4DZZA

Structure of parf-adp, crystal form 1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
b'MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partitioning protein ParF
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 70
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dzzA00
2OAP1 4Q4JB 2GK6A 5CYOA 4C0AC 3K53A 3LVQE 4M22A 3S1AA 5FBRB 3AVUA 1KIMA 3KFVA 2OV2A 4Q1DA 3GD7A 4ZIRA 1CS4C 1KMHB 2YWFA 4MRVA 1XXHA 4M9XA 2V6IA 1B23P 1KYIA 2B7CA 2CCKA 3I1FA 4A4DA 2IF2A 1XB2A 3FGNA 4L5BA 4F91B 2YVUA 1SKQA 2XSZA 2ONKA 1WMSA 1S96A 1UKYA 4Q01A 4URVR 1W2GA 2ZQ5A 3ZD6A 1P9RA 2JDID 2C77A 2ZI5A 4HAXA 1JQLB 4B76A 1DEKA 1NKSA 1E2NA 5JJLA 1DAFA 2QMHA 4BLOA 3UMRA 3CR8A 3VHXA 4FCTA 4QBFA 1TAGA 3MUFA 3AP2A 2KE5A 2ZRBA 3KKPA 3ZVNA 3KQHA 3JVVA 1LB1B 2VL7A 3VHLB 2HLDD 3IBGA 4G5SA 1CJUC 5E4FA 1X86B 1G3QA 2WV9A 3AB3A 2B8TA 1QHYA 3NHAA 3VR5A 3K0EA 2HDNB 4LYJA 2O8CA 1IM2A 5EXPA 2WPDD 1KI3A 4DXAA 3BC1A 2P6UA 4DLTA 1M2OB 1SXJD 1XFAA 4QJ5A 5CJPA 4M0LA 1W4CA 3LXRA 4A0RA 4P31A 1P75A 3ECCA 4D2IA 1AM4D 3WP1B 4LBWA 1QG4A 3GJ7A 3ONWA 3QBVA 2EFEB 1D8TA 1YR9A 2JLQA 4PPQA 1OE0A 1UJ2A 4JLDA 1G3IA 3N2IA 1ODFA 3H84A 1OH7A 3F8TA 4XTRA 3A58B 4IDPA 4CYMA 1NF3A 3AV0B 1IY0A 1AN0A 2BJWA 4RD1A 2FSIA 4H1VA 2QE7A 1VIYA 4MYTA 2CJWA 4PC6A 4Q7LA 3G0HA 3BS4A 2X77A 4D4LA 3RYTC 3WXMA 1HUQA 1US8B 3W8NA 5CYPA 4GBMA 4OHWA 4Q9HA 3U60B 2AHOA 2C03A 2IF0A 4ACBA 4B48A 1XPUA 1JI0A 1VCIA 5BN4A 1E2PA 1KMQA 1HYQA 1M8PA 2OT3B 1IJFA 4QRHA 4AKHA 3PQCA 1GVNB 4OQXA 2FEOA 4OJQA 4E07A 2NPFA 1TEVA 3K0AA 1N25A 4PC2A 4LJ8A 4GZLA 2W6JA 2X2EA 2WWYA 1ETUA 1XEFA 2VRWA 2CCGA 4A1FA 4DC9A 2Q3FA 1W36B 1CIPA 4UKDA 1YRAA 3IIMA 1OXTA 2ZE7A 4HDQB 4LJ6A 4L16A 1C1YA 4ZV4A 5FPSA 1N6PA 4Q4JA 3RS7A 3SBDA 2WJVA 1VG1A 5CDFE 2WJHA 2DFLA 3I61A 1KMHA 4X8OA 1GL7A 3R20A 5CK4A 1R8SA 2OILA 3K09C 1AS2A 1T0HB 2I3BA 4KJZA 1RYHA 2F7SA 3JVUA 1HT2E 4ZCMA 1E96A 2QMEA 4B73A 1IAQA 3UMFA 4H1UA 5EQTA 1KDRA 2L0XA 3CPEA 1SVSA 1XTSA 4TMZA 4RKEA 1WRBA 4NE2A 4Q02A 2OAQ1 4I1OA 5DYGA 1J8YF 2PJRA 1NJFA 4MRRA 2OUKA 5HR5A 3QPUA 1U9IC 3QY0A 3BERA 4TT3D 3AVYA 2AD1A 1X8LA 2WMNB 4XVUA 1TUIA 2OLJA 4IEIA 3EWSA 1KI7A 4JL5A 3TQFA 4QM7A 3TE6A 1M34E 3HU3A 2QGZA 3SE0A 3B7GA 4M1KA 4DDTA 1ZU4A 4NH0A 1YR6A 4RZ3A 3ZS8A 4QKQA 1HV8A 2QRZA 2KJQA 1R7RA 4YDHB 4YMUA 4JVNA 1YZLA 2GEDA 1A2BA 2A30A 4O2LA 1QF9A 2IYSA 1OIVA 2JGNA 4BUJA 3ZIAA 4LJYA 3B1ZA 4IDHA 2JLVA 3K09A 4RD6A 1ZIOA 1U98A 2UZ3A 2GF0A 1E1RD 1SHZA 4XJXA 2YC4C 3VAAA 5JZVA 3FFAA 2J5XA 3PENA 3HU1A 3EPJA 3GP8A 2HF8A 4BZXA 3L2OB 2G88A 4G01B 1AQUA 3FKSD 2QA5A 1GP2A 1IN7A 3ZS9A 1Z07A 4DLYA 1MH1A 4DDVA 2FDCA 5BN5A 1U9IA 2B8WA 5FPYA 5HKKD 2MSDB 1ZM9A 2Q6TA 2EQBA 2JASA 3T15A 1W0JD 1W36C 2GJSA 4F4CA 1D6JA 1GAJA 3B1VA 4Q48A 1R0ZA 4A36A 4RD2A 4BFUA 3T35A 4F93B 2W83A 3GMTA 1J2JA 1OXUA 3W3AA 3C7KA 4KU4A 1TX4B 5AUPB 2Q9AA 2VTKA 3NKVA 3IIJA 3VTKA 3P20A 1US8A 2BIFA 3AKCA 5DHFA 5DISB 2Q9BA 1SZPA 1OFHA 4KITB 1GRQA 1KJWA 3B9PA 4IVPA 1OB5A 2ZRDA 4ZKDA 1FFHA 5KSOA 2ZI3A 2WTUA 1A4RA 4FIDA 4B32A 1DAHA 5EP4A 2QU8A 4C4PA 1FOEB 1QBKC 1HQCA 2Q3MA 5E7JA 1N6LA 2QNRA 3CF2A 1E2IA 1PLLA 3M0EA 3OAAD 1SXJE 3KQUA 1XJ0A 3PR1A 4V0MA 2R6DA 5J4YA 2WVJA 3HP1A 4NL4H 1TUEA 4FD2A 2BMFA 4Z51A 2QSZA 2XXAB 1CR0A 4NMMA 3CZQA 4KFRA 1QHGA 1CRQA 4M9SA 4RZUA 1W46A 2D4HA 2MSEB 3OIYA 2XGJA 2QUZA 1Z5ZA 2CL6X 4C9BA 1NSTA 2F1JA 3K70B 5C4MA 2IUSA 2D74A 1RRCA 1NLZA 1X1RA 4JLOA 4ILEA 1R0WA 1G4UR 3A4LA 1S0UA 5FL3A 2JJ2A 2F3RA 1ELOA 1EG7A 2ZYWX 2VHUA 2FSFA 3GEHA 3QPVA 2J87A 4A6XA 1OIWA 3ZZTA 1JR3A 3VKGA 4KBFA 2BDTA 2GBLC 2GRJA 2G83A 4HB4A 4DHEA 5FR2A 1GNRA 2A7QA 3RC3A 4JVLA 2KB0A 3LA6A 2CHGA 1ONBA 2OG2A 3KX2A 1IY2A 2FF7A 5LD2B 4OHVA 4US0R 4TZ0A 1E98A 1KO8A 2C2HA 4G3XA 5FBVB 3TVDA 5FOSA 3AVQA 1YZTA 4KVGA 3U3JA 3W6OA 5CITA 2VIIA 2ZUDA 2VSXA 4TTQA 5K8LA 4ZDJA 2AR7A 5DLQC 4Q7KA 4K8OA 4RD3A 3GLIE 1NN0A 2FSHA 3QJYA 3KQKA 1AS0A 3CZPA 3OE7A 4G5GA 1H65A 2HEIA 4M1MA 2QP9X 4Q4AB 1X1SA 5CB6A 5FBQB 4M1OA 3WHLA 5K8TA 4CEJB 3UATA 1JJ7A 3SS8A 5AJYA 2BBWA 2QRNA 2WJJA 4LJAA 4E03A 1P4SA 3BORA 4QGFA 4X8HA 4TYYA 1UKVY 3LW7A 2ZJAA 3B1XA 2GBLA 4G5OA 1WBBA 2WOJA 4RZXA 2XX3A 3AM1A 1NN5A 5LB2A 4HLUC 4YDSA 3LLUA 1I4DD 1BMFA 4MGKR 2CBZA 3FWYA 1DARA 3GEIA 3QBTA 4LZZA 3T06B 1Q3HA 5L3QB 4PX9A 1KAOA 2GESA 2QY9A 3TAUA 1E79A 1L2TA 2G1JA 4B6FA 2V1UA 4IOMA 4Y0VA 4CT4B 4JVMA 4Q1CA 5JSZB 3HYTA 3RRNA 1Z6GA 3SDZA 3K70C 1FL9A 2FNAA 4HB0A 4Q66C 4LHWA 4MUBA 1XPOA 2EFGA 4QFMA 4O2RA 5EZ5A 3ZGXA 3PITA 2GZDA 1K8RA 2R9VA 3NTUA 1II9A 1GRNA 3A1TA 4CGZA 3CR7A 3RSOA 2WAYA 5BYKA 2VHTA 1DO0A 1I2MA 2WKPA 1OFTA 2H92A 2ERYA 1CRPA 4RKFA 1G7RA 1OKKD 2VQSA 3AF2A 4HLUA 2F1RA 3CF6R 4ZI3A 3RWMB 4DLSA 4F7WA 1FP7A 2FPLA 5LD2C 2XXAA 5E7MA 2AWNA 2FFHA 1NP6A 4QJ4A 1KTVA 5KSYA 3NH9A 1TADA 1Z83A 3KJHA 3OESA 4WAUA 5FUWA 4NCNA 4TYPA 4MKIA 1PVOA 1Q1EA 521PA 2ZI9A 4QC2A 4AKIA 1M74A 2QROA 2J0VA 1E32A 1PLJA 4LC0A 4OI4A 3AUYA 5TVKA 1FZQA 2ZYVX 4A82A 4C0HA 2IYUA 3MJRA 2R6GA 3TW8B 1ZNZA 3HDTA 1NVXQ 1Z06A 2RGDA 3KJIA 2H16A 3UIEA 1CEEA 1AZTA 3P4XA 4B2IA 1COWA 2FSGA 3FB4A 3NBZC 3TR0A 2ZI7A 1KI6B 3FOZA 4L9SA 