3H0KA

Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
177
structure length
171
Chain Sequence
b'KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAGERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0200 protein SSO1041
publication title Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
total genus 54
structure length 171
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h0kA00
1FFHA 3GLGE 2NO0A 4KSBA 3CRVA 4Q1BA 1Z83A 1T5LA 4DCNA 2FEMA 2CNWD 2QZ4A 2JJ8A 3BK7A 4DLZA 2FPLA 1E9EA 1P2VA 4XJXA 1F6BA 5KPJA 3ADCA 3RVBA 1CR4A 3ZVLA 4B3FX 3GJ7A 3QF4B 3IQXA 5L3QA 1G3IA 4JLBA 4DT1B 4WA7A 1Q3TA 3S1AA 3PEWA 3BWDD 2AXNA 2NG1A 1HE1C 2B7BA 3C15C 3NHAA 3N2IA 4M1SA 3KKPA 5IRCD 1WXQA 2ZEJA 3EZ9A 5EQTA 1CRPA 3LBNA 1YZKA 5JMTA 3DKVA 1N0WA 3K09C 1N5LA 4M53A 2Z5FA 1TX4B 4L5BA 3C7KA 1X1RA 5GVSA 1U8YA 1YZTA 2WWHA 4NCKA 1JECA 4MKGA 4JJZA 2HLDD 2WM9B 2O8FA 5JRJA 1XTRA 2V7QA 5FFMA 2WICA 1SXJE 3THXB 4G5SA 1XRJA 2ZTSA 3CZPA 4CEJA 3CW2A 3NBZC 4Q4JB 3AVXA 4W5JA 1XEXA 1T5IA 3FVQA 1U2RA 1P4SA 3EW9A 3I8XA 4G5QA 2JLRA 2OLJA 4QBGB 5GVRA 1NLYA 1E0JA 1Z5ZA 4NP6A 1GNRA 3PV0A 4JVMA 1KAGA 4MDFA 3LD9A 2WJYA 4G01B 1GL7A 2F9MA 1LVGA 3QUSA 4KVGA 1NN1A 3RC8A 5KSPA 1NIJA 1XJCA 2GEDA 2CE7A 4EPVA 4B76A 1AKYA 4Q1EA 3WRXC 4EPXA 2DFLA 3T1TA 3PUZA 2OE2A 3B85A 2ZRGA 1E2HA 1Z0KA 4BFZA 4DJTA 2B92A 4N0EA 3TSOA 4BLQA 2XXAB 4P4SA 2CHQA 4I1SA 5CB8A 3IDQA 1UPTA 3X1YA 3I73A 2CCGA 1ZCBA 2PT5A 1CJMA 1ZJ6A 1U98A 4OHVA 2UZIR 3FHCB 5SZIA 5JCZA 3IBGA 1ZNWA 821PA 4LC0A 5FTKA 4N1AA 3GLGA 3GEIA 2AD5A 3LXXA 3ZVNA 3PEUA 2VP5A 4IFEA 4S35A 4E03A 1E2KA 2JLYA 3GJ8A 1YKSA 3O8DA 5FI0B 4EQ6B 2REXB 3IEVA 3MUFA 2GJ8A 2VO1A 3ZZUA 2IBMA 1Z6XA 4D0LB 4DEYA 3FDIA 2OG2A 4HZIA 1FPMA 3BB1A 1UF9A 3ADDA 1FTSA 5TARA 5G3YA 2OHFA 1G8HA 1AZSC 4LDJA 4HAZA 1KSGA 2ZJYA 3QENA 2C77A 5M04A 1WB9A 3V9PA 2C99A 5FPTA 4BPBA 1D5CA 2AKYA 3H1TA 4AYWA 3WMFA 2YKGA 2O8CB 5CJPA 2ONJA 1KI4A 3QQ5A 2B6HA 4DUGD 3GJXC 4DSUA 4TT3D 2GJ9A 4LV6A 2CK3A 3FGNA 2CLSA 4Q4HB 5FPHA 2ZVQX 2MMCA 2IXFA 1RE0A 2ZJBA 2AFIE 2QSZA 1XCPA 4RVCA 2H5EA 1SKQA 5JHGB 4W5WA 2ZE5A 3DMDA 2ZETA 3BB3A 4URZR 5BQ5A 3MMPA 1TU3A 4Q7LA 2BBSA 5EE5B 4JLNA 2ZJAA 2NO7A 4GI7A 2HT6A 3KUDA 3I4LA 2OCYC 4M2LA 2FZLA 2OUKA 3NC1C 1J8YF 2JJ2A 1II0A 1GTVA 3O8BA 1M2OB 1VG1A 4KHZA 2EYUA 3W8NA 4BEBA 2PH1A 5J4LA 5CITA 3ADBA 2WSSA 4PO1A 3FB4A 2VYFA 4RSGA 2ZI4A 4Q9LA 3UK6A 3NBYC 1E0KA 3U60B 4NZYA 4B6FA 1ESNA 1RRCA 1NIPA 3K70D 5FOSA 3CONA 4M1YA 3ZZ0A 1Z0DA 2XAUA 4LCBA 4UNQA 2ZS8A 2AX4A 3OE7A 5JCPA 3TUJC 2BBOA 1SXJD 1F60A 1CR0A 1R8SA 3OAAD 4PZLA 1ONBA 1II9A 3H84A 2EFCB 3TVTA 4TLBA 2VH5R 4TYQA 1U90A 1QRAA 2LKCA 2QL6A 3B1VA 2QAGA 3DHWC 2FSHA 1P7CA 1DO2A 5EP3A 3B7GA 1KK3A 2FH5B 4UKDA 2CXXA 1ZC4A 4IEIA 5E7JA 4UJ5A 1NN3A 3GPLA 3A4NA 4OI4A 3CRRA 5DI3A 3R9WA 3X1DA 3VR3A 5FUVA 1QG2A 2C98A 1KO8A 2ZSDA 1E98A 5FBLB 2R2AA 4O25A 1RC8A 4GNKA 2CE2X 4OK6A 4KU4A 2BCGY 3WXMA 4KLZA 3SYKA 5B64A 2HDNB 2O8DA 1E2QA 3RSOA 1RRGA 3ZQ6A 1VHLA 2CBZA 3NH6A 3SNHA 2ZE7A 1QHIA 4US0R 2GVDC 2GJAA 4FI3C 4EKDA 3B8HA 1CR2A 3ICEA 2EFHB 2OO7A 2IYZA 1ZYUA 1B0UA 2J0QA 2O8EA 1VMAA 1ZNZA 3DPUA 2IS6A 3BBPA 1WCV1 2QA5A 3VTKA 1HY3A 5E7MA 3Q7QA 2GK6A 4DEXA 2V8OA 2NGRA 1UADA 5B2ZA 5H8WA 1Z6TA 4Q18A 2J7KA 5B57C 1ZU4A 4IXNA 3K0EA 4US2R 5JFGA 1IXZA 3A6PC 1SVSA 1MABA 4WW0A 3TSWA 4LGMA 2Q9CA 4EUNA 2CLDX 3TE6A 1W0JD 3W5IA 3OESA 3GMTA 3WNCA 1JAIA 1YVDA 2ZRDA 3QE0A 4A8JA 2WTUA 5CYOA 4QFMA 3FHOA 2LCFA 3SHWA 1FQKA 1VG9B 2HCJB 2E1RA 1G7CA 2A5GA 2GXQA 1N6KA 1TF2A 3QG1A 4IHQA 2Z4RA 4IVPA 1XTIA 1HE8B 2ZYVX 1OYWA 4JLPA 1E1RA 4Q03A 4HB0A 2AWOA 1KOFA 4Q9HA 3BC1A 2WJJA 4KODA 4BFVA 3QPUA 3TR5A 2AN9A 2QGNA 5DN6D 2JEOA 5G53C 4KITB 4PZZA 3CH5A 3LY5A 3UG7A 4WIAA 2CL7X 1DAEA 4BRWA 3MSXA 2WKQA 3MWYW 5EUQB 3C8UA 4HLDA 4BZPA 1R10A 3AVQA 4A4DA 3WBJA 2WJVA 2JAQA 1D9XA 2G3YA 2BDTA 3BE4A 1VIAA 1UKEA 3AQ4A 2YVUA 2GXAA 4PAQA 1ZBDA 1NMZA 2OBLA 3GCGA 1KJWA 2W6IA 4KBFA 4DLTA 4TSFA 3FTQA 1X8JA 3X1XA 2RGNA 4DCUA 1XNJA 1FMLA 1T3SA 5L3QB 1DBSA 3S1AB 4GMDA 5C1BA 4RZ3A 5DIFA 4AYXA 4EPRA 4OHYA 2ANCA 4QGAA 2ZRBA 4JVLA 1DEKA 1FZQA 4ZKEA 1VHTA 1XMJA 2GAAA 2GBLA 5KSOA 1PLJA 1ELOA 3W9YA 4GOKA 3Q9LA 5TXGA 2C03A 5FI1B 3F5FA 2IYLD 3P4YA 1G8FA 3BFKA 2CJWA 3PFIA 1NVVR 4JIMA 4BECA 4XWOA 1YZUA 2CHVA 3OIVA 5JJKA 1HYQA 4B34A 4DLWA 2O8FB 2VHUA 4IEEA 1N2CE 5KUTA 4HLQB 5FBWB 1RYHA 3AVPA 4M1KA 1ANKA 2RHDA 2WVJA 2GF9A 5FL7A 1KJZA 1QBKC 4TTQA 1XEXB 1UDXA 3C4JA 4RZ2A 1W1WA 2IYRA 1EX7A 1TUEA 1PUIA 3T5GA 2ORVA 1OW3B 4JJKA 5F9HA 4ESVA 4X8MA 4Q01A 2JLUA 1G8YA 4KSCA 3HU3A 4C4PA 3TR0A 4MH0R 1DAGA 3A1SA 3QKSA 1WRBA 3D6TB 1Q1QA 2BOVA 2IWRA 1ZUNB 1CKEA 3PR1A 3U6BA 1T0HB 4PZYA 3U3JA 5HKKA 2HJVA 3SJCA 3W6OA 2J0VA 3R9XA 4CGZA 4DRZA 4QM6A 2B21A 2WJGA 2W58A 3QKUA 3MFYA 1XZPA 4V0NA 1MKYA 2ZSFA 4AI6A 2BEJA 4P4SB 1YZLA 1W48A 3VKHA 1Z0FA 1ZINA 4DLYA 3OEED 5G40A 5CM8B 2OILA 4QRHA 1NMYA 3M1IA 5E3HA 4ARZA 4Q1CA 2QM7A 4GSYA 4NDZA 1NBME 3GJ5A 2FF7A 4QNRA 3T34A 4Z1MD 1OF1A 1XMVA 4TQ9A 2WBLC 2QPOA 1WBDA 4YXWD 3RSLA 5EE9A 3NVAA 2XNSA 5F2EA 4D2IA 1OH5A 4MRVA 1VYUA 4LWZA 4JLAA 3OIWA 4FWIB 4IRUB 4IW3B 