4DZZA

Structure of parf-adp, crystal form 1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Plasmid partitioning protein ParF
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dzzA00
1KSJA 1TF7A 4JT4A 4URWR 5FL7A 2XJ4A 3CX8A 3K0FB 1Q0UA 2KSQA 5JECA 5DYIA 1QG4A 4H1UA 2JJ2D 4KV9A 5F2EA 4BPBA 5KSYA 2JLUA 1OIXA 5L3SA 4JL5A 2ORVA 4QFMA 2QGZA 3E5HA 5EUMA 3BH0A 1TL7C 4MRNA 4D6PA 1XPOA 1M74A 1OH5A 1YU9A 3AF3A 1XZPA 3B78A 2HLDD 3IHWA 3U6BA 1KI4A 3L43A 3U3KA 2LCFA 1DAMA 4XWAA 2BM1A 1FW6A 1COWA 4MDFA 1R0WA 1O3YA 1KZGB 2IBMA 3IBYA 2AFHE 3AVQA 1P9WA 3WNCA 2ZUCA 4I4LA 1KAOA 5AR1A 5AUOB 2EFHB 4P4SB 1E2QA 3QNUA 3ADBA 1L7VC 3EG5A 4M9XA 4CT5A 4D82A 2GXUA 1J7KA 1XXHB 2ZRMA 3K0AB 3P4YA 4PTLA 1XWIA 2MSCB 4B75A 3FGNA 1I4LD 2IW3A 3U7HB 3CF2A 5EE3A 2VP5A 3LBIA 5DN6A 3Q85A 3GLGB 4HB0A 5AUPB 4XVQA 1KK2A 1SHKA 1P9NA 2P5SA 621PA 2YKGA 4DT1A 2IWHA 1JALA 4AK9A 4DDVA 4Z51A 2XSZD 4M22A 5A0FA 1JNYA 3FDIA 2OILA 5F9HA 4FMCB 3OE7A 4GSYA 4A36A 2GK7A 1DEKA 1PLLA 2JATA 3TUIC 2FA9A 4GZMA 1C9KA 3KXKA 3VX4A 1GNRA 3LW8A 1JR6A 1GKUB 2FSIA 1W0KD 2C04A 3QF7A 5KPDA 2A5DA 1OYWA 2YHSA 1G7SA 4CGZA 4Q9KA 4U5XA 3N70A 4G5QA 4A2WA 2IYTA 4Z8YA 2GXQA 2XB4A 3SJBA 2Q21A 2CHVA 3S1AA 1V5WA 2GETA 5JWHA 1UM8A 1T5IA 4OQFA 5KNBA 2OBMA 3NC1C 4KODA 4GRAA 2P5TB 1ZD9A 5J4YA 3WNDA 4D0NA 1W36B 2ZYUX 5TV2A 2ZS8A 5D3MA 1E2LA 4FWIB 3WBKA 5FOWA 5G41A 3A4NA 5TMPA 2G88A 2GCNA 2DFTA 2DBYA 4LPKA 4Q4JA 1E1RD 4PC6A 1UKEA 3IDQA 2P3SA 4LJ8A 3RYTC 3I1FA 1LW7A 1HEIA 3G5UA 1GVNB 3T34A 3HPQA 3EC1A 4O2RA 3CBQA 3LAWA 1ZD8A 4V0OA 5FI0B 3W6PA 1Z63A 1E69A 1UDWA 2ZR7A 1T91A 3QVVA 4AKEA 4R71A 2GWHA 2ZRLA 4GL2A 3QVUA 2GZHA 1ZM9A 2KBFA 2WJYA 2QBYA 4WZ6A 1VCNA 4UNRA 3B5JA 1D6JA 3B9PA 2WAXA 3OIWA 2AN9A 2N1BA 5L3QB 5G3YA 1J8MF 2AL7A 1U98A 5BXQC 2JLYA 1FFHA 2O8DB 2QTVB 4TLDA 3BFVA 4LBVA 1G8GA 4XTCS 1G8FA 1E2JA 3AVWA 2ZE7A 3KQKA 3T5GA 2CCGA 1G6HA 1ZNXA 4UJ5A 2V7QD 2FWRA 3B6EA 3GLFA 3QI2A 3U60B 1UEIA 4WOPA 4TT3A 5B2ZA 4X8MA 3J81k 4FINA 2QN6A 1O87A 1Q12A 1IN5A 1A5TA 2C99A 1ZBDA 4IDPA 5CJPA 1KI6B 3F0TA 2C9YA 3W8NA 1DG3A 4Y0VA 1E98A 4HB4A 1KIMA 2RGBA 2GESA 4GOKA 4BEJA 5FOSA 1TQ4A 3RRZA 2IWRA 4IXNA 2HDNB 4KJZA 2FPLA 2WWGA 4EQ6A 2ORIA 2RGDA 2MSDB 3U7EB 2YNMA 4LV5B 3TBKA 3VNVA 4NYJR 4L9SA 1G41A 5CLQA 2EW1A 4B32A 2O8FB 4NYMR 2ODEA 4PC1A 1U99A 3CNLA 4CIDA 2G3YA 2FMXA 3U4QA 4DJTA 4D81A 3ICEA 4M9ZA 3PCRB 3R7WA 1KY2A 4QOSA 1RYFA 4PSAA 5JJKA 2CL0X 1D9ZA 1DAGA 2BEKA 2CBZA 2BCJQ 1YR8A 2BDTA 3SYKA 2OM2A 4C0KA 1DVRA 3CRVA 3PFIA 2ZRIA 2C5LA 1MH1A 1LNZA 3CWQA 4B2PA 1G291 3LLMA 4HATA 5EUQB 1ZUIA 2KWIA 2ZE5A 2H16A 2AWNA 4CEIB 3CONA 4JLBA 2GKSA 2VHUA 3ZZTA 3NBFA 1XEWX 3SDZA 4ZDJA 1IM2A 5K8LA 3MMPA 2ZTSA 3GLIE 3AVVA 4URZR 4QKQA 4O0MA 1G8PA 2OCPA 2VTKA 1GL7A 1GKIA 1OFTA 4Z1MA 4GT1A 1XTIA 3TH5A 1R0ZA 5K8TA 2IYUA 2E1RA 3BJIC 4UNQA 5E7MA 2PL3A 1YZTA 5IHPA 4URXR 5CIWA 5FPYA 1P2UA 2R62A 4PAQA 2RGNA 4WZBE 2ZVPX 3C5CA 2HJGA 4YDSA 2PLFA 2CLDX 3D6TB 4TTPA 4UXJA 2BMJA 2EVWX 4KFTA 1HUQA 1M6NA 3AVOA 3UMSA 5KOYA 1N6PA 2NG1A 3X1ZA 2YOHA 3DOEA 4M8NE 4F91B 4BASA 3EA0A 2RGCA 3TK1A 1RC8A 2G1KA 1SXJC 4PZZA 2PEYA 1X86B 1AJEA 1XTSA 2D06A 5ANRB 4X8LA 2J45A 1ZC4A 3OIYA 3SFZA 2GJ9A 5JS7A 3PITA 4KYUA 1EFCA 1Q1ZA 2IYYA 1J2JA 3EWAA 5KDOA 2BKUA 4PO8A 5M04A 2YOFA 3CPEA 2QMOA 3GJ4A 2J3EA 3L82B 1Q1EA 4OI4A 2ECKA 4QBIA 4PC2A 1R0YA 1QF9A 3FKSA 3LD9A 4C3ZA 5CJ2A 2O8CB 1YKSA 3CPHA 4F92B 3GJ0A 2CDNA 4JSYA 5DH9A 1OJLA 4FMCF 1T8UA 3ZS8A 2R9VA 1P2TA 2QEQA 2VYFA 4CYMA 2VL7A 1JJ7A 1GNPA 3QG1A 4PFSA 1ZD1A 3B82A 4M1KA 1UBGA 4DLTA 2ZRBA 3E1SA 2D62A 5DLQC 4US1R 1AA9A 4L9WA 1JEEA 2QL6A 3AUXA 3W34A 3ZVNA 2I1VB 2ATVA 2BBOA 3NG1A 5BN3A 1QHSA 2ZS9A 4KYIB 1N5KA 2W0MA 4OQXA 3HR7A 4FIDA 3GLHA 3OFNA 1KMHB 2O8EB 5CB8A 3FHOA 1E2DA 3ETLA 1UEJA 3HJNA 3K53A 2YJTD 2X1VA 2W2VA 3NC0C 4P32A 5DO9A 3QKSA 4Q4HA 2J1LA 2FOLA 2ZI9A 3R8FA 4PO9A 1VYUA 5TARA 3ICQB 1RRCA 3QG5A 3PEYA 3HU3A 1U90A 4B2IA 1KOFA 4BLOA 2D7DA 1R8SA 3VX3A 2OFOA 3QENA 1KK0A 2JASA 2HJVA 2JIZD 3QEJA 4NYIQ 2WWHA 3GPLA 2BBSA 1G16A 2C9OA 3Q5EA 2QAGB 3CR8A 2J0SA 3EZ7A 1OH6A 1DPFA 4OJKA 4TZ6A 2GZAA 2O0HA 2HXSA 2RCNA 4Q02A 2F3TA 1CLUA 4Q1BA 4RZXA 3IHLA 4QC2A 2V6IA 4HSEA 3DMDA 2QORA 4ZI3A 2Z43A 3CZQA 3X1XA 3B1VA 5IF9A 2CXXA 1WB9A 5FOXA 1IOZA 2JLRA 3K1JA 1M8PA 3QE0A 1E9EA 4JLAA 3R8CA 2FV8A 4FCTA 5JSZA 4TMKA 1OPXA 4Q4AA 1Y3AA 3TR5A 1UFQA 2IXGA 2OLKA 4GNKA 1FPMA 2WIBA 3C7KA 4ASUD 1CEEA 1WA5A 1Z3IX 2V6JA 2W0SA 5FOUA 4WA7A 4UNPA 5K8UA 1G21E 4C0LA 5L3VA 4TYYA 1G8YA 3DM9B 1J70A 1TU4A 3H1TA 5J4VA 2D2FA 1SHZA 2PBRA 3VHLB 2YVUA 2ZRNA 4D2IA 2FX3A 1P62B 4B47A 4RZ2A 3LO5A 3KQLA 2EWWA 2IUSA 2CJWB 3H4MA 3IIMA 4MYTA 1GDDA 2UZ3A 5E7JA 1G4UR 4DLVA 3FHTA 1MABA 1ELOA 3H0KA 2VSXA 1Z0KA 1JBKA 3AGQA 1OIWA 2PLRA 4RD0A 5SZHB 4JT2A 2ZS7A 1OXUA 3CM0A 1M1YE 2BHRA 5TY0A 4HDCA 2IS6A 4TN1A 1CF4A 1YRBA 1N5LA 1BMFA 2PJZA 1DTSA 3AM1A 1OF1A 2ZROA 1N5JA 3JZMA 1JQLB 2OXCA 5DISB 1QRAA 1R5BA 3K0SA 4Q1FA 1F6BA 3D3QA 2BCGY 4TLCA 2EFEB 4FCVA 4DLUA 3SJZA 3GEEA 3LDAA 4PR0A 5FL3A 3LQQA 1SVWA 1VCMA 4KFSA 2OBNA 3KQUA 1YZGA 4EPVA 3UMRA 2XZLA 3MCAA 5DE3A 