4DZZA

Structure of parf-adp, crystal form 1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Plasmid partitioning protein ParF
total genus 70
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dzzA00
5EXSA 1YZGA 1G64A 2IYQA 4KLNA 3R8FA 1TL7C 2A5DA 5FPKA 3OF5A 4A2PA 2IA5A 2XX3A 4AKEA 5TB5A 2G9NA 4ZIRB 2QBYA 1W36B 2YWGA 1J8YF 4DLRA 4BLPA 1W36D 1HT2E 1A7JA 1GL6A 3KTAA 2LKCA 3UATA 2XEXA 3FWYA 2VP9A 4S2EA 3IIJA 1AK2A 1E2MA 1N2CE 1DADA 2FN4A 1XJCA 4HATA 2CVFA 3ZD6A 4CVNA 4HAXA 2QRNA 4DDWA 1Y63A 3KB1A 4Z1MA 4JLJA 3ZZ0A 4OHZA 4BFWA 2GBLA 2VP5A 3IHWA 2ZS7A 4V0ME 3C16C 1K5DA 3C5CA 1KO8A 3B1YA 1OIWA 1T3HA 3FB4A 4KFRA 4K81B 2ZXUA 4ESHA 2CCGA 1S2MA 1FNNA 1G5PA 2F43B 2V54A 4IHQA 1KIMA 2AFIE 2P3SA 2VSFA 4Q4HB 2OEPA 1TPZA 4PAOA 5J4HA 1OHHD 3NG1A 3NTUA 1D5CA 3OE7A 1PLJA 4JVNA 5FPYA 1B0UA 5AJZA 4WA7A 2RGEA 2FE4A 4FN5A 1ZYUA 3LD9A 1JQJC 5H1YA 5FR2A 2OBLA 3SYLA 5JJKA 3R20A 3TUIC 3IKJA 3RRZA 1COWD 2HF8A 3NDBB 3U44B 3RABA 1ZM7A 1KSGA 2QAGA 1JJVA 2ZAMA 5AK0A 4Q1DA 1AS3A 3QF4B 1ZIPA 4IOLA 3KB2A 4PSKA 2VHJA 5TXGA 5J4VA 4JLNA 3EASA 1N25A 2CL6X 3FMIA 3D6TB 3V4RA 1ZMXA 5KSPA 2ZR7A 2VL7A 1KDOA 2IWRA 3E70C 3F3YA 2HYIC 1NF3A 2V1XA 3IHLA 3VKGA 4OQMA 1SVSA 2A5YB 1G7SA 4Q18A 4GL2A 4FMDB 2JJ1D 3K0FB 5L8VA 2W6JD 3TSZA 2QG6A 3CH4B 4BUJA 1M74A 1II8B 3W3ZB 4JLBA 4Q66C 4ABYA 2ZRHA 1A2KC 3QOFA 3UANA 2IHYA 1LNZA 1GILA 3VHXA 3OAAA 3LLUA 3ZZUA 4D4JA 521PA 4Q1FA 4XSHA 1ZIOA 3K0FA 2ZI5A 1Q21A 2R6GA 1NVWQ 4RD0A 1UBEA 3L0PA 1FX0A 4PZZA 2QT1A 1Z22A 2EQBA 3D7MA 3RSLA 2ZI4A 1XEFA 2ZE6A 2HLDA 1I4LD 2EU8A 4BZPA 3CBQA 4RVCA 4FINA 1BYUA 2OM2A 4ILEA 5FFMA 2GETA 2ZSBA 1CKEA 5FBQB 3RS7A 4FMCF 2Q3FA 1J7KA 4TQUS 4HEJA 1RC8A 1VTKA 2DWOA 3PIRA 4D2IA 2BBTA 3U2QA 2DPXA 2TMKA 4A36A 1FNMA 1WA5A 3U4QB 1Z08A 4MGZR 2FG5A 3UWKA 1S96A 4JJKA 2X77A 1PV4A 1CXZA 5GJWC 4EPVA 4M2LA 2OZEA 2GXUA 1X3SA 2KI5A 3EA0A 1PZNA 1M7GA 2ORWA 1TU4A 4BFYA 3KFXA 2C78A 2JJ2D 2ASEA 3LXRA 1OFIA 1IJFA 2FSGA 2JATA 4YONB 3WY9A 3U7FB 3LAWA 4KVGA 1TU3A 2J5XA 4OJKA 5J47A 2FMXA 2KBEA 3K0AA 4FMBB 5FH9A 5FUYA 1TUIA 4YMSA 3QBVA 3RAPR 3F0TA 2ORVA 2X8AA 3BFVA 3W3AA 2EFGA 1GL9B 3BB4A 4IW3B 3SFZA 1T5IA 4YDHB 2ZQ5A 3R9IA 4DLXA 4H1UA 2HDNB 2ZITA 1G3RA 1XTIA 1YKSA 2XITA 3VTKA 5CIWA 4QRHA 1OSNA 3G82C 4G1UC 3UK6A 1HQCA 3UMFA 2CBZA 2QMUA 2RHDA 3H1TA 2GCPA 4M1YA 4UKDA 4CEJB 2W2XA 3OAAD 4H1VA 1NL3A 4Y0AA 5E95A 1S9DA 3THXB 4LY6A 5SZHB 2D62A 3VR3A 4LJ5A 1T9HA 1D2MA 1UM8A 1J2JA 2GJ9A 4OHXA 2DYKA 2GEVA 4A8JA 4DSUA 5GJCA 3T1QA 1M34E 1E9BA 3PUVA 1HQYE 2FF7A 1AJEA 3NBZC 3U61B 3CH5A 1UBFA 1CJKC 1CR2A 1EX7A 5HKKD 1ANKA 1RRPA 1YHNA 2CLCX 2VTKA 1LVGA 5AR1A 1KY2A 2J46A 2FPMA 5FOTA 5TY0A 3FKSD 3QQ5A 1GZSA 1OHHA 4M9SA 2ZROA 4MDEA 1Q1ZA 2NO0A 3DZ8A 3B9QA 1G1MA 3SBDA 1ZM9A 2QNRA 2WAYA 1VCOA 3F5FA 4JKIA 4I1VA 4B43A 1G41A 2G77B 4QGFA 5J4LA 1NSTA 2Z4RA 4P32A 4YC7A 3R7WA 3AF3A 1SXJD 3VR5A 1KO1A 4XH9B 4FCVA 1Q1BA 3VKWA 2JJ2A 4QGHA 4QC2A 2OXCA 1ZM4A 4PSVA 1CF4A 4M1TA 5L3VA 1KI6B 2VSOA 3A1VA 2B21A 2RGXA 4LBVA 4Q4JB 1OB5A 2MSDB 1E79A 4G5OA 1TF7A 1A1VA 1AN0A 5FI0B 2F1RA 2V55B 4WXPA 4ON9A 1QG4A 4Q7LA 2P5TB 3BB1A 4NCHA 1NVXQ 2CE7A 4XOIA 1NN1A 3EZ7A 3R9WA 3TGPA 1YZLA 5KDOA 1RRCA 3H86A 2GESA 3L82B 1XFAA 2ODNA 1B23P 1ZNXA 4GZLA 1G291 2GCNA 1K6MA 4MYUA 2JJ8A 3QPUA 2OCBA 4Q4LA 5KPDA 2H1LA 2ATVA 1OYYA 2ZUDA 1RKBA 1JPJA 2ZRFA 3B1ZA 3EZFA 3QXHA 2I1VB 4I1OA 4LCBA 4OI4A 2YWFA 2ZE7A 3GLGE 1HUQA 3L8ZA 2IEYA 4LBZA 1MV5A 1U9IC 1ZM3A 4WXRA 1MH1A 1V5WA 5HE9A 1YRBA 5E7JA 2ZI7A 3NEYA 1W4AA 4XJXA 1KI7A 3NBFA 2EWVA 1WE2A 1U90A 2P2LA 4DWJA 3BIFA 4HAUA 1W7AA 3ZJYA 1Z29A 1OPXA 4RD2A 1T5LA 3O47A 3W34A 3AVTA 4M1WA 4HZIA 1VG9B 4D0GA 2C04A 4TMKA 1E2FA 3T5DA 2YC4C 1YZNA 4EFMA 4X8HA 3E1SA 2ONJA 3K09A 3OIYA 2ZYVX 1W2GA 2J9RA 1E0JA 4NH0A 4PO9A 1YZTA 1KGDA 2JLRA 4PAQA 2JEOA 1NMYA 4JBXA 5KSOA 2WWWA 3GCGA 1AZSC 2PMDA 1L2TA 4LV8B 5JEEA 4B73A 4TL8A 4UJ3A 4BZXA 5IK2D 3PR1A 1G8FA 1W47A 2WPDD 4QBGB 2D06A 1FQKA 4EPWA 1E3MA 3SOPA 4RFVA 5BYJA 1KK3A 2JDIA 5BYKA 1AQUA 4QNRA 5KTYA 2F55A 3HYTA 3WMFA 3U5ZB 5FL7D 2JLSA 1DELA 1CR0A 1OH8A 2RGNC 2RGCA 4O0MA 4GOJA 1TX4B 1ZM2A 3KKNA 4M8NE 2V7QD 2W6ID 4B3GA 4MKHA 5DN6D 3AGPA 3SQXA 4AURA 3I8SA 5JHHB 2J41A 1XCGB 3D8BA 2XTZA 3LFUA 3K9HA 4HAVA 3CPHA 2X19A 4BASA 1E79D 3A8TA 1P2UA 4PANA 2D74A 3U7GA 1Q1EA 4G01B 4RZ2A 3T1TA 1PLKA 1KSFX 3WYFA 1QHHA 3FKQA 1XZPA 4Q4HA 3R9XA 5CM9C 2ZYTX 2V6JA 1Z0KA 5KOYA 1H8ED 1QVRA 1MO4A 1GL7A 3FHOA 1OLOA 4QJ3A 1SKQA 4P4SA 2J0UA 5DYGA 3LXXA 2ZRDA 1KMQA 3CONA 1U98A 1NN3A 3EPLA 1DBSA 3AF0A 1G19A 4NONA 2FU5C 2PCJA 1D2EA 1U0LA 1WMSA 5AUNB 2V1UA 4MH0R 1E9FA 3SBEA 1CEEA 3KTAB 2VSXA 1QG2A 2HUPA 5JSZA 3C7KA 3DPUA 4DLTA 1TEXA 4C7OB 2BKUA 2BJWA 4UXHA 4HAWA 4LV5B 2OAQ1 4PPNA 1KY3A 4OL0A 2QMOA 4W7SA 3PEWA 3HYRA 3IPYA 3NHAA 2NQ2C 2A7QA 2OBNA 5DHAA 2O8FB 3BE4A 2DR3A 4AG5A 2RMKA 5EZ6B 2GZHA 1U94A 2KJQA 1D9XA 4H9GA 4DSNA 2ZI9A 3RS2A 4AYXA 3GD7A 4KSBA 1ESNA 1F5NA 2ZIAA 4ASUA 1KAGA 1G8GA 1BH2A 1P3JA 3HWSA 3ONWA 4JT4A 4LK2A 4P0TA 2EYUA 4G5GA 2ORIA 5JJLA 1WBDA 1N6PA 1LY1A 1KYIA 4Q47A 3LVQE 5KU1A 4TYYA 2J0VA 3B60A 1Q57A 2XJ9A 