3OFNA 1C1YA 1OLOA 1E9RA 2O8BA 4JZKA 5SZKB 2OLKA 1E1QD 3WRYC 2ZYTX 3K70C 3MWLA 1R0XA 3GLHE 1PVOA 4D25A 2Z83A 3CUEF 1NI3A 2X8AA 2IF2A 4JL6A 4QBIA 4M0LA 3VU9A 4B2IA 2F1RA 2GXSA 2JIZA 4IVQA 1E4YA 4DLRA 3EARA 4LZZA 1KK1A 1ZAKA 2IUUA 3ASZA 1F48A 3K9HA 4PAOA 4QKQA 1GG2A 4IDHA 5AWFC 4EPTA 3EX7C 1W4AA 3DM9B 2ZM5A 3CNLA 3EIHA 4IDQA 2GETA 3EWAA 1RW4A 4BZQA 1NJFA 2IYYA 1NVUQ 4TMKA 3TVDA 3IEUA 1KMQA 1VDZA 2AK3A 3UPUA 3JZAA 4C0JA 1KI1A 5KTYA 5J4VA 2G83A 4KAXA 1X8LA 3EXAA 4PC2A 4BFSA 5L3SA 3CRW1 3IKJA 3CPHA 5E95A 1NY6A 4MITA 3H4MA 2AK2A 2BBWA 4MRSA 2WWXA 5CIQA 1II8A 4C0LA 1G64A 1PV4A 3BFVA 2VTKA 3MJHA 3V00A 4H1VA 4X8LA 5EXXA 3GJ0A 4QM7A 1G3RA 3VR5A 3Q85A 4TTRA 1XCMA 4ZDJA 1P3JA 2XOKD 2GRJA 1A4RA 4DLSA 3A36A 2KSQA 1UBFA 4MRPA 4MGZR 2VP9A 3T1OA 3K0CC 4B74A 1E3MA 3NH9A 1ZD1A 1IN7A 4MGYR 3IUYA 1Y3AA 3HYRA 4IXMA 2VP0A 5F3WB 1M7HA 1E2PA 2QMOA 3RYTC 2J9RA 5AUQA 3A1UA 4PHGA 5LPNA 4Z8YA 4PO9A 8OHMA 1D2NA 2OFOA 4XSGA 3UKDA 1W46A 1PUJA 4G5GA 4RY2A 1G21E 4KFTA 1KI9A 4WZ6A 2GCOA 2F43A 3KQKA 1Z47A 4U5XA 5EXSA 1J99A 5EP4A 2WSMA 3RRYA 3AH8A 2QN6A 1VG8A 3VAAA 1E2GA 2ZUCA 3KL4A 3O8CA 4GMXA 3MCAA 5DI3B 4L4UA 2AD1A 2B8TA 3T1VA 4TLCA 2XGJA 1PLLA 2CLCX 4EPWA 1LS1A 2V3CC 1R0YA 3WMEA 2ZAMA 2J0UA 4BLPA 2BHRA 4NONA 4R9UC 1EESA 4D0GA 2D2EA 2YWEA 2O8DB 3AB3A 2QUZA 2YOHA 1RVDA 1U81A 4ZO4A 1BKDR 4B35A 1I2DA 3AEZA 1JBKA 5KOYA 2AL7A 2OAQ1 2JATA 1O87A 2ZYUX 3L8YA 4RD6A 5JRZA 3R9IA 4C7OB 1NBMD 2DWPA 2ASEA 4IOKA 3PUVA 4A0RA 4RD1A 1KDTA 3T61A 1A2KC 1G7TA 1AN0A 4D4LA 2W6JD 4NYMR 1CIPA 3FFAA 4TMVA 4WVFA 5JZVA 4CEIA 1UBEA 2PZEA 2XNDA 4JBYA 5CLLA 4FMCB 1GSIA 1IJEA 4OYHA 4AURA 1A1VA 1P9WA 1MABB 3KXLA 1D9ZA 1H65A 1KNQA 3LV8A 4MQBA 3TQCA 721PA 1UEJA 3W34A 3DOEA 4A8JB 1JI0A 3I5YA 4L15A 1IN4A 4YONB 4JLVA 4PC3A 2DB3A 1P2TA 1LB1B 1YU9A 1VPLA 4ZKDA 1JALA 4LHYA 2RCNA 1Z2CA 1P2SA 3AVYA 3B1ZA 4FMDF 4UNSA 1SZPA 4ASUA 5TMPA 5DHFA 1NJGA 1OH8A 1BH2A 4LYJA 3ZJYA 2C9CA 5AJZA 1Z28A 1KI6B 3A1TA 2DWQA 4IVRA 1FMJA 1H8EA 4PAMA 4DCTA 2J7PD 2J59A 3P27A 3ZH9B 1I2MA 2D06A 2JA1A 3KJHA 4NCHA 5FPSA 2IYVA 3CR7A 1DAIA 3BD9A 4M9QA 1LF0A 1J8MF 2Q3HA 2QPTA 3O8RA 1XU4A 2ZROA 3FFBA 3CF6R 4L8GA 4Q7MB 2Q9AA 3OEHA 3ZIAA 5FBRB 4Q9KA 1YZGA 3SFVA 5KO2A 2CEAA 1OSNA 4URVR 2P5SA 3QF7A 3IQWA 2CNWA 1IN5A 1I4DD 1R5BA 4Q1DA 5JWHA 1R0WA 2X2EA 1NKTA 2BKUA 2YWFA 3WHKA 4A0HA 4BRUA 2OFWA 3B60A 2A3RA 2BVNA 5DO9A 5FUWA 5CDFE 3RHFA 1G3QA 1DPFA 1O3YA 3UWOA 1Z6GA 3BAFA 3MLEA 4QXAA 5HCNA 4MDEA 1ETUA 4I1VA 2A5FA 3CR8A 3HJNA 3EASA 4LJ5A 1GWNA 3THYB 3X1ZA 4CIDA 2ZSBA 4TZ0A 2H92A 3L43A 2XEXA 3GLFE 3U44A 4OHWA 4D82A 2IC5A 1CBUA 1QHSA 3KB2A 5CK4A 2JCSA 4LSGA 2QG6A 3CPJB 4II7A 2IWHA 4BFYA 2CJWB 1UJ2A 3VX3A 2VBCA 1IY2A 3WMGA 1GNQA 2HLDA 4JLMA 4B44A 1FTNA 5ELXA 4YDSA 4O2LA 2WWYA 3HWSA 3PJRA 2IYSA 1T3HA 2A5YB 3GEEA 4P4UA 4J0QA 2XTZA 2QQEA 3C5CA 1M34E 1L7VC 2DFTA 1GP2A 4V02A 3I5XA 3FHTA 2C96A 3THOA 3IIMA 5DLQC 4F38A 2VHQA 3JZMA 3T12A 1QVAA 1UM8A 2P6NA 4AYTA 1WDTA 5F98A 3LQRA 1CP2A 2DY1A 4QOSA 1SVKA 1KI2A 3QBVA 4HLCA 2XZLA 1W49A 1EXMA 4OQMA 4JMPA 1KKLA 1GUAA 4M1OA 3C5HA 1HT2E 1KO5A 5GJCA 3CWZA 4D4KA 4FD2A 4IFBA 1L8QA 1CEEA 1OIVA 3BRWD 2GHIA 2GDJA 4C30A 1SVMA 4R2IA 2GESA 2MSDB 2ZRKA 2NO6A 1AS3A 4EFNA 1XXHB 3DKPA 1FX0A 2QP9X 4OQLA 3PVSA 1C9KA 3K0FA 4P32A 1TTTA 1NLZA 3NC0C 2DR3A 3IBYA 4ARZB 1XTSA 4NMMA 5IDVA 3EZ2A 1HT1E 4M4SA 1G3UA 3Q72A 3VHXA 3QXHA 5CDFA 5J4YA 3T15A 3WYGA 4W7SA 4C9BA 3GJ3A 2JDID 2BM0A 2LKDA 1ZUHA 2OM2A 3IHLA 3B1WA 3NG1A 3R8CA 5FOUA 3U3KA 2NZJA 2WOJA 4MGIR 1TQDA 4Q21A 5DE3A 3QBTA 5A4JA 1NNEA 1J7KA 2PBRA 2XTMA 2PMDA 4FN5A 4M1WA 4BFTA 3EZFA 2O8BB 3LAWA 1BS1A 1OPXA 2ERYA 1NVVQ 3O47A 4Q9IA 4R71A 5F9FA 3VX4A 4B33A 2C5LA 5JJLA 2FX3A 2PT7A 4PTLA 4KFUA 1IXSB 3GLFA 1E2LA 4IDOA 4OKSA 4PHFA 4JVNA 4B3BA 3CNNA 4DUGA 3H2YA 3VU9B 4EIWA 1WBBA 2ZJOA 1AA9A 4TT3A 1NVXQ 3AKCA 4AKGA 1JXOA 1NF3A 1ZMXA 4QBHA 2Z4SA 4MUBA 5KDDA 5EXPA 4GOXA 1KKMA 4YC7A 4IKEA 3UATA 1G9XA 4HAWA 5KU1A 3TGPA 4JBWA 1U0HC 3PEVA 2X2FA 2BMJA 4C0SA 2ZAOA 4TLEA 4QJ4A 1N0UA 3CO5A 4JS0A 1E9FA 4LBVA 5H68A 2RMKA 4OHXA 3RANA 1N5KA 4JKYA 3T5DA 5L3SB 4BLSA 3AVUA 2WPDD 3VR4A 4LHXA 4TTPA 4XSHA 3KQNA 4KLNA 4O0MA 4UXHA 3PXGA 4G0NA 1T8UA 4CW7A 1II8B 2H57A 4D4MA 3U2QA 4RZXA 3RC3A 5UKDA 3EZ7A 1XFAA 1P62B 3SYNA 5EE1A 2C95A 2FFQA 4GZLA 4M1MA 5GJVC 3SR0A 5JS8A 2XB4A 5CLQA 1EGAA 2KBFA 3IGFA 4HUQA 3W6NA 2BMEA 2OESA 1SXJA 3OAAA 5J5CA 1ZM9A 5E4FA 1SQ5A 2QMHA 4EJSA 2GILA 1XPOA 3GEHA 1OXVA 1W36B 2ODBA 3R7WA 5KHOC 3U6KA 2O0HA 3L0SA 1K5GA 3W3AA 1P9NA 4MRRA 3TNFA 2GCOB 2F43B 2FE4A 3HU2A 2ZJZA 4BEJA 3LWNA 5JSZB 5K8LA 2OFXA 1M7GA 5CYPA 1WMSA 1AS2A 1EFRD 1VTKA 4M22A 1W5TA 4OQXA 1YRAA 4P0TA 2DCUA 1IJFA 2IYWA 5CJ2A 3A4LA 3TW4A 1X3SA 5JWOA 1FW6A 1MO5A 1P75A 1JB1A 2D7CA 2YWGA 5A5GA 2CVFA 2J0UB 2KBEA 1G16A 3IIKA 3K1JA 3M6AA 4M1TA 4PHHA 5FBQB 4AKEA 4NHOA 4DCVA 1U9IA 1DADA 4IDNA 1OXTA 1Z8FA 1JJ7A 3NXSA 3PENA 3KDSE 1KK2A 2OBNA 5C4MA 4DB4A 3GLIE 5G3ZA 2WIAA 1D2MA 4BLRA 3CX6A 4H9GA 3UMRA 1CU1A 3LDAA 4IOJA 3QXXA 2X77A 2FDCA 2IYQA 2J1LA 6Q21A 1FQJA 3REFA 2YV5A 5JI3E 4LRWA 4CEIB 3KKNA 2QAJA 5HR5A 5AJYA 5FUXA 1LW7A 1QZXA 