4HDRA

Crystal structure of arsab in complex with 5,6-dimethylbenzimidazole
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
339
structure length
335
Chain Sequence
MSLLQATVAKIMRPDTVIKDQVKTKLAGVLQSAGSLGRLEDMVEQYAGITGELNPALPKPCMVVASADHGVARRVVSAYPIETTIHMTANYLISQGASANAFANFCGADMVVVDMGVAGDLSYVPGLWHRKIAYGTQDFTEGPAMTREQAIQAVETGIDIVNDRVKHGNRCFCLGEMGIGNTTSSATIVGAFTGLAPEKVTGRGTGRLKTKMEIVGRALAVNKPNPQDGLDVLAKVGGFELGALAGVILGSAANRCAVVIDGLNTTAAALIANVIHPLSKEYMFASHLSGEPAHSIALRQLQLEACLELGVRLGEGIGASMVVDMLYVAIKLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Function of the Nicotinate Mononucleotide:phenol/p-cresol Phosphoribosyltransferase (ArsAB) Enzyme from Sporomusa ovata.
pubmed doi rcsb
source organism Sporomusa ovata
molecule tags Transferase
molecule keywords ArsA
total genus 127
structure length 335
sequence length 339
chains with identical sequence C
ec nomenclature ec 2.4.2.21: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02277 DBI_PRT Phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1610.10 Mainly Alpha Orthogonal Bundle 5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1 5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1 4hdrA01
3.40.50.10210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hdrA02
1L5KA 4HDNA 1JHVA 1JHRA 1L4GA 1L5LA 1L4MA 1L4FA 1JHPA 1WX1A 1D0VA 1L4LA 1L4HA 4HDRA 1L4NA 3L0ZA 4KQJA 4HDNB 1L5NA 1JHXA 4KQGA 1JHOA 1J33A 1JH8A 1JHAA 4HDRB 4HDKA 4KQIA 4HDSA 1L4BA 4KQHA 3U4GA 4KQKA 1JHUA 1JHMA 4HDMB 1JHYA 1L5OA 1L5FA 1D0SA 4HDSB 4HDKB 1JHQA 4KQFA 1L4KA 4HDMA 1L5MA 1L4EA
chains in the Genus database with same CATH superfamily
2Y76A 4BXOA 3PHHA 1GV1A 1WDTA 3PEUA 3WXBA 3Q5EA 4MP8A 1K5PA 2IF2A 5J1TB 1L4HA 1UP4A 1VI5A 2XA9A 3PT9A 1VCOA 4M1MA 5AVXA 4AFNA 1I2AA 1Q7TA 1BKYA 1CF9A 2F43B 1Z4JA 2OV1A 5D3ZA 4IDDA 5IWCA 4L95C 4L78A 3ZV7A 3PDHA 1NMXA 4LJLA 1RQPA 2E4XA 2Z8ZA 4IJUA 3U40A 4P54A 3MGAA 2WYUA 4P86A 3DULA 4NEQA 1TKBA 4YROA 1GY8A 3CLHA 3KZMA 3COPA 5ITWA 4J0HA 2XOKA 2OP1A 5T8KA 1NW7A 3EODA 5BXQC 1LVGA 5EWJA 1XCGB 5CHEA 4WNAB 4NJMA 3CUKA 2OUKA 1Z0JA 1AOXA 5BMOA 2G6TA 1D8TA 3RVRA 2Q7DA 2ONKA 5IARA 2DBRA 4FFSA 2EXXA 1RXIA 4FZVA 3I5YA 3P5BA 2VF7A 2XNKA 4Q4DA 2B61A 2HQ1A 2QOEA 3DP9A 4JB0A 2ACKA 2EW2A 2PKCA 4IUCS 3VOSA 4D4JA 4F85A 5JD6A 4PNEA 2RKBA 3RARA 2FMFA 2RGCA 1BHO1 1SKYE 4E14A 3KEMA 3D7KA 3FHOA 1M7BA 1SU8A 4HWPA 3CPSA 1M8PA 1GEGA 5ECGC 4BE7B 1L5FA 4HUJA 8ATCA 4QOFA 2FSVA 5I9SA 1TQ4A 4WBNA 5C46F 1DG1G 2RAFA 4BO4A 3H9GA 3JAWA 3RSFA 3CZMA 3MVEA 1LNZA 4ZRDA 5FP0A 3EVTA 5EE5B 4YLEA 3WKCA 2GM5A 4OKIA 1XLTC 4HS4A 3I62A 4EUNA 1BXGA 4MS3A 4AJJA 2XNHA 5CVCA 3BH6A 4EKIA 1D2RA 1YCDA 5HP4A 1PGQA 2WG1A 4AP6A 3ECAA 3JPWA 3NOXA 3OTHA 4MIEA 1QVAA 4WFJA 3TW6A 5AW6A 4D8WA 1IMJA 1GXSB 1O6ZA 5JZMA 1ZI9A 4HDKB 3RCBA 1F51E 1P3JA 1RIIA 1DO2A 3IYLW 4LX0A 1F9AA 4QE3A 3UIEA 4FP9A 2H1RA 4PFJA 4RV9A 5AR1A 2WNSA 1ESCA 1P1BA 1QGED 3K6RA 1IIBA 4PWZA 4GQAA 2GUWA 3GAFA 5IBPA 1FSFA 3FRHA 1B0UA 3OPNA 3VKUA 3MF4A 5I45A 3OE5A 2EEZA 2EFGA 1A9ZA 3D4LA 4LXIA 5DM60 3R77A 3THYA 3S2ZA 1F2TB 2GM9A 4QT4A 3EXEA 3SYNA 4X63A 2Q4DA 3HY3A 2EKZA 5BWMA 5I3ZA 1E2JA 2ZYDA 3AZPA 4WBNB 3PXGA 4C2TA 3KSUA 4OUKX 3NONA 1XDZA 3CF0A 4H1UA 4MX8A 2HX1A 4B40A 1YOBA 1DHRA 4IIJA 1LD3A 4GF5A 2OVBA 1ZN9A 2ERYA 5FNVB 5AJHA 2QRMA 3UJDA 3K92A 3QBVA 3H4TA 4XIJA 4NKRA 4PBSA 1L5QA 1XNGA 1V8FA 2FVXA 4X6UA 3TLBA 3G0GA 3GUHA 2RAPA 4JT2A 1QIHA 4BUCA 3TN7A 3PF9A 4UOQA 1C8KA 4DV2B 4F3RA 4IZ6A 5KYUA 4DBVO 2C4MA 3GAAA 1GQSA 1TU0A 4DSOA 5KVSA 1LNQA 3RTEA 4J76A 3SKYA 2ZUUA 1V4NA 3CLTC 4M46A 5HWSA 1I32A 1YZTA 5IKOA 1ZH8A 3U31A 2O0MA 5BSEA 5KWSA 3BIWA 1T2EA 4ALKA 2UZ1A 1QK3A 1CY7A 3IODA 5FOXA 2RK6A 2X22A 5CA0A 3S1LA 1Z06A 1ZUD1 3W05A 5KWVA 4U1RA 1RWQA 1VLHA 1LQTA 2YVKA 3T7IA 3OLQA 4LZPA 1EWYA 1T10A 1VFPA 1UFKA 1ZESA 3NASA 4JNKA 5DM0A 5JDCC 2ID9A 1PFVA 3I0ZA 4HLNA 1YQWA 5D7NA 3VYSB 2O2CA 4KEAA 5J4VA 2IYTA 4I9FA 4H35A 1YKSA 2GD2A 3GT3A 5FOVA 2ZTVA 2C5HA 2ZBFA 4TT8A 1JFRA 1ORWA 3A1TA 3VC3A 4BP1A 5E6UA 2GKOA 2BVNA 2CMDA 3KSRA 3DLAA 1GQFA 2B20A 3DDCA 5JCJD 1QJ4A 4ENRA 2Z1NA 4AX4A 4PO1A 1ACLA 4A2WA 1OREA 2DH6A 4CQNA 4N54A 3FMIA 4HH1A 4MQMA 5F9MA 2PSEA 3ROEA 4A03A 5KX5F 5DXJA 1QYRA 4CM9D 2RCNA 4AQDA 3T7SA 1ZK3A 5AVOA 4CV1A 2QXTA 3MAAC 5D6NA 1XXLA 5FOWA 4XYBA 5KJEA 4C07A 4KO3S 4F9GA 5B2FA 2OTCA 3A4LA 3ESYA 1ZU5A 2I8LA 4QJ4A 2Q2OA 1ID1A 1XZKA 3DWIA 3GJ3A 4TKLA 4UUMA 4DE5A 2M6KA 1A8HA 3W3AH 1CF2O 4DV5B 3TUZC 1KK3A 3LUFA 4K9QA 5GONB 4LQDA 3KSAC 4L1KA 5F12A 3R6DA 4NPAA 5EIHA 2JFPA 4UUBA 2ZQ5A 4R1OA 2WYIA 1IRIA 1HBJA 4OHWA 3OKPA 2QDXA 1VB5A 5JH7B 4TMYA 3W7BA 2X41A 3V55A 2ECKA 3WLNA 2JEYA 2A57A 4ACAA 3K32A 3RFCA 1ZOIA 3EVGA 5KU7A 5IW8A 2ODTX 2WJYA 2W98A 5IASA 4O8CA 3N28A 3V4VB 3WBFA 3BE8A 2O2YA 3FIJA 4M7WA 4BVJA 1V35A 3I2FA 4C0KA 2B5WA 1EWVA 2DHDA 4MRPA 3SXUA 5BXYA 2XZLA 5A03A 3CZRA 5K8TA 2VWGA 1ZRHA 3IS3A 2QBYB 4EZBA 1WIWA 2DR0A 2D3WA 1FLVA 4BNFA 5B3AA 3RFXA 3QIAA 1EG7A 3RAEC 3FPGA 2YYAA 3PU6A 4MA4A 3PKJA 2GEJA 3WLPA 3QM1A 1V2GA 3G0CA 3KPYA 1WY7A 4XQ0A 2ZSAA 2BEWB 3GFFA 4Y6LA 4V1CB 3ZLJA 4YYZA 1S8AA 2YV1A 3EBLA 1SZJG 1IQPA 4G2TA 4PTLA 2JI6A 4Z7JA 5CDFE 3DPUA 1R7RA 4V38A 1T0UA 