3FWHA

Structure of haloalkane dehalogenase mutant dha15 (i135f/c176y) from rhodococcus rhodochrous
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
296
structure length
296
Chain Sequence
SEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 108
structure length 296
sequence length 296
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fwhA00
2GBCA 2Q0XA 1OCEA 3HABA 4CG1A 3LP5A 1EVQA 3LCRA 2J4CA 4UHEA 4HVTA 5ALJA 4X6YA 4EA6A 3D2AA 2C0QA 1OILA 4EY4A 4OU5A 3BF8A 5AHXA 2HDWA 5JD5A 3UUEA 5DWDA 3QPCA 1TQHA 3STVA 3YASA 4L0CA 2HRRA 4PO3X 3AIKA 3N2ZB 3O9MA 1TCBA 4I3FA 1CUBA 3HLKA 4QDUA 3QVMA 5CXXA 2QUBA 5ALXA 2ZYSA 3WZMA 1XZLA 3CN7A 3I28A 1XZBA 4FNMA 2J3DA 2RI6A 4LYDA 5AOBA 4UHFA 5ALKA 4AN0A 2Z8XA 3ICWA 4QNNA 5JYCA 1K8QA 1U8EA 3BJMA 4UFPA 3ANSA 2H7YA 1VZ3A 1XZJA 3ZLVA 1P0MA 5A7HA 5K3FA 1C4XA 1CUDA 1AC5A 4CFSA 1A8UA 3D5EA 4IO0A 1VJ5A 2XLBA 1CUIA 4U2DA 2H7XA 4ZXFA 4J0HA 4MXDA 3WA7A 2RHWA 3WWDA 4EY5A 4CCWA 2YASA 1MO2A 4X3CA 3C87A 2VF2A 2ACEA 4E11A 3VVLA 2WHPA 1UOOA 1CUHA 3DJYA 3WKAA 2C4HA 4C6HA 3I2FA 1QIJA 4DGQA 3EF3A 3I6MA 4Y2TA 4QLOA 2VTVA 1LZLA 1VLQA 3BE8A 3DS8A 3IBTA 3GROA 4PV7A 2XMDA 1XQYA 3C5VA 1QO7A 1XKTA 1XZFA 4FLEA 4X97A 1Y7HA 3ZWQA 2I03A 2CJPA 2CB9A 4DMKA 1EK2A 3I2HA 2B4KA 1Q0RA 1H2YA 1XRQA 3C6ZA 3EQ7A 1CQWA 3HYSA 1EDDA 4U2FA 1NU6A 3HRHA 1EXWA 2Z8ZA 3R3ZA 1IUOA 5AP9A 2XT0A 1Y7IA 2XUFA 1B41A 3G0CA 3E1GA 1VE7A 1DINA 1MAHA 4MEAA 3EBLA 2GBFA 3G02A 1MT3A 1CUGA 1EDBA 5DLPA 4AN1A 4UPDA 2VA9A 5ALEA 4FBMA 1UK6A 3HC7A 4QA9A 3IIIA 5KWIA 3M83A 1ODTC 5E2IA 4LXHA 4BP8A 3D2BA 2AJBA 4KE8A 4MWSA 2HA0A 4PSDA 1P0QA 4AO6A 3KSRA 1MN6A 1ZJ4A 2BUAA 1R50A 1ZD2P 4CIBA 3PE6A 1CV2A 2HU7A 3A70A 2VQ6A 4G4IA 4BC1A 2ZJ6A 4LXGA 1ZICA 1SCQA 5A71A 2ZYRA 1CRLA 5BWBA 2GBGA 5FKJA 2FJPA 1MNQA 1GPNA 2WJ3A 2WTNA 1R3DA 2BUCA 2OPHA 4NVRA 5E4YA 1UOPA 2X76A 2GYVA 1R1DA 3I2JA 5DNVA 4FHZA 1G42A 4X6UA 3M3DA 3W9UA 5AKYA 4GDMA 1YA8A 4BRZA 5FLKA 2O2IA 4BTVA 4Q34A 2QOEA 1H22A 1XLWA 2WKWA 4KACA 3NWOA 3H04A 2WU4A 1WCYA 4DNPA 1EK1A 1AX9A 4UUQA 3STUA 5HF8A 1YAHA 3QMMA 2AXEA 3H2HA 5C7YA 4OB7A 5DTIA 5KREA 4FMPA 2EEPA 4X94A 4HXFB 3L1IA 4IH1A 1SOMA 5EHZA 3DYIA 1GQRA 4X91A 3KDAA 5CRIA 3PUIA 3STWA 4XVCA 1YSCA 1DQYA 2DFPA 1Q84A 3W06A 3K9BA 1WHSA 5AM0A 3H2IA 4KRYA 2WFLB 5SYNA 1R9NA 1TAHA 3JW8A 5ALDA 2WFLA 1N5MA 2XE4A 4YK7A 4KEAA 2XUIA 3FOBA 1AUOA 4JEIA 5AO9A 2QT9A 2QZPA 4HXEB 4UBNA 5IVDA 3WKEA 5ALGA 2LIPA 2JGFA 3QPDA 3CXUA 4Q05A 5A2GA 2WIKA 2GBIA 5FPPA 2PPLA 4U2GA 5EI5A 1LPMA 4OYLA 5HK8A 1K63A 4FTWA 4B84A 1CIJA 3HACA 5ALHA 5SYMA 4C87A 3G0BA 4WY8A 2WIDA 2ZJFA 3D7RA 1DU4A 3H18A 2QJRA 2WG1A 3VDXA 3X3HA 2HIHA 2XQKA 3R40A 5DNWA 3WWPA 3B12A 4YX9A 4HXGA 4EUSA 5EIEA 5JIBA 1TK3A 3QZUA 3FLAA 4G8CA 1KU6A 5H3HA 1ZIXA 3GELA 1CUFA 2PL5A 1WB5A 2XUHA 3DL4A 1TCAA 1CUJA 3V9AA 3OG9A 5D3KA 4BYMA 1JMYA 5ALNA 3TJMA 4B0OA 5ALQA 4YASA 5AKIA 5D6OA 1W1IA 4ZRDA 1T4MA 2CBGA 3H17A 5CH3A 4AB1A 5JZ9A 2ZSHA 4J0JA 4CG3A 1BU8A 3WL5A 1FFDA 1UK7A 5AM2A 1ZD5A 3F97A 5AM3A 3F96A 5FXMA 3ZLUA 5AOCA 3R41A 1CUYA 3IUJA 4UBIA 5LZ9A 1YB6A 3WIBA 5IVIA 2VEOA 3MGAA 3SK0A 3WI7A 1G66A 2OXEA 3DKKA 1HLGA 3WWEA 4L3WA 1U65A 4AX4A 4RPCA 3DQZA 4UHDA 3QBJA 4KE9A 4CCYA 2DQZA 1W4LA 1VKHA 3DYVA 3W04A 4UHCA 4OB6A 1XROA 2BFNA 2QS9A 3E4DA 4UBKA 3AZQA 3FSGD 1CUWA 4K2AA 3O4IA 2XDWA 1GQSA 3D59A 3KWFA 1B6GA 1JJIA 4Y2XA 4BCBA 3FBWA 2WUFA 4BVJA 4L72A 5DYTA 4J7AA 1IMJA 2C7BA 5AKJA 1ACJA 4F60A 5K3AA 2VJBA 5LIPA 4J3JA 5C8VA 1X70A 4B80A 1QIMA 2WTMA 2VJDA 3VKFA 1GKKA 5EHXA 3W05A 3PF9A 3PFCA 4N5IX 4QDOA 4H7KA 1CVLA 1CUSA 1PV1A 2VT6A 2HA3A 2ZYHA 4AO8A 4K6KA 2D5LA 3H2GA 1MJ5A 3PF8A 2OGZA 5CT5A 3TGLA 3R0VA 2JGIA 4Y7DA 1DT3A 1LPPA 5AKEA 3I1IA 2PU5A 4KAFA 2RAUA 4XJVA 3R3YA 2WFZA 4GLBA 3OTQA 5K3EA 1Q83A 2V98A 2BJHA 4BCCA 3D3NA 3V1LA 5CBKA 2E3JA 2Y2VA 3BIWA 2QTBA 4P93A 2QUAA 1GPLA 4H35A 5IH7A 3O4GA 4Y2JA 3VISA 3F8SA 4X6XA 3LLCA 4A16A 1DQZA 1ZI8A 3F98A 3G0DA 2BAGA 5IVHA 3I1YA 3B3QA 2YXPX 4GECA 4HRYA 2JGLA 4ETWA 1VZ2A 2DHCA 5AI9A 1XRNA 3GUUA 5F4ZA 5CT8A 5HF6A 2DHDA 1MX5A 1XRLA 2HA5A 5DYWA 3DOIA 2RONA 4BVKA 4LHEA 4X00A 5JZBA 2HU5A 5LKAA 3P2MA 2XUDA 1IZ7A 3WMRA 2CEKA 1TIBA 1L7RA 4J0KA 1AMNA 3O9VA 5JARA 4U2CA 5LP1A 2I78A 4HAIA 4C4YA 4WDRA 2PBLA 1LPSA 4UHBA 3CCBA 2OQIA 2WLSA 4G4JA 2ONCA 3HXKA 2XUAA 4UBLA 3PUHA 4OD0A 5ALMA 4EY8A 4TVKA 4KR0A 5C8XA 1E3QA 3BF7A 5AI8A 5AKHA 2DQYA 2R8BA 2W6CX 2JBWA 2XI4A 2HL6A 4C01A 4ZREA 1Y37A 4OUKX 1U4NA 3HI4A 1GZ7A 2JGMA 2OQVA 1XFDA 4F21A 2K2QB 3NOXA 4X90A 1LZKA 2WUDA 1VXOA 3H1BA 5AK5A 2O2GA 4U2BA 1W6RA 1QLWA 4BE9A 2PUJA 4Z49A 2IITA 2D0DA 4WJLA 2WG2A 3Q0TA 5AKZA 1QTIA 4DSAA 3O4HA 3IB3A 3VJMA 4EY6A 4CG2A 2G63A 5I9IA 1D07A 2WUGA 5T4FA 4KAAA 4X95A 2XB6A 3WK5A 5BV7A 5HFAA 1TCCA 3OM8A 1I6WA 4BDTA 2AJ8A 1QFSA 4QLAA 3VXKA 3BIXA 1O6FA 1QOZA 4P08A 3STTA 1FJ2A 3W9BA 4J0IA 3MUNA 1E8DA 4UFOA 3OURA 1JU3A 5JASA 1JFRA 2WHQA 2ZYIA 1ZOIA 2RIPA 1QIKA 1XZDA 4KRXA 4EY7A 3WK6A 2JGKA 5ALYA 4V2IA 3FYUC 5AKXA 2PSHA 5JD4A 3QMVA 3ESAA 5CMLA 3H19A 3GZJA 3BXPA 4UBJA 5HFNA 2PVSA 2XQFA 4KE6A 5AI5A 4BATA 4M0FA 5BWCA 4CCYB 4RE5A 3GA7A 3ZI7A 4KYVA 