3FWHA

Structure of haloalkane dehalogenase mutant dha15 (i135f/c176y) from rhodococcus rhodochrous
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
296
structure length
296
Chain Sequence
SEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus sp.
total genus 108
structure length 296
sequence length 296
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fwhA00
2XUPA 2WIDA 5CRIA 2VAXA 1UOPA 1XZGA 2HRQA 1TRHA 3IVMA 1DQYA 2XMGA 1XZBA 3ZV7A 3G9TA 3AUKA 4KRXA 5AJHA 4X3CA 2JGEA 5ALIA 4JH0A 1QIFA 2OGTA 3CCCA 4HS9A 3H0CA 1J1IA 3TRDA 4QNNA 1QGED 1DWPA 1D07A 4BCCA 3DCNA 5FPPA 1EVEA 3SWWA 5KWIA 1N5RA 2R11A 3H1AA 5A62A 4DIUA 3EIOA 2Z3ZA 4W1SA 2HFJA 1LBTA 3LP5A 2I3DA 4WJLA 4Y2QA 4BAUA 3GUUA 4PW0A 2O7RA 3HACA 3ZLVA 5KREA 4BYMA 1SCKA 5FKJA 4H7KA 4KEAA 4C01A 3FVRA 3IUQA 1CUDA 5DNVA 5AIAA 5LZ5A 3WL8A 2C58A 4N8SA 5CBKA 1CUFA 3L1JA 2ACKA 5AI5A 3F97A 3BDIA 3O95A 3S8YA 2XMQA 1MO2A 2X8BA 4WCVA 2DQZA 3HEAA 4X85A 2RI6A 3H1BA 4H7IA 3FCXA 5AI9A 1B6GA 2CKMA 4I19A 4BZWA 4W1QA 1E8DA 1N5MA 4C88A 2PX6A 1IUOA 4BCDA 2QZPA 3JWEA 4QWWA 4BRSA 4CG3A 1VE6A 4G4JA 2VJCA 4Y2RA 3Q8WA 2XUDA 2Y1KA 2IIVA 1MX9A 4UHHA 3G8YA 2W22A 3WWEA 2HIHA 2J4FA 3PE6A 3KDAA 1YR2A 3O4JA 3G0CA 4B81A 1QONA 1XKTA 2BUAA 4UUQA 2QJWA 3WZLA 3HI4A 4UHFA 1MNQA 5JALA 1WHTA 5AICA 2QTBA 4BDSA 3F9CA 5EHNA 4DSZA 3C87A 1JFRA 3DEAA 5AM3A 3HC7A 4N8DA 3MVEA 1THGA 2OCIA 1U65A 4KACA 1X2EA 1P0PA 2OCLA 5AP9A 5AK3A 1XQWA 4ZV9A 4IH1A 3AZPA 4G9GA 1QLWA 1R4ZA 2OQIA 3DYIA 5E4JA 2VJAA 2XUHA 5IVIA 1GPLA 4M0MA 3QPCA 5AOBA 5K3FA 1F0PA 4Y7DA 4H7HA 2C4HA 2YASA 1TCAA 1XZHA 3FVTA 4ZI5A 3U1TA 1ZD3A 3O9VA 3WJ2A 5FLKA 1IMJA 3UUEA 3WWOA 2J3QA 5T4EA 5D6OA 3V1KA 1A8SA 3D2AA 1B41A 4G1FA 4CFSA 2XQIA 2D0DA 3DOIA 2PSDA 3BF8A 2XQGA 1GXSA 4IO0A 1MNAA 4UHCA 2XE4A 4MYDA 3C43A 2WM2A 5K3EA 3G0GA 4EY8A 4FHZA 2XQFA 4ZRDA 1CUUA 5ALVA 5FV4A 3AIOA 5HF5A 4G9EA 4KE9A 4EB0A 4KE8A 3H04A 5CT4A 4RE6A 1GKLA 3CN9A 1N8SA 3EQ7A 4CCWA 4WFJA 5K3BA 5ALGA 5AH0A 3W05A 2O7VA 4DTCA 4WDRA 1W4LA 2VTVA 2Y6VA 1XZKA 3LIIA 3STVA 3O4GA 4FOLA 4AXBA 1W6RA 2EDAA 5KWJA 2IX9A 1L7QA 5FRDA 5AK5A 1UOQA 5DLPA 4QDXA 2JGLA 3KD2A 4B85A 3QMVA 3VJMA 4QDZA 1CUYA 2HFKA 1W76A 2WG2A 4UBNA 2G63A 1LLFA 1U4NA 2OCGA 1XZFA 3FYUB 1DWOA 2ZYSA 3U0VA 4GDMA 3WQHA 2XB6A 2R8BA 3WWDA 2PSJA 4H7JA 1KU6A 3I28A 1BN7A 4C4YA 1HLGA 2HL6A 5DYYA 1ZI8A 1LGYA 4B83A 1XZJA 4K6GA 3FLEA 2JEZA 5CH8A 3DKKA 1PFQA 2XUFA 5A2GA 1ACJA 1P0IA 4BRZA 2CEKA 2WIFA 2QKYA 3ZLUA 4X71A 1IZ8A 2XMBA 4LKOA 1EK2A 3E1GA 2JIDA 1QIMA 4C87A 4OB8A 4J0CA 3M82A 4G5XA 2Z8XA 4LHEA 2CJPA 1IVYA 4P08A 5IH7A 1YAJA 3FSGD 1F8UA 4ZREA 5KBYA 5J3JA 1GPNA 1EB9A 1XZCA 2WSLA 4HXGA 1SCIA 3A70A 5CURA 3LLCA 4GLBA 2ZJ6A 3PFCA 4X7BA 4MQLA 3ESDA 3MGAA 1E89A 5C8ZA 1WHSA 4OB7A 3I2KA 4PNZA 3G9UA 4AMZA 1TK3A 2GBFA 2D5LA 4Q3KA 1DX6A 2WFMA 1XRNA 4WFKA 3BIXA 1EA5A 3C5WP 3STTA 3WK8A 2BAGA 1LNSA 1WPRA 4FBLA 3FSGA 2C0QA 4B84A 1UOOA 4UPDA 1QIGA 3C5VA 4YK7A 1G5FA 4DGQA 1ZD5A 1C4XA 4KAAA 2Z3WA 4M0FA 2HA7A 1XLVA 4TPKA 1IUPA 3W2TA 3VKFA 3V1NA 1EI9A 1QIEA 3HYSA 5CT6A 4IH9A 3QZUA 5ALHA 5EHZA 4BC1A 1MU0A 3D0KA 5CH5A 4X91A 1QZ3A 2G5TA 2QXUA 2HU8A 5HFNA 3R3YA 4QDUA 1ZOIA 2VAVA 3TEJA 4TGLA 1E66A 4H18A 4Y2UA 3HSSA 5AIBA 5LZ2A 2VJBA 1CUJA 1EDDA 2JGIA 2HRRA 4C89A 5LZ9A 2V96A 1YA8A 1IZ7A 1R9MA 5JD4A 1Q84A 2RONA 2XT0A 5LKAA 1MT3A 2GBIA 1GKKA 3BIWA 2WFLA 1WB5A 2WQZA 1JJFA 1P0QA 3VISA 2ACEA 1FJ2A 3AIMA 3BWXA 3G0IA 1WM1A 4UBMA 5AM1A 3LS2A 2WJ4A 5ALEA 5BWCA 3F67A 4MEAA 1VXOA 4M0EA 4ETWA 3S2ZA 1MX5A 2DSNA 4A23A 5EIAA 2NW6A 2HA3A 3BL8A 5CTAA 1LPBB 1QIDA 1WOMA 3V9AA 1R88A 3ZLTA 1H2ZA 4PV7A 3R3UA 5AI0A 5K5EA 4BZZA 1XRRA 3BXPA 5A7GA 2CMFA 3C8HA 3AJAA 4B7ZA 4X92A 5IVHA 3WMRA 4AO7A 1AMNA 4PF1A 3RLIA 4HXEB 2ROQA 1ODSA 3F96A 5EIHA 3PUHA 3AIKA 1CUIA 4W1PA 4AQDA 4LXHA 1YS1X 4ITVA 4AB1A 3G02A 3STXA 3RM3A 2OPHA 4CG2A 1CUGA 4FMPA 1C7JA 4IH4A 5YASA 4EBBA 4LYDA 1H23A 3R3ZA 5ALRA 5ALSA 3G7NA 1ISPA 4AX4A 3R3VA 3V1LA 2HM7A 2HA5A 5JASA 1BU8A 3I1IA 5AKXA 2XUAA 2G4LA 4HZGA 3B5EA 2VQ6A 5AKIA 1YS2X 3FCYA 4RNCA 2HHAA 1SFRA 5HKBA 5AKEA 2RGUA 1YASA 2VEOA 1BRTA 1CVLA 1LZKA 4Q3LA 5ALDA 4BVJA 4H7DA 1OILA 2Z8ZA 4JUIA 2QR5A 4UHDA 1UK6A 4G4IA 1J07A 1J06A 3D2BA 1UWCA 2UZ0A 4PO3X 4RE5A 1CQWA 3AZQA 4CG1A 2ZJ7A 5EIEA 5DTJA 3UMJA 1UK8A 1VXRA 2OLEA 4F5ZA 5ALQA 2OXEA 2QT9A 4P9NA 4X97A 5EHQA 2WUDA 1ZIYA 2V98A 2QM0A 2LIPA 5AI8A 4CCYB 5HFAA 1ZJ5A 1Q0ZA 3D59A 1J2EA 5C8VA 1ZIXA 3I1YA 3DS8A 3ANTA 4RPCA 3OURA 5CT5A 2HA0A 4BAGA 5AM4A 2CB9A 4G4GA 5ALFA 1EH5A 2PVSA 3RARA 3G9ZA 4EA6A 3QVMA 4PSUA 4V2IA 2HADA 2WG0A 5LP1A 4H77A 3R0VA 4BVLA 2HU7A 1FFEA 3H2GA 4EY4A 4K6HA 3I6MA 5AKKA 4WDQA 1FSSA 4B80A 4N5IX 4K5QA 3VJLA 3WJ1A 2QJRA 3I2GA 3K9BA 1MAAA 2V97A 1R9NA 2XLBA 1XRPA 2Y2VA 1USWA 4AO8A 2HU5A 3IBTA 1CUAA 3GZJA 2B9VA 1FFDA 2K2QB 1BEZA 4ARAA 2DHDA 4A16A 4UFNA 5DYWA 3FAKA 2BCEA 4FLEA 1YSCA 3CN7A 4K6KA 4HRXA 3W04A 1CR6A 4Y2YA 1XLUA 5CXUA 5JAHA 5LKRA 3FLAA 1EINA 1QTRA 3EQ8A 4BB0A 2BUCA 5T4FA 1A7UA 3ILSA 4EY5A 1MPXA 3WKCA 5E4YA 1A88A 4U2EA 1XLWA 2WUGA 4QEKA 1WB4A 2WG1A 3SC2A 2WIGA 3HRHA 5HQ3B 2WUFA 4ZXFA 1O6GA 5DTIA 