4J0IA

Tannin acyl hydrolase in complex with 3,4-dihydroxybenzoate
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
470
structure length
452
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords Tannase
total genus 165
structure length 452
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0iA00
2WKWA 1XRPA 1LPSA 1SCKA 3BJMA 1EB9A 3W04A 3ED1A 1X70A 4LXHA 1FFCA 4XIIA 1ACJA 2VSQA 4UHFA 2H7YA 4Y2SA 1HPLA 3QM1A 2WU3A 5ALHA 4OD0A 5ALKA 4X97A 4KAAA 2CB9A 2XMZA 3AILA 1TCBA 3L1HA 3O4HA 3WL5A 2XMBA 4BBZA 4OYYA 1CVLA 2WG1A 1ORWA 2XUAA 3I2FA 1N1MA 3R3ZA 4MYSA 1QIKA 2NW6A 3IUNA 2Y6UA 4N5IX 1WB4A 4DLNA 1C7IA 2CBGA 1WB5A 4WFJA 2C0PA 4IO0A 1CUAA 2FUKA 4B0OA 1YB6A 4EY4A 3C5VA 4J0IA 2JGEA 2QTBA 1LPNA 5T4HA 3DDUA 4WJLA 4X3CA 3NGMA 5AKKA 4XWGA 2AJ8A 2XUKA 2XQGA 2HA4A 1VXRA 4EUSA 5JYCA 3ANSA 1FFEA 4G8CA 3AZQA 5E2IA 1DQZA 4KEAA 3T52A 1U65A 4NS4A 5AM0A 1FFBA 3D0KA 1GGVA 5AKLA 3WK6A 1QIGA 4XVCA 4OB6A 4CIAA 3VJLA 3DKRA 2JEZA 1Q0RA 4MWTA 1XRMA 1U2EA 4BCCA 1T2NA 4GWLA 4P9NA 3RLIA 4B9EA 1XROA 4KJXA 4CCWA 5ALFA 2I3DA 3AUKA 1EDDA 2WFLB 5K3AA 5HF9A 4MQLA 2ZVDA 5AM4A 4Y2TA 3C6XA 3D5EA 3NOXA 1YCDA 1HQDA 1XLWA 3HLKA 1WHSA 1UK9A 5EHXA 3WKDA 2XT0A 1UWCA 1CUUA 3DYIA 3M81A 4QNNA 5AOBA 1LBSA 3QH4A 2OCIA 2HA5A 5AKYA 3GZJA 4KE6A 1LPOA 1G66A 2CZQA 4TGLA 1BN7A 3V1LA 4ROTA 3FYTA 4UBLA 1YS2X 1W75A 1WPRA 3WMRA 5A71A 3D3NA 4MEAA 5FKJA 2WJ6A 4Y9SA 1EXWA 5IVIA 4I3FA 4BVLA 1IMJA 2I03A 5FLKA 4YK7A 3KWFA 1Q83A 4MWSA 3I6YA 4QDOA 4Q05A 5BWCA 3TEJA 4DMHA 1WCYA 1R50A 4FKBA 4ZV7A 1MX5A 3SK0A 1K8QA 1P0MA 1XZEA 1DWPA 3R3YA 1W4LA 2BAGA 5CRIA 2XLBA 1TIBA 4BE4A 2JGMA 3L1IA 3BXPA 1CIJA 4CG1A 1CUCA 2D5LA 1O6GA 4H7DA 4EB0A 3GROA 4BDSA 3X3HA 2QKYA 1DQYA 4S0XA 2PSFA 3HEAA 5HQ3A 4H77A 4AO8A 5JAOA 1LZLA 3AJAA 1VE7A 4ZRDA 3HACA 4Y2QA 3WWDA 1SCQA 3ICWA 4PSDA 3HC7A 4X6YA 4TVKA 3ESCA 3LP5A 1XZKA 2JGFA 3ILSA 1TAHA 3H2KA 5CXUA 1AMNA 3FOBA 4FFWA 4H7FA 4D9JA 1UK6A 3PF8A 2BUBA 1BS9A 1F6WA 4UBNA 2QXTA 4BC0A 3O4GA 4AMYA 4FNGA 5ALVA 3BDVA 1K5PA 3W2TA 4ARBA 1EVEA 1MO2A 4N8EA 5D7BA 3BWXA 3QVMA 4IH1A 1XZJA 4PF1A 2WFZA 2VJAA 4G5XA 4UHDA 5IVDA 1CRLA 4KE8A 1EI9A 1K4YA 1X2EA 5ALPA 3DOIA 1J06A 3JYHA 4I19A 4H7EA 3BDIA 1LGYA 1QO9A 4KRXA 3IULA 4X92A 1ZIXA 2RHWA 5ALLA 2QXUA 5ALYA 3IB3A 5AM1A 2XUIA 2OGZA 1R3DA 3RARA 5A7HA 5AKIA 1VLQA 1TCAA 5KWJA 1A8UA 2V98A 4B7ZA 3G0CA 2H7CA 5E4YA 2FJPA 3WA7A 2WTNA 3UUEA 4BDTA 2X5XA 3SX4A 1GPKA 1HLGA 3D2BA 4AX4A 4W63A 2DFPA 2HFKA 4ITVA 2WUDA 3A2LA 5JATA 4KR0A 4E46A 3DOHA 1ORVA 4X85A 1NU8A 1ZI9A 2GBGA 1QOZA 4ARAA 5HF5A 5C8VA 4EY8A 4B82A 3WZMA 3LS2A 3NWOA 1XZBA 4KE9A 3I28A 3R40A 5T4BA 4UBIA 2R11A 3STTA 3G9TA 1NX9A 1T4MA 2DQZA 2D0DA 3OURA 4Q3OA 2ZYRA 2EDAA 2ZJ6A 3PFCA 3DCNA 3H2HA 5AOAA 2PKYX 3WI7A 4UHCA 3FCYA 4U2BA 5ALGA 3DKKA 1CFJA 2BKLA 3A2MA 3I2KA 2XUOA 3C8HA 4DSZA 4EY7A 1CEXA 4Q34A 3EQ8A 4M0EA 3R41A 6YASA 3ZV7A 4DNOA 1VA4A 3GELA 4L9AA 1XRLA 4GLBA 4H0CA 2DHCA 5I7UA 4FLEA 3WWOA 1EA5A 4X95A 4GEGA 5JANA 3WWPA 3VVLA 1O6FA 3E0XA 1JJFA 4UFOA 5CT9A 2B4KA 3JW8A 4HVTA 2WIDA 4QEKA 5HFNA 3IA2A 1XZCA 5CW2A 3C6ZA 4W9RA 1JKMA 4YASA 3G02A 4FDMA 2GZSA 3QPCA 4MXDA 5AO9A 4BTLA 1Q0ZA 1HL7A 4UHEA 3DS8A 1BCRA 5HFAA 1IUOA 4LIPD 4M0MA 4W1PA 1LPBB 1I6WA 5E4JA 2P8SA 1XKTA 3GBSA 1GKLA 1FSSA 4X6XA 3M82A 2WHPB 4QE3A 3UMJA 1W76A 2WUEA 3QPAA 3RK4A 4B83A 4DSAA 4X6UA 4KRYA 5YASA 4BAGA 3O9MA 5CURA 3IVMA 1J2EA 3JWEA 1N5RA 3H2JA 5I9IA 2Y2VA 3W9UA 1AKNA 4OCZA 1R4ZA 4Y2VA 4EA6A 2HRRA 2ZJ7A 2CMFA 4X00A 1JFRA 2YXPX 1GQRA 3LLCA 4W1QA 2VQ6A 1J1IA 4BP8A 3HJUA 4B6GA 3DL7A 4DMKA 2WSLA 5JASA 2O2HA 2GBCA 4C01A 1RP1A 5AJHA 3H2GA 2VT6A 1A8QA 3DNMA 5LP1A 5ISMA 4H18A 2PBLA 1CUHA 2PPLA 1VOTA 1CUVA 1USWA 1XZGA 2O2GA 1VKHA 4F5ZA 1IZ8A 5CXXA 5DNUA 1EB8A 2PUJA 3W9BA 2XMQA 2GYUA 2PUHA 1GT6A 2ZSHA 1H2XA 1QTRA 1XQXA 1W1IA 1YB7A 5HZGA 1AZWA 1B41A 5DYYA 4ZXFA 2QMQA 3WK8A 2FJ0A 4BVKA 5JIBA 3BE8A 4OUKX 2XMSA 3H19A 3BIXA 2PSHA 4KAJA 3WYDA 4JUIA 5ALEA 4G4JA 1JJIA 1VXOA 5D3KA 2QJRA 2RGUA 4G1FA 4AMZA 3T4UA 1EDEA 2HADA 2OGSA 2O2IA 2XQJA 1XQVA 3OG9A 5AM5A 1XZFA 3AZPA 1GZ7A 2E3JA 4QDXA 3WWCA 4GDMA 4GXNA 3STUA 3I2IA 4JYPA 2B9VA 2VEOA 4QA9A 5C8XA 1KU6A 5JARA 5DYTA 3KXPA 4N8DA 5DJ5A 5SYNA 1TQHA 4IHAA 1ZICA 5JADA 4CG2A 2YASA 2OGTA 4DIUA 3PI6A 4PO3X 4AN0A 2ONCA 2QUBA 3S8YA 2WHQA 1UKAA 5LZ5A 2OAGA 3QMWA 5LLSA 4I4CA 3A6ZA 5FOQA 4B84A 3TGLA 3DJYA 3V1MA 2PSJA 2QZPA 3ZLTA 1J07A 1CQZA 2HL6A 2JIDA 3V1KA 2X8BA 5LZ2A 1ZD2P 4DNFA 1U8EA 1XLVA 5EGNA 4GHWA 4B81A 1WB6A 5JD5A 4WCVA 2JGIA 4O08A 5BOVA 4X71A 1LNSA 1JMKC 1ZGCA 3G8YA 2Z8XA 5CT5A 2WUFA 3G0BA 4BRZA 1XLUA 2ACKA 4PW0A 3R3UA 3WYNA 5AM2A 1EDBA 4UBKA 4B85A 2I3ZA 2XQKA 3U1TA 3DD5A 1HKHA 3O9VA 4BZZA 4BTVA 3G0DA 1BU8A 3UUFA 1XZIA 3STYA 3C43A 1QFSA 4B80A 1L7RA 3FYUC 4CI9A 2CEKA 1G4HA 4QWMA 5AICA 3PFBA 3W05A 2WIJA 3IIIA 3DYVA 1QIMA 1WPXA 3C70A 2BGRA 2DHDA 4E11A 1UKCA 2V9ZA 3H1AA 4EBBA 1R9MA 4Y2XA 4J3JA 4KYVA 1QO7A 2HA7A 1E89A 1IUNA 3BL8A 4MYDA 2HDWA 3R0VA 5FV4A 4RE5A 1ZJ4A 4AO6A 3F96A 1XKLA 4H35A 4J0JA 1CUYA 4PV7A 1F0PA 4L0CA 4AXBA 3FLEA 2VAVA 1XQYA 3TRDA 3FBWA 5LKAA 1LZKA 5IVHA 5ALZA 3ZI7A 2YH2A 