1ZCAA 2ZI4A 2ZJ8A 1EX6A 4MA4A 3ZZ0A 4HB2A 2CHQA 4GFDA 4D4JA 4XSHA 1IBRA 5DE3A 1ZCBA 4CEIB 2F6RA 4MGZR 3SJZA 3MMPA 3T61A 2RGAA 2Z4RA 1RE0A 5KNDA 3U4QB 3WRXC 2K5UA 3EAQA 3QI2A 4AC9A 1S3GA 4OJKA 5HZKA 4EPXA 1N6OA 1TTTA 1LS6A 2EFHB 4YC7A 5JJKA 2EWWA 3IO5A 2OO7A 2EYUA 1J90A 4FMDB 4BFTA 2ZE8A 4HATA 1G5RA 4GSYA 3EASA 3QKTA 4TLCA 2VYFA 2QORA 1YZGA 2YNMA 4GZMA 1WXQA 1SQ5A 1VG0B 3ADDA 1NSFA 2A2ZA 3K1JA 4MGYR 4Q4AA 1A2KC 3IPXA 4KBGA 1RC8A 3KXIA 2J0QA 2ODBA 1GG2A 2R44A 4LPKA 3REFA 3C16C 4IDOA 4CEJA 2F9LA 3THOA 2O5VA 2NG1A 3C14C 5FL7D 3ZVRA 1JEEA 2JCSA 1Z63A 3D8BA 2C78A 5AJXA 4BRUA 1GL6A 1IJEA 4CF7A 1R10A 1VHTA 1XD8A 2J46A 2OFWA 5L3QA 1VIAA 1TF2A 3CIOA 4W5WA 5SZIA 4JSYA 1DO2A 2IYRA 3FE2A 1I4TD 2WJIA 4DUGD 2V7QD 4B43A 5JEEA 3GPLA 3QG5A 3MCAA 5JSZA 3WHKA 3T1VA 4FMCB 5KNCA 5AUOB 5TDHA 2F55A 3VX3A 2B92A 3BFKA 3L0IB 4PQFA 3ZVMA 3TIFA 1H8EA 2Q0HA 2G0TA 3O8CA 2WSSA 5FPHA 2XOKD 3EPLA 2FE4A 4XVQA 4UQOA 2CNWA 2W6ID 1U0HC 2IS6A 3A1VA 1D5CA 2VHJA 3QQ5A 4JBXA 1Z22A 1NG1A 2CK3A 3EC2A 2IS4A 2B7BA 1XRJA 2ZI6A 4DCSA 3KKOA 3AF4A 5GVSA 1ZUIA 4LK2A 4BLTA 4DSOA 3GFTA 3MFYA 4OHXA 3CX8A 3C8UA 1VTKA 4Q19A 1Q1QA 4GNKA 1F60A 2ZYUX 2HUPA 3WMGA 3T1TA 1E2MA 4KI0A 3NEJA 3EARA 1Y3AA 3V4RA 3SZRA 2FG5A 2ZU6A 2PLFA 1G64A 1M6NA 1TF5A 4B3FX 2UZIR 2HT1A 1E4VA 4NHOA 1ZD1A 3IDQA 2WHXA 4Q1FA 4OI2A 2FEMA 3HPRA 1W0KD 2NQ2C 1N2CE 1N5JA 2IBMA 2HYIC 4HUTA 4P0TA 2GZAA 2ZR7A 5G53C 2GWHA 2P2LA 1K6MA 3C15C 1MO5A 1G6HA 4MYHA 1GILA 2J0UB 3RRMA 2J3EA 2FH5B 4KXFB 1KI6A 2XTNA 2ZROA 2WSMA 5KU1A 1KK2A 5EE5B 1E6CA 5JECA 3AKYA 3CNNA 2HV8A 3GJ6A 721PA 4CVNA 2IW3A 4D6PA 1TL7C 4CEIA 3LH5A 3T5GA 3U4QA 2C9OA 2EFDB 3IEUA 3OEEA 2MSCB 4AYTA 1Z08A 1RKBA 4C0BA 2J59A 1AS3A 5KPJA 3TBKA 4DVGA 1X8KA 3RAPR 1HEIA 4Z8XA 2OBMA 3LQQA 4D80A 2H18A 3B13B 1OHHD 4QHYA 2NO9A 3GJXC 3DKPA 2GJ9A 2RGXA 4U7DA 2ZJ5A 1GTVA 2ZSFA 1M1YE 1HE8B 1HQYE 3EZ9A 2ZITA 1XTKA 2YINC 3GEEA 3H4MA 3HPQA 4OK3A 2DFTA 1PLKA 1XEWY 3B60A 5JEDA 1PZNA 1E94E 4OI0A 3B2EA 4L15A 4B34A 2SHKA 1EFUA 1BH2A 5FUYA 2IL1A 1ZYUA 1MO3A 2C98A 1WE2A 3SR0A 3SNHA 1E2KA 4AD8A 2QP4A 3SHWA 2LKDA 3EPKA 2CJWB 3CPHA 3GQBA 3JZMA 3OFNA 4WA7A 4BQSA 5J40A 3W34A 4GOKA 2FZLA 1FNMA 4GPTA 2PH1A 4TLAA 3P26A 3QKRB 3SJAA 4OBEA 1ESNA 5H1YA 1OPXA 1DG3A 2XZPA 3C41J 3P27A 3RSLA 4PC3A 2IXEA 3CWQA 1FPMA 1ZNXA 1TQ6A 4Q21A 5AUNB 2VBCA 2IUUA 1OH6A 2H17A 2C95A 3PEUA 2BBSA 2P5SA 2QAGB 4WIAA 3AVVA 4HZUB 4MKHA 2HJGA 2N46A 4ZDIA 1NMZA 2QMOA 2C9YA 4HDCA 4QHSA 4G5RA 1E69A 1S9DA 1ZRHA 3K8YA 3V4FA 4W9MC 2JLWA 1M7BA 1SVWA 3LV8A 2V54A 4UNQA 4B3XA 1GUAA 2A5DA 1G4AE 1P61B 2IUTA 5ELXA 4JMPA 2ZS7A 1FUUA 4E22A 4A92A 1EFTA 2QSYA 4FMDF 3QKSB 2G0NA 4TTPA 1E9EA 5J47A 3EZFA 3RWOA 5JCZA 2NMVA 4HB3A 3ZH9B 2OHFA 3QEOA 4I1VA 3T1QA 5BYJA 3U3MA 1GOTA 2DWPA 4XWAA 4LJ7A 5AWFC 4YXWD 3K9GA 5IK2A 1Z8FA 5J4KA 1U0JA 1ZP6A 4U02A 4V0LA 3RDPA 3TGPA 1ANKA 4P33A 3SU8A 2J0UA 1E1QD 1KKLA 2H7VA 3PUXA 4K46A 1XJQA 3K0CC 5L8VA 2RB4A 1XZQA 1Z0IA 4CRWB 3LX5A 4PZLA 3DKVA 4I1SA 4QBGB 5B30A 2FX3A 3AVWA 2FGJA 4LGMA 2BOVA 4LHZA 3NIBA 4TMXA 3PFIA 5DI3B 3SJCA 4LRWA 1T3SA 3KKNA 3RC8A 1CBUA 1Q3TA 1VDZA 2NZ8A 2PCLA 1IXZA 2XNDA 5SZKB 1MKYA 5F9HA 1KO1A 2VHQA 2ZRHA 3IBYA 3FFBA 2XTZA 3B8HA 1ZVQA 2JIZD 1P60A 2A9KA 1OXXK 4EKDA 4M21A 2QQ0A 4QGAA 5LBIA 1IQPA 1R5BA 2ONJA 3GFPA 4EIWA 4DEXA 1EFRA 1AKYA 3GLFB 4L9WA 1YKSA 5FTMA 2EW1A 4J0QA 1E2HA 2QAGC 1F3OA 3VMFA 2HXSA 2N42A 3PV0A 4TQUS 1FTSA 5DH9A 2ZRAA 2BKEA 1NJGA 1UBGA 1W4RA 3K0CA 4IVQA 4HAVA 2GXUA 4LUCA 5HCIA 1XPRA 2CLCX 4NU0A 2IA5A 2KBEA 4Y0AA 4A9AA 4AKGA 1Q1BA 3I4LA 3QNUA 2N1BA 3TSZA 1G3RA 1ZM7A 4BFYA 2PZFA 1AZSC 4KFUA 4JLJA 1YR8A 4AWXA 2IYLD 2PX3A 4TL6A 5FTJA 1GL9B 3B1WA 4B3CA 1KAGA 5FOUA 2IWRA 1GRRA 2J41A 3QKRA 4TQAA 1BS1A 4XD7D 4N0EA 5EE3A 4BFWA 4IOJA 4NYMQ 2PCJA 3NBYC 5LPNA 3FDIA 3O8DA 5F9FA 2XITA 4BE7B 1UM8A 3U6BA 3N5CA 4LBZA 3BB3A 4WOPA 1JR3E 1SVLA 4B44A 2DY1A 2GETA 3LFUA 1LF5A 2FMXA 3SYKA 1X3SA 1XNJA 4IRUB 4XWOA 1KNXA 1NVVQ 2BCJQ 2H8KA 2QAGA 2W58A 4HZUA 2GK7A 3U5ZB 2O0KA 4DSUA 1YZKA 3AH8A 5DHAA 4GI7A 4DJTA 2DYKA 2QAJA 3HR7A 3QF4A 1KDOA 1NKTA 1NVWQ 4JZKA 1J99A 4TMKA 3P32A 3TW4A 4URZR 1KHTA 2ORWA 4OHYA 3A36A 5FH9A 4Q1BA 2V1XA 2XZOA 3SFVA 1TU4A 2BMEA 5JS7A 5JJIA 3FPAA 4M1TA 2WM9B 5A0FA 1DTSA 5AJVB 2FPKA 1BO6A 2FJUA 4XIGS 4A0GA 1FX0B 2FV8A 4TMWA 4WXRA 4DLWA 5BXQC 2Z0MA 4KSBA 5DN6A 3LRPA 3U7HB 2PX0A 3VKHA 2BV3A 3QKSA 1P2VA 3ADBA 1G7SA 1CJMA 4OQMA 2F3TA 4QOSA 1FMJA 1XWIA 1N0VC 3TAHA 2IXGA 4BFXA 2FFQA 2E9SA 1XTRA 4L8GA 4RY2A 3SN6A 4Z1MD 5JI2E 2GCOA 3PIRA 2NTYC 4WW0A 3ZZUA 1XJCA 1B0UA 3ND8A 1RW4A 4D82A 2XB2A 3Q3JB 3OEHD 1G3MA 1JPJA 3NBXX 4U5XA 421PA 4RFVA 5JMTA 2GHIA 2GCNA 3MD0A 1OF1A 1KI8A 4PR0A 2P6NA 1G291 1F2TB 3TLXA 2ZEJA 4CDGA 5DI3A 5CIWA 4PAOA 4DDWA 1L4YA 4FXPA 4QBIA 1ZM2A 3IO3A 5KNBA 1NG9A 3CX7A 1QDEA 2YKGA 5GJVC 5GADl 2VH5R 3KQLA 1ZU5A 2H5EA 2IK8A 4O0MA 4MRPA 2IYWA 4JSTA 1XTJA 4R9UC 2R8RA 4B2PA 5C1BA 1DG1G 2JEOA 2DWOA 2ZSBA 3K9LA 5G41A 3UKDA 2CEAA 1YHNA 2JA1A 1E99A 4TSFA 1KGDA 4DEYA 1OH8A 1Z0JA 2F1HA 3LXXA 3MLEA 3GLFA 1Q20A 2ZU0C 2BVNA 5DIFA 4EJSB 5DGXA 3FHOA 2RHMA 2W2VA 