3H0KA

Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
177
structure length
171
Chain Sequence
KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAGERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0200 protein SSO1041
publication title Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a
rcsb
source organism Sulfolobus solfataricus
total genus 54
structure length 171
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h0kA00
4TTRA 2O8DA 1YR8A 1XF9A 2D74A 2ZI3A 4UKDA 4DLTA 4NL4H 1IN6A 2BJWA 2OBMA 1SKQA 1SKYE 4O2LA 5L3VA 3VMFA 1EWQA 1CEEA 2FFQA 2QGNA 4IDOA 3K70D 2QBYB 1HA3A 4Q00A 3AVOA 2WWXA 2QNRA 3BD9A 1JJVA 3ETLA 3QF7A 4GRAA 3HU3A 3KJEA 1R6BX 3IILA 3U60B 5JSZA 3B2EA 2FFAA 1G21E 1ZP6A 3X2SA 2Z4SA 4PQFA 3A6PC 4NYMR 3FPAA 2YHSA 2GA8A 1MKYA 1UBFA 3QKSB 4C0HA 2QMUA 2JCSA 5KSOA 2ASEA 1E79A 1E99A 3OEEA 3N2EA 1UADA 1II8B 2XSZD 2VLIA 4XJXA 1MH1A 2FZ4A 2MMGA 4M9XA 4S35A 1U98A 2Q3HA 1U81A 1T0JB 5EXPA 5FL7A 1CR1A 1XXHE 4DT1B 2ZREA 5BQ5A 1P6XA 4MRSA 3VTKA 2QU8A 4LV8B 4URYR 4ASUA 1W0KD 1I2MA 2GTPA 5JEEA 4D81A 2FDCA 1BS1A 1J7KA 2NQ2C 3EX7C 2QRZA 1QG4A 2FH5B 1E6CA 3UATA 3GLGA 1HUQA 1P2TA 4NYMQ 2IEYA 2R6FA 2RCNA 2GEVA 4JLBA 1JAIA 5FTJA 1MOZA 3X1DA 2IYLD 1E94E 2QSYA 4NCKA 4CEJB 2C9YA 3EIQA 2AXPA 3VU9A 4JJZA 3E2IA 3NDPA 2OE2A 4DC9A 1JECA 1FQKA 4TQAA 2O0KA 1AA9A 3AH8A 4WZ6A 5CB8A 2XB2A 1Z0DA 1EFHA 4D25A 1XD9A 4QHTA 4NU0A 4K81B 1OHHA 1T0HB 1KK0A 3OIVA 1R7RA 4P33A 2R2AA 2V8OA 1SVMA 2ZS9A 1E2PA 2FF7A 2D4HA 3PR1A 1Z29A 2AWOA 1F2UB 2X2FA 4Q7KA 2NO0A 1Z6GA 3BAFA 3IUYA 3MSXA 5HCIA 2BHRA 4A6XA 1EESA 1KJWA 4AURA 3GP8A 1XEWX 1B23P 4WZBE 2J7PD 2PLRA 3CRMA 4DLYA 3I62A 1PJRA 4MGYR 1RC8A 1SGWA 4F7WA 3SC3A 3H4MA 3NH9A 5SZIA 3W5JA 3THYA 2DB3A 2GXSA 4UJ3A 3LW8A 3ADDA 2JDID 1WCV1 2WOJA 2QI9C 3V4RA 2K5UA 2VHUA 1NBMA 1AS3A 1K6MA 1Z0JA 3EASA 1D2NA 4KSCA 4GZLA 4H1UA 3UIEA 4NBSA 4CF7A 3BIFA 2FV8A 5DNYB 2KE5A 2ZYVX 3K9HA 5J4KA 3SQWA 4D26A 5FPKA 3D3QA 1BO6A 1TF5A 4Q9LA 2ZSEA 4KXFB 1W46A 4OHVA 2HCJB 4URVR 1G1MA 3GPLA 2EFCB 2QTHA 1CP2A 1G7SA 1UPTA 4AK9A 4DDUA 2ZETA 2CJWA 1MRSA 3G5UA 2CCGA 2WAYA 1FQJA 1QHYA 4A1FA 2ZE8A 1EX7A 3CWQA 2ZRIA 4M9SA 4B3BA 1MV5A 2WICA 4GI7A 4CEIA 1NMXA 2O8CA 3CNLA 3CPJB 2GCOA 1KAOA 1NF3A 3LA6A 4JLNA 5DI3A 1XEXA 4TZ0A 2RGAA 1P4SA 1XTJA 3QKRA 5TB5A 3NH6A 3VR4A 4BLQA 3EIEA 1DAHA 1K8RA 1W4RA 2PCLA 4Q1DA 4L16A 2QGZA 2BBOA 2Z0MA 4Q4JA 1C4OA 2KBEA 1ZRHA 2G83A 4TMZA 3OESA 3TW4A 4TYQA 1G20E 1ZC3A 4BFWA 4L15A 3SFZA 1YZUA 1H8ED 2C77A 3DPUA 4A0HA 2F3TA 1L4YA 4W5WA 2ODNA 1PLLA 4TTQA 1A2BA 2IYXA 3SYNA 2OESA 2WZQA 1ZINA 2BV3A 3P26A 1ESNA 2VF7A 3Q5DA 2E87A 2ODBA 4NCIA 1ZC4A 1OFIA 3KFVA 1XEFA 1VCIA 2PZGA 1JBKA 4C0LA 5G40A 1KZ7B 1NKTA 2ZUDA 1ZNXA 2RGCA 4ZO4A 2F43B 1SXJB 2JA1A 2OEPA 1DAIA 1U8ZA 1Q1BA 2HJVA 2XEXA 1MO4A 4Q1FA 1P9NA 2HT1A 4BZXA 2Q6TA 2O8FB 5JI2E 1NJGA 3NTUA 2I3BA 5CIWA 3T1OA 4C0KA 1S3SA 2FSHA 2X8AA 4KLZA 1NIJA 2ZR9A 4EIWA 4POAA 4F4CA 3HU1A 4A9AA 5ELXA 5FI0B 1AIPA 3ADBA 3LLUA 4GL2A 2VP9A 2WMNB 1A7JA 3L0IB 2LCFA 4ARZB 1TF7A 3MD0A 3TQFA 4WXRA 3T12A 5LB2A 3U44A 1KI2A 4D82A 1OB2A 3K0CA 4E03A 2C96A 2ZE7A 2PEZA 1FNMA 2QPOA 3CIOA 3TMKA 2KB0A 2ZRGA 5CJ2A 5GVRA 2ZJ8A 1N6LA 2A5FA 5TV2A 3SI7A 2V7QD 3QXSA 2EFEB 3L8YA 2QENA 4ZIRB 1TL7C 3REFA 3A4NA 3QE0A 2H5EA 5KNCA 1PUJA 4B73A 2XZPA 2RHMA 4A0RA 2WKRA 3Q8XB 3O8CA 1JALA 3PEYA 2ZVQX 3BJIC 5EE0A 5KPJA 4RD4A 4TWZA 3N70A 1W0JD 2IYZA 4KYIB 3QBTA 5KSZA 1FX0A 4AYWA 1P9WA 2CNWD 5HZKA 4MKHA 4B34A 4JLPA 1G64A 4CEHA 5H1YA 1QHXA 1N5IA 1OE0A 5EJEA 2F55A 2WIBA 4DLRA 4LCBA 3AEZA 5FR2A 4URZR 4RFVA 4OHZA 4CYMA 2JGNA 8OHMA 3ZH9B 4F91B 3NDBB 1AN0A 3JZMA 5IRCD 1KDRA 2PCJA 4B2LA 1GSIA 1CRQA 2F7SA 1UF9A 5L3SA 1OSNA 1D9ZA 4TL8A 1RRFA 1XCGB 1XMIA 3RS4A 3K53A 4NZYA 4MKGA 2HLDD 2L0XA 1GKYA 4RZ2A 5FPYA 3C41J 1G5TA 1BIFA 4LDJA 5KU1A 3KKQA 1XZPA 3BB4A 4HB4A 2CK3D 4CIDA 2AR7A 3GLIE 3ND8A 2GEUA 3V00A 3AKYA 4GP7A 4QGFA 2J5XA 4JT4A 2CMKA 4R2IA 3UG6A 3A58B 1FUKA 4II7A 5E95A 3FYHA 4LJAA 4A8JC 1RW4A 2PT5A 4A0GA 1HH4A 2REBA 1ZD8A 2PLFA 4WBSA 4B2PA 5TDHA 5FTNA 5GJBA 1G19A 1NVWQ 2OUKA 2QG6A 5H68A 1UEJA 2EFGA 3HPQA 4ZI3A 4V0LA 3AVYA 1U2RA 3W8NA 1ONBA 4QM6A 5EXTA 3UK6A 2QBYA 4AKIA 4RFSB 1KSJA 3PV0A 3A1TA 3FHOA 1FTNA 4KO8A 3ADCA 2WJHA 1ZM7A 2FMXA 2PJRA 3ZD7A 1NKSA 1NN1A 1LF5A 3EG5A 1M7BA 1E0SA 2GJ8A 4D2IA 1XD2B 2O52A 1GL9B 3QKSA 1UKVY 2HYIC 4M1TA 4F92B 2JJ2A 3K0EA 4LJ4A 1G3MA 4LC1A 2OLJA 1SULA 1XTRA 1VPLA 1GKIA 2YOGA 5TMPA 3GJ0A 5JJKA 2J0QA 4DT1A 2YNMA 3A37A 4P4SA 4ZDJA 1E1RD 2UZIR 1VG1A 1NL3A 4A6PA 1E1QA 4RD1A 2C8VA 3VR2A 2PT7A 1L8QA 5BN3A 3E1SA 3LBNA 1NLFA 4KBFA 5JSZB 4KFUA 1BMFD 3ZYCA 1ZNZA 2JLVA 3WP1B 2Q21A 3P4XA 4XH9B 4B3FX 2D3WA 4US1R 4OJKA 4A4DA 1KYIA 3I72A 1U90A 5B30A 2ZUBA 1ZCBA 1U0JA 2BC9A 4UNQA 3WMGA 5CB6A 2XNSA 4GOXA 1NG9A 4EUNA 1KI7A 2ZI9A 1ZIOA 2A30A 2W6JA 4GMXA 1OJLA 2NOAA 2OCAA 4NE2A 1Z3IX 3P4YA 2Q9AA 2QTFA 2CLSA 1N6OA 2FG5A 4HLUC 3Q72A 1VYVA 2TMKA 4B2IA 1TQ4A 2YOFA 4GMDA 2XB4A 1UKZA 3EPJA 4TYPA 1E4VA 3SHWA 4TLAA 3JZAA 4LUCA 1VMAA 4ZV4A 1NMYA 2HF8A 4LPKA 3B5JA 2VHQA 1F2UA 3GLHE 1UAAA 2OZEA 2W2XA 1SHKA 2WJIA 4LSGA 2GXAA 