5JZ9A 5LKRA 2OG1A 1IZ7A 1YAHA 3MUNA 4XX1A 2QM0A 5FXMA 5A7GA 1CUWA 2WILA 2J3QA 2BUCA 2Y1KA 4OU5A 1IUPA 1WHTA 2HU8A 2B61A 5ALQA 5JAPA 2G5TA 2WG2A 4U2CA 1HBJA 2ZJFA 3F97A 3I2GA 1EVQA 3STWA 4C6HA 2X76A 4EHBA 1AURA 4A16A 1LPPA 4E14A 3AIKA 5AI9A 4BB0A 1JJBA 4FLFA 2WJ3A 4QDZA 2BFNA 2WFLA 2J3DA 5CH3A 3I2HA 4V2IA 4DNPA 1THTA 5AKXA 3YASA 2XB6A 3PICA 2VJBA 4C88A 5DWDA 1AGYA 3PE6A 3ZPXA 3G9XA 1EINA 2HA3A 2J4FA 1MN6A 4JNCA 4J0GA 4K6GA 3W06A 3BIWA 5I8PA 3K9BA 3R3WA 5AHXA 1VE6A 4B9AA 3ESAA 4ZGBA 3IUMA 1SOMA 3WQHA 4AZ3A 5AI5A 5ALWA 1UK7A 5IKXA 1UKBA 3F67A 1W52X 5CH5A 3IURA 5AKHA 2WTMA 2RONA 5A2GA 4AO7A 2JEYA 3OTQA 5CH8A 3WK9A 1Y7IA 4GECA 4LHEA 5K3CA 3BJRA 3D59A 4GI1A 1YR2A 5JZSA 3WKBA 1QONA 4RE6A 1A7UA 2ROQA 3N2ZB 1PJAA 2ECFA 2GYVA 3MGAA 4W1SA 2J4CA 1JMYA 2EDCA 1JU3A 2O7RA 3VJMA 4BATA 5ALRA 4K6HA 1ZD5A 1QLWA 1GQSA 3CXUA 5AKEA 3F98A 1F8UA 4UFNA 5E4TA 3WL6A 1CUFA 1QIIA 3FLBA 5IH7A 5LIPA 4U2GA 2OLEA 2QT9A 2VA9A 4WDQA 3R3VA 3FYUA 3KDAA 2K2QB 5KBYA 4FLMA 4FWBA 5ALTA 3NUZA 3WA6A 1BEZA 1QFMA 1XFDA 1A8SA 4LXIA 1KU0A 4ZV9A 5AK3A 5LYYA 5FPQA 3AIOA 4DTCA 3BF7A 4BAZA 2GYWA 2Z8ZA 4Y2PA 2WG0A 2WIGA 3FLAA 5HKAA 3KOOA 1H2WA 3ZLVA 1U4NA 3CCBA 4MQMA 2XMCA 3M3DA 4H7HA 2HA6A 3FNBA 3WK4A 4UPDA 5HF8A 5KWIA 5EIHA 3GUUA 1JI3A 5A6VA 1CUSA 2JF0A 1DU4A 4JYMA 2GBFA 3OOSA 2RHTA 4UBJA 4DM7A 2BUAA 3O95A 1MNAA 4J0KA 1CUEA 3IBTA 3B12A 4X7BA 3EQ9A 3IDAA 2FX5A 1EH5A 2I78A 4J03A 1F0NA 2VF2A 1BROA 5C7YA 2XUFA 1UFOA 3WK5A 1ZI8A 1EK1A 1ZGBA 3E1GA 2HU5A 2V96A 2XUHA 4K2AA 5SYMA 4CIBA 5AI6A 1MJ5A 4FBMA 3ESDA 4EY5A 1YA4A 1MU0A 2ZYSA 3H04A 5EI5A 2XDWA 4DGQA 3N0TA 4HXEB 4CCYA 1DWQA 5ALNA 1CR6A 2V97A 1SC9A 3FVRA 1OXMA 4F21A 2H1IA 4WFIA 4EY6A 5HQ3B 4K6KA 4G4GA 2ACEA 1TRHA 1ODSA 2PL5A 1VJ5A 4Q82A 2QUAA 3STXA 2OCLA 5HK9A 3ESBA 3G7NA 5CBKA 2VJDA 2XI4A 5ALUA 1TCCA 4CCYB 1XRRA 3WL8A 4HRXA 4K5QA 4RPCA 2HU7A 3C8DA 1AC5A 4YPVA 5EIAA 2BGNA 4KACA 2C5GA 2WM2A 1MT3A 1K63A 1MX9A 3V9AA 1BCSA 3C5WP 4C4ZA 3EBLA 4UBMA 5A7FA 4LYDA 1QIJA 1GKKA 4KAFA 4ZREA 7YASA 3F8SA 1E66A 4RGYA 1R88A 5AKGA 1C4XA 5FP0A 1MAHA 4EZIA 4BCBA 1BEEA 4FHZA 4CG3A 2HHAA 5AIAA 1JU4A 2PU5A 4G8BA 1ISPA 2CKMA 4OB8A 4H7IA 3PDCA 1A88A 3SWWA 3HZOA 4DNQA 1ACLA 5DTIA 1H2ZA 5AOCA 4G9GA 2QR5A 5DNVA 3Q0TA 2WU4A 3E3AA 3QZUA 4WY5A 4TPKA 5DNWA 3HI4A 1CUDA 2WUGA 3WKEA 5C8ZA 1MTZA 4HS9A 5AKJA 2OAEA 1E8MA 4Q3KA 4Q1VA 1PFQA 5FPPA 1DINA 3H2IA 1H22A 4G8DA 5JALA 2PU7A 3C6BA 3GFFA 4L3WA 1EX9A 3OC0A 1XRQA 3HYSA 4P93A 4X91A 3FAKA 5JAHA 2DQYA 3TJMA 2DHEA 1S8OA 2ZYIA 2OQVA 2XUQA 1QIFA 3ZLUA 3RKSA 2XLCA 1XZDA 2CJPA 4QDUA 3WJ1A 4IH4A 2OCGA 3D2CA 4X90A 2EEPA 4Y7DA 1XZLA 1CLEA 5D3ZA 2WHPA 4UUQA 1GPLA 2H9YA 3D4LA 1P0PA 3F9CA 4MJ3A 1BRTA 4CFSA 1QTIA 3U0VA 2H7XA 3QMVA 3Q8WA 4J0HA 2GBIA 4HTAA 2HM7A 3MVEA 3B3QA 1L7QA 4AZ0A 3QYJA 1CV2A 4HRYA 3H1BA 4HZGA 2QJWA 4B0PA 2JGLA 4UBOA 5AI8A 2AJLI 5A62A 4FTWA 5ALDA 2IX9A 1MNQA 3O4IA 5BV7A 4F60A 5AM3A 5HKBA 1WOMA 5CT6A 4Y2JA 3EIOA 1B6GA 1LLFA 3HSSA 1EHYA 4ZI5A 1ZOIA 3WL7A 1QGED 1BE0A 3KD2A 1CUBA 3S2ZA 3G9UA 1EK2A 5ALOA 5K5EA 3WLAA 4C4YA 1LPAB 2QVBA 1E8DA 4DMFA 2HIHA 4BVJA 1Y7HA 3WZLA 5LZ7A 4FMPA 3C45A 2RIPA 3WK7A 1E8NA 1R9NA 3BF8A 3WJ2A 1ODTC 5ALSA 2HRQA 1P0QA 1UOPA 5AH0A 2VT7A 2XUJA 5KREA 4RNCA 1E3QA 5FDFA 1UOQA 1C7JA 2AXEA 3C6YA 1Q84A 1VZ2A 4UFPA 4QDTA 3R3XA 3IUJA 5DYWA 1QIDA 5FUMA 3V1NA 3CCCA 3LCRA 2HA2A 5H3HA 4ZWNA 2XE4A 1N5MA 2UZ0A 4INZA 1GXSA 2RI6A 4AN1A 5DTJA 2C4HA 2QOEA 2BJHA 4HXFB 1XRNA 5FRDA 3O0DA 4X94A 3AZOA 2PVSA 1Y37A 2LIPA 2JGKA 3O4JA 4BAUA 2ORYA 1WM1A 3FYUB 3WWEA 4NMWA 1G42A 2WQZA 3HRHA 3FCXA 1MAAA 4QWWA 3ICVA 2OQIA 4OSEA 4U2EA 3IUQA 4QZVA 2WJ4A 3QBJA 2WIFA 1NU6A 4KE7A 4BRSA 2W22A 1YS1X 1ZI6A 4BYMA 5EHZA 3P2MA 1UOOA 1GPNA 3QPDA 2PSEA 4U2FA 1PV1A 2Q0XA 1MPXA 3CN9A 1ZD3A 4XJVA 3WIBA 4C87A 4J0CA 3I2JA 5AI0A 2DCMA 4GBGA 5K3EA 3PF9A 1YAJA 3WIOA 1ETHA 5AK6A 1K6EA 3D2AA 3LIIA 2G4LA 5AK5A 4AQDA 5ALJA 3STVA 2XQFA 5HF6A 2VTVA 5CMLA 1JT2A 2WHRA 3GA7A 1AX9A 3DQZA 4IH9A 5K3FA 1X2BA 1MX1A 4WFKA 1RWQA 1ZD4A 4Y2UA 1CQWA 1LBTA 4WY8A 1OCEA 5C81A 4OPMA 1L7AA 3I6MA 3A2NA 4A23A 1XQWA 5CTAA 4DYHA 4Z49A 5ALXA 1R1DA 4H7KA 5IVKA 2XMRA 3FVTA 4IQ4A 2YYSA 4Y2YA 1RYYA 4A5SA 3H17A 1CUJA 1DWOA 2AJBA 1P0IA 4MEBA 4OU4A 1N8SA 1AQLA 5ALMA 2DR0A 2PSDA 1TK3A 3QMMA 3AIMA 4J0DA 4BC1A 1LPMA 5AI4A 2Z3ZA 3M83A 2VAXA 2XUDA 3D7RA 1QIEA 4PSCA 1FJ2A 1OILA 3I1YA 4LYEA 2QS9A 4Q3LA 5T4EA 5CT4A 1CUGA 1TKRA 2B20A 5JAUA 3H0CA 4W1RA 3C87A 2HA0A 1E5TA 4X93A 2IIVA 4UHHA 5AP9A 4OB7A 3EQ7A 1CPYA 2OCKA 5ALIA 2CUTA 3QITA 2ES4A 1THGA 5JD6A 4PQEA 3VISA 2XQIA 3H18A 5EHNA 4E15A 1VZ3A 4QLAA 2XUPA 1FFDA 4FNMA 2PM8A 4PSUA 4HAIA 2QRUA 1H23A 1DT3A 3V48A 4U2DA 3L1JA 3G0IA 1KEZA 3MUOA 2C7BA 1XZHA 3G0GA 5D6OA 2JGJA 2GZRA 3FSGD 4P92A 1SCIA 3WKCA 1M33A 3LIPA 5CT8A 3FSGA 2OXEA 2C5FA 4BZWA 1Z68A 2G5PA 4HXGA 4YX9A 4C89A 4P08A 3VDXA 4C4XA 1UK8A 4AB1A 3SC2A 3B5EA 2XUGA 1ODCA 4FOLA 5HCUA 1BN6A 4QLOA 3DL4A 5K3FB 5AKZA 2W6CX 1DX6A 1UT6A 2R8BA 5HK8A 3FWHA 4NVRA 1HDEA 4PNZA 5AIBA 1QZ3A 5ESRA 3HABA 3VVMA 3OM8A 2G63A 2Z5GA 3I1IA 4FBLA 2ZSIA 4G4IA 5LZ4A 1DTEA 1FFAA 3VJKA 3KSRA 4JH0A 1ZIYA 3VKFA 1QIHA 4FFVA 2JBWA 2WFMA 3AINA 5J3JA 1XZMA 4ETWA 3G9ZA 5EFZA 4LXGA 3EF3A 5EHQA 3PUIA 4OYLA 5F4ZA 4N8SA 3CN7A 4N5HX 4L72A 4G9EA 1QJ4A 1SFRA 5DLPA 4Y2RA 2WIKA 1CUXA 2WLSA 2IITA 1H2YA 5BWBA 3VXKA 1D07A 4H7JA 2C58A 3A70A 3KWJA 2XMDA 5EIEA 4F0JA 2PX6A 4GW3A 5K3BA 4BE9A 5JD4A 1UXOA 2VJCA 3I6ZA 4BP9A 5JZBA 1QE3A 2XMGA 3ANTA 5AK4A 2HFJA 3K6KA 1YA8A 3WKAA 4LKOA 1YASA 3PUHA 1CUZA 1CUIA 3RM3A 1UZAA 1DT5A 3DEAA 1DX4A 3E4DA 5T4FA 3OPMA 4WDRA 1G5FA 1IVYA 1YSCA 4DMCA 4NZZA 2ZYHA 2O7VA 2OPHA 3DLTA 2C0QA 4J7AA 4BCDA 3HXKA 1W6RA 2Y2UA 1AUOA 5LZ8A 5K3DA 3ZWQA 1ZJ5A 3AFIA 2AJCA 4UHBA 2VATA 2BCEA 2RAUA 2DSNA 4M0FA 3K2IA 1XZAA 2Z3WA 4JEIA 5LZ9A 2Y6VA 2AJDA 1VA5A
