4J0IA

Tannin acyl hydrolase in complex with 3,4-dihydroxybenzoate
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
470
structure length
452
Chain Sequence
SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tannase
publication title Crystal structure of tannase from Lactobacillus plantarum
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 165
structure length 452
sequence length 470
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j0iA00
1MU0A 3R3WA 1CVLA 4UBOA 5AKZA 2PBLA 4TVKA 2RAUA 4KAFA 1UKAA 4FLEA 2G5PA 4PF1A 1ACJA 1DTEA 2FUKA 3H18A 1CUYA 2PUHA 3DCNA 5AOCA 2JGLA 3EQ7A 1C7IA 2YH2A 4K6KA 4P93A 2JIDA 4IH1A 2V9ZA 1QGED 5AM1A 4BCCA 3CCBA 2XUJA 1S8OA 4OU5A 1U2EA 5ALMA 2XUOA 4HXGA 2FJPA 1QIGA 1ZD3A 4IH4A 5FPPA 1VZ2A 4XWGA 1XZEA 1IUOA 3I28A 2EDAA 3C70A 3DL7A 1F6WA 2G4LA 1MX1A 3WKBA 2XMGA 5ALFA 3FSGD 4H7IA 3W9UA 4C6HA 1Y7IA 1QLWA 4W9RA 3ZV7A 4X94A 3GBSA 4Q1VA 1P0QA 4WFKA 1MAAA 2FJ0A 1MPXA 4X6YA 4UHEA 5JZBA 4AMYA 2HM7A 5EIEA 4G4IA 4AO7A 4B80A 1BS9A 1YCDA 2WLSA 3AIOA 1L7AA 2IITA 2OCGA 1G42A 5JALA 2BUCA 1AUOA 2P8SA 3WWPA 2B4KA 1YS1X 4CIBA 4F21A 1H2WA 1TAHA 5AKYA 4F0JA 5IH7A 4ETWA 5AOBA 3HSSA 5AOAA 5AM5A 3PF8A 2XMZA 2BGNA 4J7AA 4FBMA 4BRSA 1JMKC 2JGKA 2HDWA 5DYTA 3KD2A 5CXUA 4IQ4A 4DTCA 5HK8A 3JW8A 1P0PA 1GKKA 1XRPA 2BUAA 3ILSA 2WHPB 1W75A 3TGLA 2QKYA 3M3DA 3STVA 2C4HA 1WHSA 1N5RA 3WMRA 1N8SA 2H7CA 4RPCA 1E66A 1QIDA 2CJPA 1EXWA 3AZPA 3MUOA 1UT6A 5CRIA 5JAPA 1ZGBA 4G9GA 5BWBA 3ESCA 5CMLA 4GW3A 2AJCA 2R8BA 5DTIA 2GBFA 2O2IA 3STYA 5JADA 5K3CA 3WWEA 1WOMA 4DYHA 2B9VA 5SYNA 2WTMA 3O4HA 2B61A 4QLOA 1XZKA 1LZKA 4WY8A 5EHZA 5AKHA 4UBMA 1XRNA 5D7BA 3C6XA 1TCBA 3FOBA 5KBYA 2R11A 1ZD4A 4GECA 4DGQA 1GKLA 1SCIA 5CURA 3BIWA 5JD4A 3DLTA 1XZMA 1IVYA 2WU4A 1IUNA 4KAAA 1FFBA 1ETHA 5CT5A 2OG1A 1LPPA 5CT6A 4DLNA 3S2ZA 2DFPA 3V48A 1ZGCA 1QO7A 3CCCA 3SWWA 5HCUA 5AP9A 1DWPA 3OC0A 4C88A 2VTVA 1TRHA 4J0DA 5A6VA 5C81A 5HKAA 1JT2A 2VJBA 2ZYSA 1BCRA 3A6ZA 1EK2A 4B6GA 1H2XA 5DNVA 1CR6A 2QT9A 1GZ7A 5AIBA 1K4YA 3RLIA 4EB0A 1QIIA 1SOMA 1DX6A 1Z68A 4FFWA 3WL6A 2VQ6A 3KSRA 1XRLA 5CW2A 4EUSA 4E14A 4XX1A 1U8EA 1CUAA 3QPCA 1ZIYA 3OTQA 3BJRA 1DU4A 2IX9A 4WFIA 4B84A 4H35A 2XMCA 4NMWA 4K6GA 1BN6A 2XE4A 4EY4A 1MNQA 2G5TA 5F4ZA 4AZ3A 2QVBA 2JEYA 4H77A 3BF8A 2BUBA 3A2LA 4Q34A 3WKEA 1A8SA 3C6BA 2WHPA 5LZ9A 3R3VA 3W9BA 4KJXA 3H2HA 2O2GA 3IB3A 4JUIA 1AGYA 3EQ8A 4A16A 4AB1A 3IUQA 4UBIA 1QTIA 4AXBA 3DYVA 4G4JA 4BATA 3AILA 4PV7A 3DEAA 3B12A 1CUDA 4ZV7A 2VJAA 5ALQA 2W22A 3VXKA 2WILA 5ALPA 1XQVA 1LPAB 1YR2A 4MJ3A 5JAUA 1LPNA 1H23A 4PO3X 4G8DA 1GQSA 3O0DA 2DHCA 5AH0A 4J0JA 1KU6A 3ICWA 5T4FA 2H7YA 2HIHA 4ZV9A 1W52X 1Y7HA 1CQWA 3NWOA 2QTBA 2HA0A 4BZZA 4PSUA 3F67A 3AZQA 3QZUA 1CUUA 1XZGA 4QDTA 1WHTA 5AJHA 3DQZA 4BRZA 3EF3A 1MX9A 3VKFA 1CUZA 4QDZA 1O6GA 2ONCA 1VA4A 1Q0ZA 4Y2JA 3IURA 2BGRA 4UBJA 5KREA 4ARAA 3I2IA 3WJ2A 4BVLA 1UK7A 1QFSA 2HA5A 4X71A 5ALIA 4Q3KA 4OYYA 3C6YA 4BZWA 4C89A 5AI6A 3C5VA 3OPMA 4GWLA 1XZCA 2AJDA 4H7EA 4LKOA 1IUPA 1ACLA 3WK6A 1QTRA 4FLFA 1R3DA 1ORVA 5ALDA 4K2AA 1RP1A 4QZVA 4B85A 4CFSA 2WHRA 5LIPA 1MN6A 5D3KA 4J0CA 1LPOA 5IKXA 4I4CA 2Y2UA 2WIFA 4U2FA 1J1IA 4DMHA 1FJ2A 5JAOA 2IIVA 2C5FA 3BDVA 3Q8WA 2J3QA 4BE4A 3LIPA 3R3UA 2JGEA 1CIJA 2XUGA 4Y2YA 2XUHA 1KU0A 5FOQA 1K5PA 3WL8A 2WUGA 3IUJA 3NUZA 3IULA 1JJBA 1EK1A 1CUBA 2VSQA 3ANSA 1XZBA 3VISA 3PI6A 3CXUA 4J0KA 3I6MA 2PSJA 1XZHA 5EHNA 3PUHA 4ZXFA 3W05A 5D3ZA 3L1HA 1TKRA 4QEKA 4OU4A 3WKDA 1FFCA 3D4LA 1MT3A 4MEAA 2EDCA 5DNUA 1DWQA 1DX4A 4C01A 4UHBA 4J0IA 4OPMA 1MAHA 1BRTA 1UOOA 3ICVA 4JNCA 4Y2SA 1RWQA 4UPDA 5JD6A 4BC1A 2PU5A 4HVTA 1GPLA 2JGFA 4Y2RA 3WK8A 3D3NA 3SX4A 1UK6A 2CB9A 2K2QB 4PSCA 3WA6A 2Y6UA 5FLKA 1VA5A 2J4FA 3KDAA 3F98A 3WLAA 2DSNA 4BAGA 2VATA 1UFOA 1R50A 2QXTA 2O7VA 3WQHA 1YA4A 1H2YA 3WL5A 2XLCA 2XUQA 2RONA 4WDRA 1K6EA 5HFAA 2HU7A 1LNSA 1ZI6A 1R9NA 3ESAA 5HKBA 3WIOA 4G8BA 1A88A 1XZFA 1ORWA 4B0PA 5AM2A 4X00A 3M82A 2XQFA 3FYTA 1E8NA 1JJFA 4UHHA 2BJHA 2D5LA 4HXEB 3HLKA 1JJIA 4G8CA 3HZOA 4FDMA 5EHQA 4U2GA 1THTA 1XRMA 3M83A 5AI9A 3MGAA 1ZD5A 2RI6A 1XQXA 2V98A 5D6OA 2XUAA 3I1IA 1JMYA 1VLQA 3R40A 2YYSA 5AM3A 2WIJA 4DNQA 1AX9A 4WCVA 4BP8A 4MQMA 1DINA 3K2IA 1JU3A 4EY5A 3G0BA 2JBWA 4AZ0A 4FMPA 3JWEA 2WJ3A 1KEZA 1QO9A 1I6WA 3FNBA 2JF0A 5CT4A 3BE8A 4Z49A 3GROA 5C8VA 3WI7A 3C45A 2RGUA 5EIAA 3DYIA 3H2GA 5LZ4A 4BDSA 5JZSA 3WWCA 5E4TA 3FLAA 3G0DA 3HI4A 4FOLA 4CI9A 2QXUA 3H1BA 3G0IA 1WM1A 3WKCA 3D7RA 4CG2A 2C0PA 4X6XA 1TCAA 2CKMA 3PF9A 4IO0A 5I7UA 4LIPD 1A7UA 3ZPXA 2XMBA 2W6CX 2ZSIA 1XLWA 3R41A 3FAKA 2OAEA 3FCYA 1W6RA 4IHAA 2WSLA 3G0CA 4H7JA 4OYLA 2GYWA 2J4CA 1P0IA 1FFEA 1AKNA 3V1KA 5AI8A 1WCYA 2DHEA 5CBKA 2VEOA 3K6KA 3I1YA 3WKAA 2PX6A 2X76A 3R3XA 3PFCA 5AKGA 3GELA 2Z8XA 2WFLB 4QA9A 2ECFA 5FDFA 1HKHA 4JYMA 5DYWA 2PKYX 5LP1A 3E3AA 2Z8ZA 3PICA 2DQYA 4S0XA 2WUEA 3DJYA 2Z5GA 4EY6A 3ZLTA 3NOXA 1ZIXA 5A7FA 3DOHA 1MO2A 5E4JA 4M0FA 1CLEA 5HQ3A 5KWIA 3AIKA 4U2DA 1A8UA 4KACA 1GT6A 1CUEA 4AX4A 4EBBA 1PJAA 3NGMA 2DCMA 1CUSA 2UZ0A 5JYCA 4CCYB 3O4JA 3BF7A 5A71A 3R0VA 4P08A 5AKLA 2HRRA 5JARA 3BIXA 2OCLA 4RE5A 3L1JA 3RARA 4Y2VA 2XUIA 