3FWHA

Structure of haloalkane dehalogenase mutant dha15 (i135f/c176y) from rhodococcus rhodochrous
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
296
structure length
296
Chain Sequence
SEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 108
structure length 296
sequence length 296
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fwhA00
3FNBA 3A70A 5CXXA 1QIGA 4IQ4A 2WHRA 4QDZA 1LPBB 3MUOA 3WMRA 4K6KA 1OCEA 1W52X 1IZ8A 4RE6A 3RLIA 1TK3A 5ALIA 2ORYA 1HBJA 2WUGA 1E3QA 2WG2A 5CH5A 4HRYA 5ISMA 2VAXA 3HXKA 1GXSA 4S0XA 1QIFA 1QJ4A 3W04A 2CJPA 3FLBA 5IVIA 3SC2A 3WKDA 3W05A 4DMFA 3GUUA 2BGNA 1WHTA 4KRXA 5BWCA 5EHNA 1ZGCA 5AKLA 1VXOA 5ALOA 5JALA 4JYPA 2HA2A 2O7VA 4UHDA 1CRLA 3WK8A 2XUGA 4X91A 1R88A 3GZJA 1ZD4A 5K5EA 1FFAA 1OXMA 2JF0A 4AN0A 4Q3LA 4MYSA 5A7HA 4QEKA 3RKSA 3O4IA 1GQSA 1XLUA 1VZ3A 1LGYA 3H2HA 1AZWA 4K6HA 4MQLA 1YA8A 4FOLA 5FXMA 4EY6A 3C45A 1XQYA 4BBZA 1KU0A 2VATA 1XZHA 1E5TA 4WFKA 4BTVA 3PUHA 1N1MA 2WIDA 1NU6A 5AJHA 1ODSA 4KEAA 1WPRA 1K6EA 2JGLA 2OCKA 5K3CA 3HRHA 1FFCA 2Y6VA 1DTEA 1CUFA 4ZV9A 4HXFB 3C6ZA 4C89A 2VJDA 5JD6A 5F4ZA 1EK1A 3KWJA 4UFOA 4QLAA 4GBGA 2VT6A 1ORVA 3WI7A 3H2JA 5JZ9A 3DOIA 4Y2JA 4MJ3A 2B9VA 5AM4A 2XQKA 3H2IA 4BE4A 4AZ0A 4PSDA 1S8OA 3QVMA 5AKIA 2PM8A 4B84A 2ZSIA 2D0DA 2Y1KA 4BE9A 4J7AA 1DINA 3WKBA 3HLKA 1WPXA 3AIMA 3H18A 3STVA 3VISA 2IITA 2XDWA 5A7FA 2ACEA 5SYNA 1CEXA 2C58A 3A2LA 1ZD5A 1SCIA 4W63A 2WIJA 3K6KA 2WM2A 5I8PA 4JYMA 1VLQA 2WHPB 1GZ7A 4EB0A 1CUYA 4B9AA 1XRLA 5ALFA 2PL5A 1WOMA 3MGAA 5K3DA 5ALRA 2AXEA 5CRIA 3V1LA 1E8MA 5LP1A 1GQRA 1UXOA 4OU4A 4C4ZA 1U2EA 3HC7A 2X76A 4NMWA 2O7RA 4DIUA 3QMVA 4ARBA 3V1NA 5HF5A 5LZ7A 3UMJA 4AMZA 4IH9A 3WWCA 3WWEA 1CUAA 1AC5A 3CCCA 4DSAA 3DS8A 3C6XA 5K3BA 4KE9A 2HA5A 1A8SA 1WB6A 1KU6A 4EHBA 1XZDA 3OC0A 4BCBA 3OPMA 4DMCA 3IA2A 4UHBA 3CCBA 1UKCA 3TGLA 1EA5A 4DLNA 2DCMA 4H7DA 4U2GA 4KAAA 2LIPA 2XQJA 3V1KA 1XZGA 1THTA 5JIBA 1ZD3A 2QKYA 4BTLA 3HACA 3IVMA 4FWBA 1W4LA 4WJLA 1UK8A 4HZGA 3BWXA 1JT2A 1YB6A 1MTZA 2OGTA 1CQZA 3Q8WA 4BVKA 3WWOA 3O4HA 4Y2PA 2C7BA 1CVLA 1TCBA 2QTBA 5JZSA 4M0EA 1GT6A 1MX9A 2XMCA 4V2IA 3G0BA 4P08A 3WK4A 1X2EA 4A23A 2XMZA 5AIBA 1XZIA 1SCQA 2XUDA 4BATA 4QLOA 1K63A 2GZRA 2ZJ6A 5EGNA 4B85A 3O0DA 1AX9A 5AK3A 4KE6A 1AKNA 5EFZA 5CURA 1IMJA 1HKHA 5AI6A 2VA9A 1R1DA 3M83A 2RGUA 4H77A 2GYUA 4W1QA 2BGRA 3G0DA 3FVTA 4HRXA 1UT6A 3O9VA 2O2IA 2JGJA 1ODTC 2BJHA 2YH2A 4GI1A 2PPLA 1WB4A 2ZYIA 4INZA 1UOOA 1VJ5A 2HM7A 4ZWNA 3RK4A 3BXPA 2Z5GA 3BDVA 3K2IA 3K9BA 4AMYA 1UK7A 1K5PA 2G63A 5HF6A 3D5EA 4OUKX 1SFRA 3UUEA 3EBLA 2B61A 3C8HA 2G5PA 5HCUA 1QLWA 4I3FA 4Q3KA 1XZMA 3EIOA 3H0CA 1EX9A 3DNMA 4YPVA 3MUNA 3NOXA 4J3JA 3G7NA 4HXEB 1CUJA 3WYNA 1YSCA 4UHEA 4Y2TA 1BRTA 3WJ2A 4B83A 1A8QA 2Y2VA 3W2TA 2QT9A 2WUDA 3RARA 2EDCA 2YXPX 5JASA 3LCRA 2I3DA 5E4YA 1W75A 4U2CA 4CG1A 1CUUA 2VEOA 4CCWA 1VA4A 3C8DA 2YYSA 4Q34A 2GYVA 4FFWA 2DQYA 3H2KA 2YASA 2WLSA 1HQDA 1EI9A 4H18A 4OYYA 1H2ZA 2OCLA 1F0PA 4CG2A 5LZ9A 1YAHA 1BROA 5LYYA 4OCZA 1CUDA 2G5TA 3STWA 4QDTA 3QMWA 1W1IA 3OG9A 3FYUA 2J3QA 3OURA 5I7UA 5AI0A 4KACA 1QZ3A 4PW0A 2FX5A 3JW8A 1UOPA 2JGIA 4QZVA 3AJAA 2XUAA 1JFRA 2JGKA 3I2GA 3Q0TA 3MVEA 4X6XA 3VVMA 3WQHA 1JMKC 4ARAA 3RM3A 4IHAA 4WDQA 1BN7A 2CMFA 2ZJ7A 5E4JA 5AI4A 4HTAA 4XVCA 4UHFA 5AK5A 5C81A 5CT9A 2HRRA 1CUBA 4LXIA 5LZ5A 1C7JA 2DQZA 1FJ2A 5HK9A 1J07A 1WB5A 3AZPA 3WL6A 1BEEA 3B12A 3T4UA 1QIDA 4DMHA 2AJ8A 3IIIA 5AI8A 5EI5A 3AILA 5AO9A 4MXDA 3VDXA 1A8UA 1ZD2P 3ESDA 3R3XA 1XZFA 3AZQA 2BUAA 3BIXA 5IVKA 2Q0XA 4QNNA 2IIVA 4UBKA 1Q84A 5C8ZA 1USWA 5HF9A 2XMRA 5H3HA 4H0CA 1DU4A 4G9GA 1XZCA 4C87A 3GBSA 4KAJA 1MO2A 2PSDA 4DNFA 3F67A 3AINA 1BCRA 5AM0A 2D5LA 2WFLA 5AKYA 4EA6A 1ZI6A 1XZKA 5T4HA 1AMNA 1AURA 1P0QA 3EF3A 2J3DA 3A2NA 3DL7A 4XJVA 2XT0A 3D4LA 4ROTA 2C5FA 1CIJA 3I1YA 3QYJA 3R3WA 5DNWA 1L7RA 5DNUA 2PKYX 4J0KA 1DQYA 2WTNA 1N5RA 4XWGA 1U8EA 2I78A 4UBIA 4QA9A 5AOAA 1JU4A 1LPNA 2H7YA 1CV2A 5YASA 5JYCA 3BF7A 4BRSA 5CBKA 1MT3A 1ZI9A 1MNAA 4MWTA 3I1IA 5ALYA 3GROA 3ICWA 5HFNA 1YASA 2OGZA 3QM1A 1CUVA 2PUHA 1XROA 2QS9A 2WIFA 2PSJA 1XKLA 2OG1A 4TPKA 5AKZA 3F97A 4Y9SA 3VJKA 3IUJA 3DDUA 2Y2UA 2QVBA 3AIOA 1E8DA 3YASA 1G4HA 5IH7A 2RIPA 2J4CA 2AJDA 1F8UA 2HRQA 4B7ZA 4J0GA 5JARA 4MEAA 1Q0RA 1DT3A 1Y37A 3O4JA 1LPOA 3G9TA 4JH0A 2CZQA 5DYTA 3F96A 2OCGA 3LIIA 4DMKA 3W9UA 1IUPA 1NX9A 1QIJA 4CFSA 3LP5A 1EHYA 4W1SA 3D7RA 5AK6A 4X3CA 3FAKA 2QZPA 1CUIA 5D3KA 2CB9A 5HFAA 3QZUA 4G9EA 1TAHA 1CUGA 1BU8A 5HKAA 4ZGBA 1DT5A 1CLEA 4TVKA 4LYDA 1QGED 5AOCA 3A2MA 3I2KA 4XX1A 3WKEA 4B6GA 1E66A 3VJLA 4H7IA 1M33A 1LPPA 5DLPA 2H9YA 3DYIA 1Z68A 1UZAA 4FFVA 1CUSA 4ZRDA 4G4JA 2FJPA 1IUOA 3C43A 4PSCA 3B3QA 1MAHA 2E3JA 2DHDA 2RAUA 4UFPA 3R3VA 2VF2A 1BEZA 2ROQA 3HYSA 2JGEA 3R40A 3N0TA 4J0DA 1N8SA 2QOEA 4MWSA 1W6RA 3S2ZA 4AX4A 3JYHA 2W22A 1DWQA 5AOBA 1JJIA 4UBLA 1P0PA 4BP8A 4U2BA 4DYHA 4G1FA 5FPQA 4WY5A 1TKRA 1PJAA 1YCDA 1YB7A 3A6ZA 2EEPA 2BFNA 3R3UA 4X90A 1ACLA 1HLGA 1A88A 3I6YA 2XUIA 3R41A 5ALUA 3W06A 3DEAA 5CH3A 4BP9A 5ALPA 3C6YA 2WHQA 2GBFA 2CBGA 4TGLA 2HA4A 1LLFA 1DQZA 1TCCA 4L3WA 2RONA 5JATA 5T4EA 