4HDRA

Crystal structure of arsab in complex with 5,6-dimethylbenzimidazole
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
339
structure length
335
Chain Sequence
MSLLQATVAKIMRPDTVIKDQVKTKLAGVLQSAGSLGRLEDMVEQYAGITGELNPALPKPCMVVASADHGVARRVVSAYPIETTIHMTANYLISQGASANAFANFCGADMVVVDMGVAGDLSYVPGLWHRKIAYGTQDFTEGPAMTREQAIQAVETGIDIVNDRVKHGNRCFCLGEMGIGNTTSSATIVGAFTGLAPEKVTGRGTGRLKTKMEIVGRALAVNKPNPQDGLDVLAKVGGFELGALAGVILGSAANRCAVVIDGLNTTAAALIANVIHPLSKEYMFASHLSGEPAHSIALRQLQLEACLELGVRLGEGIGASMVVDMLYVAIKLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ArsA
publication title Structural Insights into the Function of the Nicotinate Mononucleotide:phenol/p-cresol Phosphoribosyltransferase (ArsAB) Enzyme from Sporomusa ovata.
pubmed doi rcsb
source organism Sporomusa ovata
molecule tags Transferase
total genus 127
structure length 335
sequence length 339
chains with identical sequence C
ec nomenclature ec 2.4.2.21: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02277 DBI_PRT Phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1610.10 Mainly Alpha Orthogonal Bundle 5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1 5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1 4hdrA01
3.40.50.10210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hdrA02
1L4EA 1JHMA 4HDNA 1L5KA 1WX1A 4KQFA 1L4MA 1L4HA 1JH8A 4KQHA 4KQJA 1L4KA 1JHYA 1JHPA 1JHQA 4HDMB 3L0ZA 4HDKB 1L5MA 1JHOA 1L4FA 4KQIA 1J33A 4HDRB 4HDSB 1JHAA 1JHVA 1D0VA 4HDNB 1L4BA 4HDMA 1L5NA 4HDKA 4KQGA 1L5LA 1L4GA 1L5FA 1L4LA 1JHXA 4KQKA 1JHRA 1D0SA 1JHUA 1L5OA 4HDRA 3U4GA 4HDSA 1L4NA
chains in the Genus database with same CATH superfamily
1GTL1 1T4CA 2WVGA 4RE6A 3BWVA 2TECE 4K6KA 3AUYA 4JUFA 5CPBA 1UDAA 5SYMA 1A9ZA 4LNAA 3QX3A 2X1LA 3U31A 4CHTA 1E6EA 1XRSB 4EJFA 3LTEA 3DCJA 5J1TB 2K4MA 1PNVA 1LFDB 3I9V1 3IHTA 5L6LB 2HBRA 2HK8A 3D8TA 3KM0A 4Q02A 4L22A 3D3EA 5FWYA 3ROTA 2NACA 2QZPA 3IBSA 3WHKA 2Y1KA 3MC1A 5HILA 2PS1A 3LPMA 3VGJA 3VV2A 2OV6A 3LOPA 4WQMA 5AKXA 4N3GA 3NHSA 1AQLA 1F4LA 1NMXA 1KU0A 3OMLA 4TVBA 4CKBB 1FY2A 4G0NA 5AJUA 5JWHA 4OKSA 4PC1A 3JD2A 1ZIDA 2H9AA 5FNVB 1VYVA 4YRMA 4Z7JA 4RQBA 2BGKA 4YECA 2FK8A 1KJZA 1REQA 4CJXA 4P5PA 3RGGA 2V65A 1E20A 2FWMX 3F4BA 3DB2A 5THQA 3SD7A 3F2VA 3Q0IA 3UGQA 3ZDXB 3KYDA 1TVKA 3RRYA 3EEBA 1E6KA 2NVBA 1M8FA 2W2KB 4XQCA 2WJPA 2OV3A 3OF2A 3F0TA 4BBJA 4P35A 3DZHA 1K66A 3S2YA 1A9XB 1OYOA 4FVTA 2C1ZA 1N5JA 4JY7A 2WU3A 4IVRA 3ZY2A 4ROTA 2YNMC 1J39A 5AVYA 2VF7A 4XQEA 1VPDA 3PDHA 5CBPB 5F51A 1PFVA 3HCDA 2QNBA 5AW7A 3D3WB 5HK8A 4UATA 4RCYA 4F7DA 5IULC 1XVTA 3T7TA 2QLMA 4JBIA 4BNNA 4ZDKA 2AVNA 1JG3A 2WJ4A 3ED1A 1NI4B 3DE4X 3AHIA 4ZHQB 3L06A 1VXOA 4DLLA 5BW5A 4FKBA 4NCJA 2GKGA 2XZDA 1Q7RA 3B7PA 5T4HA 5A4FS 4MLCA 1C7IA 1L7NA 2Y9MB 4Q1EA 1C80A 1JXMA 1E59A 2VP6A 4FN5A 5FFMA 4BJ5A 1HDGO 1UKZA 1H05A 2J85A 2RHWA 2W2LD 4X3PA 4YV2A 3FAKA 4QYIA 3NLLA 2PS0A 5K0GA 2C88A 2FB9A 3BL8A 2MYTA 4MDFA 1MO6A 2XB2A 4G36A 3O2JA 4IDDA 5H9WA 3ZDRA 2M1XA 3EG9B 4DZRA 3GVIA 3OSZA 3P0IA 1LF5A 3GXBA 3QLUA 1UKCA 3BKXA 2I9PA 1O08A 3USES 4YACA 3O0DA 3CH4B 5HCNA 3WO1A 4ZCSA 1WLSA 3KV3O 1D8AA 3QSGA 3FHOA 4J0GA 4YYEA 2WD7B 2R48A 1NVMB 2XUHA 1J9ZA 1XTTA 4GKBA 1PNTA 3NBXX 4P82A 3R9IA 5FBLB 1WXHA 1N75A 1SD2A 2XT0A 3TL2A 4UQLA 5K5EA 3KKLA 1F5NA 1Z5NA 2QJFA 3E18A 3P1JA 3L6DA 3MWJA 4DQXA 2KB0A 2ZZKA 3CLRC 4AMUA 4L50A 1R88A 2RGGA 4ENVA 2IY8A 1T3SA 1MXFA 1QZZA 3R7WA 4TSFD 4P2GA 3VR4A 4MUJA 1UUFA 3UICA 2WFLB 4CL2A 3GP3A 3OOHA 1NQ5A 2PXHA 4URYR 2FJ0A 1TZJA 1TNDA 2BJWA 4MS3A 4RORA 3S44A 3VR2A 3ES9A 1H3FA 3FTNA 4G9EA 1SXGA 3AONB 3FF1A 4R1QA 4RF4A 2BGIA 3HV2A 4PQRA 3TLMA 1IULA 3K6RA 1TYZA 5AVTA 3RUHA 3D64A 1GR1A 4Y2TA 4Z7NB 5A4DA 4TYNA 3UT6A 3DA8A 4DG5A 1ECJA 3TTWA 5HPYB 2CK3D 2VJNA 4IKPA 1AXEA 1D2CA 4BVJA 1UQUA 3FY4A 2V6BA 4LHEA 3CWQA 5EP3A 4CCYA 5KNBD 1JAHA 2ZBQA 1J42A 3ZQ4A 4M46A 1ZRSA 2J3MA 4PSUA 3EIXA 1JDTA 1W75A 3V9PA 2FPPA 3OFND 4DANA 3P97A 1NU6A 2EVWX 2D1SA 2PT6A 4WNAA 4LHZA 5SICE 3PDWA 2QVLA 2P65A 2W58A 1QYVA 1Z0AA 3QF4B 4A26A 4EHLA 5A6VA 4CETA 4JSYA 2EKPA 2W71A 2B3DA 2R3SA 4DIBA 1CRWG 1KH2A 2NTJA 1A9YA 1Y3DE 3P5SA 4KH1A 4R0VA 3T34A 1YVUA 2BMWA 1LB1B 2EIHA 1I4TD 3D4OA 3EZXA 1FXUA 1F2DA 4N12A 5AQ1A 1DU4A 1F4PA 1LBTA 1PR5A 2H1CA 3THRA 4BLWA 2FF7A 5D1NA 2XZTA 3A1UA 3RJZA 2H1RA 4IM7A 1RW4A 4FQ7A 1ULZA 2JFUA 4C14A 1X1SA 3JQ9A 1EFHA 4DR7B 2GSWA 4KACA 4AF7A 5DYTA 1ODIA 1SQ0A 3E05A 1BWQA 1Z8FA 3G9XA 1PJRA 2IJGX 2EFHB 5BSTA 1T1IA 2OVBA 1E9DA 3O5AA 1MAAA 4HAYA 4JJ7A 1H6DA 1G7RA 1W8DA 1UPBA 2FEAA 3C0KA 1XAHA 4FFOA 5TDHA 1CHNA 2JBWA 1QGYA 4HLQB 4PY2A 3F71A 2XAAA 1V3TA 3AUXA 2DFTA 2WSYB 3BF8A 3HJGA 4U2DA 4FE4A 4RTOA 1BC5A 4TS3A 1ZN2A 5JAQA 3RK0A 5AKYA 4QUDA 4GKJB 3IUYA 5IEJA 2H4YA 4YQZA 2XUQA 2W6CX 4RCVA 2JL1A 5LU9A 4GH5A 3HJFA 1GARA 1JKXA 1Z26A 1ZM7A 2ZULA 3H8VA 4HPXB 4F71A 4YAJA 3TSZA 2UXDB 4XX0A 1VI2A 1MB3A 2NTNA 3ISJA 4D99A 1O5TA 3F98A 3GCDA 4KFRA 1XZIA 3A0UA 3C8DA 4KX3A 4M9SA 4JFAA 4QYMA 5KSYA 2VH5R 1KY2A 5CIWA 4JJ6A 4D5EA 4K6FA 3E1GA 5HXAA 1ADBA 1O9GA 2X8BA 2H65A 3H2YA 2XQKA 1DBIA 3T38A 3AM5A 2OHIA 4Z2YA 4HYEA 5E6RA 1T15A 4NBUA 4CKCB 5FTLA 5JH7B 2CHFA 4P86A 3CN9A 4ETIA 3ECAA 3PXXA 