3FWHA

Structure of haloalkane dehalogenase mutant dha15 (i135f/c176y) from rhodococcus rhodochrous
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
296
structure length
296
Chain Sequence
b'SEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
total genus 108
structure length 296
sequence length 296
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fwhA00
2WFLB 3BF7A 2VAXA 1SOMA 1OCEA 3QPCA 5ALGA 4H77A 1M33A 4RPCA 1F0NA 3IUNA 3RM3A 2YXPX 1BEZA 1N5MA 1J07A 1ZD3A 4B9EA 2Y2VA 3QMMA 5CMLA 5EIEA 1CUDA 4LXGA 2D0DA 1CUIA 4TPKA 4PSDA 1MJ5A 2DHCA 1UK8A 4WY8A 5ALLA 4QLOA 1N5RA 4J0HA 4X7BA 3RK4A 1VJ5A 4GDMA 2XUGA 5AM4A 4MEAA 3EQ8A 1GKLA 1UOPA 5SYMA 4CCYA 4INZA 2BKLA 4DTCA 1DX6A 1BS9A 4KAFA 4GBGA 1XZGA 4KE6A 3I2FA 2DSNA 2OGTA 1MO2A 1OILA 4BP8A 3WK6A 2K2QB 1QIGA 2WUFA 3D2AA 3BWXA 5AM2A 3I6ZA 2WQZA 2EDCA 2EEPA 2OG1A 2XMBA 2WUGA 3VISA 4OYLA 5ALTA 4B0PA 2OGSA 3IIIA 2JGEA 3H0CA 4IH9A 3WKDA 4PNZA 3VXKA 1P0MA 1XZHA 5LZ9A 4K6KA 2QUAA 3HSSA 2V9ZA 4BCBA 2XUKA 3I2GA 1YB6A 5ALSA 4B80A 5CURA 3IA2A 4JNCA 1W4LA 2Z8ZA 3HI4A 3H2HA 3ANSA 1BRTA 5HF6A 1WCYA 3IBTA 4MEBA 2HFJA 4G1FA 4B0OA 1ZD2P 2PVSA 5KWIA 1XZLA 3G0IA 4EA6A 2GZRA 4KR0A 2HL6A 3C5WP 1SC9A 1G66A 1ODTC 3SK0A 5C8VA 3DKRA 3E1GA 2RGUA 3HLKA 5AK3A 3MUOA 4BATA 3WZLA 5LKRA 1XFDA 1B6GA 3MVEA 2Y6VA 3DCNA 2X8BA 1SFRA 4QDZA 2WG0A 5K3AA 2QMQA 4Y2VA 3IULA 3WQHA 2NW6A 3WWPA 3FVTA 1UK6A 1CQWA 1NU6A 2PUJA 3UUEA 2HRQA 1U2EA 1X2BA 4C88A 4WFKA 3C6XA 4BRZA 4JYMA 1F6WA 1THTA 3D2BA 3AILA 5HF8A 1KU0A 3STWA 1X70A 1TK3A 3ZPXA 2JGLA 2HHAA 2I03A 3G9UA 4B81A 1CPYA 1THGA 4Y2XA 4N5IX 5ALMA 3TEJA 1K6EA 5AHXA 1USWA 5K3CA 1XLWA 3A2NA 1XRLA 1GGVA 1X2EA 5FPQA 4E11A 4N8EA 3WA7A 5AK4A 5AKEA 4Z49A 2QM0A 2XUAA 3WK8A 2FJPA 2G5TA 3QM1A 4X94A 4PSUA 4Y2JA 4MQLA 4J0GA 5AICA 1ZICA 3R3YA 2JBWA 1YA4A 4EBBA 3S2ZA 1CLEA 3HYSA 2XMZA 4BTVA 4CCYB 5AKLA 2WHPA 1ZGBA 4FOLA 2HA0A 2RAUA 4I19A 1IUOA 2CEKA 1ZJ5A 1CRLA 4L3WA 5HZGA 1XZAA 4DSZA 1CUJA 2WFMA 3B5EA 2ZVDA 3A2LA 1YAHA 3QPAA 5FKJA 4P08A 5EIAA 2QUBA 1AQLA 3FBWA 3WKEA 4OB7A 4PV7A 5K3FA 2QJRA 4BCDA 2BUBA 1CUAA 1TCAA 3O95A 1BN7A 1QIIA 2GZSA 1VLQA 4UBMA 1XZCA 4UFPA 3DOHA 3V48A 5ALXA 2GBIA 4XJVA 2QRUA 2BGRA 5CXXA 3ILSA 4AX4A 4U2EA 1LGYA 1JFRA 2BJHA 5JYCA 4QZVA 5C7YA 2ZYIA 4KRXA 1DTEA 1VKHA 1Y37A 1HPLA 2GYVA 4GXNA 4G4IA 2AJCA 4J0DA 1IZ7A 1R50A 3G8YA 2WUEA 5IVKA 4JUIA 3R40A 4AB1A 4AQDA 3SC2A 2JGKA 2DR0A 2JEYA 1P0IA 3BL8A 3QH4A 4EUSA 1VA4A 2GBCA 4UBKA 3HABA 4KE8A 1BEEA 2QR5A 2IIVA 1H2WA 4UBIA 5DNWA 4QNNA 1PJAA 4OYYA 1MNAA 3DLTA 5JATA 1IUPA 5I9IA 4XWGA 4YASA 4G9GA 1XQXA 3W9BA 5AIAA 4CI9A 4MWSA 4DM7A 4WDRA 3ZWQA 3HACA 1QIFA 1N1MA 2C5FA 1W76A 3ZLTA 2AJDA 3O9MA 4FTWA 4H7FA 1QGED 2PSHA 3DOIA 5AI8A 5AKKA 2XUJA 1LPBB 4KYVA 2H1IA 3H1BA 4BDSA 1ORWA 3ZLUA 4X93A 4OSEA 1BCRA 3ESCA 1N8SA 1L7AA 1EXWA 4QDXA 4FKBA 2O7RA 2HM7A 1AURA 1DWQA 4BDTA 5ALOA 3WMRA 2XUFA 5DJ5A 3WWEA 3QYJA 2ACEA 3BJMA 2C5GA 1MX1A 3LP5A 2XDWA 3S8YA 2WIJA 5HKBA 1HLGA 4OPMA 1EVEA 5ALQA 5C8XA 1MU0A 4U2CA 5JASA 2VT6A 1QIEA 1WB6A 5A7HA 1J06A 2C7BA 2WHPB 3FAKA 4N5HX 2BUAA 3D5EA 1DINA 1D07A 4OU5A 3WWDA 5AKHA 1JU4A 2DFPA 3WL8A 4I3FA 5FDFA 2DHEA 1Z68A 4UUQA 3VKFA 4A16A 2YASA 2E3JA 5AKGA 4LXHA 2XUQA 4EB0A 1J2EA 1A8QA 5JZ9A 5K3FB 1F8UA 3I6YA 1R9MA 4B6GA 3TGLA 2HU8A 3DEAA 5LP1A 3V1NA 3VVLA 4L0CA 4E15A 3CN7A 4U2BA 3U1TA 2WTMA 5LYYA 4N8SA 5AKZA 5AOAA 1JJFA 5AJHA 4RGYA 4GHWA 3EIOA 3GUUA 4U2DA 3QMVA 5HF5A 2HA7A 2VJBA 2HADA 4ARBA 5HK8A 4NVRA 4Y2TA 5A2GA 4Y2UA 2GBFA 1CR6A 3F9CA 4X97A 3CXUA 4AN0A 3L1IA 1VZ3A 4OD0A 2PSJA 4J7AA 1VXOA 2XE4A 3FVRA 1GPKA 3QZUA 1AUOA 3RLIA 4Y7DA 3WKAA 3I1YA 3O4IA 4MJ3A 4C89A 3I2JA 1C7IA 5K3DA 5EHZA 1CVLA 3FYUA 4KRYA 1P0PA 1E66A 3WK5A 5JADA 3F97A 3M82A 1CUEA 3E3AA 3O4HA 2WTNA 3IVMA 4W1PA 3C6BA 1IMJA 1HBJA 4MWTA 4A5SA 5A6VA 3GZJA 5KWJA 2WJ3A 1BE0A 2HU5A 2JGIA 4NZZA 5A7FA 2WG2A 3FLEA 3QITA 2OCGA 2OAGA 4Q82A 5ALZA 4H7KA 3R41A 3FCYA 1PV1A 4Q3KA 1O6GA 3W2TA 5I7UA 5CT4A 4W9RA 1L7RA 1ZJ4A 5E4TA 5JD4A 5LZ5A 4DYHA 2HA6A 1UFOA 4J3JA 1MAAA 5JZSA 2PSEA 2O7VA 4IQ4A 4ZRDA 4DNPA 2XQFA 1IUNA 4Y2SA 3F8SA 3D3NA 5ALHA 3O4GA 4KAAA 3VJMA 3ESAA 5ALYA 3WK7A 1XLVA 2R8BA 2CBGA 1ZIXA 1F0PA 5IKXA 5DYYA 1QTIA 1C7JA 1EB9A 3LIPA 1HDEA 5ALDA 7YASA 4U2GA 5CT8A 4G4GA 4B83A 4AO6A 1W75A 2CJPA 3C8DA 1GPNA 5ALVA 5K5EA 2WFZA 1XQWA 3R0VA 5D6OA 4H0CA 3BE8A 1XZIA 1DWOA 4B84A 4ROTA 2H9YA 1QFMA 2O2GA 3WWCA 4AZ0A 5JD5A 5ALJA 1FFAA 1S8OA 2LIPA 4XIIA 4C01A 1EDBA 3V1KA 1ZD4A 5LZ2A 1HKHA 2OCKA 2WLSA 1LPOA 4B85A 1E5TA 1EB8A 5C81A 1UOQA 3WYDA 4E46A 2WJ4A 5ALPA 2AXEA 3O0DA 4RE5A 2ZYSA 1MN6A 1K8QA 4QWMA 4B7ZA 1DWPA 3JW8A 2PU7A 4DGQA 5HFNA 4HAIA 5AOBA 4K5QA 4HRXA 3BXPA 3PE6A 2G4LA 1U4NA 3WL6A 5EFZA 2DHDA 4AMYA 2DCMA 4GEGA 2HRRA 4X91A 1ZI6A 3TJMA 2I3DA 4BRSA 1WHSA 3B3QA 5CH8A 5AK5A 1ZI9A 2AJ8A 5LIPA 1G5FA 2WJ6A 2CZQA 5JANA 5HCUA 3W05A 2ES4A 4QE3A 5JZBA 1JI3A 4F0JA 3I2IA 1R3DA 1K4YA 5JAPA 2ZSIA 4ZXFA 1LPMA 4J03A 3OM8A 4MQMA 1H2YA 5AI0A 1AC5A 3FYUB 3V1LA 4GLBA 2CKMA 1GT6A 1ORVA 3V1MA 2B20A 5JAOA 5AH0A 3GFFA 1CUHA 4YPVA 3OPMA 1TRHA 1QONA 4EY5A 2P8SA 5HQ3A 3C43A 2WIFA 