3BL8A 4Y2SA 2QUBA 5CH8A 4ITVA 1JU3A 2XE4A 3FWHA 4X97A 2HA3A 4J0JA 1IUNA 2GBGA 4PO3X 3L1IA 1DX4A 1TQHA 3BDIA 4CIBA 1VXRA 3WL7A 5FLKA 2XLCA 3C70A 4IH4A 1MAAA 3KOOA 4ETWA 1Q0ZA 4U2EA 5ALZA 3TRDA 1X2BA 3TJMA 1OILA 3R3ZA 4L9AA 1EB9A 3IULA 4QDXA 5KREA 4D9JA 2VAVA 2XUKA 2ZVDA 4BAUA 3WZMA 2OAEA 4FBLA 3ED1A 2XUPA 5ALVA 5AH0A 1LPMA 4PNZA 4Y2RA 5KBYA 2V96A 4WCVA 4EY7A 4B80A 1H2WA 3C5VA 1AGYA 3KXPA 3M82A 4E14A 4FLFA 3G9XA 3GFFA 3BF8A 3G8YA 3EQ7A 2WIKA 5LKRA 2H1IA 4G4GA 1AUOA 4H35A 1F6WA 4N8SA 3ICVA 4K2AA 2WHPA 5EIAA 4KAFA 1EDBA 4RPCA 3IDAA 3SK0A 4OB6A 3ILSA 1LNSA 4DNPA 5BV7A 5AM1A 5ALSA 3GELA 1R4ZA 5C7YA 3UUFA 1FSSA 2OLEA 3BJRA 2OCIA 1XZJA 3WWPA 2PU7A 5LKAA 1QE3A 4N5HX 4QDOA 5DWDA 1XRRA 4G4IA 1VZ2A 4X6YA 1LZKA 1Y7IA 3PF8A 2ECFA 2H7XA 5ALDA 5ALXA 4G8BA 5E4TA 3PDCA 1DX6A 2FUKA 5JAPA 1WCYA 1VOTA 4C01A 5CT5A 4E11A 2WQZA 5CW2A 3FCXA 4W1PA 4M0FA 1TRHA 4BYMA 3DCNA 4Y2QA 1GPLA 2PX6A 3FSGD 3PF9A 1HPLA 5AKHA 1T4MA 2DSNA 5K3FB 4QWMA 1E89A 3N2ZB 5BOVA 4C6HA 1LZLA 4Z49A 3I2IA 3WL5A 2QR5A 1K4YA 3PFBA 2I3ZA 2HADA 4X92A 5CT8A 1TIBA 1QFSA 4FDMA 2VQ6A 1E8NA 3WLAA 3W9BA 2WFZA 4ZREA 4F21A 4JNCA 4AZ3A 3WK5A 4BCCA 5AP9A 1QTRA 1IVYA 3E4DA 5LLSA 3DL4A 2WSLA 3PFCA 4OB8A 4LXHA 1UOQA 4OPMA 2VT7A 5JZBA 4JEIA 1GKKA 1L7AA 2QJRA 1A7UA 4AO6A 4Y2VA 1XRNA 1JKMA 1XZAA 2WUEA 4HVTA 2B20A 1K8QA 2QRUA 2UZ0A 3STYA 2OGSA 3IURA 3QH4A 3ZLVA 4BB0A 5K3EA 4W1RA 1JMYA 5EIHA 4MEBA 3SWWA 1ZJ5A 3H1AA 3DQZA 3R3YA 4UBNA 1UKBA 1TCAA 1CR6A 2OXEA 2K2QB 4FBMA 2RHWA 3NWOA 1H2XA 3KDAA 4Q3OA 4H7FA 4B81A 2XMBA 5ALHA 3E3AA 2GYWA 3ESBA 4DGQA 2XUJA 1ZGBA 2O2GA 1T2NA 4WFJA 5SYMA 5ALWA 1UKAA 2QJWA 1I6WA 1JJFA 1ORWA 3WL8A 3PE6A 4WDRA 5AKXA 2QM0A 5AKEA 4UUQA 3LS2A 3HZOA 4H7KA 5IVDA 3T52A 2HA0A 2JEZA 3FVRA 4X95A 5FRDA 1H23A 4K5QA 4PSUA 5ALJA 5ALKA 4X71A 4CI9A 3FOBA 1QONA 5JD5A 2OAGA 2C0PA 4FTWA 5ALQA 3V9AA 3H17A 2VJBA 4KR0A 1BN6A 4OU5A 2HDWA 4G8DA 4XIIA 3HJUA 3PICA 3I2FA 5JAUA 4UHCA 3ESCA 1MN6A 1WHSA 3FBWA 2OQIA 4M0MA 3QPAA 4C4XA 3OTQA 4GWLA 3HI4A 4E46A 1SC9A 3U0VA 1R9MA 5D3ZA 4P93A 1F0NA 1QIHA 5ESRA 4N8EA 5EHXA 1QFMA 4WY8A 1EDDA 5AICA 2GZSA 4P9NA 5FDFA 2WJ6A 3G0GA 5T4FA 1RWQA 2DR0A 3O4GA 1O6GA 1QTIA 1EH5A 4BVLA 4KJXA 5CXUA 1P0IA 4U2FA 2RHTA 2V97A 3O9MA 4F60A 3VJMA 4F0JA 3D59A 4P92A 1UK6A 5A7GA 4FHZA 4N8DA 2WKWA 1SOMA 5BWBA 4PF1A 1H22A 5JD4A 5FPPA 1BS9A 1CUWA 3D0KA 3WKCA 2WTMA 4GLBA 3GA7A 1PV1A 2WG1A 3F9CA 1O6FA 2BAGA 4A5SA 4J0IA 3C87A 4B82A 4F5ZA 5LIPA 3QPDA 3M3DA 5DNVA 4QWWA 1LBSA 1AQLA 3L1HA 4NS4A 4UHHA 3G9ZA 3WYDA 3EQ8A 3STTA 2XMSA 4DNOA 3PUIA 1J2EA 4AQDA 2ACKA 1DWPA 3AFIA 3PI6A 2GBIA 4K6GA 3IBTA 1QO7A 2WU3A 5ALEA 3HSSA 3V48A 1YA4A 1U4NA 2XQGA 2B4KA 4AO8A 3I28A 3H2GA 2XLBA 3QPCA 4B0OA 5C8XA 1YAJA 4DNQA 3D2BA 3SX4A 1MU0A 2WJ4A 4PQEA 4FNMA 3B5EA 1W76A 3FLEA 3DLTA 2J4FA 4Y2XA 5DTJA 3VXKA 5K3AA 1QIIA 2JGFA 5KWJA 1QIKA 5A6VA 3QITA 3X3HA 3WIBA 4AN1A 1XFDA 3WIOA 4H7EA 4DM7A 1JJBA 4AO7A 2PU5A 1VA5A 4EY8A 3H19A 4UFNA 2VJCA 3OOSA 1MX5A 2XUHA 4U2DA 1CPYA 2WIGA 5I9IA 3G9UA 3WJ1A 2AJLI 4LXGA 6YASA 4I4CA 4RGYA 4L72A 2WILA 2ONCA 2XMQA 4FMPA 1R50A 3DD5A 1EDEA 2JGMA 3DKKA 1XLWA 4BRZA 1XQXA 1JI3A 1B41A 1ZIYA 4BC1A 2C5GA 3ZV7A 1QIEA 1VKHA 4LIPD 3BE8A 2PSHA 3FYUC 2ZYSA 4OYLA 5ALGA 1YS2X 2R8BA 1ZI8A 1EK2A 3DOHA 2Z8XA 3CN9A 1RYYA 1THGA 5AIAA 4E15A 4KRYA 3LLCA 3KD2A 2HL6A 2QXUA 3ANSA 1NU8A 4QE3A 4LYEA 4UBOA 3EQ9A 1EINA 2HA7A 4GDMA 5FOQA 5HQ3A 4Q1VA 3L1JA 2AJCA 5ALMA 3I2JA 4KE8A 5FKJA 5K3FA 4BDSA 2OQVA 4NZZA 4X6UA 3BIWA 5C8VA 4IH1A 2HU7A 4QDUA 1ZIXA 4H7HA 2ZYRA 2FJ0A 2XB6A 2DFPA 1ACJA 4FKBA 1SCKA 2JEYA 2X8BA 4UBJA 1ISPA 1LPSA 4GW3A 5EIEA 1XRQA 5ALTA 4EY4A 1LBTA 1UWCA 4Y7DA 2R11A 4X85A 4L0CA 4JUIA 4GHWA 4OD0A 1YR2A 5HK8A 1HDEA 2QMQA 2I03A 4YASA 4I19A 5EHQA 2WG0A 4BCDA 3F8SA 1VE7A 1J1IA 2BCEA 1G66A 1EVEA 4OSEA 5CTAA 5KWIA 2JBWA 4UPDA 5AI9A 1GPKA 3WZLA 2HIHA 4J0CA 1D07A 5AKGA 2HFKA 2ES4A 3D3NA 5AM5A 1CUZA 5AKKA 1N5MA 1C4XA 2Y6UA 4ZXFA 5CMLA 1XKTA 3NGMA 2WFMA 1YS1X 4C4YA 4YX9A 4X7BA 4PV7A 2RI6A 1B6GA 1CQWA 1XRPA 1EB8A 1HL7A 2JIDA 4DSZA 1QIMA 7YASA 3IB3A 1ZICA 2HHAA 3FCYA 4O08A 4X93A 2XUOA 3D2AA 2GBCA 4HAIA 3I6MA 3WK9A 4MYDA 1ZJ4A 3TEJA 5A71A 1CUEA 5ALNA 1FFDA 2X5XA 1H2YA 2CEKA 2XUQA 4J0HA 2P8SA 3F98A 3ZI7A 4B9EA 3O95A 2PBLA 3S8YA 1WM1A 2VTVA 5D6OA 3DYVA 2PUJA 3STUA 1FFBA 3G0IA 5IKXA 2PVSA 4EUSA 2PSEA 2WU4A 1BCSA 5A62A 2WUFA 4A16A 2XMGA 3LIPA 5DTIA 3ZLTA 1G5FA 1ODCA 5A2GA 3AUKA 4EY5A 1MX1A 1XRMA 1XZBA 2XQFA 1ZOIA 1XZLA 4IO0A 2VSQA 4BAGA 1CUCA 3H04A 3FYUB 4G8CA 3QBJA 4CG3A 2XQIA 3P2MA 2G4LA 3ANTA 1G42A 2PSFA 5FV4A 3IUNA 3NUZA 4YK7A 5JANA 3OM8A 1R9NA 3D2CA 4DTCA 4BZWA 4CIAA 2V9ZA 5ALLA 2V98A 2DHEA 3DKRA 2CKMA 3HABA 1MPXA 5LZ8A 1XQVA 4W9RA 5AM2A 5CT4A 1U65A 2Z8ZA 3G0CA 4B0PA 5JADA 5D7BA 2NW6A 2Z3ZA 4ZI5A 1GKLA 4FLEA 5T4BA 2EDAA 1GPNA 3WA6A 1C7IA 4BDTA 4ZV7A 4BC0A 3IUMA 3U1TA 2HFJA 3IUQA 4WFIA 2WFLB 1KEZA 4X94A 4AB1A 5JAOA 4AXBA 2XUFA 3JWEA 1FFEA 2ZSHA 2HA6A 2WJ3A 3ZPXA 2CUTA 2HU8A 4FNGA 5JAHA 3BJMA 5J3JA 1X70A 5HQ3B 4HXGA 3HEAA 2HU5A 2W6CX 4H7JA 1DWOA 3ZLUA 4CCYB 5DYWA 2C0QA 1BE0A 5LZ2A 5CT6A 3VKFA 1RP1A 1VE6A 