4DZZA

Structure of parf-adp, crystal form 1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partitioning protein ParF
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 70
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dzzA00
4BRWA 2NGRA 2VTKA 5FR2A 1SVOA 1M7HA 3EAQA 4B6EA 2J0QA 3CH5A 1LF5A 5G53C 1COWA 3NEJA 5A5GA 4KLZA 4TZ6A 4PO9A 4F7WA 5AR1A 4BLQA 1J70A 1E32A 1ELOA 2QU8A 2JASA 3AKDA 4R2HA 1P62B 1YZNA 2CK3A 4ON9A 4TL7A 4NCIA 2I1QA 1M74A 4E22A 2DWOA 4MKIA 2QPTA 1OB5A 2XXAB 4OI0A 1CRQA 3NDBB 4WZ6A 1ZINA 1AKEA 3OEED 2P5SA 1BYIA 1XTSA 2MMGA 4C0BA 3M1IA 4R7ZA 2HT1A 1S9HA 4ZDJA 4MRRA 1S8FA 2X2FA 1A2KC 2J7PD 2ZSDA 1IY1A 1S2MA 4FMDB 4JSTA 4YXWA 5G3ZA 3TIFA 3ADCA 1RYFA 1E79D 1N3BA 4L15A 4LYHA 4KBFA 1P61B 2QE7D 4M1SA 4LJ8A 3EIHA 4LHVA 2IWHA 1OFHA 2FPLA 2H8KA 2BDTA 4DLZA 4DDVA 5CIQA 4PC3A 4TT3A 2B92A 1FX0A 4EDHA 3TRFA 2ZRGA 1KY2A 3RVBA 1FNMA 3OZXA 5KDDA 1MABB 3FDIA 3PEWA 1F48A 2FDCA 4MRSA 4F91B 1O3YA 2GRJA 2GXQA 3IDQA 3HP1A 2H1LA 4HAZA 1Z5ZA 3PUWA 4JBXA 4ARZB 2IX3A 4DJTA 4JKIA 4RD2A 4E5UA 1FMJA 3WRXC 2GILA 2IXFA 2R2AA 2BHRA 1D9XA 1E0AA 1TAGA 2H16A 1CJVC 3D3QA 4C2TA 2PT7A 2A5DA 3IGFA 1G5TA 1KI8A 5AJYA 2OXCA 3KXLA 5HKKA 1Q3HA 5FPYA 5EE9A 2GESA 2VF7A 2J59A 4DLTA 1G3IA 5JZVA 3X1DA 1TU4A 2CNWA 4QJ5A 4PO8A 4GOJA 1CTQA 4ZO4A 4D26A 3FYHA 2FA9A 4GOXA 1ZU4A 2Z4RA 1KJWA 3NDPA 4CVNA 3SOPA 5FBQB 5FPKA 2B21A 2BKUA 4OI2A 4UJ3A 4A15A 3HYTA 4RKFA 3V4FA 3PR1A 5FTLA 1KMHB 1G20E 4BLOA 5HPYB 3KZ1E 3HPQA 1K6MA 1SVSA 2OE2A 3OIWA 2ANBA 2Z5FA 3SHFA 1IN7A 1W46A 2EYQA 2ZAOA 2WAXA 3WRYC 2W58A 4BE7B 2IXGA 2UZIR 3M0EA 4X8MA 4DB2A 1KO1A 4DUGA 4AYXA 2HXYA 2IW3A 3CNOA 3D31A 2C77A 3K8YA 4C2UA 3BORA 4G5SA 4G5OA 3B60A 3SI7A 1VCNA 1SVIA 3IHLA 5BYJA 4RJLA 2QT0A 4F93B 1KJZA 1YJ5A 3VR5A 2PX3A 1WP9A 3CR8A 2MSDB 1NMYA 2ZRIA 1MO3A 4YDHB 1GILA 4L4UA 1ESNA 4UJ5A 3CPHA 1P7CA 2IYXA 3CF6R 1E0KA 2HCBA 3AUXA 4FIDA 4LJAA 4PPFA 5FUVA 2QMOA 1E4VA 1TQ2A 1OLOA 1A2BA 2OILA 3SDZA 4BZXA 1MH1A 1ZUNB 3IIJA 5F2EA 5L3VA 3BE4A 5EE5B 5LDDC 4LJ9A 4OBEA 1TF5A 1FOEB 1W0KA 1M34E 3VR2A 3IUYA 4PHHA 4EQ6B 3X1WA 3TUIC 3U4QB 1G4UR 3EA5A 1EK0A 4P32A 1JR3E 4HAVA 2XEXA 2ZVQX 2VHJA 2BBOA 2ZJBA 1QDEA 1W4AA 3AVQA 4V0ME 5C18A 2OM2A 4AC9A 5H1YA 4AG6A 4B48A 5AJZA 1F60A 4BLRA 3KFVA 4KYUA 4QM7A 2GWHA 2F9MA 2EFHB 4EJSB 3CRMA 5TY0A 4TTRA 3BFKA 3MRSA 4HDQB 4BFUA 2QRNA 3WBJA 2CCGA 3CF2A 2CLSA 1PLKA 4Q47A 4AG5A 3NC0C 3ZVLA 2GZHA 2BM1A 2DPXA 3LX8A 3KB1A 3C14C 3WMFA 2O0HA 2IUSA 2O8EA 2WOOA 3DL0A 3AP2A 2F1JA 3ZLJA 3SFZA 4BRUA 3UKDA 4DC9A 4NYJR 5CB8A 3TSZA 2X8AA 4A0HA 4OI4A 4P4SB 1OKKA 2GNOA 4D4JA 3DEFA 2BJWA 2CCJA 2YOGA 3EA0A 1E69A 1J8YF 1XFAA 1YZLA 3E2IA 1G8GA 4UNSA 2A5FA 3I8SA 4PHFA 5K8LA 1UKZA 3O8BA 3C8UA 1Q1EA 1K5DA 3A8TA 4HLDA 4Z8YA 5KUTA 2IUTA 4HLCA 4LBZA 4CW7A 1GKIA 1I4TD 3GFTA 1G8FA 3TMKA 1G8PA 3K0FA 2R6DA 4FD2A 4Q7KA 1DVRA 1OHHD 4RZXA 2YKGA 3FMPB 4AYTA 4M2LA 1OSNA 3QVVA 2IXEA 1YZTA 2CE2X 2OLJA 3C5CA 3CZPA 3WY9A 5FH9A 2ZM5A 4ZKDA 1MO5A 4LSGA 1ZD1A 3EWSA 3UWKA 3VX3A 3QXXA 1X8JA 3BH0A 3PV0A 4IEEA 4A0GA 2NPFA 2O8DA 1AM4D 4PHTA 2XX3A 2ZE7A 4JT4A 4KO8A 3CNLA 4LDJA 2C5LA 3RRYA 2ORIA 1N6LA 3VU9B 1T8UA 3MAAC 3KKPA 1PVOA 1HE1C 1S9DA 5BN4A 1KSGA 4TLEA 2L0XA 5IF9A 2GJSA 2FSFA 2R6AA 5FL3A 3FHOA 3ICEA 1G9XA 2Z0MA 1KSHA 1KDTA 4IFEA 3LW8A 3T06B 3RS7A 5F9HA 3FMFA 3ZVRA 3EPLA 4OK3A 1JECA 5JHHB 2JGNA 3AV0B 2DYKA 4L16A 1Z0FA 2D62A 4OQLA 2PL3A 4DDUA 4QBHA 1T9HA 2QY9A 2BCJQ 2ZRDA 3ZD7A 1KZGB 1D6JA 4EKDA 2P6NA 2A30A 1G6OA 5KOYA 2ZJ5A 5DH9A 3H4MA 1Z06A 1P9WA 2A7QA 1E9FA 1W5SA 4FI3C 5KO2A 2IYQA 1Q22A 1HUQA 3KDSE 3TJZA 4JMPA 1WB9A 5J4HA 1XEXA 1X6VA 4EPYA 3VHXA 4CRWB 4CEHB 3MD0A 5JI2E 2Z83A 2ZRHA 3C4JA 1Q0UA 1P6XA 1W2HA 4B3BA 1Z28A 3NH9A 1U8AA 2W2TA 1BO6A 2DFNA 5UKDA 2VHCA 2JJ1D 2VPPA 4XD7D 1I2MA 1CBUA 3SZRA 2ZI5A 1AZTA 4PC6A 4Q9KA 5C46F 1KI1A 2ZJ2A 3A37A 3IQXA 2QAGA 4A92A 1E94E 5J4LA 4MDFA 5FUWA 8OHMA 3SU8A 4Y0VA 3UG6A 1OV4A 2IYTA 2PMKA 3CBQA 1HQCA 3P26A 1JB1A 2CJWB 4WZAE 4TYYA 1JPJA 1YU9A 2P3SA 1P3JA 4QBFA 5F9FA 1W0JA 1CF4A 4AKEA 1E9SA 3AM1A 1OW3B 4XH9B 3HR8A 4Q9LA 2R6GA 4NYJQ 1EESA 3M6AA 2W6IA 3KQNA 1EG7A 3VFDA 2IEYA 4YC7A 4S2EA 4UNNA 2SHKA 4AK9A 5JSZB 2XZPA 1UKVY 221PA 5JRJA 4KSCA 3CPJB 4EFNA 5JWRA 3GFPA 2GCOA 2WKRA 4C0JA 2LWIA 4CDGA 4V0MA 4JVLA 3X1XA 4WBSA 2O8CB 2JJ2D 4N1AA 4QOSA 1U90A 1FL9A 721PA 2ZEJA 4CZ2A 4EFMA 5J4YA 1JPNA 2YWFA 4IVQA 1E99A 5IHPA 4TTPA 1BKDR 2CCKA 1Q20A 1W4RA 4NCNA 1RRPA 4RD3A 1Z6TA 4M1YA 1NNEA 1DAEA 3ADKA 3QF4B 3BK7A 3EPJA 3WBKA 1HT1E 2WJGA 5HE8A 3T1TA 2RGAA 3D8BA 3K0EA 3DHWC 3B6EA 2IYUA 3HU3A 4D0NA 1OH5A 4NZYA 3ZQJA 4KXFB 4JS0A 5CLLA 4W9MC 3CB4A 4GSYA 1YE8A 2EYUA 2NOAA 1UEJA 3CX7A 3OEHA 4HZIA 4UXIA 3RWOA 2F9LA 1KI7A 2N1BA 4D25A 3VHLB 3IILA 3K9HA 4WW0A 4DLUA 4LV5B 1UKYA 2F1IA 4DLWA 2CXXA 2PZGA 1GNQA 3LDAA 2NO1A 3NG1A 4EIWA 1WQ1R 2KB0A 1E0SA 1FZQA 3C5HA 2QUZA 3L8YA 4BZPA 1T8TA 2B8WA 1XCPA 2GJ8A 2WJVA 4X8HA 1XNJA 4I81A 1US8B 2I3BA 3Q8XB 4G3XA 3UANA 1PV4A 1R0ZA 1DOAA 1W47A 2DBYA 3B82A 2OAP1 3KFXA 1CS4C 4ASUA 1CRPA 2F6RA 3RLFA 2OCYC 4QGGA 1RVDA 3U44B 2ORWA 2Q0HA 3KUCA 1P2UA 