3H0KA

Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
177
structure length
171
Chain Sequence
KVILITGMPGSGKSEFAKLLKERGAKVIVMSDVVRKRYSIEAGERLMDFAKRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLSKEISELIRRDREELKLGIGEVIAMADYIITNDSNYEEFKRRCEEVTDRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0200 protein SSO1041
publication title Crystal structure of an adenylated kinase related protein from sulfolobus solfataricus to 3.25a
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics, unknown function
total genus 54
structure length 171
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h0kA00
2CL6X 3W6PA 3ZD7A 4Z51A 4JVLA 3QSYA 5B57C 2EFDB 2NPFA 1M7BA 4TN1A 1JEEA 3RS4A 5F9FA 1KHTA 4LJ5A 3QXHA 2WWHA 4F92B 1A7JA 4U7DA 1NF3A 2RH5A 3QBVA 4DLXA 2QMUA 1XTSA 1ETUA 4ZKEA 1BIFA 3SJAA 5JJIA 1VIYA 4GZLA 1XJCA 1JAHA 1Q3HA 1S9DA 4BFYA 5IK2D 5KO2A 2OE2A 4HDCA 1E4YA 1W48A 4URVR 4ZPXA 5KNCA 2V4ZA 2QEQA 2QSZA 3KQUA 3T1TA 1E99A 3F5FA 3QUSA 2BBTA 2QY9A 4TYWA 2CHVA 2FSHA 3UATA 4IEEA 2P5SA 2WMNB 4PANA 4JLKA 1L4UA 5FUXA 2VHTA 3OFND 1CRQA 2BEJA 4Q1CA 3QPUA 4HZUA 3PUYA 3I1FA 4OJKA 4PPFA 3RSOA 5FBWB 5FBLB 2W0SA 3L0OA 1W0JA 1D2MA 2ZTSA 3SQXA 5KSPA 2BVNA 2NZJA 1ZM2A 4PHTA 2ZSBA 1OB5A 3N2IA 5EE3A 2WICA 3CZQA 3BH7A 2R65A 4M9SA 4BECA 4H1UA 4LHXA 1UEIA 3W9YA 3KQLA 5FTJA 3TKLA 4XOIA 3I92A 1NVVQ 3CNLA 2DB3A 4FMBB 4MGKR 4A9AA 5AK0A 5FL7D 1GKIA 2YWHA 2X2FA 2R44A 3L8YA 4XVRA 3GJ6A 1NKTA 4Z1MA 3IO3A 4OI4A 4YMWA 4TL9A 2C2HA 4LZZA 3ONWA 2FJUA 1E6CA 2F43A 3I73A 3B1WA 4JKIA 1ZM4A 4KU4A 1H8HD 5CDFA 5FOUA 3CIOA 4TYPA 4TYNA 2A3RA 1N6NA 2QROA 3RAPR 3DOFA 1W36D 3EZFA 2J7PD 1UKEA 4IOLA 2QAJA 4BFSA 2H16A 4DLSA 5FBRB 3QEJA 2WSSA 5B2ZA 1QHGA 2V54A 1DAKA 1P72A 4HLQB 5FTNA 4D4KA 3MUFA 4IVRA 1G6OA 1T9HA 4CZ2A 1KI3A 5FL3A 4ZI3A 2YC2C 3OEEA 1HA3A 1KKLA 4AIIA 4KFTA 4GOXA 2V6JA 4DWJA 4R9UC 2BBSA 2CK3D 4JIMA 2WIAA 3FMPB 4C3ZA 3CX8A 4NP6A 1HE8B 1YZKA 3ZD6A 5DYGA 4DCSA 4MUAA 1DARA 3ZLJA 4DSNA 1X1SA 1YZQA 1QHSA 2P65A 2BKEA 4QG7A 3GLIB 4B2IA 5JWHA 5FTMA 4WVFA 4IRUB 1JQJC 1N5IA 1ZRHA 2IW3A 4BFWA 2X19A 4A0HA 3MWLA 1YR9A 4L16A 2P6NA 2F55A 4BZQA 2NGRA 4YDSA 2VIIA 1VHLA 2XZPA 3G82C 4KI0A 3UWOA 2V1XA 4LHZA 2XOKA 4YMTA 3HPQA 1AQYA 3GLHA 2CE7A 4E03A 3K9NA 5JI3E 1G7CA 3R7WA 2BM1A 5JRJA 4PX9A 1GIAA 1G3IA 2GBLA 2JATA 1FMJA 2E1RA 2AD5A 4DEXA 2VLIA 4OHZA 1P4SA 1C1YA 5FI1B 3W34A 2XXAB 3A37A 1YQTA 4FMDF 3PEYA 1EFHA 3KFVA 2JIZA 4EPVA 3TVDA 1E2NA 1T6NA 2KBFA 1UKVY 5FH9A 5EE5B 4BASA 1E2JA 2QGNA 3CR7A 3HJNA 1W47A 3K9LA 3LA6A 5J40A 3L43A 4A2WA 2Q6TA 3TQCA 2GJ8A 2C78A 3LXXA 2AXNA 3QKRB 3BIFA 3QF7A 3X1ZA 4NYMQ 4EAQA 4KVAA 3SE0A 4RKEA 5BN3A 2GXSA 2W00A 2W6JD 3NBXX 4JL8A 2ZI4A 2FG5A 3OESA 4ESHA 2PX3A 4BLPA 1Q1QA 3NH9A 2JJ1A 2FH5B 1ZCAA 2QU8A 4QFMA 2FPKA 4HLCA 2CVFA 2QAGA 1KJWA 3O8CA 3BOSA 3NEJA 3ZIAA 2IS1A 4BLRA 1M34E 2RKOA 3WP0A 1T8TA 4NMMA 3UK6A 4NE2A 1TQ6A 4Q1BA 5AJVB 1ZIPA 1ZM9A 2OLJA 1KSGA 1TNDA 2B92A 4FMCF 4ZCLA 3U44A 3OE7A 1BH2A 1Q22A 3G0HA 3BB3A 4URUR 1OV4A 3U7FB 4HAYA 4ESVA 4C30A 5F9HA 5IHPA 4MKFA 3IIJA 4C0SA 3SS8A 2VHUA 3VHLB 2CCGA 2PJZA 1Z22A 5KHOC 1Q12A 4TL7A 1F6BA 1Z0JA 2N46A 2OBLA 1WCV1 3M1IA 3PUZA 4IDPA 4M1MA 3X1YA 1SVWA 3HU1A 1KDOA 2OCAA 2CJWB 2O0KA 4L9WA 1JI0A 4D2IA 5KOYA 1G5PA 3GQBA 1GDDA 1XZQA 2IYXA 2P5TB 2R6DA 2BIFA 4M22A 4Q4LA 1UPTA 1NLYA 4DDUA 5J4KA 2DR3A 4V0OA 4BFUA 3NKVA 1G8FA 5KTYA 2JLZA 4TQ9A 2GK7A 1VYVA 4GT1A 4KHZA 5CLLA 3B7GA 2Z0MA 4ACBA 4DSOA 1OLOA 4NBSA 1W4AA 2NO9A 4NYMR 2FMXA 1KI2A 3PUVA 4EPXA 1ZVQA 4P4TA 1G4AE 1G64A 5J47A 1RC8A 1JB1A 2ZI5A 3EPKA 3WBKA 3SYKA 4ITRC 1W46A 3I5XA 2VP9A 3O8RA 1P75A 5HZKA 3OIUA 3C5CA 5TXGA 1H8ED 3MAAC 1MO6A 3HP1A 5FUYA 1AS3A 1NLZA 3EZ9A 4DCTA 4NKRA 1N6OA 4LY6A 2H7VA 1IN4A 1OE0A 2RCNA 5K8TA 1GL9B 4XSGA 5B58C 4FD2A 4UNQA 2CHGA 1KNQA 1E94E 2ZRAA 4LYJA 5L3VA 4CYMA 5ELXA 1II0A 3CB4A 5BYKA 3I3SR 2NQ2C 1CR2A 2R6CA 4Q4AB 1G7RA 3U3KA 4HLDA 1KDTA 2HCBA 1S9HA 4PO8A 5M04A 1Z28A 1V5WA 2G83A 2FX3A 1E1QA 4JSYA 1OT3A 4GDFA 1G41A 2EW1A 3IBYA 2FGJA 1GM5A 3A1TA 1Z6YA 1MRSA 4AURA 5K8UA 3T15A 4GZMA 4PO9A 1XFAA 4AY2A 1KIMA 4D0GA 4OL0A 5GJCA 2IS4A 5FBVB 1G17A 1TEVA 2GBLC 4ACAA 3ZJYA 2ZYWX 2XITA 1NIPA 2FZ4A 4LCBA 2B7BA 2WWFA 3H1TA 3GFTA 4C7OB 1NVXQ 1YRBA 1DAGA 1XX6A 1EFUA 1VCMA 1W5SA 2IL1A 4YXWA 1IY2A 1XJ0A 4TTRA 1DG3A 2F9LA 4LSGA 1GNQA 1VYUA 1AZTA 1KY3A 5HKKD 1E9FA 3MRSA 2W6IA 1GRRA 4EIWA 4B73A 1R5NA 1XD2B 2WJVA 5JMTA 1NY6A 2G0TA 1N3BA 2QPAA 621PA 2EYQA 1JR3A 3WNBA 4BFXA 3OEHA 1QHNA 2RGAA 5EJEA 5JS7A 1L7VC 4OK5A 4P32A 4HYYA 4MRRA 1N0WA 4DLTA 1XXHB 3RNLA 3QPWA 1KO1A 2N1BA 4FCTA 2GRJA 4FCWA 4BRUA 4I1UA 2WPDA 4HZIA 4M1YA 4QRHA 5AUPB 4WA7A 1W2HA 4JYBA 2QAGC 3THWB 3RWMB 1QG4A 1MO4A 2DWQA 4TMWA 4XD7D 4L9SA 4JT4A 2VP2A 3SBDA 4MYCA 3CNNA 4YMUA 3GLGA 2ZE5A 4TMVA 3DL0A 3OAAA 4ZDKA 5BQ5A 3QBTA 1P7CA 2A2ZA 1ZM3A 1BYUA 3CONA 4LDJA 3B1YA 1FTNA 1T3LA 2ZE6A 3PVSA 3UKDA 2GA8A 4GP6A 1SXJB 4OI1A 2XTMA 4M1SA 1G3RA 3SJCA 3VAAA 3BJIC 1XPOA 2Q3MA 1P9WA 2QZ4A 1IXSB 3ADKA 1D2NA 1E9RA 3HR8A 3SR0A 1JAIA 2J41A 4D6PA 2QN6A 4UNPA 1NSTA 