5E2IA 2BKLA 3KWFA 1Y7HA 4LKOA 1R3DA 4OB7A 3M81A 4Q05A 5DJ5A 4G5XA 4LHEA 1Q83A 1CFJA 3DJYA 4MQMA 3G02A 1MNQA 5EHZA 4BAZA 5IVHA 1UK9A 4Y2UA 5HF8A 5LZ4A 3H1BA 4N5IX 2BUBA 3V1MA 4KE7A 1IZ7A 3E0XA 2O2HA 3AIKA 1GGVA 2AJBA 2ZJFA 1EVQA 3I6ZA 3CXUA 5HKBA 3R0VA 2H7CA 1QOZA 5AI5A 4KYVA 5HZGA 3I2HA 4X00A 3STXA 4J03A 2ZYHA 1LPAB 4RE5A 1PFQA 4NVRA 3E1GA 2DHCA 4HS9A 1L7QA 3C6BA 3CN7A 4UBMA 5AK4A 4Q82A 3WK6A 1P0MA 1J06A 5FP0A 5DYYA 1ETHA 2VJAA 5AHXA 2QXTA 3C5WP 4CCYA 3QMMA 2XMDA 3AZOA 1XLVA 4Y2YA 4GECA 4GXNA 3ZWQA 3FYTA 1CUHA 2Z3WA 3WWDA 3WA7A 2OPHA 3WK7A 1XQWA 4BZZA 4EZIA 2IX9A 1QO9A 2BUCA 2QUAA 3WKAA 4EBBA 4RNCA 3FLAA 2C4HA 5FUMA 1EXWA 3ESAA 5AM3A 4GEGA 4FLMA 2XI4A 1CUXA 1XZEA 3FSGA 1MJ5A 1UFOA 5AKJA 4C88A 3VVLA 4BVJA 3KSRA
chains in the Genus database with same CATH superfamily
1ZUD1 3FNBA 3ZWXA 1U7HA 4OFWA 3WDKA 4WZAE 1DL5A 5BRNA 1E2HA 4KN8A 3EULA 1L1EA 3BJIC 4BV3A 3ZC3A 5J5AA 2A1IA 3ENWA 2CFOA 2WTEA 4F9GA 5CXQA 4Q37A 1YS7A 4K6KA 1SCNE 1P19A 1OCEA 1PR2A 1W52X 4HH4A 4UEKA 1IZ8A 4RE6A 1K89A 1TK3A 5LR6A 1H6DA 1FDOA 1T5TA 2ORYA 3S2GA 1WAMA 3CU5A 4C2AA 3PFIA 1BFDA 1JVNA 1X42A 4V38A 2ZT8A 4ISBA 4PANA 3GEDA 1Y9AA 2VAXA 1T2AA 5JI3E 1GXSA 5ISMA 1QIFA 1GIAA 4LWQA 5J2UF 4ND8A 4JBYA 3VA7A 3OHSX 2FFJA 4GPAA 1E1NA 1C4WA 2HHJA 3MEQA 4KXUA 4UM9D 1M1YE 1XMXA 3VU9B 4XDZA 1E9SA 1U11A 5IVIA 3GFQA 5KO2A 4HAVA 4DMFA 3GJXC 3JQFA 4JBWA 4PGGA 4YLYA 1ZWLA 3VR5A 1WABA 3IUPA 2UUOA 3IAM6 1Q0LA 1FTGA 1BMFA 3FFWA 3FMVA 3K1AB 1HI9A 2YTZA 1BWSA 2ZE8A 1H5QA 1N77A 5EE1A 5BSMA 4CIXA 5BWCA 4P84A 1JYEA 5EHNA 4YMLA 2R751 4J4HA 1ZGCA 3ZWMA 2XB8A 5ALOA 5DEIA 5B4UA 2HA2A 3DKIA 4DR6B 4R41A 4I4TA 3SR3A 5LYJF 2HJHA 4RHUA 5C3UA 3TPCA 3WK8A 3DAFA 3EIUA 5FBRB 1NBEA 2IZ0A 2WNIA 3GZJA 3ONVA 4RIEA 4AU1A 5KYTA 4NY1A 4B40A 1SBTA 4E94A 5K5EA 4OUDA 3CEPB 3HB7A 1FFAA 2QLLA 2YMLA 3IJEB 4MUEA 5A7HA 2PMWB 3FCUB 1UP6A 5T3YA 2FWIA 2J41A 3M34A 4UTRA 2OV8A 2JASA 4HQNA 3K9LA 1GARA 4C4PA 3BMOA 1DOAA 2ERXA 2FPSA 1H66A 2O4UX 1KKUA 2XCQA 3IUYA 4QJIA 5F5LA 3SZMA 4YMGA 5A4AA 5K6AC 1GQSA 4L9SA 4XB6B 3S5JA 3VZCA 1GLGA 1LGYA 2A0YA 2L0XA 4KYIB 5U4XA 7MHTA 3AONB 3QYFA 2WWYA 1PZHA 1FP1D 1DAHA 4DLBA 1VTKA 2FSIA 1YA8A 5FXMA 1SXJE 1FP7A 2H4XA 2FWBA 3ELWA 4J0FA 1ZS9A 1M7HA 1ZKMA 4BBZA 1DXYA 1KYXA 221PA 2GH1A 2QB5A 4Q4JB 1NI4B 2DVMA 1UJ2A 1XA3A 4DZRA 4PYRA 4N5DA 2YJGA 5EL0A 1AQNA 4AI6A 5EOVA 5JLJA 4AMGA 1AE1A 3D7NA 4NV3A 4Q7KA 5AVQA 1T9CA 1GPH1 2ZTSA 1P31A 4MMZB 4CIDA 1YQXA 3F7MA 4A8JC 5LMUB 4Z0TA 3I8OA 4HC4A 4NG5A 3WGLA 2H17A 1ODSA 2VNAA 4BO1A 1KAMA 1WD7A 4NTZA 4O2BB 2X3FA 3HJAA 5CTJA 1G5TA 5DCLA 3STHA 1GZDA 1VP3A 2XX3A 1O4VA 1UL1X 3EOBI 1DTEA 2REOA 3A8TA 5G0TA 5D5PA 1NTOA 1LS6A 4JS0A 4MI3A 3SJZA 4KUEA 3T12A 4D96A 5BSFA 1FTQA 2XITA 4EQ6A 1KS9A 1G38A 1U90A 3FMGA 1ISHA 4HADA 3C6ZA 4JKIA 4LVOA 2ETXA 5COAA 4N48A 1MF7A 1F2TA 1U1FA 1X0VA 2A0FA 3KL4A 4J29A 1JDNA 3MAGA 1EK1A 3K5WA 4MQ6A 1IBMB 4L1KA 3A6KA 3K92A 4IRMA 4B35A 2JI4A 3ETJA 4O4LB 4Q02A 2EKBA 3IR5A 3KZKA 1BVUA 3K2QA 1YL6A 1RCUA 2W6ID 5JS6A 1VCIA 2E49A 1WUJS 2OECA 2XQKA 1ZMOA 3E9EA 1J2UA 3H2IA 4LJ9A 4I66A 1VIDA 3ND7A 2P2SA 5LBUA 4AZ0A 4L5BA 1UXIA 1Q3HA 3MCTA 1V4BA 2PJDA 1U3WA 4L73A 4BKQA 4JELA 1QZUA 1EXVA 3G82C 3OT1A 3UWSA 4GH5A 1Z62A 2PM8A 2WWHA 3GFSA 4QYIA 1P4RA 3IVAA 3K0FB 4MWGA 1MEJA 2ZSIA 3CR3C 4B84A 4DUGA 2D0DA 2WSIA 2GPAA 3B9QA 1YRHA 3QLUC 4TV8B 1EGVB 3WKBA 2ZETA 1HDGO 2IE8A 3KJZA 4YRRA 1WPXA 4ACAA 5E2BA 2N3ZA 3UICA 3ZZMA 3ELUA 4Q4AB 3DOJA 2KWIA 4HQKA 3M1LA 3HNPA 3KEOA 1KXJA 2DKNA 2YBEA 4ID9A 4L4RA 3HNRA 3VISA 5A7FA 2WTUA 1PK9A 3HH8A 2ACEA 4P1ZA 5C7OO 1XCMA 3C5CA 3FB4A 3QVVA 1E9BA 1W2WB 1DLJA 1ZYUA 2VSNA 3G49A 2IEAA 5SYNA 4YCMA 5BXYA 1UBJS 1ZBDA 3WLQA 1R6UA 4HEA1 1GWNA 2NSDA 3HFRA 2PR2A 2B5WA 4KXXA 1P44A 4UATA 2ODWA 4V0MA 4PY2A 4A8JB 4O29A 1II0A 1T6YA 4QICA 4US2R 3K1TA 4FXOA 4G1CA 1ZM2A 1XF9A 3AF6A 3CX8A 3G85A 1Z6XA 2L2QA 2WSYB 1CE8A 1Z2EA 4KQ9A 2NOAA 1PF7E 2R8RA 3OD5A 4ZT2A 4DIFA 1MJFA 1YS4A 4DEYA 2DPXA 4JYMA 5I8PA 2XB9A 1RHRA 4XDGA 5HRAA 4U00A 1VLQA 4NULA 1IXZA 1VFPA 3QELB 1JA0A 1TMOA 5HEKA 1PR0A 4H1TA 1CUYA 4NXNB 4MPRA 4BFTA 3DDSA 1SCJA 2O6LA 4AECA 1QYXA 1IE3A 1GR1A 3QF7A 4BNGA 1XFAA 2Q1TA 3MFYA 3NEPX 4MHSA 1GJRA 3G89A 3H0KA 3LD9A 5EKSA 1NGSA 1WOMA 3LLMA 4UVHA 4RM2A 1TA0A 2Y76A 2FU5C 2P4EA 5G0WA 3A6FA 3DBHA 5K3DA 4D4HA 4N76A 5TMDA 1U8XX 2IPLA 5CRIA 3H3XA 2J33A 3D64A 4PN7A 1PV4A 1D2NA 2QX4A 1CJBA 4LGYA 2YBDA 1AK2A 5LP1A 3OLZA 1ODIA 4DXDA 1L5HB 1QXSA 2ZAIA 3RWMB 1RHUA 1RRKA 2VP3A 2C5HA 3HC7A 4IIVA 2CL0X 3DQQA 4NU5A 4MVJG 5FL3A 4ZDIA 1DKMA 2FW9A 5L51A 5L9AA 5DM70 3U4MA 2FPGA 2WYWA 2X76A 3DMHA 4RETA 3B5IA 4BEVA 2UUBB 3HJFA 1JHMA 1KHTA 1P2FA 2O7RA 4Z3KA 3CGWA 1IVSA 3UB2A 1S96A 3CE6A 4LJAA 3UO8B 2Z0MA 3S6JA 2AB0A 3JD2A 1ADCA 1UPCA 1V3VA 1V8BA 2W6PA 1HEIA 1MQ8B 5TT1A 4MITA 1NT4A 4BMZA 1PFUA 3MMPA 3RFXA 1E4YA 5HF5A 4R3WA 5DN6A 1VL5A 3CNOA 4DXAA 4Q7JB 4CLDA 1EAYA 4XLLA 3RASA 3MWDB 5BR8B 2CW5A 3U48A 2QGZA 1SNYA 2R1TB 1U8CB 1UPXA 2XCIA 1X1EA 3LHFA 5ELMA 1NBIA 3PXEA 1LX7A 2BT4A 2VR1A 3CF2A 5BN4B 4JMPA 2WAAA 5BYKA 1Q1BA 2ZBRA 3OZCA 1QX4A 2F7SA 3DD1A 