4DZZA

Structure of parf-adp, crystal form 1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
b'MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partitioning protein ParF
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 70
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dzzA00
1N6LA 4GT1A 4PC2A 5FOXA 1SGWA 3SHFA 4DB2A 4XTCS 2BV3A 1Q22A 4RCYA 1F6BA 3CB4A 4A0RA 2UZIR 2AKYA 1SKYE 2FPLA 3ICQB 2WKPA 5E7IA 2ZJ8A 3U44B 5DI9A 1N0WA 1NLFA 2CK3D 4QNMA 5AUNB 1P72A 3AKCA 1EFHA 4UKDA 5E3HA 2JJ8A 4DLVA 3C14C 4F4CA 1XCGB 2BEJA 2AKAB 2QMEA 4G5RA 1FMLA 4IDOA 3NBYC 2XNDD 4A2QA 4RFVA 1X1SA 2NIPA 3CNNA 2G0TA 2YWHA 4UNPA 5CJ2A 2CL0X 1EX6A 5KTYA 2BBOA 3TLXA 2Z4SA 1KNQA 2GBLC 1FX0A 4MA4A 4BECA 2VP0A 2XZPA 2QRZA 2UVQA 1LB1B 3WMGA 4CF7A 3P27A 4XWOA 2GK6A 2NG1A 3REFA 1JR3A 4ZV4A 3J81k 2O8EA 3OF5A 4EQ6B 2QT1A 2GXQA 3IO5A 4NZYA 4P31A 3OEHD 1IY1A 2FE4A 4JVNA 2HYDA 3N2IA 5FH9A 1QHNA 2DY1A 1F2UB 3AVTA 2XXAB 2P3SA 1HV8A 3BK7A 1OYWA 4Q5IA 4M2LA 4V0OA 2VPPA 1FTSA 1GDDA 2ZJBA 4IEIA 1R10A 4Q7MB 3W6OA 4DLWA 4MRRA 5AUQA 1YRBA 1XMJA 2OSBA 4OHZA 3O8DA 2CL7X 1E69A 3KB1A 1COWA 1QBKC 5G3YA 4KITB 4C0AC 2YC2C 3IIKA 2R65A 3CRMA 2BOVA 2QAJA 2TMKA 5KUTA 1FQJA 1I4TD 4B33A 4V03A 1JB1A 1ZAKA 5AK0A 1AS0A 4KXFB 3B9PA 2F6RA 2OBNA 3EASA 2ZREA 4QNRA 3T34A 4YXWD 3AVQA 1OKKD 2Z83A 5FPKA 3OIVA 4ARZA 1OH6A 1JR3D 3L43A 1K8RA 1PLKA 3UMRA 2FA9A 2F1HA 2ZU0C 1II9A 2NPFA 1XD8A 4JVMA 3KKOA 2X77A 3QQ5A 4DBLC 2Q9AA 2JLUA 2FGJA 2IYZA 4JLOA 4KBFA 5KDLA 2ODNA 4ZKEA 5HPYB 3U3OA 3W3ZB 4AKIA 1NP6A 4QC2A 3FMOB 4JT2A 3HWSA 4BLSA 2W6IA 2RGCA 2NZJA 2ZE8A 1WBDA 3QEJA 1J8MF 4P4SB 2RGNC 2XTMA 1COWD 4G3XA 5HKKA 5JEEA 1OXXK 3GJ5A 1YR6A 2A2ZA 1NVUQ 4AIIA 1Z47A 1NBMA 4LHXA 4OJQA 1XJ0A 3ZJYA 1JAIA 2XSZA 3UIEA 1Z6YA 4XWKA 1YZTA 3CZPA 3WNCA 1NKTA 4A92A 4JLAA 4D6PA 1CR2A 1T5IA 5IK2A 5SZIA 3DM5A 5DE3A 1VIAA 1U90A 4PPGA 3EA5A 3GLGA 4JBWA 1OE0A 1GNPA 1CJTC 3P1JA 4AK9A 1V43A 1Z0FA 1XZPA 5J4HA 4DLSA 2Q3FA 5CK4A 2IS2A 4LJ5A 3RSLA 1ZBDA 5CYPA 3IPXA 4IOKA 4KI0A 4OHVA 4Q9JA 4CEIB 3SFZA 1SVKA 4E5UA 3GJXC 4O0MA 4Q1DA 1P9WA 3DL0A 2QM8A 2WHXA 5TV2A 2IWRA 4LSGA 4A2WA 3EAQA 4B73A 5F9FA 2GF0A 2ZSDA 4B34A 4DLZA 1E4VA 1JEDA 1GKUB 2GXSA 1FUKA 5D3MA 5EP4A 2XJ4A 4TT3A 5BW8A 2P6RA 4G0NA 4MITA 5EP3A 2ZRJA 1KI9A 3KZ1E 4EPRA 3B8HA 2NPIA 2JLXA 3U3JA 2W6ID 2PMKA 1GWNA 1Y3AA 4XTRA 1LVGA 3N5CA 3KXKA 1J90A 5HKKD 4TYWA 4NCKA 2YOGA 5H1YA 3TUJC 3CWZA 2A5GA 4A15A 3GCGA 2JJ2A 1C4OA 1EFRA 4BLPA 3U3MA 2V1UA 3BC1A 1Q20A 3LX5A 1Q1QA 3ZQJA 5IK2D 3KQUA 1OT3A 2P6NA 4GPTA 1CJVC 1VPLA 2V4ZA 1JPNA 2HUPA 4EKDA 1XXHA 4IFEA 3FKSA 2F1IA 4EPTA 1NNEA 5FI0B 4TYNA 3JVVA 4I1SA 5GJBA 1NVVR 1XMIA 2AX4A 3GLFA 1G41A 1E96A 4WA7A 3QF4B 1P2TA 4FI3C 3QVUA 4XVQA 2WSMA 4OHYA 2HXSA 3L8YA 1KK1A 3NBFA 4D0LB 4TL6A 4BEBA 1KAOA 2BKEA 2P2LA 4TT3D 1G4AE 1O87A 2C78A 4HAWA 3D3QA 3ZS9A 3RS4A 1P60A 1VMAA 2W2XA 1UDWA 1GP2A 4QXAA 2ZJZA 3MWJA 4B43A 3EX7C 3GLHE 1P75A 5C46F 3A1TA 3LLMA 1QHHB 3WRYC 2GNOA 2V54A 4EAQA 2PMDA 5HE9A 5KDDA 5C2JB 3T12A 1GOTA 4JSTA 1GG2A 1TQ2A 2XOKA 3M6AA 1WP9A 2OBMA 3WBJA 2WMNB 5DI3A 1NJGA 3DKPA 1YR7A 1IN7A 1EFCA 4TLEA 1OIXA 5FPHA 4B74A 5BN4A 2IYQA 3KQNA 2GTPA 2DWOA 2ZAOA 5KDOA 4A6PA 2GCNA 1W0JD 5KOYA 1W4AA 5HCNA 4QKQA 2QRNA 1P9RA 1G1MA 2RCNA 2OCAA 3QKRA 3W34A 3CX7A 3FKSD 3Q7QA 3BBPA 4D4JA 4C7OA 1CJMA 1UEJA 3I1FA 4A8JA 5L3QA 1YJ5A 2WAYA 3QG5A 3ONWA 3SOPA 5M04A 3QPWA 3CX6A 1N0UA 3G0HA 2J3EA 2DHRA 1Z22A 3TW4A 2X1VA 1RFLA 3VX4A 3DMDA 4ZDKA 2VRWA 1PVOA 4NBSA 1Q57A 3HR8A 2RHMA 4B3CA 4DLTA 4IFBA 1BKDR 5B58C 4CYMA 4M9ZA 5E95A 4US1R 1Q3HA 5FBVB 1GRRA 2VP2A 5DHFA 3U61B 2QT0A 4ACAA 4GNKA 1U9IA 3TW8B 1ZNYA 4V0KA 3D7MA 1Z8FA 2AL7A 1AKYA 2O8DA 5EE0A 3VR5A 1NMXA 3EIQA 3AQ4A 3DKVA 4LJ9A 1PV4A 1E6CA 2FDCA 5J4VA 4MKFA 2OG2A 1OH8A 1X8KA 4GRAA 2R2AA 1OFIA 3DPUA 1DVRA 3CF0A 3FFAA 1FZQA 3G82C 4G5OA 2YVUA 2GCOB 1Z83A 1Z3IX 1YZKA 4B44A 1MABA 4TMVA 1HA3A 3EWAA 2CNWD 4G5GA 4NCIA 1KDRA 4JYBA 4QM7A 3TAUA 4C0LA 2FZ4A 2B8WA 4JL5A 4W7SA 2PT5A 2VF8A 4PFSA 4TMZA 4MQBA 3KQHA 3MRSA 3W6PA 2ZRKA 1E3MA 1B0UA 4IOLA 4DCUA 4Q4HB 1NKSA 3RRNA 4AG6A 4AD8A 2YV5A 5H70A 1D8TA 4PC3A 3TQFA 2V7QD 3CRQA 3UANA 3FPAA 1G4UR 5EQTA 1TF7A 3R8FA 1GRNA 1OFHA 3L0SA 1JNYA 3P20A 1ZCAA 2ORIA 4IVPA 4LHZA 4Q4LA 4RD2A 5CYOA 3HYRA 1CRPA 1X1RA 1E2HA 4KFSA 1MO5A 1FQKA 5BQ5A 2CVFA 3R7WB 2QPOA 4RCZA 3K9GA 4KO8A 3SDZA 1Q21A 2ZYWX 4MGZR 4L8GA 3QUSA 3SYLA 5C4MA 2RGXA 3AUXA 2WWHA 1NY6A 2JIZA 3QOFA 2Z0MA 3IILA 2IXEA 2WPDA 1RKBA 1GL9B 3SI7A 4B6FA 1D2MA 3F3YA 4DT1A 2O52A 1KSFX 1R2QA 5JJIA 2GKSA 1ZRHA 1E99A 4V0MA 4ASUD 2OLKA 4XOIA 4KYUA 5FR2A 2QM7A 4TQUS 1G3RA 3TQCA 4JLPA 4LHWA 2J87A 2C9OA 1G3QA 3REGA 4BFZA 5TDHA 2IYRA 1IJEA 1D9ZA 4MRNA 1R5NA 2IYLD 5IT5A 2G6BA 1MRSA 2ZE7A 4TLDA 4MRVA 1KDTA 2ZUCA 1KKMA 3EPLA 3T5GA 4HB3A 4FMCB 1IOZA 1P2VA 2G0NA 2H7VA 1IONA 4AKEA 2IUSA 5CDFA 1VDZA 1BYUA 3CKLA 4LJ4A 3WXMA 4GP7A 4JMPA 4B3BA 1A2BA 3D31A 4U5XA 3UATA 4M1YA 4F4JA 4DVGA 3BH7A 3RABA 4URVR 1N0VC 3ND8A 3DM9B 2QQEA 4MGKR 3GD7A 3IBYA 3TSWA 4BE7B 3W8RA 5CB6A 2JIZD 1XJQA 5FPSA 2LCFA 1JJVA 1KI7A 1VCOA 3ETLA 1KSHA 