4PCVA 1OY1A 4P5EA 5DPMA 5FPKA 1IVSA 4AMGA 3EFHA 3KSDO 3LBFA 2KBEA 2YN2A 1I7PA 1EPUA 5F35A 1GTRA 3H5OA 4UMEA 2ZBVA 2QTFA 1IBLB 1BOOA 2PGIA 2GEFA 1EVYA 2P1RA 2OL4A 3LDAA 2A9QA 3HA7A 2X19A 2OCDA 4MVJD 3QLTA 4Y2YA 2ZJFA 2WPDA 3T7TA 1XAIA 4BMOB 4HEA1 3RLFA 1EX9A 3KOYA 1SZPA 2H4YA 4MUEA 3IP1A 1QDEA 1QOQB 5AOBA 3WRVA 1Y1LA 1YBHA 3H6KA 3UT0A 2HUNA 1WNTA 1SZCA 1SFRA 1FMJA 3WBJA 3PQ2A 4EG8A 5BSGA 2JJ8A 4IWXA 3P2EA 4C5BA 3AOEA 2LKCA 4HG2A 1ZO8A 2IP4A 3LX4A 2QTZA 4NICA 4Y1RB 3F8WA 5FBLB 4H3KB 3PNMA 3UK7A 1GZ7A 5CK5A 5BW8A 5GZ3A 1C7ZA 1QHIA 1E20A 3LK7A 5BSTA 3SY8A 1C0IA 1USVA 3MZ0A 1GKYA 1L2TA 1XF1A 2QQ0A 2ZB4A 3O75A 3GLIA 3U60B 2WZBA 1JXMA 2WE7A 3EXHC 5TY0A 5C53B 3BFPA 3QBJA 4QXOA 4ER6A 2XSZA 4RIHA 4RORA 4MUNA 3ZLVA 1EK6A 2FQWA 2ONZA 2ZRJA 3EN0A 3INYA 1J5XA 1TC2A 1ODLA 4Q00A 4TWAA 4XWYA 3IESA 4KK4A 4LZWA 2Q49A 4NU5A 5DE3A 4MZXA 1XSEA 4YQZA 4EGFA 2QPOA 1DC7A 4J29A 3L0YA 3SJUA 4D6PA 4ETWA 3H8JA 4NU6A 4OFWA 1TM5E 3VR0A 2G0TA 1L4KA 5JD4A 1WKVA 2WB4A 1FUKA 1XPRA 4AICA 1X77A 3N6VA 4MEBA 4YO8A 3QSGA 1QYVA 4MMZB 2QRVB 2EBFX 2Y1LA 2YDYA 1E7RA 3FMOB 4IIFA 1AGYA 2PZMA 1C7FA 4QAQA 7ABPA 1L7DA 3BERA 3GARA 1NLFA 1PV2A 3RIEA 4C04A 4AKHA 2G4LA 4WN9B 3BK1A 4MIKA 4I99A 4MV1A 1KMMA 2EYUA 4WESB 1A2KC 3AJAA 5FPYA 1X1TA 5AK3A 4PC1A 5C7YA 5A3JA 1A1VA 1ZCZA 3GUCA 4A9AA 4Q48A 2XCIA 1TK3A 2OB2A 1GUAA 4KLZA 2J6IA 4B5KA 5B2EA 4QD3A 5ALTA 2RFLA 1NX9A 2ACVA 3LDGA 3WK6A 3NCTA 3AEZA 2FLVA 3EHDA 4OHYA 1CRPA 2R6FA 2A1TS 3AHGA 1K6MA 1Q0RA 4WLEA 1CB7A 3KLPX 3ROMA 1WETA 1QIKA 4OX9Y 1YMVA 5AXAA 4BV9A 4MIYA 4RJJA 4BP8A 3R1IA 4HX9A 5A0TA 1JAHA 1TZ2A 3UY4A 5LN1A 2V58A 3AF4A 1J2TA 2W2MA 2WZCA 3W9BA 1HG1A 1NN0A 2R66A 5EQTA 5M29A 2XTZA 4GMXA 1BDIA 1NMQA 2EW1A 4NTZA 5HSGA 3LXRA 1XNRB 1XYVA 3ZZ0A 1ORTA 1UXJA 1NBME 1Z5PA 3HUUA 3IIIA 4KZPA 4TOIA 2EJCA 3QUQA 4ASUA 5AJWA 1P7PA 1VA4A 2FWBA 3FTDA 2W2QA 3RF7A 3AV0B 2ZJ8A 1YCHA 4J07A 4LYJA 2A9RA 1UXHA 3GGDA 2OQ2A 4FE3A 4QPNA 5F78A 3TBKA 1UBNA 2Z56A 1UMDA 4D74A 1U9YA 3TX2A 2WTEA 4O08A 2Q99A 1DT3A 1ULBA 3ILYA 1VL6A 3QIVA 4IXNA 1P44A 2APJA 2RDMA 3EZNA 3MA0A 1X39A 5LB2A 3BSFA 2W2TA 4FUTA 3SZ3A 4IPTA 1NUQA 5KQPA 4IHKA 1E32A 3TQIA 3BAZA 2ISQA 4WUVA 1FX0B 2OQVA 1FMLA 3IJ5A 2CJPA 1XTUA 2OO3A 1DLIA 1L8OA 2X8AA 5HKLA 5LC1A 2O8BB 2BR4A 4B5LA 5FB3A 1NQUA 3FNIA 1L4UA 5FL7A 1G20E 2GRAA 1MB0A 3HDTA 4JVLA 3T38A 4B82A 1VE7A 3K70B 2NO4A 1PR1A 2VP9A 5GTDA 2QTVA 1AN9A 5A5FA 3F9RA 3DUFA 1NNUA 2JLRA 2WINI 3JWGA 1GVNB 2YN4A 1X7ZB 2H7VA 521PA 2OR3A 3E58A 1T3TA 5AI0A 4LECA 1GUZA 2H5EA 2AD5A 4BTEA 3H75A 3OUUA 2PJZA 3G88A 4UOEA 2VRCA 1H2XA 1AQJA 1UKVY 3ADOA 3VDMA 2PZ8A 3TLJA 3H2KA 1C9MA 2QTHA 1G3RA 1XK7A 5JS2A 4ZPJA 1OBFO 2JCGA 2Y93A 4DBLC 1POXA 1AUVA 1KJWA 5U9CA 1ZPDA 1EXDA 4ZO7A 1DADA 3MS7A 1T5SA 1C7EA 3ONNA 5CM2Z 3ABOB 4PLYA 1ZIDA 1JIXA 2ZUDA 3V1TC 2TRSB 4XWTA 4M0MA 1DV2A 1O94C 4OEHA 1A76A 5E6RA 1C7RA 5AUNB 2LWIA 1N75A 3NT4A 2O4CA 2F9LA 1GZDA 3BFJA 1C1DB 4HH0A 4L0MA 3KEOA 4EYKA 1ECGA 2DT5A 1KQPA 3INNA 4KO4S 5JR3A 1YS4A 3MQ2A 3WGZA 3I28A 1ML3A 1EFDN 1Y3HA 2Q2NA 1D2GA 4YUAA 2O8BA 4CQLB 5DCUA 1O0BA 1W88A 3Q3VA 4MQUA 4ETIA 2VFAA 2HQSA 4RK1A 1Z5ZA 1GUBA 4UUQA 3KJZA 4JENA 1PWZA 2QX9A 3TGPA 4PIPA 2EJTA 1YZ3A 4OSOA 3TD6A 1KFJB 1WR8A 1GGMA 3PT5A 2HFJA 1DAMA 5FI3A 4F4FA 5LP1A 1RHMA 5ICFA 2WHXA 4BASA 3JQDA 4QM6A 1NVDA 4C4ZA 1Q0LA 2WI8A 2V7QA 5FTKA 2ZPUA 1C81A 4KO1S 4NE9A 2Z6UA 1IM2A 1EE2A 1TOAA 5HOEA 4Z4QA 1XD9A 2BONA 1R16A 1DXHA 1F4PA 1GJRA 3AP3A 2IXDA 1CY1A 4JLDA 2NQ8A 4LVCA 3T94A 5ALNA 5JVDA 5JAOA 2VZLA 4FSXA 4QELA 3QQ5A 5GWXA 4HNRA 3N2KA 3WA6A 3H9BA 2G9QA 5KSWB 3BXFA 4IICA 4HGPA 1NXXA 4GPEA 4EK9A 3JWEA 1TEXA 4PF1A 1N2CB 5B4TA 4G1MB 3GC6A 4H17A 1NOKA 4JU9A 5BNFA 5C52B 3CRW1 2W6IA 1UMKA 3I3SR 2YN0A 5FWDA 4EFDA 2CNNA 4FBMA 1EDBA 5BSWA 5DP2A 1RQGA 3GVIA 3ITEA 2OVFA 1ITZA 5FBHA 2QX7A 4CM4A 3L2OB 2Y6UA 1X2EA 3K30A 1RABA 2QN9A 4JJ7A 4K6FA 4S12A 4CIAA 1ZGZA 3O38A 5T57A 5IC4A 4OJMX 1Y4ZA 5LXTF 5AKIA 2WY2D 2X9VA 3AR3A 3ETEA 5ITZA 2VDPB 3D8BA 3KJGA 1E2HA 4ZHQB 4L8GA 3TCNA 1QIGA 3MB8A 1T4DA 4TTVA 2QJOA 3A4VA 2BKUA 2R6R1 3BA6A 3AONB 1C0EA 3E22A 2BPOA 3UO8B 3WL7A 4D9KA 1XIVA 4DPKA 3ZGNA 1JZTA 2Q7XA 2O9JA 3LUJA 3MCAA 4N47A 3TLAA 4YCAA 5K4GA 1FDUA 1U3TA 4QDXA 1I9CA 1DCKA 4HJXA 3HACA 5A0FA 4C7BA 1XRRA 3BFKA 5KJFA 2WIJA 4U7DA 3SX0A 2OFPA 3KUUA 1XAGA 1DAIA 3P96A 4K2AA 1HFEL 2FQYA 2NXJA 2OBYA 4BCDA 1H1TA 3BRWA 1QHNA 3DMNA 2D8AA 4D9CA 3NKLA 4KK3A 3A06A 3R76A 4EG4A 5JAHA 4WXEA 3UV7A 2O2XA 3N5KA 3A3YA 2OM6A 4F21A 3UW1A 2C2YA 1K68A 3C2QA 2F43A 2CMGA 1ZJWA 2WF6A 3K4HA 3QUTA 4TUYB 4YX9A 1DBVO 2V3VA 2HF7A 2QVGA 2UXDB 1BQ3A 1IUOA 2C9CA 4R98A 4RH1A 2A33A 2I4NA 1GCGA 2RAUA 3E2IA 3F1LA 3H2BA 2VK2A 3LGAA 3NHPA 1N3YA 2H2IA 1Z6YA 2H18A 2I1LA 3QOFA 5DVZA 2K7ZA 3QBTA 3QU7A 1NVAA 1ZGCA 1Z0SA 3VPGA 3U9TA 4X7BA 3LWNA 5TRTA 1T4CB 4GYWA 4CMJA 2HDNB 2JGDA 3IMFA 2DPGA 1PLJA 2O5RA 4GP7A 4YRJA 1O08A 4CNBA 1SIOA 1E2DA 4MYDA 1SXHA 1Y7PA 1E4EA 3OCYA 5LKAA 1WRBA 5JAPA 1Q0HA 3HNPA 4TKMA 2EFYA 3GLHE 3PWKA 2J6BA 4IJ5A 2BTEA 2FW8A 1KO5A 3B38A 3GGJA 5IT4A 2RHOA 5EE9A 1SHUX 3H4VA 2MR6A 1JR6A 4WDQA 3CNLA 1Z2NX 1BJTA 2RONA 1KJQA 2B6NA 3P20A 4C0WA 5ILOA 2UZ0A 2R11A 2XDWA 2Z4TA 5ALDA 3QU5A 1UKCA 2HGSA 3CRMA 3F71A 