1UK8A 1XZLA 4LXIA 1Q0RA 5BOVA 1NU6A 4K5QA 1R4ZA 1JI3A 2VAVA 4UBNA 1WB5A 3VVLA 1AC5A 1ODTC 4UUQA 4B9AA 3AFIA 5DWDA 1TQHA 3DD5A 2XQIA 3AZOA 1HLGA 5EHXA 4Y2QA 2DR0A 1UZAA 3W2TA 5ALHA 4Q05A 3WA7A 1WB4A 1UK9A 1LBSA 5LLSA 1BN7A 2E3JA 1BCSA 4MYDA 3G9XA 2OLEA 4H0CA 5AKXA 1B41A 2ZSHA 2WFMA 1IZ7A 4TPKA 5AO9A 3H17A 4ZI5A 4UHFA 2C5GA 1OCEA 1ZD2P 1GPKA 4DMFA 5AKJA 4Y2UA 4LXGA 2WG2A 4P92A 1DQYA 4G1FA 4L3WA 4DSAA 5E4YA 1THGA 4UFOA 5CXXA 1OILA 2X8BA 1RYYA 1TCCA 4FTWA 1UOQA 4B7ZA 2Y2VA 2HADA 4BTVA 4MYSA 1H2ZA 4RNCA 1QIKA 2VA9A 4C4YA 3PUIA 4DMKA 2WFLA 2GZSA 5CTAA 1XLUA 5EGNA 1USWA 4K6HA 1J07A 1QIJA 1E8DA 4F5ZA 3HRHA 5ALGA 3MVEA 1AMNA 2JGJA 4B0OA 5LKAA 3QMWA 3T4UA 2XUKA 2XMQA 3C87A 2QUAA 5EFZA 3GA7A 3DDUA 1K63A 5AK5A 4LXHA 3I2HA 4AQDA 3RK4A 1YAJA 5E2IA 4CCYA 4E46A 2C7BA 1XKLA 1N1MA 1UOPA 3YASA 4YX9A 4F60A 1G4HA 1C7JA 2WG0A 3U0VA 1X2BA 4UHCA 1CUHA 3ZI7A 5CH3A 4U2EA 3DS8A 4AO6A 1YASA 3HEAA 1QOZA 1W76A 5ALKA 3TEJA 1K8QA 4HRYA 2QOEA 3T52A 4HZGA 3W04A 4EY7A 1CEXA 4ZRDA 1MX5A 1Q83A 2I03A 1O6FA 1MNAA 5ALSA 1CRLA 1VE6A 2WUFA 4KRXA 3HYSA 5AICA 3WK9A 3O9MA 5ALXA 5AI0A 2WM2A 4RE6A 1H22A 1DT5A 4WJLA 1F0PA 1F8UA 5K3AA 4B9EA 5ISMA 3C6ZA 2XQJA 1TIBA 4YASA 3G02A 1ODCA 2HA7A 5K3EA 4CG1A 4Y2TA 5J3JA 4BVKA 3WZLA 4GXNA 5FPQA 2HRQA 1NU8A 4QWWA 4N5HX 4PQEA 3H04A 5DTJA 3CN9A 1VE7A 2AJLI 4BCDA 5A2GA 1R88A 3OM8A 3OG9A 1CPYA 2PM8A 1HQDA 1EX9A 4DM7A 4HXFB 4AMZA 4EA6A 2OCIA 4FKBA 5K5EA 4QNNA 3H2KA 3QVMA 4Y2PA 4N8EA 4OB6A 3QYJA 4M0MA 2WFZA 2J3DA 3KWJA 1WPRA 3QH4A 5K3DA 1PV1A 4ZWNA 1YAHA 4W63A 2VAXA 3JYHA 2D0DA 5I8PA 5DYYA 4U2BA 1CFJA 4BYMA 1YSCA 4H7FA 5ALJA 4ARBA 1QIFA 3QM1A 1W4LA 3A70A 5IVDA 3W06A 4C87A 5HZGA 4DIUA 3PDCA 2Y6VA 4AN1A 1Q84A 5JASA 2BCEA 4DNPA 3OURA 3V1LA 5HF9A 4KEAA 4FWBA 1AURA 2WUDA 3IUNA 3QBJA 4HS9A 5C8ZA 3I6YA 1XRQA 2Z3ZA 1CQZA 4OUKX 5IVHA 4RGYA 1WPXA 3O4IA 4CIAA 1QONA 1M33A 4UFPA 4KE8A 4W1QA 1ZI9A 3UUFA 1JU4A 4H18A 3IBTA 4BVJA 1ISPA 2RIPA 2ORYA 3IA2A 3I2GA 2JGIA 1HL7A 3WK7A 5LZ2A 3H2IA 3LP5A 1X2EA 3LCRA 4X92A 1CUFA 1LZLA 4QDUA 4Q3LA 2XDWA 3A2NA 1GQRA 2RHTA 1XLVA 5ALUA 5I9IA 4BC0A 3IVMA 4JH0A 4FBLA 3PE6A 3U1TA 5LZ7A 1DWOA 3GUUA 3FLBA 3AIMA 4UBLA 4HTAA 1N5MA 2DHDA 1IZ8A 5ESRA 1QIHA 1R1DA 3V1MA 4B83A 1XRRA 2V96A 3FYUB 4ROTA 5ALVA 3WZMA 4TGLA 3BXPA 1CV2A 2CBGA 2AXEA 5FV4A 5HQ3B 4MEBA 4B81A 2BAGA 2ZYHA 2XQKA 1IMJA 3AUKA 2PU7A 2QMQA 3C43A 1EDEA 1EB8A 5IVIA 3D59A 5ALRA 4O08A 1VXOA 1FFAA 5DNWA 2H9YA 4DMCA 2ZYRA 3EQ9A 4GBGA 3KXPA 1P0MA 4GEGA 3ESDA 5AI4A 3F96A 2WU3A 5KWJA 4KAJA 4A23A 4BDTA 1QE3A 5FRDA 2BFNA 3X3HA 5LZ5A 1E89A 3B5EA 1DQZA 3WK5A 1HDEA 3VDXA 3STXA 2OGZA 4L72A 1NX9A 1VJ5A 4DNFA 3HJUA 1B6GA 3FLEA 4G4GA 3LLCA 1CUJA 3QITA 2Y1KA 1A8QA 2HU8A 1EI9A 2HHAA 1EB9A 2GBGA 4GHWA 4H7HA 2WJ6A 4BE9A 3QPDA 1SCQA 3UMJA 3FYUC 4PNZA 2YXPX 5H3HA 1EHYA 3QPAA 2QUBA 4PSDA 2ACEA 5EI5A 4NVRA 2OGSA 2CMFA 2ROQA 1XZJA 4QDXA 4OSEA 2PSHA 3ANTA 1DT3A 4E15A 3D0KA 1YA8A 3DKRA 3WYDA 3GFFA 4CG3A 3EBLA 3KOOA 5JIBA 4P9NA 5AKIA 1HBJA 4X97A 3FYUA 4LYDA 3STUA 4FHZA 2QZPA 2XI4A 4XIIA 1PFQA 4BBZA 1GPNA 3ZLVA 4MWTA 3N2ZB 1T4MA 3O9VA 4LYEA 4M0EA 5ALNA 2CZQA 5FUMA 2PL5A 1QFMA 1QIMA 3V9AA 5FP0A 3WL7A 5AI5A 4H7KA 1J2EA 4D9JA 4GLBA 1U65A 6YASA 2CEKA 3F8SA 2XQGA 5AIAA 2DQZA 4N8SA 5DJ5A 4KR0A 4AO8A 4A5SA 1XFDA 1XROA 3LS2A 1YB6A 1FFDA 2XUPA 2O2HA 2WG1A 2GYUA 4IH9A 3DNMA 2I3DA 2VT7A 3E4DA 4J0HA 3K9BA 1W1IA 5LYYA 4BAUA 4MWSA 3G8YA 3H1AA 5ALLA 1ZI8A 4FNGA 2HFKA 3ED1A 3O95A 3RM3A 3KWFA 3BL8A 4I19A 4N5IX 5CT8A 4G5XA 5AKKA 5CH8A 2ZYIA 3HXKA 3IIIA 4WFJA 1XQYA 2PSEA 3FSGA 1TK3A 2PSFA 5JATA 3GZJA 4L0CA 4CCWA 2WJ4A 3I2FA 2JEZA 3R3YA 4ZGBA 2PPLA 3S8YA 5JD5A 4EHBA 2XB6A 4BTLA 1G5FA 4N8DA 4EY8A 1MTZA 5A62A 1QZ3A 2NW6A 2QJRA 3C5WP 1SC9A 2Q0XA 1LPBB 5A7GA 3BDIA 4XVCA 1JKMA 3D2AA 2GBIA 1UKBA 3I2JA 4KE9A 4LHEA 2GBCA 4L9AA 4C4ZA 1VOTA 5LKRA 1LLFA 1EDBA 1G66A 4ITVA 3DKKA 1XQWA 1LGYA 3STTA 3D2CA 2XMRA 3DOIA 5AK3A 1U4NA 2I78A 2HA3A 5JZ9A 4UHDA 4X85A 4NS4A 1F0NA 5LZ8A 2VT6A 2AJBA 5K3FB 4YK7A 4J3JA 2XMSA 1CUVA 2WHQA 1EH5A 2WQZA 2QS9A 4GI1A 1XZIA 5ALEA 3VJLA 3ZWQA 5BV7A 3SK0A 1LPMA 4X90A 5K3BA 4Y9SA 2CUTA 1GXSA 2I3ZA 4AN0A 4W1PA 2OQIA 4QE3A 2GZRA 1EINA 5C8XA 4FFVA 1SFRA 4BP9A 2QR5A 3HC7A 2VJCA 2BKLA 2WIDA 4W1SA 3OOSA 5AKEA 4X91A 1UWCA 2HL6A 4PW0A 3V1NA 3I2KA 4FLMA 1LPSA 1E3QA 3H0CA 4Q3OA 2XUDA 4I3FA 5AK6A 5DLPA 1GGVA 2OXEA 3M81A 1WB6A 2QJWA 2OCKA 4KYVA 4YPVA 1VZ3A 3RKSA 1EVQA 1EVEA 2GYVA 1BROA 3D5EA 3E0XA 4XJVA 1EA5A 1T2NA 1ZJ5A 2V97A 3G9TA 3CN7A 3N0TA 7YASA 3QMMA 3UUEA 4J03A 5FXMA 1XZDA 4HAIA 1E5TA 4C4XA 2OAGA 2C0QA 5AHXA 1CUCA 1BE0A 5AM0A 4FNMA 2ZJ6A 4JEIA 4OD0A 1L7RA 4X93A 3FCXA 2OQVA 2AJ8A 5T4EA 2VF2A 5HFNA 1YB7A 4Y2XA 2XMDA 1MJ5A 1HPLA 1ZOIA 4MXDA 2JGMA 2PUJA 1AQLA 3SC2A 1E8MA 2ES4A 3C8HA 5ALWA 1VKHA 1J06A 2OGTA 3L1IA 3BWXA 2O7RA 1LBTA 4UFNA 4E11A 4BAZA 2HU5A 3FVTA 4X7BA 2XLBA 4UBKA 3E1GA 3VJKA 4INZA 5HF5A 1Y37A 3QMVA 3TRDA 5K3FA 2XUFA 4J0GA 4X95A 4MQLA 3MUNA 4WY5A 1EDDA 3WIBA 1BEZA 1AZWA 2RHWA 1XKTA 1X70A 4Q82A 4BB0A 4NZZA 4KE6A 4EZIA 2PSDA 2ZJFA 1UKCA 4QLAA 4JYPA 3I6ZA 3DL4A 2HA4A 3F97A 2QM0A 4GDMA 5HK9A 2ZVDA 5C7YA 1CUXA 