2H7CA 3CCCA 2RHTA 4M0EA 3BWXA 5EIHA 4PSCA 1CQZA 4AZ3A 4Y2RA 4GW3A 4RGYA 3C43A 1VE6A 3WL6A 5IKXA 1P0IA 1J07A 1LPNA 3IUQA 4WY5A 5AICA 4M0MA 5LYYA 1T2NA 3AUKA 1K4YA 2OLEA 2O2HA 3EIOA 4WCVA 4TPKA 1QE3A 3FVTA 2OCKA 1CUCA 2O7RA 2OCGA 4B85A 3A2MA 3KXPA 1CUXA 4K6HA 3QMWA 2BGRA 5FP0A 3STYA 5ALTA 5EGNA 1WHTA 5AKLA 1LGYA 3U1TA 2WJ4A 4GI1A 4G5XA 1ZD4A 2QMQA 2WIGA 1Q0ZA 2PUHA 2RGUA 1AZWA 3C8DA 3M81A 4BP9A 1SCIA 1EX9A 3E0XA 2PSDA 1HDEA 3LIIA 5CH8A 3ED1A 4X85A 2C58A 1XZKA 3DD5A 4G1FA 5D7BA 5AI4A 3WK8A 3I2GA 1S8OA 2BUBA 2C5GA 4C88A 1F0NA 3G9ZA 4HS9A 3ESCA 4QZVA 2ECFA 4BAUA 4BZZA 4Q1VA 1LLFA 4PF1A 3IUNA 4DIUA 4XX1A 5JZSA 1QIDA 4FLFA 1U2EA 3G9TA 1ODCA 2WG0A 4MQMA 2AJLI 1EINA 4Y2SA 1JU4A 3UUFA 1XLVA 3AINA 2PSFA 3IA2A 2Y1KA 1XZHA 3C45A 1XRRA 1AURA 3M82A 4C4ZA 5ALZA 2DSNA 4DMFA 4JNCA 1QO9A 1QJ4A 4LXIA 1J06A 3RM3A 2PSJA 1G4HA 1YS2X 1UKCA 3GBSA 3WK4A 5JAPA 2OAEA 3I6YA 3QPAA 4N8DA 4N8SA 2FJ0A 4N5HX 2X5XA 5CH5A 3G9XA 1WPXA 1CFJA 1CR6A 2Z3WA 4UFNA 4KE7A 5C8ZA 2HFKA 1WM1A 1M33A 2WU3A 4ROTA 3FCXA 4QEKA 4DLNA 4B0PA 1CLEA 2ROQA 4H7IA 1JKMA 4DNFA 4B9AA 1KU0A 4FLMA 1IUNA 3V1KA 1H23A 4EB0A 4NS4A 4WFJA 2YYSA 5HZGA 3O4JA 3WYDA 4GXNA 1E89A 3B5EA 2HA4A 3PFBA 4XWGA 3G9UA 5T4EA 3RLIA 5A62A 3SC2A 5CXUA 1EB9A 2I3DA 3VJLA 3H2KA 2VJCA 3FSGA 1C7JA 1UXOA 4C89A 4BDSA 1UZAA 4JUIA 5CW2A 1XQXA 2OGSA 1SFRA 2PX6A 4A23A 2XQGA 3VVMA 3QYJA 4Q3OA 2G4LA 1YS1X 4ZGBA 2XQIA 1MNAA 2XMZA 4OU4A 1BE0A 2XUGA 1FFCA 5AM1A 5EHQA 1CUEA 3DL7A 4QWMA 2WFMA 5JAOA 3AIOA 5JADA 4AO7A 4BC0A 5LKRA 1O6GA 4B9EA 1SC9A 2Z5GA 4FWBA 2I3ZA 4KJXA 4IH4A 1QIIA 4QWWA 1EB8A 3O0DA 5ALOA 4QE3A 4X71A 5LLSA 4NMWA 2VAVA 5AIAA 1CUZA 5AK6A 4BVLA 1ORWA 1ZJ5A 4H7EA 1DWOA 1TRHA 4J0CA 2Y6VA 2VAXA 3L1JA 2HA6A 2R11A 4DNOA 4OYYA 3AIMA 4Y2UA 2DHEA 3WK9A 4ARBA 2DR0A 1CUAA 2XMQA 4PQEA 3AILA 1BCSA 2QKYA 3DEAA 2QM0A 1G5FA 1UKAA 2YH2A 1THTA 3R3WA 4HTAA 5YASA 2EDAA 3DOHA 2WHRA 2BKLA 4DSZA 2XMCA 3PDCA 4K5QA 2Z3ZA 3WKDA 1IVYA 3AZOA 1YASA 4JYPA 2OAGA 1XQWA 3UMJA 3A2NA 1HBJA 2BGNA 1HPLA 4CI9A 2WUEA 1JJFA 3LS2A 4UBOA 2HRQA 4W1SA 1E8MA 4MJ3A 1E8NA 1TKRA 4G4GA 4IQ4A 3MVEA 1A8QA 3H2JA 2ACKA 2VJAA 5AK4A 2QXTA 3WWOA 2XMGA 4BCDA 4MWTA 1A88A 3BDIA 1J2EA 5JATA 3QM1A 2WHPB 3K2IA 5AH0A 4H7FA 3WK7A 1BROA 3DCNA 5HKAA 1ETHA 5FV4A 1GKLA 5AI0A 1N1MA 2OCIA 5CT4A 2JGJA 3WQHA 1BN6A 1MX1A 3HZOA 1XZEA 4UBMA 1QFMA 1VOTA 3ICVA 2XUKA 1USWA 1MTZA 4W1PA 3FNBA 4JYMA 5LZ5A 5A7FA 4Q3KA 2WJ6A 5HQ3A 3W2TA 2P8SA 1A8SA 4UHHA 3N0TA 3FCYA 3H1AA 4E46A 2GYUA 3AJAA 4J0GA 2XUJA 3V1MA 1EVEA 4GEGA 1YAJA 3D0KA 1BEZA 3DDUA 5LZ2A 5CT9A 3G0IA 4AMYA 2WQZA 2HHAA 2AJCA 2VATA 3WZLA 1JJBA 1AQLA 1VXRA 1XRMA 2QRUA 2HA2A 2WSLA 4EBBA 5CURA 4MYDA 4E15A 4LKOA 2Y2UA 5JALA 4MQLA 3C5WP 4BZWA 1YA4A 1W76A 1YR2A 2OCLA 5BOVA 4EHBA 4BAZA 5ALRA 2VSQA 5AK3A 2QR5A 3T4UA 4LIPD 4AQDA 2C5FA 4U2EA 1QIGA 1QIEA 5DTJA 1WB4A 3A6ZA 5C81A 3IURA 1P0PA 1K5PA 5HF5A 2PSEA 4CIAA 4W63A 1R9MA 3R3VA 5AIBA 5K3BA 4X92A 2G5PA 2XUPA 1H2ZA 4H77A 2CZQA 4GBGA 4BB0A 1PJAA 5AI6A 4DYHA 2ZVDA 3I6ZA 4GHWA 4I4CA 4ZV9A 5HKBA 3O95A 4OB8A 2PKYX 4DM7A 1L7AA 4DMCA 5AJHA 1LPAB 1EHYA 3D4LA 3JYHA 1EA5A 1X2BA 3WWCA 4E14A 4N8EA 4PW0A 1WPRA 3OOSA 1ZI9A 1NX9A 3BDVA 4G8BA 1UKBA 4FKBA 3QITA 4WFKA 4H18A 5HK9A 1IUPA 3FYUA 4J03A 4Y9SA 3R3XA 5AM4A 2JIDA 3U0VA 1LPOA 2ORYA 3C8HA 4DNQA 4X93A 5FRDA 5HCUA 3TEJA 3FWHA 4FOLA 2OGTA 4FFVA 4O08A 1LPBB 2JF0A 3PI6A 3PICA 1CPYA 2X8BA 5IVKA 3BJRA 2CKMA 1L7QA 4INZA 4L9AA 5ESRA 1XZCA 3WL7A 3S8YA 1AKNA 2UZ0A 4XIIA 3L1HA 5J3JA 1R88A 3ANTA 4IH9A 1W52X 1UK9A 4Y2PA 1GGVA 1JI3A 2G5TA 2NW6A 3STXA 1WOMA 1F8UA 3R3UA 2VT7A 1VA5A 3C6BA 5HQ3B 3RK4A 1ODSA 2B9VA 1HKHA 5LZ7A 5ALFA 2XMBA 4H0CA 4FFWA 1GXSA 5JAUA 4GWLA 1H2XA 1FFEA 2EDCA 3IVMA 4B7ZA 1DT5A 3WKCA 3HJUA 5ALVA 1KEZA 2FUKA 1N5RA 5ALSA 2HFJA 2JEYA 4W9RA 1JMKC 1NU8A 3TRDA 2J4FA 3OC0A 2DCMA 4QDTA 4QDXA 2XMRA 5CT6A 5EHNA 3I2KA 4F0JA 1YB7A 3D2CA 1LBSA 3KD2A 4S0XA 3ESDA 3WLAA 4RE6A 2XUQA 5K3FB 1E5TA 1ORVA 5ALIA 4JH0A 4RNCA 3S2ZA 3V1NA 3ZLTA 1XZAA 3HEAA 3F9CA 5LZ8A 5ALWA 5DNUA 4H7HA 1ZI6A 2B20A 4G9GA 6YASA 1F6WA 2XQJA 2OG1A 1RYYA 4DTCA 2JGEA 1LNSA 2WIJA 4OSEA 3SWWA 3E3AA 4AZ0A 2WIFA 4H7DA 4K6GA 3DNMA 4D9JA 4BTLA 3ZV7A 1SCKA 4B82A 1UWCA 1DWPA 1ISPA 1ZGBA 1GPKA 4H7JA 1XRPA 5LZ4A 1XZGA 1QIFA 3IULA 4WFIA 4J0DA 5I8PA 2PU7A 3NUZA 5A6VA 3FYUB 1HL7A 3WIOA 5JD6A 2HADA 4WDQA 1BEEA 3G8YA 1WB6A 3KWJA 3WYNA 2XUOA 4B6GA 1Z68A 1CUVA 1ZGCA 4HZGA 3WJ1A 2FX5A 1JT2A 1XKLA 5K3DA 1CUUA 3AZPA 5AKGA 4BAGA 2GZRA 5EIAA 1EDEA 3OPMA 1BN7A 2CMFA 2O7VA 5D3ZA 4ARAA 4G9EA 1UK8A 1DWQA 4FNGA 2XLCA 4ITVA 1EH5A 1XLUA 2HU8A 2QVBA 1MU0A 4F5ZA 5FDFA 4IHAA 3RKSA 1RWQA 1THGA 2ZJ7A 2ZSIA 4Q82A 3FLEA 3AFIA 5T4HA 2H9YA 4FBLA 2H1IA 4KAJA 1QIHA 7YASA 2WM2A 3ESBA 4MYSA 4Q3LA 1RP1A 2GYWA 3G7NA 1OXMA 1BS9A 4W1RA 1BCRA 4W1QA 4DMHA 5E4TA 1BRTA 1E66A 3CN9A 3LIPA 3Q8WA 4PNZA 1XZIA 1MAAA 1F0PA 4BRSA 1DTEA 4A5SA 3BL8A 4BE4A 4NZZA 4ZI5A 3V48A 4Y2YA 1J1IA 2JEZA 3FAKA 5HF9A 5K5EA 3G0GA 1MX9A 1AGYA 3ZPXA 5AKKA 4X7BA 2PM8A 2HM7A 1DX4A 1QZ3A 5AM5A 3A2LA 3K6KA 1IZ8A 3FLBA 2J3QA 2CUTA 1LBTA 2V96A 1EI9A 3DKRA 3VJKA 1N8SA 