5B3KA 4OLAA 2QR3A 3MS2A 2P2CA 4OL0A 2XUDA 3FGZA 4LE2A 2WV9A 1OWPA 3RS0A 2NTJA 3TSOA 2XB9A 2O0JA 5I4BA 4YJ2F 4DJEC 3BVPA 2AJ8A 3FX2A 2PS9A 2DWPA 4IIEA 2Y0DA 3GFTA 2A0KA 1IEVA 1SBQA 1UCFA 2G3YA 3S2FA 4CL2A 3KQVA 1TUBB 3HCDA 3CVJA 2EKQA 1MF7A 1M2EA 4FQ7A 4GSKA 5E95A 5CLFA 1CPYA 1KJJA 1E9FA 1DAPA 1XWIA 3UNXA 1JHOA 4V0SA 5FRDA 1JHAA 3THWA 1DJQA 4PC3A 3P2OA 2QN1A 4GOXA 4XUCA 3W5HA 2LZ0A 2ONYA 3QF7A 2FFJA 4YWHA 2KHZA 2FP4A 1LI4A 4A91A 4JUIA 1I9GA 2AYYA 4R05A 2G83A 3QRWA 5ALRA 1BCSA 2P9YA 2PX3A 3FVVA 2Y0EA 1OWNA 3MJSA 4GC5A 4KTTE 4B3FX 1M33A 2VUHB 4KAJA 5BNTA 2Y92A 421PA 3EWSA 3RTCA 4K9NA 1E2NA 3TTWA 1T1RA 4C4OA 5BSRA 1KBQA 1VPWA 1PIWA 4R3NA 3EGWA 4DUGA 3AR8A 2HMVA 3A1SA 3PKIA 2O2IA 2Z3ZA 5K8CA 1KEUA 2G5TA 2CL5A 4LGVA 1OJ7A 3Q9SA 4IIXA 4P4UA 2RGNA 4YPFA 1LF0A 2RC5A 3VR3D 4ZIRA 3ETHA 1VI2A 4EAQA 5KQLA 2OECA 1GL3A 3GEGA 1N2XA 2YIVX 1D7OA 1IIRA 2XJ4A 1TB4A 3OX3A 3QI7A 4GBMA 5CTAA 5DRYA 3WKDA 3GP8A 2VT2A 3KU1A 1B6GA 1QDUA 2JZOA 1VGVA 4FXPA 2IS1A 5GM1A 4HADA 3QELA 1J9ZA 1QYWA 1YH3A 4GOOD 4TYPA 4RV4A 2HA6A 3AVTA 4QU8A 4RM3A 4YJFA 1LTHR 1M2NA 3ELUA 3LF2A 3LTNC 3COJA 3VC1A 1PD0A 3WY9A 2H54A 1N2EA 1IDN1 2PEYA 5IZ4A 3UWMA 1SUAA 3PGVA 5ERXA 5JXIA 3GR6A 5GIPE 3HP4A 4M9CA 4OQLA 2G63A 2GZMA 2FPMA 2QP4A 4R83A 1QVZA 4BEBA 5C5CA 3ZY4A 4JITA 3GIDA 3IEXA 4I3FA 5B36A 1NW6A 1YS1X 2GF0A 3DL7A 3FSGA 1FS5A 3WWEA 4DA4A 4Q39A 4V0MA 1GL7A 1P8AA 4WD3A 1M6HA 1U0NA 3GG9A 3CW2A 4ZVKA 3TJMA 5IFKA 6PFKA 4UBLA 2YWBA 3A6FA 1O95A 1XLUA 1JUDA 1UIMA 1YF3A 3UGQA 1SHKA 1T24A 3CZ5A 4FT4A 4HAUA 3E9RA 2WZQA 2YIJA 2ANCA 3LY7A 3VTZA 2QV0A 2KI5A 1W76A 1Y6JA 3HO6A 3FF4A 3D2AA 2WK1A 2ZLBA 3MRSA 1C9YA 4JN6B 2K5UA 4BU0A 1V4BA 5CTJA 4ENQA 1AM4D 1KY4A 4WFKA 3U0BA 3ZY5A 4DWJA 4ZEWA 1U3DA 1N5DA 1Z7GA 5SICE 1ZFNA 1F17A 4FNMA 3RUDA 5GV7A 1R00A 4DN6A 1W5FA 5H0IA 2RGUA 4F45A 1PX0A 3DNFA 4JEUA 3SGLA 4R8LA 3WOHA 2HLDD 4EPWA 3ILVA 5JS1A 1GG5A 1O5IA 1XTTA 4MHSA 3V97A 4J0CA 3LYLA 1DAFA 1XHLA 1G21B 1FQWA 4UU1A 5GZ1A 2O06A 5K3BA 1OH6A 4Q82A 1HNZB 1BCRB 3AM3A 4EPYA 4KWEA 4M98A 4RKFA 4DXHA 1XPOA 1FJGB 5DGTA 4AJ2A 1V1MA 3DGFC 3A04A 4GKVA 3S1SA 2ZRFA 5FR2A 1OAOC 1T8UA 2FGJA 2P9ZA 4RZHA 4L9SA 1E0KA 4LGYA 4LYHA 4UZEA 4XR4A 3FWNA 1P1FA 1PW5A 2DTXA 4KBYA 5H4HA 3TKAA 2EVWX 4MKIA 5D1NA 1CZKA 3T1VA 5LOVF 1JAYA 4FWIB 3I83A 3CUWA 3G82C 2FU5C 4S1PA 1BQEA 2WJIA 1KMCA 2CLKB 4PZYA 1QYCA 1YA4A 4BO2A 4ZCLA 1WSAA 5I9BA 2ZIXB 5J3JA 1FOEB 1NA5A 4KCGA 4MITA 9ATCA 1JVSA 4TMXA 2UUBB 3BQNB 4N4AA 1EXNA 4JC0A 4UVHA 4HNUA 3S55A 4PINA 4S24A 5JSHA 1VE3A 4QDUA 4MCHA 5FA8A 2PZEA 2MCFA 2MOKA 4MR7B 3CVOA 1PJAA 3HCWA 4YUWA 4EFKA 2O6HA 3LH5A 2E82A 4YCNA 1Z6GA 2QVXX 4NLLA 2C20A 1P2BA 1XK6A 2ECQA 1FU7A 4F5DA 2XMGA 2PUBA 3CLKA 3OG9A 3KHSA 4HNAA 1RHRA 4KQMA 1KU0A 1BNCA 4QEDA 4FYXA 3HCOA 1DEAA 1QV6A 1RBMA 2JEZA 4W5HA 4D81A 4IMRA 4NBNA 1TI7A 5FBQB 5KEIA 4JYMA 3NWEA 4EL0A 3RRFA 1CVRA 5MDHA 1CR1A 1BYUA 1LBHA 2W2VA 1CLEA 5LSAA 1UBLS 2XCRB 2XGJA 1OYYA 4HBZA 3WB9A 2NU9B 3NPAA 3HR8A 1YA8A 2B25A 2AMVA 1V7ZA 2WSSD 1MGOA 1ZOOA 4UUPA 2HU7A 1J5PA 1TYEB 3Q0IA 4O0MA 3RIGA 4TSKA 4DR2B 1XRJA 4RHUA 3VZBA 3EEBA 5JMTA 3M6UA 1WULS 1BDBA 1Y3DE 3PUJA 3D0KA 2IYEA 2EZTA 1BEZA 1RWOA 2GA9A 3CNQS 3OE4A 3QVGA 4KQWA 4P81A 3RVBA 4AECA 3JQ9A 4TWRA 4OHPA 4E30A 1FSGA 2J3KA 1MT0A 4DY6A 4K87A 5DTMA 1SO8A 5HHTA 3LIIA 4B81A 4R8MA 1EP3B 4TSRA 1PEYA 1Y4UA 2X15A 2FPKA 1UC5B 3IVRA 1JG2A 3RV3A 2C0PA 3TTVA 2FRVA 3ZDRA 4C0LA 4CDGA 1PK8A 3LYAA 2OC9A 4K5QA 4HYTA 4OGLA 3RRYA 2O14A 2IYVA 2EATA 4HRXA 2V0GA 4IQ4A 5G41A 1U5BA 5IDVA 2W37A 2WOJA 4ON9A 1W2WB 3PQDA 3QVTA 1DAEA 1ESMA 1LDBA 2ZBPA 2BFDB 4L02A 1GQ2A 2AOVA 4DV7B 2R751 1XDBA 3EZ9A 3VI3B 2F4VB 2ZJ7A 1HT0A 1AO3A 2FHPA 1C30B 1XALA 4PXYA 2XRZA 3JYHA 4C87A 2YV2A 4A73A 5F23A 4DARA 1W1WA 4KIGA 2JJ1D 1Z17A 4IKPA 4DCSA 3O3MB 3QF4A 5ALIA 1RHKA 4HT3B 1GCUA 1H6CA 2DUNA 4RSHA 1PVVA 1U0TA 3WDLA 2J32A 5AQ1A 1F38A 4LY3A 5IU6A 4OMDA 3WP1B 4BWFB 3L8EA 1I30A 2UXBB 4F3NA 3ZVMA 2F8LA 1JR3A 1NW4A 2BZ0A 3IVAA 3NHWA 2VNSA 2WT4A 4NOJA 4EG1A 4LN1A 3FCXA 3QKUA 3PUZA 3V3TA 2FPUA 2AQKA 2QJWA 4MV7A 1N36B 2W2XA 1J1IA 1QH1B 4DCOA 5ITVA 2E4YA 4BO8A 4EG3A 3L5OA 4JC8A 1GQQA 4I6EA 3DUWA 4Y2QA 4KNYA 2BAGA 3F78A 3NKFA 1IN4A 1QG0A 1U28C 2GYVA 4HZIA 4PYQA 3CPEA 4D4GA 2WVJA 1EXVA 3C3DA 2ZDGA 4OO3A 2CNWA 1I7DA 1D03A 1AH2A 1CB0A 3F7OA 1AA9A 3QKRB 1Y9AA 2Q5OA 4UU7A 3WLOA 3IA2A 5E4FA 4A3SA 2P30A 1N9KA 3OU2A 2OORC 1PR0A 2F3RA 3AOEC 4FNGA 4XQCA 4AWBA 3IT3A 1E8NA 2HU5A 4PO3X 3BSSA 2Z98A 3G2OA 1G8KA 1NATA 1T5IA 4L9WA 4YP0A 1G3QA 3MXOA 3T1OA 5ADVA 2EJVA 4FZ3A 2VHVA 1WX1A 2XIJA 3GPBA 4OIFA 4WOCA 2JRCA 3C8DA 3OF5A 1UZAA 1IOVA 1DXYA 2JGDB 1N1GA 1BD3A 3QVJA 3WQRA 2BGIA 3SX4A 4HFMA 2J07A 3HEMA 1UUFA 2JGFA 3RBVA 2P5SA 2XTMA 2YXPX 2YW2A 3ZU6A 5EQFA 1HEYA 1A2BA 3NYRA 4YRBA 5K3FA 1I4WA 1EAMA 1TKCA 1NRJB 1H1LB 2C78A 2MIIA 3DL0A 3HV0A 2OBXA 3I2HA 3ANMA 5D51S 5K51A 1TF2A 4BXOB 4M0CA 2O2EA 3SHWA 5KYXB 1FLDA 3CLUD 3R8CA 3A2NA 3D8HA 5LWHA 1J06A 1FW6A 4RMHA 2BFWA 5IC6A 3LQ2A 2ZIEA 3LUAA 4V0NA 2PGJA 4MUBA 3TEMA 5JC1A 2OB1A 2ESRA 2WA1A 4A5SA 5AW3A 3H05A 4WKPA 4HB0A 4RXTA 4TZ0A 3BEOA 2PRZA 3PKZA 1VKOA 3A4TA 5EOVA 3I1YA 4AKEA 4W5JA 5K7SA 4HDRB 2YMMA 3BHJA 4HSGA 5DNYB 2PBZA 2YH2A 