4TQ9A 2RGXA 1CR0A 4M1OA 2Q9BA 4HUTA 4YONB 1WBDA 2Q3MA 4WW0A 2J0QA 1OB2A 4R98A 1H8EA 5C4MA 3PQCA 1DAFA 3BXZA 5J4KA 1QHXA 1GKYA 1SXJE 3KTAA 1SZPA 3RLFA 3Q8XB 4KCGA 4MGIR 3TSWA 5BN4A 3WNBA 3D31A 4GOXA 4HAVA 4D4JA 1LFDB 4ZIRB 1XPRA 2QM8A 1T0HB 2YC4C 5CYPA 3RRNA 5AJXA 3WP0A 1S1MA 3ZLJA 3A36A 2DFKB 2AD1A 4G5OA 5FOTA 1EX7A 2OFWA 2F6RA 2NOAA 2Z4RA 4LSGA 5FTNA 3U3MA 4TZ0A 2IS4A 5EE0A 3JZAA 2Q3HA 1PLJA 3NBYC 3QXSA 4UNSA 2NTYC 4L15A 2TMKA 4HUQB 1K8RA 3ASYA 1XEFA 3GFOA 421PA 4PAOA 4A0HA 2IYVA 4B3FX 2IL1A 1OFIA 5EP2A 1ZUNB 1S2MA 4JSTA 2VO1A 4RSGA 2L0XA 1ZCBA 2QMUA 3Q72A 4RD3A 1NIJA 3KKNA 1F5NA 1EESA 2WICA 4IDNA 1KDRA 1NJFA 2XOKD 2G1JA 4PC7A 721PA 4BGDA 1JAHA 1N3BA 2ZJ5A 5LB2A 4BWYA 4D26A 1KO7A 2D3WA 3CW2A 2FDCA 1DO0A 2G77B 4BLPA 1Z8FA 4MUAA 2WTUA 4A15A 4TTRA 4PANA 4ZCMA 2BBWA 4JLJA 4QM6A 4KO8A 3L0PA 4V0KA 1OSNA 5DSZA 5AUNB 3RWMB 1ZM3A 4LBYA 5FL7D 3GLIB 2RGNC 4D0GA 2ZREA 2GVDC 3Q5DA 4QHTA 1L4YA 1NL3A 2ZITA 3LNCA 5B57C 3CLVA 2C9CA 2EFGA 3CIOA 3FE2A 2IS2A 1N6RA 3ZQ6A 3P27A 5FBVB 1S3SA 1FNNA 3A1SA 1AS3A 4POAA 1S4QA 1T0JB 2WKPA 4W5HA 4ESVA 4DDTA 3TVDA 1D2NA 1NN1A 2OCBA 4CEHA 2EFCB 1IJEA 4KLZA 2QENA 3KFVA 3H86A 2RHMA 2MMGA 2QGNA 4OHYA 4MYHA 3L0SA 1COWD 4C0HA 5KSOA 1TQ6A 2J41A 3ZVLA 5EJEA 5KPJA 2J46A 3PV0A 2YYZA 2XAUA 5JRZA 4RKFA 2ZIAA 3LQRA 4JLDA 3GCGA 4JVSB 2VF8A 2BEJA 2C78A 1UBFA 3EAQA 3W9YA 5CM9C 4NCIA 5JEDA 5AJZA 2X77A 1W48A 2PX0A 3SHFA 3EIHA 1NN5A 3FMIA 4D4MA 5DN6D 2GCPA 1DARA 3T35A 3RSLA 2ODWA 2EWVA 4V0MA 4QNRA 1ZCAA 5CDFE 2D2EA 3I62A 3T06B 4GZLA 4M1SA 1Z06A 3KFXA 1XB2A 1JR3A 3LX8A 2GJSA 2NO6A 1VTKA 3Q7QA 1ZUHA 2EYUA 1GFIA 3OE7D 4B71A 3KX2A 2X2FA 4UXHA 1KHTA 3AF4A 3PUWA 1NY6A 3GJXC 4B6FA 4YQFA 1G4AE 3K0FA 1CR1A 1IXZA 1P2SA 3SEAA 2FGKA 4S35A 5FTLA 3SQXA 3P20A 2ZEJA 2WBLC 1KKLA 3C5HA 3AKEA 1U81A 3MFYA 3KJHA 2QSYA 4ZKEA 2FPKA 4LJ7A 1IBRA 4B44A 3K70C 2BWJA 5IK2A 4Z8XA 3CRW1 1HURA 2ZYWX 4EPXA 5E3HA 1NBMA 2FZLA 4WIAA 3DMNA 4QG7A 2ZI7A 1AGRA 1CJUC 4DCTA 2FN4A 3W6OA 3KB1A 1G3UA 4A6PA 2HF8A 4BZXA 5JHGB 3OF5A 1SKYE 4P4SA 1AZSC 2XGJA 1X8KA 4TLAA 3WYGA 3B1XA 3DDCA 4JMPA 1XXHA 3K0AA 5IT5A 3WXMA 3CX6A 4M9QA 4F7WA 2GJAA 4LPSA 4Q5IA 1KK3A 2JDIA 4G5RA 4W5JA 4EFLA 4Q7LA 2QPOA 2WSMA 4QNMA 1E2IA 4RFVA 2Q9AA 2QAJA 3GLGA 3NH6A 4HEJA 2IF2A 2YV5A 1G18A 2QT0A 4BUJA 5JCZA 2Z4SA 1A82A 3UWOA 5DIFA 2GHIA 2VHCA 4NCJA 2LWIA 2HEIA 3RS7A 1XMJA 1SQ5A 1HTWA 5FBRB 4DEYA 2R65A 2UKDA 1JXMA 2V3CC 1M7GA 2DWOA 4TT3D 2A78A 1VHTA 3EXAA 3LLUA 2W2XA 2P65A 3GFTA 4LBWA 3LX5A 5TVKA 1OH7A 1XJQA 1Z22A 5LD2C 2OAQ1 1LVGA 2EFDB 4OHXA 1HQCA 2G0NA 1R4AA 4DSNA 2R8RA 4Q1EA 1X3SA 1TF2A 2ZAMA 2ZI3A 4PSVA 1U9IA 3EZ9A 4N0EA 4CRWB 3V9PA 2A7QA 2FU5C 5HPYB 1E2KA 2XTMA 4B3XA 1AQYA 2RHDA 2HCBA 2ZJ8A 2C98A 2HT1A 5EQTA 4XH9B 3B7GA 1GZSA 4JBWA 1D2EA 4PHFA 4P0TA 2ZYVX 4OL0A 2SHKA 1PVOA 4MKFA 4TMVA 3GD7A 1CJMA 4YMTA 2GJ8A 2VP6A 4E07A 3I72A 1DG1G 2OHFA 1NVUQ 1OKKD 2ZJ2A 4J0QA 5JJLA 1L2TA 2O8BB 1XBTA 4K46A 2QRNA 4KHZA 3SHWA 5L3QA 4JVNA 2IF0A 2XITA 2ZRAA 2O8DA 4DUGA 4KSCA 3BFKA 2PCLA 4LCBA 2ZRCA 4B76A 1CXZA 2Z0MA 4O2LA 4QXAA 1US8B 1GRQA 3W3AA 4EDHA 1H65A 2V8OA 2XEXA 2A2ZA 1HT1E 5F9FA 1C4OA 2AXNA 4M21A 4CEJB 1G7RA 2IYWA 1DAIA 1XTQA 4Z1MD 3IKJA 1FX0B 2FEOA 2NPIA 1TTTA 4M1TA 1RE0A 4HLCA 3SN6A 4B3GA 2WJGA 1HV8A 1GP2A 2VSOA 1FL9A 4I99A 5TXGA 1GNQA 4FW9A 3G82C 2GBLA 3L0OA 5CITA 1KI6A 3THYB 3NBZC 2KE5A 3X2SA 2ZXUA 5CB6A 4TSFA 1AS2A 1XNJA 2W2TA 4JBXA 5C18A 2OSBA 1YRAA 2QU8A 1I2MA 4LJ4A 2WVJA 4NTZA 1SXJB 4UJ3A 3GQBA 2ATXA 4Q48A 2MMCA 2D74A 2HCJB 4TMTA 2FH5B 2CNWA 1NSTA 3MG9A 4A0RA 1AK2A 2NGRA 4ITRC 1DE0A 2ONJA 1BH2A 1ZNZA 5FUYA 3QQ5A 3ZZUA 4EPYA 2ZRFA 2BIFA 3I4LA 1K5DA 2F1JA 2PX3A 2O8FA 1TAGA 2BC9A 4TMXA 1Q3HA 1UJ2A 4DDWA 4WXPA 3HU2A 2IYZA 3B9QA 2IYLD 3QOFA 1SVIA 2F1IA 2GAAA 3CF0A 3BH7A 2GJKA 1R7RA 3ZJYA 4BECA 1U0JA 1XP8A 5BYJA 4PPFA 2WWFA 3PENA 4NP6A 4IJMA 1AGPA 1W4CA 4IVPA 2QM7A 3FKSD 4DVGA 2B7BA 2A5YB 4BLQA 1PUIA 1XCMA 4CEIA 3CRRA 1GTVA 4DRZA 3GLHE 1FP6A 4IOKA 3BOSA 1RJ9B 1Z6TA 5LB4A 4TYPA 3GJ3A 4LYFA 4OHZA 5H70A 5B58C 3Q7PA 5EP3A 1KO8A 3EPKA 3SZRA 4AURA 1PJRA 1XRJA 1C1YA 4HZIA 3SBEA 1KJYA 3CKLA 3KXLA 1OXTA 3GMTA 1VG9B 1WDTA 1AS0A 4KI0A 5EXTA 3NEJA 4OHVA 5JZVA 2AWOA 5SZKB 2XTZA 2C8VA 4A8JB 1OV4A 1JXOA 1W49A 2F9MA 3BIFA 3TQFA 5DNYB 3QBVA 1KNQA 4L4UA 4Q21A 4XVRA 3OFND 4LJ9A 4LUCA 1I2DA 2F55A 2RAPA 4PO1A 4BFUA 4GP7A 1E2HA 3NEYA 1II8B 3VR5A 3N5CA 4M1WA 2ZM5A 3K70D 1MO3A 3U7GA 2IYSA 3QBTA 4IDQA 3FPAA 4CT4B 3NHAA 4TL6A 4WAUA 3FB4A 4EFMA 3RRMA 5A5GA 1Z08A 3AEZA 4Q7KA 2DCUA 2CL6X 1XD8A 1W47A 1NN0A 2OE2A 1FQJA 4AKHA 3IGFA 4DCVA 4IRUB 1YE8A 1JB1A 2R44A 4PPQA 5IRCD 1BOFA 1BYIA 3V4RA 4TTQA 1NVXQ 5DHFA 4C0AC 4HDOB 1IN6A 3BB4A 1LY1A 4I1UA 4PQFA 4BZPA 4NCKA 2YWEA 3KQNA 2ZETA 1EFRA 4EJSB 2PCJA 4M1YA 2O8CA 1IY2A 1ZAKA 4KFUA 3N2IA 5EP4A 4US0R 1OKKA 3K09A 1P73A 4H9GA 2JLSA 5CIQA 2W6JA 4QBHA 2GEDA 2A3RA 4Y0AA 2Q3FA 3H2YA 3VAAA 1GAJA 2X19A 1G5PA 1F60A 4FMDB 2CL7X 2BM0A 4UQOA 3EIEA 2ZRDA 4MRRA 4WVFA 4BEBA 3OIUA 2O0JA 4F93B 1NG9A 2BMFA 2H7VA 3T1VA 4DC9A 4JJZA 2FZ4A 1QZXA 2PZFA 2BBTA 4OI2A 2E87A 