3FWHA

Structure of haloalkane dehalogenase mutant dha15 (i135f/c176y) from rhodococcus rhodochrous
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
296
structure length
296
Chain Sequence
SEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution studies of haloalkane dehalogenases DhaA04, DhaA14 and DhaA15 with engineered access tunnels.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 108
structure length 296
sequence length 296
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fwhA00
2LIPA 4BZZA 5BOVA 4KJXA 1BN6A 2C0PA 1GT6A 4L72A 4FKBA 5DYYA 5E2IA 2QM0A 3P2MA 1JJFA 3L1JA 2QS9A 1ACLA 2OAEA 3C6YA 4L0CA 4QDTA 1OILA 5ALKA 3FYUC 3A2LA 3Q8WA 2JGMA 4AMYA 1PFQA 3ZV7A 2DHCA 4X6UA 1K6EA 1QONA 1L7RA 1CUCA 2GYVA 3QH4A 5CURA 2ZVDA 2HRRA 2VQ6A 3WK8A 3E1GA 2VT7A 1JJBA 1VKHA 2OQIA 2R11A 5AP9A 1MJ5A 4LIPD 3IUJA 1LPPA 1CUDA 2WJ3A 3GUUA 1E66A 1ZGCA 1YCDA 5CT5A 1U8EA 1RWQA 2JGIA 1Q83A 3NGMA 1X70A 2ROQA 4FHZA 4J7AA 4CG3A 2HFKA 3I6YA 2PVSA 3S2ZA 2G4LA 4WDQA 3WK9A 3KWFA 1MT3A 4FLFA 2DQYA 3D7RA 2DQZA 4KE7A 5ALEA 3I2FA 2XUIA 3IULA 5CXXA 2G63A 4CIAA 4QA9A 1TCCA 2XMDA 3O4JA 1YA8A 3VVMA 4KR0A 5I8PA 1CUIA 4H7EA 4GECA 1JFRA 3ZWQA 3UMJA 4MWSA 1Q84A 2WTNA 2XUJA 1XRPA 2J4FA 1YB6A 3RKSA 1E8MA 1QGED 2PPLA 4NMWA 5LP1A 1T4MA 3WL7A 4OU4A 3OPMA 4WY8A 2BUCA 3IVMA 5EGNA 2XQIA 4GI1A 3WYDA 1WCYA 5K3CA 4OU5A 5IKXA 3AILA 1M33A 5DNWA 3O4IA 1CV2A 5CTAA 3I1YA 1UK6A 1DWPA 3OOSA 2JGJA 5EHNA 1CIJA 2UZ0A 5AKIA 3HZOA 2WSLA 1QIEA 5AOAA 4FFWA 3I2KA 4Q34A 1QE3A 3BIXA 3H19A 1XZEA 4EUSA 4B0OA 4RNCA 3H18A 2XQJA 4UHCA 4EHBA 4FFVA 1BCRA 1XRNA 2PM8A 3DQZA 4BB0A 3HI4A 2H1IA 3EBLA 1EVEA 3EIOA 5DTJA 3UUEA 3R3VA 4XVCA 3ZLUA 2HU7A 4IQ4A 4YASA 5ALHA 1QJ4A 5CH3A 2CZQA 5EIAA 2VA9A 3A70A 5ALXA 1CQWA 2H7YA 2Y6UA 2IX9A 5K3BA 1JMYA 2I3DA 5H3HA 4L9AA 4Y2YA 4ETWA 5BWCA 2JBWA 5EHQA 4UHHA 1LZKA 3LCRA 4M0FA 4YPVA 5ALNA 1BRTA 5JADA 4G4JA 2WU4A 5AI9A 1QIFA 1ISPA 5DYTA 4C89A 1VJ5A 2WIDA 1WPXA 2HRQA 5ALPA 5C81A 2VAVA 5ALMA 2ES4A 3VJMA 3R3YA 4HXFB 1UWCA 1O6FA 1EK2A 3FSGD 2OPHA 1QIDA 5AIAA 1THTA 3QMMA 5CRIA 5CXUA 2XMZA 2YASA 1LLFA 4B82A 2B4KA 2DSNA 4YK7A 2QUAA 1S8OA 5ALSA 1CUFA 3H1AA 5CW2A 3EQ9A 2ACEA 2XE4A 4QLOA 3WWDA 5A6VA 4X00A 1XZGA 4MEBA 4EY5A 2FJPA 3PF8A 4RPCA 4PNZA 4UBNA 3BF7A 4F5ZA 5CMLA 5HK8A 5T4HA 5LLSA 4C4XA 1X2BA 4AO7A 1H22A 3H2GA 3ESDA 4FNGA 3WK4A 4DNQA 4NS4A 1U2EA 1DINA 4B80A 1Q0ZA 4DGQA 1YS2X 2BUAA 2WKWA 1EINA 2I78A 2JGKA 1QTRA 1AC5A 3LIPA 1R88A 4MYSA 5ALWA 5K3DA 1F0PA 3DNMA 3I6MA 3WWOA 2WIGA 1QIGA 2X8BA 2HA3A 4BAZA 4DNPA 3FLAA 2WIFA 5HF6A 3K2IA 4G8BA 2W6CX 1XZFA 1JI3A 1W4LA 3B5EA 4C4ZA 4DNFA 4ZRDA 1DQYA 2GBCA 3QPDA 4QE3A 1TKRA 3AINA 4OPMA 1CR6A 1CUWA 5DNVA 1W52X 5HF5A 1VE6A 2IITA 2WG1A 5ALYA 2O2GA 2ZJ7A 4BAGA 1DT5A 1J06A 3PE6A 5ALLA 2WHPB 4ITVA 4BBZA 2CKMA 4H7JA 3C6BA 4KAAA 2V98A 1H2ZA 1MPXA 2PSEA 2QXTA 3G9XA 3ESCA 2C5FA 3FYUA 1A8SA 1UOQA 1YSCA 4PV7A 1AKNA 1AGYA 3GROA 4AN1A 2XUGA 3STWA 4C01A 2RAUA 1MU0A 4CFSA 2WU3A 1XLVA 4I3FA 4Y2PA 5IH7A 1THGA 4ZGBA 1VXRA 4IH1A 4WFIA 3SK0A 4WFKA 1XZCA 4J03A 3WYNA 1XZHA 2JIDA 3O9VA 3CCBA 2B9VA 4UUQA 3WKDA 3CCCA 2ZSIA 1ZOIA 3WLAA 2I3ZA 2Y2VA 5JIBA 2ZJFA 4G5XA 2PX6A 4H7IA 3OC0A 1H2WA 4QNNA 1YAHA 3R41A 4EY4A 1IMJA 5FP0A 4UHBA 4HXGA 4IH9A 3BIWA 5CT8A 1LPBB 3PICA 3F9CA 1R50A 4CG2A 4X6XA 4JEIA 4LHEA 4GW3A 4BE9A 3VISA 4B6GA 1EVQA 1EDBA 1HQDA 1UZAA 4CG1A 2VT6A 3STUA 3QBJA 1W1IA 2VF2A 1CUVA 3WIBA 2XMBA 5HFAA 5EFZA 1FFEA 3ANTA 1G4HA 2QVBA 1GPLA 5E4TA 4W1SA 4DYHA 4OD0A 3FYUB 4B7ZA 1C4XA 3F97A 4Y7DA 1BROA 4BCDA 2DCMA 4QDUA 5FXMA 4N8DA 4X7BA 2GYWA 2XMSA 4Y2JA 5DNUA 1UK9A 2BUBA 1UFOA 1VOTA 2PU7A 2XUFA 3R3XA 4LXGA 3ANSA 3U1TA 4Q3OA 1GPNA 3IDAA 4EY6A 4G4GA 3WIOA 4J0KA 4E14A 3MUNA 4H7HA 5D6OA 4AZ0A 3DD5A 4UBJA 5SYNA 1E8DA 2XUHA 3SX4A 2V97A 2CJPA 1DU4A 1KU0A 4WCVA 2JEYA 5AO9A 1NU8A 1WB4A 3I2HA 1WPRA 3TRDA 4AO6A 1CQZA 2OGSA 1G5FA 1EDEA 5I7UA 2OAGA 3C6ZA 5BV7A 4PSUA 5JAHA 2Y2UA 3AIMA 1WOMA 4FDMA 1BS9A 3G7NA 5FDFA 5ALOA 1QFSA 4AMZA 1LPMA 3DYVA 2QJRA 1HBJA 1DX6A 5E4JA 5LIPA 2XUKA 5T4EA 1Y7HA 1MO2A 5AOBA 2BGRA 4ROTA 4BVKA 2CUTA 3FCYA 2C4HA 5LZ7A 5AK5A 5JD6A 2XUQA 3PUHA 1C7JA 5JD5A 2Y6VA 1XRMA 1FJ2A 3DKKA 4BATA 3WA6A 5ALRA 3FNBA 5YASA 4MQLA 2AJ8A 2WLSA 1QO9A 4IHAA 4LXIA 5AI0A 5FLKA 2X5XA 1HLGA 5AKJA 1N5MA 4BDSA 3F8SA 2WIKA 2OCLA 1TCBA 5LZ5A 5HQ3A 5AKGA 4W63A 1XROA 5FRDA 3FLBA 5AKKA 3A2NA 1ZI8A 2PU5A 4K2AA 4H77A 2OCIA 5HKAA 2QOEA 4XX1A 4G8CA 5A2GA 2WFMA 4N5HX 4HXEB 5ALJA 5LKAA 3QVMA 3WKCA 4GHWA 3WWCA 2RI6A 3H04A 1TK3A 3GELA 3QPAA 3ZPXA 4ZXFA 2OCKA 4OUKX 1BEZA 5JZ9A 2ZJ6A 1UK8A 5AM3A 1R4ZA 3ILSA 4H0CA 1HPLA 1R1DA 4EA6A 4JNCA 2DFPA 4UBMA 1MAHA 3SC2A 1YA4A 4BRZA 3JW8A 4ZV7A 4BCCA 3HC7A 2FJ0A 3LLCA 1CUHA 4XWGA 2GZSA 1QOZA 1ZD2P 4Q82A 3U0VA 3SWWA 4G8DA 2PSDA 4UBKA 4MEAA 1QZ3A 4X92A 4MQMA 5CBKA 4GDMA 2H7XA 1F8UA 4UBIA 2ACKA 3HACA 5ISMA 4Q3LA 3W9UA 4FLEA 3LP5A 4TPKA 3GFFA 1Y7IA 2XUPA 5ALVA 4AX4A 5I9IA 3H2KA 4Y2VA 1N5RA 1YS1X 5JAUA 4H18A 2Q0XA 1CUEA 2DHDA 3HLKA 2Z3WA 1XQXA 3DCNA 4L3WA 4O08A 1EK1A 4U2GA 4HVTA 3BJRA 1BU8A 3STYA 2V9ZA 1CUGA 2V96A 2GYUA 3S8YA 2Z5GA 3WK5A 3WMRA 