4KZKA 4RK6A 4BZPA 3E2MA 3BMOB 4F2HA 1U63A 5EWJB 1RACA 2XMRA 3NBUA 1CETA 1GKLA 1SEVA 4OJNA 4OQ4A 1G6Q1 4HFNA 1YIAA 1XFDA 1ZRMA 4K9LA 4RKQA 4CLRA 1FC0A 4G56A 3ZWDA 4CCAA 1RYEA 4C0BA 3ORYA 5HQJA 3AVVA 1TADA 2I2WA 3IQEA 2O8DA 2WWYA 1PZNA 4FFOA 4JT8A 3SVLA 1Z4IA 2PPLA 2Y1FA 2I2FA 3DOJA 2JFUA 3K0FA 1AY0A 1ZM2A 3E9QA 5FTJA 1WW3A 2ZG6A 2C92A 4ZK2A 5IT9A 1PFGA 2NX2A 2VAVA 2QUZA 5IDQA 3R3YA 5BW6B 5CH5A 5C7IO 4TV9F 2Y68A 5D6OA 1I4TD 2VZ9A 1V1JA 3TD9A 1MOZA 3L7DA 3E82A 1IAVA 4TN5A 2AN5A 5IJ9B 5DSXA 3DT9A 4L9AA 3TRHA 3E9MA 3G89A 4XEHA 5TJ9A 2F3QA 3MBIA 3G2JA 3KXIA 2V9CA 3TL6A 5BN5B 1T0PA 2J87A 4KYVA 1C1XB 3HKDB 2ZFUA 4EI2A 4UDXX 1A5BB 1QBGA 2WDZA 3WOVA 3I5MA 3D8UA 4Q37A 2CUTA 3C7KA 3DT8A 4GNRA 3AFNA 4HLCA 4MRAA 3UJPA 2FFRA 4BEVA 2O2GA 4BVBA 4C7MA 2J6HA 2PXXA 1AS3A 2H0AA 2Q0XA 4FC6A 3BMCA 1DGQA 4RVNA 1PR4A 2C9BA 2I34A 2BGKA 3IP8A 3PX2A 5ALGA 1XB2A 1XAHA 4EEKA 1M6VA 3PCRB 1WUJS 1FUIA 1ZMBA 1SC3A 4IMPA 3STXA 2I2DA 5IUKC 4KIFA 1Y8QB 2QLJA 2YQZA 3KVRA 1YT5A 4RMIA 3W9UA 4X8OA 1X87A 4KU4A 4UNQA 1S9DA 5TT1A 4E31A 4C4TA 5MFPA 1FF9A 3V8BA 3ZCTA 4I6GA 1TA9A 3WL5A 2B8NA 3OPYI 4NZNA 3IR5A 1WOYA 5KTKA 2BKVA 1WU7A 1XC7A 4UVDA 3N0WA 5C35A 3QLVA 4A6PA 4AWXA 3E9EA 4PQFA 5CXUA 3DZKA 4UDYX 2QD3A 4ZOLF 2G71A 4AP5A 2ZSHA 2XMCA 3DMFA 3REOA 2W6PA 4RGVA 3QFHA 2VHEA 2VPZA 4ZCQA 3CW9A 4UBKA 3WHPA 4DSNA 4F04A 4K6KA 1PHPA 4B4OA 4UBNA 3BGDA 4H1HA 3FF1A 3CH5A 2HIAA 3GRUA 1RWPA 4H7HA 1DEOA 1TJNA 2F67A 2I6UA 3I42A 4GXNA 4HPWA 2AQ8A 4HAOA 2HRRA 3OICA 4AKTA 5CHYA 2H2FA 3VVCA 3G79A 3MK31 3X2SA 1U1CA 4KLRA 4IDGA 4JJEA 3KAQA 3HKCB 4JI0B 3TZCA 2KWIA 2NTEA 2XYRA 1ULUA 2PTGA 1RD4A 3K5PA 2QLLA 5A9SB 1UAAA 3STWA 4D3FA 4RHEA 3ASZA 2MTBA 5KQGA 4IZOA 5G1NA 3LW8A 3KVOA 4QHSA 3FCAA 2Z9BA 2ZE5A 3UT5A 1A8IA 1CJSA 1G6HA 1O4VA 1E7WA 4HF7A 4QWMA 4NXMB 3EQ2A 1XZEA 3MGBA 4B47A 1NBIA 1RJ9B 1N6HA 3F2IA 2FKAA 1KI7A 1QRRA 3HVUA 3WIEA 1LLQA 5KBYA 4UASA 2EG5A 4FGKA 1KKMA 3A6PC 1QAMA 4G23A 4I5EA 1QHEA 4O1MA 4OQMA 3JQFC 1RZRA 1P5ZB 2V96A 3PDWA 5AHWA 2D1TA 4CIVA 2OXRA 2BEVB 3IILA 5AHRA 5FLYA 2ALJA 5HYVA 1MO6A 2ZULA 1D1TA 3C6YA 4L5AA 1ZG3A 3QQPA 2J46A 3CR7A 4LSMA 1KEPA 4R84A 2GPWA 4AVYA 3WGKA 4TWIA 4NYJR 3EQ6A 1I1NA 3Q7QA 1LY1A 1NUUA 4NAUA 2AFVA 1ZQ1A 1CJMA 2VUTA 1B23P 1E5DA 4DL9A 4ZCMA 4P5DA 1TZBA 2RB4A 4DA7A 4HAXA 4YRZA 1VIAA 3OZRA 4N1AA 4Q9LA 3VSEA 3CVYA 3OEHA 1IQ0A 1ZY2A 2ZJAA 4N3AA 1XEAA 3W79A 1P4RA 3BQMB 4D92A 4JQZA 4D7AA 2OYRA 3MCWA 4U2EA 3SNHA 5GVSA 5B6JA 1P6UA 3UWDA 4JBIA 3IEPA 3KV1A 3NTXA 4HAWA 4TXLA 3KWLA 2GBIA 4HOYA 2H29A 3C8MA 3DXYA 3CONA 3E8XA 3K09C 3RVJA 3S68A 3QEMA 1IOLA 4NEHB 2WVAA 1FPQA 2WU4A 3FVWA 4P31A 4RVUA 3WMXA 3ZH9B 1RJ9A 3ZU2A 4LJ5A 2N9UA 2R4QA 3GJXC 2W43A 2BT4A 2FW6A 1VDMA 3AJEA 3BOSA 5H9VA 3T7EA 2PFGA 2HSDA 4W1PA 4BJ3A 5AT1A 1OT3A 4IHJA 3ZCSA 4X8LA 3FI0A 3RFFA 3GMTA 3TIXB 3PL1A 2X86A 3ZU5A 4H77A 3UV3A 1IHOA 3UYLA 1F8XA 2GJSA 3V48A 3ZHBA 4EP1A 5BQ3A 3T41A 4KL8S 2HDOA 3OAAA 1X3SA 2VF8A 3DHWC 5CDFA 3SC4A 1U31A 3T5AA 2HLHA 1FTGA 1I4LD 3IXMA 5DHPA 2FUEA 1C0PA 2D2EA 1EK1A 3G5LA 1SVWA 3EEFA 4WLVA 5CG1A 3A9WA 1FMFA 2ZYVX 2IP2A 1DBRA 1HTBA 2G04A 2XCOA 1LX6A 4ID9A 4ND4A 4RDHA 3CNBA 4FHCA 3I30X 5JYBA 4TQ9A 4EHFA 5TLSA 1NIJA 1GM5A 4R3WA 1N5KA 2QTRA 4DTIA 4B1FA 4JVOA 2NVWA 3TX6A 1J00A 2BZGA 2IPOA 5BUZA 2QU7A 4RX1A 2GEKA 2AK3A 3SVZA 2VJYA 3JQBA 3R0ZA 3UYKA 1NRIA 4OUDA 3ZHYA 3PXUA 2EJBA 4A10A 4C6HA 4CIDA 3KB6A 4EW3A 1TVKB 5ALEA 2ZR7A 2FE4A 3OQIB 4WADA 2R00C 3WWDA 3M49A 5J2UB 3FSEA 1E2LA 3WADA 3CJRA 5JXWA 4LS3A 3KCQA 4M36A 2JDID 5IK2A 2Z2JA 4MWSA 5CAEB 3T9EA 1K8QA 1NJFA 1XFAA 3GLHB 3HVIA 5J4HA 3QE2A 3DDZX 1E79A 3C43A 3HXPA 4R6XA 2P2YA 5G0SA 4YP9A 2QM3A 1G6KA 4YWJA 2Q5CA 4N8DA 4RHTA 4YMSA 2CF6A 4DHWA 1HEUA 5JNTA 3H87A 5KYWB 2H17A 4FX2A 2FZCA 5CVEA 5H3CA 5LXTA 3K9FC 3IJEB 3TSCA 4BNIA 4BNLA 6NULA 2ZCJA 1AKYA 3J80A 4UJ5A 4HVTA 1NLUA 5CLHA 4C05A 2FW9A 2JDIA 5FPTA 5IK2D 3S99A 1JG1A 3DCYA 5E1OA 1OXSC 4LHWA 5JAUA 4KRFA 1B43A 1BWRA 1X1RA 4OAOA 1YFLA 1CJCA 3I9V6 3WGNA 1BMTA 2Y2VA 1I1OA 3HWWA 1UPCA 1XJQA 5C31A 2JI9A 2ERXA 2GPAA 5ALUA 2ZUSA 5B30A 5C7LO 2CNDA 3CZPA 3O2QB 3R5XA 4RFSA 5GVRA 2FGKA 2BDTA 2VRBA 3AEUA 1WXQA 4AN1A 1A3CA 3LC0A 1DMSA 4HYQA 1CF4A 3E7DA 2HTEA 3PEYA 3QFTA 5EP3A 3TGWA 1AG9A 4QBHA 4I55B 2XUOA 1KK2A 1OFUA 1JDZA 2IYQA 4E08A 4GSYA 2CNBA 4K81B 1J5EB 2X1LA 4GR5A 1SOUA 4LHVA 5F4BA 1LS1A 1RI1A 1L3IA 2P69A 2Q4TA 4WN3A 3P0EA 4XAQA 3X2EA 4M9ZA 3B6IA 1KI4A 5KOYA 5ED4A 4P3NA 3TL3A 2QYHA 3WGLA 1L3CA 4HB2A 3VTAA 3MD9A 3DXXA 3DBOB 4PEVA 1M1YE 4DNFA 3TTTA 4DV3B 4FHZA 1S3IA 1AN0A 2OZEA 3G2NA 3NH6A 1FNNA 3A4NA 4YC7A 4QBGB 4XUDA 5KDLA 4C6RA 3UZUA 3ASUA 4MEJA 5GQSA 2CF5A 3KQTA 4BNJA 2ZI3A 4D02A 3WLTA 2A6PA 2RMKA 4E32A 5M3BA 1VC2A 1SUIA 1PHRA 5IDWA 1H2ZA 3WK4A 4WCFA 2ATVA 4IHQA 1QIEA 4ECAA 2NU6B 3FPAA 2P1DA 3VOBA 5JBQA 1EU1A 3FNGA 3KJXA 1YB1A 2E48A 2CYCA 2I7XA 3NHFA 4O02B 3NC0C 4D80A 2V7UA 3D7MA 4IDPA 4LDQA 2ZS8A 2C29D 3G5TA 4TTRA 3GNQA 3NJ8A 3BE6A 2FN7A 4LPKA 4FB5A 4J9UE 4MYSA 3PRYA 3R6TA 2ZUEA 3EGOA 4B4KA 3IOCA 2EJWA 4BX0A 1DKOA 1T2FA 4XX0B 4NF2A 2JGKA 1Y0BA 2GGSA 4OFXA 5A0VA 3I0NA 3EOZA 1YTLA 3PC3A 2PL9A 3LD9A 3DOEA 3R3JA 4F72A 3GW8A 1SUEA 3UAOA 2JD0A 2IIVA 3MINB 4UCFA 2VDVE 4V0RA 2C3YA 