1Q0RA 3Q8WA 2XUOA 1KEZA 4H7IA 3YASA 1EDEA 3W04A 3DS8A 3PF8A 3WKCA 4HXFB 3OURA 1ACJA 1KU6A 4KEAA 2XMSA 4V2IA 2PSDA 3WL7A 3ZLVA 1CUFA 2D5LA 4EHBA 4HXGA 1NU8A 4NMWA 4FNMA 6YASA 2CUTA 3G9XA 3CCBA 2V96A 5D3ZA 3R3WA 1J1IA 1XZDA 3STYA 1QZ3A 2VSQA 4DLNA 3DDUA 1E8DA 4FLFA 3WYNA 1XRNA 5CBKA 4CG2A 4IH1A 2XI4A 2XLBA 3DL7A 1BROA 3N0TA 1ISPA 4QDOA 3W9UA 1T2NA 1QO7A 2C58A 4YK7A 3VJLA 2VJAA 2BGNA 1YR2A 5KBYA 1G42A 3R3ZA 3DD5A 4UPDA 2OGZA 2B61A 1WB4A 2RIPA 1TCCA 3C6ZA 1QO9A 1XRMA 3H2KA 3HRHA 1DQYA 1AMNA 1MX5A 4B82A 1QLWA 3ESBA 5JD6A 3WZMA 5AKIA 1XZKA 2X76A 2OXEA 3EQ7A 3HEAA 3MUNA 3H2GA 4BB0A 1LZKA 1RYYA 3AFIA 2GBGA 2JGJA 3A2MA 4H18A 3K2IA 1UK9A 1LNSA 1Q84A 4RNCA 1VE7A 3WL5A 3LIIA 5LZ4A 4M0FA 5IVDA 4MXDA 3ESDA 4FMPA 4QDUA 1CUUA 4W1RA 3PF9A 3M81A 1IZ8A 5FLKA 2XQIA 2ZSHA 2W22A 4Y2YA 3FCXA 1UXOA 5ALUA 4BE4A 2XQKA 3HC7A 2XMGA 3BF8A 3BIWA 3M83A 5AKXA 5HK9A 4OCZA 3LLCA 3PFCA 1OXMA 1MAHA 1YS2X 2PUHA 3NWOA 4BZWA 4AN1A 1ZOIA 4PSCA 4J0KA 3BJRA 2AJLI 4O08A 2QKYA 1YASA 5AI5A 2G5PA 1CUXA 2CB9A 2PU5A 4G5XA 2DQZA 3F98A 2CMFA 1ETHA 2R11A 5ALIA 4WDQA 1U8EA 1ZGCA 3D2CA 2BUCA 5IVIA 3L1JA 2RI6A 2BCEA 4OB6A 1ODCA 5A62A 1AX9A 1XKLA 5AM5A 4AXBA 3FOBA 1SCQA 1L7QA 1QJ4A 1CUCA 1O6FA 4WY5A 5BOVA 4BCCA 1FFBA 3A6ZA 3STTA 5HQ3B 1ACLA 3AUKA 2QOEA 4LYEA 2PKYX 1CIJA 4NS4A 4FNGA 4DMHA 2HDWA 1DT3A 4ZI5A 3WIBA 4BBZA 4EY7A 5AI6A 1UZAA 3R3VA 1H2ZA 4FWBA 4PO3X 1JU3A 2ACKA 3ZV7A 1DT5A 3KSRA 4BP9A 4HS9A 1TIBA 1GQRA 2XMQA 3N2ZB 2Z8XA 1Q0ZA 3FYUC 3HXKA 2VTVA 5DWDA 2O2HA 2QTBA 3WA6A 2XQGA 4WJLA 4UHDA 2VA9A 2IX9A 2QJWA 4H7JA 4L9AA 4EY8A 1LPNA 5AP9A 3SX4A 4OB8A 3MGAA 1UOOA 4UBOA 5DTJA 3ICVA 1GPLA 3KOOA 3PI6A 2PBLA 5FUMA 2X5XA 2HU7A 3DNMA 2ZJ7A 1ZI8A 3BIXA 3D0KA 2OCLA 3P2MA 2WG1A 1E8MA 3T4UA 4FLMA 5C8ZA 1EHYA 4H35A 2HIHA 1CFJA 2WIGA 5DTIA 4W63A 3CN9A 3IUQA 4UBJA 5FXMA 4IHAA 2VQ6A 3WLAA 5EI5A 2B4KA 3DQZA 4C87A 1YB7A 4WFJA 1XQYA 4QEKA 4UHHA 2DQYA 1A8SA 1YCDA 4I4CA 4YX9A 5AM1A 3AZQA 4ZWNA 1GZ7A 3DKKA 3JYHA 4RE6A 2AJBA 4QLAA 4IO0A 3F67A 1TKRA 1LPPA 3JWEA 2WIDA 5E2IA 4FHZA 4BAUA 5JAHA 4LIPD 4GECA 1R88A 5LLSA 2OQVA 1CQZA 3G0DA 1IVYA 5CH5A 1UK7A 1BCSA 2WHRA 4HTAA 3F96A 1EI9A 1EINA 4C4XA 4BZZA 3C8HA 3FYTA 3U0VA 4FFVA 3X3HA 3DJYA 2RHTA 2WU4A 3I1IA 1CUZA 3EBLA 4J0JA 4C4ZA 3CCCA 1MT3A 3QVMA 5ALKA 3WKBA 3K9BA 3DL4A 1WOMA 4Y2RA 2XUHA 4Q34A 5FOQA 4X90A 5ALEA 5IVHA 3DYVA 3UMJA 1XROA 3H19A 1FFDA 3QPDA 4EY6A 1LZLA 2ZYHA 4F21A 3PUIA 5LZ7A 4UBNA 4GWLA 1LPSA 5T4EA 1QFSA 2PL5A 3FNBA 1JMKC 4AO8A 4ARAA 4AMZA 3T52A 4K6GA 2C0PA 3DYIA 4Q3LA 2B9VA 1U65A 5HFAA 3KWFA 2WSLA 4ZGBA 2HA4A 5K3BA 3PUHA 1XQVA 4BVLA 3RARA 4B9AA 5DNUA 1W52X 2JIDA 2GYWA 3A70A 3GROA 4FLEA 4X95A 2BFNA 4DIUA 3D59A 5BWBA 5AO9A 3GELA 4ITVA 4WCVA 1JJBA 1LPAB 1JJIA 1A8UA 2WHQA 4TVKA 4H7EA 5CRIA 5D3KA 1EVQA 2ZJFA 4LYDA 2YH2A 4TGLA 1ZD5A 2ECFA 3C70A 2VAVA 4HRYA 5CTAA 4PQEA 4ZV9A 4Q05A 1PFQA 3HJUA 2WU3A 2WILA 1EH5A 5ALRA 5CW2A 2OPHA 2Y1KA 3ANTA 5CH3A 3GA7A 3H2IA 4X85A 3R3XA 4BYMA 4LHEA 2QVBA 4UBLA 4H7DA 5AKYA 2WUDA 3H2JA 1LBSA 1LLFA 1K63A 2QT9A 4Y2QA 3SWWA 1JT2A 2JGFA 1RWQA 5LZ8A 4DNQA 4A23A 2FJ0A 2HA5A 3WI7A 2Z3WA 1XRPA 2GYUA 1RP1A 2YYSA 2XUPA 5DYTA 5ESRA 2IITA 4DNOA 3AZPA 3VVMA 1CUVA 1XZBA 1MTZA 5EGNA 4KACA 2I3ZA 1EDDA 3G9TA 1WPRA 5E4JA 1HL7A 3I6MA 4XX1A 5D7BA 5DYWA 3M3DA 3IUMA 3OOSA 3V9AA 3E0XA 1QOZA 4Y9SA 3LS2A 2G63A 5J3JA 4N8DA 3STXA 3EQ9A 1CUSA 4LXIA 1E8NA 2WKWA 5EHNA 5KREA 1A7UA 4BC0A 1R9NA 5BV7A 3FLBA 5ALWA 5ALFA 3W06A 1UKAA 4Y2PA 4HVTA 4UHFA 4H7HA 1G4HA 1DX4A 2PM8A 1WB5A 4X6YA 1QIKA 1AZWA 5HKAA 2ZJ6A 4P9NA 4XVCA 1K5PA 1VXRA 2XUIA 5H3HA 2WM2A 5CXUA 4S0XA 4G9EA 5AM0A 5FPPA 1CUWA 1VOTA 1GQSA 1W1IA 4DSAA 2VJCA 4ZREA 4U2FA 4Q1VA 1ZIYA 2J3DA 1SCKA 3AZOA 4M0MA 3FLAA 4P93A 5AI4A 5ISMA 4WFIA 2I78A 2Y2UA 3G02A 1XZMA 1CUGA 4JH0A 4FBMA 4KE7A 5T4HA 4KE9A 4AO7A 3I28A 1CEXA 3HZOA 3WWOA 2VATA 2ONCA 3L1HA 3STUA 4C4YA 3ED1A 4BAZA 3C45A 4QWWA 1LBTA 5AI9A 2H7YA 2EDAA 4D9JA 3D4LA 4LKOA 3WK9A 5YASA 1C4XA 1WM1A 4QA9A 1W6RA 3KXPA 4DMFA 1AKNA 5DNVA 2HA2A 1EX9A 4ZV7A 2JEZA 1B41A 1UWCA 3GBSA 4PW0A 1CV2A 3Q0TA 2XMDA 3OC0A 5FP0A 4HZGA 2WIKA 3FSGD 2C4HA 3C87A 3PDCA 4W1SA 2ORYA 4JEIA 1P0QA 2W6CX 5T4FA 3TRDA 1DQZA 3LCRA 2VT7A 4CFSA 5HF9A 1XLUA 2OAEA 3H18A 5FV4A 1T4MA 4DMCA 1EK1A 3D7RA 4GI1A 2J3QA 4C6HA 4CIBA 5AIBA 3WJ2A 5K3EA 1TQHA 3BDIA 4M0EA 1QIHA 2PX6A 2VF2A 4F5ZA 1Y7HA 1R1DA 3H04A 1E89A 1BU8A 4JYPA 3I2KA 1MX9A 5AKJA 1GKKA 4G8DA 3KD2A 2OLEA 5JAUA 2QS9A 4UHEA 3OTQA 4QDTA 3IUJA 3R3UA 3EF3A 1QIJA 3E4DA 1R4ZA 4ETWA 4DMKA 3C6YA 2RONA 2Z3ZA 4BTLA 5ALNA 2J4CA 5IH7A 3NUZA 1VE6A 1JKMA 3PICA 1XZEA 3C5VA 1H22A 3G7NA 5A7GA 1AGYA 4L72A 1CUBA 1EK2A 2XB6A 3QMWA 4BE9A 3AJAA 4K6HA 3WK4A 1GXSA 4GW3A 3VDXA 4UFNA 4J0IA 1H23A 3I2HA 1MNQA 5T4BA 3NOXA 4K2AA 4CCWA 2PSFA 2WFLA 2XUDA 2BAGA 1E3QA 4DNFA 3IDAA 3KWJA 1WHTA 1CUYA 3G0GA 4PF1A 1EA5A 3G9ZA 2RHWA 4CIAA 2XMRA 2H7XA 3RKSA 1UKCA 1YSCA 1I6WA 1UT6A 4KJXA 2V98A 3G0BA 4G4JA 1XRRA 4J0CA 3O9VA 2XQJA 5LKAA 4BVKA 1BN6A 1YA8A 3UUFA 3WIOA 4X00A 3AIMA 4IH4A 2FX5A 3BDVA 2QXTA 2UZ0A 2VJDA 4G8BA 4G8CA 4UHCA 1JMYA 2Y6UA 2XT0A 2ROQA 5DLPA 