5EI5A 5JAUA 5JADA 1GZ7A 3PFBA 4Y2PA 3AINA 1LBSA 1XRQA 1XQXA 4BVKA 1NU8A 3WKBA 1CLEA 4W9RA 3X3HA 4L72A 3I6ZA 1UFOA 3RKSA 3JW8A 1CEXA 4BBZA 5K3FB 1UKAA 1ZI9A 2WIKA 2WKWA 3FYTA 1F6WA 2PSEA 2PSFA 2I78A 3QPAA 1EDEA 2J4CA 5BV7A 4O08A 3QBJA 4DNQA 4XJVA 1I6WA 1P0MA 5ALLA 2GBGA 3FYUA 4HAIA 4I4CA 1QIJA 4XIIA 1DT3A 4UFPA 3GROA 5ALMA 2H1IA 5ALJA 4EHBA 3O4IA 4EY7A 1QIHA 3C6XA 1JT2A 2OGZA 2H9YA 3O0DA 1QJ4A 1Y37A 1JI3A 5T4HA 3ED1A 4N8EA 1CV2A 4Q82A 1H22A 2WHPA 5AM0A 4J3JA 4X6XA 5LZ8A 1XRLA 5A6VA 4EY6A 4HXFB 4QLOA 1NX9A 4X6YA 3VXKA 4U2BA 4X95A 2CBGA 4BTLA 5K3DA 4BCBA 5JZ9A 3WA6A 1EVQA 4K2AA 4X6UA 4CIAA 2XMRA 3BJRA 2P8SA 5D3ZA 4H7FA 1CFJA 1QTIA 1JMKC 2VSQA 3OG9A 5HF8A 2C5GA 5AKGA 4Y2SA 5FPQA 2WTNA 4MXDA 2Y6UA 1R50A 2XUJA 4FLMA 3L1HA 4NS4A 5LLSA 3VVMA 1ODCA 5AK6A 4NMWA 4LYEA 3MUOA 2PPLA 2EEPA 1CIJA 3H17A 5JZBA 1VA5A 1PJAA 4DNFA 4YASA 1R3DA 2FJPA 1GPKA 4AMYA 1MAHA 5E2IA 3WWPA 3RK4A 4DMFA 2QUAA 4XX1A 3A2MA 3PDCA 3WK7A 1Y7HA 3YASA 4QDTA 2VJDA 1O6FA 5DWDA 1K4YA 4Q1VA 1ORWA 4DMCA 2HA2A 2DHCA 2RHWA 3N2ZB 1HQDA 1AC5A 2ZYIA 3R3WA 5ISMA 3DL4A 5BOVA 1S8OA 2ZSHA 3WYDA 1DT5A 1MN6A 3I2FA 1VE7A 4GECA 4J0DA 3V1MA 4TVKA 2BGNA 3DLTA 2GZRA 1GT6A 1JMYA 4QDOA 5DNUA 5IVDA 3DD5A 5ALTA 1HDEA 3ZPXA 3H2KA 1DTEA 5HF9A 1ORVA 2GBCA 4PQEA 4QE3A 4F21A 2HA6A 1QO7A 2PU7A 2YYSA 5JARA 1UXOA 1A8QA 1CPYA 1BN6A 3C70A 2WU3A 2RIPA 1CUWA 3I2HA 1CUCA 3A2NA 3TGLA 4MWTA 2BUBA 3OC0A 1CUXA 2XQKA 1HBJA 2B20A 2PSHA 5CMLA 3DQZA 1XQVA 1YCDA 5ALPA 1KEZA 4AN0A 1C7IA 4ZWNA 4B82A 1BE0A 5ALYA 5SYMA 5C7YA 3H2HA 3WA7A 5AM5A 4U2GA 3O9MA 4G8CA 2VF2A 4MYSA 5I9IA 2XLCA 5HZGA 5BWBA 2IITA 4DYHA 3AFIA 1XFDA 3FLBA 2PBLA 4FDMA 1KU0A 3R3XA 1IUNA 1TCCA 1UKCA 2DCMA 4IHAA 2RHTA 3IURA 1CUVA 3VDXA 4KAJA 3IB3A 4JEIA 1BEEA 4JYMA 4I3FA 4P92A 5JZSA 3OOSA 4J0HA 1JKMA 5HKAA 1T4MA 4G8BA 1X70A 3W9UA 3IUMA 1LPMA 4ARBA 1QIIA 2XUQA 4KJXA 3NWOA 3AZOA 1G4HA 3CXUA 4F0JA 2ZYRA 2JBWA 4W1RA 4J0KA 2J3DA 1ZD4A 3R41A 5F4ZA 3H2JA 4A5SA 4UBOA 2AXEA 4GBGA 4BC0A 4X94A 3STYA 4ZGBA 3WIBA 3MUNA 3LCRA 4OUKX 3H18A 4GXNA 4OD0A 3ZI7A 1QFMA 4XVCA 4QZVA 2BGRA 2QXTA 1TQHA 1RP1A 1VZ2A 3PF9A 2ECFA 1DX4A 3Q0TA 1JJIA 5EFZA 5CH3A 3BJMA 4UBKA 3LIPA 1Q0RA 1EHYA 3ESBA 5ALZA 3WK9A 2BFNA 2DHEA 1M33A 1LZLA 1ZICA 5ALXA 2PM8A 4BE9A 5FUMA 2E3JA 5AI4A 2GYWA 1SCQA 1FFCA 3OM8A 5FP0A 1Y7IA 4Q3OA 1L7AA 4RGYA 1XKLA 2PU5A 1LPSA 3BF7A 5AKJA 1QOZA 5A7FA 3G9XA 3NOXA 3QMWA 3TJMA 1Z68A 1RWQA 1H2YA 5I7UA 2QS9A 2V9ZA 2CZQA 4D9JA 4J0JA 3I6YA 5D7BA 4X90A 5AI6A 3B3QA 4CCYA 2YXPX 3STUA 3G0BA 2QRUA 1ODTC 2Y2UA 4HVTA 1G42A 3A6ZA 1GQRA 5C8XA 3VVLA 4YX9A 3KOOA 5AKLA 3SK0A 4KR0A 2X5XA 5A7HA 4FLFA 4X93A 5DJ5A 1RYYA 4CI9A 1EXWA 3H19A 4JYPA 4FTWA 3HLKA 3N0TA 2EDCA 5JIBA 2XUKA 5FXMA 1TCBA 5AKYA 3OPMA 3IUNA 3VJKA 2JF0A 1ZI6A 4BTVA 4H0CA 3EQ9A 4CIBA 4DLNA 3DNMA 2JGFA 3D3NA 2Q0XA 2YH2A 1GGVA 1DINA 3M83A 2I3ZA 4BE4A 5JAOA 3ESAA 4X00A 4Y9SA 1BS9A 2DR0A 4B0PA 2JEYA 3SX4A 2VATA 3G0DA 4AO6A 1W1IA 3D4LA 5LYYA 3FYUC 1MTZA 1WPXA 3D2CA 2H7CA 1XZLA 4W63A 5DNWA 2H7YA 2XUIA 1THTA 1W52X 3WZMA 3NGMA 2C5FA 3L1IA 4MQMA 3B12A 1N1MA 1LPNA 2XMZA 1WB6A 2AJCA 4J0GA 2OQVA 2Z5GA 7YASA 4MWSA 4KE7A 5EGNA 4J7AA 4AZ3A 1K8QA 2I03A 3WL7A 1DU4A 2PUHA 4OYLA 1HKHA 4OCZA 3QH4A 3E4DA 1MX1A 4BP8A 2WTMA 2WLSA 4E11A 3D7RA 4UHEA 5HQ3A 4OSEA 1YB6A 4QWMA 4EZIA 1U2EA 4INZA 3KSRA 4GI1A 5C81A 2WFZA 3ICWA 3OTQA 1AGYA 1UT6A 4AN1A 2XI4A 3I2IA 3C8DA 3DKRA 2DQYA 1EK1A 2QUBA 3E0XA 4HRYA 3WK4A 1ETHA 5HK8A 2VT6A 4KYVA 2XUOA 4QA9A 3BDVA 4FNGA 4MEBA 5JD6A 1E8NA 3EF3A 3IA2A 4FNMA 1E3QA 1Q83A 2HDWA 2OG1A 4C4XA 4YPVA 4QLAA 2AJDA 5H3HA 1E8MA 1G66A 4NZZA 1VLQA 1OXMA 3DYVA 4KRYA 3PUIA 5AKZA 5ALNA 1XZMA 3EBLA 2G5PA 1R1DA 2XMCA 4DMHA 5IVKA 3A2LA 4C4ZA 2OGSA 2B61A 1EX9A 2OCKA 5HK9A 5I8PA 3STWA 2ONCA 1BCSA 4F60A 2ES4A 4E46A 1VA4A 1JU4A 4PSDA 3WIOA 2JGMA 3HJUA 3KXPA 1YA4A 2FUKA 4U2DA 1CUHA 3GA7A 3IULA 2WILA 2WJ3A 3WKEA 1NU6A 1TAHA 3WYNA 3W9BA 3NUZA 1CQZA 3WL5A 4DMKA 4HTAA 4XWGA 4FFVA 4FWBA 4Q05A 1YB7A 3K6KA 1LPPA 1L7RA 2O2GA 3ICVA 4N5HX 4BP9A 1MJ5A 2VT7A 1TIBA 1YAHA 1QIKA 4BDTA 2JGKA 3HZOA 1QO9A 4GHWA 2JGJA 3QM1A 5E4TA 5AK4A 4DSAA 4UHBA 1ZJ4A 5LZ7A 5LZ4A 2PL5A 3IIIA 4WY5A 3R40A 4H35A 1E5TA 4U2FA 3WKDA 5HF6A 4P93A 1H2WA 4G8DA 4DNPA 1UKBA 4AZ0A 1T2NA 1LPOA 4C6HA 3QMMA 1AURA 3WLAA 1UK7A 2FX5A 5AOCA 1ACLA 3T4UA 2AJ8A 1CUBA 4Y2TA 3M81A 5K3CA 2C7BA 3BE8A 2ORYA 2VA9A 1XZAA 4GWLA 5T4BA 1AX9A 4B9EA 5CXXA 3C6YA 1K6EA 4B0OA 5FDFA 4UBLA 3WWCA 2DFPA 1FFAA 2ZJFA 1CUEA 1XRMA 4FBMA 2CUTA 2QMQA 1QFSA 2WHPB 4B6GA 1VKHA 5AHXA 5ALWA 5LIPA 3F8SA 3IUJA 1DQZA 2WU4A 1XZIA 3ESCA 1AKNA 3H2IA 2GZSA 4U2CA 2AJLI 2HA4A 5CT9A 5HCUA 4NVRA 3I2JA 3K2IA 1BCRA 2WHQA 1CUZA 1VJ5A 4OU5A 3KWFA 4WFIA 4L3WA 3ANSA 1OCEA 1K63A 3AILA 4GEGA 2PKYX 3F98A 3W06A 3WK6A 1SOMA 4EUSA 5CT8A 3HABA 2ZYHA 1XZDA 2H7XA 4UBJA 3DDUA 4L9AA 4KAFA 1W75A 2XMDA 1A8UA 3PF8A 1QE3A 1SC9A 1TKRA 3DJYA 3GELA 4OU4A 4LXGA 5IKXA 5K3AA 4H7EA 4LXIA 5A71A 3PI6A 4Q34A 1BROA 5AO9A 1CUSA 2C0PA 2RAUA 2PUJA 3WI7A 3UUFA 3WKAA 4ZV7A 4E15A 1XQYA 1AUOA 2WHRA 1DWQA 2W6CX 5SYNA 3WK5A 1LPAB 3PICA 5AKHA 3DL7A 3IDAA 3DOHA 1VZ3A 