2PVSA 5EIHA 4DSZA 3VJMA 3HACA 2XT0A 2ZJ7A 1BEEA 4U2CA 2EEPA 4W1RA 1CUWA 3P2MA 4G9EA 3BJMA 3H2JA 3HABA 3G7NA 3WWDA 5HF6A 5SYMA 2G63A 3TJMA 3WYNA 5ALYA 4QDOA 1OXMA 3IDAA 3F9CA 5IVKA 1XZAA 1ODSA 2FX5A 3G0GA 2WIGA 4X6UA 3ZLUA 1FSSA 3EIOA 1YS2X 4OB8A 2HFJA 2OPHA 1VXRA 4H7DA 4KE7A 2WKWA 2B20A 5AK4A 4Y7DA 2X5XA 1QJ4A 3D2BA 2WIKA 3PFBA 1CUIA 2H7XA 3VVMA 3WWOA 5T4BA 3C8DA 5T4HA 1JFRA 5YASA 1UXOA 3FVRA 3WJ1A 4X3CA 3R3ZA 3H19A 3STWA 3WK4A 2ACKA 1ZICA 5A7HA 4BCBA 5ALOA 3FWHA 2HA2A 5BWCA 3FBWA 3O4GA 4OB7A 1SCKA 5JAHA 3LIIA 5CH5A 3A2MA 1D07A 2H1IA 4OCZA 1C4XA 4ZREA 3G9UA 4DNOA 3ESBA 4B82A 1QIEA 1CUGA 5AM4A 3IUMA 2VJDA 3B3QA 5FKJA 2Z3WA 2LIPA 2C58A 2YASA 2WTNA 1BU8A 4WDQA 5ALTA 3G9ZA 2HA6A 1ZJ4A 3AINA 4KRYA 1R9MA 4QWMA 4HRXA 5HF8A 3Q0TA 1L7QA 5JANA 5CT9A 4V2IA 3AJAA 2QRUA 5ALZA
chains in the Genus database with same CATH superfamily
4HDMA 7AT1A 1F8FA 1FUUA 1KP3A 2B8EA 2XOKD 2QRLA 1AB6A 1XD9A 2YIJA 4F5YA 3FZEA 1HT0A 4I6JA 3ITKA 1CVLA 4HGQA 1T9DA 4IG4A 3CNLA 2X4GA 3A4NA 3FJOA 4YO7A 4QTUB 5CVCA 2PBLA 3N74A 1EXVA 1NW4A 2H3HA 1WG8A 4Q16A 2A35A 1DE0A 1HY3A 3AONB 1O77A 1ESEA 1TJYA 1Y1TA 2VT2A 2WMOB 1JPUA 2Z4TA 4FN5A 3M2TA 4KAFA 3NORA 3U3ZA 121PA 2ISCA 2JIZA 2OC9A 2OOKA 2WWXA 2G5PA 3V8BA 5L3VA 3PCRB 3OIWA 2IDZA 1DTEA 1EGQA 1VCNA 2FUKA 2V4MA 3C3JA 2O14A 2ZBRA 3PXDA 2H52A 4D9IA 5BSWA 1V35A 3SYLA 4TXNA 3HUTA 5D5PA 4UM7A 3PLRA 1G5QA 1N6RA 2COKA 2PLWA 3C4QA 3UHJA 5DX0A 4I1VA 3CQ9A 3NIBA 4L5CA 4L5BA 4KIWA 1C7IA 3VA7A 2NO6A 1E0AA 3ONWA 4G5FA 1WXWA 3KQMA 3HH8A 1OH5A 4DZRA 4IW3B 3CY6A 5FBQB 4DQUA 2YV4A 2IBTA 2Q27A 5FI5A 3UAGA 5LWHA 5L3SA 3CR8A 821PA 1DIOB 1V3VA 3MCAA 1CT9A 3AVPA 5JCZA 1VIVA 1FXWF 5DBIA 5AM1A 1U0FA 4TTTS 4DWOA 2O48X 1YB5A 4KH1A 5LDGA 4D9NA 2XUJA 1BQEA 3QV1A 1M5TA 1Z6YA 4IIJB 1NN1A 2HH9A 5FJIA 1XLTA 2Q3HA 2Q7DA 2WD9A 4RFSA 4N18A 4DLZA 1SR8A 2W2KB 2VDKB 1FTSA 1KYWA 1FPQA 1FXSA 3FNRA 4OHBA 2EFDB 3BWMA 1K8RA 4HXGA 5IDYA 4F92B 4HDAA 2CL7X 3CLTC 1KXZA 5AMXA 3FZGA 2A1TS 3EE6A 4YPFA 1WDLA 2B25A 4Q4DA 3UFBA 4GR4A 1G291 2CD9A 1UXIA 4UW9A 2V4UA 3K5IA 1MBZA 3JZMA 4IH4A 1RDFA 3MTDA 3LQRA 4RLQA 1QVRA 3UN1A 3ICOA 1CB7A 1WLYA 3L06A 3C8MA 3U4CA 1J22A 4NECA 1UDBA 3RUDA 4D97A 4YDRA 2PZKA 1U5BA 3PUVA 4MWZA 2HJWA 3V80A 2EDAA 2P2DA 2ZETA 5CXSA 1E3IA 5B58T 4IUBS 4MVJP 4F91B 4WNAB 3PIRA 1HFWA 1CNMA 2V4ZA 3M49A 4R9NA 4TS3A 4YDQA 1QPGA 1OKKD 4EX6A 2XWQA 4QBTA 3NT5A 4ZYXA 4HVCA 3HDTA 1X1EA 2ZSKA 2GK4A 2O2YA 3D0OA 3D6FA 3TSWA 3W3ZB 3W9UA 1Y7IA 1P61B 3T7CA 4Q1VA 3D81A 1LFAA 4EVRA 3PJRA 4PGGA 5GM1A 4M8KA 2JCXA 4EVQA 1EU1A 3O4RA 3SVTA 1HO3A 5E3IA 5DGIA 2GM9A 3K9CA 1HFJA 5FNVB 1G2QA 1QX3A 5I9MA 1P60A 4J1NA 3ZBUA 1FUEA 4IF4A 5DWVA 4R3WA 4CBVA 3T7RA 4DIOA 4ZMSA 4I2VA 4UHEA 5JZBA 3BMQB 2HM7A 2VAWA 1K3FA 2JCYA 1SVIA 1ZLXA 2A33A 3GN2A 1N92A 3LW7A 4UZSA 3CUWA 1C4OA 3OIUA 2ZIUB 3S5UA 3UK0A 1SXHA 2VSFA 5K6AA 3AW9A 4IMRA 3E23A 3VBCA 5AVVA 1UBOS 1JA0A 2WLSA 4F4HA 1L7AA 3TIFA 5AVSA 4ALMA 1UBCA 3TQCA 4QYMA 3MJEA 4U8HA 3IUEA 5DNDA 4HGOA 2P8SA 1ZHOA 2H06A 4RZ2A 1B93A 1JR3E 1FDTA 4KO8A 2CXTA 2OMKA 2REXB 4YUWA 4CIBA 2HB6A 1RLMA 3MIZA 4L8GA 1H2WA 1TAHA 3K1ZA 1TM1E 4Y3UA 2O07A 3WXMA 1ZN8A 5F1YA 4BP3A 4F0JA 1A77A 2AL7A 5F12A 4BQRA 1P80A 5AOBA 4IZHA 4OHCA 3UC5A 3E0QA 2D1YA 1E6EA 1TKAA 3CGWA 3V4PB 2CLOB 3VPSA 4AC9A 2XMZA 3VR5H 2C94A 5K0FA 1TJ3A 3BA6A 3ESXA 5JWHA 2CUKA 2ZUTA 2ZR9A 4J7AA 4KR6A 1DIGA 4BQEA 3QVLA 1U94A 4GX2A 4M38A 4YROA 5PNTA 3BZWA 2ZIVB 3AM3A 5MDHA 3D1VA 1KFBB 1SVWA 3QLVC 4OKSA 1PT5A 1PJ4A 2P91A 3MT9A 1G98A 1RLJA 2GD2A 2H1SA 4I50B 4TKLA 2RJ3A 4I14A 4MUKA 5JS2A 3JW8A 4AZ3B 1ADFA 2ZRKA 1BA2A 3B70A 3VYVA 1K3TA 1M2WA 2WPNA 2QTVB 1UADA 3EQZA 4M76B 1CIVA 1T35A 1UMDA 2GESA 2BUAA 5DLDA 1PQWA 1WA5A 1YBHA 4GI2A 4KXFB 1SWWA 1YQTA 2IE8A 2MSNA 4FR2A 4L8WB 1PV2A 4U02A 1PBTA 4JU8A 4RMJA 5C5DA 4EQ6B 1W75A 1GGFA 1Z4QA 2RGNC 4QLBA 1B3RA 4XQGA 2G67A 3QFFA 3TK1A 4MRAA 3JATB 4HV4A 3KQYA 3RBVA 3T12A 1WHSA 4RANA 4BASA 3WMRA 1WRBA 2B1QA 4ARZA 3B48A 1GWNA 1N1EA 2ONKA 2V5VA 4DV7B 3TNLA 4WW0A 4X7PA 1S2NA 3L4BC 2F00A 5EMJA 4RZHA 4CGYA 3THYA 3ZJUA 2YWJA 1RWPA 4G9BA 1EXWA 3AZPA 5KHOC 1F3LA 3VU3A 5FL7D 2RHRA 4ZOAA 1WS6A 2LVBA 2XKJE 5EZQA 2Z5FA 2YHBA 5A4JA 2FQXA 5JNTA 2H1OA 1P19A 4NPHA 2IYEA 4TZKA 3A1WA 4W5HA 2ZBVA 3V2GA 3ME5A 4G9GA 1U0GA 2O3JA 3T1HB 5ILGA 1MLDA 5CMLA 1OZGA 2EGHA 5T64A 1KHTA 2D0IA 1B15A 3IDFA 3DXYA 1DJOA 1KFCB 2R8BA 3OE5A 4MWCA 5TF4A 3ADKA 1SUIA 4F56A 1ZWKA 1F60A 2O2IA 5JADA 1ZCZA 2BCGY 3FWZA 4D8WA 3IKTA 4GEKA 2ZJ4A 3NFRA 3CWCA 3IVXA 4JI3B 3O4HA 2B61A 1WCIA 1XN1A 2O0KA 4RKWA 3S0JA 3DE0X 1LZKA 1YS4A 4OGKA 1HLFA 2C8KA 3SYKA 4ZGGA 4OM7A 3AUXA 2ZJAA 3BHIA 3IT3A 3CC8A 1U1DA 2DLNA 1C1XB 2R1VA 1ZC3A 4E4TA 2VCEA 1JECA 4RHTA 3Q72A 4TRMA 3SAJA 1Z7WA 1TCBA 1IEWA 1Z0JA 2IGBA 3C6XA 2R11A 2MYNA 3FOBA 4PO1A 3GRPA 4ZT3A 1YQUA 2OKCA 4GH5A 5FD8A 1ZMXA 4GI5A 4C7BA 3O38A 1Y89A 2HTFA 4Z4GA 2PLNA 4OQFA 3GHYA 4ZI7B 2RGEA 3Q7QA 3W2IA 1YNSA 5C1IA 4UTXA 3FD8A 2RG7A 4C9BA 1UIRA 1VE5A 4FFBA 2P6OA 2RFLA 2PE5A 1Z17A 3KO8A 2BR4A 5KC9A 4N7MA 3EVFA 1IUNA 4JBIA 2OCDA 1FFBA 1RHUA 5CT5A 3WMXA 3QKRA 1WUYA 4EA9A 1UM8A 1D4FA 3UA4A 1R6AA 