4HDRA

Crystal structure of arsab in complex with 5,6-dimethylbenzimidazole
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
339
structure length
335
Chain Sequence
MSLLQATVAKIMRPDTVIKDQVKTKLAGVLQSAGSLGRLEDMVEQYAGITGELNPALPKPCMVVASADHGVARRVVSAYPIETTIHMTANYLISQGASANAFANFCGADMVVVDMGVAGDLSYVPGLWHRKIAYGTQDFTEGPAMTREQAIQAVETGIDIVNDRVKHGNRCFCLGEMGIGNTTSSATIVGAFTGLAPEKVTGRGTGRLKTKMEIVGRALAVNKPNPQDGLDVLAKVGGFELGALAGVILGSAANRCAVVIDGLNTTAAALIANVIHPLSKEYMFASHLSGEPAHSIALRQLQLEACLELGVRLGEGIGASMVVDMLYVAIKLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Function of the Nicotinate Mononucleotide:phenol/p-cresol Phosphoribosyltransferase (ArsAB) Enzyme from Sporomusa ovata.
pubmed doi rcsb
source organism Sporomusa ovata
molecule tags Transferase
molecule keywords ArsA
total genus 127
structure length 335
sequence length 339
chains with identical sequence C
ec nomenclature ec 2.4.2.21: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02277 DBI_PRT Phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1610.10 Mainly Alpha Orthogonal Bundle 5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1 5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1 4hdrA01
3.40.50.10210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hdrA02
4KQIA 1L4BA 1L4KA 1L4GA 1D0SA 4HDRB 1JHXA 1L5FA 1L4LA 1JH8A 1JHPA 1L4EA 3U4GA 4HDRA 1L4MA 4HDNB 1J33A 1JHYA 1JHAA 4KQJA 1JHRA 4HDSA 1L5LA 1L5OA 1L4NA 1JHMA 1JHQA 1JHUA 1L5KA 4KQGA 1JHOA 4KQFA 3L0ZA 1L5NA 1JHVA 1L4HA 4HDMA 1L4FA 4KQHA 4HDKB 4HDSB 1L5MA 4HDMB 1D0VA 4HDNA 4HDKA 1WX1A 4KQKA
chains in the Genus database with same CATH superfamily
1LB1B 1LDBA 1P6UA 4KLAA 5E2BA 3S70A 1LPNA 1VTKA 2MT9A 2YXNA 3LC2O 1ZOSA 2WUGA 1T0JB 3HLKA 5C1BA 3FWYA 2FF7A 2Y0EA 3NBKA 2Q1UA 4D81A 2ZIGA 3LBYA 4P5PA 3AKEA 3HWX1 4O4HF 4HVLA 1G8SA 2PUHA 5CA0B 3FGPA 1BTOA 1NT4A 2PX4A 4ID3A 4P7BA 1YZGA 3K8QA 1R4ZA 3LHSA 4KH0A 4ND8A 2EZUA 4S24A 5HOQA 5BVGA 5JARA 2QY9A 5CLJA 2YXPX 4PO9A 4YUVA 2YHBA 5JSUA 4U7HA 3GXBA 4YMHA 5A4FS 5KNBD 4DRXB 2QSYA 1AKNA 1T6ZA 4IYRA 1S2GA 1XDZA 3WWPA 5B2FA 2QYSA 3EOAI 5TF4A 1WHSA 2BH9A 2NO1A 4OAQA 1UBLS 4HQOA 4MPTA 5CM9C 3FFWA 4R3WA 4AF6A 3U17A 2OFWA 2JZCA 1KIFA 3FRJA 2G0AA 5LPNA 5AM2A 4DJTA 2XYQA 3Q4GA 4TYQA 5EIEA 1O89A 3IKMB 4IGKA 4N39A 4CFZA 1JEOA 3RYIB 5HRCA 4FFBB 4INZA 2ZKLA 4FYMA 3UMMA 4YJ2A 3DW3X 4BFYA 3TTSA 4TT8A 3AJDA 1KMNA 2XH8A 1E1RA 2WINI 2H4YA 2Q4EA 3AM5A 3B2EA 3IIEA 4PLVA 2ZB7A 5K03A 3RRNA 4G0NA 5ICFA 1YQQA 1SZCA 4EHAA 2C07A 4D02A 3AVTA 1XMPA 1Z73A 2E89A 2QTGA 4WE3A 3WMEA 3EEYA 3O75A 4KEAA 3RUHA 3D2LA 1IY2A 1PW5A 1T4BA 2FUG6 1WSDA 3R3WA 1J2YA 1UPXA 2ZUDA 5FA8A 3G0OA 3ROQA 5E2IA 1X7WB 5HKAA 1L5QA 2ILVA 2C9MA 1M2GA 1WQ3A 1T0UA 2NAFA 3NT5A 4Z0NA 4AICA 4H27A 4H59A 1PZEA 3B60A 3DLHA 3WNBA 4I5FA 3HVRA 4LGYA 2BE7A 4KQCA 1HE5A 1P1KA 1UMCB 2C42A 2R65A 4KIJA 4PYMA 5TPZD 5FDFA 1PKEA 3HZZA 1L5SA 4GPZA 5E6RB 5H59A 4DE5A 3UMYA 2HCBA 1XHEA 1PP4A 3L4BC 3ZDAA 2ATXA 1OZGA 4GBMA 4P5EA 4HDMA 1BCSA 2ZRFA 4GLBA 3BWMA 2FPIA 4YAOA 4M37A 5DTMA 3E1SA 3DBHB 4CWAA 3H6KA 3QMPA 3ZDFA 5CB4A 1UT6A 4XVRA 2WIAA 4KDRA 2BFCA 2WW8A 4BV3A 1G20A 3OM1A 1COWD 5CB4F 4AD8A 3NAZA 1AE1A 3KYCA 1NJ6A 3LYHA 2AYYA 2GS9A 3L7KA 4MQFA 1CR4A 2QQFA 3T4XA 5J4KA 1XRSB 3UJNA 1VIMA 1K3FA 1SXJD 1WDWB 2VHWA 2ZRCA 3HKBA 1OOEA 4JEMA 4IIHA 4KVFA 4PO3X 4RZUA 1HY3A 4Z7OB 3AF5A 3HCFA 4J1TC 4ZAWA 3R1IA 5AJXA 5AW2A 3DMHA 1NURA 1V16B 3L9XA 3P5SA 2IELA 5M3BA 5GZ3A 1RAHA 4CMCA 4BVJA 4G8CA 3T3DA 2RB4A 2V8OA 4K26A 2QI9C 4QVKA 4CIAA 4NNOA 3R3ZA 3E22B 4FFPA 4B34A 4B7XA 1PFYA 3WV5A 3EZ2A 5BNZA 3KQHA 1HLGA 3NHLA 3SIPA 3TTXA 2NO4A 3TB6A 1M66A 4I9NA 1NW7A 1H2YA 2JFXA 4QOJA 4DMFA 6GPBA 3ECSA 1N2CB 4OAPA 1Q5PA 1M2OB 1YWGO 3MLBA 2I4OA 4B2YA 1RWKA 1RVV1 2IZ7A 3EB9A 2QL5A 5AI9A 2GEDA 1M6NA 2Q3BA 2Q8NA 1ZNQO 3MUNA 2M6KA 3NS7A 4HTFA 4KIGA 3BDIA 4Y30A 4DCPA 3KHSA 2WUEA 1IHOA 2F00A 2FG5A 4ZDWA 4E5YA 5JCJD 4GP6A 2DSTA 4EUKA 2GO7A 2GYYA 1CQPA 1ND5A 5AW5A 2PUBA 5DGCA 1P77A 4DCSA 1V5FA 1Z5WA 2XRYA 5IVDA 2OENG 2BR3A 3G88A 1GN8A 3FW1A 2JAXA 3K6KA 3LUHA 2I67A 3GF4A 5LYYA 3NWPA 3RT9A 2Q1TA 5GONA 2ZGVA 2FSUA 3ZD8A 3GLIA 2J0SA 4EUNA 4HDOB 4C21A 1P4JA 2P2ZA 2IDJA 1UINA 4KXNA 4X60A 1EU1A 5ITZB 2BEWB 1ZSYA 1I6MA 1XAGA 4FNOA 4PLZA 1Z4NA 2H7XA 4G5QA 1DBIA 3QU4A 3I9LA 2HQRA 3AILA 1H0KA 1XMXA 2B5WA 3Q3CA 3WIVA 1WS6A 1R12A 4F3CA 1IMJA 1Z56C 4RV9A 3BZUA 2QG9A 5BSWA 4QPJC 3X1MA 1Z4KA 1YVUA 2GZ1A 2QAGC 3E7PA 3GBSA 3Q0TA 4PLYA 5WRFA 4KOEC 1E58A 2A8YA 4BO1A 5DASA 3JQFC 3BHNA 3LHIA 1IBKB 1QDLB 4DM4A 1E1RD 5JYBA 3NP7A 4KTTE 4D56A 2CV0A 1ZLXA 2UZ1A 2OLJA 4R3NA 2BHRA 2A7XA 2NACA 3R75A 3I04M 1AS3A 1F3OA 1Q21A 4QFBA 2OXCA 1KTVA 3KKLA 3S44A 2WIGA 4W1PA 4HVCA 2QTTA 3M34A 1RXWA 1XVTA 2QTCA 2CBXA 2KSQA 2YVLA 1Z0FA 2GM9A 2PQ0A 2X76A 3EA0A 3JX9A 4CT0A 2WD7A 4RY8A 4B80A 3PYLA 5LKRA 1DBPA 1ESNA 2YWEA 2P1ZA 3C39A 4FHEA 5EEHA 1ODLA 1NVAA 1BWPA 1XUOA 1XZEA 2ZULA 4MW2A 1DEOA 4I4TF 1ZCJA 2YMLA 1JG7A 4ANFA 5F1YA 4DAEA 4OJTA 6NULA 4D43A 2GM4A 3O95A 3BDAA 4PBSA 3D8TA 1ZQ9A 2Y1KA 2RK4A 4M21A 3LQFA 2QG6A 2QGNA 4Y8VA 4ETWA 1FDSA 4Q18A 3D6FA 3QPUA 3PJEA 5LBUA 2GKGA 4MWBA 1F48A 3O92A 1YVDA 3UG7A 4H31A 1WUIS 4J0KA 