4KEAA 2HA6A 1TRHA 2O7VA 2QUBA 1ODSA 2VJCA 4MWTA 2GBGA 1A88A 5AKZA 2CBGA 1ZICA 7YASA 1MNQA 1OXMA 5FKJA 5AH0A 3KD2A 3BWXA 1CLEA 1ODCA 5HF9A 3DJYA 1IUNA 3QPCA 2YXPX 3R3WA 2AJCA 4X90A 5KWIA 1G66A 5DWDA 2XMRA 2GBFA 1UKAA 3IIIA 2WJ4A 3E0XA 3W04A 1GZ7A 3PFBA 3WKEA 2JGLA 1GKLA 4KACA 3G9ZA 5ESRA 3B12A 4F21A 5C7YA 4UHFA 5AICA 1QIHA 1TQHA 3WWEA 3I28A 3TGLA 3BJMA 4FOLA 5EHXA 5JALA 2XQFA 3O4GA 2J3DA 4H7DA 1AURA 1CFJA 1JJIA 4QWWA 3ZI7A 4YX9A 4QDXA 1LGYA 5JASA 2OGTA 2C0QA 3H0CA 5AK4A 4ARBA 4Y2UA 3AZQA 1LZLA 4BYMA 2BGNA 1BE0A 4U2EA 2J3QA 5FOQA 1SOMA 3BDIA 5ALIA 4X91A 3UUFA 3V1NA 1NX9A 1QIIA 4V2IA 5K3EA 1ZIXA 5IVDA 3M81A 5AM1A 1D07A 2Z3ZA 4KE9A 4OB7A 2QMQA 2ZYIA 5LZ2A 4X95A 4B9EA 5D3KA 3G0IA 2PBLA 5LZ4A 1XQWA 4WDRA 1J2EA 3FYTA 1VZ3A 4KE8A 1WM1A 3WKAA 1LPSA 1W75A 3EQ8A 3W2TA 4Y2XA 4Y2RA 4E46A 2XDWA 3F98A 3M3DA 2XB6A 5CT6A 4PW0A 1ORVA 2OCGA 4BC0A 4BVJA 2CEKA 1AUOA 5HK9A 3WI7A 4UFNA 1ZD3A 2XQGA 1YAJA 2HA7A 3STVA 1U4NA 2B20A 3FAKA 3BL8A 4AN0A 3FOBA 4J0HA 4J0IA 3PUIA 2P8SA 1MX5A 4IO0A 4X85A 2EEPA 2WG2A 1XKLA 2PSHA 3KXPA 4PO3X 2RHWA 3V48A 3D3NA 5AK3A 1A8UA 3K6KA 3NOXA 3HEAA 4EB0A 2OLEA 4N8SA 5AJHA 3E3AA 1EA5A 1QO7A 5FUMA 3AIOA 5IVHA 3DYIA 1XRRA 3HJUA 5KREA 1CPYA 3AUKA 2PUHA 3DOHA 3EF3A 5EHZA 4PSCA 2FX5A 3ESAA 3I6ZA 2NW6A 4D9JA 1CUUA 2XQKA 2BJHA 2D5LA 1QIMA 3WWPA 3I2JA 4X94A 5A62A 5LZ9A 1SC9A 1EB8A 1XQVA 2OG1A 1JKMA 1CUAA 1G42A 5JYCA 3RLIA 2C5GA 2PL5A 1WHSA 1O6GA 1EI9A 2HDWA 4XIIA 4BTVA 2D0DA 4U2BA 1LPOA 1CUSA 3O0DA 5A7FA 2WTMA 2O2HA 1P0MA 2ZSHA 5ALUA 4HZGA 2AJLI 3DL7A 4CCYA 4A23A 2XI4A 2GBIA 3HYSA 4LYDA 1E8NA 3D0KA 1USWA 1TCAA 2QR5A 3DLTA 1MAAA 3G0BA 4UBOA 3PI6A 1A8QA 4S0XA 2WHPA 1P0IA 3G9UA 4GXNA 2JGFA 3FVRA 3IA2A 4Q1VA 3STTA 3KWJA 3WL5A 1N8SA 2WHQA 1ZIYA 4F0JA 2VATA 1K5PA 4ZI5A 1CUBA 3K9BA 5D7BA 3GZJA 4AXBA 3QMWA 1ORWA 3HABA 3D2CA 1GXSA 4GBGA 1ETHA 3H2HA 1CUJA 2DHEA 3DKRA 1LPAB 1OCEA 2Z8ZA 4C87A 4UHEA 2K2QB 2JEZA 2C58A 4BP8A 2E3JA 3LIIA 4B83A 5JAOA 1IVYA 3WZMA 4BZWA 4Y2TA 2PSJA 1KEZA 1MNAA 1EX9A 2I03A 3ED1A 2JF0A 3R3UA 5AOCA 3IBTA 4W1QA 4A5SA 4RE5A 2AJDA 2OGZA 5AKLA 4K6KA 1P0QA 3FBWA 4P08A 2XUDA 5AM5A 4WJLA 4GEGA 1VZ2A 4P93A 3WZLA 1ZJ5A 5T4FA 1A7UA 1H23A 3STXA 4BP9A 3H2JA 4ZV9A 4QZVA 1SCIA 1UKBA 4W9RA 1HL7A 5ALDA 4EBBA 3I1IA 5DLPA 1EB9A 5CT4A 4RE6A 3C45A 4ZREA 3MVEA 3T52A 4AB1A 3G02A 1XZBA 1R3DA 4DMFA 1YR2A 1K4YA 4CCWA 1CEXA 1AQLA 4OYYA 2VJAA 2XMGA 3QYJA 4E11A 2XLBA 5AHXA 4AQDA 1W6RA 5CT9A 3BE8A 1XLUA 3LS2A 1GQSA 3VJKA 2XT0A 1DWQA 4N5IX 2J4CA 4FLMA 1VA4A 1EHYA 4GWLA 3OG9A 4QEKA 4PQEA 3WL6A 2WG0A 5ALGA 3GBSA 1FFAA 5A71A 3VKFA 5ALTA 3C5WP 4DNOA 3D59A 3V9AA 3KOOA 4UFPA 1XZKA 4FTWA 3O9MA 2R8BA 4K6GA 4LKOA 5EIEA 5AM4A 1SFRA 3BF8A 5HF8A 1XRLA 2HU8A 2ECFA 1CVLA 4GLBA 4DMCA 1PJAA 4QDZA 4E15A 1J07A 3WA7A 2HL6A 1IUPA 5HFNA 1CUYA 5ALZA 5AM2A 3VJLA 4F60A 5KWJA 4FNMA 4Y2QA 2B61A 4PF1A 1SCKA 1J1IA 4G9EA 5HZGA 5AI5A 1C7IA 2VJBA 2QRUA 1Z68A 4DLNA 4Z49A 1MN6A 1JU4A 1LBSA 3WL8A 1CRLA 2DR0A 1MX1A 1AZWA 2HA4A 3V1KA 4CIBA 1CUXA 1LBTA 2WM2A 3G0CA 1ZI6A 2G5TA 3FCXA 5AIBA 1ZI9A 3A6ZA 5JANA 3VXKA 2WILA 1QIKA 2IIVA 3F96A 1DT3A 4KAFA 2FUKA 3OTQA 5DTIA 1F0NA 3MGAA 2WFZA 4G9GA 4J0GA 4ZWNA 4K5QA 2ZYRA 4I4CA 1XKTA 4H7KA 4P92A 5D3ZA 4AO8A 3JWEA 1FSSA 1XZDA 3WQHA 4OCZA 4WFJA 3RM3A 4BC1A 2VEOA 1XFDA 5IVKA 3MUOA 4X71A 5ALFA 1R9MA 4B0PA 4B85A 2Y1KA 3I2IA 1X2EA 4FBMA 2BCEA 2QZPA 2RHTA 4DM7A 1GGVA 1Y37A 4IH4A 3RARA 2O2IA 4JYPA 3V1MA 4KRYA 1GQRA 2OQVA 3WJ1A 4BRSA 4QLAA 2EDAA 3B3QA 3R3ZA 3V1LA 3AZPA 2VAXA 4U2FA 5F4ZA 3DOIA 1VXOA 2BAGA 3QZUA 5LYYA 4J0CA 1BEEA 2QKYA 1UOPA 2QT9A 5C8ZA 5AKEA 1GPKA 3PDCA 4X93A 2ORYA 1DTEA 3G8YA 1UXOA 3FSGA 2WUFA 2XUAA 4MXDA 1L7QA 4BTLA 2CB9A 4C6HA 4HAIA 2WUEA 1AX9A 3PFCA 5K3FB 2HA0A 1MX9A 4P9NA 5AKYA 2O7RA 2OXEA 2PSFA 3C43A 4M0MA 4K6HA 2W22A 4UBLA 1IZ8A 2HHAA 1QFMA 3ZLVA 3IUQA 5K3AA 2ONCA 3BXPA 1QLWA 4EY8A 5EIHA 2X76A 5K5EA 2C7BA 5AM0A 1GKKA 1NU6A 5T4BA 4C4YA 1F6WA 3L1IA 1CUZA 4J0JA 3CXUA 2HADA 3DDUA 5JATA 1SCQA 4HRYA 1QIJA 3H1BA 1DX4A 5KBYA 4DSAA 4H7FA 3IUMA 4DMHA 1ZD5A 2GZRA 4KYVA 3FWHA 4X6YA 2H7CA 4KAJA 4B9AA 3C70A 3ESBA 3TJMA 1EDDA 3IUNA 2VTVA 4AZ3A 4J3JA 1FFDA 2RIPA 3DS8A 1H2YA 1I6WA 5FPQA 4DIUA 5DJ5A 1P0PA 3FVTA 1K8QA 5LKRA 1ZGBA 3WK7A 1N1MA 2HU5A 2WFLA 5ALQA 3WKBA 3QMVA 4X97A 5K3FA 1BN7A 1B6GA 2AXEA 3VDXA 4U2DA 1XZLA 5JD4A 1HDEA 2WQZA 1XZAA 1E89A 1IZ7A 1E5TA 2WJ6A 4Q3KA 4DTCA 4EY7A 1FFCA 5E4YA 3D5EA 3NUZA 3G9TA 2HA2A 4B84A 2QTBA 3C6XA 4KRXA 3IB3A 1L7AA 2PUJA 2QJWA 2XUOA 4XJVA 2JGEA 1W76A 1YASA 4HS9A 1XQYA 4UPDA 1XZJA 5JARA 3BDVA 1ZD4A 1ZJ4A 3G0DA 4TVKA 2AJBA 5A7HA 4JH0A 4FWBA 2ZYHA 2RONA 4PSDA 5A7GA 1B41A 1WB5A 1RP1A 4QDOA 1HKHA 5SYMA 2CMFA 1JMKC 1JT2A 2PKYX 4TGLA 1VE7A 3I2GA 3L1HA 3EQ7A 4UFOA 1BCSA 4NVRA 1FFBA 3D2AA 5HCUA 3IURA 2G5PA 2WFLB 5HQ3B 2XLCA 2XMCA 2VSQA 2WUDA 5DYWA 5JZBA 5EI5A 1TIBA 2HIHA 3AJAA 1R9NA 1ODTC 4NZZA 1XZMA 3E4DA 4W1PA 3N0TA 2YH2A 5JZSA 1KU6A 1JU3A 1WB6A 4FBLA 3ZLTA 3ICVA 4HRXA 3HXKA 4BDTA 1XLWA 3YASA 4B81A 3M82A 4M0EA 4X3CA 2H9YA 1XZIA 1VA5A 3W9BA 3W05A 5CH8A 3M83A 1EH5A 2VJDA 5AK6A 3AFIA 5CH5A 4I19A 5C8XA 3OM8A 3CN7A 3NWOA 