4LHVA 4R7ZA 5H68A 2XNSA 1ZC3A 4QNMA 2Q3HA 4IVRA 5JHGB 5EXSA 3QVUA 5BQ5A 4JLBA 4US1R 2IYTA 3B78A 4JLMA 3ZQJA 4D0GA 2OLKA 1TQDA 2ZSAA 1IONA 4MKGA 4BLRA 3K9HA 1VYVA 3VQTA 1NBMA 3M6AA 4EFNA 4PZYA 2NO6A 1W7AA 1OW3B 2J1LA 2O0JA 2YZ2A 4MQBA 4ZDKA 1GDDA 1OXVA 5SZJA 1T91A 2QENA 2BMDA 4AG6A 2ZE6A 1ZD9A 1N6HA 3SQWA 4IEEA 2BWJA 4FCWA 4V03A 5L3RA 1UDWA 3BOSA 4HAZA 4M53A 2Z4SA 1KJZA 2JJ1D 4B3BA 4ASUD 4EDHA 4E09A 1OT3A 1VYUA 2ZRCA 1R0XA 2J45A 2VP4A 1RRPA 2OEPA 3ICEA 2JLSA 3FTQA 3KUDA 3TH5A 3F5FA 2ZTSA 4DLRA 1D9ZA 1HURA 4PC7A 5ANRB 1V43A 1XD9A 4TL8A 2QPOA 4NCJA 2UKDA 4NBSA 3L43A 4QJ3A 2FPMA 3Q7PA 4LPSA 3KDSE 4P3YA 1LFDB 5IF9A 1RJ9B 3VR1A 1OLOA 1HTWA 1LW7A 3AP3A 1XMIA 3GJ5A 5FPKA 4PHGA 5AJZA 2OCAA 4PO1A 2CE2X 3A4MA 1FUKA 3W9YA 3GLHB 1FX0A 1Q12A 3QEJA 3PG5A 2OCPA 4FWIB 4LBVA 3TNFA 1E9DA 4EFLA 1KOFA 3R8CA 2RGNC 3U3OA 3UANA 1S2MA 2XSZD 1Z6AA 3AVOA 4B33A 1OFIA 2EVWX 1E0JA 4ZDWA 3RS0A 1S8FA 1Z2CA 4RZ2A 3WBKA 1N5IA 1H8HA 1YU9A 2QI9C 3E5HA 4IDQA 1LY1A 4OQNA 2X19A 5B2ZA 3UK6A 2AFIE 2WJGA 3AKEA 2G9NA 2PMDA 4EJSC 2VP5A 2NGRA 2REXB 3PCRB 1XMVA 3N2EA 4KFTA 2ZJZA 4Q9LA 3REGA 3LY5A 2BEJA 1F2TA 1E2EA 2V8OA 2BMJA 1JR6A 1SXJB 4OK6A 4HYYA 2CLSA 4KVAA 3NG1A 3UPUA 4JL6A 4TN1A 4BLPA 2IYYA 3I8XA 1A7JA 1KKMA 1N5LA 3LBNA 1J70A 4C0KA 3U61B 2CLDX 4M2LA 1S1MA 4RVCA 3P1JA 4HEJA 3DL0A 1CR2A 1XTQA 1U90A 3BRWD 1JEDA 1F2UB 2JLYA 5EXXA 2RGNA 5CDFA 3W5IA 2J7PA 1G1MA 2FU5C 5C46F 2ZSEA 4IKEA 3ZVLA 1E2JA 1II0A 5H8WA 1XCGB 2DR3A 4ZI2A 1GITA 4CZ2A 2VP9A 3U7GA 1ZM4A 1PUIA 2HT6A 4EJSA 3EXAA 3VNUA 4R71A 2D62A 4XSGA 5HTKA 3K0FB 1LNZA 1SKYE 2ORIA 2QT0A 4NTZA 1MOZA 1CF4A 5J4VA 4N1AA 3WMFA 2ODEA 2RGEA 4AKEA 4R98A 4JIMA 4UJ5A 3U44B 1G8GA 3FHCB 2QEQA 1E2GA 1VKJA 2WOOA 2HCJB 1DBSA 2QE7D 1IXRC 3BH6A 3FVQA 1KSHA 5BN3A 3DDCA 3IPYA 2QZ4A 4M9ZA 3DM9B 4TQ9A 5C4GB 1XD2B 5BWMA 4AYXA 3TSOA 2A5JA 3NBFA 2YOHA 3SYNA 3T1OA 2OBNA 4C0SA 1MO4A 3FMFA 3FMOB 4C0QC 4C0JA 1P9WA 2A5YB 3TVTA 4G0NA 3GLGB 2C8VA 4LV8B 8OHMA 1R4AA 5KUTA 2C9CA 2A3RA 4BECA 2WJYA 1KI9A 2QN6A 3GJ0A 3HU2A 2LKCA 2FN4A 4HSEA 1LVGA 1ZNYA 3UG7A 4DSTA 1XBTA 4O25A 4F92B 3IILA 4BEBA 1U8YA 3PXGA 1KO4A 2I4IA 2W6JD 1OJLA 2KSQA 2YWGA 3TSWA 2FGKA 3DVLA 4ESHA 4RD0A 3I5YA 2ATXA 2ERXA 5IHPA 1R6BX 1SXJC 1W5TA 3MRSA 1E9SA 1RJ9A 3QOFA 5DO9A 2CXXA 3THYA 2Y8EA 3CONA 3B1YA 4H9GA 4MKFA 4PO9A 1XDBA 1ESMA 4QBHA 3GLHA 5DI9A 1DPFA 2JDIA 3FMPB 3LD9A 2GILA 3OHMA 5TY0A 1L7VC 3PVSA 2G6BA 4DDUA 4GRAA 1OSNA 4URYR 4HI0E 2OXRA 4IW3B 4US2R 3QXHA 1Z0KA 1Z0AA 3DZDA 4Q9KA 5EZ6B 2QP3A 2OCBA 3IEVA 4PO8A 5D3QA 4O3MA 1OYWA 3E2IA 1CJVC 4NYIR 1OV4A 5IRCD 2G1KA 2V55B 2X8AA 2HLDA 3QXSA 4BEJA 3SC3A 1CULC 4TTRA 4BZQA 4AIIA 1E9CA 1DS6A 2FFBA 1N5KA 3M4YA 3ETLA 1JXOA 2WPDA 4FMBB 2VP6A 2VEDA 5CB8A 1XEXB 4I1UA 3L0SA 3HWSA 3HYRA 1SXJA 1Z6XA 3T34A 4ZCIA 5TB5A 3BAFA 1Z28A 4KSCA 2IEZA 3B6EA 1OH5A 5KHOC 5EUMA 2ZETA 3UWOA 3ZIAD 2OXCA 1XCMA 1F2UA 1FQKA 4GDFA 3D6TB 1T8TA 5KDLA 4D4KA 5BW8A 1EWRA 4I81A 2PMKA 3IKJA 3U2QA 2R65A 1XXHE 1YRBA 5FI1B 3AKDA 4IOLA 4LV5B 4RD4A 5K8UA 4BGDA 1ZAKA 3ADKA 3B5JA 4PFSA 2ZS9A 4IXNA 1WBDA 2MMGA 4WBSA 1W47A 1GZSA 3K0FA 4AI6A 2XJ9A 4PSKA 1VMAA 4MYCA 2ZAOA 4DLVA 1PV4A 5CK5A 2VSFA 3UWKA 4QXAA 1KDPA 2DPXA 1VCMA 3AP1A 2X1VA 4P4TA 4JLAA 5FR1A 3U44A 2GJKA 1CJKC 4D81A 2ZS8A 4NYIQ 2BCGY 3KFXA 1VPLA 5DNYB 2BHRA 5G3ZA 2P65A 1ZC4A 4TLDA 4YQFA 1G8PA 4MH0R 2EYQA 1F48A 1XD2A 1WQ1R 4DRZA 3H0KA 2REBA 4V0NA 3I72A 4A8JB 2W2XA 4DSNA 1EESA 4TL7A 4C30A 3RS4A 4CW7A 2BC9A 2WWHA 1YJ5A 5SZHB 4DKXA 4M4SA 3GLGA 1ZBDA 4JYCA 3CUEF 2UVQA 1G18A 3AF0A 4W5JA 4AY2A 4HUQB 3I32A 1R8QA 2QMUA 2IS1A 4V0KA 3GLIA 2ZE5A 3THXB 4C0LA 2G77B 4FW9A 1OB2A 1W36D 4DBLC 5G40A 3U7EB 5IDVA 3MSXA 4QG7A 4Q9JA 2PT7A 4FINA 4CEHB 4JS0A 1YZNA 5A5GA 4KO8A 1GFIA 1RRFA 2J7KA 1W1WA 5J5CA 1QHHB 3CH5A 4C2UA 4ESVA 3EX7C 1S1CA 4TYQA 1E0KA 4LDJA 4TT3A 1KJYA 1R2QA 2XB4A 4B3GA 2KBFA 1JXMA 3HJNA 1UEIA 1T4GA 1P2UA 5UKDA 4QL3A 1VHLA 4GMDA 1N0UA 4KLZA 1R5OA 4I99A 5CM8B 4ON9A 4LOAA 3F3YA 1NVUQ 1UBFA 4NZYA 2IC5A 1RZ3A 1HA3A 2JJ2D 3EG5A 4B74A 4ARZB 5JFGA 1CXZA 4P4UA 1P72A 2GXQA 5JCPA 3AGPA 3IHLA 4A15A 1P6XA 2E1RA 1NNEA 2AWOA 5JBQA 2Z43A 4FI3C 4GOJA 1JR3D 1TQ2A 2ZSDA 1G5TA 4YMWA 3OF5A 2WICA 1P5ZB 5P21A 3VX4A 3CRQA 1E1RA 1X8JA 2ZM5A 1XEXA 4ABYA 3D7MA 2BBOA 1AIPA 1EFCA 1W5SA 3CH4B 2CVHA 4LJ9A 2P67A 3KB1A 3FKSA 2GVZC 2BM0A 4URXR 2HXYA 2YV5A 2ZREA 1VCNA 4EPVA 2DFKB 5JI3E 4HAWA 5HKKA 3ND9A 4A8JC 4JL8A 2BJVA 1KK3A 1BYIA 1T5IA 1W0JA 5EJEA 1N0WA 1P73A 4DLUA 1P62B 1FTNA 2HYDA 5E95A 2JLUA 1G41A 1X6VA 3OE7D 2W2TA 2IEYA 3AVPA 2A78A 1T0JB 4GOXA 4QNRA 5EE0A 1N6IA 2DHRA 3G82C 4ZKEA 4BFVA 1E9BA 1JBKA 2C99A 4AYWA 1UF9A 5KO2A 3BJIC 2B6HA 4GT1A 1MT0A 1T6NA 5IT5A 5TARA 1II8B 2EU8A 3CM0A 2WMOB 1CLUA 5CIQA 5FI0B 1N6NA 3WRYC 5KYKA 3W8RA 3MAAC 1OFUX 4B75A 3QUSA 3C5CA 1U8AA 2FA9A 4AURA 1A5TA 4NYJQ 4LY6A 1E4YA 1BMFD 1S9HA 4Q03A 3UMSA 2NZJA 1DELA 4JVSB 3WNBA 1P7CA 1E79D 1NIPA 3RLFA 2IXFA 3O47A 4LWZA 4M8NE 1O87A 1GKUB 3OAAA 4PHHA 5F2EA 3VR6A 1GSIA 4A8JA 1U81A 1KO5A 1NN1A 4DB4A 3QF4B 3W5JA 2GAOA 2R6CA 4HUQA 2BBTA 2REOA 3CPJB 4OKSA 4OK5A 5M04A 2OE2A 