5JD5A 4KE6A 5JATA 4GW3A 3GBSA 5D3KA 5FOQA 3QITA 1HPLA 3P2MA 2BKLA 2ZSIA 4Y2XA 2O2IA 3HXKA 3O4HA 2XUGA 4IQ4A 1ZGBA 5AOAA 2BJHA 2B4KA 3FWHA 2WJ6A 1ZD2P 3D5EA 2ZVDA 2O2HA 3GFFA 1XZEA 4Z49A 4Y2VA 3QYJA 2OAEA 3C45A 2XMSA 2WUEA 1JU3A 3CCBA 3FNBA 3C6BA 4DNOA 1H2XA 5ESRA 1JJBA 4LIPD 2OAGA 2XDWA 4OB6A 2AJBA 4UFOA 4B9AA 1ZGCA 4L0CA 4ROTA 4FFWA 2GYVA 3E3AA 1AQLA 4JNCA 3T52A 2FJ0A 4Y2JA 4J0IA 4E14A 4MJ3A 3C6ZA 3QPDA 2WIJA 1FFBA 2GYUA 4J03A 4DM7A 2QVBA 4OYYA 5ALUA 4BAZA 5DYTA 3KWJA 3ZWQA 5ALKA 4UBIA 1HL7A 5CW2A 2X76A 4FKBA 5JYCA 1WCYA 4BATA 5ALOA 3FOBA 3M3DA 4S0XA 1CRLA 4OPMA 1XROA 1U8EA 5AM2A 3FBWA 4WY8A 5JAPA 1F0NA 2QOEA 2WFLB 6YASA 1K5PA 3V48A 3JYHA 1GQSA 1VOTA 1X2BA 1EDBA 1EB8A 3WL6A 1UZAA 4PSCA 1UK9A 1PV1A 5JANA 2XQJA 5EHXA 1AZWA
chains in the Genus database with same CATH superfamily
4YBRA 2DAPA 1A71A 2QA5A 4L9RA 2AMJA 1KYYA 2OCPA 3HR8A 3GLIB 4JJ7A 1Q50A 4RM2A 1UPBA 1XRSB 5KJ1A 4X66B 2HRQA 3L1VA 4Y9TA 4OAQA 4R2MA 1Y3AA 1U1EA 3IVMA 4WOJA 3Q7EA 5BVGA 2B21A 3WBFA 5BRJA 2ZIXB 1E58A 5JVDF 2A84A 5IM5A 1PS9A 1A72A 2EW2A 2G72A 2QN1A 4PLZA 2Q2OA 3WC4A 1RM0A 3GLGB 2PD6A 4PPYA 1NT4A 2MSDB 2R8ZA 3FZGA 3I72A 4RPIA 4TS9A 3VPBA 4Z1OA 2ZXUA 1CULC 4P86A 3K9LA 2VP5A 4I36A 3ESRA 2VJLA 4UJ5A 5JNTA 2MYPA 4HS9A 1BFDA 1KS2A 1Q1AA 4HAYA 4MWOA 5CJPA 1J1IA 4HH3C 1RC0A 3FN4A 1MRSA 1QGED 2ONZA 2WV7A 1EXVA 4JLAA 4KC0A 3U81A 1WKBA 2XD4A 3GJ7A 5T3UA 3KV1A 2Z2JA 3EGDA 2W4MA 4BVAA 5FPPA 1EVEA 3UPTA 1JYSA 4Q7MB 4AJKA 3BWYA 3WGVA 1IJKA 5G1NA 5T64A 1RKBA 2YS7A 1W5BA 4UM9D 5KWIA 3RVQA 4E1AA 2IYAA 3NJRA 3QKSA 1N5RA 4QVKA 4EMBA 2FPWA 1I01A 1I4TD 2CVPA 1XNHA 1J97A 1VE1A 2AMLA 4PFKA 4YAJA 4ZCSA 5LDHA 3H1AA 4R9RA 2DFVA 1AKVA 1M34B 4MA4A 1UZNA 1B73A 2C4VA 4H7PA 4GM4A 1CDEA 4M7PA 5JT1A 4MPDA 1D04A 4C4AA 4OHRA 1UDWA 3DWGA 4DYVA 3DBOB 2AOUA 4CLXA 3F7NA 4XYLA 2AFIB 3CQ9A 2Q0HA 3X44A 3FWPA 4KZPA 4ZYUA 5J2TF 4C0QC 2PLAA 3HN7A 4KXQA 5KAMA 1ZHOA 2IEYA 3U44B 1SA0A 1HQCA 5D3QA 1CR2A 4XM0A 2H48A 4WJLA 4R2XA 4QQRA 4RA9B 3OO1A 4QRIA 3OE5A 5FNVF 2CK3A 3LT1A 1UC4B 3M6VA 4Q12A 3U7QA 4C4XA 4F3TA 1UM8A 2BL4A 1WCWA 3NATA 4JJGA 2Z9BA 4YRRA 5DM1A 3PLRA 4KPFC 3IEPA 4GLLA 2R00A 1H5UA 4RV9A 3X1XA 1Z6TA 3HACA 3QNMA 1NKVA 5KREA 4URXR 1U8TA 2Q2WA 4BYMA 1PZNA 1ISHA 1GDHA 5H82A 2OD7A 5EE9A 1OIWA 4Q7KA 5ARDA 5EJ8A 4KEAA 4HQOA 1NN0A 5A4AA 4QDJA 3L07A 1A76A 3N2YA 4R0NA 3DONA 3IUQA 3IPYA 4YLEA 1CUDA 1VHJA 2C7RA 3OZ7A 1MRZA 3DEHA 3ASVA 4MWDA 3NWPA 2VOEA 3FI0A 4FKZA 5F1YA 5AIAA 1HDRA 2MMCA 1S89A 5IVPA 2X0EA 1C0PA 4RDCA 4QBTA 3U60B 2C97A 3EY9A 1TW3A 1QLJA 1PW7A 3K20A 2Q4RA 3MFYA 3G8CA 1GUZA 3LF1A 4UUOA 1C7EA 5E8RA 2A3NA 3L5OA 1WB9A 4UE3S 1NBWB 2H51A 2N1BA 1QCCA 5DLEA 1WBJB 2CFTA 3KE9A 4LDPA 3F97A 4BB9A 3DBRB 1WSBA 4MYCA 4QM6A 1IC6A 3F74A 3N0XA 3O95A 4RL4A 2X2FA 3TIVA 3S8YA 4H0FA 2D7DA 1UBJS 2DFTA 5H4HA 4G0MA 4KSBA 5EOVA 2XMQA 4M7WA 3OESA 2LP4Y 2BWJA 1Y9JA 3RT1A 2X8BA 3L8HA 5CP8A 4IMJB 4ZHQB 4D97A 1MEJA 4HN2A 3AEKB 4WCVA 5GV7A 1TU3A 2YYYA 3HEAA 5DP1A 4RGBA 1II9A 1T5HX 1MCZA 1VM6A 3L8MA 3HH8A 2E4WA 4Z9XA 5CVTA 4I9GA 1DJMA 1ENOA 1RWOA 4EPYA 1O2DA 2WTBA 5J4KA 1TEZA 1XF9A 2RI6A 3V1UA 5B58T 3SAJA 4LRSB 5I47A 1F0KA 3VU9A 4BWVA 1H8ED 2PN1A 2Q3FA 2VSXA 4I1SA 4QAJA 4DEVA 1F8YA 4CQLB 4HWKA 2OV8A 4Q3BA 4U0JA 2WJHA 5CX1B 3NBMA 1UJ6A 3D4NA 2OORA 2NX2A 4C4RA 3EZLA 1Q77A 2EHDA 2HEGA 4M6WB 1TC2A 1OGYA 3PFWO 4EAQA 1ZN2A 2XDYA 2BRUA 2NYRA 4BCDA 1Z8FA 4C0AC 2QZPA 4MVJG 3M5CA 4TV8B 3O8LA 5AW8A 1WXEA 1CT9A 4EHKA 2UXDB 3RUFA 4TS4A 3WQSB 1QANA 1Z47A 3ZUGA 4CG3A 1TOAA 1XOIA 4O4HA 4ZZIA 1WMAA 2PUTA 2OLJA 3MPUA 1G60A 2VYCA 4IDDA 4COKA 4RZIA 5ITWA 3O5AA 3E03A 3T9CA 1C8BA 2XUDA 5EPUA 1F2UB 2MINB 3P5SA 1AF7A 4I3HA 4CE6A 1MX9A 4UHHA 2W22A 4PC6A 4E4TA 1TVMA 4Q1DA 2L69A 3T7JA 1JE1A 5DWQA 3TM5A 3W2EA 3E2PA 4JIMA 4WD3A 3KQVA 4IZIA 4MA0A 1H9AA 1Y4SA 4KVZA 5IAJA 5KSZA 3PD7A 3MNFA 1G59A 3K16A 4RIGA 1YHZA 1O96A 3WG9A 4IIGA 4BQNA 4WLUA 3K94A 5CA1A 1YDWA 1HYEA 3VDRA 1VKOA 4HDSB 4XD7D 4LEIA 4TV9B 2BUAA 1ULZA 1PUIA 3DUFA 5IWAB 5H1YA 3TLCA 1H1LA 2O59A 1KL7A 2WKRA 2CNNA 1YBHA 4YRQA 4ZQBA 1X8LA 4UHFA 1MNQA 1KH3A 1ONBA 3A05A 4RSHA 1WHTA 3WLMA 4GR5A 4FB4A 4UOEA 3MAAC 2OE2A 5HOQA 2C0CA 3VO1A 3ESYA 4XIJA 3CNOA 3FOZA 1VGRA 4AUEA 2P1ZA 5FUQA 3AM5A 4ZVQA 4XQ0A 4J7XA 2O19A 1U0GA 2JNWA 2J32A 1WSDA 1JE0A 3VR5H 4ESHA 1XCPA 3SF8A 1Z6XA 4MW4A 1HG1A 3O94A 3CKMA 3RTEA 5AM3A 2H1OA 1X6VA 3FFTA 3AYZB 2HXSA 1JP7A 2BM8A 2FMUA 4R31A 1U2QA 2D1YA 3BJZA 2OCIA 3I01M 4G5YA 5EKTA 4BECA 2GM4A 4TZ0A 1WEKA 1DPGA 5A9SB 1JLMA 2QHXA 1OTXA 4RQBA 1NNSA 3BE4A 1X2EA 2OCLA 3Q40A 4MRNA 4V0RA 4IH1A 1QFJA 1PFWA 4XX0B 1OX4A 3LDAA 3ZWWA 2O0JA 4TL9A 5FLYA 5H02A 4PQRA 4LZJA 1QTQA 2C2MA 2OQIA 1X9IA 2AEFA 2JD2A 2I4LA 1MZVA 3WP1B 3DYIA 3QEOA 2VJAA 4B7XA 4ER0A 1EFPB 1OXUA 2XUHA 5IVIA 3LYAA 1M2KA 3H9UA 2BBWA 5AVRA 4I4TB 1DQRA 1Y7LA 2I71A 3GUVA 5LXTF 2HDNB 2FFJA 1ZMXA 2P79A 1FYDA 1S4QA 1X7YA 2XTZA 4PN3A 4HLUA 1NA5A 2A57A 3EJWA 4RTMA 1ADGA 1UEJA 4O0MA 4XDGA 3JD2A 4MUGA 5H9WA 1SN7A 4ZJUA 1ZD3A 1XXHA 2FPLA 4FCVA 1USUA 2IRWA 2V7QD 1QKIA 1XEXB 4CW7A 3GEGA 4MVJF 3SVZA 1IMJA 1E0KA 1E6EA 5JH7A 