5IYZF 1T4MA 2QP3A 1Q2XA 2NO5A 2JLYA 1VHWA 4NPCA 4L78A 5ELMA 1P2UA 4FE4A 2VTKA 3HJCA 4IVPA 4OHVA 1DXHA 4CBVA 4US2R 1GGEA 1XCPA 1XTPA 1MW8X 3OPYB 4BFUA 5HRAA 2WIFA 4EMBA 1E59A 1WOMA 3CUYA 4O1HA 5AOBA 4PZDA 4OBEA 3QKSA 4Y0VA 1ULHA 1KVSA 4INOA 4EY5A 3KT0A 1E0AA 4DV3B 1QF7A 1PDOA 2PG3A 4WACA 5JV5A 4CV2A 3WSVA 1MO5A 1Y8RA 2GBLC 4M53A 5F77A 3WL7A 2VHUA 3R9IA 3HCDA 4L15A 4R40A 2QOEA 4BRUA 2POQX 4GVLA 4XDHA 3RU2A 1TO6A 1WTAA 1XNHA 1DRJA 1T1EA 4PC2A 3WL3A 5BQ3A 2BDUA 2FUNB 3C1UA 3F6YA 5LQDA 2J5XA 3H2KA 4NQRA 3C3WA 3PUXA 3QLUA 3BDVA 1OLXA 4NX2A 3TW4A 2PX2A 4MW6A 1RYYA 3GJ0A 3SSMA 3TDKA 3NDBB 3N8HA 3NBZC 4J49A 3LP8A 4OFBA 4OPMA 3FTCA 1HG1A 1HBJA 3P4UA 4UTXA 3WRXC 3ZJ4A 4CM7A 3KETA 3HNRA 3EVNA 4R1LA 4W82A 4O4IA 1PTJC 1Z0SA 2EFDB 1YV9A 4XM2A 2R1TB 4IIDA 2AJLI 5FYDA 3FBWA 2JFUA 2JIMA 4S0ZA 3WLKX 2QM0A 2ZBGA 1NC1A 4BNFA 2ID9A 4MKFA 4DBLE 3GT0A 1JH9A 4M0KA 4DQ0A 1XNJA 1F2UA 4B71A 1PQPA 3HVUA 4X7PA 3TCXB 1L7QA 5SY4A 1VYTA 5CX1A 1T5DX 2NWQA 3V48A 4AY4A 5LIPA 4U4AA 1E6EA 3LG2A 5JBNA 3GEMA 1XTZA 2XCQA 1I5OA 3JQFA 1JZSA 4V3CA 3DKIA 4FYXA 4DNOA 2VVTA 1F6DA 1TFRA 4EKDA 2C4KA 2Z5FA 4MJXA 3RIGA 1E2NA 5KWSA 2ONZA 4YRFA 3FOWA 4DMLA 2G0NA 5LZ9A 5DEOA 1GG2A 1D7AA 1I2DA 2ZJ7A 3G0GA 3CZ5A 3EMVA 3QBDA 1BMDA 2LDBA 1RHQA 3EIWA 2W93A 3BICA 2B9VA 2NGRA 3GOQA 4FU0A 4OKNA 4M98A 1QV6A 1Y8AA 4MEAA 3UFXA 4LFAB 2QN7A 1QLJA 4ND3A 2NU6A 3IKTA 1NBMD 4C0KA 4JC0A 4RJTA 4E14A 3ESAA 4JHXA 4B79A 3BMXA 4E1VA 4IEIA 4G0VA 3I6MA 1NVFA 3H9EO 2X9LA 1SCDA 1KAEA 4JJFA 4JLKA 4MW7A 3TWOA 4O0MA 5KYTA 3LQ4A 1ZIDA 3K15A 2YJ4A 1UXHA 1XOIA 2G04A 3I34X 4AMYA 4WZ6A 3CUSA 3V1NA 1W581 1E6WA 2I6QA 3GFRA 3L0IB 5H81A 3THXA 1J1UA 2H06A 2VJQA 1EJBA 3DAGA 2YC4C 3ZGXA 3X0DA 4DS3A 2DJIA 2HTFA 3RKRA 2V4ZA 1Z39A 2JBAB 4RAQA 2WJYA 3W04A 2NXJA 4HRYA 1M67A 4KQIA 1E9VA 2Z5LA 3IEIA 5K0JA 3OY7A 4A15A 1TM4E 3JR7A 3IXQA 1V43A 1ZW1A 1AU9A 1PEKE 1R6AA 4OJMX 2J9XB 4PGFA 1KFKB 1QQ6A 4OLBA 1PR3A 1U3TA 2XT0A 3PENA 1QRAA 2FHPA 3ZLVA 2F48A 1G42A 1LSJA 4XGQA 2OBFA 2X77A 4PSCA 3VPDA 1ZC3A 1HDOA 5IMBA 2ODEA 4CCWA 2GMWA 2NN3C 3OX1A 1QRTA 4DIUA 3DS8A 1QPZA 1KMIY 2J7KA 5B3KA 2ZRAA 2W9XA 1Y1TA 3MRVA 2JARA 1GNTA 1VPLA 5T4EA 4AWAA 1NDUA 3KKPA 4A0RA 5B57C 5EHNA 13PKA 1MG5A 3EK2A 4CKCB 1ZO8A 5LZ4A 3TZHA 1D1SA 2MJLA 3GVHA 2AFHB 3UJHA 3AF0A 3IO5A 2PZAA 4CM4B 1I3KA 3KP1A 3ELWA 3DM5A 2YJ5A 4CIBA 1BW9A 5CDFE 1CVRA 9LDBA 4BLUA 4OQDA 1T3HA 2J5KA 2E1RA 4TXJA 1B6RA 1EGVB 2NXEA 3WGKA 4D5GA 3OJWA 2PXAA 2MSLA 4CT4B 4UNRA 4E33A 4G01B 1S8FA 1VJCA 1VBNA 4K3UA 2OK8A 1RYEA 3OPYA 4O08A 3U7EB 2AR9A 4MO2A 1YRQA 4BZPA 3A9TA 1EDDA 2O0JA 4F4CA 2ZZMA 4JNKA 1FXWF 3H8WA 1OGJA 1JPNA 2YHSA 1FQJA 3TZQA 4E1BA 1JW9B 4M87A 1IOWA 1J20A 1DC5A 3VO9A 4AJ2A 2B6NA 3CLUD 4C78A 4R0MA 5JCOA 2XSZD 4MWSA 1XMQB 3JQEA 1WXEA 1SC9A 1H22A 2G4CA 2IL1A 2VT7A 5EIBD 3VKWA 4KV9A 1XA0A 4ARCA 4F3TA 5JCJA 4L4XA 2H4WA 4RVGA 2BZ1A 3JQAD 1O8CA 1VMDA 1ZMOA 3AQIA 1E7YA 4TL8A 1L4EA 3JPWA 4X7MA 4QC2A 1LK0A 3F7TA 3G1TA 4URWR 4MCHA 3W7BA 1CQXA 1O0BA 1CWUA 2EFEB 1BU8A 3EGWA 3I32A 3KKQA 3KZCA 4PGMA 4L72A 4MW4A 4M7RA 4CIWA 2I3GA 5H8WA 1V9LA 4ZI2A 1XCOA 2X5NA 1EVJA 1QVVA 3C8ZA 3TGWA 4GDFA 1ZR2A 4WKPA 4M6WA 2CKDA 5FI1B 4DSOA 5CYGA 3PQ5A 3AUKA 1IQ0A 2Q29A 1LK7A 2YXDA 4WJKB 1JSZA 2QJOA 2QVGA 5ADVA 5EJAA 4OL9A 3BSFA 3AOGA 2EAUA 1YCHA 2I8LA 4Q39A 1E20A 2JRCA 1IZ7A 1QMGA 3HK2A 1M8FA 3E2MA 1Z26A 3DUFB 5CT4A 5T64A 1KRXA 3HMQA 4OGKA 3EXHB 1WA5A 4PICA 4LWZA 1V7CA 8ABPA 2WG2A 3MYRA 1SC4A 4N5DA 2H6EA 4WCDA 4XRGA 1WUTA 2CFOA 1AURA 1DTWA 1ZYUA 5KNDH 1HX7A 2CFTA 3ENQA 4H0CA 1L5OA 2QAJA 3F6RA 4MP3A 4E2XA 4EI9A 3KZNA 3U16A 2HA2A 5EI5A 1QHNA 2PJZA 3E9MA 2LVBA 4EEKA 1ZHOA 1MJGA 2YR0A 3UXEA 4EG6A 3AJEA 2C1EA 1AKYA 1C4OA 1N6KA 4O2AF 1FP2A 4U02A 2XE7A 2HF8A 1A69A 1R9GA 4FK8A 5G1NA 3ZGOA 1GQSA 4HPJB 3FMFA 3KX2A 2UAGA 5ENVA 1QAOA 1Z0UA 4OSEA 3JQAA 1Y1SA 4IDHA 1D09A 2DFDA 1N6IA 2EBFX 3FKSD 4NV1A 5C31A 3VPBA 5E7JA 4BUZA 5BRNA 4DQKA 3K0AA 2G72A 5ADHA 4Q6WA 3AUAA 3VKGA 2J0EA 1HDZA 4DDVA 3D6TB 1C4KA 4EHBA 1E2GA 1L7VC 1GZVA 4EG7A 1RBQA 1QWSA 1MD9A 2O0HA 1XVVA 1RQ2A 1I9GA 5EL0A 2NSLA 3L7AA 4Y98A 3VR6D 4MIYA 4HH4A 1JNXX 2ZTSA 4DCGA 1IN7A 4L07A 1PV1A 4ZOLA 1C30B 5ISMA 3STWA 1WU7A 5HR5A 1NRIA 3ZD7A 1M2OA 3LCRA 1LNQA 2Q9UA 5MFZA 2BFWA 1NGSA 2VJBA 3LDGA 2FUCA 5LD2C 2HRCA 4R1UA 1ONOA 3QEOA 3ADPA 3MWEB 4KSYA 1Z15A 2MYNA 3MJ4A 5JAIA 3EEOA 2G8NA 3HGTA 3U3RA 1QX3A 3RAFC 5J58A 5AW1A 3D7KA 3KR2A 4YCBA 1CUZA 3P4YA 1ADBA 4JUFA 4NZYA 2HREA 3PSAA 4IAOA 3KXKA 2AI2A 4U7PB 3BF8A 4XIIA 4XD2A 1YRYE 2FEAA 3L41A 2IHZA 4LZPA 4RK4A 4JGIA 3P0FA 2AYXA 4TYYA 4RACA 1RRMA 4CIVA 3ZVNA 1MB3A 1UBHS 2VAPA 4FN4A 1RWBA 3MAGA 3REGA 4E5KA 3RC7A 3ZDYB 2PBLA 4MQUA 4EEZA 1HMYA 1N5KA 2B7BA 2YXBA 2PS1A 3GL9A 3LZDA 2ZIUB 1YZ3A 3IA7A 3U4IA 2IYVA 4JGBA 2P2CA 5DM0A 2AJ8A 2UUOA 3A70A 4DOMA 4HYQA 1JFRA 2ZJBA 2BFCB 2IITA 3QY0A 4GI3A 5BT9A 5E7QA 2Q5LA 2R7NA 1IG0A 3OZWA 4KLNA 1O77A 3VDXA 3FWPA 3RJTA 3RYTC 2A9FA 2ZKIA 4KG7A 2VHXA 4DCJA 3SHWA 3MCTA 2Q2QA 1HFKA 3ASVA 3TXAA 1WETA 4ZJPA 5JI3E 2AF3C 1V3VA 3JQCA 2GXQA 4UHDA 3MJVA 3NHWA 5HE9A 2XODA 1XD8A 3BBLA 4QOFA 4DIMA 3ZZTA 5JZSA 1GSAA 5HQ3B 3ZXUB 4YR9A 4P33A 5J40A 4BQFA 1MAUA 2XUZA 5DBIA 5SYAA 1D2CA 5H9VA 1IHYA 1D4AA 