3ZI4A 4GX1A 5K6TA 4GNKA 2EHDA 1VMDA 4OGLA 4YRJA 4TT3A 1RXCA 1US8A 2H2WA 3GYBA 4X3OA 4AROA 3PB3A 3QY9A 2EZ8A 2VEDA 1ECBA 4IFBA 3D43A 1SXJD 4HSGA 4Y2PA 2OP1A 1QC5B 1N6IA 4W9MC 4QQRA 5AUNB 4LBWA 1GTZA 4BN5A 1TQ6A 1YD7A 4FUQA 4ZQFA 4D57A 4EHJA 3ZLUA 3SOPA 3K1YA 2C57A 4G26A 4KDEA 3ZKWB 5KU1A 1HRKA 2NO1A 1OHHA 1K7EB 4CQLB 3RKRA 2OXEA 1TGVA 5K6RA 1NVTA 1OH6A 1P77A 2ZB8A 3IEKA 5A05A 4QRHA 1DUIA 2QN7A 1ZHHA 5IAJA 5U4QA 4C5AA 3TQRA 5JARA 1V5FA 3KSZO 3EHEA 4U3JB 3LA6A 3QPVA 3EYWA 2EOAA 1ISGA 4A0HA 1HE2A 5DOVA 4B4KA 5K05A 5IS2A 3PJRA 1JJ7A 1BWPA 2R1TA 2OKGA 3LUAA 2XECA 4O2BB 3T15A 4US1R 1PL6A 1YT5A 5CA0B 1DFGA 4UHEA 1AV7A 4F5ZA 3GJQA 3DAPA 4IV8A 3BQNB 3URMA 1V8DA 1L5FA 4NICA 3LBHA 1HSOA 3V3TA 2GEVA 1RT9A 4XYBA 3TQOA 1M2FA 3FPHA 4YAUA 2JJYA 4D4LA 2A1IA 4Z4FA 1GG9A 3Q7RA 1C2YA 1QV9A 4CQMA 1CRLA 3ONFA 1RC8A 3U3DA 2H7YA 2AS0A 1G6OA 1S8AA 4OBWA 2IXTA 1HFWA 3ZHOA 1WZCA 5LP6A 1EFTA 4BN0A 4G0OA 4KWEA 3DL4A 4WXRA 1QX3A 2P0AA 5AYVA 2R84A 2HJWA 2LRHA 4KIJA 3NGLA 2XUKA 3QKSB 4P2BA 3KOWA 2WP8J 5DGTA 4MAMA 4CF6A 1OVGA 4D3YA 5BVGB 1GU1A 4DRYA 2CLKB 4R3WA 3DL0A 4PV7A 3H5OA 4WD3A 4CM1A 1U0JA 1U1IA 1A50B 2GCEA 3TXAA 1N6KA 4TX1A 3RSLA 2XVZA 2WWYA 1YTUA 2IU4A 1NOKA 1ZH2A 3R24A 5CLLA 3C4QA 1XJCA 1ZISA 1S5PA 5AM5A 5EG5A 2O8EB 4RDHA 4KTVE 5HKOA 3AK4A 4W5RA 2Z09A 3DBOB 1ZNQO 4UZEA 1PX0A 1X2EA 4JLMA 3CNOA 3LGAA 4LE0A 4CF5A 5KJ6A 3U61B 3RT1A 3WGQA 1U0BB 1UC4B 3L4BC 2IYUA 3GH3A 1E62A 3OCJA 4RCZA 3RJMA 3MSCA 3UGTA 3STWA 3DCIA 4UFPA 5HGXA 3MNFA 4JLWA 4PSCA 1M8GA 1XTJA 4JBYA 4HGNA 4N7RA 3ZVRA 4I2NA 5K6AC 3X1YA 4V0ME 2Y68A 3G6WA 4NESA 2AG6A 3H18A 3PC7A 4XH9B 1NMYA 1F48A 1RYZA 1PJQA 2ISQA 4OLFA 4EATA 6ADHA 1ABBA 1WXXA 3IIJA 1IL0A 4FYJA 4JITA 4BGDA 4KI7A 4X93A 2C96A 4EG0A 3X2FA 2ZSAA 3R4CA 1EXVA 4F2DA 1XRJA 2C7QA 3SG0A 3ZUGA 2ZYRA 1AKMA 2P79A 4NPAA 4MP6A 4QGBA 4IH1A 3L0PA 3PRJA 2IS6A 1U1DA 4MVCA 2IYVA 3QJGA 4AULA 1QYRA 2I2DA 5IBRA 2RJ3A 3H3XA 2IX3A 1EWTA 1U8ZA 2PWAA 2OCGA 2BH2A 2DP4E 4JK3A 2IHZA 1WXWA 4K0RA 5EJ4A 3O92A 3VA7A 1OZAA 1Y6FA 5T57A 1Z28A 1S3GA 3SZOA 1EIWA 3SWWA 2C07A 1QHSA 3WI7A 1GSOA 3MB8A 5BMVB 1BKYA 3NV7A 4E5MA 2HQSA 2IPXA 4C0KA 3K8YA 2FFQA 5HUQA 1JE1A 2VF4X 3ILHA 3U3XA 2Q21A 3FHJA 4YAOA 4S0XA 4H1HA 2O8BB 3Q3JB 2GESA 5CJJA 3OQNA 4JUAA 2PKRA 1Y5NA 3WLNA 2KS6A 4YJ2B 4CM4B 1B76A 4BMVA 4DR5B 1BCRA 2QX8A 2Y2VA 3I73A 3AVTA 2VVTA 1XQ9A 1XTUA 4UCWA 1F2TB 1XTBA 4MCHA 2PGLA 1SG0A 1BDJA 1Y8CA 1SOWA 2EEPA 2FSSA 2OYSA 1MG0A 2TMGA 2X5OA 2Z5FA 5JFTA 5ITVA 2HCFA 2P9JA 2R7AA 4HF7A 2BDUA 1WXFA 2PZBA 4HDOB 3GO4A 5FX2A 2IHNA 3WYBA 3RYIB 3WYAA 2BFBB 2NPFA 3KQLA 1ENPA 3ESDA 5DN6A 3VAYA 4BNHA 3ESBA 1E1QD 1W8IA 1SHUX 3HN7A 3HBMA 1N6OA 2D06A 1EK6A 1GQSA 1HL7A 1KF0A 3LXMA 3MPOA 3A6ZA 3DC2A 1S9HA 1NW9B 2GAOA 1TJ5A 4KXMA 1CFZA 4ZIRA 1PKEA 2X86A 1WBJB 4KYTA 4XGRA 3RUFA 4HXEB 2WILA 3RG2A 1BNCA 3NT4A 3OX2A 3TOZA 3ZOZA 3RT7A 2A5LA 4EY6A 4BY9E 4L5BA 1A7JA 3UHFA 1AF7A 4U5QA 4C6HA 2EF1A 2VFAA 3O2SB 1T2AA 4JXXA 3CNLA 1QFXA 2QMHA 3KVYA 3TXXA 4E33A 4CKZA 4QNNA 2AJCA 4M21A 4TQ9A 1RCFA 1XMVA 2CDNA 1CR6A 2PUJA 3QF7A 4MLZA 1ODSA 3I8SA 4Q19A 2VQDA 1ONPA 5AHWA 3UWMA 3U39A 3FKJA 3IR7A 1WXQA 2ASEA 2H18A 4M8KA 2JAXA 4N40A 2B1GA 4B1FA 2Z3ZA 3DKPA 3OE4A 3HVHA 3O4JA 4KXUA 2QTHA 1PFQA 2JH8A 5HF5A 4L2IA 3DHVA 1DKOA 3PJEA 1ZU5A 4EB6B 2CNNA 4K9QA 4TN5A 3ZV6A 3K70C 3M3HA 4JLKA 4K1XA 1ORVA 3MRSA 1GXSB 3FTEA 3UJCA 4MQ5A 1QH8B 2WM2A 2NAFA 1CLEA 1SUAA 2HFJA 2PEYA 3QU9A 2ZJ2A 5K51A 3PLNA 2HYIC 3DOCA 3MYRA 3DOFA 3PNPA 3SI7A 4ER5A 3NORA 3NVKI 3RTEA 4WN9A 2YFQA 1U4OA 2IDKA 3DFMA 1VECA 3GIDA 2PRKA 1OXXK 2ZIZA 1XNJA 1VRWA 3SIRA 3WZLA 3DF7A 2YZ2A 1M10A 4G5FA 1MB9A 1PU2A 3IAXA 1W76A 4LI0A 3VKWA 3P0FA 3JAWA 2OTCA 1JWBB 3B9PA 1XDSA 4JUCA 2DZDA 1BD3A 3PICA 4G5YA 4U6NA 4ARVA 2EC5A 3G85A 2ZCJA 4CEJB 4U6QA 1RC1A 1RWNA 4HDNB 1E1NA 1L5YA 1Y1KE 2VJYA 3E7WA 4KPGA 5DCLA 1F9AA 5EKUA 4HYTA 1I7PA 4TWAA 4Z4GA 4GMGA 4QQKA 2IYRA 2XVYA 3OJFA 4RJLA 3SAJA 4F11A 4PLFA 2C4KA 1K7YA 4LIPD 5CCDA 5LP6F 2XCLA 1IHDA 2OHJA 5IMBA 2CSUA 3FRIA 3Q6IA 1YNSA 3OA0A 1BWSA 3LX4A 4LXUA 4R68A 3O21A 3DJFA 1RAIA 3ND9A 4UXJA 4F3KA 4KREA 1C8VB 3A11A 1UDCA 3UQZA 2XRYA 3PKJA 3VVMA 4RDIA 3RGWS 1HT0A 3E9CA 3C3EA 3LFHA 1GCOA 1KPHA 3MS7A 2O2ZA 3WB1A 3X1DA 3ULKA 4PU0A 4NTZA 4Y9TA 3VTFA 2YDYA 3NATA 3QWHA 4I46A 4FT4A 1G7TA 2GMWA 1A2OA 3WG9A 4R3UC 4MQUA 4AS2A 1BMFD 3DAFA 2QBYA 2AOUA 4TWBA 4B0PA 3ANXA 4ZZ1A 3AEUA 4ETWA 1ZI6A 4I8XA 2IQ5A 4G41A 1JHZA 4OU4A 4P4GA 4DIUA 3BRCA 2PY6A 3B9RA 2HT6A 1EP9A 4EHAA 5FUVA 4BVBA 5DHUA 5JNVA 5KU7A 3BH6A 1MO4A 2AR0A 2WG0A 1ZNWA 1CDOA 4EG5A 5F2OA 2X0DA 2ZRAA 1EBBA 5L4LA 4EW1A 1SOAA 1P7PA 2GVNA 3PHCA 4UHKA 1QIHA 5K0CA 2B61A 2P3LA 2XH8A 3KLMX 3VHXA 1R0ZA 1WL8A 2AR7A 2RBKA 1W1UA 4QOSA 3SJAA 1YAJA 4MMYB 2O1EA 2FPGA 1V7PC 2R44A 1M34E 1SWVA 4UDXX 4X95A 3RTCA 1PL0A 3VNAA 1E77A 4ICIA 2FVYA 5AK3A 8LDHA 2PLRA 3IUMA 4PLGA 3I28A 4PNHA 4RVFA 4Q4HB 2ZTHA 1PNRA 2GTHA 1EZZA 2VJQA 4M7RA 3K94A 3KJQA 1V96A 2F9FA 1CNEA 2IDMA 1RM4A 1AK1A 3GQBB 3SR4A 2BR3A 1ZH0A 5CFMA 1MKYA 5KAMA 2O8DA 2LDXA 5ALNA 4YRBA 1JEYB 1Z2NX 4EYQA 3B1WA 2A1TR 1CUDA 3T1VA 1J8DA 5KI6A 1GTMA 1GNTA 3D7RA 3RO7A 4BMOB 2GZMA 2NTEA 4UTXA 1TGYA 4YNBA 1QB7A 4KQ9A 3DNMA 3T9CA 5LQMA 1TZBA 