2PEZA 3T1OA 4IOMA 4DBLC 5JHHB 2XXAB 1W4AA 1CRQA 1KMHA 1Q3TA 2O8EA 1VECA 3U61B 3DKPA 1GL6A 2QP4A 3AF1A 4XTRA 4G0NA 5DHAA 5H8WA 1EK0A 3KUDA 2H8KA 2Y8EA 4IEIA 3QXHA 2HYIC 1RRFA 1SKQA 2WWWA 3P1JA 1DAKA 2CHQA 3DKVA 3MWJA 1A1VA 1DO2A 1WCV1 2WHXA 2H1LA 1KO5A 4MA4A 4LC1A 5CLLA 3MWYW 1FZQA 2JLXA 1RRGA 3I8SA 4NHOA 5H1YA 3ZVRA 4US2R 3SBDA 1SKYB 1BMFD 2J7PA 1XEXB 2QAGA 2DFNA 3VKHA 1D5CA 2NZJA 5KTYA 1QHHB 1E2MA 1E2NA 2ZVQX 5GJCA 4Q01A 1VDZA 4YMUA 2WAYA 3QUSA 2VLIA 2OV2A 2GDJA 1NP6A 3T15A 3CPJB 3ZQJA 2JLZA 2I1QA 1DAEA 1XTJA 2B6HA 1NLFA 4Q03A 5DI3B 2ORWA 3K9HA 4AKIA 1KJZA 1WBBA 3EZFA 4QBGB 4JLVA 2P6NA 3LVQE 4TWZA 4PXAA 1MO4A 1J99A 1XMVA 5FFMA 1ZIPA 4TYNA 2QTFA 1VG8A 1I4DD 3RWOA 1G20E 5E7IA 5JI2E 2OLJA 5UKDA 1QDEA 4NYIR 3ND9A 3Q9LA 4LYHA 3DVLA 3MWKA 1H8ED 4URVR 1PV4A 2V9PA 1E2EA 1WXQA 2CJWA 4XJXA 1UADA 3M6AA 1U9IC 1W36C 4MITA 1VIYA 1M2OB 2AKYA 3EPHA 3E70C 2FE4A 5JFGA 4KBGA 4L8GA 2QPAA 4FWTA 4LJ5A 2PT5A 1P6XA 1YHNA 3Q3JB 2ZJOA 4XWOA 3KXIA 4BFYA 1R5NA 3AGPA 1N0UA 5SZJA 2QMEA 3A1WA 4OYHA 1XTRA 5KUTA 3BH6A 4M0LA 1CRPA 1KTVA 5F3WB 3FTQA 1P9RA 3MJRA 3P26A 3TNFA 1TF5A 2Z5FA 3DL0A 4EFNA 1ESNA 1KSHA 3VR6A 1QHGA 3AP1A 1XJ0A 1QBKC 4Q9HA 2QI9C 3RSOA 4I1OA 4ZDIA 3OEEA 2P2LA 4Q4LA 3VQTA 1TQDA 1IAQA 3WHKA 4KITB 1S3GA 1UKZA 3W3ZB 1XF9A 3BBPA 4XSGA 3R9IA 2VRWA 3IIKA 1OE0A 3RS4A 4G01B 1KK1A 2HUPA 1U2RA 4JBYA 2GBLC 3FHCB 4ARZB 1N2CE 5DI9A 1G17A 3C14C 4O25A 4IDOA 1P2VA 521PA 4LC0A 3V00A 3ZS9A 2JJ1A 5JS8A 3RS2A 4YMSA 1NLYA 4RD6A 4LHYA 3N2EA 5EE9A 1E9RA 3UATA 4LV8B 3H84A 3AH8A 4ZIRA 3SU8A 2GF0A 1GG2A 2FJUA 2J59A 1OHHA 4LRWA 4G3XA 2H5EA 3CRQA 1Y63A 2OUKA 1RIFA 2BJVA 5G53C 3AP2A 4WBSA 4BFWA 5LBIA 2FFBA 1WP9A 3T12A 3ADDA 5JEEA 2RH5A 4HUQA 5J47A 4JLMA 4IOJA 2G6BA 1ZJ6A 4KAXA 1R0XA 4LWZA 3RVBA 3DHWC 3MGCA 4JLOA 1Z6XA 4DIEA 4QJ3A 1XJCA 3AF2A 4A1FA 2X8AA 5AK0A 2XX3A 4P4UA 2N42A 4HAXA 4B33A 4F4JA 2R2AA 1KI7A 1KZ7B 3C41J 3BERA 1AIPA 5E95A 2RB4A 4HAWA 3PUVA 2WIAA 1OH8A 1E9FA 1E0AA 4DB4A 2VPPA 2VHJA 3TKLA 1JR3D 3F5FA 4ERNA 2YC2C 2V55B 5FUXA 4A2QA 3A6PC 3UG6A 1ZINA 4RCZA 4A82A 1FTNA 3KKQA 4FMDF 1N6KA 1U8AA 2VH5R 2VIIA 5KNDA 4OK3A 3GLIA 3KL4A 4IXMA 1DELA 3C15C 1AKYA 3GJ7A 4MKHA 1E0JA 3GJ6A 4QRHA 5FBLB 2BMEA 3RS5A 1N5IA 2QE7A 1Z6AA 2W6IA 1E2FA 1QVRA 1CJKC 2FSGA 3BC1A 3R20A 2IS1A 2ERXA 1XXHE 2Q6TA 2VF7A 1Z28A 2C95A 2F43B 1AN0A 4HB3A 1NN3A 5IK2D 4B6EA 1MO5A 2GXAA 2W58A 2WV9A 1S0UA 4OI0A 3IQXA 3GLGE 1NBMD 2OFXA 5HZKA 1CTQA 1XCPA 2BOVA 4W9MC 3WMGA 3D7MA 2ZUBA 4C2UA 1IN7A 1IJFA 4XD7A 3TRFA 1A2KC 5EP1A 5JWOA 2IA5A 1JAIA 1MRSA 2KI5A 1G64A 4ZPXA 1F2UA 1G9XA 1NKTA 1OXXK 4XSHA 1W2HA 3G0HA 1ZYUA 4IOLA 3KUCA 3PJRA 4A4DA 5D3QA 3T61A 4BFZA 4KBFA 3P4XA 1ZRHA 1XX6A 2JDID 2IHYA 3NBXX 4P31A 4C4PA 4F4CA 1GIAA 2MSEB 2JCSA 4HI0E 4KVGA 1N6OA 4B43A 1XEWY 4PPGA 1G7CA 3K9GA 2AK3A 1XU4A 4IVQA 3U5ZB 5EXSA 2ANBA 1ODFA 1CJTC 3SOPA 3X1WA 4B2LA 4QM7A 2XNDA 3LWNA 4W7SA 2QQEA 1YR6A 4MGKR 4Q9IA 3PUZA 5KNCA 4E5UA 3L8ZA 3ASZA 3SNHA 4RCYA 1VMAA 3OEHA 4NONA 4IFEA 3CB4A 4LK2A 5EE1A 3KKMA 1XD2B 1OIVA 5KDDA 3CF6R 4HYYA 4C9BA 1Z47A 3FMOB 2YWHA 2A9KA 3CX7A 4LV6A 3C4JA 3EZ6A 3KJEA 3U2QA 1XPUA 1IXSB 2WJIA 1Z07A 3QXCA 1CP2A 2JEOA 1OT3A 3C8UA 1UBEA 1W36D 4RFSB 4A0GA 4X8OA 1UBCA 4JZKA 1OXVA 4NPHA 4Q00A 3EARA 1P4SA 5FTMA 4PAMA 2GCOB 3QXJA 3IEVA 1IN8A 1EFUA 4HLUA 1Z2AA 2WOOA 3KKOA 4QJ4A 3REGA 3AVYA 1YZQA 1IY1A 2WSSA 1SGWA 4URYR 2QAGC 3LXXA 1F48A 1TUIA 2ERYA 4KVAA 3UWKA 2WWYA 4OQNA 3TW8B 4TL7A 4BFSA 2OESA 1YR9A 2REOA 3OZXA 1KDTA 2ZE8A 3OIVA 1AZTA 3SFVA 5BQ5A 3ADKA 5CK4A 4MH0R 2J5XA 4V0LA 4HLQB 2FFQA 4IDHA 3F3YA 3X1DA 4ZI2A 1E9BA 2J0VA 4DUGD 1SVSA 2VHTA 4G5SA 2IYQA 3HU1A 4U00A 4ESHA 2NO7A 2WWIA 1KJWA 4ACAA 2R6AA 5FBQB 1KDOA 4QGGA 2GXSA 2OBLA 1RZ3A 1VPLA 4I81A 1U0HC 1FUUA 4AYTA 2RGEA 3UG7A 5DGXA 4ZV4A 3THWB 3BAFA 3A37A 1CJVC 3SI7A 2Q0HA 4EPWA 1QHYA 4BQSA 1KO4A 1T9HA 3GJ8A 1UF9A 1P75A 1NMZA 1ZNYA 2VEDA 3B1WA 3NVAA 4TSFD 4Q19A 3SYLA 1XD9A 3TAUA 3ECCA 5AUQA 4W5WA 4YXWA 4S2EA 1Q1BA 2FGJA 1KI1A 2G0TA 4PQRA 3CH5A 1BIFA 1M7BA 2CLSA 3VKWA 2CNWD 2C2HA 2ZE6A 3U44B 3THXB 2REBA 2CEAA 4WXRA 4UXIA 5BWMA 1F2TB 3BK7A 5CK5A 1VG0B 3VU9B 5JBQA 3GEHA 1TEVA 4XVUA 1RYHA 4KU4A 2DB3A 1WRBA 2CE2X 4DSTA 3I73A 3JVUA 1E2PA 2I4IA 1VCOA 4AG5A 2Q9CA 2AKAB 4MYCA 2GEVA 1W7AA 3SJAA 1HQYE 3VR4A 2AR7A 2O8BA 1NI3A 1K6MA 1W1WA 5HR5A 1DOAA 2DY1A 4CDGA 4D25A 1S8FA 4OBEA 3GLFE 1CS4C 2ZANA 3NWJA 3SR0A 3R9XA 2LKCA 1GUAA 2OCAA 2J0UB 1US8A 1N6NA 3RS0A 4DLSA 4C2TA 3EA5A 1OYYA 4I1SA 4CEJA 2BVNA 3AUYA 4B35A 3B8HA 2ZAOA 5BN5A 1FX0A 5BYKA 1Q44A 2XZPA 4LDJA 4DSOA 3M0EA 4HDQB 2IEYA 1XMSA 3C16C 1WQ1R 4MGYR 4MYUA 2QP9X 4C0JA 4N1AA 2REXB 1GOTA 2YWFA 4TLEA 3THYA 1KSFX 2J87A 1H8HA 3MLEA 1KO1A 1CIPA 2C03A 3BD9A 4Q9LA 5B64A 4ON9A 3GFPA 1E32A 3U3OA 1W0JA 4ZCIA 1SXJA 5KSPA 1ESMA 3OAAA 2WM9B 2JAQA 2WKQA 4GOJA 2WPDA 3AVPA 3RNLA 3QPWA 1N25A 1HY3A 2VSFA 1GRRA 2IUTA 4RVCA 5SZIA 4ILEA 5P21A 2YOGA 3REFA 1R10A 4RJLA 2IYXA 2VA8A 2B8TA 1NIPA 1U94A 4U02A 1E79A 1G3IA 4Q18A 2OO7A 1XDBA 1E96A 1MO6A 1E94E 2KJQA 2W83A 3NIBA 3HPRA 2PMDA 4HZUB 5FPTA 1T3LA 2WMOB 3VR3A 