4INZA 5J3JA 4BCBA 3FLEA 1T2NA 4C88A 4ARAA 1LPNA 1YB7A 2HM7A 3R40A 2HA5A 4N8EA 3G0GA 5LZ8A 4EZIA 3RK4A 3C5VA 3W06A 1DQZA 1XRQA 2Z8XA 2WIJA 1U65A 3C8HA 4MYDA 5FPPA 1E3QA 4CCYB 2BFNA 4KE6A 2EDCA 4LYEA 3TEJA 4G4IA 3KDAA 4RGYA 3DL4A 4DSZA 1LNSA 3JYHA 3D2BA 1ACJA 1K63A 4WY5A 3A2MA 3H2IA 3GA7A 3WK6A 1DWOA 5AI8A 3R0VA 3CN9A 4Y2SA 3PF9A 1QTIA 4BVLA 4A16A 3D4LA 3C8DA 4OB6A 1UK7A 1RYYA 3N2ZB 3DEAA 4UHDA 1PV1A 3F67A 1Q0RA 5BWBA 1H2XA 4H35A 3C87A 4DMKA 1AMNA 2WUGA 1EXWA 3AIKA 2RGUA 2ZYSA 5C8VA 4Q05A 5IVIA 3QITA 1UKCA 2QXUA 2BKLA 1WHTA 4G1FA 4BAUA 3HRHA 5AKHA 1UOOA 5AI4A 1TAHA 1MTZA 1VLQA 4J0DA 4OYLA 4QWMA 5AKXA 3X3HA 1UT6A 4U2CA 5FV4A 4OSEA 3AZOA 4BE4A 3H17A 4W1RA 4JUIA 3O4HA 3Q0TA 2XMQA 3ICWA 3WJ2A 3VVLA 3KSRA 3HSSA 3QM1A 4LXHA 4OB8A 3OURA 4FMPA 3T4UA 5HKBA 2YYSA 4HTAA 6YASA 5JAPA 2HFJA 4JYMA 4MJ3A 2WHRA 4CI9A 4Y9SA 5AI6A 3O95A 1IUOA
chains in the Genus database with same CATH superfamily
2J87A 1QYVA 4PQFA 1YBAA 1R6AA 2COEA 4RLSA 3R6GA 4D4JA 1UPUA 2ZJ1A 3KAJA 3TLZA 1BN6A 3LAWA 1MP0A 2HDHA 4IEIA 2RJ3A 1GT6A 3IMKA 4L72A 4OJQA 3VTAA 1FFWA 5AVUA 1MUUA 1L5SA 1MOSA 3OQ6A 2PV7A 3P2MA 2C1XA 4NEQA 3ZQ6A 4JHXA 2BBOA 2N0SA 1HDCA 1DGQA 3SF0A 3T06B 2QS9A 1ACLA 3IHWA 3WGNA 4LYJA 2X0IA 1DDOA 1RAIA 3BILA 4PBSA 4HLCA 3RVLA 4EHJA 5GTDA 5KU7A 2HC9A 3WL3A 4BEJA 1ZY2A 4DCCA 1UBLS 3NCHA 5AW9A 5ICMA 2FW9A 2LRHA 1IHYA 1WNTA 4TS9A 4O4JB 4QUIA 3RVRA 3FYUC 3RHZA 4JZYA 2D0OB 1VJGA 1F9AA 4DEVA 2IUFA 2HEGA 4AMYA 3CNNA 3BGVA 4UM7A 1ECGA 5I7HA 1RYDA 4A2PA 3HB1A 5DGTA 4J1SA 1H5UA 4DDKA 4ZAFA 3VSCA 3JU3A 1QONA 1UFVA 3NBYC 4F12A 2YS7A 1L7RA 1YO6A 1CUCA 1T8PA 4YO8A 5FJIA 1TUEA 1E9AA 3BMOB 4HNUA 4NI5A 1NZFA 1K98A 1KP2A 2HRRA 3U61B 3T3MB 3T1VA 1RACA 1XYGA 2FKAA 4LHXA 4R05A 4BMPB 2Z57A 4K9QA 3DCJA 4L3OA 2VK8A 3FGPA 4FFSA 4KHZA 3T3IA 2VT7A 4AQ7A 3RRBA 1N7HA 3K20A 3S1SA 4NKRA 1C5KA 1WY5A 4M1ZA 4P86A 4RKWA 3KEOA 2G36A 4KBGA 5EE9A 5FBRB 3IUJA 1MC8A 5FR1A 2F3QA 5LA6A 4BMDA 4FX5A 4RY9A 3TFOA 2DHRA 3GUUA 3ZWAA 2B25A 2WHEA 3K1JA 4R8VA 1FOEB 4K2HA 5CLGA 3WIDA 2GZAA 1ZUHA 3PT9A 3KC2A 4BMVA 1HE2A 3LX5A 1N33B 1N2JA 1YOBA 2DM6A 2J9FA 2D1SA 4IX9A 3GLFB 2GK4A 5COBA 5BN5B 3PL5A 3NGMA 1XJWA 4ZYUA 2ROQA 5FOWA 3ZKWA 2VQEB 3D6JA 4GNKA 2IKSA 1QDEA 2CK3D 4GUDA 3L1UA 5E6UA 1DAFA 2OZPA 2R6CA 2WIAA 1DARA 2X23A 2YINC 2FVYA 1WXWA 2KLHA 4R2MA 1ISSA 3U3JA 1O87A 3DNFA 4TL7A 3ZG6A 3KWFA 2VHXA 2ZJZA 3P5BA 4M76B 4NC9A 3NUQA 4B5KA 3U7EB 1Z5WA 3D7RA 3DBHA 2B94A 3NIFB 4MKGA 1HDYA 2G77B 3E03A 3KUXA 4WZBB 1QMPA 2E4UA 2QV7A 3ZD9A 3PEWA 3SZMA 5DZSA 4I46A 4RHCA 3LX8A 1SB9A 2HXGA 2QQGA 3I2FA 3OUZA 4TRRA 4XXHA 3MYYA 3EG9B 3Q2IA 4MCJA 4U4AA 4O4HA 5A9SB 2VUHB 4LXYA 3DOFA 4QATA 3I12A 1V2GA 1Z5ZA 2AE2A 3FNRA 3HXQA 5FORA 4GXTA 1P9NA 4KR0A 5MN5A 1IOWA 1VPTA 3E35A 2AFRA 4MS4B 1W5TA 1P61B 1XCPA 2O2JA 2HOQA 3H5WA 1CUIA 4H7EA 3ZGNA 4XRRA 4UTPA 1W85B 1SXJD 2CVOA 1JDUA 1FUEA 1SUPA 1IG0A 2JAXA 4IMRA 4Q1FA 4CMJA 3VU1A 1IBLB 4MX8A 2XXBA 1NJ2A 1OLOA 3LHDA 4YREA 3R7WB 3PQ3A 3UMJA 4E09A 5HSGA 4X1YA 2FF7A 4Y2HA 2JIOA 2OPBA 2C9YA 3N5CA 2HNKA 1D6JA 2O2YA 3B5IA 1Z34A 5GOZA 4NNOA 4QEZA 3RC2A 3ZVRA 3T7IA 1DG9A 3UMFA 4EG8A 1II8A 1YB6A 1DQSA 4DUGA 2GM3A 2ZTMA 3F7TA 1JPUA 4H6PA 4F91B 3GJ4A 4C0XA 3PP8A 4JL6A 4P5EA 5A2QA 1Y82A 2PPLA 4M1YA 1FNCA 4RU1A 4D3DA 4KXQA 5L40A 1Z25A 3HKDA 4QBFA 4D4LA 2IV3A 2HW8A 3PDHA 4IIHA 5KOJA 1T4MA 3WL7A 4ESOA 5ICSA 3BCHA 3GT3A 3OPMA 4MKFA 4OU4A 4BNNA 3BWDD 2BUCA 4XQCA 1D0SA 2O1XA 4BX8A 1PNTA 2XB4A 1I6KA 2ZI4A 3AVQA 4OXIA 2NVUB 1XTSA 1NBOA 5K3CA 3NB0A 1N6LA 4UTNA 2P69A 4X8LA 1JHRA 4F2HA 1CHDA 1OMOA 4J3FA 3ZCRA 5AVRA 1M2EA 5DNWA 5TIIA 5G41A 5JVDF 2A1TS 1H1DA 1CV2A 4AYXA 3QEKA 2FLVA 5GAJA 4OJTA 4LCJA 1EAMA 2GPNA 1E3DA 3TE7A 2NU7A 1OAOC 4J07A 2FE4A 4FR2A 3OOSA 4FB4A 1XNGA 4TROA 3PI7A 1KGSA 4YJFA 1VE3A 4KIGA 1D4FA 4YRJA 4BMYA 4IEFB 2CNKA 1IBRA 3HNRA 4IQ8A 1QIEA 3ZKWB 3UPTA 3Q0EA 4FMDF 3BIJA 3I2KA 2DZDA 5AW6A 1EFVA 2IY7A 4L6CA 3X1ZA 4W5QA 3H7AA 3H5LA 4D9IA 3BMNB 3AVOA 1Y34E 4UVHA 1JQAA 3F49S 3VPSA 4E5NA 3E1SA 2V1UA 4PZAA 3EXG1 3H19A 4K9RA 4P5PA 3RIGA 1VECA 2PMBA 4RSRA 2PFGA 4RNCA 5CP8A 2QTGA 4D4GA 1TQ4A 1XMPA 5TMPA 2AN9A 1DL5A 5TB5A 4ID9A 1WKBA 1XRNA 2FETA 2IXFA 2IZ6A 4B2IA 1EGAA 3DQZA 2AW3A 1I4DD 3VI4B 1TD1A 3I53A 3EBLA 4JT4A 1Z5VA 2QE7A 4ZEOA 2RHDA 3K73O 3PU6A 3EIOA 1OKKD 2OCBA 3IVGA 2P9JA 3V8MA 2FWJA 2J0SA 2ZR7A 1Y6ZA 2SKEA 3KIPA 2FPKA 3ENQA 4KWEA 1Q1NA 5EZ5A 1ZN8A 3V2IA 5CFLA 4N48A 2QVYX 1KFJB 1N5DA 4S1OA 3SLGA 5KJFA 4G85A 3AQ4A 3UMMA 4C4OA 2HJ9A 4LYFA 3R75A 5CH3A 2Q1YA 5EIAA 2D1QA 2HGZA 4FFLA 4UTOA 1S2IA 5DB4A 5K2OA 5ALXA 2H7YA 1LSSA 4FWTA 4OI1A 1L5RA 3EXFB 1NBEA 5K3BA 2XTZA 4H6VA 1OA1A 1GIAA 4YA6A 4XM0A 5JG7A 2I3DA 2YZ7A 4L9AA 4Y2YA 4DQDA 1L8LA 5C34B 3S28A 1M76A 5A3RA 1QU2A 5BWCA 3CT4A 1AKEA 1NTOA 2QLTA 3X1DA 3V8RA 2JFBA 1VL2A 5AW0A 1QKIA 4YPVA 1AKTA 1B4DA 1SUEA 3OX2A 4AZVA 4ZI3A 5LPNA 5EJFA 4RKFA 4WCDA 4G0QA 1WQ1R 3FWPA 1PR6A 4JU8A 1BRTA 3W5IA 2N1MA 3VNQA 4N7RA 1KMHA 2CWWA 1R6BX 2JB9A 2W5UA 1JDTA 1KH1A 3VGPA 5JADA 4XGNA 2Q62A 1FFSA 5TE9A 4I4TB 2WWIA 2J30A 4GZ3A 2YNMA 1J0EA 4WKOA 3O3CA 3KZOA 4IGAA 3OAAD 1ZPDA 3CJQA 