2GXUA 1W0JA 2GWHA 1DVRA 2R44A 4RCZA 1M7BA 5DISB 2BMFA 4U00A 3SBEA 1VCNA 4JLJA 4JLDA 4NU0A 2JLWA 2B7CA 4DVGA 1GRQA 4XIGS 1JEEA 1S8FA 2J41A 2FFHA 1WP9A 4O2RA 1NRJB 2MMGA 3LNCA 4TQUS 4Y0VA 4B3CA 5KDLA 3RABA 4Q48A 1G4UR 1E2MA 2F55A 5J4KA 1SKYB 2IUSA 2A30A 4YDHB 5AJXA 3ZYCA 1SVOA 2QENA 2HT1A 5DN6A 5J4HA 3AGQA 3I8SA 2Q3MA 5G41A 4DKXA 3ICQB 1XD8A 4BLOA 2HYIC 1VCOA 3PITA 4GP6A 3VMFA 3LVQE 5FTNA 4LHWA 1AQUA 1JEDA 4IOLA 1DO0A 1Y63A 1R8QA 1XD9A 1W4CA 2UZ3A 2FSFA 2I4IA 3B1XA 3L0PA 3TQFA 4A2WA 1ZU5A 1EK0A 3UMFA 2JASA 1BO6A 3RS0A 3SBDA 3K0AA 5KDOA 4Q9JA 4FMBB 1G8GA 4DCSA 1US8A 3DMNA 1VCMA 2Y8EA 2RGBA 4FCTA 2F3TA 3FKSD 4FW9A 3FOZA 1P72A 1GOTA 3CF0A 3A37A 3EA0A 3WP1B 2V4ZA 3WYAA 2FG5A 2ZS9A 4BE7B 2QBYA 1GVNB 4RKEA 3RS3A 1A2BA 4WBSA 1TAGA 1XJQA 2A78A 3QNUA 5FR2A 5FPYA 4CZ2A 1P61B 3D8BA 2JLSA 2MSEB 2WZQA 3LH5A 3KB1A 3GFOA 4HLUC 4V0KA 4JKIA 4NYMQ 1ZCAA 1XEWX 1G19A 3U3OA 4A6PA 2VEDA 4F91B 4UNRA 4E09A 4OL0A 1OXUA 4HZUB 1JAHA 2KE5A 4G5RA 3B13B 4QC2A 3AF4A 2NZ8A 3BGWA 3U44B 1Z2AA 2C78A 3L8ZA 2Z6VA 3OIUA 4MYUA 4A15A 4M8NE 4MYHA 3DZDA 3OHMA 2XTNA 4EAQA 1FP6A 3I1FA 3HPRA 2GKSA 4LK2A 2SHKA 5CB6A 1KO7A 2NQ2C 4B3XA 1BYIA 4RD3A 2H1LA 1IAQA 1AKEA 1DG3A 1MV5A 1FL9A 1ODFA 3ZZTA 5H70A 1KZGB 3N70A 5EE3A 1IONA 2R6AA 4KCGA 4PC7A 1G41A 2VL7A 4XOIA 3REGA 1GDDA 3KKQA 2IXGA 3CRQA 5DSZA 4BZXA 1QF9A 4LBZA 4XWKA 3K53A 2QP3A 3Q5EA 2G88A 2XITA 3RWMB 2EW1A 4AG5A 1ZM2A 1H8HD 1YZQA 3IHWA 2KJQA 4PXAA 2FGKA 5DGXA 1T91A 1UBGA 2ZRAA 3I92A 3P32A 4JL5A 4LHZA 4AK9A 1OHHD 2DFKB 2RKOA 1A7JA 1ZNYA 5TY0A 3ZQJA 1GZSA 4Q5IA 1T4GA 1W2GA 3KQUA 2XB2A 3E1SA 3LW8A 2H7VA 2EFDB 1RIFA 3GP8A 2BWJA 2WWWA 4LX0A 4JLOA 1N25A 2RAPA 2ODNA 1F3OA 3ASYA 1N5JA 3QKRA 4QJ5A 3OEEA 3WY9A 1VYTA 2O5VA 3M0EA 2XX3A 421PA 5IT5A 1OH7A 2F1JA 1OKKD 4TYYA 2N1BA 3BJIC 1S1MA 3K0FB 4ZV4A 4Q7KA 3CX7A 4CEJB 3QJYA 4AWXA 4Z1MA 2CCKA 2FPKA 4MYCA 3ZVMA 4NYIR 5BN4A 4OBEA 1CJKC 4YXWA 1XMSA 2P67A 2CVHA 2QSYA 3K9GA 3P26A 3BH7A 4TQAA 3VNVA 1U8ZA 4P4TA 2PJRA 2YOFA 1IQPA 5FOXA 4L9WA 2I1QA 2PCLA 3TH5A 3CH4B 1ZNXA 4G5OA 2FV8A 4A0GA 4LJAA 1RJ9A 2IS4A 1CR1A 4OHZA 2VRWA 1E1QA 2EWWA 3VHLB 2YC2C 3JVVA 4UNPA 3LA6A 3AF3A 3B82A 4ON9A 1OFHA 3FYHA 2ZI3A 4YMWA 2GEVA 5A0FA 4HUTA 5HTKA 4B2PA 2DPXA 3NEJA 3T1QA 4DT1A 1OFIA 2ZS7A 5FR1A 4F92B 2CCJA 3K09A 1S4QA 1YZNA 2QE7D 5AUOB 2J3EA 1MRNA 4ZPXA 5BW8A 1G3MA 1N6NA 2QPAA 4PPGA 3A58B 5J40A 3GLGB 1N6IA 3AUXA 3BORA 4CF7A 3L0IB 3TUZC 1ZP6A 1UAAA 1LFDB 4B6EA 1R7RA 1TF5A 4AKIA 5FTJA 5HZHA 3DVLA 2R6GA 3LBHA 1E0AA 1FP7A 1UBCA 1E0SA 2KB0A 2ZRLA 4KO8A 4Q19A 2C04A 2RGXA 3SC3A 4I99A 3DO6A 1M6NA 3NHBA 3L82B 3AF2A 2H16A 5H1YA 3EG5A 4PQYA 2ZANA 1QHNA 3AGPA 2ZI9A 2P6RA 3RS7A 1QVRA 2IYUA 2YHSA 4WZBE 1CLUA 1YJ5A 4BFXA 3ZVRA 2ZXUA 5CK5A 3PUYA 4YMSA 3LW7A 3QXSA 1NSFA 1XD2A 1E79D 3FE2A 4FINA 3D7MA 1G7RA 2XOKA 2HCBA 3GJ4A 4DDUA 4V0OA 2ERXA 3RDPA 1COWD 1CJVC 4WOPA 4KXFB 3SS8A 3KTAA 4R7ZA 4C0AC 3J81k 1J2JA 2IX3A 2ZRPA 2XSZD 2ATXA 3NKVA 2VIIA 3G5UA 3U3MA 4ABYA 2GK7A 3EAQA 3NDPA 1SXJB 1LY1A 4OK3A 2W2XA 1TU4A 3RAPR 2W0MA 4TLDA 1KZ7B 4FWTA 2VP6A 3QVVA 4EJSB 2JLQA 2GTPA 4HEJA 4PC6A 4UNNA 2EVWX 1D2EA 1KGDA 4TWZA 4D4JA 5AUNB 2CL0X 3E2IA 4I81A 1NN5A 1I4LD 5EP1A 4ERNA 2W83A 1U0LA 1LS6A 3LVRE 2A5JA 4KFRA 1JQJC 1Q21A 4BQSA 4F7WA 2GZDA 4GBMA 1TQ6A 2CHGA 2DWOA 3TLXA 4WAUA 4EQ6A 3N2EA 3TRFA 1E6CA 2YOGA 1G4AE 4O3MA 2QRNA 2OV2A 3HDTA 4RJLA 4U7DA 1YR6A 1LNZA 1AJEA 1Q0UA 2J46A 4PPNA 4NCNA 2F9LA 2R6DA 5FL3A 2OCPA 2G0NA 4NBSA 2VHTA 2ZRJA 1N6RA 1FNMA 1RRPA 1OJLA 1G18A 2QRZA 3I61A 2F7SA 4BFWA 1DAFA 4ZI3A 1QHHA 1AS0A 1ZM3A 5HE8A 4N3NA 1XPRA 3LBIA 1NBMA 2P3SA 1UKYA 3C41J 4X8OA 1MH1A 1OH6A 4B73A 2QAGB 2W6JA 1KSFX 1K6MA 4B2LA 3Q3JB 3EPHA 1I4TD 5EP2A 2D2FA 1ZRHA 3WBKA 4B43A 2G6BA 2IEYA 1W2HA 4ZCLA 4B3DA 1S3SA 5BWMA 3I72A 1E9SA 3AKDA 2PX3A 3RLFA 1LV7A 1XMIA 1NN0A 2XZOA 1HURA 3VR6A 3W3ZB 5C18A 3U7HB 3GLHA 4URXR 1W4RA 1KJYA 1X8KA 4Q47A 3TK1A 2ZSEA 1DG1G 1Q20A 3I32A 4DZZA 3EZ6A 4FCVA 2JLVA 1WQ1R 2B8WA 4BWYA 2REOA 1T9HA 1Z29A 2W2VA 2WAYA 1TPZA 4ILEA 4ZI2A 3DM5A 5JHHB 3GFPA 2ZQ5A 121PA 2J7PA 3QPWA 2IA5A 2O8EB 1KTVA 2VSFA 3FMFA 2ZVPX 1S9HA 3IO5A 3VNUA 2OCAA 4K8OA 3E5HA 2EFGA 3NEYA 2QY9A 3W6PA 3IPXA 2AXPA 1XP8A 3LX8A 1OFUX 5K8UA 4A2QA 1QG4A 4HATA 4D81A 1S1CA 2G77B 1Q44A 3U4QA 3SZRA 2QP4A 2IT1A 4JL8A 4TN1A 5FTMA 3UG6A 4ZDIA 1M74A 4RFSA 4DDVA 1W44A 4FIDA 1E2IA 2IK8A 1GL6A 4WZAE 4F93B 5GJWC 3K0AB 4AIIA 1OT3A 1W0KD 2I3BA 3GQBA 4OJKA 3RWOA 5TDHA 3W5JA 4MRNA 4KYUA 4HAUA 4B32A 5DNYB 4AKHA 4A8JC 5B58C 3A4MA 3AP2A 3QIAA 1Z08A 4FMCF 4NCIA 4F4CA 5GJBA 5GADl 2QBYB 3LLUA 3VFDA 4CT5A 4A1FA 4JYCA 3SJBA 2ATVA 3DDCA 1R5NA 5LD2B 2ZUBA 2NPIA 4LUCA 1FUUA 3IIJA 3H0KA 5AR1A 1S9DA 2BCJQ 1KAOA 2CL6X 5FH9A 4LI0A 2R65A 1OB5A 3SJAA 1KDOA 1TADA 1X86B 2AKAB 2Q0HA 2BBTA 4YMUA 5L3RA 1T0JB 2JLXA 3CBQA 5BXQC 1Q3HA 2FOLA 4PX9A 2V1XA 3THWA 2BJVA 2D62A 1OV4A 1YR7A 1E2EA 1A82A 1OE0A 4RD4A 1DAKA 4AC9A 4HI0E 5FOVA 1SVIA 2FNAA 3SQXA 4HB3A 2HV8A 1HV8A 5D3MA 4LBWA 221PA 1HEIA 3ZD6A 1JR3D 4Q66C 2A5DA 1QHYA 4XD7D 1NY5A 2G1KA 2VQSA 5KSZA 3C16C 3CKLA 4CT4B 2XNDD 4HB2A 1N6OA 4LC1A 4A82A 4BFUA 