1TEXA 2QRZA 2IHBA 3NH9A 1EFRD 4DCNA 1NMYA 1QHNA 2RMKA 4LJ6A 2OT3B 2AD5A 3RS3A 3TR0A 2F7SA 1HA3A 3CNOA 3RRYA 3U3JA 4B73A 4K81B 1U8ZA 2RGAA 2VP9A 2FSFA 4DEXA 1RJ9A 3GEIA 4GPTA 2GAOA 2HV8A 2W6JD 3BS4A 4AIIA 5TB5A 1ANKA 4E22A 1XFAA 1P60A 3RAPR 1KDPA 4JJKA 4Q7JB 4HLDA 3UMFA 1JEDA 2QROA 4RY2A 2OAP1 3IO3A 3QKRB 4Q1DA 2WKRA 1T8TA 4LZZA 4C7OB 2JJ8A 5J40A 1NVVQ 3NHBA 2FNAA 4QJ5A 4A8JA 1MRNA 2PZEA 5HCNA 1E1QA 3QPVA 4JVLA 2DPXA 3K0CA 3KQHA 1EXMA 2ZR9A 5G40A 2DWQA 3NXSA 4R7ZA 5GVRA 3WY9A 1N6HA 2F3RA 2UVQA 1II8A 4BFXA 1OW3B 2RGGA 3UPUA 1BKDR 3GJ5A 4M4SA 1HE1C 1II9A 4OJQA 2B8WA 4FMBB 4MGZR 1IHUA 1EGAA 1YZUA 2CVHA 2WWXA 3DO6A 2PJRA 1NRJB 4BZQA 4ABYA 2D7CA 4O3MA 4TL8A 5AWFC 3SC3A 1Z0FA 1Q21A 2WOJA 5FR2A 4BRUA 1T5LA 3DZ8A 5HCIA 1D9XA 1Z2CA 2A5GA 2V4ZA 1F3OA 2J7PD 1DADA 1ZU4A 4FD2A 1UDXA 3W90A 4DXAA 2XB2A 1Z6YA 4JL8A 3KKPA 5LPNA 1DBSA 4P33A 2LKDA 4IW3B 4QGAA 4EJSA 2IXFA 3WRXC 3QF4B 1FUKA 1EG7A 2EYQA 1D2MA 2AFIE 2ZUDA 5EXXA 3BB3A 5CDFA 3WYAA 2IC5A 3UXMA 3B85A 4OHWA 1GWNA 2DFLA 3HYRA 3M1IA 1MR3F 1E9AA 2ZR0A 3QKUA 3ZDQA 2ZU6A 4QHYA 1G19A 5C2JB 1Z0JA 3CRMA 1UAAA 1I4TD 2QMHA 2V54A 3BRWD 4KSBA 2CK3A 2QA5A 5L3SB 1NKSA 1VYTA 1KSGA 1X1SA 5FH9A 3BFXA 2XXAA 1W4RA 2YZ2A 1G3MA 5FUWA 5HKKA 1ZM4A 5AJWA 1KAGA 3WP1B 3UK6A 1TX4B 4Z54A 3AB3A 3NDPA 4HLUC 1S1CA 2B92A 3LY5A 2OXRA 2Z83A 1T3SA 1FP7A 1DS6A 3CH4B 3NDBB 3EX7C 3IIJA 4D4KA 1W4BA 2QPTA 2H57A 4FI3C 2IK8A 4D0LB 2QUZA 1N0VC 2HF9A 1XEXA 1B23P 5GJVC 1P61B 3RDPA 4MQBA 2G9NA 4EPTA 3K9LA 2QZ4A 1QHHA 3BGWA 1U8YA 3I5YA 3EIQA 2BJWA 2HT6A 1HT2E 4DT1B 1Q22A 3E2IA 4MDEA 1KMQA 1R5OA 1ZM7A 3EZ2A 1B0UA 4M2LA 2GRJA 5DI3A 2QSZA 1NLZA 2H18A 2ZJBA 3O47A 1V43A 3OEED 4LJAA 4LYJA 4FN5A 3T1QA 1IXRC 2J7KA 1N6IA 1SULA 3AKYA 2E9SA 4ZO4A 4MKIA 4PZLA 3DEFA 4JS0A 4G5GA 4OK6A 2JJ2A 3VR2A 3VMFA 5HE9A 3B2EA 3S1AB 3O8CA 2KB0A 3LBHA 2ASEA 4A9AA 2JJ1D 1ZU5A 2HLDA 4JYBA 4NH0A 3CO5A 1BYUA 2A30A 1UKYA 3TUZC 1LS1A 4AKGA 1TMKA 3QKTA 5D3MB 1PUJA 2VP4A 3IQWA 2D4HA 1OHHD 4YMVA 5JLJA 1NNEA 1WE2A 1FNMA 2CHGA 4Q4JB 4C30A 4D4LA 4KFRA 3MD0A 3I3SR 1P3JA 2QTHA 1ZIOA 3KB2A 3WYFA 3TQCA 2WJJA 2JLWA 4GBMA 1Q57A 5FR1A 3O8RA 1BS1A 4TQUS 2ZI6A 2GILA 2QBYB 4TMWA 4DHEA 3W8RA 4KXFB 2ZRKA 3CNNA 2NO9A 2ZJZA 3IUYA 2XSZA 5L8VA 5JCPA 2VP0A 3EWSA 3IO5A 4R9UC 5KDLA 4AWXA 3AVUA 2GF9A 1E0SA 1L4UA 1L8QA 2P0EA 4NYJQ 4Q7MB 4XOIA 3MWLA 4QL3A 2JGNA 1BO6A 3LH5A 1E4YA 3K8YA 4URUR 2BMDA 5J5CA 1AQUA 4NYMQ 3TUJC 1T4GA 3GLFB 1W0KA 3TVTA 4EIWA 5F98A 2JLVA 2IEZA 4QGFA 4RD4A 4TYQA 4IFBA 4Q1CA 4ZCLA 3PEVA 4GMXA 1GILA 1T3HA 2DR3A 1QHIA 1YJ5A 1RFLA 3L0IB 2JLQA 2NZ8A 5EZ5A 2W00A 5FI1B 4DSUA 1E3MA 4ARZA 1Z5ZA 1ZMXA 3RC8A 4DWJA 1JECA 5CM8B 2GEUA 3X1YA 2QE7D 5DYGA 4PPNA 2W6ID 3WHLA 1X1RA 4IVRA 2O0KA 1VIAA 1S9DA 3EPJA 5G3ZA 4JL6A 1W2GA 4EQ6B 1NG1A 2VP2A 5KYKA 4AD8A 1E1RA 1G3RA 5FOVA 5B30A 1X8LA 2P67A 4ZDKA 2DWPA 4CZ2A 1RVDA 4XD7D 3R9WA 3ZYCA 3A8TA 4BLTA 3KDSE 4BE7B 3U4QB 3U7FB 5IDVA 4OI1A 3BE4A 4JVMA 221PA 2XJ9A 4NMMA 3R7WB 3V4FA 1NMXA 2G83A 4N0DA 121PA 1KGDA 5HE8A 3W5IA 3VKGA 4AYWA 1HYQA 1LTQA 2ZRHA 4HB2A 1WF3A 1P5ZB 3A1TA 4DKXA 1E99A 1XZQA 1ZP6A 3CZPA 3LBNA 4JLNA 1GSIA 1TQ2A 3FVQA 3AP3A 3DZDA 4ACBA 4N3NA 2C96A 1W5SA 4F38A 1G3QA 3TSZA 2V7QA 4V03A 1ONBA 4GMDA 2ZYTX 3CR7A 1LB1B 2XNDD 4OQMA 4G1UC 4R2IA 2RKOA 3ZGXA 3QIAA 1FTSA 3QPUA 4R2HA 2DHRA 1N0WA 3MSXA 2XZOA 4A0FA 3U6KA 2BV3A 3WMFA 4PHHA 4A8JC 1PZNA 3BWDD 1X6VA 3OEHD 1KI8A 2ONKA 2ZSDA 4LI0A 5JJIA 4K8OA 3LA6A 4ZDWA 3K0CC 1D8TA 3ND8A 3IEUA 2GNOA 5GJWC 1ETUA 1JQJC 4NDZA 1G5RA 2F43A 4NZYA 4CVNA 2BKEA 1SVKA 1NVWQ 1A7JA 4X8HA 3TIFA 3FYHA 3I61A 1ZNWA 3T5DA 1VHLA 4PHTA 1SVLA 5JI3E 3A4LA 1KY3A 3CWZA 4GDFA 1U0LA 2YINC 4DCSA 1UKVY 2ZJYA 3QEOA 3UANA 3PIRA 2CCJA 1FMLA 4FCWA 2B21A 3HWSA 2P6RA 1G6OA 1HH4A 3T1TA 4JLPA 4M53A 1A4RA 4B48A 2WSSD 5HZHA 2ZSAA 4LYAA 3PUYA 2P6UA 3A1UA 3QJYA 1ZM2A 1VCIA 4AC9A 5BW8A 3PEWA 3FOZA 2AK2A 2H92A 2FSHA 3O8BA 2HYDA 4V0ME 3RABA 4DLXA 1X8JA 4BRWA 2CVFA 4EKDA 5C4GB 1RPZA 1JR3E 3LVRE 4EJSC 5C46F 1OB5A 4DIDA 2ZRPA 1LS6A 2NPFA 3FWYA 4BFTA 4A92A 4PZYA 2F9LA 1M7HA 2PZGA 1WMSA 1Z0AA 1FMJA 1MOZA 4LHWA 2ZSBA 3HDTA 2FEMA 4EPRA 2KBEA 2ODNA 4RD2A 1VYVA 5EE5B 5KHOC 2IXEA 2JA1A 3TW4A 4RZUA 3AVTA 1FQKA 1W44A 3B1YA 3THOA 4C0SA 5J4HA 3ZD6A 2ZPTX 4YC7A 1JI0A 1UPTA 3SE0A 1IQPA 1YZKA 3K9NA 2FFAA 2FFHA 1MV5A 3WBJA 1JJVA 4FXPA 1YR7A 3ZIAD 4CF7A 1XD2A 4B3DA 1IY0A 2A5FA 4IHQA 1MT0A 2ANCA 2WZQA 4GFDA 3GLHB 4RD1A 1NBME 4PSKA 3QSYA 3OHMA 1HE8B 2B7CA 2ZSFA 3I32A 3QKSB 3QY0A 2NO0A 5J4LA 3K70B 4Q4HB 3IBGA 3AKCA 1OXSC 4D80A 4AG6A 2GK6A 4JKIA 2R6CA 2ZU0C 3EC2A 4HAYA 4YXWD 4HAZA 4RFSA 1Q1QA 3I5XA 1EX6A 3ZH9B 1IN4A 2GA8A 4DLRA 3JVVA 3VR1A 2GCOA 4JYCA 1S96A 5AJYA 3DOFA 4KLNA 3M4YA 3NTUA 1TADA 3MUFA 2GZDA 4LHXA 3RC3A 1CR2A 1SVOA 1J8YF 3U3RA 3KJGA 5JMTA 1FOEB 8OHMA 1Q20A 1ZC3A 4PQYA 3TMKA 2OZEA 1LF0A 4EUNA 1NY5A 2AHOA 2WJHA 5JSZB 4C0QC 4Q4AB 3L2OB 4HAUA 4AI6A 1GRNA 4DLZA 4LBZA 4OQLA 1JPJA 4MRPA 1YQTA 4TLBA 3GP8A 5H68A 3K09C 4JLKA 1T6NA 1LF5A 2IYRA 5FTKA 1RKBA 2F1HA 2FG5A 4AYXA 3THWA 1VG1A 1Z0DA 2CCKA 1G5TA 2ZSEA 2OEPA 2ZQ5A 3B13B 