4J0IA

Tannin acyl hydrolase in complex with 3,4-dihydroxybenzoate
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
470
structure length
452
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
total genus 165
structure length 452
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0iA00
3H04A 1UWCA 3VVLA 5K3CA 5K3AA 5AIAA 3BF7A 4PW0A 4DNOA 5C8ZA 1H2WA 5T4BA 3O0DA 3IURA 4IHAA 4B9EA 3N0TA 5JAOA 2WIJA 5IVHA 3WJ2A 5FOQA 1KU6A 4Q05A 3WKCA 2WJ4A 2HFKA 3S8YA 4H7IA 3I28A 4G4JA 1P0PA 4Q82A 3QMMA 1WM1A 3WK9A 1XZCA 3CN7A 2QT9A 2FJPA 5LZ2A 4WFKA 3S2ZA 4MYDA 3PDCA 1AKNA 1YAJA 3MGAA 4RNCA 4B83A 4HXGA 4J0HA 2H7YA 4I19A 5CT9A 2ZJ7A 5KREA 5IH7A 1GQRA 5CXXA 3A70A 1UOQA 4DIUA 3R0VA 2FX5A 2OCGA 3WZMA 1JU4A 2Y6UA 1P0MA 2VJAA 3M82A 2J3QA 1CUIA 4Y2TA 3AIMA 4AQDA 1TIBA 2GYVA 1QIIA 3FAKA 3ESCA 3KOOA 4JYMA 2QKYA 2Z8ZA 4N5IX 4KJXA 4W1SA 1XRNA 2HA0A 1IZ8A 2O2IA 3L1HA 3C6ZA 2RI6A 1Y7IA 3QPCA 4YX9A 3R3WA 1QLWA 2QRUA 1FFEA 5LZ4A 4Y2VA 3WL6A 1UKBA 5ALYA 1LPPA 1LBTA 1KEZA 3O4GA 1FSSA 1ZIXA 4GXNA 5JAPA 3ZWQA 3PUIA 1KU0A 3N2ZB 1VXRA 1JT2A 4P93A 3HJUA 3WL8A 4OU4A 1QE3A 3DLTA 1ODCA 1VZ3A 4W1RA 4CG3A 1UOPA 3VISA 4OCZA 5FKJA 1E8NA 1C7IA 4UFNA 1CUJA 4BRSA 2BUCA 2JGLA 4FHZA 5LZ8A 3FCYA 4J03A 4ETWA 2C58A 3GA7A 1O6FA 2HA5A 4U2CA 2C5FA 5JANA 5JATA 2EDCA 4EZIA 1E66A 4G9GA 3G7NA 2XUPA 3H2JA 3HZOA 1MX1A 1CUXA 3BDVA 1JU3A 3BIXA 3QMVA 5JYCA 3V1KA 4YPVA 2OXEA 1I6WA 4X94A 2NW6A 5DLPA 1B41A 2PX6A 4N8DA 1XZKA 4KAAA 1MAAA 1ODTC 4HS9A 2QR5A 3O4JA 3NGMA 2RAUA 2XUIA 4UBJA 1QIHA 1UKAA 1TRHA 1Q84A 1CEXA 4XJVA 2ACEA 1E8DA 1J07A 3M81A 4AZ3A 1HQDA 2C4HA 2C0PA 3GFFA 2R8BA 2WLSA 4RPCA 1CQZA 3DOHA 4F0JA 1XROA 4DMFA 2XB6A 1ACLA 2JBWA 2JGIA 4GDMA 2H1IA 1LPAB 4K6GA 4OPMA 3PFCA 3DKRA 4M0EA 3F8SA 3W9UA 3PI6A 3WKDA 4EBBA 4BCDA 5D6OA 4H7KA 2JF0A 4DYHA 3HC7A 4GI1A 3DD5A 3UMJA 3QPAA 2G5TA 2JGKA 3HRHA 4G4GA 3G9XA 4LKOA 4G1FA 1JI3A 4X95A 4GEGA 2OGSA 2X5XA 2WG1A 2X76A 4W63A 4ZXFA 4E11A 5HF5A 2XUGA 4O08A 4HTAA 4PSUA 5ALXA 4B0OA 3BJMA 3KD2A 3DOIA 2D5LA 2JGMA 3G9ZA 1X2EA 1ORWA 4JNCA 2XUAA 3FYTA 1ZI6A 5FV4A 3GBSA 3UUEA 2GBCA 1GT6A 1N5RA 3B12A 2VJCA 2QJRA 3AINA 2VA9A 2W22A 1T2NA 1ETHA 4FNGA 2QXUA 1FJ2A 1QIMA 5LZ5A 2CKMA 5C8XA 4AMYA 1ZJ4A 3TEJA 1XZBA 1LPOA 1QOZA 1P0QA 5D3KA 4KE6A 3WK7A 5LLSA 5AP9A 3R40A 4OU5A 1WB5A 2Y2UA 4DMCA 5LKRA 4LXHA 5K5EA 2H7CA 1DINA 5CT5A 3ILSA 2WFMA 3ZLVA 5I9IA 3HEAA 3WWPA 3NWOA 5DJ5A 3DDUA 3WK5A 5HKAA 1ZICA 4DGQA 4MXDA 3LIPA 3GZJA 2WILA 3W06A 2QM0A 3I6ZA 4DSAA 1TK3A 1IZ7A 3C6XA 3BF8A 5AHXA 1IUNA 2I3DA 3PF9A 3JWEA 1R9MA 1ZJ5A 3F97A 5AKIA 3H17A 2AJBA 4AO6A 1GPNA 4RE6A 4G8DA 2WIFA 2OGTA 1WOMA 4FNMA 5CURA 4AZ0A 2BKLA 5BWCA 1HLGA 4XVCA 4FBLA 3H0CA 2BGNA 3IB3A 2OCIA 4WFIA 1BN6A 3WL5A 3NUZA 2FUKA 2JEZA 3T4UA 5AK6A 1P0IA 4DMHA 2WQZA 3K2IA 1W76A 3I2GA 3QPDA 4BTVA 5ALOA 4C4XA 2WJ6A 2HADA 3D5EA 1IMJA 1TCCA 1LGYA 5JAHA 1BROA 3GUUA 3LS2A 4J0IA 2XUOA 5FDFA 3BJRA 3V9AA 4U2BA 1CPYA 2PSDA 1DQZA 5ALFA 3MUNA 2GBFA 1ZD5A 5AKGA 1AMNA 4CG2A 3I2JA 4BTLA 4UBMA 4BDTA 4J7AA 3IUQA 4AB1A 4QDXA 1OCEA 2DQYA 4C6HA 3AUKA 3E3AA 2JGFA 5HZGA 1ORVA 2WHRA 2XQKA 4QWWA 5HFNA 1XRMA 1AZWA 2ROQA 3FSGA 1MO2A 3V1NA 3DS8A 2XQFA 5JADA 1MN6A 3G0IA 1QIEA 4KYVA 1XZLA 1QO9A 1K5PA 3WKAA 1DT3A 5JD4A 1GZ7A 2CZQA 1HPLA 1B6GA 2V97A 3QZUA 3D59A 2UZ0A 1N8SA 1BEZA 1EB9A 2O2HA 2AJDA 4TPKA 2XQIA 2WM2A 3WWDA 2YYSA 1LPBB 3R3VA 5ALDA 2WIGA 3U1TA 1MJ5A 3E0XA 3W9BA 3MVEA 4GW3A 5AM2A 3FYUA 4B85A 2XMDA 4C01A 3BIWA 1F0PA 1MU0A 4U2EA 2JEYA 4GLBA 3KWFA 4ROTA 3ZPXA 2O7VA 5JASA 3NOXA 4LYDA 4FMPA 2PKYX 1UOOA 3PE6A 2XI4A 5JD5A 4EB0A 2LIPA 3AJAA 2VTVA 1WB6A 5EHNA 3C6BA 3LP5A 5E4YA 5T4EA 2WHPB 5LIPA 5AKJA 1QONA 1G66A 4FFWA 5HF6A 5CTAA 3CCCA 2XT0A 5EGNA 3I1IA 2ZJ6A 2WUDA 5IVKA 5AOCA 1AQLA 1MAHA 3FYUB 4QLAA 1JFRA 3FSGD 5EFZA 3VJMA 4QNNA 1HL7A 4BC1A 5AI8A 1XLVA 1W4LA 4UHBA 1ZD2P 2CBGA 1T4MA 4ARAA 2QUBA 3OG9A 2VAVA 2VSQA 4G9EA 5HK9A 1CFJA 3W04A 4UBKA 2HHAA 2WU4A 2V9ZA 1A8QA 1TKRA 1IUPA 4H35A 5LYYA 4DTCA 1AUOA 4UFPA 2C0QA 2O7RA 3SC2A 1L7AA 4CIAA 1QIKA 1WHTA 5DWDA 3H2GA 1LPMA 1GKKA 1NU8A 1UT6A 1YB7A 5A62A 2GZRA 4UHHA 4WY8A 4X97A 4BP8A 3ICVA 5J3JA 3D2AA 4A16A 4IH9A 2B4KA 1THGA 4WDQA 3DJYA 1XZMA 2BGRA 2ES4A 2OAEA 5AOAA 3WKBA 1A7UA 1QZ3A 3WL7A 2OQIA 2HA7A 1MPXA 3OTQA 1QJ4A 4CG1A 4X93A 1EDBA 2EEPA 4FLFA 2XQGA 4U2GA 4BVJA 3IUMA 5EHXA 1CUWA 4DNQA 2VT7A 1MX5A 2QOEA 3C6YA 4X85A 3X3HA 2YH2A 1ZD4A 3OURA 1FFDA 2QMQA 2Y6VA 4AO8A 1ZI8A 2H9YA 4NMWA 3D7RA 4Q34A 3EQ7A 4Y9SA 2WFZA 1AURA 3EBLA 1LBSA 1EK1A 2IIVA 5ALEA 1ISPA 1XRPA 1YS1X 4Z49A 5JIBA 4NS4A 1XRLA 3AFIA 5T4HA 3RM3A 4MEBA 3WMRA 4KACA 2I03A 4QE3A 4KRXA 3WIOA 1JKMA 1VZ2A 3STYA 2WSLA 1JMYA 4PO3X 4Y2RA 4UFOA 4TVKA 5AKYA 3H2HA 3G0DA 4BE4A 1H22A 5HFAA 2VJDA 2CMFA 2XE4A 2B9VA 5EI5A 1VKHA 4B84A 1R88A 1XZDA 3STWA 2PPLA 5K3FB 4FLMA 1CUGA 2J3DA 4BBZA 1ZIYA 1G5FA 2DSNA 2HRQA 3FYUC 5F4ZA 1ZGCA 3WK8A 1LZKA 2CUTA 4IH4A 1YB6A 3STUA 5CH8A 5FRDA 4PF1A 1QGED 1XRRA 3TJMA 5ALNA 4AMZA 1OXMA 3BWXA 1CUDA 1XZHA 1CUSA 4H77A 1HDEA 4QEKA 1BN7A 2Z3ZA 5CT6A 3A6ZA 1ZOIA 2XMSA 2OLEA 4ZWNA 1EB8A 5FPQA 5DNVA 5LZ9A 3EQ8A 2W6CX 1BRTA 