3WLEA 2ZXFA 4RMHA 3NHYA 2VYCA 1EFPB 1UFKA 2R0QC 3MQFA 3WNQA 1QVRA 2OGZA 4HFNA 4YAWA 3GRAA 3U37A 1CQXA 3BFPA 4BVFA 3C3BA 2NADA 1GNSA 2RB4A 3EEQA 3DZCA 4FWIB 2AH5A 2GLXA 1DMRA 1T0BA 4NR0A 3JYPA 3MERA 4M9UA 5B2EA 2C92A 3IIKA 5HUHA 2D00A 2RGYA 3DDZX 2PZKA 3OF3A 3PDIB 4NYMR 1TMOA 1DV1A 1JECA 2O6HA 2FWRA 2NPOA 3LCJA 5FNVA 3V7NA 1X3LA 2RI6A 4DPLA 4N65A 1JAXA 1YR6A 3OZWA 1H93A 3OF5A 4EI7A 3R5JA 2IY7A 4RH0A 2ZETA 9GPBA 1XBTA 1TXGA 2D0OB 4HUTA 1XNRB 2XPCA 1DG3A 3CLRD 2OY0A 2CVFA 3M2TA 4H31A 4RX1A 5IF9A 1A77A 2A1UB 1FPMA 1OBFO 5CH3A 5EJ9A 1A9XA 4C4PA 2GXUA 1U2TA 2JAWA 1KVUA 2QROA 1SU8A 3G0BA 1C8BA 1SIWA 2WDZA 4H3HB 4J07A 1A8SA 1TIBA 3KZXA 4JVSB 4C88A 3AVYA 1SHJA 1DXYA 5CBPA 1PV1A 3IUPA 1SKMA 5LMUB 1NM5A 2Q4EA 1K3FA 4B46A 3TG2A 1X1EA 3G0IA 4HAXA 3UXYA 1Y9DA 4NPHA 5FPYA 1W44A 4S0ZA 1Q1EA 2O3RA 2TS1A 1YA8A 4L1KA 2VCYA 2XWBF 3DULA 3KJXA 3NONA 4RY2A 3UMYA 4LGMA 2OBNA 5AHRA 1EWRA 2PUEA 2YZ7A 3RFUA 1YMQA 2V0CA 1DBWA 2B4TO 4R69A 3LP6A 2N1BA 2JFXA 1VSQA 3SOZA 5FFFA 2LWIA 2BKVA 3AESB 4IO1A 2MSDB 2REBA 4BMYA 5KTTA 1D0SA 1H3NA 3DMTC 3LYUA 3PC4A 4HK4A 1KMHA 2XQFA 5TVGA 3HABA 3AU9A 3QELB 3DLCA 3EG9A 3IBCA 5TQ2B 4M7OA 2FMUA 3KTFA 1JGTA 1CVLA 2H0QA 3L6OO 5JZVA 1KGDA 4O4JF 1GPKA 1IK6A 2PNFA 5JE8A 1M2KA 1SHKA 4ZOCA 2Q5EA 4S2UA 5LQDA 2W9XA 3P9SA 1DB3A 1NI5A 2WJGA 3GP5A 2VJPA 3ILXA 5CXUA 3OI7A 4MKZA 1HNWB 3G2LA 3FLMA 3M0EA 1G8KA 2X5KO 3I92A 3R7NA 3TECE 4CR7A 1U2DA 4RIFA 5FXMA 1XMSA 1GU7A 2RK4A 2G6BA 1JKFA 1LGYA 1U8CB 1QSGA 1AXGA 2E1PA 4KUGA 4YYZA 5B1YA 3IRUA 2AFRA 1R9MA 3RK1A 1O94A 2O05A 5LWQA 4DSAA 3NKLA 3LVFO 2MU1A 3RVLA 2XUOA 4MWBA 4JBXA 4OUDA 4BQIA 5CDUA 1PJLA 4FYPA 2CKDA 2GD6A 1WKVA 3LSYA 4DVJA 1YRHA 3QLUC 3U4QB 2ES4A 3NAMA 1SUDA 1OD6A 5I4KA 2OM2A 3LHSA 2CBGA 3SYTA 4AG5A 1G9SA 4LVOA 5JCXA 1CRPA 3L7KA 2FPRA 3I58A 3ZLBA 3UV7A 3QE2A 1P4RA 1T6NA 2FWAA 3QQ5A 3AR9A 4GX5A 3ZE0B 2XB9A 3ESXA 3IXLA 3TLCA 4TM8A 3C3MA 3PPXA 2FUCA 4EI8A 4CL0A 3ZDYB 3KU1A 1E98A 1W29A 2JIZA 3A1CA 1QKKA 1ZLXA 4I5EA 5GJVC 3BA6A 4TTTS 1B43A 3UO8B 4M9XA 3B12A 2VPQA 1G21B 1R8QA 3TJMA 3DBLA 4B87A 3U3OA 2ST1A 2FWIA 1L1FA 1EM8A 1DINA 1O6FA 3X3HA 4OQEA 4UEJA 4UOQA 2ZSJA 3VRHA 3QPAA 4BOYA 5K01A 1T8WA 1NJ5A 2VSOA 4K9MA 1N6PA 1SXJE 1MGPA 4NU5A 4PYRA 3O4FA 3F7OA 3K0KA 3QXHA 1Z83A 2HEIA 2QYOA 2Y1OA 3A6LA 1ZD1A 5LBTA 1E9BA 2NO7A 1DI0A 1LQUA 4E4YA 2JJMA 3BTVA 4LOLA 1NJSA 4PR3A 3AF6A 5JT1A 3IO5A 3ONWA 3ROKA 2IZZA 1MTZA 1V5GA 4BMXA 2OFFA 4BUCA 4ENWA 4Z4EA 1IEWA 1N2BA 3AHGA 1BS2A 1W19A 2O3QA 2UZAA 3TM4A 1N32B 3SKVA 2ZBEA 1A4UA 1B00A 1NU8A 1AZSC 1FFWA 1EU1A 2X8AA 2BI7A 3D59A 3MIZA 1SIOA 5DZSA 3C3CA 4N6OA 3ESYA 3WMEA 1FU7A 4C0HA 2X15A 1UADA 2YHIA 2GJ9A 2NU9B 3T5DA 3N6XA 1RXVA 2PS9A 3PQ6A 3KB8A 3TQQA 4E7OA 2CJWA 3D9QX 2IXDA 2XODA 3R3ZA 4D41A 1WULS 3MAJA 4L15A 5IAKA 1ZIYA 3ON5A 4CE6A 2ZI4A 3INRA 1QP8A 3GCZA 3I64A 1ECLA 1R66A 3P5BA 4KQXA 4LGYA 4WX2B 4HVLA 2EGUA 1EGAA 3U1TA 2VAVA 3V8EA 1MAWA 4OK3A 1VJCA 1XZQA 2ENWA 1PFYA 2GBPA 2UVDA 3C3DA 5FULA 1ZNZA 1JXQA 1YDHA 1ATZA 3OP1A 2P6OA 2HR1A 4FDMA 5BWOA 3W6NA 2Q9AA 3JQ9C 2XMCA 4D82A 4MYHA 3ABQB 4BKQA 1Z2PX 2QUAA 3B36A 3BMOA 2O8FB 2R11A 4M98A 2MSKA 2V7QA 2CVHA 1L5WA 1ZVMA 2X7HA 4BB5A 1UPUA 4HBGA 4ZT3A 3N2GA 3QKWA 1JSCA 2FW8A 5DU2A 1JEEA 1SRRA 4JKYA 2C8VA 1N9ZA 4R8LA 5TQ0A 4WY8A 5JH7A 2G67A 3PGA1 1VJTA 5C1DA 4LXYA 3V4FA 5BXYA 2RARA 3JQAD 3C3WA 2JCYA 4M53A 3I1IA 1VSUA 4C22A 4Z86A 3LPLA 3BRWA 2BTQB 1NAIA 2D5BA 2YQ4A 1ZK2A 3F73A 5E3JA 5L40A 5H3CA 4JVOA 1QC5A 1MO3A 1PHRA 2DY0A 5K0LA 1Z06A 5U1PA 3CEJA 1E5XA 4HGRA 1D09A 3SEAA 5KTYA 1NLFA 2ZANA 3AZOA 2RGNA 5COQA 5KSZA 5KYNA 3EXG2 3P9XA 2JGAA 3HBLA 2BBTA 2BEVB 5EA2A 3WIOA 2JGDA 2PL3A 1XVIA 4WOCA 1CB0A 2IVZA 3GG9A 3LLVA 4CQLA 4M7PA 2NZJA 1L7VC 4LMPA 1DGQA 2QTGA 5C0OE 2CUNA 2PD6A 3PE4A 3TDMA 5BSVA 5AW3A 3HG7A 1EVQA 2WKPA 2Q5OA 2CMKA 3WGNA 1P80A 4UUAA 4OYHA 4QPJC 4U3JA 2F1IA 3F6YA 1D7OA 5BUCA 4OGGA 1G9XA 3C2QA 4RA9B 5DO9A 1BH6A 4O2BA 4AY2A 5JZBA 4OOEA 1EJBA 3TPFA 3A31A 3SF0A 4JYMA 2R85A 3PFNA 3AZPA 2CDAA 1GLVA 3JAMA 2A0YA 3HWX1 1NAHA 1QCCA 1VHTA 2IK8A 2XEDA 2ZI6A 3A70A 3QVGB 4OM7A 4G25A 4R1OA 4RENA 3L6RA 3WLSA 4F85A 4JB3A 4B8WA 1YDGA 4GEKA 3RROA 3KE8A 5CW1A 1Q0ZA 1C1XA 4L5CA 2JNWA 3QG1A 4KPEC 2E85A 3LOUA 3QW2A 3QK7A 2ZB4A 1W94A 3NB0A 4C7BA 5BWMA 1ZXLA 1MGOA 1SOUA 1GN9A 4YROA 1I0LA 1GGEA 5B37A 3CW9A 4M0EA 3RYHA 3KQKA 5C5DA 2PTHA 3UQYS 2DWPA 4PTZA 1L9KA 1H2BA 1LNQA 2PIAA 1L5SA 3DPIA 3QKSA 4MPTA 3ER8A 4L73A 3EVZA 4WKPA 3BJIC 2PG3A 3KDPA 1C5KA 2OCAA 4II7A 2B5WA 5NULA 1NSTA 1OC2A 3FYUC 1E63A 2C1XA 4JLDA 1ZJYA 4S1NA 5GPBA 4ZT6A 1FFXB 5A0FA 3UY4A 1EESA 3K9CA 2JIQA 2IYFA 4B6EA 3OZFA 3UFXB 3RVQA 1TUIA 4F6RA 5A3QA 2C4MA 4C9BA 2BP7B 3WYEA 4XA8A 5LBUA 3TZKA 3ZWBA 1GGJA 4GP6A 4D9IA 2EZUA 1ICEA 2O8EA 4D6PA 4UC0A 5F52A 1MB0A 3I3SR 3L02A 5LP6C 2GK7A 4IF6A 5DGCA 1NQXA 4ZFNA 3JRNA 5IBCA 4AJKA 1FLAA 3BD6A 1E18A 1G8FA 2B4KA 1M8PA 1FVHA 4FMCB 2Y1GA 3GPIA 4BTLA 1J2JA 2E3JA 3CZRA 2YINC 3BWXA 3FH0A 3OC0A 4YX9A 3ZI0A 3T9BA 2DRIA 3BGDA 4RZUA 3VNRA 4QU0A 3WWOA 2XWPA 1N2CA 2D8MA 3EASA 3ZEIA 1U2PA 1P81A 2MYNA 2WY2D 3KQNA 2CWDA 1OYWA 3KKKA 2YW9A 2HHJA 3PF9A 5CGZA 4DWVA 5JI2E 5KCZA 5A1JA 3VU9B 2HIHA 2VH1A 2Y0EA 4M0PA 4MUKA 4E31A 3ANNA 1EP2B 