3H0KA

Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
177
structure length
171
Chain Sequence
KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAGERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
molecule keywords UPF0200 protein SSO1041
total genus 54
structure length 171
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h0kA00
3ZLJA 1P3JA 2GDJA 2PZGA 1E2IA 2WIBA 3GLIB 2YNMA 4BFUA 2NO1A 4BECA 1Q0UA 4LHVA 4XSGA 1M8PA 4DC9A 5FOVA 2JJ1A 3QSYA 2FZLA 3FHCB 1DOAA 1NVXQ 4B3CA 4AURA 4D2IA 2JLVA 3EARA 3CR7A 2JLSA 1PLKA 3HU1A 4Q7KA 1DS6A 1KOFA 2UVQA 2G0TA 5AUOB 2GEVA 4XVUA 5B58C 1N0UA 5L3SB 5EE3A 2WAYA 4IFBA 1X1SA 2FGKA 1SVMA 2RHMA 4TQ9A 2VSFA 1U94A 3I8SA 1JR6A 2DFLA 4I1VA 1CLUA 4A2QA 3GLIA 2WVJA 2QSZA 1IQPA 4C4PA 2GWHA 3KX2A 1G5RA 3B8HA 1Q12A 1QHHA 4NPHA 2YOGA 1L7VC 2HT1A 2G9NA 4IDHA 1OYYA 1FZQA 2ERXA 3MRSA 4TSFA 1UBCA 2ZSAA 1XDBA 1VTKA 1N2CE 4KO8A 4EJSA 3W3ZB 1E4VA 2ZJYA 5K8TA 2GEUA 1TX4B 4PSKA 3I1FA 2DBYA 1JXMA 2PLFA 4V0MA 1GITA 3AVQA 3WMFA 2W2VA 1RYFA 5D3MA 2PCLA 2CL6X 1MV5A 8OHMA 1UDXA 3C15C 1P73A 1KDOA 4UNPA 3T61A 4X8HA 3T5GA 4DUGD 5KNDA 3VNUA 2IYZA 1K6MA 2PCJA 3ZS8A 3TKLA 1VCMA 4TTRA 2IUSA 5FR1A 5J4YA 3PVSA 5IK2A 4D26A 3ASZA 4M1SA 2QPAA 3WBKA 3DHWC 2C5LA 3V00A 2KSQA 2IYSA 1Z83A 4DBLC 1JAHA 1QHGA 3NC0C 3EC2A 1G3QA 2ZE8A 4PPFA 3KJHA 3SYLA 2RCNA 3T5DA 4BZXA 4IOMA 4YMWA 1NRJB 3DM9B 4NYIQ 4QGFA 5FBWB 3RRNA 5J4LA 4URXR 2JEOA 5EXPA 1NJFA 3AF3A 4XOIA 1DAGA 4Q1DA 3MD0A 2D2FA 1T4GA 1X86B 4Q5IA 2ANCA 2ZRBA 3LQQA 4Q4AA 4G1UC 3DMDA 1J7KA 1O3YA 3Q9LA 4LJYA 4IVRA 1T5LA 2FV8A 1ZW6A 4WXPA 1P5ZB 3ASYA 1NVVR 4O0MA 4TYPA 4E03A 5FH9A 4GL2A 4EKDA 1E2HA 4GZMA 1E2NA 1JB1A 5DSZA 1DPFA 2V6IA 1TQDA 4XH9B 3GLGE 2NMVA 3UG7A 3O8BA 3QKRB 2GJ9A 1XPOA 2ATVA 5KSOA 2OSBA 5G3YA 1F48A 2QM7A 1W4AA 4PC3A 2UZ3A 4GMDA 4B33A 2ZSFA 4EPXA 2AD1A 4HDCA 4C3ZA 2J3EA 3A58B 4XTCS 3SFZA 1LTQA 5KSYA 4FI3C 1QVRA 4EJSB 4M0LA 3LA6A 4NTZA 2KJQA 1KDRA 2JATA 4XIGS 4YQFA 1D8TA 2A5JA 1FTSA 1E99A 2XB2A 1PVOA 4M1YA 3FOZA 1NG1A 4NU0A 2GK7A 1XMSA 3IO3A 2J87A 3T35A 4A2WA 1T6NA 1E2EA 2WSSD 4TYYA 1CULC 3R8CA 2NG1A 1XD2A 4D0NA 4LBWA 2ZYVX 3LWNA 4GZLA 4P32A 1E94E 1E69A 2VL7A 4D0LB 3AKEA 2J7PD 4KAXA 3V4RA 1RJ9A 3R9WA 4UNSA 3U4QB 4EFLA 1KI7A 2QSYA 2OT3B 2QAGA 2Z6VA 4B76A 1UBFA 4IOLA 6Q21A 2WWIA 1MO6A 1Z6TA 4TLDA 4CZ2A 2IA5A 4UKDA 4HDOB 1LF0A 2W00A 1E96A 2AWOA 3U7GA 2C2HA 3CRQA 1AZTA 2QQEA 3SJAA 4A92A 4E22A 2JLWA 3GLHE 1GAJA 1R5NA 2GKSA 2H1LA 3IBYA 1VDZA 1OT3A 5KSPA 5GJWC 4QL3A 1II8A 2Q9BA 1EFRA 3DEFA 1RRGA 4JS0A 1EFRD 5C4GB 4N1AA 3JZAA 3Q5DA 4GBMA 1A2BA 3ADCA 2OUKA 4RKEA 2WJHA 1ZJ6A 1KJWA 3MLEA 4HSEA 2ORWA 4B43A 5FUVA 1U98A 1OE0A 5FBLB 1AGRA 1XRJA 1ZM9A 2C8VA 1NJGA 2WOOA 1DAFA 1Z22A 3I73A 5DHFA 3MJRA 1U8YA 3CWQA 2FSHA 4IEIA 1OH7A 1TEXA 1G64A 3VR2A 2Z83A 3CH4B 2VHQA 2VP2A 1HEIA 2CJWA 4M8NE 5AJYA 4CVNA 1GNRA 4QBFA 4TQAA 2ZEJA 2EWVA 2RGCA 2ATXA 3VR1A 2XNSA 3AVPA 4JT2A 5BYJA 4ESVA 5JLJA 3NBYC 4X8MA 3B7GA 1VIAA 1EK0A 1VHTA 4RFVA 1Z3IX 2VF7A 2V7QA 1JPJA 2I1QA 3ND8A 4II7A 3LW7A 1IXSB 1KMHA 4E09A 1LF5A 1FL9A 3B82A 2ZVPX 4ZCMA 5J4HA 1SXJC 4AI6A 3THYB 2CHGA 2V9PA 3BXZA 4PQRA 4BUJA 1TF5A 1ZM2A 4HZUA 3MWYW 4DXAA 3K9LA 5EP4A 2ZTSA 1KZGB 2QU8A 4A8JA 3W9YA 3TE6A 5HCIA 2IUUA 4A4DA 3ND9A 1Z08A 1HE8B 2GAOA 4G5QA 1DBSA 1E9EA 2YYZA 3JZMA 4B3FX 5LPNA 4IXNA 4URUR 3PEVA 4IDNA 1QVAA 2IHYA 3ZYCA 4JLMA 1FMLA 3ADKA 1GRRA 4PPGA 1FQJA 3FMOB 3IBGA 1GRNA 5KDOA 1RRFA 1MO3A 1PUJA 4AK9A 2Q3FA 4EQ6A 2Q3MA 3IPYA 4BQSA 4QJ4A 3SJBA 1LB1B 3WRYC 4A36A 4NCNA 1NY5A 2XJ9A 3AF0A 3WMGA 4EPWA 2AFIE 5J40A 2DPXA 3BK7A 5DIFA 3THWB 2FEOA 2ZR9A 4RD0A 4P3YA 3VR3A 1OB5A 1TUIA 3KJEA 2J45A 4DJTA 3GJ6A 4RZUA 821PA 4CYMA 4IW3B 2HYIC 4C2TA 1N6NA 2MSEB 1BKDR 3GEIA 2AKYA 1GRQA 4KVGA 4P4SA 2FWRA 4F91B 4UNNA 4US0R 4HLUC 2PZFA 5TARA 1CKEA 4F38A 2HUPA 3EASA 4MKFA 3HWSA 4EAQA 2C98A 2D7CA 4LY6A 3K53A 1NBMD 4O2RA 3ETLA 4MUAA 1RJ9B 2ZYTX 4NBSA 4CF7A 4POAA 2QGZA 1E9BA 2HYDA 4BWYA 4LHXA 2JJ8A 2NQ2C 2QN6A 1TQ4A 1KTVA 2C95A 2WWGA 2ZU6A 2ZVQX 3Q7PA 5IDVA 5KO2A 4Q1AA 4Q9LA 5AUNB 1PZNA 4M1KA 4KLNA 3TSZA 1V5WA 4UNRA 4DEXA 3NBXX 1D6JA 1RYHA 2GVDC 3AP3A 2P5TB 1IOZA 4GSYA 4PSAA 1L4YA 2A7QA 3QF4B 4A2PA 3KDSE 3NTUA 2ZJOA 3SOPA 1TUEA 2REXB 2W6IA 1GKUB 4KYUA 4LJ9A 4URWR 2BV3A 5FPYA 4AD8A 4DB4A 3WXMA 1KI6B 4OBEA 1N6KA 3MG9A 5JWRA 1B0UA 3KTAB 4BLOA 1DADA 4A1FA 4KSBA 1KSFX 1QRAA 1ZUHA 4OKSA 2GNOA 4TMVA 4GI7A 1HQCA 1CJKC 2PX3A 1RFLA 2V3CC 3BOSA 1ZIPA 2V1UA 1M74A 3BFVA 4PAMA 2VP4A 3P20A 5IHPA 1WBBA 3F5FA 1P60A 5B30A 1I2DA 3U4QA 2ZUDA 1P4SA 4LGMA 3RDPA 4A9AA 3JVVA 4Q4AB 2J41A 3BWDD 1JNYA 3CNNA 1KO4A 1BOFA 2BHRA 1VCNA 2BOVA 2W2TA 2XX3A 1J2JA 1FUKA 4MRRA 5J47A 1G7CA 1NF3A 1SKYE 3A36A 4LUCA 1JQLB 2CVFA 1ZD8A 3EWAA 2RGBA 1W4CA 2XJ4A 4TLCA 5A5GA 2C03A 3TVDA 1IM2A 4NYIR 4QG7A 1JAIA 1Z6YA 2CE2X 4EPRA 1UEJA 5JEDA 1BMFD 4JVMA 1S9DA 5IT5A 1S3GA 3LVQE 4HDQB 1DE0A 1OXUA 1SZPA 4H1UA 4DB2A 1E2GA 1XBTA 3K9NA 1KYIA 3VFDA 2ZXUA 3F0TA 4ABYA 4BFSA 4HYYA 1R5OA 4ZO4A 3W90A 2BVNA 1XWIA 1NBME 3CRMA 4FINA 4EFNA 4OHXA 2J0SA 4Y0VA 2QQ0A 3ZIAA 1DELA 1L4UA 3EIEA 4IXMA 1E79D 