chains in the Genus database with same CATH superfamily
1NOIA 1K08A 3A4YA 3RO7A 5CVDA 1FX0B 1XRPA 4YR9A 1S1CA 4S1TA 1FMFA 1LPSA 1XEWX 4MX8A 5E9AA 3BXXA 2GN9A 3L7OA 1EFUA 4NPAA 5C1IA 4CLDA 4AJ1A 1Y3IA 4D4LA 2W0SA 2X4DA 2YICA 4Z0PA 3QYPA 3HV0A 2PKQP 5G1PA 2OSBA 4TTJA 4YXWA 3W04A 2P67A 5B6JA 1G9XA 1XCBA 2D1SA 5I45A 3IEMA 1DARA 4BWVA 2Q21A 1DJNA 4LXHA 3RS7A 2PZGA 2VG8A 1D04A 1ECGA 1CEQA 1KYYA 1RLOA 2GZMA 2QN2A 2VK2A 3HR8A 4ZC1A 4BMOB 4R69A 3RR2A 4LECA 1RSZA 1W4CA 2OOSA 4ZT2A 3H8JA 4AG6A 5I7OA 4Y2SA 3NGLA 4UUPA 4AP6A 4XTCS 2L17A 2JHCA 3ECAA 5ALHA 3WGVA 2P9YA 3HCWA 4OD0A 3E2MA 5ALKA 5B6IA 1B0UA 2XXJA 5DBHX 2YFHA 4Q18A 2BHNA 3QHPA 3OCYA 4KAAA 2XMZA 3PWTA 4RD0A 3UK1A 2HCRA 4IHJA 3V1YA 4DZRA 4HDMA 4RZIA 2YXEA 4IPTA 4MI1A 5KAMA 3RTBA 4ZZ0A 3HDTA 1XBTA 4BX2A 1KAOA 4U6QA 1AD2A 1XAGA 5BSKA 2P2GA 5B3AA 3GRYA 4FZJA 4XEHA 1BDIA 4OX9B 1FFYA 1O94C 1FFXA 1H3NA 1ORWA 1R0YA 8ABPA 2GEVA 2ZB7A 3VNRA 1NP3A 2NAFA 3V4LA 3FX2A 2V7WA 3ZH9B 4CR7A 1Z0AA 4YJ2A 3B7GA 2CLSA 3H1FA 2CXHA 3OPYB 3RBZA 4DRXB 5IZ4A 3MT8A 3HK2A 1CDEA 4OK5A 5IASA 1I3KA 1GNLA 1Z7YA 2ZGVA 3EWIA 3K5PA 1PL0A 5IN4A 2WJAA 3PVZA 2GUWA 1USKA 4RKWA 2CWDA 2R7LA 2WD8A 1Z36A 4HQ0A 4P22A 3UY4A 2DBZA 4YAIA 3WO1A 3PGJA 1M34E 1S9HA 1QYWA 4QU9A 1KEEB 4X65B 5AMXA 3T7TA 2DULA 3F7TA 1X7YB 1TKBA 1SH7A 2A14A 4BX3A 1NF9A 2FUKA 4G5YA 2PKXA 4U7TB 5T3YA 1O0SA 2J5BA 4XJXA 5D85A 2IHYA 4MWDA 4HNSA 4MKHA 5B58C 4J0IA 3HCCA 2FSVC 5TB5A 1TZCA 2IP1A 3VDRA 1U0RA 3VTAA 4IIJF 4CTNA 4RY9A 5T4HA 2IIBA 5E8RA 1JTVA 5IJ0A 2XD4A 3DDUA 4Z0HO 3D6HA 1WEKA 5GQSA 4WGGA 2FCRA 3NGMA 4C7BA 1T3GA 3VR3A 5AKKA 4UASA 1A5TA 2ZYTX 4RXTA 5G40A 3IPCA 2FQWA 5F33A 4KIFA 5IK2D 1U1IA 2XTAA 1HR0B 1GQYA 4EUSA 1UT8A 2PBFA 2E5LB 1P6XA 3ANSA 1NYTA 3I9MA 4C6TB 1X8LA 1FFEA 1ZGAA 4P7FA 5DNYB 1GRCA 3NLLA 4RLHA 4YT8A 5JMTA 1JA9A 2IUSA 3HO6A 3K1ZA 4MKZA 3T5BA 1XMOB 1EK5A 4ZYVA 2XGOA 1DELA 3FROA 3NHWA 3NM6B 4KFUA 1KRXA 3N7UA 2IHKA 2W6MA 1GUZA 4RJIA 5IJXA 1GG8A 5E2IA 1JI0A 1P1IA 2HQSA 1NZJA 2ORWA 3BTUA 4DZTA 5AW0A 4AJNA 3MFQA 3NUQA 5E2BA 4EGFA 1EGAA 1FQOA 4NS4A 5AM0A 3HFJA 5L6LB 5MN5A 4FD3A 2WTAA 3DMTC 1K66A 1YDEA 4UQLA 1WCV1 1QIGA 1YTLA 2JC3A 4K9KA 3VOTA 4HDOB 4XVCA 1QGDA 4G5GA 5IULC 4HDSB 1SPBS 2GN4A 4YQFA 3UMSA 1G20A 5CITA 3BA1A 1IBRA 2YTZA 3KPVA 3NWJA 3OKCA 2I7TA 2QI9C 4PLWA 5AUNB 1Q0RA 3WDMA 3NJ8A 4ZVLA 3UXEA 3KSUA 1VLZA 2Z04A 2G25A 1PT6A 3IEVA 1XRMA 1SIWA 4NJEA 5C7LO 4DA0A 3B3AA 4MULA 5JHHB 4KJXA 1YRYE 2BMWA 4G65A 2AKYA 3CG4A 5ALFA 1G4AE 1YRQA 3G5LA 2JGDB 4KH0A 2WFLB 3WC4A 4P6VF 3B1ZA 2CLLB 2ZBPA 4M88A 2JS7A 2Q6OA 5B1DA 3F3YA 5DEIA 1B7GO 4GL4A 4X1KB 5GZ6A 5K3AA 3WICA 3KOMA 5EUBA 4WNIA 1ZJWA 2IHTA 4TL9A 1D7OA 1ADFA 4CMEA 3OMLA 4OI1A 2PMWB 2NOAA 2PZLA 1PBNA 1EWQA 3GGPA 3JASB 1QU2A 2BM8A 3NOXA 3PWZA 3Q9LA 1KI6A 1YS9A 3KKOA 4DJ5X 4P54A 4TX1A 2XHZA 1HDZA 1OVGA 1S89A 2DMRA 3MS4A 2QJFA 3RB8A 1RZ3A 1U28A 3DYIA 1DG3A 5AOBA 5HJ7A 3SNKA 1FTSA 1WDTA 2BMVA 1JLHA 2E4VA 1DKLA 4QU5A 3R75A 4BNFA 3GZJA 3N8NA 3AEZA 3GO4A 3BZUA 3BGDA 4QU0A 1E1LA 1R18A 1RFLA 4NDAA 2Q3CA 2EARA 3Q0EA 1GZ5A 5EJGA 3SQLA 2BGGA 5HQJA 1XD2A 1NQUA 3LTNC 2HJSA 1WWKA 2H4XA 3NAMA 3MTDA 4YYZA 1JS1X 2IYTA 3GZNA 1E79A 5C9ZA 2PZFA 1L5KA 1WV1A 2W2KB 1WD5A 3V32A 4EFNA 5KU7A 5EYPA 3JQGA 4DLTA 3AVUA 3TJRA 1QTNA 4G25A 3NC1C 5CEJA 1FP7A 2HIAA 1UXJA 2ARKA 3O4VA 4A2PA 3G0HA 1KYQA 3E58A 3A3YA 4MV9A 4MEAA 3WBFA 1AK9A 3VU9B 2OESA 2Q3LA 3EAGA 3SIPA 4DQ0A 1PL6A 5IVIA 2IHVA 1D2AA 1ZMXA 3CKKA 5ER6A 4BVLA 2I03A 4LJRA 1KL7A 1GYRA 1HDCA 1SQ6A 5JSFA 2FLVA 5IM4A 1COWA 4MWSA 1XN1A 3DZ8A 3GARA 3QVGA 2Z5FA 4OAQA 4YRCA 3THRA 3W5HA 2IIPA 2YYAA 3GXOA 3HXPA 3I9V1 3D8TA 4XRRA 3SIWA 2JFQA 1WCYA 5CFNA 2VTKA 1NJ5A 2GAFA 4AJKA 4N5LA 4ZV7A 2EP8A 2YVLA 5CLGA 1ZIPA 4TWAA 4JKIA 4RPKA 1E18A 3K6JA 3MCTA 1J39A 2IDZA 1Q44A 3KJQA 3OP4A 3PGXA 3R3YA 1EFRA 5KYKA 3V7FA 4XCXA 2BAGA 1KOGA 1OH5A 3D6FA 1Q50A 3GEGA 1COZA 2BFFB 3K9LA 5ERXA 4CMHA 1RJWA 3B53X 1NSFA 2WYIA 1UAAA 4BE4A 4KZPA 4LG1A 2CL5A 2QX7A 5LYJA 3BXPA 3KKQA 3LWZA 4FFSA 1NUHA 1AS3A 4DV0B 1JDBB 1LDBA 3DKVA 3QU5A 3DZGA 4M0LA 3E9NA 3ASUA 3NU1A 1BS2A 2Y1GA 1JKFA 1O6GA 3UZUA 1NVEA 2V1XA 1Q21A 4M0UA 5FWXB 1PNQA 1M6VA 1MPTA 1IU9A 3TW6A 4A36A 1BX3A 2NQ2C 2QKYA 3CR8A 4PGMA 1PK7A 4PFKA 3JD2A 1VHDA 4MR8A 4O2BB 1YB1A 2FGKA 3QE4A 4YGYA 3RWBA 1S3GA 4UUMA 4WRRA 1YR3A 2ZU0C 1YU6A 1OWNA 4KQIA 4EYOA 1NMSA 3PIIA 5KYXB 4LNUB 4QGSA 4CKCA 4FMCB 2QMOA 