3EC1A 3Q8XB 3KDSE 4PHHA 3DO6A 2B7BA 4IOMA 3AP3A 4URWR 2AL7A 3KQHA 2CL7X 4MYCA 1AIPA 3EIEA 1G3UA 2AR7A 1XXHB 2WJIA 1DVRA 2NIPA 2ZETA 2PMKA 3NVAA 1EFRA 1DAHA 1EFTA 3CR7A 1RE0A 3I32A 3NH6A 4UNSA 2PT7A 5JI2E 3RVBA 2OT3B 3I62A 1E99A 4P33A 1E2HA 5L3SA 4W5WA 3KJHA 4BFXA 1P2VA 4JT2A 3WYAA 4P31A 1AGRA 4JIMA 1G4AE 3ASZA 2NPIA 4YMWA 3OEHD 1R5NA 1SVMA 1SVLA 1XRJA 4NPHA 3ICQB 1ZU5A 5DO9A 2GVDC 4P4UA 1WB9A 3SI7A 1ZW6A 4MUAA 2PX0A 3NC1C 3K0CC 1OFUX 3BH7A 3IILA 4PXAA 2HF9A 2EFEB 5G3YA 1E1QD 1FTNA 4Q1CA 1Z0AA 3BWDD 2E87A 5CJ2A 2FPKA 4DLSA 2R8RA 1DAKA 1KI8A 1LFDB 3QG5A 1ZCBA 4TT3A 4C4PA 3T06B 3SNHA 1ONBA 2ZRKA 2ZAOA 3DKVA 3DKPA 4IDOA 1VDZA 3DMNA 4W5JA 5HCIA 3SS8A 4ARZA 2P5SA 1KMHB 1CULC 1ZRHA 3TSWA 3N5CA 1W0JD 3VU9A 4HSEA 2QPTA 1BMFA 3PFIA 4NYIQ 1VHTA 1NI3A 2CJWB 4HUTA 3P1JA 2GJKA 3LV8A 4V02A 3GEEA 1YZKA 2H18A 1I2DA 4B32A 4ARZB 4HB0A 1II9A 1S3SA 2A78A 2W2VA 5KO2A 4ASUD 1JQLB 1E9EA 3I8XA 1PUIA 3LBNA 4WIAA 1R0YA 2Q3HA 1AKYA 3KJEA 1EFRD 3I72A 1Z6TA 3H84A 1N6LA 4B6FA 2DBYA 5FUXA 1KI3A 2R6DA 4KHZA 1OH7A 3AVVA 2E9SA 4B2IA 2IF2A 3T1OA 1S4QA 2EFHB 2RKOA 5DISB 2IXFA 5JBQA 1GNPA 1YJ5A 1ZD1A 5C18A 3TMKA 1JJ7A 1SZPA 2NOAA 2V8OA 2ODBA 4Q02A 2ZRIA 4J0QA 4PZYA 5DH9A 4QHYA 1X1SA 3TNFA 2W83A 1QHIA 2B6HA 1KJYA 2XGJA 2WOJA 3AKCA 4OK5A 4AK9A 4B3BA 4KFSA 3B5JA 3MWYW 3WNDA 4DCTA 2ERYA 1FUKA 4TLBA 1NSFA 2B92A 1CJMA 4JVMA 4LRWA 3W9YA 4A8JC 1YQTA 3OEEA 4PTLA 1RPZA 3NXSA 4C0SA 1NVVR 2WMOB 2AD5A 5EP2A 5FTMA 1ZC3A 2QP9X 3KQNA 3UMSA 1M6NA 5AJYA 4A9AA 1RJ9A 4BPBA 2H7VA 1ZNZA 4YMTA 2BBOA 4B2PA 4MKIA 5DIFA 2IYSA 5HPYB 4HLUA 3PENA 3Q5EA 1TTTA 5CB8A 2VH5R 5C4GB 5E3HA 3AKEA 1OXUA 2RH5A 1CBUA 3JZMA 2GXSA 4GT1A 5CK4A 4XSGA 3QIAA 4EJSB 5CLQA 4E03A 5ELXA 1XZQA 1VHLA 3QKRA 721PA 1EX6A 1XD2A 4NHOA 4KITB 4IOKA 2NZJA 5JFGA 3PCRB 2Q6TA 5E7MA 1N6IA 5B2ZA 4K8OA 4DCVA 1VG8A 4F4IA 3O8RA 2O52A 3NHBA 4LI0A 4NBSA 5SZIA 3Q7PA 1SXJB 3NEJA 3K0AB 3L8YA 2Y8EA 5BW8A 4Z54A 2QP3A 4MDFA 2VPPA 4XWAA 3V9PA 3W8NA 2QQEA 3CB4A 4DB2A 3AKDA 5JWRA 1HA3A 4LJ8A 4KV9A 2GAAA 4Z8YA 2IXEA 5ANRB 1YZQA 2QAGB 4U02A 3IEUA 4M53A 2QENA 1XU4A 1DO2A 2QPOA 3AF2A 3FE2A 4EFNA 4DEXA 2ZJ2A 4PAMA 4RY2A 2B7CA 2EFDB 5LD2C 3ZIAA 1OFTA 4PHGA 3QXCA 1A5TA 3BAFA 3ADBA 2QROA 3N2IA 1CJUC 2YNMA 3A36A 4CZ2A 5CITA 1G5RA 2V9PA 4LJ4A 3UKDA 4CW7A 4QBHA 1NBMD 2GKSA 3QXJA 2ZREA 4D25A 2RGGA 4NP6A 1CR4A 4M9QA 4HDQB 4L4UA 2XNDD 3FPAA 1NJFA 2MMCA 4BQSA 2R65A 5EXPA 2BBWA 4IEEA 4TL6A 4B48A 1R6BX 1JPNA 4TSFA 2VEDA 2XZOA 3C15C 2F43A 3THXA 1QVAA 5EQTA 3GLFA 4II7A 2QZ4A 3TBKA 2NO6A 3H4MA 4ZO4A 3TQCA 1D6JA 2FFHA 2R44A 3DM9B 3KL4A 3TIFA 4JLVA 3X1YA 2D7DA 3SJCA 1G9XA 4FCWA 4RKEA 5FOSA 3I5YA 5UKDA 4A2WA 4A0RA 3ADKA 1F2TA 1EG7A 2QEQA 4TLCA 3SHFA 2DFTA 221PA 1J70A 2WKQA 3TAUA 3RS0A 5DNYB 1TQ6A 2FSIA 1FZQA 2VHTA 1BMFD 2KBFA 2DWPA 4Y0VA 2J0SA 4Z51A 1XJ0A 5JS8A 2REBA 4PX9A 1FP7A 1XTJA 3UWOA 3QI2A 3V4FA 3DM5A 3GJ0A 1NLYA 3NDPA 1Q3TA 4M0LA 1QDEA 5EUQB 2IS4A 3VX3A 3G5UA 4XVUA 2ZE8A 3EARA 1JNYA 2P65A 4TMXA 4CYMA 1QHSA 3FMOB 4GOKA 2QI9C 1W0JA 3IO5A 1J8MF 4IRUB 4EIWA 4LZZA 1L7VC 4Q01A 2N42A 3P4YA 3KXIA 2DY1A 4NYMR 4RFSB 2PH1A 2BWJA 3DVLA 3BH0A 4QXAA 4ZCMA 3LQQA 2BC9A 2D7CA 4KU4A 3M4YA 3ZGXA 3A6PC 3UMRA 5J4KA 5FPHA 4KYUA 4EQ6A 5F98A 1P75A 2RB4A 4MRRA 3T35A 3E2IA 1TADA 4D0LB 1XEWY 1KO5A 3MAAC 1IXZA 3GLIA 1UADA 3VHLB 4ZDJA 8OHMA 2DFLA 3C8UA 4LHYA 3THOA 3ZS8A 3QKSB 3AP2A 5DSZA 3KQLA 3T61A 2YWEA 2QP4A 3A1SA 3VMFA 4YXWA 3TJZA 2KB0A 1YR8A 3UXMA 1NN0A 1M1YE 2RGDA 2HEIA 4DSOA 2VP2A 4G5SA 4TQ9A 5K8LA 3GLIB 3I1FA 3KXKA 5F2EA 3QE0A 4C7OA 3K0SA 3K0CA 5M04A 2OCPA 4YLGA 5JLJA 3MWKA 1OB2A 2QM8A 3BERA 4B33A 1GKIA 1AKEA 1NIPA 3NC0C 1X8JA 4DSTA 3EG5A 5AJWA 3SEAA 3GEIA 3B13B 1FQJA 4V0MA 4URVR 2HCJB 4AC9A 4BFVA 4B3FX 2BJVA 2PL3A 4JLDA 1QHGA 3KUDA 4V03A 4MA4A 4TYPA 4F91B 3N2EA 3AV0B 1DG3A 1Z8FA 3THWA 4URXR 4YMVA 2EVWX 3REFA 5C46F 4Z8XA 4LJYA 2AK2A 3CF2A 3IIKA 2IK8A 4G5QA 5C1BA 3CF0A 4Q19A 3CUEF 4N1AA 1DAEA 1E98A 1OF1A 2WJVA 1S9HA 3PQCA 1XPUA 1D8TA 3KFVA 4OQLA 3SJAA 3KUCA 1SKYB 1SVIA 1BKDR 4B75A 1KJZA 1Z5ZA 4NU0A 2REOA 1AQYA 2WAXA 2R6CA 4QM7A 5IT5A 2VRWA 1IN7A 1KHTA 2RAPA 5EXTA 3AM1A 3MCAA 4ZCLA 2GJSA 1G16A 4Q9HA 4LPKA 4OK6A 4WW0A 1TEVA 3EWSA 1F2TB 3IO3A 3AVXA 2R9VA 4V0OA 1HY3A 1NP6A 4DRZA 3VNUA 1T3LA 4U5XA 2BMDA 1W4BA 2QMHA 1AZTA 2WJYA 2NPFA 3X1ZA 4C0KA 1W1WA 3TE6A 3WNBA 5DN6A 2ZANA 1QBKC 2MMGA 2Q0HA 2ZVQX 4I99A 1JEDA 2PZEA 1R0ZA 1VG1A 2LKDA 3Q5DA 4JKYA 4KLZA 2XJ4A 2A9KA 2GA8A 3HPQA 2AX4A 4HUQA 4NE2A 3VAAA 4ZIRA 5JZVA 3I3SR 4LX0A 1TQDA 1DARA 2QGZA 1E2PA 1KZGB 3GP8A 4KBFA 5TARA 1F6BA 1UKZA 2Q9BA 4NCKA 5B64A 5JCPA 2YV5A 4KI0A 4WZBE 2J1LA 3SFVA 1P2SA 2IYWA 3CM0A 3K9LA 1H8EA 3CW2A 4C0QC 4P4SB 4JL5A 2DFNA 4NYMQ 3JVUA 2O8CB 4IDQA 4NTZA 2IYTA 4RFSA 1GOTA 3CX6A 1P73A 4FD2A 2Q21A 1OFHA 3THYA 1V43A 5DLQC 4CIDA 1CS4C 5P21A 1NY6A 1P60A 3WP0A 1Z6YA 3RS5A 3BB3A 3CX8A 1Z0FA 4L5BA 4HDOB 2C5LA 4IDNA 1VPLA 4R71A 2FJUA 4E09A 2ZRJA 5CYOA 1N5KA 3CO5A 1TF5A 2VYFA 3IIMA 2IYVA 1KI6A 1A4RA 2DHRA 1E6CA 3VR4A 3ADCA 4RJLA 1E2JA 1R2QA 4B44A 2GEUA 3MUFA 4BZQA 4LHZA 3L0SA 3QNUA 1SXJC 