1S0UA 4ILEA 2Q21A 5HE8A 3U6BA 3D6TB 1MR3F 1NIJA 4NCHA 1XJ0A 5HE9A 4LZZA 4M1MA 2QORA 4EIWA 1SHKA 1QG4A 4B6EA 2Y8EA 2NGRA 5FOSA 2XOKA 1YU9A 2PL3A 5TVKA 4GOKA 2IHBA 3AUXA 5DH9A 1XD9A 2NPIA 5JCPA 2X2FA 1COWA 3N2IA 4M9ZA 4YXWD 2DWOA 1HY3A 1Z29A 1ZNWA 2QAGB 3IGFA 1IN7A 4MGKR 4PXAA 1CJUC 1G291 1SGWA 4XD7D 4PC1A 5EQTA 2QBYB 3ZD7A 3C14C 3BH7A 2VRWA 3EIQA 3P26A 2GXUA 3AP2A 4ZCLA 3THOA 2J0QA 3BGWA 4LBZA 1XTIA 3LAWA 5D3QA 5C2JB 4YONB 3I5XA 3OESA 4PZLA 4XJXA 4B48A 4UXHA 2GZHA 1R0ZA 2J46A 1P62B 5EP3A 3ZZUA 3ZZ0A 1MO5A 2Q0HA 2RMKA 3V9PA 4W5WA 1K8RA 2XXAA 1E0JA 4DLRA 1P9WA 1JECA 1E2FA 1S3SA 2DCUA 2KI5A 1H8HA 1NI3A 3A8TA 3C5HA 3A4MA 3KL4A 1H8HD 2H57A 2H8KA 1L2TA 3P32A 3B1VA 3AVWA 4OI1A 3O8CA 2O8FA 2H92A 2J7KA 1T5IA 2ASEA 2WTUA 3OEHA 1EWQA 1PJRA 2V6JA 2AWNA 2GCOA 4GFDA 4LC0A 2ZR0A 2BEJA 3C4JA 3HU2A 1FFHA 4EQ6B 1U9IC 2A2ZA 1JR3A 3AF4A 5CJ2A 3C7KA 1JALA 4IOKA 3SJCA 1DEKA 2IX3A 2QE7D 5EUMA 1ZNXA 4D25A 4RCZA 3VU9B 1M1YE 3P1JA 4JL5A 2RB4A 4JIMA 2X2EA 1ZINA 5CYOA 3E70C 3EZ2A 1SKQA 2ZUCA 3L8ZA 2PBRA 1GVNB 4Q1FA 4ZPXA 1UKVY 1QG2A 3CUEF 2AX4A 4U7DA 1HYQA 3REGA 4Q9KA 4ZIRB 1MT0A 5FR2A 4C0LA 4US1R 5H8WA 1XJCA 4GOXA 4L9SA 3L2OB 1E2KA 2ZI6A 2PJRA 2QA5A 1NVUQ 3VX3A 2HXSA 1W2HA 2AHOA 3SC3A 2UKDA 4YC7A 1G5TA 4NYMR 2J0UA 5LB4A 2LWIA 1D2NA 3VR5A 2ZU0C 4GP6A 1GOTA 1YR9A 1R0YA 1ODFA 4HB0A 5EE1A 4ZIRA 5DE3A 4EDHA 1P72A 1VYVA 1GUAA 4BLSA 3O47A 3NH9A 2VHUA 1E9RA 2FSGA 4MYCA 3QEJA 2YHSA 4Q03A 4UQOA 2JDID 3DZ8A 5FUXA 3R8FA 4EFMA 2YV5A 3EC1A 4M4SA 1A4RA 1HA3A 3C8UA 4QC2A 5FUYA 3CNLA 3IILA 2CDNA 1TQ2A 2O8BA 3U3RA 1XEXB 4RFSA 3IDQA 4FCTA 2ZRAA 3LO5A 1TQ6A 2WWXA 3TSOA 4Z8YA 5TV2A 1Q57A 3SR0A 2FA9A 2WJVA 4QJ3A 1SVSA 2AXNA 5LDDC 2B8WA 2C9OA 3K0FB 4DIDA 3ZGXA 2WWHA 3RC3A 1S1CA 3OHMA 3PEUA 3ICQB 5JCZA 1XXHB 3OIVA 3R9IA 4BLPA 3T1VA 2XXAB 4B2PA 1AS0A 2FFAA 2BKUA 1KI3A 3K70C 1VG9B 2EFHB 5FPKA 3SI7A 1G3IA 3CR8A 3QBVA 2REBA 3MWJA 2HT6A 2EQBA 4WAUA 3R7WA 4B44A 1KMHB 1ZBDA 2ZI7A 1HURA 1G3MA 1E9DA 4MITA 1PUIA 3W6NA 4OK3A 4OI2A 5E4FA 1C1YA 1FNNA 1N5JA 2QZ4A 5FFMA 3TLXA 4R9UC 3GLFB 5BN5A 3QPVA 4IDOA 3SBEA 1G7TA 4KFUA 4BEJA 2DY1A 2XOKD 3FFAA 5JS7A 4TQUS 1U0LA 1Q1ZA 4KCGA 1N6PA 2ZQ5A 5LD2B 1Z5ZA 4QGGA 3U2QA 1G16A 5FL7D 4XSHA 2FJUA 1AS2A 4L8GA 4DEYA 2OLKA 4RD3A 4P33A 2AXPA 2JGNA 4RZ3A 4WW0A 1DARA 4FMDF 1S2MA 521PA 1ZAKA 4K8OA 4MRSA 1Z6GA 2IXFA 3B2EA 4Z1MA 3U7EB 5DI3B 2IYQA 2BJWA 1QDEA 2QAJA 1RZ3A 4Z8XA 3THWA 1AIPA 3AF2A 3EZ6A 3OEED 1W48A 1HT1E 3NIBA 1N25A 3AVTA 1ZUIA 2ZSDA 1N6IA 1OPXA 4LV6A 2ZROA 2ZR7A 1KI2A 2DFTA 1OF1A 2AK2A 1F6BA 1CR1A 2AR7A 4NCKA 4V02A 2DB3A 4L9WA 2WV9A 2QP4A 2R65A 4B47A 2NZJA 1VPLA 5HKKA 3IIJA 3IIKA 4G3XA 1E0SA 1ESMA 1F5NA 1GNQA 3DOFA 3T34A 4AYXA 4ITRC 4RFSB 3BFXA 1H8EA 4KVAA 1J70A 4TL6A 1XMIA 4KI0A 4QNMA 1NL3A 2OILA 3QBTA 5B2ZA 1II9A 2N46A 4Z51A 4LBVA 4R98A 3PITA 5AR1A 1U0HC 4Q7JB 4P4TA 3B78A 4CDGA 1G18A 1CJVC 5FPHA 4ZDJA 4CW7A 4OHWA 3NEYA 3THXA 2C9CA 3CX6A 2HJGA 5CB8A 1T3HA 4M1TA 1W4RA 1OKKD 2AFHE 5EE5B 1KAOA 1Q1QA 4O2LA 1IY2A 1XCGB 3EW9A 1M34E 1G5PA 1FUUA 3VHLB 4BFZA 2GESA 1BH2A 2NO6A 3UANA 1YZTA 2IL1A 5BN4A 1DVRA 2FFQA 5HZHA 1U8ZA 4B6FA 2GJKA 1ZP6A 1OXSC 1J99A 3AH8A 2F1IA 4MUBA 3SZRA 3X2SA 1PLJA 3QENA 3TR5A 4UXJA 3GQBA 5BN3A 2IS4A 4URVR 3PQCA 4IRUB 2WBLC 3UIEA 2GXSA 2CJWB 3E5HA 3PENA 1F60A 3DOEA 3IPXA 3HR7A 3S1AB 1D2EA 4IVPA 1XMVA 4XD7A 4WZBE 1DTSA 3G82C 1X6VA 2RGEA 3FYHA 3RNLA 3CRVA 3FKSA 3FMIA 2BBSA 3CLVA 2GCOB 4CT4B 1XD2B 3BAFA 2G77B 5CK4A 4TL7A 1NN3A 3RRMA 3UXMA 1G41A 5C4MA 2AD5A 2QL6A 1XPUA 4FMDB 2CVHA 4L5BA 5L3RA 4GRAA 2O8EA 4B3XA 2OCYC 1I4LD 2ZRNA 3GFTA 1AJEA 5H70A 4CEHB 5FBVB 2JIZD 3AQ4A 1Z0FA 2LKDA 3UMRA 1N0VC 5EXSA 3K0AB 2JDIA 3AGPA 3I4LA 3TW4A 1OSNA 2BMDA 1NSTA 1F2TA 5KPJA 1W1WA 3CPEA 3L0PA 3BERA 1Z0AA 1OFHA 2VF8A 4CEJA 1CRPA 1P2TA 5ANRB 2QGNA 1W46A 3PIRA 5CIQA 121PA 5L3SA 1E2LA 1WE2A 5HZKA 5JECA 3QVVA 1G21E 3LBIA 2G83A 5JMTA 2VIIA 1T91A 1G7RA 3LX8A 3GJ4A 4Q4HB 4A6PA 3SFVA 5AWFC 2JIZA 1IXZA 4LRWA 4S35A 1FNMA 2ZRCA 2BMEA 2J1LA 3DZDA 2OXRA 3ZQJA 4M1OA 5FUWA 1I2MA 2IK8A 1GKYA 4OQMA 4C0SA 3UPUA 5AJWA 2RH5A 2UZIR 1ZNYA 1E1RD 2ZSBA 2AK3A 3CBQA 3BBPA 3ZZTA 4I1UA 4IOJA 2JJ2D 2A30A 2QMHA 3T12A 5E7JA 4D80A 1TTTA 1KIMA 1X1RA 4FXPA 1E9FA 1RW4A 3NKVA 1SQ5A 2RGXA 3QKRA 4M9QA 5FOXA 5HTKA 1NP6A 2VSOA 2D74A 2ZYUX 5A0FA 4C0BA 3FVQA 3U3JA 1TF7A 2FH5B 4NKRA 3SE0A 5F98A 2FN4A 3SYKA 4Q7MB 5EP1A 4JLDA 4LHWA 4QKQA 4OI0A 1RKBA 1NLZA 2B8TA 5L3QB 2NO7A 3BFKA 2FNAA 1SXJD 3HP1A 1Z6AA 3MSXA 1CU1A 1JBKA 3D3QA 1M7HA 3QNUA 4MYTA 3RABA 3GLFA 3GJ8A 4DZZA 3QIAA 2QI9C 1M7BA 4TWZA 4BZPA 1NN1A 1RVDA 2J59A 3U44B 2O52A 3HYTA 1YQTA 2YWEA 3AEZA 3BJIC 5FTNA 1KO7A 3PUVA 2H7VA 4ZKEA 2G88A 3QI2A 4O25A 4CEHA 1QZXA 3UMFA 1W44A 3CRW1 4H1VA 1AM4D 2OV2A 4PZYA 4U00A 4OJKA 3VR4A 2D3WA 4CGZA 2WOJA 1PV4A 4NHOA 3NC1C 3KQNA 3U5ZB 2BMJA 3A1VA 1XEXA 1FP6A 3RWOA 3GJ5A 2BCGY 5CDFE 4Q4LA 3SQXA 4MQBA 3NEJA 3CW2A 1Y3AA 2QENA 2EFDB 2W6ID 4R7ZA 5EJEA 4JBXA 4PX9A 2B21A 1J90A 1DO2A 1E0KA 1II8B 1ZM7A 1S4QA 4M53A 2XITA 5AJVB 1W36D 4LC1A 4NONA 1HV8A 2OAQ1 1XMJA 3R9XA 1RRPA 3RWMB 1E4YA 2ORIA 2JJ1D 4ERNA 