3H0KA 4DSTA 2Y8EA 3SR0A 2J7KA 3G0HA 3EPLA 1HE8B 2QSZA 3DVLA 2HEIA 3ZD6A 2WWHA 2JJ1A 1U9IC 2BCGY 2GK7A 1VG8A 5FTLA 1W1WA 1QVAA 1S8FA 4WOPA 4R7ZA 4W5JA 5AWFC 1G8HA 1TTTA 5CLLA 4DDVA 2ZR7A 3CPHA 2C99A 4QG7A 1W48A 1PLJA 4W7SA 4EPTA 2OBLA 5KTYA 5EE1A 4IFEA 1YR7A 4OBEA 1XRJA 4BFVA 3U7GA 1N25A 5EE5B 2BKUA 3DO6A 3LXXA 2CE7A 1DBSA 2DWOA 3C5HA 4XVRA 3ZS8A 2OILA 1N2CE 1TQ2A 2ZYUX 3I4LA 1Q21A 1XTSA 2QUZA 1UJ2A 4UNNA 3TK1A 2B6HA 2H16A 2V9PA 3I92A 4JLMA 4ZCMA 4QM7A 4AI6A 2V4ZA 1KHTA 1PVOA 1T3LA 4YXWA 1R5BA 1Q1QA 1S96A 3TSWA 2NZ8A 1F5NA 1VCOA 3SYLA 3W6PA 1CJVC 3VR3A 3MFYA 2XTZA 3PG5A 4PAMA 3E70C 3THYB 4TMVA 5JJIA 4XIGS 3VKGA 3CONA 2KI5A 5BXQC 4JT2A 2FN4A 3LBHA 4Q1AA 2XGJA 4HDOB 5FBQB 4C2TA 3AVQA 1Q44A 3X1XA 5C46F 721PA 3C7KA 4V03A 5KDDA 1XNJA 4FMDF 5EZ6B 4JL8A 1D9XA 4TZ6A 1HV8A 1G17A 3RSOA 4BLRA 1VG9B 2NZJA 1XPRA 2ZAOA 1ZM2A 1W44A 3LY5A 3OIUA 1EFCA 4TTPA 3UPUA 2BBWA 3BORA 4MYHA 1R0ZA 3OF5A 4G5QA 2P3SA 2BIFA 4KVGA 1LV7A 3FWYA 5K8LA 1E3MA 1R8QA 2VH5R 4LK2A 4KJZA 2G6BA 1KMQA 2VHCA 2CVFA 2ZJYA 4B6EA 2ZRMA 2V6IA 1DVRA 2O8CB 2GCOB 1VECA 1XEXB 3GJ6A 4LV6A 1IY0A 5IT5A 3WNBA 2DWQA 1QRAA 5FR1A 3SS8A 1NN0A 1GIAA 2F43A 1SXJA 1YKSA 3MWJA 1XMVA 4Q4JB 4XVQA 3W34A 4LC0A 1E32A 4Q4HA 4G1UC 4NYIR 3BFXA 4QC2A 1YQTA 3ASZA 1NY5A 3OAAD 2B21A 3ZVRA 2PBRA 2JAQA 1COWA 1HT2E 2O0HA 2ZJAA 3OE7A 2Q9CA 5AJVB 2IF0A 5AJYA 1Q1ZA 4HAWA 5E3HA 1C1YA 3T5DA 3ASYA 2PMKA 3A1SA 5C2JB 1NSTA 3OFNA 1OB5A 4TT3D 1NI3A 1TQDA 4OK5A 3THWB 3B6EA 5AUQA 2OCPA 1G4AE 1XB2A 5KHOC 3VR5A 4C0JA 1W4AA 4Q9IA 5A0FA 1CBUA 4AYXA 1IY2A 4HUQB 1EK0A 3M1IA 4NYIQ 1RRCA 3U3OA 1BH2A 3Q85A 3KQNA 3P27A 4OHWA 4CDGA 4P4UA 2ORIA 3UKDA 1QG2A 2QQEA 2NO9A 1OKKD 4K46A 4OQNA 3GJ5A 3U7FB 4BFYA 1X6VA 4LHXA 3A8TA 1N6PA 3U44B 4TLBA 2GJKA 5HCNA 2AHOA 2J9RA 4G3XA 3X1WA 4Z1MD 4BEBA 2VSOA 3IO5A 3ZQJA 3P1JA 4EFNA 4XD7D 3RRYA 1AKYA 1TEVA 2ZI6A 4OKSA 4QBFA 4EPRA 3CB4A 5FL3A 4DCUA 1KJZA 4PHFA 3KB2A 4JZKA 3U61B 4RVCA 3VHXA 3TSZA 2R44A 3LXRA 1HQCA 2R6CA 4YMUA 5B58C 5E7MA 1T4GA 1KTVA 4IVPA 1KO4A 3GEEA 1E2FA 2RH5A 1L7VC 3QPVA 5DH9A 4AY2A 4B74A 2YZ2A 1W36B 4RD3A 2VO1A 3BB3A 4QL3A 1FX0B 1ZUNB 1VG0B 4ZKDA 2PX3A 1J8MF 1IN8A 2W6ID 4RZXA 2GJSA 4L9WA 3CX7A 5C18A 4AWXA 1CRPA 1KZGB 1QF9A 4PZLA 5SZHB 4D0NA 3Q7PA 1P3JA 4JVSB 4TN1A 2WWYA 3QPWA 2E1RA 1D5CA 2XXAA 2CLDX 2AK3A 4OK3A 1GP2A 1K5GA 4RCZA 3U6BA 3PENA 1E2MA 1IOZA 1Z2AA 2BEKA 2ATXA 1NLYA 4NP6A 5AJWA 3NWJA 1TAGA 2FNAA 2IXEA 4J0QA 4M4SA 4QBGB 3O47A 2CL7X 3H84A 4NKRA 4PZZA 4DCNA 5DHAA 1OXVA 1HQYE 3PUWA 1OFTA 3U5ZB 3RWOA 4RFSA 4QNRA 3S1AA 1CLUA 2WSMA 4WW0A 1YJ5A 2FE4A 4DEXA 2JDIA 2NPIA 3IGFA 4D4MA 1E2KA 2IC5A 5LBIA 2YOHA 2O0JA 4JLJA 2VA8A 2WWIA 1KO8A 3OIWA 3CR7A 3B60A 3AVVA 2EVWX 3VKWA 1OFHA 5JCPA 2QP4A 3BH7A 2DR3A 4WVFA 3PUXA 4QRHA 1XD2A 4V0ME 2XJ9A 5JFGA 5A5GA 4FN5A 1LY1A 4Z8XA 1KSFX 5BYKA 1E9BA 1OFUX 2NTYC 1H8HD 1WQ1R 2ANCA 4A2PA 1K5DA 2VBCA 4HAYA 4LY6A 1OIXA 5KDOA 1E2EA 5F2EA 1ZNWA 2FX3A 3RHFA 1PV4A 3THOA 4OI4A 2W2VA 5DIFA 2IHBA 4G01B 3GFOA 1T5IA 2QA5A 2C03A 1GFIA 2YC4C 3CRRA 5KUTA 4C0SA 1CR0A 1TX4B 3EZ9A 3EPHA 2P67A 5HTKA 1KO5A 1ZIPA 4DXAA 1N0UA 2WVJA 4MYTA 4A0FA 3LNCA 2WM9B 2VSXA 2ZRKA 2ZRAA 4I1SA 4OQLA 1QDEA 4XSHA 1KK2A 4TLEA 4RSGA 5DN6D 4PAOA 3QOFA 2P6UA 1H8EA 3H1TA 4P4SB 5JHGB 2QAGC 3KXIA 3GLFB 2OM2A 3DM5A 2ZSAA 4UXHA 4CT5A 1A5TA 4LGMA 1GOTA 4PANA 2RGXA 4UXJA 3RDPA 3F3YA 5EE9A 1Z6YA 1UBGA 4QGGA 1IN4A 3AVUA 2W00A 4OI1A 2R6AA 5IF9A 1II9A 2NGRA 2RKOA 2XITA 1CTQA 1M8PA 2BMJA 4F93B 3CWZA 3QI2A 2AFHE 1P61B 4LX0A 1E2NA 1SHZA 1ZU4A 2GZHA 1Z0FA 3THXB 1S1MA 1GWNA 2G88A 3EA0A 1N5KA 5J5CA 3O8BA 2GXQA 1DAGA 4QJ5A 1OXXK 3QVUA 4EQ6A 3K9NA 3LFUA 2FSGA 3NC0C 3GCGA 1A4RA 1CIPA 1U0LA 1DAKA 4URUR 4RKFA 1GM5A 1G5RA 2VF8A 1GRRA 3AVWA 4DZZA 2ZEJA 4LHYA 4Q5IA 2F3RA 3C4JA 5KSPA 1SKYB 4CGZA 2QP3A 2GEDA 3ICEA 2HF9A 1YVDA 2R65A 2Q9BA 2ZANA 2V7QA 2IWHA 1UFQA 5AUNB 2P6RA 5JRZA 1W4CA 1VIAA 4B6FA 4DLSA 1XJQA 4PO9A 1G5PA 1Z0IA 2G77B 4M21A 2ERXA 4JS0A 4Q4AB 4KITB 4MUAA 3CRW1 3RSLA 1OF1A 1QZXA 3A1VA 3I73A 4KLNA 2DYKA 4B35A 1JNYA 3BS4A 4TMTA 2J46A 4FWTA 1IXRC 1XXHB 4NH0A 2RAPA 5IK2D 3GJXC 1G6HA 4DHEA 2YJTD 3TR5A 3W6NA 5HPYB 3R20A 4BLPA 1AQUA 3Q3JB 4PHGA 1V43A 1P60A 4EKDA 2WWGA 4DCVA 5CIQA 3CBQA 3TUZC 3PEWA 4GNKA 4P31A 1XCPA 3QF4A 4UXIA 4ZDKA 1JI0A 1DAMA 3MMPA 2C98A 3EC1A 4ON9A 4V0KA 1WDTA 4XTRA 1CXZA 1OXSC 2IF2A 3W3AA 4LPSA 1T5LA 2HLDA 1RYHA 4UJ5A 1JB1A 1AZSC 1VTKA 1FL9A 2RMKA 2A7QA 3ZZ0A 4B32A 2CK3A 2VP2A 3HR8A 4QJ3A 2HT6A 4BGDA 1Z22A 2ZJBA 4TLCA 1Z0AA 2QT1A 1E0AA 2ZITA 2OG2A 3FTQA 3GD7A 2PZEA 3KKOA 3IBGA 5K8IA 4QXAA 1IXSB 2N42A 1KMHB 3FE2A 4A2WA 4KFRA 3QKTA 2HJGA 1GITA 421PA 1DARA 4Q1BA 2OLKA 5UKDA 3QG1A 3RYTC 3SU8A 5LDDC 2MSDB 4KSBA 4Q47A 3THWA 3P20A 5JRJA 1U8AA 3FHCB 3B1XA 1OLOA 1QHIA 4KFSA 4WZAE 1NMZA 2XOKD 3QSYA 1ZUIA 1R0XA 4ASUD 4HDQB 4Q4HB 4HUQA 3EC2A 5M04A 2C5LA 3LH5A 3U4QB 4FMDB 2OFOA 4X8MA 4BFXA 4DSOA 1P2SA 2QE7D 1BKDR 4TQUS 4Z54A 1YE8A 4M1YA 1RIFA 4PPGA 2KJQA 5B64A 1GNQA 1I4TD 3A4LA 2GCNA 3DL0A 4M2LA 1S4QA 3BOSA 1G8GA 5JECA 1QHNA 2H1LA 2ZU0C 3LX5A 5LPNA 2AK2A 2CL0X 1KDPA 5EXXA 1N6RA 1V5WA 1CJKC 2CLCX 