5FTKA 3EZ6A 1M7GA 5KTYA 1E2QA 1NI3A 3BH0A 4Q1AA 2DB3A 1L8QA 3WP0A 1NMXA 5TV2A 2GKSA 2OZEA 2QG6A 3NWJA 3THXA 2GCPA 4XTCS 3EZ7A 1UAAA 2E87A 3WNDA 1KSFX 2CMKA 2OFXA 5FTLA 1KK1A 2V3CC 4CEHA 2H1LA 3KL4A 1C4OA 2PLRA 3OIUA 4WZBE 4DIEA 121PA 4BLSA 3VNVA 1E0AA 3KUCA 4M1WA 3CNLA 3TMKA 3BK7A 2PT5A 5JHHB 2CCJA 2YWHA 4DIDA 2PZGA 3SI7A 4R2IA 3OZXA 1QHHA 3GLFE 5KSPA 2GCOB 3X2SA 4D4MA 4XVRA 3DO6A 2ZRJA 2FWRA 2B21A 4NCHA 1G7TA 3T12A 4DLXA 2J0SA 3LBHA 3LWNA 1JQJC 4BASA 1GWNA 1T5LA 1KSGA 2NO0A 2AK3A 3E1SA 5DSZA 2I1VB 4HDOB 3FKQA 2WWFA 1D2MA 3K70D 3SFZA 4NYMR 2JATA 3AEZA 3NEYA 1Z2AA 3TR5A 4W7SA 4MITA 1ZUHA 1BYUA 1NBME 3IQWA 3AQ4A 4L4UA 4Q4LA 1COWD 4ARZA 2VP0A 4KLNA 2Z5FA 3L0PA 4G5QA 4B47A 3E70C 2KWIA 1NVVR 4AK9A 1AQYA 5EE9A 3X1WA 1U94A 1WA5A 2BM1A 1GNQA 3DMNA 1UKEA 2ODNA 4FMCF 3MWJA 4PPNA 4X8LA 4D0LB 2D7DA 3IGFA 2OSBA 3IHWA 2QL6A 2EFCB 4UXIA 5B64A 2O8DB 1AGPA 4G1UC 1SHKA 4V0ME 4F38A 2GJ8A 2GZHA 1QRAA 5JRJA 4UNRA 1P2SA 3EIHA 5FTNA 3R9WA 4N0DA 1K5DA 2DWQA 3KJEA 4D0NA 4D25A 1JJVA 3F0TA 3CRMA 3PUVA 4LX0A 3RNLA 2ZRGA 3EPHA 2QTFA 4W5HA 3HR8A 5FUXA 3LLMA 2P6RA 2ZRIA 2ANBA 2V4ZA 5KPDA 3DEFA 3V00A 1Z47A 1T8UA 2GNOA 1EFHA 3DHWC 3RRYA 1GM5A 3ZLJA 3WBJA 2NOAA 4M1YA 1IHUA 4TMTA 3KQNA 1DAGA 3H2YA 3L0OA 3ZYCA 1II8A 1XZPA 4ERNA 2RMKA 4HAYA 2ATVA 1RYFA 1IOZA 1G17A 1N3BA 4WXPA 3A6PC 5C18A 2V6JA 1ZINA 4PQYA 4IJMA 3DMDA 4Q4HB 2LCFA 4Z54A 3PUYA 3I3SR 1PUJA 3VU9B 4EUNA 1T9HA 3TQCA 4A2PA 3BH7A 1IN6A 4FWTA 3W3ZB 2GDJA 2XTMA 4LV6A 1JNYA 3RS5A 4JLNA 4UXJA 1UPTA 3MWLA 4OL0A 1G21E 2VPPA 4LHXA 1MR3F 4HLDA 4XH9B 1YQTA 3WYAA 1QHXA 4YMTA 1OKKA 1H8ED 2D7CA 2IYZA 2WSSD 2WZQA 3QXXA 4M1SA 1I2DA 1JB1A 3LNCA 4JKYA 3RANA 4EQ6B 2CNWD 3BIFA 2QGNA 1AJEA 2OBLA 3UXMA 1QVRA 3ZD7A 1U99A 1IY1A 2OCYC 2QPAA 2IYVA 2ZANA 2CK3D 4MDFA 4TLBA 5KOYA 5GVRA 4NKRA 1K5GA 3L8YA 1FP6A 3B82A 4URUR 4BFSA 2CL7X 2XJ4A 3KXKA 1ZUNB 3SYLA 4UNPA 1ZW6A 3Q5EA 2YJTD 4XWKA 3NC1C 4TMVA 2C5LA 2ZRLA 1AKEA 5EP2A 1N6KA 4Q18A 5JS8A 2WWXA 1TEXA 4K81B 2NIPA 3A8TA 1TF7A 5J4LA 3D3QA 4OQLA 1G8HA 3K0SA 5FBLB 4KYUA 1E2DA 4LYFA 2NO1A 3WNCA 5CLLA 1SGWA 2AX4A 2ZVQX 3U3RA 1JPNA 3LO5A 1E9FA 2LWIA 5B58C 4LC1A 2ZRFA 5L3SB 4Q7MB 5CJ2A 1IN4A 1NMYA 4N3NA 3TKLA 1Q22A 3LVRE 2C96A 4C2TA 2AKYA 2F43B 2VHCA 2ZAMA 1J7KA 2WIBA 4PHFA 2VF8A 1SVOA 1LTQA 3QENA 4TL9A 2O8DA 2R6FA 1XMSA 3OEED 1F6BA 2QM7A 1Z6YA 4EPTA 3MG9A 2QBYB 3I5XA 1Z0FA 2Q21A 3PUWA 5D3MB 2RKOA 3IUYA 2HCBA 5CLQA 1V5WA 2GA8A 1G3UA 4B71A 1W49A 4OYHA 1KI2A 1R5NA 1Q21A 3LBIA 3KB2A 5FL7A 3PEWA 1E2LA 3O8RA 1BIFA 1Z3IX 5HCNA 1Q0UA 3N70A 4S2EA 1UKZA 3EW9A 1DVRA 3C4JA 1KY2A 2IX3A 4DCVA 1MRSA 1QHSA 1TQ4A 3C5HA 4ZCLA 3Q5DA 5J4HA 3ICQB 2ODWA 3WMEA 3U6KA 1EK0A 3X1ZA 2IS2A 4DUGA 2V7QA 3GLHE 1DAEA 4P4SB 3OFND 5FOXA 3V9PA 2RCNA 4A6PA 3BB4A 4Q00A 3U3KA 1LV7A 3ZQ6A 4BWYA 2QQEA 2YYZA 2R62A 3CX6A 3VKWA 1D2NA 4MRSA 4JLVA 4PSVA 4Q9IA 4KCGA 3VR4A 4Q4HA 2XOKA 4F4IA 4WZ6A 1ZM3A 2WBLC 2WKRA 3VU9A 4RCYA 4DCUA 3R9XA 2AKAB 2W6IA 3M1IA 2X2FA 2ZRKA 3ZJYA 1VYTA 3OIVA 3A4NA 1AA9A 1KK0A 1UDXA 5TXGA 3WYGA 1TNDA 1G16A 3QG1A 2AD5A 2CE7A 4TWZA 1U0LA 4C7OB 2ZIAA 1FW6A 4YONB 3WY9A 4AG5A 2BEKA 1CU1A 221PA 5TMPA 2RAPA 3NH6A 2AXNA 1G8YA 4EQ6A 4DT1B 3SQXA 4TZ6A 3VFDA 3THYB 5G3YA 2YC2C 1IN8A 3Q7QA 1KZGB 4TYNA 2D2FA 2HF9A 2TMKA 4ACAA 3I73A 3LW8A 1CR1A 4B2LA 4DCTA 3O8BA 2PBRA 1T3LA 4Q1EA 2JLZA 3ADCA 4GMXA 5GJBA 1W0KA 3BGWA 1YE8A 1XEWX 4TLEA 3EZ2A 2GF9A 2PEYA 3GFOA 4Q47A 3R9IA 2ZVPX 4LSGA 4IHQA 2Q9CA 4URWR 2ZJYA 5HPYB 1DADA 2IT1A 1XX6A 2RHDA 5FUVA 3W6PA 5AR1A 4FCVA 1KSJA 4UXHA 5KDDA 2R2AA 5IK2D 4V02A 1SVMA 3I8SA 2D3WA 4LYAA 3NDBB 1CJTC 4PAMA 1CR4A 1KI1A 2AFHE 3DZ8A 1NN3A 3GJ4A 5L3SA 4XOIA 4R2HA 5LB4A 3LAWA 5KSZA 4MDEA 1E9AA 2PZEA 1OHHA 1EWQA 1OXSC 4DZZA 1W4AA 1TMKA 2WWIA 2F43A 1P9NA 5E7IA 2NO7A 1W48A 3MWYW 4EPWA 2ZR0A 3TRFA 3FYHA 3VR3A 1WF3A 1AK2A 2RH5A 3CF0A 1UEJA 3CWZA 5EP3A 3EIQA 4JLKA 2ZUCA 621PA 1Y63A 3GLGE 4WZAE 2QBYA 3I62A 3NXSA 5D3MA 4QGGA 2WIAA 2XNDD 2ZR9A 4ZO4A 5B57C 6Q21A 3X1XA 1A1VA 1UBEA 2O8EB 4NPHA 5EXTA 1G7CA 1NY6A 2EWVA 2ZRMA 3W90A 3QE0A 1KZ7B 4IXMA 1EFRD 5FOVA 3LX8A 3THWB 3PUZA 3BWDD 3DM5A 1FQJA 3A1WA 4YMSA 1UBCA 2GJAA 3IIKA 1NLFA 1DE0A 2RGGA 3QXCA 1XCPA 4UNNA 1ZNWA 3CW2A 5KDOA 1RVDA 4P4SA 4TYWA 4E5UA 2XAUA 4NDZA 3FHTA 2QM8A 1KY3A 3BFVA 2ZJOA 2VLIA 1WP9A 3FMIA 4PC1A 1QHNA 3RHFA 5GJCA 2NPIA 3IQXA 2AN9A 1FNNA 1DOAA 1XTIA 1TU3A 3ASYA 3GCGA 4JJKA 4KFSA 4PANA 2IWHA 1G5PA 3KZ1E 2VA8A 4LBYA 4GP6A 4II7A 3BB1A 4NCKA 4EPRA 3KXLA 4BLQA 3R7WB 3GLIB 1LF0A 1JALA 3Q72A 3SBEA 4BFZA 5E3HA 4F4JA 1S3SA 3PEVA 4C7OA 1VG9B 4PXAA 2GEVA 2GEUA 4YLGA 2J9RA 5EE1A 2QT1A 3CRRA 1MV5A 3QF7A 4DT1A 2IYQA 3B85A 4MRNA 3A37A 2ASEA 1N6RA 3VR2A 4DLZA 4WVFA 1E9RA 3NHBA 4RFSB 4P32A 5JWRA 4OQFA 3I92A 3TUIC 1NLYA 3CB4A 3Q8XB 4EPYA 4HZIA 1W44A 4FN5A 4JKIA 1EX7A 3CKLA 1SKYB 2PJZA 3AVXA 1HT1E 1P3JA 2P5TB 4YXWA 5L3VA 1LS1A 4OHZA 1T3HA 4S35A 5DN6D 1IXSB 4POAA 1E1QA 4Z8YA 1S4QA 2W0MA 3QSYA 2O8BB 2ZYTX 4PQRA 2VO1A 1EGAA 4IDNA 5FOTA 1QHIA 2AL7A 1NL3A 2ZRPA 4Q5IA 1YZUA 2DBYA 1G20E 1KNQA 2FFAA 1SVKA 1AGRA 1Q44A 2RGCA 2ZRNA 1KDTA 1Q1ZA 4KYIB 