1X8KA 4EJSB 2GEDA 3CF2A 1W4CA 2J3EA 4YC7A 4Q5IA 2ZVPX 4F91B 1HQCA 1AKEA 1ZD8A 1DELA 1WBBA 1DO2A 4DSUA 4TL8A 2WJGA 1CR4A 2EYUA 5EUQB 2Q21A 5HZHA 1E96A 1E0KA 1M74A 4KYIB 1GSIA 5D3QA 1ZUHA 2ZXUA 4A6XA 1ZUNB 3EASA 1XP8A 3FMIA 4G1UC 3GJ8A 2XZLA 3AEZA 1KMQA 2VO1A 1VPLA 1N6RA 2XNDD 3LV8A 1ZC3A 1GILA 2ZIAA 3PUXA 5EUMA 2VF7A 5DSZA 4FWIB 3L2OB 1M6NA 3TUZC 1WMSA 4D80A 5DN6D 2QRNA 5H70A 4BZPA 1QVRA 1XZPA 2IYSA 3LRPA 4DDVA 4MDFA 4MYUA 5EXSA 3QJYA 2XJ9A 3THOA 2LKDA 1YZNA 4B3FX 1XMVA 1KMHB 2QBYB 1RRGA 4RD1A 3JZMA 1G5RA 1E3MA 1A5TA 1XB2A 3JVVA 1N2CE 3ECCA 3BWDD 5JEEA 2J59A 4V0NA 3FOZA 4JLJA 1OW3B 1XF9A 2FN4A 5CDFE 3K0FB 3LAWA 3RABA 4YMSA 1Z63A 1FNMA 5ANRB 3EG5A 4NDZA 4A0GA 1E1RA 1NJGA 3C4JA 4YDHB 1RVDA 2AX4A 2WSMA 2JJ2A 2ORIA 4D81A 4A6PA 4PSKA 3U6KA 2WJHA 3HPRA 4Q9KA 1YE8A 4JBXA 4P4UA 2I3BA 5JWOA 1XPUA 1RE0A 1S96A 5LD2B 2ONJA 1GP2A 5F3WB 3WBJA 2GWHA 2ZR0A 2XNSA 1J8YF 3QNUA 2P67A 1KO4A 5A4JA 4OJQA 2CEAA 1F3OA 1UAAA 2D74A 5TV2A 4QM7A 2NTYC 4MKHA 2WWWA 1E2LA 3K0CC 1SVIA 1UBFA 2C77A 3KXIA 2BMJA 1IOZA 4KSCA 1FP6A 3LWNA 1W49A 3QXCA 4MYHA 3TQFA 2R6FA 2ZI3A 2J0SA 2Z5FA 3E70C 4R98A 2GK6A 3EARA 3GLIA 1CRPA 1I4LD 2ZRJA 1ZW6A 1W0JD 2HV8A 3W6NA 1RFLA 3A36A 2UZIR 3MCAA 2O8DB 2GXUA 2QP3A 3IIKA 2ZEJA 3B6EA 3NC1C 2A5FA 2PBRA 2ZYVX 3U7EB 5AUNB 5JCZA 4G5SA 4NCHA 4EPTA 3ADBA 1ZC4A 3IGFA 4DVGA 4JLVA 2D2EA 3X1WA 4M1TA 2C03A 2IK8A 2V7QA 4LHVA 3BK7A 4KBGA 1Z6TA 2WMOB 4RD3A 4WZAE 4QM6A 3DDCA 4QJ5A 1N6HA 3PCRB 2ERXA 4C9BA 3C15C 4XIGS 4Q48A 3AVYA 3N2EA 4Z1MD 2D2FA 3W3ZB 1E2KA 1JBKA 3H86A 4WXPA 2IYUA 4B75A 2C5LA 3U3RA 1A2KC 4EFLA 4UNNA 4ON9A 1P73A 3AF3A 2OXRA 1YRAA 2OAP1 3I5YA 2D7DA 2HJGA 3IEUA 2Q3FA 1CJUC 3AP1A 3L0SA 4IVPA 2A5DA 1XTQA 3ADDA 3SFVA 1Z0AA 4AK9A 1WRBA 5FOVA 3LLUA 1ZU5A 3QKRA 2QTFA 2JCSA 3X2SA 1DAIA 4GBMA 1Z47A 3GMTA 3LDAA 3OEED 5JSZB 4QHSA 4W5HA 3QXSA 3ICEA 2YOGA 2FZLA 4JLAA 4UKDA 4DUGA 2GCNA 1RRCA 4RCZA 3PITA 4LI0A 2GILA 1UJ2A 3CBQA 1HH4A 3UPUA 1ZD9A 2C9YA 1IONA 1CXZA 2FFHA 4OQMA 3ZH9B 3RYTC 3T06B 2V1UA 1US8B 4QBIA 4LBVA 4HSEA 4I1VA 1GL7A 2ZRBA 2VEDA 3HYRA 2HJVA 1RKBA 4QBHA 1KZGB 2WVJA 4MA4A 2ZRMA 2NO0A 1NKSA 2FFAA 4URWR 4RD2A 1Z6AA 1R4AA 2IXEA 3V4FA 1FP7A 1VG9B 2VSFA 3CRRA 2R9VA 3AVWA 1YZUA 5H68A 3W5JA 4PTLA 4JBWA 4DLVA 3T5GA 2GJKA 1U90A 2WZQA 3U3OA 3TVTA 3AVPA 3WXMA 2JDID 2DWPA 1VYTA 5CIWA 1JEDA 2CJWA 1GL6A 1MR3F 4Q1FA 4IKEA 4PC7A 4GRAA 2V8OA 5HE8A 4N1AA 1U8AA 5A5GA 1EWQA 4LBWA 2PMDA 3NEYA 3CZPA 4M2LA 1E2DA 2JIZD 3CLVA 1WP9A 4G0NA 3NBYC 4MRNA 4G5GA 4LC1A 1NN0A 1CR1A 4I1SA 1R10A 3W8NA 3KQKA 1XEFA 3A8TA 2QNRA 2YNMA 3D7MA 1KJZA 1Z0DA 4MRPA 4IOJA 1R2QA 2YKGA 5CK5A 1W4RA 3CH5A 2QT1A 1W44A 1UDXA 5KDLA 3E1SA 3LXRA 5FI0B 5JHGB 2QE7A 5K8LA 1JJ7A 6Q21A 4US0R 4BFVA 5FOSA 4PAMA 4WAUA 1YR8A 3CO5A 1IQPA 2W58A 3KKOA 2ZANA 3ETLA 4KITB 4LBYA 1EX7A 5LPNA 2H5EA 1RJ9B 2I1QA 1A4RA 3ZIAD 3ZS9A 2WKQA 1H65A 5G53C 3T34A 4K81B 4A15A 1VTKA 2R8RA 3LLMA 1TQ2A 2ZAMA 3DPUA 2IWHA 3FTQA 5CK4A 1D5CA 4LYHA 3GLGB 1YZLA 2IUTA 4R7ZA 3ZZTA 3OE7D 3NDBB 3AVQA 5KPDA 1E98A 4Q4AA 1XEXB 4P3YA 2ZR7A 2WKPA 3BGWA 4AKIA 4XTCS 1OH6A 2I1VB 2CL0X 3FB4A 2ANCA 4OK3A 4BWYA 4NPHA 1OSNA 1JPNA 1ZNYA 2EVWX 5FR1A 3QENA 1KI7A 4DEYA 1JPJA 5EXPA 2XB4A 1T0HB 1IN5A 2CNWA 2ZJBA 1ZNZA 2IYWA 1EESA 4WW0A 4C0AC 3VR5A 4Q7LA 5FR2A 4EPRA 4QBGB 1N5LA 3IIMA 1A82A 3W8RA 2D4HA 2C9CA 5HTKA 3REFA 4NYJQ 4C7OA 3EX7C 4D4LA 1ODFA 4A36A 3C16C 1E9DA 5H8WA 1NJFA 1YVDA 4ILEA 3QKTA 1AZSC 3B60A 3TIFA 4U00A 1VCIA 1P9RA 4TT3D 5L3RA 5IDVA 2VSXA 5CB6A 1MT0A 4CEIB 1XD2A 1R8QA 1NMYA 3DZ8A 3ND9A 1E32A 4RSGA 1P2VA 1IN8A 1BS1A 2HLDA 2OCPA 2F7SA 1KO5A 3LVQE 1DAEA 2QTVB 2C99A 1JR3E 2F1IA 4CT4B 1E4VA 5TARA 4ABYA 5EE1A 2RGDA 3UANA 1XXHA 4BFZA 1CLUA 5DI3B 2ZUDA 2ZS9A 5GVRA 3GFOA 3A4NA 2KB0A 4MGYR 3EIEA 3THWA 5L3QB 4HUQB 1FPMA 1NI3A 3RRNA 1E69A 1KAOA 1IJEA 4S35A 4G3XA 3R8FA 4Q4JB 5CJPA 3GJ5A 3MLEA 2YYZA 2AN9A 2UVQA 3QG1A 2ZRLA 3GLGE 1OKKD 2O8BB 3REGA 3BAFA 3KFXA 2PMKA 1Z83A 5AJWA 3KXKA 5KNDA 1SXJA 3P26A 2IBMA 2GKSA 4OI2A 3WNCA 721PA 2F9MA 1D9XA 3GEEA 3TAHA 2JLXA 5FUWA 2IF2A 1FW6A 2H57A 1AS0A 4JLOA 2BKUA 2YWGA 4CRWB 5DNYB 4I4LA 4OHWA 1KSJA 4V02A 1R6BX 2VP5A 4EJSA 4QL3A 4L4UA 4JVSB 4NYJR 3ZQ6A 1WB9A 1WBDA 2VPPA 1ZM7A 1NNEA 2V6IA 4X8LA 2IX3A 1P2UA 1GITA 1TMKA 4K46A 4A8JB 2V9PA 1F5NA 2C96A 4OQLA 2IHBA 2DHRA 3UIEA 3B8HA 4P31A 5J4LA 3ASYA 4B44A 1LTQA 4B6EA 2JLSA 4HDQB 3Q7PA 3RRZA 5KYKA 3AVOA 4G5OA 1G8YA 1Y3AA 2IA5A 1K6MA 4YONB 4YXWD 5SZKB 4D4MA 1F2UA 1PUJA 4NCNA 4NCJA 4HB4A 4UNSA 1II9A 2ZRCA 1NVVR 2BEKA 2W6ID 1EGAA 1J2JA 1B0UA 1UFQA 3BBPA 5JHHB 4CT5A 2JASA 1G291 2ZJ5A 2WOJA 1AJEA 4IW3B 4Q1EA 2PT7A 3NH6A 1JR3D 4A2PA 3K09A 4PC6A 1DAMA 1P3JA 2CXXA 2Y8EA 4QKQA 2OHFA 2REOA 4U02A 2R62A 1KMHA 3WP1B 4PQFA 2QBYA 3FE2A 1VIAA 3W90A 2CHQA 1W2GA 4TWZA 2AKAB 4B74A 1E2HA 2QQ0A 4GNKA 3AKYA 3GJ3A 2G1JA 3LBHA 5JJKA 2G9NA 1FQJA 3K0FA 4PR0A 1KOFA 4A2QA 3Q7QA 2OESA 3D3QA 1LS6A 3AP3A 2AKYA 3OAAD 2FV8A 2HXSA 3FMFA 5CITA 1HT2E 4B35A 4X8HA 2P3SA 3A1UA 3KUDA 2QP9X 1GZSA 4OK6A 3MWKA 1ZJ6A 2OBNA 5EP4A 3TBKA 3KB1A 4Q4HB 2CLCX 1YZTA 4M21A 