4NJMA 4RL6A 5ESWA 4BB6A 1YZQA 3MB5A 4PS1A 3K8YA 5JAOA 4TOIA 3RREA 1XLTC 1BG6A 3LPDA 1VL6A 4K28A 3QWAA 1E1MA 2R47A 2JARA 2P9EA 3LC7O 1E4OA 2OHOA 4WKPA 5CNJA 3V8MA 4W6QA 3LP5A 1XZKA 3HBLA 3W78A 2I1WA 3ZDFA 3AP2A 2J33A 4EBFA 2IP2A 2JGFA 4MHTA 3ILSA 4O4LB 4YCSA 4Q15A 3TRKA 3BMCA 4YJ2B 4PNPA 1GHTA 2ZYDA 5GONF 3L9XA 1KOLA 4D4KA 5FBLB 5U9CA 4GMHA 4Y9TA 2Q9BA 4LI0A 3ECSA 4K1XA 2EIHA 4A6DA 3QPVA 5IAOA 4FGSA 1DAHA 4MV7A 3GOHA 5KZMB 5CB0A 2QXTA 1A96A 1Q16A 2REQA 3HCAA 1U7WA 4JT4A 4MKXA 3MA0A 3TIFA 1B0PA 3SJBA 1VE3A 1Z7WA 3RWMB 2C3UA 3IEKA 3A3OA 5IDXA 5FA6A 1K5PA 2Y3IA 5B55A 2ZJ2A 1JHMA 5DI3A 1J0CA 1I01A 1U90A 1PUXA 1V11A 3EAFA 2QORA 3EGIA 3TM4A 4CEHB 1EVEA 2QMHA 2ZRFA 4GI2A 4N8EA 4RHEA 4QO8A 2C95A 5E8JA 2TSYB 2QG6A 1DIOB 3S7ZA 4DEVA 4DOMA 4ZDJA 1UPCA 4W5QA 4QQRA 5IYZA 2WFZA 1EP9A 2JVIA 4HFMA 5IVDA 1CJVC 4WNYA 5DYGA 5IYZF 2PKEA 1ZCAA 3VPXA 4Z4HA 3EIXA 3HLYA 5IX8A 5EKSA 4OKSA 1U80A 1O9GA 2IYUA 3R77A 4DR4B 4LZJA 1VGVA 2JFFA 4D9FA 1UUFA 1EI9A 1LI7A 1SOWA 5F2NA 2SKEA 3KZXA 1C3LA 1K4YA 2VYFA 2BLLA 4HNUA 1KJQA 4K0KB 2OGUA 4L85A 2J1LA 3OPYA 4AKTA 1PJBA 3RYFA 1UZMA 1GTL1 1J0DA 3FF4A 4FN5A 5BR1A 2ABWA 1BGXT 4L08A 4BRWA 1MOZA 2W00A 4IQFA 1PKEA 2L82A 2X77A 4RUKA 5HE9A 4DADA 2A0XA 2PQ2A 2JZNA 3IULA 1JDZA 2JHAA 4LV6A 4CLRA 1ULTA 1R16A 3IB3A 4BZPA 4DR2B 2QE6A 2CLIB 2X1LA 1LBEA 3UYKA 1AHHA 4RSGA 5B37A 3RARA 3E7FA 1X7GA 3LC1O 5AKIA 1VLQA 4XYGA 2OXRA 3L6OO 1A8UA 2QTZA 2V98A 3L8YA 4W82A 2C5HA 2Q4EA 1RE0A 1PTKA 3G0CA 4FZVA 3PQFA 2L42A 1V7QA 4QHTA 1RPAA 4QC2A 4M7RA 3GGCA 1Q5PA 2EKDA 5FOSA 2OZLA 1MHTA 1QRRA 3UUEA 2OZKA 5H3LA 3G2MA 2M98A 4L50A 2R1VA 1BKDR 2EKQA 2X5XA 3K3PA 4JSYA 4ZA2A 3GCZA 1X1DA 1GPKA 4KYTA 2R6CA 3D2BA 1HFKA 4AX4A 3GPBA 5BRJA 2FH5B 1NUUA 3U19A 3E70C 4HQFA 4KDEA 1FX0A 2DFPA 1WMFA 2W58A 3DFIA 2E6UX 2WUDA 3NORA 4K03A 3CT4A 1JYSA 4MQFA 4YC7A 5DHSA 4EVIA 4KR0A 1PHRA 1RXCA 1S2OA 2W90A 5KC8A 3JRXA 5ER9A 5HKOA 3QY9A 4FUTA 4MAAA 5H5JA 1L5NA 4DCNA 4E46A 2X8JA 2OBBA 2RI0A 4HNRA 2QQEA 3V7YA 1FOEB 1MMFB 3FPAA 4C0XA 1ZBDA 1DEOA 1L7NA 1ORVA 1RABA 4GOMD 1U1GA 1BXRA 1H4TA 2OD9A 2JJMA 5KYUA 2H4HA 2SKDA 1PCXA 1B42A 2B4AA 2WZBA 3L0PA 4MV6A 5I7SA 5ES4B 2GBGA 3GJZA 3ZK9A 4G37A 4QXRA 5ADHA 4QELA 2CK3D 2FETA 4LTMA 4EX6A 1GRNA 4CEJB 1C7RA 3QVKA 5EL0A 4IRUB 4EPVA 1Q91A 3AV3A 4JEUA 2XWBF 2J0UB 1L7MA 3K8ZA 2D0OB 3WZMA 4YJFA 4DCGA 5FUQA 2D06A 4FVTA 3RSHA 2G3YA 3COWA 3QUTA 1GSIA 1BGVA 3KJNA 3QVJA 2X40A 1P39A 2BI7A 2IDKA 1BXRB 3I28A 3RNLA 1JWBB 5T4BA 2XBUA 2HWUA 4MPTA 4UBIA 3NKVA 2XCQA 1YIAA 3G9TA 1T4MA 2DQZA 1YFZA 1VL8A 1S3SA 3RVLA 2PSSA 2QI9F 4LSZA 2EGUA 2IHJA 3CUEF 2Y99A 3ESYA 3PC3A 3DB1A 3IAXA 5CUQA 2JHGA 5CFOA 1GFIA 2VWGA 2D7JA 2HTFA 3GMIA 4BMVA 1O03A 1ABBA 4C43A 3JD3A 1EWKA 2P6OA 4QICA 1JF8A 4IFTA 4U2BA 3A9CA 3SKXA 3SN6A 1NN1A 1QBGA 2FUG1 2RB4A 3ENNA 5HWSA 4FR2A 3ECCA 4G97A 5BW4A 3FYSA 3NTOA 4MUIA 4XD7A 2I91A 3ZD6A 1G6Q1 1NSTA 4ZKDA 3ZV6A 5FPKA 2H08A 1HLDA 2AI2A 3V3TA 1L7VC 1H65A 3UMFA 4BNDA 1BXZA 1YI0A 4Z3DA 4OGGA 3WLQA 4R0MA 2AMFA 2WJPA 3O83A 1UZLA 5HUQA 4J9UE 2X9NA 2W6PA 4J4TA 3OMWA 3QJ5A 4DYVA 1IQPA 4DNOA 2QRJA 3HDQA 2EJTA 4XB1A 3M9XA 4J90A 2QZ4A 3CT6A 1RCFA 4RTMA 2AZTA 3LC0A 3T3GA 3UUGA 4BN5A 1DCTA 3ZDDA 3ER8A 3QKIA 5A9RA 2QZ9A 1JXOA 2H3HA 4N65A 4JI1B 3T7AA 1QB7A 4BNUA 1E0JA 1YULA 1XHFA 1RW4A 3CQ9A 3DV0B 3PUXA 2J0SA 4OJNA 2RMKA 4RPJA 3QLJA 1N6OA 1O6FA 3E0XA 4D9GA 5DM70 5E9JA 4YHHB 1NZDA 3PPIA 5CT9A 4P4SA 3E27A 3MRXA 4MCIA 3UT0A 4ZIRA 1JAHA 2WM8A 1TW3A 2RK3A 3C3KA 2R5WA 5JY6A 1WA5A 3ZXYA 4ALJA 4ZYXA 5HFNA 1GO2A 3SDSA 5HZHA 3AUXA 2PZJA 4X5OA 3IA2A 5MDHA 4P3OA 3K9NA 1PV2A 4OATA 5CW2A 1GL3A 4L5CA 5AVJA 2FP3A 3PR2B 1SK8A 5FL7A 3CUTA 4I3HA 1GAXA 3ROEA 2MMGA 3QVVA 2IEDA 1CY6A 1IN6A 2R2GA 1OFGA 4R1UA 4G56A 5HFJA 4JC5A 3L18A 1J1ZA 1L8OA 2GZSA 5AO9A 4MXDA 4KIJA 1Z4OA 2Y68A 1Z06A 1KYVA 5BV2P 5EUQB 1HL7A 1TTPB 5CLJA 4UHEA 1RRVA 5IKEA 2J9GA 1TM1E 2EOAA 3THXA 3I8OA 5GMOA 3DS8A 3I32A 4FMDF 2PD6A 1WETA 2NSHA 1BE8A 2WSSA 3OFJA 3RS0A 5U4XA 5KC9A 3IAM1 1U8UA 4F5YA 1ZNXA 3BIFA 1SKUA 2WWGA 4MPRA 4BX9A 4D8UA 5ICFA 5E4JA 1QH9A 3OSUA 3AETB 1JBEA 3AEQA 4PAOA 2P8SA 5DLQC 4RTLA 1W30A 1T3TA 1POWA 5IEJA 1UT5A 2CVQA 4GU5A 4RDCA 2BHLA 2XY4A 2O2YA 5HDQA 1TMKA 3AF3A 2O0KA 3HUDA 5EOVA 2O8DB 1H85A 1ILWA 4MKIA 3RJ9A 1NJ2A 3OBBA 3U9SA 3B51X 3NG1A 5KSOA 1L4UA 2G6TA 3QPAA 3RK4A 4B76A 3CEMA 4CNQA 4OHCA 4MSUA 1A2BA 1XCMA 4DSAA 2QW8A 4X6UA 1VGRA 2PL9A 3EH2A 2SNIE 2H9AA 3LJKA 3PFIA 4WLUA 5THKA 4EVRA 4TYMA 5KNBH 2EFGA 5CURA 5EZYF 1L8XA 1MG5A 2EZ8A 1BXGB 2F7SA 3HKBA 1Q3HA 2YIVX 3JQFC 4QBIA 3VO1A 1I3MA 1N5JA 2Y2VA 3Q7IA 2RBEA 4OXQA 1E2EA 5I9IA 4HGYA 2JBAB 3LUPA 1V47A 3DEFA 4QTTB 3ZCPA 1EWRA 1M1NB 3FNQA 3GJSA 4BRUA 3ZD7A 3I8XA 2C99A 1R4ZA 3I4LA 3O4RA 3OJ0A 4KQKA 4WD3A 1Q22A 2IHBA 4Q66C 5DXJA 5JD3A 3RHZA 2FN4A 2ZPUA 4QKQA 4XKJA 5JDIC 4WFQA 1G5QA 1X74A 2B69A 4EA6A 4IDEA 1SUDA 2ZJ7A 1IDN1 1NXXA 2CMFA 5F7JA 4XB6B 1TEHA 2FZGA 1BIFA 3T5CA 1O3YA 3L3BA 2R3SA 4W1QA 4WACA 4EB8A 5JJBA 1QPBA 4NBSA 2WAXA 3S8MA 1J1IA 1SXJC 1NR5A 1P4JA 3FWNA 4CKEB 5A3RA 2I2WA 2HQRA 1MRSA 3DL7A 4NYJR 3QOWA 5JYDA 2RGRA 3KQWA 