3KKMA 4CIDA 4UNSA 2IYXA 5H70A 4QGHA 1YZQA 5FOWA 3RRZA 1EXMA 1KI4A 1SVIA 3DOEA 4JT2A 4I4LA 4ITRC 5FFMA 2XZLA 1DAKA 2HJVA 3H86A 3QPWA 3B9QA 1F5NA 2JIZA 2YHSA 3AGQA 4BZPA 5JWHA 3RS3A 2CDNA 4A2QA 2A5FA 1GIAA 1CKEA 5CM9C 3R8FA 2JJ8A 3H1TA 1SULA 4EFMA 2D2EA 1HE1C 4NP6A 2W0SA 2O8FB 1QG2A 4KODA 4ZPXA 1BOFA 1PJRA 4GL2A 5K8IA 4LJ5A 3LQRA 3GJ8A 3NVAA 2O8EA 4A2WA 1A82A 1OIXA 2I1QA 4TSFD 4DWJA 4PZZA 1UADA 4DCNA 1YVDA 4Q7JB 1G9XA 5EUQB 1MABB 2QTHA 2ZJ2A 4RCZA 4PTLA 1GNPA 5A4JA 3THWA 1Q57A 821PA 4QM6A 1WCV1 1W2HA 1DAIA 2BKUA 3BBPA 1RRGA 5GJWC 1WDTA 1J8MF 4RSGA 2OFOA 1D9XA 3KTAB 5F3WB 3A1SA 3TJZA 1NRJB 4XD7A 1W4BA 2GXSA 3BE4A 4HLCA 1Z6TA 3KKQA 2Z83A 3BXZA 4LCBA 3L82B 2PEZA 1NBMD 4PAQA 2GAAA 4NONA 4HAUA 1HH4A 3CRVA 3Q9LA 3WYFA 1QZXA 5HE9A 5JWOA 3BD9A 3CLVA 2ZJBA 1E3MA 2ANCA 2R6AA 2FZ4A 4JYBA 4V0OA 3J81k 2AK2A 4BRWA 1BKDR 4JLPA 1R0YA 2DCUA 3D31A 4JJZA 3R7WA 5EP1A 2A5GA 1HY3A 1Z0DA 4D26A 4LHYA 2JLXA 1WB9A 2VF7A 2JAQA 3CRW1 1NIJA 3LDAA 3OIWA 3QKUA 3S1AB 4ZIRB 4JBYA 2ECKA 2XEXA 1XXHB 2ORVA 3AF1A 1U2RA 4RFSA 3MGCA 2FOLA 2YWEA 3ASZA 3GJ3A 3RVBA 3NDPA 2MMCA 1I4LD 2F9MA 1YR7A 4KV9A 4X8MA 4MUAA 3X1DA 4Z1MA 3ZDQA 3MJHA 5F98A 1MO6A 4NYJR 1VECA 2PL3A 3CNOA 1CP2A 1JAHA 3OEHA 3X1YA 1D2EA 5AK0A 2WAXA 4C3ZA 4CT5A 3AF3A 2O8BA 3K9NA 1NY5A 3SOPA 1JAIA 2IHBA 4HLQB 1ZIPA 1GKIA 3TUZC 1H8HD 4JBWA 2WWWA 4KAXA 2P3SA 4NCIA 3SEAA 3EC1A 5HZHA 4U00A 4MGIR 1TPZA 2AXPA 1O3YA 4LI0A 3L8ZA 4LJ4A 3EA0A 2OESA 1XMJA 1XU4A 5FPTA 5HE8A 2WKQA 3TK1A 2ZXUA 1ZMXA 3NC0C 4B35A 3PJRA 1RFLA 3QVVA 4KHZA 2YOFA 3G5UA 5LDDC 2O8CB 3DPUA 3MWKA 2O52A 4UJ3A 4MYUA 2GXAA 2JLRA 1FMLA 4LYHA 2F1IA 2GTPA 4IOKA 3QIAA 2CHVA 1OYYA 1P2TA 1E2FA 2O8FA 5JRZA 5C2JB 3BFXA 4DB2A 3TUJC 3SHFA 3Q85A 4JT4A 4B6EA 2D06A 3EIEA 1JECA 1XF9A 2G3YA 2H57A 2QTVB 2VSOA 3CO5A 2J7PD 1ZJ6A 4M9QA 2Z6VA 3SJBA 4IFBA 1MABA 2O0HA 3JZAA 4B3DA 1Z29A 4BPBA 3UG6A 1MRNA 2KI5A 3PEYA 1U8ZA 3A1UA 1KO7A 4QHTA 4RJLA 3DOFA 5AUQA 4GP7A 4EAQA 5FBWB 2IHYA 1G19A 2OM2A 3T5DA 3KJGA 3KTAA 1ZD8A 3QXJA 1L4UA 3RS2A 2CVFA 1VCOA 4OI1A 3RABA 2W00A 3AUXA 2CL0X 4PHTA 1RIFA 2ZUBA 2P0EA 1G6OA 1QVAA 4PPFA 5DYIA 1IN5A 4A0FA 3U7FB 2JJ1A 1RPZA 4ASUA 4A0HA 3AVTA 1VG8A 5JLJA 3EA5A 4YMVA 1C9KA 1XP8A 2DFNA 1CTQA 1G8FA 4IFEA 2GVDC 1DAMA 3CBQA 3K0AB 2V9PA 3W6NA 4PPGA 2QPTA 2VP2A 2YOGA 4PSAA 1GKYA 2C04A 2ZPTX 5AJWA 3P4YA 1UFQA 2RGBA 1M7HA 1E0SA 2WWGA 3EWAA
chains in the Genus database with same CATH superfamily
4Q4JB 3UOWA 1BJTA 4H4EA 4C0AC 5BWOA 2R8ZA 2ZBDA 1ZD3A 3S1AA 4R6WA 1KIMA 3UWSA 1XNHA 1AKWA 4DA7A 1RLOA 2H1IA 1TKCA 5L40A 4YJGA 1KMHB 4MRVA 1A50B 1XQWA 1XXHA 2D8AA 4A8TA 2FOXA 2V6IA 3EIFA 1B23P 2EG5A 1I1NA 2DBZA 2CCKA 2IHVA 2X40A 3AZOA 2IF2A 3P52A 4RWEA 4HS9A 4C22A 4EG4A 3TQHA 5TQ2B 3DONA 4IHAA 4ME6A 2J4CA 3VYUB 4F91B 3B53X 4YIKA 1DO8A 4P34A 4OAPA 2XWSA 4DJJA 1B1AA 3G8CA 2RGWA 4EB0A 1UKYA 3O8QB 4BLUA 1W2GA 1ADCA 1MJNA 2AE2A 3WGIA 1LI7A 4ZAVA 1P9RA 2JDID 2C77A 4B1FA 3T54A 2YHIB 1NKSA 5JJLA 1DAFA 4B85A 4FOSA 1EVJA 2EKQA 4HY3A 2WG0A 2XXBA 3UMRA 3EHEA 4XFJA 2XUAA 3N8GA 4RJKA 1D1SA 1MGOA 1N3IA 3CNEA 4FCTA 4QBFA 3U80A 2ZUUA 5CBPA 2KE5A 4U39A 4MWEA 4F6LA 2P9ZA 1GPJA 1I0ZA 2FPOA 2ZRBA 4CU5A 4YR9A 2X4LA 3X2EA 3KQHA 4CDMA 1IWOA 2VL7A 4O4HF 2IXDA 1LPSA 2DHCA 3JTEA 3QJ5A 3HFRA 4G5SA 3TRHA 3S2EA 5JNLA 5KNLA 4CTNA 3FYTA 1HXHA 3EFHA 4Z4EA 4ENPA 5B3JC 3HBMA 2RGUA 3BRWA 2O8CA 1KI3A 2XRFA 2HTFA 1SIUA 1ZH8A 3BQNB 5FA6A 4KQEA 1M2OB 5ICSA 1XFAA 1P3Y1 2WUDA 1V3QE 1O6GA 2O2DA 2QLBA 3IP3A 3PGXA 2AYYA 4P31A 3IXMA 2G5TA 4UTRA 4I50A 4ARSA 2VR1A 1OX4B 2QAIA 1RYNA 4LXTA 1BXKA 5DW3A 3D81A 3Q9UA 3RS8A 3ICOA 3TZ6A 2GUGA 5ALWA 3CU5A 3HZOA 3SHVA 1GL3A 4MP3A 3MK31 1V8OA 1TYCA 2JLQA 3EHDA 3R24A 1ZUD1 3B1KA 5KVVA 2ATCA 4A5SA 5IJ9A 2JS7A 3A2NA 1V7PC 5H3CA 4LWQA 4XTRA 4UPVA 1WZNA 4MW4A 5FWXA 3WLTA 3LA8A 5D2CA 5PGMA 1J5EB 4MV0A 3AHDA 3UT6A 2HQ1A 5LZ4A 3ZC3A 3FNGA 4IIDA 4WMLA 3LWBA 2XW6A 4JMLA 4PNEA 1WMFA 3RYTC 2FUEA 1US8B 5B3JA 2VHVA 3R0XA 2C84A 3FIUA 1RM4A 1IBCA 3VC3A 3ESRA 2VDPB 3GNSA 3M5WA 2JIOA 3R0IA 4TSKA 4ACBA 4B48A 5K0EA 1JI0A 1GQQA 4IAOA 4UAJA 4X45A 2OT3B 4L5YA 1CQIA 1OFVA 3PR2B 1RAIA 5K2OA 3PQCA 2W93A 5B4UA 1Q2UA 1N2HA 1EUDA 2JGAA 1TEVA 3T9FA 1F06A 4PC2A 2H54A 1CJBA 1LUAA 2NZVG 3QWFA 4GZLA 1QRSA 2W6JA 3A26A 1HNWB 1RLUA 4DC9A 1YWGO 2V0GA 3AESB 1Y6GA 5ALTA 2FX5A 1YRAA 3Q3VA 5EFZA 1AV6A 4WEOA 2P2YA 2XVYA 4QUKA 2ZE7A 4LJ6A 5AMXA 1H2EA 3HE3A 2GYUA 4I4TA 4CFYA 4FPXA 3VTAA 4LRYA 4ZVTA 2MU1A 3UUEA 1QMPA 5JO0A 2Q5FA 3L04A 3L6RA 2WJHA 3H99A 3I61A 2YH2A 4YN3A 1UQRA 3B6MA 3F46A 2FYTA 2Q9UA 3GRFA 3NM4A 5I3CA 3UPTA 4EA7A 3K09C 2OHIA 5EJGA 1RYHA 3I23A 3OQMA 4L76A 4HPJB 3JVUA 4YJ3B 2JFXA 5T4EA 1F2DA 1NFRA 3USES 5LQAA 1DIGA 1F4VA 2XMDA 4H1UA 1KDRA 2B0JA 2WEKA 1X1QA 1D09A 1SVSA 3EXIA 3I6ZA 3NWPA 3KXPA 5NULA 1NJFA 2B1IA 3MMZA 3PGMA 4E31A 4MVJM 1QQ7A 3QY0A 1P5HA 2AD1A 1QCZA 1X8LA 4XVUA 1N32B 4IEIA 3R2JA 1H23A 3BCRA 4JL5A 5HILA 3DOJA 3QEAZ 2UAGA 5I7OA 3HU3A 2AZDA 1MPXA 1E6MA 5LYJF 3EJ6A 4DDTA 1DI0A 1OZAA 2GLXA 3H7IA 2BI8A 1YR6A 3D8NA 3NIFB 3P96A 4XQ9A 4EF6A 3PSAA 3VSCA 2QTZA 5IBPA 2XOXA 