2ZYVX 3IEUA 4QG7A 1XZQA 2BCGY 4I1OA 1MKYA 3WYFA 2ZI9A 4YMVA 4ZCLA 4K46A 4MYUA 3G0HA 2XOKA 3ZIAA 4URVR 4IHQA 1Z3IX 4LBYA 1BMFA 1CJKC 3EC2A 4LGMA 2ZRCA 3REFA 1F5NA 3KXKA 1E3MA 3B7GA 3OIYA 4JLAA 2RGCA 1CU1A 3S1AB 2V54A 2FF7A 3CUEF 5DIFA 2C95A 1UBCA 1Y3AA 1NN0A 1NKSA 4CEIB 1FP6A 4WAUA 2OESA 3AB3A 2HXSA 1T0HB 5J5CA 5KSPA 1Z6YA 4UKDA 1KZ7B 1S3GA 2RAPA 2W6JA 2OCBA 5TARA 2JLYA 4IKEA 4FXPA 5SZIA 1QHNA 1VIYA 1XMSA 4GFDA 3W8NA 2DR3A 1DS6A 5DISB 2O52A 2XXAA 5EXTA 2FFHA 2IYRA 1KK1A 2MSEB 3MSXA 5KYKA 2V3CC 4OHXA 1HQYE 1VG1A 4LJ5A 2IYYA 4HB2A 5KSOA 3K70D 1W36D 3BRWD 3L2OB 4XWKA 1P75A 2AD5A 1KTVA 2IYWA 3CRVA 4NE2A 2XB4A 3IHWA 3NVAA 5BQ5A 1N5KA 3NBXX 3N2IA 3OF5A 4IDNA 3OEEA 3ZDQA 2WWXA 3FWYA 1W36B 1HURA 4PQFA 4LX0A 2ZE6A 4TQAA 5B57C 1M8PA 4EPTA 3GFOA 1UBGA 4QHSA 4JZKA 1E4YA 3GLGB 1E2MA 2HCJB 1E79A 2C78A 3L0PA 121PA 1GRQA 2GXUA 3QXCA 2JLQA 1EX6A 1KKLA 1MABA 1CULC 4EAQA 2QE7A 4GMDA 4F92B 4ARZA 5FOWA 1L4YA 3V4RA 4DVGA 4URWR 4URZR 2QN6A 3QEOA 4ZCIA 2AXPA 1LB1B 2CBZA 5TVKA 1J8MF 4GRAA 3EWAA 4TLCA 5DN6A 4BPBA 1CLUA 3BFXA 1OB2A 5JRZA 1YZUA 2YHSA 1P60A 4Z1MD 4K81B 3R20A 3GEEA 2ZI6A 3OFNA 3I92A 3NBZC 2WJYA 1KAGA 2ZS7A 3QEJA 1XB2A 2IS1A 3W6PA 2KBEA 4L8GA 4YMWA 4G1UC 3VNUA 4DRZA 1KYIA 1E0JA 3GPLA 1NP6A 3QSYA 3KKNA 3B9PA 3LX5A 4Q48A 1ZBDA 1DAIA 3K0AB 2JLRA 2GA8A 4DZZA 5C1BA 5IT5A 1HE8B 1OH6A 3C7KA 4DKXA 1G7SA 1SQ5A 5ELXA 4URXR 3KL4A 5LPNA 4IW3B 1KMHA 1XPRA 1Z83A 3P32A 3GCGA 5FPSA 2VF8A 1VYTA 3MUFA 3QNUA 4Q1BA 3J81k 4TMVA 1NSTA 1N0VC 1LW7A 1W2GA 4ACAA 1KNQA 4R2IA 2VO1A 4EUNA 2RCNA 2ZIAA 4US0R 4Q9JA 2QP9X 5EP4A 4NONA 4MKFA 4M22A 1JR3D 3VKHA 5EQTA 3IEVA 3Q3JB 5TB5A 4CT4B 5KNCA 1RPZA 3WP0A 1U9IA 4RFSB 3WNBA 4X8OA 1OXTA 2JIZD 1VHTA 3TNFA 1G5PA 1A4RA 4LRWA 1TQ6A 1UJ2A 3QKRB 4GP7A 1BYUA 2PT5A 3BFVA 3BH7A 4BLPA 4C0SA 3A36A 5AUPB 1WRBA 3KUDA 2EW1A 3TW4A 3EPHA 2ZR7A 2IS2A 4US1R 1IOZA 4LWZA 1GDDA 2JA1A 4A9AA 1OXXK 4Q02A 2KBFA 1FUKA 1FQKA 4D4MA 4JKYA 5KSZA 4ZDKA 3GP8A 2IEZA 1Y63A 1DADA 2ZR0A 5EJEA 1KSJA 1N6KA 4EQ6A 1IBRA 2EFCB 2R9VA 3QF7A 3U7EB 3ZH9B 3U4QA 5JS8A 3W3ZB 1BS1A 3LW7A 1KSFX 1A5TA 2BM0A 1B23P 2YVUA 4KODA 1E9AA 2R62A 5DNYB 2JDIA 3ZQ6A 1Z0DA 1XJCA 2IC5A 2EFEB 3SBDA 1G3MA 1GP2A 2GCNA 3NBFA 4EJSA 2JJ8A 3SYLA 4BFSA 2ZITA 2ORVA 1U98A 2HLDD 1DAFA 1IY0A 3B5JA 2D3WA 1FUUA 3T1QA 4WXRA 2ZUBA 2ODBA 1HY3A 3B9QA 3MWKA 3WHLA 1TQ4A 1N5LA 1XTIA 1M2OB 3UMSA 3L43A 4PZZA 1JAIA 4DWJA 4UNQA 5DGXA 4P4SA 5EUQB 4B32A 1BIFA 3I62A 1IJFA 4ZCMA 1ODFA 3PIRA 2NO7A 3MFYA 1AQUA 1E9BA 1TUIA 4YDSA 1T5IA 3Q85A 4IEIA 3T61A 2DHRA 4OHYA 1JR6A 4PZYA 4WZBE 3B1YA 5FBLB 1E6CA 1PJRA 1XP8A 1IJEA 3RSOA 4Q1FA 3NWJA 1XD2B 4IJMA 1Z6AA 2OBLA 2R44A 3IO5A 1RJ9B 4M21A 4MYTA 3W9YA 1AA9A 3HYRA 1RRFA 2G88A 4G0NA 1PZNA 2XZLA 4Q01A 3W3AA 2XB2A 4NDZA 4KFTA 4P31A 1S3SA 1Z0JA 1W48A 2EU8A 3Q7PA 3RS0A 2XJ9A 4MA4A 1UKEA 3EIQA 2GVDC 1CJMA 1F3OA 4XWAA 1E2IA 2H57A 1OYWA 4BQSA 5B30A 3FGNA 1XZPA 1OHHA 2WMOB 4TLAA 3FPAA 4A0RA 1E2DA 1N6IA 1NLYA 2P6UA 3LD9A 4Q4AB 1GZSA 2C99A 2WIAA 4Q18A 2VA8A 5CIWA 4C30A 3VU9A 4TZ0A 3T15A 4A82A 3DKPA 2GAAA 4BFYA 2WTUA 4A36A 3B13B 5HZKA 1YQTA 1OIXA 2YYZA 4JIMA 4TLBA 4DSNA 1Z2AA 3HR7A 2EWWA 1WBBA 2H7VA 4DCUA 3U7FB 4A2WA 2WV9A 2IF2A 3QQ5A 4AWXA 3FB4A 1NLFA 1VMAA 1SHKA 821PA 1WE2A 3RHFA 2QL6A 1XEWX 2GDJA 2ZTSA 3B1XA 4NL4H 2ZANA 1XXHB 3A1TA 2WSSD 2FGJA 3VR4A 2ZRMA 5D3QA 2J87A 1U99A 2RGNA 2DY1A 4HLQB 4UNPA 1BH2A 5E95A 3A58B 1XCMA 4B76A 1E2KA 4FMCF 3NBYC 1QHGA 4JJKA 1GNRA 1DBSA 1QZXA 3SS8A 2TMKA 4RKEA 4LV8B 2F1RA 2GF0A 4CEHA 1G8YA 2XZOA 3WHKA 3CRRA 1AKYA 5DE3A 1CJUC 3L0IB 1V5WA 2Z4SA 2CL0X 3FKSA 1TL7C 1R5OA 2ERXA 3GLGE 4PXAA 4B2PA 1SXJE 2ECKA 4BLSA 4ZV4A 5KNBA 3UPUA 4BFXA 4F4JA 1JAHA 2E1RA 2IA5A 4TSFA 4HAXA 1XBTA 3U6KA 1RKBA 3TSWA 2HF9A 1JBKA 4DSUA 5BYKA 2ZS9A 2JLXA 3AVYA 2O8FB 3TUZC 2JJ1A 5FTMA 1XPOA 2VBCA 3SNHA 3EZ2A 4M9XA 2VL7A 3VNVA 4XD7A 2C04A 3R7WB 3UG7A 2CJWA 1E1RA 1W49A 2HV8A 1DARA 2F7SA 4KYIB 3SFVA 1F2UB 3FFBA 3QIAA 4QGFA 2JATA 4XVUA 1R0YA 3ZS8A 3FHTA 4W7SA 4FW9A 5K8UA 3RYTC 3P4YA 4HLUC 3DOEA 1M1YE 1ZUIA 2N42A 1GRNA 4HSEA 4CEJB 1J2JA 2GXSA 2FU5C 2HDNB 2NMVA 3Q72A 2GEVA 2QQEA 2V9PA 4QBGB 2GKSA 5CYOA 5TXGA 3P27A 5EXPA 4JLDA 5JSZA 1NY6A 4IOMA 2X77A 3K70C 2IWRA 1W36C 3I8XA 4BZQA 2QNRA 3RRMA 1TPZA 3K09A 2ZRJA 2REBA 4UXHA 3SYNA 2O8CA 3M4YA 3U5ZB 3AVWA 4Q1EA 1SXJC 4RD6A 4PR0A 3K1JA 4CT5A 2QTFA 2WWYA 4AKGA 1W4BA 4JL6A 5BXQC 1VKJA 3LVQE 1YHNA 1FQJA 4A6PA 3FOZA 3U7GA 1QHHB 3QF4A 1G6HA 1R6BX 1UBFA 2QENA 2J3EA 2VHTA 4RZ2A 5C2JB 1KO7A 4HZUB 3WP1B 1KK0A 4PPNA 4XJXA 2ZVPX 4B2LA 3ND9A 4DBLC 4AKHA 3FHCB 3THYA 4A2QA 5CK4A 4ESVA 3CWQA 4QHYA 2PLRA 3CWZA 2MMCA 4KJZA 5HTKA 1NF3A 1DELA 1Z8FA 1R5BA 1U0JA 2AR7A 2OBMA 3PEUA 5ANRB 4KAXA 4LC1A 4DT1A 4BWYA 3RS3A 1DE0A 2KJQA 2OSBA 4ITRC 5HR5A 1WBDA 1TEVA 4RSGA 2V1XA 2RMKA 3HU2A 3TW8B 5GVSA 4XSHA 1DEKA 2VYFA 4D2IA 1UF9A 4PANA 4C9BA 1Q1ZA 1US8A 1GUAA 1T4GA 1XMVA 4MRVA 3U44A 3SJAA 4YMTA 3RC8A 3WNDA 1KGDA 1XTKA 1AQYA 3ECCA 1RRCA 1I4LD 2D74A 4JLVA 2WJJA 3THOA 1Z0KA 3IQWA 3VQTA 3F8TA 4ESHA 1TUEA 1Z6GA 1ZC4A 2ZYUX 5DHAA 1GFIA 2OFXA 3PFIA 