA 1MB3A 4RK1A 4Q18A 3IA7A 4XB6B 4CLOB 3CSUA 3BQMB 1GNRA 4C2UA 4MVWA 1RI4A 2VHUA 1VJ5A 4OJYA 1YHYA 4H7EA 2VP9A 4IBOA 5FKJA 3U61B 4XD7D 3K7EA 3RT7A 4LNAA 3N8HA 2A9RA 5A9SA 4NBKA 3PGVA 3OG9A 4EYQA 1C0PA 5P8WA 1HT1E 1RMTA 4OJTA 2GZ1A 3WGVA 3Q1LA 5JQGF 2VHJA 4DCOA 2OO3A 4HYTA 1T5TA 1WQ3A 5FOSA 3CNEA 1LD3A 3V2IA 1SB9A 3ZU3A 1U28C 1CHDA 1Y33E 3NAMA 4I9FA 4J3JA 2IU6A 4KGXA 4TLDA 1SG0A 1UBUS 2CJWB 2Y93A 2C03A 4FUQA 1BWPA 2JIMA 2MU1A 3RSSA 1M34E 4MDEA 4CUKA 1A95A 4BEVA 1IN8A 4XPZA 1GTG1 3HKCA 3OCXA 1Z82A 4LY9A 3NVKI 5TMEA 1N6PA 1SOVA 2ORVA 2Z9DA 1FMFA 1FMJA 2C7VA 3IO3A 2DAPA 5E3IA 4N3CA 1P29A 2JFNA 3AR4A 1Z25A 2FLVA 4MXDA 3EARA 1L6RA 2CLLB 3OPXA 4PEVA 1MO3A 2J9GA 1V9CA 3R1IA 2QVGA 4BJ5A 1GN8A 1I1NA 4KK4A 2FE1A 3QG5A 2F3TA 4C05A 2FE4A 2RIPA 3KZOA 3QX8A 5D00A 5JV5A 1F4VA 3D8HA 5LQAA 2QUHA 3PEYA 2VJDA 4LFBB 3DPUA 1JLSA 1XLVA 3IP6A 3WNCA 1O9HA 4GXTA 5KYVA 2QWXA 3HU2A 3CLTC 2EQBA 3O7WA 4V0NA 2HUNA 2NXEA 4F3NA 1AY0A 1ONNA 3DT8A 4BNJA 1MO2A 1WWKA 4V1CA 5LL6P 2O8NA 4BMYA 4CIWA 1E3SA 1XEWX 4CU2A 1ITZA 1N5JA 3KAKA 3MBOA 2BN4A 1FEZA 1C0KA 2B1QA 4RPGA 5JCOC 1XMSA 2YDYA 3NHUA 3CKKA 2AMVA 3BT7A 4IHKA 1ZSYA 2P69A 1ULTA 1WCV1 3H2BA 2DG2A 4LYAA 4B6FA 4CKBB 5KNBH 3RUPA 4M1ZA 3KT6A 3VSDA 5KREA 1Z5OA 1YL7A 1W59A 5DRTA 3H9BA 2JZOA 3TKYA 2CLKB 4FMPA 1UMKA 1J2UA 3C7AA 2VIIA 2RE8A 2XJ4A 1QLJA 1FSPA 3OLVA 4RIHA 5ECYA 1XDUA 2FUG1 1YD7A 1L4HA 2PSSA 2WG2A 2PKXA 5CPFA 5HCIA 2UVPB 5TSDA 2NP6A 2O5EA 2VH5R 4UM7A 3OQJA 3VZPA 4BYGA 1P81A 4ETWA 3MB5A 4L4YA 3G9TA 3WLKX 2VQEB 3C4JA 1RHJA 3KT0A 1S8NA 3UFXB 3QEAZ 4XXHA 3DE6X 2WAAA 2IEIA 5K6TA 5FAKA 5ELLA 5LVAA 2VHEA 5AW8A 1PU2A 1CY7A 1IUNA 3LQKA 4TS3A 2UXBB 2PBLA 1SC4A 4LE1A 4CI0B 1A3CA 1T1SA 2D1YA 2R6HA 1JN0A 2COUA 4UUBA 1N6RA 3HB0A 1VLMA 2JIDA 2VNAA 5A1TA 1Q7RA 1NUQA 3EVDA 2QQEA 5KU7A 3DBIA 1KAMA 1XYVA 4R51A 5IU6A 1K8RA 4P6VF 3WBKA 1UMBA 1P7VA 3BTVA 1K89A 4A2CA 4TLLB 2C9MA 2JF0A 4R01A 3ET5A 1B0PA 1E6UA 2BTOA 3R0XA 1FDVA 2BGKA 4WINA 2FFBA 3VTFA 4NSNA 1IG0A 1ZFNA 1R0KA 2CHFA 2Q4OA 2QLLA 3LZCA 4HY3A 4OQYA 5EE3A 4E1AA 1IBKB 3PYMA 5E1MA 1J0CA 2BVNA 4C5CA 1JR3E 2C8KA 2PNFA 3KAQA 4GZ6A 2Q5EA 1EFDN 3LC7O 3OZBA 1NE7A 3SMVA 1XYYA 4DXDA 3GNQA 1G5HA 3PSHA 4TVSA 5AVZA 4KO8A 1XJQA 1KFEB 4JQZA 3MMZA 1JIVA 2DEUA 5HBGA 1IATA 4TMVA 3N3AC 4E6PA 1W7AA 3PXXA 1KMHB 2V3VA 4LOJA 2ID4A 2IEYA 2OLJA 1UJCA 2O57A 1DCTA 3DAPA 1Q19A 2Q3DA 2VCYA 1JHPA 4I50A 4J0EA 4IIBA 4M1MA 4QDOA 2ZUCA 5BQFA 1QBGA 1QZTA 4PQFA 4PZCA 2QDXA 1TLFA 1GTL1 1NATA 3BSFA 2GF0A 1I7PA 2VTKA 4LWQA 1JYEA 2Z3VA 2HJVA 1E6EA 4CR6A 2APJA 4GLJA 3AGPA 1GZ4A 3CINA 2ZLBA 1KYWA 3DOEA 3O3MB 5AR1A 4QOJA 3FKSA 3SQLA 1F20A 1QSGA 3PD0A 2R00C 4QUHA 3RBXA 4OGWA 1DG3A 1YDEA 1U98A 1VB5A 2V7EA 4P80A 1KFCB 