2QRZA 3OTGA 5ETJA 3SC2B 1QS0A 3H2KA 4XB2A 3F5MA 3C8MA 1AT1A 1A2BA 2XCUA 2IYSA 1V7ZA 3IS3A 4JQYA 4NJEB 2GPWA 1LLDA 1T25A 4M8SA 3H5VA 4LJYA 4V2IA 3B1ZA 3JQAA 1VL8A 3K09A 5KKAA 5K0JA 4O4LF 1N9GB 1OV6A 2IIBA 1WXXA 1YBHA 1E1RD 1PZHA 2BMAA 2VLBA 5F51A 3EQ8A 3WQQA 4Y2QA 1XRNA 3HU1A 4GM1A 2XUPA 1Q92A 1HQKA 2AN4A 5DZSA 3W78A 2XQFA 3G17A 1KOJA 1ZMRA 4G01B 5A3SA 4CUJA 3PX2A 1NVTA 2GNAA 2QA5A 5IAAA 2FDCA 5JFOA 1NOJA 2CHUA 2IDZA 4TWRA 3WBFA 5BN5A 2B8WA 3V2HA 4L0DA 2Q1WA 2QM3A 5FPYA 5F7JA 5HKKD 4KGDA 1ZM9A 5BWCA 3SSAA 4NNOA 3M9WA 4Y9DA 5LQDA 2GJSA 4LZPA 1GAJA 5DHUA 1C8VB 1OWOA 2VHWA 3P9NA 2H4JA 5HQJA 4OXIA 1T4CA 5EERA 5F4ZA 2IE0A 1OROA 5LLSA 3T35A 2LIVA 3UOGA 1GAXA 4MP6A 3CEHA 3FY4A 3QU4A 3G2JA 3ZXUB 3H1BA 3W3AA 3GL9A 1YS1X 2BFFB 3HYNA 1IPFA 2IPXA 5HSGA 3DTNA 3VAYA 2XVAA 2A86A 4NMWA 3P20A 2PZAA 2BIFA 3AKCA 5DHFA 3DZGA 4GYKA 2I65A 1UJ6A 2OGUA 3EMDA 1GRQA 4MPPA 1JTVA 1OXMA 3B9PA 1Z33A 2ZRDA 5DMXA 1YRWA 3ZWBA 4ZKDA 1Q84A 1XVTA 3LUFA 1NUUA 3IAS1 4FIDA 4FZJA 4UCXA 4OU4A 2QU8A 2BW0A 1QBKC 1HQCA 2Q3MA 1G2IA 1PFUA 1L8XA 3AK4A 3G8DA 3PCTA 3CF2A 1O94D 4G1BA 4R2MA 2W70A 1RZRD 2PX6A 3M0EA 1PLLA 3OAAD 1Y9ZA 2P6MA 3PF8A 3AERB 1XJ0A 3MXOA 3HDYA 3VR6D 3WLPA 1E3QA 1J24A 4YAFA 4CODB 3JARB 3MYYA 5IEJA 5J2TB 1O58A 1DT5A 1JKMA 5TPZA 2G72A 3DC2A 2CZGA 4DWVA 1U1CA 1T5TA 1YB4A 2CMHA 2HWUA 2VDRB 2WVJA 2YBEA 2ZWVA 3EEQA 5LIRA 3OBBA 2BMFA 1CETA 1RQPA 3G5AA 5FA8A 1ULZA 4W63A 4BV9A 2LVBA 1X7ZB 1QHGA 2ZIXA 1CRQA 3UFXA 3K73O 3NV9A 1W46A 4K9NA 1DTWA 2MSEB 1VRWA 3GB9A 2XUQA 3IAUA 5BORA 3EWNA 2XGJA 3BILA 1VI6A 1Z5ZA 1H0KA 1R4MA 4DABA 5AW8A 4DYHA 1NSTA 5CFMA 3GW8A 4U0JA 1GSHA 5LA6A 4F9FA 4UTNA 2IUSA 3O9ZA 1M2JA 2ACKA 4LFAB 4JLOA 4N39A 1R66A 5DHSA 3V2UA 1F38A 2IKQA 3EA4A 4JOCA 2XDYA 5FL3A 4WASA 2ZYWX 2F3RA 1ELOA 3IAAA 1CNEA 1N2ZA 1TU0A 2G0AA 3ZPXA 2UYYA 3CCBA 2J87A 1OIWA 1PX0A 4MR9B 2CVPA 4KBFA 4TGLA 2BDTA 2PQ6A 3K71B 2GRJA 1UZMA 4BX9A 1HE4A 1WXIA 1CUGA 1YI0A 2G83A 4HB4A 4Z0TA 5FR2A 2VAPA 4UTXA 3ILXA 4RTPA 2CHGA 3ABSB 2OG2A 3NYIA 2FF7A 1RPAA 4GKAA 3TOZA 4OHVA 2VK2A 3WHPA 2FPIB 2XLCA 2XVXA 3ICCA 1E98A 5K9ZA 2JI4A 1JSXA 2NUBA 3KSUA 4G4IA 3TVDA 3JZIA 1M3SA 4JI3B 4MPRA 3AEUA 4AMGA 1GT91 3FSEA 5CITA 2Z58A 2Q0XA 3I01A 1XDWA 4TTQA 5DM0A 3X1MA 3B7WA 3QW2A 5K8LA 3TIIA 1SA0A 1N57A 1TT5A 2X1HA 3DD1A 3H1AA 5CLGA 1J25A 1J22A 5ALVA 2AJ8A 4RD3A 4QOJA 2J5RA 2FSHA 3DTYA 2MDTA 4JLSA 4BVJA 1KY4A 2I2AA 3AW9A 1MTZA 3PT5A 4PV7A 5C1IA 1AMUA 1H65A 4N7JA 3MBOA 4Q4AB 1ENOA 1X1SA 3E8XA 3Q98A 3BMOA 4PCUA 1GDHA 3GVPA 3ZXXA 3K31A 4LKOA 4TWBA 3WHLA 2AFRA 3I04M 1NOKA 2IXBA 3OCVA 2OLEA 4YIHA 3NLLA 1WUYA 4UVHA 3EAGA 3SS8A 5EZYF 4BMXA 3G0OA 5A9SA 4E03A 4ZZ3A 4QDKA 4CR7A 3LW7A 4G5OA 4ZT5A 1C41A 1RM0A 2CT8A 2I2FA 1RCUA 2Y1EA 3O4FA 2E21A 3Q9SA 2KMLA 4H0CA 2AFIB 4R40A 1DLIA 2V7VA 3DOUA 3EDOA 3LLUA 2I54A 3S2GA 1TKAA 1OOEA 1SC6A 1IXKA 1DARA 2CFTA 4MGKR 3VSDA 4EUHA 1I9GA 4R5MA 4PX9A 4WY8A 2PQMA 2QY9A 3H9EO 3PC3A 1E79A 1KWKA 2V1UA 1BVUA 1YRLA 3I2GA 4MKZA 4Y0VA 3TOVA 1MD9A 2I7VA 3NALA 2O4UX 1P8JA 1GQSA 4W6ZA 5K3CA 4IJVA 4B09A 2D1FA 2HIGA 5JSZB 4AUKA 3HYTA 1T9CA 4PGFA 1Y1QA 1FL9A 1K3TA 4MUBA 5HX7A 2JFOA 4QFMA 2YDXA 2O5RA 4J1TC 3ZUPA 4WN9B 2VYVD 1K8RA 3Q40A 4R01A 4X3OA 5EIAA 3KWFA 3NTUA 3QLUC 5GM2A 5CHYA 2BKVA 4B4VA 2YWXA 2BR4A 3CR7A 3PIDA 3Q9NA 3HY3A 4UUQA 5A2QA 2Z2XA 2G08A 5B7QA 2NTEA 4IHJF 1TTHA 1IUPA 3H5LA 5THKA 1XZKA 4WJLA 1E4EB 2VAVA 3DHVA 3LRTA 5C7OO 1GG5A 2ZATA 3NFRA 1OFTA 3FGPA 3VNSA 4CT0A 1V5GA 4PG7A 4EENA 4RXTA 3LPNA 3VJKA 1O0BA 4RKFA 4YCNA 4A73A 2W8BB 1G7RA 3FD8A 3OCZA 3CF6R 3OU2A 5GGYA 4ZI3A 4JI8B 5ADUS 1K8QA 2OVFA 3VAZA 3GFBA 4J0JA 2FFHA 1NP6A 5I9BA 1KTVA 3DP9A 2XNHA 1TADA 1W85B 1Z83A 4J1SA 4UHDA 4WAUA 5FUWA 5MFPA 5IVKA 1A3CA 1Y8RA 1WPGA 1SCDA 3ORYA 1SUCA 4MKIA 5A05A 1RRVA 2E3JA 2FPPA 4ZJUA 4NXMB 1IVNA 3ABOB 4YCBA 1J00A 1OCEA 3RFUA 2QTWB 2QROA 1O6CA 2H59A 4AKIA 2A3NA 4OI4A 4QBTA 4N0MA 4B6GA 3AUYA 1FZQA 3K7EA 4GX1A 4MUEA 1JXAA 2EXXA 3O3MB 4A82A 4E7OA 2IYUA 4PIPA 2Y71A 2HN9A 4J1TA 1Z06A 4PS0A 1OI2A 2NSJA 3UIEA 2ZB4A 3QLUA 4I08A 1WMDA 3BICA 5EJMA 4AJLA 3P0EA 3FB4A 2RHOA 2YY5A 3PYMA 4C4XA 2ZI7A 2DULA 4L9SA 3CZ5A 3BDAA 3E9YA 1TQ8A 2MT9A 4MEBA 4ZYVA 4GFDA 1H2BA 5EHGA 1GA4A 4JYPA 1IBRA 4GD3Q 1ZCBA 3HNPA 2F6RA 4MGZR 3IA7A 3AR4A 4NMHA 1VSUA 3N6XA 2QZPA 4UC0A 3U4QB 4RTOA 3QI2A 4TWIA 2B9EA 5HZKA 4EPXA 3V46A 2A1TR 2EFHB 4HDMB 2Q3LA 3CKMA 3WLOA 3BXEA 3DBIA 2B4RO 1QC5A 4RHTA 4QUEA 1W87A 4BO1A 1QFYA 3HJFA 2EYUA 1XVIA 2HBQA 3HFSA 4EFDA 1BE0A 2D3TA 2AI3A 4HATA 4TV8F 2UU9B 1W88B 3QKTA 4OLFA 5KTSA 2QORA 1YZGA 1IAVA 1W6UA 1MZVA 2W6MA 1SQ5A 4JP8A 2HO4A 2WF9A 1U0FA 3FOWA 4R31A 5DASA 2AGVA 1CUCA 4JHXA 5B1DA 2XNJA 2J0QA 5AXAA 4XKJA 4C04A 1OFGA 4PFJA 4DADA 4OM8A 1GTMA 4LPKA 1AKNA 1WV1A 3ABQB 3GP3A 4F5WA 4CEJA 1LDEA 4FGSA 4GGOA 1V45E 3TRIA 3C14C 3CTMA 3TDNA 3F3KA 3TTWA 1ETHA 2IBTA 2JCSA 2V65A 1CZRA 3TEFA 1Q50A 2GK4A 5DTJA 2DKOA 4OY3A 4S12A 5HIJA 1GL6A 1HFJA 2PS1A 4MQFB 3V1NA 2YWRA 4IR7A 2JCXA 4S3MA 3H5NA 4CF7A 1QSGA 1X7XB 2J46A 4MP8A 2PUWA 3E3AA 3QW4B 3K4HA 5JADA 3VI4B 3IDFA 1KU6A 3W7VA 4C6HA 3AONB 2O8VA 