2YV4A 4TTIA 3NC4A 2GFIA 3ZGOA 1HORA 4ZYYA 1G8SA 2Q3JA 2AD1A 3K6KA 4GS5A 3D3NA 1GRVA 1CDZA 4MS1B 3KTAA 1OBHA 3L06A 1U8FO 2H65A 2ZJ2A 4JR0A 3FH0A 4G09A 2WM3A 1ZX1A 2GAIA 2QZJA 3Q3HA 4C5CA 2Q27A 4F12A 4MR7A 3PC7A 3DEYX 1J42A 2BFFB 3DD5A 3DFUA 3DW1X 3IDZA 1E1QA 5DNVA 2VKTA 3W04A 4CI0B 4CODB 2C5FA 3F5DA 4AY2A 1RJWA 1YJ5A 2GD1O 4RVHA 4BWGA 1VA5A 4LF4B 3CURA 3HDJA 1G1AA 1KYZA 4QJ3A 5L4NA 1IONA 3FNRA 2NSDA 3SDSA 3CG0A 1EEHA 3B51X 1LPSA 2HRQA 1UBGA 3O73A 4PPQA 4QGAA 2JIOA 3L05A 5B1YA 5LMCA 3CR8A 3HJUA 2NV0A 2O2HA 3C5WP 3B70A 4LMPA 2WKWA 4W1QA 4CCWA 1MG5A 4UOZA 1TAUA 1XMPA 2BI4A 3G6KA 3E53A 1TQ2A 4P3XA 4AYTA 1GG2A 5IVPA 1VLJA 1P62B 1ULSA 2X1MA 2CXRA 4URYR 2RD2A 3FBGA 3O03A 3JVUA 1RYFA 2ZTMA 3OO1A 1TCUA 4I1RA 1XXHB 3UGJA 4L7VA 1A9QA 4PHGA 2ROQA 4AT1A 3B3JA 4PX5A 2XTAA 2C2XA 2PBRA 2PRIA 3VYUB 3KHKA 2GRUA 3K6SB 2YY5A 3GLQA 3JQBC 3E3MA 4YI3A 4JUAA 4F8YA 1YVPA 1YQUA 1ZGGA 3GN1A 2F1HA 3MGCA 1J25A 1EEXB 3A58B 2ZZNA 1WQ1R 1ZKDA 1P2SA 2Y1CA 3CA8A 5EZYF 2C3OA 3I23A 4A0SA 1PJZA 1ZIOA 3EIFA 3GUVA 1ENZA 4RL6A 2R8OA 1KOGA 4ND8B 3EE6A 1Y7HA 3H8VA 3FHTA 3REQA 1NY6A 3GQBA 4W5QA 4R0VA 4XB1A 1FFBA 3RWMB 3AJDA 1NZDA 3K1ZA 3O4GA 1NHWA 4YT5A 3MWFA 3W3ZB 4DB2A 3DE7X 5AVWA 1UEXC 1ZD3A 1U5BB 1ZC3A 3KLNA 5A04A 1UZLA 1P4AA 2W58A 3OCXA 1N6IA 2EW8A 3ZQKA 4L5IA 2GAJA 2PD4A 4M1KA 4JV5B 5ADUS 2CLCX 3Q40A 3GH1A 2P6MA 2UYHA 3DOOA 2P7IA 2WSMA 4GX5A 5DGCA 3PUYA 3VPDA 1WXFA 3DFKA 1RM4A 3A2MA 3IQXA 3M6MD 1OBCA 1SHJA 4YONB 3U4DA 1Y63A 4JLNA 3FVTA 3ZQJA 4YTEA 3QVXA 4PX9A 3JYQA 2CV0A 4CKCB 4KSYA 4CQMD 3KQHA 4KV9A 5K4HA 4ZYXA 2FCAA 1MVOA 3WNDA 1M5TA 3OIVA 4E21A 5JZBA 3PFFA 3ELBA 1IN5A 5F5XA 4LMBA 6REQA 3OEHD 2A94A 2WAAA 3MG9A 4DLZA 2C9DA 3OZFA 2DE0X 1E2FA 2BTQA 4MVJH 1LSSA 4JD5A 4ZDJA 3UMMA 3K0AB 5K0EA 1O54A 4RBNA 1ECFA 3QVOA 4F2GA 4HDQB 4OQEA 2DPMA 2GN9A 2O4UX 2W6JD 2Z2YA 3CKMA 4JYCA 4O5AA 4JL5A 5FEMA 1WUYA 4G0YA 1QGYA 3P26A 1CE8B 1OTHA 4ZP1A 3QYAA 1EUCB 4QXAA 1V37A 2GD0A 3OIYA 3BX1A 1L3BA 2R8BA 1QWOA 2YBEA 1CDEA 1ZU4A 3OZWA 4IFBA 4Y2PA 4BZZA 2G36A 5LP6A 4JI2B 4KB5A 1B2LA 2O1EA 4KOAA 3RJ5A 5CFLA 3KJNA 1T15A 1XJ5A 4L6CA 5AVRA 5BOSA 1ZXBA 1ZOSA 2Z95A 3T1YB 4N6NA 1VJRA 1GN9A 5DRTA 3WNCA 5FO0A 5BR8B 1ZW1A 1KO7A 3ZLTA 3ETGA 1JDPA 2R1UA 5BYJA 5LJLA 4GUDA 2X6RA 1XTIA 1E18A 2IYAA 4KMOA 1XZJA 2C4TA 3NCHA 5IAOA 1WSBA 1X3LA 3WLFA 1RBQA 1LLCA 3P45A 5DIFA 3TOCA 1GU7A 3FDZB 4PR0A 3ZS8A 2YHSA 3BZBA 3IAM1 4FC7A 1G9TA 3BRCA 2H52A 1PQWA 3QEMB 3GDHA 2EG9A 3H5TA 4M21A 2G9RA 2IDMA 2RHMA 2Q3DA 1JHMA 3COYA 2RSLA 3PS9A 5IHPA 3IV6A 3K31A 4QC2A 2CE2X 3TM4A 3SEZA 3F6PA 5AW0A 3I9KA 1TXGA 2JJ1A 2Y9PB 1LW6E 3EBPA 1ZK0A 3W06A 3IBYA 1LUAA 2FDRA 3GFOA 4LOKA 1KMQA 3PR2B 5I9MA 2J3QA 3BJMA 4F5ZA 4NAHA 4WE3A 5BYKA 1T3HA 2PT9A 4PV7A 4B9AA 1HC7A 1XD2A 2VJCA 9ABPA 3O8OB 1PQUA 3OLVA 1SM4A 3TW8B 2ZRKA 3IPAA 4CL0A 3B7WA 3LHFA 4GMFA 1GTMA 2MSCB 5BOSB 4BNKA 1Y34E 3LWDA 1K6EA 2P77A 1ADBA 2ZKLA 3ICEA 2V7EA 4PHTA 3T06B 1P4JA 2HFKA 3LUBA 2YRFA 4PSVA 4EG6A 2HJHA 4OA8A 4LIPD 2P91A 1J4AA 4LHSA 5E3JA 1J21A 1Z5UA 4PFKA 2J33A 1PYOA 2ECOA 3LL7A 2EFCB 4Y67A 1IEXA 2CHEA 4UTPA 4OBXA 4OGWA 3B9RA 1HDIA 1YHZA 1MC4A 4QKQA 1P73A 1B3BA 3NHRA 2D4AA 2HA3A 5EERA 3EZYA 3AGQA 1L7PA 2AI3A 1RYZA 3DAHA 3I9V1 1RYHA 3M6FA 4HQFA 4UDNA 1FDIA 4NPHA 4E1BA 1EHIA 1B1CA 4LJ7A 3DJFA 3TSYA 5B57C 2AE1A 3HEBA 5HFAA 5JDCA 3IMCA 4KDCA 2HV9A 1YB4A 3S7ZA 4ZZ2A 3VO1A 2EF1A 1C9JA 4TMWA 2VSFA 1POWA 4NMWA 5JLJA 5BV1A 3TECE 1E1RA 1IL0A 4I6JA 1R8SA 2HM7A 4YT8A 2V6JA 1JDUA 3EF0A 4Q9KA 3ZWCA 5J2TB 2C9ZA 2QMHA 3ZBTA 3WFZA 1Q7GA 1GYPA 4BQNA 1L7XA 1Q57A 1KOLA 5JTUA 3NM5A 2NP6A 3ESRA 1N6PA 2WWIA 1XZAA 4TMTA 2XITA 2Z2XA 3ANNA 1HDOA 3HWSA 3L04A 1QTRA 4ZQCB 5EMHA 2OGSA 4JT4A 2ZT5A 3RSCA 3FPHA 1GRNA 4IFEA 3DMYA 4TS3A 2XBUA 3GUYA 1D0VA 4GVXA 4RA9A 2X2PA 5G4KA 2D54A 2BSAA 3O26A 1XT6A 1E3LA 2WD8A 2CFRA 3KYIB 4HMQA 4MCJA 1GZSA 3P0FA 3PHIA 4QHTA 4QU5A 2AB0A 2DFDA 1H85A 2FQ1A 4TL8A 4LCJA 5KYYA 3WIUA 1LPBB 1Z18A 3BA1A 4GLLA 4LV5B 2ODQA 3STVA 1XP8A 4I1UA 3AKCA 2C0CA 3T4EA 4EFMA 4BJ5A 5CVTA 2AZXA 4PLFA 4TVSA 2QAGB 4YR7A 3BXHA 5AVZA 4BO0A 1VXRA 1SEPA 4YUXA 1W44A 3U4IA 3U17A 1XE3A 2QS9A 3F9IA 4WA7A 3UB3A 2IUFA 2ZTSA 5IAJA 1LVUA 1KSHA 4AMYA 2CK3D 3PQ8A 1RYYA 3K1AB 3BJIC 4ARAA 3C14C 2YVAA 3I1JA 3T54A 5BRNA 1D04A 1A1SA 4H15A 1C1DA 4RTPA 3M0EA 3MQ4A 5KC8A 1THMA 1KETA 1UP7A 2B2XA 1NJ1A 4AX8A 3ZHRA 1I01A 4RK5A 5AWFC 5KX5B 1S6YA 3E8SA 2A2ZA 5KOJA 2VP4A 4ZCPA 4I14A 3OESA 5DK6A 1NWCA 3D6VA 4YQYA 2A3NA 5BR1A 3IIEA 1CUSA 1ZNQO 3L4KA 1F3OA 2IYSA 1PZFA 3P9KA 3MXTA 1LJUA 3LNTA 2DR2A 4Q12A 4GX1A 2ZZKA 3I32A 3UXEA 5K0SA 5FLXA 1CYEA 2QTGA 3TNYA 4DLVA 1YI0A 3C7CB 3JZAA 4P4GA 4KFUA 2PKXA 2YZGA 5L6MB 1NDUA 3C4VA 1Y9DA 2VZ0A 4BIMA 2FMTA 4NCXA 1M75A 1K7CA 4DVJA 1RSZA 3ILSA 4U5QA 1GLNA 3A8TA 4YJ2B 4H60A 1BWPA 4YJKA 2M6SA 3VHRA 4CDMA 1X13A 2WUWE 5EIBC 5T8KC 3VSDA 1HLPA 1YZYA 5T3UA 4RPCA 2XMSA 1V48A 5CDTA 3EXEB 3RLIA 3Q3EA 2Q6KA 2Q1UA 3ASVA 1YNSA 2DJ5A 2G28A 2XZTA 2I80A 4OPMA 1NQXA 2GF9A 4EAAA 5FOUA 2YIDA 3W6UA 5CURA 1QHYA 2IXGA 4Q4CA 1N5RA 1JDNA 4HD8A 4P7JA 2E4ZA 3LUHA 3N0VA 4YY3B 4LQCA 3G68A 1KEWA 4KQ2A 4IV0A 3ABQB 4X1IB 3B1KA 1JIUA 3CHYA 3JQGB 1PUJA 1R9MA 4X62B 2R00A 1B1AA 2X0JA 2QT9A 4LWQA 4J16C 