2YHSA 4LC1A 2BCGY 4C0BA 3FMFA 3HPRA 4GOXA 3KXLA 1Q3HA 1KJWA 1NVUQ 1QHYA 3D3QA 3LX5A 2WZQA 3B9PA 5J40A 4FCTA 1NG1A 4X8LA 4BEBA 1HH4A 1SHKA 2FSFA 3LBHA 3PEVA 4UXJA 3LQRA 5EZ5A 5HR5A 4FMDF 1AM4D 1IBRA 1TMKA 3IUYA 2OG2A 2PJZA 1L4UA 1M2OB 1PVOA 4GNKA 2RHMA 3EIHA 4O2LA 5FTKA 3RS4A 4BFTA 2EFCB 2FSHA 3LA6A 4MRSA 3CLVA 3MFYA 5JHGB 4C2TA 4HDCA 1WP9A 1KO4A 4NYIR 3BD9A 5HTKA 4L16A 2BBSA 2K5UA 3A58B 2WBLC 4QG7A 1GKUB 2QA5A 3FMPB 3X1WA 2PZFA 3RLFA 3QVUA 3U44A 2OAP1 4EPYA 1A2BA 5IK2A 3AP1A 4AYTA 2F1IA 3B8HA 2P67A 1YU9A 2GBLC 5TMPA 2CHVA 2I3BA 1GDDA 2QQ0A 3KKPA 3ZZTA 3CIOA 1IQPA 1XEXA 4PPFA 1VKJA 4UJ5A 2JLUA 3U60B 4BEJA 1ZCAA 5A4JA 1II0A 2WV9A 4MUBA 4C9BA 3A1TA 3HU2A 4TSFD 1AS0A 2ZJ8A 3PUXA 4JJZA 4MRNA 5KDLA 1GUAA 4AKGA 3NBYC 1DAFA 3RC8A 1GFIA 1Z63A 3NWJA 2JLYA 3L0OA 4YQFA 4C0LA 4XVQA 2ANCA 2YVUA 3HJNA 1CJVC 2G1KA 4C3ZA 2N46A 4OQNA 1NVVQ 3QF7A 4URYR 2QMEA 1OXXK 2F6RA 3Q85A 3U4QA 1IJEA 1VYUA 3CNLA 3TR5A 2QTFA 3P27A 2JGNA 3O8CA 3GLIE 1DE0A 3Q3JB 3FFAA 1XMVA 1I2MA 2QT0A 2ZSAA 3DDCA 4ERNA 1NBME 4POAA 4WVFA 1DEKA 3TUJC 1GKYA 5DE3A 1H65A 1N5JA 2CXXA 3A37A 2OESA 1U8YA 3AGQA 4PO8A 2ZUCA 1T91A 3B1XA 2LWIA 2XOKA 3VR1A 1G4UR 4M1MA 1BIFA 2F3RA 1SHZA 2BHRA 4FIDA 2ZRNA 3R8CA 2IL1A 3Q72A 4XIGS 2C95A 1G3QA 1W46A 2V4ZA 1BS1A 2WWHA 2ZE5A 5H68A 1IONA 1JAIA 3VQTA 1RRGA 1OH6A 4PC6A 1H8HA 4D82A 1E4VA 1T0HB 1U9IA 1IAQA 1J90A 5FBWB 4C0HA 5HE8A 2G1JA 1HEIA 5FBLB 4ZI2A 2KWIA 1R8QA 4WZAE 4I1SA 1IY2A 4D4MA 3QBTA 4PC1A 4RCYA 2XTNA 3IGFA 3TVTA 4M9ZA 4Q48A 1AA9A 3W6PA 1GRRA 2ZUBA 5JRZA 1E2IA 1JAHA 2CJWA 5B58C 3FYHA 1T8TA 5HZKA 2H92A 2IX3A 2CCJA 4UNPA 2NO7A 1C9KA 2QE7A 2IYYA 5BQ5A 5K8IA 3FTQA 5LBIA 1M8PA 4LSGA 4PQYA 1E1RA 4OI0A 1SQ5A 2O8BA 2GCOA 5KSZA 1KSHA 4O25A 2HT1A 1NLZA 4OBEA 2VHCA 2J7PA 1JR6A 3O8DA 2A5GA 2GXAA 1JR3E 2NG1A 2ECKA 3EPKA 3QG1A 4HB4A 3CRRA 3B1WA 3K9GA 3DHWC 3QY0A 4WBSA 1F2UA 2Z0MA 4LDJA 3R7WB 3TW4A 4GP7A 1KO7A 1R5BA 1XXHE 3M6AA 4US0R 3X1XA 4KFTA 1ZUHA 3QKSA 4Q21A 4IVQA 1XCPA 2R6AA 4TL7A 5TVKA 5CYPA 4QGAA 1IHUA 2WHXA 1VCNA 2V3CC 4UNQA 1MRSA 3KQUA 1QHNA 1II8A 4JZKA 3CZQA 4GDFA 2G6BA 3AUXA 2J7KA 3VX4A 3P26A 3ZQJA 1IN5A 4IOJA 3EIQA 1O87A 4IEIA 2WSSA 1FL9A 1Z07A 4JVSB 1BO6A 3WXMA 1G21E 4JLAA 3IBYA 5EP3A 2IEZA 3M1IA 3TRFA 3ND8A 2VO1A 4UXIA 1E96A 2OE2A 2LCFA 4EQ6B 2JLXA 3LY5A 2XSZA 3WBKA 5FTJA 4Q5IA 2F1HA 5HKKA 3QEJA 2IYUA 2W6JA 4C0JA 4MRPA 2CVHA 1JB1A 2CL0X 3K53A 3OIWA 4OI1A 4Q9IA 4AYWA 4DCSA 1EWRA 5TV2A 3PV0A 5H8WA 4N0DA 3EZ6A 1VYTA 3QEOA 4D6PA 1XP8A 2OO7A 4L9SA 4BE7B 2P0EA 3ZLJA 1DAMA 1R0XA 1SVWA 1W36C 1PLLA 1EFUA 2YKGA 4Q9KA 2O5VA 2ZJZA 1KDPA 1R8SA 1F48A 3LO5A 4W5HA 1N3BA 5A0FA 4D4LA 2C96A 2C9OA 3TAHA 1LF5A 3OE7D 4DBLC 2ZJAA 3PITA 2OFXA 4JBWA 4TLEA 3WHKA 2FFQA 4DXAA 4CEIA 2CK3A 3D31A 3JZAA 4R2HA 1OXTA 3EZ2A 3BGWA 4YDSA 4DJTA 1SKYE 1Q12A 2MSEB 2ZJ5A 3B7GA 4DLVA 5BN4A 3OESA 1FUUA 1NN5A 3TSOA 4R98A 2EYQA 1E0KA 4M21A 5FTNA 2C98A 1US8A 1W5TA 4JYBA 3CWQA 1XD2B 4UNRA 2Z5FA 1D9ZA 4MKGA 4PQFA 5FBRB 1HT1E 2CEAA 4QKQA 3GLHA 1T8UA 2CMKA 3VFDA 3Q9LA 4GSYA 5FOWA 4YMUA 2IBMA 4PFSA 4ESVA 1MKYA 5FR1A 1G6HA 3B2EA 3ZVNA 3TQFA 2ZPTX 4B71A 4HI0E 2GF9A 4ZKDA 6Q21A 1P2TA 2ZRMA 2JLZA 1DS6A 5FTLA 2VLIA 1I4TD 1P62B 3IBGA 1VIYA 3B78A 1KAOA 3P4XA 2Q9CA 3H2YA 4G0NA 4GFDA 2BOVA 1P9RA 421PA 2WICA 4LHWA 2AKYA 4PC7A 5IDVA 2JASA 2BVNA 1NG9A 1Q1QA 5BWMA 1WRBA 1BYIA 3VU9B 1X1RA 2O8EB 3QKUA 3REGA 1QHHB 4NKRA 1ZNYA 4GP6A 1XPRA 5H70A 1NMXA 2DWQA 3CKLA 3T34A 1W4RA 4M1OA 1X8KA 4TZ0A 1FMLA 1O3YA 1GRNA 1IY0A 4B6EA 3SU8A 1FPMA 5D3QA 1IM2A 1BOFA 1MRNA 1W2HA 2FZLA 2OCYC 1P5ZB 3SR0A 4TWZA 2XSZD 4IDHA 4QGGA 3UPUA 4RD3A 4CRWB 2F1JA 5EXXA 3SQWA 2YC2C 4Q7KA 2VP4A 4IKEA 4HAZA 1UKEA 2GAOA 2VA8A 3WYGA 3QXSA 3OIUA 2FDCA 4URUR 2OXRA 2YOGA 2O8BB 1FMJA 5K8UA 4QL3A 3GFPA 4DDVA 4NCIA 3QKRB 2QL6A 3WNCA 1XX6A 4QHTA 4Z1MD 1Z3IX 1OIXA 3VKHA 1CJTC 2ZYUX 4HB3A 1Z2CA 3LW8A 1U0HC 3GJ4A 1MABB 3GLGB 2AKAB 1E32A 4KFUA 1SVOA 4RD6A 4IDPA 3S1AA 1VMAA 1UJ2A 4HZUB 2ZJBA 4URZR 1HE1C 1MOZA 5EP1A 3J81k 5FOVA 1GM5A 1TNDA 4DLWA 4DT1A 1OIVA 1KKMA 1VYVA 4XTCS 2DCUA 2OSBA 4AY2A 2QU8A 2JDID 3E5HA 2AHOA 2FFAA 2WIAA 3AVOA 4FXPA 1NMZA 3ND9A 4L15A 2PBRA 3GJ5A 2OLJA 2QSYA 1E2NA 1YR6A 5G41A 4M1KA 5JMTA 3WMGA 4M1SA 4EJSA 3ZH9B 2EWWA 3GJ3A 4HB2A 4KVAA 4BFUA 2HV8A 5EE3A 1OV4A 2PLRA 1JBKA 5BN5A 5L3QB 1LW7A 3GJXC 1G18A 2JCSA 2VQSA 4IFEA 1T4GA 4DUGA 4LJ7A 3OEHA 4U00A 4CT5A 5E4FA 3FHTA 3BFXA 2NZ8A 4KXFB 5GADl 4QHSA 2O8DB 3QENA 2ERXA 5CK5A 1P61B 2ZJOA 1CR1A 4PQRA 5EE9A 4DZZA 4KSCA 3K9NA 1C4OA 3M0EA 4X8OA 4HLDA 2H5EA 4V0KA 2JJ1A 4Q9JA 2O8DA 4XWOA 5LD2B 1ETUA 3A4NA 3NKVA 4EPTA 3ADDA 1XDBA 1GSIA 3LNCA 2GK7A 4GI7A 4Q03A 1DG1G 2VF7A 2RCNA 4IJMA 3HR7A 2XB2A 2GDJA 2HCBA 2X2EA 5EE0A 2FOLA 3B82A 1RYHA 1XMJA 1VCMA 2ZRAA 5TDHA 3LVRE 1XXHA 1Z06A 1E1QA 3KKQA 4OYHA 5J4YA 2H57A 4CT4B 2IF0A 4DCUA 2NMVA 4B3CA 3PXGA 2HXSA 2I4IA 2O0JA 1SXJA 2FV8A 4JBYA 1OH5A 1XTSA 1QHXA 5FL7A 3TUZC 1X86B 1LS1A 1U99A 2D4HA 2F7SA 2G0NA 2PLFA 3MRSA 4M9XA 1SXJE 1LB1B 1KNQA 1UDWA 1ZU4A 5CIQA 4Q9LA 3RANA 4A2QA 1IN8A 3ZQ6A 4QFMA 4RD1A 4LOAA 2QN6A 3TH5A 