4DNFA 2QZPA 5CW2A 3T52A 5A6VA 3WQHA 3WWOA 4U2DA 2JGEA 1EXWA 4BRZA 1W75A 5IVDA 4BB0A 3ZV7A 4C88A 1CUZA 2RHTA 5CH5A 1LLFA 2WUFA 5AIBA 5ALKA 2WG2A 3FCXA 5KBYA 1PV1A 2BUAA 3O9MA 3IUNA 3W05A 5AKHA 1XZAA 1QFSA 5JARA 2ZSIA 1XRQA 2XUFA 2CJPA 1UK8A 3C5WP 4BAZA 1CUFA 3V1LA 4K6KA 3ESDA 4OB6A 1DWPA 4G5XA 2WG0A 5C8VA 3FVTA 3OM8A 2ORYA 1JMKC 3H2KA 3L1IA 1U8EA 2E3JA 3RARA 1TCBA 4P08A 1E3QA 4DLNA 3WI7A 1UXOA 5ALTA 3DCNA 3QYJA 4GHWA 1WHSA 1BU8A 4FFVA 1E8MA 3H18A 3KSRA 2RONA 3OPMA 1XQYA 2XUQA 1QFMA 4Y2UA 2DQZA 1GQSA 3O4HA 1DTEA 5AOBA 2V96A 5A7FA 4NZZA 2QUAA 3D3NA 1H2ZA 5EIAA 1K8QA 1R3DA 4PSDA 1EK2A 1EA5A 2PSJA 1YA4A 2WFLB 5HCUA 3R3YA 3PFBA 1L7RA 2ZJFA 4IO0A 3O95A 4J0KA 1QTRA 3VKFA 1CR6A 3LCRA 2JGJA 2B20A 4U2FA 4QWMA 3Q0TA 3LIIA 5E4JA 1SC9A 2XUDA 3W2TA 5DTJA 4ZI5A 2ACKA 2DHCA 4YASA 1Q83A 1Z68A 2HU8A 3E1GA 1C4XA 5SYMA 1VE7A 3IIIA 2CEKA 2PUJA 5AM5A 3RKSA 2JIDA 3G0BA 4N8EA 5A2GA 1QIGA 4Y2QA 2YXPX 3C70A 1VXOA 1WB4A 3I1YA 3QH4A 4OYLA 5AM3A 2Z8XA 5ALRA 1THTA 3AILA 3IA2A 4X92A 2AJ8A 3I2HA 3C43A 5ALPA 1DWOA 4ZV7A 4AX4A 1XQXA 2XMZA 4ITVA 2BFNA 3STXA 1JJFA 4HRYA 4LXIA 1JJBA 3WZLA 2XLBA 2VJBA 1K6EA 3FBWA 4Y2YA 4DSZA 5ALUA 3I6MA 5HF9A 4I4CA 5E4TA 1QTIA 1WPXA 5CXUA 1DU4A 1CVLA 4Y2JA 3KXPA 4QDZA 4S0XA 1W52X 1XZJA 3G9UA 5CBKA 5LKAA 1S8OA 2HA6A 3TRDA 4IH1A 1R1DA 4CCWA 4E46A 5BV7A 4FDMA 4J0CA 1UKCA 2WUEA 4MEAA 1M33A 4UPDA 4PSCA 5I7UA 2I78A 5D3ZA 4BC0A 4BZWA 3O9VA 4X71A 3ANTA 1EI9A 2WKWA 4H18A 2WHPA 4I3FA 3FOBA 4HXEB 3H2IA 3HI4A 1F6WA 4B7ZA 1NX9A 1SFRA 4KAFA 5HK8A 1VE6A 1QIFA 2XUKA 3WJ1A 5AICA 4BCBA 5AI4A 2X8BA 3B5EA 3R3XA 4PNZA 1WCYA 4KE9A 2YASA 2PU5A 4AO7A 3M83A 3WWEA 5KWJA 5T4FA 3C45A 3ESBA 4XX1A 5K3DA 5AI9A 5ISMA 4K5QA 1QO7A 4OB7A 1XZIA 4EUSA 3G8YA 3O4IA 2ZYRA 2ZVDA 2DFPA 3VDXA 1AGYA 4B82A 1XQVA 3WIBA 5AM1A 5DYTA 3FLAA 2GYWA 2O2GA 2DHDA 1RYYA 2QXTA 4HRXA 3C5VA 4Q3OA 2RHWA 1EX9A 4MWSA 3QITA 1UK7A 2XMQA 4BCCA 5DNWA 1R9NA 4L3WA 3KDAA 3DQZA 5AO9A 3FLBA 4OD0A 4Q3LA 1CUCA 4F60A 1WPRA 1XZEA 1YAHA 2IITA 2XQJA 1IVYA 5KWIA 2HA3A 2AXEA 2XMCA 1CUAA 5FXMA 1YS2X 1PJAA 3SK0A 5JD6A 1F8UA 2GBGA 2XMBA 4JUIA 4IQ4A 5EIHA 1BEEA 2CB9A 3C8DA 4MYSA 2WTNA 5AK3A 5AKEA 4JYPA 3E4DA 3OOSA 4Y2PA 1JJIA 4C4ZA 2GYUA 1LPSA 1USWA 3AIOA 5HQ3A 2VAXA 1YA8A 4MQLA 4V2IA 4BVKA 5YASA 4EY7A 1U4NA 5D7BA 1L7QA 2VT6A 4OB8A 4KE8A 2Z3WA 4CI9A 4LIPD 4QA9A 3JW8A 1VLQA 3G9TA 4WY5A 1R4ZA 5ALZA 5ALJA 3L1JA 2OGZA 5E2IA 5IKXA 3PUHA 3WLAA 5DYWA 1GGVA 2WUGA 4B6GA 4B80A 1NU6A 2K2QB 4AN1A 2Z5GA 2WHQA 2HIHA 3I2KA 3HSSA 2AJCA 4L0CA 1CRLA 4A23A 3I2FA 1X70A 4H7EA 4QDOA 4FBMA 2QVBA 5JZSA 1A8UA 4DNPA 5ALVA 1BCRA 1CQWA 1AX9A 4JH0A 4UBIA 5K3FA 5HQ3B 3H1AA 3FWHA 2HU7A 2BJHA 4EHBA 1YR2A 4UHDA 1XQWA 1AC5A 2PUHA 4N8SA 5AKLA 1CV2A 2FJ0A 4BATA 3DL4A 4BYMA 3A2NA 5C81A 1ZGBA 1BE0A 5K3BA 4C87A 5CH3A 1FFCA 5CRIA 2G4LA 3RK4A 3K6KA 5EIEA 1N5MA 3IUJA 4W1QA 3VJKA 3HABA 1Q0ZA 2DR0A 1LPNA 4ZV9A 1DT5A 5DYYA 2AJLI 4WJLA 3DL7A 4MJ3A 2PM8A 3C8HA 4MWTA 1SCQA 3D2BA 5A71A 1VJ5A 2PSFA 4UHCA 4GBGA 2D0DA 3QVMA 1UK6A 4E14A 4B9AA 3PF8A 4M0FA 4XWGA 4E15A 5H3HA 3ANSA 2XMGA 1ZI9A 4QZVA 2ECFA 5ALMA 1DX6A 3BE8A 1IUOA 4FWBA 5ALHA 5BWBA 5LP1A 1GXSA 2BCEA 3STVA 1MNAA 4KR0A 3GELA 3PICA 5HKBA 4QLOA 3ZLTA 1XFDA 5AM4A 2I3ZA 3QMWA 1EHYA 3VVMA 4Y7DA 2QTBA 4Y2SA 2Y1KA 1D07A 4OUKX 2WIKA 3F98A 2PU7A 3JYHA 3QM1A 3HYSA 1G4HA 5CT8A 1CUYA 5AK5A 5AKZA 3DNMA 1EVEA 4RGYA 1EDDA 4GWLA 4QDUA 3BDIA 1XZFA 4BE9A 1TAHA 2WU3A 2XMRA 2HFJA 5A7GA 4BAUA 5JAUA 4P9NA 5DTIA 3AIKA 3G0GA 1FFAA 3IULA 4J0JA 3WK4A 3V1MA 1CUBA 5ALLA 1Y7HA 3ICWA 3WWCA 5ALWA 3I6YA 1XKLA 1EDEA 3B3QA 2EDAA 4D9JA 3F9CA 4G4IA 4X90A 4YK7A 4RE5A 5CMLA 5FP0A 1G42A 3CN9A 1EINA 1MNQA 2WFLA 3AZQA 4OYYA 4EY4A 1UFOA 1K63A 4N5HX 4UHEA 2G5PA 5JZ9A 4TGLA 1A88A 4H7HA 5AI0A 4JEIA 2G63A 3R41A 3FVRA 4DMKA 1O6GA 1LNSA 1ODSA 2PBLA 2R11A 4HXFB 5AI6A 1N1MA 1MX9A 3D4LA 4X00A 4M0MA 2QS9A 3H1BA 3HLKA 4H0CA 4CCYA 3BL8A 3ED1A 2PVSA 5BOVA 4F21A 3HXKA 5ALIA 5AH0A 3FNBA 4BP9A 1U2EA 2PSEA 5LZ7A 3YASA 1K4YA 2ZYIA 1DX4A 5AJHA 1RP1A 4NVRA 2BAGA 1J06A 1C7JA 4WCVA 3AZOA 1BCSA 5FUMA 1E89A 4LHEA 3GROA 4FOLA 4UBLA 1LZLA 2DHEA 1EH5A 2HM7A 2HDWA 1W6RA 2RGUA 4H7DA 2OCKA 2PSHA 1XKTA 2B61A 3DYIA 2BUBA 2WTMA 3R3ZA 2VQ6A 4OSEA 5A7HA 4LYEA 4CCYB 1W1IA 2QJWA 1U65A 3STTA 4X6YA 3UUFA 4INZA 4XIIA 1R50A 5EHQA 5ALGA 2OPHA 4QDTA 4UHFA 4G8BA 3D2CA 3WKEA 3U0VA 4HZGA 4L72A 4L9AA 7YASA 4J0DA 3C87A 3RLIA 1EVQA 4X3CA 4FTWA 1QIDA 1GPLA 3A2LA 4EA6A 3DEAA 3CXUA 5AK4A 4C89A 5ALSA 1CUUA 1Y37A 2ZSHA 3VXKA 4B0PA 2GBIA 5ALQA 4BZZA 2VEOA 2HA2A 3WA7A 5ESRA 4ZREA 2OQVA 2ONCA 3P2MA 3VJLA 1E5TA 1H2XA 4KE7A 3ZLUA 1VA5A 3MUOA 3DKKA 2XDWA 4PV7A 4X6XA 2Y2VA 1RWQA 2VF2A 4KRYA 4WFJA 3KWJA 1YCDA 2V98A 2VATA 3TGLA 2OG1A 2HA4A 2XLCA 3M3DA 3WK6A 4X7BA 1GPKA 4W1PA 2OAGA 4X6UA 1QIJA 4B81A 1OILA 1UZAA 3Q8WA 1SCIA 1VA4A 2Q0XA 5AKXA 4MQMA 4AN0A 3EQ9A 2ZYSA 4K6HA 1UK9A 1PFQA 3IVMA 5EHZA 3H19A 2C5GA 1TQHA 1XLUA 4HVTA 5AI5A 5I8PA 5K3EA 1XZGA 4BAGA 2IX9A 5DNUA 3CCBA 4W9RA 3ESAA 1DWQA 4EY5A 4X91A 5AM0A 1CUEA 3WYDA 1F0NA 1SOMA 3F67A 1VOTA 4Y2XA 2OCLA 1YASA 3G0CA 5FPPA 2J4CA 3DYVA 3V48A 4AXBA 1CUHA 3D0KA 3R3UA 1YSCA 4Q3KA 4WDRA 2P8SA 4CFSA 4C4YA 1CUVA 3AZPA 3HACA 4A5SA 4EY8A 2HRRA 4P92A 3OC0A 4PQEA 5JZBA 2H7XA 5SYNA 1J1IA 4BVLA 2WIDA 3WA6A 4H7FA 3BXPA 5FLKA 2J4FA 3EIOA 4CIBA 3K9BA 4FKBA 2GZSA 1BS9A 4KEAA 5CT4A 4KAJA 3WYNA 3FLEA 1SCKA 4F5ZA 1ACJA 1J2EA 3SWWA 3ZI7A 1GKLA 1H2YA 2WJ3A 2C7BA 4HAIA 5C7YA 4EY6A 4H7JA 5JALA 3IBTA 3SX4A 6YASA 1DQYA 2HU5A 1MTZA 1X2BA 1HKHA 4UBOA 3LLCA 1CLEA 4ZGBA 5IVIA 4UUQA 1H23A 4FLEA 2HL6A 2XUHA 4Q1VA 4J0GA 4UBNA 3F96A 2RIPA 4ARBA 1ZD3A 3QBJA 1FFBA 4J3JA 1Q0RA 4G8CA 3I2IA 3A2MA 4GECA 4DM7A 1CIJA 3IDAA 1HBJA 5AKKA 1MT3A 3EF3A 4LXGA 2DCMA 2XUJA 2ZYHA 1TCAA 5HF8A 4BDSA 2PL5A 1XLWA 4K2AA 4ZRDA 1A8SA 3G02A