4AY2A 3EZNA 2AFIE 4B3JA 1PYOA 4PAWA 3BSWA 1C8LA 4PZCA 2X1LA 1E0SA 3HBJA 1NW9B 3F6PA 4KN9S 4MYUA 4C7KA 3FHTA 1I14A 2IHBA 3UOAB 3HVHA 2EJVA 3BFKA 1Q1NA 2R6AA 3UH1A 2B7CA 2CWWA 3MMSA 5AJXA 4TWAA 5EMMA 5A6SA 5BY2A 2ZWPA 3PGMA 1EU1A 2H07A 4REMA 2O7QA 3DWGA 2EFCB 2P7HA 2Q4OA 3KR1A 2J8ZA 4P3PA 4ZO8A 1JEQB 3TAXA 3BKWA 1RXYA 4Y1FA 2FPLA 3NFYA 3A1DA 1QV9A 3Q6MA 5JAQA 4DMCA 2J3LA 1DCMA 2OVFA 3N7TA 2JK0A 4YRFA 1K8YB 1ZK0A 2Z2ZA 1GQYA 2DCMA 4DV6B 1R0BA 1UPTA 4J4BA 2OHFA 2B8NA 3B5JA 4U2GA 2B2NA 2O5VA 4CLRB 2LIPA 5BN3A 5BYAA 2IPNA 1Z7WA 1NDHA 3V1KA 1G7TA 1XZGA 1VJCA 4NNOA 2K4MA 3OJXA 4EO9A 2YKGA 4RXMA 3E23A 3KB1A 4E4RA 4F4DA 1W4LA 2OP0A 4DCUA 4WGFA 2IYEA 4PZAA 4KNYA 2OZLA 3IO5A 3NVKI 1UK8A 3V33A 2EJUA 3DKPA 1AGNA 1JT2A 3O9ZA 1YR1A 4ZRNA 1YB6A 3UJ8A 4BB5A 5I7EA 1BRMA 3ZKWB 1A82A 2C8VA 2R4QA 3Q0IA 4G89A 2IT1A 4F4UA 1OROA 1I94B 2RHGB 3EVCA 1H2EA 4QFBA 4ZQGA 1L3IA 3OFVA 2BM9A 3Q8WA 4L9RA 4OGGA 3IQZA 4DT1A 3WYEA 3ZDCA 3QF4A 5I9NA 2IZ1A 4WXMA 3MM4A 4BNFA 4MGEA 1W48A 3N5CA 4XGIA 4D8YA 4D99A 3JYLA 1O9HA 3GHHA 2YQ4A 1UEIA 4FDAA 4LRQA 2YWHA 4NOLA 3O4RA 2FRDA 4MCIA 4LQCA 5JZSA 2AZDA 3DLHA 2GFQA 1T1EA 3Q7EA 4M0EA 1I4LD 1IONA 3LLVA 2IXBA 1YV9A 4RHTA 4ED9A 3B1XA 5DSZA 3QFFA 4QGBA 4V2IA 4Q00A 1XD9A 3UGTA 1Y33E 1TM2A 5SZIA 2FFRA 1YJ5A 1TQ8A 5JW6A 3WK4A 1QHGA 1UBMS 4A23A 1S3FA 2EGUA 2XMZA 1HY3A 4ZMBA 1X1SA 3OKCA 1XZIA 3ER6A 4ND4A 4IFBA 1V26A 1C1DB 3HB9A 4YUVA 4QLOA 3SX0A 4LF4B 2B8EA 1RQ7A 2GZ3A 2NV0A 1HLPA 2HPVA 2V4UA 2QAGC 3ESYA 3ZHRA 1GZUA 5B1EA 2C04A 2LV8A 5KTRA 2ATCA 5JAMA 3S7TA 5EGNA 3AR5A 2EHJA 4JLDA 1WE2A 2VDUE 5AVOA 4AM8A 1YZHA 4F4IA 3TTVA 3VKVA 5EFZA 1VDZA 1JXOA 3ABRB 3N87A 4XFKA 5JPIA 5CB4A 4U9HS 2NTYC 4WVLA 5ANRB 3UXHA 2RGUA 4CM4B 4I8DA 3S5UA 1IG0A 3E22B 1Q6ZA 1WXDA 1H8EA 4L0QA 3EFOB 1QDLB 3DZCA 4M9QA 1KY5A 4XCVA 4IIHA 4NMLA 1M5RA 1QBGA 2D62A 3Q5EA 5KVCA 1GGKA 2VYVD 1FU7A 5H7XA 2QTTA 3TQOA 4D4JA 5EZ5A 4J3FA 3IQFA 5FTJA 4MUGA 4D44A 3PQFA 4NBSA 3NI2A 2XCRB 1CZUA 5DZSA 2NZYA 2ZSAA 4FFSA 2O2IA 2JGJA 3B2EA 4GPEA 2AN3A 3ETLA 4GPZA 1AU9A 4K6OA 3VR3A 2GEFA 1ODTC 4BMOB 5BN4A 8ABPA 4X8LA 4YCLA 1MABA 2RC6A 4LX0A 3DFZA 4G01B 3REOA 2ZUFA 3QE9Y 3AVYA 4JAVC 4NBUA 3HYCA 4RVFA 2C3YA 2VO1A 5MFPA 5E4FA 1W0CA 2GN1A 2VZ0A 1KZ4A 4MKXA 3S7ZA 4ZWNA 3EVDA 3RYTC 1N1EA 4I14A 3BXPA 1WVGA 4JEHA 1QYRA 4KVFA 1XJQA 3K9BA 4MI1A 1KVUA 3CT4A 3ONNA 3QNMA 3JASA 4W7IA 5D3MA 2O3QA 2UAGA 4MARA 3T1VA 5F35A 2FEPA 3WGOA 4AT1A 4R2WA 2HK8A 3IE0A 5A03A 5HF6A 1FMLA 1VE3A 2FCAA 1U2DA 1MJHA 2GD6A 1HE1C 2B61A 2FN8A 2VWPA 3RVQA 5JCZA 3DPIA 3NTXA 5HCUA 4DIBA 1BC5A 3I30X 4MVYA 1LRLA 3AERB 3NHLA 3Q3IA 2W6ZA 3ETEA 1VIMA 2Z04A 3N2KB 3NORA 4IVPA 1OFUX 4WOJA 1EX9A 5B30A 5GVSA 2X5KO 2NZVG 1HTWA 4HLDA 2LWIA 4KWEA 5TS2A 3LHSA 1RHJA 1W94A 1M6WA 3MUNA 3TSYA 2GJSA 3G7NA 3DLPX 1L9XA 1K5HA 3G2QA 3LBAA 4LV6A 3EA0A 1Z4JA 2RH8A 3FYDA 3G1WA 4FVTA 2B5OA 3K8QA 4JK3A 4URFA 2V0CA 3DZJA 5FQNA 1P4JA 1YSCA 4N54A 4L6CA 1PGPA 1VLVA 2JFQA 1TYAE 3MCZA 4U4AA 3WOHA 2ZULA 4J1SA 4P7JA 1K68A 1O0CA 4ZOLF 2FGKA 2Q6LA 4XWKA 5CHYA 3FZNA 1NUAA 3BGDA 2AA3A 4PCLA 3IOMA 1CRWG 3NTRA 1F2VA 3WOVA 1UFQA 3HRIA 3N0RA 3T5MA 2V6JA 2WUDA 2F62A 2QVYX 2QAJA 2YW9A 1HH4A 3RARA 2CCKA 1LD3A 2FSGA 1SEPA 2XY4A 2YXPX 3FDIA 1OWOA 3OEED 1JEOA 4GMXA 2AYZA 2I1LA 2YZKA 3EEYA 1DV2A 1RTKA 3LCRA 5JSHA 4FYYA 1VHQA 1UANA 4HNSA 4U2CA 4J0EA 1ESEA 2FUCA 4QLBA 1EFCA 3L1VA 4UNRA 4U02A 1RIIA 1GOTA 1VGQA 1ZC3A 2ZAOA 3SNHA 2KE5A 4YY3B 5LD2C 3C8DA 4R7GA 1GSOA 1D04A 4AS1A 4FFWA 1J90A 2QE7A 4ASUD 4ZGWA 4Z9BA 1LK5A 3GPCA 4QIHA 2ZUCA 1OI4A 5GV7A 1JB9A 1JEJA 4UMFA 3W2HA 3FJOA 4OYYA 3KYJB 1GNVA 4UVIA 4JLWA 1F0PA 3NV9A 3AVQA 4L8LA 5EXTA 4LRXA 1U0TA 1YFZA 5LXTB 2R4UA 4LISA 3T9FA 2JKYA 2CXXA 5LZ9A 1YFLA 2R6GA 4GX1A 5LYYA 1R0CA 3TDKA 2VDWA 1U3FA 2OQRA 3QEAZ 2ZBPA 5ITZA 2OA0A 2E6UX 5EZYB 3VKHA 3RUIA 3STWA 2JBAB 4QDTA 1RC0A 1KRWA 3MUFA 2HXSA 3SQOA 4ALLA 1Y8RB 2AYYA 1ZN9A 4HPWA 3T3OA 3OURA 5AYVA 5TY0A 5SY9A 1TEZA 1BWPA 2P90A 2X9GA 4CLHA 1T2DA 5I7UA 4GKVA 3MJHA 4XVHA 4F3TA 2C9OA 4BGUA 4C07A 2CV0A 1CR2A 1M9NA 3DW1X 1QZ3A 4PW0A 3NTVA 3CR7A 2FX5A 4REQA 3U2QA 3JW8A 2QZ9A 3M9LA 2F1IA 4X64B 4QZVA 4TS1A 3ODGA 4TVSA 1NXOA 3IT3A 1CERA 2Z08A 1E0KA 4Y0AA 4ZZ1A 1G17A 4UUMA 3DJFA 5I7FA 3PUJA 4N3AA 1BU5A 1L4GA 4GR4A 4CDRA 2DOKA 4XWWA 3HDTA 3FUWA 1AKYA 5F23A 3I2GA 5FBKA 1SOVA 1PK7A 2AR9A 3I52A 5ES3A 1D1SA 4DCOA 2VDNB 2XSZD 4OSPA 5AXDA 1VE1A 1JAYA 3O5AA 5FBVB 2Z9DA 3MWEA 4G63A 2QK4A 3HXPA 3LHIA 4CMHA 5JY6A 3GDWA 3GGOA 4JYAB 2IUEA 4WDQA 4GU5A 3SQXA 4X8HA 4X54A 5AI4A 3ANLA 3IBFA 4HTAA 4M9XA 1B0UA 2YZMA 3DAGA 3ZGOA 2J7KA 4UMVA 2PK3A 1T8PA 1IATA 2IGTA 4EJMA 4F2PA 3NXKA 2OXRA 2AIRA 2B8TA 3P0HA 4JLAA 5EP4A 3EZ7A 4R71A 1BW9A 5C46F 4QODA 3CZPA 3WLHA 4GOLD 4ZO7A 2I54A 2NXWA 3I8XA 4IDNA 4PC3A 2H2DA 2ZAMA 1NW8A 1TO2E 3QWBA 1G6HA 2AD5A 2ICAA 3LVQE 4L57A 4MRSA 4ZI7A 4PYLA 1VKRA 3GLVA 1DEHA 1T26A 2IYFA 2WIBA 3JVDA 3O1LA 1CUBA 5B37A 5A3VA 3WRYA 2EG5A 4CPDA 4JJ7A 4YT5A 5JD3A 1TIKA 1Q7BA 3F9IA 1C29B 5DXAA 5KJEA 1J07A 3M1YA 1NVDA 1VRWA 1BEEA 2X86A 2ZUBA 3B12A 4NOJA 4W5JA 4XDHA 3T4UA 1AXRA 4DG9A 2OOKA 