3D2CA 4YUWA 1YGPA 2Z83A 1QOQB 2D8MA 3DCJA 3KZXA 4WBNA 4RV4A 3L0PA 5EPUA 4UTZA 1ZLXA 3F3SA 2PKWA 3DEYX 3PKJA 4EF4A 3R6WA 1MC8A 4D6YA 4DW8A 4DLKA 2Y1XA 1Z7EA 1DEAA 1WCIA 1P73A 4AX4A 4JYZA 4B9AA 1W85A 2IBTA 4AQDA 4CQNA 3T1YB 5C4IA 1PQYA 1SA0A 1XDBA 3I6QA 4Q3KA 1O5TA 5IC5A 5F76A 1JJ7A 3F9RA 4UHCA 3FE2A 3SJCA 2ZUFA 1K97A 2XE6A 4YO7A 3KFLA 3D4BA 2FUG6 3ODGA 3RTAA 3UWPA 4L50A 4MUFA 5CA1A 1VIYA 1GV1A 3CZRA 6NULA 1NUHA 5MF6A 3EG9A 3QVJA 3TWOA 1WCYA 1WBJB 1RBQA 4FVTA 4YRLA 2PGJA 1GAWA 2Z56A 3MHPA 2J6CA 3NRBA 2BHLA 5DLDA 1QGAA 3OZIA 4GX5A 5JXGA 3HKEA 3ORHA 2PZGA 3DDSA 4JWKA 2HDWA 3AI7A 2EATA 4DR7B 5CT8A 2R8BA 3Q3GE 2GR9A 5AM4A 2A5YB 3ZE2B 1FS6A 2E4AA 5TT0A 4BMOB 3SKYA 3UNXA 3MD9A 1EVZA 4FZ5A 5JDIC 1Z08A 2JHFA 2OWDA 3AU8A 4J2TA 4WECA 4ZDWA 4DV7B 3SZLA 4ZHSA 3RKSA 2BAGA 3BWBA 4GUDA 5TX7A 3GLGE 3JQQA 4XFJA 1NONA 3SC6A 3AB3A 2XY4A 4HLUA 3EULA 3ROEA 5HVNA 1P8AA 4IHAA 4KBYA 2BM9A 1IBMB 1LVGA 3L49A 4HSEA 2Z6AA 1BX1A 4R7TA 4B81A 1ZY2A 2XITA 1KMHA 1JFSA 3KTAB 1PJQA 2J0UA 4XIYA 7REQA 4RADA 2OG2A 4WAUA 1EVYA 1V96A 2G5PA 4JCOA 1WDWB 3MBIA 1OWOA 1HURA 4LZWA 3RYHB 4DXHA 5IDXA 1IY1A 2M1XA 2FW8A 4N7MA 2WMYA 2EBWA 5AI4A 4C7BA 5TY0A 3SBDA 1I1OA 2OOSA 2QVZX 3F0TA 2NUTA 2I03A 2XZDA 4YALA 5FWXA 2AKAB 1WRBA 1CV2A 3ASYA 4OOEA 2JGDA 4JYMA 2H7VA 2BHTA 3P2IA 1DDGA 3S27A 3Q8WA 4WJKB 2Z4SA 2HNAA 1DC8A 2H2AA 4EVQA 2X15A 1Y8QA 1XD9A 2P90A 2XVAA 4KWHA 5ENVA 4BO3A 2VYNA 3EIFA 3HLTA 4ZO7A 4BFXA 4Z4QA 2ZRQA 1K0FA 1XTBA 1NVKA 1X2EA 4YRJA 1Z29A 1M1XB 4CT0A 3PX7A 3NUGA 3WGLA 4KDCA 3T5BA 3TTSA 1NFFA 4HAVA 3IIKA 2FMUA 3KDPA 4IMPA 3U4MA 4TZ6A 3WGYA 1XU7A 3ZD8A 1HDGO 3LUDA 3RSLA 1ZZEA 3I04A 4C22A 4W99A 1PS8A 3UFXA 1WZIA 2O3TA 4MI3A 3WZLA 4ZEWA 1W2HA 1HE1C 3IAXA 5ULLA 2CNNA 3L1IA 3L6OO 4M1SA 4ZVKA 3H8WA 3ECAA 4YV0A 2PNJA 3JQCA 1W5SA 4EYOA 5B37A 3FNBA 1S4QA 1NI3A 3BE4A 4M0LA 4MQBA 1DJPA 2BISA 1I2AA 4ZANA 4BAZA 4I4LA 1CRWG 1DOHA 2H48A 4D25A 5HQJA 5EMJA 3I9MA 3LUHA 2EERA 1BE0A 4N5DA 1QPBA 4EH1A 5BW4A 4TPKA 3Q9NA 3NEYA 3HBJA 4B5KA 1ZC3A 3AYXB 3H4IA 3UJ3X 4BO5A 4DR4B 4HG2A 2ZJFA 1JSCA 2HCFA 3D2AA 6ABPA 3ENZA 4IGAA 3BGIA 4QDUA 1MTOA 4DIOA 1ZO8A 1NJ8A 5FADA 1A5BB 3QLVA 4GQAA 2F9MA 3BC1A 1A76A 1ORDA 3KZ1E 1F5SA 3LUGA 2NWQA 3UMCA 1EVJA 5JH7F 1ISIA 1QLWA 3I9FA 3UHPA 2IYXA 1CE8B 5CFMA 3OTHA 3DZBA 4RGVA 1GQSA 5AXAA 521PA 1ZEMA 3QENA 4Y2XA 5FLYA 3OOHA 9LDTA 2PSDA 3KZCA 5LQNA 1XQ9A 1P45A 3QWIA 3QBEA 3ILVA 1ZNQO 4INZA 4IIHA 1MG0A 1XTIA 1ESCA 4OQPA 4ZKDA 2GWHA 5AUPB 4KQXA 4YRQA 4FBLA 2XPCA 2BSXA 5G0VA 1D1TA 2N9UA 3DVSX 3R5TA 4BNHA 4XRRA 1VM6A 3ZDFA 1V8PA 1A97A 1VRCA 3RYIB 1N77A 5K3BA 5J4KA 2NVWA 1FRZA 3MJFA 2VLIA 3M5DA 5C18A 4UTRA 2AD5A 1L1QA 1W19A 4AKIA 3KT3A 1L7EA 1U90A 3JYOA 3DNFA 2I6GA 4YJ3A 4DYVA 