5B6JA 1SBIA 3CUKA 1IJKA 2CE2X 2C04A 1I30A 5EJ9A 4A23A 1SVIA 2QY6A 3KBOA 4KKXB 2JAPA 3RUEA 2XCRB 4CM3A 1EFVA 5LP6B 3GLIE 1J9ZA 3AX6A 3QXHA 2B8JA 2YMQA 5JH7F 2LUOA 4JKOA 3MEQA 4ZEXA 2ADFA 2O8FB 5GVRA 3NORA 2ECOA 3HGQA 1XWFA 3WRXA 1EFVB 3BXGA 4KGVA 3GIDA 1BVYF 5LP6A 3AL2A 3B8EA 2QRVA 1GRQA 4EJSA 5JYCA 2A0WA 2VPQA 5F51A 1G3QA 2LKCA 4WSOA 2X0EA 3L3BA 5KYVA 4DYDA 3U2QA 2V55B 2JI9A 1RCFA 3GFOA 3JWIA 3RSLA 5KOYA 2HHCA 5BRAA 4UE6A 2GTHA 4XDGA 5L45A 5EXSA 4HDNA 4BKPA 4YRSA 3ERCA 3D4BA 3DAYA 3GDGA 4IH4A 2HUNA 1E9FA 5ED0A 5SY6A 3AR6A 4IRMA 3ZI7A 1A3CA 1VJRA 3VZPA 4BE7B 5DM70 1JLSA 1T5HX 3LT1A 2CNLA 1NIJA 2DAPA 1QTIA 1XU7A 5I7RA 1FK8A 4MUEA 4RA9A 2Q8PA 2W2NA 4X1KB 4Y6RA 1Y9ZA 1LZKA 1YHYA 3AOEA 3FMPB 5FOXA 5I48A 3SDZA 3KE9A 5L53A 1SKMA 4LRSB 2V6JA 4M1EA 4L5CA 5FBVB 5DLPA 1ID8A 4W5HA 2WTEA 3WGZA 4ZZ3A 5EVCA 4UBKA 3DKRA 4HFRA 4LGVA 3U7JA 2QEQA 2WHPB 5SZKB 4AJOA 2XKJE 3G2KA 3D3JA 4EA9A 3BH7A 3A3KA 3EZNA 2AIRA 1LQUA 3HYTA 3O21A 4HAOA 3HCOA 2OXIA 2B5VA 2WPDA 3L7CA 4LX8A 1AQ6A 5ALEA 5FUWA 3J7AC 3K8ZA 1OX4B 2GARA 4B7AA 2O2GA 3W5UA 4G1EB 1TMKA 5KCMA 4JBWA 2ZRDA 1DXQA 1QR6A 3G8AA 4KNVA 3TINA 4KZPA 4EG8A 2R5WA 2C7VA 2VL7A 2XW6A 4NABA 4KO8A 4WN9B 3TXXA 3GLFB 3M6UA 2PRKA 4FD2A 1EP1B 4RQUA 5GIOE 3ZQKA 3G8BA 5KSOA 4FFMA 3DEAA 4A8TA 4D99A 3UN1A 3RC8A 1MIHA 4DJEC 3PDIA 3U4QB 1PDVA 2B36A 1EINA 2ONYA 4Z9YA 9LDTA 3M8KA 2J6CA 1XPOA 2R4UA 4QSHA 4F5EA 2WG0A 2WYVA 1QIDA 1T6NA 2GUWA 5AOCA 5TX7A 1N2EA 1O94A 2R1ZA 3ICWA 1WF3A 1ODFA 1JQDA 4FJ2A 5FPYA 2AUNA 4RU1A 4UVDA 3G5AA 2PUAA 1A1SA 1OC4A 5K0GA 2IH5A 1CYDA 4TQAA 1NJFA 4F6LA 3VZCA 1DBWA 2IPMA 4EBBA 2PXXA 4FZJA 4LJYA 1E1CA 5FORA 3G3EA 3W3ZB 1PL6A 1X7XB 5DBEX 4LQLA 3VU9B 4NESA 1E77A 1L5VA 4GM1A 4MSUA 3BXOA 2OHVA 4MICA 1T6YA 2NNLD 3UMFA 3W6ZA 3QKSB 2D6FA 4OOEA 3P52A 4GT1A 2XNCA 1PX0A 4CQJA 1PN3A 3BRWD 1DKRA 1G98A 4QWMA 4CLRA 3NHKA 1V9SA 4GOKA 1SG6A 2Q46A 1D8TA 3I12A 1C0LA 4S3MA 2X8BA 1VP3A 4L9AA 721PA 1BQ3A 1SXJB 2DWUA 4HQRA 4O63O 1TYZA 4L5YA 2GEBA 1O57A 1U3UA 1WXFA 1PD1A 4O02B 4RS4A 3ZV4A 4Z4HA 1W6UA 4H4CA 4QXRA 2XUHA 3VZRA 1ZVQA 2OCBA 3OOWA 2CUZA 2F4NA 1NN5A 1AG9A 3GLTA 2WFAA 1Z0IA 2X2PA 2A30A 3HU1A 4D5EA 3GLKA 2X42A 3ITNA 3N53A 1CSEE 1ZK3A 2HBZA 2Y6UA 3AF2A 2IYWA 4WLUA 4Y2RA 1CW2B 4HAVA 3VNQA 5JO0A 1KAGA 1Y8QB 4NYMR 2XCIA 1R6BX 4QTXA 3ZZ1A 5CLHA 1BE6A 3HV0A 3ZX4A 1CFJA 1P2BA 4MQEB 2VHQA 2I4RA 3NBMA 4GO1A 1TO2E 1U2GA 3IT2A 3RS8A 3M4JA 1JLRA 1W6RA 1BX1A 2QT0A 3C5VA 2X22A 1KZGB 3VGPA 2UZ1B 3DQPA 4BDSA 4GX5A 7GPBA 2GLXA 5DTEA 1IONA 1T13A 1I24A 2FZ5A 2PKXA 2RH4A 5F21A 1ZK2A 1P3JA 2BEWA 3E84A 4LYGA 2V9CA 3K2EA 1VRWA 4PYQA 1HRDA 1RPNA 4JI2B 1SHTX 1ZC4A 2EFGA 1ZM7A 5FBHA 5FWYB 3A1FA 3BBPA 3DAFA 2QYHA 2NYUA 1LLUA 3EFHA 1A9ZA 4DLAA 2QMEA 1KSHA 4H7KA 3JVIA 3F4KA 4Y1EA 1C9JA 4ZJUA 1GNVA 3N05A 1KC3A 2B1RA 2QXTA 1WZUA 3NTUA 1TL7C 4XSHA 2KB0A 1UADA 3OA0A 3ZTWA 1PJQA 2EP8A 2FQ1A 3E2PA 1GITA 2ZDGA 4FW9A 5AUQA 1SUCA 1KP2A 1AMUA 3CUUA 4KU4A 2ZAMA 3ACCA 5LZ2A 2HM7A 4B5KA 3WL4A 1I7QB 3V1KA 1R0YA 2B1GA 2J9FB 2HH9A 2P1DA 1YUNA 2VYFA 4HLCA 4JT2A 2D5IA 4TRMA 4A3SA 3S7TA 5DN9A 4CTJA 4YRCA 3NDRA 3SHQA 3Q2IA 4XSVA 4NMXB 5ICEA 3ASUA 3WYGA 1RR6A 2DHCA 2VOJA 4U7JA 4CNQA 1P5ZB 4JB3A 5DI3A 3ZWWA 4FMDF 3KDPA 4OG2A 2PMEA 5TV2A 2QX6A 1BJTA 5HBRA 2QLNA 1H3NA 5BQXA 1T2FA 2ZUWA 1NY5A 3TQHA 3KHUA 4GQAA 3B53X 3R7DA 2ZB2A 2OO3A 5DV9A 5KOIA 3KZMA 3QPBA 1VMKA 1VYUA 2FN4A 5E6RA 2ZREA 1FTYA 4B6SA 2YTZA 3QE0A 2TMGA 2OFXA 4H08A 1UMCA 3F47A 4P54A 1V8BA 3ZUPA 3HB5X 3OZRA 4J43A 2BMFA 4HNAB 4N40A 4CKCA 3BJZA 1JXOA 3H1AA 1I1OA 3ZLUA 3TEJA 5DBGA 5TNXA 5HTOA 3F78A 2Y0DA 3K09C 1MB2A 3EYWA 3B1JA 3GIWA 4UDOA 4A10A 3A6PC 3MRTA 4MV5A 4TLEA 5JJ5A 2R8EA 4MR9B 5FOQA 10MHA 1XNGA 3AI7A 5KNCA 3D6MA 3ESRA 4GF5A 5DW3A 4NEGA 1WD7A 3AF1A 4N7RA 3VJRA 2Y2UA 3PC8A 3GDWA 4QWWA 1IBRA 3C24A 1V96A 3QEMA 3WLOA 4TQUS 2IV3A 1II9A 4O2LA 2FPIB 3FN4A 4GSYA 4H1VA 4XOIA 3HNPA 4RS3A 4ZMSA 1QP0A 2GESA 3KOMA 4UTOA 4RTLA 3RS3A 4HDRB 2B61A 2AYZA 1XQVA 4B81A 3A9CA 5BUZA 5I7VA 1J5EB 1SD5A 4B76A 1FFSA 1GV0A 2WJWA 2P4UA 3B51X 5F23A 1TOAA 1UP7A 1OX6A 1KJNA 2LIPA 2YWXA 3K7EA 4TTJA 2IYRA 5IUKC 4ACAA 5LQNA 3EULA 4WXPA 1N8NA 3FMOB 3WGQA 3JAWB 2A4KA 5JS8A 3NKFA 3C0KA 1YAHA 5CHEA 1L8QA 1N7JA 1XRRA 2C57A 2J45A 2VK2A 3ZTYA 5KOJA 3FR8A 4M0MA 2HDHA 2HTEA 1J21A 5IKPA 2XUGA 1HE8B 4DB4A 1NIPA 2O1WA 2PMFA 2R4TA 3KWJA 4MMYB 4MYHA 3VJKA 2CLFB 4FUQA 3SZ3A 1EWQA 5FBKA 1I2ZA 5G3YA 1ZAKA 3VR3D 1BN6A 1K9VF 2Y1GA 3RUAA 2WJGA 2Q7OE 2DKNA 3QX7A 4F46A 2DBQA 1AY0A 1HM5A 2CNDA 3M2TA 1G8FA 3C1OA 3ITEA 5LQJA 1BVUA 2OC9A 4B3BA 1UBNA 1LLFA 1YRBA 1OLUA 3EW9A 3NHBA 3O1LA 3P9NA 3UWKA 5KC8A 2QGFA 3I5MA 2HT6A 3K2IA 1E94E 2G76A 3MSXA 3SFVA 4FOSA 4CF3A 1KK3A 3EIHA 4X64B 3N2NA 1JFLA 2CVPA 5CUQA 4N41A 3R23A 3EG9B 2JKVA 1E66A 4ZZIA 4PWZA 2PX3A 3F6CA 2X2EA 3HYLA 4BQRA 3CH4B 3K73O 4N3CA 2OGZA 1P29A 2D2EA 3SHOA 2XXJA 3NVDA 5HUJA 5BORA 2JFHA 1H85A 1RWQA 3D0OA 3PK0A 4UHBA 1YVPA 3LFHA 3A6KA 4O4IB 4O2BB 2YHIB 5A5EA 4D8WA 1X94A 1Y48E 4CXMA 3S2ZA 2HZBA 4DLNA 2K2QB 1GFZA 3EJWA 2HX1A 3HFSA 2ZBDA 5CA0A 1C29B 1E5DA 1GJRA 1YNSA 4UNNA 1T34A 2KWIA 4LZOA 3BXHA 2G6TA 4R54A 1WDLA 3Q8XB 2VDWA 1P7YA 3ADDA 4RXUA 4H1HA 4Z7NB 1P72A 3H11B 1EB9A 2OG2A 