1FMFA 2AJ8A 3IIIA 1HC7A 1MAVA 1CZHA 3RFFA 1XDBA 5EI5A 4RF3A 3OPQA 1V8OA 1Y8CA 1R66A 1DC4A 1KYYA 2RH5A 4FE7A 4XXHA 2O8BA 1ZD2P 3GPDG 3R3XA 4HAOA 5EJIA 4AG5A 1UXJA 3PKZA 3AZQA 2JLAA 4NS1A 4CKZA 1KOGA 4BFZA 4E32A 5IVKA 1EP9A 4QNNA 4D8TA 1VB3A 3NM6B 4E33A 4IZ6A 2EIHA 2X8LA 1YVDA 5GTDA 1RZRA 5K6AA 3EEQA 2XMRA 5H3HA 4C4OA 2P5YA 1UZUA 3QLEA 4H0CA 2REXB 2G1AA 2CDCA 2P6OA 3AYXB 5FWXB 4EGSA 1M1NA 2H7VA 2Z9BA 4PZYA 5JSQA 4KAJA 1YRLA 2PSDA 4KXFB 5FWXA 5B7GA 3SSAA 2RG1A 3WG9A 5EE3A 3UXYA 1OI3A 1KOJA 4HS4A 5KJFA 2D5LA 3KZMA 2QRZA 3UT5A 4ALIA 4ENSA 2FTKE 3EWNA 1Y34E 3ENNA 4RPLA 3ZXSA 2ZCJA 2KLBA 4NONA 3PX2A 5JFGA 3I0NA 3E3LA 1MO4A 1SXGA 3KT6A 2OLJA 3PYLA 5AKYA 4DMUB 4WBNB 3LFHA 3W5SA 4WLUA 4UEJA 1L8LA 1Q3TA 2CK3A 1ZI6A 2UVQA 2XNJA 1YVRA 3Q3HA 4S0ZA 2Z6VA 5T4HA 4LTNA 1JFVA 4NABA 3VPSA 1M1ZA 4KQIA 3RUCA 1AURA 1LV8A 1U2GC 4PG8A 5HPYB 4Y6GB 3HA5A 2QRPA 4RH3A 4XJVA 5JVDB 4J4TA 2XT0A 1JIQA 3MTDA 2FE4A 2AN9A 5IARA 1JT9A 3QYJA 2YIDA 5DNWA 3ZR4B 4Z7JA 1L7RA 3D0OA 2GARA 1NN5A 3VDRA 1G60A 2O50A 3N6XA 1GPAA 1ZOOA 4X1KA 1IWBB 1PNVA 1XU4A 4E5PA 3H86A 3RG8A 3JZFA 3Q87B 4XGNA 4OKSA 4AUMA 3CKLA 3T1QA 1R6AA 1N5RA 4ZCMA 3KUDA 4IIJF 1P74A 1XZPA 1PGOA 3ABOB 4K0KB 3B9RA 4BLSA 5KOHB 1NW7A 2EFHB 1KP3A 1Z6PA 5YASA 4D8WA 1TM3E 2IYTA 4EJSC 1CZLA 1D7AA 1NW4A 3BF7A 1NMQA 2VCEA 2ZI9A 3P4YA 2ZE5A 3L0SA 5AJUA 1G8FA 2F3SA 1WXXA 1MT3A 4ZCPA 4ZJUA 1M67A 1ZI9A 3THXB 5IRCD 1JHAA 3SBOA 2WF7A 1ZM4A 2DQKA 4PZPA 3W4IA 1XQ6A 3MPOA 2GXQA 1F7UA 3N58A 3ICWA 1YASA 4YP9A 1KDVA 1XAIA 2OGZA 3PCXA 4QUBA 2YVAA 4D3YA 4US0R 4WERA 4DUGD 4P4GA 1BXRA 3TIIA 2GOYA 4YT8A 4ZQIA 2KS6A 3FWZA 2VQDA 4LPKA 2VJNA 2PSJA 1G5HA 3U4HA 1Z3CA 3P0RA 3QU2A 3WYFA 1BNCA 1HGXA 4OK6A 3CA8A 4HX2A 2JFZA 3RYHA 1OX4B 5AKZA 3MN1A 3AHDA 3EWIA 3F97A 3GY0A 2VZLA 1A50B 1Q1ZA 1RWPA 2F9LA 2W6IA 3ACDA 1B0ZA 4H4DA 5KNBH 2R6R1 3DDUA 4YI3A 3FZEA 4RZ3A 4CMGA 1X19A 3KEQA 1L4FA 1QHHA 2AG0A 5B6PA 2QVBA 4RKFA 1UBUS 5J59A 5CA1A 3VYRB 3U7QA 1KORA 4N41A 1XEWY 1G4HA 2EBFX 3K0HA 5IH7A 1QUFA 2QLBA 1MBZA 2FW7A 2RIPA 3ONDA 4PBSA 3UMGA 4F3YA 1B0AA 2DLCX 4GG1A 1AQ6A 3ZKAA 1QAMA 1FNCA 3OF5A 4MUIA 4B4DA 4UTZA 1JR4A 1V1MB 2IYRA 3DHEA 3AHGA 4MEAA 4NICA 3U4AA 5L95A 1YR3A 2MSDB 2PXHA 1ORTA 2WKRA 2YX1A 1Q0RA 2GK7A 3Q15C 4P38A 3UYKA 5JHGB 1DPFA 3GF4A 2E4ZA 5EYPA 1Y37A 2I67A 1W5BA 2HRBA 1B74A 1G0NA 5HS6A 4ZYYA 1VLLA 5DBIA 4I3HA 2CZQA 2B1IA 4YRGA 2EKQA 4EZEA 4YCDA 3B82A 5DYTA 1IULA 3GDFA 3LQRA 2ZYUX 4MWBA 2OCGA 5ILQA 3LIIA 3TNLA 2Z6UA 1GNLA 2WAYA 1JILA 3S2UA 5KNCA 1FP4B 1S5PA 4ZARA 1X7YB 3KFLA 2EX4A 2P2DA 3MD9A 1Y4AE 1O0BA 2J07A 1R8YA 5K0NA 3RJ5A 2CXRA 1SY7A 3DEHA 3A9UA 1NQUA 1WPQA 2AWNA 3A0RB 4M6WA 4U5XA 4UNQA 1OLUB 2W70A 3RVDA 3D7RA 3W2IA 3H9JA 4Y6QA 5TMPA 1YF3A 2AEEA 1ZJJA 1P1IA 2LUOA 4Z4CA 3FAKA 2H5LA 3FOWA 4JOSA 1CUIA 3FDJA 1FYVA 2OV6A 2W8ZA 4FUQA 3REGA 3ZX4A 5HFAA 4A6PA 4YGYA 4B6OA 1CNEA 2AWOA 3NHKA 4MR7B 3OCJA 5TPZD 2HK7A 2WAOA 2DM6A 2Y93A 4G9EA 4OOFA 4XE5A 1KK0A 3CKYA 1GV1A 5K03A 2OSVA 2ZQ5A 1P18A 2E18A 3CIFA 3D6HA 3KQMA 3N75A 3R3SA 3U6BA 2B4AA 2XQVA 2X7HA 1CUGA 4N9WA 1AZTA 1PK8A 1RRGA 1BU8A 1MX3A 4O33A 1Y1SA 4AVYA 3KZOA 1PL7A 2J0UB 3GCXA 3UPDA 4UU8A 5I47A 3O8CA 4RVHA 3DEKA 3GLIB 1P75A 1SKUA 3ORFA 2GM4A 1PJZA 1ISRA 4R3NA 4KB5A 1TF7A 4ON9A 4Z7OB 3O82A 3GT0A 3QX9A 4KJZA 3DEIA 5A9RA 1WZEA 3WDLA 1IXYA 1FRZA 4PTYA 2FETA 2Q4BA 2YN0A 2LPMA 3AKDA 3LXUX 3LDGA 3PB3A 3Q8XB 4Y67A 3TIVA 1U2DC 3L0IB 4MTCA 1I1QB 2P1DA 2ST1A 3TJRA 4P5EA 1ZK1A 4XX1A 4BKOA 4FSDA 1UMCB 4YJDA 3OCXA 1NV9A 2IOYA 3TPZA 3ZCQA 5AESA 2O8FA 3KUKA 3WV4A 2FPWA 3VOSA 2A9VA 3LXXA 1KSGA 1AK1A 2FWJA 2GFIA 2VHWA 3VYTB 1T36B 1A7JA 5DMXA 3EDOA 2NIPA 3NFRA 4AP9A 1ORDA 2WC1A 3BTOA 2DG2A 4RLHA 3TN7A 4DQKA 3C6KA 4HDSA 4P6VF 2IEZA 2J5KA 3CLVA 3OOJA 3I04M 3TZEA 1I2ZA 3MSCA 3X1XA 1C2YA 1WNTA 4FFVA 1HZZA 1DS6A 3DWFA 5AMXA 1QPGA 3H6GA 4ZRDA 3NWJA 3SYRA 2MT9A 5IK2D 3JZAA 3HSYA 1IUOA 3C16C 3C43A 1WMDA 3B3QA 1TB4A 1GNTA 2RAUA 3GVPA 1NKVA 3R3VA 2IYYA 3G6WA 1QRTA 2OC9A 5THXA 1OIWA 3ZNPA 3HYSA 2Y1EA 4GYWA 3PPWA 4B3GA 2ODAA 1YNOA 2OK8A 3T7CA 2OE2A 3N0TA 4FWTA 2QOEA 2C7RA 4MWSA 1WVIA 3EPPA 1USUA 1ISMA 4I46A 3UG7A 3K0SA 4ZPXA 2NACA 3COJA 1IOWA 2D0OB 4N0QA 4RDHA 2C98A 4KWIA 4TYPA 4QASA 4WNYA 4OBXA 3RRXA 4AX4A 3TG8A 2DT5A 1BS1A 3D8TA 2A2ZA 2W22A 1K7YA 2EP5A 3D3WB 3KJHA 3M6UA 3OQHA 4TTAA 5BR4A 3L9WA 3A10A 2FMUA 3NHAA 5G4KB 4I1SA 1JJIA 1SM4A 4LRUA 4D0LB 1IM2A 5DW0A 3NTLA 1OU0A 1X7YA 1ZCZA 4WRRA 5DX0A 4U2BA 4ABYA 4YAUA 1Q0HA 4CETA 2QVXX 1JWLA 3CW8X 3N2EA 7MDHA 2A84A 1NT2A 2ZRAA 3OBBA 4KL8S 5L3SB 4G1FA 2RGDA 1FNBA 5HP4A 2DERA 1S01A 2H5IA 3AVUA 4BYGA 1JG4A 2O52A 5HIJA 3DV9A 5FADA 1RWMA 1YB7A 3CPJB 3PNKA 3A6ZA 2EEPA 3SVZA 1JHPA 1O6ZA 4PIVA 1R10A 2OCDA 3L7MA 4MHTA 2RHDA 3QJ5A 2CXPA 2OCPA 3IB6A 2XUIA 2XE6A 3EVAA 3F4BA 4KLRA 4BU0A 3WAGA 1LK0A 5EJGA 3EXHB 1PUJA 1HDIA 4RENA 3DEAA 3B8EA 3TRJA 3ITKA 3E9MA 4QQRA 4Y30A 1QVVA 4HH3C 4B75A 2JATA 5C5IA 2DAPA 3E5RA 5D3QA 1T29A 3PNVA 4FGSA 4OXIA 2ZZNA 4FJ0A 3MCWA 4L78A 3C15C 1REQB 4BRUA 2CBGA 1UP7A 2BRUA 1N1DA 1LW6E 4O3FA 3UYLA 1PIWA 5B3LA 2HA4A 4ICIA 3HXTA 1XTUA 3TGPA 