1T0HB 4DCNA 4CRWB 2VP0A 1P9NA 2ECKA 2GF9A 4GMXA 3B9PA 4RD4A 5FPSA 2F9LA 3KKNA 4WOPA 3Q72A 1KI8A 3VR6A 1R8QA 2XAUA 2O0KA 2KWIA 4E07A 4ZKDA 3FMFA 5TY0A 3B13B 3NXSA 4OK5A 3TUJC 1ZYUA 3SJZA 4ARZB 2IW3A 3QUSA 5JWHA 1G3RA 1YHNA 1CIPA 1MABA 1WQ1R 1N6HA 5TMPA 2DWPA 5JJLA 1EFTA 3OE7A 5JFGA 2ZM5A 3EX7C 4HB2A 2P0EA 1CR2A 2BBWA 1QHXA 1YE8A 2VQSA 3OIUA 2FX3A 3AVYA 2JLYA 5FPTA 3MWLA 1P7CA 4MGIR 2IEZA 1G19A 1ZCAA 4OQNA 3PXGA 4BE7B 2QTHA 5EE0A 2FSIA 2WPDA 1W7AA 4TL9A 1KMQA 5CLLA 4OHYA 4EPVA 4BPBA 4BFVA 3PEYA 3RRZA 3BH6A 421PA 2PT5A 1G9XA 4Q7LA 4F4CA 4LSGA 3FWYA 4RD2A 1A5TA 4JLJA 4GT1A 3RS4A 3AGQA 2EVWX 1X8LA 3T06B 2Q9AA 2HLDA 2QROA 3NG1A 1TU4A 3T1OA 2CBZA 4JVSB 4PHGA 1CJTC 4YMUA 2WJIA 3KUCA 3GEEA 4TT3D 4JKYA 2ZRKA 4MRVA 2G1JA 1KO8A 2VSXA 3CZQA 2CL0X 1R7RA 4MRPA 5FOUA 5SZKB 3K09C 4DLUA 2C77A 4BZQA 5CJPA 5GADl 3DL0A 3EPHA 3GJ7A 2ZE7A 4IDPA 4LWZA 3WP1B 3BB4A 3L0OA 4P31A 3TQFA 4HLUA 1KK3A 4UJ3A 5JI2E 4Q9HA 3GD7A 4TMKA 2CLCX 2WJGA 3UMSA 2EU8A 1G4UR 2C96A 5FI1B 2YVUA 2CCJA 4K81B 2XSZD 3FKSD 2FDCA 3BE4A 3WRXC 4BFYA 2OBNA 1KK2A 2A5GA 4ZI3A 3L43A 4Q4JA 3THYA 2ZI3A 1HQYE 4C2UA 2BWJA 2IYYA 3VHXA 1EESA 2IC5A 2ZI4A 4YDHB 1N3BA 4F4JA 1W0JD 2G1KA 3LX5A 4OI4A 1HH4A 2WIAA 4AG5A 4DDUA 1WA5A 4F7WA 4Q48A 1OH8A 1H65A 5G3ZA 4N0EA 3REFA 2DR3A 4J0QA 2OBLA 4TYWA 1YR8A 3K8YA 1XTRA 3M1IA 5P21A 1P75A 2P6UA 1W5SA 2XB4A 1Q1EA 4QRHA 4FMBB 4LOAA 4JBWA 4C0QC 2RGNA 1C9KA 5G53C 2VHJA 4URYR 3KB1A 1XB2A 2V54A 4OK6A 2WMOB 1NIPA 1U99A 3L8YA 2X1VA 4PO8A 2H17A 3QPWA 3RSLA 2ZSEA 4JKIA 4L15A 3RHFA 4TSFD 1N6OA 1IJEA 1KDTA 1XZQA 3PR1A 4MGZR 2NPFA 4DHEA 2V55B 1GWNA 4QGAA 5LBIA 5SZIA 4OJQA 5DLQC 2F1JA 2RHDA 3LLMA 5IRCD 3TW8B 5CITA 4GPTA 4LV5B 5DHAA 5JSZA 1IAQA 4KHZA 4BFXA 3QXJA 1E9CA 4LJ6A 3KKQA 5JEEA 1NY6A 2F43B 1OW3B 5KHOC 3RRYA 5SZHB 2ZRHA 1VCIA 1E2DA 1SVWA 2CCGA 3RS2A 1KJYA 2CHVA 4P0TA 1JR3E 3UKDA 1RPZA 4DLVA 3RS7A 5K8UA 2W83A 2ZJZA 4BEBA 3PUWA 3LV8A 2VA8A 3NHBA 1OXTA 3DM5A 3EWSA 1YZKA 2ZI9A 1XCMA 3RLFA 1II0A 3A1SA 3HPRA 4JLVA 2GRJA 4V0OA 3DDCA 2HF8A 3DO6A 3H84A 2XZPA 4Q00A 4QFMA 2XSZA 2J9RA 4NYJQ 2FF7A 4PSVA 3ZS9A 4KLZA 1CP2A 4X8LA 3VU9A 1MO4A 1CBUA 2BBOA 4B75A 5JHGB 2R9VA 4GNKA 2PJZA 4RSGA 2OCAA 2D7DA 4HUQB 1QBKC 1TADA 2O8DB 3X1ZA 1HUQA 3QPUA 2QUZA 1BYUA 5DN6A 2JLRA 3EA5A 4NL4H 4TL8A 4FWTA 3AVOA 2HLDD 2ZE5A 3EIHA 3DMNA 1VG1A 2P5SA 3ZVNA 4KYIB 5G40A 1UPTA 2ZANA 2OHFA 2XNDA 2XNDD 2FSFA 3OIWA 1F2UA 4H9GA 4B3DA 1NKTA 2BKEA 1U81A 3M6AA 1XD8A 1ZC4A 1I4TD 4DSNA 3IKJA 3TUIC 3U60B 1KSGA 1YVDA 1KY2A 1BO6A 3IO5A 4EPTA 3C16C 1G8GA 1A7JA 3CNOA 5TB5A 4P4SB 1G8FA 3B1YA 3LBNA 5EZ6B 3OAAD 4PANA 3MAAC 3OAAA 4FN5A 4ARZA 1KZ7B 4UXIA 2CK3A 5E95A 4M22A 4QM6A 1W0KA 4PHTA 3CX7A 4LYAA 4B2LA 2FPKA 4I4LA 1GFIA 3VNVA 3NHAA 2WKPA 1GL9B 1R2QA 2IUTA 1XTQA 4TTQA 4G5RA 2LKCA 3LQRA 2QM8A 1T3SA 3AUYA 4JBYA 2QAGC 2VP9A 3OIYA 2PT7A 1VECA 2ZI5A 2Z4RA 1E9SA 3TVTA 1OFIA 1Q22A 3ECCA 1VG0B 4DIEA 2AN9A 2BCJQ 2FG5A 4JLKA 4YLGA 1SVLA 2H18A 1U9IA 2D06A 4R2IA 3HR8A 2JA1A 4V03A 4JVLA 1ESNA 2G6BA 2GCNA 4DUGA 3EZ9A 3TUZC 2ZRDA 2VEDA 1VYTA 3GLHA 3DKVA 4I1OA 1UF9A 3O8RA 5HKKD 2IS1A 1D9XA 5D3MB 4KFTA 2ZYWX 4US2R 3HU3A 4WBSA 4XVQA 3U3OA 2HF9A 4ON9A 4QXAA 4NH0A 1UDWA 1WCV1 3IHLA 3WYGA 3WHLA 4CIDA 2BIFA 3IHWA 3GP8A 2GVZC 1AKYA 2GF0A 5BQ5A 3VQTA 4OHZA 4BRWA 2QMOA 4AIIA 4JLPA 3ADDA 4D4KA 1DAKA 2P6RA 3FDIA 2GZDA 2QTFA 5G41A 5HCNA 1YR6A 3GCGA 1HTWA 1Z2CA 2OAP1 5LB2A 3I62A 4G0NA 4K46A 5L8VA 5GVSA 1QHNA 3UWKA 1IBRA 1WXQA 4RKFA 2LCFA 1YZNA 3ZVMA 4EJSC 1U8AA 5GVRA 5FOTA 5CM9C 4JL8A 1Z47A 2HJVA 4Q9IA 2XTMA 2BM0A 3A1TA 2FPLA 1IONA 3CIOA 3AKYA 4LDJA 4PO9A 2QPOA 5EP2A 1E2QA 2ZJ5A 3KFXA 5KUTA 1Z06A 2I1VB 4BGDA 1Q21A 2XTZA 2ZRLA 3EG5A 3KUDA 4DRZA 2C99A 1OB2A 1NMYA 2GILA 4OL0A 2DFNA 4LJ4A 2YJTD 1XPRA 4C7OB 1COWD 4MGYR 4QBGB 4Q47A 2BC9A 1N5LA 5FL7A 3EPJA 4PC7A 3QXXA 2SHKA 4LBYA 4FD2A 3PCRB 2OBMA 1N6LA 2PEYA 1R6BX 3KFVA 1CXZA 4V0KA 5L3VA 2PH1A 2CMKA 4OYHA 1KY3A 2KB0A 3K0EA 3QE0A 1FTNA 2B92A 1BS1A 2HXYA 1G1MA 2QRZA 4PO1A 1UEIA 4TT3A 4BLQA 2RGAA 3AM1A 4B3GA 4DKXA 2OG2A 3T1TA 4C0AC 2W6JA 3LFUA 1ANKA 3F3YA 4DCVA 1XJQA 1WP9A 4YMSA 4D4JA 2CLSA 1ZC3A 1WB9A 1NVVQ 5JWOA 4YXWA 3MMPA 3VKGA 3UWOA 1XZPA 3B1ZA 5K8IA 4AKGA 1M7GA 2DHRA 4HATA 4L16A 1UBEA 2G3YA 3Q3JB 4GP7A 3A37A 3T1QA 4LJ7A 1NNEA 2F1RA 1M2OB 2GJAA 5GJBA 2JCSA 1BIFA 4F92B 2QNRA 2W2XA 4IJMA 3U61B 1XF9A 4WVFA 5IF9A 2OCBA 3W3AA 2BEKA 2QT0A 3W5JA 1US8A 2NO9A 4CT5A 4PC2A 4IFEA 3DKPA 2GA8A 3GPLA 1KDPA 3K9HA 4I81A 2GZAA 2GETA 1DG3A 3QF7A 3TJZA 4D82A 2OFOA 2QTVB 2D62A 4DSTA 1P6XA 1GP2A 3OFND 4TMTA 3TNFA 1GILA 2FPMA 4M9XA 2O0JA 4BFTA 1GSIA 4PAOA 2KE5A 2OFXA 1KK1A 1A82A 2YWGA 3AKCA 3LXXA 1KI1A 1JXOA 2R2AA 1GG2A 3W5IA 1QF9A 3FB4A 4HAZA 1N5KA 1XXHA 3H1TA 3NVAA 3CB4A 1DAIA 3RC8A 1T8UA 1TAGA 2X8AA 4DWJA 3PFIA 4XWAA 4ESHA 2GEDA 3B60A 4IVQA 1L8QA 4G5GA 1UFQA 4ZV4A 5GJVC 1B23P 4NYMQ 1Q3HA 2HCJB 1XFAA 1JQJC 5DYGA 4NZYA 1OIWA 2R6DA 4LJ8A 3LVRE 2RGDA 1LS1A 5AJZA 3LBHA 2ZJAA 3LY5A 3MUFA 3PG5A 4PFSA 4QBHA 4AYWA 1G8HA 4NMMA 5DO9A 4UJ5A 2KBFA 3QKTA 2FOLA 2IYTA 3A6PC 4MDEA 1LS6A 4W7SA 3LH5A 4XWKA 1T0JB 4Q1CA 