chains in the Genus database with same CATH superfamily
3AF3A 2IDMA 4LTNA 3VVLA 1A8HA 4JL6A 4IY1A 2EXXA 3DNPA 5K3CA 3UWOA 3QPWA 5AIAA 1T4DA 2RHBA 5ES4B 1PDWA 2ZRNA 4PW0A 3GLQA 3O0DA 4HQLA 1YMVA 3S2YA 3EXG1 4TQ9A 5JCXA 2Q1XA 2PWPA 2ONZA 1K3UB 4BVGA 4QC2A 5BNWA 2V4UA 3R0JA 1NPDA 3ENVA 2GBPA 2J0QA 3PT5A 1OVGA 2BMAA 1QP8A 2ADFA 3DP7A 4D79A 4AU1A 6LDHA 1PT5A 1YDFA 1K06A 2BMVA 2UZ3A 3ANXA 4EHIA 2ZBVA 2DQ4A 3A11A 1U31A 4PLVA 2ZIEA 5JQGB 3ZVNA 2VP9A 1YCHA 4H08A 4AC9A 4I2NA 4MVJA 2P5SA 3VHLB 2ZDQA 2D5IA 1ESMA 2H4XA 1VL5A 2WJ4A 1J42A 2AG8A 4RPGA 5IZ4A 2X1LA 1AZSC 2G82A 2AEEA 3EASA 2E49A 2O0KA 5KIAA 1N7JA 1R8SA 3I28A 5E6RA 1P0PA 3KKKA 4Q82A 2O5EA 5BWMA 4TYMA 3WZ2A 3TAUA 2XGOA 1CZKA 2OXCA 2B4QA 3GAAA 4XJTA 3AX6A 1B43A 3NALA 3N6RA 4TRRA 2IHVA 4RH1A 5CU7A 4E1BA 1JSLA 1XZCA 3CN7A 5FFFA 4FFLA 4NAUA 1YZ3A 1L4MA 2RCNA 4R3UC 4ZA2A 1TVMA 3LY5A 2B8EA 1EFVB 2Z6VA 1X6VA 4D4IA 4IMJB 4YBRA 2MYUA 1IWPB 5HX7A 1OZHA 3OWOA 4J2OA 4KBYA 1HORA 3N7UA 1CEQA 4B3DA 4D7AA 4E21A 3MGAA 4I1IA 1IPFA 3U4QB 4BP3A 3ZE8A 4RD6A 5CT9A 4BU0A 4PZUA 4DKJA 3VR2A 2VDNB 3QNMA 2UUOA 1CY1A 1DNPA 3OQJA 4LXTA 2PE5A 2H0QA 1UXHA 5KYNA 3F3MA 3PNMA 5LMZA 2BGKA 1G4AE 1E7MA 1JIQA 2IP4A 1QJCA 3VNQA 4PG7A 1GO2A 2CNKA 2GH1A 1KQPA 3OE7A 1ATZA 3AMVA 4MRMA 2K2WA 2A9KA 2H2DA 1Y5RA 4H6XA 4CU5A 3EH1A 4AF6A 1PDOA 5GWXA 2BLNA 2B9EA 3OZSA 2J3QA 1FIUA 3X44A 4PVDA 1MRZA 2HCJB 2A1TR 4WCFB 3ZWYA 4H3KB 3RTBA 4M0LA 2Z95A 2PX5A 2WNIA 2ZUEA 2J5XA 2KS6A 4UCXA 1XKXA 5E6RB 1G3QA 3DM5A 5TPZA 5J2TA 3ESCA 2RGEA 3L93A 5C2JB 1GV0A 3JQGB 2YW9A 3Q1LA 3ADPA 1DKMA 1O57A 1WMBA 3I8XA 1BDMA 4KIUA 5HR5A 4KTTE 2VHWA 2IEDA 3OPVA 2QKYA 2ZETA 5EXTA 2IVZA 3SLRA 2JAXA 4KNWA 1ZVQA 4LJ5A 3AM4A 2GVZC 1SCJA 2PUAA 2O8CB 1CX9B 5TGDA 3GEDA 4QYXA 4UTPA 3K4HA 1NVVR 2O2IA 4BEJA 4R69A 4YX9A 4LS3A 1EFPB 5AW8A 1B93A 4O8CA 5KCZA 1JNXX 4D1YA 3FB1A 2I66A 3V8BA 4MGZR 2V7VA 3C7CB 3DZCA 3KYDB 2R7MA 2H08A 1UKBA 5AOVA 1F51E 1PWYE 1ZZEA 3WL6A 4DUGA 3VPSA 5ALYA 5B4UA 2P67A 4TTAA 2Y67A 4ZT6A 2QYTA 2GCGA 5CBPA 2VDVE 5ITZA 1FSSA 1LDMA 1T5TA 2I6FA 2VSXA 1VTKA 1XL1A 3RSFA 3ZCQA 4PIPA 3ZWQA 1YO6A 5DMXA 4MZXA 3AF4A 1QANA 1X80A 1NZFA 1VMIA 2JC3A 1SUBA 1KJZA 3ECSA 3AVYA 3RVSA 1TYCA 1TW3A 5FTMA 2FQ1A 2GJ4A 4LPKA 1KZYC 2YRXA 1M1UA 5FF9A 4P93A 3T1NA 3W1WA 5I4IA 1D2HA 3KV1A 1EE9A 1Z6GA 1KEEB 2CXOA 2DSTA 2Q07A 1CF2O 2ZI3A 3NVMB 3WBFA 3L4KA 1U0BB 1QKKA 4MEJA 3MINB 1U1IA 4S1PA 3FYHA 3R9XA 3KZCA 1E9SA 3K5WA 1XEAA 3TLYA 2Y4NA 1BVUA 2V6IA 4IF6A 3VSAA 3PQ8A 1ODCA 1LDEA 5IUNC 2EFEB 4W1RA 3L7IA 4CG3A 1ISHA 3HVRA 2H52A 3GHHA 5CIWA 3QFSA 1TUEA 1CUJA 1UINA 2DBQA 4M1OA 3S2SA 1DC5A 1HUQA 2BUCA 3AYXB 3AR9A 3KKNA 4FCTA 3BFPA 3EPPA 4U2KA 4ZK2A 3D6NB 4AJ2A 1I36A 1N6KA 4IUDS 3U62A 3B85A 1TYEB 2DU8A 2JL1A 3F5SA 4DLZA 2VTKA 1NQTA 2HA5A 1WEHA 3OMLA 1T9CA 5HCIA 3D7KA 1S8AA 3INYA 2B2CA 1KNXA 2Y9PB 4UASA 5G0VA 2Q5OA 2V6FA 3IJEB 4YRFA 2OPBA 3DE7X 3OD1A 2QDXA 4HGPA 3TTUA 3T3NA 3LW7A 5AVWA 3G8DA 5LU9A 4DLYA 3DO5A 4L5IA 2P4EA 1DC8A 3GZTB 1LSSA 1VHWA 4MVYA 5ITZB 4KQFA 1OWMA 4P3PA 5IJAA 5FIUA 1HX7A 4EG3A 1FPMA 1MX1A 1U94A 3GX1A 7GPBA 1SA0B 4JN6B 1AKTA 3BIXA 1Z6AA 3OQVA 4TL9A 3ZDXB 1C8VB 5DI3A 3A28A 5JYCA 3V4ZA 1GARA 1T9GR 4J9VA 3QKUA 2FDXA 4Q0MA 3JPWA 5HBGA 1I6WA 4UCFA 5IT5A 4UU7A 5KSPA 2EW2A 1Q95A 2YZNA 5KC8A 1H8ED 1XJCA 1EQUA 3HCAA 2OQ2A 1M1YA 3QW4B 5AR1A 3MWGA 1X1RA 2UZIR 2VLBA 4XCXA 2AUTA 3QYPA 3X0DA 5FYDA 4BN4A 1I1HA 4PRYA 2R0QC 1OT3A 3GF4A 4YQYA 4EA9A 2DXIA 2CCKA 1HF3A 1MAAA 3RIHA 4D9KA 3G17A 3MC1A 2QR5A 3RE1A 5KDOA 3AEUB 5TVGA 1I2AA 2RAUA 4C6TB 2BHRA 3L7YA 4RY8A 5E1MA 2I29A 2WF7A 1E9RA 3Q7IA 4NATA 5LQAA 3D1LA 5E9JA 1QHEA 1XRSB 2Z4RA 1EAMA 3EXEA 4CTOA 5IULC 3WGIA 3GCXA 3CMMA 1U5CA 5L3QB 3WS7A 1PGPA 2P75A 4AS1A 1UKAA 3ETLA 4DC0A 4LJRA 1E1QD 2MU1A 4BLTA 1TEXA 2ACEA 2P6MA 5FNVB 2AUNA 2QTLA 4L8VA 4RDHA 1J07A 3M81A 5JPCA 5TMPA 4RTPA 2FSIA 3ZJ5A 1MAVA 1HQDA 1E2HA 2C4HA 2PGXA 2C0PA 4OP2A 2UXDB 3U4HA 2LKCA 1G6HA 3I32A 4DA4A 2BJVA 2WLSA 5H82A 621PA 2PXAA 5CJ2A 3T4EA 2OQRA 3OJEA 3QVKA 1CQZA 1U9ZA 3WV4A 2VF7A 4INAA 1A9XA 1GPWB 1T2UA 5KHOC 3LV8A 1KVQA 1GCOA 1LWNA 1FU4A 3Q2OA 3WLEA 4ER5A 2JBWA 3H0KA 3RI3A 1QHXA 2H1IA 2MOKA 4GDMA 4OPMA 1MC5A 5AT1A 3PUYA 4EJ2A 3G7UA 2R6DA 1YTUA 4PY2A 3WB0A 4ZMRA 1E9FA 1RI4A 3P27A 5BUZA 2YYZA 3LDAA 2GAAA 4EBBA 4BNNA 5EEGA 1M1YB 1DFHA 4CG0A 1F2UA 5DW3A 1PWXA 2YJ4A 2FPSA 3EBPA 4YRJA 1J2UA 3B60A 3ZZTA 1JYFA 2HEIA 1HYEA 