2BCJQ 3E2IA 3KL4A 2G1KA 2WPDD 2VQSA 5FL7D 3OAAA 4LJ7A 4LC1A 3RNLA 5FUVA 2ZRFA 4ZDJA 4HLUA 3TK1A 5CM8B 3GLFB 1E9DA 4NKRA 1Z0KA 4Q1AA 4PSVA 3THYA 2FGKA 2ZRIA 3ZGXA 4BRWA 1LFDB 1JEEA 4M1WA 2A5FA 2IC5A 1Z29A 1Z07A 3Q7PA 5HCIA 4ERNA 4DHEA 4NYIR 2D4HA 3SYNA 4V02A 1XX6A 2OV2A 1JR3E 1EWQA 2WICA 3TKLA 1OYYA 2GZAA 5ANRB 3ASZA 3QKSB 2B8TA 3PQCA 4M1SA 1DAGA 1KYIA 3PUZA 3BERA 3QY0A 3A58B 3W6NA 4BFWA 4NH0A 2G3YA 1CBUA 3QJYA 3RS2A 1T5LA 1VIYA 2FFBA 5JZVA 2IUTA 1G8YA 1S1CA 3KQKA 5JCPA 3AM1A 1G5RA 4JYCA 2JLRA 3SR0A 4I1UA 3A4MA 2IYTA 3AF4A 3BOSA 4C9BA 3AVOA 1KO8A 1SKYB 3M4YA 621PA 4C2UA 4M9SA 2GAOA 5SZKB 1IHUA 3OFNA 1Q44A 3DMNA 2I4IA 1TUEA 2WJYA 2PEZA 4HDOB 5TB5A 1G9XA 3TUZC 4TMWA 1AS2A 1II8A 3L8ZA 2N42A 2DFLA 1G19A 2EYUA 2FN4A 3N2EA 5DNYB 4C0QC 4HZUA 4XD7D 5L3RA 3CUEF 4LJ8A 4JT4A 4WXRA 1LF0A 1WCV1 2NQ2C 2NZ8A 2WMOB 2ZEJA 3FMPB 3I73A 1EG7A 1XCPA 3FE2A 4JSYA 4M1MA 4FN5A 4NYIQ 3AVPA 2WZQA 2D06A 1ZD1A 4HAUA 4FINA 2OCYC 1G7SA 4WZBE 1RYFA 2WJVA 4X8OA 2PBRA 2XZLA 3FFBA 4TLCA 2XJ9A 3ZZUA 4UXIA 1S96A 2EFHB 2IYVA 3RC8A 4CRWB 5LDDC 5JRZA 4BQSA 4Z51A 1T4GA 2A7QA 4D81A 2O0HA 1RE0A 4A9AA 1UKYA 4F4IA 1NBME 1XTQA 3PR1A 4BASA 1DG1G 2GJ9A 3OFND 1NL3A 3LQRA 1QVAA 4P4UA 1U99A 2VEDA 1D5CA 4G1UC 2G1JA 2GJ8A 2X8AA 3B82A 4QBHA 1CJKC 1KAGA 2XITA 3DHWC 4B2PA 4QRHA 4EUNA 1XTJA 1HQYE 4WOPA 2FV8A 1ZUNB 2QU8A 3F0TA 2QPAA 4D4KA 4N0DA 4HATA 4AY2A 1KO7A 2GEDA 1FMJA 2ONKA 3CO5A 4US0R 4WW0A 4CT5A 3D8BA 3EZ9A 2ZROA 2ZQ5A 4XJXA 3AF0A 2NMVA 5FBLB 4M22A 3VKWA 4A2PA 1ZVQA 2CJWB 3THWA 1Z0DA 1KJWA 3AEZA 1OB5A 1KI6A 4EJSC 5KPJA 2N46A 2ZI3A 2NGRA 2IXGA 3PEWA 5AJVB 2BBWA 4TQAA 3HU3A 3VU9A 4JLVA 2VP9A 4QJ4A 2GA8A 2BMJA 2BMFA 4OYHA 2QBYB 2QPTA 2FNAA 3BB3A 4FW9A 3IEVA 3A8TA 1E2EA 4DT1B 1DS6A 2OESA 5FUWA 1U8ZA 2BJWA 2GXAA 2IT1A 1R4AA 2QP4A 4B2IA 4KU4A 1L4YA 1VHTA 2WKQA 1ZU5A 3W5JA 2ZRLA 1Z5ZA 3LBIA 4URXR 4LBZA 1M34E 1Z28A 3HPRA 3K0FA 1I2MA 4G5QA 1E1QD 3FDIA 4M1OA 1KSGA 4DEXA 4N1AA 5JHHB 1C1YA 1XXHE 1NIPA 2QAGB 3TBKA 4IXMA 4GZMA 3U60B 1KMHA 2NTYC 1CRQA 1J70A 4X8MA 121PA 1YQTA 1T3LA 3HJNA 2OFWA 4MGIR 1KGDA 4L16A 3H1TA 2CEAA 1O3YA 2GDJA 4NU0A 3GLFE 4DXAA 4GDFA 2BEKA 1OHHA 1S3SA 2ZRPA 4LK2A 4PSKA 1R8SA 4PPNA 4LUCA 4UXHA 2P67A 3ZLJA 3ASYA 2XZOA 1YZNA 4RFSA 1RW4A 1KY2A 5EE1A 3LVQE 2E1RA 3MSXA 4UQOA 5LB2A 5EUQB 1XF9A 2IEZA 4IDHA 5LBIA 1RPZA 1UKZA 2Q6TA 3Q72A 4B2LA 2R62A 2GJAA 4XVUA 1XEXA 3CWQA 2VL7A 5JI3E 2D7DA 2RGAA 4L9WA 1JXMA 5IRCD 2IXFA 2BCGY 3C5HA 1DAEA 4Q03A 2KBFA 3RHFA 3W90A 1E0JA 3HU2A 1MO3A 2WJJA 3AVUA 2IYUA 2J7PA 3IHLA 3LX8A 4HEJA 4AC9A 5E7JA 4QM6A 3B2EA 4CGZA 1U94A 3K9LA 1A82A 2QUZA 3W5IA 2IS6A 2FOLA 4IOJA 1JXOA 1G20E 5AUPB 1W7AA 3DDCA 1N6PA 2BMEA 2FFAA 2IYXA 3LQQA 1UM8A 2C9YA 2J5XA 4PANA 1H8HA 4EPXA 1X8JA 3QXCA 4F91B 1QZXA 3SEAA 2XTNA 2ZVPX 4V0LA 2FJUA 2AHOA 5A5GA 1OHHD 2H16A 3B1VA 5B64A 3CH4B 4IDQA 4CZ2A 3THXA 4HLCA 4LCBA 2ZI5A 2G9NA 1FPMA 4QJ5A 2REXB 4C0JA 2O0JA 4ZKDA 3CPEA 1SXJA 3ADCA 2JATA 3AKYA 1TUIA 5B57C 3QI2A 1YR9A 2DWQA 3FYHA 5HE8A 1I4LD 1OXUA 1FNMA 3K09C 3L0OA 4Q4AA 3H2YA 1M7GA 3FGNA 4G01B 3RDPA 4X8HA 4BZXA 2F9MA 5FOVA 1Z63A 521PA 4KAXA 4HDCA 1YZUA 4BFSA 4P3YA 3LWNA 3GLHB 5JSZA 4RSGA 4Q9HA 4EFMA 4RZ3A 1ZW6A 1GVNB 5DYIA 3KJHA 5GJWC 4CW7A 2J7PD 2QAGC 1Z0AA 2BHRA 3VHXA 4DUGD 3ZQ6A 3LA6A 4I1VA 1II0A 1UFQA 1E0SA 4QJ3A 1NJFA 1HYQA 1P2SA 2KWIA 5K8IA 4ZI3A 1KOFA 1UADA 2KSQA 3LY5A 3K8YA 5LPNA 1ZUIA 2WIAA 5G53C 3SS8A 2GRJA 1XPUA 2Q3MA 5K8TA 3PUYA 1L8QA 2OXRA 2Q21A 4DIEA 2O8CB 4PQRA 2IK8A 4QGAA 2BIFA 1E98A 3L82B 3K0EA 3NHBA 2XAUA 4KBGA 4AG5A 2NO6A 1S3GA 1OSNA 3SBDA 2FWRA 4U02A 5DIFA 4BFVA 1W5SA 2O8FA 1T9HA 3C15C 1RVDA 4ZIRA 1WXQA 1LF5A 3OZXA 4MRSA 4Q66C 5KU1A 1SXJD 1T3HA 4M9XA 4W5JA 3EIHA 5P21A 4TMKA 1ZD8A 4EFNA 2CCJA 1CJUC 1G5TA 4HUTA 3CR8A 4GOJA 1SVSA 5AJXA 2F55A 3A1UA 3AB3A 3D6TB 4XWAA 4IOMA 1X86B 3DVLA 3SBEA 3LBHA 3UPUA 4Q18A 1VTKA 5C18A 1HUQA 4DB4A 2C77A 3KFXA 3UG6A 3WP1B 3C7KA 1AGPA 5A4JA 1WA5A 1RRPA 4I4LA 1LS6A 3LO5A 4HAZA 3EZ6A 3U3RA 4B76A 4DDWA 1K5DA 2XB4A 4KHZA 1XPOA 2CLDX 1NLZA 1XTRA 2ZPTX 3UKDA 2V9PA 3ZYCA 4PO9A 3MLEA 4LC0A 3UXMA 2BBTA 4TTPA 4LHVA 4C0BA 1U81A 1N6RA 2RAPA 1KDPA 5EE5B 2ZUBA 3QBTA 1E9SA 4V0ME 3T35A 3QXHA 2ZJOA 3WMFA 1EWRA 2RGEA 2JLWA 3X1XA 3JZMA 4TYPA 2ZYVX 3THWB 3E5HA 2QMUA 3KXLA 1E9CA 4J0QA 1MKYA 2QGNA 4IW3B 4JS0A 4MYUA 1K6MA 3P26A 2IA5A 1RRCA 2JA1A 3PENA 3WYFA 3GPLA 2HCJB 5LB4A 4NP6A 3C4JA 4HLQB 3I61A 3RS0A 4DSUA 4NTZA 2FSIA 5BN3A 5GVRA 2W00A 4CEHA 2R6FA 1E2FA 4BPBA 1DO0A 4KV9A 1W5TA 2UZ3A 1W36D 3T1QA 4B48A 4URZR 4RKEA 1CS4C 4DLRA 4W9MC 1F2TA 1KKLA 3K0FB 4KSCA 1TU3A 2C03A 2J1LA 4PAQA 3EPHA 4NYMR 3K0AB 3HU1A 4KFRA 4IDNA 3T1OA 5KNCA 3LRPA 3U5ZB 2A5DA 4Z54A 3CPJB 1X8LA 2GVDC 2YHSA 3F5FA 4D4MA 3TSOA 1NBMD 3UMFA 2XSZD 2BMDA 1N6NA 5EUMA 2EFDB 1X6VA 4K81B 1CU1A 421PA 2QMHA 4TMTA 2H92A 3QNUA 1CR0A 2ZJYA 5FOSA 5FUXA 3Q5EA 2AK3A 2WIBA 5F3WB 1OXVA 2PZGA 4GMXA 2WTUA 1IN6A 2GHIA 2YWFA 1E9FA 2IUUA 3QSYA 1EGAA 3UMSA 1XEXB 3RANA 4CEJB 2IBMA 2NO0A 4QOSA 4ABYA 1E9EA 3NTUA 2GZDA 3EW9A 4D2IA 3GLIA 5AJZA 4PPFA 1G7CA 3X1YA 2C5LA 3BS4A 1JQLB 2BC9A 3E70C 