4A1FA 1QDEA 1Z0IA 2RGXA 4MGIR 1YJ5A 1PLLA 5LB4A 1OIXA 1KI1A 2FNAA 3NXSA 3PUWA 1IJFA 5KSYA 2Z4SA 4IEIA 4M9XA 1U0JA 1Z0FA 1T4GA 1MABB 3SHFA 3DZDA 2ASEA 2HXYA 2UKDA 2IYRA 3LD9A 4LJ6A 1KK1A 1R0XA 2IUSA 3MSXA 2RGNA 2RGCA 1CJKC 1K5DA 1X8JA 3GLIE 1U98A 1DO0A 1X6VA 2KI5A 2JLWA 1NBME 2Q9CA 3OZXA 4CEJB 5TMPA 3P1JA 2DWOA 2YC4C 2JLVA 2O8DA 2RHDA 3EZ2A 3FVQA 4HB3A 1IM2A 1KI4A 1Z2CA 2H1LA 3VHXA 3AB3A 2QORA 2MSEB 4LPSA 2XSZA 1K8RA 4YMVA 1DAFA 4DCNA 3ADCA 4RVCA 2B7CA 2A30A 2CL7X 3FGNA 5JRZA 1P6XA 2R6GA 4Q1AA 2C95A 4TMXA 3WRYC 4ZCIA 5KDOA 3SN6A 4QGAA 4UJ3A 4B34A 5KSZA 2PH1A 3IQWA 2RMKA 1KYIA 2G77B 4DRZA 2ZS8A 3GLFB 3KTAB 2ZUBA 4TQAA 2W83A 2NOAA 3WHLA 1I2DA 4LV6A 2VSOA 4IXNA 1TTTA 3DEFA 4L8GA 1N0UA 1COWA 2IYVA 2Q3HA 2Q9BA 2ZRPA 2F1JA 3BD9A 2ZSAA 3BB1A 3FHCB 3IDQA 2QM7A 1TF7A 4P4SB 3B85A 5H1YA 2JJ2D 2ZRKA 4Q7KA 3SJBA 2XGJA 1AQUA 4PHGA 1R0ZA 2LKCA 1NG1A 1V43A 1K5GA 2GZDA 3WYAA 3S1AB 1SXJC 4W5WA 1E2GA 3PENA 4D0NA 5JSZA 4G5QA 3OFNA 4RFVA 4B71A 1JQLB 5JWRA 4LJ8A 4M0LA 2HEIA 1G18A 4UXIA 1R8SA 4B3GA 2RGGA 4HB0A 4DLRA 2JLRA 5BYJA 3IQXA 4FINA 2BCGY 4I1OA 1GKYA 2WBLC 3QPVA 4NZYA 4LUCA 4BFTA 4EJSC 3SFZA 1NN5A 1CP2A 1VG1A 5TY0A 4Q7JB 4MH0R 3PJRA 1S4QA 3UG7A 4BLTA 3U5ZB 1US8A 2WJJA 1TQDA 4M53A 1ANKA 1KZ7B 1OXXK 2GTPA 2UZ3A 3BFVA 4MITA 3QVUA 2ZETA 2J1LA 1NN1A 3KQNA 3MMPA 2QMOA 2GNOA 1DOAA 1XD8A 1S3SA 1YZGA 2WM9B 4LRWA 4LYFA 1WF3A 1OB2A 3ZVLA 5G41A 1XCGB 2PT5A 4B43A 1KK0A 4DCUA 3FKSD 2HT6A 1AA9A 3RRYA 5DYIA 2V7QD 3K0CA 4DIEA 3NTUA 5SZIA 4I99A 4C4PA 3K09C 3AVTA 2O8CB 3QKUA 4WOPA 1TQ4A 2WJIA 1D6JA 3RS7A 2VF8A 1G9XA 1SULA 4B2PA 2WOOA 5B64A 3TSZA 1KI8A 4QXAA 2GAOA 3OF5A 3DKVA 3R9IA 2PEYA 3AF1A 1EFCA 4QNMA 4CEHB 1IAQA 2WWIA 5C46F 5EXXA 4ASUD 5GJBA 2E87A 2Z43A 2BMFA 3MJHA 5D3MB 1JXOA 3EWAA 2ORVA 2GEUA 1FZQA 2CK3A 4PAQA 3RANA 4CVNA 2QUZA 2IYTA 2W0MA 3LW7A 4O0MA 3HWSA 1ZBDA 5LD2C 3TUJC 4EDHA 5KU1A 1HUQA 3CF0A 2HYIC 3GP8A 1LFDB 4DUGD 2YOFA 1TF5A 3WRXC 1G16A 3CX6A 4B33A 1Z5ZA 1NSFA 121PA 1G1MA 2NO7A 3B9PA 4TLCA 4E5UA 1RJ9A 2NO1A 3K70C 1LVGA 1KK2A 3A4MA 2VRWA 1SVMA 2VL7A 4A0FA 4ZIRB 4DLZA 2Z4RA 2H17A 2C04A 2ECKA 3GJ4A 3OIWA 2BJVA 1T5LA 4YLGA 3U2QA 2D62A 2RGNC 4NL4H 1WQ1R 2PLRA 2AK2A 4PSAA 1XEXA 2BBOA 4B32A 1E9SA 2FGKA 3I4LA 4LJYA 4DLYA 5LB2A 1QHHB 3CM0A 5FUVA 3NHBA 3VKGA 3LQQA 4C0LA 3LVRE 3K53A 2FOLA 5GJWC 4TMTA 2QPTA 1F2TB 4A92A 2QGZA 4JJKA 1FOEB 2GJAA 2JA1A 4XWKA 1Q44A 1PV4A 1E79D 2CLDX 1LB1B 2X8AA 4PAOA 5C1BA 4M1OA 1OH5A 1MKYA 3B1ZA 1XTJA 2YWEA 2YWFA 3VR4A 1G8GA 2PEZA 2DYKA 1I2MA 1PVOA 2FEMA 4DSTA 2QMHA 1G3UA 1FFHA 2JGNA 4X8OA 1DE0A 3SDZA 2PX0A 1OIVA 4AG6A 2QTHA 1F2UB 2GJSA 4MRSA 2FF7A 5C2JB 2AL7A 2EWWA 1HT1E 4CEIA 1QHIA 3KKNA 1NVWQ 2AK3A 1E2FA 4BEBA 4KFUA 2CBZA 2W2TA 3M6AA 3WYGA 1M7HA 2QE7D 3WHKA 3T1QA 1E0SA 5HPYB 1E0AA 5DI3A 2ZRFA 4MQBA 1XXHE 1U0LA 1XNJA 1QHYA 4FIDA 1QF9A 2EQBA 2PZGA 1WXQA 4FW9A 4JZKA 5J4VA 2OXCA 5L3QA 4HUQA 1GOTA 4ZV4A 4NYIQ 4PPNA 1XWIA 1CU1A 4GFDA 4Q4JA 3BH0A 2JAQA 2B8WA 2REXB 1R0WA 3WNDA 4LV8B 2O0HA 2GJ9A 1U81A 2WAYA 1OHHA 2AWNA 2YINC 3FPAA 4EFNA 1DAHA 3NC0C 4TTPA 5JS8A 2O8BA 4AKEA 1JNYA 2BJWA 3TJZA 2OZEA 3ND8A 4MDEA 4RZ3A 3I8XA 1G8PA 1SXJE 1XD9A 4MGZR 1RYHA 1JJVA 2P6UA 4JVNA 5FOXA 3U7GA 1II8B 5DO9A 4AKGA 2FSFA 4XVUA 2QL6A 2DCUA 1SKQA 2ODWA 5JI2E 5L3SB 2OCBA 1J90A 2ONKA 3QG5A 2ZJYA 3GJ0A 3IHWA 4BPBA 1EFTA 1R5BA 3LX8A 3K70B 4J0QA 4A8JA 1G5TA 4G5RA 2CDNA 1GG2A 3FMOB 4A0RA 1GAJA 1T3HA 4HLUA 2JJ8A 2IUUA 4C0JA 1GNRA 1NBMA 3GFPA 1J99A 2D3WA 3BS4A 2ZYUX 2W2XA 4TSFA 4B47A 1NG9A 2F1RA 3M0EA 3V00A 4CDGA 5FPKA 1OIWA 3KJEA 3FDIA 2ZRIA 2JLUA 1QRAA 4DCVA 5L3SA 3C14C 3TNFA 1KAGA 4RFSB 1EK0A 3IKJA 3VFDA 4C2TA 1RZ3A 3CPJB 2GCOB 4JYCA 3RSLA 4LJ9A 1J7KA 1GRNA 3AVVA 3TGPA 4URYR 5KPJA 3T12A 1CULC 2WKRA 4NYIR 3R8CA 2NMVA 3AVUA 1PJRA 2ANBA 4AG5A 1DTSA 3PEVA 1FUKA 4B3XA 1YR7A 2RGEA 4A82A 1UDWA 3U3MA 3VX4A 4UXHA 4XH9B 1TL7C 1Z6XA 1EFRA 4O25A 2ZVQX 5DE3A 4Z54A 2V3CC 1SHKA 5DLQC 3QF4B 2IC5A 3EA0A 3IILA 5EQTA 3THXB 4TZ0A 3CPHA 3AF4A 4DHEA 1MRNA 2WSSD 4ZI2A 4X8MA 1U8ZA 2WIBA 5JCPA 1SXJD 3K9GA 4OI0A 2HF8A 5FTKA 2GCPA 4Q4HA 4F38A 4PC1A 4HEJA 3K0SA 2JEOA 3A1SA 2NG1A 1FMLA 4JLDA 5E4FA 4R2IA 2V55B 2ZYTX 3FKQA 3TW4A 1ZD1A 2D7CA 4TYYA 1T0JB 2SHKA 1ZCBA 1XEWY 1BO6A 3BORA 5E3HA 3LY5A 1RW4A 1I4DD 2XZOA 2ATXA 4D25A 2QQEA 4K8OA 4RZ2A 4Y0AA 2WWGA 1MABA 3TW8B 2IEYA 4Q19A 2VTKA 2ZQ5A 1SVKA 3W6OA 3FFBA 2E9SA 3LFUA 4KXFB 3AVXA 4KVGA 4CEJA 1W0KA 3L8ZA 1TUEA 3B1XA 1MV5A 5C18A 2QPOA 4DXAA 1Z06A 3EPJA 4JLMA 5BW8A 3CX7A 4RZUA 1X3SA 4TLDA 4WXRA 1Q57A 1PLKA 1G3MA 2XOKD 3LX5A 4RD4A 3U61B 1HQYE 1G3QA 2CCKA 1DS6A 5GJVC 4C0QC 2AFIE 4IFBA 1TUIA 2RGBA 3L0PA 5E7MA 3T1VA 5FPTA 3SOPA 3UMFA 3AF2A 1LS1A 1W36B 3I8SA 3F8TA 4KLZA 1D2EA 3JZAA 4US1R 5JFGA 1CJTC 1W7AA 2ZUCA 3GLFA 3KTAA 2L0XA 2P2LA 3ZS8A 5E95A 1ZP6A 4LYAA 3IHLA 3CR8A 3UXMA 2O0JA 3A1WA 4II7A 2PCLA 2DPXA 2EWVA 1TU3A 4I81A 2XTZA 4P4SA 2ATVA 4Q7MB 5TDHA 3CPEA 1OYYA 4GI7A 1E9AA 1M7GA 3EPLA 1IXRC 3VR1A 2PLFA 2AWOA 3EIQA 4WBSA 2G3YA 4TZ6A 4A4DA 3SU8A 5E7IA 1KSFX 3U60B 3U7HB 3S1AA 4O2LA 4E07A 4LHYA 3CF6R 