5D6OA 3REQA 4DADA 3HXPA 3CF0A 3TLKA 2JF0A 4CT0A 1NUPA 2C2ZA 3ABQB 3I39X 4E13A 2PH3A 2BRUA 1VHJA 2ZWAA 4IXWA 2F1RA 3HU5A 3LRTA 3EW7A 2NSYA 4G4GA 3QKTA 4U5QA 3G9XA 4WCFC 3RK1A 5CEEA 1EXVA 3GGCA 1NLYA 2XZOA 2VK8A 2D4AA 4GWKA 1SIWA 4OAQA 5K8VA 3R0QA 3SYMA 2OC4A 4G1FA 4GEGA 5AK0A 4C9BA 2OORC 2X5XA 2X76A 3OICA 2F64A 3PG5A 4MQEB 3TDMA 4W63A 4A8HA 4ARUA 3JARB 3EE6A 3Q72A 4AW9A 4CIVA 1IBLB 1FMFA 4KMRA 3RV4A 2FPIA 1HE8B 1T8TA 3DOIA 3KD2A 2JGMA 3P19A 4TVOA 5F7JA 1X2EA 1ND5A 3V00A 3RG8A 2VPXA 3FOCA 4MR7B 1FNNA 4XQCA 1SIOA 4ZYLA 4TQGA 1OWOA 4J07A 3TNDA 4EQ6A 3GBSA 3UUEA 4DQUA 5KTMA 1VSTA 1ZX1A 2CLSA 3KFLA 4F7DA 1XCBA 4GX5A 4K9NA 2LR0A 1SVOA 3OO1A 4YJHA 3W6NA 1YUMA 5LXTF 4BHTA 2GEUA 2WQ7A 2VJCA 3UFBA 5C1DA 3EZ2A 4XQ0A 4BFTA 4TSKA 3BN3A 4WGGA 4WZAB 2JLWA 3KO8A 1S4QA 4XD7D 1KJIA 2WE7A 5JSUA 5EUMA 2F8SA 1E99A 1ZVMA 1ZIDA 3OJXA 3CRMA 1D2CA 2W90A 2XTAA 3EG9B 3DHYA 4EITA 3EMDA 1E2PA 3TKAA 1MIHA 3BILA 1UBLS 3SJZA 1ZJ4A 2EWMA 3REQB 3ZNNA 2Z5VA 4CGYA 4D43A 2B1RA 3OZTA 1QOZA 1RPAA 1P0QA 3Q0EA 5D3KA 2ZR8A 2IYVA 5GTDA 3DONA 4IKOA 5LLSA 3MJVA 2L0XA 1L5SA 3COZA 1EX6A 1NBAA 3R40A 1G18A 5G4LA 4IMIB 4TROA 4TWAA 2QL7A 3SF8B 1ILEA 4DMCA 4X1OA 1K5DA 3BZUA 1DINA 3T4XA 4Z3DA 1GZ6A 3ZLVA 5FTJA 4TXHA 1L4EA 3WC4A 3ELBA 4E5KA 1Q1ZA 3AR4A 4ZGWA 5JH7F 5FPSA 2GEDA 5JJLA 3NWOA 3PI7A 1BVRA 1H85A 3R5JA 1CIPA 1UH5A 3HRIA 1Q7RA 4PN3A 1OU4A 5DJ5A 7MDHA 1YE3A 2BE7A 2IFTA 4F8EA 1XNRB 1EZ4A 1T8YA 1KQNA 2PX0A 4BX2A 2R8RA 2DETA 1PYDA 4R3NA 4EQ6B 1NMYA 2A67A 4MKXA 2F1IA 4P81A 4DGQA 5IC5A 2A4KA 1V5FA 4JJ8A 1KY5A 5FD8A 3NT4A 4DSAA 1Z8FA 1YNOA 2A84A 4BY9E 3ZD6A 1IZ7A 5JCZA 4YRTA 5KYGA 1FDOA 1NLZA 1FDTA 2Q62A 3BF8A 3ISVA 4QFDA 1P9NA 3Q8MA 3ZDDA 4RORA 4UTXA 1A72A 3B7GA 1YRBA 5I8ZA 3TZ6A 4U8GA 5LDDC 1YBMA 4PM4A 2JH9A 1NJ1A 1MQ8B 2FSPA 2JJ1D 5FBRB 5AKIA 3H17A 1G2OA 2ALJA 2UUPA 4OMUA 3RFXA 2RAFA 1GPNA 1VHQA 3EVBA 3F8TA 4W8OA 3SBEA 3FOZA 1R5NA 2ZIGA 4JT2A 5CTJA 2F43A 2KMLA 1B2LA 2GN2A 2PLRA 4G8DA 4WUTA 1GSOA 3AUXA 2BGIA 4N9WA 4BLOA 4N18A 4NU8X 1Q20A 5E0KB 2ZIZA 3KQUA 1LFDB 4LVCA 1R0LA 4IL5A 4FK8A 5IBRA 4V38A 5C34B 1SU6A 5ER9A 4Q9HA 4XVCA 2JLQA 4Z4GA 1PG0A 2VPYA 1EYZA 1XQ6A 4M0CA 3BAZA 5A9SA 4HQOA 3W5JA 2BGNA 2VFAA 4KIGA 1IJEA 3IB3A 5ITWA 4WFIA 1K7EB 4PC1A 4KQWA 3LQKA 4HCJA 3DXYA 3RC9A 3HGMA 1QYVA 1NUAA 2NNLD 1PUXA 1V48A 3H8WA 5EIBC 2ZBUA 1M76A 3B2EA 2X3UA 3ZWCA 1FTSA 2C4VA 3P52A 4CCSA 4W82A 2H29A 4QBGB 5B58C 1DKRA 3LZ6A 1XK6A 2WJ6A 2EU8A 4I5DA 3RPEA 4D74A 3GEBA 2ZAGA 3JAWB 3K9CA 3SDBA 4H1TA 1ISSA 1XJ5A 4RELA 1Y3AA 4RMGA 4D8VA 1ZOSA 4F5WA 1V37A 5JAHA 2J3HA 5KYXA 1FJGB 1O03A 1HKUA 1BHO1 1E3WB 2WF9A 2X7XA 4DV3B 1BROA 1GGEA 1E1LA 1VCMA 3QPVA 3LS2A 4BGIA 3FVVA 4J94A 1OT5A 1OI3A 4B7CA 5LJLA 1T8UA 3R8XA 2YY5A 3V9AA 4CLXA 2VHZA 2FHPA 3HBNA 1UAYA 2ID4A 4HNGA 4JC5A 3VI4B 1I94B 2KI5A 5ALFA 4GLFA 1RHKA 3LKDA 3MUNA 4M54A 2VZ9A 4EM6A 2MYTA 3W34A 2W2LA 3DAGA 2A7QA 2F43B 2P6PA 2ZCVA 1YR6A 3J7TA 3I2JA 4O2AA 2IGBA 3A58B 5F7OA 2ERCA 2BM0A 4AJEA 4CKZA 3IPCA 2VSFA 1YDHA 3LY7A 4YT5A 3UEOA 4D9BA 2P30A 3FKSA 2Q99A 3L7AA 4O3FA 1Z39A 2DUWA 4LG1A 5JAIA 1M2OA 2IS1A 1YFZA 3TFWA 1II0A 2J41A 4K8RB 4I1UA 3FPLA 5IEJA 1T26A 3DB2A 4HN9A 5F2EA 1P7YA 3I6IA 4ZC1A 1I4OA 4PU0A 4EYEA 4DSUA 2WJAA 1HLDA 1ZOOA 3TDKA 3VSCA 3WLLA 3EDQA 1R8QA 4QWWA 4DEXA 2IH2A 5BUQA 3JQBA 5HFNA 1HYBA 1RAFA 4O4JF 1AZWA 4Q3OA 3CLTC 3KLPX 4NZYA 3S68A 3ILVA 4NLLA 5EIFA 4ZO7A 4EW2A 1OJ7A 2A88A 5JADA 1XGKA 1PT7A 3DOUA 3N5KA 4ND5A 1QIEA 5B12A 1QO9A 1K5PA 1WWKA 2X5NA 3HVJA 1N5DA 4O1HA 1KEVA 1M5UA 1N6OA 1T9ZA 1GZ7A 3GUVA 3HB0A 1S3FA 2CN1A 1NY5A 2V9PA 2Z56A 3AETA 3OOEA 4U7HA 2OHHA 3GLRA 1YFKA 1ISFA 1AH2A 2R6R1 1OYYA 3R3JA 4X64B 1IEXA 5JPDA 2QYHA 1N8SA 5H80A 1KQGA 3TTTA 1EB9A 1TF2A 1QGUA 1V45E 3GWZA 1MR3F 4MARA 1LRLA 1G19A 4GOMD 3TQSA 2XQIA 4QVIA 2FN8A 1IULA 2VNKA 4L15A 3B6MA 4Q00A 1E0AA 3R3VA 3DEKA 4OFWA 2ICAA 1M2HA 3RHSA 1J2RA 5J58A 5D8DA 1W0JD 3QWAA 4TXJA 4IWNA 2MT9A 5L51A 2ECQA 1WCIA 3SF0A 3EDMA 1JF8A 3BL5A 3MVEA 3T3PB 4BLRA 4FX2A 4BNFA 4EO7A 5ECDA 1OREA 2RGWA 1E32A 1H0RA 5H16A 1M10A 4YTEA 3ZHOA 2FDCA 2EFCB 4OI2A 4U2EA 5E2AA 4XIJA 3V8EA 2ZYDA 4S1OA 2HIAA 1D2RA 3KVRA 3PXUA 4QBFA 2WAYA 3G5LA 3HVKA 4RJLA 4BL5A 1JA1A 3ZQJA 3LX5A 2O7VA 3AOEC 5JBIA 2IHBA 4C7VA 1NC3A 4UVIA 4F4JA 2ZS7A 3A3YA 1O6ZA 4PZZA 4E5PA 2QPTA 1UFKA 2XCUA 3HNOA 3QFTA 1G3MA 1UOOA 4R41A 5CLLA 4N47A 3X1WA 4EZEA 3PJRA 4NXNB 2SKCA 4FFBB 4NARA 3QQ5A 1YK1A 4WNAB 3T3DA 1N0UA 4P4SA 3B9BA 4UD6A 2A3RA 1GU1A 2J5RA 3CONA 5TX7A 4D3FA 3T38A 1MB4A 4YAJA 2KWIA 3TI7A 4ITRC 5DE3A 3WLTA 3ZU2A 1ZD1A 1H4QA 4EVQA 2WMOB 1Q12A 1WB6A 4MV0A 4F72A 2EIXA 2EF1A 3F74A 3LP5A 4BIMA 3CLUC 4GM0A 4R6WA 5T4EA 1GLVA 3DL0A 2XHZA 4YRLA 5AKJA 1QGUB 2IOQA 1J09A 3A26A 3I45A 3PVCA 3GL9A 4LC1A 2XT0A 5CTAA 4PLTA 5HF6A 3VTKA 3KPUA 3QE2A 3KOYA 4QECA 3NHBA 3L4BA 2GZ2A 2AOUB 3GJSA 3HCWA 3A1NA 1SKUA 3NHAA 3NORA 4NNOA 5K6AA 4WWHA 4YIKA 3GY0A 5KTKA 4DUYB 1Z4IA 3WLIA 5CG1A 2VRCD 2H63A 2LZ0A 5AOCA 3T5AA 2R4QA 3TE7A 1XTQA 3DBHA 4D3YA 4ES6A 2OENG 5REQB 1U0JA 1UPAA 2F8TA 3UOAB 4FM9A 1IEQA 3IV9A 3FSGD 4IILA 5EFZA 2O8FB 1ST3A 3K5PA 4Z7OB 