4IXNA 2JLZA 2QTHA 1N6OA 1Z0JA 3DOEA 2ZJAA 1AN0A 5L3SB 4FMDF 4BLOA 5KSOA 1U0LA 1VYUA 4FCWA 1S1MA 2WAXA 3SFVA 3FOZA 1XRJA 4IKEA 4E07A 2OO7A 5EE3A 5J4KA 1DADA 1F5NA 5EXTA 2WWFA 2CHQA 2BVNA 1HT2E 4KYIB 3IUYA 5EXSA 3CW2A 3LXRA 1GL6A 3CH5A 4FMDB 5J4LA 1R0WA 2DFTA 5JHGB 2AN9A 3BIFA 1SKQA 1Q1EA 4UNSA 3LXXA 1M6NA 5JJKA 2ZSAA 4RD1A 3DO6A 1KTVA 2V6JA 2IHYA 1ZINA 5FTNA 1N6KA 2JJ2D 1EFRD 1FP7A 4GP6A 5H68A 5JLJA 4CDGA 3GQBA 1SHKA 2OBLA 4LYHA 3K0SA 1OIWA 2V6IA 4JVSB 1H65A 1JI0A 2ZR9A 4TLBA 3RRZA 1MO4A 1FX0B 2CVHA 3I72A 3NEYA 4PHTA 2W6JA 3AF1A 5J4YA 5FBRB 3I5YA 4TTRA 4YMUA 2ZE5A 3I62A 1GNRA 1N2CE 5FR1A 2O8EB 3JVUA 1UKEA 2FPMA 1XTIA 4NCJA 1RZ3A 3BJIC 2OLJA 2IYWA 4BLQA 1TMKA 2B7CA 4EDHA 1QHXA 2FFHA 3WY9A 1KJZA 3HPQA 2VO1A 1G8PA 5JFGA 1E0KA 4DDVA 1YZLA 5FTKA 2P65A 1P7CA 2ZSFA 4WAUA 1KK3A 1ZC4A 1NVVQ 4PZLA 3ICEA 4S35A 3K9NA 2Y8EA 2VP6A 3OIUA 2ZAMA 4Q48A 1N25A 2ZS7A 4PHGA 4DCVA 4EJSA 3MUFA 2CL6X 3WYGA 2EFEB 3I3SR 3T1VA 4YMVA 4UNQA 5BWMA 2XOKD 1Q3TA 3G5UA 5CJPA 2O8FB 1KMQA 3RS5A 4GZLA 4YMTA 1NI3A 1HT1E 1HTWA 2D2FA 2WBLC 3KQLA 2EU8A 1XD9A 4TQ9A 2GWHA 4LWZA 2MSEB 3BH0A 3KX2A 3LW7A 4DDUA 2WJIA 2J0SA 1MR3F 3FTQA 3QF7A 2OILA 1U8AA 2CDNA 1UPTA 1D9XA 4XVRA 4X8LA 4ARZB 4QG7A 2RGGA 4NPHA 3KKPA 4C4PA 1W1WA 3BFKA 3QPVA 4JJZA 2JASA 1GUAA 4HLDA 1WRBA 2RH5A 5L3VA 4O2RA 5TY0A 2H57A 3MWYW 1W36B 2FZLA 5B2ZA 2QROA 3V9PA 3FMIA 3TH5A 1L4UA 1FL9A 3O47A 3TNFA 3NG1A 3UWOA 5F9HA 4LBWA 5CLLA 4BZPA 3K70D 1CEEA 1XNJA 3KJEA 1CULC 1NSTA 3NVAA 4MDEA 1IN5A 2GILA 2CE7A 2OAQ1 4Y0VA 4W5WA 3SE0A 4M9QA 3GFOA 2XX3A 2BM1A 1XBTA 4QGHA 3IIJA 3B1ZA 2J59A 1XD2A 5EJEA 2BKUA 3KTAA 3VR3A 3MJHA 2VTKA 3GLGB 2GZHA 2GVZC 5TVKA 4PC1A 4A82A 1OF1A 2A30A 3VAAA 2KBEA 2R6GA 1KIMA 4NMMA 3KKQA 4WIAA 5EXPA 3A1WA 3IPYA 4K46A 1XDBA 3VR2A 1P4SA 1XFAA 1E2IA 2VHTA 1E2QA 4ZI2A 1VYTA 3K53A 3P4XA 1PLLA 1YR8A 1XPRA 4US2R 3CNOA 5D3QA 2XNSA 4FMCF 1YZQA 4NDZA 5D3MB 3U7GA 1M7HA 4R9UC 2QTFA 3HDTA 1ZM4A 2I1QA 3N70A 3SNHA 4L15A 1ZJ6A 3KKNA 4HB4A 1NVXQ 4LBVA 1VG9B 1G6OA 2PJRA 1OW3B 3RLFA 3VHLB 1KI3A 1KSJA 1DO2A 4LHYA 4OQXA 2JAQA 5FUYA 1VYVA 1US8A 4B71A 1OXTA 6Q21A 2WM9B 1SVLA 2GBLA 1S0UA 4GBMA 1M7BA 4DLYA 3C8UA 4E03A 4QHYA 2B92A 5BYJA 1RC8A 2AK2A 2ZI4A 3BXZA 2GEVA 5E7MA 3AVVA 1R0ZA 3GJ7A 3LDAA 2NO7A 1T0JB 3FKQA 1TL7C 3GFTA 2ZIAA 1XXHB 3GLIB 1QHYA 1EFTA 1UJ2A 1FUUA 1BS1A 1UDXA 2ZRDA 3KKMA 4Q7LA 1CLUA 3MFYA 4RZXA 5G40A 1IY0A 3ZD7A 2D7CA 1N5JA 1GRQA 2PLFA 1DTSA 3PVSA 4U00A 3PCRB 4DSNA 4B35A 1SXJE 3KB2A 2OT3B 1ZNZA 4TYQA 2HYIC 1KI8A 5B30A 3GEIA 3ADKA 1P3JA 1J8YF 1ZM7A 1NLYA 1S2MA 1OJLA 4PX9A 4FCVA 1ANKA 1JPJA 1KNXA 3H0KA 4CIDA 2ZR7A 4N0EA 5CK5A 3U4QA 3LH5A 3PXGA 3R9IA 1DAKA 4OKSA 1DAHA 3CZQA 3SHWA 1JALA 4QBFA 4A0HA 1W46A 2H18A 3KUCA 5DI3B 2WWGA 4FD2A 4XSGA 5FOTA 2ZE6A 4Q1FA 1ZD9A 1J99A 1RRFA 1YVDA 2DCUA 4KFTA 3ZZ0A 5J5CA 3UWKA 3I8XA 4AWXA 3QG1A 2BJVA 1GZSA 3QKRB 1DELA 1AJEA 3OAAD 1HE8B 4POAA 1ZM9A 4C7OB 1RYHA 3U44A 2PX0A 4H1VA 4A8JB 2R6AA 1F60A 2R6DA 4MRPA 5L3QB 2IS4A 1AZTA 1HH4A 1OH7A 2C99A 4MH0R 4II7A 3BWDD 3BB1A 2YC4C 5FOUA 4HZIA 4ZCLA 4HI0E 3WMEA 1A7JA 1SHZA 2OHFA 1ZYUA 3OEEA 4UNNA 2YWEA 4MGYR 2RGNA 1FP6A 1WE2A 4XIGS 1R8QA 2F3RA 3X1WA 1ZIPA 5E4FA 2E9SA 2O8BA 2W58A 4C3ZA 3K70B 4EPYA 1TEXA 3FB4A 3A1SA 2OEPA 4IVRA 4EQ6A 4TLAA 5KYKA 3RS7A 2J41A 2O8DB 3PUXA 5FTLA 4WBSA 4P4TA 1RJ9A 4N3NA 2G77B 3CF2A 2JDIA 4PPQA 1Z6XA 2W83A 2JLVA 4R71A 4JL6A 4O3MA 5DN6A 5DYGA 4E22A 4IEEA 1F2UA 1HY3A 1LV7A 4OI1A 5AR1A 4ZCIA 2MMCA 1M74A 1XCMA 1P5ZB 1XP8A 2OE2A 2OUKA 1XTSA 4M1TA 1MABB 1F48A 4Q1BA 3IHWA 5DGXA 4MUAA 2ODEA 2CLCX 1A2KC 1UF9A 5IHPA 3P4YA 1GKYA 2OFXA 3JZAA 2ATXA 5CLQA 2IX3A 1XEFA 4MDFA 4OI2A 3GEHA 1XB2A 2FH5B 1DAMA 4HAYA 1NIJA 3EPJA 3EZFA 3QXJA 4JBYA 4MYHA 5KPDA 4QFMA 3GLGE 1TQ4A 3M1IA 1U2RA 2EWVA 1QDEA 2PLRA 3PUWA 1IBRA 2F9LA 3AGPA 1UKVY 4KFUA 2ZM5A 1KY3A 1NN3A 1ZMXA 4BLRA 2EYQA 1G291 4HDQB 3TVDA 3SC3A 1N5LA 1WDTA 3NDPA 1UAAA 2IW3A 2ZYTX 1DPFA 1Q1ZA 2F1JA 1C9KA 4V0NA 3ZDQA 1OIVA 5JWOA 3TVTA 2ZTSA 2QEQA 3TRFA 1HQCA 2R44A 1NSFA 4A8JC 5DN6D 1A1VA 1TX4B 4OHXA 2ZI9A 3SYKA 3KTAB 2B6HA 2ZVQX 3EZ2A 1FFHA 1UBEA 4GFDA 2EVWX 1VECA 4P4SA 3KFVA 1OLOA 1T91A 3PG5A 4NCHA 4OHWA 1XEWX 2C04A 3SJZA 3AUYA 2O0KA 3NWJA 4M4SA 3OHMA 3HP1A 1IQPA 2VSXA 1U9IC 4DWJA 4H1UA 1ZM3A 1E2JA 2V55B 4ITRC 3Q3JB 1Z06A 1HE1C 1NN0A 1OFUX 4OK3A 2IHBA 1S9DA 1R5OA 3AVWA 4MKGA 1PJRA 3CPHA 1W44A 3GLIE 5SZJA 3QXSA 2UKDA 1GAJA 2Q9BA 2YYZA 3AF2A 2FSFA 4E09A 5TARA 3O8RA 4CEIA 4O2LA 3WBKA 4P0TA 4DLUA 3I92A 3VR1A 3QPUA 1EK0A 4EPVA 3RWMB 5KNBA 1IJFA 2GXUA 2F3TA 2REBA 5JI2E 5JWRA 2GK7A 1T8UA 3X2SA 4HB2A 4BLTA 2DPXA 2OCPA 3QEOA 1A5TA 3BRWD 4TYYA 4TSFA 4R2HA 2IYYA 1CKEA 2H8KA 3GFPA 4LGMA 2F7SA 4JLBA 2QENA 5CITA 2ERXA 1AGRA 3A36A 3BAFA 2FU5C 3W3AA 3LW8A 2HF8A 4ZDWA 1P9NA 1QHGA 4LJAA 3X1DA 2QMOA 4OL0A 5JMTA 1CTQA 2ZITA 2WWYA 3PEVA 3ZVMA 2BM0A 3THYB 3MCAA 3AP2A 4ZPXA 1U0JA 4FIDA 3PJRA 2QTVB 3EXAA 2JJ1A 2Q0HA 1W2GA 2EQBA 4JLMA 1ZCBA 5FTMA 5F98A 4HUQA 1P61B 2Z43A 3HYTA 4LJYA 3WRXC 3IQXA 4JLDA 1G5PA 2OZEA 5HZHA 2D62A 2VP4A 1R7RA 4Z8XA 4DLXA 2P6UA 5DO9A 4TN1A 1YKSA 2SHKA 