5C81A 4M8LA 4Q4HA 5F9HA 1HYEA 3HDHA 3COWA 3MJRA 1QPBA 3ODGA 4IHQA 4XCXA 5BRJA 2NSLA 5LP6B 2O2CA 4QX6A 4FXPA 3VJMA 4HXFB 3SU8A 3SQXA 1UFQA 3NLLA 1Z29A 1Y3CE 1JR3A 4JYBA 4LRSB 3FSGD 5U1PA 1DJLA 1OZFA 2W2XA 4D9NA 3VSBA 1GKUB 4WY2A 1KI3A 2C82A 5DT9A 3JQ8B 4XQ0A 5KOYA 2BMDA 3GAMA 5CRIA 3ERCA 3A28A 1QQ5A 2CNOA 1B7GO 1XDZA 2R9VA 2VPWA 1ABFA 5JJLA 4LNHA 4DJ5X 1BIFA 1IQRA 4D9GA 3DOUA 1C3XA 3CNEA 1J7JA 4HNHA 4P4LA 3S1AA 2QIOA 5I4BA 2B8TA 2R6AA 5CJPA 3AFGA 1GA1A 1X7WA 2SHKA 4ZU3A 1GGJA 2PX3A 3EDOA 1MRNA 4EK9A 4ETMA 5KUTA 3JZIA 1CUFA 3H1AA 1HZZC 1N2XA 5CW2A 2W8ZA 3JD2A 4UXIA 4TKZA 5ECGC 2WIBA 3WLMA 3ELBA 1YZYA 3REQA 3QBVA 2FOIA 2AL7A 3C3MA 1XXHA 1LI7A 3BD9A 1SCAA 3CLUD 5D1NA 2VPTA 4P81A 1NLMA 2X2FA 4X00A 1XZGA 4QD3A 4EY5A 3EUFA 4U9HS 2FJPA 5H68A 3PGKA 2FSIA 3WL4A 1XCLA 4YDRA 3A58B 1HNWB 1P73A 2ONKA 2QMYA 2VT3A 2H4YA 2JNWA 2ZRNA 2RHBA 4B7UA 1WBBA 4RPCA 1GG9A 2MTBA 4F5ZA 4PBTA 4ADSG 5CMLA 5C1OA 2BKEA 5DHAA 4EFDA 4QOSA 3I76A 4AXXA 2GF0A 1QAMA 1GNQA 1OLXB 1XMJA 2XTNA 1LVHA 2OD9A 3H2GA 2HHLA 4NBSA 4HC4A 1AGXA 4HQ6A 5THXA 3WADA 3FR8A 4JIMA 3PEUA 2AXPA 5HJ5A 2ZYWX 3C41J 4YJGA 1U2EA 1FEZA 2KPOA 1UINA 3KKEA 2YR0A 1FDRA 2I2DA 2RDMA 3L7DA 3E8XA 3VC2A 2JCGA 4D80A 4GR9A 2YX1A 1GHTA 1FTYA 3BMCB 3GRCA 3ECAA 3OZAA 4RAOA 4LWQA 3BZUA 4MIEA 1YTUA 3GGGA 4IWXA 1KK3A 1AC5A 3LIPA 3OF5A 3EWIA 1P3DA 5EUCA 4KI7A 2DU8A 2FKNA 3B1JA 3WWOA 2P7HA 3QXXA 1W48A 1QIGA 2C3OA 2HA3A 4QYWA 1BZYA 3BMNA 1U2TA 2QL9A 3FTNA 2Q7XA 2VKQA 1F2DA 3ILVA 2WIFA 2J7PA 4K9SA 2PMEA 1VHQA 1Z88A 1W4RA 2PQMA 2VRCD 2XF8A 2UUAB 3WAGA 4G8BA 3L7CA 5DOVA 1A9RA 1W4LA 1TUBA 3B5EA 4IRMA 4MW7A 3RIHA 4DNFA 2C9OA 4ZRDA 1FLNA 3FIJA 2ZUVA 3M6VA 5FWDA 4XAQA 3D3KA 4HNGA 5F78A 1DJMA 3KHKA 4O2AF 1EEXB 1O9HA 1Q95A 4G5OA 5EYPA 2A35A 1P75A 1TKRA 4RZ3A 3QSYA 5JWOA 2XDQB 5EP3A 1NONA 1JQJC 2JL1A 2VUTA 3FJ1A 3PXCX 1W52X 4MWZA 5DNVA 4PR3A 2IQ5A 4W82A 1L4HA 3BE6A 4O3FA 4Q03A 1RBMA 3OE7A 2P2ZA 2Q45A 1JH8A 1E9DA 1V1MB 4PAQA 2H8KA 3QEMA 2G28A 2PZJA 1DAGA 3B38A 2Z1MA 3CR3C 2QPAA 4TWIA 2BM1A 1TC1A 5TXGA 2EOAA 1PJLA 2IITA 3THSA 4X62B 1S2OA 1FS4A 3WFIA 2G1UA 2XH8A 1VE1A 1XE3A 1ZH6A 3EGXB 3IMCA 5TPWB 1UMDA 4LMPA 1T1JA 1V6CA 3G8DA 1Z08A 2C2GA 2HLDA 2ONYA 2BRUC 5LYJB 1U94A 4B76A 5ALLA 4MR7A 4ISBA 3UY4A 4S1NA 1CE8A 2IHBA 1R0YA 2WHPB 4J7XA 3E7XA 3FCSB 4YRQA 4DFDA 3KUKA 3UCXA 4TLBA 1M7HA 4KI0A 1XMQB 1B6RA 2EGGA 2FMIA 4A8JA 3GEEA 2V98A 3FMVA 1H2ZA 1MPTA 1U2SA 2PSEA 1JWLA 4PZEA 1GZ6A 1P31A 3WO1A 2RIRA 3FYUA 2YY6A 1UOQA 1ST3A 2HK7A 3RFTA 2EQBA 2JAPA 3IDZA 1XEAA 1VL5A 1KJQA 4I4TA 4PV7A 4KFCA 3HFRA 3WHPA 4I99A 3UV6A 2H06A 3R20A 3A26A 3NASA 2AXNA 2CYAA 3LPMA 4ZU6X 5CDGA 5HPYB 4E5DA 2RAUA 4GX5A 3QNMA 3UJAA 4M21A 3AOEC 1DO0A 1MCZA 4HFJA 4CFSA 3CZRA 3ZDEA 1JXAA 1L5GB 1DEHA 3DLAA 5B3LA 2XE7A 1RXWA 5CTJA 1B8NA 3QBDA 2E4XA 4ZAVA 1KZYC 3EODA 4GIBA 1W93A 1XD8A 4IH1A 4ZTZB 1EJ0A 2F9FA 1AHNA 2HI0A 1YKGA 1QGYA 2XMPA 3KLBA 3KKOA 4HBGA 1F1BA 4J03A 1NV9A 3GT7A 5CJJA 1LXCA 2W98A 3HVUA 3O9VA 1F5NA 3WKDA 5BMVB 4EIWA 5IS2A 3LBNA 3SD7A 3USZA 4DIBA 4HNQA 2B6HA 1NLFA 2ZR8A 1QUFA 2GPSA 3LFTA 1AZLA 1O08A 5LNK6 5KNBA 3KBOA 3ZVMA 1RHKA 4Z2YA 4M46A 3RBZA 4CF5A 4BQEA 3HKEB 4JB2A 1I2BA 3G1WA 2PX6A 2XA2A 4R9RA 1YQDA 2CVZA 3DGFC 3SNKA 3JQ9C 3AHHA 1GRQA 1OOEA 1OSNA 4XVQA 1H65A 2VPPA 3BAZA 2ZUUA 3PA8A 4ER0A 2GASA 1GRCA 3LT1A 2PWPA 3I6IA 4GGOA 4EY4A 1IMJA 2OCPA 4UHBA 1XXHB 1ZBQA 1O95D 1ZIPA 2F48A 3BIWA 2IHJA 2F43A 3G2KA 3OO0A 4JP2A 4UNRA 2HHHB 4TYPA 2X8JA 4EWLA 2Y3IA 1NT2A 2PZAA 1P1CA 3OUTA 3OT1B 1TJPB 1IY8A 2L18A 2R60A 3MXOA 4W99A 2HIGA 3ORRA 2GZ3A 4CM5A 3VISA 3H8JA 4LQ4A 4YI5A 1E2NA 3BL5A 4J90A 2XBLA 3U4QB 1G2IA 2WI8A 4RD2A 4CG1A 2IZ7A 3I5AA 4A0HA 2WE8A 1BC5A 3NHMA 3IKMB 1WOYA 1ZLXA 1R4NA 2XIJA 3GRZA 4BJ3A 4EB6B 2JLUA 1ZNWA 2JCVA 4J16A 5IN4A 3QU5A 4JHLA 2I2AA 2XMBA 1M1YA 4Q9LA 4EB8A 1T8WA 2G6TA 2LCQA 5FCDA 1AKWA 4C29A 1E77A 5LYJA 1LSOA 3O8DA 1WE2A 4BLRA 1W29A 3EGEA 3PC6A 1QZXA 1HTWA 1PQPA 2R7AA 3KHUA 3B1XA 1CY6A 1JA9A 2WSSD 1HSOA 4I0WB 4K6OA 2QVBA 1NFQA 3T1QA 1X1CA 3FN4A 4FYMA 5E4TA 3TRIA 4R31A 3O8QA 3JQDA 1SK8A 4B3TB 2VHVA 1YA6A 3ZR4B 2VCHA 2E6UX 1M66A 3FYUB 4B7ZA 3GEBA 1BW9B 3AUJB 4FDUA 1RU3A 4Y7DA 1L5NA 3HH8A 4G5SA 2DUMA 2G9ZA 1MVNA 5HYVA 1PK8A 3NHSA 2OXRA 1JYSA 1NE2A 3O93A 1E3WB 5I48A 3OFSA 4RJTA 4X7BA 4D81A 5TNXA 2GM4A 5PGMA 3URMA 2XMSA 1OFUA 1P9WA 2MINB 2PGDA 4NZ9A 2XA9A 4Y2JA 3RS4A 3V8VA 2Y77A 1UK9A 4ARVA 1MKYA 3KKNA 3WMXA 3EC1A 2PU7A 4J91A 5JFTA 3PQ4A 2IIPA 3ONWA 4JBXA 2GCOA 4HLDA 4Q9IA 2WK1A 4P8RA 3AF5A 3IOCA 4JLOA 3N6XA 4GAEA 4UTVA 4PS0A 5CDSA 3KSBC 3AR3A 1RRGA 1X39A 2O50A 3RVNA 4J0KA 1G3UA 3EA5A 4ZT6A 1PU2A 4JOCA 4ZI2A 1O6ZA 3MOGA 3MUNA 2F8MA 2OP0A 3CG4A 3IALA 4H7HA 2VL7A 2H1LA 4IILA 4NY1A 4R40A 4AZTA 4DOMA 2AUTA 1W4AA 2MYPA 3KNZA 4UBJA 3K9FC 3H2SA 1KQFA 4D56A 2XUHA 5I7FA 5JRJA 4F06A 1HNZB 4EUHA 5AUPB 2I6FA 4H6WA 2Z5VA 1WDKA 3E9ZA 3ZD7A 1RWNA 4WTOA 3GPCA 4JKOA 4BGIA 4BECA 4CYMA 1ZSNA 4JEHA 3RI3A 3UB3A 3TPCA 4DPKA 4R83A 3OCWA 1C8VB 2GK7A 3DVLA 1IDN1 1WB4A 3KEQA 5AO9A 3SLRA 5I4KA 1N32B 4JOQA 2FSUA 1EX1A 4BNYA 4Y1FA 1WPRA 3TRDA 2OWEA 4AD8A 2G1PA 2QSJA 3TPFA 