3LWNA 4EJSC 2FA9A 1O3YA 2N46A 2VL7A 2ZRDA 3K70B 1DELA 1N5JA 2FWRA 1CJTC 3ZVLA 1E2LA 1OHHD 2SHKA 1M74A 1P2UA 1NJFA 1VYUA 3DZDA 4XWOA 4MKFA 3U3KA 3AGQA 1BMFA 2O8EB 1AGRA 2Z83A 3B78A 3CRVA 4DIEA 4YMTA 2IYWA 4PFSA 4PXAA 3EZ7A 2BCJQ 5EP2A 3FKSA 3VAAA 3K09C 1KAGA 2IYRA 1SVWA 4AG6A 3LDAA 3HWSA 1DE0A 4BECA 2J3EA 2WBLC 4LHVA 2XNDD 4DVGA 4BLTA 5CDFA 2JLZA 5JI3E 4CW7A 2BMDA 4RJLA 4U02A 2G3YA 4PPFA 4Z51A 1G3UA 4JVMA 4BFZA 2A9KA 5EUQB 1Z28A 2C04A 2F9MA 4Y0AA 2YC2C 5FTMA 3KKPA 5DHFA 5IDVA 2NIPA 1Q1EA 2Z6VA 2J87A 5FUVA 3GEHA 3GJ7A 2PZFA 1G7CA 2OT3B 4I81A 3T06B 2JEOA 4BZPA 1XTIA 2AD1A 2XJ4A 4LRWA 1T3SA 2JLUA 4A36A 1L4UA 1UBEA 3ADKA 2EWWA 2GF9A 4PTLA 4TL6A 4B3XA 1WE2A 4W5HA 3ONWA 4IDNA 4U5XA 5J47A 2JATA 2IS2A 4IXMA 1W2GA 4C9BA 5FBVB 1UBCA 2BDTA 3K0CC 3WY9A 2OFWA 1G18A 1JR3D 2ZROA 1IM2A 2YVUA 1MO6A 3SEAA 1XU4A 2XXAB 1DO2A 2D2FA 2IUSA 3A36A 1JR6A 1U8YA 2RGGA 4EAQA 221PA 5F9FA 1GTVA 2DHRA 2ZS8A 2ZI4A 3TAUA 2GAOA 2GZAA 1YU9A 2EW1A 1L2TA 4HLQB 2JLRA 4FWIB 3HDTA 1X8JA 3QENA 1T8UA 1G7TA 2ECKA 4PO1A 1N0VC 5EXSA 1ZM3A 1Z6TA 1X86B 2HXYA 4O2RA 4IOMA 3S1AB 1KDTA 1W2HA 1P62B 2X77A 3AQ4A 3CF0A 3SDZA 3NBYC 2GKSA 3SBDA 3PCRB 1VHTA 5FI1B 1W4BA 3W9YA 1SVOA 1ZYUA 2MSEB 3QXCA 2BVNA 3ZJYA 1XZQA 2IUUA 3GLGE 2BM1A 3A1UA 3AKDA 4IHQA 4BRUA 2WKPA 2QMEA 2ZSDA 2AKYA 1AK2A 2ODWA 1LFDB 4JL6A 3SFVA 3SJCA 1CF4A 5FOUA 4UQOA 1ZJ6A 4HDCA 5DLQC 2FPMA 4JBWA 2CEAA 1GZSA 1D2MA 3GLFA 3RS5A 2CHVA 1G3RA 4IOLA 4N0DA 1JAHA 3J81k 2QP9X 3BH6A 3G82C 4DUGA 3RWMB 3W90A 4AIIA 4LOAA 1I2DA 1NN5A 2G0NA 1AQYA 4PR0A 4CRWB 2NMVA 3SN6A 4A92A 4A15A 2X1VA 4AKHA 5HKKD 1HTWA 4LBWA 2G1KA 4LBZA 1KI3A 5LD2C 2IBMA 1Z06A 3GJ8A 2ZI7A 3RVBA 4KBGA 3GJ3A 4IDQA 4L9SA 3GLIB 2Z43A 1E69A 2LKCA 4IRUB 3VHLB 2O5VA 4GP6A 1YZNA 2J41A 3NEYA 3FOZA 5CYPA 2ZI5A 3THXA 4Q9KA 3CW2A 3LQQA 5SZJA 1XMJA 4KV9A 2B92A 3WYFA 5TXGA 2PJZA 2BMEA 2HCBA 2C78A 3LW7A 1HURA 5JWHA 2W58A 5TVKA 2LWIA 2A5JA 2ZS7A 3R9WA 2GVDC 1RZ3A 2ANBA 4TT3A 2GXUA 3FB4A 3TH5A 1FPMA 1N6HA 4ACBA 5GJWC 1XCMA 2J0SA 3RS2A 3E5HA 5DISB 2WAXA 2J0UA 5FTKA 4DB2A 3CNNA 4FINA 1G41A 1EWRA 1KNQA 2QAJA 3U2QA 4LJYA 4X8OA 1KSGA 4U00A 2H18A 2IT1A 4BRWA 5F98A 1RRPA 2AL7A 1UM8A 2CHQA 2QL6A 1HYQA 1UDWA 4BASA 3QXHA 1JR3E 1KI8A 4D6PA 1WA5A 5JWRA 4RD0A 1JQLB 2R9VA 1AGPA 4L4UA 2OAP1 4EQ6B 4Q4AA 3GJ4A 4QGAA 4PC6A 5CLQA 5HE8A 1KI6B 3FFAA 3OIYA 3B9PA 3DHWC 1WF3A 3BBPA 1OKKA 3GFTA 3KQUA 4LJ5A 2V54A 4Y0VA 4BFUA 1EG7A 1KK3A 2EYUA 4C7OB 4A2QA 1F3OA 4MITA 2ZYTX 3I5XA 3GQBA 2HXSA 3KDSE 2O8BB 1PUIA 3BWDD 1XXHA 1R0WA 3N2IA 4MRNA 1S9DA 3K0AB 1VDZA 3AF4A 2CCJA 1KNXA 3NG1A 2W2TA 3AV0B 5AJZA 4Z1MA 5L8VA 1BYIA 2WSSD 4XD7A 3WRYC 5J4YA 4IKEA 4DCTA 3HPRA 3I32A 1E9FA 4RD6A 4HYYA 2AD5A 1WB9A 2RGEA 4JMPA 2QROA 3TBKA 1R10A 1U94A 5AUPB 4YMWA 1IHUA 1LW7A 4RCYA 4YMVA 4MRVA 4ZKEA 2GNOA 1ODFA 2OSBA 4P0TA 2KSQA 1IJFA 3L0OA 3C15C 1YZGA 4NTZA 2JLXA 2ZRPA 1GL7A 2NO6A 2W6IA 3KKMA 2UVQA 5EP4A 5EP1A 1SVKA 4GFDA 1E96A 3WYAA 4MUBA 3D6TB 1DG3A 1R4AA 4GSYA 2QPTA 3AF3A 3QF4B 4JLOA 3WRXC 3K9GA 1MO3A 4ESVA 3D31A 3GLHB 1WRBA 1DAEA 1KO1A 4HATA 3IKJA 4OQFA 3TNFA 4B3CA 3AVXA 1KMHA 5DI9A 2G0TA 2OBNA 2GBLA 1Q57A 3AF1A 1S3GA 2GJ9A 1OH8A 1M6NA 4PC2A 4EDHA 5F3WB 3I61A 1QHHB 1VIYA 2ZTSA 5JS7A 5GJCA 1KY2A 2F9LA 1KI1A 3ZVNA 1DPFA 2RGDA 4IXNA 3F0TA 2IXGA 2J59A 2ZRBA 2A3RA 1MO5A 4HAVA 3U4QA 1CULC 3M0EA 1QVRA 3MWYW 4HAXA 2RB4A 3AP2A 4M1OA 2IEZA 1XTQA 1RE0A 3ZDQA 3W6OA 3NC1C 1XWIA 3VX4A 4P3YA 1XJCA 4YQFA 2PX0A 1WP9A 2I1VB 4CT4B 2Q3MA 2FFHA 3LO5A 3B9QA 1RPZA 3R8FA 5JHHB 1N6IA 3I1FA 3WNCA 4BEJA 4YMSA 2W6JD 1FTSA 5JZVA 5FUYA 1IJEA 4JYBA 521PA 4R98A 1Q20A 4PAQA 3RS0A 1DO0A 3NIBA 3T1VA 1RJ9B 3Q7QA 1E2DA 1LTQA 1N5LA 4BFTA 2CXXA 3CLVA 5TARA 2O8EA 3LQRA 2QTVB 4DIDA 2GK6A 1Q0UA 2EFDB 3T35A 3IHWA 2HUPA 1TF2A 1KJYA 5GJVC 3TLXA 1P7CA 2ZRLA 1TUEA 4TL7A 3UMRA 2XSZA 3FGNA 2C9OA 1SVSA 3PITA 2JJ1D 1BOFA 2C9CA 2YV5A 4H9GA 2ZSFA 3ZIAD 1S2MA 1W0KA 1SXJC 1CS4C 4HB2A 1KK1A 4MKIA 3A4MA 2QRNA 1XEWY 2QPAA 3WXMA 4GDFA 2G9NA 1JEDA 1ANKA 2R8RA 2JIZD 4HUTA 2FSIA 1Z5ZA 1P75A 5FPTA 5FPHA 4ZCLA 1ZM9A 2NPFA 2D2EA 4URWR 2IX3A 2V55B 4LYJA 1AM4D 3K1JA 4MGIR 1NNEA 1XP8A 5EP3A 5FPSA 4O0MA 5JBQA 3MGCA 5KYKA 4ZDIA 3NKVA 2H8KA 2Q3FA 2VRWA 1TMKA 2ZR0A 4GOKA 4X8HA 1XD8A 4A8JB 1N6KA 3AP1A 2CDNA 1TQ6A 1ZVQA 4Q48A 1DOAA 2IYYA 4M1MA 3GEIA 4GPTA 2GF0A 2JLWA 2CBZA 3I8SA 3QIAA 1FMLA 2IUTA 4FI3C 2ZQ5A 2EYQA 3BXZA 3OEHD 4KU4A 4C0QC 1OH7A 4MH0R 2QEQA 2IYSA 3FVQA 3QY0A 4Q02A 3T61A 2IS1A 3LAWA 1CR4A 1T6NA 3B82A 1BYUA 2QMHA 3TQCA 2J7PA 3EW9A 1J99A 1KKMA 2G1JA 2P0EA 3MAAC 2HDNB 3ND9A 3NEJA 2OFXA 1D8TA 2QN6A 4D4JA 3K9LA 1NRJB 5FOSA 2XTNA 2MMCA 1T8TA 2ORVA 3BFVA 4D4KA 3QXXA 4OI0A 5JEDA 2A5YB 4M53A 3B1ZA 1JXMA 4DEYA 1ZCAA 3IEUA 1E0JA 3F8TA 3HYRA 3O8DA 4G5GA 3V9PA 2BJVA 1EFUA 3C16C 5DO9A 2H17A 4JJKA 2QAGA 4V0OA 4HB0A 5HR5A 4B75A 1SXJD 2CCKA 3PIRA 4JVLA 4O3MA 4TSFD 3MWLA 2OXCA 5C4GB 5JS8A 3SYKA 4EPVA 1EFTA 1KY3A 3AVTA 4NPHA 2OAQ1 3LV8A 1JQJC 1HY3A 1GG2A 5FOXA 1OH6A 4JIMA 3TVDA 5J4HA 3OE7D 4XOIA 2W83A 2H7VA 3EWSA 3C14C 2P5TB 2ZJ2A 4ESHA 5BWMA 2NO7A 4Q9JA 1CJUC 2UZ3A 4ITRC 2AWNA 2DFKB 3OFND 2OO7A 