5BYKA 3P32A 1JBKA 3MGCA 2QP3A 2X19A 1KZ7B 3QF4A 4KSBA 1M1YE 4FCTA 4CVNA 4D25A 2PH1A 2ZXUA 3OEHA 1AQYA 3EC1A 3ZVNA 5AJWA 2GAAA 3CX8A 3AH8A 3KXIA 4RZUA 5GADl 5EXXA 4LY6A 4TSFD 3B1XA 4RD0A 5UKDA 1IXZA 3MMPA 3NC1C 4BEJA 1VKJA 2ZSEA 4AKGA 1QHHA 2C96A 2HXYA 4BRUA 4DIDA 5LD2B 1N6IA 1Z6AA 3MWKA 1TQDA 2DFKB 2PJZA 5AUOB 4A36A 1UBFA 1TAGA 4KVGA 4M8NE 2BBSA 3A4LA 2ZSBA 2JJ1D 4D80A 1P6XA 1KO5A 2V3CC 2EFGA 3IO3A 4BFTA 1WBBA 4QHTA 1II8B 4A0GA 2ZRGA 3TJZA 5DLQC 1GILA 2LWIA 5IDVA 4BFXA 4LJ6A 1H8HD 2O8BB 3DZDA 3Q8XB 4YXWA 1T3SA 1OKKA 4HZUB 2OCBA 1SZPA 3RWOA 4B47A 2MSDB 4PTLA 3ADBA 1ZIOA 3FVQA 2IEYA 4JVLA 2F43A 2C9CA 5CB8A 1RJ9B 3FMFA 4TZ6A 3RSOA 1ESNA 1DAIA 3GMTA 3SJBA 2CE2X 1AQUA 2VP5A 5IF9A 1XMSA 1TNDA 3RS3A 1T0HB 4Q00A 3RYTC 2FFQA 4DKXA 2I3BA 2YNMA 1BOFA 3Q9LA 1J2JA 4HLUC 4B3FX 3PV0A 3ZIAA 1IXSB 3VMFA 1TF2A 4FXPA 1XZQA 4DSOA 1YZGA 3CR7A 4C0HA 2PT7A 2JCSA 1VG0B 2ZJ5A 5FBWB 2ODBA 1JR6A 5DH9A 1Z08A 4RD4A 1GFIA 4YDSA 2VHUA 3T06B 3LD9A 3IDQA 4PO8A 3U2QA 4URYR 4RD3A 1XMVA 2RGBA 2QORA 4NONA 2Z6VA 4D0GA 4B3DA 2QP9X 2GCOA 2WJGA 1L7VC 4I1OA 2VYFA 1D2EA 2WOOA 5CM9C 1E79A 5J47A 1GTVA 5GJVC 4I99A 3B9QA 2XB2A 3OE7A 4HAVA 4AYXA 5FBQB 1TTTA 1KI2A 1SVWA 4Q02A 4BWYA 5GVSA 5AJYA 4UJ3A 3I8SA 4XSHA 3F8TA 5LD2C 1KI6B 2AWNA 4JLKA 1L2TA 4LI0A 5JJLA 3VNVA 3ZIAD 4Q4HA 1Z2CA 3MJRA 3CNLA 3VU9B 4LV8B 1FOEB 4ILEA 2QSZA 2D3WA 2A3RA 3EARA 2VHQA 821PA 3B6EA 1VCMA 1MO6A 2JGNA 2C95A 2OFOA 3R20A 3K0CC 1W4BA 4LRWA 4R7ZA 4DSTA 1TEVA 4PZYA 3TIFA 5CDFE 2R8RA 2ODWA 4MUBA 3FHOA 2ZETA 1WMSA 3UG7A 3R7WA 2AXPA 4FWIB 1N5KA 4B3XA 2WWXA 3A4NA 4PQFA 3OIWA 2YZ2A 5FPTA 3TR0A 4D4LA 4KLNA 2PX3A 3U7HB 4YLGA 2YOHA 2P5TB 5G41A 4BFYA 1E79D 1AKEA 1W48A 1KMHB 3GJ0A 1G8FA 3R9WA 1JQJC 3NBXX 5CIQA 2RKOA 1YU9A 3OE7D 2X2EA 2YJTD 5C1BA 1LNZA 2ERYA 4RZ2A 1XJCA 1RRGA 2QG6A 2WKRA 1E9RA 2WOJA 4RFSB 4GL2A 2WJHA 2A9KA 1NMYA 1GIAA 2GF9A 4JLJA 2ZRAA 2AFIE 4BFUA 4R2IA 3I32A 3K1JA 5KO2A 3KUDA 5DSZA 1DOAA 1G17A 1U98A 1CF4A 4WVFA 3T61A 2ZRCA 3L0IB 1TADA 3KJIA 2IYSA 4Q9IA 2K5UA 3S1AA 2ANBA 5EP1A 4EIWA 1U8YA 4MKHA 3U3KA 4I81A 3EG5A 4YMWA 3IEUA 1FNNA 4Q9LA 4PHHA 1E2PA 1SQ5A 2H5EA 2VBCA 4HUQB 1W0JA 3NBZC 4P32A 1NG1A 2CXXA 4EPWA 1VG1A 3SQWA 2MMGA 2B21A 2A5YB 1WQ1R 2ATVA 4PXAA 4M53A 2ZI6A 5G3ZA 1DE0A 3QXXA 4OBEA 1KO1A 2E87A 2QQ0A 2CMKA 2DR3A 1GM5A 2EW1A 3THXB 3CIOA 1VHLA 2IF2A 2P5SA 4NYMQ 4DJTA 4OI4A 3B85A 2HEIA 3C16C 5DHAA 3O8BA 2GESA 4ZO4A 1SXJB 1V5WA 1M8PA 1YRAA 1NF3A 2X2FA 4HYYA 1N5IA 2FPKA 2H17A 3WP0A 3AV0B 3FHCB 3WHLA 3B7GA 3IKJA 3BFXA 4Q4AB 2ZS8A 1IN8A 4B32A 2LKDA 2IS1A 4ACBA 3UK6A 2MSCB 4UNRA 1E2LA 1E94E 1KI4A 2FX3A 3ECCA 4OQNA 4TL8A 2WWIA 5JSZB 3QKSA 1KK0A 3CBQA 1SVIA 4HB0A 2B7BA 3SZRA 3LV8A 1E2DA 3BE4A 3DEFA 2H1LA 4KCGA 4A1FA 5K8UA 1E2NA 2ORVA 1K5GA 1IM2A 2LKCA 3PFIA 1UEIA 2ORWA 1G18A 2G83A 1VG8A 5DISB 2J45A 1IAQA 1SVMA 5EZ6B 1N6HA 4PAOA 4RY2A 4QHSA 3AGQA 3LVRE 5BXQC 4PO1A 4AURA 2CNWA 1QG2A 4A4DA 1SULA 4L5BA 1G64A 1NVWQ 2IL1A 1H8EA 5K8LA 2F43B 4ESVA 1AIPA 4MYCA 1QF9A 2DFNA 4YC7A 4YQFA 2RMKA 4ZIRB 2Z4RA 4MYTA 5EP2A 1S9HA 2OM2A 2QZ4A 4AYWA 4YDHB 2OXCA 5CIWA 4FWTA 1BIFA 4AYTA 2VSOA 5JBQA 3NH6A 4OK5A 3ZVRA 1JAHA 3NDBB 1IXRC 2W6JD 2CBZA 3VFDA 4AKHA 2IWHA 2DYKA 4BGDA 4DCTA 3MWLA 2V7QA 3VQTA 1E9AA 3TGPA 2QSYA 1Y63A 1Z6TA 2N1BA 4O25A 3U6BA 4OJKA 3WNBA 2I1VB 1W4RA 2ZRNA 1OPXA 4JKYA 3GP8A 1CIPA 2PL3A 2AXNA 3U7FB 1KK2A 3KDSE 2VF7A 2GJKA 3ADDA 4S2EA 2AR7A 1W2HA 2FF7A 5EZ5A 5BN5A 1G21E 2ZRBA 4GOXA 1AA9A 5HR5A 3GJ3A 1W0KA 1NMZA 1CR4A 5ELXA 4LYAA 2QI9C 1Z0IA 4QBGB 2J46A 1QVRA 1SXJC 2GEUA 1BYIA 1R6BX 5H8WA 1A4RA 3NC0C 3EPKA 4BZQA 3RVBA 2HT6A 1LS1A 1H8ED 1G3MA 4PHFA 4HSEA 1QHSA 1GL7A 4QGFA 4NHOA 3R8CA 4ASUA 4C0KA 3B78A 3W9YA 2ANCA 4Q21A 4ESHA 1E1RA 4TL7A 4F93B 4NL4H 4ZDIA 5JCZA 4PSAA 4B6EA 3SJCA 2L0XA 4JJKA 1JECA 1OB2A 4Q01A 3H86A 3BGWA 3NH9A 2ZRMA 3ZVLA 2ZS9A 3IQWA 3GJ4A 3TUIC 2HT1A 2WWWA 4IVQA 2Q3HA 1P62B 2PCJA 2R9VA 4PZZA 2JLQA 3THOA 4LOAA 3EWSA 4CEHB 3FWYA 4DCNA 4GMDA 5F2EA 1NN5A 2VIIA 5JRJA 2J0UA 3MD0A 2CJWA 3VR4A 3AVXA 3OIYA 4URUR 1W4CA 5JS7A 3CM0A 3QBVA 4QL3A 4WXPA 4IDPA 3IIMA 3RC3A 2RB4A 1F2TB 1G3UA 3MAAC 3NHAA 2HCBA 4DRZA 3GJ6A 1W0KD 1HEIA 1GITA 1VCNA 1KO4A 4C0SA 4EFLA 4Z1MA 3VKGA 3BORA 3U7EB 2QBYA 2KB0A 3A6PC 3GEEA 5FL7A 3VR6A 5TMPA 1OXSC 3HR7A 1WF3A 5FOWA 1OFTA 4Q47A 3PEYA 1I2DA 3WHKA 4OQFA 4PC6A 3TSZA 4PC7A 2C2HA 3SN6A 3K09A 1OV4A 2ZU6A 3EA0A 1I4DD 1R0YA 2ONJA 1E1RD 4D0NA 5KSYA 2FEOA 4JZKA 3B5JA 2HJGA 5KSPA 4WZ6A 3NKVA 1BH2A 5L8VA 3V4RA 4YMSA 4ZCMA 2QAGA 4NYJR 1AK2A 3I5XA 1E9BA 1R5BA 3TE6A 1W36C 5HTKA 1G3IA 1UBGA 3B1WA 1MH1A 3LBNA 5TXGA 4Q4JA 4U7DA 3C41J 2W0SA 1D6JA 2KE5A 4A0FA 3H84A 4WZAE 2DB3A 2AWOA 2P0EA 2VA8A 3S1AB 2J0QA 2CLSA 4L4UA 1W47A 3EC2A 2J7KA 4Q1CA 1PUIA 5EE9A 4RD6A 1RIFA 4MKIA 2HJVA 2D74A 1W49A 4LX0A 1Q12A 3CLVA 1G8GA 2CHVA 3VX3A 4Z1MD 4C2TA 1ZUHA 3VKHA 2V1XA 2NO1A 3T1TA 3B60A 4XH9B 3V00A 2CCKA 4A6XA 4KODA 5GJCA 4DEYA 1JJ7A 3EIEA 4Q9KA 4URWR 4F92B 1G16A 1BMFA 4LDJA 1EESA 1G6HA 4Q7JB 4GSYA 2XEXA 2ZI7A 1LTQA 3SQXA 5C4GB 2PEYA 4JKIA 1MOZA 3PEUA 721PA 3U6KA 3MG9A 4KLZA 1Z6GA 3QIAA 