4BC1A 5F4ZA 3FWHA 3KDAA 2QZPA 1DU4A 1ODSA 4OUKX 4FFWA 1FFEA 3K6KA 2QXUA 3STVA 1YS1X 1TAHA 4UHBA 3O4JA 5JIBA 5CT6A 3B12A 4BVJA 5EHXA 3H17A 5BWCA 2Q0XA 4BAGA 2PPLA 1FJ2A 1HQDA 2HFKA 1A88A 1XKTA 1XZJA 1SCIA 3VJKA 3OG9A 2FUKA 4KAJA 3AIOA 3ICWA 1VA5A 4F60A 3AIKA 2OQIA 4X6UA 2JGMA 4X71A 2J4FA 5AK6A 3IB3A 4OU4A 2V97A 1Q83A 3QBJA 2Z5GA 4X6XA 4X3CA 3AINA 1VZ2A 2O2IA 4MYDA 5I8PA 3ZI7A 1FFCA 5JARA 4CG1A 1NX9A 4FBLA 4X92A 3H1AA 5AOCA 5SYNA 1QE3A 1Y7IA 4FDMA 5CT5A 4EZIA 1FSSA 1MPXA 4Q3OA 3IURA 4HXEB 2XLCA 1UKBA 2OCIA 2H7CA 5EIHA 1H2XA 2C0QA 4E14A 1XRQA 1XZFA 1QIMA 5EHQA 5JALA 3NGMA 4AZ3A 4P92A 4W1QA 5E4YA 5A71A 2JF0A 1WPXA 4MYSA 5AM3A 1TCBA 3G0CA 4CG3A 2XMCA 5FRDA 5CT9A 2HA3A 1YAJA 3WJ1A 3FSGA 3PFBA 1QIDA 4EY4A 1QTRA 2VEOA 4UFOA 2ZYRA
chains in the Genus database with same CATH superfamily
3PE3A 3TSYA 1P1HA 5TMPA 2ETXA 1RQGA 4FGZA 1SOMA 4NYJR 4Z0NA 4AECA 1OCEA 2GZMA 1M33A 4RPCA 3ZHVA 4BMOB 3PQFA 3AT1A 1SUCA 2O1XA 5IJ9A 3OJWA 3RM3A 4ZVOA 3WLKX 3U3KA 2OLJA 5MFPA 1BEZA 5AW9A 5IDWA 1RW4A 3W2IA 1JQDA 1NVAA 1UPXA 2AXPA 1ZD3A 2H2IA 4HDRA 4NARA 5C5IA 3JASB 4FB4A 1PWZA 5BMOA 1GLGA 3KE8A 4ZEVA 5EIEA 3JQ7B 2QW8A 3PC3A 4CUZA 4D3FA 3O3CA 4MVJI 5C31A 4EJ6A 4ZVRA 5HWSA 4DV0B 3AJ8A 2PNFA 1DTSA 1S2GA 2CBXA 2J45A 2VBGA 3N8DA 4C76A 1N4AA 2G72A 2H4ZA 4IILA 1NL3A 2WRZA 4R0MA 1T6NA 3HL0A 4MAAA 3CMCO 4PSDA 1CWUA 5T5QA 3ZHZA 3SY8A 1MJ5A 3ZBPA 5I4CA 3VZQA 2JRCA 3N2LA 5ADUS 2X9QA 1HY3A 3IAS6 4B3DA 4GOLD 3TZEA 4PR3A 4BP3A 1JIQA 4OHKA 3QNMA 1MV8A 1ZH6A 2DVMA 1KAHA 3C6QA 4I6GA 1VJ5A 5E9AA 2EZ9A 4GMDA 4HOYA 3RD5A 3RK4A 3IAS1 4NRDA 4ND8B 4MQFB 4MEAA 1FDIA 2R1ZA 1DBQA 4WBSA 1TO1E 5FLYA 5ELXA 3AQIA 3T7KA 3U61B 3C4QA 3HBLA 5F5XA 1W4RA 3WOVA 5SYMA 1QP0A 1EWYA 3EVNA 5FD8A 3S68A 4UTPA 2BKLA 3JQPA 3O91A 3PHIA 3W0LB 4AMBA 1DX6A 1A4XA 3K7EA 3RHFA 2HCRA 4BWVA 4P0PB 4GBGA 1RI1A 3ZW7A 3I2FA 4R84A 1KC3A 2JI9A 1V2HE 1G55A 1K97A 2R68A 3D6MA 3E4CA 3SKXA 4BO5A 1MH1A 4RMJA 1OILA 2RB4A 3RSLA 1A9ZA 4BP8A 5ECDA 5DTMA 1JFFA 4AWXA 4R2MA 1FNSA 3KT3A 5L6MB 4D4IA 3B53X 4ZAVA 1KDYA 2O3QA 1Q6ZA 3DBRB 2ENWA 3I6ZA 2HAEA 2RC5A 4P4SA 1FX0A 2C3YA 5K0EA 1T3TA 3ZY3A 2EEPA 3OPVA 3DB1A 2KYRA 3QTTA 1IE3A 3CISA 1AB5A 2X13A 4TTJA 2WUGA 3OUTA 5JT1A 2QBYB 4YGXB 2YDYA 3B7GA 3G82C 4EMBA 2W2LA 2OGSA 3IP1A 4RTJA 4N7JA 4NONA 2H2FA 2QSUA 2H2WA 4OK3A 3I6IA 2OO5A 1DRWA 1O1YA 2FGJA 3UJAA 3WKDA 3OC6A 4ODIA 2R2AA 1N6PA 3H9BA 4HGQA 2V6BA 3TKYA 1P0MA 3MEQA 3Q6MA 2IHTA 4W8OA 1RLMA 1EESA 1G7RA 3HB5X 3LRPA 4UEWA 3B3FA 3HSSA 2C78A 2F3RA 2VLBA 3FAZA 5GJVC 5GMOA 5KHAA 4YRCA 1TPYA 5HE8A 3ENVA 3L7CA 1EQUA 1YTUA 2ZJ0A 3FROA 2VL7A 4NAUA 3OCUA 3AHCA 2ZSUA 2F9MA 4L02A 3NTXA 2F55A 3ZE0B 4ENWA 3EXHB 3RC7A 4XD2A 4HGPA 4EPVA 3EYAA 3MMNA 5E6RA 5A04A 3IA2A 2NZVG 4JNCA 1W4LA 4DHEA 1G7SA 4ZHSA 4IHQA 6GPBA 1EX1A 3HDVA 3KJZA 2VT2A 2A9OA 4TSFA 1DG9A 1ULUA 3FF4A 3ANSA 1EP3B 4PWYA 5HF6A 3ZCVA 5FBWB 4YYZA 4ZJPA 4ETNA 3BGDA 5KQGA 1P4RA 2XYQA 4DPKA 2LE0A 1GDTA 2NN3C 1OBFO 1VL0A 1E2DA 1ZD2P 4YCNA 1JSLA 5JO0A 1YVUA 1F06A 3FNRA 3MWDA 4OJTA 5EIWA 5DDIP 4OY3A 4J4TA 1JVBA 1QKIA 3RASA 4NKRA 1SPBS 4IV0A 4EHLA 2UXCB 2R00C 2EFGA 1AKQA 3QEKA 3V2GA 1CY1A 4QUGA 5EHIA 5JROA 4C6SA 1XZLA 3H2YA 4KR0A 3V33A 3RWOA 3C3DA 1ESCA 1SC9A 2JAOA 3QYAA 5F2NA 3U60B 1G66A 2Z57A 3RWMB 4W9NC 1P18A 1BXRB 3SS8A 5JY1A 3IJPA 1TLFA 4U02A 4CTKA 3EPPA 4GU5A 3ZQJA 2SKCA 3CEHA 2O8EA 2JPDA 4HAYA 5KNDH 3RV3A 1E7MA 1U7UA 2R96A 2B7LA 3ISJA 2V7XA 4LRYA 4BATA 1L1EA 3H3FA 5DI3A 4XD7D 1ZDMA 3CEAA 3FETA 3SF8B 4F4IA 1I9GA 3S4YA 1KQOA 3MVEA 2Y6VA 2P8JA 4R16A 1K3FA 4I81A 1L4BA 4WSOA 3BN3A 3ODPA 2WG0A 5E6SB 4LHSA 3AUJB 3SYKA 2FWIA 3MTIA 4OJQA 4HI0E 4D4HA 2Q6LA 5EXSA 5K0SA 1ZUHA 1Y1RA 3WWPA 4G6ZA 1Z56C 1CQWA 1J2RA 3C6MA 3MHPA 2F4NA 3HN2A 4IDPA 4TRMA 3WIDA 4K8RB 2KW5A 2VKTA 4LCBA 2V7UA 3KR9A 1QQBA 2PT6A 4OHPA 2OUKA 3BOSA 3JWHA 4LI0A 4ZQCB 2OZKA 3WMWA 1GPWB 1E6CA 2OFXA 4DLXA 3QU7A 6ADHA 2Q5IA 4WFKA 2ZPAA 3ZCQA 1QK4A 4LOAA 2RDMA 4P83A 1T1IA 4WK4B 4ML3A 5FWYA 4OL0A 4QOEA 5HF8A 2IGBA 3EQ6A 3IILA 4EY3A 4V0QA 1F3LA 2IS1A 4GFDA 4MITA 3STWA 2OCYC 3EXIA 5CM2Z 1LQ2A 4DQVA 4E1BA 3K0CA 1J5XA 3SIWA 3HM9A 2K87A 3OPNA 1LTHR 2QTLA 2HHAA 3SLRA 4B81A 3BFKA 1R12A 1CPYA 2F1KA 4NBLA 4MVJE 4N65A 1EFAA 4M1TA 4ZAFA 3REFA 4QVGA 3GLHB 4N5IX 5EE9A 1Y3AA 2B8TA 4OBEA 2V0GA 1PL0A 4UTOA 1NAHA 3JAKA 1PZXA 5AVVA 2BTQB 2NSLA 1J25A 5K3CA 3OCWA 4X44A 2QJTA 5EJ2A 1KJZA 5JEEA 1GILA 5JJ5A 2CDNA 2ABWA 1N78A 3ADPA 1E2PA 1XRLA 1GGVA 1V8BA 3HDGA 4WLEA 5KTKA 1X2EA 4V0NA 2AFRA 2CHEA 1UDWA 3NAQA 5FPQA 1JHOA 1T3HA 3GEBA 3JRXA 1NAIA 2HXSA 4LF7B 2XXAA 5AK4A 2FWBA 5AKEA 1Y3FE 3ZGNA 1EFLA 1Z17A 1MAVA 2PWYA 4KQ9A 4R2IA 1IMOA 2X0DA 1GAEO 3QY0A 3S3TA 4F1JA 1MABB 1U7OA 2EIHA 4I4TA 5ES4B 1EGQA 2P0EA 2C00A 4YR7A 1E32A 2QN9A 4HDMA 5IYZB 2GCEA 3ZDAA 3MPOA 3PC4A 1N0HA 4FYXA 2ODTX 2G5TA 1KAEA 4D8XA 5JXWA 2HPVA 4L8VA 4RK5A 3JVEA 5EP2A 4IUYA 3ORYA 121PA 4NCXA 1OYOA 1FLVA 4Y2GA 4D4LA 1SULA 2CXNA 1ZICA 2JBWA 1HI9A 1RXUA 5CJJA 5IK2A 2MU1A 4O4IF 2IX3A 4R2XA 4PQFA 4FFLA 1FTNA 4AT1A 3W2GA 2X3FA 4BLUA 2A0UA 2V1XA 2HSJA 4CU5A 4YAJA 4BTVA 2BF7A 1LBHA 2ZTHA 