4RCYA 1UKZA 2ZRNA 4Q9JA 4DT1B 2XX3A 1ZYUA 3CWQA 1AKYA 2Q9AA 4W9MC 4HI0E 3RDPA 2JJ1D 1SVSA 3X1DA 3QXXA 2GVDC 4TL6A 2OLKA 3L0IB 3NBZC 5EE9A 3VR3A 3P20A 2IXFA 3ICQB 4QGHA 5BN4A 4A8JC 2BMDA 3D31A 2B21A 4OHVA 3KUCA 4TYQA 1MO5A 1LY1A 3U4QB 1SHZA 3NIBA 4B76A 2PCJA 3MWJA 4HLUC 4EPYA 4FMCB 2XTNA 1OFUX 3P4YA 1G21E 4BLQA 4HATA 3PEWA 2ZREA 1UEJA 2P6RA 2J7KA 2QRZA 2LCFA 5CJ2A 3ZZUA 2XSZD 1CR0A 1Q0UA 3DOEA 3KKQA 4LC0A 3QE0A 1JR6A 4M9QA 4EFMA 2ZRDA 3DO6A 1XJQA 4OHXA 2PZFA 2QENA 2ZI9A 1GWNA 1PUIA 2AR7A 4QC2A 4DLWA 2O8CA 2YHSA 4IOKA 2J45A 5DHFA 3DVLA 1P9NA 3K1JA 3MGCA 5AWFC 5FBQB 5C4GB 5F2EA 4EQ6B 1P62B 4V0LA 4CEHA 2NO6A 2CLSA 3RHFA 3LO5A 3AV0B 2FFQA 1EG7A 2BV3A 4C0BA 1E2QA 1LF5A 4NU0A 2F6RA 1COWD 2ZITA 4W7SA 1NMZA 1UBCA 4PXAA 1HYQA 5D3MA 3T1OA 2G88A 3IEVA 5EXTA 3BH6A 4DDTA 1N6LA 4TMKA 2QT0A 421PA 1CEEA 4F4JA 2XB2A 3B5JA 3PEUA 4UNRA 4E22A 1KO8A 1F60A 1Z29A 3AQ4A 2OBMA 4MYTA 2IS2A 1S1MA 1X86B 2J5XA 3KX2A 4ARZB 1UADA 4GPTA 3KQHA 4TMZA 2OO7A 4PC2A 4PSVA 4MUBA 4NONA 4B6FA 5DH9A 2VP6A 3EXAA 1S2MA 3FWYA 1M8PA 1T8UA 1YR6A 4UJ5A 1N0VC 2O52A 1EXMA 2H18A 4B3BA 5K8IA 5HCIA 2MSCB 4TQUS 1T3SA 3RS3A 5GADl 4ZIRA 5IRCD 2VH5R 4KJZA 3Q3JB 2O8EB 1P60A 2XJ4A 1NP6A 1OJLA 4HDOB 3LBIA 4RKFA 3AKEA 1Z8FA 3W3AA 1VMAA 2ZE8A 4QOSA 4E09A 1NN3A 5IF9A 2ZJOA 1QHXA 1P5ZB 2A78A 1QHHA 2BWJA 2OAQ1 4KCGA 3EPHA 1E1QD 1NY5A 3QQ5A 2YVUA 3BRWD 4FN5A 4JKYA 5C4MA 2FDCA 2HT1A 2WV9A 4FXPA 1F2TA 4LBZA 2ZS7A 1AGPA 3HU2A 3Q8XB 4U5XA 4DDWA 3P4XA 1YKSA 3AKCA 4G01B 3U6BA 3CNOA 1J70A 4IFEA 1TX4B 1XBTA 4JVMA 1GUAA 1VDZA 3GPLA 1O3YA 2H8KA 2NPIA 4IDOA 5AJYA 4JL5A 3R20A 4XWOA 1OFTA 4OYHA 1OXTA 1Z6GA 4YQFA 2ZM5A 3TE6A 4IDQA 3I32A 1U9IA 1F48A 1XCMA 1Z3IX 3WYFA 1RIFA 2C98A 4BUJA 1OPXA 5FOWA 4NHOA 1CS4C 2FPLA 4LJ7A 4PHHA 3VR6A 2N42A 1HY3A 4KSBA 3D6TB 4D26A 4GMDA 1N5KA 2OILA 3K0AA 3SEAA 4LGMA 2AD1A 2HDNB 1OXSC 3MD0A 3A1VA 4H1VA 4JT2A 1UBGA 3OEHD 3UWKA 2CMKA 4Q03A 1G7SA 1TU4A 5KDDA 5G40A 4Q02A 2ZPTX 1NMXA 1FUUA 2ZAOA 4Q9HA 4C2UA 2NZ8A 4CIDA 1EX6A 4PQRA 5DISB 4IDNA 1KDRA 2PL3A 1DEKA 3MG9A 2OSBA 5CB8A 4H9GA 2WPDD 4LJ4A 4UXJA 4Y0VA 5JZVA 3N70A 1M1YE 3O8DA 2GHIA 1D9ZA 1LNZA 2C9OA 3EWSA 4Q9IA 3CRW1 2GXAA 2IT1A 5KNBA 3ZDQA 2JDIA 2FFBA 1OF1A 5B30A 4BLSA 4WZBE 3SJZA 2O8FB 1UM8A 2BCJQ 2YZ2A 4ERNA 5JEDA 2FE4A 1IY0A 1II8A 4C0KA 1QBKC 3UMRA 4DB4A 5JLJA 2FA9A 4DJTA 5BWMA 2J46A 4EUNA 1OXVA 2BDTA 4B3DA 3B78A 1NL3A 3ZYCA 1XRJA 4EKDA 2QA5A 1KGDA 4N0EA 4LK2A 1WDTA 2G0NA 2YJTD 3AUYA 3LW8A 4QHYA 4IOMA 3R9WA 2FWRA 4LX0A 1XU4A 1UKYA 4BGDA 3I62A 1A1VA 4ZCMA 1FL9A 3DM5A 3N5CA 1IHUA 4KLNA 4QJ3A 2GVZC 4ZDIA 2A7QA 1BMFA 3GJ7A 3OIYA 2JLQA 3CH4B 2MMGA 3Q5EA 4V0MA 1E9CA 5AJXA 4KO8A 5FTLA 3RLFA 4RFSA 3QY0A 1ESMA 2F3RA 3RS2A 4BZXA 3QOFA 3HR7A 4ZKDA 2GCOA 1KNXA 2W2VA 3ZZ0A 3RRMA 4JSTA 1AIPA 1Z07A 2TMKA 4HUTA 4DIDA 5JBQA 3NDPA 3RVBA 4OQXA 1S8FA 2FSGA 4BE7B 5JECA 3QKSB 1KI9A 4NTZA 1L2TA 3EC1A 1BYIA 2Z6VA 1GFIA 1HURA 1J8MF 1P2TA 4PPGA 4KAXA 3LH5A 1L8QA 1A2BA 3AUXA 5EP3A 2DFTA 1N6PA 2GAAA 2J0UB 3DKPA 4GSYA 4DC9A 5E7JA 3QF4A 4N0DA 2GEVA 2YOHA 8OHMA 3LNCA 1ZINA 2IYZA 5IK2A 3THXA 2ZJ2A 1NIJA 1E1RD 2GZAA 1OHHD 4GL2A 3IO5A 4EPWA 2HUPA 5TVKA 2WHXA 4QBFA 4R2HA 5FPHA 3RWOA 4Q47A 3THYB 2DFKB 1QVAA 1TADA 3KKPA 2OV2A 4P33A 5AUOB 821PA 4OBEA 4S2EA 1CF4A 1CJVC 1W4BA 2OT3B 1BOFA 4L5BA 4XTRA 4ZDWA 4B3CA 4F7WA 1TEXA 4Q21A 2R2AA 2AHOA 4PPQA 5EP2A 3AP2A 1R7RA 1Z2AA 4HB2A 2EFHB 3X1XA 2WAXA 1KI6B 3AGQA 3E2IA 2NIPA 4TT3A 5FPYA 4L15A 1IY1A 1JALA 4GOKA 4BLOA 3C7KA 3VKWA 1VECA 1AS2A 1NBMD 3VU9B 4AC9A 4TSFD 3DMNA 1VKJA 3I72A 4GMXA 4PZYA 2WWYA 1U9IC 2ZROA 3WMEA 1XMSA 1S0UA 4RZXA 5FL7A 3VR2A 3W5IA 4Q1DA 1RPZA 4GOJA 4LWZA 2JLYA 4MKIA 4CF7A 1FX0B 1ZNXA 4CW7A 2VA8A 4LPKA 4M4SA 5CM9C 2ZRGA 1OYWA 1DADA 1SVLA 1ZU4A 2BHRA 3TK1A 4TTQA 3VTKA 3RC3A 1NRJB 1H8HA 4WIAA 1Y63A 3FFAA 1CTQA 1UF9A 3IPYA 3RS0A 2ZRHA 4W5JA 2J7PA 2GF0A 4TLEA 1OKKA 3C41J 4V0KA 3T35A 2H92A 2EU8A 3GEIA 1Q3TA 4MRVA 5IT5A 4IJMA 1N6IA 3B13B 1EFRD 4PO1A 3GLFE 3U3JA 1XCPA 3BFXA 4M1WA 4KFSA 3EAQA 521PA 1IN6A 4RD6A 4F4IA 4Z8YA 2KJQA 3AGPA 2DFLA 3H4MA 3Q5DA 1W1WA 3K0EA 2ORWA 4DZZA 1G19A 1XPRA 2O5VA 5G3ZA 1XMIA 2F3TA 2DFNA 3TSOA 3B82A 1Q20A 4D4JA 4LV5B 1AN0A 5FPSA 5CM8B 4DT1A 3I61A 2CCJA 2LWIA 3EZ6A 3C5HA 4HZUB 4JLPA 1TAGA 2CVHA 1MO3A 3V9PA 3B2EA 1KDPA 3WY9A 2IS6A 3RC8A 5TB5A 4US2R 5F98A 2P0EA 2IF0A 1Z08A 1T5IA 1CBUA 3A58B 2AFHE 3PQCA 3HDTA 5AR1A 1GTVA 1HEIA 1SKYB 4JBYA 3R9XA 3VNVA 1JECA 1VG0B 4XSHA 3U4QA 2J0VA 3SQWA 3EA5A 1W0KD 2QSYA 4JLNA 1ZUIA 4KODA 1E2IA 1W5TA 1HV8A 2OCYC 3A4LA 4QGGA 3SYNA 3IPXA 3FHTA 3DMDA 1YU9A 4IDHA 3BXZA 1AGRA 3GJXC 3T5DA 5DIFA 2ZSEA 1OFHA 4URXR 2F43B 4HAVA 5AUQA 4HAZA 2VP0A 3ASZA 2Z83A 1XMJA 1FNNA 3QIAA 3SNHA 1N5JA 4FWTA 1MOZA 4BQSA 1OH8A 3SYLA 3HYTA 3ZVNA 5HCNA 4EQ6A 1VCNA 3HU3A 5SZHB 1Q21A 1KKMA 2ZI7A 4JJZA 1IXZA 1I4TD 1RRPA 3VMFA 5GVSA 3GCGA 1ZAKA 4TLBA 2MMCA 3DM9B 3VX3A 2RHMA 3OIVA 4N3NA 4O2RA 4P0TA 2EFGA 2W6JA 4PC3A 4LOAA 3V4RA 4JS0A 3KZ1E 1GRQA 3CKLA 1G7TA 1KSHA 1E2MA 2A9KA 3UG6A 1CKEA 1M2OB 3MFYA 4FI3C 4HAUA 4XJXA 3K0AB 3SI7A 3ZGXA 