4I5IA 1DQZA 1JLLB 4K0RA 1P62B 1T5OA 3O7WA 3R8CA 3ZV5A 1QKKA 3D5QA 4TSKA 3ZCVA 1N34B 3ZYZA 3RH0A 3LUJA 2GK4A 4TKLA 3HPQA 3PTZA 3KQYA 2NX2A 3U3DA 4X84A 2PFSA 1VBMA 2XE4A 4ITVA 3MILA 3X1MA 1RLIA 2LTAA 4JLPA 4UDOA 2HA3A 1Y1LA 4X97A 3T1YB 4YQEA 4D0SA 1L4MA 1UC5B 3T94A 1IUNA 2FVYA 1M6NA 4FDTA 2G7ZA 1S8FA 1JDPA 2BW0A 4CDGA 4ZI7F 1UPFA 3OJEA 3QKRA 3AVVA 2ZB8A 2GD0A 3JALB 3L1IA 1DCKA 4L95C 5FUXA 4JUDX 3ZWCA 5IJWA 1KPGA 1GGMA 4KDRA 2FRVA 2KI5A 3MGCA 2HCRA 3W78A 4FGLA 3CRVA 2CDAA 4MV9A 2QTWB 1W29A 2FHPA 3BDIA 4X61A 5FFMA 2C4MA 1VXRA 4U3JB 2XDAA 1J8YF 1Z38A 2Y66A 3RBZA 3GMDA 5FLKA 5IHPA 1VL2A 1N2CE 4C7MA 3GGPA 3A6HA 1DCFA 5ALZA 1X2BA 2C57A 1OILA 2WVHA 2I8CA 2QMUA 4IKPA 4KDFA 2H3HA 1E59A 3LF1A 4L9AA 3SZ3A 1D5WA 5K7SA 3TCXB 5F73A 5I3CA 2EV9A 1T4CA 4EX7A 3HEMA 3ONEA 1XOIA 3IULA 5JDCC 2HUPA 2OAQ1 3QXJA 2WVJA 3T7TA 4R5MA 4JQCA 1XK7A 4GM1A 3FTDA 3ESZA 4YP7A 1I4DD 1IDOA 1Q17A 3EBOA 5CLGA 2IHNA 4FQ7A 2J3KA 2F55A 1E7WA 2DEUA 4IAOA 5ALVA 1ZD9A 3NU1A 2ZUSA 4ZRMA 5HM6A 1WZNA 1O1YA 4XM2A 3NNSA 1NPTO 4QTTB 2E4XA 3X2EA 9ATCA 5KTTA 1P60A 4PNZA 4OUDB 1PKEA 2F4NA 3CF4A 3LZCA 2XDYA 2HLHA 1M2FA 3I09A 5AW8A 3CZ4A 2V96A 2BHLA 4IIGA 2I2FA 1WUIS 4B80A 2EYUA 3FNIA 1E3LA 1QDEA 4CKBB 2JA2A 4H1WA 4E14A 2GZMA 2O2CA 4ASUA 5B64A 1WY7A 5JCXA 2LRHA 3KQOA 4ENTA 3FKQA 1O97C 4ZT4A 2IVFA 2QL6A 3GFFA 3U4CA 6REQB 1FFSA 1UPBA 2WSSA 3RSOA 3SDZA 3G8YA 2VDOB 4MDHA 3GGDA 5HE9A 4PNEA 3OMXA 4IGAA 4KI0A 5EXDA 4YAFA 3INGA 2IRWA 4RADA 2MHCA 2H1IA 5FA5A 3RNOA 1T5DX 1AD2A 3DV0B 3P20A 3JSXA 4CMIB 3L93A 3DFKA 5DBEX 1WCWA 2JJ2D 4B74A 2AVDA 1F6WA 3AUJB 1OXXK 4LZLA 4F2DA 4C29A 3PT9A 5JWHA 2JFXA 5JC8A 1Z63A 1X1AA 2K7ZA 4YUYA 5F1OA 3PDWA 4TLEA 3RSCA 5FHQA 3CZQA 5JDCA 4PIMA 2HMVA 1KE2A 2WHPA 3T3PB 4ERXA 4YC7A 2GAJA 5EIAA 5TR9A 5AVVA 4MS4B 2XTJA 4AWAA 5MN6A 1I0ZA 1IJEA 4DDTA 2QUKA 3BQMB 1EDBA 4DCCA 5D7NA 5ELXA 3NT2A 4YJHA 1SK9A 2VKQA 1LNSA 4OO3A 3FPJA 3QFRA 4DNPA 4BKPA 3BD6A 1PT5A 1QKJA 1LDMA 1NP3A 3KU1A 3IT2A 3KFXA 1CF9A 5J4YA 3WVNA 3WJ7A 4R9UC 2DFVA 2MWMA 2PS9A 2RSLA 4CF7A 4ZI7B 4DSTA 4F6CA 3IVXA 1XEFA 3VNVA 4K9NA 3T4PA 2H4FA 1ARZA 3IAS1 4YAEA 4C4SA 4LYYA 2QTVA 1V95A 4JLJA 4K6FA 4P7FA 3H84A 2WT4A 4X24A 3UAWA 4D4KA 5KTYA 1OH8A 2Z56A 2KJQA 4KVGA 2G82A 1ENOA 3W3AH 2QW0X 4YQYA 3N53A 6Q21A 5K4HA 4LF8B 5LKAA 5KQPA 2D2VA 3ZTYA 4DPLA 4P4SA 3MQ2A 5REQA 1FFXA 1XRRA 2VC2B 3ZWWA 4EG1A 3MF4A 1NBME 2W6JA 1E96A 4TTQA 1Y7IA 2RFLA 4X6YA 1CK4A 4NPAA 1FDVA 2H7XA 1YHZA 4QPPA 1ZOLA 3NHSA 4Z0PA 3IODA 5E4TA 3KE9A 3WQRA 1X7WB 1PL8A 1DX6A 3IXLA 2J59A 1SCUA 2I9PA 5J5CA 5JAPA 2AKAB 1JECA 5JZMA 1T3GA 2OD9A 3FOEC 1XG5A 1VOTA 2YHBA 3H2BA 3K0KA 5CT5A 3O8BA 5DCWA 3AFMA 4ZQFA 1JW9B 4C7VA 1NUTA 4PSAA 1SCAA 1YOVB 3BS4A 2D4HA 3BWDD 2YV1A 4W1PA 2X14A 4ZT7A 5JR3A 3SDBA 4ZVOA 1JEDA 3U6KA 4XUGB 4YLGA 1R0WA 4F1KA 3WRXC 1NI5A 1JG3A 4PAOA 4TLAA 4BYMA 5FFNA 5GQSA 1RJEA 3GVIA 3LECA 4DLTA 4ZYUA 5JQGB 5KINB 2XRYA 3GLSA 4QUIA 1EUCB 1E3IA 1YNSA 1YGPA 5A9SA 1W36D 1VJTA 1GNRA 4Q24A 4QWMA 1E89A 3CUKA 3FDFA 4R2LA 4TTSA 1TJYA 3IYLW 1N5JA 4TLDA 2IYVA 3J81A 1V25A 1TKAA 3VPBA 1OX5A 1FRNA 1UBEA 1WDLA 3WBKA 4BUCA 1LZLA 1C7QA 4CKEA 3I2IA 3A3KA 5HBGA 2DECA 2W0MA 3EVZA 1LUAA 3D7SA 3OETA 3U5TA 3ZDBA 1IN1A 3TI9A 4YR7A 3U37A 4F3RA 4U8HA 4WV3A 3FGNA 3QSGA 4EYEA 3MMXA 4AJKA 1O9GA 5CD1A 2D2FA 4IG4A 2R60A 4W5NA 2BCJQ 3OZBA 3P9SA 3RIYA 4V02A 1Z33A 4BQPA 2QRJA 1JQ3A 1Q2XA 3DTNA 4JIMA 3RABA 2BEWB 2R00C 3LP8A 4FT2A 4Z3DA 4ZIRA 3WGZA 2ATVA 1V11A 3PWZA 1A2QA 1Y42X 4OKIA 2HK9A 4LZNA 1Y6GA 1JG7A 1GADO 2LE0A 1DRJA 3E4DA 4HAWA 3C3KA 2HI0A 3CZCA 3DMTC 1GA4A 3HU3A 3Q1KA 3LX6A 4WZBE 3PFCA 1V8ZA 1JR3A 5CPBA 4BJ5A 1KYWA 4ND5A 4HZUB 4JJ8A 1XNGA 3GPBA 2BE9A 4OB8A 4X7RA 3ZBUA 4OPMA 5I7AA 3FCSB 5JZBA 4LFBB 4Q7LA 2BHNA 1EGMB 1GKKA 1C3EA 3Q3JB 1L7AA 2D2EA 2X2FA 4BGDA 3K5HA 2EFYA 5F4BA 5KC9A 3TW4A 3TSWA 1W9HA 3GLGA 4W7SA 3E6AA 1ZBQA 3T3GA 3U80A 1YZLA 1CR0A 3EIEA 5FHRA 3RU3A 4OQZA 5HM8A 3SQDA 2QYHA 2Q6OA 1JKMA 1XZAA 2WUEA 1C81A 4LC0A 5I4BA 1R4NB 2R1UA 3HBNA 2OZKA 2SKDA 3HCNA 4LE0A 2JAUA 1BKSB 2QRUA 3ROQA 4C05A 2AOXA 1I32A 2EX0A 3GL9A 4GS5A 3STYA 3VSEA 3VSDA 2X40A 4EG0A 4E21A 2YXDA 2GVZC 1RPAA 5J4LA 2PX2A 5ICSA 3M33A 4HJRA 1FQWA 3E27A 1I3CA 3EFHA 3BFJA 3R6TA 1TJ3A 4L8YA 4XZ3A 3T54A 3VAYA 3DQZA 4FJ1A 3R3YA 5CVTA 1P2UA 4UBNA 5BN5B 1UKBA 3KS9A 1J2TA 4OJMX 3H9QA 2EXXA 2Z83A 3DVSX 3K8OE 2K2QB 3NT5A 1O4WA 1NVAA 4W6ZA 3S8MA 4CR8A 4HDMB 4LBWA 1E1RA 2ILTA 3GARA 5JBIA 1CY8A 2VYFA 4H7FA 4P33A 4S1TA 4C6RA 5JY1A 2XMBA 2IZOA 3FOCA 3OIDA 2IODA 1QS0B 1YZNA 3ESBA 1BA2A 1SVKA 3X44A 5BV1A 3QPUA 4RMGA 1RYEA 2O2GA 2DR3A 1T2NA 4WFJA 1MZVA 3N59A 4Z7NB 1WMEA 4LDNA 2PBZA 1QQAA 3USES 1KP2A 3MJVA 1RRVA 2PNJA 3B60A 2H4WA 3LPCA 4PVCA 2CLEB 4DJFC 5K45A 1I6WA 2J1LA 2PH7A 1YZTA 4FFBA 5JMTA 1LB1B 3CLUC 2EWMA 5JXIA 5BNIA 3WL8A 3A6EA 3HKCB 3M6FA 5KYUB 3W8EA 2BONA 3HWRA 3WICA 4AQYB 1Z36A 2ZATA 3TDNA 1AB5A 2XWSA 3NB0A 4LJ6A 2Q5JA 3JQAB 4UUQA 3LS2A 5B58T 1V11B 4AROA 1IM5A 2R85A 1U9CA 1YKSA 3LDHA 5IVDA 3JZIA 2AE2A 3KD3A 4KO1S 1G20A 1ZGHA 4QXMA 5ICFA 2JEZA 3FVRA 2MMGA 2YWJA 2G6BA 3GRFA 5H82A 1QV6A 2X41A 