3UK1A 2G8NA 1CQZA 1OLUA 2BKAA 1Z6ZA 2K5UA 3CO0S 3IO5A 3AL0C 3DDSA 3SS7X 2Q2OA 4NHEA 3TN7A 2QDKA 1KDYA 4DSUA 4TWJA 5LP6C 3TW4A 1NBHA 3QW4B 2A5JA 1E2IA 1UBHS 1IEXA 3C6ZA 3ODPA 3V42A 4TYWA 3P9QA 1JRLA 5BV7A 1UKVY 2I2CA 2JAUA 1JAHA 2G72A 5ADWA 5DGDA 4ZKDA 4DWOA 1PZMA 1YZUA 4G56A 1PRYA 1XNHA 3K31A 1JBEA 3DF9A 1X1TA 3FMFA 4FDMA 1NBIA 1LC3A 4N0MA 4RACA 1BS9A 2LNDA 3C15C 3G7NA 4LZAA 1G20B 1TKBA 2JVJA 2P3QA 1RXSA 1Y6QA 1QFSA 4GRAA 4CUKA 3MWEB 2CC2A 1SHLA 3S2YA 1EDOA 4KP7A 4LOHA 4P4UA 4EI8A 1IY0A 1K7EB 1QPZA 2FPRA 3LD9A 2R8OA 2R8PA 2VYCA 2WVGA 3L0OA 4FMCF 1KZGB 1P60A 3ONDA 5T4EA 4CPDA 5JAIA 5DX1A 2BF4A 5HOEA 3PLAE 1TKAA 2BGRA 3R0JA 4ROTA 2R6GA 1B2LA 2VJKA 3L4EA 4US0R 4Q7LA 5BW4A 4NF2A 4RDXA 2AD1A 2CUTA 4JVNA 2PDAA 2HSEA 3EJ6A 3PCRB 2BFAA 4DG9A 4L4YA 3FPKA 1Z6AA 3B6IA 3FKSA 4E5SA 3RS8A 1E20A 4EGAA 3PFHA 4WN9A 4TMVA 3O94A 4RH0A 1SZCA 3P2IA 4DQVA 3NYRA 3BH0A 4A6XA 3T7JA 1WXGA 3FE2A 1RQNA 3HL4A 4Q1AA 3DKKA 4FQ7A 5AW3A 4N0PA 3HM9A 1G55A 1AKRA 1HOXA 2IF0A 4C0KA 5IT5A 4NBKA 1U7HA 4TSKA 3TKAA 5YASA 2D5CA 2KHZA 2AJ8A 1XEWX 4CLOA 2I2WA 5HUQA 5KYNA 4LXIA 1NI3A 2GSWA 1ESMA 2VJMA 1L4FA 1V5IA 2FK7A 5AKJA 3NTRA 2VZ0A 3M33A 4RTQA 5IK2A 4BNDB 3HDYA 4PBRA 3UXEA 2FPLA 1NR1A 2JIPA 2YDXA 3ANLA 1HQKA 3E5MA 1NVUQ 1NYQA 1IN1A 3I01A 4JT8A 1KOGA 5AKGA 2QY6A 1VLVA 1ZWLA 3QSGA 4HATA 4A2WA 4RHXA 1SY7A 3AJRA 3HL0A 5CFMA 3GGPA 1E2PA 1QO0D 1LB1B 1U5BA 2JJ2A 4H77A 1UADA 3UV3A 4DIOA 4PYJA 5CEEA 1KEKA 3TTXA 4ZOQI 2G82A 1J09A 1RXEA 3OIYA 4URYR 3L7KA 4DM4A 4YAKA 4QGSA 3NRJA 2E5FA 4FHFA 5IXYA 2NG1A 3MMSA 3AEKB 4REQB 3PFGA 1AM4D 1UZNA 2BTOA 2ZTLA 3A6EA 4CG0A 5I9SA 2HJHA 2ZYAA 1VYHA 3ANMA 3WLSA 1VP9A 4GP6A 4IUCS 2RI6A 4RZIA 3L79A 3H04A 1WUJS 1F14A 3OBBA 2A5LA 4TL8A 4XWYA 2W2VA 3RIMA 3SKVA 5B58C 1E6LA 2C8KA 1J23A 2UZIR 3QPAA 3ZK8A 2ZRLA 2DKOA 3O8QB 2OCKA 2Q0HA 4QDJA 4XH9B 3LUKA 4XD7D 4BPRA 1UEIA 1FMTA 4JI0B 3UAOA 2Q0QA 3ENNA 5AM3A 5DM70 2OOSA 3IKTA 1YR1A 1KRXA 3ILSA 1CIPA 1Z4MA 1WL8A 3C3BA 1K9SA 4NYIR 4O2LA 1YR6A 4FDVA 3CG0A 3K2BA 4HDCA 2RGNA 4GXQA 1SQ0A 4DTIA 2XCSB 2ZVQX 3BWYA 3PZBA 1KJ9A 4JNCA 4PGFA 1ZJYA 4JASB 4UBMA 1MAHA 1JTFA 2BTQB 3W8FA 3SC2A 1ZH0A 4ACBA 1ULBA 1LX6A 5C37A 4MAMA 3A6PC 4F3CA 2A1TR 2W6OA 4ODIA 5HIAA 2WPDA 2ZZMA 4EHKA 2FJ0A 1J97A 1GXSB 2GVZC 5FL3A 4S24A 3I4CA 2BRUA 1T2CA 2GCOB 1O5IA 2GN9A 4RMHA 4ZVMA 1P4AA 2BEUB 4YXWD 5JFOA 4JYZA 4B8WA 1XP8A 3HR8A 4I5EA 4AY6A 4B6EA 2HB6A 3SMQA 1Q3TA 5C8YF 5DISB 2QRZA 5JU6A 2TRSB 4BFYA 1JHVA 1VMIA 4MEAA 4L22A 4RVFA 2IWRA 1MG5A 4I55A 1LEHA 3AESB 3GGDA 2GTHA 1E5XA 2H1OA 4DLUA 1R2QA 3NRCA 4LX8A 4X92A 5J9FA 5ELLA 5LJLA 4URXR 4LMAA 1JHOA 3RJTA 3ZW9A 1E58A 1F8UA 4NCXA 2HF9A 2QG9A 4UBIA 2XJ9A 4WKGA 1RPJA 3HACA 1YK1A 3I73A 2YCBA 3TDKA 1KWGA 1H4TA 4P84A 4ZALA 1EXMA 4YVFA 2IK8A 2FPPA 3OIWA 4NBNA 4RIHA 1B43A 1P3JA 3CIFA 3RJZA 3FTCA 2V74B 2WZDA 1D2HA 3H9QA 4S2UA 3P9PA 2CFRA 2GR9A 2H1RA 4C0WA 1H8HA 4HH0A 5I9IA 3RV3A 2IU0A 1Z2PX 3I1FA 5JAUA 4LYYA 2L19A 4BNDA 1H0HA 1YRQA 5J2UF 4TS4A 2QVLA 3VR4D 1W4ZA 4MCIA 4J43A 3CQ9A 3Q11A 4DADA 4URVR 3ROKA 4Z9BA 1B0PA 2ZI3A 2DHDA 1NP6A 3HE3A 2Z3WA 2E87A 1NZJA 3WDLA 3QUBA 3TX2A 1XQXA 3DCNA 4EX7A 4GYKA 5T6MA 4XLZA 1RRPA 3JYPA 4NYMQ 1U5BB 3MCZA 4IDBA 4I2VA 2XEDA 3UMGA 1XVIA 1B8VA 4JC4A 4L95C 1ISFA 1BHSA 1NLZA 2ZSEA 1K08A 3HV0A 4XD7A 4BX9A 4F4HA 5KHAA 3OQIB 4IRXA 3AI7A 1G20A 4BP1A 1JP7A 2Z5GA 3WBFA 1AQNA 3MLBA 1EGMB 5BT9A 5EY5B 2B7CA 4C7BA 1T3HA 2WJHA 5CD1A 2QMEA 4KEAA 4X1IA 1MD9A 4CHTA 5HW0A 4B3CA 1XWIA 1XL0A 4WCFB 3P2YA 2IXAA 1BGVA 3K0BA 5LBUA 2QUBA 2O5RA 2WF8A 3K05A 4EDFA 5I7RA 2PWZA 4I5IA 4MKZA 1D6MA 3QNWA 1Y8QB 5AXCA 4QFDA 3NETA 3KCNA 4LN1A 5D51S 1R15A 3A3NA 4IDOA 4WN9B 2GBGA 2CHVA 5TPZA 3RD5A 2AEFA 4MDFA 1QHYA 2AFIE 3HJAA 2FW7A 1XHLA 3IFSA 3LRPA 2JI4A 5KVQA 4DPLA 5DCYA 3FTFA 1JPVA 1YVRA 7YASA 3BTSA 1WUIS 3AP3A 5DYIA 2OR3A 2YIMA 3WSTA 4JSTA 1GA6A 3GRRA 3QHAA 3ZS9A 1L4UA 4OJKA 4JUCA 4WXYB 3IUBA 3KYCA 2K7ZA 1J20A 3JCZA 4EYOA 2KLBA 4G0VA 2BEUA 2KSQA 2JI8A 2OHIA 3DJYA 1VLLA 1Z4LA 3RK1A 1B0AA 4MGIR 2ZSUA 1IUNA 3RYCA 3NGLA 1KYTA 3T5AA 4L8YA 3ENVA 3EIEA 3PNLA 2G5GX 2Y1GA 4F6RB 2WJVA 4CMGA 5KWIA 2WWGA 2FK8A 1MV5A 1O4VA 1OHHD 1X7ZB 2DBRA 2J59A 2JVIA 4OKSA 2BZSA 2MYNA 4QO7A 1G66A 2AQ8A 3PNPA 2XMRA 1K97A 4EQ6B 5TS2A 4LZOA 2FRDA 1PT7A 3WWYA 5L8VA 3B2QA 4AKSA 3R9IA 1P44A 2CZGA 3IIIA 1WLSA 3E0XA 4I50B 5MFZA 3NTOA 3FD8A 4D97A 1QK5A 3T4EA 3OQ1A 3HMKA 4QSHA 3PFBA 2XD9A 4FZRA 2JGLA 1GKLA 2PQ6A 3AC0A 1Z5GA 1OZ0A 1Q3HA 3LK6A 3NAZA 3WLPA 4AMUA 1NKSA 1IHDA 4QECA 3NHFA 3QXSA 3CS3A 3L9WA 4BNMA 4HDNA 4YJ2F 1T2VA 3ETJA 2VIIA 4RGVA 4CM7A 3DUFA 3VPFA 4LX0A 4D7AA 1OYOA 1NIPA 1I6MA 3FWNA 3GU3A 3I28A 3TGLA 1ODJA 3IAHA 2VHEA 1SBIA 2VSXA 2X22A 3EXHC 3R7LA 3OAAA 1T2FA 3D6VA 1THZA 2YFYA 5DI3A 2XKKA 1CQJA 2JJYA 2A9KA 4GQIA 1FIUA 3TEMA 1JR3D 1QOPB 3PG5A 1KDPA 2IGTA 3IAEA 1WAMA 4JBNA 1H6DA 3ZI7A 4DDMA 4EJFA 1U8TA 4C2UA 1ZQ1A 2RCNA 3OWOA 3V4SA 5JQWA 4U2GA 1Q1GA 2Q7DA 3AY0A 2VJLA 3S8EA 2QENA 2Z4TA 3CMMA 3OTWA 3EDRA 3WVNA 3AFMA 1VM6A 4EA8A 1OVGA 4GOOD 3OM0A 5B7GA 1RYNA 4HGNA 3UKJA 1BE0A 4QUKA 2DLCX 2JFPA 1J8MF 1HG1A 2X4GA 3MZ0A 2BR5A 1Z7GA 