4MQMA 5EQTA 2P11A 3Q3CA 5KAMA 5CX1B 2XYHA 1H85A 2P9BA 2YX1A 4MVJI 3KEQA 5BR7A 3D54D 1ODLA 1PJRA 2REBA 3ZXIA 4HZGA 3UZUA 3PICA 3C14C 3OIUA 2TMYA 4WIAA 1XO1A 4AJ9A 4W5TA 5HK9A 2FZVA 5IXSA 1HQCA 5JSQA 1W4AA 1M6HA 2IYLD 3KUUA 4P35A 1J8MF 4IRUB 3Q12A 4CKCA 1VMDA 2DUNA 3U9LA 1BQ4A 4P38A 4ZAXA 4ZYUA 2NZUG 4RULA 4OHCA 4N7RA 5EFZA 1M1NA 2G9UA 1TJNA 4G36A 4BNNA 3CF2A 2Q99A 4DXAA 3CMMA 3ZNPA 2QORA 2Q1TA 4FDAA 3U7RA 1SOWA 1T6XA 5A0VA 3G7SA 5ALUA 3CXRA 1E1LA 2X22A 2BKUA 4JLSA 1RSZA 4Q1VA 4XWOA 2ZTLA 3BRQA 4CKWA 1R37A 1Z13A 1F6DA 4CLOA 1GRCA 2R8YA 1PTJA 3KCQA 4H60A 3T1NA 3O83A 4LJYA 3W8DA 3BSWA 3AEKB 3T6KA 1SKMA 4X3OA 5G0SA 1NBMA 2XMSA 1USWA 3CXUA 3FCXA 1FK8A 4Q12A 1DUSA 1ZZGA 4BPBA 3QXGA 4F4FA 1M5TA 5DYGA 2ZZMA 1LLFA 2HY7A 1LX7A 4M6WA 3CH4B 3DS8A 3WNVA 4J07A 4E5SA 4N8SA 1G3RA 2YYSA 1ZNXA 2VS1A 1LXCA 1J5XA 1R0LA 4UVIA 1SCAA 3J81k 1V5EA 3BGSA 3DOOA 5C1BA 2VNHA 1JALA 4BB9A 4G1EB 3OZ7A 4MA4A 2AUNA 4R2XA 4AY5A 4UPEA 2V3WA 3WNBA 3LQFA 4ROSA 4URHA 2C7RA 2K2QB 3OQ6A 4ZAWA 1YS2X 2PQ6A 2XCIA 3G2NA 1E58A 1ZAKA 3RJ9A 4D9EA 1GTZA 2NTEA 1I10A 3QHAA 2OHJA 4OFWA 3L9WA 4M54A 4P5DA 2GAIA 2XKBA 3VV3A 4J4HA 4G0QA 4MV7A 3LUFA 1JH8A 3I2GA 3KU4A 2GCIA 3FJOA 1H1LA 5AMXA 3QLTA 3WISA 5K1ZA 3RKUA 1GR1A 1ZOOA 3HDJA 4YYEA 5C8ZA 2EJCA 4Z3OA 1IEVA 4PR0A 2CMDA 1GIAA 2BR3A 1FFWA 1Y37A 2PUVA 1AF7A 4OM7A 2XQFA 1UZAA 2W2TA 4DLUA 2C2ZA 4TKVA 1ADFA 2IXEA 4RHFA 2QTLA 2RAUA 4MULA 4PX2A 2YW9A 2PS3A 1Y8ZA 3BB1A 3OFJA 2LKCA 1TA0A 5K4AA 3ZJTA 3BB3A 1B0UA 2C5SA 5HE8A 2OHFA 1YI1A 2FV8A 2CLOB 4GNKA 4Z51A 1YR1A 5ICMA 3GJ4A 4J7AA 2BZ1A 3AR7A 4IG4A 1OZGA 3WOHA 3K2BA 2G4VA 1Q50A 2HX1A 3HCPA 3I6ZA 4DLVA 2GJ9A 4CM4A 1EDOA 2JS7A 4X00A 1MOSA 1KQ3A 4GF5A 3X2FA 5LQRA 4NCAA 1NN1A 4LHWA 1WW3A 3UICA 2PQ0A 3AEUA 3HRIA 2DJIA 4HX9A 1H42A 3DDNA 4U6SA 1MX5A 1IN7A 4IHJF 1NNUA 1O0CA 2Q3LA 2Z0MA 2D5AA 3ETLA 5KVAA 4J1QA 4DFDA 4HDSB 2GN2A 2HSWA 1VYUA 2C1XA 3OJOA 3V4OA 3U6KA 1OLSB 2ZYGA 3LVBA 2I2FA 2UDPA 2HK7A 2JW5A 3EQ2A 4QU5A 4TXMA 4Z3DA 2XT9A 5I4BA 1GPNA 4P7BA 3QK7A 3TW0A 1P1FA 4JBNA 3KOYA 3V7FA 2X8JB 3SZGA 3HYNA 4REQA 2ZRCA 4G4SP 3ZDRA 4PNPA 3SEAA 4GW3A 2ZR0A 1O0SA 3EHDA 5D6NA 3UWMA 1L5HB 1G9TA 1QH0A 4Q3LA 2CK3D 4GHWA 4RMNA 4DQ0A 1C7ZA 1BTOA 1U8AA 2KB0A 2RHLA 3IP9A 1DUIA 1RE1A 4RKEA 4IMIB 4RETA 1KEVA 5BO5A 4ARSA 1H05A 1HFKA 2GJKA 2ZTUA 4GI1A 1NYLA 3BMNB 3HN7A 4HGPA 3UUGA 5C1DA 3OQIB 5JNUA 2B0CA 1A7UA 2I7TA 3DM5A 1LS6A 4M0EA 2HJGA 3ESQA 1NX6A 4NEQA 5JZVA 4RDIA 5ITZB 3QLVC 5CLIA 2DTEA 1ZC4A 4ZVPA 4HVCA 1DMSA 2RHTA 1PGQA 1INLA 2ALJA 2HU5A 2Q4RA 4Q9IA 2VNJA 4PZEA 2H1CA 3R3JA 2REOA 4YX9A 3JVUA 2DPLA 4WBXC 4BQNA 1OC4A 1MJGA 3T94A 5EKDA 2ONCA 1RYBA 3DFIA 4H1HA 3H5IA 5K0SA 5ALQA 5ALXA 2NSJA 4QSHA 3ZHZA 4ZI7F 1KZ9A 