2FEMA 3BIFA 2O0HA 3QG1A 2WKRA 4UNQA 4V0NA 2CL7X 3BRWD 1NMZA 1XEWY 1OIXA 4B32A 4Q01A 3NDBB 2AKAB 3ONWA 5H68A 4DLSA 4BLRA 3H2YA 2BMFA 2CE7A 4JMPA 3P4XA 4LJAA 2WWWA 2PX0A 1ZMXA 5AUQA 3TGPA 4ZDKA 1WRBA 2QEQA 2QMEA 1NN0A 1W47A 4KXFB 1AN0A 2A3RA 2ORVA 2R6AA 1CF4A 1MOZA 1T9HA 3NBZC 5E7MA 3SU8A 4F93B 4JZKA 3GLGB 4JVNA 1RIFA 1SXJE 1YZUA 2GXQA 2XTNA 3KXLA 1JJVA 4WXRA 1ONBA 4QNRA 2D2EA 1ZM4A 5CB6A 3X1DA 4ZI2A 1K5DA 1DAMA 1D5CA 2NTYC 3P4YA 2V1XA 1R8SA 4O3MA 2P67A 4Q1BA 5JI3E 1TEVA 1Z0JA 3GFPA 3TRFA 4HI0E 1OV4A 2GJ8A 2E87A 4M1WA 2V4ZA 3CRRA 4HAWA 5FTJA 3QEOA 3FTQA 4DSUA 4LCBA 1RC8A 2BM1A 4AYTA 2WJYA 4HLDA 2PLRA 4PTLA 1N0WA 2CXXA 3ICEA 1Z07A 3K0FA 3QOFA 4MKHA 4Q66C 1UADA 2JLZA 2IYLD 2J5XA 1NG9A 2QBYA 4ZDWA 3CM0A 4G01B 2O8CB 1IY0A 3BB3A 1CRQA 5KU1A 2RGNC 2GBLC 3FPAA 2EW1A 4KU4A 4AKEA 4B35A 5AUPB 2O8EB 3CPJB 1KKLA 3ZIAD 2C9YA 2EYQA 4XWOA 2WMNB 4AKIA 1IY1A 1E3MA 1TPZA 4HLCA 3TMKA 1N5IA 3QF4A 2OFWA 2GK6A 3D31A 3CWZA 3W8NA 3BB1A 1VMAA 2OE2A 4S2EA 3HPQA 1Z28A 3MCAA 3RSOA 1CR4A 4Q18A 1QHIA 2QT1A 3CONA 2Z0MA 4EPYA 1KJZA 3K70D 3RYTC 1G6OA 3I5YA 4PPNA 4F4IA 3QXSA 4DSOA 1UAAA 4Q21A 4DVGA 3SQWA 2VLIA 4DLXA 1E6CA 4HAYA 4R2HA 5CYPA 3X1XA 3UATA 1G3UA 1ZCBA 1MRSA 3I72A 3AVUA 4LYHA 4CEJB 5CIWA 1T3LA 1GL6A 1E2PA 3EAQA 4X8OA 3RAPR 1W0JA 1KO5A 1RRCA 3D8BA 2WAXA 2ONKA 4QGHA 2ZPTX 4HZUB 1AKEA 5KNBA 2R6GA 2EFGA 3SNHA 5TDHA 1IN6A 1P2UA 1ZU5A 3PEWA 3U44A 1OKKA 5BWMA 2ZRMA 2WJJA 1F2UB 2O5VA 1NN5A 3Q5EA 2VH5R 2R6CA 3PJRA 2GAAA 3PUZA 1EWRA 1EFHA 3ZVRA 5AK0A 2EYUA 4M21A 4DLYA 1VCOA 1G4AE 3BH0A 2R8RA 2P65A 1E32A 3U7HB 4B3BA 1W5TA 2E1RA 2IXEA 2JLQA 2QG6A 1LV7A 5DYIA 1FMJA 3ADBA 1IJFA 2IXGA 2ZS7A 1FPMA 4D4LA 3I8XA 4MKGA 1VYUA 2ODBA 4D4MA 4TLBA 2ZITA 5C1BA 1Q3TA 2OZEA 3WBJA 2VTKA 3W34A 2G0NA 3PUYA 1E2JA 2ZRJA 4JLOA 2F55A 1NSFA 2QPTA 1ZNZA 4A0RA 1ZU4A 5J5CA 2JLUA 1ELOA 2O8BB 3LXRA 1A2KC 2Q3HA 4LHYA 5BW8A 3GJ3A 2IYXA 2P3SA 2RAPA 3H4MA 3U7FB 1XTSA 4A8JB 1K5GA 5M04A 1OH5A 1CS4C 3EXAA 4HB4A 1ZRHA 4TN1A 3HJNA 5KYKA 3Q7QA 3OEEA 3IQXA 5SZJA 3KQKA 2ZS9A 4N3NA 4Q4HA 1QHSA 4FW9A 2IS2A 2QP9X 4G5SA 2YOFA 2XZOA 3M4YA 1OYWA 4Q4JB 4TMWA 1LW7A 2ERYA 3SS8A 2KBEA 2GXAA 1KGDA 3OF5A 1GKIA 3OZXA 1S1MA 2WSMA 4RJLA 2OXCA 1NLFA 2F3TA 1WBDA 2HCBA 1G6HA 2ODWA 1OHHD 3A1WA 1O87A 1X3SA 1Y63A 4JSYA 1YKSA 5KTYA 2YWFA 1GL7A 3QKSA 1ZD9A 3KQHA 3I61A 3GMTA 3CF0A 3B6EA 4JYCA 1AS3A 1OLOA 4FCWA 3GLIE 1P2SA 3KKPA 4TLEA 4MYUA 3LNCA 1UKZA 1EFUA 1G17A 1NBMA 3U3MA 1UJ2A 5LD2C 3N70A 4A82A 2OM2A 2YZ2A 2NO0A 3QVUA 4YMTA 2IEYA 1IHUA 4CEIA 1P2VA 4BRUA 3ZH9B 5IK2D 2A5YB 3TIFA 4OQXA 2HDNB 2DWQA 3GJ0A 3VX4A 2F9MA 2V7QD 3C41J 1VHLA 4RD6A 1QHHB 2NOAA 2YC4C 4Q9JA 3QG5A 1E0AA 1H8ED 3L82B 2Z43A 1AQUA 3MJHA 4FWIB 4HUQA 5DISB 4C30A 3B9QA 1JR3D 1NMXA 1CR0A 5KSZA 1KNXA 2IT1A 4AG6A 2ZRGA 5EE9A 4ACAA 1W0KD 4C0JA 4JJKA 3A4LA 1US8B 3K0CA 3KJIA 4U5XA 5HR5A 2A78A 1VG8A 2CK3D 2IYUA 2XEXA 5AJXA 3GJXC 3CZPA 4JLNA 2P6NA 4QBIA 1QHYA 1EFCA 5F9FA 4NP6A 2H16A 4WZ6A 5C46F 4A15A 2J0UB 3G0HA 4TZ6A 5FBQB 3VAAA 1XEWX 2CHQA 3JVUA 3KB2A 1SHZA 2K5UA 3G5UA 3R7WB 2OEPA 4TLAA 4B71A 2L0XA 3QXHA 2CEAA 4HAXA 3NDPA 5F2EA 4C0HA 3LLUA 1FQKA 2ZJBA 4HZIA 1JEDA 5JRZA 4QJ5A 3OFNA 4DCUA 2WHXA 4W5HA 1Z0KA 3THXB 2DYKA 2X19A 1NVWQ 1ETUA 4A6XA 4TMXA 4NCJA 3SEAA 2ONJA 1T8TA 5KNCA 1UBGA 4I99A 1D9ZA 2F7SA 1Q20A 1RE0A 2R62A 3HYRA 1AA9A 1MKYA 4TYNA 2FFHA 2VHCA 5TXGA 3P27A 1GM5A 2ZRIA 4A0FA 1OHHA 3CKLA 3Q8XB 4B2IA 4Q1EA 4R71A 1IN4A 3FFBA 2EFEB 3L0SA 4Z1MD 3W8RA 2O8CA 2QE7A 3V4FA 2WPDD 4GOJA 4KJZA 3X1WA 2MMGA 4P4UA 1ZVQA 3I3SR 1IXRC 1JI0A 3UK6A 2NIPA 4YMVA 5DN6D 5ELXA 4HAVA 4MH0R 3E2IA 1EX6A 2ZUBA 2MMCA 4OQFA 4PHHA 1ZUNB 3IQWA 3TAHA 1UKEA 4URZR 4D81A 1DO0A 3R20A 4DLTA 4YDSA 2B7CA 1E79A 5FBRB 1P61B 3B5JA 5JZVA 2I3BA 2RGGA 1FP7A 3AP1A 4Q02A 4QHYA 4Y0AA 3RS0A 5FTLA 3FKQA 2F1HA 2JJ2A 1YR7A 4IHQA 4B74A 1ZIOA 1G8PA 1YZGA 2JASA 2W0SA 1HT2E 1U2RA 5L3QA 3EZ7A 4MRNA 4NCIA 3WYAA 1G20E 2HV8A 3RANA 3TSWA 2NZ8A 2FZ4A 3K9GA 5A4JA 5FI0B 3GLGA 2FGJA 1I4DD 4Q19A 4ACBA 3OE7D 3TK1A 1AGPA 3VTKA 1SVKA 3KTAA 3SBDA 1XP8A 1IN8A 3WNCA 3K1JA 1ZD1A 3PUXA 2YOHA 5F9HA 3KXKA 3C5CA 3ZJYA 1KI6A 4DCSA 1Z63A 3FMPB 1J8MF 2W58A 3A4NA 1W49A 4KSCA 3CH5A 4BFWA 2O8FB 5JSZB 4AY2A 3O8DA 2P2LA 1OJLA 4JSTA 4NE2A 1OH6A 2EWWA 1KNQA 3NWJA 4ZCIA 2O8DA 4QOSA 3SHWA 1VIYA 2ZAMA 3WP0A 3BD9A 1Z0IA 2ZAOA 4TMZA 5FTKA 5JJIA 1LFDB 2ODEA 1TU3A 3PV0A 1R4AA 3EPLA 3HDTA 2CNWA 5FTMA 3RS5A 1EGAA 5FOWA 5E3HA 2WZQA 2VHTA 2PMDA 3TQCA 1CJMA 3EPKA 5EXTA 3D7MA 3OEHD 4PR0A 3KZ1E 1KI4A 3GEHA 2BJVA 4V0LA 4JL6A 4GDFA 4IKEA 4OHVA 1SVIA 4KFSA 1BMFA 4I1SA 3RS3A 4PQFA 2BBTA 3ZQ6A 3J81k 3GLFE 2FMXA 2N1BA 3E1SA 4D6PA 4EUNA 3I32A 2GTPA 4KBGA 1GTVA 4QHSA 4A0GA 3K0AA 5DNYB 4MKIA 3K0SA 2TMKA 4RY2A 3ZD6A 2GJSA 2VYFA 2IS6A 2R44A 3NBFA 2GHIA 1CTQA 1TMKA 1X8JA 1YZQA 3UG6A 1HE1C 4RD1A 2IYVA 3MWKA 3AVVA 2IYRA 1XU4A 1JPNA 1BYIA 1KO1A 2X77A 4M9SA 2VP6A 3FHOA 5DI3A 4KBFA 1XXHE 2OESA 3LDAA 1IN5A 1E98A 2QMUA 1P9RA 1X8KA 2VP5A 3CF6R 1SVOA 3GLHB 5GJCA 721PA 4DCTA 1YJ5A 4AKHA 2N42A 1KHTA 3VKWA 3IUYA 3L0IB 2WWFA 3IEUA 2DFKB 5KPDA 5B57C 2C04A 4HB3A 1XTJA 1JJ7A 