3SQNA 4DCJA 1RDFA 2VHWA 3F46A 1S02A 3LUHA 1EJ6A 1DEXA 5FOQA 5ITZB 2H9AA 1TOAA 4UZEA 2UKDA 1CEYA 5FF9A 3RT1A 1I3KA 2Y0EA 2VA8A 3KALA 4PRKA 5KWEA 9ABPA 3UT0A 1Q0LA 5K99A 1W25A 3I4FA 5M2QA 4L4RA 5ED0A 4ALMA 1EFUA 1G8YA 3N0WA 2NO6A 4YRBA 1ST2A 5AM1A 4Z1MD 5ITWA 4DV6B 3H4IA 5JJKA 2L69A 3QELA 5HKKD 1BWPA 4FK8A 3DBVO 1YCHA 1JDBB 1NMXA 2Z3ZA 1L7MA 4IS2A 2NQTA 3KZKA 5CVEA 1US8B 4GNRA 2HXSA 4RVHA 3HJHA 4FYWA 4V0SA 3PNVA 3ULKA 2GVNA 3HPQA 4PHHA 4JELA 2HR1A 1NVBA 1RJEA 4LXQA 2OBMA 4B9EA 3ND6A 1RI3A 4S1WA 5D3KA 1JDSA 2ODEA 5H9WA 3G0IA 2YJ6A 1N2SA 1RXVA 1QGUB 1XQWA 4WDRA 1BVRA 3HLYA 5BOSB 1KAGA 4L7VA 2Y27A 3T61A 4WZBE 2NQ2C 1SBTA 1UKEA 2BFEA 4PG5A 3V5NA 2ZB2A 2ZCJA 1YHNA 4LF7B 1VZ3A 2QZJA 4IDPA 1LW6E 2F7SA 3PDIB 3AXTA 1QK3A 4KE8A 4LE1A 4REMA 1V8BA 3K0FA 4MJXA 4Y6SA 4BUZA 3J7AC 3TKLA 2GGSA 2HSZA 4P22A 3BSSA 2XB9A 4M2LA 3THOA 3PC7A 1DG3A 3NHBA 4KW7A 3W2TA 4AS2A 5JISA 1ZIDA 4I08A 4Y2RA 1JDPA 2GHRA 4ZI7F 1TD9A 4YQEA 4E46A 3ZGLA 1VL1A 4KNWA 4UUPA 4BPBA 3M3DA 5SY4A 1SUBA 5CX1A 1R9GA 4D4IA 3ME5A 4LOLA 4JDUA 4B47A 1NA5A 2ZANA 4LRQA 3P9YA 2DQKA 3TGWA 2EZTA 4FVTA 5J5AA 1U3TA 1Y89A 3OF2A 3GFOA 3E15A 4C2BA 5HK9A 5CCBA 1B1AA 3MB8A 2B8EA 2WSBA 3LUAA 3T3GA 1RABA 1YAJA 4MVYA 3JZFA 2UXDB 2VP6A 1HLPA 3C4JA 1YWGO 2X5NA 2RK6A 4FNAA 3P9CA 4M37A 4YFVA 3T3HA 4BO0A 4YDHB 1OBOA 5JS6A 4E1VA 2BFWA 4ATNA 1RQPA 3KXLA 3IR5A 3H75A 4UEWA 3FNGA 4ZO7A 3A6HA 3G2OA 2XEXA 4ZQBA 3FOBA 5F9FA 2YOGA 4WK4B 1OH6A 1GSHA 1N2OA 2P9FA 4J0IA 2ZQYA 3DTVD 5JYDA 2GXAA 4J8PA 2PUTA 3LECA 4GMGA 3T4PA 2ZUEA 1M9NA 2EEPA 2Q5OA 3TINA 4GC5A 4E5VA 5B37A 3KXPA 5HRUA 4OQ4A 2NTYC 2W2PA 2X5OA 1SIUA 1T25A 3V1YA 3WGZA 2IEIA 1S8NA 2RHWA 2IEGA 3D3NA 3R6TA 2W9XA 2QTZA 4WLOA 1NJ1A 1TQ6A 1Z3CA 2B69A 4ZVUA 2RAPA 4NULA 1ODKA 3HB4X 4EB0A 2YCLA 4GSYA 4F3TA 2VYNA 3CF4G 1UBTS 4LJSA 3CUVA 3GJZA 4KWCA 1EA5A 3EBOA 3MWGA 2VH5R 4RQTA 4F6RA 3R5HA 1ZGAA 3GOQA 1HYBA 3AIOA 3IUSA 4P7BA 2EG9A 3OCZA 4UE6A 5KAMA 3ZIAA 4FBGA 4IIFA 3IILA 1X7ZA 2DT5A 4GKVA 3TRKA 1EWKA 4I5GA 1W36B 3AUKA 3MJCA 4ILEA 1HGXA 5EHZA 5COQA 1Z2OX 1PVDA 4QTUB 5EMNA 3NEJA 1Y33E 4D9JA 2FE1A 1U81A 3AR2A 2WM3A 1QIMA 3SGLA 2QUZA 5EZSA 3OHSX 3IOEA 2V7QD 1OFGA 1C0EA 3CEMA 4X94A 3CVOA 3OOWA 3ICOA 5DK4A 1EB8A 4W6ZA 3KJFA 3WRYA 5E3HA 1N3IA 1VIYA 3MM4A 4G4SO 3DUFB 3L0ZA 3T7AA 2VYQA 2A0KA 1K06A 4OL9A 3P19A 5E8RA 1FTWA 1CUAA 2BV3A 2R6R1 3B2NA 3S2IA 1ONPA 2OUIA 4QHSA 1V43A 1G42A 4WZAB 1XWFA 1YS9A 2RG1A 1RC8A 3CX7A 3K94A 3KYBA 1I1NA 1USVA 2FWAA 2FSPA 4WLVA 4CW7A 1ZH4A 3KPJA 3QG5A 2JD2A 3MJTA 1NJSA 5KTSA 5KTYA 3FWZA 2ZXFA 3RVOA 1Q1ZA 2YY7A 3BWCA 3VAZA 4C7XA 1JTVA 4Z4QA 1F7UA 1N5JA 3GH3A 3Q10A 2DFVA 2ZXEA 1O54A 2D0DA 3E5NA 3O74A 4R81A 4TN1A 1OIXA 2J5QA 1TEVA 3E3NA 3A7EA 3H1TA 3MAGA 1IN5A 2WB4A 3LLVA 4HEA6 4AMVA 3T5TA 3VKVA 3FM9A 5I45A 2KB0A 3I32A 3KFVA 3GPIA 5H4HA 2NACA 2WTMA 4UNIA 1DXHA 2ZSHA 4QDKA 3TSWA 3X1XA 4EGQA 1NC3A 1CDZA 1XDUA 3JQPA 4A73A 4CCYA 1E2DA 3PIIA 4UTRA 3SQWA 1QYXA 4A9AA 2PH1A 2XADA 4K88A 1C14A 1GZ4A 3DH0A 3PUYA 4QU5A 2E9SA 2Z58A 3PQ6A 5CLLA 1W35A 1DBSA 2GBIA 3I09A 1KE2A 1SC4A 2DWCA 3A9CA 3HYSA 3GJTA 1BO6A 3OJEA 4UNQA 5DT2A 3PHJA 4GSLA 5FO1A 4DLXA 4C5CA 3ZCQA 2AKEA 4NE9A 3E3LA 2QTAA 4OIFA 4Y9DA 3M1LA 3PI6A 5AW8A 4JUFA 2DFTA 3SX2A 3B7GA 2RHJA 5T64A 4AF8A 1XQ9A 3G9UA 4GXNA 2MMCA 5AK0A 2JGFA 1RKXA 5CXSA 3IA2A 4B1FA 4OQDA 4YV7A 1OZAA 2G71A 3DEHA 2M6RA 4MW5A 1T6ZA 2OXIA 2A1UB 3F4LA 5EAIA 1A5SB 3R9KA 5A4AA 1LRKA 1P4SA 1WKCA 2JFVA 2ZWVA 1EFRA 1U28A 3PPVA 1WIWA 1E5LA 1N8SA 1T6NA 4UUMA 3EEFA 3I9FA 4AWXA 3M2TA 4F0JA 1G7SA 3KSZO 3E82A 4HNRA 1DSSG 3HYNA 4QUEA 2B4QA 5FAXA 3TM5A 4MO2A 5DHSA 5CB4B 5E95A 2A9QA 3ER9A 3KD3A 4HCJA 2XCTB 2QR3A 2FW1A 3JD4A 4HAWA 1E2EA 1SXGA 3DVAB 4X0EA 5D7BA 3HA7A 4YMHA 4TXMA 1G5HA 1PYDA 4LE0A 4TLMB 4MDEA 3D2CA 4GBGA 4WPGA 5DNYB 2W2TA 4L75A 1KI4A 3KPUA 2DHEA 3DKRA 1PNVA 1VYUA 3R8CA 3M1YA 2JLBA 5DYGA 1LD3A 4ZPJA 2MSNA 1RXIA 1EWTA 4KGVA 2APJA 2VP3A 4KO3S 5F1OA 2NU8A 2JDIA 4E5YA 5IC6A 2R85A 4EF5A 4TZ0A 3IEUA 5HIIA 5EWMA 3U16A 4XWKA 4MUBA 1IVYA 5JAOA 1TVEA 4PFKA 1P1RA 4BZWA 4CETA 2PSJA 2ZBUA 3ISJA 3AG5A 1KRHA 1UXHA 4YV1A 4OBEA 1EX9A 2EU8A 4YRGA 3AEQA 1TJ3A 3ED1A 2H5LA 2JF0A 4MV4A 4KR9A 3VOTA 2RHMA 3L02A 4OXXA 4PZLA 3BJIC 1XMXA 4YRDA 2PS3A 2O3TA 2QRJA 2HV9A 3R5JA 5JAMA 4LC0A 2ZIGA 4OQZA 3ZTYA 4R1UA 4ZJZA 5IAAA 2OGZA 2WWVD 4R0MA 2PSSA 4QYSA 5KI6A 4FFOA 3GJRA 3FBWA 1EE9A 2JBHA 4P08A 1SELA 5AM5A 1H6BA 4RLFA 4JS0A 3U2QA 4YY3B 4F86A 2WMDA 2QP4A 2PGOA 4QRDA 1KI6B 1UR5A 2HRBA 3HU1A 1NQWA 1NQXA 3ND8A 1J5PA 1ZH8A 1DAPA 1ZJ5A 4IG9A 4AP9A 4GZMA 2VAWA 3A31A 1A7UA 1H23A 3K30A 4C2TA 3FTPA 1XVUA 4KN5A 2RKBA 2GLUA 3H2JA 4OHWA 1KOFA 4ZV9A 2Q3BA 1MT0A 2Q5LA 4U0KA 2VBIA 2O8EB 3WBJA 4YB8A 1OXXK 1SCIA 4HXYA 1WXQA 2QD2A 4HFNA 4X1KB 2GFIA 2HQ1A 1HL7A 3B9PA 5T8KA 1OXTA 1P0CA 3N75A 4HS4A 4JJ4A 5ALDA 4EBBA 2PBRA 2I22A 3MNFA 1SG9A 4Y6LA 5K05A 4O4HF 4AKTA 4OHYA 1YKSA 1PL0A 2WJZB 3K8OE 4JGIA 1WMBA 1B00A 1NQUA 3DMDA 5DTMA 1YZTA 1Z73A 4HK4A 4WECA 3A6GA 4Q48A 2WBLC 5CT4A 3EWSA 3CLRD 4FHEA 3LC1O 2BGIA 3C16C 3TQHA 1PP4A 4RE6A 1PHRA 1VI2A 2X0RA 3LA8A 4FGUA 3I92A 3BCSA 5JBIA 4OGGA 4QELA 