3BMQB 3JWPA 4X71A 4XM1A 4ZALA 1EFRD 3VRHA 4EG7A 4EPWA 2BZ0A 4YRZA 3AETA 1QH9A 1ECPA 5FR2A 4FTWA 2X58A 3PR1A 3TSOA 3G9QA 1SJ9A 2WRZA 1M2EA 4E30A 3C41J 2Z1NA 4QO8A 3I9V6 3ELDA 3CNEA 1B43A 3R5XA 4IZHA 3INRA 4TS3A 3R7WB 1YRAA 5I3ZA 1X1BA 2VZ8A 4B8ZA 1PS8A 2ZWIA 3GFOA 3TKAA 1W1WA 1E2UA 1OF1A 2FGJA 5EUQB 4HDNA 3RT1A 4IQ0A 4E6PA 4HFNA 4IMRA 4KH0A 3R7BA 2OHHA 2NVOA 3IQXA 3GQBB 3OZTA 5KYWA 2VHYA 3U60B 3T7AA 1SUEA 4AYWA 4L7QA 4NMMA 2EZ8A 1OGIA 5IAOA 1QH1A 1E2FA 1JFLA 2IYOA 1WG8A 2SKCA 3AGQA 1ZUNB 3OPYA 3WLNA 3C97A 2XIQA 4FN5A 3PC2A 4EKEA 4YR9A 2WIAA 1JG6A 2PJUA 4XVQA 4LYHA 1EWYA 1M6HA 3GLKA 3FBWA 1VBNA 2OQIA 4KQWA 3WQBA 3ZHOA 5KNDH 1Q20A 2ORED 3GUHA 4M0MA 3BREA 2CLKB 1BHSA 2XJ9A 4TZTA 4ZCTA 3LY5A 5CEJA 1BD3A 1CKEA 4BEWA 1TJ4A 1WXHA 5H02A 5JWOA 2RBEA 1RKVA 4II3A 3WISA 4E46A 1KZ7B 2YIVX 3GU3A 3OMWA 3OTIA 5FQOA 3RVJA 3U0VA 1HQYE 4QFMA 4P93A 1OR8A 1J0DA 3D4NA 3U9LA 1WXQA 3FOFC 1W73A 4FOSA 2NQTA 2OHGA 4HGOA 4CEJA 3K9CA 3D8SA 3AW8A 4FZVA 1O95C 2Q3CA 4IEFB 3NHBA 1KMQA 3LPNA 5ADUS 1FIUA 1GPDG 2AF3C 3EX7C 1R0KA 5LVAA 3AJRA 4F4CA 3KVVA 3MIIA 5FULA 5EHXA 4P31A 1KFJB 3A9CA 3BAFA 3R20A 1X7HA 1NX6A 4QPJC 3WXBA 5C4IA 4ZVMA 1EUQA 1PX0A 2OFWA 3AVXA 4Y9UA 3ICOA 4GBJA 2GKGA 2XTNA 2PUFA 3MGKA 2C9ZA 5AICA 5ABPA 3A7EA 4Z99A 3RADC 3KTAB 1U0BB 2EZ4A 1IY9A 1QNFA 4V0RA 5HGXA 3QU5A 3ETCA 1WZCA 2WJ6A 1SG6A 1NVUQ 3EE6A 3G0GA 2ZRKA 2YY6A 4XGQA 1N6RA 1RWQA 2CHFA 1JBEA 2SCUB 3CFYA 3FCOA 1U9IA 2ISQA 3G2MA 1NN3A 3QVKA 4BPRA 1JFTA 5FEUA 1ID8A 1J97A 5H83A 2YV4A 3VKGA 1QTIA 3GN2A 2M1XA 4LY0A 4OJYA 1T1IA 3RTCA 5ES4B 3LYUA 2IEIA 3NOVA 4LSMA 2CD9A 5LP6A 4DREA 4F7DA 5E1MA 5CXUA 2JIMA 5DGHA 1KPHA 5LQAA 4DZTA 1MG0A 1GD1O 2PKEA 1R37A 5J2TF 1QMGA 4F60A 3GXOA 5AVSA 4Q3DA 3AQ4A 4BNJA 2BHRA 2G07A 1E1LA 2ONKA 4FNOA 2Q5CA 2VPQA 2YJNA 4EGJA 1UBSB 5CFOA 3OUZA 4TQAA 3HY3A 4FHZA 2MYNA 1L5VA 4N8DA 2VSYA 2XECA 1XN4A 4BNNA 1Q22A 4FYVA 2FJUA 4R05A 5MGNA 1SA0A 4L4XA 2Q49A 4TKMA 4V24A 3OCWA 3HDYA 3MTAA 3WV5A 3W1EA 1CUWA 2D59A 2Q9CA 3TVTA 3RAPR 2VRBA 1PJ3A 5DXJA 2V0GA 5KAMA 5PNTA 3DVQX 3W7AA 3ZE2B 2Z5LA 3WNCA 1QJCA 1T3ZA 2I71A 3F9CA 4UM5A 4A5SA 1C9NA 5HR5A 1KYVA 1ZGZA 4FMDF 2QPLA 1OWLA 5CDTA 1NBMD 3EQZA 4HDAA 5LIPA 1IK6A 1PFYA 1FVOA 3L6EA 3MGBA 3SYMA 5LM3A 3VBCA 4ESOA 2IPOA 3R0JA 4QBGB 3ZVLA 4AKEA 3OIGA 4FZJA 4N82A 2YWCA 3EHDA 4ZMRA 5B2FA 4FEYA 3CS3A 3A1WA 3OAAA 4UHHA 4WUVA 5BVGA 5IDQA 3O47A 1P29A 4K9LA 4O25A 4QFDA 4WA8A 5EP2A 5F33A 1UF9A 2Q6KA 5BNFA 2EYQA 2Q9BA 4Y0NA 1NQAO 1KAEA 1LDGA 2BOVA 3UHOA 2BI7A 3IDSA 3NHYA 4JT2A 2ABWA 4KI7A 2GGSA 2DUJA 1KI8A 3PUIA 2BHTA 1XVVA 2VPPA 2X1HA 4GQAA 2ZIXA 1XU9A 4CT0A 1YOBA 5E2AA 5JV5A 3TDMA 4MB0A 1DWPA 3ZHYA 3FROA 3PI6A 5EN4A 3G8CA 1ZSVA 2AZ4A 5EZSA 3W6OA 1EZ1A 4R2XA 2M6KA 2LIVA 4K6GA 1QOQB 2WW8A 3SXUA 3VX3A 3ZD7A 4TRJA 2DYKA 1UDXA 3K70B 1OVMA 2WU3A 4GX0A 4ZJZA 5ALEA 3HSSA 1DO0A 3R75A 3V48A 3N8DA 3OX4A 2OFPA 4CBVA 4KR3A 1MORA 4RIGA 2W48A 3QUSA 1G4AE 5B53A 1DBRA 3AV3A 3CV3A 4KMSA 5K0EA 2GDJA 1NV8A 1RWWA 2ZE7A 3EB9A 5JJIA 3PEEA 3H2GA 4H4CA 2WM3A 3OE4A 4RJIA 2QW1A 2WYUA 4R01A 3VGJA 3EDRA 2PAAA 1KO1A 1RZUA 1XDWA 1JP7A 2C9BA 4P2GA 4AIRA 3QPCA 4KVAA 2XT9A 2XD9A 3PA6A 1A5TA 3ZTTA 3PGKA 3BMCB 1Z18A 2H6EA 1NQXA 4CM9A 3KCQA 4B0OA 2XXAA 4NH0A 3VQTA 5JPCA 2ZIAA 2FX3A 3LZDA 3RJTA 4CKWA 3G7UA 4E03A 5FV7A 2F17A 1ND5A 3D2BA 5HKLA 4TROA 4FR5A 4FHDA 4WN9A 3JZMA 4FB4A 3FPHA 3GH1A 4A73A 1VJ1A 1ETUA 4NATA 4FNMA 2JLQA 1P1HA 2D4AA 2JNWA 3B5EA 3ECCA 4OXYA 4A0RA 4CU2A 1RCFA 1PQUA 5IT9A 3B6IA 3SQLA 2KPOA 3RYIB 4NQZA 5IUKC 3QEKA 5K3AA 4E0BA 2OXIA 1PO7A 3H97A 4CMJA 3QKUA 5JNUA 1CG6A 5A6VA 5B2EA 3TOCA 3ZBPA 5IABA 3LFTA 3DQPA 2G9ZA 3ME5A 2IS4A 2J3JA 1TU4A 3OZUA 3PQ4A 4LZJA 3JCZA 4UASA 3OAAD 1OUMA 3JYNA 1MC8A 3DAHA 3RVKA 1GSAA 2H5JA 1DBQA 2PU5A 4XQGA 3ZCSA 5IZCC 3EPRA 4ZOQI 3OZIA 2HMTA 2JH8A 3EXHA 3M2TA 1UT8A 2HEGA 3R74A 5ADVA 1DPGA 2Z2IA 3DO8A 4ZHSA 4UFNA 3VU1A 3FAZA 4IV8A 1KAGA 4RPJA 4OHYA 1G5IA 5IJAA 2JG3A 4TMVA 4IDFA 1ZPDA 3AL3A 1A7KA 1SZCA 1Y9ZA 2JH3A 2XUHA 2O2EA 1BHQ1 4NCIA 3X1KA 5IF3A 2EG9A 2PEZA 4CW7A 1B6SA 4IV0A 2AKYA 1ZINA 3E5MA 1G8YA 3FSJX 2GO7A 4RGYA 3JYPA 1EKXA 1VPTA 2B92A 4FEEA 4IJ5A 2HW8A 2V7PA 2WILA 4V1CI 1XLTA 2EKZA 3DNFA 2VDPB 3DMYA 2A0KA 3FNEA 3I1JA 5DCYA 4FMPA 1Q2UA 2IV2X 3VC1A 3ZZ0A 4N6NA 4ZEVA 4URXR 4BFUA 3H5NA 1XQXA 2F90A 1JI3A 2J30A 3NCTA 5ARCA 3GNSA 4RVGA 2OPBA 1VYUA 3ZV7A 4AMVA 2V9PA 5L45A 3J81k 1CEQA 3LUCA 4BQEA 1XNQB 2NO4A 1L5LA 3COSA 1T5BA 2V55B 5J40A 4G09A 3H7AA 4B3HA 2HSEA 3PDUA 4CUZA 4CL0A 1DKNA 1P6XA 2EAUA 4H3HB 2XXJA 2AFHE 1RI5A 1SVOA 1GZ3A 2HMUA 2PSHA 3BSFA 5BR1A 3AG6A 2GF0A 4NG4A 3FYUC 4RVNA 1VL8A 2NU6B 1OE0A 4MVXA 3E9DA 4NZYA 5LIRA 3DOCA 1DQPA 3WBBA 1BVRA 1XXHE 2PUWA 3TM5A 1QFXA 2FUEA 2EL9A 4P4UA 4F11A 1ZI8A 2FEMA 1EK2A 1TKCA 4BO5A 9LDTA 2CDNA 2Z8XA 3CN9A 1RYYA 1NA5A 2XH8A 3ELYA 1U81A 4Q7MB 4YRJA 1HG0A 1THGA 1UBTS 3PHLA 3KHUA 5F7ZA 4Q9KA 2IBSA 5F2NA 5BWMA 4KRYA 4QQNA 3RUFA 4UDYX 1SU4A 1AS0A 3IOBA 3N6VA 3UFXA 3L79A 3WYAA 1SU8A 4WZAB 3NAQA 5DW3A 1E94E 2AT1A 3ZWKA 2Y0DA 1MFZA 1YCHA 2DUWA 1R0LA 2R00A 4IYRA 5K4AA 5K1ZA 5IJ9A 2X2OA 1E7YA 