1Z2AA 1DBSA 2W0MA 4LV5B 1R0XA 5JWHA 4KVAA 2VLIA 4XD7A 4HAXA 3ZZTA 1MV5A 2HDNB 4PR0A 1T8TA 2GCPA 4OI0A 2QY9A 2G88A 1CP2A 1IN4A 4NYJQ 1WB9A 2GETA 2QN6A 2BWJA 2FSGA 4JBXA 3RRYA 1CXZA 3AVYA 3BFVA 3Q85A 4KJZA 4OQMA 5FFMA 3VTKA 3LFUA 3I4LA 3VNUA 3Q5DA 4F7WA 3QE0A 1G8HA 3GLHA 4L9SA 1EX7A 4EJSB 3DZ8A 4Q1EA 2VH5R 1BMFD 2ZJ2A 3TMKA 1XWIA 1GNQA 3OESA 2RGDA 1FW6A 1MT0A 1ELOA 1ZC3A 3AKDA 5A0FA 1OH5A 2WSSA 4LPSA 4NE2A 3K0CA 3PITA 2AFHE 2REOA 2ZYUX 1J7KA 1S8FA 3QENA 4LV6A 4TTQA 3SJAA 2XXAA 1NG9A 1KI1A 2YKGA 1YE8A 1KHTA 1D2NA 1DG3A 4DZZA 2QE7A 2O8CA 1DEKA 2JLYA 2Z5FA 2C98A 3X1ZA 1KDOA 2ECKA 2XGJA 3ND9A 2J0VA 4YONB 3T15A 4G5SA 2Q9CA 4DC9A 2JLSA 1E2MA 3NXSA 4D82A 1ODFA 4P33A 2ZR0A 3QKUA 4GI7A 3OEED 5KHOC 2D2EA 3V4FA 3TR5A 4BUJA 2W2VA 4GOKA 4PAMA 2YINC 3B1YA 3E1SA 2WVJA 1MRNA 2F1RA 3A1VA 4QGGA 5JEDA 1TQ6A 3L0PA 1YHNA 1E2KA 2FEMA 4H9GA 3IGFA 2CCGA 3GJ8A 1QHIA 2OAP1 1NRJB 3RRMA 1B23P 4LZZA 4RVCA 2JDID 3A37A 2WSSD 1AS3A 3AP3A 4UXJA 5FPYA 1HURA 4TMXA 2FSHA 2ZANA 1XD2B 2R6CA 1E1QA 2EWWA 3BD9A 1EFUA 1P73A 4IJMA 4ON9A 4AI6A 1PZNA 4C30A 2HLDA 1S4QA 3WNDA 1LY1A 1TPZA 5JECA 2QE7D 2VHCA 1VCIA 2A5JA 1ZP6A 4NCNA 3CF6R 5KNDA 1E0AA 3ZH9B 3ZS8A 3CONA 3W8NA 4Q7KA 2J0UB 1ZU4A 2JEOA 2IF0A 3K70C 1QRAA 1Q1BA 1X3SA 1AM4D 4FMBB 4JIMA 3L2OB 1IY2A 4QBIA 3R9XA 2O5VA 1ZNXA 5SZHB 2ASEA 2PZEA 2QGZA 3AF3A 4OK6A 2EFCB 4M1KA 1P2UA 1F3OA 1NN1A 2FMXA 5J40A 5AWFC 3RAPR 1ESMA 1E4YA 4LPKA 4LYFA 4M0LA 4PQYA 1N3BA 1PLJA 3PUVA 4W5HA 2AD5A 4IRUB 1US8B 3KJGA 4IHQA 1QG4A 3CRRA 1ETUA 3M0EA 3TAHA 1DARA 2DWPA 1XEWY 2FG5A 3IBGA 3T5DA 3WYAA 3LLUA 1CR1A 2VSFA 3H4MA 3LAWA 1T6NA 1NY5A 4R98A 2KJQA 221PA 4TL9A 5KSZA 1PUJA 3CRVA 4D26A 4LYJA 3QKTA 3O8CA 3AKEA 4K8OA 3FHTA 1E2GA 2PCLA 3BB4A 3EZ7A 4TWZA 3K0AA 3C5CA 2J9RA 2QA5A 2HLDD 1AZSC 2XTZA 5FTJA 4CT4B 5HZKA 3ZD6A 2VHJA 2BDTA 1UBCA 3K9HA 1E32A 2WV9A 2HV8A 1GKIA 2YWGA 3DOFA 4Q4JB 1TF5A 4M21A 4DDTA 3NIBA 5JS8A 2A78A 4Y0AA 1G7TA 5FI1B 2CK3A 1XU4A 1ZNWA 4DCSA 2W2TA 4JL8A 1FTNA 1M2OB 2C8VA 2RHDA 1TU4A 5FL3A 2YOFA 3NEJA 1DAFA 2AD1A 2NO9A 1LW7A 2NOAA 2XNDA 1EXMA 2GJSA 4Q19A 2QNRA 1GSIA 4OQLA 2KI5A 4CEJA 2ZRHA 3U4QB 1BO6A 3LNCA 4RKFA 2DBYA 4TZ0A 8OHMA 2HF9A 3AP1A 4UJ5A 4F38A 5L3SA 4DUGA 1SVOA 3QVVA 3PIRA 4JLNA 4B75A 2V8OA 1ZM2A 1Q0UA 3BH6A 4RJLA 2CHGA 2PZFA 2ZUDA 4B3GA 4Z8YA 2QL6A 3B13B 1XTKA 3CRW1 1G7RA 3SU8A 1KZGB 4LBYA 1KJYA 1ONBA 1U0HC
chains in the Genus database with same CATH superfamily
3BHNA 1B8UA 4LXXA 4PC2A 1MDFA 3R5FA 3AO0B 2OHHA 4BNUA 3THXB 4XTCS 4RQUA 4YREA 4DB2A 1R0LA 3TJRA 4RCYA 3LECA 3B7WA 4F5ZA 1UK8A 1PEAA 1T9KA 1NYTA 2UZIR 4JI4B 2AKYA 3PHCA 3SQDA 1C8BA 2XIJA 2FPLA 2WKPA 3LPAA 4QYIA 4X1KB 4F6CA 1N0WA 1NLFA 3PNMA 2P9YA 3R6LA 3AKCA 1WDMA 5M29A 1ODTC 5A9TA 3WV5A 2B6NA 1GZ4A 2EARA 3GAZA 6NULA 3C14C 3AFGA 1XCGB 3OLXA 4AAYA 2BSXA 3RJMA 3DTTA 1BX3A 1LSJA 4FXOA 4MV4A 3MOGA 3G85A 3CNNA 2G0TA 4R01A 4UNPA 5KTYA 2CL0X 2QRPA 4KN6A 4OXIA 2Z4SA 3NTRA 4RL4A 1FCJA 1FX0A 7YASA 2XZPA 2QRZA 4B09A 3NHZA 5FA8A 3E7FA 1UJMA 4HJXA 4LG1A 4PU0A 4KXWA 3UFXB 3REFA 4CR8A 5EIXA 3J81k 2O8EA 1WM1A 3OF5A 4JQOA 5K09A 2GXQA 1EKXA 1IZ9A 5TRTA 4NZYA 4HH0A 3LU1A 1YIOA 2FUG1 3FBTA 3AR5A 4P31A 3OEHD 3VDQA 1B0ZA 1DV2A 1XK7A 4W8OA 4F2WA 1KH1A 4QPNA 4C5AA 4YCNA 3NZEA 4I2VA 1HLDA 1EXVA 1CY4A 5IVPA 1AQJA 1NOJA 3N2IA 1R0KA 3AVTA 5A2QA 3BSSA 2JGEA 2XXAB 2O19A 1OYWA 1MG0A 5JNLA 3QRWA 4TXHA 5DYTA 1W6UA 2FK8A 3HBMA 1JR4A 5L7WA 3H83A 3KOZA 3VZDA 4EG7A 5KYXB 3FCXA 3TEMA 4C4XA 3HVJA 4Z9FA 3ZHTA 1V1JA 5FNZA 2R00A 3MAJA 4C0AC 3DE3X 3RTCA 4BMDA 3R5JA 1H5QA 2EQAA 3DDSA 3L1HA 5LC1A 3RKUA 3CRMA 2BOVA 3PC7A 5ALZA 2FLWA 5KUTA 4QWWA 5ALRA 5JO0A 3CA8A 2HMWA 4G4SO 2VDWB 4CI9A 1EP1B 4HFMA 1JB1A 3RPEA 2E6KA 4KXFB 2OC9A 3CT4A 5PGMA 3AOGA 4BVAA 2BI7A 1VHDA 3LZDA 2NADA 3OEYA 1OCEA 2OBNA 1ADCA 1MQAA 1N2HA 4PX2A 2XRZA 4F3KA 3NNSA 2VDQB 4CR7A 3F6RA 3OIVA 1Z37A 5E6SA 3PNOA 4U7HA 4OB8A 2EL7A 4ZV7A 4ARZA 5B55A 5BVGB 1OH6A 3HYCA 3O90A 3UMRA 2FA9A 3RYIB 1IBMB 1QAOA 5BUZA 3ZGYA 1II9A 1FBNA 3ZV7A 5IAGA 2IOFK 1HNNA 3KKOA 4KUHA 3BE8A 1NUSA 2HK7A 4YS6A 5DBOA 1IBLB 3QQ5A 4FI3F 4M38A 3LP6A 1XQXA 3ZXUB 2OP0A 3ZGZA 4ZKEA 5HPYB 3VAZA 1SM4A 3KP1A 4EF5A 2AI2A 3EH2A 5ERXA 3MJVA 2O20A 5FPPA 1JEOA 3T5TA 1N8NA 4IIJF 3V34A 4G8DA 3WXBA 1JG4A 2QZZA 3P71T 2NZJA 4DIOA 3PA8A 1O9BA 1N8KA 4BX2A 1G8AA 3KPYA 3GOQA 3WIVA 1P39A 3DTVB 1ZMOA 4OTZA 1MOQA 1BFKA 3W4IA 1Z74A 3PDJA 4EA7A 1Z47A 5DBFA 4PNHA 1JIIA 1I6LA 4YAUA 1TYZA 2V5VA 3UIEA 4EX6A 5E7QA 2Z5VA 2Q1WA 1H93A 4UMFA 3QJGA 5IK2A 3R9XB 4CQMB 1E9VA 1VIAA 2G9ZA 5LP6F 4Z0TA 1MO2A 4BWVA 2K87A 4X90A 2VKQA 4PPGA 3EA5A 1UDRA 5FJIA 1I3KA 1N3YA 3SM3A 1CJTC 3AJEA 3P1JA 4XGKA 2MINB 4PQGA 3RG2A 5J4HA 1M8GA 2Q3FA 1F0KA 3DAYA 4N8EA 4YCAA 4DLSA 2AEEA 2QPLA 4LJ5A 3RSLA 1ZBDA 3ANNA 3MQ2A 5AXBA 2Q5QA 1N2SA 1NULA 4KQWA 4MI6A 3SFZA 4D8YA 1NX6A 1HG1A 1SD1A 1S8OA 1XR3A 1L7BA 3T6KA 2QN9A 2BTOA 2Y0PA 4HWTA 3DL0A 1K27A 4ZQIA 2IWRA 2XRMA 2YYSA 3G1WA 5BR7A 3TB6A 4NDNE 3B2NA 3IA2A 5F9FA 3ZV6A 3JZDA 2A1TS 1ZW1A 2OQIA 2ZSDA 1VE5A 1E4VA 1SXIA 2AI1A 3A9TA 5EP4A 5D3MA 5AXAA 3JQ6A 3QGMA 5ADWA 