1YR6A 4AIIA 2QG9A 2XCIA 3DMHA 5AKLA 1YXMA 2HR1A 2C57A 1G64A 1W4AA 1JWAB 3H1PA 4I8DA 4TLEA 2EGHA 5DZSA 2HA0A 1QH1A 2ZR7A 1IWOA 1KMHB 2HJWA 2HZBA 4HYEA 4K46A 4JR1A 5CHYA 2GCNA 3BCHA 3AFHA 3TNLA 5LD2C 2HC9A 2V3WA 3R7SA 5CITA 2VZ0A 1JA9A 4L3WA 1KSHA 2EF1A 2FU5C 4LVCA 3THXA 4ZRNA 4DSZA 3CKMA 4UD2A 4IQFA 5DCUA 4H27A 2XGGA 1RZRA 3EPHA 2ZVDA 4MLZA 5JSYA 2F48A 4YUVA 3K05A 2I3GA 2R8ZA 3FUCA 2GF2A 3QPAA 5FKJA 3RVLA 4QRIA 2OWDA 2D1RA 1WXFA 3VTKA 1UBJS 2OXTA 1GGEA 2MINA 3JR7A 2QUBA 1AQLA 2J6HA 3FBWA 3KZ1E 3LFUA 4OB7A 3R75A 1NF8A 1DJPA 2N42A 3FDZB 3SZGA 3RFTA 1SZCA 1X7ZB 1Q1GA 5C9ZA 2JC3A 2PX0A 2QJRA 1GGJA 3ASYA 4JA2A 1PNQA 1ZG3A 3I76A 4TL6A 2FWAA 2FW6A 4BCDA 4B3RB 3CX3A 1L4KA 2IE8A 4LYHA 4C4PA 1FYXA 1H6AA 4E33A 3N0XA 1QSGA 4Z5XA 2QGNA 4GLOA 2W0MA 2Q4DA 2YJGA 2BIFA 3CT6A 4WH0A 1YL5A 4LRUA 1VLQA 3O1HB 4AN4A 1XZCA 2QLLA 3DOHA 4Q1CA 4RVSA 4MIOA 2CNOA 3SR0A 4MDYA 5DLQC 2P40A 3V48A 5IBCA 3LPMA 1D0SA 4UHKA 4W5HA 4KMOA 1VJRA 3MWEB 3TG8A 3AYXB 2BGRA 1D7AA 1EK6A 1OLUB 1Q1EA 1L7PA 3B1WA 3QPUA 1TQ8A 3N1UA 2IYUA 3KX2A 4LN1A 4UCXA 1YZGA 3RVMA 1IY0A 1Z0UA 3MIIA 3NP9A 3TPZA 4QZVA 5JWOA 1GZ5A 4YLYA 2ZIWB 4J4HA 4M6WA 2WTEA 2ZANA 2JI6A 2ZYIA 4NJMB 3N2IA 4B8YA 3FTDA 5G3YA 1A8PA 2EL7A 1Y37A 3EIQA 1BD3A 1K7SN 3QG5A 5KX5B 5IM4F 1ISFA 2RKWA 3BB1A 1JYSA 1JH8A 1M0WA 2D1QA 2UYHA 3AHIA 1HPLA 1MENA 2GYVA 4Z8XA 3K9HA 2JKZA 3QEMB 4GXNA 1IHDA 4G4IA 4EAQA 4NZNA 3C7CB 1YS7A 4IQ8A 3CPHA 2PGOA 4YEDA 3REQA 1RYNA 1TF7A 1IZ7A 1NWHA 3GEIA 1YB5A 2FPKA 3EMDA 3N8KA 5F23A 4B46A 4ZAWA 4OAOA 4XPIA 1R50A 3G8YA 1R66A 5IVKA 3Q8KA 3HHPA 4BHTA 1KBQA 4JUIA 2TSYB 2OD7A 1QWOA 2IPNA 3DAYA 1MRZA 2A1UB 4QXMA 1MZVA 3WGMA 1KZ4A 4RD0A 3OZWA 5E4FA 1DIBA 5MFZA 1NLFA 2JGKA 2OZPA 3P94A 1JLHA 1K9VF 4HK4A 4TLAA 2ODQA 2BGUA 1QANA 1P0IA 2XWPA 3EFOA 1ZSYA 3QH4A 1ESDA 2Y0CA 4LCJA 4YJ2F 4Z7QB 2GBCA 1QCDA 3HABA 3C0KA 5ARCA 1YB1A 2W0SA 4OMUA 3VPDA 1MOQA 2WSMA 2Q07A 3AUYA 3F78A 3MD9A 1FUEA 4NATA 4CIXA 2Z8YM 4JI0B 4DQUA 1UBMS 2AI3A 2ZIFA 1EE2A 1EWVA 1GZDA 1KMIY 1KETA 1Z39A 1Y48E 1IZZA 5E7QA 4EKYA 5IFLA 1XZ8A 3TTSA 2HH9A 2Q9UA 4Q9KA 1JEAA 3ZU2A 2NU6B 3HYNA 4V1CA 3BGVA 3WBJA 1UDRA 4GDFA 1UT5A 2QYSA 5J9FA 2SCUB 1BKYA 3P5SA 5KZMB 5KNBA 1ZJZA 2QX8A 5AR1A 1V4VA 2GKGA 1II8A 1DEKA 5D8DA 4CI9A 3V7WA 1BDIA 2VWHA 3SBOA 4JT4A 2FN3A 3GCWA 3HR7A 2BJWA 3OIDA 5H1YA 3MINA 2ZRNA 3TB6A 4DLTA 4C9BA 3ZYCA 1QB7A 4HH1A 4S1VA 3ZLTA 8LDHA 1G38A 4FTWA 3EGEA 5BUSA 1L4HA 2WM3A 3IO3A 5CVUA 1N9GA 2VPWA 5JH7A 1LBQA 2H9AA 4B5KA 1T3SA 5EWMA 4X8OA 3AV0B 3H1BA 4BDSA 2Q4BA 2QTCA 1UMDB 3UKDA 3GVPA 1OH5A 3MOGA 4YQZA 4MAFA 1VMIA 3RIGA 2VNIA 4YV1A 3CF4A 1IQPA 3SEQA 2DETA 5LBIA 3NP7A 1KEEB 2PQ0A 5BWNA 1RQRA 2HCBA 3TQSA 3KQUA 1XJCA 1ZW6A 3H8WA 3PJRA 1MVNA 1WKCA 3ESCA 4UATA 3I39X 1ZGZA 3TCKA 5AUOB 3E2IA 3GDHA 4F85A 2H59A 1OY1A 2TS1A 1R0LA 1LS1A 1RRGA 2FZWA 3HRKA 2HJVA 3CWZA 3ITNA 4UTRA 2HCTA 2QLMA 4W7IA 4DRZA 3DZDA 2VHTA 4WIAA 1JIKA 4B09A 3EJ6A 5FL7D 2QE7A 3SHWA 2G1KA 2D62A 3L7NA 4DG8A 3OMXA 2ZUSA 5ALOA 2AN4A 2A5LA 2CHQA 2YWBA 2FTKE 2DJ5A 3BMQB 3ISVA 2XGJA 4P8RA 1HE4A 4GG1A 3ADCA 2HJHA 1O94D 5D85A 1E1CB 2ZJ2A 2FK7A 2C5GA 1KQFA 3IQZA 3ZR4B 2FF7A 3BKWA 5U4QA 1Z29A 4YRRA 1LK7A 3DOCA 3BWMA 2WIJA 3GB9A 1SEPA 2KMLA 3EAFA 3WJAA 1AJEA 3E35A 1AQNA 4TSKA 1HLGA 4DHWA 3T7RA 1D7OA 3K09C 5TQ2A 5JAZA 1BWQA 1GUFA 2B8JA 2VIIA 1H94A 2WD7B 1EGMB 4S05A 3M2PA 4MJXA 3WNZA 3ZDZB 2WE8A 3DE3X 3TIIA 2XJ4A 3DL0A 3OKFA 4U2CA 1TJNA 5IJZA 3EEIA 3JQAB 2OBXA 2VT6A 4HRVA 4LVOA 1QIEA 2ZR9A 4RKWA 1EP2B 3GPDG 4N03A 5IFKA 3FAKA 4MVXA 5HJ5A 5E9QA 2Y66A 3UW1A 2JAUA 2D2EA 1DSSG 1L4LA 1GPH1 4IJKA 4KU4A 5DBEX 2ZIAA 5HNKA 1CJUC 3HXMA 1DTWA 3ILVA 5FWXA 3BB3A 3HSKA 5B3JA 5DI9A 3WWYA 3T1YB 1VPWA 2DFPA 3WL8A 2ZTUA 1ZHHA 2XGOA 4GWKA 2VQFB 2W4IA 3MLAA 1QO0D 1R8QA 1ZNZA 4XYLA 1Z68A 3BL5A 3VKFA 2QTAA 9LDTA 2OZLB 5L53A 3LKDA 1SEVA 4O59O 5C8YB 2E3JA 3KU1A 1FS6A 1YU9A 2FSIA 1L8AA 4MP8A 2Q45A 3HXOA 4CIDA 2K5UA 2B6HA 3DP9A 3U3DA 4QYSA 4DIEA 2WYUA 2I1QA 4E09A 4YP9A 2HRBA 4TRJA 1E4OA 3WGNA 4EVRA 2MJLA 1P44A 2CDBA 2VKQA 1BXZA 4H08A 1F2TA 3M5WA 5H81A 3PC7A 3AVVA 3K72B 1MXHA 3HU5A 5DTEA 3RDPA 3RUHA 1QKJA 2FWNA 3VNQA 1R9MA 1WBDA 1E9DA 4ARIA 2BM8A 4B6GA 2IZ1A 3EXHA 3FOAA 4YAWA 1GZVA 3TGLA 1A7JA 1NBHA 1L5YA 4NXMB 2ONKA 2QTMA 3CRNA 2ONZA 4PN7A 2I76A 2ARKA 2GUWA 2JH9A 4X7RA 3ENQA 1H5QA 5D5HA 4LOJA 2I29A 4RF2A 2ZAOA 3D31A 4RXUA 5AJXA 2OP0A 3A9SA 2FPIB 5EFOA 3H5VA 1KYVA 2I8AA 5LYYA 3EPLA 2PKEA 3T54A 3AETA 5IC5A 3H8VA 2C03A 2J7PD 4JT2A 2ODAA 3U9SA 5SZKB 4MR7A 5AOAA 1E2JA 3C48A 3RFFA 3H2BA 3TRHA 4EG3A 4GE0A 3VPBA 4CMHA 1S8NA 1LFDB 3QMVA 3S70A 5I45A 2ORED 1XTSA 4BRUA 4J94A 4E4RA 1KEUA 4J7CA 1NVVQ 2ZXFA 3OZFA 3S8MA 1DQRA 1NVTA 1T0PA 1T2EA 3KC2A 4ARBA 2PGXA 4RVNA 3QE0A 4NVRA 3NWJA 2ZJ5A 1SVKA 5A2GA 1B3BA 2PKCA 4WE3A 4F9TA 5GINE 2IHNA 1IZYA 4F12A 1PK8A 1Y1SA 1SVNA 1AHNA 2ERXA 3DMTC 5ERXA 3VJRA 4AN0A 3IP6A 1KARA 4RDCA 4CLRB 1N32B 3FMGA 3P0RA 4DDVA 4RD1A 3A4LA 3LZCA 1XI2A 1QRUA 3VRHA 3W8EA 3ZZUA 4CWAA 4B31A 3OZCA 4J7AA 1HL3A 1VM6A 1R5BA 2HT1A 3SC4A 5F5LA 1E4EB 1IL0A 3D3WA 4RO0A 5KINB 1UDAA 2PS9A 5GOTA 5KWSA 