5I9LA 5C32A 3EVGA 5FOQA 3OZGA 1JIKA 3SLRA 3PEUA 3A9VA 2AJCA 3UAVA 1IPFA 2C83A 1ZQ9A 2NO5A 2DPMA 4IXTA 1VPDA 1SCBA 4I8XA 5C1BA 4AKIA 2XW6A 5KSYA 3ZY2A 3ZQUA 4X6UA 3EEIA 1Z73A 2R2AA 4WJKB 3WZ2A 5JYBA 4EHIA 5C8VA 4A36A 1NZDA 1YIAA 3NH9A 2H1WA 1VB5A 2PUCA 1GAWA 5LOVA 3UKJA 4QJBA 3K7EA 1ESZA 4H7HA 2ZYRA 3M6VA 4CQMA 5A5VA 1GV0A 1RI2A 3CY6A 2DFPA 2O59A 1JEEA 4LF7B 1U8AA 1IAVA 2P68A 1D4FA 1WOYA 3QKSB 4NR0A 3QVTA 2I6TA 4AUNA 1ISPA 1MVLA 4JP1A 3TVDA 1HT1E 2I7VA 1IL0A 3RB8A 1G8MA 1LBTA 4QTZA 5K51A 1KF0A 2I7CA 2A3NA 2QYTA 4E4TA 2R11A 3OLYA 5D51S 4L0CA 2BFWA 1G63A 1F8GA 4RGQA 3G2HA 3ZE7A 2QD2A 3ZI4A 5FBLB 3ZJ4A 3GT4A 1GRQA 4LX8A 4GHWA 2FPMA 1YZVA 3NBYC 3WGIA 3ZXUB 1J5EB 2OYRA 3DT9A 1CJTC 1W47A 4H59A 2DX7A 4HDQB 4P83A 3RGGA 4F8EA 2IH2A 3NYIA 4BCDA 3F8SA 4OQYA 3M3HA 2XUZA 1CRZA 1HFEL 3TLCA 2WKQA 5TIIA 4KQMA 1JDZA 4CTOA 5EP1A 4HEHA 3TTSA 4OHZA 4NYIQ 4WNIA 4GOKA 3HCWA 2PFKA 4I2VA 2BZGA 3EYAA 5BW4A 3E8XA 3TR6A 1DIHA 1JN0A 3WLRA 1RTTA 2BVNA 2LXNA 5CM2Z 5KWIA 4MDFA 1KSFX 3MLBA 2C1EA 2PRJA 3PKIA 2VK4A 1MQAA 1Y6QA 1JIJA 2PANA 4FMCF 4YTEA 3TL2A 4TV9B 1NBAA 2O2ZA 1SR8A 4U7DA 1TM4E 2P0AA 3LX8A 2HFKA 5EYPB 4NZOA 4AULA 1RPTA 3GLIE 4C0SA 4K9KA 5AM5A 1CUZA 1JIIA 4U6QA 2VNIA 4BKMA 3DWIA 5KU1A 1ANKA 4HVAA 4WNCA 4IUYA 1GQ2A 2L42A 4HFRA 3K70D 3AVTA 4JI6B 1B7GO 1EX6A 1YUNA 3UJ9A 4G0YA 3HU5A 1OA1A 2XNDD 3B52X 3SCZA 1Z15A 2PGDA 2GVDC 1XKTA 1OFUA 1HZJA 3HVJA 5BSHA 5LL6P 3NGMA 4LJYA 3LT4A 2J85A 4ZDWA 2ZQYA 1CZKA 1VI2A 2WFMA 4BZPA 5EJ8A 5BXQC 1NE7A 3RSQA 4EEZA 1L5QA 4PZDA 2HPHA 3TR0A 1OX4A 2QRHA 1DTSA 3V8EA 5FAKA 4V1CA 5LOVF 3PQEA 1G1MA 3AESA 3LP6A 5KHOC 3C4JA 5AVWA 5B3JA 1XTVA 1A69A 4A0FA 1WKBA 1QWOA 4YS6A 3ROZA 2DMRA 4Z54A 5BOSB 1XPRA 3R3HA 5CDFA 1HT2E 1EB8A 1M6VA 2GETA 4DIKA 1O95A 1VSBA 4U7HA 2YYAA 2C2HA 3WNDA 1P1BA 1C9EA 1WXEA 3H5AA 1R00A 1MB0A 2UYYA 4YQFA 4OLBA 3UK0A 3CRQA 3DL2A 4O08A 2YCLA 1U7UA 4RPGA 4UKDA 1Y9JA 4DWOA 4PLYA 5IH3A 3I8SA 5A4DA 1VKJA 4B4OA 3F6BX 3A9SA 1IOVA 1IY0A 3D4BA 3JWHA 4TMYA 5FWYA 1TX4B 5IBCA 4KGDA 1XJ5A 4MYDA 1AUQA 4X3PA 3V46A 4LHXA 4MP8A 4JOQA 1FC0A 3QXHA 2AOUB 2RGYA 3HLTA 3GRRA 3IUSA 4UNIA 5DWQA 2P65A 5BSUA 2CEKA 4YXWD 1ZONA 4B5LA 1D0SA 3F8TA 4C1BA 1GRNA 2FB9A 1G8SA 2JDID 5E6SA 3ZS9A 4B9EA 5CITA 3B7PA 3PD0A 1EZ4A 3JYQA 2VTVA 2JARA 3T7IA 1U3GA 2R5NA 5T41A 2BEWA 1KNQA 3P9YA 4YRMA 1J1UA 3KHTA 4NZMA 5JYEA 2IP4A 2JJ8A 4GGOA 4YA6A 2NUAB 1P9NA 3HRKA 4O2LA 2E55A 2PVSA 1MP0A 2Y1FA 4U7GA 3QVXA 2FQXA 3NHRA 1YS9A 3IHKA 2CXTA 3QVLA 4DV5B 4R6WA 4LTMA 4I99A 3PQ3A 1B6TA 5CVJA 2WUFA 5A62A 1TQ4A 3OQPA 5HJEA 5HNKA 3PK0A 4MR8A 3ZNNA 1XDSA 4C3UA 2EKPA 3NMUF 1Z35A 3L7LA 2IW3A 1X8JA 3GFGA 4JGIA 4MJXA 3U09A 2A58A 4MRVA 4RC9A 4KAXA 3RVOA 1H0SA 4GMFA 1VSTA 3ZUGA 5AW7A 1ODCA 4ZVVA 3ZWAA 2WTXA 3EGXA 3TX6A 1T9DA 1ISGA 3AUKA 4EY5A 3WXMA 2MSCB 2YXEA 3C4QA 3PWTA 1R5NA 4M76B 3TXAA 5JJ5A 2WP8J 2AVNA 1KWKA 3DMRA 1HA3A 2HQBA 1XZBA 4UZEA 4RD4A 5GJVC 3R7FA 1ZOIA 4OA5A 4YP0A 4QUHA 5E3IA 1Z5UA 3KPWA 4GIBA 3ZDAA 2JHAA 2QQ0A 1XZLA 2IY8A 5A04A 2B78A 2VSQA 1NVBA 2OQ2A 4UQLA 4EYKA 3THWA 2V3CC 1LKZA 3HCOA 2MINA 4LF6B 1D7OA 1L7VC 3BT7A 5G0UA 4G5HA 4HEA6 3RYFA 4KFCA 1GCAA 1EGAA 4EVQA 3MIZA 2KM1A 4NECA 4YV2A 4JP5A 3P2MA 4QU0A 5FA8A 1VKZA 3DL0A 4YECA 1KIAA 1SUCA 5KTOA 2EIXA 4HX9A 2BI8A 4MQFB 4OHUA 5FV4A 1HFKA 4YK7A 1Z0UA 1JKIA 2H52A 4IJQA 3SDSA 4FDLA 4WCFA 2PG3A 2J3HA 2R7MA 2XXAB 1DEKA 4CLOA 1FNSA 1SC1A 2XHEA 4BZWA 4I4LA 2P35A 2V9ZA 4RVUA 3WRXA 2VF4X 1JI0A 3R4CA 1DKOA 1SVMA 3QY0A 3HUFA 2ZUDA 1VHDA 1Y9EA 2CNDA 2JPDA 3UMYA 4LJ5A 5AWFC 2C4WA 3RRJA 4BGEA 2QV7A 1QH8B 2DTEA 4GX2A 2VP9A 3UW3A 2AOTA 1GPWB 2P79A 4W9RA 5CNIA 4QYWA 4KBYA 2WSSD 4MZDA 4PG5A 4TL6A 2NMVA 5FLYA 2A78A 1M76A 3A28A 1SQFA 5L4SA 1IIBA 3RHFA 4CF3A 2PA0A 2AG8A 2XBMA 4DJJA 3OCUA 1USGA 3I5YA 1LTQA 2OHVA 1U65A 3ZHXA 1UADA 1G59A 3UGJA 3IR7A 3NVMB 4FFPA 1GU0A 1GCGA 1PSZA 2VAWA 1X1RA 4IDEA 1GPNA 2NO6A 3X0DA 4RH0A 2NSLA 2GI4A 2NVBA 2ZUVA 1OI7A 1JEYB 3V8PA 3SHVA 1MIOA 2QVGA 1FRQA 2H5EA 2O0KA 5IDYA 4F5YA 1V4NA 1U5CA 1D5CA 3EZ9A 3IUMA 1BZYA 3KWMA 4TL8A 2AC7A 4TM8A 2QMEA 1IYZA 4Q3AA 3TQRA 4W8HA 5I4KA 2WFLB 5BN1A 1KEZA 4OGKA 4WD3A 4AB1A 4A7PA 2X3YA 3HZZA 1EWVA 2WI8A 2XUFA 2D1SA 1BKDR 3LDUA 1Z4QA 3JWEA 3SS8A 4JYBA 4BLQA 4EB6A 4W5RA 2HA6A 1GY8A 1W88B 2IIQA 3AH8A 4AXXA 1T0HB 1MG5A 3P97A 4Z1MD 3V4RA 1G8PA 2HU8A 2LNDA 4OXKA 3B6KA 2B1JA 1I7LA 2C2GA 3I01M 1P2GA 2XKBA 3QJYA 4GMDA 4JVSB 3LWNA 4JJ6A 1BMQA 1N0WA 5JAHA 3M1IA 5LQDA 1Y5NA 5FCDA 1X70A 3S1AB 1RQPA 2A1UA 2VP0A 1Y89A 1YHYA 4C0WA 1SIBE 5IN4A 1ABFA 1E9CA 1FMCA 2LKDA 2PWYA 2W6CX 1BWRA 3S1LA 5IWAB 4ZVPA 2A67A 2V5UA 4GBMA 4Y18A 4A4DA 4D41A 4XPIA 1Z5GA 1IFXA 3TOZA 4DDVA 6ADHA 5CJPA 1K06A 4CCYB 2DFTA 3IAEA 2C0QA 3DNPA 3OO1A 3P9XA 2NUPB 1VCMA 3L06A 3PWSA 4R1UA 1DAGA 4R84A 5A4JA 1U28A 5AJZA 2G5CA 5KTKA 3K4PA 4EQ6B 4PZ0A 1RP1A 2RHHA 2XYHA 2C3UA 1LJLA 2C9MA 2RGWA 5JC1A 4LYGA 1Y7HA 1OY1A 4LKOA 1ORHA 2Z1MA 1CP2A 1YI1A 3DP7A 3KCNA 1P39A 3QK7A 4GE0A 4Z9FA 3ZNOA 5DJ5A 3IT0A 1KL7A 2ONYA 5ICGA 4JP8A 1D2CA 1N8NA 3FDZA 4GQBA 1ULSA 3FBGA 4O2BA 3VVCA 4U7PB 4B5KA 1AG9A 5HF8A 3UFXB 2B98A <