1J70A 1JU9A 3GU3A 1ZI8A 1OFHA 3C41J 5F2EA 4ZI5A 1NKTA 1TCAA 3RV4A 3RFFA 4OUKX 3QI2A 2GCOB 2NUTB 5H81A 3QZUA 1AGRA 1SVWA 2P4UA 4LF7B 1C3JA 5AXAA 1CWUA 2AZXA 3Q2KA 1CFJA 4FD2A 2E89A 2HUNA 3N8GA 3DNFA 2H2IA 1Z0DA 3OD1A 1EG7A 4IHKA 1E2KA 1PUJA 1XZFA 5FT9A 4KQJA 3ZD9A 2Z0MA 1WSBA 1VPEA 1U0OC 4GC5A 2OC4A 4NOLA 5BMVA 4JLOA 3RC3A 3BEDA 2F2TA 3MCAA 4W6ZA 1YRWA 3GJ3A 2ATVA 2ZBUA 3D02A 3QE3A 1MB2A 1T24A 3IQDB 4G4SO 2DETA 2NVUA 3C7KA 3LM8A 4FDVA 3BIJA 4JLAA 4JXJA 1OWOA 4KU4A 1P7CA 4DNXA 5JS1A 3VMMA 2O8BA 4Y9RA 1BAPA 1HURA 2HA4A 4MV8A 4WFKA 3COYA 4UAVA 4YJFB 4YJ2A 2IH5A 5LL6P 5JYDA 2FMTA 4C7VA 2XB6A 1GUDA 1GZHB 2WR8A 2C04A 4GLJA 1VPWA 2ZGVA 2WB4A 2IKQA 4FNMA 5DI3A 1F2TA 1X7YB 1Z5GA 3GFSA 3RWMB 1UT5A 1PNQA 1K4MA 5ENVA 4B8YA 4LCEA 4H15A 3V7FA 2PQ2A 4LHVA 4MCAA 2YMPA 1PFGA 2YUTA 2QX6A 3C1OA 1TOAA 3QFCA 4Z8YA 3WHIA 1OXVA 4O4IB 4B4OA 2EATA 3QXJA 4ISCA 1Y4UA 4JQOA 4FR2A 3RYIA 4WXMA 2ZRCA 4AYXA 4I5FA 4MUMA 2HWXA 2ZI5A 4AXBA 4DMLA 5KO2A 4M1MA 3WVNA 3AJRA 4JWTA 1VKRA 4FPXA 3THXB 1GV1A 3KOZA 3WL5A 1RYNA 2CXQA 3ZE7A 1JSXA 1S3SA 1SG6A 4JGIA 1I5RA 2F00A 4F5WA 1ZRMA 4LCBA 2JIPA 5H1YA 1XYVA 4RXUA 1J49A 3SHFA 1USGA 3GLGA 1CY8A 3I76A 4MPRA 3CUEF 1Z6GA 4QPZA 1TJYA 3QKTA 5JH7F 2LUOA 3T95A 3PQ2A 4CF7A 3NEYA 4TN1A 1QP0A 1MF7A 3NDPA 1MJGA 2CF6A 3Q3IA 3FIJA 3A9TA 2F3RA 4MIOA 4NAUA 1WEHA 1V6CA 4GVXA 3WL7A 2XSZD 1JEQA 3EGEA 3PRKE 4LWOA 3H5NA 3FOWA 1XCGB 4UAUA 4JKIA 3W5CA 3OEYA 2HHHB 1N2HA 1SZJG 4LY9A 4TL8A 1K06A 1XCBA 1XGKA 4U7PB 1AUQA 1DAIA 1QGUA 1OX6A 2W2TA 1VSTA 3FZGA 3Q9UA 4JEIA 1AZTA 1ZONA 2VJOA 4NC9A 3IKTA 3P52A 1WVGA 1QR2A 1BHQ1 1Q14A 1JDSA 1Q1AA 1L7RA 3KVRA 2AJTA 1H4VB 2BH9A 2YL2A 2XUZA 1P9NA 3QFTA 1D6NA 3RRJA 5IF3A 5JAIA 5MF6A 1T2EA 2B98A 3DXYA 1GXSA 1LPPA 3DUFA 1A4IA 1NXXA 1QH8A 2OXCA 3KPJA 4RGQA 3MCVA 4F4UA 121PA 5TF4A 5BSHA 5KINB 8ABPA 4Y2JA 4KVFA 3VR0A 3QX8A 1NN1A 1P0CA 4HB3A 1T8UA 2VUTA 3RS4A 1H2WA 4HC4A 2C3PA 5EJGA 3NEPX 3LDAA 2LPMA 4P53A 1XRQA 4HNAB 3ZTWA 1H8EA 1SU7A 2IRWA 2IYXA 1NQTA 1P6UA 3EBPA 1MW8X 1SVUA 4H3KB 5JCZA 2CD7A 1YIAA 1QG4A 4FKZA 3TTUA 1O77A 1NFRA 1Z39A 1UJCA 3GFGA 1C50A 2RAPA 4G0WA 4JC5A 1GAQA 4WERA 4I3HA 5AW6A 5KKCA 2R8PA 1ENZA 4N9QA 4D44A 4KJZA 4DLTA 3IIEA 4CEJA 3ND6A 2HX1A 1FYEA 1SG9A 3KT6A 3P9CA 1UBLS 1TQDA 3UK6A 1I4DD 2G25A 2OVFA 3ZIAD 4CBVA 1LK0A 1R00A 2I4MA 2QU8A 2VDWB 1J5XA 3OH8A 4IICA 4LMAA 5GGXA 3RVSA 4BWYA 4KRFA 1P6XA 4M22A 3KSUA 3EZ2A 1HWYA 1U5BB 2FW9A 2YV1A 3TOSA 5IJ0A 5IZCA 4G1VA 4LJ6A 1SCQA 2WNIA 4NE9A 3DDSA 4LCJA 3PL1A 4MVJM 4D8TA 3MTEA 1NJ2A 3E2MA 4IJKA 4KQMA 2YJ6A 1U11A 2MDTA 5FAKA 4S1OA 4IDNA 4WFIA 1XXHB 4XDZA 1U3DA 3NHRA 3VU0A 4U0KA 4YRPA 3ABOB 2YN2A 2PMWB 2QL9A 3K1AB 4D81A 2HV9A 2HBYA 5EIOA 3WO0A 1H2XA 2WG2A 4EGAA 1L5LA 1QH1A 1B4DA 3OT1B 2J48A 5JDCA 4EG1A 4JUIA 2AUMA 3ZHVA 2WIJA 3GARA 5K2MA 4TT8A 4RD6A 1U7TA 2H3HA 4M0DA 4PGGA 2ZU6A 5LZ8A 4BO7A 2WM3A 4BVKA 1FDUA 2UU9B 3AI2A 1CG6A 4FEEA 4FGWA 2C2HA 2PX5A 1M2HA 4MVWA 1RXYA 3P27A 4Q3AA 2XJ9A 1TTPB 2TMKA 4X54A 2H4FA 1KI9A 4LV6A 1I2DA 1TC1A 1NR1A 3KCQA 3OTWA 3P9IA 4BGIA 1P60A 1VA4A 2FETA 2OXFA 3O8NA 3NHUA 3FYTA 2BMEA 1VQ1A 4R8KA 4J9VA 4IXWA 5K8CA 4DV7B 3AEKA 2BCJQ 4GIBA 4GL4A 3UXMA 1N77A 4RDXA 1LEHA 3H8WA 1DRJA 3NC0C 4AJ9A 2FPLA 5G0SA 2B0CA 3D6TB 3ZLTA 4Q4HA 1SHTX 5HOQA 2OBXA 1LDYA 1T9AA 5DE3A 1BJRE 3OJ0A 2FSHA 3QTBA 3B5IA 4CI0B 3QE9Y 2HSEA 2OZPA 4QULA 1EFDN 4KN5A 4TKLA 3W2GA 4PC6A 3L8GA 2GEDA 1LBEA 4NFHA 3E35A 2QY9A 1JEYA 3GZTB 2PSJA 2YVKA 3BE8A 1KYIA 3KJNA 3WIBA 4E3WA 3KSBC 1ZGAA 2BM9A 2G7ZA 3AOEA 2CFIA 1FPQA 5K3BA 2A1TS 1GZUA 1YH3A 1TEXA 1UKEA 2BE9A 5T64A 1E1MA 1P0FA 3RU3A 4ZP1A 2A58A 3GGOA 2QQEA 3IAM1 1EFPA 3A1FA 2YKGA 4PHTA 3F9IA 1EX7A 1HLPA 5BMVF 3MHTA 5I3CA 1BQ3A 2XE8A 1M0EA 2JCSA 1CVRA 4OSEA 4H08A 4R7ZA 1GL9B 3PA6A 2VYVD 5BNZA 3OHPA 5EJ2A 5B2ZA 5FIUA 4I4NA 3U7RA 4EFDA 4NEGA 4NENB 4YJ2F 3I5AA 2C3UA 1QU2A 1NZDA 4MITA 1EWQA 1P9LA 3IT3A 1ADFA 1WW2A 1R5BA 3UJAA 2XKAA 3NZEA 2ZJ1A 3H5VA 1UBJS 1AMUA 1GL7A 2Q0SA 1RAEA 1GPMA 1N36B 3FMIA 3PGJA 3O84A 4PIPA 1Z07A 2E6KA 2GZHA 4QQ8A 4N76A 3MGBA 4RA6A 2A9VA 5B4VA 4KPFC 1X14A 2XKKA 2K7ZA 3UUEA 4GAEA 4BJ6A 4YRKA 3EXHB 2VXOA 2OK7A 1XTZA 3BIWA 3DOEA 4CMHA 2BC9A 1JJVA 1U3TA 1MBZA 4AJ4A 5T7BA 3CRW1 2V3CC 3T7IA 3UFBA 2RJOA 2NW6A 1U4NA 4KYIB 3KXKA 4DZTA 4EMBA 5FWXB 4LF5B 1KKMA 5KB3A 3AHDA 3FGZA 5DM60 3DSRA 3GH1A 1J07A 2R8EA 2FJUA 3EWIA 2HQRA 4ZARA 5C52B 1M2GA 4XDYA 1DKMA 1EVLA 4HH4A 4I3FA 2WEKA 2ORWA 3WX0A 4HMQA 3ZY4A 4AF8A 1C41A 2UVQA 4QHSA 1YZFA 1RBMA 3M2PA 2OUIA 2IXAA 4GMHA 4DXHA 2Q2WA 1Y80A 3IAUA 2ZVPX 3NNNA 1LPOA 4TLMB 4H77A 5CK5A 3SS7X 2QA5A 2Z2XA 3HWWA 3RVPA 4E21A 4F8JA 1GGMA 3DMPA 1OXBB 5HF9A 4JJAA 3GWGA 5I8WA 1AH2A 1A98A 1JSLA 3B9BA 3CVUA 4KVGA 3GAMA 2ZYVX 4B75A 3HXQA 1A9RA 2J31A 3V34A 3UF0A 2WM8A 4EG7A 1ZKDA 2B1JA 3QELA 4MVJP 3HP4A 4TQGA 2FEXA 1ZUIA 4PFSA 1OJLA 1SK9A 4WH0A 5ALGA 5TQ2A 3R9KA 3D8SA 3TO5A 4EYKA 2ARKA 3WIVA 2WB2A 4K1LA 3ZD6A 3F6CA 3RRNA 3WAKA 3W7BA 5KYYB 4MK4A 3CRZA 4MAAA 3B48A 3CURA 1NM5C 5BO5A 2ZE6A 1AB6A 1DJLA 4ACBA 2F59A 5B36A 4AQYB 2RGXA 3CJTA 5IM4A 2C3OA 2OYRA 4BEJA 5E1BA 4L5JA 2NU8A 2PNJA 2W6QA 4C4AA 5F3WB 1IDOA 4A4DA 4BNFA 5D00A 1M2EA 3B3QA 5CXSA 4EOGA 5CDYA 4WUVA 2DH6A 2SHKA 1T35A 1E3WB 3K0BA 