5JBNA 3ANMA 3DW3X 4G0NA 4JIGA 4MITA 2ZRJA 1CD5A 1DKRA 1MHTA 5G1NA 1UXIA 1F9AA 5BYBA 2OV3A 1M2FA 3QE9Y 4HH4A 3DPIA 1PZHA 4JA0A 1XF1A 3N2KA 1XZFA 4LECA 1IWOA 2YOGA 5H1YA 5JDCA 4E5MA 3E3LA 3CWZA 2Z2XA 2A5GA 1UPAA 2OCIA 2UUAB 1EUYA 1KA9H 2Q62A 2A0WA 3U3MA 1YZHA 2V1UA 4U3JA 5IK2D 1Q20A 1CC1S 3EG9B 2HQBA 1UDAA 2H06A 2PYDA 2PPVA 3K1AA 3LPMA 1V16B 4UBOA 2P6NA 3M5PA 2NU8A 4CCWA 1GTG1 2VQDA 3LZ6A 5A06A 1EE1A 1JPNA 2HUPA 4XR4A 4AY6A 1GZ3A 1XXHA 3F8WA 1E8DA 2WFAA 3NDRA 5AW3A 5IF3A 4OMUA 4OU5A 3UWPA 4WFKA 2IODA 2XB9A 2IX9A 1G41A 4Q24A 3WHIA 3BTUA 3QVUA 5FA6A 3PFFA 4OHYA 2Y71A 1WMFA 1ADJA 3BJMA 2N75A 3L8YA 1M1XB 1X7WA 4QT0A 3EOBI 1EINA 3CUTA 2C78A 1ISGA 1JVBA 1ZIDA 4HAWA 5CCDA 3D3QA 3INRA 3RS4A 4HKTA 1VMAA 2YJ5A 2QZ9A 1RBYA 1UDWA 3EVAA 3H4IA 3TFQA 2V7EA 3GLHE 4E46A 3GLRA 4Q37A 2C1EA 4WK4B 3ISVA 1IZZA 1XA4A 3LLMA 2C2KA 1XTVA 1Z0SA 4PG5A 1G9TA 2N47A 2GNOA 2PV7A 4RPIA 2PMDA 4K9SA 2M32A 4IV0A 2BT4A 1GOTA 3I1YA 3PVCA 2Q0SA 3TLYA 3EXHB 4HJRA 1WP9A 3UUEA 1CVIA 3WBJA 4YPOA 1IVSA 1Z88A 1KEZA 2I2FA 3EBPA 5K0ZA 1R6DA 1MAAA 3SKXA 1YR7A 1IN7A 2ARKA 3GT7A 5JQGB 4YAKA 3CVUA 2WTEA 3EIXA 3JQ8B 3ZYZA 4A6PA 4RTSA 1RZRA 1T13A 1Z7YA 1KRXA 3PE4A 1MB9A 1GYRA 1Z4IA 1G1MA 3C6BA 2HQ1A 1XKTA 2B1IA 2OO5A 3EBOA 3CX7A 3UICA 5J23A 1KORA 2D8AA 3FYDA 4ZGWA 4YCMA 3OTIA 3Q7SA 4TUYB 4OQEA 3V1TC 5L3QA 3FPBA 3I53A 1YJ5A 4MTLA 3WICA 3H3XA 3QNWA 2FP3A 2PUJA 4E2YA 3QVMA 4M0MA 1EVIA 1RKUA 3QPWA 4NESA 5EWMB 3ZHVA 4AFNA 2J3EA 5C7OO 4W1PA 1RFLA 3VX4A 4EVIA 3ZDCA 1IBSA 3T3GA 3EWIA 5B37A 2DLDA 3NWPA 1APBA 4K2HA 4L4SA 4WVLA 3FNRA 4DLTA 6ABPA 1H2EA 3K1TA 4IFBA 4CYMA 5E95A 4F06A 1YQXA 2VZ9A 4JBLA 1GRRA 2VP2A 4R6XA 5FBVB 4QOIA 4RNCA 3RV4A 1S2IA 3NX4A 2CFTA 4C1NA 2ZT5A 4WXEA 1Z16A 1Y5LA 4K2AA 2PE5A 1U0OC 4V0KA 1Z8FA 4NOJA 5ER6A 3UPTA 1AKYA 4LYGA 1XROA 2PSSA 1JIQA 3B8EA 5EE0A 1JTEA 1NMXA 3QFSA 1SCNE 4X7PA 4X61A 3EIQA 4F3TA 2N0SA 2VPYA 2ZOSA 3AQ4A 3DKVA 4LJ9A 1E6CA 2FDCA 4MKFA 2AOUA 2BFMA 2WSYB 1FSZA 1ZGCA 3JQRA 3WSWA 1CDDA 5AW0A 1OH8A 4IDCA 1RZRD 3ZW9A 3DPUA 3FFAA 3EF0A 3G82C 4TROA 5EZQA 2YVUA 1Y98A 2PT9A 1TEHA 3GFSA 4H7HA 1PG2A 3EWAA 4M0EA 1ODJA 3VKUA 4NCIA 1SVNA 4B2YA 1XDWA 2HW8A 4L27A 5IVKA 3L5OA 1Z62A 3C43A 2GKOA 3ZLUA 4XE5A 5JSKA 5CEJA 4KXVA 2IE8A 4N6NA 2FZ4A 3TN7A 4CLEA 1P31A 1W88A 4JL5A 2YWXA 4U6QA 5AI9A 3ZE1B 5EIHA 1R6UA 3FCSB 3KZMA 4MQBA 4PFSA 3WNQA 3KQHA 4CIYA 3VZCA 3MHPA 2RAUA 1PEYA 1NKSA 1JSXA 1P80A 4Q4HB 3RRNA 2C7VA 4C3VA 1J23A 2NQ8A 3SBXA 4RHCA 1PNTA 3GCWA 4L3WA 1J4AA 1V9SA 1ZUNA 3L18A 1JW9B 1PJZA 2QN8A 1IK4A 4JB0A 4J43A 2O23A 1G4UR 1SURA 1PFQA 3UB4A 1OFHA 3L0SA 3QMVA 4PS1A 4RD2A 4LHZA 5HJ2A 2D59A 2NXCA 1X1RA 3O95A 1TZ2A 5TF4A 2ICAA 3OPMA 3UV7A 2UDPA 3ZQ4A 3I9FA 1WV1A 2ID4A 2R1UA 2YQ4A 3G6KA 4ZN6A 5EJ9A 4MGZR 4OLBA 2J9GA 3F9IA 3WQRA 2PUDA 3WGIA 3KELA 3E9NA 3DBLA 4Q9DA 4F3YA 3IUSA 1MIOA 2H4XA 1NM5A 3A9CA 3IILA 3QP9A 2P4HX 2IXEA 2VRBA 5AKJA 1YCHA 4KXYA 3C85A 1GL9B 4MQEB 1UKCA 3WYNA 1SB8A 1PI3A 3N05A 3WIUA 2BSQA 4OHBA 1H0KA 4H7IA 4RKRA 5BMVA 3I2IA 5DLPA 3FB1A 1KTIA 5KVQA 1NBWB 4ASUD 3BF8A 4ENRA 1SJ9A 5FR2A 1GDTA 4WLNA 1EBFA 4KIGA 4BXOA 1Q1NA 1UIRA 1QFJA 3K5IA 4LZPA 2PZAA 4X92A 4AJ9A 1EE2A 1G3QA 4ENTA 1IJEA 1D9ZA 2H31A 4ES6A 1R5NA 4BO9A 4UPVA 1OOEA 1CQZA 2ZE7A 3RVSA 1N2OA 3A2MA 3ESQA 4MRVA 1RP1A 4ZQHA 4J91A 2ZJ7A 3RTDA 1KEEB 1PQ4A 3EPLA 3ZQUA 2HJHA 2EFJA 4FMCB 4WKGA 1XDGA 2VQ6A 3WL7A 1P2VA 2G0NA 1ZSYA 1IONA 4CV0A 4QZVA 2IUSA 1BYUA 1U1FA 4P80A 3W77A 2DSNA 5EHZA 4FGKA 3D31A 5TT1A 1C9NA 1O03A 4MIYA 3BFPA 4QDUA 1YVPA 2BGUA 4H7JA 4URVR 2GD2A 3ND8A 2P79A 2WJPA 4MGKR 4J75A 1M34B 4JT9A 2YW9A 3IBYA 3U1VA 3TSWA 4AVYA 4B6SA 1VJ1A 1L7AA 3AUAA 3NT4A 1XJQA 2LCFA 3ETEA 3UMMA 2HK9A 2BCJQ 4L5YA 2I34A 1DI0A 4LMAA 3G8BA 3T3DA 3WQSB 3OAAA 3JY6A 4LJ7A 1FDOA 3PRYA 4BV9A 2JD1A 3D5TA 5A9RA 4W1RA 3COZA 2DJIA 2DY0A 2QLFA 4DV5B 3DLHA 4ZDJA 1UPCA 4D9NA 3BWEA 3GLFB 1E9DA 3D4IA 1U7DA 4Q1AA 4MAFA 1SPXA 4JU9A 4RMNA 4UULA 4ZD6A 3MTJA 3GCXA 4HMPA 2RDMA 2P2YA 2MYTA 1OLXB 1YIDA 2HNAA 3CJQA 3VPFA 2A5FA 1TM1E 4I9HA 4UU7A 4C7XA 3DBRB 2QRJA 2QTWB 1PFUA 2VJBA 1H5NA 2JH9A 5LM3A 2FUEA 4NYIR 4O5AA 2WF5A 4BBZA 4AMUA 1PD0A 2HWXA 3ZXXA 2HJRA 2I2WA 1T1JA 2YQ5A 3WGZA 3PRJA 2D5IA 4OMDA 2GX6A 4NU6A 1JEQA 3ASZA 3QKSB 2B8TA 1YI8A 2W2KB 1XMQB 3Q3CA 2YMPA 4ALLA 1I5EA 3DLCA 3LE8A 2AYYA 2CLKB 1EBBA 1I1NA 4BEVA 4BFWA 3EGXA 4OQ4A 4D9BA 3UOGA 2FXIA 4TPKA 3NYIA 2GKGA 1XZBA 2VPXA 4MVJP 3RS2A 2Z2IA 2HU5A 1R4NB 1Y82A 5JZVA 1YHZA 4GMFA 1OYOA 2IUTA 5BQOA 5CA1A 1DFGA 2WNIA 5LDGA 1GARA 1V7QA 4RJJA 1G5RA 2FSUA 1RVV1 3RJTA 4CE6A 2JLRA 5IBCA 5JV5A 1ZPDA 3A4MA 4LHEA 4PHCA 4D42A 1QC5B 3ZU6A 5I7HA 4NFHA 3AW8A 4XCXA 4ZZ1A 3PFBA 4A27A 3W1VA 4K40A 4RM2A 1Y9JA 1SKYB 1RQPA 3FTDA 2GAOA 3DZKA 4BWFB 2FN3A 4MQ4A 4MWSA 3ES9A 3K73O 4MB6A 1IHUA 3JALB 2VYNA 3ELDA 4HZGA 4OP3A 3DMNA 5E2AA 2I4IA 1S89A 2RH4A 2J9XB 4JHLA 2YHIB 2WIFA 4R31A 4XCVA 1E1NA 5TB5A 3EH1A 2FMIA 4X1YB 5BV8A 1KRWA 2VAVA 3AIMA 1II8A 4DR3B 3L8ZA 4ARUA 2DFLA 4X7RA 1T25A 2J31A 2BM9A 3ZHZA 4RANA 3KYDA 3ZCQA 4FGZA 1U6JA 5GIPE 3GEBA 5H81A 2AMJA 2FN4A 2JFGA 2XUJA 3N2EA 4D4GA 4BGIA 