2VC2B 4IIGA 4MVWA 1U7XA 1RCTE 4QGBA 4ND8A 4OMFG 1RMTA 2P9QA 4WOCA 3DT6A 1NMSA 4RPJA 2HQRA 1QVZA 3MGKA 4AT1A 3Q3EA 3JZMA 4JSRA 3UAXA 1H3FA 5LOVF 2WC1A 2GCPA 1NVKA 4AY4A 4JX8A 3K6SA 1GPMA 5ICEA 5E1DA 1TL7C 5GV7A 4LOKA 2XOKD 1ZP6A 2JFGA 4EEZA 3ZZTA 3BGSA 1AQLA 1JEQB 4NCKA 4I36A 4QGAA 2NU9A 1V9CA 4OG2A 4FCTA 1H9CA 1F2UA 1KH2A 3V7WA 2J6IA 2YXBA 3DSRA 2OCXA 3ROGA 3BE8A 2KX7A 2B2XA 1EP3B 1GQSA 1EUCB 3E9QA 3PE3A 4NMHA 2O0JA 4Y1RB 4LI3X 4JQSA 1Q2XA 1SHZA 2G67A 4UOQA 4WNIA 3W2IA 1SZDA 4KUGA 4MARA 4G23A 3UATA 1L5MA 2IEYA 3UKOA 5G2OA 4A2QA 3ABSB 3DQQA 1EHYA 2V5VA 3DUWA 5CXQA 2DWQA 1DELA 2Z1NA 4PYMA 3ZYZA 5JNSA 3UCEA 3U60B 1ESEA 2WG0A 1U2ZA 3I61A 3NHLA 3FKJA 4L8FA 3CF4A 4X8HA 5D2CA 1AVTA 1DADA 4X60A 2Z5FA 2G1AA 5JW6A 2YC4C 3LCVB 1T8UA 1ITZA 1XP5A 3OT4A 2J4DA 3VKFA 1LV8A 4MP8A 3CONA 5BNWA 2XW6A 1AN9A 4PN3A 4RULA 3N2GA 1CY4A 4GEKA 5CA0F 3RUHA 3ANYB 1XK7A 3PKZA 4UFPA 2QDXA 4FTWA 1MHTA 4R1LA 3P9RA 5EQFA 3W9SA 2R8BA 4LKOA 1G5PA 3ADOA 1NVMB 4N40A 4YEDA 5EIEA 1IU9A 2PWYA 3RADC 5D3QA 3L5KA 1IQUA 2WU0A 1Z38A 3JRWA 4O4IB 1ZOSA 4TTSA 3OD1A 4RTLA 3M6FA 2Q99A 4QNMA 3AT1A 1ADJA 4WGFA 4H4CA 1TNDA 5HFNA 3IS3A 3ZI0A 4F97A 4EJ6A 5ALZA 1JN0A 4KC0A 3ZJ4A 3F3SA 1EBFA 1OFUX 4FNMA 2AFHA 2A0UA 2ZQ5A 4KSBA 4TQAA 5B7QA 1AE1A 1BOFA 2P91A 4O8CA 3OEEA 3QKSB 5BNFA 1SCKA 4CM4A 3U9TA 2PX0A 3F8WA 2VJQA 3BS4A 2C4KA 4OHPA 3M6WA 3HR4A 3QJYA 3HCPA 4MHSA 5A04A 5JMTA 2H1HA 4IXTA 4QU8A 4DQXA 1G8JA 2ZE5A 3RVJA 1C7IA 3LYHA 4NZMA 1JJ7A 2X5JO 3DMTA 4GH5A 2QRUA 3WXMA 3K70C 3HNPA 3BK7A 4IKEA 4JB8A 4MWOA 4QXPA 5CVJA 3NVMB 3B48A 4C2AA 3B2EA 2Q5IA 1RHMA 3CX6A 4DLNA 4Z49A 2G83A 1RHQA 5HOQA 4JROA 4OY3A 1JU4A 2VWPA 3TQOA 3LO5A 1C0PA 1LI5A 3DOEA 5AVQA 1LVGA 1W0CA 2OVBA 3I3OA 4ND1A 1DMSA 2OY0A 2M32A 1BE6A 2QQEA 4B6OA 2EBFX 1PEAA 1O9GA 3NBZC 4IIEA 3HA3A 4KVGA 3I39X 3O7MA 3R0IA 1CUXA 1ZJJA 1AUQA 2AQIA 3PHHA 4OXKA 4QUHA 5J1TB 5A03A 2G5TA 5AIBA 1N2EA 3FSJX 1YQTA 3A6ZA 3VMFA 2MOKA 1HY3A 2WILA 1XMSA 1YGYA 3IO3A 6CHYA 2OBBA 2WLTA 3JAKB 5C5DA 2C2YA 4CMHA 5IAEA 3A6DA 5SV2A 3ZV4A 3TECE 1Z35A 1HWYA 2FZGA 3F6PA 3X0DA 3K2EA 5F5LA 1KI6A 4F7DA 4GPD1 2GS9A 3DA8A 4OHKA 4M83A 5E6UB 4BMXA 1H0KA 4ZWNA 1N36B 5CA0A 4DUPA 5IX8A 2XKJE 1KBQA 2ZYRA 4DCOA 2V8BA 3LPAA 4FYXA 1XKTA 2EP5A 1BXGB 1AT1A 1X8KA 2WD8A 2CXQA 3LW8A 4PG7A 2A92A 3JRXA 1G59A 4NU5A 3WR5A 1RSZA 2CXXA 2CJFA 3A36A 1IPHA 1FSSA 3A4LA 4QICA 4RIIA 4NCNA 3WGQA 1XQ1A 1AA6A 4OCZA 3TB6A 4WFJA 3PQ8A 4V0ME 5EMHA 3QX9A 1NNEA 4MGZR 5JD3A 1ADGA 1JALA 1EJ2A 1Q77A 1T36A 4GMKA 6AT1A 4TZ6A 3A4TA 4L8VA 3JWIA 3OWXA 1VSTA 1U0GA 4IICA 3T5MA 2CY0A 4EEKA 4RENA 4JP8A 3N7AA 3MUOA 3U7FB 2CNBA 4NABA 4LNUA 1AB6A 3OOJA 3EHEA 4FILA 3I5UA 4L8LA 5LQCA 3BWBA 4IIJF 1R9MA 1U04A 4B85A 1U1DA 2Y1KA 1UBKS 3F78A 1S3IA 3I2IA 2CXRA 3ZWMA 4YJHA 3ZHRA 3WNCA 1G8SA 2DUWA 4WXEA 5HZHA 3RWOA 4NHOA 3JD1A 1J0BA 2W4QA 2Y0BA 1ZUIA 3PHBE 1M0EA 4JYPA 1E1DA 4FW8A 3RTCA 1H6CA 5E7QA 1LDNA 4CGZA 5IC4A 4KRYA 5K45A 2QRPA 1GQRA 1ENPA 4HQRA 2OQVA 4A0RA 2CL7X 4BRSA 4YV2A 3HK2A 4KKVA 1KAEA 3UMVA 2EDAA 3UJBA 2G25A 4TQGA 3PITA 3EUAA 3B3QA 3R3ZA 1F20A 3HKBA 3OUUA 4Q7JB 3KWMA 4BXOB 3H86A 4NICA 1PS0A 2P9HA 2A88A 2BEKA 2Q49A 1GGEA 2ZWIA 4OQQA 5B6PA 1MOZA 1ZN2A 2VAXA 3GIDA 4U2FA 4U5XA 5DWVA 4PINA 5LFAA 5FI0B 3H16A 4LVOA 3DOIA 3GFGA 1AGPA 4GGPA 5LBTA 5KWSA 1COZA 4I1YA 3SIRA 3LUFA 5DBGA 4REOA 5IYZA 3U44B 3W0LB 1HT0A 3DZGA 3BULA 1FW8A 4J0CA 5TLSA 1H85A 4G1BA 3ROFA 4EQZA 5C8ZA 2PG3A 3TEFA 4MWDA 4RDCA 5AKEA 3U7RA 4Y6PA 5FBKA 3SEQA 4FYHA 1E9EA 3PDCA 1T2DA 2HDNB 4XVRA 4NS1A 4EPVA 2ORYA 1KY3A 2IU6A 5HKOA 1YULA 2P27A 2H65A 1P2VA 3C4VA 4LZLA 5FAKA 4YJFB 2EATA 5DN6A 3BPSA 2YIDA 4II3A 2A7QA 3GLGB 1B93A 4ZODA 2A2ZA 1GZHB 2GRAA 2XUAA 2G08A 2JK1A 3K0CC 1ZOPA 1Z6YA 4H2DA 3PTAA 3RTAA 1KNXA 4OHZA 3GY0A 2MSEB 3JPYA 4C6HA 4NJOA 3OQMA 2C9ZA 5F7XA 2E55A 1N8TA 3C3YA 4PRYA 3UNXA 3WISA 4ZO6A 2WUEA 2B1RA 1DAKA 2QZSA 3ADDA 2I6SA 2Z95A 2PLNA 3F73A 2IZ1A 2JZOA 1NXOA 4MVJG 1Z39A 4O1IA 4WNAA 4ZQFA 1KQ3A 3UN1A 1SKYB 2BIFA 4K9NA 1MX9A 1NY6A 5BQFA 1TXGA 1I9GA 3FNEA 1RLUA 3DO6A 3VDNB 1OXUA 2I4LA 1Y8RA 3FOWA 3FW1A 4LRTB 2G9NA 4LOJA 3JQCA 4MYRA 1E4EA 2DX7A 2H07A 2PSFA 2SICE 3B36A 3K7EA 4H16A 3RIEA 3TNJA 2C3PA 3ZE6A 5C46F 2F43B 3DM9B 5LNK1 4K6HA 2W22A 4OLBA 2DAPA 1T36B 1AF7A 1IZ8A 4YUYA 2X8JB 1QG6A 1RYFA 2GK6A 4ESVA 3TQFA 2IBSA 3ICPA 5EQTA 5EIXA 2N46A 2QYHA 4QPZA 2DQ4A 2P9BA 3V8PA 3ICEA 1DKNA 2H59A 2ONCA 4KQXA 5IT9A 2ZYTX 4NE7A 3UF0A 1SUSA 3TTUA 4QT4A 1CY1A 2GA9A 1Y4ZA 3V2HA 5E3JA 2P2CA 2W0SA 1LBHA 1PLLA 1A76A 3FZEA 4U1RA 5K5EA 4XWWA 2Z9CA 1V11A 5AM0A 4DS3A 1GKKA 1T2EA 2BHSA 2JW5A 2X14A 2Z2IA 1M73E 2JARA 3LQ2A 4L3VA 1MV8A 3L1IA 2NVBA 4Q4LA 3TZCA 4WBNA 1ISJA 3OJCA 1QDLB 3PWKA 5JCXA 3CNBA 1DVRA 2IYLD 4J0JA 4XWAA 3ZLBA 3GZ4A 6ADHA 4XFKA 4DCVA 2I67A 1M6VB 3DDUA 3UH1A 4PG8A 5JATA 4HRYA 1QIJA 2FR0A 2G4CA 3QENA 4WHMA 3W1VA 1K9VF 1OFVA 3FPGA 1URPA 2FDXA 2JFZA 3H1BA 3MT7A 5JJBA 4AY2A 2DY1A 2IZ5A 2O6LA 4D26A 4DMHA 1ZD5A 3OHPA 2I34A 3MGCA 5DX0A 3FWHA 1VSBA 1D2RA 4G0WA 4DY4A 4F72A 3DEIA 4HLUC 4L9RA 3ESBA 4DLTA 2IYYA 1X92A 2HV8A 3LDFA 2D1TA 3Q5GA 3QIAA 3IT2A 1SU6A 3UB2A 