2YC4C 1H65A 3S1AA 2ZE5A 1P2TA 1YZQA 2BMJA 2FZ4A 4MYHA 4CEIA 3LQRA 1AS0A 4QL3A 3QG1A 4KV9A 5JCPA 5FUYA 1ZNWA 3LAWA 2YWHA 5IDVA 4GL2A 1MO6A 4M0LA 2XGJA 2EFDB 3R9IA 4DLVA 4P0TA 3BB3A 4IOKA 1CKEA 5EE3A 1DAHA 3L82B 1KNXA 4HLUA 3WMGA 5KU1A 1GKUB 1UFQA 1XEWY 3ASYA 1OIVA 2PJZA 1ZUHA 1N25A 1ZVQA 5IRCD 2HT6A 2QPAA 4OI1A 4B74A 5F98A 2PZFA 1ESMA 3VAAA 4PAMA 4B73A 2EFGA 1QHSA 1RW4A 1XEFA 5AUQA 2AK2A 5A0FA 4TMTA 4KHZA 2X2EA 3I5XA 3GLGA 2QQ0A 3W5IA 1ONBA 2ZI7A 1T0JB 3W5JA 2C03A 3AQ4A 1TTTA 1PUJA 4B34A 3Q9LA 3L8ZA 1KDPA 2GJ9A 3N2EA 4YXWD 3KQUA 2C9YA 4HAWA 2QM8A 1IQPA 4O25A 2VEDA 2EQBA 4QGHA 3P1JA 2FFQA 2HJGA 5D3MB 3CX8A 1U94A 2ZI4A 1P5ZB 2GJKA 3LA6A 2HYDA 1G18A 4Z54A 2E87A 2IHYA 2HF8A 3MJRA 4J0QA 4MGIR 4Q21A 2FPKA 4PPGA 2GCPA 4TTQA 3DM9B 4FCVA 1U2RA 421PA 2QPOA 4R9UC 4BLTA 1NBMD 3U61B 2NZJA 2ZJYA 1XXHE 2ZYTX 4Z1MA 5L3QB 4OK6A 2GBLC 1AIPA 1NIJA 3K0AA 2OAQ1 5FPTA 1Z0AA 2BBTA 1MRNA 521PA 4TL9A 4D4LA 5HKKD 1H8HD 4M1KA 1NMZA 1DPFA 1N2CE 1KO8A 3LXRA 2AX4A 5A4JA 2VHUA 4LOAA 2PLFA 1O87A 1U0HC 4TYNA 4TN1A 5L3RA 1D5CA 1IHUA 3VKGA 1H8EA 4CIDA 4D0LB 4PQRA 4BECA 1IY2A 4G5RA 2FWRA 3K0CC 1ZW6A 3X2SA 1R2QA 2REXB 2OXRA 2WM9B 3MMPA 2ZYWX 5HZHA 5JMTA 2FH5B 4RD1A 4MUAA 4R71A 4RFSA 1S1CA 4MQBA 4GT1A 4PC2A 2JEOA 1ZU5A 4LPSA 2ZRLA 1QHXA 3QKRA 3LBIA 2J0SA 4IVPA 2G9NA 1JR3A 1XU4A 1YR8A 2ZU6A 3DM5A 4C0AC 5TV2A 4DDWA 4KVAA 3THWB 2CLDX 1EXMA 4ILEA 4B3CA 4JLOA 5JJIA 2JIZA 3SE0A 1E9RA 1PUIA 2BOVA 2KWIA 3DZ8A 5JS7A 1QRAA 4KFRA 4F4CA 1KI4A 3LWNA 1HA3A 1SVMA 2NQ2C 4PHGA 3PQCA 2F1HA 4Q66C 4GZLA 4Z51A 5KDOA 4JLPA 2QRZA 3RS5A 5DI3B 1IXRC 2H5EA 4MITA 2BIFA 2YOFA 5CDFE 4V0LA 1Q1BA 2IL1A 2BEJA 1NN3A 2G3YA 2RGXA 1QF9A 3T1VA 2WWIA 3BC1A 2WPDD 4FCWA 4B6FA 5BW8A 5E7IA 5EE1A 1ZAKA 3OIVA 4PPQA 4I4LA 4P4UA 5DLQC 1MR3F 2G77B 1D9ZA 2IYSA 3O47A 2WICA 3QENA 5FBRB 2W00A 3NIBA 4WIAA 1Z22A 3EZ9A 2PH1A 3KKQA 4B75A 4FMDF 3PENA 1Z6XA 2V7QA 5LB2A 5SZHB 2XNDD 3U3RA 3CNNA 1WA5A 4D81A 1AJEA 2D4HA 1YVDA 4QJ3A 1MOZA 2D06A 2WOJA 4DIDA 5HCIA 1C9KA 4DDTA 3LBHA 4POAA 1XMJA 1WF3A 2BJVA 2CVHA 1JEDA 3AVOA 1NIPA 4A8JB 2I1VB 5BWMA 4JVMA 5CK5A 4Y0AA 2VP4A 4IDHA 2QZ4A 5LD2C 1D2NA 1IAQA 2WSMA 5GJCA 3AF3A 2D2FA 1FW6A 2IK8A 1T5LA 1X1SA 1U8YA 1VG9B 2ZROA 2ZPTX 3EZ7A 4MRPA 1D2MA 2NO9A 1CP2A 1XDBA 2W2VA 1XD2A 2B6HA 4KFSA 2A3RA 1RJ9A 3CZQA 4F38A 2ZRAA 4IDOA 1Q57A 4C0KA 3CM0A 3DZDA 4FINA 3BB4A 3GLIB 3UATA 4DSOA 3LFUA 1E9CA 1E9EA 3ND8A 5JI3E 2GETA 2FEOA 3KB2A 1Z08A 4Q7JB 2RHDA 3ASZA 3K9NA 1VYVA 2VIIA 4GNKA 1II8B 4C7OB 3U3KA 1N6HA 4Q4AA 5LBIA 1IM2A 3BAFA 4B47A 4RCYA 3JZAA 3L0OA 4G5GA 1N6OA 3TE6A 1GVNB 2ANCA 5L3SB 3B2EA 1E2QA 3H86A 2V55B 3NKVA 3DOFA 1FFHA 5B64A 1SXJD 2PBRA 4P33A 3ZZTA 1XX6A 2P5TB 4I99A 2GK6A 4ABYA 3K0SA 2OO7A 3K70B 1X1RA 4LYAA 2V1UA 2VP2A 1J7KA 4UQOA 1S96A 2A5YB 4OQMA 2J7PA 3LRPA 1XXHA 4WOPA 1EFRD 1SXJB 3MCAA 5AJWA 2OEPA 2QG6A 4JL5A 2O8DB 4O3MA 1XWIA 4YLGA 3GLFB 1E96A 3WXMA 2ZSBA 1KI6B 2FEMA 4II7A 1HH4A 2XAUA 4TMXA 3QVUA 3CRW1 2F43B 4NYMR 1E2PA 4KVGA 4X8LA 5FR1A 3THXB 1ZM9A 2BEKA 4LCBA 4HI0E 2DFTA 1MRSA 2ZE8A 1KI3A 1Z0IA 3QKUA 3NC1C 1R0WA 1QVRA 2OT3B 4QM6A 3GJXC 3QI2A 1PLLA 1ZP6A 5CB6A 2ZRNA 2R6CA 4B2IA 1N0UA 2YWEA 2O8FA 1OXUA 1TMKA 1W1WA 1SULA 1VDZA 2FV8A 4JLKA 1NI3A 2FFBA 4B71A 3RRNA 2WZQA 4GPTA 3DMNA 3R7WA 3UIEA 4LY6A 2J1LA 2OCAA 2XTMA 2PCLA 4BFVA 1CXZA 1F2UA 3G5UA 4C4PA 4NKRA 2ZRFA 4LUCA 4B33A 1BOFA 1EWQA 4U5XA 2QMUA 4ZDWA 2PJRA 3NXSA 3PUXA 3QKTA 3U2QA 4CEJA 4MH0R 3TUJC 3DDCA 4HAUA 3BS4A 4DSTA 1ZMXA 3CO5A 4PQYA 3ZD6A 5IK2D 1KI2A 3ICQB 3NTUA 3SEAA 4IFBA 6Q21A 4GMXA 3GJ7A 2QMEA 2ASEA 2EWVA 2WAYA 1CR2A 5CDFA 2CLCX 2IYLD 5JFGA 1ZNYA 4HAYA 2BV3A 2FE4A 4Q4LA 1JQLB 3GLHB 5L8VA 3T12A 1EFHA 3LV8A 3GJ3A 1KI9A 1NBME 3H2YA 4JL8A 3PG5A 2ONKA 4RFVA 3TGPA 1KAOA 3AUYA 5E4FA 1P4SA 3FTQA 3MWJA 3U3JA 1NKTA 2VSOA 4WA7A 1S0UA 5GVRA 4LHWA 2CL6X 2KI5A 4M8NE 3I3SR 1RRGA 2NO0A 1QHHA 4JBYA 4YMSA 4NTZA 1WXQA 4LJ7A 4KBGA 4NHOA 4BEJA 2J5XA 3KTAB 4HZUA 3VX4A 2IF0A 4PC1A 2NIPA 2UVQA 2VP0A 1K5GA 4W5HA 5FI1B 2RGBA 1QHIA 1SZPA 1XJ0A 2ZRKA 1GTVA 1U0LA 2W0SA 1GL7A 1G3QA 1YR9A 1NN1A 3QXJA 3I61A 2G6BA 4PSKA 3AKEA 2G83A 2WWGA 2P6RA 2PX0A 5FOTA 1VTKA 2NZ8A 3IIMA 4HYYA 2JLUA 4RVCA 1T3LA 5BN5A 1ZM2A 4V02A 3SN6A 4GI7A 5DI9A 2ZSAA 4EPXA 4DHEA 4PO1A 1RIFA 1Z2CA 5CITA 2BBWA 1CR4A 4HB4A 4ZKEA 2FG5A 1U81A 4KSBA 4TYWA 4E03A 1UDWA 4GBMA 4M4SA 2FZLA 3DPUA 4FWTA 1X8KA 4OJQA 2G0NA 4BFTA 2YWGA 1OJLA 3QPVA 2RB4A 2LKDA 1IN6A 3MG9A 3IIKA 3U3OA 2IS6A 2K5UA 2YJTD 2GF9A 4DEYA 1LVGA 1AK2A 4MRNA 1NMXA 3N5CA 1DAGA 4NYMQ 2AWNA 2W2XA 3T34A 1RC8A 3GJ0A 1DG3A 2FPMA 1FP7A 2NG1A 2J41A 4US2R 4IVRA 3B1WA 3PUZA 2ZJ8A 4IOJA 1R8QA 1YRAA 4AIIA 4YONB 4P4TA 4P3YA 1IN4A 1D2EA 3IBGA 3TBKA 2OBNA 3AF2A 2QTHA 5DYIA 5AJVB 1OFIA 4BASA 1S4QA 1I4DD 2J0UB 3EZFA 2XOKD 4Q03A 4Q4JB 5H70A 4RZUA 2CEAA 4LI0A 4LYFA 1VIAA 1VCIA 2JLSA 2QORA 5J47A 2UZ3A 3B1VA 3CH4B 1N5IA 5K8IA 1R10A 4IXMA 4M9SA 1ZD9A 2A9KA 1G17A 1Z29A 4K8OA 3HDTA 1EFTA 2LCFA 4A0FA 5AUOB 3Q7QA 2CHQA 3BXZA 1HV8A 4B3GA 2GJAA 3CKLA 4UNRA 2FSHA 5JJLA 3WYAA 1E9DA 1E2LA 4QJ4A 1MV5A 2W6JD 3BERA 2WJIA 3NEYA 