2OHFA 1E2KA 1KK1A 3F8TA 4X8MA 3AVPA 3SYNA 2C9YA 1E1RD 4CEHB 1EGAA 1ODFA 2WMNB 4TYQA 4F93B 2ZM5A 3ICEA 5DGXA 1WF3A 2J87A 2WVJA 1E94E 4HLCA 3ZVMA 2UKDA 3EAQA 4OQFA 3IEVA 2J59A 2J45A 2AWNA 1GVNB 1JI0A 1E69A 1KZ7B 2V7QA 2C03A 2XB4A 3DOFA 1DTSA 4UNNA 3G0HA 4Q1AA 1OJLA 1Q0UA 1P7CA 3CRVA 2BMJA 1K8RA 4GMXA 2X1VA 3SN6A 3MJRA 4MITA 4NCJA 5K8TA 4OJQA 3ZDQA 3GJ6A 4DUGD 1ELOA 3RS3A 1EFHA 3Q7QA 5FPSA 2WWGA 4B34A 5D3MB 2WJJA 4Q00A 1NRJB 1CRPA 2XZLA 4Q4JA 4NCNA 1N0WA 2O8FA 2HJVA 4QBFA 3AVWA 4TT3D 2HJGA 2ZRPA 3BS4A 4BLOA 3B85A 1G5TA 1TQ2A 1L4YA 2J0QA 1ZAKA 5D3MA 2WKRA 4MQBA 1E9RA 2BDTA 4UQOA 3QSYA 2GEDA 5KNCA 2JIZA 2P6RA 2XXAA 3IQWA 1W4CA 2FH5B 2VHQA 5G3ZA 2W58A 1AGPA 2HT6A 1P9WA 1XNJA 2HYDA 2VF8A 1ESMA 3HU1A 2NO9A 1RFLA 4E5UA 4DHEA 2BMFA 3QKTA 2D2EA 2E1RA 4RZ3A 2IS2A 821PA 4MYTA 4XD7D 2XXAB 1RIFA 3SZRA 3EZ9A 4KODA 4DB4A 5KDDA 4LC0A 4US1R 1G20E 2IYRA 1X6VA 2ZTSA 3RWOA 4BLRA 2CK3D 1NNEA 2ZR9A 2ZU0C 3FGNA 4BLSA 5G40A 2CHQA 3DOEA 1JXOA 4JSTA 3GPLA 3BC1A 1Z47A 4DEYA 3K09C 1N5IA 3PEUA 4Q7MB 3LH5A 1Y3AA 5FL3A 3U3JA 3CZPA 5FUVA 1Z0JA 2UZ3A 1S0UA 1RRFA 1XTKA 4PC2A 2QUZA 5L3SB 4DVGA 2H8KA 3T5GA 2Z6VA 1U8AA 2YZ2A 2IUUA 3OIVA 1W48A 3P20A 4FI3C 1HE8B 1G3MA 2H16A 2FFBA 3AF1A 4FW9A 2XNDA 4US2R 4I1UA 1E2LA 3AVQA 2G88A 5AJVB 5IHPA 4TMZA 4TZ6A 1NIJA 2CE2X 1XWIA 2HXYA 1YR9A 3C41J 3ETLA 5CJPA 5J5CA 4QOSA 3X2SA 4AKIA 1I4DD 4E07A 3T1VA 1IN4A 2CDNA 2VP6A 4MGIR 1M7BA 2JA1A 3BRWD 2FNAA 4DDUA 3HR8A 3LW7A 3FOZA 5EE5B 4IVPA 3TR0A 5FPTA 2ZS9A 4GPTA 1IY1A 4R7ZA 3RRYA 2WWYA 1OKKD 2BEJA 1R10A 4DDTA 1ZUNB 2ZEJA 1UKYA 4JLOA 2QBYB 1KSJA 4GMDA 3PG5A 3THYB 2QTVB 2C99A 1NY5A 3FVQA 1TQ4A 3THWB 4NDZA 2IHBA 3LDAA 3HU3A 2BKEA 2WKPA 1CTQA 1G3IA 4LJ6A 1WCV1 2WWFA 1JEEA 3T12A 5EP4A 5KPJA 2W0MA 1YR7A 1FTSA 1M7HA 1ZJ6A 4MRVA 3RC3A 4A15A 1P4SA 3LBIA 1F2UB 5AWFC 4AD8A 2UVQA 1WBBA 1XF9A 2FEOA 2GRJA 3WHLA 4CEHA 1L8QA 1LF0A 1RVDA 3LWNA 4XVRA 1R4AA 5CM8B 4C0AC 3K1JA 2ZI6A 4KO8A 4MYHA 2IYZA 1IN6A 5KNBA 1XEWX 3K70D 3GLHE 1FOEB 1N6HA 3WMEA 1UBGA 2QAJA 2PT5A 3MMPA 1G17A 4PPGA 5FOXA 2IT1A 1GTVA 5SZKB 2YWHA 4L8GA 4DT1B 4DIDA 4ZPXA 4LBWA 3W8RA 2ATXA 3MLEA 1XTRA 4P4TA 1Q44A 4LGMA 2YJTD 4V0NA 3SHWA 1AS2A 1ZD9A 2ODWA 4IVRA 4NYJR 3CWZA 4LYJA 4KCGA 1ZD8A 3TW8B 2R2AA 4DLZA 2RGNA 3AVYA 1ZNWA 4S35A 1N5LA 5LB2A 1DPFA 4PPQA 3QF4A 5FUWA 3T15A 1N6OA 2QGNA 1QRAA 3AH8A 1E0SA 1JECA 2PEZA 2O8EA 4NYJQ 1IOZA 3PUYA 5EUMA 1OKKA 1GRQA 4XWKA 1PJRA 3QPVA 3S1AB 1DOAA 1GWNA 1Z6AA 3OZXA 4LHXA 2L0XA 5FBVB 1E0AA 4TMTA 3I61A 4JLMA 1CIPA 1E2DA 1E9SA 2P6UA 2F9MA 1D2NA 1NKTA 3AEZA 1E9DA 3OHMA 4MGKR 2JIZD 2FGKA 4IFBA 1OE0A 3FDIA 2PJRA 3BXZA 4RSGA 5KUTA 2GHIA 1MT0A 3NBXX 1MO3A 2CNWD 5LB4A 2OFWA 4ZI3A 3SYKA 2AK3A 3EXAA 1GITA 5L3QA 2WJHA 2AXNA 2IW3A 3ZS9A 4RZXA 3K0EA 4DCNA 5AUPB 2Z43A 4TYNA 3P32A 5HCNA 3KX2A 1G7RA 2FX3A 1CLUA 1UF9A 2JAQA 1XPOA 2ZU6A 2WJGA 3CNOA 4TTQA 4BFSA 4LBYA 2OBMA 4PSAA 3B1VA 2H17A 4DIEA 3CX7A 4QM6A 2G0TA 2ODEA 3CPJB 2ZRGA 2ZYWX 2F3TA 4OK3A 4HZUA 1SVKA 3FKSA 2WSSD 3U3RA 2QM7A 3SE0A 1TUEA 3ECCA 3FFBA 2G3YA 3QJYA 2I1QA 3W5IA 4F4CA 3PJRA 2GNOA 3ZVLA 5C2JB 3KQKA 3CRMA 4TYWA 2ZSFA 1EXMA 1TF2A 2BIFA 4BLTA 1Q22A 2R62A 1LV7A 3CRW1 1IXSB 4M22A 3MGCA 4PHFA 1US8B 1HURA 3ZIAD 2DFKB 1E2QA 1F3OA 1UFQA 3WBJA 1T6NA 1Z2AA 1F60A 1ZINA 5JECA 3UIEA 4WAUA 5KSYA 2VHUA 1N6NA 2Q9AA 2OFOA 1FX0B 4Q4AB 4MKFA 1KMHA 4WOPA 4HYYA 3C5HA 4G5RA 4TLAA 3GMTA 1G8PA 3OEED 3FHCB 4KAXA 4LPSA 4TN1A 5L3RA 5FOUA 4BRWA 4QBIA 3MWLA 1N0UA 1YRAA 1DAGA 3I92A 3SJZA 3V00A 5F9HA 1XEXB 4OHYA 4ZV4A 4Q4AA 3RRNA 3KKMA 4BRUA 3IPXA 4QJ5A 3ZD7A 4P3YA 4NL4H 2JLWA 1P9NA 3AQ4A 3CF6R 4OI2A 2V6IA 4CEJA 1MO6A 4HUQB 2IC5A 2NTYC 3MD0A 2IS1A 4BECA 4ZKEA 2FA9A 4NZYA 4DLYA 2AD1A 3GEHA 2W00A 1UEIA 4KBGA 4LYFA 4EFLA 1R5OA 2BM1A 1EWQA 1COWA 5BN3A 4JL8A 5JS7A 2PZGA 3EPHA 3U3KA 1NLFA 1S3GA 1Z0IA 3WRYC 4PO1A 5CDFE 3BJIC 3U3MA 1N6KA 4GZMA 1TAGA 4QJ4A 5EJEA 1EESA 5JI3E 4AG6A 3SC3A 1XJQA 2C2HA 4AIIA 2CNWA 2VIIA 1R0WA 4R2IA 4EJSC 3TVDA 1RYFA 1GAJA 1GNQA 2B8TA 2G83A 1G8HA 5DI3B 5EE1A 5C4MA 5LDDC 1ZP6A 2BCJQ 4B3XA 2AXPA 3U6BA 3SDZA 4ZDKA 4XTRA 1LTQA 3MG9A 4JLKA 3W6OA 5GJVC 4HLUC 1RJ9B 1XCMA 3BBPA 4M4SA 3KKOA 4TTPA 3I4LA 3GLFE 2ZRBA 4O2RA 2WPDA 3QPWA 5AJXA 2GVZC 2J3EA 1U2RA 5A5GA 4PHTA 2O8CA 1U81A 4LYHA 1XBTA 2ZJYA 5JEDA 2GXQA 4JYCA 4TL9A 1HV8A 3ASYA 5JCZA 3K70C 1VG0B 2FZ4A 3I73A 2O0KA 1E9CA 1UBCA 2IYXA 2ZR0A 3EPJA 2GCOB 4JVLA 4BGDA 4JSYA 3W6NA 2GK6A 4OHWA 1OXSC 1NBMA 1DO0A 2HLDD 4B35A 1G7CA 2PX3A 2CHGA 4DLUA 5JWHA 5E7IA 4ITRC 4RD4A 3QVVA 2ZI3A 4MGYR 1E4YA 2ZVPX 2RGBA 4IXNA 3RHFA 3ZYCA 4CDGA 1W0KD 4R9UC 4I4LA 1GG2A 1S1CA 3OFND 3PUZA 3GQBA 1QZXA 4V0LA 4LYAA 4BLQA 3VR6A 3BFKA 2Q3MA 3VR2A 1YZUA 2QSZA 4L9WA 2QRZA 4FWTA 1DAIA 1KK0A 1W0KA 2A30A 2VP0A 5KHOC 2D3WA 4DKXA 3U3OA 2WOOA 1E2GA 3BH6A 3BORA 3O8BA 1XB2A 4LUCA 3SJBA 2OCAA 4C2UA 4EKDA 2B8WA 4A0GA 1S1MA 4B76A 4YXWD 1CU1A 3AKYA 1FW6A 4B74A 2Z83A 1OW3B 4BWYA 3GJ7A 3ZVRA 1GIAA 3QXXA 3B6EA 1KDRA 3UG7A 4GRAA 1RW4A 3L43A 4G3XA 2CLSA 5SZJA 2PCLA 1GP2A 4D81A 4QNMA 1VECA 2XTMA 2W2TA 4A1FA 1EFCA 5LPNA 1IXRC 621PA 1UEJA 