2R6ZA 4QBIA 2IL1A 3OM0A 5AW2A 3KLBA 3QVOA 1BU5A 5A2GA 5C2JB 1OF1A 2VP2A 3ND8A 3UMRA 5JXWA 5BR8B 2HFJA 1TJYA 3DBLA 1BOFA 4G6ZA 1L5RA 3V8QA 4BVEA 5JD5A 2D2FA 4F5ZA 1HK7A 4JT4A 5FUBA 3C6KA 1T5DX 2YWHA 1P3JA 1XDSA 3E1GA 2OFXA 1I14A 1N2CB 1VBKA 4WDQA 1KR2A 3GB9A 3ICWA 1D1QA 1CQIB 2NV0A 1BMFA 2ZSIA 3SM9A 4RH1A 1XF9A 3W05A 2ZQYA 1D8TA 3MAAC 1ECLA 3OTGA 2QTHA 1JWLA 3LGXA 4NFSA 5CT5A 4N9WA 4N9QA 1BIFA 4GQBA 1I32A 4J0KA 2X9LA 2GRJA 4GNRA 3AVYA 1Y3BE 2GTHA 1UKVY 4MGYR 4R9RA 1X38A 3OOSA 4EY6A 4KXMA 5AJVB 2H0AA 3WGZA 5LR6A 2Y1KA 1N6KA 2HHAA 2AZ4A 2GO7A 3CJTA 5U1PA 4AJPA 3NTLA 1X77A 1W48A 3BCHA 4MWSA 2G6TA 2ZAOA 3N07A 4C76A 2EX4A 3IILA 3JQ9C 5H8WA 3DHNA 4XOIA 3ZYZA 3ROFA 4PYJA 3TL3A 1DDIA 4F3TA 3VYUB 1AE1A 4UHFA 221PA 2WG1A 4HH1A 4UDXX 2DY1A 4CUJA 4YJKA 1BFUA 1C1HA 1USVA 2HQOA 1X8LA 1K7CA 4HATA 1OPRA 4OK3A 3WIVA 4BVJA 5JYEA 1Z4OA 5BVHA 6Q21A 5KKNB 4PQYA 1XNJA 3TVTA 4WESB 3BXPA 3VR1A 1ATIA 1E2BA 4QYSA 1Y6ZA 1CDZA 4ZXFA 2UZAA 2O9JA 1J00A 1UBOS 3NT5A 4O2BF 5TJ9A 3ZE6A 4JAVC 3DL2A 4DMUB 4Y9RA 3DA8A 4DMRA 5JSKA 1XQWA 2FZEA 1PR0A 2HBYA 4AWXA 1T3TA 1K68A 2J5QA 3I8OA 3PQ7A 2X8JA 2ZWAA 4N8EA 5HQTA 4BKOA 1QE0A 2C4UA 4WLOA 1B76A 3IP8A 1D6JA 1F0YA 2C7QA 4KO1S 1DKQA 2GUWA 4DA0A 4E5MA 2VHYA 4KP7A 3HRHA 2ZRJA 4LHVA 4EMSA 2LE0A 3KP1A 4AY3A 1JECA 4LJRA 3TLZA 4Z99A 5M3BA 3B9RA 5LDHA 2GAFA 4EMTA 3IP5A 3N58A 2MSKA 2GOYA 1PG5A 5IRCD 2ATVA 3FIJA 5K7SA 1RI5A 5IKEA 5B3JC 1N5IA 1NW5A 2OFOA 2GEFA 1YDGA 5AVKA 3L7LA 1TJ3A 5FD8A 1NUAA 3QKUA 1N8NA 3VHXA 1QP4A 5EIWA 1GWNA 1O94C 3KL2A 1JT2A 4FDMA 3USCS 1QFSA 3A2LA 5L3VA 3WLLA 2ZYWX 5KMGA 3W9SA 4B6RA 5CITA 4NQRA 2D3TA 3KXDA 1HLGA 2FP4B 2C5EA 2CL6X 3AETB 6CHYA 1W5TA 2YFHA 1NXXA 3OURA 4JUBA 1W8IA 4RZHA 2X0FA 3T8YA 5JWRA 1O08A 2IHTA 3ZX4A 5KOJB 3RAPR 2LW7A 4BEBA 4DJJA 1KH1A 5KTRA 1VLQA 3VR6H 4HYQA 1LPAB 2YYZA 2X6RA 1XD2A 5AKHA 1YDMA 3FBGA 1SBIA 3PR3A 3EXHB 5A3SA 1ZCAA 2XGSA 1NDUA 3O2NA 3DLTA 1L9KA 1CC1S 1XAIA 3QXXA 5JMTA 5I3CA 4DRZA 3ESBA 4ZT2A 1C7FA 3WQRA 3FZEA 4D0RA 2HHJA 1NBIA 4KQEA 7MHTA 4G81A 1SUCA 1CZLA 1O57A 2DM6A 5KWVA 1YUMA 5IHPA 3HACA 2Z6VA 4CQMA 3RADC 4W63A 1UKEA 2V7WA 2ZRNA 4HDQB 4JI6B 3B20A 1BQ3A 3E9RA 1S7GA 3SYRA 3OSZA 4MW7A 3BXOA 5JANA 1NZDA 3IAS1 2E1PA 4B35A 1B73A 4QASA 1JLLB 2X1VA 2FW0A 2XYQA 2YYYA 3KOZA 4ZZIA 3T35A 1KEWA 5TRTA 3JWGA 4K6GA 1WDKA 4UM9B 2IUFA 2J0EA 4LWZA 1AQLA 1GNLA 5CT9A 4DNQA 5JBNA 4UDYX 4I6JA 5FFNA 4G24A 1YRHA 4TWAA 4JEIA 3S68A 4A1FA 5I9NA 3G3EA 3QV2A 2PL3A 4H0FA 4L6CA 4LRTB 3CX4A 1K92A 1M2HA 3FTPA 4PX5A 3H8SA 4UULA 1SQ5A 2FZGA 4F85A 3ESYA 5FEMA 1WHSB 3N7AA 3IIIA 2IRWA 3O8QB 1MPTA 2QPLA 2B82A 2QSJA 5F2NA 2O8CA 1LF5A 2V4UA 4QM7A 2XE4A 2ECQA 4GBJA 2GZAA 3NKVA 4L78A 1WHSA 4L0QA 4ND3A 3JQGB 5D3KA 5F98A 