4EGJA 2F4VB 1EGVB 1FFAA 4N54A 1HDRA 3H9UA 3TQHA 5BORA 5I51A 2LIVA 4EW3A 4MB0A 1JX6A 3IX7A 1L8QA 2GASA 3PYLA 3DMFA 4GWLA 2Q50A 1JKIA 1KSHA 4HB0A 4WBNA 3WL6A 1YA6A 1WUYA 2OCDA 4L16A 1Y89A 3AYZB 4R2KA 3QKUA 1ZH8A 3KWFA 4MYSA 4ZGWA 3U4QA 3BEOA 2W98A 1F6DA 4RK7A 4YR9A 1ESZA 5IJ9B 2I6SA 2C8JA 1BYUA 4B79A 1I4LD 2X6TA 2YFYA 1VJRA 2BT4A 4J3JA 4QUBA 3VNVA 1DBRA 3G88A 3KVNA 2A5GA 4B7CA 3CUKA 4XFDA 5BW4A 1FIUA 3HU1A 3T99A 4XB6B 4IG4A 1Y1RA 2ZUFA 4DAEA 1Z2DA 4MYDA 3R9XB 2Q5IA 3IR5A 1NVGA 2GVDC 2QMQA 2Q6KA 2VJDA 4ZXPA 4DV5B 1G21A 2Y0CA 4IIEA 1P62B 4PZPA 4WEOA 2CB0A 1O94C 2DH5A 3NUZA 1G42A 1BU5A 4NJMA 2HXSA 4YMGA 4FW9A 2PKEA 3P9RA 1EWVA 2O7QA 4HEHA 4TLDA 2NYAA 1CS0B 4I19A 3SYNA 5K8TA 3HVUA 1SCNE 2PHZA 3DF9A 3N3AC 4I5GA 4ZVKA 1THZA 5C8YB 4II2A 1MHPA 1TMGE 3TZCA 3ZJUA 1OW3B 2FN9A 2Z56A 1H23A 1D6JA 1QJCA 3AFHA 3OY2A 2BGTA 2A5DA 5I47A 1QO7A 1WNTA 3H75A 3W3ZB 4KXWA 1WPQA 3L1VA 2BV3A 4GOND 4JT4A 2XRFA 2OP0A 5HIKA 1HQYE 5TNXA 1O5IA 1A5BB 1HQCA 1AKQA 1CUYA 1RBYA 3MHPA 1IK4A 1UBSB 4BP3A 3OOSA 2NO9A 3W1EA 4CLXA 4EX6A 1GUBA 4OI1A 1W5AA 1GLGA 2YYYA 3GUUA 4EK9A 4FOSA 4GX0A 3LPDA 3PXAA 1PI3A 5K03A 2NU9A 5DWDA 4KAAA 1ZIPA 2PDAA 5KX5B 5CFLA 1KDPA 3N0VA 2ZR8A 1TAHA 2G5PA 2R68A 3BD7A 1KO4A 3U19A 1VFPA 4HQKA 4IUCS 2Q49A 2WJAA 3HJHA 2X0KA 4TLBA 221PA 1RVDA 4IGEA 1CP3A 4TXMA 2PK3A 5KTRA 1XVVA 5K4AA 1U0SY 3C5EA 3TNDA 1R6XA 3QHQA 4FWTA 1QP7A 2CXRA 3EGOA 3QPUA 3U7JA 3W2FA 2PD3A 3TAUA 3VDMA 5AIAA 2OV2A 2A2ZA 5HQJA 1CY6A 3CVWA 1L6IA 1P8JA 2FPIB 3CRVA 4ZAGA 3ETHA 1IOZA 1E4EA 4EPVA 3VHLB 5JAPA 1AMOA 5ULLA 1DEAA 3NTQA 2I80A 3OIYA 2VQEB 1YC2A 2RHRA 1XZPA 1HYHA 2FRDA 3ETEA 4GPBA 4IV0A 3VOAA 3RWOA 5C7LO 1J2YA 3H1PA 1CF2O 1GCAA 3WLPA 4BUJA 1XZAA 4I9FA 1VC2A 1ZG3A 3HYRA 1WSAA 4A1FA 1ML4A 5D3KA 4EHFA 3W8RA 3JWGA 4B0OA 4RACA 1RXUA 4GS5A 3UBMA 2BTQA 2YWJA 1DOZA 2W6ZA 4ZQBA 3HKCA 1DKLA 1WPGA 2ZIWB 3OETA 5BNIA 3TMAA 1AS0A 2P8SA 3FGNA 1KSFX 1N0HA 5CT8A 1YCDA 3IVAA 3E9DA 4YI3A 2WWGA 1AKNA 2HCTA 3G17A 5EPUA 4CM5A 3H1GA 3HR8A 5AK0A 3HJUA 1W73A 4HRXA 3UKJA 4GOLD 5KOIA 1MEJA 2C4UA 2H4ZA 3I32A 3RSCA 1FJGB 2BEVA 2KWIA 3U2QA 4PYKA 1KC3A 1IJKA 4QXOA 1XI2A 5IDWA 3AI7A 5FBKA 3PTAA 4GYJA 3DKVA 1F8UA 2F4NA 5EZQA 1UZMA 4XJSA 1D2HA 1QAQA 2TMDA 4NQRA 3RTAA 4IJ5A 2XA9A 2QLLA 2OXIA 1DDIA 3TIGA 1CUFA 3A1WA 3ROFA 1O97C 1L4KA 3EDQA 4RVDA 4KIWA 1D4FA 3K35A 5CM9C 5FQOA 3RE1A 2CEAA 5A9SB 1QRSA 1GCIA 1YRYE 4EITA 1RE0A 3QVGA 1YCFA 7MDHA 4BXOB 4WT7A 1MRSA 4CM7A 4CDGA 1SZCA 4BASA 5D51S 2XUPA 3CZMA 3CQ9A 5IT9A 3CF0A 1EUYA 3DOOA 3BOSA 1Z7YA 4ZOBA 2VTVA 2H4JA 4ND2A 3N2KB 2X76A 3A6PC 2JLRA 5GIPE 4ZDWA 1TU4A 1VA5A 2H4XA 4G0UA 4DR4B 1ESDA 2C5GA 7MHTA 4QYSA 2ZYSA 2Y1CA 1A9QA 1VHWA 1AXRA 2Y77A 1JBEA 3KU4A 4D9KA 3PHHA 1L4MA 2GLTA 2HBQA 2BDTA 2VZLA 4FGUA 2OSVA 1C3EA 2XCUA 4JOCA 5IM4F 5K3SA 3RVMA 4CKEB 3ADCA 1PJSA 5K3CA 2QJRA 2VJBA 1TCCA 5ALTA 4ZYLA 1X8KA 2F3TA 1N92A 2P1ZA 2NO6A 4J1SA 5A03A 2Y4NA 1FYFA 2WC1A 1RJWA 1NBOA 3V4PB 3N75A 3LCRA 1H8HA 3NBKA 3ZGYA 4KVAA 1PT8A 3FOBA 4X1KB 3EWAA 2OLJA 3D5TA 2YTZA 4OATA 2BP7A 3AVQA 4S1VA 4YBZA 1GNPA 3SDBA 4E03A 1CK4A 3NTVA 1J5EB 5D6OA 2QUJA 4R8SA 3R77A 4WBNF 2O7SA 2JD2A 4AYTA 3ESQA 1CUZA 4BFUA 4UE3S 1OBVA 4MUNA 5JPIA 2CYCA 2OFPA 3B5EA 1HPLA 1SK8A 4L27A 1A4RA 2FHSA 3AF1A 3GD5A 1HA3A 4IDOA 4E1AA 4AZSA 5JNSA 1ZINA 1AVTA 1NV9A 3T54A 3CG0A 4NCKA 3V4OA 3NYIA 5GWXA 5IAGA 1QYIA 4OL0A 4FCWA 5JQGB 1EK0A 3TAXA 3U44B 4ZC1A 2P4QA 4RFLA 3D6HA 5AUPB 1T4GA 2HIGA 3G0HA 2YBEA 4ZODA 3VU9A 2CFSA 3VSAA 2QVYX 1L8AA 1CERA 2ZE7A 4FFNA 1G3RA 1LCIA 1ND6A 4FUTA 4JYCA 2VR1A 1EAYA 2DFVA 4JZYA 4XQ0A 1UCFA 2GCOA 2M6RA 4XGQA 2RIPA 2HMWA 1P5ZB 5K3AA 2Q8QA 4DEYA 1TF5A 1KFBB 2FSUA 4D26A 2R1VB 4NS1A 4OJKA 2XDQB 2NAPA 3EXIB 3S40A 1M7GA 1E32A 2FQWA 2I3BA 2Z08A 4BJHB 3OU7A 1IJEA 3VFDA 16PKA 2WU8A 2WWHA 2X13A 4OMCA 4OBBA 1D2RA 3EDMA 2HMTA 2OPHA 4LBVA 4AX8A 4BZQA 4DA9A 3OCXA 5B1SA 2UYHA 3REGA 4C6RA 4CT4B 1LBHA 4XJVA 1KAOA 5DK4A 4KGZA 3BMCB 5B6PA 1WW3A 3AFGA 3B8EA 1QZTA 4HN9A 4PBTA 1BMDA 4HX2A 2PZFA 3SYLA 4AN4A 2AI2A 2QWXA 3HZZA 1NC1A 4TGLA 1NG1A 5B1HA 2ZP1A 2CCJA 2Z1NA 4PZYA 4NBTA 3PEVA 2X19A 4MVJH 5CTAA 5FOWA 2FI1A 5C80A 3SSMA 5JJLA 1ODKA 1P9WA 2JZOA 4Q4DA 1C81A 3OC6A 5FBHA 3KXPA 1KIFA 1Z47A 5KSWB 1Z37A 3ICOA 5KYXA 2RGDA 1U6IA 2Z8ZA 3DVAA 4OTZA 3ICCA 4TYYA 1X7YA 2I6TA 1M54A 4NIMA 4JYPA 4HQ6A 4M60A 5DN9A 1LRLA 3C39A 1K86A 2DHCA 4AUMA 4AD8A 5I5EA 4BYMA 2IXEA 5IH7A 1RJFA 4IEEA 5JCJA 4QDKA 3UWDA 3VR6A 4CLRB 2R97A 1PO7A 3ZHBA 4KWIA 2KHZA 4G5SA 2AXQA 3FPBA 1JIUA 1QE3A 2C2WA 2VJLA 4E1BA 5JJBA 2C2MA 2HK6A 4MEBA 4O4LA 3THYA 1NPDA 1UXGA 3IOYA 5CLFA 2FUG6 3AT1A 3RAJA 4E15A 4CLHA 2RAFA 2I91A 2R4UA 4RTQA 4WHMA 3D4NA 1QQBA 5A1TA 4BKUA 3DV2A 4N5HX 4QC2A 4XPIB 3TFWA 3UC5A 4U7GA 4F93B 3OE7A 5DNDA 3R75A 3PEUA 3A1TA 1Q7GA 3QEKA 3SJZA 3VZCA 4B6QA 2OEPA 4IZIA 4DDHA 3ENVA 3OCWA 4B17A 3V42A 4XWTA 5E4YA 4BLUA 2BHLA 2V9CA 4F5YA 3G49A 3OMXA 2FSPA 2WV9A 1I9CA 4KK3A 2CHVA 4D9JA 2XF8A 4QARA 2OK8A 4ZAYA 4IKEA 1BXKA 3LHDA 2CD9A 2JGRA 3T4PA 1LTQA 2HFKA 2WPNA 3PITA 4Y2YA 2HW8A 3AVVA 2V54A 4GFDA 2GM9A 1GGNA 2OXTA 2CV0A 2WTBA 4YXWD 3DBVO 1C9DB 1NXPA 2ZDHA 3KYBA 4YR7A 5LUBA 4QO7A 3U17A 2P9BA 4K7JA 1TZKA 3CZ9A 2POQX 3D8UA 5BYKA 4D46A 1IJFA 