5IRCD 5GJBA 1XMSA 4HAYA 1W5SA 2WWIA 3C14C 5B30A 1MR3F 1KOFA 2VBCA 1CRQA 4LHVA 4OQXA 5B57C 3IQXA 3RWMB 1WDTA 1C1YA 2Z4SA 3WP1B 1T0JB 4OHVA 1YE8A 1KTVA 4ZDIA 3I5XA 4OKSA 3LLMA 3KJGA 1NKSA 2IUTA 1XMIA 2C77A 3GLFB 1U8ZA 1VIAA 4JMPA 3MWJA 2A2ZA 2AWOA 2XZPA 2WSMA 4EPXA 1VCIA 1UAAA 2GZDA 2JLVA 2W0SA 4A0FA 4F7WA 1XD9A 2IS6A 3W5JA 5GVSA 1WXQA 3LX8A 4W9MC 3GFOA 1K5GA 1Q20A 1Z83A 2GILA 2GJ8A 2ZRCA 1KI1A 4F92B 3K8YA 3KZ1E 5FI1B 3L0IB 2NO1A 3GJ8A 4A8JB 3PEYA 5G53C 2GTPA 1GNRA 2BM0A 3UG6A 4A0HA 4D0NA 5KNDA 5DI3A 2PEYA 4D80A 2ONKA 2CLDX 4A6PA 4A4DA 1OXVA 1KK2A 4LV6A 2QE7D 5BXQC 1H8HD 4JLPA 3GFTA 4TLDA 1P6XA 5CDFA 4U7DA 3OFNA 2IUSA 4RCZA 1R7RA 121PA 2J7PD 4A92A 5HZHA 1EK0A 4DC9A 1KI2A 2QORA 3JVVA 1MO5A 4Q7JB 1J99A 3U6KA 4AKHA 2BEKA 4BFZA 3TK1A 2ZRLA 4B2LA 2XAUA 3CR8A 4FMCB 2FPLA 3EC2A 1G8YA 4A82A 2YYZA 1ZBDA 4RZUA 2JLQA 2GWHA 1G7TA 3A1WA 1QF9A 1W44A 4CF7A 1WQ1R 2KSQA 4KJZA 3WRXC 1KKLA 1ZUIA 4JS0A 2CCKA 4N0EA 4ZDWA 2OLKA 3EW9A 2FGJA 3TKLA 2AFHE 3DL0A 3HDTA 1LS6A 1JXMA 2P6NA 5DI9A 4I81A 2AN9A 3EA5A 2SHKA 3BOSA 3TLXA 2IWHA 1UKVY 2J0UB 4LWZA 1Z6XA 2X2FA 2OILA 1JALA 1XTQA 3MSXA 4Q1BA 3PVSA 5DYIA 3C4JA 5CB6A 2NGRA 3RNLA 4B3DA 4B47A 3VNVA 1KI9A 1UPTA 2ANBA 2IYLD 2KE5A 2OV2A 3HP1A 4A6XA 5AUQA 5IF9A 3CPEA 4EAQA 1MABA 3GLGA 1P72A 3AUYA 5JSZB 2WTUA 1N6RA 4PC3A 5KYKA 3AB3A 2XNSA 2RGAA 2YINC 2D2FA 2QTHA 1NJGA 1E2EA 2ZSEA 3RSOA 4ACBA 1CP2A 4ACAA 4EDHA 3X1DA 5DHFA 1W49A 2N1BA 5GVRA 3CNNA 4Q1EA 1OYWA 4TTRA 1KNXA 2A5FA 2EW1A 1RZ3A 1T3SA 2UZIR 1U0JA 1KI4A 2O0HA 4TMVA 2DB3A 2FWRA 3U7HB 4EUNA 2A5JA 1Z0DA 3RDPA 2QY9A 3RYTC 4LJ9A 4D26A 1KDTA 2FEMA 3CRQA 3EWAA 4EPRA 4XD7A 1E9AA 2OUKA 3A4MA 4HLQB 1HTWA 2GF0A 1Z6GA 4KYIB 2ZS8A 3BK7A 4PZLA 3AVUA 3KJIA 2C8VA 1YVDA 3W90A 5CLLA 2YOHA 2IXGA 2R6FA 1PUJA 3NH9A 4CGZA 1N0VC 4O3MA 3QUSA 4JL6A 1JR3D 3EX7C 4WZ6A 2W6IA 1HYQA 1FP6A 5F9FA 5JJIA 4CEIB 3DMDA 3IDQA 4K46A 1X8LA 2WWXA 3A4LA 3L2OB 3DEFA 4RKFA 1FFHA 1JR3A 2WM9B 4FWIB 4AWXA 1UDXA 5F3WB 1SULA 4AI6A 2QPAA 5JRJA 1A82A 3MJHA 2QAGC 5JWOA 2BV3A 2REXB 3LRPA 4GBMA 3A1UA 1ZC4A 2WIBA 3RRMA 2A3RA 4LJAA 2C9CA 1Z28A 5AUOB 4PR0A 4N3NA 4ZCIA 2BMEA 1XD8A 3H0KA 3U7EB 4C30A 4TMWA 3GLHB 4D4KA 1G6OA 1S8FA 4NMMA 2YOFA 1SGWA 3NIBA 2XOKD 4TQAA 3PUWA 4F4JA 2F9LA 3AF4A 2GZAA 2ZSDA 1ZVQA 3DZDA 4E22A 2GJAA 4IXMA 1OT3A 2MSCB 4F38A 3K70B 3N70A
chains in the Genus database with same CATH superfamily
1RXYA 1YCGA 1ZLYA 2JI8A 3A10A 4O8ZA 2PKXA 4U8GA 1KJIA 4ARCA 4K3VA 2HK7A 1QYIA 1H4SA 2IKSA 2YRXA 1XA3A 5TB5A 2QVLA 1XAGA 5JATA 1E2UA 4C7KA 1QV7A 5BR7A 2YWGA 4BHTA 2FVYA 3V80A 5KTSA 3VR3D 2G82A 1KOLA 1K2VN 5A06A 4AJPA 1UOEA 5TSDA 1CUXA 1AK2A 1E2MA 3R8XA 3WB1A 2GO1A 4KZPA 4PSCA 1RLOA 3AILA 4H6VA 3ZD6A 2VOJA 1LPMA 1Y63A 2WFAA 3QSGA 4Z1MA 3ZZ0A 4AZVA 4MUEA 1FYEA 2B5OA 2R8BA 3COSA 1XZMA 3C5CA 3H2JA 4KKVA 1B2LA 3FB4A 3NCTA 1RRVA 4KFRA 2NUTA 3WK4A 4D45A 2CCGA 1S2MA 2F43B 1CY0A 1BEUB 3O8OA 1DDOA 3R9XB 2OEPA 1ULAA 5DNDA 4RC9A 1MUUA 4RHXA 5IS2A 1XJ5A 4DIMA 3F9CA 5EZQA 2MSWA 4PQGA 3WGIA 4FYPA 5IBCA 3OE7A 4HK4A 5FPYA 1HXHA 4CODB 4O4IA 4XQCA 4BGVA 1M2HA 2PZAA 3UH0A 3FETA 1O77A 1GTMA 2RGEA 3NDRA 3WWOA 2LXNA 1VSQA 2IHUA 1GQFA 5JY6A 2VNIA 5F1KA 3LD9A 5ICFA 1JQJC 3SGLA 2OBLA 2PZMA 2DQZA 4BDTA 4GHWA 4YCCA 5BVGB 4MDEA 2P7HA 4RKWA 2DXIA 4ARSA 3NDBB 3U44B 2X0IA 4FFRA 3IPLA 5FLXA 1ZM7A 4CF4A 3HYCA 4M83A 3AIIA 2MHCA 2QAGA 4RIEA 4S0XA 4JEMA 2Q4EA 3RFVA 4M87A 3QF4B 4MMZB 4H31A 3KB2A 4LXYA 1UINA 2IGBA 4JLNA 5EFOA 2DJ5A 3I9OA 5J4VA 1PGJA 4BX2A 1EAMA 1KDOA 4BIIA 2Z5VA 4IUDS 2QX8A 5HX7A 2I6TA 1PN3A 3FUCA 4W9NC 4PGMA 1YKGA 1C7JA 1WSBA 2YIJA 3WIOA 1Q6ZA 4ZZ0A 1Z2DA 2JJ1D 4MIEA 3N39C 1E6KA 2OOSA 4ZU1X 3RTCA 3ZDEA 5DT2A 5ERXA 3VC1A 4JLBA 4AQDA 4RX1A 5I6DA 3EVTA 2AUNA 2ZRHA 2DQSA 4YT5A 2A84A 4R2MA 3DBRB 5JADA 2PMWB 4OBBA 2CUNA 1GILA 4X20A 3LLUA 3QVSA 3ZZUA 3DOIA 1KEEB 4D4JA 521PA 3ETCA 5AHOA 2GM9A 2OZLA 1JDUA 4PGFA 3L0PA 1AHPA 3ZG6A 2B2CA 2WVGA 2QT1A 1C1DA 1NP3A 1Z22A 2VUSA 3D7MA 3E9ZA 4J2OA 3RO7A 3Q5GA 1OREA 3UT0A 2ZE6A 1AQ6A 1NONA 3OPQA 4F3RA 1GHTA 4BZPA 4FINA 1BYUA 4OJYA 6NULA 1LC3A 4ILEA 5FFMA 2CVPA 3DV0B 3Q9SA 1WZ2A 3M5PA 1IHXA 4NZNA 5KVCA 3EXFB 2FMFA 5FBQB 4ZEWA 3K9BA 3WGQA 2Q3FA 4F9FA 3V33A 4HYQA 4FW8A 4F5EA 4ALKA 5BSFA 4HEJA 3RWBA 5F7OA 3KT3A 1X14A 3DZBA 2WHRA 3TX2A 3V1NA 2WFLB 4JQZA 1ZGBA 5JNLA 3U13A 3IOYA 5I4CA 4RAQA 3CLUC 1RRKA 2TMKA 1BMTA 3E03A 4FGUA 4TTSA 1WA5A 2I2BA 4Y9SA 2X0FA 4MGZR 4NNPA 3UWKA 4A36A 1S96A 2AOXA 1IEWA 1CXZA 2YXEA 1A5ZA 1W96A 2A0XA 1Y3FE 3LC7O 5EMNA 2GXUA 4JA0A 2QN7A 1X3SA 3KT6A 4JNCA 3TSCA 5JQGF 3BXPA 3I1YA 1Z5GA 2JCXA 1GG5A 2H2DA 2VC2B 2CZQA 4J0DA 1FF9A 4EB6A 3BBLA 5G1NA 1TU4A 1AUXA 2JJ2D 1SO8A 4WESA 1KDYA 4Z7QB 1LFAA 1QB7A 5EGNA 3U7FB 3WY9A 1UR5A 2PV7A 3RW9A 5LJIA 1W4ZA 4KVGA 4ND2A 4YCAA 4BEWA 5J47A 2V3WA 3ETHA 3ECAA 4RMHA 3WWCA 2RBEA 5FH9A 1BEZA 1MVOA 3PF9A 3AM3A 4IDAA 5BNFA 4Q9AA 4UOZA 4ZJUA 2OA0A 3EG9A 4JJ6A 1DCTA 2QTCA 3BFVA 3W3AA 4X00A 2IEDA 1R0LA 2WHQA 4JGBA 3ZDRA 3R9IA 4A6EA 2WZCA 4DLXA 3FPHA 1ILEA 4H1UA 4Y9TA 2HDNB 2ZITA 3JQ9C 1WUKS 1XTIA 4JITA 2VCEA 3AR5A 4PXYA 