2J9RA 1YZLA 5LD2B 2QQ0A 1MABB 1RRPA 3A58B 1H8HD 3UKDA 2X2EA 1KKMA 1Z29A 4BFVA 4MRSA 2QT1A 1R6BX 4C0BA 1W0JD 2NIPA 1SXJD 2NO1A 4V0NA 3TE6A 3FKQA 3OAAD 3ZD7A 5L3RA 2QP3A 2C77A 2V1UA 4PX9A 5GJBA 4V02A 2WPDD 3I92A 1PLKA 2XTNA 2WMNB 4WZAE 3U44A 2JIZA 4L5BA 4M9SA 4RKEA 3TSOA 3THXA 1OFHA 5LDDC 3SQWA 4LHZA 3NKVA 1F2TA 2N46A 3VU9A 4A2PA 3TAHA 3OESA 4MUBA 4F4IA 3ZVMA 5K8IA 1EWQA 4Q66C 1G7TA 5E4FA 1E79D 5JRJA 3VNUA 3VHXA 1KI3A 1GITA 4Q47A 4TL9A 1A2BA 4DCUA 4E09A 1AM4D 3FFAA 4EAQA 1NSFA 1RW4A 1W46A 3RANA 1CULC 4TQAA 4I1VA 4LJYA 1OFUX 5ELXA 4NU0A 3SYNA 4B3BA 3IPYA 3ONWA 1TUEA 2NMVA 1AKEA 3DM5A 1TPZA 4P4TA 2FPMA 1IONA 4DLYA 3BORA 4ASUA 2AXPA 2J0UA 3B60A 4YLGA 1KI2A 3MRSA 2FF7A 3A4MA 4QGHA 3F8TA 4YMWA 3PXGA 3AF0A 1CR4A 2F1RA 1GL9B 4TMZA 4BLSA 2EQBA 5HTKA 1R2QA 3HP1A 1DAHA 5A4JA 3PR1A 2VHQA 2O5VA 4MKGA 3KTAB 1CU1A 1ZVQA 3DPUA 1KI9A 3LFUA 1P72A 4QBFA 4ZKDA 3TLXA 3LW7A 4NKRA 2PMKA 3FMPB 1E1QD 1TNDA 3KJIA 4LOAA 4TYWA 3MAAC 5AJVB 4B34A 4IEEA 1JPNA 4LY6A 4NBSA 5FBWB 3ZIAA 2EU8A 1E0KA 1YZNA 1F2UB 1Z83A 2ZJAA 4P3YA 3FMFA 1NF3A 4NCNA 2OG2A 1E9CA 2NQ2C 4PC3A 3EASA 4L16A 5EXPA 1GM5A 1QVAA 3ADCA 1R8QA 1M34E 821PA 4OK5A 5GADl 1J90A 3AQ4A 5FPSA 3UIEA 6Q21A 3AKDA 3BB1A 3VFDA 5JWRA 2A5JA 1G1MA 3IPXA 3A1VA 2PT7A 4AY2A 1QG2A 4Q9JA 4DDUA 4HZUA 3B1ZA 4JIMA 4BLRA 2ZRGA 5TDHA 4RZ3A 3ZZ0A 3KZ1E 5KSZA 1W5TA 5FUVA 3SJCA 4A6XA 4PHGA 1E2GA 2QY9A 3EW9A 2VBCA 4UNNA 4CW7A 5FPKA 3MJHA 3SS8A 4DLWA 1VKJA 1P7CA 4LHVA 3PEUA 4M1MA 4JKYA 4IKEA 1OLOA 3PG5A 4H1VA 2R6GA 5C1BA 2ODBA 3FFBA 3PVSA 1KYIA 1E6CA 2XNSA 4B3CA 1CBUA 1S9HA 3IILA 3QKRA 1NJGA 1K5GA 3L8YA 2K5UA 4C7OA 2CK3D 3TJZA 3D8BA 4MRVA 1EFTA 1E9DA 2VQSA 2I3BA 2R6DA 1Z6GA 3LV8A 1TU3A 1XCGB 2GTPA 3QXXA 4U7DA 4CEHB 4YDHB 3TGPA 5HKKD 2PH1A 1E4VA 2UZIR 5KO2A 1G8HA 4GI7A 2H17A 4XWKA 1KNXA 1EFHA 4XIGS 4UKDA 4II7A 4QHSA 2DYKA 2HXYA 3HR8A 3W6NA 2Z6VA 2V1XA 2IUUA 3CUEF 1E9SA 4B74A 5GVSA 3AVXA 2O52A 2CLCX 3PUXA 3WRYC 4LX0A 4DZZA 2ZRJA 1XTKA 2WJVA 4NL4H 4GP6A 1YVDA 5CYOA 5EZ6B 3K0EA 1ZW6A 3VTKA 2R6FA 2AX4A 3RHFA 2CE7A 2XOKA 2YWGA 1NVVR 2OCYC 2ZI5A 3AV0B 3O8DA 2IT1A 1Z0IA 4NCHA 5FTJA 2QG6A 1N6LA 3WMEA 4NE2A 3W5JA 2QNRA 1LV7A 3P32A 1II0A 4Q1AA 1EWRA 2ZI4A 3QF4A 3LXRA 2IX3A 3EPLA 2GVZC 4E03A 1MKYA 2CMKA 3I8XA 3LRPA 3HYTA 4LGMA 5KU1A 1CKEA 5FPHA 1SVMA 4OKSA 4DB2A 1XMIA
chains in the Genus database with same CATH superfamily
1C3JA 4LISA 3UT0A 4URWR 3ZYZA 4X44A 1Q0UA 1GA4A 1NLUA 4J1TA 4K5QA 4QDUA 5DYIA 5CDUA 3GRCA 1AKVA 2PU5A 4IDDA 5HM8A 3IVAA 3ZHXA 2JLUA 2FP3A 1R4MA 5L3SA 1FJHA 1C1XB 2FY8A 3OZIA 1AE1A 3GFRA 3JQ6A 4QFMA 3GY0A 2IZOA 3A2NA 2I4TA 3NEAA 1AB6A 4B31A 1SH7A 5B1DA 1M74A 3PEEA 4RHXA 3FIUA 3IPLA 1B8OA 1H1TA 1XZPA 2HM7A 3Q2IA 9ATCA 5M34A 3JQQA 5H7XA 4G6ZA 3U3KA 1MB0A 1DUIA 4Z4EA 4FWBA 1XAIA 2QN7A 1CRLA 2NYVA 1VFNA 1XHFA 4TTSA 3LL4A 3IBYA 2VDVE 1P9WA 2PMCA 3R0JA 3IQHX 3R1IA 4I4LA 1KAOA 4NECA 5G1PA 5T64A 1L5GB 5AUOB 1L7VC 3EG5A 1I3LA 4M9XA 2G71A 2PGOA 4YRZA 5IMSA 1KYXA 2W5UA 1J7KA 3IV6A 1UIRA 3IEMA 3MCWA 2MSCB 2W6ZA 3UJ9A 1JKJB 1I4LD 4B82A 5MFZA 2AEFA 2VNHA 4EJ0A 1TYZA 4PRLA 3FMVA 4MMYB 5IC4A 3PE4A 2R1VB 2O05A 4EARA 3LVBA 4HB0A 1EWVA 1NAIA 2I54A 5HDQA 1Q77A 1U5CA 1ZGZA 2XSZD 4OSPA 5A0FA 4O4JA 1PJZA 1VSUA 3HYLA 3I04M 3FDIA 4LZLA 2R4QA 3GGOA 4FMCB 1AUPA 5JZMA 4EG5A 2CNDA 3CURA 3GDHA 2FA9A 4IHJF 5JDIA 1GSHA 4GQAA 2JK0A 4GZMA 5AVXA 1U4NA 3BE8A 3VX4A 3H7IA 3WGIA 1I24A 4EWLA 3K3PA 5IXYA 2VC2B 5JZ9A 2DAPA 3JYQA 2FSIA 5L3ZA 3TL3A 4KN6A 5IVIA 2A5DA 2AB0A 2CJYA 2VNKA 3P9PA 5BOVA 5L53A 3L3BA 3KEFA 2FQ1A 3DUFA 1AB5A 4A2WA 2NUTB 2IYTA 4I4NA 1PL7A 1TA9A 2SCUA 2CHVA 4DMLA 4X1YB 1PV1A 1XA4A 2BYTA 1UM8A 4X97A 4OQFA 2FPGA 2HJHA 1J24A 1O94A 3NC1C 4K86A 2NYRA 1PNOA 3H8JA 2GSWA 2FP4A 5CT9A 2P5TB 2PMBA 4IAOA 1EP1B 2XOXA 3CZRA 4KHPB 5KEIA 1A76A 2ZS8A 3WBKA 3HDVA 3DNFA 1BEEA 4FWIB 5CURA 5YASA 5TMPA 3K30A 2GCNA 2E4WA 3KTDA 3T7RA 5KJ1A 4FSHA 4HJRA 1E1RD 2Q1SA 5M3BA 3ZCPA 4LF6B 1UKEA 3FROA 3IP1A 1ZKMA 2PSSA 5L40A 2JZOA 3MXTA 4NBTA 1PDOA 1RJGA 3KG2A 4RKQA 2BF4A 5CVJA 3L0DA 4W82A 2DPHA 2WAAA 3G5UA 4ZCTA 3T34A 4FK8A 4J1NA 5ECDA 1Z63A 2ES4A 2WQZA 4WZAB 4LGVA 3OSUA 1T91A 4CMJA 1NX9A 3QVVA 4AKEA 4R71A 3CCFA 2PKQO 5CCXA 4B4OA 5HTOA 3OQMA 8MHTA 2KBFA 2WJYA 4DUYB 2QBYA 3DEZA 4WZ6A 4DMRA 1D6JA 3B9PA 5KREA 1ZXLA 2N1BA 1J8MF 3K1AB 3L4BC 4CQLB 4WT7A 5BXQC 4IG9A 3JQ7A 1WM1A 5DKFA 3FLAA 2QTVB 3QLTA 1ZK4A 3H9GA 1GPLA 4BQFA 3IJ5A 1IVYA 1DC8A 1ZGGA 1PI3A 4LBVA 2F8TA 1WCXA 2WM8A 1X7DA 4CLOA 3AVWA 1M5TA 3T5GA 3EG9B 4EMUA 5AK6A 3QWFA 3PXCX 2VF2A 4FYMA 5FAKA 2IH5A 2P8JA 3PJGA 4TT3A 1KH3A 1V8OA 2WKWA 5NULA 3EVZA 3PNLA 3WWOA 1RTTA 2O7NA 1QONA 4H7KA 5DX1A 1TUBB 2ZBRA 3VC7A 3OCXA 4JB8A 4MDHA 2Z2IA 1PR9A 4NOLA 3MHTA 2PS0A 2GPSA 2HREA 3ZLBA 3GH1A 1B1AA 4YY3B 1QG6A 2I78A 2EBHX 2GEKA 4HB4A 2XMRA 2FMHA 3F5MA 4M8KA 1BSVA 4L8YA 2B94A 4FDVA 4V0SA 1QZUA 5F3DA 5JADA 2ZUTA 3TAXA 3HNRA 3RRZA 4EDFA 4IXNA 4BMVA 4KJZA 4GKAA 1E59A 3QI7A 1PN3A 2BFFB 1J9GA 2HF2A 1I13A 1C3OA 1I3MA 2VK8A 2WWGA 2ZOSA 3L7BA 2RGDA 4HMOA 4KIJA 3PIDA 4NJMB 4RIFA 1EB9A 1ST3A 1V8ZA 2YNMA 