2ES4A 3T52A 2IX9A 4HRXA 3EQ9A 2QJWA 4BBZA 5E4JA 3WKBA 1CEXA 1ZD3A 1C7IA 3SX4A 3F67A 5K3CA 1YCDA 3FVRA 1W75A 2AJDA 3FYTA 4I19A 1XZMA 4ZWNA 3C6YA 3C70A 3DLTA 3NGMA 5KWJA 1FFBA 3RARA 4QDZA 5ALPA 3IUMA 1DX6A 3ILSA 3WA6A 1HQDA 1K6EA 2IIVA 3JWEA 5FPQA 1QGED 1A7UA 1VA4A 1R4ZA 4P9NA 2GZSA 3C6XA 3QH4A 5ISMA 5FUMA 4ZV7A 5DYYA 3I2IA 1QONA 3WJ2A 5FOQA 5I7UA 4B83A 5ALUA 2WILA 1QTRA 1ACLA 3EQ8A 3KOOA 1ZIYA 4C4XA 5EFZA 4P92A 1FFAA 4MEBA 1H2WA 3H0CA 1X2EA 1GT6A 4AMZA 3IDAA 4AXBA 2V97A 4TGLA 2V9ZA 4EZIA 4Y2QA 4G8DA 1UT6A 5A7GA 2C0PA 5JANA 5ALLA 2B61A 1PFQA 3MUOA 4YPVA 2HA7A 2BCEA 5DJ5A 2XMSA 3GFFA 2Y6UA 5AOAA 4OPMA 3WL8A 1UOQA 4Y2VA 3HSSA 4B81A 4FDMA 1UFOA 1XQVA 5KBYA 1FSSA 2W22A 2QXUA 1MPXA 5T4BA 4OCZA 5JAHA 4LYEA 4PSUA 5CTAA
chains in the Genus database with same CATH superfamily
3GLSA 5A9TA 2C9CA 2PLAA 4QGSA 3Q8LA 3EXAA 1NG9A 1EBFA 4PAWA 3EXEB 2PLRA 2EQAA 1QBGA 2AOWA 4QYSA 4QXPA 5ADUS 5JDIA 1VCOA 2B1JA 3LCRA 4K9KA 1YB2A 2ZB7A 3H9UA 4ZK2A 4HEQA 1TXGA 5ALJA 1H1DA 1F1JA 2XIJA 5D5HA 5GPBA 1NRXA 3VUEA 1T9GS 1M0WA 2FEMA 3W5HA 4EA6A 3D2AA 2N1BA 5ICCA 4OGKA 1OHHA 1P1HA 2WB4A 3TSZA 2XNDD 4QPJC 4MHTA 3SX0A 3MXOA 1T8UA 2PMFA 1KF0A 1SUSA 4PS0A 3UUEA 3ZDXB 3PVCA 5DN6D 3HKDA 5CDUA 3CIOA 2EHDA 4F2PA 4L0CA 4LF8B 1ANKA 2DBYA 2YV1A 4PO3X 2UZIR 2ZYAA 3F4LA 1OT5A 2YS7A 3NWBA 3CWZA 4NU8X 4QQRA 4RPIA 2PWBA 2DXIA 2JIOA 4BHTA 4FGZA 4N12A 1Z0IA 3B6JA 1T5SA 3URMA 4FQ7A 5ELMA 4CBVA 1H6DA 2XD9A 3HLKA 4QDUA 3QVMA 2OMKA 4YRIA 1K7YA 2C8VA 2JPDA 3GRAA 4II7A 3WZMA 4AZTA 1Z8FA 2I5PO 5IYZF 1JQDA 1W85B 3MB5A 4F6LA 3RWMB 5SYAA 3I28A 3BJEA 2AZDA 2J3DA 4LYDA 2VPWA 3N53A 3AB7A 1M1NB 1UT8A 4PZDA 4TWRA 4PN3A 3OPQA 5B6IA 5KJ1A 4FOOA 1XYVA 1BMTA 4QNNA 4WLNA 3A3YA 3GMSA 3I72A 2M1XA 2VHUA 3ZHCA 2RBKA 5E7IA 1EBBA 1YZYA 3QEAZ 3BJMA 3P19A 5E6UA 4JC5A 2FJUA 2IYAA 2YX1A 1GGJA 1XELA 4YECA 3D3JA 1C3JA 3HL4A 4YO8A 1PJCA 3C4QA 3JQ6A 5B6PA 4MV9A 1VZ3A 3AW8A 4KDRA 5CTJA 3THXB 6GPBA 3NM4A 1A2KC 2CNWD 3WTBA 5BOSA 3ZLVA 3O0TA 1PK8A 1Q2XA 2Y68A 3OAAD 2PH3A 3ITKA 3PUYA 4NNOA 3EUWA 4TYPA 5A7HA 3AVVA 3OQHA 1E0JA 3SHVA 2QN1A 5J1TB 2JBAA 1CUDA 3OIGA 3JVIA 1BRMA 2JIRA 3H4IA 2C96A 2MSLA 3LRPA 1MB2A 3M6AA 3SBDA 3SEAA 1KMNA 4XB2A 1YZ3A 2BFDB 2G71A 1E79D 3NBMA 4KVGA 2OZEA 2MWMA 3PTLA 2VSFA 3TSYA 3NBZC 4X61A 3T3PB 3WA7A 2RHWA 3A04A 2B2CA 3RVKA 2AW3A 3NEAA 5BVGB 1N2IA 1I24A 1K98A 3OKAA 2CVFA 4JJKA 4YRLA 4ZQEA 2VF2A 3I9FA 1F4LA 1MORA 2ZREA 4ZICA 2OQ2A 4E11A 5FPYA 3LBAA 5EE1A 2EIHA 3B82A 1GAWA 1HYQA 3QY9A 3U4AA 3IPAA 2GZHA 2C1XA 3A26A 4RD0A 1OPRA 5KQRA 3H5RA 4D3FA 3O82A 1U1GA 3K2BA 2Y0EA 3DEZA 1MG0A 3FJYA 3IDZA 2O8CB 1KE1A 3HYLA 2BGUA 1ZC3A 1ULAA 3QE0A 1CUHA 4LYAA 3ANNA 2XHZA 1BVRA 4OGWA 4CW7A 1R64A 2P2YA 3C14C 1FSZA 1SU7A 4NAHA 4JJEA 3TW0A 3J81A 4CMCA 3GLIE 3L46A 1JDSA 1F2TA 1SWVA 3WKAA 4QQNA 4YQFA 3BXOA 1XJWA 4PSKA 1Q21A 4LOKA 1DC3A 2J0QA 3JD0A 1X8JA 3I0NA 4IPTA 2B98A 4UCXA 4KWIA 5ENDA 1LZLA 3O3CA 3C24A 3T7SA 4L02A 1JILA 1SKMA 2ZBQA 1E32A 1M83A 1KIFA 1SXIA 1FTNA 2AE1A 4MIKA 4LRSB 3OTHA 2R4TA 3T4EA 4JXXA 2J9FA 4HB3A 4B7CA 1P1BA 4AQ7A 2XA1A 4LECA 4REOA 1VBMA 3HPRA 1XTSA 1MOSA 1AQYA 1CJSA 1EJ2A 3OTWA 2DPMA 1FZTA 1QO7A 5DTQA 2B7LA 2H48A 4EUKA 2B2XA 3ZBQA 2F00A 1Y7HA 1C3XA 2YVLA 2W6MA 3AG5A 4HGPA 4WV3A 4KR3A 2X3UA 1Z38A 1PEDA 2CJPA 1U3WA 4LQCA 4ND8A 4DMKA 1EK2A 2B4KA 1Q0RA 4KDEA 1BAPA 3IAFA 4AWXA 1QVVA 4ALNA 3C6ZA 2IPMA 4LV8B 4YRTA 3WNCA 3TQSA 2NU8B 1FTWA 2QZ9A 1LK5A 2GVDC 4ARCA 1LDBA 2M1ZA 3U31A 3U7HB 4LZPA 1UUFA 2OC9A 2QTMA 1UDXA 1LLUA 4XEHA 1YRBA 3LA8A 2PA3A 1YT5A 2VHCA 4KXFB 4OP1A 5INTA 1FLVA 4PG6A 5ESWA 1IUOA 1HL3A 2GD0A 3NUGA 1OYVA 2D2FA 4L73A 4US0R 2DHRA 3L06A 2R1TB 1Y80A 2DUJA 2I3GA 1Y7IA 2REOA 3O8RA 3THWB 1ESZA 2OILA 3AG6A 1B41A 4URUR 1L7EA 2H3EA 3E1GA 3KVRA 2MSCB 3MWLA 1DINA 4GR5A 5EJ2A 3LC7O 4P80A 3RJMA 4C7KA 3W5BA 4GX2A 4N0PA 1U3FA 2FWAA 4EGCB 2ODNA 4JNKA 2UUOA 3NS7A 4LY6A 3CEPB 4NH0A 4KJZA 1YS7A 3QPBA 5AYVA 3GNTA 1TC2A 3CPSA 1MT3A 5EXTA 1RE1A 1QGOA 1CUGA 1O9GA 4NU6A 3JAKB 2V59A 2A3RA 4RIHA 1GRRA 1TAGA 3PIDA 4UPDA 3F3KA 2R00C 2VA9A 4MHSA 1D0VA 1QAOA 4QREA 3HRIA 1HLFA 4OHXA 5ALEA 3CH7A 4FYJA 1XMVA 1A72A 4FBMA 4MS4B 2WY2D 3D1JA 1AU9A 3IDSA 4EG7A 1T10A 3L79A 5AVYA 4PO1A 3GMTA 1H1TA 1UK6A 1XCGB 1NYLA 3K6RA 3BOSA 1AKYA 4W4TA 2REXB 2OOKA 1KFEB 1PWZA 2P5SA 4H2DA 3OZIA 2AC7A 2CV0A 5B1YA 5BVHA 1QYXA 1U0GA 2DU8A 3JALB 5UKDA 5FQNA 4UAVA 4MW0A 1CRZA 3IIIA 4XB1A 1WMEA 1YDEA 2L17A 4NESA 2FSUA 5E2IA 2IZ1A 4HY3A 3RWOA 4BP8A 1HT3A 3G89A 5EQDA 2H31A 5FNVB 3ZU6A 4RSMA 2HA0A 3KEMA 4D82A 5HJEA 1ORRA 1W29A 4US2R 1EHIA 2YOHA 4ACBA 5JG7A 4YJFB 2O1SA 4MR9B 2CDAA 3KSRA 4ROSA 1SVOA 2B3TA 4MROA 1ZJ4A 2IP4A 1VMKA 4IDNA 3U19A 5DWVA 1AM4D 1KPGA 1QE0A 2Z2XA 4P0QB 3ZHZA 4OJKA 2F1OA 4FHCA 4QJ3A 3S2EA 5H16A 4OHUA 3W5IA 4Z7JA 1FW6A 3QEMA 4I9UA 3LT5A 3RIMA 5A4JA 4JGGA 3I3OA 4YJGA 1ML4A 3KUXA 4BC1A 3R0JA 2ZJ6A 3WGOA 4EENA 3I1JA 2D1SA 5K1ZA 1IVNA 3W8NA 1ZM7A 8LDHA 1HDXA 3KELA 3U7FB 1SUIA 3GZNB 2WYOA 3USES 1QPGA 3ZCTA 3M6UA 3DV9A 3Q41A 4E2YA 5L4LA 2GLTA 2ZYRA 1FOEB 2XY4A 1NM5A 5BORA 4MKFA 1CYEA 1ABFA 2HRBA 3ISJA 2ZBDA 1KP3A 