5CYPA 5CJ2A 1KIMA 3KXIA 3KJIA 3PITA 4FN5A 3GJ4A 2QEQA 3ZS9A 4D6PA 1N6NA 2QMHA 2IT1A 4PSVA 2CHVA 4ACBA 3GLIE 2Q3MA 5JCZA 1VCOA 4NCHA 5J4KA 4QGAA 3UMRA 3JVVA 3B78A 4B35A 1EFCA 3NHBA 4LV6A 3KKMA 3TAHA 2A2ZA 2Q9AA 4JBWA 2WIBA 5KNDA 1YZGA 4TLDA 5C4MA 1N6PA 4DLXA 5D3MA 4A8JC 3OAAD 2FX3A 3BH6A 1Z47A 2OG2A 4TL8A 3RABA 1MO4A 2Q9BA 5EE0A 3QBVA 2C96A 4B3FX 1CR0A 3ADDA 4I1SA 3KQKA 2QROA 2WWWA 2Q3HA 3DMDA 3RNLA 1ZD8A 4LPKA 1VYUA 3RS4A 1M6NA 2BC9A 2GTPA 3OE7D 4QKQA 1KOFA 2BWJA 4H1UA 1XCGB 2XJ4A 1KO5A 3F3YA 5SZJA 5L3QA 3BIFA 2ZS8A 4C3ZA 1XPUA 5DN6D 2AKAB 3ZZUA 1AGPA 1ZCBA 4JLJA 4B44A 1LV7A 3Q5DA 3GLFE 4N0DA 1TF2A 1J99A 2IUUA 1NBMA 2C8VA 4JJZA 4NBSA 3OFND 1OFUX 1OF1A 5C4GB 4QRHA 3FFAA 1D8TA 1E1QD 2C98A 4RD0A 4QHTA 2DWPA 1TEXA 4TMZA 4B43A 4TWZA 3VKWA 2WKPA 4PZLA 3BB1A 4OHVA 3AGQA 2ZAMA 3GJ6A 1NG9A 1H8HA 4I1UA 4OYHA 3X1YA 2P2LA 5KPDA 1VG0B 4L5BA 2J46A 2Q9CA 2J0VA 4DCVA 4Q5IA 2FGKA 1LTQA 1QG4A 1X8LA 2CL7X 3LO5A 3TAUA 3WYGA 2OUKA 1L2TA 2IHBA 4XOIA 4QXAA 1W44A 3IPXA 4LJ4A 5LD2B 2JCSA 1DO0A 4DLSA 3LH5A 3B85A 2Q3FA 3EG5A 5KHOC 1KK3A 3R9WA 1G41A 5K8TA 2XTZA 3THWA 2OFOA 2PZEA 4M9ZA 4V03A 2O8BB 4NU0A 1LS1A 3QKSB 5JLJA 4OHWA 2GHIA 2GEUA 5FL7D 2Z6VA 1KJYA 5FOVA 1HTWA 2O5VA 2XTNA 3U3MA 5P21A 3B8HA 4JLNA 1E2FA 5DI3A 2JJ2A 1QVAA 2AD1A 2QGNA 1YKSA 2J9RA 3QJYA 2ZSFA 3GLHE 2CVFA 5EUMA 4ZIRB 4PSAA 5E7MA 1E98A 5EXSA 3ZVMA 1LS6A 4HUQB 1VG8A 3GMTA 3IO3A 3AKCA 1V43A 4XWOA 3ZYCA 4NCJA 1W4CA 5FOXA 1OH8A 3MWLA 4PTLA 2A5JA 2WPDA 3AP1A 2AWOA 3AVPA 4Q4HB 5EZ5A 2EVWX 1XD9A 3L0SA 2GZAA 621PA 3VR6A 2ZJZA 2ZJAA 1M7GA 4ZI3A 1OYYA 4B3XA 3AVXA 3QE0A 4OL0A 4LJ6A 2PMDA 3A6PC 2QBYB 4ZPXA 2JDID 1T6NA 4IDQA 4L9WA 2C2HA 2PCJA 4JT2A 1IN8A 2ZSEA 2DCUA 2ZR9A 3EIEA 3LNCA 1N6RA 1ZIPA 2MSCB 2NPIA 2ZRPA 3F5FA 4G01B 4JYBA 2FOLA 1G8HA 2XNDA 4CYMA 1XTJA 3HJNA 4A8JA 2VP5A 4NCKA 4YQFA 3U6BA 1P2SA 1Q3TA 3TH5A 1S1MA 1NRJB 2XSZD 4JSYA 4IDPA 1EFUA 4D82A 1AZSC 3NH6A 3VR3A 1RFLA 4EPRA 2X1VA 1DG1G 3IBYA 3EASA 5HE9A 2VHQA 4BUJA 2BBSA 2P67A 2QAGC 1IXSB 5FOSA 4V0KA 3KX2A 1NVWQ 3E70C 1FTSA 1G291 5FOUA 1TQDA 3SHWA 4LHXA 4LHZA 4F4IA 1CEEA 4DCNA 3UXMA 3WMEA 2G1JA 4GOKA 2F55A 2YOHA 2N46A 1XRJA 1A1VA 3GLIA 2CMKA 1KDOA 5E3HA 1NVUQ 1YR7A 5TDHA 1UEIA 1NJFA 2BVNA 2QT1A 3A1VA 4M9QA 4R98A 2BMEA 4MDEA 1F2TB 4O0MA 1NG1A 1II8A 3TKLA 4C7OA 1GRRA 5HCNA 2HJVA 4D80A 1R4AA 1T91A 2VSFA 5JECA 4L9SA 1COWD 3NHAA 2IYVA 3FMIA 3GJ8A 4OJKA 3PEYA 5FTJA 1NVVR 5L3SA 1II0A 3UK6A 3ZGXA 2CK3D 2QGZA 1TX4B 1ZJ6A 4M1TA 5LB4A 4QFMA 1TNDA 4Q1DA 4HB0A 4LBWA 2IBMA 3K9LA 3D6TB 3KJGA 4NPHA 4YMUA 3MGCA 2HEIA 2ZI3A 4LJYA 4AI6A 4B3DA 2ZU0C 1SKYB 5DSZA 5GJWC 1LFDB 1SXJA 1CIPA 3T5DA 4DEXA 3QUSA 3EC1A 2ONJA 1A7JA 3GLFA 2F3RA 2VP6A 3CR7A 1JALA 3BGWA 4IOLA 3EX7C 3REGA 4RZ3A 1KI6A 1QBKC 5JEDA 2AXNA 4RCZA 1EFRA 1G1MA 2F43A 4RD4A 4LC0A 3EXAA 4TT3D 4OQFA 3THXA 3T1OA 3H1TA 4N0EA 2BMDA 4U7DA 1FMLA 4NH0A 3R8FA 4LBVA 2ODWA 1IN5A 3N70A 1JXMA 1EX7A 1GSIA 2A5GA 5TMPA 1ZNXA 2B7CA 3AKYA 2NO6A 1XTRA 3RANA 2RKOA 5GJVC 1FX0B 5F3WB 4BFZA 1ANKA 1Q1QA 4V0OA 5B2ZA 4XTRA 1TU3A 1G7RA 3H0KA 4EPVA 4DCTA 3TQCA 3V9PA 2Z43A 1GNPA 3AF1A 1G64A 4DLYA 3FKSD 3IKJA 3KQHA 3ZVNA 1C4OA 1YZKA 5KTYA 1R0XA 3RDPA 2ZRBA 3OHMA 5KDLA 4Q7LA 1GG2A 4TSFD 2C9CA 1UDXA 1ZM3A 2CNWD 2J7KA 3H84A 3TLXA 3LY5A 4MKGA 2BMFA 1KDRA 2KSQA 3W6NA 1G7TA 4Z8XA 1YRBA 1E1RD 4Q1CA 2REOA 3GLHA 3MLEA 3QY0A 2GK7A 4HB3A 4U00A 5FTKA 5IK2A 1C1YA 3P4XA 3BJIC 1JJVA 2FSGA 2H92A 3MWYW 4NYIR 5DO9A 5JWOA 2DFLA 2FNAA 4DLRA 1X3SA 1G7CA 4DUGD 1SGWA 3RRZA 4EFLA 1L4UA 1VECA 4HUTA 5M04A 2WWHA 3D7MA 1NSFA 3KTAA 5FTNA 4A6XA 2B7BA 3BBPA 2YINC 3LQQA 3JZMA 3AP3A 4PC7A 2AN9A 3K53A 1DTSA 2HUPA 2WWFA 1WDTA 3RS2A 3QBTA 3O8RA 4IXNA 4AURA 1GWNA 3AEZA 1ZIOA 2OV2A 4W5WA 4D0GA 2H17A 1GITA 1KY3A 4D4KA 5FPHA 3CW2A 3WNCA 3SQXA 1ZYUA 2FFAA 3FMOB 4M53A 3VMFA 4Q9HA 4KITB 3TK1A 2ZREA 2RGEA 5JEEA 5FUXA 2GEDA 2OLKA 1UM8A 2H18A 1NVVQ 5GADl 3QXSA 4MGKR 3ZJYA 3T5GA 2F3TA 2R65A 3I4LA 1OIWA 2IYZA 2GZDA 3FVQA 1W0KD 2ODEA 1AS2A 3BOSA 4FMCB 2QA5A 4Q00A 2CHGA 4QBIA 5JBQA 2R6FA 2WMNB 2ODNA 2D7CA 1KMQA 3C16C 2WVJA 2Y8EA 5FFMA 3U7HB 4IRUB 3THYB 2G1KA 2HLDA 3K9GA 4AKIA 4ZDIA 2RGGA 3KJEA 3PVSA 5BN3A 4Q9IA 3PCRB 1LF0A 4E07A 1AS3A 3EARA 3DKVA 2QSYA 1E2EA 2QM7A 5EXXA 2FJUA 2GAOA 2UKDA 5GJBA 2P65A 3F0TA 1QG2A 2CDNA 1JNYA 5DHFA 5G41A 4DT1B 2W83A 4TYPA 3ONWA 4ERNA 1RYHA 4WVFA 4TL6A 3MJHA 1P73A 4LYJA 3UWOA 4MYCA 1UAAA 4W5JA 1KK2A 2QSZA 1ZCAA 3A1WA 2YZ2A 1Q21A 4KU4A 1VPLA 5AK0A 2GBLA 2J0UA 1SHZA 1OKKD 1GAJA 2PEYA 4OQXA 5CM8B 4Q4JA 1XJQA 2C9OA 3QPUA 1ZM7A 2O8EB 2AFHE 4U02A 5JWHA 1GL6A 3O8CA 3HWSA 3DO6A 1GM5A 2X19A 3SBEA 5AUNB 5DYGA 3GJ5A 1KO4A 2XNSA 4FCTA 2BKEA 3GQBA 4DXAA 3G82C 4RY2A 1WMSA 2PEZA 3I1FA 3AGPA 3C41J 1MT0A 1YR6A 3OESA 1I2DA 1U9IC 3W90A 3CF0A 5AJXA 4HDCA 2GVZC 3V00A 2YV5A 1R7RA 3K0CA 3A4LA 1NL3A 2YC2C 1IONA 3W8RA 4A2PA 2RHMA 3QG5A 2VLIA 1P9RA 1HYQA 4NP6A 4XSGA 4JLBA 3SJBA 3K0FB 3TQFA 4DIEA 1OXVA 3CX6A 4XVRA 1HEIA 3LVRE 3LXXA 4QNRA 1Q12A 2D7DA 1G5RA 1JEEA 4H9GA 1NY5A 5SZKB 4NYIQ 4TMKA 5EP2A 5KPJA 2AL7A 4LK2A 4XVQA 3EPKA 4HATA 3C15C 4C0QC 