5KB3A 1JIKA 1YBMA 4NKRA 4FWBA 4HBGA 1M7BA 3JZFA 5JNWA 3A6FA 3KSZO 2C2XA 2FPGB 3NHKA 3EIQA 2DKNA 1XRPA 1NBOA 2EJVA 2WAYA 4NC9A 1HFJA 1YI8A 4YV1A 1M1NB 4BX8A 1FNBA 1GJRA 3KHUA 5CW2A 5KVVA 1JU4A 2WU4A 3QELA 3OD5A 2WHRA 3ZIDA 4EFKA 4JUFA 4O59O 5EPOA 2WINI 2WJVA 4YUYA 5KNDH 3LC1O 3IT2A 3AOEC 1L5YA 2X3UA 5EXSA 1YCGA 4Z1MA 3FLMA 3IKLA 5HDQA 3RIEA 3S2YA 1EWVA 2GWRA 1UPUA 3M81A 4B73A 4RSRA 5C51B 2YZ7A 4MR9B 3MTBA 3PXDA 4MP6A 1YR8A 3D6AA 4UU7A 1TVMA 3FKQA 1H9AA 5DNWA 1UJBA 4W8GA 3L0DA 1Z7GA 4ZQCB 3VR3A 1P1RA 4KYVA 1V6SA 3DL0A 4PC6A 2FA9A 3P9RA 1C3OB 4UUMA 3T7KA 1ES9A 1N9GA 2Q8QA 3N2YA 4F56A 3UAWA 3VVCA 4AMZA 1AKNA 1FMLA 2PX5A 2X8WA 5HF9A 5EJ4A 1Z0AA 2A8YA 4YIKA 3K72B 4RO0A 2JGEA 2VUSA 4DZTA 2HF2A 4UVEA 3ZHTA 4UC0A 1E2UA 1NGSA 3DTYA 4L28A 3LKDA 4EJFA 1PR6A 4CLRB 4GDFA 2PFKA 3E0QA 1DKUA 2X2EA 2BEVA 2CZCA 3ZCTA 4D99A 3L05A 5FL3A 2VTBA 1QHHB 5H5JA 5A6VA 1XZMA 4FXPA 3DXFA 1ZGGA 1C3XA 1OIWA 2O0LA 4X85A 4YV2A 3IJRA 4RK0A 4ZU6X 1SCKA 4PO9A 5HPYB 5JSFA 5KMGB 1PX0A 1KZ1A 1NVUQ 1ZA2A 3C97A 3H19A 1I0ZA 2B6HA 3ONVA 5SY6A 4A4DA 1GG9A 3RJMA 3WJAA 5CBPA 3Q88A 1JFTA 1K06A 3RYCA 2D8AA 3WWYA 4LJ6A 2V6GA 3QOYA 1XVIA 2VRWA 2V7QA 3ANLA 2FPMA 2RI0A 3IOMA 4KQKA 5DP1A 2GPTA 4YAIA 3KR9A 1LBHA 1THGA 5I8PA 5AVWA 4PG8A 5SZJA 2HYIC 1PJLA 5KWSA 4B6EA 3BS4A 1IYZA 1CE8A 2I4NA 3OX3A 1PQUA 5IUNC 4ZCTA 2N75A 2Y1OA 1N3BA 5JFOA 4XX0B 5B6PA 1CU1A 2FH5B 5KQSA 2XAUA 1N6NA 1OWMA 1VMIA 3MRXA 4GZLA 5ENZA 1MDFA 2J9XB 3IT1A 2BKXA 1U2GA 3O8RA 4FILA 3UJ9A 2RAPA 4YLEA 1YWGO 1JKFA 1FTQA 4KMRA 5DRYA 5JAUA 2IW1A 4WERA 2C88A 1G2IA 2H5JA 4XQ0A 5K0NA 1T2VA 1RC0A 2VNKA 2W6ID 2F1RA 1F48A 2OHIA 4PTZA 1AKQA 3CNNA 1Y6JA 3OKCA 4D46A 2O3UA 2P68A 4KQFA 1JDUA 3EGEA 3PRKE 1LV8A 1TD1A 2OZLB 1G9XA 1MB4A 1R2QA 1EB9A 1PYOA 1UT8A 2PWBA 3RWMB 5DIZA 3NO4A 3SEQA 2ZRGA 3KTDA 3GLHE 1L8OA 4MDYA 2YVKA 5BUCA 1NVDA 3I04M 2QR5A 1OH5A 3D8NA 4M98A 3W78A 3GLFA 2O8EA 1F60A 4E32A 2JFHA 4NZMA 4MEBA 3VR2A 2REQA 4DRXB 5GV8A 4R83A 3EEBA 4IXWA 2JLCA 3N2NA 2X4DA 2WF7A 3AHGA 1SVKA 5D7NA 1RZVA 2X5KO 1UBEA 1RRVA 4NTZA 2YRXA 2YCLA 1LDGA 4MKXA 5AVUA 4PE5B 4YCCA 2NW6A 3TVDA 3T12A 1AGRA 1NXSA 1YIAA 2JGRA 3GEHA 4Q7MB 3D8TA 2OEPA 2H17A 4L5CA 2YJTD 2NSYA 4HGRA 2ZYAA 4G0OA 1QVVA 4P4NA 3CJQA 4JT9A 1Y9JA 5CXSA 5FUYA 4GYWA 1B6GA 3CWZA 4LMRA 3W2FA 2M6SA 4OHBA 4E2WA 4S1PA 4YRCA 3KDSE 2QL6A 4MW4A 4NNPA 1M2KA 1PCXA 5KNLA 2C8LA 1YAHA 2JAHA 3E9DA 1YZHA 2HLNA 3JVDA 2RKWA 2JEYA 3QUTA 3T9EA 3A1UA 4YJHB 4DWOA 4K9KA 2BV3A 1EA7A 3HY3A 5DHFA 5LNK6 1J33A 3NFRA 3AI1A 3FBTA 1B6TA 1NVGA 4DM4A 2JLWA 1G6OA 3CCCA 3L0CA 3AGQA 2FJUA 3AV3A 3HBAA 1TXGA 2AN3A 4YY3B 1KE2A 2C4WA 4KU4A 1B41A 1X7YB 1VLHA 1GZSA 4M0CA 4I8XA 2CBGA 3AY0A 4ZU3A 2OZEA 2OYCA 1TJ4A 2I6XA 1DIBA 