1GGJA 1GP2A 2XCOA 3PX3A 5JASA 1RRKA 5DM0A 3ONWA 1CY0A 4X7PA 2GBCA 3TRIA 4GRDA 1YL7A 4C01A 1O8BA 1DKOA 3H2GA 1HT2E 1A8QA 1LS6A 3ZUPA 4EUNA 4DDTA 1TPYA 4C0JA 1E7YA 4BZQA 1S8AA 3NDPA 4LTDA 1RHKA 2XEXA 4PQRA 4N7MA 4EQZA 3L49A 4H18A 2I76A 1QH8B 3L7MA 1LQUA 1PKXA 1ZAKA 4H2DA 4D80A 1J8VA 1KTVA 3BQ9A 2V7QA 1PI3A 2IC5A 1XZGA 3RS3A 4TV8A 2KLHA 1DO8A 4A82A 1GYQA 4OJTA 4ETNA 2E1RA 2YS7A 2Z08A 3OJLA 4B43A 5FPHA 1E3DA 3UK7A 5A02A 4P3YA 4ETMA 4KXUA 1I32A 1NF2A 2FZ5A 3OKAA 3U3XA 4PG7A 2CJXA 4C5AA 5J43A 2YV2A 3W9BA 4D74A 1JKIA 2FPKA 4WT7A 1L4MA 3OESA 1P4SA 3EOAI 4G07A 5IBPA 1DFHA 4DMUB 3BKWA 4EL0A 2H4ZA 1A9SA 1W93A 4FGKA 4JUFA 2BR4A 5F98A 3NV9A 3C39A 3HUTA 1UAYA 3OTHA 4DXDA 5J4YA 4ZVOA 5L3QB 2PDAA 4K26A 3FETA 1YFJA 2Y4OA 1H2XA 1QTRA 3BZWA 3ABRB 3VHXB 2V54A 4GZ3A 5TT1A 5AW7A 4M98A 2RKBA 3U7HB 2WA2A 1L3BA 1B41A 2C57A 1E3EA 1FYVA 1QCCA 1PR5A 1JAYA 2VF8A 3L8DA 3PQCA 1T9ZA 4PPGA 4URHA 4ZXFA 3UQYS 4Z0NA 2FJ0A 4BVKA 4F06A 3LUFA 4NESA 1L5RA 1ES9A 2R79A 1B3RA 1JT9A 2I6QA 1UINA 3ZCVA 1T10A 3EVFA 1A4UA 2TRSB 1H1LB 3RFCA 1WXEA 3DPIA 4OH7A 2PSHA 3WYDA 3QU7A 1PTJC 4JUIA 2W83A 4M1EA 1KE1A 3OJFA 3HBAA 4C4OA 4R0NA 3HKEA 4XUCA 2ZYWX 5EEGA 3OEWA 1I6LA 2Q1WA 1G18A 2ZREA 3FPHA 3M5DA 2F4NA 3K4HA 4H3SA 3MN1A 4N54A 4B7UA 2Y76A 3U4QA 1Z4MA 2R1ZA 2YCLA 3CZRA 3TAHA 2YYYA 3V8EA 2X13A 4CMGA 1EDEA 2HADA 4FEGA 3H6KA 2OGSA 4QVIA 1FDVA 3O8CA 1FYEA 5AM5A 1U2SA 2C9MA 4HX9A 1XZFA 2ZROA 4RLQA 3VHQA 2D74A 4AAYA 2ZCVA 3T3EA 2ATEA 3R9KA 4B17A 3TVDA 2JAQA 4DM4A 3NASA 2NX2A 3U5TA 3BRWA 2XGGA 4RA6B 4GXNA 1CSEE 3KYDB 1T8TA 3I2IA 4PONA 3STUA 2YXBA 5CVEA 1W88B 4KBGA 4PXYA 4EFLA 3PFFA 2H3EA 1YF3A 1XCJA 2GO1A 4WINA 1GFZA 4EA8A 1P3JA 4BQQA 2WWHA 4UJ5A 1EVJA 5HMLA 2JHPA 4ZCQA 3REQA 3PHLA 1GTG1 2VR1A 5CG2A 1AGXA 2DR2A 1VMKA 3UA4A 3F2IA 4L0MA 3WGGA 4W7SA 1ESDA 3H84A 3KXPA 4K9LA 2QLJA 4N8DA 3A10A 1LC3A 1XIVA 3E22A 3NT2A 3HZHA 3QENA 2DFNA 4G1BA 5CGZA 4RCVA 4JYZA 1T9AA 3BMXA 3OU6A 3FDZA 1ZICA 4GNRA 1RAGA 5JADA 4NBNA 1CZUA 1Z25A 1EX7A 1R6VA 4PVCA 3FOCA 4ENUA 4NJOA 5GGXA 4N9QA 4XA8A 2WYWA 1NMXA 4ZHQF 3L0OA 3GP5A 4Q03A 4AN0A 2VK4A 3PC7A 5AVXA 2Q0HA 1UZNA 2GTPA 1CD5A 3CONA 3BD9A 2HKIA 3DONA 3B6JA 2JD2A 3EXG2 4INAA 2PR2A 2OAGA 4MQ4A 4UXHA 5DHQA 4B6JA 3R1IA 3IBCA 1WW8A 2XYHA 1RJGA 3A6ZA 3F3KA 4YREA 4F3NA 4L7VA 2WA1A 1KA9H 2O8NA 3DZFA 1T0IA 4E4YA 1RMTA 4N3CA 1KXZA 1ZM9A 2DE0X 2KBEA 1WDMA 2D5BA 3M1LA 4G0MA 3E3MA 4BVGA 1XP8A 4EG6A 4OXNA 3REOA 2HL6A 1A9YA 1PR2A 3AF4A 2JIDA 3T3PB 5F4BA 1XMQB 5FO1A 1SUSA 1YZLA 2AB0A 4DNFA 1SO8A 4I1UA 4TMXA 1XLVA 1X39A 2Z5VA 1XU4A 3D8NA 4NPCA 5EGNA 4C7MA 3LT5A 3F5QA 3O3MB 4GHWA 4J1TC 3ZQKA 2OOKA 4OK6A 3ZC3A 1K5HA 3BL6A 3G1WA 5K0SA 3QOXA 4YAOA 3QVXA 4QYIB 2M1ZA 1L5WA 4FSHA 2ZJ0A 4OHVA 3L4KA 2A1IA 3BFKA 1PL8A 1XVUA 2XPCA 3GPDG 4KXXA 4KMSA 1F48A 3K6RA 1Z6YA 1AIPA 2JIZA 2Z1MA 5JWRA 1EJ2A 2Z8XA 3QTLA 4GZ5A 5CT5A 4ZO8A 2IYSA 1PHPA 1G0NA 3RHTA 3EBOA 3U6KA 1N1DA 1EFDN 1DSSG 4IL5A 3W7VA 2JVKA 4K8RB 3F49S 4BRZA 1YRHA 1WZCA 2OHGA 3R3UA 4B79A 2B8EA 1VSTA 4MAMA 4Q4AA 5H7XA 2I3ZA 3ROQA 1QG6A 3OPVA 4DG8A 3HV2A 3I53A 5BRAA 1Z15A 3DD5A 5FHRA 3E22B 2A33A 3DH0A 3OKFA 2JZCA 3N5KA 3A9SA 5EIWA 4OQZA 1NBWB 1A8HA 4C78A 1W9MA 1T3ZA 1ZL0A 3G0DA 4K9SA 3OT5A 2AOUB 3P2IA 4YCBA 3T9DA 5JYBA 4KR7A 4YAWA 4ND5A 3I62A 2H2IA 3B1VA 5IN5A 1AF7A 3LKZA 3P0EA 4R83A 2X2FA 4ZCIA 1XJ5A 1L7RA 4V1CA 3BTVA 3KT3A 4ZOLF 5DT2A 2C92A 2AOXA 1HE4A 5EE5B 3X44A 4C08A 3WAGA 2JFXA 3GPLA 3S1SA 4HH4A 1H0RA 5AHKA 1UBEA 3K0FA 3MXOA 4E3ZA 1DC8A 4L9RA 2VZ0A 1BMFD 4AY6A 1U81A 3QLUC 1VCMA 1PWEA 2IE0A 2F8SA 1UM9A 4DY6A 1E6EA 1HY3A 4CF6A 1T0PA 2RGAA 5HGJA 4J1NA 1G4HA 4K6CA 1W5TA 1THZA 4GLJA 3ILXA 2X8LA 5ANRB 4D46A 2VSOA 5CCXA 3DYVA 4JYBA 3C70A 4HG2A 2DHDA 4ARIA 3VO2A 2DKOA 3PEFA 1N57A 2YHIA 1CIVA 1N7JA 1UFRA 1DCFA 2NUBA 2ORVA 2YV3A 3B89A 3DE0X 3H1AA 4ARSA 3FFAA 3QLTA 3VR2A 4RPLA 4F2PA 5EERA 4ALMA 3HHEA 4V0RA 3GQVA 1JSZA 3CS3A 5I4KA 3H5NA 2YZKA 3CKMA 1P6QA 1I7SB 3DLAA 2CXXA 4J2TA 1E89A 2NYRA 1H2AS 2P0EA 3DDHA 1C3JA 3HO8A 2HDWA 4H08A 5DBGA 1VLLA 1LD3A 1OV4A 4ZALA 2XAAA 1RQNA 2D0PB 1Z2CA 3EYAA 3I4FA 4ZT5A 3PEWA 1TF5A 1ZCBA 1AZLA 1JG2A 1K75A 5C5EA 1ZOSA 4JZYA 4AO6A 4BVAA 3NHSA 1T4CB 4JB8A 1O5TA 4HQKA 3BMOA 2QLMA 4RM2A 3L04A 2ZIXA 1CUYA 2PO5A 1YDHA 2QVLA 2NV6A 3CC8A 1HYHA 2E55A 3CGGA 4GPD1 2GERA 1WUKS 7GPBA 3A3KA 1IPEA 1ULUA 1Y1TA 3OHMA 5D86A 5LM3A 3TW8A 2IYOA 2Z3VA 4D3XA 2X0KA 1T5OA 2AG1A 2EKLA 4RJ2A 3ZWBA 5EUMA 4PFQA 1HDOA 1KQ3A 2GNOA 3AK4A 4MCJA 3W5SA 4CQMD 4CM6A 3C3DA 1J8DA 4IICA 5JMOA 3RSSA 1KJWA 3QEKA 5CX4A 5ECYA 5LKRA 2YH2A 1IOWA 1Q1NA 3QBVA 4RPGA 4ZI7B 2V7EA 1BDBA 5BUSA 4ZMRA 1NY5A 3P2KA 1AUPA 5DHRA 1U2TA 4EI7A 1E98A 1FK8A 1DRKA 1UANA 5A0FA 2Q2OA 1RR6A 2J3QA 1NMYA 3PDWA 3E82A 5TEVA 4BFVA 1JKXA 4AG3A 4C7VA 5BXQC 3K96A 4OU5A 5CU7A 1KJ8A 4XYMA 1WHTA 2PAAA 5ALQA 2DQSA 2XW6A 2G5TA 2WG2A 2BMFA 5GP1A 1Z74A 2AFVA 5KTSA 2G5CA 2LCQA 2J85A 5I5GA 3EDMA 4DQLA 1DPFA 5FCDA 3U3ZA 4BKPA 1P7PA 2DHQA 4CEHA 1NLMA 3FHCB 3N2NA 4QIHA 4W5WA 3ZGZA 1X14A 4BNJA 1AURA 4A16A 1SQGA 1NM5A 4YTEA 1P74A 3AIKA 5HOQA 1BTOA 4G86A 2DM6A 4QHSA 4KNYA 5DMXA 1GTMA 2E21A 