5G02A 3KZVA 3LAWA 4PX3A 3WFZA 4PE5B 1W0KA 5SICE 5M04A 1TTTA 4DLNA 3S2ZA 1W94A 2GRUA 3E9DA 3G1WA 2P2LA 3VPBA 1IWOA 1ZGCA 5HQJA 2AD5A 4OMFG 1EWRA 1Y4SA 2FWAA 1DWPA 1F2VA 1JYEA 3JALA 1U31A 3OC0A 2R86A 4C88A 2WD8A 3EDYA 5DGCA 1UJCA 2VTVA 4MGYR 3DBLB 3ZV4A 3NB0A 2HOQA 2PZJA 2R68A 1K2VN 1BCRA 3GGDA 1M9NA 3IQEA 4MCAA 4V0KA 2AOXA 2HSWA 1J9ZA 3ADOA 4YDHB 4G09A 2AFRA 1JLSA 1RJFA 4AF6A 1CR6A 2QT9A 1GZ7A 1V7CA 1PHRA 2CYCA 3HU3A 3KXLA 1MGOA 3U7IA 3A3OA 5IBPA 4TSFD 3D4IA 1ZRNA 3JQ6A 1NW9B 3V5NA 3PUKA 1Z68A 5ADHA 3HJNA 4KW7A 2Q9BA 4MW5A 3UENA 1IY8A 4AF7A 4WN9A 3L7OA 2J9YB 5KCZA 4RZUA 4EAAA 2JRLA 4EENA 4DKXA 4EUSA 5I9TA 1TJNA 2OZLB 3U4QA 1N0IA 2A5FA 1VPTA 3DC7A 4L5JA 1UZMA 4NU0A 3TCXB 1RQXA 3P4YA 4HGPA 3O2NA 1N77A 4GE0A 3U6BA 5JAQA 3D7SA 4LYYA 4RJTA 5JNLA 4C6TB 2QX7A 4M8NE 4P6VF 5L3ZA 1VJRA 1JSCA 4FE4A 2Q7OE 1Z7GA 1QAMA 1CY0A 1X86B 4EMSA 1PFYA 1J1ZA 3UYLA 2WWHA 1PDVA 3KKKA 4HC4A 4MAAA 2AFHA 4MUMA 1M8FA 3TIIA 1UFQA 1NQVA 1LV8A 5DCUA 4EY4A 2A9PA 2VNIA 1MNQA 3HG7A 4QHYA 4XYLA 4B3CA 2CGEA 2WZQA 2QVBA 1E32A 4ZVRA 1E9CA 3FDZA 1P1KA 2APJA 4EX7A 4ZYZA 2PQ6A 2GCOA 5L4LA 3JQCA 3VR1A 4IMPA 3TL6A 4Q34A 1JNYA 1G3IA 2ZUWA 3T7TA 1VHWA 3O8RA 2J9GA 3C3KA 3KOUA 1C5KA 5EQTA 3AR9A 3PRHA 2XOEA 1Q5PA 2C3PA 2IEZA 2A1UB 2G0NA 1YCHA 3NHBA 4PICA 5DK6A 1BH6A 2H7VA 2G70A 4JVOA 4GP9A 4R41A 4I7EA 1AGYA 3EQ8A 1L4HA 2RJNA 3KV1A 4I5IA 3OT5A 4I4LA 4NYIR 5CJ2A 5H59A 5JDCC 3IUQA 4ALJA 4AJ9A 4KQXA 2ZKIA 3HBFA 2IE0A 4N0PA 5F7JA 4C05A 1L5RA 5I7SA 1S96A 2G0AA 2Q6TA 4XCQA 4PRKA 2W6ZA 3TQFA 1IAQA 1M6YA 1PLKA 2VZ9A 1KHHA 4QGBA 3BRCA 3TL3A 4EG5A 3WISA 3AJEA 4PNPA 3UH1A 2D0OB 4ZV7A 3L01A 1HT2E 1QYCA 3IERA 2IYNA 1E58A 4YYEA 9LDBA 4NE7A 3LD9A 1USIA 4GMXA 2HLDD 5BSEA 5LIRA 2B99A 2ZT8A 2NZUG 2V74B 1PDWA 1X0VA 4AJKA 1MVOA 3PL1A 1LPAB 1Z6QA 1YR2A 4EP1A 1HH4A 3GLKA 3ITEA 5EWMB 1DXYA 3TBKA 2C5BA 2R1TA 1PWHA 3A9TA 1YB1A 1WEHA 3DMGA 4Z9XA 4M0CA 3OQPA 1GQYA 3U4IA 1LPNA 3CKKA 1H23A 4B3HA 2CHVA 2Y1DA 2VA8A 4GP7A 4EKGA 2ODTX 4AJPA 1TTPB 3T38A 4FHGA 3K5PA 1QR6A 2JFXA 3HL0A 4UZEA 4NCBA 2IU3A 2WKRA 3ICWA 1TM4E 1VMDA 5EZYF 5T4FA 2C2WA 3RTAA 1U3GA 4P0TA 1SM4A 1SBCA 1W52X 3HCCA 3NPAA 2FSVA 3WGYA 1YQWA 1A9RA 3AF0A 3NWOA 3EQ6A 4JXKA 4QUBA 2RAFA 4ETIA 1ZM3A 4BS9A 1V4NA 2HA0A 4BZZA 1K08A 2O8DA 4RSGA 3RU9A 3RANA 3UKJA 3FFXA 1I7QB 3FTQA 3PVCA 2O50A 3OJEA 5TVGA 4JIGA 3OCWA 1Z18A 2ZRHA 5AJHA 4Z4QA 2G04A 4QUIA 3S3TA 1CZHA 1CR2A 1Z3IX 3UHPA 1MX9A 3ZIAD 2UAGA 2X8WA 3GVPA 4CR6A 4TYPA 1NAIA 3K1YA 4HQNA 2NTVA 3NT2A 3MRVA 4UE3S 3PZRA 4NYJQ 1CE8B 4LPSA 3RYFB 4AQYB 4C4SA 4L15A 3LP6A 1VA4A 2M6LA 5CR9A 5JBNA 1UAYA 1Q0ZA 3K9LA 1NVMB 1I2AA 4BMOB 1E9FA 2R6DA 2VP5A 5KSPA 4FZ5A 3D4NA 3D5QA 4Q6BA 1M0SA 4EMBA 1A5TA 3KL2A 3LPAA 4S24A 3VU9B 1JRLA 4BVLA 1UK7A 4QG3A 3EGCA 2ATXA 2E1RA 3L0BA 4RK4A 3GIWA 3LT4A 1X6VA 2JKYA 3P9CA 3PEFA 4MV6A 4Q3KA 3SX0A 5IDWA 1P4GA 3KQUA 1O8BA 1FJXA 1LX6A 1C0PA 4BLSA 2QTWB 2C98A 2CXNA 1X9GA 3PFIA 4OQXA 3C5VA 1P5JA 3OPMA 4GWLA 1ZD8A 1V95A 2AJDA 4RTNA 1PLLA 5KTTA 5ITWA 4UTNA 1GN8A 1RAHA 1YDGA 2GN9A 4JBHA 4JIMA 1ACLA 1SKBA 4J0QA 4KQEA 5DGDA 4QQRA 3WK6A 3PQ3A 4TZ6A 5CLHA 4K7JA 1KYTA 3UOGA 3WIUA 4EO9A 1U4SA 1DCTA 3PT9A 2C83A 1BDIA 1A9OA 3E70C 2RJOA 1RS0A 3D4PA 4I46A 4FU0A 2EP8A 2YY6A 2QSYA 4B85A 4CFSA 1WKVA 1NWHA 2YOHA 2W6IA 5LIPA 1D2NA 1R64A 2FLVA 2ZUDA 2ZATA 2ZSFA 1T91A 1EJBA 4QOJA 5DTMA 2X0RA 3GPDG 4L8LA 1HOXA 1Z34A 4LWZA 4M9CA 4KNYA 4PX2A 3R7LA 4D8UA 2VNSA 3FZQA 2VIIA 3ORFA 4NOKA 4JI1B 3T1YB 2WIFA 2Z56A 4IJWA 3VZRA 2VR1A 4L6CA 4YRGA 2RHDA 1NF8A 3HK2A 4DPMA 2XRFA 4K26A 2X2PA 3KZXA 1WD5A 1P0CA 2IYXA 3B36A 3C5CA 3JZIA 5BYKA 2OA0A 4H9GA 2BT4A 2GCEA 1TGYA 2WT8A 5D7NA 3BDVA 3QFCA 3Q8WA 5KNBA 2J8ZA 2MSWA 3R4CA 3PEYA 1GTL1 3AEQA 4W8HA 5SZHB 1VE9A 3VX3A 3LIPA 4RVCA 1U0NA 1OGYA 4ZCPA 3OTOB 2LR0A 2JGEA 3DOFA 4MUYA 1CRZA 5K4HA 2JFUA 2WSMA 4I3HA 1KU0A 4OHWA 2FN9A 4K6CA 1Y3AA 4AZ0B 5FOQA 4KGXA 1US8B 5EQDA 1LC0A 3OCXA 1ISIA 1CG6A 1Y1QA 4IEIA 2BFCA 4YJ2A 2DXIA 2HIAA 2WUGA 5KTSA 3NDRA 4BWGA 2YMPA 3IUJA 3BMOA 5KQRA 1H9AA 3QFTA 4H3VA 4LJSA 4BLQA 5JJIA 3K2QA 2ZRFA 4R05A 1CUBA 1DDGA 2SCUA 3AF4A 4NZ9A 4UU0A 3I58A 1EP3B 1USVA 4H0FA 1MFZA 2M1ZA 4G5YA 4WBNF 4QOGA 4HDOB 4HX9A 4JJ4A 4Q4JA 4JT2A 3I05A 1HSZA 4KC0A 1IWPB 5FWDA 4BO7A 3IXQA 3VKVA 1YS9A 1CS0A 1RYNA 5EHNA 2YMLA 5TEVA 1E62A 1PL7A 1BJTA 5JS7A 3ZJYA 2IQ5A 3W05A 3OCZA 2DJ5A 4P38A 5D3ZA 3V7WA 1G5IA 1FBTA 2H1CA 1Z63A 2A5YB 5HZMA 1MB0A 2YHAA 4M36A 1P2VA 1QPZA 1Y5RA 1MTOA 3DHYA 4IAOA 2V7VA 4ZVNA 1GSHA 1W7AA 2PWPA 4EKYA 5AXCA 2DEUA 1TCUA 1ZK2A 3RJTA 1UIMA 4MEAA 3R6WA 4L9SA 2ZJ3A 3KVVA 4GOOD 4HTFB 3DBHB 1V47A 2P77A 5JBQA 3S68A 2QLBA 3FTCA 2EDCA 4NU8X 1D09A 2TS1A 2OXTA 1DWQA 1P77A 1TM7E 3TF5A 4QFDA 1WB9A 3W0LB 2YFQA 1U28C 4OPMA 1MAHA 4BB9A 1BRTA 1GGJA 3M1IA 3PSAA 1SB9A 4BL5A 2O8EA 2PV0A 2IHKA 1NLUA 1NW3A 1NAHA 1RABA 1PWYE 1WJGA 1RWQA 3GLTA 4AMBA 3PR2B 3I5XA 1Y8RA 3K92A 5JD6A 4BC1A 5H4HA 3PNOA 2JGFA 4Y2RA 4R54A 3D3NA 1I5RA 5AQ1A 1Y82A 4OHUA 3JWHA 2C4VA 2CB9A 4OLFA 1J8DA 1MIOA 1MOZA 2JNWA 3DLIA 5GVRA 4O33A 1Y8QA 3W8RA 2PX0A 5AW5A 1Z26A 4UDNA 4YUZA 2KBEA 3OQMA 1QYRA 5H83A 2VYQA 1BGXT 2IDMA 2C5HA 