4W4TA 3CLKA 3HA5A 5BSWA 2V7WA 4MV0A 2EQBA 1JG1A 5ELMA 1C1DB 1C7EA 1X0VA 1K8QA 2YJTD 1GFIA 2AEFA 1XZ8A 3GVHA 3FFWA 3T6KA 8OHMA 4I4LA 4RQTA 1P0IA 3AUFA 5D87A 3W8FA 3T5PA 4IGAA 3ZVNA 4WASA 3RJ9A 4JI8B 1JI0A 2VCEA 1HTBA 1EQAA 2ZRHA 3L7NA 5JRZA 3Q6MA 2HNAA 2NSLA 1LJUA 2AIRA 1RLIA 2DJIA 4IV5A 1N8SA 1IOLA 4R71A 2DCMA 1SUFA 3ADPA 1QTNA 3F4KA 1DQSA 1C9JA 2FUEA 4CXMA 4FLMA 1R6TA 4YJKA 5AI6A 4ZOAA 2HO5A 2O7VA 4J8PA 1ZK4A 2VO1A 2XMQA 5K3OA 5DH9A 1T5OA 2JFNA 3QPCA 1JQ3A 1U5BA 2IXGA 3AYXB 3HCCA 1ISIA 1ZITA 4LE2A 5SYAA 3DT9A 4D4HA 2PSFA 4DNPA 2IYWA 1N8KA 3QUCA 4KBYA 4MCIA 2WZCA 1VDZA 3KQOA 3QXGA 4GYYA 3IE2A 3WGHA 4E09A 2PM8A 4Q82A 2YY6A 1HNXB 4K6CA 1XXHA 2DPLA 1L7EA 3KAJA 2Y67A 4EHKA 3GVCA 3HPRA 5I6DA 3GPDG 5B53A 2ZITA 2FAXA 4YJGB 4CM9A 4IGFA 1IUOA 5FORA 3SZ3A 1Y1LA 3JALB 4YRIA 1E3SA 4J0FA 3VKGA 4QHYA 3K92A 3L93A 3KZMA 1S2GA 3LBFA 4XYEA 5BNTA 4L5IA 5EUQB 4DF3A 4AL4A 4RIHA 4Y2RA 4BFLA 4C20A 4U2BA 3NAQA 5EJ6A 4JJKA 4UJ3A 4G2NA 1FNMA 3A27A 4J7AA 5DHQA 4CU5A 1NUPA 1DC8A 2A5JA 4MQFB 5IZCC 1QK3A 2P1DA 4JH0A 4RAQA 2QRLA 4P3XA 1FP4A 3NGXA 4UXIA 1GQRA 3D3KA 4FMCF 3RYCB 3W3AA 1AQYA 1ZP6A 1DQNA 2EU8A 5G0TA 3KQUA 1E1KA 4RZQA 1X8JA 3VR5A 4G0YA 3R1IA 5PGMA 4D25A 1JFSA 3SEZA 2L2QA 3RSOA 1AURA 3B3AA 4JLSA 1NW3A 5AESA 4MXDA 3FZNA 1JA1A 4IIJB 3A36A 5KS2A 5AVJA 3KPVA 1RI4A 1NVFA 1QHIA 2YVLA 1S2DA 4QSMA 1CSEE 3UKOA 1J97A 3HL0A 1U3UA 4F3TA 1H85A 2E0IA 4HADA 1XVAA 2XE4A 3OESA 2HLHA 2AXNA 1Z74A 1A0OA 3D6UA 3SF8A 1HMPA 3DV0B 1CQIB 3LUJA 1IOWA 5BXQC 5C3MA 1KEPA 4JMLA 1RMYA 4P22A 5LZ9A 2QTVA 3LUKA 3CS3A 2AQKA 4ZU1X 1MB4A 2AW5A 3G9UA 4PYIA 3UMCA 3V3KA 3ZXUB 3WWEA 4OHUA 3GBVA 2AUNA 2EL7A 3NHZA 5ILOA 4MARA 4MV6A 4X1IB 3LT2A 2G9QA 5JD3A 2D6FA 1SM4A 2NO4A 3FYDA 3PNSA 5BRAA 1YI0A 3HBJA 1EUDB 3H1BA 4JB2A 4DV3B 1G1AA 5FPTA 4RU1A 1UDWA 3O2QB 5AHXA 5BV2P 5J58A 2A33A 4HDSB 1EE1A 2W8ZA 3ZK7A 1IY9A 2JI9A 2SBTA 5AOBA 5EE3A 4E7PA 3ANMA 1D1TA 4RTJA 4EF6A 1PTKA 4P0TA 3FROA 4OHRA 3VC3A 4WKGA 4L9SA 3UKDA 2OENG 5DCYA 4PVDA 3BH0A 1K3TA 3A06A 1GQYA 1N3BA 4EUHA 1YJ5A 2GWRA 5DYIA 1W35A 2ZYDA 1QS0A 2VXCA 2VYND 3DZBA 2Q0XA 3VC7A 4RTNA 2CSXA 1PSDA 1NRWA 1UOOA 2QIPA 1U0LA 2R5WA 1IZ0A 3AOEC 4ZCPA 1XCJA 3DFFA 3OBIA 4BBPA 1S2LA 2ZT7A 3NUQA 2IYNA 3KB1A 4PEVA 4HDKB 1XZBA 2ADMA 3O8OB 3A6HA 4LJ9A 1Y5RA 4GGMX 1KFJB 2EHJA 1VE9A 1JZTA 2CNLA 4BWVA 3HVRA 1FUIA 2Z8YA 2QRPA 3EGWA 2JAOA 2QPLA 3FDFA 1HEYA 3FPFA 3H11B 1PKXA 3PFBA 2K6GA 4J1NA 4O4LF 2KJQA 4W8GA 5JY1A 3SC3A 4KQEA 4R2XA 3WGLA 2VWQA 4L08A 4B5LA 4D97A 4KMOA 4EY4A 1DDOA 4LJ7A 3X1XA 1KXZA 2QN2A 3MOGA 1UZNA 2Z98A 3DZFA 4FEGA 2ZCVA 3BD9A 4JI4B 1KXJA 1ZH6A 2DBRA 3CIOA 4Z4IA 1JBQA 4LGCA 1C9MA 1JDUA 1PWHA 4S1TA 3TTTA 3WZMA 4OSPA 2A4MA 1EXMA 3RIHA 5JSHA 2GF9A 10MHA 5FLYA 4XLLA 2CHUA 3IIMA 1UF9A 2R86A 1AUXA 2O7NA 3HFGA 1L5GB 3PEYA 2XT9A 2IIQA 3JASB 2AFIE 3G59A 3PZBA 4WCFA 4ARZA 3BXEA 1V2HE 3TX2A 4X66B 1ODCA 4OXXA 1ILEA 1PVOA 3C8ZA 2G7MC 3GP8A 2QD1A 5COAA 5EPEA 2R96A 3JZMA 1PEYA 2Y27A 3MWEB 3SM3A 3FKQA 4DR1B 1QAMA 2WQZA 4KN6A 1PNOA 4ABYA 2OBLA 2I7CA 3GEBA 2JBAB 1L6RA 2XHZA 1H0RA 1EUQA 4HN2A 1YB6A 1M8KA 1PG0A 2EZ4A 3HCFA 3PT5A 4NE7A 3K9GA 3CVJA 5JZ9A 3B7GA 3REOA 4IQ4A 4WZBE 3QX9A 2MINB 4Q7MB 3E58A 2YV2A 2ZRKA 3MJEA 3TTYA 3PHBE 2P2ZA 4BRZA 1U0EA 4DY4A 1E5TA 4EZIA 3INTA 3NV9A 1WZUA 1G3QA 3DZKA 2JAPA 4MQLA 1NKSA 4QEDA 4W5JA 4MVJI 4ARSA 3C6XA 4JXKA 3D7NA 5KWEA 4Q18A 4IOKA 3GF4A 3IEVA 2DQSA 4MI9A 4TQUS 3FHCB 4C7KA 1BDHA 2VPXA 4BQFA 1IZ8A 3ELBA 4L6CA 2LKDA 4YFVA 4ZMBA 3DHWC 4H4EA 5EXPA 5E3IA 1PIWA 3FWHA 1X7DA 4OM8A 2FG7C 3IAS6 5FPKA 3IOBA 4MLDA 1M67A 3FI0A 3IE0A 4LOKA 1S89A 1T0JB 2AOVA 2OO7A 2PQ0A 5L3SA 1EE9A 2NUPA 4UDYX 3SE0A 4B3CA 1FLNA 4GQBA 1L4UA 1UBUS 1Q0PA 2VTEA 4EL0A 2OQ2A 4DLWA 3OWXA 2G9NA 2WTUA 5JWRA 4D0GA 3ZGXA 4D8WA 3C3PA 3A6JA 3LC1O 4B3RB 2BZ1A 1ENYA 1YMVA 3BB3A 5AKLA 1M2JA 2ZJ3A 2PZLA 2GHIA 2ORYA 4NZMA 5FUYA 2PS3A 2D5CA 1JE0A 2E4YA 2INGX 2JKVA 3MCWA 3P9NA 4TM7A 5TS2A 5JVDB 2JFHA 4DM4A 4Y8VA 1X7WA 3R9XA 3K5PA 3LX5A 4DV6B 2IEIA 3SR0A 4KNYA 2P5UA 2H1HA 4IVQA 4R81A 2O4CA 2NOAA 3BGIA 5EXSA 3FGPA 2PYZA 4UM9D 1L4GA 3TSAA 3L43A 3ENNA 2XMSA 3GJ5A 4BLTA 2N3ZA 2VZ9A 5M2QA 1XD8A 2CMHA 4MIKA 5JV5A 3UK1A 2IYTA 1XAJA 4Y6PA 3C5WP 5EHQA 3T5CA 2OD7A 4H0CA 3MMXA 1M5TA 1ULHA 3K0HA 1M2VB 4PWYA 3S29A 4G8CA 4GBED 4CRWB 2IYOA 2X8JB 4Q7LA 5EUCA 4IRUB 2J30A 5JW6A 2VQFB 2G4VA 2FHPA 4XFJA 3VBCA 3RVDA 1B1AA 3OZUA 4OQFA 4HAOA 4DXAA 2HTEA 2VNKA 1OXTA 4N6NA 4Z9XA 3H9EO 3IDZA 1D2EA 3H9GA 1Z13A 1MVOA 4ENQA 1CPYA 3CLSC 4LRSB 3RKUA 5JCPA 1HLDA 3ZD7A 2IOFA 1SQSA 4A15A 4Y6OA 1GAJA 1TF7A 2ZQZA 3PD1A 4KSYA 3HGQA 3CC8A 4YP6A 4D9NA 2C4NA 5AKJA 5I7UA 1MOZA 1NXTA 2VF2A 4KYUA 1T4MA 1G8GA 3MWDB 4RDCA 5EJ7A 1LK5A 3R3SA 4RQUA 5IT5A 4OYYA 3I2GA 3RT9A 3TEFA 2YY5A 4LV5B 1ZOSA 1X7HA 3URKA 3ZZMA 3CEHA 3I23A 5FD8A 2EF0A 4K3UA 1KVRA 1HG1A 2ZUCA 3OKFA 4WAUA 3L7LA 4XEHA 1DKQA 2QMZA 5IAAA 2XA1A 5E4FA 3BM5A 1NQVA 2CBXA 2E6UX 3AEYA 4UOEA 4J3FA 5LZ5A 4LZAA 4YRNA 3L0OA 1KK3A 1LXCA 1V5IA 1WCYA 4WLFA 3PFCA 3IP6A 3OX3A 3QEJA 1VYTA 2AFVA 4KBGA 3OCVA 5F64A 1BCSA 2JHPA 5EL0A 3DEJA 5K09A 4CG1A 3DWEX 1F2UB 1A27A 2ORIA 1XZKA 2ZROA 4BGEA 3ITKA 1IOVA 1FDOA 2X14A 1FUKA 2BJVA 3BE6A 1U9IA 1H65A 3HA2A 4BECA 3FZYA 