4Z8XA 4B48A 2A5GA 5FFMA 1G8HA 4ARZA 1E9BA 5BN5A 2FU5C 3ZVMA 3TAUA 4MKGA 3ZQJA 1KO7A 4RJLA 2DBYA 1ZIOA 4RD0A 3BFKA 4Q9LA 4KBFA 1FTSA 1E2PA 1UBEA 2IWRA 1Z0KA 4AYWA 2X2EA 3QEOA 2WJYA 2RAPA 1U94A 4DB2A 5J5CA 4F93B 2OUKA 1KY2A 4OKSA 4C0HA 4CGZA 3AH8A 5CYPA 4GP7A 2O8EA 1S1CA 3KJHA 1SKYE 2ODNA 3MWYW 3O47A 5UKDA 1PZNA 5G3YA 3GLHB 1G6HA 2GESA 1E0JA 3NHAA 1XTKA 2GZHA 5SZJA 4Q00A 3TR0A 2IXGA 1E2EA 3R7WB 1BKDR 1IN7A 4RY2A 3L82B 2I4IA 1E9EA 2ERYA 2GXQA 3GEHA 2QM8A 3PXGA 2XEXA 5AJZA 1U0HC 2HCJB 3CRMA 5EZ6B 4AD8A 4DBLC 2CNWD 1XDBA 4QHTA 1N25A 1D8TA 4M1KA 1N6KA 3B1VA 2IEZA 1G20E 3QVVA 3KJGA 5EE0A 2VP4A 5HE9A 2KE5A 3TSWA 1W36C 3VNUA 5DI9A 2EFCB 5CLQA 4HAWA 2BM0A 3LBNA 3IUYA 4D82A 3B9QA 4M9ZA 1DVRA 1VCOA 3LQRA 1XTRA 2G6BA 2F1HA 3JVUA 2HF9A 3WMGA 3RS5A 4ZO4A 3KDSE 3VKHA 1MH1A 1CJMA 4JMPA 1VG8A 1TPZA 1H8EA 1ZNWA 3BERA 3H0KA 3C8UA 4LHWA 1C4OA 1ONBA 2A5JA 2ODEA 2QAGB 1XTIA 3E5HA 3PIRA 4Q01A 1ZMXA 2HLDD 2VHQA 1SVOA 2BC9A 3PG5A 4JLBA 1U99A 5FOTA 2VBCA 4IXMA 2CE2X 2MSDB 1Q1ZA 2G1KA 1P61B 2QP4A 5J4HA 2HYDA 2REBA 3CUEF 3U44B 1X1RA 3QI2A 3Q72A 5KSOA 2OFWA 1HE1C 1G4UR 2B6HA 2VHCA 2WWXA 1R0YA 3TLXA 3M4YA 1OXUA 3K9HA 2J0QA 3O8BA 1U2RA 1JXMA 1IBRA 3Q9LA 3F0TA 1GKUB 2ZJAA 2R6AA 3FKSA 3GLHE 2FPMA 3BC1A 4KYUA 4D0LB 3EZ7A 5HR5A 4O3MA 1LV7A 4QNRA 2FSIA 3DHWC 3GD7A 3SBEA 5LBIA 2XXAA 2O8FA 3K8YA 1KJYA 1TF2A 2IYQA 1AK2A 1QZXA 2EFEB 2QMEA 4UQOA 1CIPA 4WZ6A 5J4YA 5KUTA 3BB4A 2X77A 4POAA 1RYFA 2GETA 1DPFA 4OHYA 1QG2A 3QXJA 1GNPA 5EZ5A 1HTWA 4JL6A 4ASUA 2YV5A 3CRQA 4LJAA 4AYTA 5DGXA 3CWZA 4TLAA 1O87A 1GVNB 4BEJA 3TR5A 3NBFA 2GF9A 3TMKA 3EW9A 5HKKA 5A0FA 3PV0A 3EIHA 1RRFA 3G5UA 3VQTA 5CYOA 3H84A 3MJRA 1PLJA 1Q1BA 1B23P 4OQFA 3OHMA 1WA5A 2ZR9A 2ZJ8A 3KB2A 1ELOA 221PA 4NCIA 3SZRA 3CW2A 2VYFA 2ZU0C 4NCKA 4V0ME 4AI6A 5P21A 2B8TA 3NWJA 2KSQA 1T91A 2BBWA 3FYHA 3FHOA 1VHTA 2BOVA 2ZE7A 2ZSFA 4XD7A 1SQ5A 2ZI6A 3KL4A 4PZZA 2ZSDA 3ZVRA 3QKSA 5BXQC 3Q85A 4KFRA 2VHJA 2J9RA 4OQNA 4PZLA 2KWIA 4B2LA 2AXPA 2OG2A 4FMDB 2ODBA 2C8VA 1KTVA 1LF0A 3CRVA 4FCVA 2J0UA 1X8LA 2VQSA 2A5YB 3NVAA 2RB4A 3TUIC 1DG1G 2PJRA 2IYLD 4KV9A 2XAUA 3AKDA 4V03A 1Q1EA 1S3GA 1ESNA 3KKMA 4XVQA 1EWRA 4QGFA 2PZEA 2QG6A 4NH0A 3A6PC 5EP1A 3T61A 1XEWX 2J87A 4AKHA 4DKXA 5DHAA 4R71A 3THYA 1AM4D 4PHFA 3UMSA 1E79A 1DBSA 1YHNA 2DY1A 3IBGA 4QJ4A 2KBEA 2BMEA 1L4YA 4AWXA 3P27A 1NVUQ 3D8BA 2OFOA 2OEPA 2IYYA 3SC3A 4F4CA 1LW7A 2OM2A 2Q0HA 2K5UA 3PR1A 3K70D 2WTUA 3AF0A 3TH5A 4URZR 5L8VA 3J81k 1KI6A 1R5OA 2XNDA 4HAXA 2FEOA 1WE2A 1NLFA 3KXLA 3WMFA 5LDDC 4Q66C 3H2YA 3AM1A 5DN6A 3VU9A 3PFIA 1P2SA 1FQKA 3KJIA 2QI9C 3SHWA 4BRWA 3BE4A 3P32A 5CIQA 4DLUA 5JJLA 4ZDJA 4PQYA 3EC2A 1OH7A 3TRFA 2GDJA 2OFXA 1SGWA 1BMFD 2ZU6A 4XWAA 1U8YA 1C9KA 1FX0A 4IHQA 4AYXA 2ZJZA 4M8NE 1OFIA 4PFSA 2X1VA 3F3YA 4Q18A 1KK3A 2D06A 1SZPA 4IVQA 3NG1A 2IHYA
chains in the Genus database with same CATH superfamily
1Z16A 5JC8A 3GELA 4Z51A 2YS6A 3JYOA 1EBUA 1G0OA 2PV0A 1T2EA 4L4YA 5K8VA 4MR9B 4J4TA 2DPLA 4NZZA 1VA4A 1JEEA 2VN8A 3AHDA 3O9MA 1AGNA 1FMFA 4DCMA 3VPSA 4WBNB 2ENWA 4HPXB 1DC5A 4BVFA 4U7DA 2JH9A 3MMNA 3NP9A 2IUYA 1GGMA 1ETUA 4YVFA 4ZKEA 2Z2YA 1O94D 1TPYA 1VIYA 1IBCA 1IMJA 3AZQA 4IGIA 3ITEA 5ALSA 5A4MS 5IK2D 1QO9A 2MSLA 5MGNA 3KSZO 5FBZA 5CH8A 1HTTA 2PKQP 4M0FA 2IP2A 3F5FA 3L5KA 1IQ0A 1XTUA 2B83A 2QY9A 5DTRA 4ETIA 2CHVA 3UATA 4IEEA 4EW3A 4NU6A 4YQYA 1L4UA 1Y1LA 4MWBA 5FUXA 4JWTA 3DWGA 1AHPA 1CRQA 3J81A 4Q1CA 4TN5A 4MIYA 4TVBA 1X1CA 4MV9A 4REQA 4CDRA 2M98A 4QUGA 2ZTLA 2WD8A 3CKMA 3GRKA 3N3AC 1YZFA 4H0CA 4KLCA 4DG8A 3A2MA 5KSPA 4B85A 1J0XO 1G9SA 1QFZA 3NHKA 2Q3DA 1WW2A 4S04A 2C3PA 4Y2TA 2ZSBA 1N1MA 3TEMA 5TQ0A 1XTTA 2FK7A 1I7LA 3IMFA 5EE3A 2ZVDA 3ZDEA 2WU3A 4YJFA 2HBRA 4BECA 4M9SA 3Q41A 4LHXA 3KQLA 1NTOA 5FTJA 4KR9A 2I71A 4DA9A 4EO7A 4YAUA 3CCFA 1YFKA 3BJEA 5AK0A 4A9AA 5FL7D 1GKIA 2VAVA 5KS2A 1W88B 4NBLA 3PC6A 4G0VA 1SXGA 2X2FA 3L8YA 2OVBA 3J7TA 2FCRA 1EK2A 3GJ6A 4M49A 3TZKA 3ZBTA 3DB1A 1P9LA 2JFNA 4NAHA 4KAJA 2JGAA 3PWTA 4LZZA 3ONWA 4PLWA 3ETGA 2JGMA 4JKIA 5CDFA 3WO1A 1DXYA 2NZXA 1CUHA 2XMPA 2CFOA 1USUA 2RB5A 3BCSA 3CIOA 4H35A 4N5LA 1DI0A 3EZFA 4NOJA 1UKEA 3EFOB 5CTAA 5DHPA 1ULZA 2JJMA 4FE3A 3HVJA 4BFSA 4DQLA 1UFRA 1PJAA 2YVLA 3EXHA 5B2ZA 1V5IA 2BDEA 3L4BA 2WQZA 5F1PA 3ZDCA 2V54A 4XI9A 1V96A 2WR8A 1QDUA 1GZHB 1TI7A 3UAOA 1Y4UA 3GH3A 3MUFA 4PIPA 1G6OA 1PHPA 4ND6A 3I09A 4A3SA 1QP8A 1WB6A 3UYLA 1BEZA 4ZI3A 1ECGA 3P19A 2YFKA 1PNOA 5CJJA 3WZMA 3EODA 1AUPA 1JDVA 4KFTA 3TZEA 1TJNA 4OPMA 3W9UA 4QJBA 2BD0A 1HLDA 2PXHA 2WIGA 3PIDA 4F4UA 3LKBA 1M2OA 2WIAA 3FMPB 2P4EA 4U2GA 5IBQA 4BO8A 4A1OA 5JSFA 2H11A 3ABRB 1I9GA 4NJOA 2VP3A 4AJ1A 4GYJA 1QIIA 4IV0A 4E2XA 2LV8A 1QZTA 1KPHA 4Y9DA 3SKVA 1T1IA 5JSUA 4IDGA 1JSXA 1OTYA 3REQB 1QVWA 1X1SA 4LQDA 1QHSA 3EVFA 1I5EA 2TYSB 1QLJA 3NHRA 4QG7A 3RLIA 5G0VA 4B2IA 5IKPA 3TCNA 3W06A 3FWHA 4E88A 1Z0SA 3OA0A 1A4UA 1CZKA 4FHZA 5E8JA 4Z86A 4A0HA 5ECDA 3CISA 1HYBA 4U9IS 1FFWA 2TMDA 4G07A 3FVVA 4UUBA 3N05A 2E5FA 2IIBA 1PX0A 2C54A 3GMIA 2XCIA 4LHZA 4C7JA 3GAFA 4M0KA 7YASA 4LNHA 4CM4B 1AQYA 1SPXA 2W8BB 