2ZU0C 2G28A 1UMKA 2VK2A 1IN8A 3TFOA 3RUEA 3KDAA 1ZM4A 4P4TA 4HG2A 1TIKA 5ENDA 3WLAA 1FVOA 4DSNA 5L4NA 1NG1A 1XYGA 1FYFA 1H1LA 1RTKA 2VYCA 2ZT6A 1K97A 1ICEA 1QAQA 1P4SA 2HY7A 1J20A 3IUBA 3K2EA 4BNDA 3LKDA 1OLUA 3UATA 1C9EA 2JGNA 3M1AA 2ZBUA 4M88A 2HPHA 2YCBA 4YAFA 1E2DA 5G0TA 3ZUPA 4ZYWA 3T7IA 1BH2A 1L3CA 3HFGA 4DMUB 3NETA 3LK6A 5J4VA 2JFPA 5EUQB 3UO8B 3KETA 1SXJA 1E2KA 3B6ZA 4PZCA 4LNAA 4W5NA 5NULA 2AFIB 2Y0CA 3TPZA 3HCNA 3HI6A 4P83A 4R2JA 5KKCA 3A1FA 4FDVA 1W0CA 4MAMA 5ADUS 1VKJA 3RYCA 5AM2A 2YW2A 3H4VA 1P33A 5DLYA 2JIRA 2OGWA 5IBCA 3M82A 1NBIA 3VV3A 4Q0MA 4M0UA 2FSUA 1V6AA 3FYTA 2FY8A 1C8BA 1WF3A 1U1IA 4O5OA 3FA2A 5BSHA 5KNDA 4M1KA 1J4AA 1ZJJA 1PIWA 1NXWA 2RHCA 5JQGB 1KTVA 2WHXA 1UP6A 5IP5A 3NRCA 4UVHA 4DABA 4DSTA 1G9TA 3SBOA 1LTHR 3M1YA 2QYTA 1SZJG 4CEJA 1R0YA 1T5BA 4NU6A 1GPWB 4E2XA 1LTQA 4Z53A 3LNTA 4W8OA 3VNSA 3OEHD 4AIRA 4EGSA 3J80A 2XUAA 1NV8A 1JMYA 3KPVA 3FFTA 3WADA 1ADJA 3ZHSA 4G01B 4BNVA 1YE5A 3HCEA 3CX8A 3EXIA 5FOUA 3M89A 3SC3A 4WCVA 1IRXA 5HKOA 1C8VB 4TUYB 4BP8A 1F8XA 5LNK6 3LOUA 2ZXUA 4LQDA 1SG6A 5LFAA 3OWXA 1I01A 2OCYC 4B2IA 3CNBA 3K2IA 3TAHA 1JU3A 4AW9A 4EY5A 5KTMA 1ILEA 1ZUNB 2VNHA 4MRMB 4D8TA 1XAIA 1RWMA 2ZVPX 1R6TA 4FMPA 5DWQA 2GA9A 2WTXA 3BN3A 3VPCA 1TJPB 2GTHA 1XPOA 1IQPA 2Y9MB 3BL5A 5FT9A 5JDIA 1P7ZA 3FNBA 4EB6A 10MHA 3WDLA 3BE8A 3SM3A 3EPKA 4G1VA 3RBXA 4Z49A 3AVTA 3OJCA 1JWAB 4LY0A 3WI7A 4ZAWA 3W3AH 2BELA 3C45A 2H0QA 5H9VA 1M1UA 2P11A 3CWQA 3NBZC 2GDJA 3H2GA 4MW9A 1FZQA 5HILA 4BHTA 5EKUA 1X9HA 1AT1A 1T8YA 5E7JA 2FPXA 1ZONA 3BCUA 3AHIA 4ZT6A 3WWCA 3Q7EA 1Y6FA 3G0DA 3HI4A 3CNEA 4V3BA 4B8ZA 2YZNA 5H02A 2OBYA 2QXUA 5M2QA 3DXZA 1ONSA 4EHJA 3ZHXA 1DO2A 1XV5A 1BCSB 3MINB 5F7OA 2O4CA 1NIJA 3SDZA 2V3WA 3GT4A 3H1BA 3KZCA 1IZ0A 4I4IA 4YLEA 4LRSB 4YBRA 3N05A 2EFHB 1POXA 4ENTA 2LDXA 2IU6A 4HLCA 2EU8A 1E7SA 2V7XA 1U2GA 2W6NA 1PYGA 4IXDA 4K28A 4UMDA 4XTCS 3RRZA 2X3YA 4OIFA 3WJ7A 2R8ZA 1GU0A 4IHJA 4X6XA 3PNKA 3F6PA 1QXSA 2YNMC 4C5AA 1M6WA 2CKMA 2FPLA 3LW8A 2DF8A 4LIPD 1A7UA 1ABBA 3MGGA 4NMMA 2WWYA 4Y9UA 3SFTA 5JT1A 5DB4A 4QYIA 4K40A 3S7TA 1LF0A 3OEEA 3OKPA 4EDFA 3CFYA 5U4QA 3ZBTA 4DR2B 1S1CA 4LDPA 4O4IF 2B9EA 4A5OA 2YVKA 3TZQA 3EXG2 1SKUA 5LQRA 1I6KA 1WUHS 2B2CA 1AA9A 3H2SA 3MPUA 4RD2A 2VJYA 2D3WA 3EJWA 4WA7A 2OHXA 4QAQA 4J0EA 4G25A 3SBXA 2DPXA 1FFEA 2QVYX 1YJXA 4MI1A 2R6FA 2JD0A 3C6KA 3JCZA 4BWVA 4CM9D 4PYNA 3D6HA 1CDZA 1RU3A 2HNKA 3EOAI 3ONVA 2OAQ1 4DEXA 5KQSA 1CLUA 1J23A 4FGJA 5CBKA 1E2PA 4RKQA 4I1PA 1H4SA 3FCEA 3ZW8A 3WKAA 3VZCA 1LNZA 1WSDA 1I7LA 2PX6A 2X76A 3AUTA 3BGWA 2XYQA 2C4KA 2BFBB 2OEPA 3R3XA 1L4GA 2NO5A 3EVCA 3DTVD 4MGKR 4DUGA 4YHHB 2Z8XA 4D92A 2QW8A 2NIPA 1FFGA 3AB3A 5DBEX 3QLJA 4IVPA 4PIVA 4YJHB 3L8MA 5KU7A 5K8CA 4WN9B 1GGHA 3ZDXB 1NVKA 1TF5A 1KI2A 1ZRHA 3GGGA 2NZYA 5CLLA 5DYWA 3PFHA 2PKYX 3HE3A 2WE7A 4ZC8A 1FC0A 3VR4H 3WRXA 5KQLA 2Z8ZA 2Q8PA 3P5BA 4PGMA 4INJA 4XIYA 3SPXA 3O1JC 4CM5A 2Q3CA 4BNFA 5CX4A 2ZSUA 4HH0A 4S0XA 4DY4A 4XWOA 3F1KA 2WUEA 3DJYA 1B43A 4TKMA 5IHXA 1NBHA 1N4AA 2XCQA 3NAGA 3MCWA 3QVVA 4LOAA 5LU8A 2BTEA 1ECCA 5A7FA 1BXKA 2PH3A 4CVNA 4M4SA 1XHEA 4M0FA 4ZVTA 1YBVA 5SZKB 5JNWA 5CB4B 4CMHA 3NVKI 2DPHA 4C14A 5HQ3A 1DUIA 3II6X 1RTTA 3GBVA 2XZPA 1KPHA 3JSXA 4RIIA 5A0FA 4QYXA 5I9NA 4N9QA 1GT6A 2Y71A 3NUGA 3CVYA 1Z62A 2QBYB 5JMWA 1RLUA 2X8JA 5DMHA 3I39X 4MICA 1GYRA 1ZA2A 3A3PA 4HOYA 3ZHZA 2RHHA 1P9LA 3CZ9A 4WLFA 3EVTA 4WK0B 2DCMA 5LJIA 4O4JF 2DPYA 3IP1A 4W5TA 1VI6A 4AJNA 4Y9TA 2RAPA 5A71A 1T0UA 2ONJA 1YZVA 2AHRA 3RG2A 3K31A 3ZE7A 1M8PA 2XZOA 3QJGA 5LMCA 2PQ0A 4OV6B 5AKLA 1N3BA 4HAVA 5JYEA 2F62A 3MWEA 3LKBA 2R60A 2OCLA 2Z30A 3PRYA 2IYWA 4CMAA 5D6NA 3BMNB 4MQ6A 1M2OB 3L7LA 5JVDB 1QC5B 4I2NA 3EGXA 1P5RA 2V6IA 3T3MB 2GZ1A 2P75A 3PGJA 5H80A 1XZLA 2GXSA 4LZAA 4PQRA 3DEHA 5LA6A 3BIOA 2IGTA 1OQAA 2P5SA 4NONA 3FZYA 5C52B 1NU6A 1PSZA 2VK4A 2Z57A 3DE3X 5KAPA 1V1MA 4CLDA 4MP3A 5ITVA 3WWYA 4HQ0A 1Y6RA 3HZHA 1AC5A 2D1QA 3ELUA 4MO2A 4UUQA 4N47A 2WT9A 2RKWA 4B9AA 4DJEC 2IFTA 4I55A 4A2WA 1WZEA 3BICA 1BKDR 2QRGA 3NBFA 5I48A 5ELXA 4LOKA 4UUPA 3TX6A 1JHUA 2BEWA 1RXSA 4TV8A 1E79A 2QYSA 5D8DA 1E9SA 1U0LA 3HMKA 4A3SA 1PN3A 3A6EA 2WMYA 3AFOA 2JCSA 1G5RA 1GNVA 4NBUA 4HSGA 4Q05A 4C0LA 3H9JA 1ADGA 1OKKA 1UK9A 4D99A 4V0RA 5LLSA 3L0SA 1USKA 1HL3A 3IUSA 5KI6A 4EW1A 3OE4A 2EJCA 4FDTA 2OO3A 2X77A 1AHIA 4UU7A 3B53X 4LX8A 4XW2A 4RH1A 1MQ8B 5DI3B 4HDRB 2BLLA 1QF7A 4RACA 5AKXA 5B3KA 3N7UA 4HI0E 1I3KA 3UJ8A 2ZSHA 4FEGA 2WFMA 4O2AA 1E5LA 1GITA 4WSOA 2EC5A 3OJFA 3OZVA 3DEJA 4GU5A 3TINA 3WGZA 4ID3A 1PGOA 1NW7A 4IWNA 3GLHA 3VNVA 2PUDA 2Y76A 3OFSA 1N7JA 4D0GA 3BK1A 3K05A 2MR6A 2YHIB 2C5GA 2ZWPA 3ETJA 1XDWA 1AS0A 2JD1A 1RC0A 1UC4B 4IIEA 4Y2UA 3L4EA 3UA3A 2JJ2D 2WDPA 2FEAA 1YO6A 1DQYA 4G1FA 5KOYA 2QN3A 4HRVA 1VSTA 4MA0A 5DHUA 4D42A 4TMVA 5KX5B 2YRWA 3U60B 1J8YF 3NKFA 5LP6A 2P6NA 2IYFA 5B7NA 3TPFA 1THGA 2JFZA 4BKRA 3IHLA 2X7HA 3B13B 5CXXA 3MXOA 3T9FA 3UWDA 1NNEA 4TTRA 1OFTA 2HJ9A 4RA6A 5TEWA 3W2HA 2X8BA 1E3JA 1GG5A 3IE2A 4FTWA 1JEAA 3CTPA 1H5NA 1QV6A 4U6SA 4I9FA 4XQEA 5DN9A 4TT3D 2O2SA 4ZEMA 4C6SA 4BBPA 2WVJA 1AHPA 3ADCA 2NM0A 3K0AA 1KO7A 1M75A 