1UM8A 1MNQA 3WLOA 4A82A 4DABA 4Y18A 4DRZA 3LVRE 1RHJA 1PJTA 4EI2A 3GPIA 1XHEA 2Q49A 1QH8B 5EZQA 3JCZA 4MUHA 3EXG2 2OPHA 1OZAA 4FM9A 3HKCB 1ZCAA 4ZCQA 2FVXA 4HAZA 2G4CA 2KE5A 1YDHA 4XD7A 2BZSA 2IHKA 1UOPA 2QL5A 4DBZA 2X76A 1RW4A 2O2EA 1HMYA 2GYVA 2CC2A 3DTVB 5CVEA 1QKIA 3ACCA 1QR2A 2I4LA 3VOAA 4JQYA 5DNVA 3PNQA 4EMTA 3SJBA 1RXVA 2LD4A 4YNBA 1U2PA 4FHZA 3UW1A 4POAA 2JD1A 4X6UA 2KSQA 3PXXA 2G7ZA 3QG5A 4RQTA 1BW9A 4GDMA 3UF0A 2Q07A 3W9UA 5DM60 1F4VA 1ORHA 2O2IA 4BTVA 4KX5A 4Q34A 4XQGA 1FL9A 1BHQ1 5BSEA 1N5DA 4Q02A 2QOEA 3SAJA 4AF8A 2YOGA 1U63A 1XRJA 2HCTA 5EINA 4TUYA 1N2OA 1IQPA 3MXTA 3EGDB 1CRQA 4LXQA 4MV7A 2WKWA 3RVSA 1GZVA 4K88A 1PV4A 2NGRA 2PLFA 1G16A 1CLUA 4M55A 4CKZA 1FTQA 3BCSA 2AWNA 1QCDA 3MMSA 3CLUD 4XGRA 2Q99A 3TGWA 4OGLA 1JVSA 3CNHA 3HADA 5CNJA 2NVOA 5B36A 1Q77A 1P60A 4DQXA 1IYZA 4TTPA 4QYIB 5LA6B 1EK1A 3QBTA 4C07A 1LA2A 2IYVA 4UUQA 3AP2A 1JLMA 3TQOA 2E87A 5JSHA 2GKSA 4WA7A 1OH8A 3QMMA 5BMVF 1SXJB 2J3EA 3OUUA 3UN1A 1YJ8A 3S55A 1EYZA 2H2GA 4I50F 4ML3A 5KREA 3JWGA 1N7HA 3AFMA 4FMPA 1PG2A 1P19A 2XB8A 3HYCA 4CT4B 4Z4QA 2VZEA 3OZCA 3UMMA 1R18A 3EDOA 1IAQA 3AEYA 1X1SA 3QOWA 3L1IA 3UYKA 4AY6A 3ER8A 1L5SA 4WBNA 2ZKIA 5KTKA 4YRCA 1CJTC 2AOUA 3PWSA 1YB1A 5EHZA 3CVUA 1NR7A 3GCXA 4XJTA 2GCOA 4F1KA 5IYZB 1A5TA 5CRIA 4FT2A 1B2RA 5DEIA 3ISVA 1CZUA 1JHDA 5C51B 2GS9A 2Q5EA 5LXTA 4MDYA 1RXSA 5FAKA 3SF0A 3JX9A 4PWZA 4CDGA 1TLTA 1W6UA 2JC3A 1KVQA 2PKQP 3GFRA 1OYYA 1QYRA 2REBA 4PBRA 4TT8A 3ZWCA 3UK6A 3GUHA 2PQ6A 4DLZA 2F8MA 1DQYA 1D2AA 2VHWA 3BTVA 3K9BA 4CQLA 3H2IA 2C29D 2CF5A 2JRCA 4MWOA 4I1OA 4J6FA 5IEJA 3Q10A 3MD0A 1TAHA 1I36A 2R84A 2R8EA 3KUKA 2W6ID 4MAMA 4R8SA 3GJZA 3OIWA 5EKDA 3L8FA 4PO8A 3VSBA 4OXXA 4BQOA 5A1JA 4MGHA 3THRA 1NMZA 4PVDA 1L4HA 2C9MA 3HO6A 2BW0A 2BLLA 5JHGB 1O58A 1VDZA 2JFHA 2JAPA 2EZUA 4B48A 1UKVY 5E7MA 1P3Y1 1NNI1 3CZQA 4OQNA 3TRFA 5AO9A 2G0NA 1UIRA 4HXEB 3EY4A 4R4JA 3KPVA 5LQKA 1AUPA 2JA1A 1BQ3A 5I7WA 1T9ZA 1GY8A 4RD1A 1MIHA 3QPDA 3WLEA 5HIAA 2XZTA 3NHKA 2UVPA 1ODLA 1DC8A 3HY4A 2WA2A 3R6GA 5DH9A 5A2GA 2ZRIA 4PZZA 5FPPA 3B51X 3ZE2B 4TYNA 4KZPA 4U2GA 2PUGA 3L05A 2ZXUA 3CO5A 1P80A 3NBYC 4BPRA 1LPMA 1UKEA 3AV0B 3DLAA 4M0DA 3ZGLA 4OYLA 3NBKA 3ZK7A 5I7FA 1TPYA 4NYMR 3JQFA 1NV8A 3ELUA 3HACA 3EC7A 3WAKA 5KNLA 2NXEA 1UAAA 3QVVA 2BEUA 1T6BY 3BB1A 2ZJFA 3MJHA 3PGXA 1BH2A 2X9GA 3CR3C 3TNYA 1YNSA 2E82A 4CTMA 4PLVA 3C5CA 1KP2A 1ZVVA 2QJRA 2IHVA 3U3MA 1N8NA 2ISQA 2K7ZA 2ECKA 4I8XA 4RETA 1KZHA 2OBBA 1AZLA 1P18A 3ZHOA 4ZV4A 2FDRA 4S1VA 3H9GA 4LXYA 4ZD6A 4UTRA 1DWUA 5M04A 1M67A 3EGDA 4MDEA 2GM9A 2G9ZA 3OT1B 4LE1A 2ZS7A 2IA5A 4XDZA 5ERYA 2R6ZA 1Q1NA 2ZCVA 3IDFA 4PGAA 4WJZA 1Q7RA 4HXGA 5KUTA 1P9WA 4QLBA 5E9QA 4LWQA 4FU0A 5JIBA 3FETA 2VBFA 4PZLA 1PO7A 2ZWPA 3PYLA 3W6PA 1DB3A 4G4SO 3TQFA 3HYNA 1Q0HA 1R6DA 2UYQA 1E1QA 3Q98A 5CB4B 5H3HA 4YXFA 4M9CA 2GAIA 3GELA 2NTEA 2ZPUA 1IY1A 2PL5A 2E18A 1V1MA 1AXEA 2P90A 2XUHA 1KEWA 5LQSA 3DL4A 4TMVA 4C03A 3OJEA 1XE3A 3UPTA 5EPUA 2EQ5A 1NKTA 1KO8A 3OG9A 1DVRA 4HQLA 4JWKA 3DWIA 4OJQA 5CCDA 5DLEA 3CKYA 3NPAA 5F1YA 4D74A 4HNTA 2AVDA 4M8NE 2DECA 2JAWA 4NZPA 2FETA 3VNVA 1QHHB 4ZC1A 5ALNA 3TJMA 2HSJA 3K0EA 4B0OA 1KVUA 4HUJA 1HV8A 5CYOA 2IU0A 4QFMA 5GQSA 3RGWS 4G0YA 3T7DA 5L95A 4TKMA 3L6DA 5LUAA 3E81A 3RAEC 2A0KA 1QYVA 4PXSA 3WIEA 2GAJA 2BDUA 4ZRDA 2AX3A 1JDTA 5CH3A 5JZ9A 2CL6X 4DCUA 1I1OA 1JV2B 5D87A 4L95C 3FMIA 4YAWA 1BQ4A 3AR7A 3CIFA 4TS9A 3WL5A 1FFDA 1UK7A 3JVDA 4GGOA 1K5HA 3NHSA 5KDLA 3MMXA 3O47A 3WLQA 1LWOA 1O5IA 1XA4A 2PHZA 4JK3A 5DE3A 1LV7A 3VBEA 4J0EA 3A4MA 5NLLA 3R41A 5JJIA 4KV7A 3PNBA 3HSYA 3KQSA 3T5BA 2XVAA 3DFKA 4TTIA 3A11A 4CJXA 4N0MA 1SURA 4WI1A 4XQEA 3VR6D 5ITWA 2V0GA 3PJDA 2HO5A 2HNBA 4DTIA 2QIPA 3H5TA 4B3CA 2IHJA 4EKYA 3ZY3A 3OZWA 4IOLA 4HB0A 4BO2A 2FLWA 2A8YA 1GPH1 1PVVA 5IBCA 3WIBA 4KMSA 1T9DA 4AI6A 2P9FA 1Z4QA 3VR2A 1AUQA 1U7DA 5A9RA 3FFXA 4MWZA 2BYTA 3DKKA 1OAKA 1M1ZA 2GLUA 1DPGA 4NK5A 4I4IA 1DRUA 1TM5E 1B3RA 2G82A 4K46A 4L3WA 4RD3A 4BGEA 3GLHA 5IDQA 4WHMA 3C6QA 5BVHB 1TM7E 1KRHA 3P32A 5K2OA 1E1CA 3SOZA 4BJ3A 1NLMA 5A1TA 2IXDA 5L3RA 3H9BA 4Y2GA 1QMGA 3HY3A 1L1EA 3CRNA 3KJGA 4X1KA 3DV2A 1AHIA 5DBIA 1GM5A 4JVSB 2GSDA 2GEBA 1C3LA 1C7RA 1FYVA 3EN0A 1N2CA 1W4LA 3IVRA 3PNVA 3BD9A 4PYJA 3QNMA 3VNAA 3DZKA 5JAHA 3DFZA 3TUZC 3D4PA 3K9QO 3MMNA 3ORYA 4OB6A 1XROA 2BFNA 3E4DA 3AJRA 3DV0B 4EPVA 2XGGA 3QFCA 1KORA 3GJ5A 2R751 1XCBA 3H3XA 2LCFA 2P75A 3B1WA 2BC9A 1ZRSA 1CUWA 3HE3A 4K2AA 4RVGA 1ODFA 1KYWA 3O4IA 1FRFS 5CJJA 4EPWA 5CA1A 2N9UA 3I9KA 1Z0ZA 3Q1KA 3TLYA 3DE6X 5EJAA 1U5CA 4BUCA 2VHJA 4B33A 7AT1A 1Q92A 4C6RA 3SQXA 3WGYA 3RYHA 3TPZA 4WQMA 1H2RS 3WVNA 4ASUA 1RMTA 4BVJA 4ZYLA 1DAGA 4K9NA 1RTKA 3EMBA 3FGOA 4DLAA 4MPRA 3FPBA 3EVFA 1XL0A 1DO0A 4OIMA 4UVDA 1NQWA 1PLLA 1ZGAA 4I81A 1IXRC 5G40A 3HO1A 2X15A 4BNGA 1J23A 3DE7X 4GOND 4HDMB 4J3JA 4UOQA 1XV5A 3TK1A 3COWA 5C8VA 3R6DA 5CM2Z 5I6DA 2W00A 1O96B 2D2EA 2Y1WA 3DUWA 3TM5A 3UT5A 3WNQA 4A0FA 1AS3A 3IPCA 5B30A 5L3VA 4G37A 1DBQA 1S89A 4U63A 4NBNA 1FJHA 1GKKA 3V2UA 2IIPA 5ED4A 3AL3A 3OOWA 1J0EA 1OVGA 1RYHA 1YU6A 3GAAA 4J43A 1MCZA 1PD1A 1D09A 