1RWMA 1WZIA 3C43A 5JI3E 5EIFA 4HHEA 1JX6A 1TA0A 1YKGA 4NQRA 3L6BA 3MTBA 2GEKA 4NVRA 1SKMA 1GIAA 3WKCA 1SD2A 2Z9CA 3TOXA 4CL0A 3MJFA 1EQ2A 1NKVA 4RF5A 3B52X 5DZSA 4P22A 1B4DA 1U0FA 2OM6A 1C1YA 3W34A 1MHPA 4PYLA 1JVBA 4A27A 4FMDF 4MVJM 3RU9A 5JO0A 4V2UA 5ELMA 1ZGAA 1L4KA 2QM3A 2BH9A 4HN9A 3KLNA 4CLHA 4CQLB 3EXIB 5DM4A 2K4MA 5HGJA 5E4JA 1XRNA 3DD1A 5EE5B 3TQIA 3GROA 1N2IA 1NFQA 4BASA 4K9OA 3ZHUA 5GMOA 3CR7A 1ZDMA 4XRRA 2VJNA 4QOEA 1NUPA 1HKUA 5TS2A 1LBSA 3EGCA 2H1WA 2ONCA 4Y0NA 3RVLA 4EJ6A 4NNJA 3WL7A 5HJ5A 2C78A 2YY5A 4YPFA 3UY4A 2GH1A 5AT1A 3EH2A 5DTQA 4CIWA 1QUFA 4EAQA 2C88A 2V97A 3QK7A 4JMLA 3OESA 3RHSA 4BQEA 3ANXA 2IYEA 4NATA 1P1BA 2MT9A 3HYNA 3WLAA 2JJ1A 3HKDA 1ZCAA 4QFMA 3PHGA 1DJMA 4RTSA 3CB2A 3P2MA 1Z7BA 3UC5A 5BSVA 3ABIA 4BUZA 1RZUA 4E5VA 5HW0A 2IS1A 3BWMA 2E21A 5LM3A 2P9HA 3CT6A 1DUVG 3EWNA 2RHOA 1T8TA 3Q0IA 4FTWA 4NMMA 2WQ7A 4I55A 1X1EA 1O97D 3ZGLA 1ZIPA 1ZM9A 2GF2A 3ISVA 2B92A 1KSGA 3U44A 3OE7A 1P2FA 1ZIYA 5CAEA 5AVXA 3U7FB 4HAYA 2GR9A 5LYJB 5CGZA 2JFZA 4OEHA 1BVUA 1FYVA 1GPWB 4GKAA 4C30A 3MQFA 5A3SA 4URFA 4YJ2B 5EJ4A 4PQGA 4HJXA 2PJZA 1T1SA 2HLNA 1RCUA 4GEKA 3S55A 3TFWA 4GSLA 5KTMA 1QMPA 1NI4B 1NURA 4DLPA 1Z0JA 3UFXB 1DCTA 1X7GA 2WKSA 2N46A 5BRNA 2OBLA 1P5JA 2RHBA 3PUZA 4IDPA 1E6LA 2N75A 3X1YA 1NW5A 5AVYA 2P2GA 1U7OA 5CFQA 1UBHS 2O0KA 4GOND 4L9WA 1JI0A 1QE5A 4IFIA 1A9XB 2GN8A 3FNRA 3KDAA 4UU7A 4UM9B 3DQPA 1T8WA 2NW6A 2P5TB 3B2QA 1RJFA 2IYXA 3IXLA 4DDUA 1GQSA 1K2VN 3BWEA 4FWBA 4OUDB 3ZTTA 1PO7A 2ROQA 5AVJA 1GQRA 3NP7A 2JEZA 3I6QA 2RE8A 2HIGA 4GT1A 5BMVA 3B7GA 1MB9A 1IG3A 3AERB 3DEYX 4D97A 5JYBA 3KZOA 1I0LA 1W4AA 2G06A 4IIJB 2OBBA 2ODQA 4X65B 1NYTA 2EBWA 3ZGVA 4NOKA 4WV3A 5AHRA 4RLFA 3EDMA 3A2LA 2HRDA 3L93A 4XGQA 3VNBA 4A03A 4P4TA 1CVIA 4F85A 1UBLS 5J47A 1C29B 2ZI5A 3L4BC 3W4JA 3K8ZA 2GEJA 4CDNA 4YR9A 1O8BA 2Q0SA 1XVIA 4RPIA 5F7JA 1U2GA 4MVCA 4FIZA 1HFEL 3O8RA 2ZXFA 1YAHA 5FHQA 2NPOA 2ZB3A 3V8EA 2UYOA 3C5CA 2LDBA 1U8TA 2VNSA 1H8ED 3RUPA 3GPDG 3PNOA 4YV1A 1SCIA 2I9PA 4D9HA 4DCTA 3OMWA 3Q2OA 1N6OA 3FOWA 3MA0A 2XRYA 4LY6A 3FETA 2H7VA 1IN4A 1OE0A 4PWYA 2FJ0A 3F9RA 4Y2HA 1TMOA 4XSGA 4ZOCA 5B58C 4H3KB 4U7GA 1YDMA 1KNQA 1E94E 1YT5A 1NYLA 4LYJA 3V4ZA 5HSGA 3I5UA 4CYMA 1JQDA 1YJXA 3ESXA 4PNHA 3AJRA 3B8EA 3BG5A 3I3SR 4RK5A 4RXUA 5BYKA 1JVNA 4IQGA 1NBOA 2BFFB 5HA5A 3FCCA 3DMFA 2OXTA 4WNYA 3JVIA 4E4TA 3VNSA 5BW4A 4CLEA 3U3KA 4HLDA 3WGYA 3UXHA 2HCBA 4B4OA 1E8MA 1U3DA 1ZQ9A 5M04A 1Z28A 3AR7A 1X19A 4G4SP 2KQUA 2XUOA 3HUUA 1S5PA 2XDYA 2V0CA 3L7AA 1JTVA 2C0CA 2EW1A 2VPTA 3H0CA 3L05A 4HXEB 4MUNA 3WICA 2HA2A 3ACDA 3G1TA 4AURA 2JVIA 1MRSA 1XKQA 5MF6A 5JZBA 1ABBA 2M32A 4D0GA 1DXHA 3NANA 2IS4A 2HO4A 5FBVB 2VDQB 5AW1A 1XCLA 3ZJYA 2AZXA 1UH5A 2MSNA 4M76B 4J0EA 1NIPA 3C6QA 2B7BA 2CVQA 4H77A 4CMAA 4C7OB 2Y1FA 1K68A 4MVXA 4O4LF 2VJCA 1DAGA 3ROQA 3IV6A 1RAAA 2QK4A 1EFUA 1YRHA 3L6EA 3TBFA 1IY2A 1NPDA 3F67A 3UJAA 1QF7A 2F9LA 3BWBA 4K3UA 4Z5XA 2BHSA 4JASB 2O2IA 1ZI9A 1D4OA 4CM8A 1GRRA 3EQ7A 4EIWA 2ZB7A 1CX9B 2WJVA 4ZQHA 5JMTA 1V3UA 1FZTA 2EYQA 3OLCX 2LVBA 4GU5A 4J90A 2XA9A 4BFXA 2B4RO 4TPKA 2RGAA 4P36A 3WBBA 4S05A 9GPBA 4TTTS 4TKUA 4DLTA 1XXHB 3EPRA 3PNPA 1M5TA 5ARBA 2N1BA 4JZYA 4FYVA 3H1EA 2W11A 1IM5A 3TLZA 5C8VA 1EP9A 4PICA 1Y1TA 4YLEA 2BFEA 1UZNA 3FNFA 1I5RA 1TYAE 2BHNA 4OSOA 4ZV7A 3RWMB 4A8TA 5JY6A 4XD7D 2O07A 3JWPA 4JVOA 4FOTA 4JT4A 1H1TA 2VTEA 5H4GA 4MYCA 4TMVA 5FLKA 4RZHA 3TX2A 2ZBVA 1KQ3A 2Q1XA 3Q87B 4RIFA 3OAAA 3ST7A 4ZDKA 3P2KA 3AEUB 1BYUA 2FZVA 4QVGA 4LDJA 4BTLA 1T3LA 3ZU5A 3WNQA 2GA8A 3Q5GA 4OI1A 3SJCA 1X80A 3WQSB 1M8FA 3UAZA 4AM8A 4CI9A 4BNXA 3FN4A 1ORVA 4EUFA 1NUAA 2QHXA 5EXDA 1SUWA 4ME6A 1QFMA 4O2BA 3RU7A 2KPOA 4E2WA 4DPLA 3A3OA 3VDNB 3IAFA 1O0BA 2Z8YM 4QBTA 4UBOA 2XLBA 4YYEA 2GPTA 4D6PA 4IHJF 2BGMA 4RW0A 5EZSA 4L3WA 3M6WA 4OREX 4UCXA 4XQ0A 5CVVA 3VPAA 5IFLA 4F91B 1ZD8A 4MEAA 1WBBA 1M2VB 1G42A 3RHZA 2WJGA 1CR4A 1R66A 3M6MD 2Q21A 2UVPB 4WKGA 3OUZA 4K6HA 4KN6A 1BJTA 2H1CA 4UPVA 2OG1A 1ZUHA 1ISJA 3C8DA 2O7RA 2QXYA 3UJPA 3MWEB 4A6XA 4D3ZA 1FRFS 1Z56C 3GJ8A 7AT1A 3A3YA 1RZVA 1KY4A 4MUHA 3GGDA 1DJOA 4R6WA 3QVOA 1N6RA 2YV1A 3TYXA 4ECAA 5JARA 3LV8A 2PQ2A 2GGSA 2YMMA 2ZIAA 3G2QA 5DSZA 2O06A 3TM5A 3IE1A 1BXGB 1P5FA 3ILXA 5K8CA 3NWPA 4BZPA 1J8FA 3ETNA 1R0LA 1ODCA 1QVRA 1XZPA 3ONDA 3S6JA 4XLLA 3GUYA 3HP4A 3K5HA 3NETA 3ZLBA 3BIXA 1M1ZA 1O6BA 1P1RA 3QJYA 4LRYA 3FPSA 3GT4A 4M37A 4WZAB 5EXSA 5IBRA 4E11A 4ZT4A 3L7BA 2A86A 2L82A 2QL9A 1NM5A 2R11A 1L4FA 4GO1A 2L19A 4QDZA 2IHKA 3NTRA 2EL7A 4H7DA 4RKRA 4ZI7F 4H6XA 2F8LA 4XDZA 4MW9A 3VSCA 1A5TA 1XB2A 3ECCA 4AUMA 3O84A 3DZGA 2PXXA 5IDXA 3FOZA 1LLFA 1XF9A 2FN4A 4B4DA 4MQ4A 1VHDA 3THRA 1ZJ5A 5CNMA 1V1RA 3N8HA 3FRJA 3KYCB 4RK6A 2AX4A 4A16A 4YFVA 2NUPB 3TG2A 2CLKB 3E8SA 5E9QA 2H0RA 2RAFA 3RIHA 4D81A 5BOSA 5I4KA 4Q3KA 3T5PA 3R4CA 2ABWA 4O1HA 1NNSA 2RJOA 1CQZA 4OIFA 2H07A 2XNSA 1X1QA 3GA7A 4MQLA 3T1NA 4TM7A 5A9SB 1S2DA 3N8IA 2P67A 2RG7A 5A4JA 3PFBA 1E1NA 1FMTA 5JE8A 4M1QA 2YQ5A 5AXBA 2AXQA 5TV2A 1BFUA 1GO2A 2WWWA 2C77A 3DAGA 4PONA 4ZXPA 1T2UA 2BMJA 2P40A 