1Z16A 2FPXA 3I1YA 3VHXB 4YRIA 4W6ZA 1E58A 2DH6A 4C89A 3ZWOA 2CFRA 3TAUA 5E6SA 2JANA 3EEFA 5G1PA 3OEHD 1G21B 5GGYA 3SC2B 3L1UA 2EFCB 1VL8A 1U0NA 3OQVA 3PEVA 2X8WA 4H3KB 4E03A 1I80A 1HR0B 3T7AA 1E66A 1GZUA 1N2ZA 2O0JA 1D0VA 1EQAA 2VZEA 3SVZA 2Z2IA 4BFTA 3QJGA 4FYMA 4G81A 2IOQA 1F4PA 3P9NA 4WCDA 5BR8B 4GMHA 4W1PA 2ECPA 3ICEA 3EG9B 3U7QA 2JJ2A 3IQIX 3DBHA 4BJHB 1G9TA 4OX9B 4B3CA 2JFBA 3FH0A 1OA0A 3KKOA 2AD1A 5A6VA 3GJRA 5HIAA 2HQ1A 4W82A 3P2IA 2H5IA 2YOGA 4DCJA 5JI3E 4ZT3A 5IHXA 2PLNA 5A7FA 2PL1A 3PTAA 4AURA 2JIOA 1GD1O 1WJGA 3N5CA 1D3AA 1QJCA 1PD1A 2IZ0A 3A6FA 4HDNA 4JCCA 1LLUA 2OCGA 1EAMA 4QPNA 4BFSA 3DQQA 5C51B 4OMCA 2PUGA 3OFVA 1M5RA 1CZKA 2E4VA 4QOHA 3VDMA 4AW9A 4DSUA 5FT9A 5I7UA 3G89A 1GSAA 1U7HA 1ZIPA 5HIIA 1T8SA 4YJFA 1T2CA 5E4TA 4O25A 5DGHA 2HX1A 1D2CA 1VSUA 5LZ5A 3UQYS 4DYHA 2HA6A 2I3AA 3R4VA 1P0CA 4I08A 4PX5A 1UFOA 2Q1UA 2YZ7A 4M3NA 5BSTA 3UMVA 3WRXC 2NSJA 4CM4A 3I6QA 4HEHA 4J3JA 1XVUA 3USZA 4A0RA 1WUTA 5IMSA 3CUEF 4J1QA 1LDBA 4KHZA 2O2JA 2F59A 3HGMA 4ZRDA 3A31A 4RZQA 4ER7A 4B2IA 2AN5A 3RJZA 2VJOA 4GBED 2XQFA 4JHXA 4DNPA 3D3NA 4MLCA 3ND5A 3RYFA 5L51A 3T5MA 4XGRA 2EWWA 2GFQA 4DIKA 4IEFB 4K9MA 1XLVA 3ICCA 2VSOA 1CEEA 4Z4HA 3COWA 3TX6A 1U0RA 2CBGA 4M8IA 3QA9A 5DEOA 3N53A 4QHTA 1SKMA 4F3KA 2P9ZA 3IBYA 1EB9A 4EHKA 7MHTA 1Z0JA 2HJSA 2WYIA 3LIPA 2G82A 1GFIA 5D2CA 1LB1B 3QHQA 4WZ6A 5ALDA 1X19A 2XXBA 2FRVA 1LY1A 2NV6A 3DP7A 5CT8A 4AO6A 1A82A 1BQ4A 1J0AA 4BGIA 2NV0A 3ROGA 2CJPA 2J1LA 2W71A 4M1EA 4MRSA 1GPNA 3Q3JB 3TZLA 5K5EA 2E5LB 2C3MA 2XEXA 3AW8A 5D6OA 4BWFB 1DV2A 1VI6A 2DPXA 1MR3F 2B2XA 2QN6A 2RJOA 4J07A 1KEWA 2WTUA 5KSOA 3ZQUA 3GNSA 4CI0B 4IV8A 1NRWA 5GVSA 4P7GA 2LIPA 3QIAA 4DIFA 1EDBA 3NT2A 3OTIA 3L8MA 2MTBA 2JW5A 3WDLA 2V54A 1EFVA 2UVPB 4PQYA 4RTPA 1PS9A 4FGWA 4G9BA 1YJXA 4RENA 2AVDA 2JG3A 1EM8B 4B85A 5DE3A 2JDID 3T9DA 4BMXA 2UYQA 3K5HA 3GPLA 4E13A 4M9ZA 2FW1A 3FLMA 2WJ4A 5ALPA 2AXEA 3RVPA 2D3TA 3B9BA 1XMSA 1O77A 4Y6GB 4E5VA 4UNRA 1GPMA 1P81A 4RMIA 1ZMXA 1MN6A 1K8QA 4L0QA 4QWMA 2F4VB 1QLJA 1RRCA 3PC8C 3JW8A 3ZIDA 3RC9A 5IKMA 3KJXA 4EYEA 1QZXA 1AKTA 5HFNA 3CLKA 2XVZA 4L5AA 5CTJA 2IOFK 5CYFA 3TL3A 5DMXA 1EP9A 1ZH4A 3I9OA 3GRRA 3RIHA 1N6KA 2O7SA 1TYDE 4PS0A 4YRKA 1VP3A 1SG0A 4YN3A 3WFIA 2R8PA 2Z9DA 4E5UA 1DRKA 1O8CA 1ZSVA 3VR1A 4A8PA 4HZUA 5TQJA 5FYQA 1P5RA 2BP7B 2KBEA 2DHDA 3T94A 3EVCA 5FPHA 1BH6A 1A5ZA 1HKUA 1GA6A 3IXQA 3T7SA 4E12A 3K71B 4FFRA 4GEGA 4DR5B 2LZ0A 4PY2A 2HRRA 3KSDO 2PIDA 4I50F 2F9LA 5IARA 3EG5A 1QE5A 4OK6A 3JWIA 3WGHA 5KYWB 1KS9A 2I3DA 2QTGA 2WSBA 4B8ZA 1NN1A 4BRSA 4RTOA 3T5CA 4Z7NB 3GEMA 5FWAA 2UKDA 5CH8A 2V59A 3SJBA 1RCUA 1U5CA 4ARZA 2C9MA 5F98A 2DT5A 2IDMA 2N1BA 1II0A 1EEXB 1ZI9A 2PZMA 3NTQA 1QS0A 3ME5A 4Q1EA 4A91A 4ZEWA 2R86A 3R4CA 1QZZA 4IGFA 5C1BA 1Q7TA 2R6JA 1W4BA 3BA6A 3GR6A 1DBWA 3I9FA 2Z1MA 2QQEA 3L2OB 4QE3A 4G26A 2ZI4A 4QOGA 4BNVA 4Z9FA 4I8XA 3I04M 1SKAA 3VR2A 4F0JA 2IBTA 1UKVY 1OLXA 4PC7A 4PZ9A 1NW5A 4FX5A 4LDAA 4NMHA 1WXDA 2OFWA 4QD3A 1YH3A 4XLTA 1EG2A 1UBFA 2VOJA 3LCCA 5CNJA 4EKIA 2PAAA 2ZSIA 4DVJA 4OVKA 4RKQA 1FJXA 1YBVA 4I99A 3MCZA 2CEAA 4PCVA 4UARA 4ZXFA 1I5OA 1JHUA 3N8HA 4J03A 3ZU5A 1XT6A 3OM8A 1U8ZA 2XJ9A 1M75A 3DOEA 1UBLS 4MR9A 2G6TA 3I3OA 4F71A 5I8WA 1Z0DA 1XRSB 2O8BB 3N75A 4EJSA 4MQEB 3A1NA 2I6SA 5TY0A 2CBZA 2OHIA 4Q4JA 1RCTE 1TECE 1GSIA 1ZWKA 4GLBA 1NW4A 2QSZA 3SE0A 2PS3A 1RYFA 3T7IA 1A96A 2F3UA 3I32A 4KQ2A 1DP4A 1K8ZB 2JK1A 5JAOA 4QFDA 5AH0A 1KSGA 2CFTA 2O3UA 3GFFA 3OCVA 3V9PA 1SELA 3M6WA 3M6FA 4WXHA 5DT2A 1XKXA 2PHZA 1G8PA 5ANRB 2ZAYA 3FG9A 3V4OA 4PXSA 3SX0A 4ZV4A 4JROA 1DIAA 1VHQA 4IWYA 4MR8A 1WWKA 5LA6B 3TXAA 4A6PA 2P2YA 3PE4A 2JHPA 3C43A 3DO6A 3Q8WA 2G17A 5TMBA 1KEZA 1UFVA 1E94E 1DJMA 4LOKA 2ZB8A 2PCLA 1VYVA 4RBNA 1ZUNA 1Y1KE 2Z9BA 1MW9X 3CUUA 4GX5A 2H2AA 3FGPA 2FY8A 3ROKA 3W04A 4KITB 1TVMA 1IQUA 1EGHA 3OURA 2Q4OA 4MRPA 4CF6A 1P1JA 1S2OA 3I5UA 4KEAA 3OLYA 2XWQA 1WMBA 3FIJA 1NI3A 3WL3A 3FTQA 1C9EA 4RLSA 1KEEA 3ZLVA 1ZMTA 3ZCSA 1OAKA 4HXGA 1OFVA 1VL5A 2A57A 1NU8A 2CJFA 2HHCA 2N3ZA 3GEHA 2D1SA 3K1TA 3O74A 4OQDA 4QGGA 4RZIA 2QD4A 4TMWA 4U39A 4RMNA 3WO1A 4TYNA 1JIUA 2ACWA 3R0QA 4IXNA 5FO1A 5C7LO 4HLQB 1EXNA 5DLYA 5ARDA 3ZWVA 2A88A 3ROXA 2V96A 4K7JA 3TRKA 2NZXA 4BYGA 1NN0A 4C2BA 3LQFA 4CEHA 1E5XA 3R5TA 4R83A 4OP3A 3E58A 2GLUA 2Q2OA 3PGKA 3RFUA 1P1BA 2AN1A 3VOBA 4CUJA 1SGWA 2BHTA 2HD4A 3KTDA 3VC2A 3TFOA 2WAYA 4RD3A 3SJZA 5BVGB 1KYTA 3H9QA 3DAOA 5CBKA 3CH5A 2DWOA 4X20B 2YWDA 3CHYA 2GN1A 2AV6A 1RJDA 4DIOA 4EYQA 2AOUA 4RJIA 5ESXA 3T8YA 521PA 1L8OA 4CT0A 2I2AA 2OG2A 1COWD 3N0TA 3O4VA 1XB2A 1YR7A 1CNFA 4QDOA 1LK5A 4BY9E 3I9LA 4GXRA 1XDDA 2A4MA 3VZRA 2AK2A 1QO7A 1ZK1A 4YK7A 4UOZA 1W36D 5IM5A 3THRA 5D1HA 1K88A 2Q6KA 2EFHB 4UPDA 3TRIA 3HV0A 2A0KA 1ADFA 2N9UA 2ZBEA 3F4LA 1F20A 1FP1D 1NA5A 1TCCA 3KJHA 4I5DA 1G16A 2ZRFA 1KWKA 3L7LA 1GAJA 3OT5A 4ZCSA 3BE5A 2CT8A 3BSFA 5IKPA 2YUIA 3RUDA 2FPUA 3HRHA 5IDYA 1JNYA 4KXYA 1UXJA 1U04A 3BRQA 2XZTA 3ESBA 3U19A 1YHYA 3WLEA 4OLBA 1VFNA 3E9CA 3H2ZA 5AKIA 1O0CA 1LI7A 1XZKA 3HXPA 4NNOA 3EQ7A 4ALIA 3EUEA 3PVSA 4QC2A 4TYQA 2OZLA 3H2GA 4PWZA 3L0DA 3S1AA 