1IXRC 2C9YA 2AFHE 1TUIA 4DDTA 1ZC3A 3PUXA 2IYTA 3FMIA 4E07A 3TAUA 2I1VB 4YMTA 5FOWA 2RGNC 3DOFA 4L16A 4Q02A 3U5ZB 2VP4A 1CS4C 5K8TA 3AVWA 1OXSC 3AVOA 2GAOA 4AY2A 2YZ2A 3QXJA 1G7SA 1DOAA 2VHJA 2XJ4A 4YLGA 2BJWA 1N6LA 2J5XA 1XJ0A 2NOAA 2QROA 1R4AA 3OZXA 4DIDA 3K9LA 3CF2A 3QKRB 1VKJA 4K81B 3RRZA 1H8ED 4DSTA 1HTWA 1WE2A 1NVWQ 2OBMA 1DS6A 3MG9A 4LOAA 5DYGA 1XF9A 4KBGA 4MKIA 4NYJR 3H86A 2ZE8A 2NPFA 3HR7A 1EWQA 4L9SA 2IEZA 2ZJ8A 3KX2A 4GZMA 1Z63A 2JDIA 2LWIA 3KFVA 4MUAA 1C4OA 5DHAA 3ECCA 4ESHA 2IF0A 5DYIA 3KJGA 1ZM7A 3NWJA 4I1OA 4K46A 3AF0A 3QKSB 4NTZA 1BMFD 4Q1FA 2ODWA 2ZR7A 4F4IA 1IN8A 1RJ9B 1BOFA 5ANRB 1UKZA 2BV3A 1SVLA 4HB4A 4QHSA 3VQTA 1S3GA 5IK2D 4OK5A 4PR0A 1AK2A 1EWRA 4Q4AA 4XTCS 2WKPA 2Z43A 3AP3A 4DSNA 1KI8A 3MJRA 1E9AA 4V0ME 5SZJA 3QSYA 1XPUA 1VECA 1Z0JA 4MKHA 4NCJA 3ND9A 5KNDA 1EFHA 2JJ1D 3AP1A 1KMHA 2RGDA 3QEOA 3BXZA 2C2HA 3B9PA 2RH5A 2NIPA 5EJEA 4QHTA 2ANBA 2AWNA 2YNMA 1NG9A 4D6PA 5EXTA 1TQ2A 3Q8XB 1RFLA 3CM0A 4OJQA 3ONWA 1F2UA 1XEFA 2O0KA 2ZR9A 2WPDA 4W9MC 2BC9A 3HR8A 5KPDA 4F4JA 1NL3A 4BGDA 3FMPB 1BIFA 1L4YA 1G6HA 1LF5A 4NL4H 2YINC 1E2DA 3NTUA 2OXCA 2R6FA 3UXMA 1XD2B 3QY0A 4DBLC 4TL8A 2PMKA 1JXMA 5TVKA 1G5TA 2ZRNA 3FKQA 2K5UA 3G82C 4FCWA 4U02A 3MGCA 2WMNB 5J47A 3VKGA 3KTAB 2RGAA 1E2JA 4NYIQ 1M8PA 2IL1A 4US1R 1IOZA 1TNDA 2Q21A 3PIRA 4DLXA 3ZLJA 1M1YE 1P9RA 2FEOA 1JR6A 4WXPA 4RZUA 2IXEA 1YHNA 4TYPA 2PEYA 1GKYA 2WKRA 1QHGA 4XH9B 4LJ8A 4MGKR 2HEIA 5C46F 2VF7A 4TL6A 1R6BX 4IDPA 1ZVQA 1TMKA 1KNXA 1ZIPA 2IUTA 4QG7A 3KQHA 2WIBA 1E9CA 2V7QD 1OXXK 1W47A 2R9VA 3QOFA 2UVQA 3QG5A 5JEDA 1EFRA 2D4HA 4TL7A 1GRRA 3U61B 4DIEA 1KI7A 1XTKA 2H17A 2WV9A 2Z0MA 1K8RA 3BERA 4KYIB 3SN6A 3EC1A 2IW3A 2PLRA 3FWYA 4M9XA 1RZ3A 2FGJA 3E70C 2WWFA 1NSTA 2C8VA 4R98A 2V6IA 4XWAA 4PSKA 3R8FA 2N46A 4LPKA 4V0MA 4UJ3A 5BYKA 1JQLB 3V4RA 2NO1A 2RB4A 3UIEA 4LYFA 5KNCA 3RS2A 1QHHB 1OIXA 2A2ZA 4PO8A 1IN6A 4HYYA 2X19A 2DFNA 1FUKA 1XWIA 4MKFA 3X2SA 2IS2A 1KDPA 2ORIA 5FPKA 2PZGA 4YMVA 1KY3A 1U99A 2YWHA 1S96A 1Z6AA 2NO9A 2W00A 4HAXA 2FN4A 2KI5A 3TUIC 3ZGXA 4XVQA 2MSCB 3PUWA 4KV9A 1W36C 4I4LA 1XBTA 1AIPA 3LLMA 3F0TA 1GRNA 1OB2A 2A9KA 4UQOA 1CJTC 4HDCA 2PCJA 2J45A 3I3SR 1CF4A 4QGHA 3PQCA 3ETLA 2HYDA 3NDBB 3GLHB 3P20A 4ZDKA 5L3VA 2CMKA 4LYAA 3OF5A 1G5RA 1WF3A 4ZDWA 1E96A 1AM4D 3KJIA 3EA5A 2ZRCA 1IBRA 2HUPA 5KYKA 1F5NA 2FJUA 3CNOA 4ZIRA 4RKFA 5KNBA 3W8RA 3K0CA 2PX0A 3EWSA 2QM8A 4M9ZA 1VCIA 1Q12A 2ZRHA 3TMKA 1DAHA 4JSYA 4JT2A 4BLTA 2CK3D 2P5TB 3U4QB 5JBQA 3L2OB 3GFTA 5LB4A 5LBIA 4LJ7A 2QQ0A 5FBVB 3KKOA 4RFSB 4QBFA 1R0ZA 5BN3A 3AKYA 3FKSA 2OZEA 2F6RA 3PG5A 3SQWA 4PHTA 1J70A 2VHCA 3N5CA 3LXRA 2Q6TA 4XTRA 2FFAA 4TYNA 3L0OA 3GJ6A 3DL0A 1KHTA 4M9SA 1EFCA 3LQQA 2JJ2D 3TJZA 4ACAA 4C0BA 1Z06A 2WOOA 4HAYA 4UXIA 1QHXA 4V03A 2FSGA 3SE0A 1DTSA 1F2TA 1Z0IA 2ZR0A 2WSSD 2PL3A 4BASA 4A2PA 2EQBA 4HAVA 2QI9C 3DEFA 4DWJA 4DLVA 4JLKA 4PPQA 1MO3A 2J87A 2P0EA 1DARA 2ZPTX 4CEHA 1ZM4A 3SFZA 2GEUA 3U7GA 4RFVA 3BFXA 3OE7D 3THWB 5FOTA 1HH4A 1W7AA 3CIOA 3LRPA 3KKMA 1LTQA 2ZITA 2UKDA 4C7OA 3I62A 3EPLA 2O0JA 3K9NA 2D74A 1SULA 3FPAA 5D3MB 4CRWB 1UEIA 2IS1A 4OQNA 4R2HA 2CDNA 4LJ4A 3KFXA 2ZI7A 1CJUC 1RYFA 3NBXX 5AJVB 2ZRMA 4GRAA 1MO4A 4JVSB 2GJSA 3U7FB 1GM5A 3CPEA 1H8HA 5LB2A 2NTYC 3EIQA 3GLIA 2TMKA 3B6EA 3EPJA 4B3GA 1G8PA 1OHHA 1Z07A 4ZCIA 2ZU6A 4POAA 2V1UA 1EX6A 2H18A 3T06B 4PC1A 2R62A 4EFMA 2ONKA 5JS7A 1KI6A 2QU8A 1N6HA 4PANA 1RRFA 2FFBA 2GVZC 1Q57A 3QKTA 2YC4C 4JSTA 1OKKA 1ZW6A 5EUMA 2VPPA 5AUPB 2ECKA 4EPYA 5AJWA 5IHPA 3U7EB 3BB4A 2GNOA 3DZ8A 3SEAA 1YQTA 3T35A 4WXRA 1XXHE 1GKUB 2W0SA 4GFDA 3PCRB 4P33A 1ZD9A 2ORWA 1IY0A 2DYKA 2WMOB 1IY1A 1ESMA 4QNMA 1V5WA 1E2NA 4ACBA 3TIFA 3EC2A 2GZHA 2OEPA 1CULC 2D7DA 2J0SA 4QGFA 1HQCA 4LJ6A 1EFUA 2FU5C 4CVNA 1EFTA 3ZD7A 2QTFA 4HSEA 4C2UA 1GKIA 1OFTA 1P60A 4M21A 3A1WA 1BYUA 3KUCA 4N0DA 5CM9C 3B78A 4Q4AB 5HPYB 1E1RD 2X1VA 1ZIOA 4A0FA 1XDBA 2QE7A 3MRSA 1MR3F 1MRSA 4QGGA 5SZHB 2F1IA 1FX0B 3EIEA 3IILA 2PJZA 2FMXA 3V4FA 1PLKA 1FOEB 2RHMA 1R5OA 3BIFA 4HDOB 4C0HA 2VP2A 3THYA 2F3RA 1U0JA 1KMHB 1OIWA 2VSXA 1KDRA 4S2EA 3WHLA 3KXKA 5AK0A 1V43A 3G0HA 1SHZA 4Q7JB 3ZS8A 4A6XA 4AG6A 3CB4A 4PQRA 3HP1A 1F2UB 5TV2A 4C0KA 2VF8A 3ADKA 1E9DA 4MA4A 2IHYA 1YRBA 1HQYE 2W6ID 1Z0AA 4CDGA 3Q5DA 4ZCMA 4TSFD 5C4GB 3TKLA 3QF4A 3GLFB 1SHKA 1E79A 4B71A 1X1SA 3B9QA 1XTQA 1E4VA 2WWGA 2XZPA 3CX8A 1R2QA 1COWA 5B30A 5JEEA 4NYJQ 1XEWY 3KQLA 3KXIA 2XSZA 4Y0AA 1N5IA 1P73A 1Q1BA 5D3QA 2OCBA 2P6UA 2C9OA 1N6PA 2QEQA 2GF0A 4PPFA 2Q9BA 3C14C 5BN5A 2NMVA 3MAAC 2QTVB 1T6NA 1VG0B 2ZYWX 3B1YA 2GZAA 3CWQA 3RNLA 2DBYA 1PZNA 3LFUA 1S2MA 1XXHA 5JLJA 3EPKA 2P65A 3F3YA 1AZTA 1AGPA 1FNNA 1TL7C 3VR1A 3THXA 4OI0A 5P21A 4Q4JA 1GITA 3AF1A 2EFEB 5KSYA 3D3QA 4TMWA 1J90A 5FL7D 4ITRC 5TB5A 2QT0A 3P1JA 3ZDQA 2G1JA 4LHVA 1T8TA 1ZD8A 3UWKA 1E69A 3BH0A 3TSZA 1G6OA 1N0VC 3AKEA 1CRQA 1KY2A 1KSJA 2V54A 2WJIA 1L2TA 4LYHA 2R8RA 1Z6YA 4E22A 3VKWA 3K70B 4DB2A 1NKSA 1KK0A 4KFSA 1KIMA 2AR7A 4URUR 1GFIA 4PSVA 4XVRA 2EYQA 3HYTA 4LBYA 3SOPA 4RCYA 4HUQB 3R20A 4P3YA 4Z51A 2HJGA 5HE9A 3HPQA 4KJZA 4QHYA 1VYVA 4LJYA 1U8AA 2R6CA 2XJ9A 2ZSAA 