4G5OA 2Q9CA 5E7IA 2V8OA 4RVCA 3N2EA 5KDLA 4HUTA 5KDDA 4WZAE 1SXJA 4KITB 4PAQA 1YRBA 2QY9A 3IEVA 1NLYA 4LHZA 1E9AA 4XVRA 4C9BA 3DVLA 5HPYB 4D0GA 2W0MA 4FMCF 1FX0A 5C18A 1W4BA 2WSSA 2ZJ8A 1WMSA 3MFYA 2WICA 4TYQA 3VMFA 4HLQB 1E2MA 1EXMA 3TR0A 5JRJA 1KSJA 1G8YA 2ZRPA 4JYBA 1SXJB 3WMEA 1KAGA 3M0EA 1A1VA 5B64A 2IWHA 3X1YA 5JJKA 4AWXA 2H5EA 4LYJA 1AK2A 3BS4A 3I92A 4B34A 2B7BA 1GNPA 221PA 4HEJA 1E1QA 1XCPA 1XX6A 3N5CA 1GIAA 1Q1BA 2IWRA 3MGCA 1F3OA 3B1XA 5J4KA 1WDTA 3QKUA 4E5UA 3VKHA 3QKSB 3QY0A 2FE4A 4FCVA 3AVXA 2D4HA 3KKOA 1OXVA 4DT1A 1LVGA 1Z2AA 3CX8A 3ZVLA 4N0DA 3SHFA 2MSDB 3BORA 5H1YA 3KKMA 1VKJA 2JLXA 2ODNA 2R6FA 4C0KA 3K70B 2B6HA 2OLJA 1OFTA 4KV9A 3S1AA 2OCPA 2I4IA 3KJGA 3W6OA 5CM8B 5JBQA 2HEIA 2XGJA 1KI9A 4TTPA 4IDQA 4JT4A 2JAQA 2VO1A 2GBLA 2A9KA 2FU5C 3DPUA 2QP3A 3AV0B 2WM9B 4C7OA 4WIAA 5BYKA 1U0JA 2PMKA 1KKMA 4PC6A 4PHFA 4PPQA 2OO7A 1EX7A 1SULA 1R5BA 5DI9A 1GZSA 3SYNA 4DT1B 1GDDA 4M2LA 3FHTA 1R0XA 1AZSC 1M6NA 2PZEA 4DLZA 3FGNA 3Q85A 1WF3A 2Z5FA 3FE2A 4U02A 4LPKA 4RZXA 5UKDA 2XZLA 1UKYA 4DLWA 3LW8A 1XTKA 2F3RA 4BASA 2CNWD 4NDZA 1N6RA 4BLTA 4KODA 2W6JD 2A5DA 1FOEB 4B73A 1TL7C 2ZJ2A 5F3WB 2EFCB 3H0KA 3T15A 4LYFA 2ZS8A 5CLQA 2IF0A 2IBMA 4W5JA 5EUQB 4QHTA 3F8TA 1R10A 1W2GA 4PZZA 3SN6A 2WKQA 2ZRFA 2F43A 2E9SA 1Q44A 2VBCA 4A0HA 1FX0B 5J4VA 3TH5A 3TAUA 1F2TB 2ZIAA 1NKSA 4HAUA 5FL3A 5BXQC 4V0ME 1Z0DA 3LRPA 3KQLA 4FMCB 1D2MA 2A5FA 3U3KA 1OIVA 4Z54A 1UM8A 3QQ5A 1U90A 1OXXK 4XTRA 1OFUX 3GFOA 1Z8FA 4LPSA 2J7PA 3B85A 5EZ5A 4OQLA 3WYFA 5DGXA 5CK5A 4PQYA 1E1RA 2REOA 2AL7A 2CLDX 4WA7A 1V43A 1MRNA 1TNDA 3WY9A 1S8FA 4FIDA 5JHHB 1CEEA 2FFBA 4ASUA 5KOYA 3W6PA 2ANBA 4RCYA 1AQYA 4LX0A 2ZE6A 1LNZA 2IYWA 3AB3A 3AKDA 3BC1A 3LD9A 2RKOA 4TZ0A 4A8JC 2YC2C 5K8LA 3EA0A 4LI0A 3CF2A 2J0VA 3SDZA 2VPPA 1YRAA 2Z4SA 1SKYB 3WHKA 1S96A 1XEFA 3IIMA 2F6RA 3K0CC 4L4UA 4JJZA 1W36B 1YZLA 4RZ2A 2GCPA 1S9HA 2YKGA 4DDWA 1JEEA 2QRNA 4DDVA 1MH1A 2YINC 4IEEA 2IF2A 3RVBA 4DDTA 1DAHA 4MYHA 4JLBA 4LV8B 3TBKA 3KQUA 1Z6XA 2MSCB 4LK2A 1TF2A 1J8YF 1R0WA 621PA 4KFRA 4CEIB 1XNJA 3QJYA 4ZDIA 2BDTA 2WWYA 1E1QD 3U6KA 3WNBA 5EXXA 4AC9A 4W9MC 2CCKA 1PLLA 4MDFA 3KXIA 1DG1G 3A1UA 3EZFA 3NH6A 1MABB 4MA4A 3WNDA 4JLAA 1KSHA 1LY1A 1DAEA 2YWHA 2ZREA 4NYJR 5CDFA 5JS8A 4LJ5A 4ASUD 3CPHA 3AF1A 3B1WA 2Q6TA 2C78A 3H86A 1EG7A 1C4OA 1W36C 1ZM3A 1FW6A 3ZDQA 4QM7A 3CO5A 1G7SA 1KK0A 2PEZA 2ZETA 3K09A 3QXCA
chains in the Genus database with same CATH superfamily
3UV3A 1MZPA 1P3JA 4DV3B 1ULTA 7REQA 4ZGGA 1GAWA 2RHLA 2WIBA 4KTTE 5JFTA 1R0LA 4BECA 2HAEA 3DVAB 4NFSA 1Z45A 2I3GA 3OECA 3E58A 4YBZA 1EYZA 1WSBA 3IE2A 3K4HA 4B6SA 3QSYA 1D4AA 1H05A 3U48A 1XDSA 3TEFA 3V4LA 3HCFA 3L7AA 3UMGA 3ZK9A 4B3CA 3EARA 4AURA 2CXPA 5KYUB 4LDAA 1S89A 5F5XA 3ER9A 2WNSA 3CR7A 3DE1X 2HDWA 2PT9A 3AFMA 4OJTA 5BSVA 3C8MA 2YZGA 2VBGA 3CJTA 4RVFA 4CG0A 3D0QA 4FYYA 4R2JA 4KQ9A 3K0KA 5GP1A 2YN4A 1N75A 5EE3A 3S7TA 3FZQA 5JD5A 1GDTA 1E4EA 2R1VB 4FQ5A 4WD3A 2FGKA 1P1KA 1SVMA 1Z8HA 2RHMA 2VSFA 2DFLA 2YN2A 2UVDA 4I1VA 4MZXA 4DJDC 5BSWA 3FWKA 4A2QA 2JI6A 2WVJA 2C2KA 2QSZA 4P8RA 4ID9A 5EFOA 1G5RA 2NWQA 4NPHA 2BFPA 2HT1A 1LSSA 2HA0A 4MWGA 1TVKA 5E4YA 2P35A 4NMWA 2ERXA 4FKZA 1UBCA 1GAXA 2IELA 3L6DA 1N2CE 3NRCA 4Z4FA 2H1RA 4R1LA 2BHSA 2G0AA 3KQMA 1TX4B 4PSKA 1CY6A 2HRRA 1IVNA 2NSDA 2DBYA 4HNAA 2ID8A 3TE7A 5ES4B 3O3CA 3WB9A 4QARA 3ACDA 1GITA 3AVQA 3SM9A 1IZ7A 5HF6A 4E08A 1EVQA 2ZTMA 3ZW8A 4ZZ1A 3KOZA 3GDWA 1KWGA 3BAZA 2F1KA 4DMHA 3G17A 3IAM1 4JT9A 4X0EA 2XF8A 4YRTA 4ZYWA 2VJQA 2ZUUA 3O73A 4GEKA 1IEWA 4N8DA 3F9IA 3WJ2A 3WKDA 2PCJA 4BV8A 5AW3A 3BD8A 4OKNA 4ZWNA 2H0QA 3EVGA 3K5WA 4N40A 4WN3A 4IX9A 5IK2A 1T9CA 1EVKA 3RQSA 1ZD4A 1KJQA 2O8NA 3I28A 3V00A 3RAFC 2RHJA 1H69A 2P0AA 2IYSA 3LXMA 3RSQA 1Z83A 2QV7A 1UQRA 4B5KA 1JAHA 1BKYA 1JA0A 5CDYA 2JGMA 3EC2A 5C51B 2XVZA 4FHZA 4UCXA 3SYLA 1KBOA 5F76A 1O6FA 1Q92A 3K35A 2PGDA 4JI3B 3ELUA 1FLVA 1NRJB 4QGFA 1GQOA 1S7GA 4G0YA 3V46A 4CM9D 2JEOA 5EXPA 1NJFA 3GMIA 4Q1DA 3H18A 2D2FA 2CMGA 1X86B 4MX8A 4JBLA 4XRGA 5ABPA 2O6LA 2V4UA 4Q4AA 2VAVA 4HWTA 1NASA 1J7KA 3H5TA 1SBYA 2E4VA 3OQBA 3ZNOA 4IVRA 2FV8A 1AGYA 1ZW6A 3P9PA 1LQUA 2JKZA 2W2KA 3JYNA 3NHKA 4W8HA 4WXPA 5BSTA 4MULA 4O0MA 5FH9A 2DOKA 2I1LA 2NT4A 4EYQA 3KLPX 4TVOA 1OTHA 4GZMA 1E2NA 2ERCA 1JB1A 3BD7A 3PS9A 4J4TA 5FA8A 1DPFA 2IOFK 1M9NA 1DRVA 3OCWA 4N12A 5TNXA 3L4KA 2NMVA 2AS0A 1MAUA 2RIPA 1JYFA 2RHBA 3C3AA 2PSSA 3PR3A 2Z58A 2GJ9A 4GGOA 1H6DA 4OFXA 1CEEA 1L4HA 3PDUA 1FYDA 5C1IA 1S2DA 3OG9A 1K3FA 4P98A 1ICEA 2G5PA 1O4WA 4PC3A 4XFDA 3D7NA 2PX2A 5IKOA 4EPXA 5E6RB 2AD1A 3AZQA 4C3ZA 5A2GA 5KMGB 7MHTA 3OKAA 4HRXA 3SM3A 4X1KB 2WT8A 5KSYA 3BXPA 2O7QA 1EP1B 2YIDA 3AYXB 2KJQA 1IJBA 2Q99A 4XIGS 3RU3A 1ABFA 1D8TA 2A5JA 3Q88A 2G25A 1E99A 4ZCTA 1ZR2A 2GA9A 1NG1A 1XELA 2GK7A 3T35A 3DFKA 4EHKA 1T6NA 4KR2A 4NMLA 2C2OA 3S2SA 4NK5A 1CULC 3ZGYA 3L3BA 4JBGA 3PA8A 5JH7A 1KR2A 1XD2A 4D0NA 5I9BA 2BSAA 2UUBB 4K87A 1BE1A 3AIOA 2ZCVA 5I9TA 1JRLA 2DUUA 1A98A 4XUCA 5T4HA 5KOJA 3R9WA 3WLIA 1OUMA 3ILVA 5TMEA 4B3SB 2Q2VA 1N1EA 4M76B 4QTXA 3RGGA 1NMEA 1V8BA 2PVPA 4CZ2A 4F4UA 4BNYA 