3DWFA 3EAQA 3UUEA 3P8ZA 3QOXA 3WWOA 3NEAA 4LZNA 4TN1A 2OXIA 2J3QA 2FOXA 2NVOA 2PKQO 3V1KA 1YTUA 1F14A 3D2AA 4G3XA 4PS0A 4BVEA 3BUSA 4R1LA 4RPGA 5EVJA 3ZQ4A 1UP7A 1A9SA 1AIPA 1EX6A 2LCIA 2YIMA 2XQIA 3M6WA 3M7IA 1L5GB 3WBJA 2Y4NA 3AW8A 4E09A 4AJNA 2FI1A 1AZLA 3EF0A 4YAIA 5AUPB 5LQKA 2FHPA 2W2LD 4JBHA 4JA0A 2RD2A 3KTOA 5HA5A 5AK0A 3ZX4A 4EL0A 1WZEA 3LG2A 2OHVA 3RTGA 1GXSA 4YACA 4YALA 2I7DA 4YAGA 3RTDA 2BEWB 2GN6A 3KQMA 3TLBA 3VZDA 4J9UE 4F97A 4YT2A 2CXRA 3C43A 4UU1A 5FBQB 3G0GA 5EWLB 3I5XA 4MUHA 1JHMA 2XQFA 1F0YA 3FPLA 5ALVA 5FV4A 2YOGA 3WO1A 5K6AC 3DLAA 1M2OA 5H8WA 2BVNA 5ED4A 5KDDA 4WBNF 5LBIA 1PNVA 3H05A 1QGAA 1FS4A 2V7EA 5K7SA 4PXYA 5LYJF 2F3PA 2JLWA 5BWLA 1DJLA 4P1ZA 1J24A 2MSLA 2VVTA 3LGSA 1IOWA 1QH8B 2EJTA 4JFRA 3KYCB 1CB7A 4RFSA 2JLSA 4IIDA 4QJ5A 1GSOA 1PR3A 1UPXA 3C8MA 5AW6A 2H1SA 2QW8A 1C9EA 4OQ4A 5F3DA 5B55A 1VSQA 1PWZA 2HQOA 3KZKA 2FE1A 5BSWA 1KARA 2E2WA 4WDRA 1ZNWA 3M4ZA 4GSLA 5BVHB 4KXUA 4IIXA 4B8WA 5CFPA 4QQNA 3IQFA 2VTVA 4RPLA 2F1JA 2I1VB 2Y6VA 3N8KA 4ZOLA 2B4AA 1J99A 1TYDE 5JI2E 1MC1A 1VYHA 4O4JF 3O4GA 3M1YA 4JUFA 1Q12A 2WP8J 5IXSA 5M34A 1JFTA 1NXWA 2A0XA 4FGSA 1D8AA 1RQGA 4BGDA 3IEMA 3OQHA 4DBZA 4DF3A 1JJAA 5JNSA 3MTEA 1X19A 1E7WA 1KJQA 1O95A 2R2AA 3F7TA 1L7QA 1C9YA 1PEDA 2F1OA 3R0ZA 1XWWA 4MW1A 2ACVA 3X1ZA 5AK5A 1SPXA 3L6CA 5ELLA 5JTUA 2O8BB 2NVWA 2V7UA 1R6DA 3GAZA 1Z5PA 3AHCA 3KD2A 3P0RA 2LR0A 4YWJA 3D0QA 2NUAB 4DQLA 4R6XA 1YJAA 2GAFA 4OL0A 4X8OA 5CYFA 4ZU6X 1HTBA 2N1MA 3H86A 4RJ2A 1ZCBA 1R12A 5GVRA 3N9IA 3GH3A 1CQIB 1TF7A 4YJ2F 5BNWA 4Q1FA 3MMZA 4Q48A 4ZT6A 1QP7A 2C29D 1LLFA 5DGHA 5DSZA 5KOHA 4CIWA 1TM1E 2GI4A 2V3WA 3A1CA 1YR1A 3OIUA 4B5KA 2A4KA 2C1EA 1NYQA 1Z56C 2OCGA 3MMPA 4TYMA 1E6LA 1XZFA 3UB2A 5AQ1A 3QBEA 5LOVF 3HJRA 4LC9A 5TLSA 1ZOSA 3QLUC 2D0OB 3E9NA 2QR3A 2XXJA 3NOOA 1KJWA 3GGSA 2R7LA 1UF9A 1RI4A 4MI6A 4C03A 3M49A 3IPRA 1YI0A 1K5DA 2YDYA 4H7JA 5REQA 1H93A 3R7DA 1JR6A 4S1NA 2ADOA 4TSKA 4ZN6A 2YRXA 3RVOA 2C88A 4JUDX 1WNTA 2J5QA 4C4YA 4CLOB 4E22A 4ARCA 3F5DA 3LU1A 3UAYA 1M1XB 1YMQA 2BFCB 1M5RA 4B83A 1XZJA 1RTTA 2CL0X 2FFBA 3KVNA 4RYLA 3ZHOA 5ETJA 1PDVA 3CKYA 1NTOA 4Z9BA 1XC7A 3T1NA 2I1WA 3N7AA 4FMCB 1EWTA 2FZLA 3EVAA 5CH8A 4DLWA 3DKKA 5EQTA 4V0OA 1ACJA 1MHPA 4JI7B 3LGAA 3LOPA 3QY9A 2VP3A 4O4IF 4MTCA 4RL6A 2QROA 5TS2A 1H1TA 5C7IO 4MITA 3GGJA 4PONA 5DNEA 4LG1A 4C29A 3G2KA 2WIFA 4HKTA 1C3XA 4IOKA 1Z7EA 5EHGA 5GINE 1Z2CA 1XB2A 3HDTA 5HW0A 2AOVA 3T0FA 4FFDA 4EJ2A 4R71A 2WEKA 4PZDA 3V3TA 3DXZA 4N49A 5I7EA 3HVHA 1B2LA 1GRVA 1OTYA 2RHRA 3PFHA 4URZR 3GG9A 3H6GA 2IZ1A 3IAUA 3S2YA 3UMCA 4KVFA 1ZJZA 3NB0A 3FR8A 4GSYA 3IUPA 2H5EA 4DZZA 2CJWB 3M4JA 3ZWBA 5CU7A 5KO2A 3BRQA 3I9FA 3M82A 4G5XA 3M89A 2IOHA 1X92A 2Q4BA 4K28A 4ZI7F 3THWA 3W79A 2JBAB 1QAQA 2JIZA 3EZXA 4B71A 4IS2A 4P08A 1IN1A 1YAJA 1Z8HA 2GD2A 2ILVA 2J5BA 2WWRA 3FSGD 3NRCA 4GAEA 4MWBA 4QOFA 5AD1A 4OYRA 4FW8A 1IDOA 3VI3B 5BN4A 4ER3A 1KEUA 5JPCA 3HNPA 1NATA 3NHFA 4MOWA 4TTVA 1TMGE 2GRJA 2MHCA 2H4YA 3L05A 1N6RA 4J76A 4UVDA 3LECA 4CIXA 2IVFA 3FTEA 1HRDA 4B3BA 1CRZA 1P2VA 2WP0A 3W9YA 2YHSA 1P7YA 4HUJA 4AM8A 1W19A 3HCCA 5KQPA 4B31A 3A70A 4NMLA 5CURA 1H66A 3LT2A 5IWCA 4WXHA 4GLBA 1H9CA 1T9HA 4IIJB 5ITZB 2CYBA 3KB8A 1GNRA 3M5WA 3EEYA 4X7BA 4BZPA 3JALA 3MGAA 2ATEA 2CMKA 1DAEA 5C8ZA 2PUEA 2QRMA 3TEMA 5G4KA 2GJ9A 4DQ0A 2QSJA 4JQYA 3I1JA 1NVFA 2JFBA 1OAKA 2MJLA 4MYHA 3ZQ6A 1FSZA 4GP7A 2D5BA 3HO1A 1PNQA 1TI7A 4KFCA 1A98A 2R4QA 1L8OA 1OAOA 2VR1A 2W9XA 1E9VA 2XVZA 4NK5A 4QAQA 4Z7QB 3A6GA 1JWAB 3GJ3A 4NCBA 4WESB 1XRNA 2VPZA 3A9SA 3FCAA 3IMCA 4P3KA 4R81A 5FBWB 4P0TA 7REQA 4JR1A 5KVSA 3STTA 4O4LF 4I6GA 2P4SA 4E4RA 2ZAIA 3C5EA 5EHXA 2F3RA 3JQAD 2BOVA 2C9CA 4Q15A 5TJ9A 4JLKA 2B8TA 5DDIP 3VKHA 1JAHA 1EM8A 4LX8A 1DMSA 3K1AA 1U1CA 4WIAA 4DPLA 3JAWA 4MQEA 4NBLA 5F2KA 4ZAVA 4B84A 1T8TA 2P3SA 2VIIA 3LUGA 4UPDA 4YK7A 3RIYA 2FZ4A 1W46A 4MUKA 3UAGA 3EH2A 1ZD5A 4HTFA 5LOVB 4N4AA 2Z3WA 4M2LA 4PVDA 4JGGA 1RMTA 2ZSKA 3CZQA 4POAA 3TW4A 5B64A 4LTMA 1IUPA 5IBQA 3ZDCA 5DPMA 3W2TA 1F51E 1XMQB 5GZ1A 3MTBA 1Z5VA 2H1VA 2P68A 2VJKA 1SXQA 4BFVA 3N2GB 4RJKA 4Y6SA 5A02A 1ESMA 1FDUA 4LSMA 4NH4A 1KVUA 2CXUA 2Q21A 4IH9A 4ZJZA 2FOIA 2O50A 3R76A 3TTTA 2DOKA 3S28A 1RKQA 3DQQA 1TUGA 4G84A 2J59A 4Z0TA 1MU0A 2CLCX 3N6XA 3MWGA 4MVJA 5CH5A 1HDYA 3EZ7A 1VL1A 2VHQA 2VRCD 4ETIA 1EWYA 2D0PB 2PKXA 1VHTA 3DFFA 3UT5B 1QQ7A 4FFLA 2EWVA 1ZA1A 3OX4A 3P2JA 2QTHA 1DEKA 3FSRA 4FYYA 1ZNQO 3PEWA 1DBRA 4GMXA 1EFCA 3TLZA 4FR5A 5KTTA 1XL0A 4Y6OA 3ZE8A 1UJNA 1E66A 1S9DA 3AEUB 2BZ0A 1TMOA 3I39X 3PC8A 1IHUA 3HSSA 4LOJA 1O97D 1N2EA 2GSDA 1TTTA 3WHKA 3L7JA 3WB9A 4EI9A 4Z53A 2K7ZA 2V6GA 2P0EA 1TLFA 1YK0A 2KPOA 2VWHA 3IOMA 3LXMA 1I30A 1LJ8A 4K2HA 1FFHA 3O84A 3GJZA 3KR9A 3LW7A 3CVUA 2H0AA 3EPRA 4BN4A 5LZ9A 2VRBA 3IAS1 4JL5A 1RVDA 1YA8A 1APBA 1KVSA 2GK6A 3HXPA 4INPA 4AY2A 2R00C 1CJTC 1DBPA 2FMKA 4JBGA 3IE1A 3WGTA 4TMFA 4BU1A 3ESQA 2HI0A 3VVCA 4FEGA 1N78A 4DJAA 4WZBB 4QPZA 3V00A 4NV3A 2PZFA 3MB5A 3GRFA 1HDXA 2XT0A 4MPPA 4RFLA 3RRNA 3HJGA 5E6SA 2NO5A 1FW6A 4L02A 5LKAA 2I65A 4R8KA 3S55A 1MT3A 1AQ6A 1SUEA 3NG1A 2YIVX 4C3VA 