3UAWA 4QRHA 4XR9A 2PGJA 2W2PA 3G82C 3M2PA 1QO9A 4G1UC 1WCIB 4PYKA 1UPBA 2QMUA 3H1TA 4Y30A 2GCPA 4RNDB 3UMFA 5SYNA 3ZY2A 4CEJB 3PHJA 1X1EA 4FOLA 3WLPA 3OAAD 2M98A 1NL3A 1EDDA 4H1VA 2HN9A 1M2KA 1S9DA 3KPUA 5SZHB 3FDFA 3JAWA 2R00C 3B36A 3U4IA 2XA9A 4OIMA 2G9ZA 2ZIWB 1LPOA 2W6PA 2WA2A 4DXHA 1T9HA 4RELA 3JD4A 5G02A 1YB6A 1AT1A 4DQXA 3CVYA 1O96A 1UM8A 3MMXA 4BNGA 2DYKA 3X2EA 1UJ6A 2GPYA 1BXGA 4A8JA 1PEDA 5GJCA 4DSUA 1IM5A 3E6AA 3QY9A 5FWDA 1V1MB 3ESQA 3MJCA 5HVNA 4X92A 3ZWCA 1UBSB 2XRFA 3KWLA 4UCFA 3NBZC 1FTWA 3U61B 3M2TA 3HLTA 5JFTA 2WMYA 4II3A 1CJKC 1EX7A 2NZWA 2H2WA 3HMQA 4AMGA 3SZOA 4QU9A 2PD4A 3MLBA 1JSCA 1UXOA 1RRPA 2CLCX 3N8GA 5CX4A 3IPRA 5DBIA 3HRIA 4YRDA 1KY2A 3E3LA 4RWZA 2FEXA 5CFRA 5DM2A 4JHXA 1UK6A 4C4SA 4I4CA 2ZOSA 2JGLA 1GZSA 1OHHA 2GDZA 3A1EA 1UJ5A 2GAIA 2WM2A 3I76A 2CVZA 3S29A 1MJGM 3KFLA 3DZ8A 4C1NA 3B9QA 3F8SA 2DUUA 2CFOA 2P2NA 5FCDA 3SBDA 1VCOA 3WRYA 2G77B 3LQYA 4RMNA 3W6ZA 4AX8A 3MTDA 3GARA 2Z4RA 5DXFA 4GI2A 3GP3A 1NQTA 4BATA 3N58A 3VR5A 3M82A 3ZGZA 2V8BA 4FCVA 1Q1BA 2B4QA 4AKTA 2NXWA 2VHWA 4IY1A 1ZM4A 4QC2A 2R1VB 1EHYA 1DT5A 5BWBA 5L3VA 4MRMA 1DCKA 2LIPA 3OQBA 1RNLA 4HGYA 4WCFC 3IAUA 2MSDB 2I80A 1ML3A 3VNBA 4G5OA 1HE5A 3PK0A 1XMXA 3N74A 5DBEX 5FI0B 2F1RA 2V55B 5IH7A 2P5TB 3BCSA 5ENDA 1ST2A 3VNRA 1BXRA 3TGPA 2FWNA 1B74A 3GUZA 3H86A 1T36A 1P7VA 1ZBQA 2PTHA 4GPBA 5HP4A 1NOIA 1G291 3AI7A 1Y3DE 1K6MA 2CDBA 2H3HA 1ISRA 1JPJA 2B6NA 1N2OA 3B1ZA 3WQQA 2I1VB 3L7KA 3FIUA 5ECYA 2CNBA 1UMCA 3L8FA 5HDQA 5EN4A 2AFHB 2Q8NA 1T5TA 2IEYA 1RXWA 1TAHA 1BX0A 2YXPX 5HSGA 1ZM3A 2C2YA 3K35A 1WABA 1GAQA 2H8GA 4UUBA 1PBTA 5HE9A 4AS3A 3PUJA 3R3UA 4L07A 1QYDA 3GJSA 1A7UA 2VF5X 1KI7A 4ZI7B 4KMMA 1WE2A 4PGHA 2C3MA 5CYGA 2BY4A 2VKTA 2HU2A 5B1IA 1W7AA 3ZJYA 2XLBA 5E38A 3B2NA 1OPXA 4FZRA 3O47A 3UO8B 1QZUA 1O6GA 3BWYA 2EGGA 3C3JA 2VYVD 4M8KA 3WLFA 2EGHA 3BF8A 2YC4C 3KVOA 4MQ6A 1R15A 4MW6A 4X8HA 4U0KA 2ONJA 2Y1GA 4HDRA 5A9TA 1NP7A 3MS4A 2EARA 2VHXA 3N07A 5CEFA 1E0JA 1YR1A 4NH0A 2E4ZA 5EZYF 3PPXA 4BNLA 3BIJA 3FNEA 3HYSA 4LRTB 4A7PA 1QE5A 3NUZA 3OLXA 2WWWA 4LDAA 2Z2XA 3ZD8A 1F8FA 4G6ZA 3HZHA 4E1VA 9ATCA 1U7HA 3V4LA 3WBBA 1DT3A 5KU7A 5A6SA 1GG9A 3FFTA 4TL8A 3WYNA 1JMKC 4BZXA 5A4KA 1T1IA 4PO3X 4EJFA 1W47A 2WPDD 1DLIA 4U2BA 5FI3A 5J3JA 1N5OX 2OQRA 2XIQA 5TE9A 1E3MA 1I1QB 3PVZA 2D5AA 3PQ8A 1NVFA 1I5OA 2O6LA 3DZKA 1AQUA 4PLTA 2BEUB 4QNRA 3HYTA 4IZOA 3U5ZB 4HNAA 1A9OA 3PE3A 4NJEB 3GA0A 1KS9A 1DELA 4IIDA 3RCBA 3VNQA 5CAEA 3ERCA 4R8VA 2ARKA 1KJJA 2AQIA 2RGNC 1N3YA 3FSGD 4QUDA 5EJ4A 1CYDA 1Z5PA 4GOJA 2EKZA 3QOWA 4Y9RA 4C2BA 1ZM2A 3HUTA 4LVNA 4M8NE 2W6ID 4XB2A 4YP9A 5DN6D 3SQXA 1CUGA 2X4IA 3T5TA 1K98A 3EXG2 3LFUA 3QVKA 3PHCA 4DGSA 3E23A 4AP5A 1NI5A 3EUAA 2ATIA 1VA5A 3LKVA 1P2UA 1B6RA 1FJ2A 1VOTA 2FUCA 4G01B 1T3GA 1UXGA 3DAPA 2QXUA 4C0XA 2FZEA 2CHUA 2VQDA 4IDEA 1XZPA 3E8SA 4UE3S 3WAGA 2Y05A 2VJLA 4NEQA 1H8ED 5K3CA 1QVRA 5KOYA 4L4XA 2I62A 4I9FA 4MV6A 3TEJA 3A6KA 4EHHA 3P2OA 4KQ9A 1HDRA 1SKQA 4KWEA 1CDEA 4P4SA 4UTOA 5TMEA 3WQRA 4CETA 3CONA 3RKUA 2NXNA 3AY0A 4QQKA 5HOQA 1DBSA 3TFQA 2D1TA 3E2PA 2EKQA 5JC1A 2X8BA 4CCYA 4PSUA 5AD1A 3W06A 3SQOA 3QMWA 5TIIA 2PCJA 1BHO1 1FXWF 2GN8A 3DLTA 3QX8A 1WMSA 3E7WA 1CE8A 4RORA 1E9FA 2XBLA 4GVLA 3SBEA 3NT4A 2AJLI 5CDSA 3MWDA 3TM5A 1YL6A 2PH7A 2Q27A 2W37A 1JRLA 2FETA 4DLTA 4C7OB 2BKUA 2AGVA 2WK1A 3BGSA 2XE7A 1P31A 2G0AA 3BXGA 3N0RA 1TVKA 4EELA 2N47A 5ADVA 2VRNA 3DMHA 4MVJH 4R1UA 3GH3A 4OL0A 1G8AA 4ZC8A 4ENSA 3HYRA 5KQMA 3IPYA 3NHAA 1EVIA 1JJIA 1ECFA 1LQUA 1SNYA 1XDDA 2JIPA 4FK8A 4ZT6A 4C04A 2Q0QA 4YQEA 3MCUA 5LYJA 2HBQA 2DR3A 5B53A 1IVNA 2EQ5A 1FFBA 1U3GA 1SU4A 2RMKA 2JIMA 3N0XA 3R3XA 4R1PA 2KJQA 1ENPA 4P58A 1K66A 3B3FA 4EY6A 2P2GA 3IEKA 2ODTX 3HJBA 3F7TA 4FUTA 3S70A 1ESNA 2ZIAA 5IKPA 3R5XA 5JMOA 1P3JA 1COZA 3ONWA 1DNPA 1W5EA 1U1GA 3H5LA 1BD3A 1FVOA 4N7JA 5FNVF 4D43A 2ORIA 5JJLA 4IEFB 2IFTA 1RYZA 1JG2A 1LY1A 2Q28A 1AUOA 1QDLB 1KYIA 3CVOA 4Q47A 5A9SB 2WNSA 1GZ3A 3LVQE 1G55A 1W35A 5KU1A 2NVBA 2BD0A 1JNXX 1Q57A 1ZSYA 2NT4A 2B82A 3KDSE 4IHJB 3A27A 2GSWA 3INGA 5EWLB 3AP3A 2AL7A 5EFZA 2CL7X 4FM9A 4ENUA 3EIEA 2G9RA 2YMPA 1G3UA 5CUQA 2DHEA 4I9HA 3G9ZA 1XXHB 1ZI8A 2WJIA 4P5DA 3A0UA 2NIPA 5LLSA 1J0CA 2PMKA 2ZIXA 3NVAA 1EFTA 4KXLA 2R8PA 3OM9A 4UNSA 1RPNA 4MP8A 4TM8A 3EXIA 1F51E 1ORRA 1ZX1A 2UVPA 4RPCA 4A10A 4G0WA 1L1QA 5AICA 2ZFUA 1E99A 1YACA 1HL3A 2VZLA 1L5GB 4MS4B 3E05A 5L3SA 4UZSA 3A28A 3PXCX 4J1QA 3S99A 5FIUA 3ETDA 4C01A 4CKEA 1FRNA 2IKQA 1E3WB 3BIXA 4RACA 1SCDA 4JIMA 1EDEA 2X14A 4IHKA 2BFAA 3FROA 4E1BA 4LJSA 1XHFA 3LP5A 4HO1X 1JWLA 3R44A 1XRJA 2H1HA 2ZBGA 1PJ8A 1WB9A 2GVDC 4P4UA 5DT9A 3WLOA 4Y0NA 3MGGA 4MV0A 1VRVA 4MUAA 5JUWA 1EIZA 3BH7A 3EGXB 1FS5A 2AEJA 1R6UA 1W6UA 5G3YA 4WZAB 3KHKA 1E1QD 1N7IA 4Q12A 4OLFA 2A1UA 1FTNA 1NDHA 3AR9A 1Z0AA 3BWDD 3OFVA 4RESA 1XU9A 1NUTA 1U8XX 5SY9A 1HKHA 1K2WA 2R8RA 3KJZA 1DAKA 4IH9A 3HKDB 4V1CI 3QG5A 5HA5A 2VJAA 3U62A 1NQOA 4HFNA 1EFPA 1M54A 2JI9A 3FF1A 2PMFA 4UCWA 5D7BA 5DX1A 4UULA 1T8WA 2HHAA 5E9AA 3W7AA 4C4PA 2MYPA 1ONOA 1BKYA 4DABA 4BVBA 1P18A 1BN6A 3DKPA 1VDZA 