4LIPD 1QYVA 1Q5PA 1SQSA 2C7BA 2Y68A 4RGYA 4UKDA 5ESRA 3S28A 1LF0A 1VJ0A 2W00A 3NLLA 4I0WB 3A9UA 5F3RA 3QJGA 1V48A 3SJAA 4G6ZA 4FPXA 2PT6A 3ANNA 3NAZA 2XVAA 4I2VA 1GAJA 1RZVA 1YA8A 3IBYA 4QDKA 3VR5D 1CRWG 4DYVA 1P0QA 3MOIA 5GJWC 5JOQA 2Q5OA 3USES 1NUAA 1KAEA 4LJKA 2Q9BA 3DEFA 3L02A 2CJPA 5C4GB 1K2WA 4YXFA 2GBPA 2GK4A 2XTAA 1TYBE 2ZB4A 4IJKA 3Q8KA 1VKRA 1N92A 2Z98A 1V1MA 1P3Y1 1HI9A 1NBHA 2PN1A 3L04A 4NI5A 2YWRA 3STWA 4B43A 3GCWA 1CY0A 3HZHA 2CSUA 2C97A 4M55A 1EUDB 1NJGA 3CTPA 1ISMA 4Q9AA 4RK4A 1VHDA 1DAFA 4W1RA 5DHFA 4CV1A 16PKA 3KUUA 2II6A 4FC7A 4K26A 3STHA 1C3VA 4MWOA 5DPMA 4F0JA 1GTSA 1VL5A 1G64A 3OM8A 1Q11A 4V0SA 3H05A 1FU7A 5D01A 4NOKA 2RG1A 4LJSA 5K3FB 4DR2B 3HMKA 4M8NE 4UVEA 5TPZA 3ADOA 3V97A 4CVNA 2J30A 4CXMA 1GNRA 3SXUB 1ORVA 2WTMA 3SQNA 3GVXA 2EWVA 3C3MA 2RARA 2RIRA 2ATXA 4GWLA 3AVPA 2J6BA 3EXEB 3L06A 4E3ZA 3FG9A 1F3LA 7YASA 5HQ3A 5JLJA 1I80A 3AK4A 3B7GA 1EK0A 1Q77A 1SUWA 2V7QA 3NTXA 3ND8A 2GZMA 4ESOA 2J09A 2XNHA 3ANYB 4I6EA 2OBBA 4GZ3A 1LX7A 2V8BA 1EA5A 1M6WA 1MO2A 1ZD3A 3B82A 1SXJC 2JGLA 1MTZA 1LVHA 2WJAA 4PNZA 3ME5A 3ABRB 3ZY4A 2C3UA 1RBYA 1YOVA 1JDUA 3S68A 4AMZA 4DLLA 3BXZA 4PQRA 4BUJA 1B16A 1LUAA 3AY3A 2HIAA 3QVOA 1KZGB 1QZUA 3DP9A 4ZQIA 3W5DA 4JUDX 2Z2KA 2X6TA 3UT6A 3OE4A 3HB0A 4U9UA 2ZXFA 3S55A 3TB4A 5ALPA 1Z8DA 4WI1A 3R74A 2GAOA 1QF7A 4G5QA 4LK3A 1DBSA 2VT7A 1VHQA 2PMEA 1N2JA 2YYZA 1DX4A 3FLBA 3JZMA 5DT9A 1OVMA 4KPYA 1HT3A 4URUR 3RLIA 4OB8A 1HLDA 5DF1A 2IHYA 1DJMA 4BAUA 4JLMA 2A9RA 1BA3A 1IQUA 2KLBA 1X2EA 4PPGA 2I7XA 1X0VA 3TZLA 3UC9A 3L9WA 4D8UA 4RH0A 5JQGB 1WKCA 3IBGA 1GRNA 2Z2JA 1X92A 3GCZA 4YACA 4CMKA 1OX4B 2KLHA 1FXSA 2ZTVA 3OE1A 1GCGA 1V71A 4YMIA 3IPYA 4BQSA 4RK6A 2W42A 3SJBA 1NX9A 3R6LA 2FN7A 2XKKA 1QU3A 3DWIA 4C4ZA 3BTOA 2XJ9A 1QGAA 3AIIA 2DLCX 4UMEA 2EIXA 2AFIE 1PR2A 4NEGA 3HV2A 5J40A 4YPFA 4IS3A 2FEOA 3NEPX 1TMOA 1K0FA 5F1YA 3BN3A 3VR3A 1OB5A 1EWVA 2XTJA 3GLSA 5AHWA 3WICA 3WK4A 3W2FA 4CKYA 5L4SA 3KJEA 4N5MA 2QY6A 4N8EA 4FHEA 4CYMA 3GNSA 3IQEA 4C2TA 5DCWA 4ENPA 2OSVA 3DBVO 3G1UA 1BKDR 3WBFA 3IAFA 2J31A 1V4VA 2H2DA 5FT9A 5CFZA 4MB2A 4AJ1A 3DVRX 1JE1A 2PZFA 1OWLA 5TARA 3PC4A 3ZUPA 1IRIA 1QE3A 1CKEA 1T1JA 3CJQA 1EZ1A 4EAQA 1SWWA 4EI7A 4E3WA 2I76A 3ZVKA 2OZPA 1XRMA 4MUAA 1IHYA 4NBUA 3HA7A 2EKDA 2ZYTX 4NBSA 1EU1A 4TV9B 5KOJB 4LG1A 2KS6A 2CXHA 5I48A 3R24A 4LHXA 3WNVA 3GH3A 2WYUA 4YGXB 2WWGA 1TQ4A 2FR0A 3CUUA 3SHOA 3Q3HA 5KO2A 4E22A 1PZNA 3ZCXA 3DE6X 1W94A 4KLNA 5ALQA 3ZD9A 4DEXA 3IB3A 4HNAB 3KSRA 1C0PA 4RPLA 1S2OA 2VOEA 3AW8A 1D6JA 1LJ8A 2FPPB 5A4MS 1RYHA 1Z4IA 3AP3A 2QF7A 4B6QA 4H1HA 5F2KA 2P5TB 4XKJA 1B0AA 4PSAA 1L4YA 5SYNA 3BSYA 3M34A 3KDSE 2NADA 1RJWA 4O4HF 4YJ3A 2J3JA 1Z5VA 5CPFA 2ZJOA 3SOPA 3QX9A 4O33A 1CJSA 4BNDB 4LGVA 4M98A 1PJ4A 2J4FA 1MG5A 2VNSA 1GKUB 3KCNA 4WHMA 4HWPA 2C8KA 3OUTA 4KEAA 1H0KA 4M37A 4OBEA 3E3LA 2C1XA 2HSEA 4ZOCA 3UMCA 3SHTA 2X0EA 5BORA 5FWDA 2WM2A 4A1FA 4EHBA 2EZ9A 1ODLA 3L7NA 1KSFX 1QRAA 1EX1A 5F78A 4MICA 3ZHUA 4B3JA 1MTOA 3Q2OA 3IP8A 2BZ0A 3PJGA 3R2JA 2PX3A 4WNAB 4AUKA 3VNSA 4CIXA 2O9JA 1OT5A 3SZLA 3UYKA 4CMJA 2DCMA 1M74A 2V74B 4QYSA 3FTPA 3R7BA 3TXXA 5J23A 2VP4A 2ADOA 3HXTA 1WBBA 3SC6A 1P60A 4NRDA 4ZYUA 2I2AA 3RDPA 2Q3BA 1XO1A 1XAGA 3H65A 4E2FA 5DCUA 4GPEA 1BOFA 5IBPA 1VCNA 1ODIA 2BOVA 2G07A 2O2ZA 2DC1A 2W2TA 4MRRA 3MELA 4ASUA 5J47A 1G7CA 1NF3A 1NRWA 4MV4A 5EJ8A 4OMCA 3BK2A 1RP1A 1ZD8A 1KP2A 3EWAA 3TNYA 3V1NA 4CLXA 3WGGA 1TRKA 2RGBA 3KU4A 3UPTA 4ARCA 3VR0A 1O9BA 1Y4SA 2Q2NA 4E1AA 2IHVA 4QG7A 1Z6YA 5ECWA 5DN9A 4NULA 1UEJA 4X64B 1BMFD 3TLCA 1OXBB 5JEDA 5GONF 4RY8A 2CN1A 3SC2A 1T4BA 3KC2A 4QOEA 2ZXUA 1TA4A 4ABYA 5JSQA 2YIJA 2VDUE 3BXGA 1KVRA 2P6MA 3U0VA 4QVIA 4ZO4A 4BX0A 3V7NA 2BI8A 5L51A 1S2LA 4PAWA 2RI1A 2H1SA 3L8HA 3NIWA 4YFVA 4BGEA 4GLOA 3IVAA 2ZJ6A 5FUQA 1JFTA 3CS3A 4G0VA 3CRMA 4FDLA 4KYVA 1UC8A 4WY2A 1WVMA 4EFNA 1KAQA 5JNUA 4OHXA 5LQAA 4Y0VA 3RSFA 2QQ0A 1O6CA 4DC1A 2AEEA 4HDAA 3F9CA 4N47A 5KTSA 2HMVA 1EGHA 1OMOA 1GQ2A 3G0OA 3NANA 3PRJA 5HE8A 1VDMA 3FOWA 1MR3F 2NAPA 1U1CA 3NEAA 4PFKA 4XSVA 1TZCA 1NIJA 3ZDYB 4NCHA 1CQWA 3N0RA 1Z25A 5K3EA 1QG4A 1XZMA 2XOKA 3ETEA 1YU9A 1TVKB 3B1KA 4GOKA 4ZQHA 1P91A 5DH9A 1XD9A 4ZODA 1QH1B 1NQTA 4OFZA 3CURA 1WW3A 3H19A 4BNUA 4YXWD 1JHRA 3W77A 1Z29A 1ZNWA 4BVJA 4BQIA 5GTDA 3D7KA 3GAMA 4PXAA 2DQYA 1L7DA 1SGWA 1XQVA 2P7IA 2Y0PA 1ZJJA 3IMKA 5EQTA 3D3WA 1L6RA 1TLLA 3C14C 4RVOA 2PUCA 2AQHA 4IQ8A 2H4YA 1I4EB 3P26A 2Q4BA 2N0SA 3QITA 1OC2A 4OQYA 4REMA 4ZCLA 3THOA 4ATNA 4EB8A 1OAKA 3O4HA 4QTUB 4YONB 3WAGA 1Q0LA 2F9FA 3G2KA 4B48A 4E0BA 1ZL2A 3B3GA 1P62B 1V4BA 2J9FB 2R8EA 3ORFA 1Z0ZA 3QHAA 2D1TA 3U80A 1MO5A 1UK8A 4HVTA 4IUCS 2RC6A 5CLGA 4J6FA 3LKBA 3D54D 2XXAA 1K8RA 4Z3DA 3IT3A 1E2FA 1K7SN 3E4CA 3KL4A 3MOGA 1NC3A 3NETA 3ENQA 3LLSA 1L2TA 1Z0SA 3P32A 4G89A 1J24A 3PNLA 4OI1A 3O8CA 4RS3A 1HG1A 1W4ZA 4EHAA 2O8FA 1JBQA 1UP6A 5IASA 3LTEA 3QM1A 2IOFA 5SYMA 4CDNA 4KAAA 2VAXA 1O95C 1TCBA 2YZKA 2H1WA 2NT3A 1U9IC 4PYKA 1MBZA 2EX0A 3AF4A 1UK7A 3K3PA 3C7KA 2PQ6A 3T7EA 3SJCA 2G6TA 2J08A 4X1KA 1ZNXA 2R7MA 3P1JA 3LZDA 2ADMA 2IXDA 1O0BA 5CYOA 3E70C 4YCLA 