2WJIA 3HFJA 1ZIXA 4D57A 1Q6YA 1PG5A 3L0CA 5JEEA 4KH0A 2CGEA 3MJDA 3ER9A 3UWDA 4AQ7A 4LF8B 3EZXA 1OI7A 3FPHA 4FMCB 3T1VA 2QIOA 1SEPA 4EA9A 4FFRA 2OYSA 1R4ZA 4D3YA 5CNKA 4JH0A 2B92A 1V7QA 4OEHA 3V2GA 1YK1A 2VWHA 5HBGA 3VR4D 5FPHA 4BC1A 2XOKD 3RUEA 1QB8A 1Q95A 1QTNA 2FSVC 3O1LA 4BO5A 4JT8A 4XVQA 2HNAA 4L4SA 2CNWA 4UPDA 2ZYHA 2I66A 2HA4A 1M1UA 2OK8A 5BY2A 4I5GA 2C2YA 4RPHA 1CB0A 4EI9A 3A1VA 4JBXA 4FCCA 4DQLA 1MX3A 3HDHA 2ES4A 1RYBA 3MMXA 1A7AA 2B7BA 2M2IA 4D6XA 1JFLA 2ZTVA 3AF4A 2V45A 4G09A 5GVSA 2G63A 4OKNA 1OC4A 2D1SA 3MFYA 1Z13A 2I7TA 1POXA 2FRXA 3R3YA 2KS6A 4EVRA 1ZMBA 3PHGA 4D43A 1F60A 4FSXA 4G89A 2OA0A 3S2YA 3WMGA 2O7QA 1E2MA 3IEXA 3LL7A 3PK0A 3PFNA 3V4RA 1ZMTA 3ZE8A 1M2EA 1AXGA 2ZU6A 1WR8A 2UZIR 1E18A 2R0QC 5LNK1 4NMLA 3LY8A 4NHOA 1C7ZA 1JEJA 3IDQA 4P7FA 4WNCA 5H5JA 3TRJA 2I7CA 4OI2A 3A1NA 2OB1A 1W0KD 1R3UA 1SPXA 2BUAA 3OY2A 1QRUA 1N34B 2FSVA 2ZR7A 5JZ9A 2P2LA 2ZYIA 1NT4A 4XUGB 2BD0A 1MO5A 4HXGA 5HF9A 1C5KA 2J0UB 3H8WA 3RRMA 3ZV3A 2FH5B 2V4UA 2Y6UA 2PZMA 2OECA 2ID9A 2ZYRA 1HE3A 3DTTA 2IOHA 1XKTA 1KK2A 4O33A 1DEAA 3FSJX 5JECA 2HF2A 1PKXA 4PYQA 4R9VA 1AUXA 4YH1A 5ALSA 1JMYA 3VISA 4K9KA 4AZ0B 3PDUA 3O3NB 4EKGA 3D59A 3ENZA 4LF4B 4DC0A 3LH5A 4II3A 1KJ8A 3NJRA 3T5GA 2WM2A 1ULHA 2MSCB 2Q8NA 3A11A 3IBTA 2BI7A 4ZVUA 4JOBA 2BEWA 4WBNA 1X8KA 3RAPR 4TVSA 3RSGA 4D6YA 1L6RA 3PJEA 3IPAA 2JAPA 2H18A 3B13B 1OHHD 3HA7A 3GJXC 5CX1A 4FKBA 4P22A 2RGXA 3INRA 1P1BA 4JJAA 5IARA 2OFFA 1HE8B 5M2QA 3EZ9A 2FPXA 3M7IA 5CVVA 2FW6A 1AUQA 1E89A 3IIIA 3RLIA 3PHIA 1E94E 1WKBA 2BKXA 1R0LA 2C92A 2REQA 3PJFA 1YI1A 3FUXA 4L15A 3T9CA 4K9SA 1JKIA 1KPGA 1V3TA 2H06A 1XMPA 1J39A 2I99A 1EFUA 1BH2A 3LUKA 2IL1A 2BR3A 3CEJA 2C98A 1V26A 3L7OA 1I33A 2PBFA 4H7KA 2B4YA 2VOJA 5H3HA 2X8LA 3INTA 4AD8A 2E5WA 4HTFA 2AH5A 3CPHA 3BQMB 3JZMA 4AU1A 4FILA 4GX0A 5J40A 2X0IA 4J6FA 3LRXA 1YQGA 4BP8A 2AZ4A 1HRDA 3NWOA 3VC1A 3DS8A 3JWJA 2ZP1A 4L22A 1B0PA 4TLAA 3H11B 3ROQA 3LQ1A 2WQ7A 3QKRB 2AOUA 4QLOA 4S1NA 2EKPA 3LUJA 5FWYB 5H1YA 4MRMA 4LRTB 3SXPA 4L0QA 4MW2A 5KYVA 5KJ1A 4YEDA 5J43A 1T8SA 4BV8A 2XZPA 2IV3A 3RSLA 2RBKA 3L4JA 4WK6A 4J6EA 4LGCA 3D4BA 3ENVA 3OPYA 3U16A 3NETA 1FPMA 4KV7A 1TQ6A 3WWYA 4IFTA 3ZY5A 1NW9B 5DBHX 1E1CB 5T64A 3BIJA 1EU1A 2PUGA 5DNCA 1AA6A 4WIAA 3AVVA 3T7TA 2O7VA 5I8WA 4NZNA 3LFTA 2B94A 1QO7A 5EIBD 4EARA 4CQMD 4KWHA 1EX1A 1NMZA 2C9YA 2ZWPA 2IYNA 3ED5A 4HDCA 3S5UA 1E69A 1YRHA 1TA4A 3V4FA 4W9MC 3SLRA 4DDUA 2FZGA 1NR7A 1QH1B 4HGZA 4NQZA 2JEYA 1INLA 3L06A 2VDWA 2HSZA 1VYHA 1MH9A 2P77A 1TJPB 3NWEA 3VR2D 2P0YA 5IC4A 4JYZA 2NUPB 1SO8A 5JROA 3DEAA 4OP2A 4A92A 1NFQA 2QSYA 4DWWA 2QXTA 1XQ9A 4RTNA 2IPAB 5J47A 1AD2A 3FWZA 1E20A 5ECYA 2WKWA 1A8SA 4DV5B 5E9WA 1QIMA 2R1UA 3QEOA 4M76B 3WLJA 5F76A 1OTHA 1SHUX 2XGGA 3QMMA 4LXYA 2QX4A 4NU8X 5DNUA 3NKFA 3WWZA 2BN4A 4X20B 1P81A 1ISPA 2P9QA 2DWPA 2XUOA 3CURA 4IDAA 4XWAA 3VH4A 2QRJA 4DLAA 4EH1A 5KX5A 2WFZA 1O97C 2GF2A 2H52A 3AEKB 5IK2A 1ZP6A 2GPBA 4KK3A 4AP5A 2IYEA 3DEZA 2EF0A 3SU8A 1Z45A 4HDNA 2H7VA 3PUXA 1UT5A 5L8VA 1BCSB 2H1VA 2NT3A 4IQ0A 4BDSA 2RB4A 1Z0IA 3C5WP 4CRWB 3GT0A 3PC8C 1WMEA 3UJAA 3DKVA 1UP7A 3KT3A 4KR7A 1USWA 4QAQA 4ZGWA 4AY5A 4N5MA 4LGMA 4YAJA 4LHZA 2C59A 4U3JB 4AJOA 1XZLA 3SJCA 3O0TA 4LRWA 1FTGA 3VNQA 1QTIA 3BD6A 3OA2A 3RC8A 2PS0A 4GOOD 1Q3TA 3KLNA 4H0FA 1VDZA 3KT6A 2W42A 3MPUA 2PCLA 1NDUA 2Q4DA 4DY4A 1T6ZA 1FYDA 2C9MA 2I2DA 2XNDA 1NXXA 4U7GA 4F1WA 1TYDE 1OWPA 3JQGA 4FZRA 1CYDA 4D0SA 5JH7B 4BO8A 2ZRHA 3IBYA 5DP2A 1Y4ZA 2XTZA 3B8HA 3CEPB 4WZBB 1QV9A 5JSQA 1JJFA 3KZKA 4G0QA 3O73A 1SCUA 2H3HA 1BH6A 2WE8A 1I9CA 4N3BA 1YCHA 2JL1A 2BGIA 3CINA 3LPLA 1EFRA 4WCVA 5FFNA 1QU2A 1A8HA 4L9WA 3K6JA 2K87A 2QN8A 2ZBFA 4YV1A 1E2HA 2QAGC 3ZWVA 4DMFA 3UYLA 2ZVJA 4K9RA 1WULS 2HXSA 1I7LA 1RLMA 5DH9A 1CQJB 2WSBA 2ZIEA 4O02B 2BKEA 4GKBA 4A91A 2Y1DA 3H4TA 2CV2A 5F1KA 4RPKA 5DXFA 5HQTA 1M6YA 1VI5A 2C7PA 4ZFNA 4Q0MA 3L18A 4RTKA 4HG2A 3PC8A 2CLCX 3FLBA 2KBEA 2QW8A 2C4VA 3L7JA 1EP1B 3E03A 4KMRA 3LHKA 2K2QB 3QIVA 1Q1BA 5JZOA 3CRNA 3GFQA 1G3RA 3BMNB 2P91A 2VQDA 3I53A 3K96A 3F90A 3PGVA 4JLJA 4FDTA 1Q17A 3QHQA 4TL6A 1HZZC 1LDBA 1GRRA 3IB6A 3HXTA 2HKIA 3PRHA 3N8HA 4R8RA 1VKHA 4UUOA 3R74A 4BATA 2Z98A 1XLWA 4K87A 2ZB8A 5AVXA 2PCJA 2GT1A 3MERA 4YRRA 1GGKA 2PA0A 2BGGA 5F9FA 2JBAB 1G0OA 1VLJA 4IIEA 3LDHA 4B44A 4WFJA 1ZEJA 2GETA 3LFUA 4PSCA 5FWNA 1XVAA 1QE0A 1ZZEA 2FMXA 2MINB 3O6VA 1QQTA 3TKAA 4EATA 1NVVQ 2QAGA 4JBGA 2HBYA 5EL0A 2QL5A 4ZYYA 2GK7A 1HPLA 3FRHA 2FX2A 1EDEA 1YZKA 2A4KA 4PLFA 1V5EA 1UAGA 1Y3DE 4D3FA 2B82A 1R64A 1F8XA 2DYKA 3OP4A 5I3ZA 5JW6A 1JFFB 1NVWQ 4JZKA 2JZOA 3R7LA 1JA0A 1SCIA 3P32A 4ND1A 4N3CA 4PPYA 4TMKA 3WBBA 1C14A 2V1XA 5FBKA 3A0UA 2QXUA 3SFVA 1TU4A 2BMEA 4GPD1 4XGIA 3FPAA 4H3VA 1U4SA 2FPKA 2P2CA 4OYYA 3OZIA 1B7GO 2FMIA 1EP3B 1E3EA 1HZZA 4MQ4A 4WE3A 3ZDEA 2QTCA 2Z0MA 3U7HB 2G7ZA 2PX0A 3PFKA 4LECA 2BV3A 3QKSA 1V5IA 3VKHA 1WNFA 4WK2B 2PGAA 4GMFA 4E14A 2C0PA 1UDAA 2RHGB 2VDKB 3ANYB 1G7SA 3C1TA 3CUUA 1QG0A 2F3TA 3H87A 3I2HA 4QOSA 4QUJA 5E1MA 3TEMA 2C3YA 2Q4TA 1BEUB 2CYBA 2X0RA 3SHOA 2FFQA 2JGDB 3H18A 4UHBA 1XTRA 1NQVA 