4ODIA 3M3PA 3WP1B 4R54A 2A5FA 3K1JA 4TL9A 3TAUA 4AG3A 3S7TA 1N75A 1C3EA 1EEXB 1OLXB 1EWRA 1XCLA 1GT91 3S81A 2A9KA 5CGQB 1MB3A 4FFMA 3A28A 3U4GA 4F72A 4XIYA 4N5IX 3DAGA 2DR3A 1UMDA 1UINA 1KAMA 5DCUA 4MW5A 3EX7C 5FUYA 2NUTA 1NAIA 4XZ3A 2E4YA 5KKAA 2FGJA 4D44A 1K8XB 1CUSA 4WCFB 1SIUA 1N2JA 5FUXA 2BFBB 1IM8A 1RDFA 2B8NA 3GNLA 2OD7A 3PI7A 4JC0A 3KVYA 1H8EA 2VT6A 4QXRA 4XOUA 4PX3A 3DSRA 4JC8A 1ZLYA 4IDGA 4K6KA 2AYYA 3GO4A 5JT1A 1IHOA 4UASA 2HV8A 1AO3A 3LA6A 3U7QB 1THMA 3CF4A 2CHFA 2W4IA 2XVYA 1MJ5A 3DO5A 5F5NA 5ILQA 5CYGA 1E20A 4C0WA 1VM6A 1JYEA 1OAOA 3BGOS 3DOOA 3GDHA 4RLHA 5KYKA 2OKCA 1U2DC 2WKQA 2FA9A 4FJ0A 1NW5A 1GYQA 1XT6A 1GAJA 5DV9A 2WF6A 3IAXA 3PQ6A 2ZAOA 3NVMB 5D3MB 3CNBA 2JGIA 2QLFA 2BGIA 4JFAA 4E03A 1LPPA 3EIUA 4MQ5A 5KQPA 1E63A 2G6TA 4J75A 4YJKA 4DV4B 4L7VA 1GU1A 1G2IA 4EH1A 1SUEA 4RZQA 1I7QB 3N59A 1UWKA 4CNQA 4FXOA 2XCRB 4GWGA 1JQJC 1GITA 4KOAA 2YMLA 3UIEA 1NBEA 1P2TA 1X7YB 3HL0A 4ZI7F 2YR0A 3MQ2A 3JQEA 5K3EA 3OQMA 4ARZA 1Q83A 2V98A 1E2QA 1O8BA 4M89A 4LDAA 3MSCA 3HP1A 5DNAA 3RLIA 2ERXA 1I0ZA 2J09A 5EJ7A 3E9QA 1O9BA 2I8AA 1V3TA 2WD8A 2QUAA 4GYJA 2Y67A 1DAFA 4H35A 4JKOA 4V03A 2XT9A 3MWEB 2BFMA 3VISA 3X43A 2FW0A 2PIAA 3DGEC 4TRMA 3W1EA 4UE3S 1QHXA 4GSLA 2XVZA 5DYIA 1O6ZA 4QFBA 3W6UA 1OI7A 4C1BA 1N4DA 2RG7A 5TEVA 3NR2A 2X22A 1UBGA 3SIWA 4I5IA 3UJBA 4ZVRA 3HMQA 1TAUA 4ESEA 2BBWA 1M7GA 3CNQS 5THQA 3LVFO 4Z2AA 3ADKA 4DLVA 3LCCA 4LG1A 3G0DA 2BAGA 1M0TA 3I1YA 3ODPA 4YJHB 1MW9X 4Z9YA 4HRYA 1HOXA 2A1TS 3FZQA 3T9AA 1WIWA 2CLSA 4GPEA 4OJMX 2BR4A 4BFXA 3P4XA 5BV1A 5LMCA 1X15A 2VJPA 3MPOA 2W58A 3P7MA 3R4CA 3I32A 4P7KA 3W6ZA 4X8LA 4C04A 4XRGA 4GKJB 3C7TA 2DHCA 3NTVA 1XRNA 5IJAA 3VTKA 1GUYA 2V4MA 2JCYA 5F4ZA 4B4OA 5G4LA 4GZ5A 4BVAA 1M1YA 4ZOLA 1XRLA 5FO1A 2REQB 3U2QA 4DCGA 2YZMA 2ZPTX 5DYWA 1I4DD 4EVRA 5L7WA 2ADFA 4MPTA 1TEVA 1CD5A 3QYFA 4IDAA 3C15C 2DULA 4JX9A 4BO0A 1KEVA 3D6TB 4X00A 1Z07A 5A2QA 2HU5A 3P2MA 1DQNA 2JLBA 2XWQA 1YZHA 3QFRA 4LVOA 1IZ7A 1GA1A 3MD9A 1IBKB 4UD2A 1WW8A 1X1CA 1ZOPA 2CEKA 4HVCA 2ZRFA 3SQDA 2CVHA 1L7RA 1OXXK 1LNQA 1PW5A 2FQXA 3KR2A 1YACA 3OEYA 4J0KA 2W70A 3VO2A 2EKQA 1QFYA 4KH0A 3ZD8A 2YNMC 4DSNA 3O1HB 4P86A 1WZIA 5J5AA 3H5AA 1L6IA 4RA6A 3DOEA 1R6AA 3DWGA 5CX1B 3GBVA 3CW9A 2RKBA 3GT7A 4N18A 3TZKA 4C4YA 2PBLA 1UPAA 1V1RA 2PG3A 2HPZA 2F7SA 4TZ0A 5FI5A 3ZNNA 5IWCA 3LECA 1C9EA 1NRIA 2VUTA 5JJKA 2ZT6A 4KX3A 4QPZA 4BMVA 2G0TA 5I9NA 1SK9A 3PPWA 4Q21A 3UJ9A 5BMVA 1OI4A 3E1KA 4BU1A 1RYZA 1XQ9A 4OKNA 4S1WA 3RR2A 2PXCA 1GKYA 4ECEA 1T9GR 3NFRA 4KLAA 1UOEA 1CJMA 3IOBA 1IJBA 1FNDA 3AXTA 2PBRA 4MLCA 4DIOA 3KJEA 3A9TA 3FWZA 2W6CX 3ZQ4A 2JBWA 3UCXA 5L3QA 4RFSB 3FZEA 3AOEC 4EG5A 1EUDA 4ZREA 2II6A 3RG2A 3NGXA 1UBNA 4GLFA 4OUKX 1U4NA 4BZQA 3AM3A 3N2YA 4RL4A 1GR1A 1W8IA 3RFUA 3V1UA 1X7YA 4D5EA 3LD9A 1OWNA 3UXHA 1S2LA 4WL0A 3ABOB 3K15A 3D7SA 2Z5LA 1ZVMA 1DG3A 4PYNA 1A0OA 1DDOA 3KQKA 2AZTA 4I1YA 1PR5A 3JU3A 5F4BA 4QEZA 4ARSA 4RORA 5JDCC 2O8EB 1VPEA 3M1IA 4EIWA 2WUDA 3H1BA 5AK5A 5GTDA 2GCGA 1PI3A 1T3GA 5I3CA 2GD1O 4EWLA 1UBSB 4YREA 3LF1A 4DCPA 1ZR4A 1BYUA 1YQGA 4W5HA 2RHJA 3O3NB 3B48A 3BX1A 3QHAA 2PUJA 1ONBA 2VHTA 3OICA 4I2NA 1NMYA 5TRTA 3TRKA 4DBLE 3EJWA 5IX8A 1TVKB 2CDCA 2IITA 4WINA 1V7PC 2D0DA 1BOFA 1L5LA 4YDSA 2W5UA 4O4HB 4FGSA 2XXJA 4Q18A 4WJLA 2XAUA 2BCGY 1ZINA 3VZRA 3WGVA 1OZHA 3ID6C 4DSAA 2ZBFA 4PHTA 1B8PA 4ZOAA 3VJMA 4TYMA 2DJ5A 5GADl 3ZVNA 5I9IA 3OY2A 3WLHA 2CXRA 3MRVA 1D07A 3V5NA 4IXWA 2JZOA 1IZYA 3FZGA 4Q0MA 2XWBF 3IEIA 4KAAA 2QRMA 4PSVA 1OGJA 4G5SA 2YOFA 4CGZA 2EF1A 1JSZA 3WK5A 3FZNA 4P53A 4MRMB 5DVZA 1F3LA 1F5SA 5EZSA 4YP9A 3T5CA 3L3BA 1TCCA 6REQB 3BB3A 2A33A 2GUWA 4BFZA 2G09A 3FPJA 3A05A 3ZU2A 4BDTA 4XWOA 2P7IA 1Y6FA 3GGDA 1PT6A 1L5VA 3QEOA 1OTYA 1NJSA 1QFSA 4W8GA 4QLAA 3C3YA 3VXKA 4FS8A 3G0HA 3VZCA 3W5SA 4BY9E 1CJBA 5D51S 1XHFA 3Q7PA 1XO1A 2OGUA 1DRJA 2JBHA 4RZ3A 4YP5A 3D6MA 4A27A 3KZNA 3VNRA 4ZRNA 4J0IA 3K5WA 4QATA 4KK4A 3MUNA 4RDXA 3N1UA 4BMCA 2FN8A 3DBLA 2O2ZA 2DWPA 3PXAA 1VL2A 3ONNA 4RNDB 4JKIA 3FPEA 4UAGA 1GVNB 5H3CA 5EJ4A 1SVLA 2BONA 2WHQA 4UE6A 3ETGA 1E4YA 2Q28A 1CQJB 2PUEA 1TQ4A 2ATXA 2ZYIA 1RM5A 3NOVA 3I6QA 3N70A 2V45A 5DHSA 3OHPA 4G0UA 4OP3A 5C7LO 5FUWA 3TPFA 3AHHA 4ZAZA 3WK6A 1JDJA 2JGKA 3ND9A 1E2DA 1G20E 1XK7A 4PU0A 5ALYA 3EGVA 5KYYB 1I4TD 1W36B 4LPKA 1IBMB 2NV2B 1C9YA 3VR6H 2IYXA 4KXVA 1T8YA 2PPVA 3BMOA 1ZAYA 3IA7A 1E3JA 2ASEA 4DM3A 9GPBA 4AJLA 4NDAA 5GV8A 1Z22A 2IXBA 2QVCA 3NVKI 3GZJA 4G5HA 4PANA 1AV6A 3EHEA 3KKLA 3BXPA 3HPQA 4LGCA 2QJTA 2OOSA 3MG9A 1UJ6A 4UBJA 5HFNA 2ZVPX 1TUBA 4DDVA 1YS4A 1W2WB 4CIWA 3MWJA 1TVKA 1R7RA 2WQ7A 3UWKA 5IPFA 1QH9A 4XVHA 5BWCA 2D4HA 4CCYB 2FR8A 4RE5A 5IBQA 3F74A 3BREA 3ZI7A 3WQSB 3CCCA 2Z6AA 4HMOA 1OWPA 2OVFA 3BWXA 5EIHA 2VDWA 3HNRA 1D7OA 3RDPA 5KNBD 1HEYA 1E1YA 1Z25A 4U7DA 3C0KA 3A9SA 3NTUA 4BFWA 4DV2B 3RVOA 2AUMA 2CK3D 2OCPA 4QODA 5DT2A 3ZGZA 4YRAA 1C3OB 2AOTA 1NC3A 2OHFA 4GE0A 3VR5H 3BZUA 5KWEA 1KS2A 1PT8A 3DVLA 4NE7A 4Y9DA 1YMVA 3PFIA 3TSWA 3HWRA 3KAJA 5ITZB 3IUQA 4GX1A 3V4LA 1K4YA 1VLZA 3TD2A 4DNXA 1NVMB 1JNXX 2GB4A 3WL4A 5KYNA 1XXHA 2O2HA 4B7UA 1OPXA 