2ZUCA 3PSAA 2GYVA 1R16A 4QD3A 3F6YA 3L8ZA 4Q1FA 4ZK2A 1G98A 5LKRA 1UKVY 4MUKA 2IODA 3CNEA 4OIFA 3UB2A 4EENA 1QBGA 4Y2YA 5BURA 5AESA 3FZGA 1N3LA 5EJ5A 2PE5A 1NAHA 1M76A 2XODA 5DLPA 5B3JA 4KH0A 1Q15A 4GOXA 5CGQB 3ZDCA 4R2MA 5J2TF 3U7JA 4DJFC 3BXXA 5C52B 2HU5A 4Z6KA 4P92A 2QVLA 5CNIA 5DWDA 2HXSA 1W2HA 4NMHA 5EPUA 4FLFA 1Y6FA 1AN9A 2AZDA 2UKDA 1G5TA 4NYMR 2QM3A 2I22A 4E1VA 2XUIA 2OXIA 1YR9A 2NV2B 4ZIRA 5EE1A 4L5IA 1JXAA 3IEVA 1NI4A 2UYYA 2AHRA 1Y98A 2NYUA 1YL6A 1L4FA 4QUGA 4CCSA 2JAXA 3RBVA 4ER6A 2YZNA 1Y6JA 2FR8A 2ZIEA 4Q03A 3K72B 5COBA 3RAJA 2JDID 4Y9DA 3UK7A 3R7DA 1L5MA 1MH9A 3TLZA 3JARA 1MPTA 1NYRA 2FVYA 1A4RA 1DZ3A 3C8UA 3KVYA 2FK8A 2R5WA 3CZAA 5FUYA 3ZH2A 3HO6A 1VE5A 5EVJA 3JPWA 4H08A 2O8BA 1XEXB 1WL8A 3IDQA 4ARAA 4CQMB 2ZRAA 1B8VA 3LO5A 5A05A 3OIDA 3V4PB 2QX6A 2A5LA 3SR0A 1Q57A 4LDRA 2PRKA 3RODA 2AXNA 4D4HA 5BQXA 3P9QA 5LDDC 2D1SA 3GD5A 4DIDA 1ZOSA 5TX7A 3GXBA 3E15A 2WWHA 1D2RA 2WE7A 2W11A 1S1CA 3OHMA 2P30A 4XVHA 4DREA 2WUGA 5JCZA 2EJUA 1JLLB 1V96A 3FR8A 4FNGA 1QE5A 4LY3A 4BLPA 5ELLA 1EAMA 1VI6A 5HF5A 2FI1A 4LDNA 3L8GA 2ADFA 4PGGA 3NM4A 4Q24A 3ZWXA 4EDFA 2QRUA 3ZW9A 2W22A 3NU1A 4CQLA 3K70C 3VZQA 2H65A 3HC7A 3QBVA 5BSEA 3MWJA 5K05A 2EQBA 2HRCA 4B44A 4PR3A 4FYIA 2ZI7A 5A9TA 1HRKA 1LW6E 2XBLA 3ROEA 3TQTA 5CEEA 1PUIA 1AO3A 4OK3A 1U0NA 4OI2A 3FVVA 1TVMA 2VRNA 5FFMA 5HQ3B 1T34A 1XVTA 3GLFB 2FXIA 5A9RA 5ENDA 3QPVA 5BN5A 3K2QA 3FTFA 1E6KA 2H7YA 3SBEA 2BLLA 4WCFC 1E8NA 1D03A 3FFAA 5E9QA 3ZCSA 4ZYYA 2YASA 5E2BA 3TRDA 5LD2B 1PS8A 4QGGA 2HPAA 4I1RA 1G16A 1GN8A 4R9RA 2A59A 2FJUA 2PH5A 4CL2A 2WEKA 2OGSA 3DQQA 4BIMA 4CLOA 1VFNA 4RD3A 1JJAA 4IHJF 1ZAKA 2PWYA 4L9RA 1BWPA 1EM8B 1BE0A 2R85A 2QRPA 4PNPA 4KVFA 2W70A 1V9CA 3U7EB 1T9GR 5C1PA 3JQ9A 3OPQA 1FSPA 1RZ3A 2W71A 4NK4A 1KYYA 3EZ6A 3OEED 5CVUA 3UK2A 4HC4A 1HT1E 3NIBA 4ZYZA 4DV7B 3AVTA 2ZSDA 3IULA 3KZKA 5HZGA 1OPXA 2LCQA 1XNQB 3OT1A 4ZQBA 1O9HA 3DAOA 1Y4ZA 2O0LA 4H27A 4MW4A 4UTXA 4BOYA 8GPBA 2QVYX 2R6HA 2AR7A 2DB3A 4OJNA 3RC9A 1L5HA 5EXDA 4RHEA 5FADA 3VYRB 3LPNA 2YNMC 2E18A 2GGSA 1VPLA 5C31A 4QQKA 1BEUB 2GCGA 1F5NA 3T34A 3ZWWA 3DOFA 4RFSB 1JKJA 2WF5A 1H8EA 3BFXA 1GTRA 1ZFNA 3FWHA 1XMIA 2VKQA 2XT6A 1S7CA 5CLHA 1AKTA 4QNMA 3KZOA 1A1SA 3QBTA 3F2IA 3DBLB 4Z51A 2GSWA 3CW8X 4LBVA 4R98A 2AZXA 2IW1A 2ECFA 1LSJA 3MUNA 4HMQA 4M99A 1G5FA 1IK6A 3I9JA 1CJVC 4CW7A 4OHWA 2JAUA 3NEYA 4JBHA 3THXA 5ILQA 4HMPA 5IYZB 1X1QA 1OKKD 3D6MA 4CKCB 4BU0A 3PGKA 2AQKA 4I7EA 4X94A 1RYMA 3BHJA 1XL0A 1KERA 2ZAYA 1BH2A 5DWQA 5B7GA 4M46A 1CNEA 1CRZA 2HR1A 2FFQA 4B6FA 1DWQA 1ZP6A 3I83A 5BW5A 1OXSC 2BYTA 1I6MA 2X8JA 1LSOA 1LBIA 4MUGA 4MUBA 3WKCA 4DBLE 2B78A 1PLJA 3QENA 4FUTA 2OAEA 2IS4A 1NVDA 1PZEA 1J6UA 9LDTA 1K4KA 1A71A 2PL5A 3E7PA 5F23A 1ZXLA 1U3DA 2OV4A 2CFSA 3NAGA 1EBBA 1LTKA 2CJWB 2GXSA 2JI4A 1RI5A 5I7OA 1Z7EA 3ZDDA 4ZRNA 5LUAA 2C61A 4HDSA 5JAIA 2ACWA 3RM3A 1D2EA 1JDZA 1DCKA 4IVPA 1GLVA 4L8YA 4BJ6A 2WQ6A 2E4UA 1SD1A 1DTSA 3SEQA 4OHKA 2UXDB 1X6VA 4I6GA 3ZEAA 4RTMA 3CRVA 4RV5A 3FMIA 1LC0A 2G8LA 4Z4IA 3M9XA 3P0HA 3CLVA 2GCOB 1REQA 1JVNA 3CNQS 2IZ0A 1FQWA 1GTMA 1YQEA 3F6BX 3H0EA 1NVBA 1G41A 2C9MA 1SHJA 2AD5A 4TXLA 3RRMA 1XPUA 5KKNB 2DPMA 4J16A 4DPMA 1SIBE 2X15A 4RKRA 1KL7A 2YHIA 2LDXA 3B53X 4GOLD 5B4VA 1I4LD 3TFQA 4QYMA 3GFTA 3H1GA 4UNIA 2P1ZA 2GQ0A 2PZMA 4D9CA 5FBVB 3CVVA 1MJNA 2FUG1 5IKPA 1ECJA 4RHXA 3RTDA 1Z0FA 2WIKA 2Y2VA 3UHPA 1PWYE 1SZCA 3NT4A 2WNHA 2X2PA 3QNMA 4H15A 3UMRA 3AGPA 3I4LA 2CNKA 1E5QA 2BMDA 3FX2A 5DB4A 5KPJA 1W1WA 2AJDA 1T26A 4C4YA 1WU7A 3H5IA 2CB9A 2VF8A 1JU3A 3AR9A 5JVDB 4NOJA 4LXGA 1CNFA 1YGYA 5ANRB 2JFGA 2QGNA 3PIRA 5LLSA 5CIQA 4YJDA 5HIJA 3VU0A 3ELYA 3EGDA 4PYRA 1MOSA 4JOQA 1QFZA 4FCCA 3RVSA 5MN5A 2CLFB 3OUUA 3LBIA 5JS1A 5JMTA 4GKKB 3R6GA 2Q3CA 2BLNA 3BTUA 5BXYA 4CTOA 4NIMA 3D3JA 3HKDA 3LJKA 3OZIA 3SFVA 1VLZA 1IXZA 4LRWA 3LSTA 3MS2A 2OZVA 4EGCB 5IP5A 3LYAA 4WBNB 4EUFA 1GKYA 3QMMA 1IHDA 3ZZTA 5C32A 1ZNYA 1DMRA 3UM9A 1IDN1 2OUIA 4FI3F 4BJ5A 5LLDA 1V47A 4QDOA 4YAJA 1DXYA 5ENZA 4I4TF 4KDRA 3IOYA 2O2XA 4RY0A 4FXPA 1FXWF 1RW4A 1VSBA 1E3WA 3NKVA 1NJ8A 3RIYA 3UA4A 5CT4A 5FOXA 1FFGA 4S0ZA 1HG0A 1T1EA 4TVKA 2HMTA 3IAHA 4C0BA 5A0FA 2XUKA 4ND6A 4XR4A 3U3JA 4HNSA 2GNPA 1XZBA 1YBVA 5DP2A 1NQOA 1ECCA 2H4XA 3E84A 3OPXA 2WFMA 2BEWB 3D2BA 2O3TA 2H3HA 3GP3A 4JLDA 1Z15A 2ID9A 4KQFA 4L0QA 4LHWA 1KU6A 5ED0A 1RKBA 4OI0A 1MUUA 4RZIA 4B46A 1BDBA 1S3FA 5L3QB 2FNAA 5PGMA 3G0IA 4BY9E 4OQ4A 4QGSA 1CU1A 1MC1A 4MYTA 3GLFA 3QNUA 3L8FA 1LFAA 2HNBA 3EQZA 3WO1A 2IVZA 5CMLA 3RVNA 3L7DA 4FSXA 3BL6A 3WYCA 5BWCA 3GUVA 4RA6B 4INOA 4L4RA 4R9NA 4TWZA 3ON5A 1FQOA 5HUJA 1E3TA 3HYTA 1YQTA 1LVUA 3AEZA 5FWYA 3CZCA 5F77A 4AJLA 3PUVA 2J8ZA 3FXAA 2VTVA 1VL0A 4QU0A 3SR3A 4JB3A 3JWIA 5IEBA 3G5LA 3G13A 2ZBEA 4R8SA 4Z3OA 4IZHA 1Q0TA 4D9HA 3NJRA 3H5LA 1XTZA 4GLJA 3HO1A 1XQ6A 4A0RA 2RH8A 1R18A 4D9EA 3TTVA 1X70A 2XQGA 1QTQA 1ISPA 2WRZA 2XPCA 3N0TA 3W5AA 3PWSA 1ZK1A 4MW9A 5AIAA 1PV4A 5H80A 2HPZA 2IV3A 3A1VA 1XEXA 2C2GA 3WL4A 5HJ7A 5L6LB 2FEWB 1ZHOA 1H93A 2OAGA 2QENA 4JYMA 3U4AA 4YYEA 4K9LA 4JQOA 4E88A 1YMQA 4B6RA 3O8OB 4N39A 3T5MA 1FFXA 