1VB3A 3OLWA 4IRMA 4ZDKA 4B6FA 2YWBA 4UMDA 1M10A 2CHEA 2IKQA 4FONA 2A94A 1JMVA 4WECA 4ZTBA 3ZW9A 4BLWA 4WN3A 4W7HA 2H2DA 1GD1O 4OQNA 4G1CA 1FDSA 1P2GA 2WFLA 2J3DA 4XLTA 2VIIA 3AWIA 2R00C 3VZSA 2O7QA 4EQ6B 3TKAA 5BNIA 1EVLA 4B1FA 4DNPA 2CNNA 1RC0A 3YASA 3TLEA 2GWRA 1V4VA 3X2SA 2XB6A 4EAAA 3H99A 1R7RA 1QRDA 2HBYA 3PICA 5KNBD 2QMEA 1DGQA 3WDLA 1RWXA 4Y1EA 5GJVC 5HR5A 1YR9A 2DF8A 2ON6A 2PZKA 3A1CA 4C88A 2L19A 4CEIB 3HMQA 5DWDA 3PE6A 1QHSA 2XNCA 4LUCA 4M1TA 1IONA 5JNWA 1EINA 2J4FA 3TCKA 2WWVD 4N01A 1T1EA 4FKMA 4F6LA 2D1QA 4LC9A 2ANBA 4TTVA 1I36A 3NXKA 1FSPA 1HO3A 1T34A 5K1ZA 1NVWQ 2Q3HA 3MTBA 4G81A 4RV5A 2NO0A 1B43A 5DBEX 2DUNA 3IIJA 3GEPA 4RAOA 3G5AA 1UAGA 1VE6A 2EF0A 3QYFA 4IX1A 3ESAA 3H87A 4B9AA 4D4IA 3QKWA 5CD1A 3AY7A 3PRJA 3ZDCA 1T2UA 2ZAIA 10MHA 3UG6A 3FKQA 4PC6A 2GM4A 1ULAA 1M2OB 2DEUA 4IIJA 2PX3A 5IKXA 1Q0TA 4NQZA 3TZKA 2GEKA 5ICGA 4XXHA 1OBFO 4I5IA 1J70A 3IX7A 1U0HC 3A4LA 5AKHA 3OT1A 2OC9A 5DYNA 5I7VA 4BIIA 3WRWA 4B4KA 2PUBA 3AWDA 5JRDS 1NG1A 2AR7A 2JEYA 2V5VA 1D2MA 3OTQA 4EPTA 3MELA 4EH1A 4IJVA 4JB2A 2JFVA 4UD2A 3TZCA 2ZDGA 2VWQA 3WYAA 1EYZA 2RI1A 1Y7IA 1X80A 3AGPA 5ENZA 1G21B 1OX6A 2Z09A 1VFNA 2Y0EA 3D59A 1ZVJA 3CNNA 1A76A 1E59A 1E6KA 3O8LA 2JFBA 4M8NE 1QC5A 3V8BA 3LAWA 1UXIA 1KIMA 5BUCA 1RE1A 4TZTA 1V6AA 5IC6A 1OH8A 1V9SA 1P8AA 1VIMA 3TTWA 1N36B 2EU8A 4KXVA 1V3QE 1Y6FA 5JTTA 4TMTA 1ZNQO 1GITA 2I22A 3J7TA 3HL4A 4TUYB 1RT9A 2V3WA 1J7KA 2ECFA 2WRZA 1CS0A 1ZIOA 2QAIA 3MGAA 4PC3A 2EDCA 5CLHA 1JU3A 5KQPA 3CZMA 3E1KA 4NY1A 4DPKA 1ISSA 3RIMA 1P2FA 1WMSA 3G23A 5IDVA 1ISGA 3KLMX 3MTGA 4XQEA 3Q7SA 1ZD5A 1ZS9A 4RGVA 1QLWA 3ZKWB 4BCCA 3JV7A 4R9UC 4FB5A 1QVZA 2GVNA 5JJCA 2OFWA 4PAMA 2AKEA 1JWLA 3QKRA 2PIDA 2YZMA 4XWTA 3GY0A 3QUQA 1CY1A 4UFNA 1TQ8A 4NG4A 1SOAA 3WL6A 3EH1A 1X8KA 3OX4A 1GUBA 1NASA 3G7SA 3G2LA 4F11A 2VBGA 3TTSA 1DUIA 1WBBA 1EU1A 1SD1A 2OLEA 4CV2A 4S04A 2NZ8A 1R5NA 2VA9A 3B13B 4OQEA 3DHNA 2EQAA 4INJA 4NCAA 3T3IA 1XTRA 1U94A 2Q4DA 2GETA 1HT0A 1AHNA 1AUXA 1M74A 3FPLA 3SHQA 3TIXB 4JR0A 3UTDA 1HFJA 1T5BA 4FLMA 4FWBA 1H8HA 1BEZA 2H51A 3I92A 1ZH6A 4LYHA 2O1SA 1RBQA 2QD4A 2QIOA 3DBRA 3SXPA 1A8SA 4LBYA 5B1YA 3G2JA 5JSUA 2OAQ1 4TVOA 5DI9A 1QF7A 4MV8A 3H86A 4N6OA 4K3VA 3VYVA 1R4MA 3LDGA 4NNPA 2AKAB 5TNXA 4OLHA 3KL2A 2CFCA 1H66A 2FMXA 4DBLC 1PT8A 5G1NA 1MZVA 1XTVA 4BAZA 1OH6A 5DM60 1AKQA 1AQIA 2BKUA 2OORA 3AW9A 4FZRA 5L4SA 1MTOA 2GN0A 3SX0A 4Y2PA 1BGWA 1OTYA 5EVCA 2IZOA 3OJWA 4I99A 3LCJA 4RHUA 3ZW7A 2ZZNA 2AZXA 1GA1A 1U4NA 2EJCA 3AL3A 4MV1A 5AVYA 2ZSKA 3G17A 4TLEA 3FE2A 3ZH2A 4NJEB 1UCFA 1W2GA 1P9LA 1Z83A 2POCA 1SHLA 1W581 5E6SA 4H7HA 3GAMA 2C3YA 1FBTA 2I4IA 1F38A 5FQOA 4UU1A 1AQJA 4DUZB 2WEKA 3FNBA 1LUAA 1N1GA 1VPVA 4Y1FA 3SYKA 3ZZ0A 4JLOA 3D7KA 3RG2A 2QVXX 3TTTA 1U3FA 1MQ8B 5BVHB 5KWIA 1KR5A 3GUUA 4LBVA 5HS4A 4CKZA 3OQOA 1RWOA 4E4TA 4F85A 1BA3A 4LNUA 4QGAA 3OOSA 1H0KA 4ZT7A 4AY5A 3HCNA 2EVWX 4J0KA 4BGDA 3IBTA 1KI6B 2GKSA 1NQAO 2ST1A 1XU7A 3F3MA 4KWEA 2X0EA 1G59A 4DSNA 3RBAA 3HA5A 3DTVA 2FX5A 2I78A 1YUNA 3OQJA 2F48A 1ZAYA 3AL0C 2HDHA 3EK2A 3ZV3A 4I1YA 2C4MA 4PLPA 4R1QA 5B2ZA 5HEKA 4YP7A 3VYSB 2XVAA 2XUFA 3WAKA 3RFUA 1SZPA 1UFOA 2Q1YA 3CLUC 4KFRA 2HO5A 4NATA 1NYQA 1C0IA 4S1OA 5ULLA 4BLOA 3ADOA 5E3JA 2FSIA 1ZI8A 3AUSA 3OTWA 4D92A 1ZOOA 2R48A 2DLNA 2PX2A 3QE3A 1ZGBA 4PO8A 5G1OA 3FFWA 4E30A 1G3RA 4EW3A 2WSBA 3M2PA 2OHHA 1UBGA 3LUHA 4K2AA 1U31A 1ISFA 2FVXA 3GPIA 3K5WA 1N34B 1N2CB 4MGKR 4IWNA 4DLVA 3A7DA 1F60A 2X86A 2BFEB 4BPRA 4MR9B 1IK4A 1Z0FA 1SD5A 3ITDA 3THWA 3NVAA 3OOEA 1YXMA 2PYIA 2ZR7A 1KZ4A 2XDWA 3H04A 1FQWA 2P6NA 4DDKA 1NXQA 2H1SA 3VKVA 4HXEB 4D3SA 1RPJA 1XB2A 1DWQA 1JHRA 1U0GA 1CR6A 3T5TA 9LDTA 1E92A 2V97A 1SC9A 4LE0A 3U39A 5BNTA 1WBDA 2REXB 3FVRA 1NM5C 5KCMA 1OXMA 2OILA 2HB6A 1G7TA 1REQB 4ZGGA 5KYTA 3GG2A 4UREA 2QEQA 1TYCA 4XI9A 2DGDA 1E62A 2FFAA 2ACEA 1DBRA 1LV7A 3FZGA 4K6KA 3KZKA 2VDRB 2PL5A 2X7JA 1BC5A 5HIKA 4KBYA 2I62A 2PPVA 3STXA 3NAGA 2X3YA 3RUAA 2P65A 2UYYA 4FEAA 2AYZA 2R8YA 3ESBA 5DK4A 5EJFA 4JS0A 2GS9A 3P9QA 4IYJA 4OYHA 4KTVE 5CBKA 5JAQA 3IEPA 5C51B 5K99A 5ALUA 3OQMA 4AS2A 3F6EX 3O3NB 4EAQA 2Z2IA 3I52A 2VT2A 2FI1A 2HXGA 5JCXA 4YDHB 2OXCA 3ZE2B 3DDNA 2QA5A 4NI5A 1Z8HA 1F2UB 1LCIA 3JZIA 4XW2A 1JWAB 3WRXC 4XLLA 4ZAZA 3T9EA 2CJYA 2XCUA 4DLUA 1O95C 1OWMA 4H1HA 4HN9A 5D5HA 4E1VA 4TYNA 2V8OA 3FDFA 3J80A 4MP8A 3AFHA 1EVKA 5CM8B 3UAVA 3ZOZA 2P9HA 1WABA 1BCSA 3C5WP 5KHOC 5KTOA 1OAOC 1AXRA 4O8ZA 4RZSA 1DBPA 2WUVA 4B31A 3ORSA 1JQ5A 3B82A 4N49A 4LYDA 4UTZA 2DQ4A 4OV6B 3WBKA 1M9NA 1DQSA 3K9HA 3RAGA 2B4QA 4ZREA 1JPJA 4W5RA 1BVUA 3HVUA 4E12A 2VNHA 2GKOA 4JOBA 2JW5A 3D4BA 5B1EA 2ZAGA 4G63A 1K3UB 4JUAA 1C9NA 2QD1A 1P1JA 2D54A 1VHTA 3MT9A 2YY6A 5FP0A 3HHPA 3L9WA 3M8KA 4R7ZA 4DVGA 2B4TO 4MUKA 3PG5A 4ROSA 5FPSA 5G4KA 1EXVA 2HPVA 4BO6A 4BCBA 2OMKA 2VP3A 3FW1A 4EZBA 2E1PA 4UDNA 2FPIA 3RVBA 2AWNA 2QQGA 3KYCB 3EZ9A 3PZBA 2HHAA 3HVJA 5AIAA 2Y0BA 2ZTUA 3TQHA 5F9HA 2EFHB 5H3CA 3VHXA 1ZEJA 3HU5A 1M8FA 4L1KA 3OIGA 4M8SA 1B74A 4BQFA 1NZFA 3OZ7A 1OBVA 1SXQA 1RAEA 1KI2A 3AB8A 1WQ4A 2WT9A 3EIFA 1DC5A 5BOSB 2GD1O 3WLEA 1NQXA 4FFMA 1LLDA 