4MGZR 1G3QA 4C0AC 2ZM5A 2AX4A 2Z5FA 3H2YA 4NMMA 5KO2A 3CF6R 4B33A 1W7AA 1XX6A 3DEFA 1YZQA 4P4TA 5AJXA 2IW3A 3RC8A 1VHLA 3GLIA 2FU5C 1E0KA 2VYFA 2ZRCA 5D3MB 3BRWD 4KFTA 1SVLA 3PXGA 4DKXA 2OV2A 1UDXA 5FOVA 1ELOA 1II0A 1IBRA 3AGPA 2RGNC 1CJMA 3NBFA 2FOLA 2CE2X 5EZ5A 4LBVA 4OI2A 1H65A 3ZLJA 4ERNA 2QMOA 5H8WA 5CM8B 4F4IA 3DKVA 4MDFA 3ZS9A 1ZU5A 1Z0KA 3IDQA 2W0MA 5DGXA 2C2HA 2EWVA 3PUZA 3SOPA 4Q18A 2XOKA 4E09A 1FP7A 3ICQB 3KJHA 3KQHA 1O87A 4PC7A 1G8PA 1MABB 4N3NA 3EWAA 2H57A 4EFMA 5F9HA 2QE7A 4WA7A 4NONA 2FPLA 1UEIA 4LJ7A 3WHKA 1YR9A 5DSZA 3PUVA 1SVIA 1KKLA 4YONB 5BN4A 1KI6A 3IIKA 3KQLA 3WMFA 2P6NA 1JXOA 3EARA 3L2OB 5ANRB 5FOTA 1E2IA 2V6JA 4C7OA 2I1QA 4YC7A 1CKEA 3PJRA 1VCMA 3L82B 2NG1A 1P72A 2F1IA 4D0GA 1IN7A 2O8BA 2BBTA 2J0UB 2XTMA 5J40A 4BE7B 3RRMA 2WTUA 3K0AA 5B57C 2F6RA 1XTKA 4ZCIA 1F2TB 4LJ6A 3LVRE 4JKIA 3DMDA 2YYZA 1D6JA 4W9MC 2P5SA 2ZIAA 1EFRD 3IQWA 4KYUA 3TUIC 1TU4A 1X1SA 3DM9B 4RKEA 1TUIA 3CH5A 4DLWA 2OCBA 5FBLB 3FFBA 3M6AA 3IEVA 1Y63A 2WPDD 3CM0A 4XTCS 4ACAA 4R2HA 2IXFA 3EIHA 1YZLA 3KJIA 1YRBA 1G9XA 1SXJE 1W0JA 2XNDA 4QNMA 3BFKA 3U7EB 4US0R 2CNWA 5AR1A 3PFIA 1OXUA 1X8KA 4DRZA 5HE9A 2ZPTX 1E9AA 4DSUA 1FW6A 4S2EA 3ZZTA 2FFBA 1A1VA 2IYVA 3C5CA 4DLZA 2WIAA 2I4IA 2ZRHA 3BH0A 1E2GA 2Q0HA 3BC1A 4HI0E 4QBHA 1NVVR 3GLHA 1ZNYA 3ZVMA 3DZ8A 1Z6XA 4PHTA 3VNVA 3QNUA 3LLMA 3RLFA 3KZ1E 1KIMA 2J45A 1R8SA 2PL3A 4B3GA 3WYGA 1QHHA 2DFTA 2JLSA 3TRFA 2ZJ5A 4DBLC 5KSYA 5FBRB 2FGJA 3EZ6A 3RS3A 4URXR 4M8NE 3LVQE 3CF2A 4PC3A 4P32A 3W5IA 3K0FA 4MDEA 3NXSA 2ZE6A 5DYGA 4LZZA 4AYTA 1F60A 1JR3A 2EFHB 4FMCF 2YWGA 4JKYA 1GKUB 1Z8FA 2VIIA 3IO3A 4AG5A 2E9SA 1Z08A 4FD2A 4TLDA 1W47A 3JVUA 3MUFA 1NVVQ 4KODA 4OL0A 4B43A 4EJSA 5JLJA 2BM0A 4BLSA 1B0UA 3I3SR 4FMBB 3OHMA 3CPEA 5IHPA 1AKEA 1E79D 2REXB 3OEED 4NHOA 3BB1A 3L0PA 3ZGXA 4B76A 4D80A 4X8LA 4FIDA 4Q1EA 1R2QA 5FL7D 4IOKA 2PMDA 1JPNA 3B13B 4DWJA 621PA 2GZDA 4OQXA 6Q21A 3QBVA 3O8RA 1RKBA 4UNSA 2GJAA 1J70A 4US2R 3K09A 1RJ9A 3JVVA 1E9CA 2BBSA 1E9SA 2QM7A 2JJ8A 4IEIA 3SJZA 4BUJA 4C30A 2MSCB 2ONJA 5K8UA 4Q7LA 3WP0A 1N6NA 4DJTA 1IY1A 4D0LB 2F1JA 2ZVPX 4KCGA 3KXLA 2OHFA 1OYYA 4HLCA 4IEEA 3SZRA 2QY9A 5FOWA 2Z4RA 3CX6A 4HEJA 121PA 4NCJA 1GL6A 2JASA 4ILEA 4RY2A 2GAAA 2CL6X 3TR0A 2BEJA 3NVAA 3SNHA 5BW8A 1WXQA 3K0SA 4QFMA 3MJRA 1E1RA 2ZRNA 1ESMA 2D7DA 2YKGA 1S9HA 4QBIA 4DLUA 4JLAA 1NY6A 3MRSA 5EUMA 3Q5EA 5C4MA 1M7GA 4L8GA 2XX3A 3TSOA 2WJGA 3RAPR 2F1HA 3MCAA 2DFLA 1AS0A 4LI0A 4LWZA 4BQSA 3B85A 3N5CA 5HKKA 3KQKA 3VKHA 3MLEA 4NYJR 2AN9A 1LS1A 4AC9A 1ZMXA 2QT0A 1Q3HA 5J4LA 3X1ZA 1TPZA 4QKQA 3KX2A 4BPBA 3PEVA 3ZZUA 3IQXA 4A8JA 1G6OA 3PEUA 1CU1A 1ZAKA 4U7DA 3WHLA 1N3BA 3Q9LA 4PQRA 1MR3F 2ZSBA 2ZU6A 1F6BA 3BE4A 3QJYA 1GRQA 1DADA 1JEEA 1TU3A 2GCPA 1NBMD 2QORA 2ERYA 1G8FA 1IQPA 1KOFA 1HEIA 2R6GA 2WKQA 4O25A 3ECCA 4EPXA 1NSFA 1A82A 4C3ZA 4NYJQ 4GBMA 4YDSA 4R9UC 3W8RA 4QOSA 4UNRA 1XBTA 4EPYA 3FMFA 1Z6AA 3R7WB 1D2EA 2IYQA 3T34A 4Q7JB 4GOJA 1P73A 3IHLA 4KI0A 1E98A 1US8A 3RC3A 3U3JA 1RVDA 4MYCA 4FCWA 4JLKA 1XPOA 4HZUB 1DTSA 2DBYA 1LS6A 1ZBDA 2ZRJA 2DFNA 4JBYA 4ZDWA 1Z47A 2A5GA 1FFHA 1YZTA 4G5OA 1RRGA 4GT1A 2WOOA 4N1AA 1X8LA 3KUCA 3UG7A 1M7HA 1R5NA 2F1RA 2FSFA 4XWKA 2VP0A 4Q9HA 4QJ4A 3RNLA 5FFMA 3KTAB 5DE3A 1VYTA 1PZNA 3I5YA 2VHJA 4I99A 5L3QB 2GVZC 3CRQA 4DDTA 3CX8A 2WSSA 4Q7MB 1OXTA 2VP4A 4B44A 1F48A 1W36C 1MRNA 2R6DA 1DAFA 2IYUA 1IAQA 1E4YA 4JL5A 4JLDA 1QBKC 5BYJA 1Z2CA 4Z8YA 5H70A 3KUDA 3L8ZA 2ZE5A 1EX6A 2QZ4A 5CITA 3QVVA 3HJNA 4LV5B 2ODEA 2UKDA 5FH9A 3D7MA 5AUOB 1YHNA 2QAGB 5B2ZA 4D4LA 2VSFA 2AKAB 3RABA 4M1WA 3QQ5A 3U3RA 4IDPA 4HLUA 5JCZA 1M2OB 3BERA 4DCSA 1UKEA 2RHDA 1M1YE 1WBDA 3TE6A 4TYWA 2P65A 2FEOA 2QM8A 4E22A 3WMEA 4DSNA 4LHWA 4CVNA 5D3MA 2OXRA 2PEYA 4FCVA 3R9IA 3C8UA 2W0SA 4PSKA 2CHGA 5G3ZA 1FOEB 2REOA 2FZLA 1WMSA 3CO5A 1G291 4IJMA 1LF0A 3DOEA 1JJ7A 1U9IA 1ZM4A 5E7JA 4A82A 1R0YA 4OYHA 4C0BA 4RZ3A 4TQ9A 2O8DB 1Y3AA 3AVPA 1E2QA 1II8A 3K8YA 2WJYA 1J8YF 1KO7A 2A2ZA 5JMTA 4E5UA 2IA5A 1VKJA 3DOFA 4I1VA 5FUWA 3TUJC 2VP6A 5JWOA 3WNDA 1MABA 2P2LA 4PPQA 3OAAA 2GRJA 3KKNA 3H86A 1Q3TA 2VHTA 2IWRA 3T15A 2FGKA 2H92A 4MGKR 3QG5A 3KFXA 3V4FA 1NBME 1GILA 5E7IA 3FKSD 5E4FA 4V0MA 3PVSA 1X1RA 4CEJA 3TIFA 3IPYA 3FDIA 3CR8A 1W36D 2HV8A 2YWHA 1RYFA 1TNDA 4N0EA 1GVNB 2A5DA 3L0SA 2DY1A 3GFPA 1WBBA 4EPWA 2ZAMA 4QGHA 3NBXX 4R71A 4WXPA 4EFLA 1F2TA 4MYUA 1GAJA 3EPKA 2WMOB 4AKEA 3LX8A 1KDOA 4PC1A 3AUYA 3GLGB 3GMTA 4IDHA 3NHBA 1R5OA 4OHXA 4M9ZA 3U3MA 1YR6A 3EAQA 3QKUA 2VP5A 2X2EA 3F5FA 4LHZA 5FBWB 4HZIA 3B8HA 4MA4A 1IONA 3SBEA 3VU9B 2C95A 3CNOA 4LBYA 1G4UR 2XZOA 1U99A 2ORWA 2WJVA 1NP6A 3BGWA 3TVTA 2IL1A 3ZIAA 4HSEA 4HLDA 4G5SA 1TEXA 1W5TA 2PH1A 1FNNA 1XDBA 1G7RA 2D06A 2GHIA 2JIZA 3EXAA 3TAHA 4TYYA 3QPUA 5CYOA 3WBKA 3MJHA 3CZQA 4K8OA 2ZRFA 4V0NA 3SJBA 1HE1C 3IIJA 4TYNA 5FUXA 3U6KA 2EU8A 1KSHA 1GDDA 1VCNA 3HR7A 4RD2A 1LNZA 5KPDA 2IYTA 4NCHA 3EZ2A 4PX9A 4L5BA 1KGDA 4MRPA 3UWKA 1DG1G 1S1CA 1MT0A 1GNPA 2ZUCA 4PO8A 3VNUA 5JJLA 3FMOB 4Q4LA 4KAXA 2GESA 3IPXA 1J90A 4TMKA 1E9DA 4LYAA 3RRNA 4B71A 2J1LA 4ZPXA 3OEHA 1P9RA 1IXZA 1NG1A 2D7CA 1OIWA 4C4PA 1YZKA 