1FFXA 2EHDA 3EA4A 4TV8B 1HL7A 4HMOA 3Q2KA 4DCMA 1W5TA 3NQ41 2XPCA 1T0HB 5HS6A 4HFRA 4LHYA 1XPOA 4RHEA 3MCAA 2VJYA 4PPFA 3A2KA 3A6JA 4G89A 5F5NA 1OGJA 3AP3A 3E70C 3CVOA 4G5QA 2Z43A 3QHQA 4FN4A 3WBKA 3OZCA 4BNHA 2QMOA 3ASZA 3BGWA 4B5KA 3K30A 2E9SA 4OBWA 3OG9A 1ZJZA 4BKMA 3HHEA 4C1BA 4YMWA 1W6UA 2VAVA 4GOLD 1MLDA 4HDNA 4HLQB 4FR5A 4IOJA 1DQPA 4P4SB 3DMTC 2I4OA 1JDUA 2H4ZA 1W44A 4IDEA 1TKCA 4OQZA 1BMDA 4XB1A 2F9MA 1GWNA 1NNSA 1SXIA 2PUTA 5AMXA 5JT1A 2XSZA 1U7TA 3PA6A 5C0OE 3UVEA 1G55A 3ZI4A 4DTCA 1XZNA 3H9JA 4TT3A 3SBDA 4P80A 3H6HA 1TCVA 1P4AA 2C0QA 3RC2A 5BP7A 4CODB 1SD2A 2C3MA 2C9DA 1EIZA 3GUHA 1K3FA 2O7RA 4IOKA 3U7QA 1XPRA 3EWNA 3IP9A 4KKVA 2PSSA 1CNEA 2B98A 2JFXA 1CY4A 4OQ4A 1G8PA 1OY1A 2NUTB 3ZXUB 1CU1A 3P20A 1QIKA 4KQXA 1G5TA 4Q9LA 3ZNOA 5DWDA 4ZHQA 2BR4A 4KGXA 3ONDA 1GKKA 2KLBA 2WTAA 1P7ZA 2SKDA 1Y1KE 1SBYA 1YB7A 4ZAGA 3IXLA 3ZDQA 4EYGA 1RI3A 2F3SA 2Q1WA 2YVQA 4WY8A 4LRSB 1LJUA 3E9DA 4Q4HB 4UHJA 1QOPB 3HCRA 4L27A 4O02B 4S24A 4X1KA 2QIPA 2RH9B 1ZGZA 4MYTA 1W36D 1ORIA 3RT7A 3ZCUA 3BEOA 3WAGA 2QRGA 1JLKA 3SX0A 2V74B 4QOJA 2QZSA 2A4MA 4IH9A 3T15A 1PU2A 1CZUA 3EIEA 3PWTA 2I1LA 2BGRA 4FT2A 4OHOA 2C7PA 1E20A 1PGOA 2BFWA 2A9JA 2CHVA 1E6CA 4EF5A 1JKJA 4EHDA 3N5CA 1A7UA 4DIFA 1KERA 1QZ3A 3DZKA 5DHAA 3GJ3A 5JSKA 4ZOLA 3SKVA 1KKLA 1MPXA 1U11A 1ZJJA 1HM5A 1QJ4A 2AG1A 3HO8A 4YHBA 3SJAA 1ULZA 3IPAA 3JQ7A 3UW1A 4B6EA 2GM4A 4ZCQA 3BSSA 2G1AA 1AS2A 2M1XA 1JS1X 1RLTA 3DE5X 4D0SA 2YWCA 4NCXA 3DE2X 4X93A 4JXXA 1WKBA 1CF9A 2EEPA 2O1WA 3ETJA 1SH7A 4FLFA 4XGQA 5AW4A 1PFVA 1EJ0A 1GL7A 4BRUA 3L5KA 2Z04A 3ITEA 3IUMA 4RC9A 3VKWA 3ZUPA 3IHTA 2B1QA 4F2PA 1B4DA 5DGCA 1ZIOA 1NJ5A 1A1SA 3IEUA 1YZQA 5A03A 3QQPA 3U7QB 1XVTA 1TVKA 1ZISA 3EFOB 4NECA 5LP6B 4BFYA 2BFDB 4ZP1A 2RAPA 2WWTA 3GEGA 3FHCB 2PMDA 3R6WA 4ZHQB 1BMFA 2HCBA 3BERA 1G7CA 1CE8A 1L5YA 3LTEA 3AHFA 3OURA 1L5NA 3EUFA 4UNNA 4QKQA 4X24A 4XUDA 2EWWA 1KZGB 4JB3A 4GO1A 3RVNA 4F3TA 1T36A 2PYDA 3EUEA 3HA2A 3JSAA 3M9WA 4Y6GB 1ZI8A 4JUCA 4GVXA 3D7RA 2Q45A 2XVXA 4MPJA 1T0UA 1TLFA 4X1KB 4ZQBA 2G9RA 2GFQA 9ABPA 1PQWA 1Z6TA 2QMHA 2R1ZA 3L06A 3K94A 3KBOA 5EVCA 5KQSA 2FR1A 5HOQA 4NK5A 1G7SA 1AURA 1H2RS 3K2BA 4JA2A 1Y81A 4UARA 3U13A 3KAQA 4DCTA 1R0YA 1LBSA 2EBFX 4YRPA 3ELDA 1XXHE 2OL4A 4DDUA 1XUOA 1Y7LA 3EA0A 3P9SA 4L3VA 1Q11A 2IIVA 4MS4B 4G65A 3AY6A 5DBFA 3Q10A 1JKJB 4Z49A 1SOAA 1YRLA 1XRLA 1SCDA 1WZUA 1MC8A 3L49A 3PNSA 2C1EA 2X22A 3AFIA 3Q7QA 1DCMA 4OA5A 4ZT4A 3RM3A 1H1TA 3E35A 4EW1A 3AL0C 1PW5A 3B3JA 3JQ7B 3OCUA 3OQIA 4IIXA 4KRXA 4WOJA 3KP1A 1YMQA 2LUOA 3OEYA 3UHPA 1T8RA 3WIOA 2PO7A 1QQBA 1R66A 3K1AA 4MJXA 1V47A 2ISCA 5JJ5A 4A2QA 5HWSA 2WSLA 4PLFA 1JMYA 4PO3X 2YZGA 3E5NA 3RODA 3DYBA 4Y2RA 2CZCA 5HGJA 4RDXA 3GG2A 1Z5VA 3CX8A 4L9WA 1MX3A 4LCBA 1TAUA 4DEYA 1HY3A 1M8FA 4B45A 1U7XA 3G0DA 3ZY2A 4DBVO 4ZCLA 4M8SA 3LXUX 4N01A 1QF6A 2CMFA 3A1VA 2X7JA 1MGPA 1VKHA 2AVDA 5HZKA 3KYCA 5HUHA 4YAIA 4KFRA 1NC1A 4ZT2A 2CBZA 4QD3A 3OEHD 1R0CA 5ADVA 1T36B 2C2MA 2WYVA 5ILGA 3ULKA 5AVYA 2Q3DA 3N0XA 1IZYA 1GUAA 1G6Q1 1DARA 3F4BA 3L0DA 4MR9A 2H31A 3WRXC 4BBZA 4PEVA 1O54A 2J30A 4URFA 3K0SA 2PV0A 2PD3A 4MAFA 5L53A 1JTVA 2QJOA 2QP4A 3PYXA 2F55A 1J5EB 3E5RA 4KVZA 5BRNA 2FOLA 3IMGA 1OTYA 1ZRNA 1TMGE 4YO8A 4BBJA 3ZGZA 1U9IC 4QFMA 4F2WA 5IC4A 1EFLA 4FKMA 4WL0A 3ZIUA 4AJHA 4FIDA 1LS6A 1Y1TA 1NUTA 3P2JA 2BBSA 4FW8A 4KQMA 2WD7B 2GJAA 1ZCJA 1EHIA 1XU4A 5F78A 1YB6A 3AU9A 4MIOA 3JAKB 2I4RA 3VR5A 3VPBA 2IYUA 3OQIB 2ZTHA 3TFQA 3VO8A 1Q44A 5FRDA 1KJNA 1IPEA 4LYFA 3CUWA 3KVOA 4Q4JA 3TJMA 2Q3FA 4DR7B 1MZPA 5G4KA 4GEKA 4L07A 3GNQA 2YOGA 3O6VA 3TLXA 1LNQA 3HYNA 4DDHA 1T5SA 4H6VA 4Q7JB 4ZEVA 1TZJA 3ZJUA 2WWHA 4NZMA 1OXMA 1TVEA 2Q9AA 2Z1DA 1E2GA 2A0FA 4MW6A 1UR5A 2FNAA 3E5HA 4NRDA 4QOGA 3QTTA 3B6KA 3OBBA 2EW1A 1C9MA 1HDEA 2X2PA 1HXHA 3W5SA 3T5BA 1B6SA 5I6DA 3KT3A 1BN7A 3LDUA 3BMCA 4YP1A 4HSEA 4U7FA 4PO8A 3R5TA 4IINA 4D4HA 3BRWA 3WHLA 3CZQA 2D2FA 2XMSA 4UNPA 1WP9A 1XMJA 2C95A 1HDIA 2MYPA 3IAEA 3NTXA 3PD0A 2OBFA 4ARCA 3OETA 2PXXA 4JI0B 5KSYA 3N2GA 5B7PA 2XVZA 1IYZA 3L4BC 4HY3A 2XZTA 1RAEA 1H6BA 4II7A 4DARA 2I80A 2NU9A 4MR9B 5CW2A 5FOTA 5TGTA 4A0FA 1T5BA 2VNAA 4EP1A 4J6FA 3WQHA 3WWOA 5D87A 5AXAA 3ZGYA 4CEHA 3ZDCA 1JR6A 1KHHA 4KPUB 3SZLA 4BJ5A 4E4RA 3JYLA 1EXWA 4X61A 3WY9A 3UBMA 3EZ7A 1R37A 2AMFA 1BOOA 4BMZA 4BB0A 1EK0A 4G2TA 5T41A 4LX0A 4RCZA 5C46F 1E6EA 4C88A 1BA3A 5HJ5A 3EXFB 1ODFA 4XRRA 1IZZA 4PX2A 1CW2B 1QWOA 1DG3A 1JHUA 2H2GA 2IYNA 4XIYA 5CH5A 3RJ5A 1NW6A 2Q1UA 4MRRA 1O0CA 2WUFA 5FB3A 4Z4IA 2XTMA 5K0TA 3QU7A 1P74A 4LK3A 3OKPA 3FXAA 3A3OA 3IR7A 4FFOA 4WESB 1B6RA 4UNQA 5DHQA 2O6LA 1T3GA 2XNSA 3SHWA 2C9BA 4ZARA 3NVAA 1OH8A 1VMEA 1YOVB 1JHVA 1U0TA 4C1NA 4EGAA 1JEOA 2PT6A 5HVNA 3VNSA 4URWR 4DC9A 1SG0A 2WJJA 3DTVA 3UJBA 1MA3A 4MS3A 1NF2A 3BFKA 3ZUGA 4DIBA 2GS9A 4ZEWA 1GUZA 4Z0NA 3SE0A 4Y6PA 2ZSIA 1KKMA 4Y1RA 3UAWA 2XUFA 1O77A 3FNRA 4TWJA 2GERA 2IU6A 2CJPA 3NVDA 4ZVMA 4PLYA 1W8IA 2QXYA 2GJ9A 3DMYA 3DW1X 2YHBA 3RUIA 3C5WP 3N2GB 4YHHB 5IKPA 4D9IA 1CUFA 2DBZA 2NU8B 4QYIB 1ZU4A 1WU8A 5LP6C 4RYLA 3V1LA 4KRFA 2QDKA 3ROZA 1SUPA 1RABA 1CIVA 1Y1PA 2BFEB 