3BWDD 2QTVB 2OFWA 3PUVA 4DCSA 4G5QA 2GXAA 1NN5A 1UADA 3SC3A 1OT3A 3AF0A 2QAJA 3RSLA 5FBVB 1P72A 1P9NA 5E7JA 4C0LA 4ZI2A 4O2RA 4BGDA 1A82A 5G3YA 2WSSA 4GZMA 2JLWA 2WJHA 4N3NA 4AY2A 1K8RA 1T3SA 1G16A 1SVKA 1AGRA 4EJSC 1SVWA 1CR1A 1G21E 3RWMB 4Q19A 2RGDA 3OAAA 3DVLA 3SJZA 1WCV1 2V6IA 2VRWA 3HPRA 4C0HA 2KE5A 4FWIB 2RH5A 3GEHA 1SKYE 1AN0A 3A1UA 1E2HA 1IXZA 5AWFC 3QPWA 4M1WA 3ZZ0A 3BD9A 3TSOA 4AYWA 1N0WA 2YNMA 2DFKB 4LHYA 2DB3A 1JI0A 3E5HA 4LZZA 3TR5A 1Q44A 3OE7A 4BEBA 1RE0A 1UBEA 3EZ6A 2FMXA 5FI0B 1OH7A 2VH5R 4BFWA 4A1FA 3P20A 4JLMA 4KLNA 5G40A 4Q1AA 1FNNA 1NLZA 1XEXB 3SJCA 2JLVA 2Q6TA 1JXOA 3KJHA 2E9SA 3VTKA 4A4DA 4TYQA 1W7AA 3KKOA 5CJPA 4PAOA 1E1QA 2ERYA 2JAQA 2AHOA 1SKQA 1E2NA 3A1SA 3GD7A 3AVVA 1JJ7A 3LBNA 4KFUA 4S35A 4XIGS 3UMFA 4GDFA 5JJKA 1Z07A 4URUR 1TF7A 2V6JA 4MUBA 1VHLA 4I1VA 1FPMA 2ATXA 1X86B 2QAGB 2NTYC 1H8ED 5H8WA 2IS4A 1VCMA 2VP9A 1W0JD 3CONA 4QNMA 3I32A 2J45A 2O8BA 4KCGA 3VR1A 1SVLA 3QKSA 1OPXA 2ZUDA 3CRQA 1UPTA 1ZC3A 1DAMA 1ZRHA 2W6ID 3CLVA 3W34A 3PJRA 1II9A 1OXSC 1XTQA 2G0TA 2HYIC 2VSXA 3R9XA 5KSYA 3AF4A 1EGAA 1QHYA 1N5JA 3A4MA 3FE2A 2ATVA 2VQSA 4JVNA 3Q5EA 2XITA 4JVSB 4E09A 5FL7A 4MGYR 4EPWA 3KQLA 2LKCA 4ZIRA 5JHGB 2JLZA 4FMBB 1G3RA 2V8OA 3RC3A 1XF9A 2B8TA 1NJGA 2DWQA 3GEIA 4HUQA 4OHZA 4OK5A 4PAQA 2ZXUA 3ETLA 4HEJA 1T3HA 4XTCS 3AVUA 3CIOA 2QP3A 4HDOB 1ZM4A 4Q4HA 1DAKA 2GCOB 3CPEA 2WKQA 2FN4A 5CLQA 3AH8A 1R8SA 3X1ZA 4KI0A 2Q21A 1ZNZA 5CM9C 1M7BA 2RGNC 4OKSA 4CF7A 4TQ9A 3I72A 1R5NA 2CE7A 3LLUA 2W0MA 2QBYA 3I73A 4WXPA 3SQWA 3QOFA 4OQNA 5EP3A 3FKQA 1G3UA 1Z63A 3TVDA 2AKYA 1KKMA 3OEHD 2QP4A 1ETUA 1L8QA 2R8RA 1U8ZA 5EZ6B 3RAPR 5J4VA 4UXJA 1JQJC 2WHXA 3PUYA 3QXHA 2ZJOA 2V7QD 4MKHA 3ADBA 2FSIA 4V0NA 4TMWA 3JVUA 1E2JA 3EW9A 3T35A 3SR0A 1E2GA 2A78A 2QI9C 1P2VA 1L7VC 2AFIE 3I5YA 5EP1A 3W6OA 4URYR 2AK3A 4M1OA 4O2LA 2XSZA 1GKYA 1HT2E 1J90A 3O8DA 3SYKA 3HU1A 4ASUD 3B1ZA 2V4ZA 2OHFA 1DO2A 4TQUS 4PX9A 4CGZA 1NVXQ 1GIAA 1TADA 1XD8A 2ZETA 4Q7MB 3PEVA 1OE0A 4JYCA 5FBWB 4DB4A 1OFTA 1W5TA 4GP6A 4NMMA 2I4IA 2P0EA 2O0KA 3TR0A 4AD8A 3ZIAD 1F6BA 4MGZR 1BMFD 1FTNA 1F2TA 1XMIA 4M1MA 3TVTA 1G19A 2ZUCA 3E1SA 4PFSA 5H68A 3PXGA 1B0UA 1LNZA 3OIUA 1GOTA 1CJTC 4QC2A 1PLJA 2OCPA 3A4NA 5J40A 1RZ3A 2ZQ5A 5B58C 3AVTA 1LY1A 2OZEA 3IPYA 3LLMA 1G4AE 4H1VA 3R8CA 2D2EA 2O0JA 3U60B 2WBLC 1KHTA 1GL9B 1EWRA 3K09C
chains in the Genus database with same CATH superfamily
5ICEA 2R60A 2LZ0A 2EATA 1UR5A 2VTKA 2Y9PB 4R8LA 4TTIA 4XDYA 4EO4A 1UPXA 3DYVA 4MWSA 1SVOA 1TAHA 4H3SA 5I7HA 2YWXA 4B6EA 1VL5A 3M3HA 3ZTWA 3ADOA 2JFUA 1U3DA 1GNLA 4KLZA 2WQ7A 4TZ6A 5AVWA 3A9CA 3IJ5A 4GPEA 1U1GA 4F7WA 1RC0A 1T29A 1P0PA 3AY3A 1QHFA 1WCWA 3T3IA 2WSLA 3DFZA 1QRRA 4K5QA 4QQFA 1YS1X 2NVWA 2EKDA 2R84A 4RF3A 4UUPA 2AI1A 2B4AA 1SWWA 2H2IA 2QTTA 3B7WA 5A5VA 4OI0A 5LQKA 1UK6A 1JJBA 4JJGA 3EF1A 4WZ6A 1A71A 4PS1A 4P92A 3HLKA 5ILOA 4R7ZA 5TT1A 1XIVA 4YRTA 3I1JA 4ZRDA 4KRGA 2HMTA 1K3TA 2I4RA 3PKIA 3RH0A 4DS3A 5G3ZA 4F4HA 3IJRA 4B3TB 4P22A 2HNKA 2NXWA 4L15A 4DA0A 4W9RA 4ICIA 4KLCA 2JRLA 4IMIB 4MEAA 3S2GA 1P61B 4WLVA 2PKYX 4IHJA 4Z0HO 4ARSA 4WERA 5CIQA 3TYXA 4CU2A 2NZ2A 4DMFA 4BE9A 3C7DB 2ZRGA 3CUWA 2C2BA 4HGNA 4DLPA 4BC1A 1FNMA 1WXGA 4F12A 3H65A 4DCTA 4FFPA 2FLWA 2IRWA 2Q3EA 2XMZA 1PGJA 3E15A 4WFKA 4C4OA 2H1LA 4KXUA 4M8IA 4E5UA 2XLBA 3WL4A 2GILA 1G59A 4M3NA 4MHOA 2BHRA 1D9XA 3HRIA 4RQBA 1C0KA 2BFOA 4OSEA 3CXRA 4EENA 4C2TA 3VO1A 1P7ZA 1FDIA 2PT7A 4Y1FA 1XMPA 3VYWA 1G5TA 1KI8A 5AJYA 2YW2A 4RH0A 6REQB 1K2VN 3DQZA 1AMUA 3LZCA 5G0WA 2H3EA 5HKKA 4O4JA 5C1IA 4ZVLA 3MBOA 5KYGA 3L7NA 2H4HA 2OK7A 4KIGA 3FLEA 5FPYA 7MHTA 5K09A 2VF7A 4WFQA 2J59A 4H7HA 2R8OA 3QYPA 2YXBA 1JZQA 4ARBA 4L8YA 1MU0A 1RNLA 3W5AA 1U7HA 4XX0B 3STTA 4ZO4A 4CIYA 4D26A 2FA9A 4GOXA 1N2JA 2Z4RA 3B1KA 2C3YA 2PRIA 1XTVA 3NDPA 4OA8A 4M55A 4A15A 3HYTA 1KMHB 4WFIA 1G8JA 3UYLA 1G20E 1Q91A 1TW2A 1UFRA 1YKFA 1SVSA 3OIWA 4TSKA 2FAXA 4H15A 3SHFA 4N41A 2E21A 4K05A 3FNQA 4J2HA 3DDNA 2EIXA 2NAFA 2PXHA 1TRHA 1GFZA 2IXGA 2QRVA 3C3CA 1UEXC 4X8MA 4Z49A 5LNK1 4K26A 4DB2A 4LXTA 4L3WA 5IT9A 4RHYA 1PJ3A 4HH0A 3UQZA 3B60A 4C76A 1VCNA 3DFFA 4IXDA 3AHHA 1JSZA 3VR5A 2LUOA 2PX3A 4WSOA 3R7LA 2BJHA 3HB7A 3SEZA 2OV8A 3O4GA 3W5SA 3ZDFA 1HYGA 4DWVA 4HEA1 3T3OA 4FGSA 4ZVQA 5ER9A 1GILA 4WGGA 4DCCA 4I6EA 4OQPA 3PTAA 2V58A 3N2KA 4K28A 2IYXA 2J4DA 3G5LA 4KKXB 3WO0A 2W37A 2BFAA 3QV2A 1FDRA 2GBIA 1E0KA 3DP7A 4PFQA 1XMOB 2YMQA 2CXRA 4PPFA 3HV0A 3IV6A 2DFPA 1W35A 1NJ2A 1OLOA 2VNSA 2EXXA 3AW8A 1XEAA 3ED1A 1C9DB 3D02A 3IIJA 2Q29A 4J3FA 1S3IA 2R6HA 4ZV9A 3V8EA 3GRRA 1I3CA 5EY5B 1TF5A 1LX7A 1YACA 4R8RA 1DCMA 3ELYA 4M86A 2O2SA 1ZISA 1K7FB 1YDEA 1RHUA 2QN3A 4I4NA 4NOLA 3WAJA 2RHHA 3TUIC 5JCJD 1D6SA 5CT9A 2DBQA 4AMUA 1G4UR 2Z3ZA 4KPEC 3KHTA 2XDWA 4HAVA 1YVRA 4XIJA 1DMSA 1JR4A 1QDEA 2HRBA 3BF7A 3NFYA 4D57A 2IIBA 3AVQA 1N5MA 2J5QA 2PTHA 3CF4A 3DB2A 2RHLA 3CE9A 3DHYA 4ZQFA 5H1YA 2H65A 5AJZA 4AG6A 4CCWA 1KQPA 1EP2B 1SQSA 2I34A 2EFHB 3MQ4A 4X1KA 1W73A 4XXHA 3O74A 4HSGA 4TTRA 5TY0A 5CXUA 4HDQB 1NLUA 2PLWA 4D9IA 2QRNA 2FFJA 4GLBA 1VB3A 3RGGA 3BWXA 4MV9A 