2ZBVA 4WHMA 3TE7A 3HABA 1XZIA 3R5FA 4Q7QA 4IZIA 3RLFA 5AW8A 3QLJA 5L8VA 1OMOA 2QKYA 5A3JA 3HL0A 2B4TO 1RXEA 1JBEA 2POCA 2DR0A 2P6PA 2AOVA 4P34A 4QUJA 4AKSA 2AW3A 1ULZA 1YBFA 4UE2A 4ZN6A 4FCTA 3ITKA 3Q12A 4BO8A 1NZDA 1LWNA 3ILVA 4HGOA 2H4ZA 4DLLA 4W6ZA 4KDEA 2E85A 4XYMA 1J09A 2PGNA 2MYUA 3B2NA 4N9QA 3ZJTA 1F20A 1VFNA 3U13A 1SKQA 6AT1A 4C7XA 4LHEA 4GC5A 4WNCA 4A0QA 5HNKA 4EF6A 1K4MA 3GW8A 4PHCA 1RRVA 1MCZA 2Y77A 5DXFA 1T2NA 2I87A 5DHFA 1NYRA 4JJAA 3CM0A 5AXDA 2QD5A 3OZCA 8GPBA 5IX8A 5IZ4A 5HYVA 1M7BA 2G4VA 1C2YA 4ZHSA 3ROKA 3EPHA 1F0PA 2HXGA 4BL5A 4OHBA 4NU8X 1TTPB 4G2TA 5LLTA 1WBDA 1JQ3A 3H1FA 3L8MA 3QF7A 1I01A 5U4XA 1DRWA 2QTAA 2QVYX 3T41A 1ESEA 1U8UA 1X7YA 1X7GA 2FUKA 3FKJA 3SQMA 4EDHA 1IXSB 4BKMA 5KYXA 2VDOB 2UZ0A 1D6MA 4JQYA 4JR0A 2FX2A 4J3FA 4HB0A 3ZWVA 2CZGA 3OZUA 2VP4A 4C5AA 1WNFA 5FTKA 5D8DA 3RJ5A 4BBZA 1QS0A 2O20A 4IHKA 3FUUA 2QPLA 3FFAA 2V74B 4ER6A 4G84A 2OCPA 1R6VA 1XQWA 4JODA 3COJA 1NXVA 1NL3A 1XJCA 2O23A 1KO5A 1P45A 2C5GA 2F90A 2V5UA 2KS6A 4G5XA 4UHHA 2I2FA 3EFEA 2P9ZA 1GL3A 3VVLA 2YRXA 4F9FA 4BXOA 2H29A 1ODIA 1HT3A 4BU0A 2W6MA 1I4LD 3KKKA 4U9IS 3CWQA 5K6AC 2PX6A 1K8XB 2YZ7A 2ZETA 2RHMA 2VZ8A 1JS1X 4XOUA 2R6ZA 3R8XA 1XFAA 3EGEA 1M1XB 3G02A 3B7GA 2ZTUA 4OBBA 3VR2A 2XMRA 2Q4BA 2V4MA 1RKQA 4TV8A 4UQPA 5FOUA 5FI0B 1TT5A 5IFKA 4JI6B 1HTWA 1N2IA 2H1HA 1AUXA 1A5BB 3TOXA 2O7SA 1A88A 4YJGB 1N33B 3U4HA 1BHQ1 2V7XA 3DOOA 1TIPA 1T4CB 3O2SB 2K5UA 3O7MA 4IOMA 4AROA 3IEMA 5A9TA 4YMTA 4IQ0A 3TI9A 4JSTA 3EXAA 1MX3A 2C2XA 2RHWA 1HF3A 4M6WB 4ISBA 1FSFA 3GGSA 3PNLA 3RC2A 1NXSA 2FZCA 4WL0A 3BD7A 3EIEA 1UAAA 3QUSA 3IESA 1P1FA 1YRWA 2H1RA 3RYFA 2Z57A 2PH3A 2X7HA 3GLQA 2J46A 1IOVA 4CHTA 2XYRA 3RFFA 1I3CA 4CV1A 2I8CA 1TB4A 3OZVA 3PC7A 3RRXA 3BIXA 3H1EA 2G0TA 3V5NA 2ODQA 4LBYA 3OCVA 3ZDXB 4FILA 3ZDEA 2K7FA 1HI9A 3ZE0B 2FJPA 3AHCA 3FUWA 4NCXA 1V16A 1KKLA 3PQ6A 2O57A 1YCDA 3RS7A 4E7PA 5JH7A 3SNKA 3DO5A 3M5WA 3DBIA 3A3NA 1VG9B 1N7GA 1N3IA 4LHVA 5L3RA 1FFYA 4MS1B 1J56A 1QE3A 4LXUA 1IN4A 2F3TA 1WKCA 1X0XA 1Y5RA 2AK2A 3H5VA 4G81A 4PG5A 3I0NA 3ROMA 4CDGA 1GFIA 4GR4A 1K63A 3WLEA 3NLLA 4TLBA 1DCKA 2PZKA 2VSNA 4P53A 6LDHA 1JQJC 1V11A 1SVNA 4Z4CA 2YY6A 2V9ZA 1DUVG 3PQ4A 5TR9A 5JHHB 1KU6A 2HMTA 3FSGD 4RADA 3U7GA 1SXPA 4UAUA 5DULA 3LBNA 2JIDA 4DZTA 4PCAA 3N3BC 3TZCA 3H5WA 1P0CA 1PYGA 1L5KA 4KQ2A 4KQGA 5FKJA 2WI8A 4TVSA 1T1IA 2ODNA 4PRYA 1RHMA 4ALMA 4MDFA 3TJMA 2FFJA 1Q0RA 4GBGA 1ZM3A 4B3RB 1P1HA 1ZJZA 3W5JA 3E7XA 3TW6A 3GLHA 4XQCA 5KC9A 1FMJA 3N2KA 1KQNA 1OFVA 3MAAC 4JI4B 4UBNA 5H4GA 2DT8A 2EDCA 2GD0A 5ALNA 5KINB 3OP4A 5H68A 4ONEA 4LXYA 1TGYA 3FMIA 4IG4A 1I7PA 3PWKA 3STVA 3IDFA 1TZKA 2PTHA 2Z5GA 4ZC1A 1QVWA 4OM7A 2W83A 2JEYA 2PXCA 2H1LA 1VLJA 4R2KA 1R0RE 2GSWA 1JB1A 2P4HX 3DMNA 3OJOA 3I42A 2QPTA 1QNFA 4NFHA 4CG1A 3WLMA 1OFHA 1XJWA 2DPXA 3CRQA 2BELA 3DT6A 3AF6A 2IU0A 3F5QA 1XB2A 3GQBA 4CL8A 2YCBA 4JSYA 4F7WA 4BKUA 3BD9A 3QLEA 1MOZA 3IEXA 2FLVA 2JBAA 2J32A 3RBZA 4KLZA 2HRRA 3CW9A 1M1NB 1KVUA 3OCJA 4X94A 4OXIA 1C41A 1A9YA 5K3BA 1JYSA 3PKZA 4AS2A 2G70A 1AHIA 2NUAA 4NMHA 1FMCA 1RYZA 2ACEA 3KZXA 3MXOA 4JVNA 2X5JO 3NTOA 4Y2XA 3W2HA 3I5YA 1W7AA 3WDKA 3UK7A 4DDUA 1OV6A 4Z6KA 4AKGA 3ME5A 2I4NA 1QG6A 1USVA 4H7EA 1DV2A 5KU1A 1BDIA 2AMFA 3WX0A 4QJ4A 4DR6B 3D2BA 4RDXA 4K6OA 3RG2A 3O5AA 4AULA 4OA8A 5I51A 4UOZA 5ALHA 1GPYA 1W0CA 4X3CA 3KVOA 1VPDA 2ECFA 2XPCA 3G17A 4TWRA 4XQ0A 5TJ9A 3TQOA 4AZVA 4EL5A 4ZOBA 4ZVKA 3OZAA 1KQ3A 5E3JA 3R3HA 2LR0A 3LNCA 4GVXA 4O1IA 1PQYA 3LX5A 4U2CA 3EC1A 3V8BA 4WCVA 2IY8A 1O5OA 1LX7A 2COKA 1HETA 2XVMA 4Q5IA 3PHJA 1XZJA 5DWDA 3TJRA 3MERA 4MI1A 3QYFA 1CS0B 3RYCB 1JLLA 1W4ZA 1XTUA 2ZWMA 3RKSA 5L3QA 4TXNA 1RJDA 2C1XA 3EVFA 3WB2A 5BYKA 1F17A 2B30A 3GO4A 4FMCF 5AJYA 2WQ6A 3HUUA 5H3LA 1Z13A 2IWRA 5C3MA 1PUJA 1KC1A 4WINA 3VVCA 2PKEA 3A1DA 3IHLA 4TMWA 4L0MA 4LXXA 3QXGA 2CFIA 3FPSA 4PBTA 4FGSA 4RQAA 2M6LA 4AX4A 3QJ5A 5CVUA 3L8FA 3PXAA 3II6X 1I2CA 1E1YA 1E2EA 1TU3A 4V2UA 1IY8A 3AUUA 3RSOA 4UVEA 4DIDA 3BREA 3BJMA 5KNCH 5JTTA 3DL4A 4YIKA 3D0QA 2HLPA 1UK8A 2FWMX 5BN3A 1Y9EA 1G4AE 2PZEA 3QOWA 4RY2A 3OI7A 4TV8B 2O5VA 2PAFA 1JDBB 3C4JA 4ZQBA 2V3CC 2JCSA 1O08A 4O4JF 4ZPJA 2JH8A 3AMVA 1II8B 3RVLA 1QORA 3PUKA 4XD7A 1T15A 5FOSA 3O3OB 1NOIA 4HXGA 5C5CA 2NTVA 4BWFB 4B3GA 3SVZA 2EWWA 2NU7B 1EYZA 5KWIA 4EF5A 5HHTA 1PR0A 3H7AA 1QAQA 4G36A 2QVZX 1RXCA 2LW7A 5HE8A 4TL7A 3ZVRA 1C7RA 3GJZA 4WPGA 5SZJA 3THWA 4KR3A 1JI3A 3DNFA 2JJ8A 2LKDA 5JS2A 1KO7A 1AKEA 2XZPA 3HCNA 3PJFA 4Z9AA 1T91A 3DF7A 4HUQA 2WTAA 3R3XA 3D5EA 4YV0A 2QA5A 3DYIA 4DABA 3FR7A 4TRRA 3CXRA 1D6JA 2A92A 2IP1A 1LTHR 3CCFA 2GEKA 2Q3JA 3DPSA 4I1SA 4OGFA 1AKWA 3SS9X 2Z8YA 5T41A 2HHAA 3KHKA 1EGMB 3DZIA 4BCBA 1YIOA 1XXHB 3G2PA 3Q88A 3AEUB 4B48A 2D06A 4R1OA 2WE7A 3ZGLA 1FP4B 3WK7A 5JAQA 4J1SA 5K8CA 4WESB 5AJUA 2HBRA 1XEXB 1P7PA 2QNBA 1V37A 3F73A 2E87A 4UHFA 4C7OA 4R1QA 5E0KB 5KHAA 4ESOA 2OO5A 2PH7A 1R4MB 3IYLW 3H2IA 3LKBA 3RTBA 1J2RA 1AXGA 1DFGA 3FD8A 3UGQA 3R6LA 3WGJA 1BFDA 2AD5A 4CQMD 4UJ3A 5TQ2B 4HAZA 1EVYA 4D8VA 1Q0UA 5ERGB 2QXYA 3F5SA 3HWSA 2E4ZA 3AR5A 2CXTA 2AG1A 3EXIA 2QIOA 1GGNA 1XE3A 2H9YA 3D31A 3H2ZA 4OHXA 2MCFA 1U9JA 1NR7A 1KDZA 2MINA 1PK8A 3OM0A 1ZVKA 3X44A 1PJ3A 5D5PA 3PQ3A 3VGJA 3ZHQA 