4MZXA 1LZKA 3LFHA 5CFLA 2AZDA 2YS6A 3IMEA 4ER0A 2ZUDA 3TOSA 3BTUA 1BKDR 2C42A 4QYMA 2D1FA 2I2FA 1RYYA 4ACAA 4MHSA 4H0FA 1AQYA 1KMNA 3PC6A 4ZIRB 2NWQA 1XNJA 3PNVA 3A9VA 3K2IA 1V16B 2BD0A 2VJKA 3KLMX 3MQFA 3ABIA 3QVVA 4RNCA 4YXWA 1RCFA 4L85A 4FMDF 3WGTA 5K8IA 4UVHA 3DZBA 3NX4A 4N7RA 6Q21A 3AEKB 3AM3A 3LLMA 1RQXA 2AMJA 2NYAA 2OESA 4WLUA 2CDCA 3V55A 1FX1A 4B6RA 1QU2A 1CR0A 1I2MA 3B3AA 1P3Y1 2GJAA 4BZPA 5IVDA 3U1VA 3ESDA 1IBLB 1GAWA 2AZ4A 4RJ2A 3ZWBA 1OAOA 3ORHA 1CUUA 4C08A 4D41A 3AL0C 3DFIA 1C1XA 2XXJA 2FZLA 2JZOA 3DH0A 1IZ8A 1YJCA 4XQ0A 2NV2B 2QY6A 3EVFA 1PJZA 4N47A 5KYGA 2W22A 4ETMA 1PHRA 3PFIA 1E1DA 1Y7LA 4OHWA 5F7JA 5JNSA 2EERA 3EFEA 3PGVA 5DM1A 3CW9A 3EIEA 3BCRA 2QTVA 1BTOA 4MVWA 2K2WA 5EQJB 4JSTA 3RK0A 3L40A 4MINA 2D0PB 3RVBA 3QU5A 4OGLA 1O58A 1H5NA 2HDHA 2H2DA 4GWGA 1A7KA 1O95A 8ABPA 4FFBB 1FL9A 2EJWA 2YVKA 1T0UA 3AX6A 4TXNA 2ZZNA 4M53A 1LF5A 2ZVPX 5HK9A 3DCYA 4OCZA 2C1ZA 3PFCA 3VR0A 4DJJA 4B3SB 1MAHA 2XWJI 2WNIA 3GF4A 1JR2A 3BH7A 3L0BA 4RY9A 3DHEA 3WG9A 1Z18A 2FPOA 3ORSA 3VC7A 3ZDRA 4HQ0A 3SP1A 5B58T 3R8CA 4QPPA 5ERGB 1ZOIA 1L8LA 5DO9A 4J0KA 3EVTA 3M1IA 2QPAA 2AG8A 4C5AA 3T3OA 3ND8A 5TR9A 4DOMA 2VRNA 4L57A 4MAMA 3LC2O 1KO4A 1Y6QA 5GJCA 5KYTA 1XEFA 1XPJA 3EVZA 1YASA 2JZCA 4BMDA 2HMVA 2G5PA 2DQSA 1OWOA 3L7OA 4LNAA 5IJAA 3K70B 3PQDA 2CB9A 1H9BA 3E22A 4G5XA 5JJCA 2RBKA 1RM5A 4D96A 5JBNA 2GEJA 1NW3A 2DQZA 2FSVC 3NS7A 4FFOA 3WBFA 2WSIA 4QICA 1MIOA 3KQYA 4QPZA 1D6SA 3NU1A 1BE1A 2BGIA 5DF1A 4EI7A 2O8CB 2OKCA 2JCYA 3O38A 3BEDA 3OKAA 1WCIA 4NYJQ 4XOUA 3EG9A 1KC1A 1OFHA 2X3YA 3GUVA 4PYQA 4TT3A 1U8EA 2DB3A 4ZJYA 2FW0A 4QBHA 2IUUA 2DMRA 5IVIA 5FI3A 5A3SA 4AS3A 1TCUA 1W0CA 3E48A 4NDAA 3OZRA 3L8HA 3PDJA 3IBFA 4KIWA 3SZ3A 1ZRNA 1S9DA 3VBEA 2Q4TA 3GFTA 1ODCA 2GBPA 3OESA 2VPYA 2NADA 1VMDA 3HDQA 1Z0ZA 3ZQKA 4R9UC 4YY3B 4E3WA 3AKYA 2FPPB 4YS6A 1L7QA 2FOXA 3OJLA 1GTJ1 2KI5A 2O2CA 3KEFA 3UAWA 2RHCA 1ZNXA 2N47A 3AL2A 4MYCA 5KJCA 3QVOA 3D1JA 3OSZA 1AMUA 3AFGA 5EXXA 1A5BB 4BXOB 3L8CA 2QAIA 3R6TA 3BZUA 4GQBA 3N2YA 1IOVA 4EHNA 2G1PA 4XQCA 5A1TA 3HJFA 4P1ZA 4RF3A 4RGVA 4N0PA 3BL6A 4UE2A 3PCRB 5GGXA 3N2GA 2PKYX 1XLTA 3SSNA 3CH6A 1CIJA 2PWBA 4Y98A 3TFQA 2QN3A 1OWLA 4DBLC 4FNGA 3AOEC 4DMHA 2VSYA 3IQFA 5G40A 1DT3A 3DDOA 1HDRA 1JS1X 3C3PA 3FMPB 4OHCA 4BBZA 2ZI5A 1T34A 1BHO1 1UZAA 2A59A 3GRFA 4BVLA 1RLOA 1JU3A 2ACKA 3ZU4A 4R8SA 1GAXA 2PA3A 3D43A 5JSZB 3R3JA 5I4KA 1K7EB 2SICE 1RQNA 2WT9A 1TIBA 1EYZA 2AI1A 2OCBA 5ETJA 2BFCB 1GP2A 3AR2A 1PX0A 4WA8A 1ZD1A 5F5NA 2ZZMA 1FS5A 6LDHA 4PZLA 2GZ1A 4H16A 3V8EA 1CJTC 3RW9A 5FJJA 2XBLA 1Z45A 1FQOA 4PAQA 3DE1X 3FPEA 2DRIA 3ZQ4A 4UXJA 2VTVA 4KYIB 4TKVB 3AR6A 1P19A 5KTYA 4KQWA 3UCXA 3UAGA 3Q10A 4BLTA 1T9KA 1S02A 1E7SA 1IHUA 4K81B 4QIHA 3DOOA 4W5JA 2VA9A 4M9XA 2X2PA 1FTSA 4XWYA 4MQ5A 2NG1A 4EY8A 1LPNA 1HYQA 2FX3A 1H0RA 3KFXA 3P0EA 4KN6A 1Y5MA 4N0EA 4L78A 721PA 2XF8A 1Y3IA 4OSPA 2B69A 4GQAA 1FFHA 1RM0A 1UOOA 5DTJA 5EMNA 3SKVA 4CQJA 2FDCA 2QZ9A 4KR2A 1YKGA 5AOVA 2JLAA 2WM9B 4LG1A 4E3ZA 4C6RA 1QH8A 1PLLA 3H0EA 2O3JA 3TBKA 5MN4A 1UBGA 1ONNA 2PBLA 2QWXA 4P4NA 2WWVD 1II9A 2H48A 1JEYB 1JB9A 4DAOA 1OPRA 2I0FA 1P2UA 5CM9C 4JI6B 1PJ8A 4KYUA 3TLBA 1L5NA 2VSXA 3MWGA 2W4QA 5LP6F 1ZFNA 5EP4A 2IHKA 1ST3A 4NENA 2M32A 3DVSX 5CNMA 2GD2A 4EHDA 3THYA 2RGDA 1TU0A 4G5QA 1NQAO 3IE2A 2YJZA 4PYIA 5BSMA 4TTIA 1I5EA 4NOLA 5TVKA 4G89A 4L07A 4ZCIA 3LK7A 5D3QA 1SVWA 4HVLA 2RH4A 2D3WA 1N6OA 4CQMD 2QVZX 4MVJM 3IPXA 1V26A 1UJ5A 3LK6A 3RRNA 3LX8A 4KQGA 4UMVA 1HM5A 1A9YA 3RSOA 4EPXA 3KO8A 4QJ3A 1I32A 1QYIA 2D74A 3GN2A 3N6XA 4BP1A 1WPGA 2V6JA 4RVUA 2JZNA 1NIJA 2VJPA 3SYLA 1J1UA 3F73A 1NONA 2XSZA 5L9AA 3VTAA 2FP4B 2Q4RA 3MNFA 1R8XA 4W63A 3IUQA 2MWMA 1NQTA 2P6MA 2X6QA 2ZJ8A 1K08A 1Y3DE 1WDKA 2MHCA 1FMTA 2WWHA 3IIMA 1ZNWA 3OZXA 4KG7A 5FXMA 2QYTA 2VHWA 3V6MA 1SBYA 3VOTA 2VQ6A 2GHTA 3WAJA 2CK3A 1M2NA 3L4SO 3OJFA 3G2MA 3WLAA 3AEQB 4HFNA 4DLSA 4OJMX 4WHMA 4HQKA 5FNVA 1Y8CA 2WSYB 3HFJA 4M9RA 2W43A 4NU6A 4CM7A 1E0SA 2V9CA 1FXUA 4DDMA 2DUJA 5ILGA 1XGKA 2R84A 4KVGA 4UHHA 2DQYA 2VQ3A 3G5MA 2NXJA 3GVIA 3IP5A 4KMRA 4N82A 1YCDA 2BP7A 2O2XA 4I4CA 1QP7A 4YUZA 2AZXA 5AM1A 2AG6A 3VUFA 1M10A 3T5PA 2ZIUB 1GZ7A 3GWGA 1QB8A 2YJ5A 2CSXA 3W8DA 3O8NA 4IDOA 4LYFA 4A3SA 2YZMA 3B9PA 3I53A 4R40A 4XYBA 5LOVB 2ST1A 3FPJA 4TYYA 2RD2A 4RETA 1H69A 1ZINA 1JHAA 2FFRA 2V55B 1VB3A 3MMSA 1R8YA 2P4UA 4XB1A 4BAUA 5JAHA 4UULA 4I3HA 1R8SA 1KIAA 3WDMA 4KLCA 1Z35A 1BVYF 5IT9A 3HDTA 1ABBA 2E49A 5CA0B 1TD9A 1ID8A 1J9ZA 4WEOA 3UC9A 1IFXA 2GJ4A 2PUWA 4IMJB 1NSTA 1BCSA 2WHRA 4L5JA 5HJ7A 2V7GA 3ABOB 3FNIA 5FBRB 1EINA 1JXOA 3COSA 4Z4IA 3U0VA 1MO6A 4ZI3A 4MOWA 4MRVA 4BV2A 1QHIA 3GRAA 3HU3A 4X60A 3SDZA 1NURA 5CVEA 4MSUA 4CM1A 1U94A 4RHYA 4MKHA 2C2HA 4A4DA 2XNKA 2Q6OA 2VAPA 4MGIR 5G2OA 1M54A 3BS4A 4DQLA 2V45A 4KPFC 5CXSA 5C7IO 1NMXA 3I1IA 3EBLA 1N25A 2OCDA 3QLVC 4J0JA 4D2IA 1YMVA 4HNUA 5JU6A 2JA1A 3CCCA 4OQZA 5ALKA 5H7XA 5EJIA 1QGDA 1DCMA 3FGNA 2P6UA 4Y0NA 3DL4A 4RKFA 2GK7A 4MA5A 3ZHCA 1WOMA 4D8WA 2VYFA 2NP7A 5WRFA 3LPLA 3DE6X 4QT4A 1D2RA 1ZXLA 1THZA 1HE1C 1M9NA 1T4DA 2V6GA 3BBPA 1ZVMA 5FOQA 