3ESDA 3WLHA 4JLDA 1DWPA 3KLMX 5D6NA 2WG0A 4BVHA 2HTEA 3QEAZ 3UJ8A 2EGHA 3OM8A 2ORYA 2GHIA 1H69A 4H2DA 4KV7A 4L5BA 1D2AA 2E3JA 1FXWF 4P08A 4KMOA 4TYWA 1YE5A 3QWHA 5I48A 4MVWA 5CAEA 4R5HA 3RABA 4TTVA 3I0NA 5HRAA 3MWYW 1JFLA 2VDQB 1UBJS 1C81A 3AEQA 4FFVA 2ILVA 1GLNA 3OJOA 3PNQA 3KSRA 2H5EA 4B76A 2ATVA 2OT3B 2REQA 1P29A 4CKWB 2P78A 2XUQA 2ZI7A 3WGLA 2CWWA 3QEMA 3MTEA 1UL1X 5E6SA 1QFMA 2DQZA 4WVFA 1Y4DE 2AHOA 4K2HA 3H1EA 5K4HA 1QB7A 2HEGA 3B1XA 1Z6PA 4RXMA 5AOBA 4PHTA 8GPBA 4TYQA 3W3AD 4NZZA 1EM6A 3MRVA 1V0JA 1R16A 2XTJA 4C5BA 3E7FA 5CB0A 2CLFB 1XTTA 1MIOA 2C2XA 1K8QA 2YFQA 5DHTA 5EP2A 3BFXA 1RMTA 2OBLA 2YS7A 2ZT6A 4L8YA 4R1LA 2H5LA 5BURA 3LLVA 3LW8A 5I7AA 2LNDA 4XVHA 3NNDA 1NTRA 3GN1A 1RPNA 2JW5A 4YO7A 4C2UA 1VKNA 3TQQA 5EIWA 4O2RA 4AKEA 3ZD7A 4Z9AA 2PSJA 3S1SA 5AW2A 3NFYA 5DCYA 3F6SA 3HUDA 4FDTA 1B8PA 1YA6A 5DGHA 1LQUA 2FHSA 3U60B 2HJRA 3DZIA 3PFBA 3GEHA 4JSTA 3LWBA 2X1HA 4KPYA 2D7CA 4IO0A 1FVOA 2JD2A 2C9OA 4LXQA 1G20B 2OK7A 4DLLA 2JIQA 1YS6A 5DV9A 5FQOA 1XQ9A 5CAEB 4NV1A 4DR3B 1P9WA 1DOAA 2QV7A 2BZSA 4J0KA 2X5OA 2UKDA 3B9PA 1I9CA 4RO0A 2ID9A 3W5UA 2NAFA 3AEQB 5ICGA 3NHMA 1N4AA 2IXGA 2NM0A 4UTZA 2WYUA 1ZMXA 4HRVA 3FPAA 3NIWA 2JGJA 2REQB 3L05A 2AEMA 5DEOA 3KT8A 3K9WA 4LI3X 2FUCA 4KR2A 2FGKA 5HZMA 3QJ5A 3Q0TA 3L4EA 4Q1AA 3LIIA 1L4NA 1ZCBA 2QD3A 5DULA 5AFSA 4OUDA 5EXDA 2PNJA 2XRYA 1Z22A 1GAQA 3LF2A 4FCWA 3RTEA 2XKBA 4ZPJA 3THOA 4M1MA 4F6LA 5EZYB 4HVLA 2C7RA 1MIOB 2Y1GA 1AB6A 3CZAA 5CA0B 2ARKA 2FG6C 1Q83A 1EBFA 4TMVA 5KTTA 5KNBH 3K0FA 1C4XA 1DSSG 4G26A 2XYHA 3OA0A 1IM5A 1RW4A 1VE7A 2ZWVA 1GZ3A 3CUVA 3IIIA 4HH3C 4QPNA 1ADFA 3ZKWB 4YUXA 5AM5A 1W85B 2AL7A 3E82A 2JIMA 3RKSA 2AKEA 1DIRA 1FL9A 4IUBS 2JIDA 2MR5A 1R15A 4BO8A 4E1VA 3O73A 3A32A 4W5NA 2XQVA 1P19A 1MTOA 1DJNA 5AVQA 1CERA 1WAMA 1IUKA 1XVIA 2QSZA 5CLIA 4MP6A 2QNIA 1QIGA 2I1QA 2QLFA 2XY4A 4TMWA 4CR6A 5J4YA 2Q8QA 1KXZA 3DHNA 2BH2A 3QH4A 4RKYA 3PNOA 4MULA 2W11A 4RDCA 4JDUA 3EGWA 2RGDA 4XGKA 1THTA 2ZJ2A 5ALRA 3RC7A 3IA2A 3HCPA 3VYSB 4CHGA 1W96A 2G70A 3SYKA 1URPA 3NYRA 2AJ8A 1OZ0A 4FP9A 1J0CA 4EARA 3S1LA 1L8XA 5JMWA 1C5KA 1NUQA 2GO1A 5DASA 2E4XA 2PWZA 3LUBA 5HQJA 3SS7X 1KY2A 3GPCA 2VR1A 5TMDA 4OJQA 1FX0B 5BWOA 2RGRA 4UUOA 2J0SA 2WD9A 5ALPA 1EE2A 2SECE 4V02A 5KINB 1CY0A 1ZH4A 1GPBA 1P33A 4OOFA 1DS6A 2I6TA 2JFOA 4NF2A 3O8NA 3L8EA 1AUPA 2BFNA 3STXA 2O4UX 4E32A 4N0PA 5LBIA 4Y1FA 1AG9A 1ADBA 2D4HA 4LXIA 5DHUA 3TTXA 3HDVA 3IA7A 1JG3A 4PZEA 4ZOEA 1BXZA 2GKGA 4NQZA 3T8YA 1SELA 3QSYA 3CR8A 4GH5A 4B3FX 1JMVA 4DSZA 5ALUA 3IO5A 1D2MA 4NNPA 4BMXA 2JFHA 2CEAA 1IZ0A 2JI9A 2ZRJA 4JVLA 4OK5A 5E4TA 3TD9A 3A1UA 3LNTA 3UH1A 5HKKA 2P2NA 3RVPA 4MHOA 1X1TA 2E1PA 3WLQA 1XJQA 5JS6A 1MVLA 2OBYA 3KZXA 3WSTA 1XXHA 5KNCH 1CVLA 3DWIA 3H11A 1FUEA 4REQA 5KVVA 4QDZA 3AKDA 3OCVA 1O96A 3OIGA 1WRBA 1ZK1A 1X7YA 1TTTA 5B53A 3SYRA 2W2NA 4LCEA 3DBIA 2O8BA 4ZAWA 1N0HA 1DXOA 4BZQA 4YRKA 1BDHA 4AL4A 3G9UA 2GPSA 3V3KA 3U1BA 4M7RA 5CVTA 2WNHA 2H1LA 1JQ3A 4GZLA 2X0EA 4FKZA 2VBIA 3UAGA 4IFTA 1A7JA 3UJ9A 1ES9A 3ME5A 2ZBFA 3A04A 3BGDA 3JQ6A 2OXRA 3KELA 4O4LF 2EATA 1JLRA 1T2FA 2ZGVA 4MA0A 1TYAE 4KITB 1KMNA 3SXJA 4F71A 5IKEA 4QXMA 1UKCA 3P9QA 4Y2HA 1M7GA 2ZYAA 3QFHA 4HL6A 1S8NA 4LC9A 3QXJA 1N75A 1YRYE 1JYSA 2CF5A 5CM8B 2VWHA 4DV2B 5M3BA 3AR5A 1S0UA 3CO5A 3FTDA 4RA9A 2DC1A 3JYPA 4HQ0A 1Z28A 2PZEA 4RSRA 4RNDB 1UDAA 3ASUA 4ENPA 3KSUA 3J7AC 1F0KA 1RFGE 1RHQA 3KB6A 3U3XA 2A5FA 2FE4A 5FT9A 3IXMA 1RHJA 3ZV4A 1LX6A 2I78A 4H4CA 1AGRA 2CLOB 4W9NC 2AD5A 4QHTA 3ZBTA 4BFSA 5BXYA 1NIJA 4MCHA 1L4KA 1KJJA 1FQOA 4GX1A 5G1PA 3RQSA 4BC0A 3N53A 4X71A 5BW5A 1HL3A 5B58T 3DZHA 3TIXB 4DY6A 1DTWA 3PUKA 1RXIA 2I1VB 1Z3CA 2QK4A 4WA7A 4WK4B 1RYZA 1XXHB 3L02A 2BCGY 3H11B 2WHPA 3BMQA 2EZ9A 4L4YA 1J00A 4N7BA 1ESZA 5EG5A 3W2IA 1O96B 2V5VA 4JODA 1T13A 1UEIA 3I3OA 4O2LA 3SVZA 3HI4A 3TZKA 1XMQB 5BO5A 3BXOA 2G9NA 2GWHA 3P0IA 1OBHA 2GCEA 2HDOA 4KN8A 1NXXA 4RHXA 1KSFX 4KW7A 1L7BA 1VE6A 1QAQA 1V1JA 1SOVA 1ZU5A 2J32A 5AICA 1J8MF 3CNNA 5EQJB 3VHXA 3L6UA 4A10A 3GU3A 5FOWA 5BSWA 2HJVA 2G0NA 1ZUHA 3B5EA 5FBLB 3BWYA 2NZJA 1KPIA 2CF6A 1OFUA 1RU3A 1SXJB 3W8RA 2VJQA 5KTOA 3B6JA 4FPXA 2JASA 2CHEA 1A4UA 2B8NA 1PFYA 1GCAA 4FFRA 4AO7A 3JQ9A 4IQFA 4F46A 4M1YA 3M1AA 3IHLA 3WWEA 3A9VA 4CUZA 4UUNA 1ADCA 1KNQA 2YNMD 1QWSA 2QLNA 3C45A 5JECA 1E2JA 3BWDD 1PIWA 3G3EA 3RF6A 3HCOA 3ABSB 2GNPA 2I54A 1YDWA 1W0KD 3PHCA 4JT9A 2QQFA 2NX2A 4H3VA 3HKBB 5ISMA 3QWIA 4OLHA 3LF1A 3BGOS 4U0JA 4UDNA 1RE1A 1O7JA 3PNKA 4DJEC 3EMVA 1PJLA 2PKEA 4OB7A 4X60A 4FOOA 4FFDA 1JFSA 4OJKA 3B13B 1MJFA 1X92A 1QC5A 2PL3A 3FZYA 4DRZA 1L8LA 1Z4JA 3VZDA 2XOKD 1T6ZA 3PRKE 4N0EA 4NCNA 4EB0A 3O4IA 1GP2A 5KQMA 4MRVA 1JIVA 2HLPA 1BX3A 3EPRA 4ZYWA 1PBTA 3DE4X 4B82A 4N65A 3B1WA 1EBBA 3DWEX 1C4WA 5GMOA 3T9BA 2BGGA 4I7EA 2YJ5A 3K6SA 1Q6YA 4J4TA 2C5BA 1EVYA 4WKPA 5AM1A 1GNVA 3K8QA 1XO1A 3GJTA 4IPTA 1D04A 3QUBA 4FHDA 2GYWA 3OSUA 2MCFA 2O2GA 4I3GA 4JB8A 1AV7A 2OV2A 3OTWA 3BXGA 5GQSA 3GWGA 3VHXB 3WQQA 3FSRA 4B33A 1GTRA 4DB2A 2XDQA 1E98A 2DHDA 1RYYA 1RC1A 3D1VA 3ZY4A 3EARA 4B4UA 2QXTA 5I51A 1YI1A 2QTZA 1KYVA 3DUFA 3IAM1 1HFEL 