4NBRA 4FMCB 4FS3A 3PI6A 2PL3A 2O8FB 3FJOA 4DC1A 1PGNA 4MI6A 4D57A 5L3SA 3EEQA 1G21A 2QTLA 4GUAA 4F7WA 1ATZA 2XRFA 1ZM4A 3PNBA 4QECA 5ICCA 1PL6A 3QWBA 1FYVA 3ETNA 5BNZA 1F2UB 5BV2P 3ZWYA 4Z9XA 1NAHA 1ZM7A 3DKKA 1GL6A 3N7AA 3QA9A 4IH4A 3P71T 4J4BA 4R3UC 5ENDA 3S5JA 4MB6A 2XNDD 5HBRA 1XMIA 3V1MA 2WB2A 1IDOA 4KX3A 3NZEA 1E5VA 3NTVA 3NB0A 2OCBA 3VAYA 2ZUBA 1JR3D 2PZJA 4AO7A 1N7HA 1Q15A 4IM7A 1YHYA 5E8RA 1Z2CA 5AKLA 3PA6A 3TW4A 5SYAA 4DWVA 1TEZA 3CF2A 2J41A 3ZGYA 1TIKA 3C8HA 3DA8A 4LNUB 3KETA 4NCAA 2GCOA 3GUZA 2PMFA 4E5NA 2QG9A 1CRWG 3BFXA 3TCKA 1OH7A 4UREA 4LUCA 3KBOA 1VSTA 5E6UB 4UQOA 4X6XA 4IGEA 2IGBA 2JAQA 4CKBA 1B0AA 3AIKA 2JIDA 3FRJA 5AVJA 13PKA 2NP7A 1ULHA 4POOA 4G0VA 4ZO6A 1IN7A 3O2SB 1WWKA 3C3PA 4OATA 3MEQA 3G2PA 3AF2A 3OFJA 4CIWA 4ZRMA 2B5VA 3PDCA 3VPFA 4KO8A 4O2BA 4UTZA 2QNRA 3U13A 4ZDIA 2V3CC 1I4DD 1JBKA 2WKRA 5ESXA 5LZ7A 2W8BA 1KZ7B 2DWCA 3G9ZA 3G0BA 5GZ6A 5F7XA 3I5AA 1T8TA 1XI2A 3GJ0A 5BPFA 2IUYA 5BN4B 4U9IS 1WTCA 1XEWX 2Q4RA 1W36C 1D1SA 1JIVA 2E7ZA 4Q3BA 2VYND 3L1HA 4CIXA 3U09A 4B33A 3KNZA 1MRZA 4TL7A 1QG6A 4QM7A 2REQA 1X1AA 2ZAGA 3MN1A 2PSFA 3BXOA 4LSWA 1J2UA 2V45A 5F3DA 4CV3A 5EJEA 4U7TB 4IO0A 4CEJB 3K94A 2DBVO 4MWBA 5CYGA 5AHXA 1ZAKA 3B1FA 1BFUA 4P4NA 4F4CA 2LCFA 3K0EA 3IULA 4IHAA 4INJA 1W85A 2X3YA 2CXXA 4XCVA 3RUHA 1C8LA 3KYJB 5BSMA 4OHVA 5HVNA 2RGRA 4MGEA 5EXSA 2JEOA 1JQEA 2OWEA 1D7AA 1ODSA 3ZHUA 4BVGA 1W46A 1ZJZA 4KPUB 1U7PA 4II7A 1XVLA 2FPOA 3DYIA 2B35A 3W4IA 1GAWA 3BWBA 3JQRA 5GOZA 1II8A 3U1BA 1GRCA 3PJEA 3QYJA 3R3XA 3Q9UA 3SR3A 2GNAA 5DK4A 2V5AA 3G0OA 3FLAA 4ZOQI 1AA6A 1YRHA 1ISHA 1ZONA 4D4MA 2D0IA 1GCIA 4FBLA 1ZD2P 3K2QA 1E8DA 3TKLA 3UWOA 3I1FA 3EW9A 2OXEA 5HRCA 5BMVA 4Q9NA 5G1OA 2H85A 5DB4A 4EZEA 1XLVA 4Q34A 5BNWA 2OBBA 2D1RA 4FGWA 4PX2A 1ORHA 2Q1SA 3JQ7A 3AEKB 3MWEB 2BFDA 1ZLXA 3W2TA 4OH7A 2AX4A 3L8DA 2DPYA 4RHCA 2W2LD 3NRJA 3A2LA 1RQ7A 1TC1A 3P9RA 4X93A 3HBAA 3G9UA 3LRTA 4QARA 4M7OA 2XQKA 4PC2A 3WLQA 1YB7A 4AJ9A 4BN5A 3TVDA 1UBEA 2C8KA 3LQFA 4QODA 2YJ3A 4D5EA 2C7QA 1V45E 4MI1A 4RYDA 5LQAA 1OXMA 3UMFA 2IKSA 2JIRA 3ZZUA 2J5RA 4JA0A 4L2IA 3GV0A 1J39A 4UHFA 5KPJA 1WZIA 3S2IA 2IRWA 4FFRA 4KLNA 3Q8KA 2AJLI 2XUJA 3ID6C 4RS4A 2GDJA 4CMIA 3RJ9A 2EZ8A 4O2AA 2Q5QA 3OJFA 3ER9A 1Z0AA 3M1AA 2OHFA 3CRVA 1FP2A 1CJTC 5K3CA 1FJ2A 4DIDA 1U7OA 2R97A 4W5TA 1SXGA 4IEIA 5E0KB 1JPVA 4KI0A 1CEQA 3EGDB 3VNRA 4K05A 4ZJPA 2ZIWB 5C3UA 2H7XA 3ELYA 4PX3A 3EEIA 5BSKA 4YJGA 4JEHA 1QUFA 4CIBA 3MUEA 1J1UA 4HEJA 1QQTA 5EC8A 1JHZA 1R6TA 1SD1A 4UHKA 1D1PA 1M6YA 1JVNA 1O95D 4FD2A 3HR4A 4PRKA 2BGUA 2ZJBA 4MKFA 1G8PA 4NATA 3PDIB 3RU9A 3EFBA 5JT1A 3ADCA 4F4JA 1W6UA 4JB3A 3FPJA 3HSSA 4L76A 3S8EA 5L4LA 1HOXA 3VKVA 3NEPX 4KRXA 1Y98A 1Y9ZA 2HSJA 4I3GA 4MWOA 4DV4B 5BV8A 4ZVOA 4BGIA 1UBCA 5CYFA 3O92A 4HVAA 1XVAA 1QOZA 3K0CA 3L77A 3WYAA 5AIBA 3U16A 2VI5A 3Q3IA 2G70A 4WZAE 3LO5A 4HLQB 3A11A 1IN8A 3OJWA 3WISA 4YT4A 1IJEA 1I7SB 2XKKA 3IEVA 1XNHA 1X9GA 1JU4A 2JLBA 3O1HB 5HQ3A 2PH3A 3M6IA 2IS2A 2AXQA 1WD7A 3SF8B 1LTKA 2Y3IA 4LE0A 3AHJA 1N3IA 4JWKA 1TM2A 4LYAA 3PL5A 3NVAA 4B31A 4IMIB 2GZ1A 2ID4A 3TRKA 4PANA 3FYSA 3JCZA 4INZA 3RB8A 3F7NA 1L5GB 1CIPA 4M9SA 4PHCA 4C7XA 3UJNA 5TMBA 3EC7A 4M8NE 4NNJA 3HB4X 2GESA 3LCRA 2ODPA 5DWQA 4BMSA 1ZIPA 3R09A 4MARA 4YAGA 5AESA 5IANA 1C3OB 1YZUA 3KC2A 3V00A 3PV0A 1O2DA 4C29A 4RHFA 5HGJA 1Y3AA 4BJ6A 2RIRA 1AHPA 2IU0A 5IM5A 3HFRA 3QU2A 4LYDA 2XEXA 3EAGA 5HCUA 2BFMA 3PTAA 2JHCA 1QR6A 3K35A 5EPUA 3VNQA 2XHZA 1P7VA 3ACCA 3BMQA 2R65A 4LKRA 3EPRA 3TIGA 3L0DA 5DBIA 1NDQA 1KDYA 4UU0A 5D1HA 4BQEA 1WBDA 1Z73A 4JDPA 4ZT2A 1KK1A 3CPJB 5EQJB 4E5UA 4Q4JA 1OIWA 5CEEA 2YTZA 1LZLA 4JYPA 2VJKA 3HADA 5TPWA 3VO9A 4HI0E 1OMOA 1RQLA 4RPLA 1UJMA 4LCEA 1NF2A 2C8VA 2V8BA 2C2GA 3EVFA 3OCWA 5FFFA 5A5DA 4MNTA 2EP7A 1VLLA 3AVQA 1GKKA 4FS8A 1RLJA 1V1RB 4AUEA 2WWRA 2ZUWA 4F6RB 3DEFA 3E48A 2QRUA 5JZVA 5KMGA 4FN4A 4RTLA 1WMEA 2V6BA 2JK0A 5DM1A 2DEUA 3KXDA 5EE0A 3F3KA 4BECA 3ND7A 3DL4A 2Q4BA 4OHRA 4TVBA 3H2GA 2FNAA 1SELA 2BR5A 3A32A 3VSAA 4IDQA 5JSQA 2KJQA 4X91A 2XE6A 3NS7A 5JHGB 4R4JA 1LK0A 2GR9A 4WNCA 1CY2A 1XQ1A 1ESNA 5E2BA 2QLBA 3DMTC 4QEKA 3OX2A 4HL6A 3HM2A 3G17A 3Q7EA 4OBWA 1VPLA 5EIWA 4MLCA 3R7AA 1UJ2A 3OLXA 4N65A 2DGDA 1IATA 3B9PA 3K2BA 1AIPA 2LDXA 2ZB8A 3GHHA 5DYGA 1HTWA 5DKFA 1W36B 3RDPA 2R5FA 3D6TB 3ZK8A 4TWJA 1B8UA 1VRCA 4M55A 3D6HA 5EFOA 3SWWA 1T2NA 4D3YA 3WWZA 1AKVA 1UM8A 1WMSA 4HK4A 3E1SA 3F9CA 4Q4JB 5CB4A 2G1UA 2NLOA 4FPXA 2EGGA 3KPJA 2KX7A 4L4UA 1X38A 4GPZA 1ABFA 3OTOB 2GI4A 5H02A 1NM5C 1DLJA 3D2LA 1OVMA 5BRAA 4AZTA 4NX2A 1XWWA 4E12A 4DT1B 3L7CA 1KOJA 5CCBA 4ND5A 1QZZA 4RTJA 5HRAA 1O9GA 1HRDA 5EP4A 4Z0NA 5I7AA 1YB2A 3C6QA 4M0KA 4OF4A 4G0OA 3W5SA 4XWOA 3NIGB 4NU8X 5EFZA 3VH1A 3M8KA 5BN3B 2CBZA 2J5BA 4PFQA 5AKZA 2JFFA 5EWMB 4LYGA 1WPXA 2DY0A 3RVOA 1MO4A 1UP6A 4CF6A 4FX5A 1JFFA 1T36B 3D4IA 4YHBA 3VYWA 2NZYA 2VRNA 2KW5A 2QW0X 2Q2QA 1ZH6A 4TV9B 3GLKA 2IF0A 3L8YA 1EUYA 3GT4A 3H9QA 3PSHA 4F56A 4FKZA 3RE1A 1A9RA 5FO1A 1PYDA 3P9XA 4O4HF 2NV6A 1SA0B 1ZD1A 3D1LA 4C88A 3R7WA 3B82A 4EM6A 3G9QA 4IUYA 2PBLA 3IIKA 2IZZA 2VYVA 3RJMA 5IF9A 2JI7A 1IN6A 4ZI7F 4DMGA 1L8AA 2FX2A 1DOHA 1DIAA 1U8UA 2CL7X 4C6TB 4N5MA 4Q5IA 4NDAA 1FPMA 3AVPA 5KYKA 