1RQGA 1M2WA 3DS8A 1G3MA 1I7SB 4RWEA 1E7SA 1N1GA 3TR5A 3DMTC 4ZOLA 5JYBA 4UVGA 2QLMA 1I6LA 5FPQA 4CDNA 3UHFA 4DIUA 5J5VA 2HWUA 3A0UA 3C8MA 4EABA 1O1YA 1E3LA 1K8QA 2C4VA 1DMRA 1T3GA 4HJRA 3CVWA 3FFXA 521PA 3FPLA 5JOQA 3O8RA 1QQ6A 4YP7A 1X9IA 1N1MA 2WFLA 5ALQA 2QRKA 3D4PA 3WGJA 1KRWA 1AO3A 1XCJA 3HDGA 3ESRA 4ZAXA 3ZU3A 2FZCA 2PZMA 5EZYA 4JJ6A 1IJKA 3EZ2A 3NTUA 2DERA 3CY6A 5H5JA 3UBMA 4FOPA 4ZCQA 3FB4A 3MYRA 4LF6B 2QUHA 4E2YA 3MS2A 2OD7A 5AR1A 4WNAB 2Q2QA 5ULLA 3VSEA 4YLYA 1EUYA 1B6GA 3VDXA 1KFCB 2HNBA 3DE3X 4PC7A 4PLCA 5JD4A 3HCFA 1E0KA 2V3WA 1JDJA 1GUBA 2YWHA 3MJSA 4FDLA 3TLMA 1K3TA 4F96A 1E89A 4CNBA 4TRMA 2ZT7A 4MI9A 1E5TA 4NONA 1QNFA 4J29A 4Y1EA 2WJ6A 4PXSA 4Q3KA 4IS3A 4UHKA 3PENA 3TLKA 4DV1B 1N3YA 2ZVJA 2FEXA 1Q12A 4Z7NB 4BXOA 3JQBA 2HT6A 2V6BA 2NP7A 1IBSA 1JFSA 2W6NA 1DXQA 4WQMA 1X1AA 4OSPA 4EL0A 3TL3A 1EKXA 2PUJA 4IDFA 1UT8A 2BR4A 3VSDA 4ARZB 4AP5A 1ZHOA 2XUOA 3B3GA 4FGWA 2GJ9A 3U81A 3ZZ0A 3H0EA 4GBMA 4R6WA 2CWDA 3BG5A 1NN0A 2YMPA 2EZ9A 2PT7A 3JZDA 2Y92A 3DT8A 3UJDA 1JIJA 2BFBB 4B43A 1RWMA 2H8GA 2Q8NA 1BJTA 3GMIA 4JV5B 4UPDA 2Y0CA 3UMCA 1ULUA 1N1DA 4AN4A 4B79A 1Q17A 1ZQ9A 2DKFA 3JQ6A 1QF9A 5K8LA 2PANA 1EE1A 4IDCA 3NX4A 2RH8A 1ZD4A 4BKUA 2RC5A 4G6ZA 5E3IA 3GLIE 2CD7A 3D81A 4EJSB 3ELUA 5CD9A 3PRKE 1U0LA 3EUEA 1ZZEA 3GUCA 3NHRA 1E0DA 3QY9A 4TVKA 4UQLA 3I37X 4HSEA 3M1AA 2OYSA 4KN6A 2AJBA 4L74A 4OVKA 3T9EA 5KNBD 3W34A 1XCBA 3FVWA 1PJSA 1TM5E 1U8ZA 3KQQA 1RWKA 4JH0A 5HMLA 1T0IA 3MT9A 1OBCA 3B6JA 4KXYA 2KI5A 2HUNA 2P4EA 2YICA 2GKGA 3OEHD 5BSMA 5A7GA 3VU9B 1B41A 2Q9CA 4U7PB 1WB5A 4OGFA 4TXHA 2HCFA 3SKYA 2W2MA 1V7QA 3QTLA 4LGVA 5AVYA 3AF1A 1CP3A 2Y66A 3AEZA 3BGIA 5I9MA 5DIZA 2HDOA 3RUPA 1FE8A 1GITA 1U0BB 2YWRA 1JT2A 3B1WA 1KFKB 4V39A 4TGLA 3WP1B 4PLVA 3BWEA 3KQLA 3HQ4O 1FU4A 4UFOA 1U8YA 3QVOA 4YNBA 3FHLA 3GLTA 4N1AA 2BLLA 1NHWA 3ZIAD 1U63A 4BNLA 1D8TA 1TF7A 4JA2A 1DRUA 1T0PA 1X0VA 4UVDA 3IURA 3I8OA 5KTNA 2WFLB 4CWAA 1S3FA 2NNWB 2NXCA 3HWWA 3MBKA 2WU8A 2XLCA 4K40A 4H3HB 4W5RA 2WVHA 2Y1DA 4RJ2A 3SDSA 5L7TA 3PHLA 2R1VB 4IX1A 5ESXA 4LJ7A 1TEXA 3KSMA 4JKYA 3AJAA 1DB3A 4RK5A 3KQTA 1KP9A 3LZ6A 4GQAA 4EKEA 2JFXA 2XYPA 2AMLA 4W1PA 4U7FA 2HPZA 3QXJA 2Q2WA 4AJ4A 4LI0A 4M6WB 2WAXA 1Q7CA 3QE0A 4ZVLA 1FC0A 1PUIA 1MB2A 4LRXA 1IXRC 2R48A 1EWYA 3I0ZA 1V48A 3KPVA 1Y0BA 5CVUA 3RU9A 4F2DA 3M49A 1JECA 3NALA 5D00A 1TW3A 3GGCA 2PZBA 4LYEA 1D2CA 5IKPA 1AHHA 2H5IA 1PL8A 3DXYA 3DWFA 3LL7A 1TMYA 1NY5A 4MR8B 1NJ8A 2YOFA 3WG9A 3ZLTA 4C4AA 3EGIA 3M70A 3PV0A 3BB1A 3ET5A 3ICVA 1RW4A 1XX6A 1FLDA 2VG8A 1J1UA 3IQXA 4F8YA 3F9RA 3FPFA 4HMPA 5ESDA 5D01A 3ZN2A 3JQAD 2ZBRA 4DW8A 4YT4A 4R1SA 3ZCTA 2D1FA 5KC8A 4B81A 3SNHA 5KTKA 2R8RA 2I9KA 1E3EA 2H08A 3KE8A 1KC3A 1PTJA 2QW8A 3W2GA 1YF3A 3OU2A 3LY7A 2F17A 4P2GA 3IPYA 1AG9A 3M6AA 4NAHA 3NOOA 2I65A 2GD2A 1VL0A 2GM9A 2REBA 1EH5A 5BSUA 2NZXA 2YS6A 4CE6A 3LWBA 4A0GA 1GCIA 1WSDA 2Q6TA 1BTOA 3EWAA 4LTMA 1JBQA 2D0IA 3B85A 3UGTA 3AFIA 5AHKA 3ZIUA 4RVDA 4I19A 5H81A 1C9DB 3HZZA 4I55B 2PH7A 1FXUA 1XTQA 2O20A 3ZCPA 5BQOA 3I64A 4BEWA 4DYVA 4DQLA 1CK4A 3PNQA 2M98A 4RK6A 1D8AA 3W4KA 2YVQA 1E5QA 3ZDBA 3V6LA 2I7TA 3HZRA 1RYMA 2D5AA 1LPNA 1YB7A 4BNGA 1A7KA 4G36A 1FQOA 2REXB 3IQFA 1EHIA 3MIIA 2VHTA 1YJ5A 2WPDD 2WUWE 3WYBA 1I1OA 2VHZA 2HA5A 1WXHA 1VJRA 2IXTA 2PGAA 3OJ0A 3G0GA 3Q98A 5DSTA 2WWFA 2GXQA 3S99A 4EZIA 2GBLA 1GEEA 4B4DA 4ZIRA 4R98A 5JXIA 1CNEA 3TIIA 3TCNA 4RY8A 2G9QA 1RBZA 4BTEA 1YFKA 5HGJA 5M04A 3U4QA 3N7TA 3E27A 1E3QA 1NURA 1X1RA 4QQNA 4WJKB 1AH2A 3Q7TA 3DBIA 4GO1A 4WXRA 1SRQA 3GB9A 3VR5A 1FDTA 2ZSBA 2X4IA 3P0JA 3TEJA 3CLTD 3IE0A 1FP4A 2PRKA 3B9BA 1YUBA 1DLJA 1NHGA 1U7UA 3NHZA 4N6OA 2ZSKA 1Q1AA 3OESA 3FGOA 4C4RA 1QHNA 5LQMA 4M6WA 2YJ4A 5DNAA 4JT9A 1LNSA 3LHKA 4IJUA 3EFEA 2ZDGA 4OHVA 4FI3C 4CCAA 1U3WA 1FLVA 2NAPA 1G0NA 3RR2A 1VPEA 3H2IA 3JTEA 4CKBA 5KNDD 3GA7A 1DWOA 5AI8A 4AZWA 5CM8B 3GLHB 2OG2A 2YRFA 3ZWWA 3PF9A 1NG1A 2PNJA 2V9CA 1QWSA 1QTIA 4FMDB 2WYIA 5TQ2B 3MCUA 4BVLA 3DYBA 4RVSA 2PS9A 4KUEA 3KTDA 5CYFA 2O2EA 3WYEA 1SWVA 2QGNA 1T9AA 2J3KA 4PNHA 4Q4DA 5KNCA 1A72A 3DEAA 3KKMA 4JR2A 5HS6A 4DQ0A 3M8KA 4UCWA 4DLVA 2HK8A 5L6MB 3GLQA 3F67A 2GN6A 1FDWA 2VT2A 5BWBA 4LRWA 3KYCB 4H35A 4RKEA 4V1CI 3C87A 4Z9AA 5L3SB 2AI1A 2HMSA 1W36D 2WUGA 1U0RA 1WHSB 2HTEA 3AHEA 5CNKA 1H2RS 5G1PA 1CJCA 3O2JA 1OB2A 2QN6A 4Q05A 1U0NA 3KU4A 1D4OA 4IVQA 3TVYA 1VBFA 4HWPA 1JQEA 1NXVA 3B53X 3ZCUA 3CT6A 2NO4A 2QXUA 3VR6D 3ZWYA 4UE2A 3Q8LA 3GN2A 4TLLB 4YWJA 3VR5H 3V8BA 1DE0A 1PUJA 4P35A 1U0EA 1U8CB 1R5JA 2IA5A 3BQ9A 5FA6A 4HGYA 3O8LA 1A2BA 3V3KA 5KB3A 3TMYA 2DT8A 2WF9A 1Z5PA 4EQ6A 2XR1A 4Z7JA 4ZGWA 4LC9A 4M86A 4Q6BA 1BEUB 4OO3A 2Z6AA 4MQFA 2G70A 2Q9AA 3OCCA 4EPYA 4R1QA 1E7YA 2V6GA 3OPXA 3QIVA 4F46A 4BO4A 1NVAA 2D8MA 4NG5A 3GFRA 1ZJ6A 2VDMB 1FFHA 3PLNA 4WOKA 1ZGZA 5EUBA 3RJ9A 4QXQA 2WYUA 3EVGA 4IDDA 3UWPA 5I9BA 2OHOA 2DCUA 5FADA 1QYCA 1EVIA 3OE4A 4AICA 1FFGA 2ANCA 2AYYA 1WXFA 3OY2A 4LYAA 4ZT4A 3AHJA 5H59A 4ZEWA 1QHHA 5EJAA 4E12A 4KOAA 3AO0B 3GP3A 5CBPB 3IT0A 1TIPA 4YP1A 4CLRA 5FHQA 1GUFA 2XXJA 3A3KA 3PJEA 4ZGGA 3JY6A 2B1QA 4OA5A 3PYMA 4RL6A 1ZVJA 3VVLA 5CLFA 3WQBA <