4PQGA 1X7XB 4CCAA 1H4VB 3WC4A 3P9KA 2GZHA 4Y6GB 4O2AF 5LZ7A 1IHXA 3C14C 1J06A 2B98A 3NHFA 3PCTA 4FXOA 4DADA 3JD0A 3JZDA 4K6FA 3ZLJA 4J7AA 2O8EA 2P7HA 4BRUA 1I0LA 3HE3A 4JT9A 2GUGA 1DIOB 3A4IA 3Q6IA 1GYRA 1RP1A 4OI4A 1OKKA 2YRXA 5DXAA 2GNOA 3DEFA 3L7YA 4AECA 2CCJA 4J2OA 3GA5A 4MRMB 1E69A 1N9ZA 2OCIA 2ZTMA 4GLJA 1YZLA 4O4LB 4XQGA 2A0UA 3PPVA 4BGEA 3I8SA 5K8LA 2Y93A 3C8UA 3R5KA 4RXTA 1CNMA 3A8TA 5KUTA 4Z8YA 5KTRA 4AO8A 1IZ7A 2RSLA 1MZVA 2WFAA 3P9SA 5CPBA 3RAJA 3BSFA 3SMVA 1GKIA 2EFYA 2ET6A 3BTUA 3UT6A 4CW7A 4L02A 1K86A 4FOLA 4WKBA 4X3PA 3VPCA 3CLSC 3AF5A 3SHVA 2AZDA 3HJBA 3CBGA 4Q7KA 3OX3A 1XQWA 1Q5PA 1J0EA 1OHHD 2C83A 2I3AA 3WWEA 3OBBA 4RZXA 4DZRA 5B1YA 4F8EA 3FMPB 2YKGA 4JP8A 4AYTA 3MWGA 1I3NA 1OSNA 5F76A 1XVVA 2E82A 2IXEA 1YZTA 2DH6A 2HSWA 2KMLA 2JGFA 3C5CA 4HDKA 4JLWA 4RM3A 5FNVB 4DDMA 2ZM5A 2HU2A 2D6FA 3EWSA 1PHPA 1M33A 2FEXA 4YRQA 1YFLA 3QXXA 1F1BA 1X8JA 3FN4A 3OZUA 4HMOA 2X0DA 4IEEA 4HDSA 2NPFA 3ZWVA 3TL3A 1ENYA 2XX3A 1YOVA 4PHTA 2V6BA 4LDJA 1B43A 4M1EA 3HXKA 3MAAC 1ITZA 3CZ9A 2W2PA 1QQ5A 3EVBA 3KKPA 3Q7EA 4FFBA 4YCLA 1AMOA 3ZXSA 2X8JA 5AHOA 4JNCA 1IPEA 4D3XA 2H5IA 4DA6A 4YDQA 3FHOA 1BXGA 5F2OA 4NFLA 2Z0MA 4MVWA 4RAQA 1N4AA 4Q39A 1V4VA 4A3SA 3VR4D 3GRZA 1U28A 4X90A 2JAWA 4Y2TA 4ALIA 3RS7A 4TKLA 3RROA 2VWQA 3EPLA 4AQYB 5AVQA 4OK3A 3GRFA 1GG5A 2JGNA 4GDMA 5JHHB 4IWXA 3E9DA 5GOZA 3RI3A 2C31A 3RVQA 3J80A 3CCFA 4OQLA 5FWYB 1QG6A 1RJGA 1CQIB 1SBTA 4R1LA 4KPGA 1VRWA 2ZBPA 2WF7A 4R0VA 1BAPA 4JB8A 4LNAA 3GPBA 2G04A 2C7BA 2Q6KA 4XGNA 4XWTA 4QT4A 2L82A 5IFKA 2OMKA 1K8ZB 1A69A 1DMRA 2VAWA 4TMFA 3GU3A 2QYSA 4TKUB 3M5CA 1P9WA 2A7QA 4FSHA 2GAFA 1E9FA 4EKYA 2WQ6A 3PQ2A 1HUQA 1MC8A 1WB9A 1C7QA 4JMPA 1ATIA 1XEXA 5D7NA 5CA0A 3IV7A 4MVJD 3PT5A 3QLUA 1U1FA 3BREA 4CRWB 5JI2E 3THSA 5BMVF 5KNBD 3H8VA 3SCZA 2BFWA 3SKVA 3C4JA 2H06A 4H7DA 3TBHA 1GYQA 3QFRA 4B3BA 5U1PA 3NH9A 5FFNA 3FPKA 1QH8B 4FYMA 4YMLA 1U2TA 4XD7D 2XE8A 1GGHA 1CBUA 1NF2A 4AULA 2C00A 2O6HA 3MYRA 5AOAA 3QFTA 3AJ9A 3DULA 5A5DA 4HH1A 5ALYA 2YY6A 3DA8A 4D42A 3S7TA 1E94E 1PO7A 4FFNA 1ENOA 2RJOA 4LG1A 5ILGA 1ZSYA 5FUWA 4G1EB 4YQYA 1HX7A 4Y0VA 4YCJA 2HRCA 4G81A 4QUGA 2PMKA 2M98A 3PDIA 4KXWA 3PYXA 1U7ZA 4KFCA 2CJWB 3GVCA 4TYYA 1JPJA 4JCCA 3ML1A 4GOND 3UKOA 1YU9A 3IQZA 1YHZA 4OA5A 4N5IX 5FPQA 4FEGA 3ZXUB 1CF4A 4AKEA 3PHHA 5G4KB 3IMGA 3AM1A 3SQDA 1RCUA 2GVNA 2Q0XA 3HR8A 2G4VA 3K72B 3LT1A 4TM7A 4TV8A 1GADO 2HCFA 2R6GA 1HNWB 3FWKA 3ZQUA 3UAYA 2W6PA 3ZY4A 3KQNA 1JFVA 2WV7A 3A11A 1M34A 2GDZA 5IC6A 4RC9A 3HDYA 4YC7A 4HQNA 4M0EA 4S2EA 5KKAA 3CTMA 1V47A 5IC5A 1T2FA 1B6GA 4B4DA 2QUIA 3N75A 3KZOA 4BKOA 5JSZB 3OQIA 5KJ1A 2XZPA 3JCZA 2O2ZA 1UFKA 4HPXB 1PYGA 3CPJB 4EFNA 4ZT2A 2GCOA 2VVTA 3R9KA 1JDUA 4C0JA 2FF5A 2LWIA 2AMVA 4V0MA 1AHPA 1KFCB 1RU3A 3L7CA 1Z2OX 4FK8A 4N1AA 4W8OA 2ACVA 1GPYA 5AKYA 3DOOA 2CNLA 5BSGA 721PA 4CZ2A 3J81A 2HWUA 1JPNA 2ECPA 2ZT7A 1E99A 4MUIA 1I4OA 4FU0A 2AFIB 1BKDR 1S01A 2MTBA 4KNWA 4GS5A 1XJWA 3AHGA 4TTPA 4Y30A 4BQRA 1A2OA 1MPXA 2Q5HA 3O4FA 1HR0B 1S3FA 3ADKA 1IJKA 2O1EA 2CDRA 4NCXA 3HUEA 2HFKA 4WUVA 3SZGA 2B69A 2GD1O 3EK2A 2XKBA 3T1TA 2DU8A 3D8BA 4Z5XA 3HU3A 3PRHA 3PXDA 1C7JA 1QXSA 1DX9A 5JARA 1SBHA 3QI7A 1Y89A 5CLLA 2DVMA 5WRFA 3VR0A 4W9MC 2XUHA 3JWHA 2HI0A 1RWWA 1YE8A 3MLAA 4ZCPA 1IHPA 3LXMA 5ENVA 2G76A 2C3MA 4PY2A 4EUSA 3MW8A 4O02B 3OEHA 2W4IA 4HZIA 4LHEA 5DW3A 2XAAA 2IYEA 5IU6A 4RVDA 2N1BA 3JD3A 2Z2KA 1J4AA 1YB2A 2OTCA 2Z8YA 3DVSX 4RE5A 4DLWA 2CXXA 3A1FA 5JD5A 1CB7A 2VRNA 1X39A 5KTSA 3LDAA 4EUKA 5A9SB 4MAFA 5IWAB 4MUJA 2KB0A 3HBJA 3PZRA 1IZ0A 2PJDA 4P80A 3SEFA 4BZPA 5LOVA 4ZFNA 4FX5A 1XCPA 4R8SA 3COYA 3KAKA 4O63O 3UCXA 3WIEA 1HWYA 1XNJA 4ANFA 4I81A 5I7FA 2B0JA 2I3BA 1EVQA 5DM70 1DOAA 2YVKA 2FSUA 2HREA 1T1SA 5TSDA 2F8TA 5JYDA 1RVDA 1IM8A 2ORWA 3SQMA 1EAMA 3IDZA 3GYGA 3T3DA 2Z6QA 3CLRD 1XZQA 2BCGY 4QEDA 4LISA 1B14A 2XUPA 2A1UB 1KRWA 1XA4A 1Q50A 3EISA 4URVR 1NONA 3L46A 1L9XA 2H63A 5LKAA 5U9CA 4IHQA 1BMFA 3EC2A 3SY8A 5BY2A 5EC8A 4IIHA 1EHIA 1QVZA 1WCYA 2PSEA 3DD5A 3SXJA 3W6UA 2VOJA 2DPYA 1VSTA 2VXBA 4JSRA 4RHUA 3S1AB 2V54A 4CTJA 1W93A 3KEFA 4JHXA 2JFFA 2C7QA 3OLWA 2CB0A 1GPMA 1H5UA 4OHOA 1NKSA 2W71A 1PQPA 4W82A 1GNSA 4CEIB 1YAJA 4BN5A 3MJVA 4WAUA 3GDOA 5JQGA 3MRXA 2DJ5A 1CDEA 2ZM6B 4N47A 2PKEA 3AB3A 2OB2A 3RGWS 3UWMA 4AROA 5KSPA 1Z6YA 4CLDA 1JRLA 2W6JA 3VDQA 2C61A 1HLPA 3T5MA 1XMSA 1GGNA 3AI1A 2VNJA 5CNKA 3UK1A 1HKHA 4RQAA 2GQ0A 3HXLA 4N18A 2F17A 4M7WA 1QB8A 4Y9DA 2VCEA 3BA6A 3UJHA 2XXAA 2IYRA 1E6MA 1NF8A 2DSTA 2MSEB 1NVGA 3LY8A 4EHFA 4OHXA 4KQKA 3SDSA 4D3DA 2IYYA 4HB2A 2BMVA 1CY6A 1P75A 1DT3A 3WOHA 3CRVA 3NHUA 1LQUA 1U9YA 3HCEA 3NVAA 3EUAA 1EFDN 2G6TA 2QM0A 2AX3A 3U40A 3OF5A 3UMVA 2IP1A 3GEGA 3FBTA 5AKKA 3MAGA 3W8DA 3GP5A 3AK4A 3OEEA 3TOVA 1LPBB 3CQ9A 3GJRA 4CFYA 1SCQA 1X3LA 1XDUA 2DC1A 1JG1A 2JANA 4FFDA 5B57C 4TQAA 1OUMA 3FCAA 3OCXA 4EPTA 3IR6A 2R8YA 1L4BA 3I28A 5ECGC 1S2DA 3GDWA 3P2YA 4MCAA 5FB3A 3N6RA 4U7JA 3VNAA 2HCJB 3MJFA 1E79A 1KEWA 2JCVA 1XK7A 1PFWA 1SM4A 2HAEA 2M2IA 2PH3A 3UB2A 5IJ9A 1MJFA 1EX6A 1KKLA 3FR7A 4EAQA 1JXQA 4D9BA 5HBGA 1Z18A 