1P7CA 1R6XA 2SNIE 3IAFA 5DP1A 2ET6A 1E7YA 4JFRA 3C3EA 2VBFA 5SY6A 4IBOA 4N6GA 1LPPA 1JQKA 4F3CA 4B3MB 3ECCA 1HLGA 4ZU6X 4PSCA 3H5IA 2I3BA 1QO9A 3FNQA 3OZVA 4DTCA 4AF8A 1GFSA 1D4OA 2FN3A 1C8BA 2KS6A 4L57A 3CS3A 3ZR4B 4EF6A 4ZD6A 4BV3A 4CF4A 1OH8A 4E2XA 4EF5A 1QFJA 2VAMA 2X9QA 3CTPA 4RU1A 4CM4B 1W5EA 2I76A 4YACA 3GH3A 2FV8A 2ZBQA 5EY5B 3RVLA 1EG2A 2BJHA 3PNOA 4R16A 4MW4A 3IOYA 3HA5A 2DPXA 1NP3A 4REQB 4ZT4A 3MAJA 5CBKA 4BPRA 5HW0A 2AR0A 5C80A 1R0KA 1OX6A 3IHLA 1F5NA 4ZALA 3UMSA 3DMHA 5ABPA 4WZBB 3ACBA 4CFYA 4E5DA 2VSQA 3IUBA 3AKDA 4KVFA 4NK5A 5E4JA 1L5WA 3N7UA 5A9TA 5KTOA 1ZVQA 4KOEC 1KEEA 1KYVA 2AC2A 2OHIA 3NTUA 4G0ZA 4HMPA 4IJ6A 4YRKA 1MFZA 4LRSB 4MZDA 4PPYA 3T5GA 3MWJA 4F7DA 5JCXA 5MN6A 1X94A 3PVZA 1KPHA 2G09A 3L40A 3VKGA 3E15A 1XV5A 3OZCA 2OXCA 3EA5A 4M8LA 5BYBA 3TTYA 4B6GA 16PKA 4GX2A 5IYZB 1MB3A 1AV6A 4FKMA 4YK7A 1JGTA 1PG5A 1SHZA 5AI6A 5H80A 4AAYA 3H6GA 2FHSA 2ZRMA 3KFVA 5IC5A 3BMNA 4JOQA 1TM4E 4LRXA 1XDGA 3P97A 3WRYA 2JFVA 5JADA 1L5SA 3EC1A 2QZPA 5PNTA 1IZ7A 4EWLA 4UM9D 4B17A 2QRPA 4H6XA 5HK8A 5AW8A 1Z34A 1DHTA 1TZKA 3GDGA 5LU9A 1EDDA 4GT1A 5TPZA 3AO0B 5DXAA 3WLRA 2AS0A 1LVHA 3OJ0A 1JT2A 1L7BA 2GJAA 4FXOA 3SQLA 3UEOA 1E6CA 1Q5PA 3A6KA 2NSYA 1FVXA 3CIOA 2HEGA 1VIMA 1AC5A 1OB2A 2GPJA 4Q9DA 1N2GA 2BF7A 2W0MA 4KN9S 1T9ZA 2HK8A 1CY8A 1VI6A 2HA4A 4IIBA 4WEQA 3ITDA 1DMRA 1JILA 1HPLA 4R9SA 1W1IA 4RCZA 4WKNA 1N8TA 4RVDA 2H1IA 1Y37A 2YVQA 4Y1FA 3MTDA 1P91A 4JU8A 4MWCA 5LL6P 2VJOA 1VE5A 1U0LA 4IXMA 1EFHA 1K7EB 4JQCA 4RZIA 1SD2A 4JKYA 4A2PA 3ADKA 4IJKA 3FR8A 4UEWA 1CP2A 4QFDA 5FHQA 1TX4B 2QVLA 3MD0A 3GPLA 2FDCA 1PBNA 4KR7A 4GI3A 3H4MA 2JJ2A 1G7TA 1VOTA 5I7FA 3OQIA 3PRKE 2O7VA 2JFQA 1Z62A 2FN4A 2VLIA 1U9IC 4WQMA 1C80A 1BW9B 1ODTC 2BTOA 5AXCA 2ZI5A 4BUJA 4WLFA 4BNGA 4BNVA 1CDDA 4D9NA 3SE0A 4DLUA 2WWGA 3A0RB 4N0EA 5JY6A 2JKZA 2OMKA 4YRQA 5L51A 4RF5A 4DR4B 1PT8A 1NVXQ 2HXSA 3JXEA 4OHMA 4QTXA 3ZGXA 4YFYA 4DQ0A 1T91A 2FXIA 1PS9A 2RBGA 2DG2A 3FDFA 2IHBA 3IT2A 4EB8A 3CMCO 5CA0F 1QS0B 4DLRA 3C6XA 1H2WA 1BH2A 4PGGA 3I6ZA 2BGGA 1ORDA 3D4BA 3V7FA 2I8CA 3TZBA 1CT9A 5CRIA 1KH3A 4B3XA 2NUTA 1NVGA 4IRXA 4G4JA 3W8FA 3BB3A 3DLBA 2P9QA 3MBKA 2OILA 2O5EA 3O2JA 3EZ7A 3IP6A 3GP5A 5L9AA 5JPIA 3PXXA 3E3NA 1LSOA 3FOWA 4MB2A 3EAFA 5ALWA 4TRJA 1LV8A 5G0VA 1NSTA 3WFIA 1A2QA 2Q1YA 4GM1A 4MRMB 1XTJA 1XTBA 3NAQA 3KAPA 3ZI4A 2XZPA 3IAS1 2E55A 4IH9A 4Q1AA 1R4NA 4M0DA 1U3VA 1G66A 2DTDA 4JQOA 3W6OA 4RJLA 5IUNC 4BCBA 1KRHA 1MD9A 3WIBA 1TF5A 1O03A 4CE6A 3IO3A 4JBWA 4YT2A 4LF6B 3TIVA 3ZE7A 2AR9A 1WEHA 3DAOA 3DTTA 4IDHA 5HMMA 3WRYC 2QAJA 3DBIA 4BNHA 4CTKA 4CLDA 1M8GA 1Y1SA 1YDEA 4YXWA 5T67A 3RR2A 1BMFA 1SAYA 1VJCA 2R5NA 2WICA 3H1EA 1KAHA 1T25A 3R5SA 3EG9B 3ANYB 4HLUC 4XFJA 3OFKA 4XIIA 2HHCA 3RWBA 3U6KA 2CD7A 3JWHA 4K1XA 1P6XA 2DSTA 1NVFA 4ZT7A 4OXKA 2ZS7A 3M70A 3OP1A 5HZMA 3AJ9A 3TCXB 2AI2A 3K5WA 4G2NA 4QGHA 3RVKA 1MV5A 3ENQA 3NBFA 2DJIA 3JTMA 5J2TF 1H69A 4GI1A 3B6ZA 2FZGA 4YLYA 2G8NA 3PC2A 1DBWA 1G2OA 3QELB 4MW7A 4IIUA 2FE1A 3ROQA 3RVDA 3HO1A 4MV9A 2B34A 2H8GA 5K0TA 5TX7A 3IPCA 5CDGA 3RFUA 1IBRA 1X1CA 1ANKA 4CFZA 3KWJA 4U0KA 4YRPA 4X1KA 4RFLA 5JG7A 2DAPA 3GFVA 3ZXXA 3GWZA 3DHVA 5E6SB 2IEDA 1IBMB 1BS9A 2C5SA 4I4TB 3RBZA 4F86A 1DQZA 3BDAA 2HPVA 4DIBA 4C1NA 2RHTA 5JXJA 4DCJA 4IJMA 1SKAA 2HF9A 3QPUA 4KFSA 4OOFA 1LGYA 2VR1A 2WIDA 1LTQA 3O5AA 1G64A 4JROA 2P27A 3PFNA 3L7MA 1GVHA 4MMXB 5F51A 3N2KB 4FOOA 2PT7A 1Z5GA 5FHRA 3SC2A 2FPPA 4C20A 4Q7KA 1C0KA 1G6OA 4A5OA 1F8FA 3G2QA 2JK1A 4XYGA 2P3QA 3NNDA 1KSJA 3ONWA 1CD5A 4LXHA 1KJYA 5K3SA 4KW7A 1CRZA 3U7QA 1XKTA 3AFHA 4JNCA 2QLNA 1UJ6A 3V4ZA 3GLGA 5TPWB 1UDCA 2ZRQA 3DE1X 1ISGA 3JD2A 4JJAA 5KTNA 3W8DA 2ICAA 3PPWA 4MQEA 1H66A 4LYFA 3W6NA 1Z82A 5M2QA 1TZJA 2IPLA 4DM4A 4K9RA 4PO9A 2PUHA 3GJ8A 1MIHA 3P0JA 4I50B 1LDYA 1AKQA 1XA0A 1U65A 2W8BB 3DWGA 3PNSA 4JR2A 4QTTB 4B8YA 4YIHA 1CR2A 2B30A 2C58A 3CSUA 4BTLA 1T8SA 3VO2A 5CFQA 1NVTA 1FRFS 2CLEB 1KZ1A 2IOQA 3ON5A 5AI8A 1EWTA 4XM2A 2PV0A 2A4KA 5ALJA 5BURA 4K9OA 5ILGA 3AWDA 4Y9UA 2X5XA 1AV7A 4KQCA 2ZE8A 4DFDA 1ZNYA 3L07A 3C48A 1HNWB 3OKCA 2ZZMA 1G5PA 1W0JD 4CKYA 1SU7A 2I1QA 1TAGA 1L5HA 2B8WA 2B1GA 4KYIB 2ZUFA 4G9BA 4KXQA 2JIQA 3QXHA 4A0QA 3DPSA 1VBFA 3BHMA 4PZ9A 3DSRA 4D8UA 1E0JA 1KRWA 4PNZA 5CFRA 3UCFA 2ZK7A 5C4MA 3ZUPA 5INTA 3RQIA 5GADl 2VZ8A 1QJCA 3HR7A 2BUCA 4ZEMA 1P2GA 2HNBA 3MT0A 2GYWA 3BFVA 2B83A 2VQ6A 3E0QA 4X1YA 4XUEA 4EJ6A 2HSGA 1M5RA 1O5OA 1FFSA 2D3TA 1I10A 1IC6A 3LG2A 3OY7A 1VG0B 2ENUA 3ZV4A 4H2DA 1KJIA 3L0BA 2LW7A 3ZE0B 2Y0PA 4TVKA 4PYOA 1E0AA 3H2JA 1US8A 3FOBA 2QW8A 4N0MA 4TN1A 3TLCA 4M88A 2BI7A 2M6LA 4CHGA 2A4MA 2P8SA 4ZZ3A 2G07A 1SVSA 3SJBA 2P9JA 4G1FA 5IT5A 2SKCA 4RZSA 1MC5A 1XDUA 2VUSA 4I2VA 2FA9A 2R85A 1RYBA 3DEAA 4DCMA 4NU0A 3HJGA 2COUA 3FVQA 3GBSA 3R5TA 5DX8A 3MLEA 3JD4A 3MJHA 4L5JA 1I5OA 5JS7A 2O7RA 1L5KA 2IBSA 2OXFA 4ZKDA 2WUVA 1U8AA 5GOTA 3WB2A 5IJXA 4YMVA 4U2DA 4J0KA 4TV9A 3FDJA 2V0NA 3RIMA 2W6OA 2WU0A 3MYRA 4LRTB 4R8VA 1QF9A 2LDBA 3RSZA 3X0DA 3A70A 1WO8A 3CBQA 3ND5A 1DAKA 4RTKA 2W90A 3TJRA 2P4SA 2C9OA 2C99A 4L8VA 2WFLB 3DOCA 4KVAA 3ME5A 4RLQA 1TRKA 3EEYA 5EZ5A 2PZGA 3ROPA 1CQIB 3CB2A 2V1XA 4BQRA 3E4CA 1TUBA 2C88A 4MJ7A 1OAOA 1VL0A 1G55A 2C61A 2Q0SA 3L4BC 