2OXIA 1B76A 4RA9B 4RS4A 4U7GA 1XKXA 2Y1WA 5L4LA 3P0RA 1A88A 3A05A 5AW5A 5BQOA 1JHDA 3V42A 2AK2A 4CRWB 1IHPA 5CFLA 3PPWA 2JD1A 4YB8A 3R5XA 1ACLA 1QG4A 4ZRMA 3Q5DA 4CQMA 5A4AA 1EDOA 4KMMA 2LZ0A 1NKVA 3F3SA 4QJ3A 3IJPA 4G9GA 4D25A 4YMLA 4MW7A 5MF6A 4C2BA 2NUTA 4EGJA 3RC2A 2HF8A 2Y93A 2QRMA 3O31A 4KP7A 4ZZ3A 3O26A 1ELOA 3Q3IA 3IDQA 3Q0TA 2CFSA 3ACDA 2WU4A 3QZUA 4TPKA 3Q88A 4JN6B 2LDBA 3L0IB 4LQCA 4O4JB 5DNWA 5IAJA 1BO6A 4LW8A 3LT2A 3DR3A 4X6LA 5IYZB 3DV9A 4EFDA 1N77A 1L9XA 1YOVB 2B2NA 3OOWA 4LK2A 4DJTA 1HTBA 2X15A 4JIMA 4HS9A 1VL2A 3K92A 2YJ6A 3WLNA 3T5MA 4R31A 4B2LA 4LRUA 5AKJA 2QX4A 5AHWA 1E8MA 3UT5B 3RAFC 1PFQA 4IVNA 3QEBZ 5LWQA 3V2IA 1KDTA 3CKYA 4JENA 1X7WB 3BXZA 3IAHA 4URZR 2GF2A 1JKJB 2JZOA 1DKPA 1JA1A 1EFPB 3IYLW 4PYKA 1CRZA 4RESA 5J9FA 3NTRA 3N74A 1F0YA 2HMTA 5AW2A 3PIRA 2VWPA 3OC0A 1EUYA 3K32A 1TA9A 3U7RA 2A3NA 2DUUA 2P6UA 2QTLA 1JR3A 4WK2B 5FI5A 2LGJA 1SZDA 4X91A 3AKCA 1EBFA 3I9LA 5LUAA 5TMPA 4MUBA 1CB7A 4JJFA 1IY8A 1A1VA 1OJLA 3I9JA 1GAQA 2WTBA 3SGLA 3LFTA 4BNHA 3FWKA 1WV0A 3TX6A 1QIFA 1PJZA 2QSYA 5C80A 3CSSA 3DAGA 5BSRA 4ALKA 1VCNA 4B74A 4XYEA 4EK9A 4JSRA 4MA0A 4YCNA 1SHUX 2GB4A 3OWOA 1UXKA 2XAUA 5DP1A 4EHHA 2MT9A 3W4JA 3MAJA 3WJ1A 3RRJA 4BPBA 4Q4LA 3HSKA 1BFUA 4GKAA 4BV3A 3DC2A 4DKJA 2G80A 2ODQA 3D02A 1MABB 2EEPA 2WYUA 2YX1A 3D2CA 3EFOB 3IP8A 4X90A 4Y7DA 1FXSA 3VO8A 3VO9A 1J00A 1GNVA 3R6GA 2BFAA 4Q3DA 1RYEA 4FR0A 3KFXA 3OUTA 4H6XA 2V7UA 1FTQA 2R96A 4UUQA 2H4JA 5JH7B 3F4KA 1A4RA 3D4LA 1QWOA 4BMXA 1P0PA 3KJHA 1JSXA 1E1NA 3ORHA 3AF2A 4UOZA 3SJUA 1KSHA 1F4LA 2EP7A 1E2BA 4BNNA 1GN8A 4RZXA 4URVR 1BRTA 3HRKA 2JAOA 5E6UB 3DOJA 3U0VA 1SULA 4CGYA 4F45A 1E96A 3FMIA 3RT9A 2G5GX 3O90A 1Z2PX 3VZRA 4JBGA 2X6TA 3UHAA 2X2PA 2WNIA 3W7BA 3KSBC 2Z98A 1I6KA 2X0RA 4TS3A 621PA 1XPOA 3IODA 4C6SA 1MUUA 2XRMA 1O97C 5B4UA 1J97A 4C1NA 2O3TA 5EQDA 3UJNA 1YGYA 2CNOA 2F8TA 3A37A 1MZPA 3O47A 2OQRA 3QYJA 4J1SA 1PJRA 2HUPA 2LDXA 2WPNA 3MCAA 4HRYA 5KTNA 1DKQA 3FCEA 1DIRA 5TC4A 2XB2A 3LP8A 5IFKA 1M1NA 2QJWA 2BP7B 1F1JA 3DFMA 5K51A 3R7DA 1QYIA 2CMKA 3JX9A 3A0UA 4HNGA 2J5XA 3AU8A 4IUDS 5KYYB 1ZH4A 4ML3A 3JAKB 5KHLB 1Q0LA 3GJ8A 3N39C 5CA0B 3AEUA 5K0JA 2V6GA 5CYOA 1Z2OX 4R16A 5JS2A 1KFBB 1OT5A 2AJLI 2W6ID 2Q9CA 3GLVA 1G20B 1IRXA 3K0AA 1ENYA 5BV7A 3EEIA 4GYJA 1EP3B 2CK3A 2PN1A 4N41A 2ZKLA 4YMWA 1XC7A 4TKUB 3UAGA 2C3MA 2FDXA 3HB5X 3I01M 5GV8A 4KXLA 2QLBA 1B6GA 1EM8A 9ATCA 5LQDA 1D3AA 3HSSA 4M37A 1ONSA 5C53B 1CIPA 4GX1A 2GNPA 2JLUA 1E3IA 1QANA 2LD4A 1ZOIA 3RUIA 1U3UA 1A4IA 1BE0A 1RQXA 3PHJA 2QPTA 3U7QA 3MXTA 2X9VA 1CUBA 4EJMA 1MC8A 1ZGJA 2JFNA 4I5FA 1TQ2A 3P96A 2WHEA 1GNSA 3BEOA 5AHOA 5U1PA 5CK4A 3WIVA 2CD7A 3OZBA 1ZJJA 1DEAA 2JLBA 1BA2A 1FTNA 2B6HA 5FI3A 1HSZA 5ALOA 3FTEA 3GLGB 1NFFA 1QGUA 4O8CA 4C4YA 2LIVA 5KCZA 1LW7A 2B25A 2JLZA 2ZEJA 1S7CA 1UBCA 3VDMA 4LVOA 3KUXA 1GZVA 2G1JA 3QIAA 1GG5A 3JVUA 4FMCF 1QUEA 5MFZA 2C4TA 4CQLA 2GSWA 1URPA 5HBRA 4D26A 1R9NA 2C77A 5LQAA 3R44A 3R5TA 1DOAA 1P44A 3WJ2A 4ZYYA 2B3TA 4XDHA 5AWFC 4O2LA 5EZ5A 5LQCA 3EG9B 3MT0A 3AHDA 1CP2A 4BIMA 5A9SA 1PAUA 1UBTS 1X9HA 2XUJA 2YIDA 3KE8A 3OOHA 4P4SB 2ZIXB 5AH0A 3LCMA 3F90A 4CIVA 3MAGA 1GUAA 1O95D 4IKEA 4TKZA 3GFSA 4WPGA 2OE2A 4RNCA 3ULKA 1RXWA 1LF5A 3MUFA 3RUCA 1NURA 2P35A 1E3QA 1NQ5A 4GD3Q 5FDFA 4ND8A 1TJ5A 3KL4A 3TNFA 3DNFA 2R6FA 3VNVA 2G77B 2IUFA 1JFLA 3GHYA 4DMLA 2AXEA 4DQKA 1WZIA 1R27A 2QJOA 3O84A 2HSZA 5CDGA 1Q84A 5DH9A 3LX8A 2Z2KA 4ZVKA 1QH1A 3MG9A 2QUKA 3VH4A 1NNLA 2MYTA 1JDBC 4UFPA 3DKIA 3L43A 3RDPA 3ZGVA 3COJA 1QFXA 4IXWA 4GBED 3ABSB 3UAWA 1V16B 3JYPA 4AJ9A 1YO6A 4R3WA 3CUKA 3V1NA 4QTZA 1U1CA 2ZIZA 2ZT8A 3D6MA 3GGGA 3MCWA 5DXAA 5EP1A 2UYHA 1GCIA 2HH9A 4HEHA 1Z33A 1N2IA 4G5RA 3VZQA 3K0EA 1GZ3A 1QLHA 1RWKA 2W2LD 1TUIA 4M83A 4KLAA 1Y8RA 2UZ0A 4P83A 4PGHA 3W2HA 3WB0A 4AFNA 3IV6A 4EPYA 2RI6A 5MGNA 2XRZA 1NTOA 3D3QA 4ZXPA 3QXSA 2PUTA 1JFSA 4YQYA 1KO8A 1Q6ZA 2EX4A 1BH2A 4U0JA 4Z7JA 4JC8A 4RF4A 2YRFA 2BVNA 2NVWA 1IZYA 3N3AC 4N3GA 5FRDA 5DSTA 5IU6A 2FEMA 1ZMOA 1J22A 3CTMA 3PNQA 3VOAA 1Q1ZA 3OD5A 3FD8A 4C1BA 4BWGA 1ZN8A 4PX9A 1OFVA 5FAXA 3RFXA 3HADA 2FOXA 3WZ2A 3K70C 1D8TA 8MHTA 4CV1A 3VUFA 4BAUA 4EDFA 3P0IA 4C0AC 2CY0A 4MVJP 3NTXA 3LQQA 3EPJA 2BHRA 1WM1A 1Y8CA 4JLSA 1QQBA 1GUFA 4UE3S 4KN6A 1U9YA 3WWEA 4E94A 4L9SA 1G42A 2DQKA 2O48X 3W5JA 4RA9A 4EO9A 2P0AA 2ZUFA 4L5IA 4U00A 3PGVA 5IAKA 3HLTA 4V0SA 3TBFA 4NEGA 4ZT4A 4QWWA 1WQ3A 4FE4A 1I2CA 3F46A 1LLUA 3MMSA 4Q7JB 2OQIA 2AK3A 2ZJ1A 2ZYGA 2EXXA 1GZDA 4R5HA 4E4RA 4U2EA 3NT4A 3MSCA 2HAEA 1S3IA 1O57A 3LUBA 5AVRA 2WIFA 4L73A 1BD3A 1D0IA 1NWHA 1SMKA 3N6RA 2UYGA 4MUYA 1ZHHA 4O4IA 4KE7A 5CM2Z 3Q9NA 3OZEA 4FHFA 1F8GA 1FJXA 1ESEA 2IHNA 2GX6A 3JCZA 3R74A 4EG0A 2GZ3A 2WWXA 1ZI6A 3GRRA 6CHYA 4KITB 4QTXA 1TC2A 4FOOA 2IEYA 3BGWA 2CVHA 2HLDA 4F5DA 1EEXB 1OTXA 3MB8A 3P2MA 1UOOA 1Y3HA 1O94A 3QPDA 1N8NA 1PX2A 3WB9A 1J9EA 1QH8A 1XVIA 2PSEA 3OBIA 2QLLA 4M87A 4U2FA 2UVPB 4UM8B 3RT1A 3CN9A 3SLGA 2JIBA 4I08A 2JIZD 4J0CA 4Q4HA 4RK4A 3AVYA 1D0SA 1M2HA 3RKRA 1FFGA 1BEUB 2J9YB 2ZYUX 4CIDA 3DVSX 4E1BA 3K0KA 1Y9EA 4HGPA 4L5JA 2VRBA 2Z6AA 1YAJA 1U63A 5LLDA 