4FNMA 2ZS9A 3C4QA 4GSLA 3WYCA 2O54A 1I6WA 3YASA 4ZC8A 1ZAYA 3Q41A 1EVQA 2CJWA 3Q7TA 1YA8A 2WJJA 4NTZA 4AYTA 2VF4X 3BD8A 3D7MA 5LNK6 1R66A 1MIOA 2YICA 3EAGA 2GPYA 3Q9UA 4M36A 4Q9JA 5AESA 3ADBA 4CG0A 3EGDA 2YIDA 4AG6A 3E61A 3DNPA 4EPTA 5JWRA 1W0JA 3L1UA 4J03A 2HCFA 2ZYAA 4Z9FA 5EGSA 5KKNB 2D1SA 4QXQA 4V0RA 3LY9A 5JNRA 3H42B 3DT8A 4Q4DA 1EVKA 2EEZA 2FXVA 2C9YA 3JQGB 3S1SA 1R0WA 2R47A 2JHAA 1JEDA 1N2SA 2E4VA 3K96A 1QUFA 2NADA 4IJUA 4L5AA 4L3VA 3W5IA 2R6CA 2BONA 3KTAB 1U2QA 3AJAA 4RAOA 1V1RB 1ISPA 4HZUB 3WO0A 4CGZA 4OUDA 2WKQA 4MLZA 4JL5A 4ZQEA 1NFQA 5LQKA 3K0SA 2P35A 2H1SA 4UEKA 3CRVA 5DIZA 3GNSA 4QASA 3A3OA 4C0AC 3UAWA 1DC3A 2EYQA 3M3DA 4DPKA 5T6BA 4N9WA 4YP9A 2IEZA 2YVAA 4JXJA 3RE1A 3F96A 2PUDA 4MHTA 1BX3A 5T8KC 2AFVA 2GBFA 2RSLA 3HUTA 5DTQA 4RTOA 3LHDA 1OASA 4JLMA 5JCZA 3K6SA 4C29A 4N8SA 4MUNA 4CJXA 5D51S 5JFGA 4DV7B 2XAAA 3BMQA 3RFUA 5IJXA 5K0SA 2I4TA 1JZTA 1X1AA 1WE2A 3GJ3A 3P9IA 3PITA 4AZTA 1TECE 3V8MA 5FJIA 5KJ6A 3AR3A 3SU8A 4AUEA 1O5IA 2COEA 4TT3A 3BD6A 3JTEA 4L27A 1H8EA 2ECKA 4HCJA 4ES6A 1A9XA 1TIBA 3AGPA 3AVUA 4CQLA 2PWPA 4ZVTA 2HB6A 3T1TA 2L0XA 5JRDS 1Z75A 2VP5A 5L3VA 2GF2A 1Z7EA 2GAJA 3KUUA 4HH3C 5FFFA 1AXRA 5KVSA 2BMWA 2V6GA 2AOXA 3N0RA 5BXYA 3NTRA 1XCGB 2J9GA 3CR3C 3MTEA 4QPPA 3RROA 4BVAA 5K3OA 5EHZA 2ZI6A 1XZCA 1JG1A 2ZIXB 4MLDA 2GYUA 1D2NA 1XLWA 4X92A 2YH2A 1QP8A 1ZJJA 2ONJA 1YZQA 2IIBA 4WOPA 2H7VA 2JLCA 4KJXA 1DBSA 4Q3AA 3AM1A 4XB2A 5CLQA 2P9JA 2ZP1A 1UAGA 3F9IA 2RD2A 1IH8A 2C2KA 1LBEA 1HE3A 1W52X 3JWJA 2OSBA 5E9JA 3E03A 2XA1A 4HNAA 4IWXA 2X6TA 5M2QA 1QO9A 3GUHA 3A4TA 3LPAA 1IYZA 2PZJA 3GEDA 4IOKA 4LDQA 3TO5A 2YOFA 4PXSA 2Z95A 1PJTA 4D0RA 1OA1A 2C4TA 1MC8A 2AQ8A 3DL7A 3NB0A 1GGFA 4MR9A 1QYDA 5G1PA 3LO8A 5F3WB 2OY0A 1SUEA 3V42A 4BWVA 3QH4A 5BPFA 5JOQA 5GINE 1T5SA 2IYOA 4RORA 3NIWA 4WWHA 1JIXA 2VT3A 4JN6B 4DWOA 2B99A 2I2WA 1TD9A 3DE4X 3M4NA 5CAEB 1HNNA 3GCXA 5DX8A 3VSDA 3C3BA 1SXQA 4RJKA 2EG9A 2A9QA 3DLTA 3EVZA 1IZYA 1N0IA 1V6SA 1RM5A 2UV8A 4IQ4A 4MPRA 3OLZA 3PQFA 5A4JA 3UUEA 1AQLA 3GCWA 3G2JA 2CXXA 1KFJB 4ZODA 1N5LA 1NJSA 5KWJA 1WDKA 4YP0A 2XNJA 2JJ2D 4DMGA 4CL0A 2C7QA 2UUBB 5FOWA 1VL1A 2Z2KA 3BB3A 2J7PD 3B9BA 4RYDA 2ZUBA 4MRPA 1QGDA 1F9AA 2PLWA 3LUDA 5EMMA 3WZMA 4J6FA 4Q9IA 5JTUA 1Y5NA 3IDAA 4WA8A 1UF9A 3ET4A 5T6MA 1L1EA 1MFPA 3UANA 5IHPA 4CKXA 4XYLA 1DQYA 1T9AA 3GEGA 3SOZA 5CEFA 3NNSA 1R3DA 5F3DA 3R7AA 4PX9A 1AGYA 1M1YE 2VPYA 3CMCO 3HY3A 3U3ZA 3B82A 3MB8A 2P4EA 5A0TA 4HLQB 4ZK6A 3DFFA 3ONWA 4D8UA 5DYGA 3GRRA 2QAGA 1C9DB 4MCJA 4Q21A 4ZAFA 5HKLA 4MKZA 2W0MA 4C30A 3P0HA 4PGAA 2I2BA 2XYGA 2FQXA 4CEIA 2O5EA 5FQOA 2H48A 4OQYA 1SU7A 4DW8A 3AP1A 4X24A 5L3SA 2FPPA 2NP6A 1T3ZA 4LXHA 5CFNA 3VR2D 4UBOA 4OHRA 2NU8A 3ASZA 1RZRD 3TNDA 3NUZA 3EC2A 1RQPA 4RLFA 1K7YA 4ON9A 4JC5A 1MGPA 4F5WA 4A8JA 2XTNA 2IJGX 1U2DA 4GMKA 4HDQB 4PVCA 3WE7A 3OJFA 2I91A 1K75A 3A1EA 4QTYA 5C53B 1XP5A 2HR1A 1WAMA 2Q99A 2C3OA 2UVQA 4PHTA 2X8WA 1BXKA 5IHXA 1IXKA 4DG5A 1FBTA 2Z5VA 3KSDO 1H65A 2WDPA 3TRFA 1Z2EA 4OB8A 2OPBA 2VJKA 4FQ5A 2QNIA 1DELA 1XEWY 1JU4A 3UT5A 1T4CA 4KXQA 1FS4A 1G55A 1SVUA 3IVCA 1EQAA 3R5JA 4LY9A 3TMAA 1SU4A 4JIGA 5A2QA 1M8KA 2JI4A 1AM4D 5B7QA 5K8IA 4JXZA 1F1BA 1BE0A 4FINA 1WBJB 1U9IC 3PVZA 3FUVA 3OH8A 4YMSA 4C4ZA 2Z6QA 1M6HA 1UDBA 5FWXA 1P4RA 4YRRA 4UOQA 1KWKA 2DB3A 1X2BA 1OW3B 1QTQA 1BROA 2WOJA 3P2KA 4NJOA 2FPKA 3USCS 2PZFA 1WMBA 2Q3HA 2MR6A 4GRAA 1RRCA 1XF9A 1BGVA 1WKBA 3B85A 1Q7EA 3C41J 3H8VA 5BUCA 4CDRA 4E0BA 1IAQA 4R0NA 5KTRA 1CR2A 3HKCA 1PLKA 4PZZA 3UYKA 1NV8A 2GEFA 5F78A 3PRKE 1R5BA 4LNUA 2LNDA 3N6XA 4KODA 3CX4A 1G41A 2VZEA 4A6EA 2AI1A 2PZGA 3KQSA 4L73A 1JEJA 4G8JA 4W5JA 4K6FA 3S2SA 4A6XA 3T3EA 3FETA 5AI5A 3AFGA 2E4WA 2GX6A 4BV8A 2JFBA 4GGMX 2PVSA 4BMOB 1MO6A 3QW2A 2HGZA 1QOQB 4DLWA 3PGJA 1O1YA 3JRWA 4EJ6A 3I53A 4V38A 1K2WA 3WTBA 1ISIA 2EKDA 2VF7A 2NNWB 3R20A 3N2GA 4IR7A 2IS4A 2WYWA 2NV2B 2W6QA 3QFFA 2X6QA 3SKVA 4OSPA 1I33A 1AK1A 1YMUA 1O7JA 2XEXA 3JATB 5GVSA 1N2GA 2TMDA 2WM9B 3KYDA 1DX9A 1Z5VA 3OTWA 3FNQA 4NAUA 4G1BA 4Q7MB 4RSHA 5BWBA 1XKLA 1AHPA 3FY4A 4HLNA 3W6OA 2V0NA 1GTL1 1Z5OA 4F2WA 1NX6A 2GB4A 4HBZA 3ZWBA 3JR3A 3GLGA 4IW3B 4AU1A 5KOHA 4J2OA 4RD6A 2JZOA 2ENUA 2QV0A 1HK7A 3AB3A 1R6TA 2NZ2A 3FWKA 5BMVB 1X2EA 5UKDA 3TSWA 3TE6A 4P4SA 2FRDC 3KPYA 4OFXA 1GPBA 4ZOAA 4E3WA 3A9VA 4WN9A 1BGXT 1TQ2A 5AFSA 2HU8A 2FMUA 4NPAA 3FOBA 1CKEA 3GVCA 5AUNB 5TQJA 3WJ1A 1Z4PX 4C2BA 4HX5A 4TTTS 4IIXA 2MSEB 3PC6A 3K20A 2LIVA 2Q2OA 1U81A 2MSDB 2EF1A 2BGRA 5EQFA 4NVRA 4ZRDA 5FUQA 1O4VA 1E2DA 2DLDA 5K3FA 2ZCJA 3PTAA 2ARKA 1Z5ZA 1JR4A 1QGUA 2B8WA 3I2KA 3JYPA 4FQ8A 1KZ6A 4OHMA 4W6QA 3WNQA 1CYEA 1IWOA 4A91A 3RSFA 1SUFA 4YV7A 4IIEA 2ZAGA 2QRZA 1O95D 4JH0A 4ZZ0A 4ZCRA 4HDRA 3A1VA 4L6CA 1U7HA 1YZVA 2TYSB 3TIIA 1QYXA 1R4NA 5L6MB 3OURA 2X6RA 2ZS8A 2Y0CA 2JL1A 1ZWKA 4KR0A 2SCUB 1QZTA 3DBLB 4QFCA 3B78A 4I9HA 5CM2Z 1WQ4A 1ZK4A 4GNRA 1VCMA 3A28A 4WXHA 1H2XA 1PFVA 1ZIYA 4RHUA 3WLAA 2IPLA 1RYNA 5EJ4A 5HA5A 3RRBA 1YQTA 2QTLA 3ZS9A 1UOEA 1SD2A 3ZDBA 4LJSA 3VNVA 4ZJYA 2A59A 5D85A 5FYQA 5EIAA 2QRVB 5F1KA 2OOSA 2VDJA 4QLBA 2XRZA 5KTSA 3GQBB 5D5HA 5FPQA 5JBIA 4EA7A 2G1UA 1S1MA 1UJ6A 2H2AA 1T9KA 1POWA 3GRZA 1QYCA 1NM5A 2R66A 4HS9A 4AUMA 3NALA 2H2WA 3P27A 