3BIXA 1T9DA 2MOKA 2PUJA 1E2HA 4IIJF 4PGFA 2G09A 3AI2A 1K88A 4TVBA 3BHIA 1RNLA 2OYRA 3LWBA 1SKAA 3BQNB 1SKYE 4JP2A 4UW9A 3NM4A 5LYJA 2BMAA 2A88A 3KTOA 2Q2QA 1Z16A 3WWPA 1AKRA 1TEXA 1TM1E 4Y7CA 3KYDA 3KEMA 2RI1A 2AYYA 3SYLA 3LK7A 1HFEL 4K9SA 4JKIA 4XGQA 2LCQA 4KR9A 3EG9B 3F47A 3KJIA 4LOAA 2GJ8A 3I83A 3PQCA 4TS9A 3U17A 4B1FA 3NJ4A 3GV0A 3M82A 2V65A 1BKYA 3ZU2A 3I2JA 3OPYI 3I5MA 4WK2B 1HOXA 1PN3A 3D5TA 4IJVA 3CT4A 3JV7A 3KHSA 4RVSA 1L1EA 3ROXA 3CIFA 1Z39A 1AQNA 1DEXA 1E1QD 3V46A 4LXGA 1NP6A 1XMXA 3H3JA 4PPQA 3H8JA 4F86A 1MIOA 3RODA 1T35A 1TU4A 1R6BX 3C6YA 3ELUA 2HXYA 2AFIE 1EK2A 4PFSA 1PJTA 4JWTA 3A04A 3ZCRA 3ESCA 4PYLA 1LB1B 3GD5A 3NWOA 2FPXA 2PJUA 2OORC 4HKTA 1HTWA 3ACCA 3ZJ4A 4C03A 3UK1A 2WYVA 3F5DA 3ABRB 4UTOA 5KTKA 2PYIA 2ZB8A 3CLKA 3ISTA 1ULUA 1J8YF 2R44A 2ZE6A 2LZ0A 4G41A 3ZJVA 3L0YA 4KUHA 1GA6A 3ZI7A 1OAOC 3N5KA 4PHGA 2RIRA 3QA3E 1GYRA 3ESDA 1P1HA 1GQRA 3TSCA 1RVV1 1SA0B 4X7MA 4ZARA 3T3PB 1TYBE 4PONA 1GZ7A 2C3OA 4JT8A 3GG9A 1U0EA 3ORYA 1X8XA 4HWKA 2JJYA 3Q0EA 4MYCA 1LPBB 1FBTA 2JJ8A 3BJMA 3E58A 2O0MA 3GRYA 4FHGA 5F4BA 1G20E 1E2LA 1TJ5A 2G1KA 2VC2B 2W5UA 3Q7RA 4KHZA 1AZWA 2IHJA 3N5CA 3QH4A 4KSYA 4LJKA 5JWHA 3URMA 3ZOZA 1U31A 3UIEA 1LNQA 2R7LA 2Z5FA 2BF4A 3ETJA 4QVKA 4Z3KA 1PE0A 1T5HX 1VBNA 3LFTA 2JFXA 1J5PA 3JQBA 4NYIR 9LDBA 1WPXA 2YVUA 3GMSA 2YV5A 3K30A 4PO3X 4ARUA 2IS1A 3RYFB 1DJOA 4ZVMA 2HNKA 3T4EA 4CMGA 2DBRA 1EU1A 1PS0A 4S24A 3GIWA 4CFSA 3ADKA 3ONDA 3ET4A 3EDMA 1IBRA 3NAGA 4W4TA 5AXBA 1OLOA 2W6ZA 1KO7A 1NXVA 2CL0X 2DUWA 1HYEA 2XMZA 4EUNA 4UXJA 3FH0A 3E05A 2Q1UA 3KVOA 3DZJA 3H0CA 1TEVA 1OBCA 5JO0A 5KYWB 1G8MA 3IEKA 1H1LB 1QORA 4RGYA 1CY6A 4DMGA 4QZVA 4HRXA 4FKBA 5IZCA 1I4EB 3ESRA 1ZXLA 4PLCA 3T54A 4DV2B 4C4RA 1QANA 3ZLVA 1R6UA 3CEHA 1N2SA 3HN6A 4M9UA 3LG2A 1UXGA 3JQ7A 4IIUA 1XJ5A 3EA4A 2JB9A 1Y5IA 1XEFA 2HI0A 4B33A 2Z6UA 3R9KA 1GZDA 3MCZA 4G84A 5T67A 4AJJA 1I3MA 3B36A 5E6SB 1QP7A 4RTOA 5CIWA 4Y2PA 4QUDA 2B7BA 1G5QA 2WYWA 2Q62A 3HJRA 1S96A 4YCAA 1QZXA 2REQB 3PDHA 5EZYA 3I9KA 1KJQA 1Q77A 1H2ZA 2Y67A 3D3NA 5H9VA 2FUKA 3W5HA 3GLFB 2O8EB 1U8FO 3OPYA 3TB4A 3AZQA 2YUTA 1UDWA 3W3AA 4M6WB 1CTQA 4QX6A 3KM0A 3AUSA 1B43A 1TAHA 3NASA 1IK6A 1HM5A 1QH1B 1UBSB 3B6EA 3F73A 2IITA 5IH7A 3D59A 3JCZA 1PR3A 2UYQA 2ZOSA 1VG0B 3K8YA 2G4CA 2QYSA 2PGLA 4R8SA 2QROA 4PF1A 4OYYA 4IIVA 4GEKA 4CL0A 2DHRA 1DHTA 1O97C 2VDNB 4EUKA 4N03A 1U4NA 1WXQA 3ZQUA 5ABPA 1ZGCA 4MZXA 1B2LA 1QCDA 2HA3A 1TF7A 2IXDA 3EH2A 5AOAA 5DHSA 5TV2A 3W5AA 4J1TA 1EGAA 1V7ZA 1DFIA 2A9VA 2NO6A 4ZO9A 5E0KB 5FA5A 4ZQIA 3UMVA 5BNIA 4J7UA 5EE1A 1JJAA 3DDOA 4ND7A 4MUNA 3RR2A 3VYVA 1W581 1KPHA 1E77A 2H8KA 1YJ5A 4JQOA 3U7HB 2OD9A 4OBXA 4UTVA 4V2UA 1QOPB 3ZDYB 3DJYA 1LJUA 3BX1A 4LYHA 4IQ4A 3T41A 