3NHAA 1Z63A 2FEMA 4F38A 2DCUA 5C1BA 2IK8A 1GRNA 2JJ2D 2DPXA 2GWHA 1XJ0A 2GILA 1A2KC 5KDLA 2WWFA 3KB1A 4JLVA 2YWEA 3ZQ6A 1X3SA 5HZHA 2CJWB 1HT1E 3CZPA 4IOJA 4OHYA 5P21A 3QEJA 3DMNA 4G5RA 4PSAA 1TADA 5L3RA 2BWJA 3AM1A 1E1QD 1NLZA 3K0FB 1GNRA 3QEOA 1DS6A 4DLVA 5BN5A 4CEIB 3SE0A 1W49A 1N0WA 3DDCA 3HU2A 1NIPA 3MWKA 4DUGD 4Q1CA 1NVUQ 2YWFA 3FMPB 5DI3B 4DLXA 4EJSB 4V02A 3AUXA 5AK0A 1CR2A 4DB4A 3AKEA 2IS6A 2QQ0A 3QKRB 3I8XA 4PHHA 5G41A 2KBFA 4HAZA 3U7HB 2GETA 1IN5A 4TMXA 4TSFA 5SZKB 1FUUA 1OIVA 1QHSA 4GZMA 1AS2A 2WJJA 3UMFA 3CUEF 3P32A 4TL9A 3TW8B 4I1UA 1H8HA 5CDFE 1Z07A 4JVNA 1E9EA 2A78A 3VFDA 1NN3A 4E07A 2O8FA 3DKPA 3LRPA 4XVUA 1U0HC 4H1VA 2VPPA 2OCYC 1LB1B 2B7CA 3VR1A 3FKQA 1OPXA 1NVXQ 5A4JA 1G3IA 4XWAA 2B7BA 4M22A 3T1QA 3EA5A 4JYCA 2WHXA 4IVRA 3T1TA 4FW9A 3LD9A 4ABYA 3FMIA 2GDJA 2ZJOA 5TY0A 4BLOA 3RRZA 4ARZA 4IVQA 3B1YA 1ZD1A 4FMCB 2ONKA 1OV4A 2V1XA 5CM9C 1C9KA 3CH4B 4BWYA 1Q12A 3OZXA 2HYDA 4Q03A 2VQSA 3IBYA 4CZ2A 5DN6A 3UXMA 3PQCA 1XFAA 5D3QA 3B7GA 3REGA 3VQTA 2GBLC 2D62A 4M1KA 2AXNA 2NO1A 3MG9A 1S0UA 2FJUA 5G3YA 3WBJA 5CK5A 5KNBA 2BKEA 3AKCA 1YRAA 2RGBA 1OT3A 4I4LA 3VX3A 2CVHA 4ZIRA 3D8BA 1E2JA 1ZUHA 1GUAA 3LBIA 5LB4A 5CJPA 4FXPA 2ZYWX 4UNPA 2FPKA 3X1YA 1OYWA 3R9XA 1J2JA 2WWWA 5K8TA 4HB3A 4Q01A 1KI9A 4M9QA 4LYFA 1LVGA 3RANA 2BMFA 2R62A 3B1WA 2ZXUA 3VR6A 1XMSA 3B1VA 1SQ5A 4FCTA 4YXWD 1T9HA 4LYHA 4M0LA 3R7WA 4AD8A 3KJGA 1Z83A 1W5SA 2VTKA 4LJ9A 2JLQA 1T91A 1FP6A 2J0VA 3AB3A 4MQBA 4BZQA 4PSVA 4AKGA 4HAUA 2AFIE 4RZUA 4HZUA 4LJ8A 4QHYA 1DEKA 821PA 1KI4A 3PUYA 4BFSA 3K70C 1FZQA 2B8TA 3HYTA 4C2UA 4IFBA 1AJEA 4PPNA 5KNDA 3T5GA 3TGPA 5DYIA 4DDWA 2V3CC 2N1BA 3AP3A 4OK6A 5GVSA 1T3HA 4QHSA 2V1UA 4JSTA 1AZTA 2XZLA 4KHZA 3AF2A 2VEDA 3IIMA 3QUSA 4KVAA 2XAUA 4IW3B 1E2HA 1G8YA 4I1OA 4PZYA 2ATVA 1I4DD 3KTAA 4CEHB 3BK7A 2IS4A 4PQYA 5L3QA 3NBZC 1US8B 5G53C 4NCNA 3RS7A 4F4JA 1OH5A 3GLFE 3SHFA 1FMJA 2LKDA 4JSYA 1EFRA 2KWIA 1EXMA 5EQTA 3L43A 3R8CA 3SJAA 1OW3B 3CKLA 1RFLA 3M4YA 5GADl 3TJZA 1SZPA 2WPDA 1ETUA 5L3SB 1I4LD 1M34E 5KOYA 3UWOA 1UKYA 2WV9A 2BOVA 1JPJA 1P5ZB 4B3DA 3FHTA 1G16A 1PLKA 1ZW6A 4G0NA 4YLGA 4B48A 3SQXA 4WIAA 5EE3A 3UMSA 2RGNA 1P2VA 4YDHB 5IK2A 3EZFA 1Q22A 4JBXA 3AF0A 5J4VA 1QHGA 2DWPA 2ZJZA 3QXJA 4WAUA 4B47A 4ZI2A 4OJQA 4XSGA 1ZD9A 2B8WA 3KL4A 3KXKA 4M1SA 1COWD 4Q66C 1XPUA 2X19A 4Q21A 5LD2B 5CK4A 2JLYA 3TKLA 3A1WA 4OQMA 3W3ZB 2YINC 1E9RA 3HP1A 4MRRA 4TMWA 2IHYA 4Q19A 4NDZA 2EQBA 3UANA 1EGAA
chains in the Genus database with same CATH superfamily
2Y0CA 4LZAA 5CA0F 2O8DA 1A4UA 2G4VA 4UKDA 4YQFA 1IN6A 2BJWA 2XUZA 4KI7A 2XNJA 1E5TA 3B6KA 2PNJA 4PFJA 3CINA 1CUDA 1IHPA 2BFMA 4ZALA 3DAGA 5IAAA 3QZUA 3AVOA 2WWXA 4IV5A 3UH0A 3QF7A 4FBMA 4CLRB 4LC9A 3IILA 5HCUA 4RS4A 2VXOA 1XELA 2FFAA 1PDWA 1G21E 4Q3BA 4I9HA 5E6SB 3X2SA 3DC2A 1ILEA 3F5SA 3CZ4A 2I2FA 4FHGA 3NOQA 4WN9A 3WWPA 1PJ2A 1YB5A 2DKFA 2IZOA 4NYMR 2ZVDA 2H0AA 3FPAA 4QOIA 2I1LA 1GQOA 2WJ4A 4QBTA 4B81A 1UBFA 1YNOA 2WHPA 5HK9A 4NBUA 1N9KA 3KD2A 4O63O 1V5IA 4DG9A 1DBPA 1KJ9A 1R64A 2XSZD 1V8OA 1ADYA 2JAOA 4M9XA 1T6ZA 3F6YA 4XJXA 3RUEA 5E9QA 1U81A 1WPXA 3DTTA 5EXPA 4BV9A 2KLBA 1CR1A 4IIVA 1XVTA 3PNOA 4NK4A 4U3JB 4JXKA 2OCXA 1JXAA 1GZDA 3HL0A 2H31A 4GEGA 2QU8A 1W0KD 1HOXA 2YXNA 5JEEA 2I7CA 3TTVA 1ZPDA 1E4OA 4C7JA 1YRYE 4F3KA 1Y0BA 4X3CA 2FH5B 1NVBA 3R6DA 5HGJA 3G49A 4IWYA 1L5GB 4F4FA 1HUQA 4ZQFA 2WZCA 1CS0B 4NYMQ 3D1LA 4RPLA 2RHHA 4JLBA 5AHKA 1QC5B 3ADOA 1Q7GA 4YRNA 3X1DA 3D3JA 2QSYA 5TGZA 4CEJB 4JODA 4DM3A 3EIQA 3AOEA 2VBGA 2XB9A 5K6RA 3GGPA 5AOCA 1RXUA 1WS6A 4OBXA 4DC9A 2Z9CA 2YZMA 3UMYA 1FQKA 4F4DA 3F1LA 3AH8A 1RNLA 4W5NA 3MT8A 5GV7A 1QUEA 3CY6A 4NU0A 2YY7A 2YIDA 4KJXA 2QLJA 3I53A 3WI7A 1GT91 4YYEA 4DPMA 1F51E 4QDZA 1T9GS 1F6DA 1L5WA 3OCWA 5DYWA 1JDBC 4JFAA 2QR5A 1I7NA 2V8OA 5TPZA 3UNXA 2ZS9A 4CQNA 1YDFA 3ZX5A 4AIRA 1PWZA 3QE4A 3W7BA 3IUYA 1EESA 3NUGA 2GQ0A 3OIGA 3L49A 4A6XA 3PFWO 1L7PA 1XEWX 1E3EA 2OXIA 1Q6YA 4L5YA 2OVBA 4DLYA 4HS4A 2O2IA 1PJRA 4DSAA 3I62A 3F3MA 4MGYR 1RC8A 3F9IA 5T4FA 4B83A 4F7WA 3NTOA 1HT3A 4I1RA 2DQ4A 3B3AA 1RC0A 3ENWA 2Y2UA 2HJRA 5F4BA 5GPBA 5FNVA 1QH1A 2F8LA 4XB6B 2ZP1A 2YL2A 3VH4A 3FGPA 2IU4A 4CKBA 4D8YA 1BXKA 4M36A 2GXSA 4UJ3A 5CX1B 5JXWA 1Q0ZA 4R2LA 2GCEA 1TZ2A 2WOJA 3V4RA 3BF8A 2GFIA 2PZLA 3GRKA 3ZX4A 4DBVO 4F4UA 1YL5A 1YS4A 3PFCA 2IOYA 3AL2A 1DDGA 2ZYVX 2D5AA 1F20A 1Z4NA 2OSVA 2AOWA 4BVJA 5J4KA 3SQWA 1BO6A 4Q9LA 4ZQHA 1KYZA 3ZGOA 2ZSEA 1R5JA 4FWBA 1J06A 2HCJB 2W2LA 4URVR 1QCZA 4J3JA 5DSTA 3GC6A 4B4WA 4DDUA 4GX2A 4ZRNA 4ARBA 1E2BA 2QSJA 1GGKA 1MRSA 4L5AA 5DKFA 4BMDA 2WAYA 4A1FA 2ZE8A 3TQSA 4JYAB 3G1TA 4YAFA 5CMLA 1L1FA 5A5EA 2OHXA 4ALMA 6YASA 2ZYSA 2WKSA 1H6DA 5CG1A 4HJXA 3V8MA 1LI7A 4LNAA 4Y6QA 2AW3A 3CNLA 2O8CA 4RVGA 4ZT7A 3O4GA 4AUMA 1XIVA 5HSGA 2K4MA 2RGAA 3OM1A 4JN6B 4QXPA 5HEKA 2Q7DA 1GTMA 1QYWA 3EIEA 4BLQA 1NWCA 1K8RA 3PL5A 4MV6A 3K1AB 1YBHA 3VDNB 5LP6B 2CYBA 2J3QA 2X5XA 3AHDA 3L7DA 3DT6A 2BBOA 3PYMA 3JZIA 4KB5A 2ZPUA 1KXZA 2CV2A 1ZRHA 3OESA 5A71A 5KVCA 3GV0A 1ZC3A 2R47A 3MJFA 1PV1A 2X0NA 4FE3A 1X80B 4JQCA 4ARCA 1YZUA 3O8QA 3QU7A 1H8ED 2C77A 3DPUA 1N0HA 