5HKKD 4W5HA 2ZREA 4GP7A 3R7WB 2XXAA 4G3XA 1G1MA 1GNPA 3B5JA 1E94E 3SYLA 4B48A 4TYWA 1X6VA 1MO6A 1SXJC 5BYJA 2JGNA 1A5TA 2WAXA 2W2TA 1DE0A 1KYIA 1Q1ZA 2ZU0C 3IPYA 4EJSC 4KI0A 1Q22A 1NP6A 2HF9A 1DELA 2QORA 1MT0A 3AVVA 4A9AA 1HA3A 2REBA 4NPHA 1XZQA 3GD7A 4DC9A 3UANA 1JPJA 2FPMA 3CRMA 4UXJA 4EDHA 1KO1A 1JR3E 1U94A 4XVUA 5JWRA 4RD2A 4LV5B 2PEZA 5EE0A 1GIAA 3KJEA 3ND8A 2GCNA 4PQFA 1QDEA 1TEXA 2OT3B 2V9PA 2N42A 1GILA 2QT1A 3HU1A 2ZRIA 3BH6A 3OFND 5K8IA 3A1VA 3D31A 3CLVA 2ZJ2A 1SGWA 2EU8A 2IHBA 4OI1A 1U9IC 2O52A 4OQFA 1KI3A 4ZIRB 2O8CA 1W5SA 1E2FA 4QL3A 4IJMA 1E9BA 2F1HA 4JYBA 1YR9A 3LX5A 3WNDA 5C2JB 5JJIA 2E9SA 3AV0B 4C0QC 2JIZD 4G1UC 2JLZA 2QMUA 2OAP1 4TLAA 2ZJ5A 3VR2A 4Q4HA 1SKYE 621PA 2BEKA 2QAGC 3TW8B 4DDWA 2PZFA 3WP0A 4Q4LA 4Q1AA 1E32A 1RKBA 1W0KA 4A92A 4C3ZA 2QNRA 4Q00A 5JI2E 3PEYA 2RGEA 3NIBA 4LV8B 2FZ4A 1IM2A 2ZI6A 2QMEA 4X8HA 3SHFA 2HXSA 3K0SA 5FTLA 4FXPA 1TF7A 4JBXA 5DH9A 4RD0A 1Z3IX 4PFSA 1NG1A 2D3WA 1E99A 5JSZA 2QGZA 2ZIAA 4Z8XA 3TAHA 3U3RA 3K8YA 3QEJA 1XCGB 4BUJA 3SJZA 4TMZA 4AD8A 4Z54A 3BS4A 1NMXA 4DLUA 1GL9B 3QXCA 3BOSA 1YR8A 1F2TB 1AGRA 2A7QA 4B47A 4E5UA 3SI7A 2GJKA 1MOZA 1G291 2FWRA 5IF9A 4GPTA 5E7IA 2V55B 4CEHB 1UFQA 1VIYA 4MYTA 5EZ6B 2YJTD 3RRNA 3B2EA 1DAMA 1B23P 4QJ3A 2PLFA 1US8B 1D8TA 3ZS9A 3AUYA 4IOMA 1KSHA 2Q3FA 1XB2A 1W36D 2YYZA 4GDFA 2ZE6A 2AHOA 1RPZA 5JECA 1JR3A 4DXAA 2WHXA 1YE8A 4XD7A 5HZKA 4FMDB 4A36A 1TQ4A 2FA9A 4C2TA 4D0NA 4NE2A 2BM1A 1UDWA 2L0XA 1T3LA 4OI2A 3MWJA 4B75A 2RGCA 4HDQB 4GL2A 1XTJA 1OYYA 4I1UA 4CYMA 3QI2A 3GLIB 1CXZA 5LD2C 2ZRFA 3NBFA 3P4XA 3QPVA 2P2LA 3AM1A 2GCPA 3RRMA 1P6XA 3WYFA 2HXYA 3MD0A 3LO5A 1KO4A 4URYR 1L4UA 1JPNA 2HF8A 3SDZA 4TZ6A 3QVUA 4D26A 1Z22A 2H8KA 4GT1A 2RGGA 4DSOA 2WJHA 1UKVY 2GA8A 2OSBA 1TEVA 4NKRA 1G20E 1G5PA 1CTQA 521PA 2EWVA 1HUQA 2BKEA 1Q1EA 2BIFA 3Q7PA 5DI9A 2WWIA 4TMTA 1NLFA 1D6JA 3FMOB 2VLIA 4PSAA 4NH0A 4H1UA 2KWIA 1GAJA 3RS4A 3X1WA 4LJ9A 3TBKA 1JNYA 1K5DA 3A8TA 3JVUA 4KVAA 1WA5A 1XX6A 3KZ1E 1W4BA 2OXRA 2BMDA 3RS5A 1BMFA 3UMSA 2ZUDA 4DHEA 2G9NA 4D80A 4ASUD 5IK2A 1G17A 4HLUA 5LDDC 2G0TA 2QTHA 3OIYA 1N3BA 2DHRA 2FSIA 3SU8A 4EFLA 1EG7A 2GBLC 2E87A 3CZQA 1S0UA 5L8VA 2V6JA 4P31A 4TL9A 1PJRA 4LPSA 5EZ5A 1SVWA 2JJ1A 5HCIA 4V0LA 1JJVA 4HZUA 3M4YA 4JT4A 4YQFA 1P2UA 5FUYA 3IO3A 3F8TA 1IHUA 2VSOA 3MWKA 4LY6A 2IYXA 3WNBA 4GOJA 1AQYA 1P5ZB 3AVTA 3W90A 3OEHD 1ZUIA 3ZIAD 2ODEA 5CIWA 2VA8A 4URWR 2ZI5A 4TMXA
chains in the Genus database with same CATH superfamily
4AFNA 3PNOA 3RS8A 2NO0A 4NOJA 3AETB 4BLUA 2OP0A 1Z17A 2BEWA 1V16B 1ACLA 4N7RA 2QZ4A 3V1YA 1KOGA 2D13A 2VUIB 4XJXA 1W85B 3B89A 1CR4A 3KKKA 4HDNA 1CQIA 4KJXA 1YXMA 3A31A 1B42A 3ODGA 1G3IA 5H81A 1ISPA 2KLBA 2W7TA 2W2KA 4Y2HA 1HM5A 3C15C 4JI6B 3BFPA 2MSNA 4M1SA 4S1PA 4XZ3A 4EEKA 1CRPA 3HFJA 3LBNA 3W1VA 3DKVA 2PWBA 4O8ZA 3AKZA 3JALB 1N5LA 1BU8A 1YQEA 1YNSA 3BIWA 4MMZB 4CQMB 5GVSA 3MN1A 4RJIA 4HXYA 3IQIX 5IVPA 1JECA 1MJFA 5HQ3A 1WB5A 5AM2A 1UBJS 5TEVA 2I3DA 5COBA 4DA8A 5BYAA 1Y81A 2GASA 5JRJA 3EXEA 3NBAA 5FFMA 3UAGA 2WICA 4P35A 3AVXA 3ABZA 4F6RB 4Z2AA 3NBZC 2O5RA 2FQYA 2XQVA 1XZ8A 2UUPA 1CV2A 1OFVA 1CK4A 2J08A 2JFVA 3OO1A 4G5QA 4CKBB 3H9EO 5CFZA 1GNRA 3IT3A 1QQBA 4IBOA 1KAGA 1TZMA 4G01B 1GL7A 2F9MA 4R84A 2OHVA 1NN1A 3O91A 5I9NA 4J7UA 1ISGA 4DABA 3RC8A 3UV7A 4U6SA 3TDKA 4FFSA 3MCWA 2I4RA 1Y5IA 1GEEA 1T5SA 3GHYA 2OD9A 4Q1EA 3HDVA 3WRXC 1Y1KE 3ZHSA 4QJBA 3CEMA 3G5LA 3T1TA 2CHFA 4J49A 4R6WA 1NXPA 4FFDA 5KI6A 1B6SA 3BILA 2J6HA 3HVUA 3M83A 3QEAZ 5CLHA 4AJOA 4BFZA 4HNGA 1R8JA 3I6BA 4MPDA 5B53A 4N0EA 4BLQA 1C9JA 3DGEC 1QVVA 4KN8A 3OJEA 4QYIB 4ZJYA 5IUNC 2XXAB 3EEFA 4I4CA 1I3OA 3MELA 3X1YA 5DASA 3N0XA 3NNDA 2PT5A 2PUAA 1ZJ6A 1WULS 4OHVA 1VM6A 1ZOPA 5CXQA 3FHCB 5SZIA 3MMNA 4D8VA 5JCZA 1EFPA 4KQIA 4E46A 2Q50A 4LC0A 5FTKA 4AU1A 3GLGA 2AD5A 4BNWA 2PGLA 5F7XA 1NW4A 1SO8A 3ZWNA 3PRKE 3ZVNA 3PEUA 4RLSA 1C3LA 3CLTD 2P3OA 3GJ8A 3IEVA 1KP2A 3DE1X 3O8DA 4WLVA 1R0LA 1N8KA 3M6FA 3MUFA 2OO5A 3TQOA 6LDHA 2VO1A 1Z4PX 1Z6XA 1H1TA 1WJGA 1JHOA 1FUEA 4DEYA 3FDIA 4B3MB 3ZKWB 3K5HA 1KORA 1FPMA 3BB1A 1UF9A 2WT8A 1MW9X 5AK4A 5LQKA 5EUCA 6ABPA 4LDJA 2UZ0A 3D1JA 3HHEA 5TLSA 2ZJYA 5IT9A 3KT0A 4DV4B 3H99A 4CCSA 3HBNA 3V9PA 4AXBA 2R8BA 5LOVF 4OFWA 3N53A 2Y9PB 4YB8A 1EFVA 1YDEA 4AYWA 2DWUA 4KYTA 5CJPA 5DWDA 2ONJA 3WO0A 1SFRA 3UA4A 2FZKA 1SXQA 3GJXC 2YL2A 4GZ5A 4X1IB 5D6NA 3RHZA 3OD1A 1XLUA 3UYKA 3UN1A 2MMCA 4N12A 5BNFA 3UB3A 4JBLA 2CLEB 3ZOKA 4OFXA 4MVJM 3QMVA 1FCJA 2FK8A 5H3CA 4JHXA 1HDXA 1T5HX 3MQ2A 1VE9A 4W5WA 4WZBB 4WBXC 5LZ7A 4URZR 8ATCA 1TU3A 3IBCA 3ZWVA 1H2BA 5GTDA 3HC7A 3PTZA 2P4HX 2PKRA 4FJ0A 2ECPA 2AMFA 4GMFA 4R69A 5ICFA 4LXHA 1UT8A 1JXQA 2I2WA 2FZLA 3H5RA 3VR4D 3O8BA 1Y8RB 4KHZA 1L1RA 1M2OB 1VPDA 3QUQA 3U17A 4FLMA 5KQRA 3K94A 3W8NA 1KRHA 3UW1A 1GG8A 2C00A 2K87A 5TC4A 4I3GA 4GP9A 1G55A 3V33A 4PO1A 2O7QA 5DRTA 2XYPA 3FB4A 4FGJA 3K9CA 2B4RO 1CQJB 4O4LB 1ODCA 2B3TA 3D0QA 4AAYA 4PG6A 2XMSA 2GBCA 3D59A 3DONA 4G0ZA 1WV0A 2IPXA 3ANSA 5DHQA 1DLJA 4UNQA 1FJHA 4AL4A 5HSGA 3ZNQA 2PNJA 1HWYA 4PSUA 5J5VA 2BBOA 3M3HA 3OOEA 4ZVOA 3UK0A 5ADVA 1QV7A 4H6WA 1ONBA 