3LUJA 3GPBA 4S05A 4C89A 3L8HA 3Q41A 2ZIUB 1GN9A 4D2IA 3TMKA 1HG1A 5IC4A 1WB9A 3L7CA 4ID9A 4RCZA 1QIEA 3K1YA 4OQDA 3M3HA 2VPWA 1L5ZA 1P5FA 4IIJA 3RK1A 4FB5A 3O5AA 1NIJA 4A03A 4PGGA 1BS1A 4DCVA 1W0KD 3VA7A 1C3JA 3LU1A 4X1KB 1ISJA 3PHGA 3ZY3A 1GDDA 2Z2IA 2CUZA 3EXEA 3K8ZA 2VJCA 4GO1A 3A6KA 4QDXA 3SBXA 3PVSA 3WGJA 1F38A 1H3NA 1MAHA 5DLYA 3CBGA 3ONEA 4PZZA 1U0GA 1KO8A 4NU8X 4UTPA 4OMDA 1M8GA 2WVJA 1H0RA 1J49A 2GVDC 3NYRA 2PIAA 3EK2A 4UD6A 2MTBA 4WY5A 4XFKA 3ZZNA 2DXIA 1KC3A 4K6MA 5H3HA 1DIGA 5T4BA 3A3KA 1X1TA 3TIIA 3G2OA 4ZZ3A 4MH0R 4GAEA 4ZWNA 2YMLA 2JA1A 2M98A 4J2OA 4M60A 1BHSA 4N54A 5A3VA 1BGVA 3ZCSA 4EARA 4AKHA 2CXQA 2WJAA 4JASB 4YLGA 2C2WA 1TUBA 3IVGA 1C3OA 2L17A 3S2UA 3WQBA 1VYHA 1NWHA 4E4RA 2OWEA 1C8LA 1S2IA 3FLAA 4L75A 4U6NA 4Z8YA 3SHQA 3V9AA 1KF0A 3EBLA 4Q4LA 4HAYA 5LLTA 4YR7A 2OTCA 4V2IA 5LP6F 3H9GA 3FRJA 4JLWA 4F12A 4B74A 5I9BA 4LHYA 4XVUA 5K3FA 4BB5A 2HCJB 2OESA 1DQRA 3VSEA 1W0JA 4TV9F 2CJWA 2VJMA 3W9YA 3NP9A 3PJGA 5JLAA 4RD0A 1M2JA 4H35A 4PPGA 1NVXQ 2GFQA 3LRTA 4EW6A 4RCVA 2B8JA 2BDUA 3P1JA 3CGWA 4NMLA 2R8RA 3TB6A 4MKIA 3VPHA 1OU4A 4TMYA 3KQLA 1QFXA 2XLCA 3WLSA 3FPGA 1Q0RA 4U0JA 3VTZA 2OCBA 4EJSC 5I7FA 2QPAA 3H6GA 3TQFA 3I1JA 4FNAA 3FSJX 3H3XA 1P4HA 3SDBA 3L0BA 1COZA 1R6AA 2BSQA 4I9UA 2IZ1A 2WLSA 3FLEA 1M72A 1PDVA 1MENA 2VTVA 2WJ4A 3DOIA 4L16A 4OSPA 1D9XA 4R4JA 2ZBGA 1ZM4A 4E15A 3OIWA 3HKDB 5HKOA 1NKTA 2NVBA 3OHMA 3W5IA 1KI9A 3O8QA 1WXFA 4OKSA 5IUKC 2R6DA 3Q72A 1U7OA 2C04A 1YMVA 3H5LA 2OL4A 1E6MA 3HU1A 3I3SR 1R4MA 2B35A 2RGXA 3CLTD 4JNKA 5YASA 1IOZA 1FVXA 1KEUA 1QHXA 2QJWA 1U0SY 4DMHA 1M2OA 5C5CA 3AR5A 4X6LA 3PQ8A 1WTAA 1XEAA 2XADA 3L0ZA 1OW3B 2GXQA 5CJ2A 1KK1A 3IQZA 4DY4A 1NU6A 1M8KA 3E23A 3DVAA 4YC7A 4WH0A 2BFBA 3B38A 3GZJA 2JAQA 1ZVQA 2O0KA 2OQRA 1N7JA 3S2EA 5ITVA 4TTPA 4M83A 4NDNE 1CRLA 4NEGA 2K7ZA 4HD8A 2CFOA 4LMBA 5KYWA 3BFJA 3K9WA 5DNEA 5BY2A 4JEUA 4RYLA 4Q4AB 2YXLA 3RLFA 2C61A 3GGJA 4U4AA 5AQEA 4LC0A 3RVMA 4ZYVA 5EWLA 5K8LA 1U2GC 3L6UA 1WETA 3B1KA 3A4LA 3FHTA 3DKPA 1JHOA 2FMTA 1WKBA 1GCAA 1NSFA 3WWDA 2C7PA 5LU8A 3EZXA 4ZV4A 5BN3B 4JOCA 1DAFA 5DH9A 1F8UA 1VSUA 3RVSA 2IEAA 1O5OA 4I1YA 5B7PA 4XCVA 4CYMA 2GUGA 1NULA 1A4IA 2HCTA 4QYTA 2FFJA 3ZWDA 3BFVA 5L53A 5JAPA 3LY9A 3AKDA 4LY0A 5JMOA 2Y4NA 1V5IA 3FOEC 3VYWA 1NLYA 4K26A 1N0WA 4CLXA 1G3MA 1IBLB 1NMXA 3ICQB 4JHXA 3CEJA 3UOGA 1ISFA 3D6JA 2O07A 2B5WA 5E9JA 4ZCMA 4CKYA 2P79A 3KZMA 4QRIA 4M9ZA 5BP7A 2DFLA 4R1QA 5A5VA 4CEJA 2ZS8A 1RRMA 1Y1SA 1T0UA 5E8JA 5G40A 2JHPA 3MB8A 1SPBS 3HCEA 5REQA 1KI2A 2PMBA 2ZIXB 3HWSA 2B21A 4RZUA 1P72A 3V2GA 1VPEA 1S3GA 3FR7A 4L08A 4A9AA 4I81A 2VAXA 3ASVA 3EGOA 4LZJA 3QPWA 1TUBB 3QI2A 2IYOA 2P6NA 3ICCA 4B09A 1AHNA 1ZVJA 3UV6A 2HEIA 1OLUA 2FFHA 