4W5JA 2HCRA 2I1LA 2PGIA 4DWVA 3IUPA 3UCEA 4LWPA 4MCJA 3IAS1 3ROMA 1DRUA 3PWSA 1BGVA 4HRAA 1SB9A 4RHUA 2XHZA 2O5RA 2ZWMA 1NC3A 4GG1A 3VU9A 3M6FA 1TJNA 5TQ2B 3I1IA 3TZ6A 1GVHA 1NI3A 1O94D 2B8JA 2CJWB 1Y4ZA 3DQPA 3OKCA 3OX3A 3P1JA 4PIPA 2NU9B 1YZKA 3BRQA 4IMJB 1ECPA 3EDOA 3ZXYA 2A78A 4DY6A 3U7IA 1G8KA 4PLGA 4AAYA 2QZJA 2W2VA 4ADSG 4ASUD 4AT1A 4WCFB 2GD1O 1JFTA 4HQKA 1IY9A 4MULA 1EFRD 3K15A 5HBRA 2FX2A 3H84A 4B6FA 3OIGA 5L40A 1J49A 2R6DA 3IOBA 1BC5A 3K31A 3PT9A 4IIJB 3H97A 4G0XA 5JDIC 3OG9A 4LQ4A 1OH7A 4LJRA 1GPH1 1S4QA 1JHVA 2EFHB 4FFMA 4S1TA 3FSGA 4C20A 2D1SA 2EP5A 4R3NA 3L1UA 4R8MA 1A4XA 3TNDA 2O6HA 4A2CA 3HN6A 1MO2A 4X1IB 1SZPA 3DYBA 3R9KA 2ODBA 2Z58A 4IM7A 4J0QA 4WNAA 1HDOA 1VP3A 1SHUX 2C9BA 3HDHA 2ZIGA 1KJYA 3PHHA 2WOJA 1DFIA 4AK9A 4B3BA 3JX9A 4YCBA 3EVFA 1R0RE 2ZTHA 1RWVA 1UPFA 3I4FA 2WRZA 4TLBA 1R5JA 4X0EA 4LRWA 3LT5A 1QVZA 1B8OA 1YQTA 1MB3A 4PTLA 3N05A 4ZO8A 2WZDA 5JV5A 5FTMA 3KQNA 5KYWA 4A9AA 1K86A 3DHNA 3AFOA 1E5XA 4DMUB 5LXTA 7ADHA 1ZNZA 5K99A 2JZCA 2GYYA 2HU7A 4RK7A 3PENA 1PS0A 2UUPA 3LCCA 5D5QA 3HWX1 4OFWA 3E9RA 3OLCX 5L6LB 2QE6A 2W48A 2X1HA 3C6ZA 4Z7OB 3Q7TA 4LDZA 1H0KA 1OXUA 2AYZA 2QTMA 4GT1A 5LP6C 1ULHA 3ZGLA 1DEOA 2XZDA 4JJ8A 4XSGA 2Y1EA 5CLQA 1B6SA 1PQPA 3FTDA 5CBPA 2ALJA 3N2YA 5FKJA 1H2ZA 1DPGA 3I9V1 1Z33A 1CQXA 2V7BA 1EX6A 4MJLA 2H08A 3RVJA 4TVSA 4IOKA 3ES9A 5JFGA 3PCRB 2Q6TA 5E7MA 1N6IA 3OJLA 4G24A 1MZVA 1VG8A 1TW3A 3IVRA 4PBTA 5TQ0B 4FDUA 4DILA 4NZOA 5SZIA 5DYWA 1M10A 2PUJA 2HRRA 1QFMA 3I23A 3NHKA 2O2XA 3NEJA 4YALA 3RSCA 3L8YA 4ZYYA 2Y8EA 4Z54A 5C80A 4LF6B 2QP3A 1UWKA 3TMYA 4OXXA 4WSOA 5GONF 4KB5A 2WF6A 1UOOA 3M33A 2YWJA 3ZJVA 3QPDA 1NVGA 3OJCA 4ZVSA 3T54A 3GDGA 3UJCA 2GAAA 4WBNB 4WDRA 1ZAYA 5DK4A 1PJ3A 5AVRA 2JS7A 3JWGA 1TCBA 4LDRA 4MK4A 2NU7B 1YZ3A 3MILA 4U02A 4NK4A 2CLEB 4U7GA 4CL0A 4FHEA 2QENA 3AF2A 1DO2A 3LU1A 4GOMD 3SOZA 3FKJA 3M83A 3HXLA 4DEXA 1H5NA 2EJBA 4PAMA 4RY2A 2B5VA 2G8NA 3JWIA 1XT6A 4GX2A 3RVSA 4I55F 3KTDA 1E1LA 3V8EA 5IYZB 1BE1A 3ZIAA 2VWPA 4KV7A 4Y18A 4WKCA 5I9NA 1AO0A 1A5TA 3BAFA 2QROA 4FLEA 3A36A 3BMQB 1G5RA 4CW7A 4LJ4A 4CLRA 4QOIA 1NBMD 1KY5A 1NJ6A 1Y4SA 2WTMA 2ZREA 3JATB 3LE8A 2WYOA 3EAGA 4TLMB 4NP6A 4JEIA 4ZREA 2P7IA 4IZHA 3Q3GE 4M9QA 4HDQB 3TMAA 2FWIA 3FPAA 1NJFA 2MMCA 5BWOA 1GUDA 3H75A 3RGGA 3VR6H 2P69A 1DIAA 2BBWA 4IEEA 4TL6A 1EK1A 4TSFA 2VEDA 1H85A 4HEA6 1BWSA 3IULA 5FWXA 2JFFA 3QEMB 4ZI3A 3OTQA 5IKOA 1QIIA 5L4SA 4IF6A 4QD3A 1EDBA 2PRZA 1DJMA 4CQLB 3L84A 2NO6A 3TN7A 4ZO4A 1D6JA 2FFHA 3DM9B 4WERA 5DTEA 3LDUA 4QFDA 4QUEA 2PZLA 4FSDA 3ON5A 3SJCA 1RBYA 3X1YA 5FOSA 3VDRA 2HUNA 3DCIA 2PLNA 5EESA 2FZ5A 1Z5OA 4LCBA 3RYCB 1EG7A 2JJYA 2X42A 4P1ZA 2DFTA 2XUGA 1J70A 4AY5A 3NYWA 3NBUA 4GGOA 5TR9A 1TQ6A 2MSLA 3LQ4A 2W11A 1CRZA 1FZQA 3ABSB 4NOJA 4H16A 3G7UA 4A6DA 4B4KA 4N65A 2J0SA 1U7ZA 3ZV4A 4Z51A 4HMOA 4I5FA 4MB0A 1A97A 4DDHA 5C51B 1M72A 1FP7A 1XTJA 5C81A 5ADWA 2BJHA 1V96A 4BX9A 3GJ0A 1RHRA 1MQ9A 1V3QE 1YUBA 1Q3TA 4M0LA 3OQPA 2RBGA 4ZCQA 5IJ0B 4LFBB 3GPIA 3L7YA 1L5OA 4NG5A 4XVUA 1C8BA 4CHGA 5J58A 2V03A 4MJ3A 4HFMA 1PBNA 2ECQA 4CYMA 1QHSA 3FMOB 4H08A 5JSYA 2K7FA 2QI9C 4YJ2A 3TW0A 4IILA 8LDHA 3D6FA 4DG8A 3LPAA 2J4FA 4L9AA 1TI7A 4KWHA 4LZZA 3KZMA 4IUYA 2JBAA 3FSJX 4IIBA 1P1RA 5ALQA 3KXIA 3I6QA 4JQCA 1GQ2A 2AFHA 2NO5A 2IV2X 5DLEA 3EMKA 2EATA 3OPXA 3DMYA 4RA9B 1N0HA 2QTBA 3BH0A 3NHYA 3UHOA 2Y92A 2FKNA 3AJEA 1B14A 2JIOA 3E8XA 3B7PA 4LNUB 2GZ2A 2B25A 3UMRA 4LZWA 1ZH0A 1QH9A 1UMDA 2RB4A 3MT0A 3T35A 2V45A 4GW3A 3VC2A 2ZBPA 1TADA 3UK2A 1RHKA 5I47A 4HF7A 1GCGA 3FNGA 3HEAA 4HJRA 4J1TC 4DV4B 5DIZA 1KO5A 1FE8A 1UADA 5EIBD 1K7YA 4UTRA 3VHLB 3LC2O 5JXIA 2Q0XA 4DBZA 3R6DA 2R1ZA 3B20A 3HP7A 3IERA 3RYFB 3U7RA 4LHYA 8OHMA 3ZS8A 4QPJC 2C8JA 4X6UA 3OTGA 3T61A 3VDXA 2I5PO 1N1MA 3EY9A 4RVOA 2HEIA 2JLUA 2HRCA 2GLXA 2Z56A 3AETB 5FYQA 2EKDA 1R50A 3QE0A 4JP5A 4C22A 4AY6A 1WKBA 1FNCA 3OOHA 4BS9A 4CMIB 4ZI7A 4QULA 3STVA 1OB2A 4ZWNA 3ZW7A 1H9AA 1PAUA 3BERA 5HIIA 1GKIA 1NIPA 4DSTA 2QW0X 1X8JA 1YD7A 3EG5A 3SEAA 2R8XA 2AMLA 1FQJA 2HF2A 4HS9A 2FP4A 2HCJB 5IAEA 3RG2A 4URVR 1HK7A 3KLMX 1I32A 1Y6ZA 4B3FX 4HH4A 4F8EA 3WNVA 2C5AA 5DSTA 3N2EA 2PKEA 4MROA 4F2HA 2QTVA 1DG3A 1Z8FA 3PUKA 1OI2A 5H83A 4KR9A 1J00A 4M7RA 4YMVA 4Z4CA 5C46F 5IU6A 1KU6A 3FLMA 1O6CA 4LJYA 1XZFA 3BMNA 4Z8XA 1P0PA 3R23A 3KU4A 1JJBA 1G9SA 1M67A 3CF0A 3CUEF 2H51A 1DAEA 3LHSA 1E98A 2BPOA 4Q19A 1S9HA 2GA9A 2VTBB 1XQVA 3SJAA 1H1TA 5U4XA 2Q1WA 1R27A 1YC2A 3ZLUA 5IKMA 3ZI7A 1BKDR 2HO5A 2O3TA 1KJZA 3MTGA 4JT8A 3DVRX 1GUFA 2REOA 5BYAA 1AHNA 2R6CA 4QM7A 4GRIA 3URMA 1KHTA 3AG5A 2JCBA 4I9NA 4ZCLA 3RROA 1UUFA 3GFFA 4XM2A 3LSTA 2CJPA 4GR4A 2I2DA 5ALLA 3GYGA 4Z9XA 2OYRA 5IYZF 1I3KA 4QXQA 1YNSA 5LC1A 2L19A 3E7DA 1UANA 3C3YA 3VBEA 5FAXA 1TAQA 2DPLA 4P54A 3OOYA 1SEPA 4E33A 1ADJA 4UM5A 1UFVA 3EUEA 1NP6A 5IJ9B 4D6YA 3PDIA 1ETHA 5JE8A 3W2EA 3GT0A 1IUOA 2C5SA 1LZKA 2BMDA 1YB4A 4WDQA 1G5FA 5DNUA 1E3SA 1QG0A 3SJUA 4Z0PA 4ZT5A 4AY4A 5LYYA 3WNBA 2D54A 2ZANA 2MMGA 3BWBA 2OV8A 2ZVQX 4ZVVA 1MW9X 2PZEA 1E62A 1R0ZA 1E3WA 1TYEB 1TT5A 2Q2OA 3HCOA 3JQAD 2W2QA 