1VBFA 3Q9LA 3SLRA 4D7AA 2XVZA 2YWBA 4ZZ0A 3P94A 4W9NA 2QT1A 3BTOA 5F35A 3G3EA 3IQHX 3EDOA 3PHBE 5I9BA 1DTSA 2IF0A 5BOSB 4XJTA 1IVSA 1BMDA 4TTQA 3EWNA 5EP4A 4DR6B 1U2DC 4LQCA 2GZSA 1RMYA 2IYVA 2YDYA 3T1TA 1H6AA 1XLUA 2Y1CA 3BMCA 4R2LA 5DM0A 4GDFA 3TW8B 3R5FA 1T29A 1W8IA 1S6YA 1NTOA 5CYFA 3VNQA 4N0DA 4JBYA 5GONA 3BB4A 4OGWA 1VLLA 3ZD6A 1MEOA 4NWIA 1J07A 1QIJA 4J2HA 2IZ5A 4LNUA 3VPFA 4X1KA 2OKGA 1PYOA 1ZITA 3NALA 4WVFA 3EEYA 1VB3A 2QW0X 2GSWA 1KI6A 2R47A 2FRDC 3E84A 4KXUA 3VHRA 2AK3A 3P2OA 2H16A 1AMNA 5DF1A 2JGJA 1Q95A 4L74A 3QMWA 1J00A 3JWJA 2KS6A 4LUCA 2XUKA 2QL9A 3A27A 2XMQA 2QU7A 3C87A 4QDKA 2YR0A 3VMFA 1G19A 1SCAA 3F4KA 3DDUA 3GA7A 4EW6A 4F1JA 2F90A 2PIDA 2IEYA 1JIQA 5HIKA 1O7JA 5KZMB 4U6NA 3J81A 2ODWA 2PMFA 2IH2A 2AXQA 3WLNA 4W7SA 5B64A 3C3MA 5AOVA 3NHPA 1CY6A 4N49A 1Y9ZA 2JLAA 5B1SA 4EHIA 4AQDA 1X1BA 3KELA 3E2MA 4HYQA 1X1DA 4UE2A 1EUCB 2Z2JA 3CEAA 3NV7A 1JLHA 4ZYTA 3NNSA 3GFTA 1TLLA 3Q98A 5FL7A 1U6JA 3LDUA 3VC1A 1E2JA 5JPCA 2PPVA 1Q7RA 3FFWA 3NWBA 1EDZA 5WRFA 4QJBA 4DRYA 4YJ2B 2QN2A 4BKOA 1N6NA 4PS0A 4EJ2A 1UOPA 4GNRA 2C54A 5ES4B 1WVGA 1WUTA 1ZCAA 1OD6A 2I5PO 4DCTA 1G20E 5AXDA 3U0VA 5C1BA 3PC3A 1J9EA 1A27A 5HPYB 1JHXA 1SN7A 2VFAA 3L8CA 3JQAA 4PG7A 4U2EA 4YJ3A 4E7PA 3TLKA 2N3ZA 2QQ0A 3K1AB 4QU0A 1YASA 3HEAA 4JI0B 1QOZA 5CDFE 4LOLA 4CN9A 4V38A 4HF7A 4OGFA 1OREA 2FE4A 4A9AA 4OHFA 1OIXA 3B2QA 2R62A 4PVDA 2ZREA 2H65A 1OLSA 1OOEA 1YR3A 3T52A 2R1ZA 2QOEA 1AKEA 4EY7A 1VGVA 2OCAA 1CEXA 2Z9CA 3AHCA 3WQSB 5KYGA 5ULLA 4K9KA 3AEKA 3EUAA 2FEXA 4BFWA 2DH5A 2IXFA 2V6GA 2HDNB 3AGQA 4WXYB 3S70A 5JZVA 4JVNA 4YIHA 3ZHRA 3K8OE 4PYQA 1J56A 2Y92A 1O6CA 1O6FA 3V8NA 5ALSA 2ZEJA 3IR7A 4KN8A 3NJ8A 1CRLA 1HUQA 5BRJA 1VL1A 3TIGA 2I7XA 1WVIA 4PLVA 4RW0A 2W2LD 2W37A 1FYDA 1R4NB 4D6YA 4Q47A 1M0EA 3V7NA 2OGUA 1BX1A 4GX5A 3O9MA 3RGGA 1CJKC 1Z0FA 2C2YA 4RZQA 2PLAA 2N46A 2ZK7A 4D5GA 2UUBB 1QANA 5EUCA 1QG2A 3R6TA 3DGEC 3H11A 3GJQA 2VG8A 3E61A 1ZOPA 4JBNA 3B3GA 4R3UC 5HCIA 1PBNA 3RYIA 3IPLA 2D2XA 5FOWA 1PJLA 1TZCA 3WBKA 1M2GA 2WICA 4ETNA 1DBSA 3KTDA 3C6ZA 1XNHA 4P33A 1O6ZA 2XQJA 1V1RA 2I1VB 1U9JA 3BQMB 3H99A 2OBXA 4IDNA 3QXHA 4JJAA 3BGSA 2OFXA 5EUBA 3SSAA 4GBED 1XCGB 3DOUA 5LCXA 3QU2A 4R84A 4UC0A 4CLXA 2VF7A 4KLRA 1ODCA 4M1OA 1MRSA 1PG2A 2DECA 1U7ZA 4NBLA 4US1R 3O75A 5J3JA 4M1TA 4BVKA 3EVDA 3OU2A 1MKYA 1CY4A 1RHQA 4G85A 3V7FA 4R2IA 1VQ1A 5D87A 3KCQA 1IFXA 3QEKA 2QAGA 1RAIA 2DWPA 3H04A 3L2OB 2OK8A 1UBLS 3NAQA 4M0PA 1QHFA 1XRJA 3I37X 1H1LB 5FCDA 3AETB 5C37A 3GJ8A 3PJGA 4ZO4A 3F5DA 4GXQA 1KYIA 1L4EA 2PGXA 3OM1A 4BNDB 4MQ5A 3IQIX 1ULZA 3HQ4O 2OECA 4MHSA 2FEPA 5COQA 3WNQA 2WMDA 1GCOA 5CA1F 6ADHA 2HJHA 2PM8A 2RGAA 3AY6A 4LZJA 4PEVA 5KYYA 2Q1XA 4V0ME 1WXHA 1QHHA 3FOCA 3S28A 4ZAGA 4KOAA 2C8VA 1EX9A 2A4KA 2FXVA 1RWBA 4AMZA 1WSBA 5FBRB 4OH1A 2DPMA 1ATZA 2Q21A 1KZ4A 5CTJA 2HYIC 2JH9A 2WP0A 1Y8ZA 3H2KA 2A88A 5AWFC 1PSWA 3D64A 4PFKA 3QVMA 4Q4AB 2QJFA 1NQAO 1SQ6A 1N5IA 1LLUA 1AK9A 2AOWA 2J3MA 2NLOA 1ECGA 3AHEA 3P7MA 3QA3E 3BFXA 4KBYA 3T5BA 4A0GA 4AP5A 1QP0A 4FJ2A 1NUAA 2DBRA 1R5BA 2F6RA 4H31A 4MYUA 1L1FA 3Q8MA 3O2SB 4CKBA 1T4BA 3N86A 1T8SA 1LD3A 1RBMA 1KZ1A 2PVCA 3DF7A 1YC2A 1N2CB 1OF1A 2GLUA 1K7SN 3KLPX 4ZJZA 2VAXA 1T9CA 3QXSA 5G1OA 1KH1A 3PTAA 2ONZA 3K70C 1TFRA 2NYRA 4KWEA 1H6CA 1CFJA 3HR8A 4MSUA 4NL4H 4DMGA 1SKQA 3IDOA 5L95A 3K16A 4POOA 1YFLA 4RD1A 2HUNA 1K86A 4BN4A 3RVMA 4ARBA 1JUDA 3B2NA 4Q48A 1IEQA 3UV6A 4BQFA 1V7QA 1AGRA 3VR3A 5IVDA 1XF9A 4HJRA 4XVRA 5HZGA 2R00A 3SU8A 2D2IA 3IMEA 4K6OA 3VU8A 3JD1A 4ICIA 1N3IA 1QYIA 3N28A 5L8VA 2H92A 3OO0A 4RTRA 1NXTA 4J16C 4QSMA 1RRMA 2A30A 4V1CI 5REQA 4F2WA 1J70A 1XXHE 1E3DA 4AN1A 1HRKA 3GB9A 1V26A 3VH4A 3MJCA 3N53A 1QB7A 2QPOA 4N3GA 2C4NA 4OQDA 4CG0A 4DE5A 1Q84A 5IM4F 4B45A 4PAWA 4ZO8A 4D2IA 1UM9B 2CZGA 3VDRA 4CQLA 3AEYA 4REQA 4QG7A 2NO9A 2KPOA 3DL2A 3RHZA 3V1LA 4AG6A 1DIBA 2BSAA 5BVHB 4CQNA 3LJKA 4KEAA 4OHOA 2VJOA 1VL6A 1VKOA 1SMKA 4DLYA 2D00A 4U4AA 4UDYX 1AURA 4G8JA 4GMDA 1DKRA 1DZ3A 3IBSA 4G1CA 4QQKA 4AULA 4YT2A 1ZKMA 2EQ5A 2QZ9A 4KKXB 4OQEA 3I6YA 4WOJA 5F3DA 4K1LA 2C99A 3OICA 3UXMA 2EKZA 2R6ZA 5C51B 3KPUA 3VC2A 1V8DA 3VBEA 2A5JA 3GCXA 4LHZA 1W5EA 2AJTA 4L6AA 1AH2A 1DAPA 1I0ZA 5K8UA 2QHXA 1GFSA 2D4AA 2J3JA 3HBLA 4EJSA 3KE8A 4W1QA 5KNLA 3HB4X 2VDMB 3G2LA 1ID1A 1GY8A 3VAZA 1H0SA 3TSAA 4H18A 1BQ4A 4Q1DA 1JFVA 2DCUA 1E4EA 4YMWA 3A9SA 2ORYA 4FILA 4CW7A 2XTZA 4OEHA 5KUTA 1SC6A 3IA2A 4AVYA 1XNQB 3T5DA 4D9FA 1NUPA 1C1HA 4UNSA 1L2TA 3ZIAA 4LHWA 4Y6OA 2AEEA 1EEXB 1V11A 4FFSA 4OMCA 4NH4A 3WK7A 3JQBC 2H9AA 1E92A 4JJ7A 4XR4A 5I9LA 3MFYA 1PTJC 1OIWA 3Q5DA 4RHUA 5EHGA 5KAMA 1WO8A 1WXGA 2DKOA 3WVNA 2ILVA 1Z74A 2BV3A 2I4OA 4G0ZA 3ZGVA 4U3JB 2V3VA 3A2NA 3I64A 1XLVA 4F9TA 4HZUB 4RVSA 1JH8A 4PFQA 5ALUA 3N8KA 2OXIA 1HDXA 5FWAA 3U1TA 4CPDA 3L6RA 3AIMA 4BE7B 4D45A 4UBLA 4QX6A 1N5MA 4NCNA 4O6VA 1AKTA 2QYHA 1JLLB 3GJ6A 2EGUA 3RTBA 3MLBA 3U17A 4CKEB 4EATA 1G60A 1M66A 3IT2A 2WJGA 3EW7A 5MFZA 3V1MA 3B20A 1NI5A 4MLZA 4B83A 2YV1A 1U9IC 1YR6A 1RZRD 2V96A 4BFXA 4D25A 2BKAA 5ALVA 4G24A 5B3JC 5TIIA 3G7UA 3WZMA 4D9MA 4NBVA 4K2HA 2UDPA 5BNIA 1SIBE 3MJ4A 4UAJA 4HBGA 