2D5CA 4RD3A 5CEJA 4MR9B 2WTUA 1EUYA 1NUHA 4B47A 1EUCA 2WFLA 4J4HA 1LB1B 1WB5A 4FJ0A 4NCJA 2GRAA 3G9QA 2WQZA 4FYIA 2Q62A 3SVLA 2YWCA 5FA5A 4LJ5A 1MOQA 4RDHA 3VISA 3O7WA 5CAEB 4AXXA 4RTJA 2X13A 3BCHA 3L82B 4PVCA 3HLYA 3F47A 1FQWA 4IIYA 4L4UA 2VP6A 1L5KA 3LQ2A 3QW2A 4PZ0A 3R8CA 3V8EA 4I1PA 1W73A 5E1OA 2AKAB 2FETA 2GO7A 1T36A 3PHIA 2IWHA 4CMIB 1KP2A 1JFSA 2GVZC 5KIAA 4ZODA 2AC7A 1W5TA 2R79A 1ZK3A 1YC5A 1J42A 4MEAA 3U48A 3V9PA 1WULS 1E3JA 5DEOA 1SVIA 2LWIA 3DH0A 1CQPA 3GZTB 4NK4A 3SHOA 3BN3A 3TH5A 4ETWA 3HXLA 3CPEA 3DF9A 1GTZA 2QZSA 4W7SA 3HDJA 3FZYA 3OEWA 4D6XA 3N70A 1DIAA 5HRUA 5A0TA 2APJA 3GZ4A 4A23A 4YTEA 2HA3A 1CSEE 2VQDA 1NN3A 4HI0E 1HT2E 1E3DA 4R9NA 4TKLA 2EBUA 5K0EA 3V9AA 1IQ0A 3PIIA 1E9BA 3M2PA 4WZZA 4PV7A 4MVCA 4E07A 3UFXA 5DI3A 1U0JA 4K0RA 1Q44A 2EGGA 3V2IA 4GUDA 1A27A 2F62A 5KNBA 4S12A 5DYIA 3U3ZA 4NBTA 2CMFA 4TLLB 1VI5A 2H4HA 1ES9A 2O8NA 4FFMA 3I3OA 4FSDA 3RHTA 4BEBA 2C4UA 5JDCA 1KFCB 4WTOA 1P1IA 3WMRA 2K4MA 3D9QX 1YF3A 3MJVA 1DHRA 1MO6A 1SUCA 3NTRA 3P0HA 4HXEB 4D99A 5IT0A 2Q9AA 5CDYA 4TZTA 5JCZA 3M1AA 3IQIX 4JI3B 1O3YA 1Z62A 4KIWA 5JBQA 5D01A 2G0NA 3UHFA 1N2ZA 2BFPA 3DBVO 5EXDA 1W87A 2VPQA 5AW9A 3ZTWA 4LXHA 4JI8B 4ITVA 4EMUA 3H3JA 4PAQA 1P4AA 1K3FA 1AQYA 2X9NA 4RK7A 3RM3A 2XOKA 3ZE0B 3QEMA 2I54A 3KPYA 2PGNA 3KDPA 4PLFA 1DC3A 1KZGB 4PQGA 4K9PA 3UH0A 1RW4A 3SX2A 1TX4B 4IXWA 2GEKA 1VG1A 2IKSA 2PUVA 4MAMA 4ND8A 4IH4A 1CDDA 3DAFA 2E55A 3ER9A 3Q72A 4EK9A 1G5HA 3NHLA 4NCNA 4BQOA 1JNXX 3WGLA 4LZZA 1F5NA 1OZHA 3B8HA 1FP2A 5ALRA 5ALSA 1XCLA 2GNOA 3TB6A 4BN5A 1H2BA 3G7NA 1G8KA 3EUAA 3NYWA 2IXFA 1QP4A 1CE8B 1ZZGA 1HNXB 2BIFA 4CEJA 4JLJA 3ET5A 1XQ1A 1COWA 1AUQA 3I1IA 5AKXA 5GAJA 1SU7A 3KL4A 1OZGA 4C0XA 1LVGA 2QQEA 1B8NA 4LJSA 4ENUA 5LWQA 2A9RA 1UDXA 1TYAE 2R62A 1NUQA 1YS2X 1NXVA 4RNCA 5AKIA 3W5IA 4YO8A 4E2XA 1RXYA 5IF9A 1M0EA 1HYQA 4G0XA 3R75A 4D41A 2HHAA 1EGHA 2PRKA 1E1NA 1LA2A 5C3MA 3OPVA 2PVCA 4ECEA 3V5NA 5JEEA 4QKQA 4W5TA 1GA4A 5EKSA 3A7DA 3BE6A 1AUPA 4HLUC 4PGFA 4E70A 1CVLA 1JKFA 5ALDA 1FUIA 1K3TA 1YD7A 1RLMA 4LNHA 3KPVA 2EQ5A 4TLMB 1RD4A 2GEDA 2ZRFA 3D3WA 4PBSA 5EP2A 3CE6A 1RJGA 2E37A 4KXMA 2K6GA 2HQRA 4JUIA 1MG5A 4UASA 5IJ0B 1E4YA 3K4QA 1ISFA 9LDTA 1YBFA 2P6OA 1K4MA 1O9GA 1XTBA 4DTIA 3SDZA 3N2KA 4M0CA 4RE5A 4EM6A 2J6CA 1CQWA 3SEQA 3AZQA 5C3UA 4BNFA 5IRCD 5KYKA 2PBRA 2ZJ7A 3AT1A 5AJYA 4DYDA 1P3DA 3B70A 3FGNA 6LDHA 3BWMA 2WHEA 3CLRC 4OBBA 3TLEA 1CIPA 1UK8A 3ITKA 2NSHA 4GPZA 5CCBA 1SCAA 3PRKE 3QFCA 1ZBQA 4EDHA 4LGYA 5EHQA 1M8PA 1EWVA 1ZIYA 3F8TA 2A9QA 4O4LA 1W85B 1ACMA 1QX3A 3CLTC 2ZQZA 4JXJA 4P3XA 4R2JA 4BO3A 1P7VA 3AL2A 5K8VA 2IHZA 5AI8A 2CFIA 2JAOA 4KMSA 3SJZA 5IKEA 1Z0SA 2EBHX 2P6NA 5BT8A 3JAKA 3NHMA 1OKKA 2G9UA 4FR0A 1RCUA 4UD2A 4E2ZA 3P2KA 2M2IA 4I46A 4IKOA 3HKCB 4CPDA 2DPXA 5G0UA 4P3PA 2AOUB 1G1MA 5GOZA 4RPCA 3F6SA 3OURA 1P1JA 3D6JA 5IJWA 5CT5A 1DX9A 4Q9IA 1V48A 2GZ1A 3RSGA 3Q0IA 3SQOA 4XUEA 2XB8A 5ALFA 5TX7A 3RUHA 2F8TA 4XTCS 2VHXA 1VHQA 1YJCA 4ENWA 1B6SA 3M6IA 5FHRA 3WWZA 3QVMA 4EA6A 4IJMA 3ILYA 5F7ZA 4PZUA 4H77A 5FL7A 3CEHA 3GARA 4IINA 3HCWA 1FFEA 3ZU2A 1NVGA 2ID8A 3G85A 5A4FS 5KNCD 4EY4A 3ADCA 2Q46A 3DE3X 5JS7A 5AHWA 3UIEA 2ZREA 3ADKA 1MIOA 3HBNA 3V4PB 1U7UA 4JI5B 3ZS8A 2GILA 4NE7A 4OMDA 1F2TB 4WDQA 4F6RB 1ODJA 4Q1EA 2BEUA 4CR7A 3VYSB 4O8ZA 1NNUA 3KEQA 1CEYA 4ZOAA 1V7PC 1KKLA 4Y1RA 3WIEA 4XIYA 1XD2B 1DIRA 5JC1A 3FPAA 3ZQJA 5JISA 1G17A 4LDNA 2BDUA 1OHHA 1O95C 4C9BA 4L6IA 5TEWA 3WGMA 4IDBA 5MN5A 1DIGA 1MAAA 3QYPA 1RJFA 5BSFA 2IVZA 1M6YA 4P0PB 3WXMA 4YXFA 5KYWA 2V54A 4PHCA 1RXEA 2XNHA 3D81A 3NHAA 4RHYA 1SOWA 1V41E 1FTWA 2X2PA 5KPJA 3W5HA 1KI6A 3T0IA 1KQNA 2QRVA 3UHJA 4NJMB 3SMVA 2VF8A 5J2UB 1XELA 4ILEA 1A5BB 4MV0A 3WSTA 2F3UA 2DRIA 4HLQB 5ICMA 1QGYA 3VU0A 1XAIA 4CT0A 1SCBA 1SEVA 4P31A 4WZ6A 1KDRA 1J4AA 1Z4OA 1U81A 3IBTA 3NUQA 3HV2A 1P73A 2QEQA 3O8NA 5G4LA 4GPIB 3TSCA 1BXGA 3OA0A 2A9PA 2GEVA 1VRCA 2WM9B 4L7QA 4NESA 3HUFA 3ASYA 3RU2A 4YPFA 5KVQA 4Q4AA 4PPFA 5DYWA 2CDCA 4YJ3F 4G5SA 1KNQA 1GGJA 1I0ZA 1T1JA 4EB6B 1FP7A 2ISQA 1KO7A 3HZZA 3K0EA 4OV6B 2JLUA 1CR6A 3S70A 4Y2YA 5DCLA 3WR5A 5K8CA 5AXAA 1OYWA 1LI4A 2RB4A 4A0FA 4GGOA 1SU6A 2IHJA 3QFHA 1AK2A 4WOCA 5LKRA 1CQXA 2FPSA 3BORA 4MIYA 1Q0LA 4YREA 1U8UA 2V7VA 3EQ8A 3JYPA 3MBKA 3OICA 3CNQS 1J9GA 3ND5A 1R4NB 2ZBQA 2Z8YA 3R23A 1HV8A 1KAEA 4G8JA 3V1TC 1Y1PA 3NTXA 1U9IA 2B0JA 3LDUA 1O96B 4Q03A 1A7UA 2EZ9A 3HGQA 3ILSA 4EY5A 5IC4A 1UPUA 5CA1B 3GLHA 2R8RA 4Q3EA 3VZSA 1AV7A 4CKCA 3ROPA 1E2BA 1EE2A 6PFKA 1CP2A 4DLLA 1XNRB 1P7CA 4RTKA 3EW7A 3U7IA 1XTJA 1JBEA 3CNNA 3M6AA 5LB2A 1H1LB 1Z28A 2UKDA 4DIMA 4UU8A 1GGMA 2BGKA 2PMWB 1WHTB 3HSYA 3IILA 4QEKA 1E5LA 5BUCA 2Z1MA 4EDFA 1BEUB 1UBFA 3B6EA 1YFJA 3BWDD 3HRHA 2B82A 3I52A 4PZPA 5MF6A 3A26A 1I33A 4ZQIA 1UP6A 2J6IA 4EGQA 1FRVA 4IDNA 2HEIA 1MC5A 5EJFA 3I9NA 3SF8B 1YGPA 3KPJA 1NVUQ 1YQWA 2F00A 1EZZA 2WPDD 1M10A 2NTYC 4H1HA 1XEFA 1XRQA 4NEHB 4BVKA 3JSAA 2Q5HA 2RK6A 3KKNA 1N4DA 4ASUA 1G6OA 1KJIA 3C3MA 4NCAA 3BBLA 1NU8A 4R2KA 4BNLA 1GJRA 5B7PA 1BYIA 1HL3A 1UANA 4TUYB 1RFLA 2X14A 5L3VA 4KREA 1MQAA 2RB5A 3P2OA 3B3FA 3WIVA 1IXZA 4HFMA 