2I0FA 3WL4A 3SSOA 2VYCA 1ETHA 2C2ZA 4K40A 2ADMA 4L0QA 5JXIA 3ELWA 2VBFA 2IY7A 2PTGA 3PVCA 7MHTA 3AG5A 3CG0A 5K8LA 2P90A 2EBFX 1TJPB 2DT8A 5M29A 1F51E 1SRRA 1U8ZA 1JIKA 1Y3CE 2J3MA 4BECA 5K7SA 5C4MA 5BVGA 2VTVA 1RJ9B 5CMLA 4CIXA 1PQ4A 3ZY3A 2P1ZA 3LBAA 1DL5A 4RKEA 3WLHA 2RGNA 1OV6A 1JTFA 4E32A 4PPYA 1LBHA 3DQZA 3GFPA 4IH9A 1ZCFA 1MX1A 1NW3A 4TXNA 2ZWPA 4D42A 1I24A 3C5EA 1OLSA 2VXCA 1XNRB 1TZMA 2N47A 3R3JA 2OLKA 1FP4A 4RK1A 3RYFB 1J90A 3JQAB 3WLIA 1MV5A 1NSYA 2WYOA 3A06A 3ET4A 3LXRA 4E22A 4MIEA 5C81A 2P2CA 2NO5A 3WBBA 2W70A 1F2TB 2NVUB 4KXQA 1YCGA 1YVDA 2WABA 3IV9A 3I6MA 3F7NA 4KDCA 4FN4A 1ZLXA 1GA4A 2ZWIA 3QX8A 5TGTA 3M6XA 4LMPA 3R5SA 4ER7A 1K0FA 4DYHA 4OHMA 2B1QA 3DLPX 4Z49A 1KEUA 3FNIA 1CZNA 1QXSA 1KXJA 1R0KA 1VSBA 2PBZA 3PV0A 4R1OA 1R1DA 4EDHA 1I2ZA 4ECAA 3VM6A 4MLDA 1JHUA 1WDWB 3Q15C 3HVRA 1MAWA 2Y1EA 2LCIA 1LJ8A 2YYSA 3K5IA 4P4TA 4TLCA 4ZOQI 1VGQA 3W3AA 1P9RA 2AUNA 3QBEA 5EPOA 1OYYA 2FJUA 2VT3A 4RTRA 1IMOA 3OT1B 1LK0A 1T3LA 2QMUA 2EEZA 5ERGB 3DQPA 1A69A 4MQ5A 1CUJA 1P0IA 1WF6A 1OU0A 1QPGA 1Z28A 1YRBA 4OU4A 3C14C 2HBZA 1AQLA 5JQWA 3FJ1A 4BV2A 1BJKA 1TCUA 1Z7EA 1K6XA 2PSDA 2XKKA 5FV7A 2R5FA 1TK3A 2XRFA 4FSXA 1GCAA 1H2BA 3F5SA 3NAZA 1FU7A 3ZS8A 3U60B 2AN4A 5BURA 1X1EA 1NJ8A 2AX4A 1X7HA 2GF0A 2VDQB 3H13A 3RC3A 3KJIA 1J8FA 1YQEA 1GGFA 1PBTA 4HGQA 1EHIA 3NHPA 4PGGA 5F52A 1UQTA 1FC0A 5AI4A 4P32A 3VPSA 2VAXA 1RYHA 3QEMB 4JC4A 4R2LA 3RIHA 4C03A 1GU7A 4U6NA 1H42A 1YUBA 1XP5A 3UJ6A 4EJSA 2Z1DA 1OI2A 1KJYA 2EJUA 1TC1A 3SDZA 3OKPA 5AOVA 5AXAA 4RLFA 2QS9A 1L1RA 2GN6A 5BQ3A 4QM7A 1NJSA 3AVPA 4DHEA 1CUGA 2B20A 2GZHA 3WIDA 1JV2B 2PLRA 2ZRIA 3F78A 4OXRA 4X93A 3CF6R 3W6UA 4PRYA 1QMGA 2W11A 3OZSA 4UHHA 1THMA 3IOCA 2HHHB 1E4EA 5REQA 4H0FA 1Z2EA 3KS9A 4IIYA 2NTJA 2DG2A 4FS3A 2WY2D 3V9PA 1W5EA 1YB2A 1TA4A 2JJ1A 1MRZA 5IKOA 4CYMA 4POOA 5JAZA 1Z5OA 1C2YA 2DC1A 1VLHA 2BKVA 2G7MC 4TXJA 2GBLC 4YQZA 1GM5A 3LDAA 4MO9A 3OA0A 1W36B 5A5DA 3ZXXA 1IYZA 2O52A 4JVMA 3ENWA 3NRJA 1QRSA 2H2AA 1JHYA 4TRMA 4PSUA 4HAIA 3M2TA 3DFKA 2QRUA 2ZUTA 4A8TA 1OFHA 2EGGA 1UDAA 3GZNB 3V48A 4K86A 2WF7A 4F86A 2UUAB 2H11A 3WJ7A 3G0IA 1V1RA 2QAJA 1HYGA 1U7UA 2UUOA 4LMAA 5J1SB 1KEVA 2C7BA 2GCOB 3KWMA 1V1MA 3G2OA 4HAXA 2JBHA 2D59A 1XE3A 3RGWS 1SCIA 4YFYA 2FQYA 3AHFA 2Q5EA 2YWJA 3WKCA 3GJ0A 4G1VA 5M2QA 1YK1A 4RCZA 4DC9A 2ACWA 4DDMA 3TECE 2IUYA 3LIPA 1AKVA 3IC5A 4IFIA 1WDKA 2C5FA 1RLJA 4BZWA 4ZKEA 4OGFA 1H69A 2CHGA 1KFJB 3ZVNA 3WMXA 4HXGA 4JI3B 1M2WA 1OLUA 3VDNB 4C89A 2FG5A 2PUAA 5KX5A 1FMTA 1JEDA 4PZUA 4M9XA 4TRRA 3TPZA 4CMBA 1SKBA 4YRPA 1QQAA 1G21E 4FOLA 3F5MA 3MRVA 5HCUA 5SY4A 2GZDA 3HGMA 4L8WB 2FPWA 1F2VA 2QTAA 1JPNA 4G89A 4BZXA 2R0QC 3KPYA 1E1KA 3RIEA 1MB9A 5G2OA 4ZAXA 3U6BA 3NJRA 3MWDB 1TYZA 1BS1A 4JKYA 1HRKA 3R6LA 4F6CA 4BJ5A 1JDPA 2P9FA 3T3NA 1UT6A 4FYVA 1NBMA 2XJ9A 4D0GA 5TF4A 2WJZB 3A6EA 3TRHA 3CBQA 4HGNA 3FWHA 2CHUA 1JVSA 1HDEA 2QK4A 5AIBA 4M49A 3VVCA 3KEGA 4L4ZA 3T5AA 1WCIB 1QOPB 4O33A 2P1RA 3GAAA 4NJMB 1SB8A 2JRCA 2NG1A 5AESA 2OBNA 2XZDA 5DGDA 1N8TA 2D1RA 5DI3B 1ZN7A 2P6PA 2Y67A 3OEHD 4GPBA 2QNIA 2I65A 1A4XA 2JKYA 4BQRA 1ZVKA 1VHLA 3ESXA 3KEFA 4ZU6X 3EXHB 1F9AA 2YHIB 3O2JA 3R6TA 3R0QA 4GF5A 1P19A 4MJ7A 4IRXA 5A4KA 1UMDA 3D5QA 1DTEA 2V3CC 3K0BA 1FFAA 1ZONA 3HM2A 1NKSA 2FF5A 5T5QA 4E5SA 1Z08A 2ODNA 3HYRA 3SYMA 5K4HA 2ZRLA 1TVMA 1X8XA 3GU3A 2W9XA 1QIHA 2CNLA 3QXGA 3T3HA 3U4MA 2PEYA 4QOEA 2JI9A 2IX3A 2XNHA 2B2XA 2BISA 4QG7A 3G0OA 4A0HA 2OV3A 3G9ZA 1H6DA 3EGWA 3P0HA 1OASA 1R2QA 3PUIA 1ZW1A 2D2IA 4QATA 3A4TA 3RSOA 3OQ6A 2FMIA 4K6MA 1X9IA 4EGAA 2WOJA 3AEKA 3GJ3A 4WEQA 3OO1A 3EISA 4G9EA 4JQYA 3N87A 3UB2A 3ZKWA 3GBVA 3OZVA 5KINB 2WIKA 1FVOA 3O5AA 5GONB 3S27A 5JPDA 1TLTA 4YUXA 5GIPE 1H2YA 4XDZA 4CWAA 4PZ9A 1D9XA 4N4AA 4CHGA 3K6SA 1V71A 2PLAA 4BLQA 4GRIA 5DNEA 1AQYA 3I5MA 3HE3A 3SSNA 1U04A 3A70A 3KWJA 3PGKA 3LXXA 1NMEA 1FTGA 4EVSA 1KYWA 1JHQA 1FUKA 4N7JA 2PXHA 4MROA 4ESEA 2A0WA 4XDYA 4GW3A 1SK9A 5JMPA 1A04A 2GVZC 1KPIA 3KIPA 4NIMA 4ZVUA 1SNYA 3SC2B 5B7NA 3LNCA 3UENA 2PD4A 5CEFA 3JVIA 1C1XA 2HQOA 3ZJ4A 5C18A 4Z6KA 4DAOA 4JJGA 5JNSA 3JVEA 2FR8A 2WZCA 3MWGA 2VJPA 1BU5A 1JNXX 2WJVA 3TR5A 3ZCSA 3MRTA 4Y6OA 4BP9A 5BMOA 4MP6A 4PFJA 2XMGA 3GAZA 3IJRA 3KVYA 1CR2A 4RZHA 4C5CA 1Q2XA 2XX3A 4H6VA 1U1DA 3R20A 4QREA 3UATA 5JUWA 3HA7A 3RS2A 5JXGA 1NVVR 3VUEA 4HDMB 2C0CA 1TZKA 4KFTA 2F3TA 2K87A 5DHTA 1S8FA 1T0BA 3V55A 5HM8A 4KREA 3V4SA 3SXUA 3GN1A 3FHLA 1UXGA 3OEEA 4OY3A 3OTOB 1G6KA 4NBRA 3J81k 2X9QA 2JAUA 5DM4A 5IKMA 4TL7A 4LF8B 3QXJA 3B6MA 4LKOA 3AESA 5JSYA 4BEVA 1E2LA 1MEOA 4XWYA 1Z63A 1Y4SA 3UF0A 2NSJA 4E21A 4TZ6A 1E5XA 3IVXA 3U4HA 1CUZA 3GFRA 4RANA 2AQKA 2BR5A 7REQA 2C7OA 5L95A 1G55A 1DT5A 4JBWA 4NU0A 4D0LB 5FF9A 4CQJA 2OHVA 1PIWA 1P2TA 2VZ8A 5FFNA 3E4DA 3BFPA 4QRHA 4DIFA 5DBIA 1R0ZA 1W5AA 3LZ6A 3NHAA 2XYQA 3VI4B 5TMEA 4PN3A 1VJ1A 5KEIA 1YQQA 2O7NA 3H0KA 4AP9A 2PXAA 3W1EA 5KNDD 3I9V6 5KPJA 4NZZA 4R2KA 4NBLA 1F3LA 1P3DA 2B21A 3KR0A 1X94A 1ID1A 1PG5A 2C2HA 2C0QA 4QOFA 4J7AA 2OPHA 3SZGA 4I2NA 1GEEA 3VBCA 4UM5A 4BCDA 3HXKA 4OQDA 4QQFA 3EGEA 2E4XA 3T3DA 4C29A 1AU9A 2O05A 3EVDA 3Q6IA 2REO