3PL1A 4XX0B 1DU4A 1AKMA 1KIFA 1W49A 3QXCA 4TVOA 1SO8A 4OYYA 2ZI3A 1YULA 4QO7A 2Z5FA 4RGYA 3WYBA 3FNEA 2BJHA 2GK6A 3EARA 1GN9A 4IXDA 3ZDYB 3T7JA 3RVJA 2K2QB 3IMEA 4G67A 1ZW6A 1Y37A 4CNQA 4UARA 2JIOA 5SICE 3W6NA 1RFLA 2GCEA 4CKBA 3GPCA 3RKUA 4CL2A 4MUXA 5EHXA 2UZIR 1KFCB 2H9IA 3IIKA 5G0SA 2G4VA 3B6EA 3MGBA 4QBKA 2PBRA 1KZYC 1EZZA 3VU3A 4K5QA 3VHXB 4IKPA 1DIOB 1F8YA 3ADBA 4C2AA 2NSDA 4RYLA 3IKVA 1FVXA 3IGFA 4KDCA 4HYTA 2WYOA 2M6LA 5E2BA 4BRSA 8GPBA 2DHDA 5E9AA 4MQFB 1JMYA 4KBGA 4M60A 1JIJA 5BSMA 4H3HB 1J42A 3TLEA 2P5YA 2Q7DA 1IHYA 4IIDA 1SIUA 4O2AB 3N2EA 4Q48A 1UJ5A 4Z1MD 5JCJD 3FX2A 4NH4A 2FMTA 4FDLA 4B31A 4CFYA 2C5LA 3U3RA 4CMIA 4HEHA 1A2KC 3GVPA 4UUAA 3ABZA 4UNNA 3NM4A 1JHZA 3PXBA 4QPCA 3I5YA 1RAEA 2OXRA 2HGZA 2OAP1 2RI6A 3G2JA 3FIJA 5EHIA 2D7DA 3FNHA 1SU4A 3UCXA 2FX2A 5LZ9A 2Q0QA 3U31A 3JQ8A 1XAJA 3PEFA 1YE3A 1PW5A 2HREA 4CN9A 1Z0AA 2JAWA 1J06A 1N5RA 1Q1NA 1WRBA 2BFBB 3ISTA 3LBFA 4UVEA 2FWAA 3LLUA 5LN1A 3QUTA 4B09A 4BQPA 3EYWA 2BM8A 2JCSA 1Y9DA 5HQTA 1C9MA 2HQSA 3TM4A 1Z47A 2RK4A 3E4DA 3GMTA 3OEED 5TVGA 4W5HA 3IFSA 4CCYB 2ZCJA 1WZNA 2X0IA 4HAIA 1J0BA 1K63A 4F3RA 4ZYWA 2FPPA 3LT2A 4JLAA 4MTCA 4P5PA 4DR7B 3TZHA 2GCNA 5E38A 4DUGA 3LP8A 4LI0A 5CT6A 2GILA 3I2JA 2I0FA 4B7XA 1KAMA 3CBQA 4KJXA 4HTFB 5A62A 5JDIA 1SU8A 2GYYA 1M0EA 1XAIA 3M2PA 1LI7A 2VYND 3RM3A 5ALRA 2CLFB 4H7PA 4S1VA 1IONA 2P2SA 1H9BA 3FZQA 1TTQB 2R85A 5EWMB 3RYTC 2Q3BA 4MS1B 3ZH9B 1JU9A 3EXFB 4QBIA 5AKGA 1AK9A 1GL7A 2GN1A 2O7VA 1L4EA 3JD3A 4MPDA 4ZWNA 3QVXA 2HJVA 3IOCA 3GFGA 1G21B 2R5NA 5BR8B 1PD1A 1RHRA 4C3VA 4BNMA 3I01M 2YZKA 1N57A 4RA9B 5JO9A 4RD2A 1KBOA 2Q2NA 5DP2A 1R4AA 5FO0A 3UBMA 2R25B 3UENA 1FP7A 4HH3C 4MQ5A 5BY2A 3CV3A 2R9VA 3AVWA 1A4XA 3ILSA 1YZUA 2BMVA 1M54A 3R5SA 4EHFA 4PTLA 1B41A 4JBWA 4DLVA 5KQSA 4BJ6A 1MEOA 3FZYA 1CE8B 1ZD4A 2GJKA 3HCFA 4QTTB 3U3OA 5FBKA 5LZ7A 3AV3A 2XZTA 5CFOA 5JVDA 3DONA 3V4LA 2NZUG 2DWPA 3ZWVA 4FFNA 1W581 1GL6A 2TS1A 3A9UA 3ZZ1A 4RANA 5BQXA 2JFFA 3L92A 3LHSA 4O6VA 1M2FA 2SECE 5J2TB 4DRXB 2W4QA 1NM5C 4YR7A 2QRLA 4GRAA 1RQRA 3PXDA 2OD2A 1EWQA 4J0FA 4LBWA 4U7WA 5JH7F 3ZDXB 3FPEA 2JIZD 2AZDA 3OLVA 3CLVA 1RWNA 4JROA 1KP9A 4MRNA 2P6OA 1CUXA 1QB8A 2H2DA 2QD3A 4JDPA 2GLXA 4C5CA 4KO3S 3GFFA 5ESRA 1JA9A 1R10A 1P5HA 4KG7A 2WYUA 1THZA 3MGAA 4YALA 3W8NA 1WPGA 3KQKA 4A8PA 5DNDA 1KEEA 5I01A 3FAZA 3VYUB 1E3LA 4G1EB 1PGQA 5EQJB 2ATEA 4GRIA 2M6SA 2D2XA 3ZGZA 4LK3A 2NYVA 3WNVA 4QU9A 4X94A 2GAIA 3CH5A 4F8EA 2QT1A 3TOVA 1JT2A 1GQOA 4M8LA 1EXNA 1MC8A 3H9UA 5K8LA 1DBQA 1M2GA 4YRTA 2BW0A 1G8JA 1ZK3A 2QTNA 2AFRA 1IQPA 2YHIA 3CO5A 4XWWA 3KEMA 1E2UA 3N8GA 2A0UA 2H5EA 2I1QA 1A4RA 2HHAA 2WKQA 4FYIA 1H65A 2EDAA 4WLOA 3RFFA 5C7LO 2ZTVA 4K81B 4CODB 2R8RA 1TQ2A 2ZAMA 1M6HA 3AK4A 2AMLA 4ICIA 5CK4A 5REQA 5AI8A 2IUTA 5JV5A 5C31A 3H2BA 3W2FA 1XA3A 3EVCA 5KNLA 3AVQA 5KPDA 1Z7YA 2VBFA 2YIVX 3ORSA 4KN9S 4IVNA 4Q4AA 3O3OB 4QYIA 2PRJA 3O75A 2O1SA 4M86A 2ZR7A 3T0GA 4HEQA 1QVVA 1ZGCA 3R75A 1BHJA 3UT5B 3N2KB 2FHSA 4D56A 3AFMA 3GO4A 4BWYA 1QK3A 4JBHA 2PPVA 3WL8A 3DBRA 2GO1A 4YJHB 2J3LA 3QENA 4TTVA 1KI7A 4XLTA 4XM1A 1OV6A 1HGXA 1JPJA 3E0QA 1G66A 3IVAA 3OBIA 5DBIA 3JRNA 3RC7A 4BX0A 1Z18A 3G79A 4QODA 3ZX4A 1RXSA 3W5HA 5D87A 1Y8QA 2PRKA 2YMPA 4P81A 3VR5A 4C0AC 5FR2A 5HCUA 2F3SA 1G6KA 1BW9B 1N5LA 1IHOA 5B1SA 1NW7A 1RPNA 2QRVB 3AZOA 3W8RA 1GXSA 1XZMA 3FJOA 3LUKA 2FW0A 2E37A 1PJSA 3BMCB 3HY3A 3REFA 3UMBA 4ROTA 3AUKA 1CR6A 4QREA 5J2UA 4PLHA 3C16C 1ISIA 3LCUA 1DZ3A 1I4EB 5LQAA 3AKZA 3OZBA 4RHUA 2PIDA 3L18A 4BTEA 1W76A 5HF9A 5I8PA 5L3RA 1L5HA 5IDVA 5EMKA 4JXZA 5CB6A 5F51A 2ZYDA 3MW8A 4HNGA 1R12A 3DZ8A 4UREA 3KHKA 4WVLA 4RSGA 2OCPA 1BS1A 2HLDA 2R1TA 3L3BA 4GWLA 1NNUA 3LVQE 3SQDA 3VYVA 1DAEA 2QTVB 1SB9A 4EA6A 1JR3E 2I7VA 3RO7A 2ZCUA 4CT4B 1E4VA 4I55F 2QWXA 4ABYA 2C9MA 2RHCA 4QSMA 3UANA 1EVYA 4I2NA 5DW0A 1DCMA 5DI3B 3ZWCA 3CLSD 4EGQA 4F9GA 5BWLA 5JAOA 5F7XA 3IP1A 3QVSA 4QNNA 3K4HA 4Z0NA 5CLFA 1BVYF 4CQNA 4DG9A 4TV9F 4HUQB 5M34A 1NHGA 1M1YB 1NI3A 4AB1A 2SKDA 1E69A 4CM6A 5JDIC 4L8LA 3G7SA 3QWHA 4G3XA 3Q7EA 1J97A 3R8FA 4JQZA 1YL6A 4W1QA 1DRWA 3MLEA 3QG1A 1NJ6A 1UFKA 2ZRLA 1HRKA 3GLGE 1ILEA 1TJYA 3MHTA 3OQJA 1B2LA 4FC6A 4XUDA 3FUWA 2DM6A 2XWSA 4O1MA 5AJWA 1P1FA 2ONZA 4D5EA 1L5KA 1KTIA 4WZBB 2WUDA 3E22A 3UXYA 3AW9A 2GKSA 3WNCA 4CMBA 4DV0B 2AZ4A 1KGSA 3LFHA 4KIWA 2D00A 3UMGA 5DX0A 3BK1A 1K3TA 2V74B 2W98A 3JR7A 3OQVA 4KPGA 3SQNA 3ZU3A 4DWVA 4JLOA 2XVXA 2YWGA 5EMMA 3Q12A 1E4EB 3SZOA 4UHKA 1UDRA 3UVEA 1JSRA 5KTPA 4OHWA 5CA1B 5BMVF 4V02A 1NVDA 4EJSA 4LDQA 4P9NA 4UE2A 4CMHA 4MS4A 4YRDA 2VPPA 5TF0A 3SXPA 1NNEA 1KA9H 4X8LA 5HFAA 5ALDA 1GITA 1TMKA 2AA3A 5LDGA 4W5NA 4P6VF 4C0HA 2IHBA 3DDOA 4FDAA 2FZGA 2PS9A 3B8HA 3UIEA 2JFUA 2Q5CA 2C5GA 3QLJA 4OQ4A 4IXTA 1FDUA 3Q7PA 5DYYA 2V9ZA 3RRZA 5KYKA 4G5OA 4HYQA 1X0VA 4V0SA 1JDBC 4BUCA 2R60A 1QFSA 1WUHS 1KOJA 3FTCA 2WIJA 4YXWD 5IHXA 5B1HA 4S12A 4D4MA 2W9XA 3SSNA 1PUJA 1AKUA 2IHUA 3OF3A 5HOEA 3L6OO 4IDCA 1JFVA 5DWVA 1II9A 2ZRCA 4QDKA 4YACA 5BSEA 5JHHB 1J2JA 1UFQA 2CDAA 1PR6A 4NENA 4BNKA 1G291 4XQEA 2QTTA 5A5FA 1BDMA 