2XZOA 5ALEA 2NVUB 4LC0A 3TLMA 3OQIB 4U1RA 4RHTA 2IV7A 1GEGA 4D46A 3LCVB 2ILTA 3LWDA 3LT1A 2CXRA 1HZJA 3LA8A 2D59A 2CFOA 3I30X 2EKDA 2KB0A 4E7OA 3FJOA 2ZYHA 3VR3D 2IPAB 2PRJA 5B1IA 3HFRA 4DCMA 2EJCA 3P71T 3PUIA 5MGNA 3G8BA 1NVMB 1FVHA 4ZZ3A 4Q4AB 4NBSA 4O4LB 1P7CA 4YRMA 4HY3A 2EFJA 2SBTA 3TPFA 4L4XA 3ZGOA 3OZ7A 4E22A 1JDNA 1LPSA 3OZIA 3SZLA 1G291 1JMKC 4HPXB 1EUDA 3W6NA 1P2TA 3K70C 1VJ0A 3IJEB 4K6GA 1BDJA 4YUWA 3IXLA 3DV2A 4KTVE 3TFWA 3UV3A 1PT7A 3DV0A 3DYIA 3GLTA 4GP6A 2B9VA 4Q3LA 4I4NA 5DN6A 3F5QA 1AF7A 1U65A 3OZEA 4BFYA 1KIMA 4HUQB 2WSLA 2RI0A 1HH4A 4JXKA 2CZGA 3RTGA 1OFUA 2WQ6A 1FB5A 2HA4A 3OLWA 4O1IA 3VSEA 4IHAA 1E2FA 4C0HA 1Z2DA 2YHIA 1DBVO 1ISHA 1X1TA 1CY2A 2FQXA 1PBNA 1Z6AA 1AGNA 1HE5A 1HG1A 4LC1A 1S1MA 4LHXA 4D9MA 4EGFA 1PL7A 3ESQA 1AXEA 3ZH2A 4UVDA 3RFVA 5K8LA 4DIUA 5C7OO 1NBOA 2YZNA 1N5JA 1J24A 3D59A 2QEQA 5EZ6B 4D4JA 2Y27A 5A4JA 4CV2A 2V0CA 3HKCA 4ALNA 3WNQA 3OQ6A 1HOXA 2W6NA 3FBGA 4ITVA 4M9QA 2C88A 5AW4A 2A67A 3H1GA 3A14A 4BO1A 5JAIA 1KNXA 1XAIA 1NNEA 5JSHA 3PEEA 2X2OA 3V7NA 2R5WA 4Y6QA 4QXQA 1W0KD 3G2NA 4I6EA 1A8UA 1MOZA 5LWHA 4GKKB 1WMAA 2JBAB 3PBKA 4TVKA 1NDHA 1J5EB 2A5GA 3ITKA 4BQNA 4LE1A 4EVQA 1VHDA 1EWKA 1KZ1A 3EEBA 1L5HA 1YRWA 1RYEA 2J08A 1VDZA 3I0ZA 4I1VA 4CR7A 1XNQB 2BI4A 4DYDA 1REQB 3NDPA 5EQFA 2FZEA 3OHMA 1ABFA 3SOPA 3NVMB 2ZJYA 5JOQA 1O5TA 1SB9A 3OIUA 1XMXA 1G3IA 1ZHFA 3BK2A 3EHEA 1PGNA 1XR3A 4P7JA 2V4ZA 3IRVA 1E69A 5K4HA 3L0PA 4HRYA 3AVTA 1TO2E 1BGWA 1KSFX 5IUKC 1JPJA 4ZV9A 4ASUD 1TW3A 4ZQHA 1T8UA 3ABZA 3VYUB 2WU3A 4E30A 2WILA 2E4XA 2H0QA 1T9HA 2OPHA 3W9SA 2B92A 4NBVA 2RH5A 3RYHB 3EA5A 1T8RA 4WUVA 3KQMA 5CH3A 4C4RA 3H2IA 2W2VA 4F3YA 5KSYA 3OWXA 3EX7C 5H8WA 2WPDA 2LR0A 2ECQA 4FYYA 1V16A 1GL9B 3FHTA 4F3NA 4DY6A 1N6RA 5FBKA 1FNNA 3HN6A 4UBLA 4PC1A 1KJ9A 3ZKWB 3FE2A 3B3JA 4ER6A 4L5IA 2HY7A 1X80A 2Z08A 3FJ1A 4QOJA 3KXIA 1SCUB 5B12A 3RRJA 2WYWA 1YVEI 4YP1A 2EC5A 1CS0B 2RCYA 3LVRE 3OLCX 2ATIA 4I1RA 4TLLB 4DM3A 4GSLA 3SWWA 4I6JA 1H85A 4BJ6A 4UQLA 3CONA 3VOSA 5BUQA 5LZ8A 4DNQA 5HZMA 2C97A 5HJ2A 4EY6A 3K15A 1YZUA 4AJEA 2GO7A 3WR5A 3IAAA 2ZJ4A 1R4NB 1OYYA 2F43B 4OAPA 4EUHA 5TT0A 2HA5A 2I7TA 1R0WA 3OFND 2WVJA 3DAHA 5K09A 4JS0A 5CIYA 2XCOA 4F3TA 1KI6B 10MHA 2Y05A 1RP1A 4HLNA 4TYWA 3HLYA 5BWMA 1MO3A 4UAGA 2YYSA 3LUBA 1K86A 2XUPA 2FG6C 3FWNA 3G79A 3PNYA 2B4YA 3OJCA 4JQSA 4NHOA 5ESRA 4BKOA 2Q3LA 1IQRA 4C0SA 2NGRA 5FWNA 2P2SA 5EKSA 3ZS9A 1NOJA 1HF3A 2PUTA 1CUVA 2QRVB 2XECA 2ZKLA 5EGNA 1JHVA 2J67A 5SZIA 1Z2EA 3U48A 2AR0A 2FLKA 3MCUA 3PNSA 4KXNA 2Y71A 4YP0A 1F6BA 4W8HA 3V7FA 3GUZA 1NVKA 2HWXA 3LSYA 1GR0A 4DEVA 1PCXA 1HL7A 1N75A 4DPMA 3PL1A 2RGNA 3JQ8B 4AF8A 3UMGA 3QVGA 2VO1A 1UKEA 2VTEA 3EIHA 3QLUC 4OTZA 4EO7A 4BNDB 4P0QB 4UD6A 1E20A 3QKSB 4Y0VA 4JJZA 3E9ZA 3LS2A 1EBFA 4YT2A 1MB0A 2JIPA 3L6UA 4ZDIA 3D64A 2GEVA 1SKQA 1C0LA 1J2TA 2P9HA 1BXGA 3KUCA 3STXA 2Z58A 3IP3A 3LA6A 1Z5WA 4UJ5A 1E8NA 5T6BA 1WXQA 3PWTA 3EMBA 1PG5A 4RK4A 3LG2A 1U2SA 1Z7GA 1IWBB 2YY7A 4FONA 4HQNA 1Q95A 4QDKA 3P1JA 4BC0A 1RRVA 3H5TA 1KZ6A 4CNQA 5BV7A 3E9EA 5JC1A 1XPRA 1EWTA 1ODJA 3RYIB 4AMVA 1ORIA 4CQLB 1YACA 2AJTA 2JVJA 1JEEA 3GJXC 3MJFA 1CZHA 4IR7A 1XOIA 5CVCA 1UBHS 7AT1A 2FPWA 1TVKA 3BBLA 3ZV6A 4UHFA 4WKBA 3PA6A 4I55F 1NXQA 1G3RA 4IQ0A 3H9JA 1IY1A 1L5MA 3IRUA 4A10A 1DX4A 3AF5A 4CM9A 4JUDX 2ZJ1A 1OLSA 4X6YA 5IULC 3CH4B 4B3BA 4WMLA 4DDTA 5A4DA 2IYSA 4P9NA 4XYMA 3N76A 5CVVA 4D8YA 1FRQA 2HV8A 4WJZA 4AMUA 1W29A 1DE0A 2ZTSA 2CLOB 5H3HA 5CXUA 3M4ZA 4ZU6X 4ZICA 1UODA 1CY6A 1OXTA 2C7OA 1W2HA 5AM0A 1DC6A 1C29B 1GUZA 3LX4A 1Z6ZA 1GQSA 3QFSA 5FPPA 4BKPA 2PXXA 4PM4A 4D0NA 4PLGA 2B36A 3PNQA 1NMSA 4O2BB 4XJTA 1RWKA 3KXLA 4EL5A 3L0OA 4HVAA 3AY6A 1AU9A 2V7BA 3TSOA 4YALA 3GQVA 4INPA 2NIPA 1ZIYA 4M0LA 1Z2AA 4JSRA 3WY9A 3OCZA 4US0R 4TWBA 2A9FA 3VR5A 1QGOA 4KR6A 3KPVA 3SZMA 1PNRA 1EFKA 1TAGA 3K3PA 1CUGA 4D3ZA 3K4PA 5CCXA 2PZBA 3JPYA 3VR6D 2ATVA 1XK7A 4A7PA 1B6TA 4ZU3A 5HCNA 3I28A 2ERYA 1PK7A 4EYKA 3OF3A 4EUEA 1T0IA 3W5HA 1UAYA 2HSZA 4N6NA 3ZJVA 3ESXA 4MUEA 4PTLA 3ZJUA 3KKPA 1PR1A 2VATA 1R4MB 3MS2A 4B3TB 2BI8A 3O3MB 3V46A 3WGQA 3W7BA 2SKDA 4L27A 2R8YA 2ZWMA 4C4YA 3B60A 2IVZA 3F7NA 1EFRD 3W34A 2VPIA 5DTQA 2ZSBA 3WDSA 1J20A 2Z9CA 4MWBA 2PMDA 3M49A 2BMAA 1N2GA 2CXPA 4RD2A 5EUMA 4LUCA 4N39A 3FVWA 2D2IA 5KVQA 4BEBA 2FEPA 4HGNA 5DCWA 3ZWPA 1ORRA 1JEYA 1LBTA 1JQKA 5ICMA 1Z5UA 2ZBUA 1VLVA 3M6LA 4IDDA 4LKOA 1NBMD 2MT9A 4PVCA 1CJKC 3D0RA 4S1NA 2QMYA 4ZDJA 2C8JA 6NULA 3ZXSA 4KXLA 3ETLA 2W2QA 4UNPA 4ZODA 5DX0A 2BKAA 1AHPA 1DGQA 4ESHA 3EJWA 5ICGA 1T4CB 1PEAA 3RS5A 3RAEC 2PLWA 2ATXA 1KL7A 4FYVA 4L5CA 1PZMA 2VPQA 3RS3A 4B43A 4F1WA 2XY4A 2BGJA 3DUFB 5TT1A 2H16A 1N2OA 1RDFA 2YOFA 3M5DA 5BNFA 3MJSA 4Q7QA 1EX9A 3NRCA 4GKAA 4MROA 3WRWA 2COKA 2L0XA 1CQIA 2QAJA 1F9AA 4FCWA 3I6BA 2VXOA 3FA2A 4LKRA 2BWJA 3Q7RA 1IU9A 4DSTA 2PN1A 1ADYA 1JGTA 1U1DA 1CV2A 2OZVA 2HMSA 2W2TA 1ESMA 1F8XA 3EVEA 4PAMA 4J90A 4RHEA 4Z2AA 3ONFA 4C22A 4MB2A 3KVOA 5REQB 3RVOA 2AYZA 3MOSA 3UG7A 1PGOA 1RSZA 1OX4A 2WIKA 3DE0X 3IOCA 5EYPB 5FTMA 1M8PA 1YO6A 3ACCA 3RRMA 4L51A 3JQ6A 1ILWA 3SICE 4F86A 2P9EA 4MW7A 