3OD5A 3T0FA 3K32A 5AM3A 3GJ8A 4F72A 1EESA 3AI2A 4MDEA 1Z82A 4DJJA 4ECAA 4IGFA 3AONB 2IRWA 4IJMA 2O3QA 4RK7A 3KNZA 1NXQA 1UKCA 1XVLA 2IXTA 4KZKA 5DK6A 5B3JC 1YR3A 4F38A 4B2LA 1VE6A 2HIMA 2C92A 4CM6A 1FDVA 2CCKA 1EAYA 1JX6A 1RKXA 1X19A 3HGMA 3L05A 4MINA 5F7JA 1MJFA 5KO2A 3AHFA 1G38A 3V1UA 5I7HA 5BXQC 2GZHA 2QQGA 4JYPA 3T7JA 1RQGA 4RD1A 2ZSUA 1UDXA 4IV5A 4YN3A 2ZJ3A 5LCXA 4TKZA 1ZKMA 2FG6C 5TEVA 3SP1A 4W9RA 2J3KA 3NYIA 4A2WA 4JY7A 2ZZNA 1A2QA 4YRJA 1QDEA 1XZFA 3C3CA 1DKMA 2HIGA 3M6AA 5LR6A 1VE5A 4B31A 1B1AA 4M0CA 3KEOA 3REQA 3UJBA 1ZM9A 2J9RA 1N2CE 3P0JA 3GRAA 1G6HA 3QLVA 4P84A 1V9CA 2J8ZA 4HPXB 1JDNA 3PE6A 4FFVA 3VYRB 5CLGA 4B7CA 1R15A 4DF3A 1Z5UA 3VV3A 3SR3A 5F7OA 3H1TA 3MF4A 4FLMA 4YGXB 4HD8A 2UDPA 1L8OA 4X97A 4IY1A 2VUSA 4I6GA 4LSGA 3L0PA 5EPEA 3D3QA 4AQDA 1UPBA 3P2EA 4FSDA 4D4MA 4LRYA 3WYNA 1BWSA 1Y3DE 5CA1A 1GZ3A 3DTNA 4IJWA 3RIXA 3ZDDA 2Z9CA 1GGJA 4G3XA 2GVDC 3U0BA 3ORYA 4JJ4A 3TGPA 3DMGA 1VPTA 1VRCA 2SBTA 1VL6A 4WNIA 2MYTA 4Z8YA 2GZ3A 5E9AA 1YBMA 3KAKA 1NNEA 1K8QA 1JHRA 3PT9A 2VJPA 3D3NA 1G8JA 2PFGA 1XKXA 3LL4A 4M88A 1DUSA 1MW9X 3L7BA 4OEHA 4TN5A 3V7FA 3QTBA 3TDNA 1BAPA 1OI2A 3VR6H 2ZXEA 3QVMA 3FFBA 4ZAVA 1VJTA 2WKWA 4UULA 4FLFA 2CN1A 3JPYA 5HF8A 2I6FA 1JKJA 3QXSA 4XVCA 3HVKA 4D3YA 1OIXA 1Q1EA 2R00C 4TM8A 4NCJA 4LF5B 3IVAA 1R88A 3JALB 2DR3A 3PFCA 4H7IA 4RV5A 2HQSA 1JH8A 1K5GA 5F7ZA 1DLIA 3DTVB 1NY6A 1AKVA 2YIVX 1PFGA 4IQ8A 1TVCA 4XFKA 5AXAA 4BOYA 4KQJA 5F2KA 4QFMA 1HKUA 1ENYA 3JZFA 4YYZA 1PK9A 2QJRA 4JJZA 3KL2A 5CB8A 2X9NA 4QEDA 3BIOA 2WWYA 1J2JA 5COQA 3ZXXA 2FRDA 4NZ9A 4LRWA 2ATEA 3KB8A 3TVDA 3TLZA 1IE3A 2H1WA 3E53A 2P4QA 1OXKB 2QD2A 3G0BA 2WY2D 1UM8A 3X1YA 2RHRA 3CMMA 2PQMA 4YAWA 1TQ8A 3TKAA 5KX5F 5U9CA 2W6ID 3AYXB 1LDGA 4JP1A 3VX4A 4O59O 4FB4A 3RK0A 1DHRA 5HIIA 3CLUC 3ED1A 3MCWA 2Q5QA 5JFTA 3L8CA 4MVJM 5LP6F 4OY3A 1N4AA 4BDTA 3U4QA 1I0IA 1TU4A 2GF0A 3UWMA 1IL0A 5IJ9B 1F9EA 4KWCA 1XU9A 5EEGA 3PD1A 3ZK9A 3B20A 3AI3A 1MAHA 1L1FA 4YIHA 5F9HA 3FHTA 3ONEA 3SZMA 2HW8A 4F7DA 5DHRA 2R85A 3FCYA 3QE3A 4QOIA 4D92A 4ZYVA 2BISA 2R8XA 3ABIA 5TS3A 5H70A 1H8ED 2O2ZA 4LZWA 4X6YA 1H42A 1BG6A 2XXAA 1DKOA 1LXCA 1EDZA 3CUTA 2BI7A 1OF1A 4K9KA 1FJGB 5DPMA 2I6TA 5FJJA 1OCEA 4J2HA 1KEUA 1E9CA 4ER7A 3QHPA 2CDRA 3WGVA 2WF8A 1KFCB 3V34A 3NBQA 4DGQA 4DV6B 2VYCA 3L40A 3AVYA 2ZSFA 2B78A 4DT1B 3ONVA 4AIRA 2Y0BA 3DR3A 2WUVA 4A26A 2GPAA 4JLAA 3RADC 1HO3A 4NJMA 4EA8A 3CZ4A 4DQVA 1NW3A 4II2A 2X14A 3OECA 3OO0A 4EB0A 3IB6A 3K6SB 3V32A 1OBVA 4EQZA 5C7LO 4ZCTA 3RSCA 2ZB3A 1CHNA 3SAJA 3ZLBA 4X6UA 3IIIA 1G2OA 3F3MA 5FI5A 4BO6A 4TX1A 3KAPA 1U0SY 3EX7C 4A8PA 4DA7A 2CGEA 2L82A 3HZOA 3LUKA 1YZFA 3F5MA 2OXFA 1U4OA 3CW2A 5F2OA 3UMVA 3V8QA 2IWHA 1RBMA 1Z6QA 5HIMA 1XRNA 3U4DA 4A2CA 4G4IA 2B37A 1G59A 2QAIA 4X1KA 1TT7A 5JSKA 4YMWA 1JEYB 1Y1KE 3F4BA 1G5QA 2BC9A 4WBNA 2HHJA 3I23A 2PUCA 5ITSA 1ZI8A 3EPPA 4TYWA 1ZH0A 4MVJG 1U0EA 5B55A 3AETB 4II3A 2OVFA 2YKGA 3CF6R 1PSZA 1PZGA 2ZCUA 3OA2A 4IXNA 1ZUD1 5H02A 3SEFA 2R62A 3ZHOA 3T6KA 3ZGZA 3K05A 4RYLA 4ZQIA 2IHKA 1STOA 5BWCA 1A5TA 3DZCA 3GUZA 4HADA 4QHTA 4RKRA 5KSZA 1JJAA 2C4MA 2GZMA 1YQDA 1C1HA 2YDXA 3P9SA 5C2JB 3WAGA 4RTMA 3AFHA 1FRQA 2NXCA 1XI2A 3KWLA 3DDCA 1QFMA 3DZBA 3B1WA 1E3LA 3L0CA 2O2JA 2TSYB 5DJ5A 5IAKA 2WWVD 3UGTA 4M0UA 4C14A 4F85A 4QBHA 1PZMA 5G53C 2H57A 3SBDA 1X39A 1B0UA 1L7NA 3KRTA 2A5YB 2OBLA 1WABA 4QUGA 5EKTA 5K51A 3TEMA 2B9EA 2DZDA 2DH5A 2I34A 2WYHA 3AYZB 4YTEA 1J8MF 2MSWA 3L1JA 2FRVA 1IG3A 1ODKA 1JMKC 2GD1O 2R6FA 1YQ9A 2BFFA 3H4MA 4R9UC 4DPMA 3S1AB 3V7YA 4JLNA 1PT7A 4R7TA 5CT8A 1TU0A 1P33A 3FDZA 1Q0SA 2M6SA 1CUEA 1X0VA 4NOLA 4PM4A 5ALQA 4M9RA 3FIJA 1NN1A 1R37A 3IPYA 4RA9B 4BO0A 1JDJA 1P8AA 1WEKA 3FIUA 4TS3A 1PWXA 4D9MA 2TMYA 4M8NE 3TSOA 1ZIOA 1A7JA 1B26A 1NVTA 4JQZA 3C1AA 4PFSA 4WNAB 5H9WA 5B1DA 2Z30A 2YYAA 1UXIA 1BKYA 2Y68A 4EG3A 3DL2A 3BFVA 1P39A 5B7PA 2ZTVA 3IAM1 4OJNA 1RRPA 1WO8A 3IUQA 4WXMA 5CNIA 1KOLA 2V1UA 3DVAA 2IXBA 3RTEA 5EINA 2VNSA 3JZDA 5FO0A 2J6HA 4EMTA 1XZLA 3QY9A 4BVGA 2FG7C 3I1IA 3RKUA 3L7MA 2RAFA 3RS9A 4FHGA 3E5HA 1F4VA 2WYIA 3S99A 2PSSA 4DBZA 1E7WA 4AN4A 3I52A 3WNVA 1Y7TA 3DQZA 3VO8A 5TEWA 1E0SA 1KO4A 4JYAB 4X62B 2OHGA 4GOMD 2FX3A 1TKRA 1JPVA 4HG2A 1E8NA 3SX0A 4UZEA 4XLTA 1DT5A 4QNRA 4N0PA 1JU3A 2AG5A 2GA9A 4R9VA 5FOTA 3O8QB 3S2IA 3N8DA 3ZCUA 2QU7A 5IP5A 3TSYA 2G25A 1XU4A 1CZLA 1F2UB 4RHXA 1GPMA 1GCIA 2FEWB 4YV2A 3HPRA 3SMQA 1JILA 5BN3B 2G1KA 1TAHA 2AOWA 3RS4A 4NMLA 2IV7A 4CT5A 1UQUA 1M7GA 3JYLA 2VP3A 1W8IA 1QCCA 1TK9A 4RJ2A 4TRJA 3GRKA 4HR7A 5KQLA 1EE1A 2RAVA 3WMFA 2JPDA 2NZJA 1VYVA 2OV8A 2BJHA 4N6OA 2QMOA 2V97A 3PTLA 4IIGA 3WP0A 1W2GA 4XWAA 2BGUA 1ZK0A 1S89A 4XWKA 1USIA 3D8NA 1PF7E 4PIMA 5EE5B 2IUEA 2ENWA 3HVHA 5F35A 5LM3A 2GN8A 3VZBA 4E2WA 3HDGA 2GWRA 1QFSA 2ORVA 5IBQA 4QOEA 5TJHA 2HWXA 1FYDA 3OX3A 3DFMA 5L4NA 4LV5B 1NJ1A 3BWVA 4PZCA 3SYRA 4MLCA 2J3EA 1CDEA 3S1LA 3UJPA 3DJYA 9GPBA 4I8IA 3BGDA 3O8NA 3OZ7A 4LJ9A 1NTRA 1R8SA 1HDCA 5I8ZA 2AG6A 3H3FA 1XZAA 4IXMA 4IKEA 2A9OA 3FBTA 1Y3AA 4M9SA 3X1XA 1UMKA 4MROA 5LC1A 1YL7A 2AXEA 2JHCA 4O3FA 3L6CA 3OTIA 4A2PA 4DRYA 4LDRA 4DR7B 1XHFA 4K6MA 2FVYA 1K1EA 3RVQA 1XPRA 1X7DA 1WIWA 3OQVA 3KPJA 4W5RA 3KTOA 2MYPA 2PJRA 1FYEA 3I9FA 5ENZA 