2E2WA 1AK1A 3VSCA 3SHOA 1M3SA 1GQRA 4GPAA 2KYRA 3DZHA 5HTOA 2IYXA 4JROA 1X14A 1C0IA 5BN5B 3Q1KA 5KQRA 3EQ6A 2G04A 1DP4A 4RAOA 5BQXA 3I9OA 2ODBA 1M2HA 2EKBA 3KFVA 4MP6A 2P11A 1QVZA 1K8QA 1VCIA 2PZGA 3FRHA 3OZ7A 4M9UA 5DGIA 5G40A 2ZUDA 1YB1A 3LRTA 2M98A 4C0LA 1ZNXA 2WVAA 4O4JA 2F43B 5L3ZA 3PHJA 2JA1A 2R1TB 1DAIA 3C48A 4OH1A 4TUYA 1ZOIA 3N6VA 4PBTA 1OLUB 1MO4A 3K15A 4H6VA 1TYZA 2DTEA 3S3TA 5LQCA 1H4TA 1P77A 3Q9NA 4CFYA 3EDMA 1P9NA 1MEEA 1U7PA 3EQ9A 1QYDA 3LYHA 1QQAA 3D2BA 1DOHA 4B0OA 1KY4A 3NTUA 1ZGBA 4ER5A 3BDVA 2RI0A 2OZLA 1U1DA 2WE8A 1S3SA 3K6RA 4LCJA 2X8AA 4PX2A 5LZ8A 3RSCA 2II6A 4S1PA 5JSQA 1GKLA 1M72A 1Q0LA 4POAA 1G5QA 1CJBA 1AXEA 3FPCA 1EVZA 3HU1A 1RMTA 3TNJA 4D0SA 1JI3A 4PINA 4PLPA 1H2ZA 2GK4A 1JEAA 2HNAA 2OM6A 2RARA 3LHKA 4G8BA 4L8VA 5AXDA 3RVRA 3TNDA 3VPDA 2OV1A 2BZSA 1T2VA 1AGXA 4PAWA 3TQFA 4YCDA 1X1BA 3AHCA 4N6OA 1TYBE 4NNOA 4RVDA 2E6KA 2JRCA 4WXRA 2J33A 3K0CA 4I1IA 2ZE7A 2PEZA 3TMKA 2B34A 1H6CA 2J4FA 4PLGA 5GVRA 4O2BF 1Y9JA 3LX6A 5JVDA 5AXBA 5ALKA 4DNOA 2OV3A 5CH3A 1N6LA 3WKCA 2QX4A 2IODA 4YAUA 2QENA 3ZK9A 3F8SA 4XFKA 3L8FA 3QE0A 1SG9A 4B4KA 4LEIA 4LY0A 1BD4A 4JUBA 1IL0A 2XZPA 4B73A 1H0RA 5LMCA 2JFOA 3EYWA 1JALA 3O8CA 2M2IA 1ZHOA 1CR6A 1EWYA 4XX0B 4ZYLA 4Y6PA 2ETXA 3T94A 2NV2B 3C1UA 3BKWA 3ENNA 2H51A 3G89A 1PKEA 3WWEA 3N70A 1PSWA 1U2EA 1W0JD 3GJZA 4KYIB 4LSWA 4OF4A 4Q6WA 3ZE6A 4WBNF 2XQVA 1ZD5A 4L7VA 1P9WA 1UWCA 4YAGA 2FPRA 3AY3A 1FYDA 4CEHA 1N5IA 2Y0DA 1NVTA 1YDWA 4JSRA 4ZEWA 3T3EA 1QTQA 2XKJE 4EGSA 1PJSA 4LCBA 1OWOA 3CVUA 2AOVA 4KQ9A 5A5VA 4HGZA 4OHZA 1EBBA 1SKBA 3ZJTA 4OLAA 4QUDA 2GTHA 4MV1A 3ZH9B 1RPJA 1AN0A 3JZMA 5IRCD 3FWPA 4KMMA 1ZISA 4R40A 3W5VA 3HZHA 4W5RA 1GSIA 1CRQA 2F7SA 1UF9A 5FRDA 4UCXA 3DWFA 4TL8A 4QODA 4M0PA 2HWWA 2Y9MB 3A10A 1YRLA 3A04A 3L7MA 4FHFA 4NZYA 5C7LO 1UXOA 2P9CA 3DUFB 3IMFA 3C41J 1M5TA 3UM9A 4F9TA 5KU1A 4ISBA 1XZPA 4CT0A 2QRLA 4WKGA 4P08A 4CIDA 1IAVA 4J4HA 1U1FA 1GTRA 3HKEA 4RELA 4V39A 1THZA 2H2AA 4MUJA 3W5BA 2J5XA 2APJA 3CIFA 4JT4A 3RC7A 1RYEA 4MUXA 5C8ZA 2VOJA 4KNVA 4GNRA 3UG6A 3A58B 3VZRA 1LVHA 1FUKA 4KNWA 3TDNA 3F8WA 4NE9A 3MWDA 3GAFA 3GDHA 1CUBA 1RW4A 3B8EA 2PT5A 3PGKA 4QDOA 5MGBA 1CV2A 2PLFA 2HMVA 4YJ2F 1JV2B 3JD0A 5GJBA 4FKBA 2OUKA 2QG6A 3HFJA 4FB5A 3ONEA 1DZ3A 3ZI0A 2HWXA 1YONA 4V0LA 3A6HA 1GNLA 2PGDA 4N54A 3DBLB 4B0PA 4E5SA 5EHXA 1WR8A 4IDFA 4AUNA 4HDSA 1K2VN 2J30A 3NIDB 3HVHA 5B7GA 4IINA 3PV0A 5EIHA 2AFIA 4KPYA 7REQB 4KO8A 2D4AA 2G82A 4PLVA 2J9FA 4XB1A 2FMXA 4YQEA 3UJDA 5DNDA 2ZQYA 1NN1A 5FUQA 1M7BA 2HSDA 3FPKA 3ROTA 2VJNA 4BOYA 4D2IA 1ENYA 5J2TB 1ULZA 1XD2B 3N0TA 3KKKA 1GL9B 3FPJA 5BT8A 5LNK1 2O14A 2ZBFA 3K0EA 5A05A 1YCFA 5EHQA 4LC1A 4M0UA 3A3KA 5DOVA 1SA0A 1JQKA 1VPLA 2BZGA 3QW4B 2PRKA 3RUFA 3TX2A 4E7OA 3EBOA 4E51A 5TMPA 5JJKA 3BL8A 1RE1A 2CDBA 5J2UB 4P4SA 4ZJUA 3QVMA 1E5QA 4BPRA 4NMLA 3ZG6A 4CG1A 3QP9A 2XCTB 3GGJA 1E1RD 1VG1A 4X93A 1AO0A 3B3JA 4RD1A 3AHIA 4QQNA 1XVVA 1DQSA 2CY0A 2GARA 3DYIA 2B0JA 3LIPA 4NCBA 1NPYA 3WK5A 4IUDS 3MS7A 3JATB 4KFUA 1LBHA 2FKAA 3HV0A 4GOMD 1ZNZA 1HORA 4MUFA 4X94A 3THSA 2JLVA 3O03A 2C94A 3AI1A 2ODTX 2JFZA 3T7DA 4EYOA 4FYKA 4OJKA 3IP9A 5HIKA 3I72A 1YA8A 1ZCBA 3V1UA 1ZH0A 4O4HA 5CB6A 4KBYA 3FNFA 4RV5A 3AL0C 3WRYA 5D01A 2ZI9A 1YXMA 1XZFA 2P4SA 4HMOA 3W06A 5FXMA 1B1AA 3DB2A 3F4LA 4WADA 4E33A 3P4YA 2BI8A 3RUPA 4AKSA 3AB7A 4EM6A 5EMKA 4YCSA 1FMCA 1NXWA 4HLUC 4DDHA 4B2IA 3URMA 2YOFA 5AH0A 5HOEA 1Y3FE 5CA0B 3EPJA 1ZRMA 1TGYA 4W9NC 4YCCA 4TYPA 4LFAB 1X9HA 2YY6A 4FFBB 1L5HB 4TLAA 3JZAA 4L4SA 1EBFA 4GXNA 1ISSA 1NMYA 4V1CB 2OPHA 2UYGA 1GFZA 2PRZA 2VHQA 4A16A 1KMCA 1V41E 3OVMA 5CJJA 1UAAA 3V8RA 3HBJA 1GNTA 4Q4DA 4LW8A 1L9XA 1YQWA 1SQ0A 2ZJ0A 1EM6A 5DX1A 1FFYA 2J7KA 3NAQA 5MN5A 4DKJA 3G0HA 4P93A 3H8VA 2G0AA 3VV3A 1DX9A 1CRWG 1U9IC 3CEPB 2GK7A 1U8TA 1VG8A 3F1KA 1QVAA 1WKVA 4ETMA 3KB8A 4W5JA 5AWFC 1GQQA 3EVEA 1G8HA 1JDTA 5DHUA 5SYNA 3T7SA 4YAOA 3W8FA 4DDVA 3ANSA 4Z9FA 4QG7A 5KTYA 4YCNA 1Z5NA 5L51A 2OBLA 3PGLA 5B2FA 4IFEA 1HEYA 1XRJA 3JWEA 3D3EA 4XDYA 3JPYA 3H05A 3IIEA 1SELA 4XJSA 5CH5A 5GONB 5HKAA 2QOEA 2AQKA 1N1DA 2DWOA 4GXTA 4YQZA 4NCXA 3EVGA 2OILA 5TF0A 4EF4A 1N2CE 2CKMA 2ZYUX 3GRVA 2BFNA 4CCYA 5KKCA 1TZKA 2HFKA 4RTNA 4JLMA 3H11A 3LQYA 4O4LA 5AK3A 1SVUA 3PXAA 1HLDA 4MUGA 1Q1QA 1RVV1 8MHTA 3T5TA 2W90A 4IH4A 3QA3E 3WLQA 3ELWA 4HGOA 1NQUA 4XD2A 2OGSA 2Y2VA 3KJXA 3IP3A 3MFYA 2XTZA 3PG5A 4PAMA 3E70C 2DCMA 3RIYA 3VKGA 1O96B 2BFCA 2FPPA 2WINI 3CONA 3E3LA 1YBAA 3FGZA 3LU1A 4KP7A 4XYMA 2FB9A 1DCFA 2LE0A 5KJCA 3VBCA 4Q1AA 1GGNA 3ZKAA 3CS3A 2W8BA 3WIOA 1SCIA 3ABOB 1DB3A 3BCRA 3VHQA 4V03A 3PTLA 5KDDA 1D07A 4YLYA 1QE0A 2I0FA 3AHGA 4JL8A 1HV8A 3RSOA 2NZJA 5DMHA 4EYEA 2ZAOA 3VTFA 3U62A 3IT3A 3OIUA 3RU3A 4AZ0A 4L28A 4F0JA 3BORA 4MYHA 3FSRA 1JA9A 4DLNA 1RZRA 5B1IA 3FFTA 3II6X 2BR3A 3JARA 3LSTA 1VPTA 2P3SA 3MMSA 4IO0A 4J0JA 1LV7A 1Y6GA 3EH1A 5JYEA 1PTJC 3FHJA 3CSSA 1AG9A 5MN6A 5BRNA 1J49A 1VHQA 3GZ4A 4KJZA 2Z3VA 3ROEA 4B6EA 2FPXA 3L4SO 1E60A 4GEKA 5DV9A 4P3NA 1VECA 3ABQB 4FGKA 2QDKA 4JOSA 4S24A 5IT5A 1NRWA 1X94A 4UULA 1T3TA 4CE6A 1QRAA 2IHZA 2Q5IA 1LU9A 1NN0A 3KS9A 5ENZA 