1T3HA 2WF8A 1P19A 3H13A 1J22A 4DHWA 3DL7A 3EF1A 3PHGA 3LG2A 5GQSA 2NUAA 1H94A 1A7AA 2WIBA 2NU6B 3EAFA 3R2JA 4LKOA 2O20A 4REQB 3ICPA 4E5NA 4UTVA 2DBQA 3HY3A 2CXXA 3AY7A 1W48A 1IVSA 1OOEA 2CFTA 4G0ZA 1VJ0A 3ZY3A 3DOHA 2O06A 2GPJA 3ASUA 1OZGA 1CZOA 2C7VA 3NBZC 4NECA 4Y9UA 4J9UE 2RGEA 5DK6A 5IK2D 4OGWA 1G66A 1IEXA 2OV4A 3FNGA 4QATA 1QTIA 1VGRA 4WLOA 5GVRA 2JJ1D 2Q2OA 1O4WA 4ER7A 3I5XA 1FS4A 3H5AA 1SD1A 1K5DA 3FE2A 5JTTA 1U3VA 2BGMA 1W5BA 4BVLA 4N01A 4RW0A 1RR6A 2NUBA 2VF5X 1T10A 2FRDC 3ASZA 4LF4B 3RF6A 1X7XB 2HAEA 1VJGA 4JEHA 1L1RA 3IEIA 3SIPA 4G2TA 1Z35A 1FVOA 2PU5A 3D3QA 4O1MA 4N41A 2YZNA 1GG2A 3CVOA 4DYVA 1AO3A 5AJWA 4AMZA 5U4XA 5BUZA 5EWLB 2IP2A 3KALA 2ZYHA 5AM1A 1QG0A 3A3YA 2OWEA 3OLZA 4YP7A 5J59A 3TD6A 1HXHA 5CB6A 5CTJA 5KNDH 2QM8A 3DGFC 1ZBQA 1E2IA 2ZUWA 1RZRA 4I99A 4DC0A 3F5DA 3UB2A 5A9SA 1O6BA 3WLAA 2BEJA 4P80A 4AJPA 5DM2A 3PQCA 2LR0A 4FK8A 5D3MB 2J87A 2Q46A 4Q5IA 3KZCA 1UM8A 1J7JA 3PC8A 2JZNA 3PQFA 1POXA 1O7JA 4Q7EA 4CLOB 1IN1A 3KJHA 4Y6GB 4RSGA 5D84A 4E2ZA 3MBKA 4WFJA 3LY8A 4HTFB 3S2GA 5EKDA 1PGQA 3CIFA 3N7AA 2FYTA 1MAHA 3A6EA 1GRVA 3O1HB 4FDAA 1UBFA 3EEFA 4KRGA 5LKAA 1UMCB 1U1CA 1QBKC 3B60A 2KI5A 3NANA 4MUGA 1O4VA 3D6VA 3QVTA 2FRVA 3ECSA 5AI5A 4E13A 4HWSA 2C9DA 3K73O 3P9QA 5D3ZA 1UPTA 1E60A 2QRVB 3AJDA 4YFYA 1G2PA 1V37A 4N0PA 5CXXA 4AZWA 2GM3A 4PXYA 4CKEA 1Q19A 2GRAA 4K88A 1U94A 2R6ZA 5GM2A 1OCEA 3UCXA 4CL8A 1OI3A 2Q1YA 2C61A 4Q3BA 4UMDA 1R5OA 1X94A 1IFXA 2V6GA 4EARA 5JFOA 4BQEA 1T0UA 3B6IA 2FH5B 4LXQA 5TMPA 2AOTB 3SYRA 2C4WA 4TV8B 4EA8A 3ZWAA 4B6OA 2VNSA 1KY5A 2WHPB 1PFUA 4FGJA 1RSZA 4E88A 1PZNA 2C1EA 4NDZA 3K9HA 3PXGA 2B69A 3NRBA 5JJCA 1WDTA 1FB5A 1N2OA 2ZLBA 2MT9A 3F47A 3L9WA 3CISA 4TMYA 3TVDA 4I4CA 3V4VB 3MA0A 3HUDA 2PT5A 1T2FA 4P4UA 3U4MA 1JQJC 4AO7A 4KO2S 5E2IA 1A04A 3TLGB 2Y8EA 2VF8A 1M9NA 2EARA 3EVTA 5K20A 1DTWB 5ICEA 2YJNA 3HADA 3G5UA 2A0KA 4B3HA 2O2YA 4B6SA 2R2GA 4Q7JB 7REQB 2OD2A 2XZOA 5HKBA 2FUNB 1ZWKA 4HDCA 4B33A 5HKKA 1SKQA 1U1GA 3I1FA 2XNHA 3ROXA 1K9SA 2NMVA 4HDMB 4PZZA 1JQ5A 3HXTA 3QOFA 3BDVA 3C6QA 4V0MA 4KPYA 3NP9A 3HH8A 1IN6A 2NXCA 4OB7A 3PSAA 1DCKA 2DFPA 1V3VA 1WDLA 1E89A 3N5CA 2ZYIA 3TAHA 3PP8A 4ZU3A 4BNLA 4JI3B 5EXTA 3PNKA 4V0KA 1NP7A 4IUYA 3EIQA 3QFSA 1NDQA 4OGKA 4Z0HO 1E2MA 5J1SB 1W96A 4PYJA 2XZLA 3VOBA 2WVJA 4MKGA 2LP4Y 1PVVA 2FDCA 3BMCA 3QHPA 1HM5A 4JGGA 3ESZA 2H2AA 4DV0B 1QIKA 4CKXA 2WOOA 4QUEA 4G0QA 1TAUA 3G8AA 3L3BA 1IZ7A 2CLLB 4WL0A 4WNYA 3PHIA 1EFLA 2PAAA 3ILVA 2CCKA 5ALEA 2I3ZA 1JLSA 1RKUA 3WKCA 3HCWA 4PINA 4EW6A 3H1TA 2PRIA 4MRVA 4TYWA 2VKTA 4DCCA 4M0MA 3S55A 1IC6A 1KP9A 3DFIA 3DFZA 3MUOA 4LJKA 4W1SA 5BWCA 3C7TA 4PFKA 13PKA 1I2ZA 5HKLA 4N3BA 1QMGA 1YZVA 1BVUA 2B21A 3N7TA 2RHBA 2ETXA 2A88A 1EUCA 1GTG1 3HYTA 2GEFA 2WDPA 4FE7A 1KDTA 1KWGA 1C3LA 1KNQA 3CLUD 1FFDA 3NTXA 5EIEA 4DSNA 3TR5A 5F77A 4LX8A 3LT5A 4X60A 1T2CA 4YAGA 5LWHA 1WF3A 1V8ZA 4LECA 3PJGA 1YK0A 4D45A 3L79A 3OIWA 3CUSA 3WWYA 4BO2A 4D2IA 2EW1A 2V5UA 1BA3A 1PYDA 5B58T 3VPXA 4BO6A 1ETHA 2RHLA 3RS3A 4WV3A 3L4JA 3BWYA 3NEAA 1L7DA 1MX1A 1XDUA 1O96A 4K6MA 4N18A 2FPUA 2I34A 2BAGA 4NFLA 2G76A 1YOVB 3I8OA 3DWGA 4RMIA 4BU1A 3E22B 4RD1A 4ZO9A 1YZ3A 5IRCD 4MP3A 1E2NA 4UVGA 3MT9A 3JATB 4IUDS 4TMKA 3FOZA 2XIQA 2OAP1 3D31A 3HACA 4A8JB 3K2QA 2CV2A 2HLDD 3EQ9A 3GJ8A 1ISMA 4N8EA 5KMGB 1O87A 5ALQA 3G2PA 1DIOB 1WNFA 1LD3A 2BE7A 2EBUA 3OFVA 2RK6A 3TN7A 3ZE1B 3GLIE 3R8XA 1CDEA 5ESRA 2XE7A 5ARBA 1NIJA 2GB4A 4TUYF 3VTAA 1V1RB 4FFDA 2Y1FA 1SMKA 3KDAA 3PG5A 3FETA 4KCGA 1OAOC 1XZNA 1Z5PA 1RRGA 2RKOA 1SAYA 1L5QA 1U7DA 4FNGA 4MQ4A 4PLTA 1W4ZA 5FUMA 2G1PA 4CNBA 1GG5A 1XQ1A 4UUNA 1J21A 2WIGA 3C3XA 1XZGA 4J0IA 1FC0A 4JLNA 2IBTA 3Q12A 2IYSA 2X0EA 1TD1A 2JGFA 3AF0A 1RAAA 1K92A 1IQ0A 5AHKA 2I7XA 1IH8A 3CN7A 2COEA 4NCAA 1P5HA 2UYQA 4E07A 3O0TA 2Z1MA 3PV0A 1RCUA 1Z8DA 1AD2A 3FMPB 2HMVA 3PWTA 3AHCA 6NULA 5DLQC 3TF5A 4LDJA 1KEEB 1RLJA 2WF7A 2QVXX 3UT5A 1VCMA 1VIYA 1JQEA 1Y5IA 4ODIA 4CMIA 2I99A 1C1DA 5G0UA 4BFVA 1B3RA 1C4WA 4MQMA 3VO9A 1P0PA 1JHPA 5SZHB 2G4CA 1JPJA 4ALMA 5FOXA 1PFWA 1UBOS 3GNLA 2VTKA 2P6RA 3MTGA 1L5VA 1X38A 4G89A 1PR3A 3Q40A 4ZT5A 3W2IA 1NONA 4NHEA 2XRMA 1S7GA 1QHNA 3I45A 4UBIA 1ADJA 3LO5A 4PYQA 2OKCA 4TV9B 4X5OA 4MVYA 1XPUA 5EXEA 3HU3A 3MRTA 1Q0SA 1RS0A 3PNOA 4BO9A 5KSPA 4X6LA 2QQ5A 5EJ8A 2BPOA 2BEKA 4ZV7A 2HJSA 2FZLA 1PHPA 1GRRA 3O82A 1M83A 4GPTA 1R4NB 2EYUA 4XUEA 5J2UA 1FYDA 3OJXA 3LFUA 4HWKA 3R7LA 3VO1A 3OCYA 4E08A 1SXPA 5HDBB 3W05A 5NLLA 4ZK2A 1KS9A 3A04A 4DCPA 2NIPA 1OXMA 1IHOA 1ZOLA 3EZYA 2AKYA 4UMEA 4X20B 2JAUA 4YJGA 5I7VA 1FQJA 3GZ4A 2GI4A 3JALA 2EBFX 4GZ5A 2X5NA 5CB0A 1I2CA 2HU7A 3A6KA 3MXTA 3HFSA 4FGSA 2Y76A 3PSHA 3IA7A 4M6WB 2YJ4A 3ZW8A 4V3CA 5B1IA 3GDWA 4M8LA 1GZDA 1RP1A 1HE1C 2IE8A 1JKMA 3HCOA 3VJMA 1R4AA 4LNHA 5BV1A 4UDOA 4IQ8A 4RTMA 4LQCA 4I55A 4MQFA 1P2FA 4BAGA 4QGFA 3A58B 4TXLA 5K0SA 1BKSB 4UE2A 3I4FA 2IODA 2QR5A 1S8FA 2JAHA 2NQTA 4OI0A 2FSVA 4RNCA 4YUZA 5K3FA 2ODEA 2ONKA 5DSZA 2QRKA 3N1UA 1T8PA 2C7GA 2VAXA 3L07A 3PFFA 4DRXB 4TS4A 1SBYA 4Y2QA 3DCYA 1NUAA 1Z5UA 2ZJ6A 3FFBA 4H1WA 1OTHA 5TVKA 2EP5A 2ZVDA 4RMNA 2B2CA 2VP0A 1EK1A 1UFVA 2ANCA 1KDOA 5EZYB 2X9GA 3DW3X 5I8ZA 1WUIS 3D4PA 4IIJA 1WCXA 2FQQA 1NW5A 4DQ0A 5LDDC 2VI5A 1N78A 