3EG9B 4YRTA 2G9ZA 4BNZA 3NH9A 3D6JA 4CM8A 4MQFA 5IJXA 3GH3A 2EP7A 3CO5A 3RQIA 1JBQA 3BFVA 2R8PA 3UFXA 3JWGA 1THMA 1KFEB 4ALNA 4RFVA 1U2SA 1JBKA 1Q1AA 3ORYA 5J9FA 3M6AA 2VSNA 3PYMA 1R0WA 3FDXA 5HQ3B 5EY5B 1JHOA 4GBMA 5CX1B 3CLTD 3L5OA 3UJ3X 5C1OA 1Y8CA 2XQKA 3F71A 4RIFA 4R6WA 1IBRA 2QP4A 1DEOA 2HXSA 2V8BA 1T2AA 2PU7A 3AUKA 3MTAA 2QAJA 5TSDA 4YT4A 1FZTA 1NRXA 1PE0A 3CYFA 4RS3A 3G8CA 4LZOA 1CZOA 5KSYA 3KKZA 3BWCA 3LDAA 3RJMA 4C4AA 1YUBA 2BMJA 1EDEA 1HEYA 3AY3A 4OP1A 1FF9A 3QLTA 5IVIA 2LV8A 4D9GA 1RHRA 3R3HA 3ZWCA 1AKRA 1XDZA 2W8BB 5KKAA 1AGPA 1JW9B 1O94A 4AKTA 4CLEA 3EXEA 5GOTA 4B6OA 4E2WA 4YA6A 1L4FA 2JH3A 4XDGA 4ZDIA 3H2BA 3O8DA 4HNRA 3DNPA 3OFKA 5EE3A 3NU1A 5EJ8A 1F4VA 2OBBA 2X5KO 4QVKA 1A98A 2CXUA 1NFFA 3LCVB 1N25A 2JGRA 5BQ5A 5BV2P 4EMTA 4AS1A 3FOAA 4YRAA 1YDWA 4KQCA 3WLHA 1KEEA 3EEQA 3ANLA 5FI1B 3ESDA 5BW5A 4FYKA 5AI4A 2JI6A 3TLXA 2N42A 4KAJA 5FL3A 4JDUA 3EIQA 1G8SA 4PLFA 2FFRA 1Y6JA 4MP6A 1V37A 3EVEA 3QVGB 1NYQA 1VBNA 3QELA 4XGKA 2Y1WA 3K4HA 2EFEB 3D02A 2BFNA 1PYDA 2EP5A 4MUJA 4PWZA 4H6VA 2ID4A 1DQZA 4R01A 3SNHA 4YECA 4ZK2A 1OH7A 1Z3CA 4HZIA 4LGCA 5FPYA 1Z37A 1HDEA 2Q4EA 3EXHA 3GF4A 5EXDA 2P67A 2JEOA 2YHSA 3STXA 5CNKA 2OGZA 2J6HA 4L72A 2Q5JA 4ANFA 1PCXA 1WP4A 3GEGA 1DHTA 2I7TA 2BGTA 1V3UA 1QP7A 1NBEA 2B21A 4H3KB 4YAJA 3V97A 2NYUA 5A3VA 1B0UA 4RTKA 3MLAA 1RRPA 1L7DA 1NXXA 2VO1A 4QPNA 3QITA 2Q8NA 1BWRA 1UF9A 4MLPA 4S1PA 1IC6A 1EUZA 2HJGA 2Y1FA 2HHAA 1F2DA 2D8MA 1RQ2A 4IXNA 4PX9A 1L9XA 3TVDA 1Y9DA 2F8MA 5E7QA 4PPYA 1NM5C 4H7HA 4HWRA 1MEEA 2IZ6A 3O8LA 3QPDA 1UZUA 3IKMB 1TEVA 4O63O 1DFHA 4D82A 4DMLA 3DMTA 3TJZA 1RVV1 4B3XA 1YUMA 1OROA 2R84A 1I0IA 4YCSA 1D1PA 4FR0A 3F78A 1P1CA 5FF9A 3CVUA 2Z5LA 4AJJA 1DQRA 2BR3A 4DCSA 4KO1S 1WZNA 2IYPA 3ABIA 3PGXA 3DR3A 4XX0A 3GJ5A 5HS6A 1CZLA 1HI9A 5PGMA 3UJDA 1JQLB 3WMEA 2OGSA 3LA8A 3OLXA 2CVQA 1FLDA 1TZBA 4R8MA 5JZ9A 1XZJA 1GA1A 2GS9A 4MUXA 1EAYA 3KQSA 3QE3A 1MABA 5BNFA 2VH5R 4O4HB 2MT9A 3L77A 1XE3A 5AVJA 3SF8B 3D3QA 4GVPA 3ADBA 3HYTA 1T1IA 5K0LA 5ITZB 1HR0B 2Q2QA 3F6CA 2XCLA 3DHWC 5FUBA 2ZBEA 4ZIRA 2I7CA 3ZCVA 3K8ZA 2GZDA 1DDOA 3GL9A 1Z9BA 2GWRA 2Z8YM 4Q12A 1MRZA 2GQ0A 3QWHA 1P1IA 4KVAA 3BXFA 4MZDA 4MR7A 3H75A 3ETGA 3A3KA 4L5AA 5E6UB 4ZVOA 3PC8C 2Q9AA 2A7QA 1YRQA 3L0DA 2MCFA 2G40A 4X1YB 3VTKA 1A9SA 2EARA 1JAIA 1QZTA 3UB2A 1GTG1 4NMXB 2WZCA 3WOVA 3KM0A 1JVNA 3TN7A 1ODIA 5FUWA 3WB0A 5GY7A 3UCXA 4WBNB 3FYUA 3ZHVA 1E1NA 2ZBQA 4QC2A 2I4LA 4LYDA 1JV2B 3EZFA 4PC1A 4FHZA 1N0WA 4AWXA 1TADA 1OYYA 2J9FA 3K96A 4JB3A 3WQBA 1IQRA 2XI4A 2RGYA 4Y0NA 4ECAA 3PQ4A 5GJVC 3SOPA 3A3NA 1H65A 3Q7PA 4TMZA 3K6SB 2Q5HA 2A0YA 2A1IA 1GL7A 1BS1A 4LYEA 4AG3A 3TRJA 5J58A 3RHTA 3FGPA 1JI0A 5FUMA 1FP4B 5EPUA 4LF9B 1YOVA 1GXSB 3BGVA 2XWJI 1QIMA 4KVFA 3Q8KA 1X7XA 3MJVA 1P2BA 3COYA 1ENPA 4XB2A 2GA8A 3S2GA 4NKRA 1MOSA 2F1OA 1GRCA 3H6KA 1RQLA 1NX6A 1A7AA 2P9JA 3DC2A 1WNTA 3WHLA 4K9QA 4MVCA 4F38A 1CK4A 2YRFA 2X40A 4OL9A 2SBTA 2G06A 4GLBA 1PFVA 4EO7A 4FUTA 4CEIA 4WGGA 5JXJA 1KF0A 3A4MA 4P0PB 3C5EA 3OIYA 3WLOA 3BX1A 1ORTA 2CEKA 3FMFA 2PTGA 2FP4B 2QTLA 2NNLD 3KJHA 4V03A 1SKMA 1ZEJA 4Q18A 5CIYA 1FFXA 1R27A 4Q3CA 1B6SA 3ER6A 2ERCA 4N8SA 3OTGA 4U5XA 4CZ2A 3H1PA 1XROA 2ZB8A 5CA0F 3DH0A 1YB6A 4ARVA 4W6ZA 1A9TA 1RKBA 2O2HA 2XUPA 2FSGA 4TSRA 4DILA 2K2WA 1P17A 4ZOCA 3A1DA 3RFUA 4M9XA 4IH9A 2UUAB 3LBYA 1GPDG 4TTIA 1TYAE 2WSYB 3ASYA 3JZAA 3KJNA 3VHLB 4BQSA 2KQUA 3K9BA 4A73A 3BIJA 3TCNA 3UANA 5JSQA 3O3OB 1H1DA 4IFEA 4C0SA 5J4KA 1JVBA 3PFGA 4NESA 3G8YA 4IDGA 2ZIWB 4MTCA 4U7PB 3H1AA 2TMYA 5B3AA 4RV4A 2BMWA 1ZI8A 1TYBE 3N7TA 2CMGA 5TQJA 2HFKA 1HLPA 2G6TA 1AS3A 3ED1A 3KHSA 1O97C 4K9PA 3RM3A 3GEBA 1PJSA 1KI8A 4DNXA 5CT8A 3IEVA 2WD7B 3L0CA 2AYYA 1WZCA 5AKKA 4MW6A 2PLFA 1JS1X 4EF6A 4O2BF 2PAFA 5FYDA 2B6NA 3OFJA 4GFDA 2QPAA 2SECE 4BNLA 4KGDA 3ZU3A 5HRUA 2WAXA 4L51A 4KQ1A 1IN6A 5FYQA 5GGXA 4UU8A 2ZYIA 3GCZA 2XT9A 1JZQA 3WGJA 3CBGA 3KAJA 3ASVA 5EAIA 2HBYA 1I8TA 3THWA 3CEMA 5JFGA 3W6PA 1D2GA 3GMDA 3C16C 3HB7A 1E6CA 3KFLA 3PYXA 5EMLA 3UTCA 1T6NA 3DBVO 4URXR 2GPTA 5JATA 3NDPA 4FMCF 5LUAA 4RSMA 5JBIA 3B7PA 1RPJA 2AQKA 1WP9A 3BA1A 3L07A 2HWUA 2YVAA 4C7MA 5IXYA 2QP3A 3GLGA 4N39A 4EFDA 2EF1A 3EFOA 5HSGA 2O5EA 2JEZA 5LQAA 2D1TA 3SGLA 2OL4A 2PPLA 1C14A 3GN1A 1BRMA 1QGDA 4MPJA 2VP4A 2FMUA 3ORSA 5H3CA 3GLVA 4H3HB 5A4AA 2O8FA 4QGAA 3ICPA 3T99A 4F97A 1NXSA 4F8YA 3BYZA 4N8DA 4TLAA 1L9KA 4CUJA 1FS5A 3FGNA 1GPMA 1PJ2A 2W2VA 4CM9A 1QZ3A 2X0FA 2AUNA 2VF4X 3A25A 3G85A 5AVOA 4P4LA 1DELA 1AJEA 2IK8A 4OQPA 2H5EA 4FNAA 4CR8A 4RDXA 1QQAA 3ZGZA 4IEEA 4L4UA 4N3NA 4ABTA 1D6MA 5IW8A 4MMYB 5LBIA 1RWKA 1G38A 5J2UA 3IVGA 3V4FA 4IDBA 2YIDA 3UEOA 3VR5D 3DV0A 1XDSA 5EXPA 4IGIA 4B3BA 4ZYVA 3DTVA 1YJCA 3KOWA 4UNNA 4Y6LA 1QTQA 4S0ZA 5JC8A 1APBA 4E6EA 2E4YA 1VJGA 2ZS7A 3HUDA 1TMOA 3I4LA 3U3XA 2BMFA 1LLFA 2X5JO 1DWUA 3DAGA 3QYAA 4HDNA 1CRQA 4LY6A 2GBLC 3KOMA 1TAQA 3W1VA 9ABPA 1LGYA 4JHXA 3ZXUB 3STTA 1PS8A 1SOWA 4I0WB 4Q37A 1LJUA 3SQDA 3VPDA 2H4YA 4BMCA 2XMRA 3A31A 1J2YA 3QVJA 3A6HA 1IL0A 2G25A 3RVKA 4DQ0A 3O7WA 1U7TA 1ZIPA 2AOTA 2Q3DA 3H8VA 1R0KA 1F3OA 3HZZA 1SPBS 2Z95A 3NWEA 5CJPA 2W71A 3GH1A 4EECA 