1XVUA 2XUQA 3H84A 5DBOA 4AMYA 5HYVA 2OMEA 2GCGA 4BY9E 2LKCA 1HFJA 1RLTA 2QL6A 4NATA 3B1VA 3D3WA 1P7CA 4DR1B 1DO2A 1WNTA 1ML3A 1HOXA 3B7GA 2GNAA 1REQA 3TSYA 1ZC4A 1SBZA 2ZIWB 3I05A 4GC5A 5E7JA 4CQJA 3BIOA 4UJ5A 1USKA 4G0QA 3OIDA 3PCXA 1PD1A 2IY9A 2G6TA 2VS1A 5DI3A 5AW2A 3R9WA 1V7QA 3OOWA 4F1WA 4B09A 4G4SO 4GM4A 3PT9A 4FBMA 1ZW1A 1JKJA 1KO8A 2WKWA 4NHEA 3GGCA 5FBLB 1NBIA 3AUAA 2QE6A 2WQ6A 2BCGY 2B4AA 1LDGA 4MJ3A 5B64A 2O19A 4MV0A 5CBPB 2PGDA 2Q3JA 2QJWA 3EFOB 1RRGA 3B12A 3KKLA 4Q6WA 3SNHA 1X2EA 4ZIRB 2FQXA 3OG9A 5BSRA 4F9GA 5B6IA 1WP4A 2ROQA 5DT2A 4RX1A 4C4TA 4BJ5A 1UANA 4FFLA 4EKDA 4IDAA 3VI3B 4KRFA 3AERA 4XUGB 9ATCA 1G6Q1 4G1BA 2JAXA 4URHA 5I4IA 1Q91A 4RVGA 1ST3A 4HN2A 1KJ9A 3B20A 3VTKA 2FWPA 1HY3A 4CODB 4CDRA 5H8WA 4MP6A 1GQRA 1UADA 3QNMA 3NUQA 4NQRA 5B2ZA 4MS3A 5B57C 1GV1A 1ZU4A 2A67A 3K0EA 4US2R 5IANA 4YAWA 2OGTA 4D3YA 1A5BB 2MOKA 5JAQA 5JFGA 5LQUA 3A6PC 3HR4A 1MABA 3UJ3X 4UOZA 1NVTA 3U09A 4LY0A 4PCUA 1W0JD 3T5CA 2GK3A 3GMTA 4BVEA 1L3IA 1YVDA 1SUWA 1G6KA 1TLLA 1UM9B 1DT5A 5IYZF 1LDBA 1XCOA 2CYCA 3FHOA 4KB5A 4RELA 4QAQA 4LXTA 1ZJWA 3FPBA 3D8UA 1VG9B 2NV6A 3WKEA 1SXPA 2H1RA 4BX8A 4GOMD 4PYNA 5A04A 4JI2B 2A5GA 3EQ9A 3TQTA 1N6KA 1TF2A 1UBTS 3QG1A 3T9FA 5U4QA 1ILWA 3MA0A 4KMRA 5AXDA 1E1CB 4IHQA 1DJPA 3MXTA 1G5IA 1XTIA 1HE8B 2ZYVX 3DOJA 3P9IA 3ZX5A 4G1FA 1AK1A 1Z35A 2J07A 4M1QA 1KOFA 4Q9HA 4HYQA 2AJDA 3BC1A 4KODA 1QQ5A 2JHGA 1QIMA 3L7OA 3BA1A 5BWNA 5BRAA 5BRJA 1ORTA 1XTZA 4AW9A 1Q95A 2QDKA 2AN9A 2QGNA 3BE8A 3K9WA 3N07A 4WZAB 3TR5A 3JQPA 2ODQA 5G53C 5B6PA 4PZZA 2PSEA 4BRWA 3MSXA 3CLUD 3NXKA 2MR5A 1OVMA 2VJMB 3R0JA 5EUQB 4F72A 5JATA 5IZCA 1QU3A 4BZPA 5I7HA 2Q4BA 3AVQA 2CLHB 5JS1A 4BN4A 1R4MA 2I7XA 2EHDA 3BE4A 3BMCA 4L5YA 4EF6A 1E6EA 1L5MA 3NOVA 4GNRA 1X1TA 3QFCA 3DD1A 3DUWA 2YVUA 2JLUA 3EGIA 3U26A 1ZBDA 2WE8A 4PRYA 5ALOA 4DDKA 4W8GA 3WMRA 4O1HA 4AMBA 1U2SA 2WJ6A 4H0FA 1YOBA 1ZMBA 1X8JA 3X1XA 3E7FA 2UDPA 2J3IA 3E23A 3KKZA 3NWOA 5NLLA 1YCFA 4UMVA 1CQIB 3EYAA 2IPLA 4UAUA 1QCZA 4RWZA 4M88A 4EYGA 5AESA 5JYEA 1DBSA 4JWTA 3TG8A 1C9DB 2NV2B 5C1BA 5GAJA 4RZ3A 4OJYA 2W93A 4PR3A 4EPRA 4OHYA 4TV8A 4MW2A 2ANCA 4JI5B 3I04A 2W2KB 4JVLA 1CEXA 4F1KA 5JFOA 1ECBA 2PX4A 3QFRA 1FQWA 1P5HA 1H42A 2GBLA 5ED0A 3NMUF 4GOKA 4R5HA 3ZTTA 1K7SN 4RVFA 5FI1B 2I7DA 3SVZA 3P4YA 4P34A 4IHJF 3A2KA 1TKCA 1VB3A 2C5EA 2ZIFA 4C3UA 4BECA 1QRRA 1GTJ1 3GJYA 5HQ3B 2WZBA 3WK7A 2OO3A 4TROA 4GXNA 4LOHA 4B34A 4IEEA 1GLVA 1NYRA 1XN4A 3EXEB 2IUEA 3DC7A 2FFJA 3CV3A 3IE0A 4J1NA 2XMZA 4QQNA 2GF9A 4FHEA 1KJZA 4TTQA 4ENWA 1NMSA 2FYTA 3P9QA 1FP4A 3EEBA 4S1OA 1MC8A 3G2LA 3KE8A 4ESOA 4QO8A 3JRNA 5JAOA 5JC1A 4DIOA 5IWCA 4Q01A 2XVXA 2I54A 1DJQA 3H9GA 1XYYA 3RHSA 3VSBA 2W2MA 1ONSA 1K7CA 2ZKIA 3ICWA 3ZN2A 4OLBA 3FYUA 3OECA 5KWEA 1B3BA 4H60A 1YDMA 3ACBA 2QL7A 1T25A 3U6BA 2EFJA 2TMDA 1BFKA 1SKAA 1T0HB 3JASA 2EP7A 5REQA 4NBKA 2Q5JA 4GWLA 5EI5A 5A0VA 2ZK7A 1ORIA 2B21A 4QM6A 3NHPA 2W58A 1LGYA 5JBIA 4V0NA 5KOHB 2ZSFA 1YZLA 4M7OA 1AUQA 2VUTA 1Z0FA 1YH3A 2JCYA 3N0RA 4HWGA 1RBZA 4YHBA 1AVTA 4ARZA 1EFPB 3A6HA 4U5QA 3RG2A 3ZGYA 3KZNA 3ZV4A 3LCJA 3SOZA 2XRYA 1UJBA 3N8GA 4O4JF 2HLNA 3KT3A 2HRQA 2LE0A 3A0UA 2QPOA 1ND6A 2WIFA 5E6UA 5B55A 1MT3A 2BGMA 2I1LA 3UEOA 4Z3KA 4N76A 3IP8A 1E92A 2BF7A 4LWZA 2O3RA 3HDYA 2IHZA 1XVLA 1G8SA 4ATNA 2L2QA 1ZOIA 1AUXA 1S7GA 3BKXA 3EEYA 4FWIB 3RVDA 2ZB2A 4OU4A 1BEZA 5A9TA 3UPDA 1QZ3A 1C1YA 3H75A 3UPTA 2ZRQA 1TZJA 2H1CA 1E9RA 2RHRA 3D6FA 4GEKA 4AECA 4A3SA 3Q8LA 1PVOA 2HRDA 2A4MA 4O4HF 4G24A 1NI3A 1RDFA 3BRQA 3KOYA 3N76A 4UOEA 3HB4X 4GX1A 1EQAA 3VU9A 5JAPA 2CC2A 2GXSA 2JIZA 4IVQA 1ZD5A 4DLRA 3IAS1 3G3EA 3E82A 1UZLA 1PR6A 3ENZA 1F48A 4PAOA 1P33A 4JNCA 5AWFC 1QAQA 2BM8A 1O8BA 2KM1A 3CLHA 3DZJA 3EHDA 2DHQA 3RTGA 4IDQA 3EIHA 3RTDA 3LMKA 3WOHA 4YRKA 1KVRA 1IBCA 1KMQA 4ARCA 1Z8NA 4IWYA 2I6XA 2ZB7A 3JZAA 4C0JA 4YX9A 1WEKA 4QLAA 4M0CA 2P8JA 5BSHA 4PC2A 2PMEA 5A9SA 4M37A 4HNSA 4N5IX 4RENA 2GZ1A 3O1IC 1JIVA 4MITA 1JEAA 4R1TA 4RLHA 4AB1A 3FAZA 2BBWA 4GLOA 5B5SA 4Q1VA 4MRSA 1VIVA 3M1YA 3VISA 1II8A 4CFSA 4PAGA 5ALYA 1T2UA 4XUCA 2VTKA 5CVDA 3R5SA 2VYNA 3IP1A 1JH9A 5HBRA 3Q85A 1CE8A 1XCMA 3IUSA 3G68A 3R24A 3GXOA 1PK9A 3JQ7B 1A4RA 1BN6A 3B3QA 5A6SA 5DBGA 1RCTE 3R3ZA 1FYWA 1N92A 4OGKA 3HUFA 4QATA 2A0KA 2HREA 5D5HA 3K0CC 1E3MA 1PHPA 2DKFA 3RYCA 1ZD1A 4J0CA 1JQ5A 3H19A 1Y48E 2C4MA 5L4LA 1Y3AA 3HYRA 2DP4E 4Y18A 4Y6SA 5E2IA 1M7HA 5CG2A 2JC3A 3WKCA 1ABFA 1B8UA 2EKDA 2M6RA 2QMOA 1WSDA 1OU0A 2C9BA 1AGYA 1PUXA 1TM5E 2P8SA 3N87A 1D2NA 1Q7RA 4XSGA 1PR5A 3UKDA 1QK4A 3D3WB 3DLPX 1J8QA 3HZOA 4KFTA 4WZ6A 1REQB 5H59A 4ZQEA 4U5XA 1J99A 3IBTA 5EP4A 2WSMA 4DWOA 2V7TA 2C83A 5C8ZA 2ZUCA 2C7PA 2AVDA 5DI3B 3MCAA 3O8CA 4L4UA 3JAWA 2GBGA 2IY7A 5BY2A 3T1VA 4IUBS 2XGJA 1IWBB 4PNHA 2C4UA 1PLLA 2NV0A 1JKJB 2O14A 1H9AA 1TO6A 2C2BA 1RNLA 2CLCX 2DLDA 1LS1A 2PS0A 4AVYA 1R0YA 3LP5A 2H07A 3HCRA 4YJFA 1XTPA 4GW3A 5K3OA 3GRYA 3NORA 5ALHA 3UMCA 2BHRA 4BLPA 5C0OE 1EESA 2C9ZA 3B6ZA 1EK2A 2G36A 2VRCA 2YWEA 4U9IS 3W4KA 4FHDA 2C7VA 1RVDA 1BKDR 1O5IA 1T9AA 2EXXA 3FNHA 2W37A 4B35A 4LMRA 1I2DA 2PO5A 3AEZA 1Y8ZA 2F64A 2XUFA 