1G3IA 2IHUA 1A2OA 1JLLA 1LQ2A 4JIGA 3LWNA 4PLHA 3OOWA 1EX9A 5KHAA 2WWVD 1UF9A 3IEXA 4L8GA 3WADA 3QITA 4RTJA 2FW7A 2WNSA 2ZU6A 1FOEB 3GRYA 2CXHA 4BCCA 3ERCA 1NJ2A 1TPZA 2Q2VA 3VC2A 3AFGA 1PNQA 4NV0A 2YIDA 2M6LA 5KOJA 2CE7A 1Y34E 2HTFA 4B6PA 1J25A 1NLFA 2O2ZA 4XEUA 2W6IA 3BVPA 3VPAA 3KQNA 3WICA 3SVTA 4JK3A 1CEYA 1YAHA 2NTYC 2F8LA 2XQJA 3PUXA 1MJGM 1UBKS 2CYBA 2HSGA 1YS2X 1G60A 1EWRA 1PJAA 1YU6A 1YJAA 3H16A 1I1OA 4NAVA 3T54A 3FUWA 2F1HA 3HKDA 3P0EA 4WZ6A 4Y1EA 4L3OA 3X1XA 4AJ9A 3Q0IA 2OSBA 4LOKA 5EIHA 1QC5B 1IY2A 2YWDA 4P4UA 3REFA 1MF7A 4J90A 3RFTA 3C8DA 2C07A 3IXQA 4MKRA 1D6MA 1GQOA 2FPRA 2RIRA 2V6MA 3ROKA 4KHPB 1A5TA 1XTKA 4A6XA 2WTNA 3H2ZA 2P4HX 4KL8S 4PFKA 1QYRA 5AKEA 2QZJA 5E8JA 1PYOA 1HDXA 4PXYA 5E95A 1O4VA 1S02A 1R8YA 4JBGA 4BNKA 4ALNA 2L69A 4MUIA 2FWNA 3RRJA 4XYLA 5MN4A 1E63A 4WXHA 1JJIA 3B38A 4QOHA 1XB2A 2PBZA 2QW1A 4FCVA 1AKEA 2OR3A 4OAOA 5EQTA 4ZAYA 4ETNA 4I1PA 1VSBA 1X1BA 5BYAA 3V4RA 1QLJA 4YT8A 2WF6A 4K7JA 1RHMA 2PD4A 3L0IB 2WDPA 4RY2A 5HQ3A 1RWMA 4WXRA 1YA8A 3C3XA 3E8SA 2XWJI 4V2IA 1WTAA 1JLLB 3FWNA 4C03A 4Z54A 3H5RA 2P2LA 1IY8A 2B7CA 2XZDA 3VI3B 5B6JA 5ITSA 4DLSA 2ZRMA 1V7PC 4G63A 4PGGA 1M2EA 2NU7A 2Z3WA 3GQBA 1H42A 1PYGA 2MSKA 3L7BA 2EKQA 4KC0A 1NVUQ 2BKUA 2X8JB 1BH6A 3K0AA 5L4LA 3UGJA 3IBGA 5LIRA 1ZM9A 1IXSB 4WY5A 3UYKA 3HHPA 3HBAA 4D9FA 5ALZA 4C4PA 4E2FA 4F38A 2XGGA 4N54A 1DIHA 4H1VA 3L1JA 2OC9A 1CVIA 1YKGA 1ZK4A 4JHXA 1W9MA 1OI4A 4ENQA 3EX7C 4N3NA 1N0WA 3PUVA 4BNVA 3HKDB 1H3FA 3NAMA 2B78A 4E03A 4RM3A 4YMTA 4ND6A 4Q12A 3L6CA 2LCFA 1YC5A 2QLTA 3HMQA 1AKWA 4R51A 2YHIB 3VHRA 4B80A 3I9OA 5IKOA 1G59A 2Z5GA 1KY4A 5K09A 4RZQA 3HSSA 2ERXA 2LDXA 3IVRA 1ZONA 4RGQA 2G1KA 2AJCA 1KI3A 3A9WA 5AYVA 2PS1A 5KVQA 3HJNA 3L8MA 3K1ZA 3TMYA 3VPFA 2ZUWA 2YJZA 4UNRA 4URVR 1LDNA 1JKFA 3OM0A 2NQ8A 3AFOA 4YWHA 1XCOA 3FOFC 4H7EA 1NFRA 2HXSA 1FC0A 4QPDA 1A8UA 3ST7A 4K26A 4DNPA 1BCRA 4AFNA 1K86A 2BJWA 2AQIA 5E1OA 1SURA 3IUBA 1X1CA 4UBIA 1I14A 3FNIA 3OFND 1BMTA 5HQ3B 2CKDA 3FETA 1N9GA 4Z1MA 2BGUA 1GRNA 1RYNA 4JUBA 1SHJA 1JA0A 3EIHA 1Y1SA 2NU7B 2GDZA 3C2QA 3GAFA 4NBVA 2OHGA 3M1LA 4OHCA 2AJTA 3PRYA 1YQGA 1R0WA 5GY7A 4Q93A 3RT1A 5K8IA 1YR2A 1E62A 4GMFA 3GLGE 1PHPA 1XQWA 1C1YA 3LKBA 4BUJA 5IMBA 4GOKA 4QU5A 1SXJC 2LXNA 5FWNA 2IYTA 1CV2A 3DE6X 4PAQA 5DCUA 5BN5B 1L1EA 5C18A 5J4KA 4ASUA 5A3SA 3L18A 5LYJF 2AMYA 2J46A 2VOJA 3FWZA 2FEWB 4A2CA 2IPLA 1WLSA 2OO7A 2CY0A 3SZOA 1BYUA 2EARA 5IJXA 1RWVA 3DW3X 1U1DA 3SQNA 1V1RA 4F1KA 1L7NA 3C3WA 4ZQGA 1CRQA 4JMLA 2WTBA 2DB3A 3H8SA 5EIEA 1NW4A 1JIKA 1O95C 2J0UA 1OZGA 4Q66C 3GFRA 1MO5A 3DF9A 1Q0ZA 2DR0A 2HCTA 3GC6A 1MXFA 3JVUA 2BI8A 3BXXA 3BWMA 1DKUA 1RZRA 2MMCA 3O3CA 2JDIA 3RFFA 2JH8A 3AV0B 4WJLA 3DL7A 4UHKA 1SIUA 4HR7A 4RZUA 3RIGA 3RS0A 4DFDA 1YS9A 2DLNA 3C8HA 5JPIA 1DL5A 4D46A 1EUDA 4Q6BA 1I4TD 1M8JA 2WZBA 4EATA 1EGHA 4EVRA 4NYJR 4UVEA 2D59A 4UCWA 4Y6OA 3CRW1 2PSFA 2YX1A 5E8RA 1N9GB 2AXNA 4JJ4A 5IAAA 4ND7A 1TMYA 2J59A 2PJZA 3CE9A 3KSMA 1U1CA 1NBOA 4FR2A 2P8JA 2R8ZA 2I2BA 4ON9A 4TWZA 5FWAA 1C1DA 4LJYA 4Q4LA 2ZI5A 3A06A 1JG7A 5DOVA 4I81A 1Z07A 3PF8A 1HDZA 2JIZA 4E5VA 2IOFA 5I4CA 2BISA 2W6MA 5HRCA 1L5GB 4KZKA 4E15A 4KO8A 1O8CA 3HGTA 5LNK6 1N57A 3MLAA 4JL8A 3ANSA 4GBMA 4XDGA 2XYQA 2UYYA 4R40A 2ZJ5A 1D8AA 1JLMA 2XMGA 3R7NA 4CWAA 4QZVA 4DM4A 4BLQA 3KQLA 1LLCA 2H1VA 2I65A 2JIBA 1VIYA 2TMKA 4RACA 1U6IA 2G9ZA 3R4CA 2WJZB 4IHJA 1KBQA 1CK4A 1IUOA 1H0KA 3PFKA 3HCDA 1P2VA 4FWBA 1N2CA 4RH0A 1AK2A 2AZ4A 1SC1A 3E7WA 2BCEA 3WHIA 3UPUA 1A8IA 4MGEA 3EAFA 3PHJA 3CUKA 4P3KA 1IHPA 3FGZA 3NTVA 3W7VA 5CDUA 5HKBA 3ZLTA 2Q27A 3CRZA 3CWQA 4PZAA 2FOXA 1XTZA 3FH0A 3LFHA 4ZQHA 3QMWA 2RHHA 4I50A 1NP6A 1OLUB 4MB0A 3VVMA 3Q2IA 1M3SA 2XBUA 4MJLA 2Q5LA 3UMBA 2Q9CA 4NWIA 3RSGA 1O94A 1X3LA 1D07A 1KSJA 2ZIFA 3GDHA 3WDMA 1MFZA 5KX5B 2UYQA 2YQ5A 2Q5FA 1XDZA 4DREA 2G7MC 2X3FA 4AUKA 4OGWA 2OLKA 5TQJA 2QR3A 4UM7A 4QGFA 5FUYA 4KG7A 1EUDB 3QM1A 1G4UR 1CDDA 3OU6A 4CQLA 1QO0A 1V5GA 3DZDA 3MJ4A 3NIFB 3BG5A 3QLEA 3PXCX 2VRWA 4BMOB 3CJTA 2LCQA 4F7WA 2VUIB 3AKCA 2OOKA 2YRWA 1NNEA 3ADCA 1EVEA 4R1UA 4HVCA 1A5BB 3O31A 3HWWA 1FP7A 3NEPX 4PFSA 4Q3BA 1C1DB 1JQKA 2XX3A 1Z6YA 3BDIA 2WWGA 4DLUA 3WGNA 4FFNA 2F3UA 9MHTA 2JZCA 4DWVA 4BE9A 4IV5A 3C1OA 1VJ1A 4YMUA 4NSNA 1XTRA 3MWDA 4C08A 4UU1A 4U9IS 5LDHA 1A96A 3CT4A 1NXWA 3SS9X 1QHHB 4G07A 1ST2A 4HYEA 4EL0A 3T7DA 2EKPA 4CT5A 5I45A 2CFIA 1THZA 3A3NA 3B9RA 4I9HA 2ZRQA 4JDPA 4KUEA 4IHJB 2R6AA 2IT1A 4BAUA 5JAUA 2O19A 1K7FB 3DBVO 4P22A 5FTWA 3C6KA 1AA6A 4ALIA 4XA8A 3JQEA 1FFAA 3VH3A 3GMTA 5JDCC 1M54A 1EK6A 4RK0A 1PZNA 2IIBA 5EWMB 2ZJ1A 2KQUA 3PFHA 3QX3A 4FHFA 3WQRA 1C7QA 3MWKA 2MSLA 3M4NA 4GSLA 5BVGB 5JDIC 1ZH6A 4IFEA 5DYGA 4CMIA 1CUBA 3RIXA 4CQMD 2FSGA 2OKCA 2POQX 2FUG6 2FF7A 5CITA 1YI0A 1NX6A 3JZFA 4QGSA 4L5AA 4LZJA 1YR9A 3WGVA 1VCIA 4HYYA 2P1DA 3EZLA 5KNBA 1GTZA 3R7BA 1NLUA 3EVEA 4V0QA 1IDN1 3T06B 3K70D 1ZNZA 3F9CA 2BVNA 2ZJ4A 4X90A 1SVIA 2HGZA 5KYWB 4DQ0A 2ZQYA 4Y9DA 5A2QA 5FP0A 1H66A 2Q5QA 3T3IA 3S70A 2G77B 4NPHA 5CX1A 3LP6A 4S12A 2FEKA 3E4CA 4ZI2A 1X7XB 3O84A 4AJIA 2GPYA 3IKJA 3L6EA 3LWZA 2VTDA 3MLBA 2HUPA 