3KT3A 2PWZA 4LV5B 3TBKA 1Z6PA 2UZ1B 4L9SA 1G41A 1DHTA 3WDLA 2HSDA 3MQFA 5CLQA 4DF3A 5TSDA 3FVTA 4JCCA 2O8FB 4IIJB 4PC1A 3R7DA 4NBLA 5AVJA 1XMOB 5DM70 1DXOA 3D8UA 3U7IA 1Q92A 3TIIA 3ASUA 1Q84A 1R8XA 5CEFA 1GKLA 4L27A 1KY2A 3AW9A 4O1IA 1RYFA 3JTMA 4UTOA 3ANTA 2CL0X 1H3NA 3GLQA 5K3CA 4UM9B 1DAGA 3OPVA 1VI6A 1OAOA 5BSUA 1YI0A 2BDTA 1J33A 1YR8A 2ON6A 3WLOA 3LZDA 1ML3A 2GHQA 3AL3A 4RELA 4YAOA 2HWUA 3PFIA 5FWAA 1EUZA 2ZRIA 3O93A 1XALA 1MH1A 4DADA 5FA8A 4HATA 2IYOA 1ZUIA 1Y9EA 2KWIA 4YXFA 3AO0B 4I2NA 2YR0A 1N5MA 1TVEA 3NBAA 3CBGA 2VHUA 4GR4A 4I19A 4QLAA 1VDMA 1XEWX 2HGZA 2TMGA 1TT7A 1D7AA 2CF5A 3UJBA 3KQMA 5K8LA 3CW8X 4AMGA 3OX3A 5DXAA 4F9GA 3AVVA 4URZR 4QKQA 4ZEOA 2P9HA 4Z1MA 3VNRA 1H2RS 1YCHA 4GT1A 2V7VA 2IV3A 5HFAA 2IYUA 2R8XA 3BJIC 1GEEA 1GGHA 3DOOA 1H2XA 4FP9A 4MKXA 1ZD5A 1CY4A 1TU0A 1P2UA 5H59A 4GUAA 3SYMA 2RGNA 3R3ZA 2GM5A 3C5CA 1R6UA 2O5CA 5IT9A 1T3GA 4GDMA 1DKQA 3D6TB 3RODA 5JLAA 1NPTO 1N3IA 2BMJA 2EVWX 3AVOA 1M6NA 4FQ5A 3GGSA 5M7EA 2HRZA 1FFAA 4OCZA 1Q3KA 2I03A 3F5SA 4LDZA 5KOYA 4BE7B 1VRWA 2PUAA 2ZIXA 1N7IA 3X1ZA 2YOHA 3R5HA 4H2DA 3DOEA 3QWHA 2Q1XA 4Z0TA 1U63A 2CB9A 3REQB 4BASA 4D92A 4OLBA 1W5FA 2OQVA 3PNSA 4BWGA 4TMFA 2G1KA 4HYEA 3CY6A 2H1FA 3PQ2A 1XTSA 2HRRA 4YREA 4EZIA 2D06A 3KYIB 2C7BA 4IZIA 1S6YA 1INLA 5AXAA 5ANRB 1UXJA 5AW4A 2B36A 1J06A 1ZC4A 2KM1A 1MBZA 2YVAA 3ELWA 4O4LA 5EKUA 1IC6A 2GJ9A 1M5UA 1OC4A 1PYOA 3PITA 2BR4A 4XGNA 1VXRA 4OLFA 4Q3KA 3S29A 5CLFA 2IYYA 1J2JA 4Z7OB 2IDKA 5KDOA 1VL2A 2YOFA 1GQQA 3CPEA 4UE6A 2A94A 2D0PB 2IZ0A 1G6Q1 4A26A 3O3NB 2D0OB 1EFVB 2H0AA 3QNWA 1JPVA 5SY4A 4BNLA 5FX2A 2OGWA 3PCXA 1U3DA 4IIEA 4OI4A 4Y1RB 3OOSA 2ECKA 2R97A 3LYLA 4QBIA 3TI7A 4DY4A 4JYAB 1CUGA 3LD9A 1VMIA 4C3ZA 3AETB 5CJ2A 4D8UA 2O8CB 4HRAA 2BFAA 3CPHA 2Q5FA 3WO0A 3CMCO 3PNBA 4JP5A 2G76A 1U7OA 1A1SA 2CDNA 2IJGX 4JSYA 5DH9A 4ZU1X 1T15A 4F92B 1LDBA 3WWCA 1ZK0A 1GNPA 1I8TA 5EMLA 3AEUA 3OCWA 2HJSA 4X6UA 2HU8A 2OFPA 4J1TC 3B82A 2Y99A 4M1KA 4DLTA 5C8YF 4O6VA 1PD1A 2WTBA 3E1SA 3KPJA 2D62A 4TVSA 1ZAYA 4BMZA 1KYZA 4US1R 4OX9Y 4C2AA 2W4IA 3KOUA 4XCQA 5AOBA 3H2GA 1JEEA 3AUXA 4JB3A 3ROGA 1O03A 3W34A 3OA0A 4CN8A 2Q4BA 4LA4A 4ER6A 4U63A 3NG1A 2ZS9A 3L0BA 4KYIB 2PD6A 1S02A 1ZSVA 3HR7A 4FIDA 3GLHA 3OFNA 5A05A 4QQRA 4FZ3A 3FHOA 4BP9A 4ARIA 2HKIA 2F3PA 3HJNA 3K53A 4LMAA 2DUUA 5AH0A 4FFBA 1Y37A 4FX2A 5DO9A 3NFYA 1K89A 3G9UA 2FOLA 4X3OA 4X95A 1VYUA 3E3AA 4BJ3A 3ICQB 1FRZA 4H27A 2Z6UA 4N5NA 2X3UA 5LP1A 4MCHA 4N0PA 1PQYA 4JROA 3UJAA 4DLPA 1R8SA 5THKA 2OFOA 1KK0A 4GX0A 1NDQA 5WRFA 2HJVA 2JIZD 3QEJA 4NYIQ 3PHJA 5AKJA 2AFHB 2LXNA 5ELMA 1MEOA 2X7JA 1I1NA 1M76A 2YRXA 5BV7A 1U1DA 3KOZA 1GPNA 2NSLA 3Q5EA 2J0SA 3RRFA 3ZWBA 3QMPA 3DFFA 1OH6A 2GZAA 4L0DA 2HXSA 2RCNA 3NWBA 2F3TA 4V3CA 4QC2A 2WNHA 1G6KA 1DOZA 4EGJA 4B3MB 2XECA 4ZI3A 4G5FA 3OCYA 4DM4A 2RH9B 4W9NA 4ZO7A 2CXXA 5IABA 4ALKA 4G1BA 4FYHA 3WLPA 1B42A 1M0TA 1IOZA 1T5DX 3LCUA 3K1JA 5JDIC 1NYTA 2A7XA 4NU5A 4Q4AA 3ZCSA 2QAIA 1Y3AA 2EX1A 4LFAB 5F1YA 3HXKA 3RC9A 1TCBA 4ASUD 1CEEA 1WA5A 3AUUA 1QCDA 4ZVQA 3JQ8B 2W0SA 5U1PA 1G21E 4N3CA 1THTA 1V1MB 3WKDA 4HMQA 4OMDA 3GC6A 4GP9A 4Y2VA 1G8YA 1X9GA 3UF0A 1J70A 4HH1A 1U2SA 5L3VA 2D2FA 2NM0A 3A6KA 2K2QB 3AEQA 2Y1XA 4FEYA 4E32A 5DCWA 2FX3A 1O94C 5B4TA 1P62B 2J6IA 5D2CA 2C5GA 2F59A 5C8ZA 3KQLA 2JCBA 1CY2A 2EWWA 2IUSA 3GGGA 4CQNA 2G72A 3PJDA 2PKYX 3DXFA 4DLVA 3AY0A 4K9SA 4EW2A 1CCWA 1JS1X 2N3ZA 1YBMA 2GD2A 1MC5A 3D2CA 1JBKA 3AGQA 1OIWA 1LBTA 3H05A 1BX0A 4HFMA 3ENNA 1PVVA 1H6CA 2OP0A 1GA1A 3D0RA 1MJ5A 1OXUA 4PLFA 1JILA 2B5VA 3CM0A 5T8KA 3ELUA 1Q7BA 1M1YE 2PUFA 1JWAB 3AOEA 1FS4A 2Q5CA 4CBVA 2IS6A 3ENZA 4HQ6A 1YS1X 3N2KA 5CPBA 1BMFA 3UWPA 4CIXA 4F56A 2YBEA 1BG6A 3G79A 5H4GA 2V59A 3HYSA 4UVIA 4Q39A 3LUAA 2LP4Y 1IAVA 1R5BA 1KS2A 3KTFA 1DJOA 5H02A 5AVWA 3K0SA 2D13A 2P8SA 4ND3A 4D9EA 1QPGA 2C31A 3OZTA 2BP7A 3LP6A 4MGHA 3TTXA 5ITZB 2MR5A 4KMSA 1BEUB 2EFEB 4HJXA 3SJZA 3GEEA 1QDUA 3LDAA 4KNWA 4AZSA 1SVWA 3LC1O 4KR0A 2Y4NA 2R00A 4MPPA 4WJZA 1JR4A 3B1JA 3G8CA 1C3XA 2WEKA 3THSA 3KQUA 4DOMA 2XZLA 1DRKA 3AM4A 3F98A 5AW1A 4IQ4A 1MEEA 3T3DA 1L4BA 5DE3A 4NAHA 4TQ9A 2OWEA 1AVTA 1TC2A 2RGXA 3NHMA 4W63A 4CG0A 3RTGA 1GTSA 1IOVA 4AIRA 2Q9BA 2CVPA 2PUBA 1PK8A 4UU7A 4YO8A 1WBDA 3MMXA 4XCXA 4YCAA 2G80A 2VDQB 1TGVA 2GYWA 4R98A 1HM5A 5A4MS 1DJMA 4N5IX 4DZRA 1GTG1 4TS1A 2IHNA 5CDYA 1SXJE 3KTAA 2MYUA 1SZPA 4X63A 4GQIA 3Q8XB 1L1RA 4CTMA 1POWA 3PA6A 3WNBA 4C4XA 4PZDA 1K68A 5CVVA 4ZK6A 2HSEA 2YC4C 2ECQA 1BE6A 2ILVA 3GFBA 4N54A 4XYBA 3L07A 2B78A 5I7AA 4RTKA 3ZLJA 3IDAA 1WVIA 1EX7A 1G9TA 1HQDA 5HFJA 1J25A 1E1CA 4BVAA 3K1ZA 4LOHA 4EL0A 3T5TA 1RI2A 2Q3HA 1PLJA 3A05A 3ABSB 2XHEA 2CXNA 2FPIB 3BXEA 4UNSA 4L15A 5IKMA 2A59A 1ZOPA 1KU6A 2DBRA 2TMKA 1K8RA 1Z16A 1XEFA 3ED5A 4HUQB 4MI3A 3EFOB 4J2OA 4MB2A 4B3FX 1OFIA 1P6QA 4EG4A 1NWHA 5EP2A 1GR0A 3RADC 2I29A 1KJNA 1OAOC 2WNSA 3ICOA 4L9RA 5AVKA 2BDUA 5I6DA 1KBZA 4F3NA 3GO4A 2IU6A 3A3PA 3KQTA 3R6TA 3VR5H 4NK4A 3MM4A 2RHGB 2W2NA 3HSSA 4E2FA 2WICA 4IDNA 1MA3A 2XOKD 2G1JA 3D0OA 1E3LA 1JUDA 2Q3JA 2P35A 2WINI 2HFJA 2Q2WA 4IDAA 3H4TA 