3JPYA 4GMDA 4Q9NA 3CZ5A 1EPUA 2DUJA 1HKUA 3SF0A 5FOWA 4FDTA 5PNTA 2EKPA 4DVGA 1Q7GA 1GLGA 3ELWA 3LUCA 1SUDA 1BA3A 1WD7A 4OOFA 2RBGA 4URWR 2ZGVA 1ZL2A 2AXPA 4TV9A 5TVKA 2QXTA 3AHJA 3G2HA 4OY3A 3CU5A 3LUKA 5JXHA 4URHA 1CLUA 2YJZA 4PNHA 1OB2A 3FHLA 1G20B 5BV7A 2YHSA 4Z1MD 3R20A 3EVCA 1KAGA 1M1YB 3CNHA 3HKCB 2UZ1A 1I13A 3W6PA 4D92A 5KTTA 1JDBB 3HKDA 4ENRA 3WLFA 3TEJA 3LX5A 1T5BA 4RS3A 1ZBDA 3L0ZA 3RV3A 3C5EA 3ZCSA 1DAIA 1M76A 1MA3A 1CHNA 2JLRA 3K0AB 5C1BA 2QPLA 2PO5A 2XDYA 4MW1A 5H80A 3ZHQA 3OX4A 1OH6A 3C7KA 2YJ6A 5B6PA 2IU4A 1SQ5A 3UFXB 2XDQA 4DCPA 3U16A 1XPRA 1Z83A 3P32A 4NI5A 2C5EA 1FE8A 3GCGA 2VF8A 1RQ7A 2DETA 3D4NA 1NM5C 2AV6A 5IBRA 1N0VC 5TE9A 4WOJA 1J9ZA 1LGYA 2Y4OA 1W2GA 4B85A 1UMCB 5CT5A 4NNJA 4EY3A 4X54A 4R2IA 3JASB 1JMKC 4XVHA 2RCNA 4EUNA 2ZIAA 4US0R 3RBVA 4YO7A 4Q9JA 3TI9A 4KDFA 5EP4A 5F77A 4NCAA 4C03A 2UYGA 3W2EA 2FJPA 3DF7A 3HJUA 3QFCA 3NWBA 5FOQA 5KNCA 1EUDB 1RPZA 1Y8CA 4RFSB 3WNBA 3WG9A 3COZA 2JIZD 4DMCA 4MZDA 1VHTA 3TNFA 1G2OA 5FRDA 1E1YA 1EXWA 2WP8J 5EIHA 4FFMA 1Z15A 5C5DA 4NBKA 1B2RA 3QKRB 4GP7A 4PHCA 2PT5A 2RHJA 3BH7A 3TQIA 4C0SA 2PUFA 1A76A 1OC4A 3U9LA 5AUPB 2WYHA 2EW1A 5BP7A 1PSDA 2I2BA 5COAA 2PRKA 2JAOA 3C4QA 4LWZA 1M5UA 3QXGA 3RFXA 1NE7A 5EWMA 1JT9A 4FR2A 4D4MA 2DLCX 5FWXA 3L0YA 4C20A 3BHNA 3V6LA 3GP8A 4WOKA 1QGDA 1DADA 4HJRA 4XJSA 1KSJA 4C01A 1N6KA 3EUWA 3G13A 2X9QA 4OBWA 4L51A 1FJ2A 1IBRA 4LXHA 4QU5A 3QF7A 4UFOA 3OH8A 1D1PA 1A4UA 2F8LA 4WEOA 3EIUA 3U4QA 3ZV3A 3ESZA 1ZKMA 1KSFX 1A5TA 1NLMA 1B23P 3NBQA 4PG7A 4KODA 1KQOA 4RVUA 1A2QA 2C0QA 2R62A 2WVHA 3O1LA 4X1YA 1DINA 2JDIA 1KETA 3LF2A 3ZQ6A 2A7XA 3IC5A 3WI7A 1G3MA 1GP2A 2CFOA 2MJLA 3H8SA 3UF0A 4PG8A 2C1EA 1PFUA 4KQJA 3WNQA 5CDSA 1H6AA 2JIOA 3P2JA 3DAOA 4MKRA 2ZITA 2TS1A 3HVHA 1XTTA 4R0NA 1U98A 2B1RA 2W8BB 1UINA 1JP7A 1DUIA 3VC2A 1YR3A 5CFOA 3B5JA 1JSXA 3IMFA 5F1OA 2ZBDA 3MJ4A 3FGOA 1F4LA 2ZVDA 3WZMA 3PPYA 1QK4A 4OXNA 3B9QA 3A9WA 4IHJF 5IEBA 5AIBA 3WHLA 2O2JA 3PC8C 1HT0A 2AJCA 4M8LA 4PFKA 3TM4A 4F1WA 4WBNB 1JAIA 3NTVA 2EL9A 1NFFA 3T95A 3ZCPA 4QJIA 3DO5A 4P4SA 5TQ0A 2H1RA 2I6XA 4ZN6A 2WJ4A 1IJFA 4IIJA 3IH5A 3ZHOA 3N2GB 4GLFA 1RQLA 3CCBA 2RIPA 2O07A 4H27A 3JWEA 3SIPA 1E9BA 1TUIA 3A3PA 4G5HA 3CX3A 3CZMA 3KDAA 3Q85A 4RYDA 3WYEA 4TXHA 4OHYA 3NHYA 1JQEA 1PJZA 1D7AA 1PJRA 1ODJA 1TGYA 4MA0A 4WK6A 1DO8A 4K9SA 5ARDA 1IJEA 3U39A 2CLEB 1G6Q1 5ILQA 5K2OA 2HNBA 4O4JF 1Z6AA 2OBLA 2R44A 2DPHA 4M21A 5K3FA 1AA9A 2G06A 4E2ZA 1LDBA 4CV1A 1T5SA 4JY7A 3W3AA 5HTOA 3REQB 3COVA 3NHWA 2YXNA 4YEDA 1XRLA 4P31A 3PK0A 1S3SA 1V41E 1W48A 2JFZA 2ZTUA 1MDFA 3GLTA 1QS0B 4MV0A 1UKEA 4JK3A 1CJMA 1F3OA 1E2IA 2V3VA 1NM5A 2CBGA 2IPAB 5IVDA 3K92A 3N2NA 1F7VA 4LF5B 1HDCA 1E9VA 3K4QA 3V4ZA 2JRCA 4BDSA 3GRKA 1E2DA 1BHO1 1N6IA 2IX9A 3LD9A 3T52A 2WIAA 2YW9A 5CIWA 3VU9A 1LBTA 4TZ0A 4PYRA 5JNLA 1BNCA 2GAAA 1LBQA 1UWCA 3B13B 5LKRA 5T64A 1J7JA 1I7NA 1SUFA 2YYZA 3S29A 2O20A 3HR7A 1QGUB 2RGUA 1M1NA 2H7VA 3B1FA 4M7PA 3I39X 2DQKA 3WLOA 5JTUA 4XQEA 1WZNA 2JI6A 1NLFA 1VMAA 2RG1A 3A70A 3CW8X 2REQA 3JVIA 5COQA 2I55A 4FOPA 2B5VA 3ANYB 2HA2A 1WV1A 3IDFA 3JWIA 2FR1A 5CGQB 5D5PA 3BZUA 4JEUA 4GHWA 1Q7EA 3B1XA 2Z3WA 4H77A 5CR9A 1U9ZA 5CB0A 3A1TA 1JJFA 1WXWA 2TMGA 5LQDA 4M54A 3HK2A 5E0KB 1FX1A 3TXXA 2PYZA 3F96A 3MGBA 1L6IA 2Q3DA 3IKMB 4AUMA 1BWRA 4N0QA 3T7AA 1OX4A 4B76A 2UDPA 3A3OA 1XDZA 3UUFA 3OURA 5B7GA 3T9DA 1WZUA 3VC7A 4Q16A 1K88A 1XL0A 1U1CA 1W87A 3WL6A 4EHAA 1GG8A 2YNMD 5TS2A 4NESA 3A0RB 1PTJA 1T9DA 2A1TR 3H5NA 4GR9A 4KGZA 1ULSA 4CTOA 5IZCA 5JISA 3ABRB 4W5NA 1J0XO 2GI4A 3L0IB 1V5WA 2DHDA 3PQFA 1CSEE 3FKSA 3TZLA 4C1NA 4CIBA 1WMDA 3EVZA 1GTG1 3T0IA 4B2PA 5JDCA 4HXYA 3CUVA 1RSZA 4FNMA 4UDXX 4BFXA 3EDRA 2IA5A 2XWSA 4X71A 5DHRA 3Q3IA 5G4LA 4EATA 4N7MA 2I2CA 2OCKA 3TSWA 4DCJA 3M6MD 4M76B 5BYKA 3TTUA 5C3MA 2O8FB 3DZIA 1P4HA 5BO5A 4UCQA 2JJ1A 5FTMA 2C82A 2VBCA 4GBGA 3EZ2A 4M9XA 2OFFA 3SNHA 2VL7A 3OM8A 4UBMA 3AESA 3T9AA 3WOVA 4DIKA 4P4NA 4DMGA 3G6WA 4DMMA 2FP4B 1J2YA 4GEGA 1ZK4A 1GL3A 1DARA 3ANNA 3OLVA 4KYIB 3TDKA 4MW0A 3UV6A 4HWSA 3SS9X 5A5FA 5MFZA 5EIBD 4JJIA 4QFDA 4UEOA 3OJWA 1DBPA 1ISRA 3DOEA 3WO1A 3BTVA 1ABFA 3ZWQA 1SCNE 2GXSA 4RQTA 1PQUA 2NMVA 2A0FA 1ZG3A 2GEVA 3LHIA 3GPCA 3BZBA 3VPAA 3QVTA 4FGKA 5TXGA 4M1QA 3DO8A 1NASA 1ISMA 1LJUA 1Q0PA 2VWHA 2XH8A 3D6FA 4N82A 4E08A 4NATA 5CB4B 1WVIA 4IOMA 4Z0NA 4ZU3A 1X9HA 1ZBQA 2AQKA 3I8XA 4JZYA 1F8FA 1QF7A 4D9MA 4ZT3A 4UBKA 4V38A 2O06A 3B36A 2VK2A 1KERA 3WWDA 1QONA 3X43A 4BO4A 3I5UA 3LKVA 3SYNA 3M4YA 4C89A 5DOZA 4ENQA 1YS6A 4MVJM 2O8CA 4XM1A 4Q1EA 4F21A 3PC2A 2P68A 3CSUA 3TKYA 3AY7A 3K1JA 2AZ4A 2YHIA 3B89A 4PGMA 5HSGA 4JL6A 2NZVG 1E7RA 1TIKA 4IGEA 5K51A 5JY6A 2XV1A 2ACEA 2BR3A 3T8YA 1QIGA 3WK9A 4YRSA 3FOZA 4N48A 4DMRA 5AW3A 1QHHB 1CUIA 1VIVA 2IU3A 3R9XB 3P97A 3PJDA 4RSMA 2ZTHA 5GZ3A 2ZAGA 4RZ2A 3V55A 4Z2YA 4XJXA 4BX3A 2Q3CA 3PNLA 4MW9A 4MQEA 3BMXA 4DBLC 4AKHA 2ZB7A 3THYA 3L7IA 4QDXA 3C3BA 5CK4A 3A27A 5IBQA 5K99A 1XROA 1BCSA 3G6KA 1NDQA 3M9LA 4ZEXA 4ESVA 1WHTA 2EJVA 2PLRA 2FE1A 3DE4X 3HZRA 5HTKA 4R68A 4JB2A 1NF3A 4HNVA 2HTEA 3PX7A 3B52X 5DNEA 