2J6CA 4IIXA 3UKJA 3ETNA 5J4VA 3ZCSA 4DE5A 1XVUA 1WAMA 3A7EA 5I7OA 3D43A 4GPAA 1OX6A 2QSUA 2XBLA 2YVQA 4NBUA 3EPKA 2HJ9A 2XAAA 1ACMA 3EIQA 3I5UA 1KAHA 2OB1A 3H65A 5IT9A 2QTLA 4CLRB 2NVUA 3Q3GE 5DSXA 1GZ5A 1P44A 1WETA 1BCRB 3RS8A 4LZJA 2DQ4A 4D92A 2VXOA 2ZT8A 4OXYA 5EGNA 3S6JA 2QZ4A 4CI0B 3H1GA 1QHEA 4B8WA 3OZAA 4BB5A 1NWCA 3KB2A 4DIFA 1QPBA 2NSHA 1EFDN 2QG4A 1S3SA 2PL3A 1LGYA 3CZPA 3IP5A 2X7HA 3CGWA 3OLCX 4L50A 2P27A 4ER5A 4U8HA 3L01A 2PUWA 4G5XA 3U1BA 4CTOA 4MRVA 4WXYB 2UXCB 5F73A 2W4QA 1WDMA 3S3TA 4BV8A 4C43A 4BUJA 2WIGA 2PUHA 1MDFA 2IYFA 3JQBC 4QO7A 2L42A 1AGNA 4KQJA 2WPDA 3IP8A 2C9BA 3IKLA 1QG0A 4EF5A 1HY3A 2QD2A 1M6YA 3NRJA 2FN9A 1QNFA 4RF2A 2H85A 1KO4A 1Z36A 4U7JA 3EPJA 2ZQYA 1AGRA 4MR7A 1EQAA 4E13A 4BKRA 1AZWA 1MIOA 4LJ5A 4Z7OB 2XYVA 5EWLA 3LE8A 2EYQA 2ZI4A 3OZXA 4D4KA 5JSFA 4J1NA 4WN3A 1MF7A 1SCIA 3L0BA 4JU9A 4ERXA 5JCXA 3IEMA 2GILA 1EX9A 2H9AA 4HAYA 4WRRA 4ENSA 4TZ6A 1VBKA 3AEZA 1ZWLA 3E35A 4BQQA 3U39A 5KSWB 2ZU6A 3LIIA 1DZIA 1G1MA 1WF6A 4MWEA 4DMGA 1HZZA 2C58A 1XZKA 2R3SA 4X85A 5CFRA 4LHWA 2Q2QA 4F8YA 2FZGA 3HV2A 4D99A 1KI4A 1N7GA 3ICOA 1HLPA 3WK8A 3I2GA 4N5LA 2F1JA 4OYHA 2J30A 2HLDD 2GN4A 3WSWA 4DGSA 5EUBA 1FXUA 1W88A 1Y4SA 2C5GA 1NVVQ 2RB5A 1ONNA 3GJXC 4C88A 1XG5A 2QLMA 1ENZA 4HS9A 1SR8A 4CKEA 3RRJA 5JRDS 1G5IA 2ECFA 2YHUA 3L8GA 5MN5A 2X0FA 1D5CA 3B9BA 2GPBA 2PJZA 4M46A 4TMYA 2QUZA 3PC8C 4KQCA 4PF1A 4Z0PA 3JD4A 3ZJYA 4X62B 4O5OA 3TZLA 3VMMA 3THWA 3OPYB 3SU8A 1ZHOA 4BB6A 2G70A 5FT9A 1FMFA 1E3EA 2QMOA 3I37X 3PRJA 2DFKB 4X5OA 2CL0X 3H2BA 2W48A 4FI3C 2E48A 2FWBA 2ZTLA 4QOSA 4KIFA 3GCDA 4FSDA 5CB8A 1ABEA 5LJIA 4L3VA 1N1DA 3EYAA 3L0PA 2BKUA 3PA8A 3PZRA 1GV0A 5D5PA 4WZAE 3ZU3A 3T3NA 5KVAA 1D2CA 2WZQA 2C7OA 2CLEB 1U2EA 2W8BB 4NU5A 3G9TA 1ZN8A 1IN6A 4KN8A 1ODCA 2FUG6 3A9WA 4QTTB 4C5AA 1UXKA 3O74A 4QUKA 1NUQA 2RI1A 5J2UF 4K9PA 1PGJA 2FZ4A 3PUJA 4HX5A 4PX2A 1DKMA 2WSSD 4YMTA 1FP2A 1GFZA 2Q2VA 3WRVA 4HVLA 2WSYB 4WWHA 1Y1LA 2VPZA 5IJXA 2PSFA 3ZLJA 4WGFA 1KZYC 2KX7A 2ZE7A 4UVEA 2WI8A 4UTVA 4B3HA 4KOEC 1OH6A 5KYUB 5K0TA 2OT3B 3C8MA 4J94A 1D1SA 2PR2A 3ITNA 1IZZA 1V9CA 2QQ0A 1E2PA 4FN5A 1G2PA 3LP6A 5CLLA 4KCGA 3UEOA 1MW8X 1IIBA 3W5DA 2DFTA 2WP0A 4JNCA 1QO9A 2Y1FA 3C3CA 3NYQA 3R3JA 4N5NA 3V8NA 5BUCA 1MKYA 2PX5A 2C2OA 4KO8A 1FVFA 2C0CA 3BFJA 4XR4A 2O3RA 5CD1A 1IK6A 2ZE6A 4ND5A 1N6HA 1YS2X 1UKCA 2FMKA 1PJ4A 1AKWA 4JVLA 3HJRA 5JAPA 4XYLA 1OLSB 4RGQA 2Q41A 3O3MB 2FSVA 4K05A 3OJOA 4F5WA 3ADPA 2C4UA 4TT3D 2AYZA 2X19A 1B74A 4BGIA 4BWGA 4L4UA 4C3UA 1C1XB 1ZBDA 5JMOA 1DEHA 2A0UA 2X5XA 1I1QB 4IGIA 5I5EA 2QW1A 5AVVA 4W5TA 1WPXA 1Z5VA 1JXAA 1WDLA 2DUNA 4FIZA 3U3RA 3H1EA 3WADA 2Z3WA 5DKFA 4V0ME 4KE7A 4EW3A 3E2PA 1IPHA 1JHZA 2DQKA 3F7MA 4I7EA 5E2BA 1MJFA 2OP1A 3NWJA 1CR2A 1KS9A 3F3MA 4D45A 4MCHA 3FWPA 4QEKA 2GNAA 4C4PA 4DLNA 1IOVA 1CLEA 2D6FA 4O59O 3VPBA 2G9UA 3ESZA 4V3CA 5B4UA 1JKMA 1RQXA 4PZCA 3F49S 1M6VA 5LBTA 4DNFA 1H0HA 4J7UA 2IDJA 4YMWA 1ZBQA 3R7WA 3NHFA 1VCMA 2WAYA 2YN0A 3G6WA 4WPGA 5EQFA 4XFKA 5CW1A 2WRZA 1Z8HA 3K1AA 4WJKB 3R75A 2QSZA 1I32A 4HAWA 1H23A 4EB0A 3KVOA 2JG3A 3M8KA 4H6PA 5IG2A 1FRZA 5HZGA 1MOPA 3TI9A 3W1VA 1J8VA 1IDOA 4GXNA 5E8JA 4B47A 3L7BA 1V11A 2O23A 5HBRA 4Z8XA 3TVTA 1TIKA 2HA4A 4O4LA 3NHMA 2ZB3A 2PXHA 4GPBA 2Q1XA 5CA1B 5AQEA 4ZCRA 1Z3CA 3FJ1A 3SC2A 3F6CA 3LBFA 5KTOA 3SQWA 1EB9A 3GYGA 2I3DA 1PR0A 4FBGA 4OLHA 4B2IA 1BXGA 1DCTA 5C0OE 1K66A 4BVBA 4MVJH 1JHYA 4ZCIA 2HQSA 4TXNA 1YQQA 2F3QA 5GJWC 3L8HA 1CTQA 4YI5A 2IW3A 2Q5QA 2Z1DA 2WZDA 3KBBA 1XA3A 3KZVA 1GUZA 4DIMA 1VCNA 4YI3A 4G1UC 2B37A 4AP6A 3I45A 2PX6A 3EIWA 5JJ5A 3VVMA 4P58A 1ZISA 4RUKA 5C1IA 3QYJA 1X9IA 4R0NA 3S4YA 2ZRKA 3SVZA 1A9OA 3L9XA 1I8TA 4Q3OA 5J5VA 3RD5A 3SJUA 5EJFA 3FUXA 5HGXA 4A3SA 4YJ3A 3V4OA 4TSRA 1ZNZA 2V55B 3PXCX 3QKUA 2XMZA 1G63A 2BD0A 3CLTC 2VDKB 2HHCA 5HJ2A 4XQCA 2PGOA 1Z8DA 2RH4A 1V37A 4U8GA 2ZIUB 4MGEA 3GNQA 4QWMA 1ZCZA 2DGDA 1NKSA 3A1TA 1FY2A 4OAOA 3ZWAA 1J20A 5BW4A 2H7VA 4HX2A 2BFWA 4IEFB 3SZOA 4QBGB 1RC0A 1L7VC 1KH1A 5LKRA 3C97A 1O6GA 3AX6A 3JWHA 2VVTA 4E5UA 4EOGA 4AWBA 5HZKA 3PT5A 3EG9B 3WYGA 3OCUA 2VYFA 4ZJZA 5F7OA 1IZ9A 2ZZNA 1OFGA 3N7TA 5HQJA 1ND5A 3KAPA 1TFUA 4IH4A 2WKSA 4QWWA 1AZSC 4H4CA 5FNVF 1E5VA 2R1TA 4IBOA 1EE9A 5T64A 4QT4A 5FBWB 5ALOA 2X7JA 5KU7A 1W85A 4BQPA 1LSOA 1IFXA 1Z7YA 4GYKA 2WM3A 3KKNA 5DK6A 5DRYA 2ZTUA 1O97D 3LHFA 3Q1LA 2FCAA 4RANA 2GMWA 4MWBA 3FHOA 4NMWA 2CUNA 4N9WA 1OREA 5LC1A 3M70A 1H94A 4ARUA 4RZUA 2P62A 2YXLA 5E7QA 4F2GA 4DR1B 4HAOA 2VI5A 3KE8A 1Q3KA 4IF4A 4BVLA 5LB2A 5BW6B 1ORWA 2D7JA 4MVJD 4H7EA 4EARA 1DWOA 1P7ZA 2Z9DA 3BHMA 3OCVA 4K9LA 3S1AA 4D4IA 3RUAA 2VRWA 3DMRA 3QE4A 1QYIA 1VL0A 2RGXA 5SZHB 3GJSA 1SK8A 3DQQA 3NP7A 4MS4A 2AMFA 3A6GA 4FDTA 5TT0A 3DW3X 2PUVA 1U31A 4ARZB 2HA6A 1SPBS 1U3TA 2R11A 3P2JA 3FVVA 4LJRA 1JQAA 4WKNA 2D1TA 5AW5A 5AW6A 3GLGE 3EVAA 4PC6A 5DN6A 2NNLD 3SX2A 1PUIA 3D3QA 3V55A 2LRHA 1ZHFA 1EJ0A 4HRVA 1YDFA 2DHEA 1Z15A 3B5IA 3OM0A 5BSVA 4IVPA 4DA6A 3C41J 1RXCA 4UNQA 4B7XA 3TW4A 4YONB 3OVMA 4B17A 4BQRA 1KIAA 1W5EA 4ZZ3A 3GOHA 3KLOA 1NTOA 2O8BB 1P5FA 2ODTX 5IUKC 1UPXA 4OMCA 3WBFA 5E6RB 