1JLLB 3BTSA 4BNHA 3MWJA 4Q4JB 2CLOB 3QQPA 4OV6B 4J0HA 4LC0A 4DYVA 2NACA 4AY6A 4HY3A 5E9AA 1E8MA 5E9WA 3A0RB 4NYIR 2C88A 1YGPA 3PEWA 3ASZA 4ZYWA 4UUAA 4IZ6A 1KFEB 1ZUD1 1NHGA 2B21A 1EFAA 2PQ2A 3BXHA 2NO5A 4GQBA 4CLOA 4AF8A 5AJVB 2Q9CA 5AKLA 1W5BA 3RVKA 5BY2A 2V58A 3K05A 3T7JA 3OE1A 3Q6IA 1GZ5A 1Q1ZA 4HVLA 3QX3A 3BAZA 4INOA 2XB8A 3CHYA 4M3NA 5E3HA 3KOOA 1NFRA 2PMKA 2PT9A 1LC3A 4DNPA 3OFNA 1VA4A 3ET5A 1P18A 5CXXA 1XNRB 5F23A 1QKJA 1KEUA 1TQDA 2JANA 2RKBA 3N8HA 4L50A 3THWB 2PYIA 3P94A 1BHO1 3FNQA 4KMSA 1G4AE 3TKYA 3AKZA 4ARAA 4JXXA 3KPJA 3F5DA 5ALQA 1JIUA 2CWDA 3UJ3X 1XL0A 5AW7A 4UATA 3DO5A 3ZCTA 1EK0A 1EVLA 4LYGA 4PRKA 3VNAA 1P4JA 4E5DA 4NYIQ 4Z49A 3QNMA 3DTVB 5EIXA 4U9HS 3VYWA 1NASA 3QU9A 4XE5A 3Q85A 2XUDA 5HBRA 4EA9A 3KQNA 1FFEA 1VL0A 2Q0SA 2GPTA 1XDWA 2LR0A 4CL0A 1J0EA 2ORIA 4X1OA 4HEA6 4WV3A 2C4HA 1AC5A 2XHZA 3PQ6A 1BQ4A 1FDIA 3EJWA 1OKKD 4K46A 3GZTB 3RFFA 2IBTA 4QPDA 3GF4A 2I5PO 2JFQA 4BFYA 4F8YA 4OY3A 3A8TA 1N6PA 1K8YB 3DBHB 4N5HX 2CDRA 2RHRA 2GJKA 4GOND 5EJ2A 3ZBTA 1CF2O 1VZ3A 2PUHA 3WIEA 3EOAI 1EGHA 4EI2A 4Z1MD 3IO5A 3DXFA 1K27A 1W59A 3PKIA 2PAAA 3UHAA 3ZQJA 4BGEA 5A04A 4QBFA 4QSHA 1AU9A 2Q5QA 3RAFC 2XMGA 3CB4A 1Z5UA 4DCUA 5I6DA 2IPXA 2XIJA 3R5KA 1YJCA 1CWUA 2YV3A 1ST3A 2BFFA 4LJLA 1I9CA 4MQMA 4QUHA 4PE5B 2JH3A 2LD4A 2XT9A 3TSZA 4BJ5A 1CD5A 4DG8A 3K8QA 4DIUA 3NTLA 1RCFA 2I2AA 1OBCA 3NBQA 2IPAB 4K05A 4ML3A 3PC8C 4J0GA 5EJ5A 2NTEA 3HK2A 1E1DA 3C7TA 3QPVA 3RTGA 2DBRA 1W36B 3GT4A 1MVLA 3LHSA 3RF7A 2N1MA 4QL3A 2ABWA 2W6ID 1IN8A 2B4YA 3I2IA 3H5WA 1GSAA 4L9WA 1N2JA 5AVWA 3DGFC 3O8NA 4ZQCB 1EGQA 2B5VA 2V7EA 3QLUA 1NUQA 1B2RA 4GZ6A 1KZGB 3RKRA 2C00A 2XGGA 4XDGA 1WNFA 4ZVNA 3WE7A 2IYEA 3AWIA 5I47A 5CX4A 1P3JA 4QNNA 4JVSB 2X0JA 3KR0A 3SHQA 4HNUA 4JI7B 3QPWA 4H7HA 3KT8A 4G23A 5ALMA 1KEVA 4O2BB 5DM0A 1SQ6A 2PG3A 1ARZA 4PN7A 1E2MA 2PKQP 3IAEA 2G1AA 2OXTA 4CKCA 1E5XA 4XQ9A 5AJWA 5T7BA 1TAGA 1OAOA 2FNAA 1YUMA 2NZVG 2XA1A 3PNYA 1KKUA 4KIGA 3KZXA 1W85A 1MX5A 4KQCA 2HSEA 7ABPA 3AZOA 3UHPA 1J33A 4BP3A 1HQYE 2VPTA 3ECSA 4GPEA 5CVVA 3PUWA 1OFTA 2D1FA 2OHGA 3NM6B 4RFSA 3D6MA 4MYSA 3RUHA 5IVHA 4F21A 4X0EA 4DJAA 3MS2A 2WSMA 4CLEA 4WW0A 1YJ5A 1EVQA 4FDVA 1MQ9A 4M8SA 5BMOA 4D4MA 3IGFA 4Z3KA 5C35A 5WRFA 1R15A 3KUUA 3MFQA 4WBNB 1RTTA 2YOHA 1VBFA 2ACVA 2J5BA 2O0JA 3QEMB 4JLJA 4WOJA 5EJ4A 2C5SA 1Y1RA 3NTVA 3EXFA 3OIWA 1ORRA 4M55A 5BYBA 3JSXA 3JD4A 2QP4A 3E7XA 2WYIA 3HACA 4QRHA 1C1DA 1DEHA 1WPRA 1P5JA 3DAFA 5JFGA 1ADCA 3DPIA 1ZUWA 4IWXA 1EUDA 5KOHB 1LY1A 1YT5A 1KSFX 5BYKA 1E9BA 1GQ2A 5IBCA 1WQ1R 1ODCA 1GLGA 2HNBA 4HAYA 1OIXA 5KDOA 2JGKA 1E2EA 4GR9A 1ZNWA 4X91A 5F2EA 3ZWCA 3BK2A 3WMWA 3WBBA 4OI4A 3GFOA 1T5IA 2O2EA 2WVGA 1A5SB 3J81k 4YT2A 1U5BB 5C7YA 3HGTA 1PT5A 4JP8A 3WLMA 2YC4C 3MUEA 2ZXFA 3VUEA 2PGNA 3ZEIA 1WXIA 2C9BA 2JNWA 3EZ9A 1PJ3A 1B42A 5HTKA 2QI9F 5HFNA 5HF8A 1ZIPA 1NA5A 5KZMB 4YJHA 2DUWA 3SF0A 2WM9B 2ZRKA 2ZRAA 4L9RA 3ND7A 1KK2A 4W63A 4G25A 3O1HB 5DN6D 3GJRA 5J1TB 1VJ0A 5AMXA 4JI1B 4B3MB 1WDKA 1Q3KA 2WUDA 3FYSA 3MTGA 1H8EA 1YU6A 3EDYA 3IAUA 4HQLA 4YP7A 4B9AA 1LDMA 1TM7E 3SSOA 1S01A 2CEKA 4YJ2B 2WQZA 1D7AA 1QKKA 4PCAA 1W93A 1NT2A 3BTVA 4I0WB 3NPMA 2OM2A 3OJXA 3IURA 2F17A 3NGLA 3TL3A 1GOTA 1V3UA 4UXJA 5U4QA 5K20A 1GCIA 3F3YA 5EE9A 4GLJA 4KO1S 1KZ9A 3OQNA 1RQXA 3TRHA 4M7RA 4HP8A 4JQOA 3IEIA 4QGGA 1JDJA 2WRZA 4RJKA 2W00A 1NQWA 4RVNA 2Q2OA 4L27A 5DYYA 5IW8A 5IF9A 5EKXA 4B9EA 5HILA 2A67A 3S5JA 4HH3C 2GD6A 3RUCA 2CF6A 4GYWA 2J9XB 2L19A 3EZLA 3QUCA 2QRPA 1V1MA 2NYAA 1M1YA 2B8EA 4GECA 3WLEA 3CWZA 3FUWA 4IXWA 1JKJA 3T7AA 1T4CA 1BJKA 1RLOA 1UOOA 1ZU4A 2GLUA 2GZHA 3LHFA 2H9IA 2Y4NA 3G23A 3HDVA 1J07A 3M6IA 1FFSA 4G9GA 3EEBA 1JQ3A 3N76A 7AT1A 5HS4A 2PQ6A 1N2EA 2WMDA 3HE3A 3D2CA 3NRBA 3ZD9A 4C6TB 1NTOA 1OXXK 3IP6A 5HF6A 4J3FA 2QPLA 1XZHA 1MEJA 2RHTA 1WB4A 5ER6A 3GEDA 3M9LA 2ZPAA 4DC0A 4AFNA 3NIWA 3HO1A 3AVWA 2VRBA 3MGKA 2ZEJA 4L8LA 4Q5IA 4B46A 2WTNA 2IP4A 2NZWA 4GI5A 4WLNA 3CPSA 3LOUA 2BHSA 5EEHA 2BFEB 1BOOA 4RFLA 1PFKA 1PD0A 5CB4F 2RKWA 1GV1A 5DNCA 2I7DA 4TTSA 1C3EA 2PSEA 1B1CA 5AHWA 4YP5A 1GZ6A 5HVNA 4OXNA 3ZQUA 3VO9A 2FX5A 2OCLA 3LRXA 2PGIA 1L7QA 3WQQA 4B6FA 1HDEA 1WMAA 4W82A 5FV7A 2CYCA 2K7ZA 1G5PA 3JQGA 4PO9A 4AECA 4D9HA 4ENPA 4RIHA 1KYTA 4MUAA 1F4VA 3CRW1 3USES 3ZTWA 5FO1A 2MSLA 3ACDA 4KLNA 4EH1A 4ZMRA 1TEZA 1N9ZA 3IT2A 3M2TA 2TRSB 1R6UA 3HDJA 1JNYA 3WYBA 1EH5A 3SR3A 4RYLA 2HRRA 3RAEC 1BCSB 1IXRC 2VHWA 1ZN9A 1SXIA 2RAPA 2V59A 3FSGD 5IK2D 1AB6A 3NM4A 3TR5A 3JR3A 1BWQA 3CEJA 3E48A 4HNHA 5HPYB 1ZN7A 4S2UA 1GVHA 4E2YA 2MSKA 3D8SA 3ADPA 1ZVKA 2PVCA 3H4IA 3IAAA 4ZC8A 4BGUA 4KN8A 1ZW1A 5CBKA 3TUZC 4TKUB 4KLAA 4GNKA 1TW3A 5AJUA 1QS0B 1XCPA 2G40A 1LJUA 4G26A 4UXIA 3OHSX 4I4NA 3Q4GA 1VL2A 1O5TA 4C2BA 3RM3A 4ETIA 4N0QA 2PAFA 3OQOA 4JK3A 4N47A 1YUNA 4G1BA 4JWKA 4MUKA 2FDRA 1WDTA 1MH9A 1EUYA 4I4CA 3N0VA 1BHSA 2IDKA 3PNPA 1E7YA 2CHFA 4IGEA 3C7AA 1O6GA 4UJ5A 1E6MA 3R2JA 1N9GA 3PSHA 4GLFA 4R1LA 5IMBA 4B3JA 1U3FA 3CUSA 5DIZA 4FGSA 4RQUA 2A7QA 3NHLA 2VP2A 4UZSA 5GIPE 4QJ3A 4N7MA 1YQUA 1XKLA 2ZJBA 3KOYA 5ADUS 3KQTA 4DNQA 5LP1A 3EB9A 3ILVA 4IQGA 4Y6RA 1E0AA 1YTLA 1SIWA 