4ZANA 4N5HX 4QTXA 3CVYA 3QHPA 3RYTC 4QTUB 4UHEA 1UM9B 1UBOS 5FAKA 3EMKA 1YR7A 2GM9A 3U6KA 2FPKA 2YV1A 1ZAKA 2BCJQ 4JEIA 1XEWY 3IMKA 1Q1BA 3G2IA 5E7IA 4P2GA 3UWKA 4DMKA 4JQCA 1QH1A 2QBYA 1UANA 1LNSA 1N5JA 1ODSA 2R11A 4JJFA 1VDZA 4RJKA 3T5TA 3UGTA 4MGYR 3BHMA 2QTWB 3O7MA 3WB9A 2O07A 4ZVSA 4NYIR 2O7SA 3V3TA 3D4LA 4X00A 3RRYA 4HPWA 2FMXA 2D1QA 1NJ6A 2IPMA 3OUTA 5D00A 5EE1A 2ZRGA 3U61B 4DANA 4IIFA 3BL8A 4CCYA 4WFQA 2JG3A 1NM5A 1GAEO 4KLCA 1SCUA 4JGIA 1Z34A 2H4HA 3JWGA 4E5NA 1PR4A 2CMHA 1VSUA 1ZA2A 3KD3A 3DLPX 5DI9A 1BEUB 4JROA 4QGAA 4UVHA 2PVSA 3RRMA 1KXJA 2P9JA 5LXTB 3GRRA 2CXQA 1XX6A 2COKA 3FTPA 1OXSC 3JD0A 4KGZA 2C92A 3B1JA 1ADJA 3KG2A 5U4XA 4FEEA 4N76A 5KUTA 1U2EA 1EUYA 1UBNA 3IMFA 4UNSA 5IYZA 1NASA 3IE1A 4RIIA 3YASA 2ZYIA 4D4JA 1UBEA 1DX4A 4D9MA 4OLAA 5ECWA 1N3LA 1U0LA 1RKBA 1JQ5A 1X7DA 3AYZB 3Q7EA 4YJ3F 2BAGA 1HH4A 2DX7A 3FFWA 3U0BA 5FULA 1TPYA 2CD7A 4DMRA 5G0SA 1KWKA 5K0FA 2RMKA 3QVLA 2JA2A 3P97A 1E59A 2WJIA 4O63O 3SHVA 5G0WA 3P9KA 1T9KA 1USGA 1YR8A 3AR7A 2XNJA 4D02A 1FMCA 2VF8A 2P2GA 4RVUA 4W6QA 4NZNA 1USVA 3CYFA 1EG7A 1EH5A 2HM7A 4M60A 3NYWA 4M99A 4TLBA 1E2KA 4HYTA 4CDNA 4EB6A 3IQFA 2C4KA 5KSZA 3AY7A 4FHCA 4QFBA 5CK4A 3OE4A 1U2SA 1CJCA 2RGUA 3TJZA 4BS9A 5AW6A 3EZFA 1LY1A 2Q4DA 5CDGA 2YR0A 5JNUA 1SUAA 2PSHA 3FE2A 2P7IA 4TS3A 2QBYB 1SVWA 2B61A 3C39A 1XMSA 5JH7B 4L28A 2BUBA 1DHTA 3SXPA 3N8NA 1B23P 1UMDB 1QUEA 3PR3A 3MCVA 3BICA 2F1OA 1VM6A 2XCIA 4S1WA 2B3TA 3R3ZA 3ESYA 4G25A 4JZKA 2VQ6A 1PJCA 2G5GX 4IZ6A 4M9QA 1KMCA 1NAHA 4CCYB 1W1IA 3HI6A 5K51A 3STTA 2IL1A 1Z2EA 2HKIA 3IOCA 4Q3AA 4QXPA 1O89A 3BMOB 4INZA 4XIIA 2BMEA 3A6EA 1UODA 1I5OA 3O4VA 4FYMA 5EHQA 2X14A 1QBGA 1P6XA 2EJWA 4DRXB 4HNSA 5IK2D 2VEDA 4DE5A 3ZGOA 3EDYA 3D2CA 2HLNA 4U1RA 3ZCSA 2JI7A 3F5DA 5LN1A 4BXOB 2C3PA 2OZEA 2V7BA 5ED4A 4PG6A 1I2DA 3MUFA 1ML3A 3DZBA 3BGIA 3GJRA 1JR2A 2J5QA 1C50A 3NP7A 2I8CA 4FEAA 4HNHA 4P3YA 3L1UA 1W5AA 3OZVA 3FUXA 3C87A 2GGSA 3WDSA 1PL0A 3O0TA 3LUCA 1W88A 1SVUA 1U5BA 1UXKA 2VQEB 1GCGA 1NKTA 3LKZA 3WLFA 5I47A 4NU0A 4XVQA 2WE8A 1IQPA 3CLRC 5TY0A 1WXHA 1OUMA 1AB5A 3FB4A 4MOWA 5LD2B 4PAGA 2Q4TA 5F76A 4AKTA 4DGSA 4LFAB 3DHEA 4JGBA 1MDBA 3LSYA 4IDBA 1MT0A 3GJZA 1PVVA 5JFGA 1CUUA 1A50B 3O1LA 4DZRA 4EB6B 5DGDA 4UOZA 2V5UA 4YR9A 3BHIA 5L45A 3EWSA 3FMVA 3D6AA 2ZITA 2HA2A 1LTHR 2HIMA 1BHQ1 1WD5A 3VPCA 3QG5A 4AQYB 2FP4A 2FWIA 5CLJA 1DC6A 2HXYA 4YUWA 3VKHA 2ONCA 5KYYA 1N7HA 1E5TA 4P33A 1WQ3A 4AS2A 4NULA 4BFZA 3U44A 1LV8A 3WNBA 5HE8A 2DLDA 2AXQA 2TMGA 2V6BA 3ONNA 2P4QA 3F5MA 4QQNA 4X6XA 4B75A 2Y2VA 2PR7A 2OCAA 4ZVVA 1CZOA 3IKMB 4KRYA 4K9PA 3AVVA 5MFZA 4FI3C 4YRDA 1WXDA 2FFJA 4BB6A 1S2LA 1YCDA 1F60A 2ZAOA 4ZRMA 1K0UA 3NH6A 5GIOE 1VLZA 4ZCTA 5MN6A 1SNYA 2W6NA 3DHVA 4NL4H 5CXQA 2XLCA 2LKDA 3F7OA 3O8QA 5JSYA 2DPYA 4FDVA 3M3DA 1WUHS 3KJIA 4QQFA 3VHQA 5ILQA 3UFXA 5GONF 2GAFA 3ROTA 3G88A 3VZCA 3H99A 5WRFA 2D2IA 4X6UA 4Q24A 1EWQA 2I4IA 3GLGA 3LHSA 3V7WA 4XWKA 1O4WA 1Z5PA 1NQWA 1KO4A 4B81A 1JU9A 1WCXA 1GAJA 3THXA 4BXOA 3LJKA 1A9QA 2P6RA 3BIFA 3IHKA 1A9ZA 1CQJB 1QFZA 3ISTA 2B4AA 4YJGB 1HYHA 3UJ7A 1UZAA 1W87A 4FYVA 2P6OA 4F3KA 2GWRA 2XXAA 5H9VA 2FPPB 3P0FA 4D9NA 1RBYA 4BNGA 2H4WA 1HDOA 4RGBA 3HR8A 3UMCA 3X1MA 2XTZA 2IHNA 3M4XA 4LOAA 2WB4A 4K6HA 4Q02A 5B4VA 4GPBA 3U44B 1GGHA 1RMYA 4O4JB 3DEYX 1XZQA 2WA1A 3IVCA 5DKFA 3H19A 2C2WA 2EZ8A 1QYWA 2PS0A 2HMVA 3AW8A 1WE2A 4KXXA 5FJJA 1XLUA 4AJPA 1H9AA 3DFZA 5TDHA 4AZ0B 5JFTA 4MMXB 2VP3A 5C31A 4CLOA 3LZDA 1CULC 4BAGA 5DNUA 1BFKA 1X1QA 3EGCA 3PQ7A 4M6WA 1EP1B 2ZUCA 4N3GA 1P62B 4NPCA 2H1OA 3V97A 2JZNA 2J87A 3C24A 3WFJA 4CV0A 5EHZA 3N7TA 3D6UA 3KPWA 4N5MA 3LHKA 2CNWD 2W70A 1L7PA 1G8JA 2IU3A 2NZVG 3Q3CA 4C0BA 2I0FA 1SOMA 5M7EA 1E96A 2A94A 2QTTA 1VJCA 1C1XA 2B69A 4CXMA 3CW8X 1L5MA 1P6UA 1QUFA 2E48A 3LG2A 4TTRA 3VR3D 2FUEA 1VOTA 4MQFA 5KKAA 3V55A 2PRJA 1YASA 1F14A 3B7WA 4KX3A 3JRXA 3AG5A 3DYVA 3B1VA 4JLKA 5JMTA 1XTJA 3D0KA 3R3UA 4MKZA 1YIDA 1KYZA 1GITA 2D1YA 2ZT7A 3CZMA 1DRVA 4PTZA 3LTNC 1FSPA 2QPLA 5FA5A 3FCCA 3Q3IA 3KJHA 4CLHA 4N3AA 4KQGA 2AKAB 3DMGA 1I3MA 4J43A 4LJAA 3HACA 4WBSA 2KW5A 3M6VA 2H07A 4UE6A 2JLRA 2Z3VA 4B3JA 3EXIA 2FN4A 2PWBA 3OC0A 3OSZA 1WXQA 4PQEA 4GMGA 5EKDA 3MEQA 1UT5A 1JQLB 1XLTA 4WLEA 2ZK7A 1JPVA 3BQ9A 4H7FA 4CV1A 2P11A 1ODLA 4MA4A 2BGMA 3UMYA 1IN6A 2GI4A 1JT9A 1NVXQ 4C7OA 4ER6A 4O0MA 1V26A 1YZUA 1JJAA 5AJYA 4KEAA 1N32B 3RUFA 4HT3B 3CF4G 4ISBA 2B36A 4MUNA 1IHDA 1EFKA 2JS7A 4UPVA 1E3EA 4F5ZA 1NM5C 3AHCA 3KTDA 2VF5X 1JEQB 3P2YA 1PVOA 1J2EA 4I2VA 3C3KA 5IAOA 1Z8DA 2DG2A 4MRPA 3I62A 1GKLA 1H2YA 3INRA 3HN7A 1OOEA 2HBQA 4ZFNA 3L0CA 1EUCA 3NM4A 4TQAA 2LWIA 1WB9A 3KX2A 1GA4A 1RDFA 3DLAA 1AQUA 2V58A 4HFNA 4IQ0A 5DTEA 3SPXA 3MBIA 3U7RA 4ZAVA 4FGWA 2C5LA 1HA3A 5I7VA 3PWKA 1DOHA 1HKHA 4UBOA 3DOOA 4YV0A 3PP8A 5IWAB 2TRSB 2H92A 3NETA 4G01B 1XJ0A 2H51A 4R81A 2UV8A 4X1YB 2W2LD 4UUQA 4AJNA 4CKEA 4D9GA 5IF3A 3SOZA 4GGMX 1J5XA 2HT1A 3QV2A 1RYBA 1YQUA 4EQZA 4V24A 3EH2A 4R1SA 2EC5A 2H9IA 5GVSA 4X1IA 3E5MA 1YVDA 1IXZA 3FKSD 3BGVA 2JHPA 5LD2C 1KYXA 2O8VA 4MPRA 5TC4A 3HK2A 3TUZC 5HIIA 1KEPA 1U2GA 4YP5A 3ZWWA 3CVVA 3DLIA