3TBKA 4C22A 2IXGA 4IJVA 1W5AA 4J3FA 3DVRX 3GFGA 4RTSA 5EZYA 3S4YA 3SNKA 2XWBF 1TYEB 1ML4A 3NYRA 1C1DA 4IMRA 4L4YA 2IDKA 3WFZA 4YMGA 3DZCA 2WJWA 2JHFA 2RC5A 4Q4HA 4YR7A 1WMEA 4HJXA 1X7YB 1C7QA 1G5PA 2JI6A 2YZGA 4L73A 2WKWA 3W8NA 5HWSA 1U1DA 4BUCA 3V2HA 4MPTA 3B7WA 1NUSA 2YZMA 3ZY2A 3K9HA 1F6WA 2PSEA 2Q5OA 3FMIA 3USZA 5BV7A 1FDSA 4DCJA 2OV3A 4US0R 1XXHB 1T2AA 1O03A 4UE6A 3ROZA 3TLXA 4DBLE 2NZJA 4MVJP 1U0HC 2P9BA 1XHLA 2R6JA 4A2CA 3ZJTA 4EEXA 1JH8A 1EVKA 1XTSA 2O06A 3PGKA 1KZHA 5JH7B 3KQLA 1G55A 1I6WA 5E6RB 3QPBA 1SUSA 2VT3A 1A9OA 4J16A 2WD9A 2GBGA 3O4VA 2XR1A 5AVWA 1NZJA 3N07A 1NI4A 4U63A 3UJNA 2OOSA 2AXQA 1QMGA 1QIJA 1MW9X 1J20A 5C4IA 4XIIA 2NUBA 1DT3A 4K40A 4BO5A 2CD9A 4K88A 3JQBC 4PLTA 4WOKA 4UFPA 3FUUA 3EPPA 1E62A 3I4FA 3AFNA 3LY9A 4BGEA 5JCJA 4GNKA 5SZHB 1D1TA 1BCSB 3OCYA 1K2WA 4FYPA 1I7NA 3WV5A 4Z7JA 2ZZMA 2CVOA 3ROFA 4PLGA 1MOSA 3DZ8A 1DBQA 2OGZA 4GPTA 4IQ0A 1KPIA 3AETB 3WLJA 5BOSA 2FMFA 1W4BA 3MF4A 2DBZA 1NTRA 1VCHA 3L8GA 2ZU0C 2X3UA 4KFUA 3UGQA 3FE2A 1CV2A 1TVCA 3UCXA 4EGFA 3NOQA 5HBGA 4IL5A 1ZVMA 5AM0A 4X6XA 3VR6D 4HG2A 4LSGA 4B3SB 2NZXA 3AOEC 1RS0A 2Q8QA 3C24A 4MR7B 4X44A 4HXFB 2NVUA 2JJMA 2VBCA 4QLOA 1XEWY 4X1IA 2RI1A 1NX9A 3MJRA 4U2BA 2XNDD 6ADHA 1G8AA 5BNTA 2RKBA 4A8JA 5FULA 4XOUA 3K0HA 5JZ9A 3G17A 1YZKA 1EVQA 4FFSA 5CK4A 1KI4A 2BJVA 2EP8A 3PC8C 3T9EA 3S8EA 1OFIA 2C92A 3C98A 2P8SA 2V7XA 3CUSA 3FLMA 1TM7E 2A5LA 5JXJA 1ZK1A 1Z07A 3MAGA 4I9HA 1JMKC 5DBIA 1DV1A 1S8AA 4D8XA 2O6LA 3H1PA 4M1MA 2ZB2A 3OTWA 3FCSB 1V1JA 1I2CA 5EY5B 4AZSA 2C77A 2FE4A 4LI3X 5FWXA 1XEAA 2I8LA 4JLNA 2Y76A 4Q93A 5BNZA 3G0HA 1JQJC 4ZOLB 3TMAA 4BNXA 4JC4A 4YP1A 2WTNA 2FCAA 3KJFA 2XBLA 4X45A 5FPQA 5KYUB 4DR4B 1MR3F 4MXDA 3RSLA 1DS6A 4PWYA 2IYSA 9LDBA 2HO4A 1GG9A 1PIWA 1IJBA 2PJZA 2B3DA 3K35A 2ZR8A 1OI4A 3KQQA 3LMKA 3C97A 1EDZA 2Z08A 3ZY6A 4D9HA 4K9QA 3GPCA 2RG1A 3SYTA 3BE5A 1Y7PA 1KR2A 4N0DA 3T7AA 3PNKA 2YV4A 4FLMA 3OFNA 4UC0A 4CUKA 2RHGB 5IHPA 1XU9A 2X8JB 1ZLYA 3AUUA 1J22A 3TXXA 3IE0A 3SIXA 1N8KA 1V8FA 2NGRA 1T8PA 4I08A 5CHYA 2WZDA 2PUFA 1S2MA 3GCDA 5D84A 4H2DA 4LYEA 3ZGVA 3BFXA 3PEVA 2IBSA 3DB1A 2B7LA 4EJMA 3QTLA 1QORA 3LF2A 1P8AA 4DVJA 1SBNE 3WY9A 4EW6A 4PZCA 4IO1A 2FJPA 3BA1A 4RIHA 1GPKA 4D02A 5KOHB 3ZV5A 4ZAXA 4NXMB 2OAQ1 2OCAA 1KSFX 1V2HE 1NV9A 1OFGA 1Y5NA 2HT6A 4MGEA 3R3SA 4FM9A 3WWPA 3LA8A 2EZ8A 4KK4A 3HCPA 4E5KA 4FYWA 2BKXA 1ISSA 2XZDA 4XX1A 5MFZA 3E53A 1BMQA 3MAJA 4UAVA 5G0SA 2GEBA 4DABA 1U0SY 2RGEA 1Y7HA 3YASA 5REQB 1AO0A 1RWVA 3OMLA 2CXNA 3O75A 3ZE2B 4ZCLA 1Q0SA 1O6FA 3AHDA 4DMCA 1PP4A 5DN6D 4DCNA 3THYA 5FNZA 4UXJA 4A6DA 4RDXA 3N1UA 3WGIA 1GQOA 4KBGA 5DSTA 4V1CA 3R3WA 4WJKB 5IT9A 1HSOA 1TD9A 3W6ZA 1S8OA 1I13A 3HBJA 1ONOA 3AKDA 3RUDA 4ZCIA 3GEMA 1DT5A 4LAFA 3AWDA 1Y8RB 1YDEA 3OQIA 4D1YA 2EVWX 2X0FA 5KKCA 4HGOA 1QVAA 1ULSA 4UVIA 5A4MS 1BVYF 4QECA 4J0DA 3Q2IA 2O2XA 4CI0B 2CZCA 3LUPA 1Z16A 2J1LA 2JIOA 4YI5A 1CY0A 5B2FA 1XVUA 1S5PA 1GZ3A 3MS7A 2BGNA 1TJNA 4IPTA 2B6HA 1FUYB 2OHGA 3LY7A 3UWMA 1G7TA 3U31A 1L4MA 4D9MA 3IJ5A 3WGZA 4DCVA 1JEYA 4RETA 4OY3A 2VC2B 1GT6A 3B2EA 3NHSA 3D8UA 1S2OA 4RY2A 1GGFA 1IDN1 1XZQA 2O9JA 2VK4A 5DNUA 3T3EA 1N7HA 3SKVA 4H59A 3HJAA 3A9UA 5ULLA 1XMJA 3M9XA 3EMVA 4MB2A 1JXQA 3D6MA 4AMUA 1SELA 2PL9A 4M9UA 1CZRA 5K4GA 4LVCA 3Q3IA 4JASB 5HF9A 1ORVA 1VSTA 1ZRHA 4FX5A 3UT0A 3KX2A 3MQ2A 4JLPA 1YONA 4JR0A 4PQEA 3GDGA 5BN4B 3IPAA 1Y4DE 2O2JA 1C1XB 2RHCA 3W5UA 2GMWA 3M2TA 3KQNA 2PU7A 3PV0A 2GEJA 3HBAA 3OM9A 3OZGA 1A2OA 3A37A 4OGWA 4TRJA 3R7NA 4CM7A 5JARA 3OQMA 3L0ZA 2WDPA 3ML1A 5LMCA 5DRYA 2FMXA 2BGMA 3SS9X 3PHLA 2XAAA 2EQAA 4C21A 1KOJA 1T34A 3OO0A 4YA6A 2NUPA 2RCNA 4FQ8A 4BMXA 2XBMA 1LSSA 3R8XA 4YFVA 1D6NA 4OHPA 4Z5XA 4PLWA 4O2LA 1P1KA 2RIPA 3QYFA 3K0AA 1IPEA 1JHUA 4KLCA 3O73A 3AY7A 4LXYA 1CUWA 4FFOA 4QFMA 1Y8ZA 3GL9A 1YS7A 1CUCA 3FMFA 4DSOA 1DMRA 3LBNA 3OUTA 4K26A 2XOXA 5G4KB 1NXSA 2OCXA 3A2NA 3WLRA 2V5AA 3EWAA 3IDQA 5IF3A 1QH1B 2P30A 4QNMA 4A8HA 4PGGA 2W6PA 3VR5A 1E2LA 5KZMB 3KALA 4QHSA 4WL0A 5KOJA 1H65A 4INJA 4MVXA 1AGRA 2OEPA 3D8SA 3QEJA 3V6MA 3GO4A 2ZYGA 4HGYA 1OJLA 3BD7A 1N2IA 4ZALA 2YYZA 3L6UA 4FW9A 5CDUA 3ZJYA 4II7A 1YCDA 3ZWKA 3F9RA 2C2OA 2GPAA 1V96A 1WXFA 3KTAA 4EW3A 1PYOA 7REQB 2P6RA 3ZE1B 1FOEB 2C2WA 2TRSB 3Q6MA 3NZEA 4MB6A 2QRGA 3NX4A 1XN1A 1YUNA 1XT6A 2D06A 3EGEA 2FQWA 2P5UA 2B2NA 1P39A 4RF5A 5F33A 2Z1NA 3E48A 2YY6A 4JP2A 3FUXA 1DKNA 2D0IA 4QPDA 2XEDA 5C52B 3K1AB 4F12A 1OJ7A 1P4JA 2W98A 3JAWB 1UZLA 2ZRGA 2W2TA 5AM5A 3T3MB 1E3LA 1IK6A 1WXIA 3DDZX 2GCNA 1YDFA 2REOA 2CNBA 4ZDIA 2VF2A 3SE0A 3V6LA 4MO2A 5CA0F 2JLQA 2W6NA 2FZVA 3RV3A 1W4CA 2YUTA 3KQTA 3O2JA 4WUTA 1SUDA 1C3LA 1F3OA 2B2XA 2FN8A 2IW3A 4KXNA 3VI4B 1IRXA 1VLHA 3HBMA 2ODNA 4D4KA 3D02A 3GFBA 2IITA 1KR5A 2WMOB 3PENA 3IS3A 1E1RD 2JH3A 3NWJA 1DC8A 1RJWA 3RCBA 4MKGA 2PUGA 3PC6A 3QELA 1GUYA 4ZOBA 4GRAA 3V8MA 5CYGA 5L3RA 2G88A 1QG2A 3Q10A 2FPXA 1F4PA 4JX8A 1NC1A 3B85A 3KSDO 4B09A 5KX5F 1NVKA 5JW6A 2I2FA 1SXHA 3DW3X 3RT7A 4D6PA 3ZVKA 3GPBA 1I14A 2NM0A 3DDWA 4UTRA 3RAGA 1VFNA 1YZGA 3PD0A 5KVCA 2SNIE 1BAPA 4HUQA 2EKZA 3DEIA 4GMDA 2G08A 3E15A 4I3FA 