1FMTA 3CS3A 3DKKA 4GE0A 4IQGA 4B79A 1LDNA 4YMHA 3PIRA 4Z1MD 3G2PA 3EGCA 4KO2S 2BP7B 2HRDA 1L7XA 1RW4A 1W30A 3ND8A 2QUBA 4GZ3A 2CF5A 1IUKA 4JLUA 4W8HA 3UEOA 5EIFA 1QXSA 3NBXX 4JI4B 1KOGA 3UNXA 3FOEC 4XLTA 3I83A 3Q7EA 2GHIA 4IIVA 3MD0A 1KI8A 2O50A 4GI3A 2D6FA 4MPTA 1G291 5KU7A 1F20A 1D2AA 1UBRS 4PGGA 2XH8A 2CMDA 1DL5A 2FP4B 1FYXA 5C53B 3G13A 4ZO9A 5CIWA 2OAGA 4PAOA 4DDWA 4QBIA 4UUAA 3SQNA 3BWYA 1RKQA 2I6XA 1QDEA 2IOQA 1L1QA 4BO9A 2YKGA 2HXGA 3UB3A 2VH5R 5GADl 4JXZA 1XALA 3IFSA 3DQPA 5LP6C 2PNFA 4D5GA 4NDNE 2R8RA 5C1BA 1DG1G 4HGQA 2DWOA 2ZSBA 4JKOA 5G41A 3UKDA 1USKA 2CEAA 3WK6A 5MGBA 1E99A 4TSFA 3W7AA 1TA0A 2ZB2A 1K86A 3C6XA 2E4YA 1Q20A 1YB7A 2C7GA 5BYAA 2QRUA 5JG7A 4QXPA 5F5LA 5KTMA 3N0XA 1GGNA 2HGZA 2XYGA 4AMZA 3FCAA 1TAQA 3L8FA 3L8DA 4EJSB 1QAQA 2PGIA 3CY6A 1DQRA 2E4WA 2V74B 1CUFA 3IV7A 3JAWA 4IVRA 2C88A 4IH1A 3NT5A 3GA5A 2IUEA 2D59A 3ZQJA 1C8KA 1RTTA 2ZSAA 2PNJA 3V48A 4MKGA 1NBMA 1QGYA 4KR9A 2G5GX 3WIEA 3D7SA 1UDCA 3OO0A 3PA8A 2C94A 2YZ2A 1U7OA 3H17A 3I09A 4GF5A 3G2HA 4RHCA 4XQ0A 4ZDKA 4ZI7A 3DBHA 5BN3B 4OX9Y 1NNLA 1RI5A 1RLTA 4MB2A 2QENA 5CNMA 4BQIA 1Z4KA 3JPWA 5K03A 4ZEWA 1M5RA 1N6HA 5HJEA 5LP6A 2ZPUA 4IEEA 3ZCRA 5HOQA 1IHYA 1UDWA 2BFDA 2IDKA 4HAZA 4M53A 3WXBA 5DP1A 5GQSA 2Z4SA 1GNTA 4BNMA 3DEKA 2JJ1D 1VZ3A 4DCJA 1MENA 3KQQA 5AQEA 3UM9A 1LRLA 2H29A 3ZV6A 1B3BA 4E09A 2IP1A 4AS3A 2J45A 2WP8J 5EHNA 4YT8A 5BR8B 2OEPA 4Z53A 2R25B 1VE1A 3ZCSA 4ZMRA 3ZHVA 4C43A 3JATA 2WNIA 3F5FA 4AJEA 1FRQA 1N8TA 3DMHA 2YV2A 4ENTA 4PC7A 3EGWA 2X2OA 4UW9A 3D3WA 3KAPA 5CAEA 5LMNB 4WLUA 4TL8A 4I46A 3BL6A 4NBSA 3KDSE 1J9ZA 3KETA 4QQ8A 3FA2A 3PGKA 3PQ7A 3QQPA 1UP4A 4GXTA 2P8JA 1AU9A 2OCAA 4B80A 4GPEA 4PO1A 2NP7A 2CE2X 1Z5PA 3E2PA 3M6IA 1F8FA 3PXCX 3EBLA 3VPDA 4DNXA 3QEJA 1T43A 4BKOA 3PG5A 3IT2A 2NYRA 2OCPA 4FWIB 3IP6A 2DQYA 1H6CA 3CUWA 2UXCB 8GPBA 3FPKA 1OU0A 2G9ZA 3I4CA 3IQFA 4UHHA 4JI2B 2XSZD 1ZG3A 2XTAA 4BKRA 4C0WA 2CZQA 3UHOA 3PICA 3PF9A 4RZ2A 3NVMB 3S6JA 3WBKA 2D2XA 1KBZA 1YU9A 3D43A 3PR3A 5JXGA 2I87A 4OQNA 2X19A 4X0EA 4XZ3A 4MI9A 3AKEA 2GASA 1S01A 2VJCA 1QZUA 2Y0CA 3CRZA 3DKRA 3KAKA 3LKZA 3PUKA 1Z17A 2G80A 4YV0A 1KVQA 3KUXA 1Y7IA 3KV3O 4WXYB 1YQQA 5K8CA 4EJFA 1GQYA 3C85A 1C0KA 4Q9LA 3W2TA 4L5AA 1A9RA 2V8OA 1M8FA 1JR6A 1H5QA 1YXMA 1NZDA 2PL5A 1GTG1 3UPUA 3BTUA 1NOIA 2OD2A 3L7LA 3QE3A 4MUMA 1FSZA 2IYYA 4KQMA 4BLPA 1N5LA 1TJYA 1WX1A 1Q0TA 1A88A 4LNAA 3WL3A 4PNZA 4KN6A 3VPXA 1DEXA 2CFOA 1A9TA 4HEJA 2QLJA 3DL0A 1CR2A 1K7EB 2NVUA 2OD7A 2QN9A 2WQ6A 2JLYA 4MW9A 4BNKA 1Z8NA 3NONA 2VS1A 4D99A 5CDFA 1BD4A 4ER0A 2MR5A 1FS4A 3RCBA 4M55A 5KI6A 5JISA 1C7QA 2ZSEA 3ZVLA 1BFDA 3M6WA 3DW1X 4RENA 3UUWA 2R2GA 4BVGA 4ZI2A 2WA2A 2H0AA 4NIMA 4CM7A 3PPIA 3EXAA 3VNUA 4R71A 5HTKA 1ZN7A 1ID8A 3K0FB 2YIMA 2ORIA 4NTZA 4JB0A 4CDNA 1MO2A 2H7YA 1MORA 5J4VA 3A9VA 1A9ZA 3T3DA 3CF4A 3NCHA 1NBOA 2RGEA 2WI8A 2Q4RA 5DHTA 4EA6A 4UJ5A 3U44B 2XA1A 1G8GA 3LPMA 4UAVA 2JD1A 4C03A 2X2PA 3G0DA 3TKYA 1VKJA 2WOOA 2GTIA 1QZ3A 2HCJB 2OSVA 1H2RS 3FFWA 3NZEA 3U4AA 1DBSA 3B3JA 1FU7A 1ZESA 3QWBA 4FFBA 4U8HA 3VYTB 2QL7A 4PW0A 1IQRA 2BFOA 1IOLA 3BZBA 3IPYA 2QZ4A 3OG9A 2R11A 5IXJA 2ZUEA 1O5TA 1D4AA 1UM9A 4AYXA 5CVCA 4QDJA 1H69A 3D3JA 3NBFA 3ZWXA 4MS1A 1M2VB 2WSYB 1MO4A 2VJLA 3FMFA 3FYDA 4UUNA 4C0JA 4MULA 1PT9A 1YKGA 3P8ZA 4ARAA 3TVTA 5CA0A 2XEDA 4G0NA 3V8PA 4M9UA 3GLGB 1PWYE 4LZWA 1FS6A 2QD5A 1XLVA 2QYOA 2W6OA 8OHMA 4UCFA 5K05A 2C9CA 2WJYA 1KI9A 3REQB 3ZE9A 3UGKA 2FWMX 2JI8A 3FYUC 2HCTA 1XQVA 1ZH4A 3G9TA 3IILA 2FZVA 1NF9A 2KSQA 4LMPA 3TSWA 2GLTA 4YRZA 4ESHA 3W2GA 3QYJA 4XLLA 3QU5A 3UK0A 1NLMA 5ALXA 2ATXA 3NDJA 1W1UA 2ERXA 3GZTB 1R6BX 4HBZA 5E1BA 2IOFA 1FU4A 1E9SA 1SMKA 1P0QA 1E1YA 3HUUA 1AN9A 3THYA 4BFLA 3WQHA 1Y82A 3GGJA 1N9KA 1PAUA 2Q28A 3B1YA 4H9GA 1XDBA 1ESMA 2RKWA 4PO9A 3JPYA 3UBMA 4GICA 1X80B 2XI4A 3LT2A 2JDIA 1Z4PX 5A6SB 5TY0A 4DW8A 4CKCA 1JEQB 1NF8A 3FPGA 3PVSA 2A9VA 3K6SB 4DUYB 4ARBA 1ESEA 1TCBA 4WXEA 4C4YA 3LHSA 1RJFA 4E5YA 3QUTA 1L0BA 1P7VA 1YA4A 4US2R 3QXHA 5I9LA 2PV7A 3RKSA 5BT8A 2JARA 1Z0AA 3HM9A 1D8AA 2V03A 3AF5A 3PD1A 2XTJA 4O3MA 3BWEA 4CE6A 1E66A 5DBIA 5LMCA 1HE2A 5IRCD 1D4OA 2W2KB 4N65A 1NURA 4R8MA 3VPSA 3W3AH 3FYUA 1CULC 3GT7A 2YXEA 4MROA 5KINB 1Q0RA 1TW3A 3DWFA 3IV6A 1MEEA 1IL0A 3JWIA 2GWRA 1RZUA 2NVOA 2YXPX 2O0MA 4CTOA 1ADGA 2YHUA 4QXMA 1NNUA 2VNJA 3HYRA 4F45A 1Z6XA 3T34A 3PQ8A 2NXWA 1IN1A 1JHAA 3JQEA 2EC5A 1BXRB 3DDUA 1LLFA 5DX0A 5K0LA 4CR6A 1CY1A 4OFBA 3IVAA 4WTOA 3EVFA 2V97A 2ZKLA 4WN3A 5HCUA 5EUMA 1JTFA 1LD3A 1GTRA 3U19A 1QZZA 1T8TA 2EIXA 3GG9A 4D4KA 5BNWA 5JTTA 4HVCA 3EFOA 1L5WA 3ZWCA 1VE3A 2PMKA 3IKJA 1PDVA 4LNUA 3QVXA 4WNYA 4IOLA 3C3XA 4Z4IA 4EHJA 3DSRA 2UUPA 4FONA 1M33A 4H1HA 3LVFO 4PNPA 4MUHA 1ZAKA 4XARA 3EEIA 1BHSA 3B8EA 1A5ZA 5IAJA 4IXNA 3GELA 3WLIA 4E5SA 1RE1A 4FKMA 4KTVE 3F1KA 4TYMA 4C2AA 4PSKA 3FI0A 4I55F 3GMDA 1O03A 1VMAA 1VLQA 1L5KA 4DLVA 4NPCA 2GPTA 4IVNA 1PV4A 2XUDA 1GZHB 2IY8A 1KDPA 2OY0A 2XYRA 3N8IA 2X1VA 4N48A 2C4NA 2IZ7A 3FOCA 1F1JA 1GYQA 3GXOA 3LZCA 4MEAA 3PGJA 3RVRA 5B7PA 1CJKC 3ZLTA 4HDSB 3F6PA 3GH3A 1OT5A 2AE1A 3WV5A 2HFKA 4TLDA