4JYZA 5CFZA 4B4WA 2JLWA 2G8LA 5B30A 4PG4A 3EAGA 4H0NA 5IBQA 4RKRA 1O6ZA 2HPHA 1P9RA 1UXGA 2VT7A 3L1KA 2NUTB 1BMFD 1BE6A 2NUPA 3JYQA 4FU0A 4TL9A 3GBVA 2FWJA 3FTCA 4DG9A 2A9RA 4I9NA 4EZEA 3M6UA 3Q41A 2QRPA 3HWRA 3MXOA 1JR3E 1SOVA 4QEZA 3H18A 4PLTA 2POQX 5EESA 1K5DA 4DDUA 5FV4A 4MUNA 1E18A 3L7YA 2YR0A 3E18A 3E9NA 1JW9B 4XSVA 3R0ZA 3LQ1A 4HYYA 2B4RO 4D42A 5KTPA 4HO1X 3T61A 3PYXA 3UHAA 2Y1XA 3CKLA 1Z7BA 2G7MC 1X9IA 2PKRA 3ND7A 4CIBA 1NYLA 1U80A 2C4UA 4XUCA 3G6WA 3WJ2A 1ZK0A 5T64A 2R1TB 4M86A 4NE7A 2Y1OA 2R5FA 4EDFA 5AVQA 3PS9A 1PG2A 1YQGA 2IUYA 3D7LA 1QIHA 3KQSA 4YJ3A 3DTYA 2QG6A 3G8DA 1FRVA 1YCGA 1YB2A 3MW8A 3OP4A 1ZRHA 5D86A 5HFJA 4F5ZA 1Y7HA 3AI2A 3D3JA 1DRUA 5B1SA 2NO4A 1JG2A 1T9GS 4CDGA 1YKFA 3CLHA 1XEXA 1P9NA 1NSYA 2IODA 4UM7A 4XI9A 5AKJA 1UM8A 1Y6ZA 5IF9A 4C4SA 5M5BA 4D99A 1S8AA 4ZVKA 3UF0A 4J1SA 4B4KA 5BV1A 2AG5A 4OIFA 3KXKA 1UZMA 5I5EA 1RVDA 1N2SA 3BHJA 3JQFC 3TD2A 4JC5A 2BFOA 4MV0A 5CA1F 1YI8A 2C8KA 1AKVA 1SC3A 4FFMA 4NOJA 2QS9A 4UHEA 4LJ7A 4EA9A 3OTQA 4OAQA 3CTPA 3LT2A 1G59A 1LDEA 4MW4A 3UMYA 3EF3A 5L4NA 1JEQB 2OD2A 1KQNA 4LBVA 1KQPA 3F5DA 3QX3A 2AMLA 3FW1A 3HLTA 1VGQA 4IJ5A 4WGFA 421PA 4C2UA 2MYUA 3PI7A 4KUHA 4EQ6A 5INTA 3TIVA 2ZIEA 1RRFA 1QGZA 4AG6A 1I94B 5CFMA 2EJUA 3PLRA 4AU1A 4CV3A 3BGOS 2OOKA 2JAWA 2XT9A 5EJFA 1J5PA 1D03A 2EATA 5IN5A 5ALNA 3IS3A 3DHWC 2FWPA 3NWPA 2RGYA 2WQ7A 2Y1WA 2HJRA 5E7MA 3F5SA 1SUSA 5KYYA 1RMTA 1SWVA 2EFEB 1KO1A 9GPBA 1U3DA 1VE6A 3W6OA 1O08A 1ZU5A 2DTDA 2CMGA 4P2GA 1D2GA 3BM5A 2ZE6A 5MN5A 3TL6A 2BRUA 3C3XA 1JBEA 5AW8A 4KTTE 4RX1A 2BCJQ 3BD6A 4YDQA 1H9CA 3KEMA 5AHOA 4HEJA 4L8FA 4TQAA 4U6QA 3ZWXA 1E1QA 4CR6A 4LY0A 3SQOA 1DKOA 2ZCVA 1AG9A 4KFRA 1GUAA 3WO0A 3LKBA 2A30A 1WVMA 2VYNA 3ICPA 1PJ4A 1T3LA 3QMWA 4ONEA 5HUJA 4FUQA 4JASB 2Q5LA 3AJAA 2GJKA 4RHXA 1QHNA 4ZAGA 1U8FO 4ZMBA 1NNSA 2HO5A 4WUTA 5LVAA 1VG8A 3IIKA 4PSVA 4F5EA 4IYJA 3TLAA 3WYCA 3F6RA 1GG2A 4GW3A 4CIYA 3DWIA 1Z33A 3VKVA 4KL8S 3E70C 1U0TA 4LRXA 1P17A 2FRDC 4YMSA 5FQOA 4QHYA 2VNAA 1F51E 2WT8A 4BBJA 5ELLA 4J2OA 1MNQA 2P79A 2ZSJA 4CKXA 3G59A 1YFLA 1GPDG 3NOXA 3QELB 1V39A 5ECYA 2XQVA 1AGXA 3EMKA 2GCIA 3DGFC 3E5RA 3ELWA 3F6BX 4PBTA 5TMDA 1Z2OX 1KEPA 2BAGA 1L3BA 3D2LA 5D5PA 2H4WA 3T5BA 3L82B 2EKPA 1OJLA 3LQRA 4PTYA 4FE7A 1R37A 1IEQA 4EFMA 1CUYA 3G0GA 2OAQ1 2WMDA 3B1KA 4LZZA 2DQKA 2DU8A 2QI9F 2RHWA 1W85B 3A4YA 3IPAA 4XFJA 1FU8A 3WAKA 4EBFA 2PUAA 5ENDA 1QRSA 3THWB 3NPMA 4HMPA 3OIVA 3O8LA 3RKSA 1UKCA 3TH5A 1E5VA 4YAKA 5IWCA 1RQLA 1I6WA 4MRNA 3E7DA 2JBAA 1TTPB 2DYKA 2PX8A 2Q29A 4HDQB 4RA9A 4I5GA 1I7QB 1CC1S 1T3ZA 3LBIA 1U8UA 3G0BA 4JP2A 2J48A 1I30A 4ON9A 5IUNC 1XRRA 3HL4A 5A4MS 2V6IA 1OKKD 2UXDB 4J0CA 4OHXA 2MSEB 5GONF 3DE2X 1QU3A 3MJVA 3O8DA 3PPVA 1UBUS 5BO5A 3GYBA 2JFXA 4JFAA 1MOSA 4AS2A 2BEUB 5LKAA 1PJSA 2IVFA 2REQA 3B52X 4I1YA 1R64A 4HLUA 3A6KA 4V24A 5HEKA 3AY7A 3SEAA 3UUFA 2GQ0A 3AIMA 4KX3A 3WYFA 5EIBC 1SO8A 1WW2A 3NM5A 3SHVA 1Y98A 2UZ0A 2C4KA 2D7DA 3T9BA 1X1DA 3G1UA 2O2SA 4HB0A 2VJDA 4NE2A 5EHGA 2YV5A 2Q9CA 3VFDA 3QTBA 1JMYA 4UNIA 1B76A 2CJYA 1XAGA 2HQBA 3SFTA 1KAOA 2VF8A 3EISA 1FMFA 2DPYA 2HV9A 3FPLA 3PHHA 5M7EA 1Q0HA 4XLZA 5AQEA 5JMTA 4CEIA 2BMJA 2YNMA 2VDKB 2PIAA 3O5AA 2FMUA 5DGCA 2BHSA 4TV8B 5BV0A 5KOHB 1Q77A 5LLDA 5CBPB 5F4ZA 3DEIA 1I0IA 4W5NA 4C0WA 1PQPA 4DMUB 4KK4A 5JZVA 1I2AA 1VCNA 3HS3A 3ETEA 5TPWB 3UK2A 2PYZA 2QZPA 4P98A 1IHYA 4EI2A 2QP3A 5KAMA 4FSXA 2AK3A 4OUKX 5AW2A 4FFWA 4JGIA 1E63A 3P32A 4AF7A 3FB4A 2ANCA 3AKCA 1JLLA 2QZZA 3OF2A 4K9SA 2ECKA 5IAGA 4KWEA 5CM8B 5DOVA 3SYNA 5KNDA 2IBSA 1VLZA 1G1MA 2F43A 4AULA 2PO5A 3N2KA 3I4CA 4ZVVA 3JQBA 3T1NA 3VU9B 2QNBA 3ZOZA 1JDSA 4MKGA 4YJHB 4BGUA 4EPYA 3GGSA 3VO2A 1H3NA 4LHYA 3QW2A 4FMBB 4POAA 3R7DA 4BVBA 3FZEA 1MC4A 3GRYA 5EHXA 2QZJA 3H17A 5KTTA 5GJBA 1QDUA 4DCOA 4BFLA 1P33A 4FOPA 1IBRA 1UPUA 2JCXA 3JARA 4B2LA 4CM3A 1UDXA 2Q0XA 3FPCA 2NACA 3OIFA 4ZCPA 3KKMA 2OXFA 1Z4OA 2HFKA 2NPFA 3U4AA 4YMTA 4LHVA 5LQMA 1TEHA 2IYOA 3CRW1 3OMLA 2P4EA 4L3OA 5E9WA 3SKYA 1CYDA 2G08A 1KF0A 3QE2A 2FUKA 1BD4A 4MS3B 1S8FA 3I42A 4OBWA 3ICWA 1VA5A 4F60A 2ZIXB 4LC9A 3UK7A 3QI2A 1Z36A 3AVYA 3AEUA 1W94A 5DP1A 1C0EA 1NFRA 2ISCA 3PL5A 3E3MA 3JQAD 1TM5E 5AVJA 3SXUA 3T38A 1U6KA 2JFHA 5IUJC 1U0LA 3C1AA 4RW0A 4W7SA 3AWDA 3G5AA 5EY5B 1G2OA 3IB3A 3F5FA 4CHGA 3GFSA 1XEWY 1Z3IX 1SKUA 1OIVA 3PHLA 1RJGA 1N7GA 5HTKA 1P5HA 1Q83A 4KO2S 2GM3A 5EKDA 5U4XA 2ZUBA 2Z5GA 1Y1TA 3QBJA 1ANKA 4X6XA 4DCVA 4EYSA 3Q7SA 4DMLA 5EP3A 4MPPA 1W96A 1XN4A 2DPGA 3JQCA 4GZLA 4MYDA 3U7FB 3UMFA 5J5CA 4CG1A 4DSNA 4JHLA 4X92A 1DG1G 1S2MA 3NHAA 3SJCA 1DCTA 2QAGA 4E2XA 1Y7IA 3B1XA 4JWTA 5C0OE 4ATNA 5EXTA 4ARCA 4W99A 4YV7A 3KELA 1ZH2A 1YQEA 2HBYA 3PHJA 3UWOA 4DA0A 1CT9A 3MBOA 4Q3OA 4G0VA 3IURA 5EJ8A 1YR1A 2WT4A 3BH6A 3DC2A 4HXEB 1BVUA 1WXWA 3LLUA 2AE2A 1LFAA 4KX5A 3VBCA 4DV2B 3KUXA 1UKBA 2EBFX 4QQKA 2NU7B 2R2GA 3KEGA 2ECOA 3UXHA 3L01A 5TGDA 1L8QA 5B4UA 1KYWA 1CY7A 4FVTA 4E14A 4YCMA 1XRQA 5FR1A 4GMKA 2OV3A 4QUKA 1QGUB 1YRQA 2H06A 3E1KA 2B1RA 4WASA 3DVAB 1M1NB 4QYIB 3B70A 4MYTA 3SZUA 3F1LA 4EW1A 5EJGA 3OA0A 5TQ0A 2CNNA 3IKVA 3U6KA 4MKFA 2JF0A 3EHDA