4RHCA 3G2QA 4MUIA 5F5LA 4ZCPA 3IQEA 3RSFA 2ZTVA 1JZSA 3OZWA 4F5DA 1QE0A 2P3OA 2X2EA 4J0HA 5JXGA 5K8JB 5CJ2A 1NQUA 1G9XA 2FXVA 3U7FB 4OMCA 1ECLA 1MDFA 3O1LA 4NPCA 1AQIA 2CSXA 4G8BA 3H5NA 4Q3NA 2PRIA 1J49A 1POXA 3PHBE 5KMGA 1AKMA 4NEQA 4Z1MA 1WR8A 1RHKA 3AEYA 3IUMA 4E6PA 1FB5A 4EYOA 3KR2A 1XVAA 4N65A 3NT5A 2I6TA 2C4NA 2XWJI 1FRNA 5JZVA 1N4AA 2Y0PA 4UAJA 3AZOA 4OQZA 4R7TA 3Q5DA 2ZYRA 4KDFA 4FOTA 2B4QA 2Q5JA 3ABIA 2IBTA 1GLGA 4BGVA 1JLSA 1TLTA 2PX0A 2H06A 3CH4B 5G1PA 3SZGA 2J3DA 4BMVA 2JZOA 1ZD4A 4EPXA 2O2CA 4UNNA 4OK3A 3RODA 1USVA 1RZ3A 3RIHA 1NOKA 1WW3A 3IIKA 1E1KA 3SZ3A 1VJRA 2GR9A 5JLAA 4DILA 1O08A 3AEXA 1HNZB 4I2NA 4F7WA 1EUCB 1KZ9A 1Z5OA 3UW3A 4BC0A 3UPUA 3STYA 3BJEA 4U0KA 3U4GA 3WIBA 3I30X 1EM6A 1RWPA 2QI9F 3NVAA 5JSUA 4MYTA 4DJDC 3OIFA 2QD2A 1DBVO 3A4VA 5PGMA 2VJNA 3OQPA 2P40A 1ZU5A 3ZD7A 3FRIA 1MKYA 4WXMA 2HY7A 4XVCA 2XT6A 4JJEA 4LECA 5B6PA 4LJKA 1GYPA 1TIKA 2YINC 2FWPA 3WV4A 5LQNA 3LQQA 1BW9A 2PQ6A 2ECFA 1GUBA 1V3TA 3D8RA 3RYIA 5ES3A 1JJIA 2P35A 2JFOA 3CSSA 3I34X 3H7IA 4G0ZA 1TQ4A 1K27A 1E64A 4R1UA 5CH3A 3RI3A 3VHXA 1NI3A 4TTRA 1K8RA 2JB9A 3GHHA 1FQJA 3P9ZA 1G20A 2C5HA 3L3BA 3O91A 3GGGA 4LOKA 1J0CA 4J43A 4LJYA 3SLRA 5CEEA 1R37A 1Z6GA 2R1VA 1WU7A 1EHYA 4TTTS 3RG8A 5ALZA 3LUKA 3ZCXA 1BHO1 4AC9A 5M2QA 2AR9A 2VFAA 4YONB 1LZLA 4Z4CA 1Z82A 2ODBA 2ZSUA 3MS2A 5IULC 3PX7A 3DZIA 1DG3A 4DZRA 1O89A 1SM4A 2VTEA 4A0RA 3EIEA 1D6SA 1YVPA 2GYWA 4BQIA 5I4BA 3UFXB 5JZMA 3B1FA 6NULA 2YMPA 4Q3OA 3AR7A 3UMSA 1RLIA 1L7AA 2HSGA 2XVMA 3K5HA 1CU1A 1G3IA 4RGYA 4YJ2B 2F3TA 4EGCB 3BF7A 1A4IA 1ND5A 1G4UR 1QOZA 2QVZX 1SVWA 3KTFA 4XWTA 5AKJA 4CLEA 4D0GA 3QMWA 4R0VA 5JY1A 2DMRA 3OZDA 4P38A 3RU7A 2YYAA 5T6MA 1H2YA 2QS9A 3CW9A 3DHVA 3SDSA 2V9ZA 2BMVA 1ZCFA 1U0LA 1QYCA 4NMMA 1XHEA 2DCUA 1U9IC 2B8WA 4HLCA 1O94A 1YOBA 2BLNA 4TTPA 4X0EA 1EU1A 4MV7A 3L4EA 3O38A 4DJTA 1C9MA 3RAFC 1FFXA 4LRUA 4WJZA 2ZSDA 4F96A 3BK7A 1GPYA 2YXPX 1X8JA 4WOPA 1NFFA 3TR5A 4D9IA 3QEMB 5D6NA 2C20A 1Y82A 3ZWPA 1LRKA 3KEMA 3TSYA 3HO6A 1X1TA 1H2RS 2D59A 3LQKA 1FSGA 2R751 3ESZA 4IIHA 4DRZA 3K6JA 2C3OA 1RLTA 3A58B 3D4BA 3A6ZA 4Q16A 3LC2O 4LDAA 2IF2A 4PX2A 3VVLA 4O4IB 2Y1XA 3KOOA 1EK6A 1L7VC 5DTEA 1LS1A 4CMBA 2AXPA 1E1QA 4X93A 5DJ5A 4QVIA 5TT0A 1EX7A 5FPHA 2OFOA 1SBHA 4OL9A 2QMYA 2XSZD 3LUJA 4U1RA 3TKYA 4AIIA 1Q3HA 2D2EA 3CT6A 3COPA 3FSJX 4GYJA 4EB3A 2ZUEA 3EHDA 2XKBA 2FW8A 3R0IA 1SXIA 3VNAA 2JF0A 4BTVA 1PFYA 2HCRA 2I3GA 4H0CA 4DZTA 3IH5A 1H0RA 3S2EA 4PEVA 4QDKA 4WNCA 4D74A 3DOCA 4AICA 5TR9A 2DWCA 3BKWA 3LO5A 2UYOA 2H92A 3GRUA 4CDNA 1D4FA 1M75A 1XXHE 3D3NA 4DAEA 4ZI7B 1GZ6A 3EXEA 3PG5A 3GN2A 2PWYA 1DKOA 4MPRA 3UOWA 2YH2A 5ABPA 1QVVA 2W6OA 2OQ2A 4WUVA 2JD0A 1PUJA 4BIMA 4JA2A 3M83A 2I3ZA 4BE4A 2E4VA 4M0PA 2JD1A 2ODAA 2UZ3A 4ZVSA 4LK2A 1HE8B 1PLJA 1ZRNA 2LD4A 3W6NA 3X1JA 3L0CA 5JSKA 4Z4IA 3D3WB 5FPYA 2DR0A 3RC2A 3U5TA 5DISB 1X14A 1BVRA 1BDMA 2ZB3A 2V7WA 4QTTB 5AT1A 2Q1SA 3U4AA 1RM5A 3NIGB 3SX4A 1OH8A 2F8LA 2Q28A 3G0DA 1MDBA 3NVMB 5DFAA 5I9TA 4X64B 1S3SA 4C06A 1AT1A 2VP4A 3D4LA 2PPVA 4F3CA 2EKDA 1L0BA 1O9HA 2AWOA 5LYYA 2H5JA 3N2KB 3AGQA 1KQ3A 3DMPA 4R69A 4BNIA 5HJ2A 3C6QA 1ULUA 5NLLA 3E2IA 3G2OA 2H7CA 4TLDA 3MCTA 4YQZA 2GSWA 1WVIA 2QYHA 3T5PA 4JNKA 3BFPA 2HMAA 3UF0A 3CXRA 4XFJA 2YJTD 4A9AA 2XUIA 4ACBA 1MHTA 1C4WA 5J4YA 1THTA 2GM9A 4P3OA 2VZ9A 4OQQA 4HAVA 4LV5B 4PTLA 5DOZA 3UJ6A 3BPSA 3WZMA 9GPBA 5L3QA 1IBRA 3NGMA 4O4LB 1TJ3A 1U11A 4QPNA 2I7VA 1Z45A 1JQAA 4XAQA 5BWOA 1ZIPA 3DR3A 3V8NA 2OMEA 1T5OA 1LPNA 1AXGA 1ZXLA 5GADl 1ZHFA 2O20A 3JAKB 1KZ6A 1T4CA 4JS0A 4UEQA 4DHEA 1U7DA 1O9BA 5MHTA 2X5JO 3VKWA 4ZIRA 1XK6A 3CZMA 4TKMA 1P2TA 2AJCA 4E4YA 2AQHA 2OQVA 2Z5GA 3NHKA 3QLEA 1MQ8B 4NRDA 2X9QA 2VH5R 4FGUA 2DTDA 2QM3A 3BMXA 5IARA 3SIPA 4A8JC 1UOEA 3AIIA 1QF6A 4KE7A 5J40A 1XRJA 5EGNA 3BGDA 1RRCA 2G1JA 3L06A 1R9GA 2GAIA 3A9VA 3E58A 1K8QA 2IYLD 4GSKA 4H16A 3TB4A 4AZ3A 2XRZA 4W8OA 3WL7A 3E1KA 4N41A 3VSEA 5K0NA 3UAXA 1JHXA 4EHNA 5JG7A 2D1SA 4BFWA 3AF4A 4F7DA 5F23A 3RYFB 3E4DA 1H2FA 3H9GA 2KB0A 2J48A 4PZEA 4BP8A 1SJ9A 2WJIA 2WTMA 1DCTA 1HNWB 2JIRA 1H4SA 4IFEA 4ZVKA 5IG2A 4NU0A 3ETLA 1YB6A 1E9SA 1GKIA 3K5PA 3P9YA 4QO8A 3PUZA 3OLXA 4AQYB 1OLXA 1MFPA 3Q12A 4DIDA 3OWXA 1K08A 2BBOA 2IGTA 4IGKA 1WL8A 3ELYA 5E4FA 3WRXA 4X24A 3CLRD 1EUDB 3AI2A 2ZE5A 3K96A 4DCCA 2VQEB 1NF9A 3OTQA 2CWDA 3N58A 3V8QA 1KJJA 5HTKA 1OI7A 2DHRA 4NBRA 2BR5A 5HDBB 4MMZB 3BIFA 1LLQA 4GWKA 2CHQA 4ISBA 2DQYA 2HK6A 2QUBA 1LKZA 3DMYA 3WK4A 1ETHA 1Z74A 3KWLA 2MU1A 5KYWB 4XGRA 1O54A 1JFVA 4QU0A 2XUOA 3RF6A 3P2IA 4KCGA 2A5JA 1WPQA 3NDPA 2O4UX 1D2RA 1SXGA 1ZA2A 1FNDA 1K9SA 4MEBA 3S1LA 3ZGYA 1KI6B 3UBMA 4OGFA 3WYBA 4OQXA 4W9NA 2P1DA 1E3WA 3A9CA 3PGJA 4RHEA 4Y2HA 4ZVVA 1XSEA 3GT0A 4GZMA 4JEHA 3ADDA 4AKGA 3HUUA 3IHLA 4YDRA 4HFJA 2ZCUA 3NPMA 3S99A 4NZZA 4OBWA 3MIZA 3TTUA 3UK2A 4GR9A 4HNUA 4LVUA 4O5OA 2ZPTX 3U17A 2Q1XA 3O8BA 1NYTA 1OXMA 1THZA 4I81A 4KRYA 1PL0A 1N8NA 1BXGB 421PA 5AKZA 1O0SA 4TTAA 1JPVA 1L1QA 1VMDA 4QRHA 3FUCA 3EBLA 4Q4AB 2J33A 3BAZA 3VR4A 4Z54A 2FN7A 2XRMA 1YL6A 3K70C 2A1TR 2VCHA 4Z4FA 2GKGA 1ZGAA 4DMHA 5L6LB 3MTJA 1Z17A 