1I2ZA 1GU1A 3PRKE 4DQKA 5KCZA 2Q5EA 1HDGO 4ZMRA 2NQ2C 1FLAA 1XGKA 3HDGA 4UHBA 3PQ4A 1R9MA 3I45A 2Q4RA 4LSZA 1QR2A 4JSYA 1FW8A 1T2EA 2IYEA 4KR6A 4M1MA 4FN5A 1C5KA 2XMPA 3AVPA 2V8BA 2WZQA 4O4HF 4QOEA 4WLEA 1BA3A 1ODSA 1DIGA 4GPIB 1IZ0A 2JRLA 2C2XA 5DB4A 4ZCQA 2OCYC 1JYFA 1EVKA 2XPCA 2YXLA 4J3FA 2PRKA 4OQQA 4WZBE 3AI7A 3TIGA 4AMVA 2FUG6 2GEJA 1S96A 5C1IA 3BQNB 3LTEA 3RC8A 1Y4ZA 5LDDC 1WNFA 1MQ8B 2Y3IA 3HWX1 4L4YA 1ORIA 3R3VA 4BQSA 1T4GA 2A7QA 4M7OA 4YCBA 3QUAA 2A9OA 1RE0A 3PYXA 1UKYA 4AUNA 1IDOA 2COKA 1TIBA 1NBME 2NM0A 3N3BC 5LXTF 3PR1A 5CBPB 2VYND 4P58A 1EFVA 5K51A 1QKKA 3OZIA 2GYYA 2B69A 1BTOA 1QVAA 3D7RA 3IERA 1U99A 1KEPA 2WYIA 5KOHB 1CY1A 3HB0A 4G1UC 4QPZA 3ESCA 4HFJA 4WKBA 1PSDA 3BWMA 3HXKA 3II6X 1HNZB 1XELA 3EFEA 3JWEA 4JGIA 3T4EA 4N12A 4JDUA 3LQ4A 2ACEA 4WUVA 2G70A 2QU8A 1DKMA 2QPAA 2XUQA 1EH5A 2G4CA 3KKKA 2EJWA 4N0DA 2F90A 4PZDA 4D4KA 1FMJA 3ZIDA 3KT6A 3N7TA 4US0R 4ZOLA 3GPDG 1H23A 4GPZA 4PWYA 1DT3A 1GD1O 5K20A 2WP0A 5FBLB 2WUWE 4NU5A 4FEAA 4FQ7A 1E5DA 2H3EA 2IDZA 2H08A 4G84A 5T67A 1HF3A 2DPLA 3F6SA 1OXKB 4DARA 1OB5A 5DBHX 2AW5A 1KI6A 3LT0A 5KPJA 1B0PA 1QG0A 2X2PA 4KQ6A 3PEWA 4PFJA 1X2BA 3HU3A 2VJLA 4FMPA 2C92A 4QJ4A 3UOAB 1GNTA 3O9MA 1Y8RB 3QMMA 4JJ8A 3WGGA 4BVBA 5C52B 4J0JA 4HUJA 2Q7OE 4DOMA 4YJFB 2KLHA 1YUNA 4LFAB 3H0CA 3PGVA 1E2EA 1DS6A 1E3WA 1WPQA 3QTBA 4C6SA 3HTXA 1QU3A 5T6BA 2CEKA 2QP4A 1QFYA 3SIXA 2NXEA 4B2IA 3IVXA 2EHJA 1E3TA 5DNCA 5IM4A 3EQ7A 2WKQA 3EE6A 1JSLA 5ESXA 3W5JA 5KQLA 1S4MA 4LBZA 4RPJA 3SZMA 5TPWB 3HPRA 3CLTD 4EVRA 1TM4E 3K0FA 3JPYA 3FDIA 5M3BA 1HORA 4AF6A 4QUGA 5HKOA 1TE2A 3H8SA 1QRSA 4HNHA 4X62B 2ZYSA 1KHHA 4GZMA 1QUEA 2WHEA 2KM1A 1USIA 1KMHA 1XKQA 1QDLB 1CRQA 1WUIS 1UC4B 2P9CA 2WHPB 1DCMA 4FOSA 4IWXA 4PV7A 4R7GA 4EZIA 1RHRA 2WR8A 4NU0A 3HCRA 1J2YA 4UTRA 1P8JA 3ZXSA 1PD1A 1W75A 2ZRPA 3DDNA 4UEOA 4Y6OA 2R7KA 2CXPA 5ALXA 5DYWA 4D98A 1UODA 2DFDA 4PPNA 4MWZA 4OBBA 4ZHSA 3ZLJA 3ASYA 3ZDEA 3HO1A 1KY2A 2DWUA 2IELA 3ZU3A 3LVQE 4I6JA 3AY0A 3Q9SA 4M89A 3TRDA 2GM5A 5FB3A 4UQOA 3UJ9A 1XF9A 4IDHA 2P3LA 4MTCA 5FBHA 3LKDA 4RAQA 4KKXB 2P5YA 2SNIE 3JRNA 3Q72A 4KLCA 5A7HA 2HMSA 1HLGA 2Q6IA 3OCCA 3R6WA 3U9SA 4MZDA 1SBHA 3VNAA 1OAOC 4YXFA 3AFHA 2LUOA 1GADO 5IVHA 3HCEA 3HKBA 1Y5NA 3WOVA 5BMOA 2E6UX 4GYKA 3UHFA 4BE4A 4PCLA 3WWOA 3ROXA 1IZYA 5CGZA 4LQ4A 1X70A 2BEVA 4ZT5A 2GT1A 5BQPA 3SMQA 4MW5A 3LXMA 1OBFO 1ZL2A 1TKBA 5GM2A 1KIFA 4JFAA 4CTMA 3KBOA 4ND3A 2C7OA 2M2IA 4OO3A 1U94A 2QUZA 4INPA 1PU2A 2I9KA 1RM0A 1S8NA 2HIMA 2Q2WA 4PCUA 3LNTA 3DAOA 4LMBA 2XWQA 3DDCA 1N6PA 2BMEA 4ALMA 2J6HA 3TD9A 4EPXA 1NJ8A 2J5XA 3IALA 1H8HA 5IWCA 4ARCA 3SF8B 4CDNA 2PIDA 4F91B 2C9DA 2G7ZA 5A5GA 1DHRA 3B51X 2H16A 4A16A 5KKAA 3CPSA 4J7CA 1EGHA 4YRRA 4BJ3A 3KNZA 4CMGA 3BZUA 4E5SA 3THXA 4JWTA 2F48A 4BYMA 4PYIA 4C0JA 4OYRA 4JBGA 2PNJA 3OPQA 1FQWA 3KD3A 4F2GA 2JATA 3RRJA 3UJPA 4Z7JA 4AW9A 3QI2A 1YR9A 5B57C 4IQGA 3RSFA 1DTWA 1U3CA 2O7VA 5EZYA 3K09C 3A26A 1EUCB 3CNEA 3L0OA 4J0IA 4Y8VA 4IR7A 5JRDS 5K3EA 4MRMA 2HK8A 4KGDA 1ND6A 2CLFB 2AXEA 5F78A 4BFSA 1TAQA 1YZUA 1A7UA 5H82A 1RXVA 4RSGA 5DHUA 4ZZ3A 5EUBA 4LMRA 4EFMA 4CNQA 3E7DA 1Q92A 3R24A 4WX2B 3T9DA 3GWGA 4DUYB 2FRXA 3VHXA 3I37X 3D8SA 1C3VA 3EY9A 3ZK9A 1JU9A 1SBCA 1II0A 1UFQA 4QQFA 4QJ3A 2XKAA 1NJFA 3L7OA 4N4AA 1VPEA 4MKRA 4OAQA 4X63A 3N5KA 4X91A 4D9FA 4UCFA 3NYWA 1GQ2A 2KSQA 1EYZA 3RCBA 3RSQA 3ZJVA 3HN2A 3RUHA 3SXJA 4DMFA 5U9CA 3SS8A 2GRJA 3PWSA 4Z0PA 1XPUA 4MWTA 4DIEA 2W8BB 2IK8A 4QGAA 4U8GA 2BIFA 1E98A 3VNQA 3E23A 1XLUA 5JMWA 1N2CB 3L82B 5LZ4A 5EWJB 1GAXA 4TV8B 2NO6A 3D3JA 3UJ6A 4AG5A 1C0PA 4NFYA 5DIFA 5IJZA 1ECLA 1OR8A 1Z5UA 3K4HA 1U2TA 2ZJ6A 4MRSA 4ZIRA 5FRDA 4Q66C 3DE5X 1LA2A 3JW8A 2YV2A 4M9XA 3LQ2A 2H7YA 3DMTC 5P21A 3QX9A 3IEPA 4EFNA 5IFLA 3S2IA 2CCJA 1MVLA 1CJUC 1MA3A 2ZIUB 3CR8A 3NIWA 4GOJA 1PNRA 3INNA 1SVSA 4WJZA 3O2JA 1U8UA 2EX4A 3A1UA 4GZ6A 3AB3A 3QVJA 4W6ZA 3EGWA 5HK8A 4EAAA 4IOMA 1WMAA 4UCQA 1FNDA 2GAFA 3LF1A 3LBHA 5CMLA 2EIHA 4Q18A 4DMCA 3U4MA 4LDZA 2J6IA 1BQ4A 2HRZA 3HJGA 4XA8A 2HY7A 5C8YF 1W85A 2LGJA 1QUFA 3OM1A 1EVZA 2LPMA 3DAHA 1ZGZA 3PUJA 4I4LA 2MCFA 3STTA 5CFZA 5L95A 1TCCA 3RYCB 1YI1A 2LCQA 2HMAA 2XADA 4AY4A 3U3RA 3F7TA 3RSGA 5H9WA 4CKCB 1E58A 3L8GA 5B3AA 2IGBA 3W3AH 4DDWA 2P2ZA 4GD3Q 4XLTA 1DG9A 4XW2A 3TTUA 1XPOA 1X0XA 1YL5A 3SIRA 1FUYB 2V9PA 3ZYCA 3K8QA 3EZNA 4KMRA 1EFPB 2PWYA 4BGUA 5CDGA 1TK2A 3UXMA 1TVCA 2SICE 2GSDA 2BBTA 4I7EA 2IY9A 4TTPA 1U81A 2RAPA 2GPWA 3TLZA 5DBEX 5EE5B 3T35A 2BFCA 2HDHA 3QXHA 3M4XA 1ZUWA 2ZJOA 1EWRA 5IW8A 4IUDS 3H8JA 4RVDA 4XGRA 5BOSB 2JLWA 3FI9A 3RU2A 4CLXA 1WDLA 2HA4A 3ENVA 4PE5B 5D84A 2QMUA 4ZU6X 1E9CA 4F04A 4J0QA 1WPRA 3V42A 5F77A 2D0PB 5LYJA 3KSBC 2JH3A 4N01A 2AVNA 3A2LA 2IUYA 2I3GA 4GPAA 4MYUA 3NAGA 2JA1A 1H42A 3WYFA 1VJDA 4G0XA 3C4JA 4JR0A 1E3SA 1YS9A 2X5NA 3RS0A 4ZO8A 1G2IA 3Q8KA 4BOYA 1O97C 2EV9A 2B9EA 4Y7DA 5F35A 1U0EA 2F62A 3HDVA 5A7FA 4M7RA 1OGYA 5KEIA 2XE7A 1IM8A 4RMGA 4E7OA 4IICA 1E2FA 4BPBA 4WK0B 3V2IA 1ZHHA 4KV9A 4QSMA 1W5TA 3TQQA 3T1QA 2E49A 2P90A 4URZR 2ZSUA 5DCLA 4W9MC 1OLSB 4KPYA 1F2TA 4WN9B 3L6CA 2GBFA 2ATEA 