4D79A 2O52A 3TD9A 2O8EB 3R0JA 3AV0B 3HP4A 1VC2A 5KJFA 3W90A 2W6IA 2XUIA 2XNKA 3NCHA 2XF2A 5KPJA 2Q5HA 3PWSA 1BOOA 2WVAA 4L1KA 3OVMA 3WLRA 1EGAA 2Z3VA 3PWTA 1PSWA 3M6VA 5GJWC 1OFIA 1ZESA 5DTIA 4AZ3A 4YMIA 1OBFO 3MYYA 5C9ZA 1SBHA 2P5YA 2HWYA 1YKFA 4JXXA 1YA4A 4XQ9A 2MOKA 2XJ9A 4BNMA 3FVWA 3D5TA 4TMKA 3O03A 1M0EA 1Z08A 2OFOA 1YRHA 5TGDA 2BJVA 5K0ZA 3WJ2A 4B6FA 4AJNA 2ODTX 4UDXX 3WYEA 2GPBA 1WU8A 1JHPA 1UWLA 4K9QA 4RPJA 5BQPA 1ECBA 4LYEA 1G1AA 1N2OA 1Y81A 4OMDA 3VR4D 4U7DA 4CTNA 2GJ4A 2OHXA 1Z74A 1ONBA 3ESBA 1OC2A 1XLTA 2NO7A 2YMPA 4KYTA 4DILA 1I1QB 4Q4AB 3H3JA 1YJ5A 4CF7A 3DHNA 2RGBA 2AFIB 2CL0X 2Y3IA 5DGXA 5C8DA 2BKAA 3U4MA 1P9LA 4L57A 4IUYA 2B35A 1L5YA 2RMKA 3DVRX 1E9RA 3ZPXA 5CX4A 2DECA 2G9RA 4XVUA 3E9CA 3R74A 1MDFA 2JI7A 3O9VA 2PV0A 2WR8A 2AJCA 2O50A 2OR3A 3UQZA 4E4TA 1Y6QA 3PRHA 1GR0A 3Q3JB 3GGJA 2XUQA 3MLEA 1NRXA 3MTDA 2C7PA 1LDNA 1V11B 5KAPA 4JDUA 4XEUA 4QELA 2EKQA 1KSGA 3S5UA 5KWVA 2WKRA 1KYYA 4KJZA 1JKJB 3CS3A 4J0EA 2DKFA 4CZ2A 3B6KA 3OCCA 3RSQA 3L1VA 4DCTA 2MTBA 3RUIA 3SN6A 4DM3A 4U9UA 3ONFA 1H2ZA 2ZTMA 2VAVA 1LUAA 2Q2NA 4LNHA 5AKKA 4YV1A 4ZI5A 3Q9NA 3COSA 1HWYA 4CLXA 3B6ZA 1HSZA 2XDQB 4X85A 4NBTA 4E22A 3OU7A 4EENA 3LSTA 1SQSA 4L6IA 4EX6A 1T0PA 3S27A 5LBIA 3F67A 5J1SB 1G66A 1FDIA 2JH3A 3DZFA 1WLYA 4EA6A 4Y1RA 3GRUA 2YYSA 1YOBA 4XJTA 3OHMA 4AUNA 2EJWA 2QNRA 1SBTA 3FCUB 3GUVA 4N0QA 1GFSA 1MX9A 2WJVA 2I7VA 3H2HA 3NWEA 3NC4A 3OQ6A 1B8UA 1Q1BA 1V6CA 1GPAA 1N2CA 3AF4A 2OV1A 3WIEA 4Z4IA 3ER8A 2ZAYA 2EJUA 1XQ6A 3VNRA 4X1YB 2PH5A 1KARA 1UDRA 4M38A 4I66A 1QHFA 2I66A 4ZVRA 4J6EA 1JA9A 3IRUA 1SH7A 2C5HA 2VUHB 3EFOA 1CNEA 4V1CA 1PG0A 4Y6QA 2JHPA 5HM6A 1MG0A 1LPAB 1DQZA 1V7ZA 1Z83A 2EZ9A 2VRCD 3NWBA 1VLLA 3O4VA 4PR0A 2GERA 2ZRKA 3CZ9A 3HKEA 3WMGA 4O0LA 1Y34E 5FPHA 1LZLA 1OROA 1AKQA 1QSGA 1W5FA 4ZCPA 1D5WA 1FFXB 5I3CA 4QQFA 4H7JA 1E5TA 2FVXA 3PFGA 3TQCA 2C31A 5EZYF 2XCTB 2AR7A 1VHDA 2QORA 5DZSA 3V8NA 4MITA 3H05A 3KDSE 3WGYA 3H0KA 3QM1A 3IV6A 3A1NA 3F74A 3CLTC 1Q15A 1VKNA 1QJ4A 2GAIA 4YCMA 1UJCA 2VEOA 1J99A 1Q19A 4XUEA 4O2BF 4PEVA 2ZRHA 3O4GA 3KYIB 4KVAA 1VIVA 1J22A 3GU3A 1VP9A 3H87A 1P7ZA 4GEKA 3TNLA 1GUAA 3HDVA 4MVJD 2XE4A 5L51A 4K40A 2IA5A 4UATA 2XVZA 1ADFA 1DKNA 2GJ9A 3E8MA 4IDOA 2VSXA 4A8HA 5A2GA 4JELA 3VQTA 3A6JA 5IWCA 2I3ZA 1LPBB 3UC5A 3DG9A 3L9WA 4II7A 4BGUA 3MJSA 4LDJA 4IWNA 5K0TA 1T8UA 1K3UB 4C04A 1HYHA 2J67A 3TKYA 4YP5A 3F9RA 1P4AA 4QYXA 3K0CA 1EQ2A 3DFZA 1QIHA 1U2RA 1ENOA 2AS0A 1M0TA 4X7RA 5I7EA 2O8FA 2E4UA 1S8AA 1ECCA 3VHQA 5ICSA 1T36A 8MHTA 3PHLA 5AVKA 1WV0A 5F9FA 4UPDA 1JSLA 3GFFA 1NI4A 2QTHA 3I92A 3RVMA 1R4NB 2ATCA 5G4KB 4TSFD 1IJEA 1I36A 3GC6A 3RS5A 3D8UA 2IH4A 2MMCA 4G9GA 3DFIA 4F4IA 3SG0A 3K0KA 3PGVA 4R9SA 1XD9A 3WRYC 3FBGA 2Z2JA 1AGPA 2X1MA 4HJXA 4IIVA 4XQEA 4B45A 4B0PA 3FROA 2FWIA 3I2FA 4FFNA 4EABA 4LC9A 1G3RA 4B43A 5G0SA 1UPAA 5EP1A 3CB4A 3IUYA 3ZD9A 4WLEA 1HGXA 2A2ZA 3GCZA 4IZOA 3JD2A 3GAZA 1S0UA 1CUSA 2JJYA 2LCFA 2Y6VA 4MA5A 3ND9A 4NK4A 1Q7RA 2JIPA 1GA4A 2ZIFA 4HHEA 4MR8A 4L50A 5B3AA 2CNWA 1YA6A 3SPXA 5CFZA 3PIDA 3VR0A 4ESEA 4BFSA 4BFZA 3HJHA 1JR3D 3IAFA 3WQQA 1VL2A 5BW4A 1R0KA 5DE3A 3WLQA 2GLTA 4PQYA 2XQIA 5CG2A 1N6RA 5K3EA 3HM2A 3ORFA 1V8DA 2NSHA 5EMJA 3HCEA 3W8NA 2R8OA 3FNGA 1WXQA 4KN5A 2BMDA 1ADGA 1Z0ZA 2Q0QA 2X58A 3TW0A 1XTKA 1YDFA 3PRJA 4IEFB 2FN9A 2Y1CA 4TOIA 2O1XA 5B53A 2QHXA 2RHLA 2QN6A 3Q11A 2J3JA 2RJNA 3CEJA 4PQEA 2YWJA 3DXYA 4BX8A 1DCTA 1H9CA 2JGKA 4LF4B 3SYTA 3I64A 1YDWA 2GEVA 2GN2A 1GYRA 5TT0A 4AJIA 5AVRA 2VF8A 4A92A 3F90A 3P0RA 4IDNA 1WSWA 2E1PA 5T5QA 5CGZA 1GFWA 4O29A 4BRSA 1CRPA 2X7XA 1Q0PA 3G89A 5EC8A 3IKVA 1NDQA 2W2XA 4TLAA 4AWBA 1VLQA 4N82A 1QIMA 1SUSA 2ROQA 4NAVA 2BVNA 3NVMB 1ZD8A 2GD2A 5EUMA 2QN2A 4QQRA 2WJ3A 1W4BA 4LPKA 5D1NA 5K09A 3C98A 3WK8A 4FONA 2PX8A 3DVSX 4I4IA 3KQYA 4YPFA 1LFAA 2J5BA 1VL8A 2FN7A 1OH5A 1U8YA 4MYRA 2VDRB 2AF4C 2VA8A 1IDOA 2ZJ1A 2G9ZA 1QZXA 4FI3C 4PS0A 4ZQCB 3ZW7A 4DMCA 2QP4A 3T1QA 2R11A 3T7IA 3Q1LA 2BIFA 2GPJA 2H2GA 1WZIA 2C2ZA 3FNIA 1VYHA 3N2YA 4ZAZA 3UNXA 3ADKA 2WJHA 1J0BA 2ZDQA 1T8RA 1XYVA 2GR9A 2JLBA 2DPLA 4OM8A 4DCMA 1ZJ5A 3R6GA 4JL6A 1X1QA 2ADOA 3TDMA 4YAKA 2Z83A 3CVXA 4H3VA 3GMTA 3HU2A 3OZDA 4MV3A 3ZOZA 1DVRA 4FHFA 3CU5A 4LDZA 4OHCA 4PONA 4RENA 2BMVA 5E1OA 2I7TA 4AWXA 4F4FA 1XCLA 2OZEA 3D6VA 4EY8A 3AKDA 3H2GA 3IQEA 3PGXA 2XDAA 4BBPA 1DCMA 1WG8A 2RIRA 1JJIA 5FL7D 1CQIB 2JZNA 5B5SA 1Z33A 3WWCA 2AQHA 4KQKA 2P62A 1AKMA 4LYJA 3TG2A 2FMXA 2O3JA 3WWOA 4IMPA 4KXMA 1I13A 4MKXA 4BNDA 3A0UA 1P2DA 4ER3A 3A0RB 5EQTA 4RVNA 4X1IB 1GPNA 1T29A 2O6LA 4EKNB 3B7WA 1Z35A 1FRFS 1ORVA 1MH1A 2GHTA 4CKEB 3FMVA 5C32A 3W05A 4OH1A 1KHHA 2NYRA 2D4AA 2ZYUX 4LY6A 2H2FA 2JLAA 3AZQA 3DGFC 3OE5A 3SCZA 4J0GA 2FN8A 2GOYA 3GAAA 2YXEA 3HEMA 4FMPA 4KFRA 3WAKA 4H7HA 3EY9A 4E88A 2FPSA 3P2OA 1IN1A 4FWIB 4TZTA 4LV8B 1U90A 1XD2B 3FOCA 1C7IA 3N2IA 4UMFA 2QW0X 2G09A 5P21A 3RSSA 4KVGA 3SE7A 3VYVA 4ITVA 3W9YA 4EB6B 3ND7A 4YCCA 5CFLA 1QP7A 1DIGA 3DULA 5DHAA 3G59A 1LBSA 3P7MA 2WWGA 3A1TA 2ZBEA 2F9LA 3GEBA 1TEHA 4KGXA 1D4FA 4L4ZA 3HA7A 3NT2A 2CLSA 5HBGA 4ERNA 5TS2A 3O84A 2BKLA 2CL6X 4KE6A 2HHLA 4REQB 5DX1A 3U3JA 5KTKA 2GJKA 3LW8A 3S5JA 5M34A 1Z4JA 2I4LA 2J33A 1SBCA 2XYVA 3TIVA 4OLJA 1R50A 2PVPA 