4WN9A 1NASA 3GGDA 5CR9A 1TZBA 1TUBB 3ZYCA 4A73A 2AG0A 2B61A 4G0WA 3NIDB 2VXCA 4FGLA 1GCOA 2OCKA 2WU8A 3U3XA 4CRWB 1V9SA 2JDID 4FGWA 4NIMA 4R7ZA 4BN0A 1EG2A 2ONCA 3C6KA 3A3PA 1SPBS 1KYQA 3I8XA 4YVFA 3ZBTA 5C7OO 1V6AA 1N8TA 1KH1A 3PGVA 4H3HB 2O0MA 1VJ0A 1XBTA 2O5RA 2Q0QA 3HUDA 3MRTA 3PX2A 3RNOA 1O95D 4BKOA 3HS3A 1AG9A 4TRRA 5DEIA 5I48A 5THKA 2RJ3A 3LX5A 4RD6A 1JU4A 4NBNA 3DPSA 4EJ0A 5B4VA 3WNDA 3EDQA 1BSVA 2Y93A 3IBGA 3EPLA 1IONA 1T13A 1VECA 3U7EB 2WT9A 4EMTA 4PGAA 2HV9A 3SU8A 5DHFA 4CR6A 3E5NA 1XVVA 6ABPA 3V32A 3MT0A 4MS1A 1CUHA 1Y1QA 4AP9A 3EIUA 3IULA 2XD9A 2DH6A 2VJOA 2WILA 4KYTA 5IASA 4RQUA 5CFRA 3LNTA 2Y8EA 4DGSA 3C5CA 1MC8A 3MTIA 2WJ3A 2BCJQ 4EA8A 3BYZA 3I6BA 1K6MA 1FK8A 4OHBA 2VTBA 4RVNA 1NU6A 3H5AA 3ZDFA 3K9GA 1JDTA 4MDEA 3E3MA 4XYMA 4OQPA 4RZSA 1XZ8A 3FNIA 3KLBA 3LVRE 4YCJA 5ERYA 1ISRA 4OMFG 3U7RA 1TQDA 2B5OA 2I6SA 4HTAA 5AW2A 4LF6B 2XF2A 2DSTA 2VHVA 2YWXA 4FWBA 4P4GA 1RCTE 1ENZA 4LE2A 5CB4F 3V8RA 2HKIA 4Q05A 1YB7A 4JOSA 3VC1A 2KWIA 3W7VA 1N1DA 2QRKA 1L7RA 2YZNA 3S2IA 1PZGA 2GZMA 2IP4A 2QMOA 5B4TA 2KSQA 2O2GA 1ZP6A 1ZH2A 1GZHB 4N5HX 2Y9PB 2YR0A 2O3RA 1MJ5A 3DVAB 1DUSA 3WWYA 4L8GA 4WI1A 4IP0A 2AG1A 3PNYA 5EA2A 4IVPA 4KQXA 4CETA 5EZYB 4BDTA 2ZI4A 1EP9A 3HZOA 3RJZA 1C1DB 2PT7A 3OJ0A 4N6OA 3ZXIA 5AVQA 2JGJA 3HYTA 4MI1A 4O33A 3ID6C 1V25A 3QM1A 4N9WA 4OKNA 2Q99A 1L5YA 2W6ZA 3ZH9B 1W2GA 3GBPA 2I67A 4DLTA 4L0DA 2Z95A 2W2NA 3N8NA 4UHBA 3EXIA 1FYWA 5LZ7A 4F3YA 1OYYA 1XU4A 3F1KA 3SI7A 6REQB 3GXOA 1MH9A 3L04A 4H35A 1E5TA 1K06A 4OP3A 1TQ8A 1QGOA 4AECA 4P93A 1H2WA 4G8DA 3JQQA 1B4DA 3SFZA 5EEHA 4B6JA 1A0OA 1CY1A 1I80A 4AZ0A 2R6GA 3EDOA 1LPOA 5C5IA 5JFOA 3QMMA 1YI1A 1C1YA 1ONPA 1AURA 4QYIB 1VDZA 1P74A 2FX5A 2M1ZA 5CPFA 4UATA 1ACLA 1PR5A 2JIZD 4RIIA 2AJ8A 3JCZA 2ZOSA 1JEQA 2O48X 1VBNA 1JFLA 3M81A 5K3CA 3OEHD 2C7BA 3N6RA 1W59A 5L4NA 1JL3A 4KQFA 1RQ2A 1LDGA 3D4OA 5I7AA 3A6EA 2NYAA 1AX9A 2DBQA 2P2LA 2R1ZA 5B7QA 1QKKA 1KY5A 1K6EA 2IL1A 5IPFA 2MR6A 3D8TA 2W6JA 3KV3O 4JLDA 3FTNA 3HXMA 3CLSD 2NO1A 1J8VA 1EDOA 1S3FA 5FOWA 5KJEA 2ZRCA 3EZFA 1LK7A 1XJCA 4MARA 5AJVB 1VPTA 3EZ9A 3E27A 4I8DA 4XQGA 1U2GA 2VSFA 3QVTA 3IVGA 4EGSA 2OHHA 3C1OA 3COWA 4KH1A 4A2PA 4EZEA 1W7AA 4ALLA 1C29B 2WZCA 1VKHA 5L7YA 2IODA 1K89A 3HI6A 3AFHA 2NVUB 3F8SA 4JX9A 5CNJA 1TO2E 4D4IA 5EE5B 1AKNA 1UPAA 4A8JB 4NZMA 3RF7A 2GZSA 1LS6A 1I5OA 3EWSA 3U4MA 4MV1A 1GQFA 3NASA 2AJLI 2CUKA 5CT9A 5K0TA 4UEJA 4D45A 3T4PA 2WWGA 3BCRA 2GHTA 2VXYA 4I5FA 3ANLA 2H4ZA 2FQ1A 1N2CA 1AXRA 1ZUHA 1BCRA 1RIFA 3SYLA 1PR0A 4IOJA 5LA6A 4PXSA 3CX7A 5BT9A 4U5QA 4MDHA 4AG5A 3HWX1 3P20A 5E3IA 1U0RA 3EZYA 5IK2A 4PYNA 2C2GA 4N7BA 1HDCA 3TDKA 3ANSA 4V1CI 4RH3A 1NRWA 2Y92A 2K2WA 4QXOA 4HS4A 4AZTA 1XA0A 4MQBA 3E35A 3W2FA 2AI2A 2CN1A 3HV0A 2JHPA 3R9XA 3ZTTA 2R3SA 2Q45A 3W06A 1PWXA 1Y81A 3O82A 4Z0NA 1V47A 4N5LA 3ZZ0A 4WA7A 3S6JA 4MSUA 1ZRMA 4UDNA 4EPTA 1QQBA 1SOMA 1IZ9A 3NS7A 4XI9A 4XARA 2ZW9A 3GCGA 1FP4A 1PFUA 3HABA 2VOJA 1XZDA 2VDRB 1L3BA 2FWRA 2JANA 4FYXA 4LWPA 2PZAA 1C50A 2F8MA 4LJ7A 4XD2A 2NZ8A 5FOUA 2AR7A 1U3DA 3WBKA 1GTG1 3C48A 1DRJA 3K1YA 4XPIA 2XADA 5THQA 4DNXA 3DDUA 3H7AA 4GOJA 1NUTA 1FVOA 3LDFA 1W75A 1RPZA 2EYUA 2IUEA 1KJYA 1ZM9A 3DC2A 4C7VA 3D3KA 3EIQA 3P45A 1ORHA 4L2IA 2H59A 1YIAA 3N74A 2GF0A 4MVJD 5CVDA 1ZH4A 3TW8A 4OM7A 3U3KA 3DEYX 1KY3A 4DG9A 2Q6LA 5BSMA 2GJKA 3DJYA 1ZC4A 1M7GA 5IKXA 3UHPA 1I94B 4O29A 3ENVA 5JBNA 2YWFA 2P90A 2ZR0A 1E2NA 5F5XA 2C0PA 5FWYB 3I23A 2AZ4A 3BVPA 2ZDQA 4ZDWA 1K7EB 4AG3A 5JZOA 4DAOA 1HG0A 1QQ5A 2D6FA 4ZCMA 4E15A 2IHKA 4K87A 4OP2A 5JDIA 3ACDA 3AR6A 4DCTA 5HM8A 4PM4A 2O8VA 2IEBA 5HUJA 4ZYXA 1TK2A 1JR3D 2JZNA 2WYVA 1CP3A 1QNFA 1J2YA 5SYNA 1AY0A 3TMKA 3ZDDA 3K70B 1LDYA 1DO0A 3THYB 2OO5A 4JOQA 2PWZA 3VUEA 1YE5A 3UMFA 4CCAA 1AD2A 3PICA 2O0HA 1RLUA 3RHFA 3GK3A 4O2AA 4KN6A 5FWNA 3KFXA 3Q3CA 1GM5A 3IIJA 4PZYA 1T5TA 4UXHA 1QU3A 1UBCA 3AVXA 1ZSYA 3PB3A 4Z3KA 1VZ3A 1SCUA 4FQ5A 2O4CA 2GCEA 4PCUA 5HZHA 5JATA 1GGHA 3NTQA 4BMCA 5A5VA 4M53A 4UEOA 4S1WA 4V0QA 1YB2A 3L7DA 1KHTA 2RBGA 3CPJB 5ELXA 4M9SA 2XJ4A 4FWIB 3DP7A 4L8FA 3BRSA 1V3QE 4D92A 4ND1A 2JLAA 5TQ2B 2A58A 5FOQA 3R5JA 2KLHA 2WI8A 3P2MA 5AVYA 1CY8A 1UMBB 3JZDA 2RMKA 5TPZD 3I37X 1U2TA 3JYOA 1JDPA 2XA1A 3A4TA 4QUKA 5CEFA 1II8A 3GEPA 1M0SA 2B4YA 2JJYA 3LWBA 1W0KD 4IQ4A 1ZGBA 3PWKA 5AOAA 3N0VA 4EG6A 3BZBA 3HVUA 3COSA 4MINA 4NZ9A 4BMDA 1LD3A 2UYCA 1E79A 2KS6A 3K0FB 2EGHA 1KORA 3DE5X 1SVNA 3FDXA 3GJSA 4HDOB 2O7QA 4CWAA 1XZEA 4Z49A 2WSSA 3IV9A 1PK7A 2PRZA 2X5NA 3TQOA 3QYJA 1OGIA 1VDMA 1Z2AA 1MA3A 3OZVA 4RLHA 1BS1A 4GGPA 1F1BA 3L9WA 2CFRA 5EP4A 3TQSA 1OBVA 4EI8A 4RY0A 4JELA 4YLYA 1MVOA 3GPIA 1UKVY 3B9RA 1MO4A 1JU3A 1J8QA 4ZCRA 4Z2AA 2O7SA 1V7ZA 1K4KA 1IXSB 4HWPA 2HBRA 5MN6A 4EVSA 3GRYA 1JLKA 2FDXA 3L7OA 5TGZA 4HQRA 3TLKA 3TQCA 1SD2A 3EGIA 3K0AB 2XDWA 4OB6A 5ADHA 2AJBA 2F90A 2YQZA 1F5SA 3A4MA 5IKPA 1ZL2A 4RZXA 4MUMA 3PKJA 2ISSD 1OQAA 4RXTA 2CMGA 3MXTA 4FFWA 2PMKA 4ROTA 2ZTMA 4A6EA 4TRNA 1LTHR 1A04A 5ARBA 2IZ7A 4IF4A 3S7TA 3V34A 4FEEA 4CKBA 1JXOA 3QPDA 5FBRB 1T29A 3VR3D 1C30A 1C3JA 2WIJA 3MWJA 3Q15C 3BH6A 4B3JA 1KRWA 1T6NA 2DWQA