2J1LA 3LFTA 3EPHA 3O94A 3CW8X 4HX9A 4WHMA 3OY2A 5IF9A 2DUJA 4B0PA 3I6QA 1MENA 3AESB 7REQB 3U5ZB 1PG0A 5CAEA 5DMXA 3HB1A 2DQKA 3K6SB 3O84A 4MV8A 4G25A 2YCLA 3CPJB 4KVFA 2CMFA 1BRMA 3F5FA 5L53A 2ZBQA 3FG9A 3TG8A 1NBMD 1LGYA 1U5AA 5ALPA 3OLWA 1WLYA 4FLEA 4N82A 4W7IA 5EUMA 4J1QA 5T3YA 4GZ3A 2QMHA 4Y6RA 2H92A 3V6LA 3KTDA 1JU3A 4G0OA 5FOSA 4CM5A 4KO3S 5AVTA 3GFRA 2H3HA 3TL3A 4BJHB 1ZITA 1USGA 2WIBA 1IC6A 4M99A 2WTUA 1JWAB 1I7LA 2YWFA 1U3WA 2IUUA 1UR5A 1XEXB 5HRAA 4CEJB 4QOSA 3WGLA 2OGZA 2GZDA 1M2JA 4HWSA 5BPFA 4PPFA 2PKEA 4CM1A 5DOVA 4LTDA 4NJEB 4F46A 4PS0A 2V9ZA 2QTHA 5JW6A 5L6LB 1N6OA 4XEHA 1Z0JA 3ESYA 1RWBA 4OA8A 1D8AA 3QEAZ 1FS6A 2OLEA 1U0LA 4ALIA 4BLOA 3PJGA 2WAXA 5CD1A 1VL1A 4KPEC 3FJYA 1DJPA 1DADA 2JAUA 4WNCA 2FEAA 2BVNA 2YJGA 4PGMA 4LRYA 4ER3A 5FEUA 3B1FA 3H13A 5AIAA 4DLAA 4IJ6A 4MPTA 5EXSA 3N53A 4FMDB 4CHTA 5J4LA 3IBTA 3JQAD 3A2KA 2DFTA 4RGQA 2JFPA 1J07A 2G4VA 1Y1QA 1A1SA 1SKQA 5ARDA 1VLJA 3RUFA 4UNSA 1TUGA 3LWBA 1U5BA 4IIBA 4QOHA 4YMHA 2L69A 4NHEA 3ZWQA 5BWCA 1PHPA 2ZSAA 2KX7A 1NPDA 1ZESA 5JJKA 2D7JA 1KTVA 1R18A 1ZWLA 4BGEA 2IHYA 2W2LA 4UDNA 2X40A 4L6IA 1R4MA 5FTNA 4YRCA 2JJ2D 3C5WP 4ZTZB 2AZ4A 2VTDA 1CVLA 3VZRA 2GPTA 1ZOLA 1DMRA 3BJEA 4J4BA 1YBHA 5BV1A 1W9HA 1T9BA 4IDFA 2XMQA 4LYHA 5EJIA 3WJ1A 5AVSA 4JVSB 1NUPA 1JI0A 3PJDA 4R54A 4TLBA 4BB5A 1Y34E 5AK4A 5DF1A 4DLPA 3NEYA 4DIFA 2P1DA 2W6JA 2NSYA 3LT1A 5IH7A 5J4YA 1B1CA 3I5YA 4OSPA 1CUGA 1GNRA 2Q8NA 4MVCA 2GPAA 4RV5A 2NUAA 3TQTA 2I7TA 5JFOA 1ZN9A 2FPMA 1B16A 2NN3C 4YRJA 2OZLB 4Z49A 5D85A 4RQBA 2W6NA 1S5PA 4IL5A 1M1YA 2K4MA 3WB1A 3K8OE 3WY9A 3UCFA 1HE3A 4Q9NA 1XPJA 3J81A 4JXXA 4DDVA 1QIGA 4NZZA 4ER6A 3NC4A 2P65A 4QIHA 4WAUA 4WGGA 1KK3A 1ZC4A 4KYVA 4PZLA 2OORC 4YI3A 2VP6A 3OIUA 1NW3A 3HY4A 1Z5NA 5MF6A 3EISA 1Z5PA 4EJSA 4C7BA 3TW0A 2XYPA 1FDSA 3I3SR 4P53A 3BXOA 2O07A 2W2LD 3T1VA 4UNQA 1WU8A 3HUDA 3DZIA 2PLAA 4EG4A 1Q3TA 1JKFA 3MWEB 3PZBA 4ID9A 1DBVO 3WKBA 1EHYA 3BXPA 4UPEA 4K8RB 3OOJA 3IOBA 3G0BA 2OM6A 4GZLA 4BX3A 1AZLA 1NI3A 2G5TA 2WBLC 1RQRA 1GUDA 1RPTA 4LWZA 3BH0A 4OUDB 3EF3A 3BXGA 1ZJWA 3HJUA 1F4PA 1RXUA 2J0SA 4IJ5A 3FTQA 4HXEB 2OILA 1XZIA 2NZ2A 1UPTA 3FOFC 1ZD3A 1GHTA 1U4OA 3K92A 4QG7A 1VSTA 2RGGA 4BCDA 4DABA 4LE1A 3FPKA 1PVVA 1GUAA 4RMHA 2MYNA 4LNUA 5L3VA 4RVUA 4I14A 4O2RA 2PZ8A 5KYUA 1ILWA 2H57A 4MGEA 1UAGA 3F5SA 2XOEA 1V26A 5B2ZA 4I9NA 3H97A 5DXAA 1VJ5A 3V9PA 2JFHA 2JVIA 3AI1A 1GUZA 3LL7A 2Z2ZA 3OKCA 2XUOA 4DWWA 2AEFA 1FL9A 2AG8A 3CZ9A 3ORYA 3TNFA 1B00A 3NG1A 3CVWA 3UWOA 2DHEA 3K2IA 4LDPA 5FBKA 2VNIA 1NHGA 3P8ZA 4Y2UA 1K86A 1RHJA 1N92A 3ZNNA 3NIDB 1HRKA 2X5JO 2O4UX 1IN5A 2WV7A 3TXYA 3ZWNA 4MDEA 4YLEA 2ECQA 2X4IA 3PQFA 2WDZA 2DAPA 2GEFA 4MJ7A 1EEXB 3L7AA 5TF0A 3OH8A 3SE0A 1VBKA 1X1TA 2FP4B 1TCVA 3HCWA 3Q11A 4M9QA 1PT8A 3GFOA 1NNUA 3IIJA 1R37A 2QE6A 3B1ZA 5CFLA 1XKXA 3N0RA 2HFJA 4AX8A 4YRPA 3OJXA 4Z4EA 3VR3A 3PNVA 2OQ2A 1CETA 2AOVA 1LRLA 3UF0A 1F7VA 1BDIA 3R9KA 4YCLA 5H0IA 2HBRA 1KIMA 4K5QA 2O3SA 3KKQA 5F5XA 2XBMA 3HC7A 3NHLA 3GUCA 3IPYA 1XDBA 5BN3B 1V4VA 3CUVA 4H27A 5FQNA 1K7EB 2P27A 4KPUB 2OK7A 3HE3A 1MHPA 1GA6A 1P6QA 2EZUA 4JBNA 2QL7A 1PLLA 3CEPB 1RWQA 1GT6A 3ZWAA 5AK3A 1XPRA 1KYQA 4J0CA 4EUEA 4US2R 2XNSA 4P0QB 4QQKA 4TM7A 3H87A 4JUCA 1GZ5A 1N33B 3D2AA 2H2WA 2G9QA 2PKQO 5KVSA 2EX1A 2I1QA 3N70A 4PCVA 2ONYA 2Z30A 2WTMA 4HB4A 3NHWA 5GOTA 1VG9B 1XZMA 4OQYA 4C3OB 1TT7A 5IYZB 1KI3A 4B71A 4OQXA 2ZW9A 1VYVA 1US8A 1X87A 2QR2A 2VAPA 4L3OA 4TQGA 1Z82A 4URHA 5AI6A 4C22A 4DTCA 3GVXA 2WM9B 1W0CA 1QLWA 4GYJA 3AKZA 1CE8A 3RTGA 2IPNA 2VZLA 5DM2A 2VTVA 5AO9A 1J20A 3A25A 3C8UA 2VZ8A 4DA9A 4E03A 3L1JA 2ZIVB 5BYJA 1HDOA 2V6BA 5BSVA 2IIVA 3ID6C 3GJ7A 4KDCA 2GASA 3QVLA 4BNDA 4RY0A 3T7CA 1FYXA 4HVTA 1JQ5A 3SEFA 3KM0A 4NBKA 1EFTA 3HDYA 2YVAA 5EC8A 1IY0A 3E6AA 3HY6A 2D7CA 4HDSA 3N0VA 1IBCA 4KN8A 1WJGA 5G0WA 5LA6A 2ADMA 2PLFA 4RVNA 4U00A 3PCRB 1U9ZA 2JFOA 3NTQA 1XOIA 1SXJE 1WOYA 2GJ4A 2X8WA 4ROSA 4B35A 4OEHA 4B3IA 3ADKA 3D8HA 5CGQB 5T5QA 2NXJA 2Q99A 2R66A 2QN3A 3I0MA 4J9UE 4EHNA 1SD5A 4PX9A 1ANKA 3QE2A 2AFIA 3GXOA 3FIJA 1J7JA 4HQOA 4XYGA 3H0KA 1SD2A 4U2BA 2AN3A 4CIVA 2XVMA 4YYEA 5JMOA 4R1QA 4J3NA 3MIZA 5JNWA 1L4MA 1P5FA 2IZZA 2E4YA 3VRHA 2BDUA 2QOEA 2ZSIA 2RI0A 1V6SA 3ZTYA 2PY6A 1XXLA 4DPMA 1DAKA 1W34A 1G4HA 4OKSA 2JANA 5ALOA 4BVGA 5IMSA 4A0HA 1FFAA 3F6BX 4B85A 3CS3A 3PKZA 5ESRA 3TF5A 3PUKA 3HM2A 4JROA 4HVLA 4BDTA 4PG4A 1CRWG 3MWFA 4MP3A 5DI3B 3NBAA 3D8NA 1AURA 5FOTA 3SIPA 4QGBA 2HL6A 1ZD9A 2W37A 3LLSA 4RW0A 1JA0A 5J5CA 4DV6B 2H29A 1SBNE 2HSEA 3QG1A 4R84A 1O5OA 2BJVA 1GZSA 3JD1A 2ECPA 1FFYA 3D59A 4NLLA 2QTGA 2P0AA 3RF7A 2P9FA 3ZY4A 3ELBA 1J21A 2WF6A 2I6XA 5BW6B 5BV2P 1RYHA 3PT5A 2PX0A 4X1KA 4A8JB 1CZKA 5K0GA 3HK2A 1F60A 3OOWA 1DKOA 3V48A 4PZAA 3EFBA 1HH4A 3MELA 3DZBA 4J1TA 2C99A 1OGIA 4MH0R 3BB1A 5I7WA 1GLVA 1KRHA 4HZIA 4ZCLA 3WIDA 1IAVA 3CTMA 5A5VA 4HI0E 4YUAA 4F60A 4BS9A 1E5XA 2Q5JA 1A7JA 4QWMA 2YFQA 4FGSA 1NYQA 4HPJB 4TMFA 4DUPA 4I8XA 5CB0A 4MQFA 3FNGA 2RGNA 4MGYR 4MUMA 2O7NA 5EJFA 2Q2VA 4FFVA 1Z7EA 2HDWA 2O54A 1N7GA 5FXMA 2R0QC 2XODA 1EWKA 1QZ3A 13PKA 1T26A 2QN7A