4IVQA 2WWWA 4YBZA 2YY5A 3SMVA 1BA2A 1RRKA 3AXSA 2ABWA 1L4NA 3FHLA 3G0CA 3O0TA 4ODIA 1Y37A 1X8KA 2FN3A 2XNDD 2P8SA 3AR7A 3ZZ0A 2AOTA 1P5JA 3SBEA 3T9CA 4DQDA 5HWSA 4WV3A 4NFYA 4CCYA 3B1FA 1C7EA 3HFGA 2AE1A 4U6NA 4ZEOA 5A5GA 3GMSA 4MGKR 3V9AA 3SF8B 3GPLA 1C8KA 1NUSA 3OFNA 1UZMA 16PKA 1AD2A 3AR4A 4DVGA 4O4LF 1FUUA 1R1DA 3C5EA 3M5DA 1COWA 2IC5A 1XDUA 4K03A 4MUHA 2CXQA 4OV6B 4RCVA 3U09A 3I0ZA 1L4LA 1U2EA 2VOEA 4B8WA 2H54A 1GRNA 2CLKB 1RAGA 1VCNA 4B3JA 5FV4A 4JLBA 3DVQX 5TQVA 4Y1RB 4FB5A 3QXJA 1VLVA 4WDRA 3CYFA 1FZTA 1L4HA 1OFUX 4Y7CA 3W2GA 1DINA 3HWWA 1LD3A 4OYLA 3T4EA 1DC4A 1BKDR 2E48A 3BXFA 3NPMA 1KR5A 2Y2VA 2NP7A 3HFRA 3CR8A 4R05A 3TCNA 3TSZA 4LBVA 2ZT8A 3JYNA 2HF2A 3K94A 5EGNA 1E3SA 4RTPA 3UMSA 5BNWA 4PHFA 1DG3A 2WYOA 4MQFB 4P3NA 3I73A 1G5FA 2O7QA 3L2OB 1DZIA 2GZRA 3BCRA 4N54A 4Q6BA 3CISA 5MGNA 3INNA 3BZWA 5E3HA 4I55F 2YFYA 2VYVA 2WWRA 1ZZGA 2AG8A 3VOAA 3R41A 4ENWA 4BBAA 3ZWPA 5KB3A 2Y1DA 2BZSA 1HDGO 2HU7A 3DMPA 3O74A 2PGAA 2G36A 3HN6A 4JU9A 5GV7A 1Z2AA 5LQAA 4NC9A 4YRIA 1CY1A 2E5WA 3QBTA 3DXZA 5AVXA 3CURA 3PHGA 1G4UR 2GD6A 4BAUA 1NBME 1RJWA 2VC2B 3R9KA 2C84A 1PR2A 4FUTA 5REQA 2JLRA 3GBVA 2B7LA 2PMCA 3EXG1 5D86A 2PJDA 2HIAA 3BIFA 3FPBA 4NXMB 1NPTO 2WMOB 2FW7A 1MAWA 2QTRA 4G5HA 3A10A 1FUKA 1MO4A 4IDPA 4YNBA 4I36A 1LTKA 1LS1A 4ZMBA 1U94A 3BKXA 3NJ4A 1A4IA 1IM8A 2PWAA 1J8QA 4YRNA 5DNDA 4IDCA 1GARA 4BV2A 5BV0A 1XQYA 2RH5A 3ULKA 3A4IA 1DIRA 3T1NA 1CZOA 4Q1EA 5MF6A 2GETA 4HX2A 1KY5A 1E2KA 1YI8A 3IPAA 2C5EA 4JJEA 5C8ZA 2EBWA 2OEPA 1QRRA 4JBIA 1ISJA 1RWVA 2BRUA 4HX9A 4XWOA 1VE1A 4RXTA 4C6TB 5JS7A 1P9RA 2XMGA 1U1DA 4B1FA 4RHFA 4F2GA 3RIYA 3Q0IA 1YRLA 5JAOA 3MOGA 3O4IA 1LDEA 3P96A 1P1CA 1KOJA 1SUIA 1M2NA 1Z06A 2EU8A 3BRWA 3DDWA 1NQVA 3F2IA 4IOLA 3QYJA 4NCNA 4XLZA 4Y1GA 1VLZA 2PWYA 3OLVA 2I62A 4GMXA 3PC8C 3PSHA 3DNMA 4INPA 4LK2A 4GZ6A 1SCIA 2GPNA 2PRSA 4FBGA 4LDPA 1MNQA 3SSAA 3TEFA 3P71T 3TRKA 1E62A 1QE0A 5KUTA 4YCDA 2Y1LA 3SX4A 4G8DA 2ZJ6A 3GB9A 4F6CA 4F5YA 5I9MA 1AQJA 2DHQA 2HK9A 4NENA 4QG3A 4B3SB 1PTKA 1ECLA 1HZJA 3AFIA 4HNGA 2WHRA 1SMKA 3LT4A 5CM8B 2AHOA 1M72A 1RACA 3OTGA 3RT1A 5TMBA 3AP3A 4F97A 3KVVA 4FHDA 1C1XA 2C5LA 3OY2A 3TIGA 3SJUA 2W4QA 2BSXA 1WCYA 4EG4A 1E60A 4R8KA 4B2PA 4R7ZA 1REQA 1AGRA 1B23P 1RM0A 3ZNNA 2ANBA 3AUYA 4A36A 1ZX1A 1XAJA 1Z68A 1CUAA 4H17A 1LX6A 4JJIA 4JBLA 4EMUA 1E6KA 4KRYA 3OQJA 1CB0A 1Y0BA 2JD0A 4DTCA 4D97A 1F8YA 4H0FA 4KW7A 1L4YA 4LSWA 4MYDA 4X71A 4BKQA 1SHZA 1J9GA 1RABA 1NI4B 4PTLA 3HBJA 1JHOA 2IP4A 2M1ZA 4HH1A 5EN4A 3WSWA 5IAJA 1Y4ZA 3GWZA 1SZDA 2J09A 4XTRA 5K3CA 1Z9BA 1N32B 2ZEJA 3CSUA 4AQYB 4U5XA 4LJKA 4UREA 3DE1X 1ST3A 3NAQA 1F1JA 4GD3Q 4QYWA 1MJHA 2NXWA 3EDCA 4B3TB 2OORC 1JEQB 2ECPA 3IRVA 5JYDA 1RS0A 1UPCA 3FUXA 3KJFA 2G5TA 2JC3A 2NUPA 4RKYA 3FZQA 4ZHQA 2ZCVA 5LXTB 2N47A 4NG4A 2ON6A 4UC0A 2ZAIA 4YJ3A 1P4GA 2B21A 3TLCA 2XD4A 1RWXA 4HNSA 3IV9A 3FZEA 5AI4A 1JHYA 1N8KA 2I99A 1IWPB 1MPTA 3RREA 4MWDA 1L9XA 1AB6A 3A7EA 3HADA 2WP0A 2SKEA 2ZE5A 3MIIA 3PUWA 3PNQA 5DNWA 5JEDA 4MW9A 1GSIA 3GWGA 5I4BA 1RCTE 5H3HA 4W5TA 1NHGA 2J3IA 1NDHA 3G2MA 3QOYA 4HP8A 5EWJA 1W5BA 3PXGA 1NVUQ 2OVBA 2UZAA 4MZXA 2Q62A 3HC7A 3IIMA 4D42A 2GF9A 2ZYTX 1FFGA 4FC6A 5DSXA 1Y7PA 2O8BA 3ESQA 5CD9A 1W85B 1KZ4A 1DBVO 1EI9A 1L8XA 1Q7TA 2R1VA 1EK0A 5ELLA 3FRHA 4PN3A 2N3ZA 3TB4A 2FMFA 1GUBA 3CPJB 5AK4A 1RMYA 2IEDA 4ND6A 4M83A 2O0MA 1FX1A 3NV7A 5DCUA 3T9EA 3IODA 4BO2A 4Z3KA 3IQWA 1YUMA 3IVRA 1XELA 3TUJC 2JANA 4ZFNA 1X13A 4FE3A 1YRAA 3HKEB 2WTMA 2JVIA 1ZCFA 3CR7A 4CEHB 3VC7A 2IZ0A 5LA6F 4OCZA 4GOJA 4GKVA 1A97A 4RIHA 4MPJA 4Q00A 3IPCA 2SKDA 2FJUA 3MRSA 4JQCA 5HIAA 1MQ9A 2QSJA 3MVEA 5FNZA 1P4HA 1KK0A 1XTJA 3CUVA 1RRGA 1RHRA 1UXOA 1YJQA 2QVXX 4FOTA 4I55A 1RMTA 2R751 3IQZA 3QWHA 2OXEA 3U44A 2ZI5A 1X1RA 3FAKA 4G5YA 4Q1DA 4XM0A 1DADA 5E7MA 4RVHA 3IIKA 2FCAA 1DG9A 1PIWA 3BXEA 4NHEA 5FTMA 1WQ1R 4GNKA 1XMJA 3QKRB 2IBTA 1H3EA 2V7TA 1AZLA 5E2AA 3O3MB 3R6DA 4RKFA 3NOVA 5ADUS 3WRVA 5JZMA 4URZR 3A9SA 5CT5A 3VC1A 3ZE9A 4MRVA 4OA5A 2QLJA 1BU5A 1T0BA 3IJ5A 4G65A 3DDOA 1YZHA 1WUJS 2V5VA 1PR4A 1A2BA 3KU1A 3KYDB 4GPAA 2OB1A 4I4NA 4TYMA 4AF8A 5KYWA 4NBVA 1Y4AE 1GYQA 2JCBA 3SS8A 4AFNA 2GN9A 1KPIA 1EZZA 2D00A 1I4TD 4WRRA 5EZ5A 1SKUA 5AK3A 2FGJA 1G8MA 4EHDA 3G6KA 2BE9A 1Q0ZA 1ZH4A 3L0OA 4TGLA 5AT1A 3NWOA 2B2NA 2QZZA 5AM5A 3DDUA 4C6RA 4E5MA 1NVGA 2ZB8A 4PHHA 4HQ6A 2O8DB 4Q12A 4GPEA 2OAP1 4P4GA 4V2IA 1EHYA 3JY6A 4OI2A 3JYHA 4LJRA 1D2AA 3MELA 1TC1A 4TSKA 3UBTA 1KJJA 1L7DA 1AF7A 4XVQA 3V3TA 1Q95A 2FR0A 1Q3TA 4UE3S 2SKCA 4HYYA 5EWLB 4AQ7A 3VU0A 1LC3A 2LRHA 1WXGA 4Q02A 4EUHA 3JWPA 1TTTA 4NMMA 4FCWA 1EAMA 2WNSA 2BGWA 3V4SA 2CFRA 1JSRA 2R1UA 2H1IA 4KDFA 2VJCA 1SHLA 1PHRA 4YDQA 2ACWA 3E3OA 1YS6A 4FGUA 1QYRA 1VG1A 3ZIDA 1BOFA 4UTPA 4P2BA 4BNTA 5EXEA 5C1OA 5IM4A 3RGWS 5G3ZA 4AKTA 1UM9A 1DAMA 4B7UA 2PBRA 4MWOA 4JWKA 4MR7B 2PGIA 2Z43A 2W2KA 3DEYX 1T9CA 2R8RA 3ZZMA 1BCSB 4HGPA 5IBCA 2EGUA 1U2TA 2J4CA 2VLIA 2FW9A 2VDMB 4FZ3A 1FP6A 5IU6A 1TFUA 5JDIC 5GJCA 1NKSA 1WF6A 3IUNA 1RRFA 3GLHB 1DEXA 4PTZA 5BVHB 2REXB 3TLGB 3FLAA 2ONKA 3JD3A 2VP6A 3WRYA 3GT4A 4NYMQ 5ILQA 1MV8A 2QRMA 5EKSA 5EWMB 2F3QA 3KPWA 2IEIA 3L49A 3UH1A 2WABA 3R3JA 2PNFA 1N0VC 4ZKEA 5HP4A 2AHRA 2X8LA 4QU0A 1J6UA