3EN0A 2OG2A 4RUKA 2HRDA 3FTQA 4WFIA 3UV3A 3GD7A 5B6IA 3FG9A 3WGHA 1UXJA 4N39A 1HFJA 2Q5FA 4OJNA 1SBZA 5DM70 1E7SA 4KW7A 2IV7A 4QYWA 2GD1O 2N42A 2WP0A 3UHJA 1CEXA 2O1EA 3FE2A 1DEOA 3LFHA 1T2AA 4KFRA 5TF4A 3RADC 1SD2A 1YD7A 2O50A 3Q6MA 3S70A 2P90A 2XADA 4CF4A 1R4MA 1C80A 4KFSA 5AIBA 5JAHA 1RRKA 4CG0A 3QSYA 1QYIA 3DOHA 3R3YA 3NDJA 2RK3A 1DMRA 3TLGB 3OFSA 4FHCA 3LH5A 2X23A 3RVPA 3ZCPA 5GZ3A 4TLMB 2Y6UA 1YE8A 2XOXA 1RIFA 4TKVA 3AINA 1WXHA 5GAJA 1GNQA 3A4LA 3E9MA 4M2LA 3DL0A 5B64A 4JI4B 2K87A 4OAQA 2F3PA 2PH5A 3DOCA 1QWSA 1XN1A 2OORA 2ZIUB 1QHNA 3I6ZA 1CVIA 4ND4A 2WZBA 2R8EA 1KDPA 3DOOA 2IH4A 1DWPA 4PHCA 4EBBA 1XZEA 4BU1A 4QFBA 3F6EX 1SAYA 1Y3CE 2HPAA 1IBSA 3LWNA 1Z5VA 1HO3A 4EJSC 1POWA 1K06A 2N46A 1RP1A 2VL7A 3JAWA 3QGMA 3RRBA 5D7BA 4DIKA 3ZE9A 5E6RA 4R41A 4FR0A 4N7RA 3UWPA 3ED1A 2IH2A 4LDZA 5JAQA 3VOTA 1PGOA 1CY0A 5IWCA 1A9ZA 1VYUA 3DZDA 3L9WA 3O7WA 5IMSA 4EB3A 4UTZA 2GCIA 3LK6A 3DHVA 3FLBA 2JRLA 1JQEA 3IE0A 3MRTA 4C7KA 1CDOA 2W9XA 1TVKA 4MDEA 5TQ2A 2W6QA 3B78A 4YMTA 2AQHA 4PNPA 7MHTA 1EK1A 4PXAA 2BCJQ 4DARA 3VAAA 5CLIA 4RLHA 4KXMA 1SBHA 4XWGA 4AG6A 1PZFA 5DCWA 3HWSA 4RV9A 3FBTA 5I4IA 4BECA 1L5QA 5KB3A 1ZITA 1G20B 1EZ1A 2R97A 3NAMA 1RQGA 2VNHA 4OAOA 4UBIA 4DVGA 4EHLA 2JLZA 1S8NA 4A3SA 1Z2NX 2JCYA 2RC6A 5CVCA 1SB9A 2BHTA 2H2DA 1GGEA 1RKXA 1WP4A 3EXHC 4CMEA 1RSZA 1P33A 5IU6A 3R6TA 2P9FA 4JVMA 4BFZA 1Y1PA 4MVJG 5E0OA 4CQMD 5HRCA 1L7RA 1Z28A 1ID8A 4JR0A 1NF9A 3OIFA 1R9MA 2Z8YA 3JQPA 5AVJA 5DHFA 1O6BA 3C4QA 2QTRA 3ZGNA 3SF8B 5JNTA 1ECPA 1DT5A 3QWIA 2PUAA 4IDCA 1X13A 2PX2A 3EWNA 3NCTA 4I81A 2X0RA 4EKIA 2VT2A 2R8OA 3VU3A 4NK5A 4LRWA 5K3AA 1DSSG 2EV9A 1T3SA 4M8KA 1L4UA 1UBEA 3ADKA 3HVRA 3SZOA 2XI4A 4B3XA 1GYRA 3ILYA 5J47A 1QIMA 2C3MA 2PM8A 1UBCA 3AJAA 3LC7O 3OZIA 2OFWA 3T7CA 1V5GA 2E4AA 4NR0A 1V16B 1P0IA 3G6KA 1MO6A 1R8YA 2V5AA 3LC2O 4UAJA 3LL4A 1NXQA 2PN1A 3A36A 2XR1A 4GW3A 2UZ0A 4DYDA 1JR6A 4KEAA 3ZWYA 1HDOA 1FLVA 3IAHA 1U1CA 1X8XA 3OT5A 3OA2A 4EGCB 4Z99A 1BKSB 2DHRA 4K6HA 1TVMA 2ZI4A 3C0KA 4NOKA 2GAOA 2PGOA 1Y4DE 3SZ3A 1S02A 3DBOB 5AQEA 4M8IA 2OP0A 1YU9A 3EF0A 3QH4A 5I7OA 1GL3A 2JLRA 4HAOA 1TLLA 5CR9A 4PO1A 1T8SA 3KM0A 4RHYA 1E4EB 1ZM3A 2YWRA 1YL7A 3NT4A 4NEQA 3R5SA 4EKYA 1W2HA 3ROPA 1P62B 3AQ4A 3SHFA 3CLTD 3ENKA 1V4NA 3T4EA 3IAXA 3GUUA 3W9YA 1R88A 2Q6LA 5SICE 2YFHA 3LVFO 5BNIA 3I9FA 2I6FA 2VXCA 3ZJYA 4Y9RA 2IUUA 2IOHA 1KIAA 2EP5A 2CXHA 1NULA 1ORHA 2DKOA 2OCKA 3A1UA 4H35A 4F5WA 1I7DA 3GZNA 3FPEA 1P4AA 5CPFA 2FFRA 4BRUA 3RYCB 1W8DA 1JLRA 2ZSDA 3BL6A 1M33A 1XVAA 2Y0PA 3PC6A 2XDWA 5EC8A 3SFVA 2DJIA 1TDJA 3C5EA 4HMQA 3SJCA 4EHNA 2YV2A 5FOUA 4HDCA 3DD1A 3S99A 1Y8ZA 4BXOB 1WXFA 1FTQA 2FPMA 2Y0BA 2WD7B 1GZSA 3L0CA 4JBWA 2J3MA 1D2MA 1C5KA 4F9EA 3ISVA 4MNTA 4PCUA 4LFBB 2D3TA 1Y3BE 3E58A 2QP9X 3G82C 3PD1A 3C3BA 3TLMA 5K6TA 4UEKA 3W90A 4MV7A 4TX1A 2I4RA 2IDZA 3B89A 5DXFA 5K5EA 2QVCA 1M34A 3FDXA 4XXHA 3SN6A 3UT5B 3FVRA 2Z1MA 2I54A 2ZM6B 1H94A 4DV0B 5L9AA 3E8SA 2JC3A 3GUVA 1DL5A 1GG5A 2CFTA 2G1KA 2YN4A 4LBWA 4LBZA 3LQFA 5DM4A 4LVOA 2G17A 4YRAA 5LD2C 3N75A 4MMYB 1X7XB 3IPAA 4ZV9A 4DR4B 4L95C 3RHSA 3GJ3A 2Z43A 2FWMX 3LC0A 2HIMA 3BE8A 3TUIC 3VHLB 3ZWWA 1JH8A 2ZFUA 4BO0A 1AHHA 4I5EA 1C7JA 1WV0A 3F47A 2QUHA 3ZGZA 1DNPA 2WHYA 4KTTE 4KPFC 5BWLA 2B2XA 3LUAA 1YC2A 2JGJA 1KE2A 3D81A 3TYXA 5TXGA 1C9EA 2VAXA 3LS2A 4KTVE 3UICA 4G4SP 3TOCA 4UDNA 3UAOA 4FYYA 4LXUA 5DM60 1ZKMA 5F7XA 2GVDC 2ANBA 3QFSA 3KPVA 5I7EA 1ZD3A 3TH5A 4MYRA 4EG6A 4U2KA 5KQGA 3CNEA 1WCXA 1XCMA 3E5HA 1CHDA 1QIGA 2WAXA 2J0UA 1GGJA 4CETA 3EMDA 1G41A 1K92A 3NALA 2DWUA 4X8OA 5C7OO 4U00A 3RYIA 3V4OA 5LCXA 5C80A 3VKUA 4ZAFA 3HBMA 3ACBA 1UM8A 2ZBPA 2DETA 2WJWA 3VJLA 1LDBA 3UGJA 4LZJA 2R9VA 4L4UA 3RJ9A 3FWZA 3H2KA 4EHBA 4L85A 4Q4AA 4EQ6B 3GJ4A 1KI6B 3GNLA 3B9PA 3DHWC 1WF3A 3E82A 1OKKA 3EQ8A 3D4NA 1PUXA 2V54A 4MI6A 3KOWA 3ZHOA 4JJAA 1L7EA 4HBZA 4BFUA 2EYUA 3WKAA 1J8FA 1UJNA 2C3YA 4IDEA 4M9RA 5AI4A 2HR1A 1Z3CA 1XRLA 3EGCA 4H1TA 4HT3B 3ESZA 3I01M 2GYVA 2R6HA 3BWDD 1XXHA 2YUIA 1VKZA 5EUBA 4GM0A 3E3MA 1S9DA 4F2HA 1VDZA 4Z1MA 2X1MA 1KNXA 3SQOA 4Y8VA 3AV0B 3OJCA 3SXPA 4CKEA 5L8VA 5CAEA 2XRFA 3O83A 5AVSA 4UEWA 3HZOA 3HPRA 3C3EA 1RI1A 5HS6A 4O2AA 4RD6A 5FB3A 5B2EA 1VPWA 4X1YB 4JMPA 3G79A 3IV6A 1R10A 3D59A 1R0BA 2GUWA 3TINA 1IHUA 2RIPA 3UJ8A 4PY2A 1VXRA 4MW4A 4OLHA 1IBLB 3VJRA 1LW7A 5KVAA 4FCCA 1WSDA 3K9BA 4QYIB 4BHTA 5BRAA 3F73A 5T67A 2IHNA 1TAQA 4DQXA 2KSQA 1E3JA 1N77A 3D6JA 2ZT7A 3DE3X 4AVYA 2RAFA 2ZRPA 1U2GC 2W6IA 1FU7A 1X1TA 1WMEA 2DHDA 3PA8A 3QFHA 2HM7A 1H2FA 2ESRA 4GVXA 3SKXA 3P2KA 1KP3A 2O7NA 1SVKA 4GFDA 2MYUA 3OQIA 1L4BA 1Z5OA 4UTPA 9LDTA 2I3ZA 2G9ZA 5FWXB 1DG3A 2AF3C 3VDXA 1OUMA 1WHSB 4L73A 2VNSA 3UCFA 3WRXC 3WLTA 5CB4B 1X7DA 2X86A 3FW1A 3D31A 3U39A 2A0UA 4I5DA 5HQ3A 2FYTA 4MVCA 4UQLA 2ZIGA 1KO1A 1XC7A 1IEQA 2Q0XA 4CQJA 5LLSA 2JIQA 2V7WA 1RQNA 2GBLA 3LBFA 5JTTA 3AF1A 1S3GA 2ZBUA 3U56A 2NUAA 4PC2A 4QX6A 4HS9A 1QHHB 3L7JA 3OMWA 5LU8A 1FRZA 3TVYA 1LDGA 3JVDA 5JS7A 1BDJA 3EXG1 3F6SA 5AOVA 1O9HA 2JHCA 4R0NA 5HNKA 2J59A 4MLCA 1EG2A 4RVUA 4DILA 4G0PA 3U4QA 3LYUA 3M0EA 3WRWA 4N65A 3VHRA 2IEZA 1XTQA