4ZZ0A 3OZBA 2XE6A 3EW9A 4PICA 3GX1A 4KDFA 4BNXA 1THTA 3KQPA 2N75A 3E23A 4P2GA 3K2EA 1JA1A 1U98A 3MWFA 1XAIA 3EZYA 3HCCA 1F60A 3EZXA 2IHTA 2ODBA 3MYRA 2ZI9A 1YC2A 5B7PA 4DSZA 1T5OA 5K6RA 3PDCA 1CERA 3WMWA 5DGDA 1B8OA 2P5YA 2L2QA 3F0TA 4FFOA 5HVNA 2TMGA 4HDOB 1IVYA 1ECGA 1F8XA 1Z37A 1POWA 1YASA 1UMDB 2GJAA 2H8GA 5DISB 4F4FA 2XOEA 1I80A 3GJQA 3PUVA 1XQWA 4U7FA 3R5HA 5CNKA 2PAAA 4E88A 4PC1A 2GK3A 2JK1A 4CIXA 4ZVQA 2R6DA 3A4VA 3A2NA 1HBJA 2I6TA 2WQ6A 4JLPA 5A0VA 3MAJA 4IIJF 5HIMA 2HQOA 5JQGA 4CI9A 1Z0FA 2EOAA 4JVOA 3LC2O 4NK4A 2WK1A 5E7JA 4ZA2A 1M8GA 2VYVA 2ZROA 3LS2A 2EFEB 1NPDA 2HX1A 1GUBA 2AFHE 4MVXA 4Q6BA 4UTZA 4W1SA 3UW3A 1XZQA 3M4XA 3ZX4A 1E8NA 5SY9A 1ZNWA 4JROA 4CHGA 3V7YA 1ULTA 1XEWX 3UT5B 3NTXA 4Q1AA 3VV2A 2VJYA 3N58A 3P9ZA 5AK4A 1DBIA 3HGTA 4PZ0A 4ZC8A 1U0OC 2OC4A 2RCYA 4JV5B 3IELA 1IATA 4PYLA 4MUNA 4ZZ2A 1KMHA 3AM4A 5EUCA 4DLSA 2WM9B 4XVQA 3VZQA 3PUXA 3QU7A 3KHUA 3QX8A 3V33A 5KNCH 2VYND 4J7CA 1FQKA 4RVSA 4Z1MD 1Z63A 1E7YA 1A88A 1ESMA 2J5QA 3Q3CA 1QF7A 1U1FA 3AB8A 4NDZA 1IG3A 4WKGA 3IJRA 4F4JA 3VRHA 1PUXA 1I7LA 5F2KA 5F3RA 3EZGA 1G8PA 2LTAA 4H7FA 1BROA 1NZFA 1PDWA 3DCNA 4URHA 4ZOCA 3WK7A 4ZEMA 1EAYA 1DARA 1ISRA 2XQVA 2A57A 5AI0A 2DEUA 2P2DA 1W46A 3M0EA 3SHOA 1II8A 1PTKA 2M9MA 1RI5A 2ZE8A 3B8HA 3OUTA 2Q3CA 4IQ8A 4YJ2A 2BLNA 2FG6C 4BNJA 3LW7A 3TTYA 2HH9A 1RJEA 4BJ5A 1RADA 1BFKA 9ATCA 3RUCA 4E5NA 1CHNA 1XZEA 1A96A 4QUGA 3UBTA 4DLLA 2C61A 4GLLA 1PL8A 1DEKA 4F7DA 3E84A 4LMBA 3OAAA 1ZL2A 4US1R 1E1CB 1T1GA 1RJDA 3COYA 3UMBA 1T3SA 3FNBA 3RYTC 2PO5A 1G9SA 1L5OA 4QYXA 3DFFA 1W0CA 2PBZA 5EIWA 3VH2A 5KHOC 5MF6A 1KRXA 1TW2A 4Q3KA 2WJ6A 3ZVLA 3C3DA 3L6CA 1FQWA 4JUAA 3CZ9A 3Q4GA 2GASA 4TXMA 1JVNA 1TAQA 3G13A 4XPZA 2C8LA 4HN9A 3LLMA 2OENG 1RRKA 1RRFA 5B7QA 4GI2A 2XCTB 1R5NA 2R97A 5TGDA 1AK9A 4IJWA 5LP6C 4Y6LA 5L51A 2PL1A 4IF6A 3GIDA 2ODEA 3PDJA 1TJ5A 5TNXA 4LV5B 2G9QA 2XUJA 3O9ZA 2R2AA 3EW7A 4Q47A 3V1MA 4DJ5X 4GEGA 4ZOQI 1YAJA 1BEZA 4IVQA 5CT9A 1RHUA 4FI3F 1E62A 1ZRMA 3AR4A 2FXVA 2HHAA 4RY8A 2W2LA 4OG2A 4WESA 1EQUA 3RFTA 4ZVLA 3DDSA 4MTCA 3RS4A 1P8AA 3PQ8A 3RHTA 1HR0B 2VIIA 3UT0A 2IYEA 2V0NA 4WZBA 3ETLA 2VS1A 1A2BA 5DX8A 1NNUA 3HWSA 2P6NA 4KU4A 2PRKA 4P81A 1WDWB 1PUJA 2X9QA 3CA8A 5CURA 4MYDA 2AEJA 1N1GA 3TMAA 4LKOA 4U7WA 4EGQA 3KV3O 5BQXA 2I65A 4BZWA 2Y4OA 1NBHA 2Y1DA 4HUTA 1YA4A 1JR4A 2CLHB 2BFFA 2XNDA 4AC9A 3GMIA 1YR2A 3QSYA 1QHHA 3ZR4B 3SZLA 3PTZA 1PWYE 4TVOA 1TUEA 3R44A 2PKWA 1CR0A 1VLHA 2VUHB 2BT4A 2VSQA 2HC9A 1NJ2A 5AK3A 5FYQA 5TV2A 5JI2E 4R1MA 3OQIA 4L9SA 1UBEA 3P94A 3P0JA 3UHAA 2C5FA 5HRUA 3MRTA 3EZ9A 4U2EA 1XDWA 1V7CA 5IDXA 2KM1A 1NM5C 3UWOA 3LKDA 4EVSA 2V9PA 1P3JA 1JEQA 2H4YA 2OFWA 4ND2A 3ETDA 4AF6A 3B3JA 1NUSA 3H83A 4FEYA 4MGKR 1SOAA 3V32A 5K05A 4UPEA 1IWPB 1O77A 1OGYA 1QF6A 2FR0A 1ZK2A 1Z47A 2IDKA 3JASA 4J91A 1R9MA 3H1FA 3K9CA 4W63A 2OFXA 4CIAA 3QVTA 3ZWYA 1QWSA 2O8NA 4QUEA 3G8CA 3SLKA 3VV3A 1N1EA 2A1TR 1SIBE 1YKFA 1EVLA 3OEWA 1OXVA 2CZQA 2D5AA 3M3HA 4FW8A 2CXHA 1KDYA 2OO5A 2FSGA 5K7SA 4GBGA 4FMDF 5FL7D 4RTLA 3PFGA 4JLUA 1SY7A 1FP6A 1NQTA 3IKJA 4U6SA 3VSCA 1JFTA 3LI2A 2QTVA 2R9VA 2CGEA 5GIPE 3EVTA 4JLAA 4CEHB 2X0NA 3M5DA 4IIVA 4WNYA 5IM4F 2MHCA 4ZV9A 2LPMA 3EFOA 2WKPA 2JLAA 1FDTA 3UJAA 1E2HA 1KYTA 2YKGA 3O95A 2GI4A 3M5WA 2H17A 1T3ZA 1IY2A 2PKYX 1W34A 3PPYA 4B3RB 3OTGA 3QHQA 1BHJA 3QXSA 4ZZIA 4DM7A 3FX2A 1YZQA 2KMLA 2XNHA 3FD8A 3QIAA 2BEVA 4BB9A 5A5VA 3LSTA 4V1CA 1LPAB 2VBIA 4DIDA 4DA0A 4Z0NA 1KOGA 1N3BA 3V4VB 1X38A 1RHKA 1UP7A 3WWCA 4K28A 2QQEA 3O73A 3IBGA 5CM8B 821PA 4R1SA 4CV2A 5D7NA 3F90A 1NX9A 1DXOA 2FE4A 5T41A 3L4BA 4ZJUA 4G8BA 13PKA 3CV3A 4QDKA 3N9IA 4WH0A 4J03A 2PCJA 3R3XA 2D1FA 3Q3JB 4MP3A 4WLOA 3LQYA 4ZXPA 3FDFA 5FEUA 3EYWA 3KEQA 4AX8A 2NVBA 1OWOA 3OQIB 4WT7A 5FRDA 3TEJA 2Z58A 4X20A 4LOHA 4U2KA 3ZGOA 4M9ZA 1IN4A 1Z75A 2FZCA 4H6WA 3REOA 3FWHA 3SNHA 2B8WA 3QELA 1H69A 5C8DA 5K9ZA 1PZXA 1U9CA 4LGMA 4LJLA 2C4KA 4FFVA 1KQOA 4EVQA 4MW2A 1A9QA 3IDQA 2WD9A 1BDHA 4KQ2A 4O29A 1NN1A 1Q0TA 4GMXA 2CL7X 4LXXA 2M6LA 4KMOA 1G41A 1VSBA 5IVKA 2YFQA 3ZE6A 5JS2A 2ZUWA 2IF0A 1F0KA 1FQOA 2COEA 3BJRA 2WJJA 1Z39A 2I4OA 4II3A 4ED9A 1L7QA 1AQNA 2D06A 1AKVA 4INZA 4OH7A 5HW0A 4YP6A 2W0MA 4LCJA 3F73A 4UREA 2W2TA 5CGZA 3IQHX 1IMOA 4MO9A 2E4XA 1T4CA 2MMGA 2AHRA 3FF1A 4XIIA 5GP1A 2QTCA 2XTZA 3GQVA 4ZDWA 3T5DA 1U1CA 4KREA 5J3JA 3OIVA 4KQWA 4CFYA 5BR8B 4LK2A 4D2IA 4YAEA 2QE7A 3K20A 4DJJA 3I1FA 4FCVA 4IH9A 5K0JA 3C2QA 4KQEA 5K0BA 5G0UA 1W52X 1Y9JA 1OFTA 1CP2A 1UK9A 3BGSA 1J9ZA 4H4EA 2VUIB 1JHPA 2G5TA 2J9FB 1VMAA 3ZHYA 1CY6A 3STXA 1F8UA 4J76A 4HDRB 4OM8A 4EL5A 1HE2A 1Z4KA 2VT7A 4HWSA 3FI9A 4RTRA 2OV6A 1LTKA 1NW7A 1WCIA 1VJ1A 1FCJA 3ELBA 1GGEA 2J9YB 1WR8A 4F85A 3RREA 1N6OA 4QXQA 4XVRA 3UOAB 1N25A 2FLVA 4LHXA 4Y6GB 1EFUA 1ADJA 2B94A 3CBQA 2XR1A 3O94A 4H0CA 2ODWA 4RAQA 3IAHA 4TLDA 4TQGA 5EMHA 5I9TA 4ZQBA 4AULA 5FTNA 1GFSA 3DLCA 4P34A 5EWJA 1YBAA 2OY0A 1ONPA 3HJUA 5EMJA 4ZI7B 2QHXA 1KEZA 3NIBA 3EIHA 2FUKA 4R2LA 2R6JA 5ALSA 5I4BA 4QJBA 4HI0E 1XCJA 3AJ9A 4YP0A 2VTDA 3JD3A 4EX6A 2C95A 4W9RA 2WHEA 3BTUA 4DWVA 4J1QA 3TS1A 1ID8A 2YBEA 3GL9A 