2H2DA 1PL8A 4TOIA 1GPNA 3T61A 2H08A 1JHMA 1N8TA 1U02A 2SKDA 3E9MA 2VUUA 3GK3A 4EA9A 1B93A 1JT2A 1RKVA 2R1UA 3DV0A 1CQIA 4KRXA 5C3UA 3ICQB 4QPNA 2CVZA 2BSXA 4X00A 1ZMTA 2EG9A 4PZCA 1IBSA 5G1NA 4EVIA 1YRBA 5IBQA 3L0ZA 1A7KA 4MHOA 3WOVA 4ESHA 2V1UA 2R5FA 5IFLA 3MLEA 3TS1A 3AHHA 1V95A 4K26A 4ZYZA 2CXTA 1T1JA 3OLCX 3CPEA 2CJYA 4PLYA 2VDOB 2W42A 2FR0A 3IBYA 2W2LA 3ED5A 4LY6A 3WK7A 1U9YA 5IKEA 3UK2A 5FA6A 4D4KA 4TVKA 5E7IA 2PH5A 3S70A 3WGKA 3EYAA 1T2DA 3KAQA 1LPSA 3M4JA 4HUQB 1QJ4A 4YALA 5DHSA 1MIHA 1P9RA 1GFWA 4PBSA 5ALLA 3TRKA 4BC0A 1R8XA 2HCRA 3LNCA 5DTRA 1Y42X 1BIFA 3GDFA 1TM1E 1BGWA 3L0DA 4TS1A 5HQ3B 2QT1A 2FEPA 3JXEA 2G5GX 4NVRA 2ONJA 4BKPA 1MDFA 1T2VA 2IBMA 1ZMXA 3AUKA 2BGRA 1JBKA 3LMKA 3WK4A 2A0XA 2VDKB 3G2QA 2P67A 3PS9A 4X24A 3RYFB 1CUXA 3ND5A 4J49A 3BVPA 3ZQUA 3PBKA 4OHPA 1K5GA 1ARZA 4LYJA 3RSQA 4CIBA 3V2HA 3ADKA 3MTIA 4HDKA 4MV5A 4NYIR 1DKRA 2PPVA 1WUHS 1G3MA 4D56A 2BMFA 1NN0A 5K1ZA 1TYAE 2GHQA 4CVNA 4OLJA 2V5VA 2VT7A 3DCNA 5COBA 1B23P 3GFQA 1XCMA 1UP4A 4TSFA 2ZAOA 3NAZA 4UMFA 3TBHA 3BFXA 2WIDA 3ZGNA 4A0GA 5I9TA 2H5LA 3GIWA 1VIDA 3TRFA 5DX1A 3UC9A 2AJLI 2VTBA 3V48A 3P26A 3WDSA 1BRTA 4DJFC 3HMKA 4UNQA 4JI2B 1I0IA 4P8RA 4IS2A 4QNMA 2P9ZA 2I3GA 3I9V6 2QLJA 5IH3A 1JJAA 2I22A 1FRQA 2FX5A 2EFJA 4P7JA 4RPJA 4UTOA 4QTXA 3S2IA 2CK3A 2O2XA 4DGQA 4QQFA 4KQGA 1KC1A 3AKZA 2EWWA 1CUEA 1MMFB 3B2QA 4F9FA 1NJFA 3HDHA 3JZFA 5CH5A 1A76A 1KPGA 4A2WA 5KNBA 2GJ8A 5AJZA 2FCAA 4FYIA 5FB3A 1E0SA 1XB2A 3EG5A 3MWEA 2QT9A 3OFNA 1BJTA 2C5LA 4JXZA 1CY0A 3KKOA 4ND8B 1SN7A 2DY1A 4PNPA 4RWZA 4XSVA 4B7AA 1FYVA 4JT8A 3OTOB 1KNXA 2Q2NA 4XE5A 1CUWA 1YVRA 2W43A 1XZEA 4HFRA 4P6VF 3JWHA 5CK4A 3VR5H 1H4QA 1MT0A 4UUQA 1O3YA 2B35A 1YZTA 3HXOA 2MINA 2XXAB 2VDUE 1OFGA 5IVHA 4FCCA 5LB4A 1T9CA 1AF4A 4BVAA 4HDRB 2J45A 3OQVA 4OJNA 4NCBA 1D8TA 1A72A 1Z6PA 2Z4SA 4RLSA 5CHEA 3CLSD 4I5IA 4MUBA 4KV9A 2E55A 3AWDA 1NOJA 3L8ZA 2C9CA 4KE9A 2X58A 3AW8A 5GINE 2G77B 4KLCA 3TIVA 4WCFC 2M1ZA 3K4HA 4DR2B 3LW8A 4BNDB 1Y3AA 3VX4A 5L53A 3NHWA 1KTIA 3EAGA 3DG9A 4PQEA 4DEVA 1QRTA 4I7EA 2SCUB 3RAPR 2DPMA 2A67A 2B6NA 1HQDA 3HKDB 1OFIA 1U80A 3EBOA 3K1TA 1XWFA 1KIMA 4LVCA 1VHDA 2PR2A 3ZWQA 4NBLA 4D8VA 4IPTA 1ILWA 2AKEA 1TDJA 2QQGA 3EDRA 4I1RA 4BFZA 3GJ0A 5M34A 1IXSB 4H3SA 4M83A 4MA4A 3GRRA 4IY1A 5E9QA 5G40A 4L78A 3ZDZB 1JDVA 1ZGBA 2ZSFA 3QBEA 4G5QA 1Y9ZA 3Q7SA 1Y34E 3ICEA 1XSEA 4ZTUB 2O2HA 4GRAA 1FW6A 3UNXA 5J2UF 4J2OA 2I03A 4YMVA 2PEZA 4EX7A 4PAMA 4MA0A 4AZ3A 2PAFA 2HJ9A 4ERNA 1EFUA 2BHNA 1GDTA 4YRCA 2IELA 4HQ0A 1XFAA 3HO1A 1LRKA 1HI9A 3QLEA 4K46A 3L8MA 3QOYA 1INLA 2FXVA 3PXCX 4LXXA 4TROA 5J47A 1G8YA 4LJYA 2AB0A 2AGVA 1CTQA 1CUUA 3MTJA 4HGPA 2NQ8A 3GDGA 3EEIA 1JA9A 4LHYA 2VHEA 1M2VA 1KKUA 3AJ9A 1I1HA 4WUTA 4OHBA 1LWNA 3X43A 4JB0A 3G0CA 1JIVA 4LTNA 2IWHA 3A7DA 3TMYA 4B47A 1XU7A 5BSRA 2P6NA 4PAQA 4R1SA 1EK2A 3JQAB 3ZK8A 3KT3A 4I55F 4IX1A 2DOKA 4OAOA 3EGXA 2AN3A 4GYWA 5AK4A 4PG4A 1JZQA 1T36B 4Q3EA 1XUOA 3FG9A 1SXJA 4LXIA 4UBMA 3ZHSA 4E3ZA 1KFEB 1V11B 3ZGZA 3UAGA 4AJNA 1DNPA 1Z15A 3P2MA 2DTXA 4GU5A 2C94A 3BSWA 4KW7A 4DCGA 4EY8A 2EKDA 3C3JA 4R2MA 2Z6QA 3MWDA 1IXZA 3LNTA 3R0IA 4BO8A 5I9LA 4CEIB 3LWNA 1BW9B 3STTA 7ABPA 1M6EX 3KP1A 1XMJA 5CVCA 1JSZA 3T1HB 5ITZB 2V74B 3O7MA 3DP7A 1BZYA 3D2BA 4QGGA 4UEOA 1MJHA 1T9GR 1PL7A 1XR3A 2D2IA 3E03A 5REQB 1ESNA 3UMVA 4O0LA 2BM8A 1MQAA 1QVAA 2W70A 1HOTA 4ZCMA 1R74A 3IOMA 3TYXA 4H0NA 1IIRA 4ZQHA 5A5DA 4U39A 2DFDA 3UMSA 3ZWOA 1F2UA 1I01A 1ZIXA 2ON6A 2X23A 3PIIA 4ZPJA 5GMOA 4RIIA 4EG6A 4PZ0A 3VPSA 2IIPA 5CM2Z 1E0JA 2ZRPA 5BVHB 1UKYA 1V7CA 1YR2A 4ZVMA 2G0TA 4PIVA 1W5TA 3O1IC 5JEEA 1DJQA 3BS4A 4G5GA 3F6PA 4MR7A 2J3KA 4YP5A 1P44A 1KORA 3P2EA 4X41A 3ZHZA 4DBLE 1UM9B 3X1MA 2CV1A 3JYNA 1W2HA 3MILA 2Q5QA 4CTKA 2GN1A 4Q00A 1A3CA 1VGQA 5JYEA 4ZCRA 3WBKA 4LQLA 4QOGA 1PZEA 2JZCA 4LRYA 4C3VA 1I3OA 1Q15A 4L7QA 5AWFC 4CIVA 4B6GA 4QFCA 4PFQA 1Z6YA 2HJGA 3ML1A 5GOTA 4LJSA 4RZSA 4PTLA 4CM8B 1EEHA 1DJPA 2C20A 3AI3A 2BDEA 1WP4A 1WMEA 2NYUA 4NARA 1KZ1A 2IEYA 2K7FA 4XQGA 2XUAA 5DIZA 2VNAA 3KQMA 1K7XB 4DNFA 1VCOA 3HB0A 2GR9A 2I0FA 2O2GA 3AL3A 3FWKA 3SZGA 1WWKA 1HO3A 2XUGA 3OO1A 4ND4A 1RQPA 3BB4A 1DG9A 1RQGA 2REQA 4MRMB 4ZVOA 3FKSD 2NP6A 5JSQA 1M76A 1Y8AA 3DMNA 3ODGA 4OPMA 1RLOA 5DM1A 1EDZA 2PMBA 2I6GA 2V96A 4ENRA 2FLKA 4QGHA 1UFRA 3KZVA 1MVLA 4AP6A 3PYMA 1Z68A 1Y4ZA 4M8SA 4YGYA 5JTUA 3GRPA 5CFZA 3DC7A 2WTNA 2JF0A 2WZDA 4RK0A 1DMSA 3P4UA 5LJIA 1D0IA 3GDOA 4GG1A 3ROEA 5IVIA 1PT5A 2Y71A 1NNLA 3DVSX 2OCYC 3R23A 5D3MA 5KOJA 1RM5A 2I6UA 1IM2A 3GFFA 4FC7A 4QO8A 1VPLA 3BILA 1KQFA 2QRMA 1A5AB 3W7AA 3W8EA 4BO1A 3OQHA 1M1YE 1QHYA 4YONB 1NJGA 1TCBA 3K9NA 1Z4PX 3QJ5A 2GILA 2EL9A 4ZU6X 3T8YA 2AYYA 2FSGA 2MWMA 4R9RA 3VH2A 1ABEA 2AEJA 3GFBA 2HZ7A 4MJLA 5JZOA 1UT8A 2QRVA 3OFKA 4OA5A 3DTVB 2G9UA 2P3OA 4G65A 1ZCAA 3VZQA 5TPZD 1T3TA 4ZCTA 3FZQA 1VLZA 3TJRA 5KQGA 1E9VA 2CDRA 2R6AA 4FZ3A 4AZTA 5D3QA 3IERA 3AVPA 2OQIA 2NU7B 2FX3A 4CLEA 2B2NA 4P4SA 3RS8A 3JR7A 5DM4A 3BREA 1BDMA 1D5CA 3F5QA 4P3PA 4Y0VA 2OGSA 4TV8A 4MTLA 3JWIA 5MGBA 2WHPA 2YHUA 3K53A 3N0XA 1C0KA 2W0MA 3GPLA 4TKMA 2C2KA 4RANA 2D1TA 1RRKA 5WRFA 8AT1A 2I2XB 3KTDA 4UCFA 4YP0A 3W5HA 1UWLA 2F3UA 4AQDA 1ZNYA 1U2EA 1W0JA 4IWNA 1K6IA 3VSDA <