1NFQA 1SVUA 3VTAA 721PA 1TB4A 2D3WA 5E3IA 2IUYA 5TQ2A 2ZT5A 3D6HA 3TDMA 3RUFA 5B12A 1ZN9A 2G77B 4CIAA 4QUBA 1TLLA 1BN7A 1SBHA 2DOKA 1MFZA 4P1ZA 4IH4A 4P83A 2R5FA 4V0KA 2BRUA 1BU5A 3FCCA 1OSNA 3K32A 4JNKA 4S1OA 1X70A 5DHRA 1GZ7A 2NVUB 3HG7A 3RWMB 4B3DA 2HR1A 3W1EA 3FUTA 1ETHA 4W8GA 1UH5A 2JGLA 2RGNC 1NT4A 2VT3A 2G82A 4QHTA 3SLRA 1O6ZA 5EJFA 1X3LA 3KZXA 3CLVA 5T67A 1REQA 1Q11A 2EFGA 3CIOA 4R1SA 1N6RA 4NS1A 2O2EA 4XGIA 2OC9A 5FBVB 4KMRA 3SAJA 2B8JA 5DNCA 5K0TA 1FNNA 1OXBB 2XYQA 5BOSA 4X71A 4M8IA 2BJHA 1UJNA 1T0UA 4PSCA 3HUTA 3M1LA 3V7WA 1KWGA 4DDTA 3T3HA 3FHLA 1GO2A 3ILHA 1NBAA 1NA5A 4Y2PA 2HSJA 3KFVA 5ALHA 3H86A 2RHMA 4Y1FA 3K5IA 4O4HF 3RHSA 1N8NA 3CEHA 2XE6A 2X9LA 3ZVLA 4C0HA 4GAEA 5EXDA 3PWZA 3TD2A 2ZIAA 3LX6A 2R6R1 5H3HA 1UC4B 4BCDA 1HE5A 5KQGA 3FDFA 4J03A 4PYIA 3WGKA 3C7TA 5E2BA 2IPAB 4IY1A 1I6MA 4Z3KA 2BEJA 2C78A 1UBFA 4I50F 4HAIA 2ZSJA 1WCYA 2W2KB 3RV3A 3R24A 3HDHA 3MOIA 1DXQA 5CM9C 1E6EA 1RQ2A 1W48A 3SLKA 1WW2A 3ESRA 4I66A 3FMIA 3EAFA 5T3UA 1G5HA 4D4MA 2O2SA 3WIEA 4DC1A 4AZ3A 3FI0A 1XCBA 2FHSA 4O4LF 3T35A 1CB0A 1SK9A 2ODWA 4MUMA 1B4DA 2G6TA 4MQMA 4ZRMA 2HLNA 4HWKA 4GZLA 3JQ9A 4M1SA 3S8YA 1XB2A 1P9LA 2GJSA 4LTNA 1VTKA 2HC9A 1X0XA 2M2IA 1IU9A 2EYUA 3CH7A 3P71T 1QNFA 4O63O 4RS3A 1RKQA 4X7RA 1M2GA 3ND7A 2GR9A 4UXHA 1THZA 4YGYA 3ZE1B 4K05A 5JMWA 1U1IA 1NY6A 3LDGA 1KHHA 2O7QA 4LS3A 2WE7A 3MAJA 1G4AE 2PU7A 4YJ2B 4YQFA 1IXZA 1HG0A 3KO8A 1P39A 2AEJA 3LWBA 3U4HA 1JJIA 3MCZA 2FGKA 2R8OA 3UK7A 3IPRA 3WMXA 4CKCA 4D3SA 2O2ZA 1HNNA 3EXIA 1BN6A 1NV9A 4LRYA 2UYYA 2RHBA 1EZ1A 1U81A 4IRXA 2LZ0A 1T4MA 1N75A 1JNXX 1TYCA 4Q82A 4ZKEA 2FPKA 3AERB 1IBRA 4MGEA 2BUCA 4PGGA 3WGQA 4DZTA 1NUAA 3OT1A 5IK2A 1O94D 1Z5GA 3CRW1 3LOQA 3ENVA 4XRGA 1UOEA 3UAXA 3I6QA 4FTWA 1JIUA 2FZLA 2IW1A 1Y7LA 2RHWA 2F3SA 2ZIVB 1TK3A 1N7JA 1PSDA 3H13A 4E3WA 4AROA 4JBIA 4N41A 3KDPA 1JQ3A 1QZZA 4IYJA 1GD1O 1ICEA 3IA2A 1AZSC 4HEHA 1X8KA 4PR3A 1IH8A 4FE3A 3WYGA 3ID6C 5DT9A 3VZQA 2OXIA 4JMPA 1DJQA 4U4AA 3QJGA 4KDRA 5JXGA 1ESZA 4C6TB 6ADHA 3MILA 3RUIA 4W9NC 1XQ1A 2QPOA 2R7AA 2WSMA 4AN4A 1ZVJA 1TQ8A 1AZWA 5HF8A 4ZYUA 3QX9A 1EQUA 4G56A 2QT0A 1Z7WA 2Z4SA 2ZYSA 2I6FA 4Q9DA 4R8VA 3V1NA 3UWOA 3VDQA 5DIFA 2E1PA 5E4JA 4CDNA 2GHIA 4EJ2A 1NURA 5DLDA 2VHCA 1EA5A 2QIPA 3GN2A 1QFYA 4FFDA 1B16A 1NUHA 2IEGA 4BY9E 4JCOA 1DTWB 3PTLA 2CZQA 1J2TA 3YASA 4KXVA 4HQNA 1QX3A 4UUNA 5LQUA 1YZFA 1JXMA 2PFKA 3EEBA 3SG0A 4B6GA 4TT3D 1VBFA 4XFDA 3LLUA 4OOFA 1YA6A 2RI1A 5TVKA 3MD9A 2YQ5A 1XJQA 3OJFA 4AG3A 1DBRA 1LRKA 2AXEA 1B14A 1B15A 3E5MA 2CYBA 5JMOA 1Y9AA 3E18A 4OHXA 1JG2A 2P9ZA 2BZ1A 3LQ4A 3R40A 3I39X 1MG5A 2R8RA 2JH9A 1FLAA 1BKSB 1X3SA 4G07A 2HA7A 1JA0A 4N0EA 2EEZA 4CRWB 2A7QA 5DM1A 3A3NA 5T8KC 3EN0A 2FU5C 1ZJYA 4A0SA 1QJ4A 3AFMA 5BT9A 3GEGA 1U7WA 2BEUB 2GPBA 3AOEC 3K8QA 5B3LA 5BYAA 2LUOA 3DEKA 1SOUA 2YNMD 2OECA 4K6CA 2HT1A 3TG2A 5EQTA 4ZCRA 5CB4A 1KDYA 2QLNA 3BCSA 4PAWA 2O6HA 3PRJA 4M88A 4QTXA 1E5DA 4MCJA 1ENOA 2ZG6A 1O9GA 3HKCB 1ECGA 4MKFA 4MP3A 2PAAA 4TMVA 2Z5VA 1NLMA 1OOEA 4NZOA 3GNSA 4ZQFA 3O31A 3T1NA 3HXLA 1L7NA 2VP6A 5D01A 5JAPA 3I72A 1K7FB 3P9NA 5FRDA 4DTCA 2YMQA 4BNVA 1XBTA 4J3FA 3HZOA 5L3QA 5F2KA 2R00C 3QELB 3O1JC 2ZRAA 4EVSA 4MROA 1RAGA 3DFZA 4QOGA 4UVEA 4RO0A 4D9JA 3ZY3A 2JHPA 4ARVA 1YXMA 2E6UX 2FMFA 4YFVA 2GCIA 4K03A 1BJKA 4DLAA 1CXZA 1XDDA 8ATCA 2QUAA 2XIQA 3ER6A 3HVKA 3IP6A 4LVCA 5K3FB 2JIMA 4FFRA 2V8OA 5L51A 5FJJA 2W2QA 4MS1B 5BUSA 1LPPA 5F9FA 3PC8A 1C4OA 2C4HA 4Y2RA 2HCFA 4CEJB 4MV5A 5EWLA 1PTKA 1XTQA 5ULLA 3WNQA 4Z1MD 1FX0B 1MN6A 1OBVA 3GMIA 4NJEA 4KPYA 4M1TA 3SN6A 2C2MA 1HV8A 1GP2A 1OVGA 2CVQA 2VSOA 4I99A 5SY9A 5TXGA 2LD4A 3L7KA 3L0OA 1PYGA 4BB5A 3NBZC 3NP7A 3X2SA 1AS2A 3F73A 1UFVA 2EBUA 4JBXA 5C18A 2Q2OA 4LJ4A 1GPDG 3N87A 3MWDA 3D4IA 1CW2B 2REQA 5LA6A 2ATXA 1KMIY 1R6AA 2R6JA 3URMA 1EFKA 4KXNA 2VHXA 3TTVA 4TXLA 3UV6A 5KINB 1I6WA 1HSOA 2CBGA 2CNWA 3OPMA 4K7JA 4DCJA 1Y9ZA 1QS0A 2NGRA 1PHRA 4IGEA 3EOBI 1ZNZA 1Y3FE 2CLEB 5F9MA 2ONJA 3TZQA 3ZZUA 4BO1A 1XZLA 1W85A 2BIFA 2ZRFA 3HXMA 3I4FA 2F1JA 3EEYA 3I4LA 2PX3A 4DMMA 2H31A 3SMQA 1YJQA 3WGVA 4KH0A 3CNHA 1Y6FA 4R54A 4F7DA 2WA2A 4PW0A 3JWPA 4JP3A 1OGIA 2BM9A 2F1IA 3EPPA 1ZCJA 2DP4E 3BH7A 5BQXA 5K8CA 1YD7A 3HGQA 1KIAA 1JEQA 3U1TA 2YVKA 4M0MA 2NO4A 2O1XA 1ODCA 4PPFA 5BYJA 4E31A 3HKBA 4PWYA 4TRRA 1D5WA 1P1CA 3BBLA 4UE2A 4NP6A 5BSMA 4WHMA 2PX5A 1YFLA 4NSNA 4MP8A 2B7BA 4BLQA 1PUIA 3DNMA 2BFCB 3CRRA 4DRZA 4MPTA 1R4NA 1GGJA 3VJMA 1KYYA 1M2FA 2BRUC 2C7GA 3GRAA 4P9NA 1BD4A 1FFSA 1KXJA 3BOSA 3L6UA 3S7ZA 2HW8A 1RAHA 1ZOOA 1M9NA 1KWKA 4WK2B 4ENPA 4LYFA 3Q88A 1D7OA 2DQSA 1RZUA 2QD4A 2VT7A 3KQQA 5H70A 5B58C 5ALMA 2GTIA 3VPGA 3SZRA 3H11B 2PXHA 1C4KA 2A9OA 4RY9A 5IVKA 5FEMA 2WHEA 1ENYA 1OXTA 1VG9B 3SD7A 1WDTA 1AS0A 4U9IS 3A26A 5SZKB 3AL0C 1DDGA 2C8VA 1UWCA 3FTFA 2F9MA 3UJNA 2APJA 3K6JA 4I08A 1I80A 2PSDA 1OX4A 4KTTE 3TQFA 4ZZIA 5H83A 4UU8A 3D7RA 1TEHA 4XVRA 3OFND 1X7WB 4I4CA 3A28A 4LJ9A 4YB8A 4C87A 1I2DA 4WVLA 2F55A 4PO1A 1L5WA 4P5PA 4X24A 1II8B 3JWEA 3N5CA 1FBNA 5LZ7A 2BGRA 3U7GA 5JAIA 4NZNA 2IYSA 3BICA 2IZZA 2VS1A 