1JSZA 4RTKA 3P9NA 1II8B 2XDAA 3CG0A 3E9QA 5FBKA 2CLMB 2H1CA 5LUBA 2QZPA 2QN1A 4WADA 1QP7A 1A5SB 3HKDB 1RRPA 3WLTA 1E4YA 2ZM6B 1GUYA 1MW9X 1LWNA 4IIHA 4HGPA 4QO7A 4P7FA 3MTBA 2Y1FA 2VP0A 3N7UA 2ECKA 2GF9A 4RD4A 2FWIA 3FVWA 1YBHA 3O91A 3WLJA 1E3LA 4AROA 4BLVA 4YI3A 1KI8A 2ZBGA 3S3TA 5B3LA 3QELB 4A6DA 2OZLA 5LP6A 4P0QB 4FXOA 1ZBQA 4J75A 3NXSA 1ZK0A 4OIMA 4ARZB 4CMIB 2AOTA 1BWSA 2V03A 1PNRA 4PYQA 1G3RA 1CUFA 1NQUA 1WQ1R 1N6HA 5TMPA 1VP3A 1BVRA 1C0EA 2ROQA 4WCVA 1EBFA 5JJLA 3SVTA 2ZM5A 1CR2A 1OXMA 2P0EA 1K6JA 2VQSA 1TCCA 5EMJA 2LZ0A 1T5BA 3MWLA 4KWHA 1YZVA 3PXGA 3X2FA 1ZCAA 2JAHA 4QU8A 1UDBA 5FA5A 3P9CA 5GWXA 2M1XA 3SZ3A 4E2YA 1Y8CA 2BSXA 2PU7A 4KUEA 5HTOA 3RRZA 2IBSA 1G9XA 4EY6A 1TZKA 3NNSA 1A88A 4I5FA 4RD2A 5CVJA 2D8MA 3DV9A 1RPTA 4JLJA 1X8LA 2HLDA 2QROA 3F1LA 4J4HA 3IV9A 1CJTC 5JAQA 2EKPA 4RLQA 5DYWA 2P9EA 5FBZA 1BX1A 1YC5A 4O2BA 4TT3D 1NT2A 1JFVA 4BFTA 2AUTA 1UP7A 2A58A 5L3QA 2CL0X 4RELA 5JCOC 5K3FA 4PZDA 5I7SA 4HD8A 1AZLA 2WWRA 3NVMB 4H7JA 5EIHA 5AI6A 3DQZA 5DBGA 2BGJA 2KPOA 3VDRA 1B6TA 1OZHA 4Q3EA 2ZE7A 1NE2A 3T3DA 5MFPA 2JCYA 1S6YA 4GXTA 4EY3A 3WFIA 3RHSA 4YUXA 4R8KA 3TR6A 2HJSA 4Q3AA 4RQTA 3U0BA 4GQAA 3U62A 5JI2E 4AZ3A 5KQMA 3I58A 4JSRA 4ZI7B 3M6WA 2H1OA 2EU8A 4MWZA 3X3HA 1O89A 3L8DA 4BMYA 2H59A 2C96A 1JG7A 3EGCA 1PFYA 1NV8A 2C9ZA 3PNBA 3C5WP 1Q2XA 3U7QB 2FDCA 3BE4A 3DCJA 4C7VA 4IWYA 2OBNA 4EBFA 3KVRA 3VPSA 4OY3A 3FSEA 2IYYA 1HOXA 1TECE 2FR1A 1EESA 4XIIA 1KQNA 1M6YA 2ZI4A 4LXXA 1AT1A 1W0JD 4ARBA 3LX5A 5IHXA 4WOJA 1MAWA 4KK3A 4Q48A 1OH8A 1RYEA 1SG0A 2RHCA 3DKKA 4GR9A 1T4CB 4N0EA 4MQEA 5FFFA 5JCJD 1XTRA 4EGQA 1QAOA 1C9JA 3OC6A 1N2EA 1ZOLA 1IBKB 1EE2A 2PXHA 1X2BA 1QYDA 4QRHA 4IM7A 2IPLA 3OX4A 3RYCB 4BCCA 5K3CA 3SHQA 4CL0A 5G53C 4RDIA 1UM9A 3SSAA 1BE6A 3NBMA 1JLMA 1U99A 3L8YA 5TC4A 1E18A 3CU5A 2AXEA 3QPWA 2HHHB 2ZSEA 4JKIA 3C1TA 4L15A 2JGKA 4BC1A 4FZJA 1KQOA 1CP3A 4TSFD 3HXPA 3G9XA 2XBMA 1VZ2A 1XLWA 2NPFA 1MJFA 1GWNA 1QM5A 3CMMA 3EJ6A 3FNHA 4QOHA 5LBIA 5BV1A 2ZIUB 4AT1A 1I1NA 1QAMA 1JKJB 4J1TA 3LI2A 1X74A 2XYGA 3FFXA 3H5NA 4MW5A 4U7HA 5IUKC 2PS0A 5F5LA 3O03A 5JSZA 4BO1A 5KNDH 3GBPA 1JKFA 4K9NA 4TMFA 3NB0A 1E9CA 4YQYA 1K6IA 5JEEA 3SWWA 2O19A 4C2AA 3UWSA 4KL8S 3GGOA 2QIPA 5SZHB 3QLVC 3AUUA 3M2PA 3C24A 3ISJA 2CHVA 2D54A 5DM70 1ISRA 4EY5A 1TCAA 3I01M 2BGWA 3DTVB 2ODPA 4HAOA 4B3RB 3GOHA 3Q7SA 4FDTA 4O5OA 2Q3JA 3DM5A 4DR4B 5EINA 5CVTA 3U13A 2WLSA 1L5OA 1XLUA 2YWCA 3G6KA 4I3FA 1KOGA 3ESZA 1II0A 1W59A 1Y4AE 2JVKA 3HWWA 4HS9A 3ZI0A 1TJNA 3HDVA 4JLVA 1RWNA 2OCIA 4WKOA 3ZOKA 3PPYA 5GGYA 1USWA 2DJ5A 5HS4A 1DHRA 2E5WA 3DO6A 4XYEA 3E23A 4U9IS 1RYNA 1ZJYA 1NE7A 3C5EA 1JJIA 3U56A 4TVSA 2J9RA 1FXWA 2FF7A 5M34A 2ZB3A 1IZ8A 2QD3A 3BT7A 4KLZA 1YS6A 3OM9A 2FZEA 4P5EA 3P0EA 3VU9A 1FPQA 4F3TA 2BBOA 4GI5A 1OGIA 1ZQ9A 2BHLA 3VJKA 3LUJA 3TWOA 5BMVB 1PGNA 4FU0A 4EG6A 3SQDA 2D7DA 3H6HA 3BKWA 4P3KA 1P77A 1U2DA 1HUQA 1G63A 1IBSA 4NQZA 4ER7A 1NJ2A 2FN9A 4N5HX 4F60A 1RXCA 2GFHA 3O82A 3EIHA 2PD3A 5CBPA 3NGXA 1VJGA 2NUBA 5EJAA 4ND1A 3UOAB 3WWCA 4B3DA 4YT8A 1RCFA 4QBTA 2BKEA 1U81A 4IICA 3U7RA 2X8WA 1KU0A 4N8SA 4CE6A 3DH0A 3C3CA 3PK0A 4F3CA 1JIXA 2QVGA 3IKJA 2J9FA 3EBOA 1YVDA 1KY2A 4EPTA 1GCOA 4XE5A 1XRLA 1X0XA 4I6JA 4O4JB 5IJXA 2J0EA 5DTJA 4G8DA 4B2YA 1JMYA 4YECA 1JZQA 3MAAC 4R16A 3OAAA 2Z2IA 3GHYA 3WRXA 1J1ZA 4I36A 3QU5A 5EJ2A 1VA5A 1XTBA 4EG5A 4OSOA 4M22A 3BZUA 3VGPA 1IUOA 1LSUA 1W0KA 4A3SA 1QO0A 2QUIA 3CX7A 3WSWA 2FPKA 3N53A 1T9GS 4I4LA 4MQ5A 1GL3A 4B2LA 3VNVA 1DAOA 4EW6A 5H3LA 3A4TA 4MVJP 1MFPA 1XTQA 2NAFA 3ZLUA 2QRHA 5F1PA 2LKCA 4AW9A 2QM8A 1ZGHA 1WLYA 1T3SA 3ZDFA 4JBYA 2UZ1A 2DP4E 5IAAA 3Q0EA 1MVLA 1O95D 2XQFA 4GGMX 4RPCA 4Y67A 1O95A 2I4RA 4UAJA 2Z4RA 1E9SA 2FWMX 3KDAA 3RYFA 5AICA 5HJEA 3EEQA 1FNCA 1E1MA 1MHPA 3O4GA 2ZBPA 3CX4A 3JSXA 2NO4A 1W5FA 2BELA 4YLGA 5CDTA 3HEAA 2ATIA 4E5PA 5HM8A 2H18A 3SX2A 1U9IA 2D06A 2JA1A 3FZNA 4JVLA 1ESNA 3TUZC 2FPXA 1CFZA 1CS0A 2VEDA 4N6NA 3FDJA 4OXIA 2O1WA 1UJ6A 4A5OA 2AQIA 3E9NA 3G23A 4I1OA 1UF9A 5EESA 3O8RA 4KMRA 1KFEB 1V5IA 2DKOA 3S5JA 3ET5A 5JDIC 4YLEA 2ZYWX 3ETJA 3UICA 3U3OA 2ZDQA 3IV6A 1VMDA 2HLNA 2RJNA 4NH0A 1S02A 1YB4A 1Q17A 4IYRA 4CKWA 3WHLA 2GVZC 4S1NA 2IZOA 5EHIA 3GJSA 5FWAA 4IHKA 3VQTA 3OPMA 3FYTA 4IIFA 4XQGA 5KVAA 3QOYA 1FVFA 1OX6A 1X7XA 2HADA 3MXOA 3FOCA 4GVPA 4PG8A 3OZUA 4XOUA 4KX3A 5KINB 3ADDA 2QZSA 4D4KA 2R1ZA 4IGAA 3ZUGA 4XWGA 5DEIA 3FDIA 4F06A 2GZDA 2QTFA 1QVZA 1Y7IA 2WSBA 3QMVA 1OX5A 4K40A 5K6RA 4LF8B 4KXLA 5HCNA 1R15A 3T52A 1YR6A 4LRTB 2OAP1 3I62A 4BMNA 2HF2A 5HGXA 4K46A 2PXCA 3OHPA 3IERA 4EW1A 3VZCA 5MN4A 3JAWB 1U2ZA 2LCFA 5AKHA 1AVTA 1DIGA 4R1SA 2BM8A 1IWBB 1U8AA 4PWYA 3RYHB 4HFNA 3RVOA 1Q0QA 3SS7X 3PQ3A 4NCBA 3VXKA 4JL8A 4Q9IA 2HJVA 2QW0X 3HA2A 1MENA 3RRJA 2BM0A 3G2PA 2FPLA 4LDJA 4PO9A 3AKYA 5LVAA 3FOFC 4P83A 3UMJA 2ZJ5A 2REQB 3MMSA 1Z06A 2XXJA 1XXLA 3A6LA 4P9NA 4A8PA 1TGYA 4BKRA 4BGDA 5CFLA 3EG5A 3ST7A 1GSHA 3KUDA 1OB2A 1HE5A 1EEXB 1PZHA 3WLAA 1YIAA 1Q0PA 3PFCA 4LJ4A 4P34A 4G65A 2I2FA 2GARA 1WDWB 2PUFA 3JATA 4RYDA 2BL4A 1LDEA 2BC9A 2P2CA 2Y6VA 4YEDA 5WRFA 3TZQA 3EPJA 1HLPA 3BE5A 4J49A