4KIJA 4RHYA 3SEFA 1Z37A 4WGFA 1SKBA 5SYMA 4BWYA 4V3BA 3W1EA 5ESWA 5CLIA 1N3BA 1XBTA 2OBLA 3L46A 2JASA 3LBYA 2O07A 4PSDA 4AJIA 5F3WB 1IHYA 1N0HA 4WT7A 5KAPA 4BVFA 4DQVA 1Y1KE 5F73A 2D2IA 1V7QA 2AT1A 4JP5A 4FW8A 2H9AA 2PSSA 4LWPA 4E5PA 5KKCA 2CLSA 4N8SA 1ZVJA 1FRQA 1OGJA 4ZCRA 2G8LA 1G16A 1GG8A 1XA4A 1IBCA 4NBUA 1ZD4A 2GSWA 3G8DA 2FPSA 1L7OA 2VEDA 4M6WB 1M5UA 4J1NA 4V2UA 1WNFA 1M1UA 3FY4A 3CVVA 1P77A 1FFYA 3WP0A 5DDIP 4ZT3A 1XWFA 5B4VA 1SVIA 2HB6A 2ZUTA 3E27A 4RIGA 1IY0A 1DUIA 1QB7A 3OD5A 2WJZB 4R1UA 2WTAA 2WP8J 1PR9A 4IVRA 3A9TA 4R8SA 4RIFA 2FFBA 5JAIA 1WJGA 2P6OA 4X44A 4X94A 5I4KA 4UJ3A 4HGNA 1U0RA 2GK3A 1GZ5A 3HXKA 2GN2A 4AKIA 1OROA 3DNPA 5IAEA 4IDNA 4K86A 3ENWA 3UHFA 3IMGA 5KTMA 1DWQA 1QZXA 2IQ5A 3FWPA 1LPOA 1K4MA 1U2DA 2CLIB 2PYIA 4F8EA 3DHYA 1EFKA 3NHAA 2CJYA 3E7XA 3OMLA 1WSDA 2FSVC 2X8JA 4YCLA 5DW3A 2I7DA 3COSA 3VU3A 1WXGA 3E03A 1FX0A 3OIUA 5I4IA 3UMCA 3OFVA 3CLTD 1ESZA 3I5UA 3FKSA 2A9JA 4AJHA 3O8OA 1S3FA 1Y9EA 2YC4C 2P2NA 3A25A 3F74A 4Q7MB 1CHDA 1TA0A 2B5OA 1WCXA 3BICA 4L74A 1DFHA 3NTLA 4GXTA 1LPAB 3CRNA 2V7GA 4FYKA 2J09A 3DH0A 3P0RA 4NJMB 4KXVA 5EKUA 4CCSA 5LQMA 4GHWA 5AW1A 1EUDB 2IVZA 4A2CA 2Y4NA 5HKAA 4Z1MD 2NT4A 4GVPA 1CZLA 2E89A 4MUFA 1JE1A 1N6RA 3AL2A 4UNRA 3U61B 1R0ZA 3HY6A 3FYUB 3JARB 2VAWA 5ALKA 4ODIA 3AUTA 3GF4A 3JQCA 3C6MA 3BC1A 3QG5A 3FLEA 1TRHA 4L72A 3G13A 4L9RA 3UHOA 3FE2A 1HUQA 3D81A 3L0CA 1BA3A 1GNSA 1Z5VA 4UNNA 1W8DA 1S8FA 1F3LA 3PXAA 4QRIA 3GEEA 4CEHB 3NR2A 4RZ3A 1J2JA 2NO6A 3NXSA 2A0FA 4LYEA 2O59A 1QGUB 4NHOA 1XDWA 3O47A 3QVLA 3GWGA 1EE1A 1S3SA 2FEPA 4UAGA 2VDMB 3UA4A 3LHDA 1KEKA 1SBIA 1HKHA 4B4DA 3HXMA 4ZVMA 1CY4A 4D1YA 3JRWA 3Q1LA 4P3OA 4ZYTA 4HDSB 6ABPA 1ZNWA 1GZ6A 4L6IA 2X5KO 4KXUA 4YV0A 3SLRA 1EP1B 4E3ZA 3N76A 1GWNA 3OM1A 3W1WA 1VE6A 2PAFA 4BZXA 4XUGB 4B48A 2RG1A 1H94A 1OZFA 1TEVA 2YBDA 2QB5A 4GMHA 3GEDA 2OOKA 5EINA 5K0BA 1IXRC 1TJ4A 1OR8A 3EWAA 1H0HA 1URPA 1B8VA 1ECCA 1T9CA 4OYLA 4YCSA 4M54A 1M72A 1AZLA 1RKXA 1SK9A 5DHQA 1OXXK 5AJUA 4AKGA 1J9GA 4XD7A 1P1HA 2E18A 1W4ZA 1Q19A 2FWJA 2ZYWX 4M76B 4BNNA 3UAYA 3THYB 1E64A 2PSHA 3LXXA 1F60A 1BEUB 3VR3A 2C07A 4D4IA 2H1OA 3NX4A 3EHEA 1SOVA 5KOHB 3T4XA 1Y5NA 3URMA 1B6RA 2G77B 4JR1A 3HB9A 3E9YA 3N8GA 4KE7A 2BEJA 1COWA 3GQBB 3QHAA 4IY1A 5DLQC 3FMGA 4O33A 5D2CA 5U1PA 4F4IA 3IVCA 5LBIA 1BEEA 1BXRB 3OHMA 1N2OA 1QGUA 2EGHA 4RWZA 1Q2UA 3A6LA 4NESA 3BHNA 5KKNB 2YICA 5I7OA 2L19A 5HF8A 1J70A 4WXHA 3AUYA 4BNUA 4NG5A 4ANFA 4DXDA 3ABIA 1FJHA 3RVQA 1A4IA 4Q03A 4TTAA 3RS9A 4BNDB 2QTVB 4G63A 1UDWA 5HR5A 4HNTA 1HE1C 1CQJB 1L5OA 4QDJA 3PNKA 5K0LA 5TC4A 4KUGA 3LOUA 3WWCA 4KWIA 3M5CA 2HYIC 3EZXA 3WQSB 2VBIA 2ZANA 3NU1A 1MH9A 4XXHA 1JR4A 4MQLA 3TNFA 4AKSA 3RS7A 5KTRA 4GGMX 1Y8QA 2QZ9A 1MJ5A 4D79A 3GD5A 2HBYA 4TLDA 5JY1A 3OEED 5HMLA 4EOGA 3N3AC 4QNRA 4BVEA 3K70D 3IDAA 3RROA 4EFLA 1QRDA 1N32B 1EX7A 2AFHE 3E9ZA 3M9XA 5B2ZA 3PZBA 4Q3OA 5JCZA 4PGAA 4P0TA 2PKQP 3U49A 2NGRA 3CZ9A 2WF5A 2JPDA 1MHTA 1DQSA 1U4NA 1VKNA 1NLYA 3NEJA 5KNBH 1MOQA 2DWQA 2J9XB 1N5IA 2JFNA 3RRXA 3RYFB 4DBLE 5B3LA 4GKBA 4K88A 4JLOA 4MAFA 1SXIA 1YRBA 1XO1A 4J1TC 1XTRA 2NUPA 4GEGA 4XTRA 2ZJYA 3EK2A 2Z5VA 1FB5A 4EJFA 1T9KA 1BGXT 1TFRA 1PK9A 1SVOA 3NHYA 4NOLA 4CQLA 5K8VA 3JAMA 3CB4A 2VNHA 3TRDA 3HXLA 1WD5A 3HWRA 2BFCB 1SRRA 4J75A 1HG0A 2N42A 4DYHA 1KDPA 1V9SA 4POAA 3MCTA 2HNAA 1OXBB 5BMVF 4C5AA 3PEVA 2TMDA 4JT9A 4LQLA 2VXYA 3HKCA 5FX2A 5AH0A 1G0NA 1S3GA 4OI2A 2RHGB 4QG7A 5GONA 5TSDA 3WK5A 3I9OA 2WE8A 4KQKA 1EDZA 3D7RA 3W3AA 5DEIA 3F6BX 2B8TA 2I1WA 3IHKA 3P2YA 5JZOA 2GZ2A 3KE8A 4DMLA 4KN8A 3AINA 3R0VA 5C4IA 2CBXA 4AG3A 1JHQA 2YDXA 4GI5A 3ADDA 1H4VB 1GRQA 3VU9B 3STTA 2QTWB 2Q9CA 3ZWOA 1BKSB 2VP6A 2FSHA 3BH0A 3QX8A 4HUQB 3ABSB 1C7JA 2OD9A 3SAJA 5EJ6A 1U11A 1CVIA 3BTSA 3VAZA 2JCBA 3SCZA 3ZDXB 5JRDS 3M5PA 3BGWA 4I2NA 2GNOA 3V2HA 2CFSA 2INGX 3CUUA 5JDIA 2WPDD 1MR3F 3N0RA 1HTTA 4V1CI 5L40A 2O3UA 1GZHB 2VTBB 1ZZEA 1X7XA 3DEJA 3K7EA 5A62A 4JGIA 1R2QA 1EBFA 1BQ4A 2GK4A 3IX7A 3H5VA 1ZKMA 3ENKA 4TMZA 3V2IA 4LF8B 2X0RA 3BEDA 2BGWA 4Z2AA 4LXQA 4WNAA 1OFVA 1IFXA 2IEBA 3NP7A 1RADA 1ZQ9A 3OFNA 2O23A 1GARA 1TJ3A 3BGOS 4LCBA 5CU7A 1FDWA 3UGKA 5KQSA 4DLXA 4BLSA 3OKAA 4FJ2A 4LZZA 5AFSA 5JWRA 2CCKA 3DM5A 4BY9E 1X8LA 3HCNA 5B1SA 5HG0A 4OA5A 2CN1A 3IUNA 3KQYA 1ESDA 4FQ5A 4NDZA 4UC0A 1RIFA 1OTYA 5FAKA 1E63A 5E0OA 2Y71A 3FI9A 1RYMA 4PQRA 3F49S 5HS6A 1Z4NA 2GZHA 1K8XB 4ZT5A 3SG0A 5ETJA 2HTFA 3TAUA 4QU9A 1UWCA 4QJIA 5B58T 1E8MA 2QEQA 3KXLA 1YACA 3L93A 3QKIA 4JH0A 4TYMA 2XVXA 5KYNA 2J5XA 4F06A 5T4HA 2HMTA 1P72A 1UK7A 2W93A 5EKXA 4RY2A 4CTNA 5HS4A 1X1DA 2AZ4A 4X6YA 8ADHA 4DRZA 4OLBA 3UJCA 2AZMA 1JU9A 4OHOA 1ICIA 1LBEA 2JGRA 3MNFA 4L5CA 4PSAA 4RSMA 4FYJA 2QW1A 2X1VA 4BLWA 4ENWA 5BQXA 4MVJM 1CVLA 1E2EA 1M7HA 4IP0A 4K26A 1YQTA 1YZLA 4WI1A 1KMIY 1WB5A 2R8ZA 3FTNA 3VR5A 3W5IA 2QLFA 1I3OA 4IVQA 1A2OA 5TMPA 3ZU4A 1Z3IX 4AO8A 1QORA 2H08A 3CX7A 4WKBA 1P2VA 2I4MA 4FYHA 4C0HA 3UWKA 1L5RA 2HPHA 2XYPA 2ZSFA 5MGBA 5FOQA 2C94A 3ELDA 1CQXA 4YAJA 5FWYB 2AK2A 5C1BA 4HXFB 1DIBA 1E3EA 2DETA 3AU8A 3V5NA 1G20B 3TQCA 5K0FA 3NNSA 2H8KA 5A5GA 1E4EB 2J0QA 2H92A 5KYYB 3QMPA 5EJIA 4TKVB 1PLKA 3MJRA 3MUFA 4ZHQF 3MTBA 3R9XA 1IHXA 3K15A 5B6IA 3SQDA 4EUFA 2I71A