1WULS 1FDIA 3MB8A 4RQUA 4EW6A 3ZZ0A 4S3MA 3AVYA 4PAMA 3KG2A 1N6RA 3OX1A 1EZ1A 1LDNA 4LMRA 4QKQA 4DBVO 1C0EA 2DRIA 2LWIA 5JZMA 3HN6A 2LZ0A 2E4ZA 3O75A 3P4YA 4QDXA 4D9HA 5EHNA 1H1LA 4HQRA 4OXNA 1QH8A 4B4KA 3CZAA 4BVGA 1UBOS 3ZEIA 4KIGA 1O5OA 3QYAA 3VC1A 1YB7A 3NI2A 3HXLA 1UDAA 3QJGA 5COAA 3TFWA 3HB1A 3I9OA 2CXTA 5ED0A 2YV5A 3IVXA 4Y9TA 5AJZA 4YR9A 2KB0A 2IXTA 4S0XA 4AWAA 3NEYA 4FDUA 4NBKA 1E9FA 2WT9A 4Q39A 2Q5LA 4WW0A 4HNRA 3JYOA 4IGKA 4RE6A 2XUQA 3DMYA 2NIPA 3KT6A 5EJEA 4PYIA 4Z6KA 5AVSA 2W6NA 1ULZA 3TM4A 2XMPA 3VU9B 1O95C 4CQMD 3EEIA 4JLNA 5ALIA 4JH0A 1JG7A 2GPNA 3UH0A 4EJFA 4IDQA 2NZYA 1OBFO 1DL5A 1DPFA 2WWXA 1H66A 4UC0A 1G4UR 1XZAA 1PYOA 3C4JA 1NIPA 3TUJC 4AJHA 4B5KA 1KY2A 3G8BA 3L1UA 1JWBB 1RRVA 4MS1B 3FPFA 5JTUA 2WAXA 1E7QA 2OBFA 3DG9A 5KNCA 1ZI6A 2JGRA 1MAWA 2B20A 3GVHA 4UM7A 3WYEA 2L82A 4ZQGA 1A7KA 1B0AA 2FWJA 4JBHA 2JHCA 3C3WA 4OUDB 4UUOA 3UT6A 1R0KA 4X7RA 1KSHA 5KS2A 1RAIA 4J29A 1S2MA 1JMVA 1NOJA 4JOSA 3CMCO 1AXGA 4DTCA 1RAEA 1VJ0A 1ZM3A 4OSEA 3DE0X 5IHXA 2QPAA 2VAMA 5SY4A 4IX9A 9LDTA 1DAPA 1L7XA 2GVNA 3E3AA 2DBVO 4G36A 3LGSA 3T9CA 4HKTA 1KEKA 4Q37A 4Z3KA 3C16C 1YBMA 1STOA 1Z26A 4H7DA 3FIUA 1PL7A 1BC5A 3PDIB 3PPXA 4K6GA 4NE9A 3X2FA 1IK4A 3TJRA 4C6TB 3DNMA 4D9JA 1IG0A 4BTLA 5CDYA 4ARIA 3UBMA 1ZZEA 1G20A 3FCUB 4U6QA 4C9BA 4KPUA 1E6MA 3V4ZA 1CDOA 1NX6A 1U0SY 2B78A 2R1UA 1XF1A 2WJYA 3ADOA 4HUQA 1UAYA 2YNMA 3QVXA 1N0VC 2CCGA 5EPEA 2NPFA 5HUJA 5BRAA 3A9VA 4NBWA 1LXCA 1ISPA 1Z2DA 5AVJA 4BNLA 1GPKA 4BASA 4BN5A 4IUCS 4MYTA 1B00A 3MGGA 4H7JA 5ELLA 5LXTF 2BR5A 5KJ6A 2X2PA 3FMFA 3PL1A 3CF4G 1XMSA 5I8PA 1MJGA 1G6OA 2I2BA 2OO7A 2OTCA 2PU7A 1F20A 5HKLA 3UMCA 1PR4A 3V42A 4IQ0A 3DOCA 3F6EX 3CUYA 2ZRQA 3SR4A 4LF7B 3FYUB 1DV2A 2J41A 4ITUA 5H80A 2MR6A 3CH4B 2HSDA 4RYLA 3T9FA 2VQDA 4NI5A 4PCVA 3WIOA 4KO3S 3A6JA 3GUCA 1IXYA 4KO2S 4IIJA 2J6BA 4WDQA 4PLTA 3S1AB 5EP3A 3VYSB 3ASZA 3G8YA 4HDAA 5FOSA 4GZ6A 2CMGA 1SIWA 1UXGA 1Z08A 2GJSA 2XUOA 4V24A 2JIPA 1XMOB 4ARVA 5IAAA 3T06B 1FLNA 1ZGCA 4HWOA 2JIZA 4ONEA 3WJ1A 5ER9A 2FX5A 4YY3B 1XTZA 4MMYB 1JT2A 1VDMA 1SVIA 5IAEA 3VU8A 1CUUA 2NT4A 3CRQA 4RPLA 2ZRBA 5AKGA 4K26A 2AWOA 2HMUA 2I3BA 1SD2A 3MTJA 4Q4LA 4D8YA 3BSYA 3ORQA 4AUKA 2BP7A 3L4EA 3P2IA 1XMJA 2IHUA 3LLSA 5G1NA 1LDYA 1XNRB 2VQSA 3Q88A 5JV5A 3BXZA 2O7VA 5D3ZA 4E2FA 4ARAA 5HTKA 2J9GA 3RROA 3SR0A 3PLAE 1DWQA 4TWJA 4WOJA 1FFSA 2W2OA 3QW2A 4IM7A 2XIQA 5F9HA 3RT7A 3L6OO 4IZOA 4LC9A 3KE9A 1PJBA 5HX7A 1E2UA 1G20B 3PX3A 1JEDA 1KDPA 1NXPA 2HK8A 3X1YA 1U3VA 4XJSA 4IHAA 1RWQA 2ZJ7A 2UYGA 1I7NA 4BX8A 1HSZA 2LP4Y 3UUWA 4ES6A 1A1VA 2QDKA 3AEKB 4M4SA 1H42A 3JQFC 2H9YA 3BRCA 3P96A 1G3UA 3JARB 1X1QA 2O8DB 3C74A 1JR3A 2VJQA 4WXMA 2VNAA 7YASA 1NE2A 1VIAA 1U0NA 5AVOA 3D7LA 4PC3A 5EJ8A 4BNIA 3NG1A 1F5NA 4C22A 1LTQA 2PRJA 2BFFB 1SVUA 2WAAA 3H2ZA 4HWRA 4C6TA 5K8CA 2YXDA 4HH4A 4IDCA 1X80A 2C3UA 2FPIA 1LQUA 2R68A 3HK2A 2WNHA 3F5DA 3M9WA 1X7ZA 2QX8A 1UMBA 2JJ2D 5TY0A 4RD6A 1YFKA 3U26A 2IYRA 4N0EA 1OXMA 4WEQA 1QRAA 2ZRAA 1NW9B 2X2EA 4FK8A 2EC5A 1G8HA 1XK6A 2Y0BA 4DMHA 3UMYA 1ZN2A 1JE0A 2JAXA 3CN9A 5CIWA 4HLDA 5CBPA 2A5YB 5C18A 1PYDA 5AVZA 2J0SA 1RAAA 1TD9A 3ZDCA 4OBBA 3CLRC 2ONZA 6AT1A 1U94A 4WADA 4IRXA 3L49A 4GI3A 3DDHA 3OLZA 5CNMA 2YY6A 3DOUA 1R4NB 1C50A 3IUBA 3KU4A 4GGPA 1CK4A 5HF9A 2VCHA 2G77B 5AHRA 3K0SA 3AHCA 1NLZA 3WMFA 4RHTA 1T0UA 5GOZA 1CX9B 2H4HA 4GOXA 3ZPXA 2Q2OA 5K0CA 2XDYA 5GM2A 3U0BA 2H06A 5AKKA 3SHWA 4URXR 1WXFA 2HM7A 5I9LA 2ZB8A 1NQOA 3SMQA 2R4UA 3FPKA 1C3OA 2AOTB 1UMKA 3SR3A 3D3KA 1RS0A 1F12A 4L9RA 4B3XA 1P4JA 4NYJQ 4PZEA 1E2GA 4MAAA 1FLDA 4O8CA 3SEFA 5DIFA 2D54A 1JLLA 1HFKA 5K0LA 1BE6A 4H3HB 2QGFA 5EZYA 1H9AA 2FF5A 1JEOA 2WUWE 2CUTA 5HHTA 2XA2A 4DZRA 5FV7A 2H00A 3G85A 4NJEA 1O94D 4MRPA 1PU2A 3RAJA 1T36B 3EC2A 1V8BA 3M6XA 1VPTA 4DCMA 3GCWA 2NU6B 2ATCA 5AJYA 4C7OB 4IKOA 2AZ4A 3W8EA 3HU5A 3HUFA 3NASA 3BSWA 2IIBA 4AW9A 1OLOA 2B4QA 3PNSA 5JEDA 1G17A 4G0MA 1ZUNA 5E4JA 2IYUA 3CSSA 1CEXA 4FFDA 4LPSA 5IARA 5BSUA 3V80A 3WKBA 3ZWMA 3UO8B 1EP3B 3GVPA 1A9XB 4MVJM 2GD6A 1QC5B 3FH0A 4WASA 5T6BA 3KQUA 1ZNQO 1QGDA 1Q0PA 3ZXXA 1E7RA 2EATA 1GIAA 1SCJA 1D6JA 2I6SA 4QAQA 1A71A 2E9SA 1VYUA 4YT2A 5F3WB 2OHIA 4COKA 1XZMA 4Q4CA 1V95A 2V6FA 1JG2A 4KL8S 9LDBA 3DLTA 1I5OA 3NGMA 5KWJA 4OHMA 5D85A 5DN9A 1M74A 2AMYA 2Q5OA 3IUMA 5LWQA 3LUJA 4Y67A 4UDXX 1XOIA 1C4KA 5FLXA 3GQBA 5B3AA 4DKJA 1P7YA 4H6XA 5DEOA 1E2KA 5FPQA 4BTEA 4R71A 1ZL0A 1SQ5A 1QGED 5EIBC 2O52A 5TEWA 1BXRB 1JQ3A 1IJEA 3RW9A 3HDHA 4PYRA 4N0DA 1JJ7A 2C77A 2FZVA 4RFVA 3HB5X 2ZR0A 4P9NA 2FRDA 2VZ0A 4A8JB 1QQ6A 2B3DA 3C6XA 3INNA 4TQUS 5DHTA 5ISMA 2PNJA 2AUNA 1GG9A 2RC6A 4ZV7A 5FUMA 1X80B 3V6LA 2CV2A 4V3BA 2R8XA 3L0ZA 5DYYA 2YJNA 4AY5A 1YVEI 1YD7A 2CXPA 2FLKA 2FW9A 1C1DA 2X1VA 3FKQA 3A6LA 2FK8A 3ABIA 3I2IA 3OE1A 4IOJA 3OPYA 4L7QA 2PMCA 3FPSA 3WIDA 3UGKA 4NQZA 1EUCB 2BMVA 1RBQA 1N2CE 3T5PA 3WTCA 4AY3A 1PNTA 1ZGJA 4KFUA 1LQ2A 3MS4A 2ZJZA 4CEJA 3B1VA 2WF5A 3OOYA 1YUMA 3R20A 4I3HA 2JD0A 2WLTA 3WGUA 5ALUA 1GZ3A 1MJNA 4ZVMA 1A8IA 2WILA 4MRRA 1WXXA 4TOIA 1ACLA 3KOOA 2V3CC 3DCJA 1ZIYA 4L8FA 3ENNA 4HWKA 2ZUTA 1UZNA <