2CJFA 4UBKA 4IRMA 3CPJB 3BL6A 3EAFA 1RAIA 4ZVUA 1K9SA 2W4MA 4IUYA 3T7SA 1JMVA 2VJOA 3MWDA 2AMYA 1NXTA 3C24A 3L0SA 4EPWA 4FC6A 2IIPA 4C6HA 2WPDA 4EG0A 2IP2A 4KKXB 1FUEA 3QVMA 2HMSA 1TUGA 1QKIA 4LDAA 1Z63A 2XCLA 3ZV7A 1OJ7A 3K5IA 3DQPA 1T8RA 1QF6A 3A37A 4GZ3A 3MQ4A 5E1DA 1KJZA 3NGLA 1WMAA 4JZKA 5I9TA 3ANNA 3JD0A 2ZVQX 3DZKA 3I45A 5JWOA 3R3YA 1RQ7A 4WBNB 5LWQA 5J23A 1P7ZA 4LJ8A 1ZN2A 5IC6A 2D0OB 2H51A 2Y1FA 4DR1B 1CJMA 2E4WA 3IUEA 5ILQA 5C1PA 5FTLA 4HN4B 3CH6A 4IHJB 3RC8A 4TMFA 3RVBA 2J7PA 1T0JB 4EM6A 1QAMA 4NBSA 1H8HD 3DDHA 4F46A 1OXBB 1JBEA 5IEJA 3CF4A 2Y1LA 2JD2A 3T7JA 4EAAA 1KWKA 1C0IA 1HO3A 2VKQA 1Z17A 2GZDA 2ZSFA 4FGWA 4NFLA 1QFJA 3EUFA 3VMFA 3GLRA 1TM5E 3PQEA 4OXIA 2PZFA 1KY4A 2TMGA 3GRVA 4RHUA 4YRSA 4FUTA 3TYXA 4HEHA 2CGEA 1T3HA 2Q45A 1BAPA 3FUUA 2ZWOA 4Y8VA 4BJ6A 2EJUA 1R88A 1KVRA 3W90A 1MW8X 5ALYA 3ZJ5A 4DTIA 1GEGA 3EWNA 3ZDCA 5JC8A 1FYDA 1Z4NA 3M33A 4QBKA 2A58A 1ZONA 8ADHA 4N39A 3C48A 4OP3A 4KRFA 3TTXA 4WEOA 1UOQA 4DJEC 1BWQA 3A27A 1U2TA 1ECCA 2R6JA 2WY2D 5HHTA 2QL5A 1R9MA 3PWTA 4RUKA 2A35A 4MARA 4U3JB 3CKMA 2XT0A 5EZYB 5FXMA 3HXMA 3HZOA 3NR2A 3IPLA 5B1SA 3DLIA 1RWXA 2Q9BA 4FU0A 5HXAA 4OHKA 3DBLB 4P3OA 2ZXEA 2R4TA 3C98A 2EW8A 2F9FA 3R7DA 3DSRA 2IV7A 4YCNA 2PGIA 3BZWA 3PEUA 1VE9A 3SJ7A 3W1EA 5KBYA 5FPPA 4ASUA 2PAAA 4O2RA 1WD5A 5CFOA 2WM8A 1YHNA 3LA6A 2IY9A 1VJ1A 4HDOB 4RACA 5FBHA 5BYBA 2IUYA 3EWAA 2X7JA 1Q1QA 2EKPA 3HE3A 5EEGA 4QWWA 5EXDA 5JAQA 5LOVB 3S55A 5LOVF 1ZCZA 1A9XA 2ZWIA 4OOFA 4BO8A 4IJKA 4HH4A 2IYUA 3TL2A 1FX1A 2X23A 2IYTA 4UM5A 3B3JA 1O1YA 4P7JA 4TMTA 3N8GA 4L95C 5AI8A 4D80A 4XLTA 5I9MA 4WXMA 2V9ZA 2DUMA 2GZHA 4XYGA 5IASA 2GN9A 4ARZB 1IY8A 1AQUA 5DWDA 1BDBA 2F43A 4EPXA 2J07A 4NYJQ 3VAYA 1WP4A 1VFPA 2IVZA 1Z34A 2H00A 2ZI3A 3GRKA 1B2RA 4DBLC 2J09A 2YJGA 1WHTA 2J7KA 1JWAB 1T91A 4LF7B 1VCMA 2JPDA 3JYNA 4Y2YA 4CKBA 4O29A 3L8CA 3DEAA 4F38A 4CETA 4WCVA 4KJXA 4TKZA 4X20B 4OHWA 4HDNB 1O95C 2I76A 2HT6A 2YJ6A 4ODIA 2MSCB 3OFSA 1Z5PA 2B9EA 4FFPA 1O0BA 3RRBA 4XLLA 5JAIA 3SOPA 3MJHA 1WM1A 4OHUA 2QE6A 3ZNNA 4D79A 2WT8A 4Q39A 5CDFE 1J0EA 1E0JA 2JAUA 3K6RA 4AYTA 1YUBA 3NRJA 4OY3A 4KLCA 1CDOA 4Q3NA 2BI8A 4MQEB 3QTLA 2O6HA 3IKVA 4X61A 4AY2A 4ND2A 5AW7A 1YL6A 2HA0A 1VHWA 3K32A 4DA9A 1AKTA 4Y2JA 4DAEA 3RGWS 4KITB 4FKMA 3CVYA 5TS3A 4JSTA 1D2MA 4CLRA 3LT1A 3L5KA 2ODEA 4E22A 1HYHA 1Y98A 1V48A 1XT6A 2AF3C 2YOHA 1SEPA 3DWIA 3NGXA 5GPBA 1BCRB 5C7IO 2QZPA 1SBCA 5KHLB 3IALA 5BYKA 1W4BA 1AZSC 2J3EA 3HVKA 3NHZA 1LPOA 4LDNA 5AVVA 4X8OA 3Q6IA 3IAAA 3DC7A 1J5EB 3WLJA 1ZCFA 5FPYA 1Y6RA 4IZHA 2FW7A 2RK6A 3OLCX 4RA9A 4S1VA 2JHCA 4U7TB 1SVLA 4G8CA 1FQWA 1QRAA 1RZRA 3IEVA 5FA6A 3U3DA 2B4YA 1KY3A 2YV4A 4B4WA 4N0QA 2QD2A 2C9CA 1VYTA 3ZDBA 3ORSA 5DM1A 1EH5A