4J3JA 4R5HA 3WZMA 2EQAA 4IX1A 3BGOS 1TFRA 3NHAA 1XG5A 3DCIA 3P9YA 3FB4A 5AD1A 5ICSA 1G2IA 4YMLA 3SC4A 2FSPA 1Z08A 4JOBA 3AEZA 3KP1A 4YHBA 4BV2A 1KEPA 1W47A 2OE2A 5EUBA 3G8AA 2FI1A 5CGQB 3WYDA 4PNEA 5JXHA 1Z25A 4PPQA 5IRCD 2IZ1A 1W59A 3W4JA 2FRVA 4E5KA 4JJ7A 2CMDA 4I3FA 3W5SA 1TCCA 4JGIA 5DHFA 3RLIA 4HDOB 1IN6A 5JH7A 3PI6A 3D6VA 4BE4A 3JQ9C 2NVWA 4TTTS 5DU2A 5MGBA 4EJSB 2CV0A 4E1BA 2AV6A 2XMQA 4MMZB 3UN1A 3W78A 5HRCA 1P5FA 1FYWA 1VRVA 1ZAKA 1JHZA 3RVQA 4KFUA 2NU8B 4ER5A 1VM6A 1K3FA 2LGJA 4Z5XA 2NV2B 2HK7A 1P73A 1RWOA 3D8RA 2JLSA 3LSYA 2YV4A 2W6JA 3UAZA 1GPAA 2A3RA 2GSDA 5E6UB 3NI2A 3VAAA 4BZZA 4P93A 1Y5IA 4JXKA 4LF7B 1UM9A 1CZUA 4MRRA 5F21A 2ZCJA 4MI1A 2O54A 3OIUA 2FAXA 1G42A 3ANMA 3CE6A 1YS2X 1G8SA 1E3WA 4XIJA 2BEWB 4B4WA 2O6LA 2PZFA 2L17A 2RG1A 4DIKA 4EI2A 2E87A 2XCOA 2IGTA 2NXNA 1O1YA 4IKOA 4S24A 4GPBA 3FJ1A 2XXAB 1CB7A 1JFTA 1W4AA 1U0GA 1FW8A 2O8EA 1NP3A 1O5IA 2WFAA 3TFOA 1CYEA 1EJ6A 1NXVA 1DBPA 1VE3A 1EK0A 2JANA 3AK4A 4BVKA 2H8KA 1QHEA 2XHZA 3I64A 3WB9A 4BKRA 2H1OA 3QE2A 1VKNA 2E82A 3DWGA 1RRFA 3GP5A 3OZDA 3ZBUA 1ZSYA 1E4EB 2CHQA 3MWJA 3OCCA 5FIUA 1WCV1 3FZYA 1XCLA 3IOCA 4MLPA 1GGNA 3VO2A 2W2PA 3GBPA 5FO0A 4C4OA 3VISA 2GTHA 3N2LA 3ZWKA 3ZVRA 4XPIB 3V7UA 1BMFD 4ZU6X 1OA0A 4E7PA 2R6ZA 2JGDB 1E2MA 3BXPA 1ZHFA 1GCGA 4YGXB 1N2OA 3DHYA 1ZCZA 2JD1A 3VJKA 1VDZA 1C0IA 2ZQZA 3F4KA 1E1KA 5A5VA 2GDJA 1UJBA 1T2UA 2VJLA 3T15A 5ALPA 3ZU6A 1L8AA 2AOUA 1SC6A 4R3WA 3PQ7A 2NP6A 2OTCA 1NLFA 4WLVA 1X7GA 5DI3B 1Q1GA 3TIVA 1WBBA 3PQEA 2H54A 4CMIB 8ADHA 3GQVA 4M49A 5ALFA 1ZDMA 3LVQE 4C07A 5AW7A 4TWZA 2Y4OA 4PXAA 1QQAA 1MO4A 2M1XA 3DMTA 4IJKA 3O4GA 3C3JA 5FFMA 1F9EA 4KV7A 1QQ6A 5TGDA 1RYZA 1J49A 3AFNA 4EB3A 4MAFA 1A2QA 4DIFA 4UFOA 1O89A 4PLPA 2DPYA 1XRLA 3O7WA 3R3VA 1R0LA 1UMBA 4JYPA 4RY0A 3W6ZA 3MWKA 4HGYA 2W48A 2Q3DA 4MSUA 4BKOA 4URVR 3BMQA 1GLGA 4IXDA 1K88A 1PV4A 3NPMA 2V9PA 1WXQA 4XJXA 2YTZA 2VJAA 3M9LA 1W36C 1P8AA 1YBHA 1M2OB 3OC6A 2QVLA 3L4JA 4ZC1A 5GZ6A 1GYRA 1GAWA 3EY4A 4UFNA 3K92A 3EPHA 5AI6A 4M76B 2G07A 4HRXA 4KPFC 4B5KA 4NC9A 1KJIA 1RWQA 2LDXA 1PX2A 2Q27A 5E1BA 5EMMA 4JJEA 3KXIA 2YFKA 3DKKA 3ZD9A 3PFCA 4FLMA 5B5SA 5CDTA 1N0UA 2V6BA 4EKGA 4QLOA 2ID7A 3BZUA 3ERCA 3ABQB 4LTMA 4OYHA 1A04A 1Z5OA 1C8BA 3BH6A 1W1UA 1L5HB 4Y30A 3KVOA 1HE2A 3RIMA 3NZEA 1C29B 4JQZA 4F3RA 2O3TA 1E60A 3FTQA 5LL6P 2ZP1A 1P9RA 1USWA 1G38A 3ROTA 4EUHA 3BSWA 4NCAA 4BP8A 3QBDA 1TF5A 2FPRA 5CB4F 5I4KA 3OQHA 4EFNA 1F5SA 2YZKA 2WMYA 3A6FA 2JIOA 1PHPA 3VR6A 1KMCA 1M6VB 3OLXA 1QBKC 4Q9HA 2QI9C 1PR0A 3ACCA 3E2PA 3AEYA 2P2LA 3M6WA 4MW9A 2QTZA 4AJHA 3QW2A 5L4NA 1S3GA 3PC8C 3KETA 2E37A 4LOJA 3W3ZB 1XF9A 1VKHA 2IZ5A 3AY6A 5KYWA 2PUJA 1FU8A 4XSGA 4BC1A 5ADWA 4YPOA 4TVBA 1KAEA 3S28A 5AKYA 3BIWA 1DIAA 3I1JA 1KK1A 2HUPA 4YRCA 1GQYA 2ID4A 2ADFA 1RYDA 1ZVMA 1CD5A 1G17A 3DTYA 5G02A 4Z99A 5FBZA 4L8VA 1P2VA 4QICA 4DW8A 4QFDA 4LC0A 5JS8A 3RS2A 3RYFB 1QGAA 3PE3A 4D9HA 4Q9NA 3HBJA 1EJBA 2MSWA 4YUZA 3UATA 4RS4A 3HFSA 1UPCA 2BZ0A 1YOVB 2I3GA 3AH8A 4TRMA 5TMBA 3RU3A 4CHGA 2XKJE 2J6BA 3COZA 4EG3A 1GG2A 3MINB 4G3XA 3UJCA 2OUKA 1RIFA 3GAFA 1C7JA 3AT1A 4MMXB 4CM8B 2PS1A 3ZEIA 5JC8A 3CLRC 3N9IA 3K7EA 1U6IA 4MUKA 2FFBA 1WP9A 3AR5A 1NQOA 5JDCC 2O2XA 4Q1VA 4ND2A 5E1OA 3RK1A 4R69A 4HX5A 2RBEA 3A6JA 4G89A 4UAUA 4R3UC 4IOJA 4ZCPA 1E8DA 3T0GA 3T3PB 4GKKB 3KHTA 4RPIA 3A2KA 4D0SA 3DHWC 5KVQA 4DIEA 1Z6XA 3AF2A 3MBOA 4I5IA 1IZ9A 3G2MA 3FBWA 2YIVX 1PT9A 4GVLA 4HAXA 4B33A 4F4JA 4BO4A 1A9SA 2R2AA 5FYQA 3C41J 3BERA 1ND6A 3ZUPA 3RSQA 1AIPA 4M60A 4HAWA 2FN3A 3PUVA 2LDBA 4ROTA 1OT5A 2AS0A 3Q7RA 2OHXA 4DB4A 1IG3A 2NAFA 3N7AA 1L3BA 3LUDA 3TKLA 5LBUA 2Y1DA 2NUBA 2KW5A 4JI6B 3F5FA 1R3UA 3DKIA 1A50B 5EJIA 1ZK1A 3DDOA 1ZD4A 3ZJ5A 2YC2C 4PYQA 4A2QA 3ET4A 2K6GA 4E5VA 4RCZA 5TS3A 1O8BA 1FTNA 4FC6A 4FMDF 4AUMA 1N6KA 3RUCA 2G08A 5KNDA 1DELA 4MKHA 3R4CA 3R44A 1E0JA 4R16A 1DKUA 1D4OA 1YBAA 1Z39A 4IH1A 3U4MA 3EULA 4K0KB 1XZBA 4HC4A 4LDNA 3ONEA 4N5HX 1T5BA 3BC1A 2O7SA 1CJKC 5TIIA 3OU2A 1N2IA 3QYJA 3IP5A 4RLFA 1QVZA 1TZBA 2Q6TA 2C95A 3ORSA 2G04A 2WKSA 4BB0A 4IEFB 2ZBQA 4HB3A 5IEBA 5IK2D 2Y3IA 2GXAA 2WV9A 3DULA 4JJGA 4FGSA 5FV4A 1KJQA 4X62B 3NWOA 5CTJA 4CMCA 5EVCA 1CTQA 1XCPA 1ZJZA 2PXCA 2CWDA 3QBEA 3D7MA 4OO3A 2ZUBA 5DTJA 1MH9A 4W9MC 3TRFA 3WQBA 5AESA 2QYSA 1ORRA 1W5BA 4GPZA 5EESA 5JWOA 4PS0A 3NFRA 3LX4A 1JAIA 1MRSA 1H2EA 4LMBA 3DPIA 2XYPA 3BULA 2RG7A 1BH6A 1OXMA 4JUDX 1NKTA 4F4HA 4XSHA 1K2WA 1XRRA 1ODSA 1SUBA 1K4YA 1UP4A 1F6WA 2VRBA 3IIIA 3KUCA 4U2KA 4BFZA 3PJRA 3P4XA 4GC5A 3P0IA 1ZRHA 1XX6A 3NBXX 4P31A 4OIFA 4OQPA 2OUIA 2JCSA 5TE9A 4HI0E 4YDQA 4KVGA 4BV9A 1BNCA 1N6OA 1IQUA 3CGWA 1XEWY 2RH8A 3NWEA 4B43A 1G7CA 4Z0PA 4HDKA 4MWDA 2AK3A 3FTNA 3BSSA 1YVPA 3KPYA 4O8ZA 3PX3A 5ALLA 1RQ7A 4MVJH 3SM3A 4B2LA 5F7XA 4RKWA 1E7YA 4YAGA 2I34A 4QM7A 2XNDA 2Y67A 1ABBA 1USUA 3KZCA 4RXUA 4ZTUB 1X7HA 2QQEA 3EXEA 1Z75A 3O8QA 3U9TA 1JU4A 4ZYLA 2E18A 3LOPA 3QSGA 3CF4A 2FWBA 3DMPA 2V03A 1VMAA 3VVCA 1D1QA 2AH5A 4LK2A 5EC8A 2ODQA 3QQPA 5GINE 3AESB 1SXQA 3QU9A 1XD2B 5KDDA 1ZH8A 3QEMB 4IDEA 4WEOA 2K7FA 4C9BA 3OQIB 4F9FA