4REQB 1U0JA 2OBMA 3M6FA 5DF1A 3C0KA 1NVDA 3U19A 4S04A 4LC1A 4DT1A 4BWYA 3RS3A 1NXXA 1NZDA 2DHCA 1T9CA 2UAGA 4RSGA 3W2HA 2DTEA 2V1XA 3JD1A 5F3RA 5U4QA 3A3NA 1DEKA 1SCUA 2VYFA 2HK9A 4I66A 1GYPA 1Z36A 3QELB 4C9BA 3BXPA 3PI6A 4P3XA 1Q1ZA 2VAPA 1US8A 4IVNA 5IJWA 1FZTA 2IHZA 3ZGYA 3JTMA 4NJOA 4ZAYA 3SHQA 4BC0A 4CMIA 1QP7A 4S2UA 3C1UA 4MV7A 3NDIA 1BMTA 3D5EA 4QQKA 3SJAA 3DFKA 3CJRA 3U44A 2WD9A 3C74A 4WLOA 5E6RB 4IKPA 3O1HB 3WRXA 1XTKA 4B84A 5JMPA 4OX9Y 1ZCZA 5C80A 2ONZA 1MEOA 3HCWA 1TCBA 4WNAB 3DVRX 1UXHA 1Z0KA 3IQWA 4L5AA 2JBAB 4O1HA 3DZJA 4BVLA 2JARA 1PG2A 1T9GR 1Q77A 1T5OA 2EF0A 2B1GA 3PFIA 4FYYA 1WZEA 1C1DA 3PX2A 3R4VA 5CA0F 2FLKA 4ARIA 2FZ4A 2B1QA 4MYHA 4REOA 1AS0A 3F6YA 3H75A 3QG1A 3AUKA 3DQPA 3R77A 4JEMA 3AFHA 4NMWA 3LQKA 4BO2A 4L4YA 4HQFA 4OREX 5DCYA 1PGPA 5F4ZA 1SIWA 1DXYA 4NULA 1TVMA 5FUYA 4AF6A 1XDDA 3IVMA 3TSAA 2AG1A 4R2WA 2Y1XA 5IDVA 3FWNA 4YUXA 1U0GA 3QTTA 4PF1A 4PLWA 1THGA 3S0JA 3UOAB 2KM1A 1N92A 1ODLA 4RESA 4EHDA 4PVDA 4EB0A 4OXYA 3KLOA 4J49A 2GK3A 1UXOA 4DA7A 2W93A 2WFMA 2OV3A 3GI1A 2BRUA 5EE3A 2RI0A 4QFBA 5DLPA 5K0NA 5JNWA 2A84A 3WMGA 1UZUA 5KU1A 4GVPA 4HNSA 3FIUA 4YASA 3IKLA 1CHDA 4KXXA 4ES6A 1GR1A 1X7WA 1N25A 4P4LA 4R3NA 4R83A 2C2YA 4RUKA 5F12A 3FGZA 2HT6A 4X0EA 5F98A 2IYPA 5ESXA 3LSTA 2OO5A 4KIUA 4OKNA 4TV8F 3VAAA 3FYUA 1G5IA 4B3JA 4D1YA 1OBHA 4NJMB 3PI7A 1RYDA 2G5PA 5L4NA 3VSEA 4KHZA 5AK4A 2WDZA 2ZRQA 2X2EA 3KSDO 5KNDD 2XADA 3GLGA 3W5IA 3W2IA 4DNXA 2G5TA 2ZI7A 1V16B 4F6RA 5BN1A 2BM9A 1XKQA 5K6TA 1EFAA 4BQEA 2DMRA 5K0GA 3GAMA 3S81A 4ZU6X 2OHVA 3DTVD 3KQUA 1D04A 3R7FA 2QIOA 2QM8A 4COOA 2VYND 4D5GA 4CM1A 3KCQA 1ZD5A 4RVNA 2EQBA 4MB0A 1OFGA 4H3HB 4OQ4A 1L4EA 3HBLA 4WDQA 3WGMA 5D3MB 3U31A 3GLSA 4CETA 1U94A 3LA6A 2GJKA 2WA2A 3OX1A 1PD0A 3AJRA 2HYDA 5EZYB 3DTVB 5LMZA 4DGSA 1ZLXA 1UMBA 1V7PC 3AR2A 3MIIA 3PNYA 3G0BA 3TB6A 5JV5A 4DV4B 3VSAA 1ZMBA 4Q21A 1PT7A 2QD2A 4TTQA 3E5NA 3AUSA 2ZCUA 4ENSA 4EJ2A 2P2CA 4JQCA 3W7BA 3U61B 2ZJYA 2VJNA 1B73A 3KVOA 3M4NA 3CLTC 3I2FA 3RFUA 3VI4B 4YAUA 2E4UA 1HYEA 2CNOA 4JP2A 3W8FA 2OAQ1 3M70A 1Z7YA 2BBTA 3LQYA 4H6XA 1IZ9A 4HWPA 3QOWA 3WLAA 5HKKD 4U2EA 1H8HD 4K9RA 4YBRA 3ZI4A 4MPDA 3PU6A 1MAWA 2P27A 3JQ8B 1JHMA 1I33A 4K88A 3I9MA 4Z4HA 3V7WA 1PSZA 3ICPA 1AUQA 1D5CA 1R18A 5LOVF 2VRCD 4LJRA 3KS9A 3SKYA 3VKGA 2XDAA 2CLHB 3FETA 1BE1A 2YJGA 1DFHA 2X0KA 4WXHA 2OYRA 3RC7A 1R2QA 2REXB 2XVXA 4MWOA 3MMPA 5HZHA 1P9LA 4GOMD 1NBHA 1U3UA 4MYRA 4N65A 3LZDA 4RD1A 1V3TA 5IJAA 2VBGA 1SVUA 3ESBA 2FRDC 3GLQA 3T99A 4BNZA 1LVHA 2JEOA 3TQSA 3I58A 1O96B 4BJ5A 2V98A 1TKAA 1TU0A 4MW4A 4MQMA 1U7XA 2R5FA 1ARZA 1UT6A 3ORQA 2G9NA 1V7QA 2ZU6A 3RIMA 5B6IA 4JJFA 1J8QA 1E2UA 1L3IA 2YZGA 1M2VB 2CLDX 2I8LA 3ZN2A 3RQIA 3FPSA 4AJKA 1NF9A 2C2XA 4ETMA 1PUIA 2GBPA 3V8RA 2HO5A 2CLLB 1HA3A 4ZICA 5JYCA 2E4ZA 3H5VA 4Z51A 5KDOA 3LUGA 5F9MA 2Q4RA 2DUWA 2FZWA 3BK1A 3LTNC 1CS0A 5DI3B 1IXRC 2C3UA 3BFPA 4GBED 4LVOA 2W4MA 1WCIB 3O94A 4G1VA 1BFKA 1LLCA 4G9GA 2PRSA 4GQBA 3MWFA 3CVXA 1Z33A 3ICVA 3EVFA 3BC1A 2HRQA 5E7IA 5K3DA 2LNDA 1B3RA 2H52A 3LLVA 4H60A 4NBWA 4XLZA 1YA4A 3OKAA 4I4LA 5C3UA 4O5AA 5C8DA 1WIWA 1D9ZA 3QENA 3VC1A 4RHXA 2QV7A 2FK7A 4NMXB 1AQLA 1E7QA 1TZJA 2R25B 1O03A 3HDHA 1DLIA 4Z2AA 2JG3A 2ZWMA 4AU1A 1P19A 3INTA 1IIBA 2VTEA 3D0OA 3WGIA 3EZNA 1IMOA 4FFRA 3IX7A 4FGWA 1YUMA 5SZHB 4UQLA 3RTBA 3D59A 1GKKA 1K1EA 2ODTX 2XNDD 1NYLA 2XQGA 3U3RA 4M9RA 2WYUA 2AFVA 2X1LA 2Z58A 3SR4A 1JPVA 2D4HA 2E4YA 2IE0A 1YVDA 5I5EA 1HXHA 1X1CA 1HDXA 3AFNA 4RJ2A 4DW8A 4EWLA 2D06A 2ZDGA 4ZQHA 3TOSA 3GARA 1C9KA 1M2OA 1NVTA 4Z4EA 3SLRA 1Z5NA 3MJDA 4DDTA 4POAA 3F9RA 1N36B 3C6XA 2BJVA 3PVZA 4E0BA 1P5HA 1YZHA 5BMOA 1X7YB 1FXWF 4Y9SA 3AVOA 1U1DA 4ADSG 2I1VB 3IE2A 3BDIA 1OBFO 5T3YA 3LY7A 5BWMA 5BUZA 2UVPA 1T9BA 1MOPA 1ZQ9A 4KIWA 4WCFB 3RYFB 2J9YB 3OPYA 2QZ4A 3TMYA 1X87A 3U4DA 1IAQA 4Y2VA 1ZN8A 3TX6A 3IAM6 5KWSA 1LSJA 2H1FA 2YMPA 1BA2A 1M75A 3U7QB 3TEMA 1FW6A 2IK8A 4TV9F 2OQRA 4YJHA 3S6JA 3U7JA 2QTRA 3LPAA 4AZ3A 2NXCA 1YK1A 1PD1A 1VYHA 4HNAA 2ZDHA 4LDRA 1XD2A 4JBHA 4KIJA 4RA9A 1TM7E 2DJIA 4U3JB 1NP3A 2OD2A 2G4CA 3GCZA 1NQOA 4MTLA 1ZESA 1NHWA 1P7YA 1UFVA 2H0AA 4BJ1A 1XVIA 2B1IA 1I7SB 3SP1A 3CM0A 3KVVA 3QIVA 3UJ3X 1C7ZA 2XKAA 1N3YA 4N5MA 5LQRA 3GLIB 3UATA 4F56A 5JJCA 4DSOA 1ZHOA 2I7TA 1EVJA 3ND8A 3VAZA 3L4BC 2YVAA 3G7UA 2FEOA 3O83A 2RHDA 1F0NA 2IH5A 4EVRA 3CH6A 4ZO6A 1Y37A 2QJRA 4KWEA 5FAKA 1X38A 3GVHA 4C7OB 3WNVA 4Q4AA 1V37A 2O6LA 3LCJA 2W6ZA 4ML3A 4DMKA 4R51A 4YV1A 3EZYA 1IM2A 3UAWA 4FEYA 1K9SA 1TKCA 5DSXA 3MTBA 3HADA 3L6OO 3N8IA 4G5GA 4F5EA 4QAQA 3GB9A 1RAFA 4F8JA 3RS8A 1OU4A 2H2HA 1M1ZA 3HWRA 2FVXA 1JSCA 1XX6A 1ZMRA 1L4LA 3IELA 2PZAA 1QV6A 2GK6A 4QPJC 4ER3A 3FNEA 4X85A 4XDZA 4DUZB 1I4WA 4R31A 1Z35A 2H9IA 3L6DA 3ZY5A 2FFRA 2CWWA 2IZ0A 1O95D 2H5JA 1Z4JA 4BBZA 3NHMA 1RAHA 2EJWA 4WY5A 5KQPA 3MCAA 1OD6A 1EB9A 3RYCA 1PEKE 3DAPA 1G42A 3OQJA 5ALRA 3P0JA 1Y42X 4XUGB 2DPMA 1P3Y1 1U11A 1WU8A 1Y8QB 4RJIA 3GUUA 4RV5A 4YLGA 4O3MA 1GZHB 4LXUA 3O21A 3N2LA 1QGYA 2X4GA 3D81A 3WXMA 4PCAA 2ZSBA 2FEMA 2VJPA 1O2DA 2Y1WA 4II7A 4QUAA 1EM8A 2FCRA 5DLEA 2Q0QA