2XJ4A 2A9KA 2AIRA 3GVHA 1ZMOA 1E5TA 3HPQA 4UDYX 2WA1A 5JZVA 1ABBA 3AUUA 4MV3A 3BHJA 3WGZA 1A9QA 3H7IA 4NCKA 1I3OA 3K32A 1M3SA 2PO7A 4KI0A 3T7RA 2FN3A 5JCPA 3SFVA 1IK4A 1FRFS 1KH2A 1P2SA 2IYWA 3CM0A 3LY8A 5JYBA 1P4GA 1Q14A 4E1AA 4FGZA 2Q5CA 3TG2A 4NYMQ 5IAJA 4CKWB 1P7PA 3NC4A 2K6GA 3EK2A 4IDQA 5CLIA 4EHLA 5LQUA 1GOTA 3CX6A 4RF2A 4J91A 1TA4A 2RG7A 1RXVA 3E9DA 3MBKA 3THYA 5DLQC 2IDKA 2VPXA 2J3QA 3E3MA 2RH4A 3GMDA 3Q8WA 4DMHA 5IAOA 1N77A 4GVPA 2NSYA 4OHRA 4DG5A 4FX2A 4C7MA 4UUPA 4L5BA 2C5LA 4IDNA 4LY3A 1T2EA 2NXJA 2Q6KA 1ZHHA 2X9VA 2ZPUA 2IV3A 2FJUA 3MTQA 3UQZA 3G68A 1Q1GA 3LT2A 4B85A 4F11A 1U28A 2OYSA 2QM0A 3PJFA 1CFJA 4FGLA 1ZIDA 2H4WA 3F96A 1M75A 1PJ4A 1ESEA 2DHRA 4FKMA 3ADCA 1ZH4A 1P33A 3H8VA 5K2MA 4YLYA 1RQGA 5F73A 1E2JA 2X8JA 2JZNA 3HL0A 3S27A 3USCS 2RFLA 4B44A 4U2DA 2PRIA 2YW9A 4YIKA 1AKTA 1YVUA 2Y1FA 4BZQA 2O07A 4UFNA 3RAEC 1M5RA 1FYVA 4ZTUB 2BCGY 4XGNA 2PA3A 3WS7A 1JT2A 4I0WB 1N7HA 1BCSA 3PUHA 3A4IA 3KXLA 1QHYA 4N8SA 5C8ZA 3D3QA 4RADA 1C3VA 1S2OA 4Q16A 4ATNA 2A1IA 2WZQA 4HUTA 1KYXA 4IH4A 1ZFNA 2R97A 1RLIA 1L4BA 1C7FA 3B9PA 4FBMA 4FCTA 4LSZA 4BEBA 1SHKA 4QE3A 3DE0X 1ID1A 3IEXA 4OKIA 5EZ5A 2PSSA 3LP8A 3TQHA 2Q1SA 2Q6VA 1FXWA 5HR5A 3OETA 4FMDF 4C08A 2X1MA 4L8FA 2PR7A 3S2UA 3GO4A 1BE0A 3DAYA 4YT8A 3BRSA 1M2OB 3QVTA 5T3YA 2Q4DA 3RS4A 2FSHA 5D01A 3GGOA 3QFFA 1K3TA 5IVDA 1YIAA 2UZAA 2W6QA 3C2QA 5AFSA 1GKLA 3CW8X 4F21A 1SHJA 1O5OA 3IE2A 4YWHA 4NBLA 3R3ZA 5T5QA 1WDLA 4QAQA 1QIGA 4L16A 3CEJA 3ZLTA 1OA1A 2BBSA 2K5UA 3G2IA 2BTQB 1B7GO 3JALB 3FMPB 2EP8A 3JYNA 3QVUA 2DT5A 1LDGA 3TRKA 4RIFA 3U44A 2PSJA 3G8YA 1WOMA 5IKXA 3ORQA 4UDOA 2WJZB 4C06A 3OKAA 1DINA 3I9JA 2GBCA 4QDZA 1WUTA 4MHTA 5G4KA 3GELA 1X7ZA 4JY7A 4UEWA 5CCXA 1C3JA 3VDMA 3FAKA 3FPLA 3CIOA 4PPFA 1XEXA 3GROA 3E5MA 5KAPA 4UJ5A 4R83A 5CEEA 4GPIB 4GPZA 3OJFA 3S68A 4GKVA 4JH0A 3THSA 3UUWA 1J8VA 1V8ZA 4NFLA 1ZCAA 1XL0A 4KL8S 5DM60 2MTBA 4G56A 4GAEA 4C9BA 3A1TA 3HU2A 4TSFD 3IHTA 3NWEA 1X7ZB 3PUXA 3HNRA 1V8DA 3L7DA 3RT1A 1RJWA 5KDLA 4CQLA 1L5QA 1DAFA 2I6UA 2PKQP 5EJ2A 2VJDA 5IWCA 4FC6A 3L0OA 1TVCA 3AHEA 4XVQA 4KQ6A 1UOPA 1PGOA 1CJVC 1GDTA 3BD6A 4JYAB 3QF7A 4CKBB 1WPGA 3LPMA 2QPLA 1JBEA 3CNLA 4B6SA 3P27A 2G07A 3MGKA 4J1TA 3RUIA 1ECJA 3TKAA 3O8CA 3H5NA 3P9PA 3P7MA 3GLIE 1C2YA 1SR8A 1TXGA 2JJQA 4H15A 4MP3A 5LP6F 3FFAA 4AF6A 4KACA 3VISA 1NBME 4POAA 1N2XA 1DEKA 4WVFA 4LFAB 1NURA 2GYUA 1YGPA 4I5GA 3VH2A 5CA0F 4YV1A 1N5JA 1M83A 2JGRA 1JFFB 1BVHA 2VVTA 3DEKA 3LQFA 2WM8A 2G28A 2C4NA 2NU7A 1C8LA 1QYVA 1B0ZA 3AGQA 3CLKA 2D13A 3KWJA 3G9UA 2ZYSA 4IFTA 4OD0A 2B61A 3ZW8A 2F62A 2LWIA 3LKZA 2XCOA 1WJGA 1C0EA 1QO7A 2QWXA 4M1MA 4R7TA 1BIFA 3GA7A 1SHZA 1MFZA 3B1KA 3I2IA 4FIDA 2WTAA 2ZRNA 1U63A 4BX3A 1L5NA 2B3DA 2FRVA 1U7PA 2HMUA 4U2EA 1OVMA 4KH1A 5H68A 2CV0A 1IONA 2D5CA 3H0CA 1OH6A 4PC6A 4PCVA 4FB4A 1T0HB 5AW2A 4MVJI 3V2IA 3K05A 5IDQA 2GFIA 3QVGB 5FBWB 4GO1A 1M6WA 3MZ0A 1K4KA 1TVKB 4PGAA 4UMFA 4ZI2A 1VJ1A 3OJXA 4WZAE 1TO2E 3DBLB 3IGFA 1ZXBA 1PWXA 4RCYA 4M9ZA 2PX4A 3SVZA 4HXFB 4YJ2B 4EHBA 5FUMA 3BSWA 3F7OA 3KEQA 2H92A 2YIVX 2JI4A 3H2ZA 2IX3A 1WY5A 1XDSA 1C9KA 2IPAB 2QE7A 4GU5A 1N2BA 4N7BA 5JROA 3I5AA 5BQ5A 1V4NA 3Q3EA 1VLLA 1KVTA 1UL1X 1FSSA 4MTCA 3G2PA 1M8PA 1OWLA 1I7SB 3CTPA 5AM0A 1WM1A 4UM9B 3I6YA 3PFBA 3MT7A 1KSHA 2HT1A 5CT8A 1T1EA 2C5FA 1NLZA 4OBEA 3ICWA 3SQMA 4XCVA 2A5GA 1RTTA 2GXAA 2ECKA 4W5QA 1ZG3A 3CRRA 2PO5A 3LCJA 4OUKX 4WBSA 4WMLA 2P4QA 5AHKA 1XKLA 4PSDA 4LDPA 4US0R 3M6AA 4XKJA 1DIBA 3RF7A 1Z88A 2QUJA 4TRMA 3A6DA 3Q2IA 4FOPA 4KFTA 4ETIA 4XVCA 3ND6A 1VLJA 4Q4CA 1U4OA 3GR6A 2OCIA 3MTJA 2C2BA 4KR3A 1YS1X 4GMGA 3KQOA 5THQA 4C2AA 5C8VA 3KQUA 1PR6A 3CEPB 4JZKA 1Q1AA 1X1BA 4GDFA 3PX7A 1CLEA 4RZQA 1KR5A 4KQFA 3H11A 5LKRA 2YN4A 1B1AA 3G49A 1VL0A 3SHTA 3VX4A 1AXEA 1W19A 3PHIA 3EIQA 1NUUA 4KXUA 5A05A 4WZBB 3W2IA 2YJ5A 1E7RA 3DOJA 1BO6A 1EQ2A 4HBGA 4RF5A 4YVFA 2IEZA 3FHLA 3PRKE 4U8HA 3RBVA 4G5HA 4UXIA 2VO1A 2VPTA 3FR8A 4EQ6B 2GN1A 2B0JA 2O2GA 1TRKA 3OF2A 2XSZA 2QL5A 4RXMA 2PUCA 5G1PA 3K92A 3L9WA 3GL9A 3UJNA 1XLWA 4NU8X 4HHEA 3NBMA 3CZ9A 5H02A 3T94A 1P0QA 3K53A 3OIWA 3PXUA 4Q9IA 4OI1A 1UBHS 4ZVQA 1EWRA 1SXGA 4GWKA 3PV0A 2EFJA 4HDSA 1GGKA 3U1TA 2GPTA 4N0DA 4OQ4A 2X86A 1MBZA 4DUPA 2P0EA 1PL6A 1LBSA 4AXXA 4A0QA 1R1DA 3QE4A 4CG2A 5FDFA 4OAQA 2WSIA 8ADHA 5ITSA 3FJ1A 4LAFA 3S5UA 2R7LA 2YKGA 1HYEA 3EGEA 4AJEA 1E58A 1MRZA 2ZJZA 3IQEA 3SYRA 3H16A 4DN6A 1KDPA 2DM6A 3ET4A 4AWBA 4BGIA 5A0FA 1SCQA 2V97A 1THMA 3D3WA 5JPCA 3ENKA 3EQ7A 4JBWA 2NT3A 4TLEA 5ERGB 3N2KB 4DXAA 2HA4A 1P74A 3H4TA 4O63O 3FFWA 3D31A 4CEIA 3JZAA 2VYND 2XUJA 3FPFA 3ZXSA 2ONZA 3BGWA 3NIFB 4G25A 3F2VA 4RL6A 5CHYA 2MYUA 3RJ9A 2ZJ5A 1PT7A 3P97A 4MQ4A 4CIYA 2Z30A 4GRDA 4A1OA 4D8XA 3TSOA 3I2KA 3IJPA 4XJSA 2ACWA 4ROSA 3OURA 5I7VA 2IZ6A 1EUZA 4Q3CA 4M21A 1QWSA 3CWQA 4F46A 4UNRA 2AVDA 2G4LA 2XODA 4RIIA 5IJXA 4D8VA 3NTQA 1R16A 1YJBA 4QKQA 2IU4A 3M5WA 1T4DA 4HMPA 3DT8A 1KRHA 4GSYA 1AXGA 4PFSA 3PI7A 2M6KA 4ZI7F 4W6QA 1VBFA 5FR1A 4P8RA 4ESVA 1G6HA 2QUIA 4RXUA 4YAIA 7ABPA 5KMGB 4TXHA 3EIXA 4BAGA 2WYIA 3SZLA 2PBFA 1KFCB 4M86A