3JQ8A 2JATA 4M1EA 1AURA 1O87A 3AERB 1MMFB 1YWGO 3S1SA 3HV0A 5F1YA 1BVHA 3Q7TA 1NBMD 2W8BA 3DPIA 3THRA 4J3NA 5HOEA 1QYRA 1WUHS 4HQLA 3PNQA 5FJIA 4X90A 4B80A 2XDAA 2JF0A 3DE0X 4ND1A 3E1KA 1G7TA 4CLRB 1CIPA 2UAGA 3FFAA 1OBOA 3HZZA 4MS3B 2OCGA 2QZSA 2I99A 4JBYA 5CLLA 4FMCB 1FBNA 3LIIA 1MABB 1GGNA 4QFBA 5F4ZA 2J3DA 1JTEA 3N9IA 3TQCA 4KQ2A 2QW1A 2R8XA 2GBFA 4N18A 1BD4A 3EZYA 1MX1A 1JI0A 4OXIA 3FFTA 2DB3A 3PC7A 4ZKDA 3O8QA 4C76A 1TW3A 2OCIA 3CRNA 2JAWA 3V4VB 3TPFA 3W2TA 1HLFA 2QY6A 1ZGJA 2VEOA 3TZKA 3ZWXA 4B4UA 5TMPA 4ZAFA 1OH8A 5BSTA 4FFNA 4LYJA 2ZDGA 3ZJYA 1F8GA 5AJZA 4ENVA 3AY0A 1Z28A 1KI6B 4IVRA 1RAHA 2W11A 4PAWA 3C1AA 5DT9A 4ZHSA 3SSOA 3HM9A 1FMJA 1XTVA 3QLTA 4ZVRA 3O2SB 4QPNA 4C1BA 2WF7A 3ZH9B 5C35A 1SQ0A 5FPSA 3RKUA 4WASA 5IH7A 4M8LA 1Q17A 4M9QA 4R0VA 1LF0A 5DWVA 5JVDB 4Z1OA 4QOFA 4ZI5A 4DM4A 3HY6A 3T9BA 2NQTA 3L7MA 5G1NA 3QKIA 1XU4A 4NFSA 1G8MA 2MYUA 4L8GA 2ZWPA 2Q9AA 2VHZA 1J6UA 3ZIAA 1R4MB 1YZGA 2IU3A 1WCWA 2JGJA 3ORFA 4ND7A 4OREX 1RZRD 4RHEA 5KVSA 1ENZA 3DTVB 4QWWA 5CRIA 5CD1A 1IHXA 5EL0A 5F52A 1GQ2A 3GGGA 1VLHA 2CNWA 2QJOA 4OF4A 5JWHA 4O8CA 1H93A 4RAQA 4U9HS 3I6ZA 2BKUA 2YWFA 3E9ZA 4FS8A 3FJ1A 1GG9A 2KLHA 3ENKA 3TLZA 4ZK2A 1QIFA 3TKAA 3ONFA 2HDOA 4YH1A 1R88A 2WC1A 2ZTHA 3UWOA 3K31A 3MLEA 2SBTA 5EPEA 2HCTA 2DULA 2C2WA 4JUFA 1GLGA 2JKYA 4XWTA 1USWA 4KNYA 2O7SA 3CR8A 1V8BA 2XLBA 5ITWA 2RD2A 3QEBZ 2WUFA 3OQPA 5JQGA 2VT2A 3RKRA 3VI4B 5DGIA 1UXGA 4LJ5A 1GWNA 4K9MA 4NCBA 1N2EA 1C9NA 1WXFA 1HL3A 3OPNA 1U6IA 1U0EA 3OOJA 2H92A 3KZOA 1EGHA 3L43A 4TZ0A 4UVHA 3W8DA 3GLFE 1KKUA 2XQIA 3NDRA 1CBUA 3KB2A 2OMKA 1XZIA 3LUCA 1ZMTA 3R3SA 4HQ6A 4LSGA 4FWBA 3QVWA 4BFYA 3V32A 3KLMX 2ACKA 1LCIA 2CDCA 2XGMA 3WMGA 2HLDA 3WZMA 3BUSA 4BHTA 3OETA 1TO1E 3HUDA 3MPUA 2WWYA 2JG3A 5LXTF 3JPWA 1PBTA 1Y3CE 3OFSA 1Z4MA 2A5YB 2FEWB 2Q6KA 3GEEA 3PSAA 4NC9A 1UZMA 1ZZEA 2UYQA 2XB8A 3H5TA 3OZAA 7YASA 3ONNA 2QQEA 2WUDA 5KC9A 3HA3A 1GP2A 4S12A 3VSCA 1HQKA 1FP4B 1MIHA 1NXXA 3FBGA 3HE3A 3NANA 5DLQC 1FK8A 1L5WA 1RSZA 2QQGA 2VHQA 4YI5A 4LSZA 3RV3A 4ANFA 4KDEA 4ROSA 4F2PA 1N77A 1C0KA 1UM8A 2ZBGA 2Y0DA 4Z0TA 1WDTA 5F98A 1GUYA 1Y9EA 2G06A 3FCSB 2IU0A 2H7YA 5A6VA 1SVKA 1KI2A 2CMGA 2B34A 3FYUB 4HLCA 2WG0A 3IT1A 4MV9A 2H2FA 4F21A 4OQMA 1IQ0A 1XNGA 1I01A 1QO7A 3OM1A 2JGIA 2UYCA 4L4YA 3O21A 3WYEA 1J0CA 3OTGA 4KIUA 4LZJA 3T5MA 4IFBA 4MUGA 1L8QA 1NJ6A 5BNIA 1I7SB 2EW8A 1OIVA 5CEJA 1NQXA 3I30X 1GSOA 1SVMA 4XGQA 5D5QA 1GFSA 2PVPA 3UJAA 2GESA 4L0MA 3T1YB 1IN1A 4D3SA 5K5EA 1L4FA 2Q27A 1XXHB 5DK4A 5GGXA 1XZEA 3UM9A 4OQLA 3DUFA 1C9KA 2RAUA 3PVSA 2BI7A 1MC4A 1T3TA 3IUJA 3U4AA 4BNIA 3BMXA 1EH5A 2DR3A 3LDUA 1W5AA 4PTYA 4WGFA 4LEIA 3UMJA 1XTSA 2N3ZA 4ARZB 1W6UA 3PKZA 4NMMA 4BC0A 3ERCA 4ZGGA 3O9MA 2HWUA 3AZPA 3ORHA 2VYVA 4YRRA 1SHLA 3VHXA 2H5IA 3AR7A 3GIDA 1G0NA 3JR7A 4EF4A 3OEWA 4NZPA 3EDRA 4C9BA 4ER5A 5M7EA 1UMBA 1KGSA 2JDID 1H2WA 2OM2A 3IHLA 1YR3A 3BWBA 4LZNA 3M4ZA 4BWVA 1TQDA 1PT7A 1NNEA 5ALXA 5K1ZA 2PBRA 3UMMA 1R6VA 2DX7A 4G1EB 1ZI9A 5K51A 3VC1A 1DMRA 2YFQA 4WFKA 1Y7PA 2H3HA 4BNXA 1NVVQ 1YBHA 1T0PA 3NOXA 4JC8A 1SEVA 4OAOA 1FUIA 5JJLA 2GS9A 3KSZO 4PTLA 2MDTA 3DHVA 3I1IA 5IKXA 1KQ3A 1W96A 3IMCA 1EP1B 3NJRA 5KYVA 3VNRA 4B3BA 4D8TA 3ZK7A 3VU9B 4DUGA 4EIWA 3ZNNA 4BKOA 1XUOA 3Q2KA 4QASA 3OM9A 4PSCA 1TJ4A 3M6UA 1QPGA 2Z4SA 1PJTA 3E7PA 3TSCA 3V4LA 5C32A 1GTRA 1LBEA 1A4XA 3CVYA 2FE1A 3ZE8A 4AJJA 4HQOA 1MUUA 4KAFA 2FDRA 4PFJA 3VV2A 3TGPA 1U0HC 5JAUA 2NYVA 4N0PA 1A5ZA 2SNIE 3R3YA 3CO5A 2PHZA 3HYSA 1ISSA 1LTKA 4NFHA 2GZMA 3NBKA 3U19A 1S2LA 3K5IA 4MVJG 3I53A 4YUYA 4ME6A 1VJDA 5DM1A 3WL6A 4JKYA 3T5DA 3OTQA 4FYMA 4S1WA 3QKWA 1RAFA 3M3DA 1O5OA 2GBIA 1J4AA 1W76A 4MMYB 1QLHA 4RDCA 4UXHA 3HJTA 4G0NA 1Y4SA 4Q34A 3QA9A 3OPYA 3A6DA 4WWHA 1II8B 5IG2A 4O4HA 1DUSA 1JG1A 3OQBA 4ZAGA 4ZVQA 1TDJA 4OHOA 3ZCPA 1L7XA 1P1HA 2XTJA 1CE8B 4IXDA 3UMYA 5JS8A 3H3XA 5IEJA 2XB4A 4BAUA 1PS8A 3O2JA 2XT9A 3V6MA 1SPBS 1A50B 2I76A 2OESA 3A1EA 3H9JA 1N1GA 4N0MA 5J5CA 1CYEA 1ZM9A 2MSKA 1SQ5A 3AYXB 3LT4A 4QTXA 4PNPA 3U1TA 3ICOA 1GEGA 1DDIA 2AJTA 3R7WA 2VLBA 2CFRA 3HY4A 4FZRA 3U81A 5C5DA 1RM4A 4M89A 2C5SA 4KUHA 5KQGA 4EUEA 3GZ4A 3W3AA 1I33A 2W2LA 4ICIA 4MRRA 5L7TA 1N2ZA 2FE4A 5HHTA 3ZJ5A 3JTMA 3R1IA 4R0NA 3T41A 4HGYA 3WL4A 3DQQA 4KXXA 3WL3A 1M7GA 1ZO8A 1SWVA 3U4DA 1MAUA 2PR2A 1JR2A 2Z58A 3D6AA 3LVBA 4TKZA 1AS2A 3U1VA 3JAWB 4WJZA 4ALNA 1DL5A 1RMYA 3PQ6A 3WJ2A 4H17A 4P4NA 5LQDA 3GMSA 3MT7A 5JZMA 1X3SA 2V7GA 1FW6A 1P75A 2LDBA 2YWGA 3FAKA 1ZD4A 1G16A 3STTA 5LLSA 4AJPA 2VT6A 3K1JA 5FBQB 1JAYA 4D45A 5HFJA 1OXTA 1H9CA 3BWMA 3ZH2A 1DKUA 3L1VA 2ATIA 2JFZA 3EBLA 1KK2A 2C54A 3F71A 3GH1A 4MJ7A 4YRMA 4UAGA 1EM8A 1QE0A 4C14A 2QMYA 1QO0A 1Z0SA 1AKMA 1QWOA 5G3ZA 3R7DA 1ECGA 5THQA 4H9GA 3DLBA 2HJ9A 3UAOA 3PZBA 4MA5A 3QXXA 1D1QA 3RH0A 2BONA 4OM8A 4K9PA 3V55A 2W8BB 2NSDA 3YASA 3EODA 2HX1A 3ZY5A 2FDCA 3NS7A 1WHTA 3HCDA 6Q21A 4QD3A 2JK1A 2XYVA 2OSVA 3EBPA 4P3KA 5DTJA 1E5VA 2AQKA 1QNLA 2IP1A 3BXHA 2JFOA 5JZSA 5FUXA 3ZHOA 1GNVA 1U8XX 1AH2A 2GWHA 1LI7A 1ISMA 1KFCB 5BUCA 1M7BA 3EDCA 3SEQA 5KJFA 3S44A 1CRLA 4OB6A 2BMFA 5AH0A 1PFWA 2IYAA 5C7YA 