1BO6A 4J6FA 2E85A 4OX9B 1ML3A 2ZBPA 3R76A 3E5RA 3T06B 3KYDB 3T1QA 3GPLA 2JHGA 3OD5A 4J3JA 2NU9B 3MQFA 4EKEA 2WIBA 4JZYA 2IZ1A 3KEOA 4DLBA 1FJHA 1UWVA 4IIBA 3ROMA 1T36A 3DFZA 1IJFA 2N1MA 2YJ3A 3VC7A 4CM4B 1F6DA 3KR1A 1XEWX 3EZ9A 2DQSA 2L19A 2YJ6A 3F3YA 3L6EA 3PUYA 5ALEA 2Q2OA 2ZI4A 2HMAA 2J0EA 1U2PA 3OVMA 3QUBA 4FDUA 3ZI0A 2B7BA 4R5MA 4X90A 5HIAA 1NQTA 4RPJA 1WQ4A 3K0SA 4MK4A 2O4UX 4NHOA 1R18A 4QBIA 3D4OA 3SHOA 1YRYE 3UOAB 1ZJ6A 4MTLA 3WX0A 4URHA 2J6BA 4MLCA 1T0BA 3IT1A 1KSHA 2FH5B 3EG5A 4HAYA 2QD2A 3FI9A 5C8XA 3O3CA 1R6XA 4ZP1A 3OOHA 2G1UA 3ZWYA 3AFNA 2YVLA 2FEWB 4A8PA 3FRIA 4RIHA 1ZZGA 1HYBA 2J48A 2R6AA 3LX4A 4UREA 5DM1A 4ZALA 4BP9A 1RJDA 4IJ6A 2J45A 2FEMA 2HF9A 2RGWA 3KFVA 4LDZA 4MUIA 2C3OA 4RV9A 3W4IA 4KXXA 1OBVA 5C1PA 2VJCA 4CKWA 2WIDA 3N75A 4DYVA 1VHJA 4ZCQA 5AKEA 2FSHA 3GZ4A 5DCYA 3P2YA 1SD2A 2BFEA 2FQ1A 2QP9X 3I0MA 2OHOA 1GKYA 5BQXA 4DJDC 4RY0A 4YT5A 3G2QA 2POQX 4D3FA 4BMYA 5KCMA 3T5GA 2UYGA 4ZTZB 3EDMA 2I55A 4RQBA 3LL4A 2FPKA 3GYGA 4MS4A 1DRVA 4MUGA 4OBEA 3JQRA 1JBEA 4QTXA 1AK1A 4DLSA 3PXUA 1HDCA 5KNCA 2OXEA 2VDUE 1Y8AA 2BHNA 1WB6A 2QJWA 1XTSA 2B6HA 2P1RA 2R6CA 1VZ3A 2UVPB 1RI5A 3LXXA 2HRCA 3PR3A 1NKVA 5HDQA 1G8YA 1EVEA 5D86A 1T0HB 1UBFA 1BROA 4XJVA 4HNVA 4NDAA 4HRAA 5E6SA 4M1ZA 1T2NA 3AXTA 3P0RA 1KXJA 4GLLA 1WMAA 2CJWA 3HVRA 1ODKA 4AFNA 1N6HA 1W2GA 3DLAA 4HN2A 3CHYA 4P4SB 3D0QA 3PD7A 1GGMA 3MYRA 1EJ0A 2FXIA 3KSMA 1JDTA 4JENA 4GVXA 1FLAA 5HQTA 4G36A 1XJCA 4R4JA 5FOTA 2PS1A 1GAEO 3B5JA 4HNGA 4U7GA 4BRWA 5DYNA 2QTZA 1HM5A 3KU1A 5KDLA 3EIXA 1X1TA 1L5VA 3UUEA 2BI8A 2EIHA 4M6WB 1L5YA 1N7GA 1GRRA 4ZC1A 4TXHA 2VHQA 2QRZA 1KVUA 3MQ2A 3R6GA 4GM4A 5FXMA 5HEKA 1R10A 1XZDA 3WRYA 1EHCA 2IJGX 3COZA 4XFDA 2C7RA 4MUHA 4KPUA 4YQZA 3M0EA 1UJ4A 3OQBA 1A8IA 3KC2A 1Q1ZA 3IBCA 4M8SA 4U00A 4C4XA 2RGRA 4P8RA 4TV9A 3COPA 5LXTA 4JA2A 1T13A 2J6IA 3DNFA 3GNLA 3NAZA 4L7QA 4HB3A 2YYZA 4LSZA 2VBCA 5H1YA 2AEMA 2GEDA 5K45A 3MWFA 4O1MA 2R65A 2XB2A 4RXMA 1JDBC 1C3OA 1WVMA 4DB4A 5TGZA 3V4LA 4GKBA 4J2TA 3U39A 1X3SA 3ZJ5A 1OV6A 4JSTA 3U3DA 1JFFA 2GVDC 2GN8A 1BHSA 3IV6A 4G63A 1YI1A 1GG2A 1WW3A 1WQ1R 2AD1A 4LC9A 4XPIB 4ZEXA 5TLSA 4ALIA 1L7RA 4HFRA 4ZCTA 2OQVA 2IU4A 1QQ5A 1X39A 2KB0A 3CLSC 3ZVNA 2X0DA 2XNHA 5T4EA 3W5DA 2VF2A 3I8OA 4ND6A 3REOA 1RYMA 2XOXA 4M86A 4HEA1 5TMBA 1HYHA 1XTKA 2YZMA 3TZBA 5JSUA 4NY1A 3KV3O 1MJ5A 5E8RA 4FHCA 4UU1A 4BMXA 3UTDA 1X7HA 1C9KA 3HLTA 3AMVA 4R9SA 1K89A 3NYRA 5EL0A 1D2HA 2JGMA 3TRIA 5AVTA 2D1FA 5BUZA 4X63A 1KC3A 4DAEA 2TMGA 4KYTA 4QUHA 3SM9A 5CNIA 1PR0A 2GNPA 3N6VA 5EWJA 3IX7A 1VKHA 1RIIA 4ER7A 3S1AB 1FMCA 3IJ5A 4PBTA 1JB9A 2BI4A 2OGTA 2P9HA 3HKDA 1VCOA 2DWUA 4DWJA 2CMDA 2XZLA 3BWXA 1LDBA 1RR6A 2PY6A 3TOXA 4DIEA 2DJIA 3I4CA 5CVDA 4CRWB 4EKDA 1PUIA 4BPBA 3MNFA 4OLJA 1REQB 2JZOA 3NANA 4UBKA 1Q6ZA 1KP9A 1WEKA 1NQXA 1BYUA 1UAGA 2GLTA 3C5HA 3FMOB 4G4SO 1Y9AA 3U2QA 4R0MA 3QSGA 3WBBA 1BU5A 3EVZA 4RZSA 4INZA 2VJKA 3LQQA 4XD2A 5IAKA 4Q24A 4TZ0A 3TRDA 2I2FA 2QXYA 2JJYA 5EESA 2JJMA 3KD3A 3O31A 3SYTA 3X2FA 1YKFA 4MGEA 1VMIA 3NHAA 4MR8B 3IAS1 2FFBA 1PX0A 1BVRA 3PIIA 2XUFA 5K3FA 5TPZD 4LKRA 1EXDA 1KARA 1V5WA 4J0GA 5IX8A 1NVXQ 4YJFB 3MUNA 5C8YF 1XTVA 4CL2A 3N2KA 4IV5A 4JJ6A 3EZNA 1FXUA 2FAXA 2FPGB 1R6UA 2H4XA 3KZMA 3NEPX 4AXXA 1CJCA 1G16A 2QIPA 4JT8A 1O95D 2ORVA 4EA7A 3CBQA 2RHWA 3HU5A 3ENQA 4JUDX 3RSZA 4QAJA 3NGLA 2WHYA 3PA8A 2B8JA 4V39A 2DGDA 2QTNA 4Z2AA 3HXQA 1RC1A 4DEYA 5P8WA 3FWYA 5J5CA 4MDHA 4EZIA 2Q46A 2SKEA 4NMLA 3WO1A 2PKRA 1PNRA 1UKCA 5BSFA 4HAWA 4PGFA 3WNBA 3K53A 3JZDA 1E0DA 4B1FA 1DRKA 3BOSA 3VDMA 4QXRA 2PMEA 4BOYA 1WSAA 1S3SA 3F97A 4GDMA 5CLQA 4FUQA 1RKVA 1QAOA 1UBMS 4LTDA 2PVSA 3TLZA 4FIDA 4TLMB 3TOCA 1HNWB 1PZEA 1ZNXA 3HACA 1Z5NA 3T54A 2OO5C 3O1LA 4IPTA 5D85A 1ESZA 4E4YA 5AUNB 5GVSA 2ZJ7A 3OLWA 5EIFA 3VO1A 1TW2A 1ODFA 1NLFA 4W1RA 3WLTA 3SS9X 1P39A 3HB0A 1L1EA 9ATCA 1UOEA 5IRCD 3PZBA 3FM9A 3H3FA 4IZIA 5FTKA 1RCTE 3HXMA 1H2HA 2MINA 2OZPA 4ED9A 5GJWC 2GH1A 1RLOA 4R2WA 4IGFA 5SYMA 5B55A 2XZDA 1NDUA 4MJXA 3IQFA 1DPFA 2FYTA 4RELA 2PUFA 4QDOA 2IOFA 2G9QA 3IV7A 3NYIA 3SICE 4HEJA 3DHNA 1OXMA 4P1ZA 3WDMA 2W2LA 2H59A 4D81A 1TU3A 2C1ZA 3NEJA 4G0PA 3IDSA 3CLRC 5BN5A 3VR6D 4YHBA 1TXGA 4KTTE 4RAQA 2DG2A 2D7DA 2FX5A 2D1SA 1YHYA 2A9RA 2ZRPA 3MS4A 5FWXA 2CDRA 3ZLUA 3W4KA 1SELA 2PZEA 4HB4A 3V9PA 2XD4A 4JHLA 3TTTA 4I99A 2J5RA 2VPWA 1RFLA 3QFHA 4H7DA 5F76A 3T4XA 1GZUA 3CVJA 4BMVA 5LPNA 4KE7A 2JLBA 2XTNA 3ABZA 4OY3A 4D0RA 1Q77A 1C4WA 2OM6A 3A6FA 3KBOA 4EYGA 3EB9A 4XVUA 2Q29A 1FNMA 2FK7A 1ISHA 1QVZA 2PN1A 1QJ4A 2RHLA 1WW8A 2UVDA 2X5XA 3E7PA 3NM6B 3Q11A 3ESYA 1NVBA 2A84A 4EK9A 4JYAB 2WIKA 1RYBA 4ESHA 4C76A 4C5CA 5L3RA 1YVPA 1Z06A 4G37A 4F4IA 3V1YA 3LO8A 1CQIB 3KYBA 4L5YA 1QF9A 3UUWA 2NUPA 1M74A 1BDJA 2QUHA 1HDRA 4X8HA 3LBNA 4MQUA 5F78A 2P0YA 2P68A 4AJ4A 1JFRA 3LP8A 4FGWA 2C9DA 5T6MA 3RRXA 4UMFA 8OHMA 1JIJA 1O2DA 3QEJA 1L5GB 1VLVA 3IQZA 5L45A 3TLEA 4Z4IA 2ACKA 1VCHA 1ZICA 2REBA 4BCBA 3OTHA 2B1RA 4LBWA 5FQOA 2PXXA 1AU9A 3EPRA 4JR1A 3ROXA 2FQWA 2HA2A 3N3BC 3PD1A 1XN4A 3I1JA 3GRRA 4XIJA 3LZ6A 2KMLA 3O4GA 3V6LA 2RK4A 4FCCA 3EXG1 4NOLA 4EEKA 3JYNA 1KBQA 4G07A