2G08A 1P2FA 3O8QB 4FDAA 4JLDA 5DGHA 3NRBA 2JLWA 3TB6A 3LWDA 3P19A 1L5HA 4RIGA 3TTXA 3V42A 3ZJVA 3QW4B 4KPEC 1RWKA 1WP9A 2FFHA 1L5OA 4Y0VA 2CXHA 2MMGA 1FNCA 4ZODA 3STYA 1JHQA 2ACVA 2H2IA 1QX4A 4MHOA 1QH8A 2F48A 5FTWA 1E2MA 2IYOA 3TOCA 2HQBA 2A8YA 3QX9A 4YJGA 3DJFA 2JFFA 2IUSA 1FYDA 3TL6A 1KRXA 5HF5A 3ESBA 5ALVA 2XT6A 3PQ7A 3LZDA 3OWOA 4MQ5A 3W5CA 2E4WA 1IBSA 3I8SA 3QVTA 3GEGA 4RL6A 2BR3A 2H52A 4B31A 4DKXA 1U11A 4BLOA 2H8GA 1VCOA 1KE1A 5FTNA 2X8BA 3NGLA 1AQUA 1V11A 3GMDA 1D6SA 1XD9A 2VSQA 4OSPA 3Q6MA 4J4BA 1EK0A 2WDZA 3A3YA 1KBQA 4PGFA 4CMEA 1ZOOA 2FQ1A 3UMFA 1VFPA 3RS0A 1W35A 2PX2A 2GPJA 4AT1A 1BTOA 2R1UA 3GGSA 1JFSA 1WR8A 4WVLA 1G38A 4NXMB 3MJ4A 5IJZA 1KQGA 2QJFA 4FW9A 1P72A 2QLJA 1I5OA 3UC5A 1YUBA 2YIDA 4IM7A 3WP1B 3WYAA 1UXHA 2BGJA 1KZ6A 2DFPA 2V3VA 4DUZB 1XJQA 1D6MA 4PYIA 3PX7A 1QKIA 5FR2A 5FPYA 3R41A 1UAYA 3HA2A 2W71A 1EEXB 3JARA 1AMNA 4U6NA 2ZVDA 4NFYA 2ZAYA 4HLUC 3GFOA 4V0KA 4D43A 1OT5A 4MI6A 3ABIA 2VTBA 5JQGB 4NYMQ 4DR6B 3TWOA 1XEWX 1G19A 1WD5A 2VEDA 4UNRA 4MIEA 2FW1A 4IJ6A 1OXUA 4L22A 4OL0A 5D3KA 3GX1A 5GV7A 4DM3A 2HJWA 5CFQA 2R751 2NZ8A 3BGWA 4BWFB 1K06A 4CKXA 4DN6A 5IJ0A 4WI1A 3GWGA 3OIUA 1Z9BA 1GLNA 3DZDA 4AMGA 4HGZA 4I4TF 1HT0A 2H2DA 2Z9DA 4EAQA 1FP6A 1NTOA 3L7NA 1CQZA 4OHCA 2GAFA 5DDIP 2QLLA 4RKWA 2ZSUA 1GZUA 1MHPA 3TQRA 3RLIA 4E0BA 2H1LA 3LGXA 4GU5A 1XNQB 4BVKA 1BDBA 3GZTB 3I1YA 2PFKA 5JPCA 4OXXA 4Z3DA 3ZZTA 3LC7O 4AS3A 2ACEA 3C4QA 1QYDA 2J9GA 3E3MA 2QTBA 1RYNA 1TIPA 1Y4ZA 2I6TA 1PBNA 2PD3A 1XDSA 4IWXA 5BV8A 4AZSA 5FRDA 3CRQA 4RKRA 4PE5B 4BZXA 4NOMA 4H7IA 4JFRA 4X3OA 4XWKA 4E2WA 2CYBA 3U7JA 2A1TR 2AYXA 1ZM2A 3AC0A 3LOUA 1NVFA 4BNHA 1YZQA 1TK3A 4IIHA 2FGKA 3F6YA 2ZRAA 3P32A 1T1SA 1V3UA 2JA2A 5DGXA 4IHAA 1R12A 5G02A 2G5PA 5T6BA 3WK5A 1OHHD 1TVKA 1KQFA 1HYGA 3ET4A 3QWAA 3SC6A 4EY6A 1UOQA 3VZRA 4P22A 1LW6E 4BO2A 1ZNYA 2POQX 1YRLA 4P7GA 3ZX4A 1T4GA 4B3JA 1KRWA 2AOXA 3A6EA 3LW8A 3AMVA 1KFEB 2X0KA 4JLOA 2F4NA 2OKGA 2NP7A 4GMHA 2C8LA 4QJ5A 1FA9A 4JUCA 2G5CA 2O5VA 4RPGA 2H4FA 2XX3A 5IX8A 3QM1A 2F1JA 4NPCA 1PN3A 1OKKD 1SOAA 1S1MA 3BJIC 4CKYA 4Q7KA 5FB3A 5TMDA 1GPLA 6GPBA 2FPKA 3TOZA 2WYWA 2JHFA 4MYCA 1XNRB 3P9YA 4NYIR 2UZ1A 4JT9A 3LM8A 3WGGA 1MB9A 4D9NA 4YXWA 3K30A 2CVHA 1DEXA 3E7WA 3K9GA 2AYYA 3HYNA 3P26A 2QRGA 1HE5A 3JD4A 1EI9A 3BH7A 5HIJA 1PV4A 1UMBB 2G8NA 4CJXA 4CV2A 3K92A 3ZCRA 3AESB 4L9WA 4Y6GB 1HOTA 2QTZA 4NI5A 4EJ0A 2WNHA 3CH4B 1ZNXA 3DTVD 2C7RA 2FV8A 1QCCA 4I0WB 2ONZA 4BRSA 1FSSA 4H31A 1CR1A 4OHZA 1E1QA 3U5TA 2EWWA 1FRFS 3E3OA 3JVVA 2W48A 3VHLB 1X9GA 3LA6A 5F12A 1TUBA 4IIGA 4QIHA 4TXJA 3L7CA 3N6VA 1NNSA 5B7PA 1ZY2A 3NEJA 2Y4NA 1OFIA 1CFJA 3OMLA 2CCJA 4YCAA 3CZ5A 1YZNA 3UAYA 4IZHA 4TV9A 5K03A 1JHXA 3QU9A 1YZYA 2J3EA 1CNMA 3ESQA 1Z5WA 4FFBA 3N2NA 2DG2A 2FSUA 4MO2A 4L51A 5LWQA 3A58B 5K0FA 1I7NA 1N6IA 2IUYA 2XBUA 3JYOA 4LWOA 4RIFA 2P0AA 5F5NA 2HV9A 1KOLA 3SIXA 2O3TA 2VDQB 5F23A 1RXWA 4B6EA 1HNZB 1MBZA 3AR6A 3UA3A 2X40A 1MJGM 3PFFA 1W0CA 2AG8A 1DKOA 1SCDA 1T1EA 3PLAE 3G2OA 1UBCA 2KB0A 1K9VF 3BXOA 3IP3A 2RGXA 3ZGNA 4M98A 4I99A 5LMZA 2GAIA 3NHBA 3DXZA 2H16A 3NTXA 2J3HA 4H7HA 4RS4A 4YTEA 1KZHA 4D8YA 3WL7A 2ZANA 3M6LA 3WIVA 1QHNA 1ZRNA 1BJTA 1ZN7A 2ZI9A 1O8CA 5GQSA 3RS7A 3IVXA 4WZBE 2ZW9A 2VK4A 1SY7A 1O95D 1YJ5A 4IIYA 1EA7A 2I3AA 4J6FA 3ZVRA 4Q82A 4CIAA 4YMSA 5FV4A 2IDMA 2EG5A 5BNZA 1JX6A 2TRSB 1ESEA 2AOTA 3FE2A 2JI6A 2RJOA 2XOKA 4FINA 4ZVTA 2QKYA 1COWD 3FN4A 1OWNA 2B69A 4KXFB 2ST1A 4IJKA 1CJCA 4R7ZA 1CUWA 4KQHA 1EZ4A 4C0AC 3SEFA 5HJ5A 1H2YA 2VIIA 2CXTA 2FSSA 1K9SA 2GK7A 3QJ5A 2AS0A 4TX1A 1TW2A 3NDPA 3SLRA 3T3EA 4N48A 3PX2A 1LY1A 2W2XA 3L18A 2VRBA 2W0MA 3RAPR 4FWTA 3DMGA 4LF6B 3KQVA 1EX1A 4N39A 3HLTA 3SPXA 3U7RA 2C0CA 3LLCA 3VU8A 1ZLXA 4DE5A 3W6UA 1RHQA 2INGX 4HEJA 1OY1A 1WWKA 1Q2UA 4PC6A 4QDZA 3ZCXA 3UBTA 3MILA 2DPYA 1KGDA 3JR3A 2PSFA 1QPBA 3UCXA 2CL0X 3I0MA 5DB4A 2IV2X 2V96A 5CXSA 1I4LD 1LUAA 3JQGA 1U9CA 4A5SA 4JB3A 3QQPA 4ZJUA 1QGOA 3LVRE 1RAEA 3W8FA 3ESRA 1ID1A 4YK7A 3F9CA 4KEAA 4KFRA 4F7WA 4DREA 4L0DA 4MB0A 2DWOA 4YVFA 3TLXA 1UXOA 4O3MA 1E6CA 3RNOA 3DMFA 4BNTA 4LKRA 2FLKA 3MRVA 3HDTA 3SZGA 2QRPA 2IZOA 5IM4F 1KYYA 1U7ZA 1M67A 1ZZGA 1Q0UA 3I6YA 4L95C 1GPKA 4GEGA 3KJQA 1Y6FA 4LSWA 4C04A 2VHTA 2ONYA 5DNAA 2QRZA 2XB9A 1PP4A 2F7SA 4M7PA 3V48A 1O03A 1U1EA 1X2BA 3FWKA 4BFWA 1EM8B 2GM9A 3CFYA 1XPRA 3ESDA 3NR2A 4YRCA 2GEBA 3HDJA 3LJKA 4MW1A 3M33A 3CVXA 2FSPA 4WBNF 1P31A 2C5AA 5FEUA 2JD0A 3AEYA 4I3FA 2XUOA 5DTEA 3GA0A 1WHTB 1ZMOA 1KSFX 1DAOA 3WQHA 2C8KA 1XO1A 2H2HA 2YJZA 2BSAA 3O8NA 2Q5HA 3Q3JB 3DV0A 3E61A 4G1MB 3G2NA 4G37A 4RYLA 5FQNA 4DR4B 3GFVA 1DBPA 1H3NA 4K3UA 2J5QA 1ZK4A 3DVRX 1NDQA 5ER9A 4ES6A 1BW9A 3OP1A 3PICA 1XOIA 2EOAA 3H5VA 3LUKA 1NN0A 5B12A 1DXOA 2WP8J 4WH0A 2XZOA 5I9SA 1TI7A 4HTFA 4QYXA 1SJ9A 4B46A 4HEA1 1W4RA 1RQ2A 2AEEA 5HKAA 1X8KA 1YE3A 3TK1A 1L5HB 3R23A 4UTNA 4DZZA 1P3DA 5FA5A 1G66A 1SOUA 1LVUA 4LMAA 1GTSA 3NTOA 2B8WA 5KNLA 2NZVG 2HHCA 5KNDH 1B4DA 2C7QA 4YJGB 2IIQA 3EVTA 4ENUA 1JDVA 2O8EB 2FX5A 3FMFA 3JV7A 2QXUA 4LRYA 1S9HA 3IO5A 4OA5A 1C1HA 2OCAA 4UEOA 2Y77A 3E5HA 2EFGA 3EE6A 3IURA 3NEYA 5D7NA 2AXP<