2FKAA 1Z4KA 5BNTA 1QF6A 4RPKA 3QM1A 3MINA 4A2PA 4BVHA 5AJUA 1DQPA 4FGZA 3B51X 1VQ1A 4R41A 4CCSA 2CXXA 4I9NA 2ET6A 4U8GA 3DBLB 5H59A 1RLTA 4QKQA 2HK9A 1ZRNA 1RWKA 3EDRA 3LF2A 1GT6A 4HKTA 2IP4A 1DTEA 1BQEA 3O21A 2EERA 1KMHA 2UDPA 4X66B 2QBYA 3DFMA 3FE2A 3IKMB 3O8LA 1I36A 4GX5A 4KPUA 1ST3A 2C0PA 4TWZA 2AKAB 4B74A 3FI0A 2JAUA 5HM6A 3IP8A 5FORA 2HHLA 3AKYA 3MAGA 1U8UA 3LBHA 1Y80A 1C1HA 4HQNA 1FQJA 2XA2A 4ZT7A 2G9NA 3K0FA 2Z5VA 2ZIXA 1GZ5A 4MB6A 2M6RA 4BNVA 3F71A 3U9SA 3AP3A 1T15A 3LGSA 1EDBA 2FV8A 3TN7A 1ZH2A 5CITA 2GI4A 1HT2E 1V3QE 2MHCA 2P3SA 2P7IA 3A1UA 4LOLA 2CUNA 4OK6A 5H16A 4MVJA 1RJEA 1ZITA 2RHJA 2VTDA 4JR2A 1WTCA 2XI4A 1P0PA 1PQYA 3QMMA 1PGJA 4D9FA 2I91A 2V0GA 2UZ0A 2GZRA 1YZTA 2RHGB 4M21A 1LKZA 1Z0IA 1EE2A 4MGIR 1ZMRA 3GZNA 4KGVA 1LSUA 3UHJA 5CB4A 5LB4A 1OIXA 4YRGA 3AILA 1K0FA 2PBFA 1T2NA 3H1BA 2CDCA 4F8JA 2Z4SA 4HWRA 1SQGA 1GFSA 2ARKA 4L8VA 4EJ0A 5FWDA 1PT5A 1GGHA 2HKIA 1J8DA 2UKDA 2IV7A 1EP1B 4CKZA 3OOJA 5F76A 1GTMA 2QZZA 3RVPA 2RGNA 4KW7A 1CJKC 2AZMA 3R4VA 1ZCFA 1I1OA 2VJLA 3GEPA 1X6VA 5AXCA 3ROFA 1POXA 2Q9CA 1SWVA 2B94A 5TMPA 1CUSA 4W9RA 2GX6A 1O0SA 2WVGA 2XTJA 3IPAA 2ILTA 3ZI7A 4A73A 3T3DA 4JA0A 3RYHA 3NAQA 4IRXA 4EA7A 1IM2A 4PZCA 1CDDA 1EDDA 2ECOA 1DV2A 4UTOA 2MSEB 3JTMA 4U4AA 5L7YA 5AXAA 3MIZA 3KPYA 1K8RA 1EFPA 1W4ZA 4XWGA 2DRIA 2GCGA 3IAHA 4IDEA 1TFUA 4X7MA 2YFYA 4F3NA 5ALLA 4BO5A 4OB7A 1UINA 2A30A 5JRZA 4FSXA 2IV3A 1P6XA 1Z37A 2C95A 3CG4A 4A0QA 5KDOA 1NVKA 3ZY4A 3S70A 4UJ3A 2AMVA 3CJQA 2FMHA 5KSZA 4GS5A 5EJ2A 1USIA 2CKDA 4DRZA 5AQ1A 2QVBA 4F5ZA 3GLFB 4OP2A 4BVAA 6GPBA 2IHTA 1AHNA 1JEQB 1O94A 1GUZA 2AEFA 2W83A 4TQAA 3VOTA 3WHLA 4BQRA 3COJA 1QRRA 3QOXA 2V6FA 2VSOA 3EBOA 4O2BF 3ZWKA 5LZ2A 4M0MA 1TTTA 2E0IA 1N0UA 1TZBA 2Q9BA 4PLYA 1LXCA 5E6RB 3ILYA 1NW3A 2QM7A 4JUFA 4L6IA 4UD6A 5I9NA 2HZ7A 2JJ2D 3GFRA 4Q7KA 4DYVA 3K35A 2HCFA 2I4TA 3BXEA 1AQUA 1FU7A 1F2VA 1JXQA 1R0ZA 2LKCA 2Q07A 1NG1A 1V43A 1COZA 3VSDA 3WYAA 1T2FA 2SNIE 3DVAB 1NMEA 2ZRQA 3OOHA 3PHBE 1ZICA 3R3SA 5JSZA 2C4NA 1DJLA 3CCCA 4M0LA 4JK3A 3A9TA 2K87A 3B6ZA 4EELA 1H2ZA 2HEIA 1N2GA 1TK3A 4JJ7A 4UXIA 5BYAA 2RGGA 2VSNA 2JLRA 3IQXA 4FINA 2Y1EA 4RORA 1GKYA 2WUEA 3I0ZA 1ECLA 4IMJB 3U39A 2AFHB 1CY6A 4D3YA 5CVTA 4EJSC 1NN5A 1CP2A 1VG1A 2H4HA 5H3LA 3KIPA 4F2PA 1N1DA 5KX5B 3PJRA 3B6IA 5BN4B 3WRVA 1PWEA 1US8A 1T4DA 1YAJA 2JIMA 2RK3A 4LRSB 3STVA 1J39A 4BAZA 3GNTA 2IDJA 1GPMA 1OXXK 2P75A 4JR0A 4MITA 4PCVA 1N5MA 2XE7A 4EVSA 2GSWA 2V0NA 2D3TA 5BRAA 3MMZA 3LWZA 3GVXA 1S3SA 4LRWA 1U9YA 1EQAA 3B12A 3EVGA 3D0OA 1LBEA 1VIVA 5K3SA 4B43A 2J6HA 4HP8A 1E1YA 3WVNA 1T5HX 1AA9A 2PMWB 3WKBA 2V7QD 4KI7A 4NK5A 3QBJA 1QIKA 2RBGA 5HRAA 4DNPA 3LWBA 4DJ5X 2BFCA 3OO1A 2VJYA 2B2CA 3H9BA 1YR2A 4GC5A 3A6EA 2Q3JA 4Y2YA 1M73E 1D6JA 4M87A 2VF8A 2WOOA 5LYYA 4WJZA 1R4NA 2PG3A 3AI2A 4QXPA 4WJKB 3TSZA 5KWEA 4HTAA 3R9IA 3UUFA 2ADOA 3A1CA 1PR2A 2PEYA 2H4WA 2Y1KA 3EGXA 4QNMA 3ILVA 2WWIA 5KHLB 1T9BA 1TA4A 2PUVA 5C46F 4ASUD 4JB2A 4RJTA 2OYSA 2PX6A 3KVVA 1YBHA 1B74A 2E87A 3FG9A 3KLBA 4H0NA 4GIBA 4HL6A 3W8FA 4B8WA 4ZEOA 4CN8A 3O4RA 4AS3A 2C29D 3MXTA 5D3MB 2ORVA 3MUNA 1VCHA 3OZIA 1FZQA 4PAQA 3RANA 3RASA 3IH5A 2C8KA 1HNWB 1MQ8B 4JELA 4AT1A 1U7TA 5B6JA 2IYTA 3DDSA 3INYA 3V55A 5IT9A 3LW7A 2D5LA 4O0MA 3W4IA 1V11B 4GUDA 5HF6A 1ZBDA 3E3MA 3V1TC 2VJMB 4HDNB 4BX3A 4CM9D 2WFLB 4TT8A 5AI0A 1ZNQO 3GRRA 4EDHA 2Z5GA 3EJ6A 3NVDA 4QPDA 2X6RA 3HLYA 3GP8A 1LFDB 3R23A 3Q98A 4HN4B 1GEGA 4N5NA 1G16A 3K9BA 3V8BA 1Y7TA 1Z5ZA 4G63A 1OBVA 1OGIA 3HCEA 3I64A 3G49A 2NAPA 2PMCA 1RJ9A 1Y5LA 2NO1A 5DXAA 3NASA 1ZGBA 4E5UA 4LNUB 1BWQA 1YDHA 1KK2A 3WSTA 4BBJA 4ARIA 1A9ZA 2GNAA 4FX5A 1P1CA 1SHLA 3H1GA 1WUIS 2QM0A 3A3KA 3PDHA 4AO7A 2NNLD 2PUHA 3BA1A 1YUBA 4H1HA 3U2QA 3LCVB 2RGNC 4OXKA 1WXWA 5DCUA 2AK2A 2ERCA 1XEXA 2BBOA 3WWZA 4CMJA 1E9SA 2VHYA 2ETVA 4K9LA 4OBWA 3AINA 5LB2A 1YUMA 4I4TB 2Y0DA 2QVLA 3NHBA 2BM9A 3DEHA 4ZRDA 5TGDA 1YE5A 4C0LA 1QCYA 3MFQA 1N7IA 4H7HA 3R40A 1GCOA 5GJWC 4QPNA 4TMTA 3W78A 1VSQA 3IAEA 1IVYA 1CS0B 1QQ5A 2GS9A 1FOEB 2QGZA 2R8ZA 4X95A 3DYVA 2ZLBA 1Q44A 1FRNA 3VTAA 3LL7A 2CLDX 4G0XA 1EX9A 5HOQA 4NZNA 3SR4A 1PJ4A 2O2EA 3IHKA 4CFZA 2HA7A 2MJLA 4NBVA 3IA2A 3B1ZA 4I3FA 3FNIA 2FG7C 1G8GA 1YACA 3LF1A 2DYKA 2I4NA 3WWPA 4XIFA 3PGLA 1PVOA 1HG0A 3ABQB 5A3JA 4XKJA 2Z8YA 2PS0A 3KLPX 1T8PA 1O94C 1P0CA 2PX0A 3GD5A 3O1IC 2QTHA 1AK1A 3WOVA 5E2IA 4AZVA 3DHNA 1F2UB 4MRSA 1B3BA 2B3TA 2FF7A 3PQ8A 2AL7A 3IQGX 4XFKA 4ER6A 2FN3A 4YAWA 1RI4A 5BMOA 3HXOA 5BN5B 1HZJA 4CTMA 3UH1A 4F1WA 3A70A 1GPAA 3KKNA 3PC8C 1JEYB 3H11B 2YYAA 3EGWA 3OMXA 4D9BA 4EFDA 4BEBA 2CBZA 1GAQA 2YZGA 5CCBA 3WYGA 3O8QA 1K7CA 2DERA 1E0SA 4YGYA 2BGUA 1H1DA 3ORRA 4M6WA 4FYJA 2ZRFA 3TMAA 5A5EA 2UZ1A 3OICA 1XXHE 4MQBA 1XNJA 4BNDB 1QF9A 2A3NA 1U02A 3MNFA 2XD9A 5J4VA 5IXSA 4Z49A 5L3QA 3UOAB 3WA6A 2GPWA 3RVDA 1JMKC 4UFOA 4NYIQ 4PPNA 1XWIA 2Y77A 3BKWA 3C3WA 2NU7B 5ICMA 2H9AA 2D8AA 3SKYA 3EEBA 1E3TA 5TJHA 5KYXA 1R0WA 3WB0A 4LV8B 2CV1A 3S44A 2O0HA 2WWRA 3LGXA 2ISSD 1U81A 3IEKA 3QLEA 4W7HA 4EFNA 2AYZA 3F3SA 1NDQA 2E85A 3G6KA 4OQPA 5JVDF 3BAZA 1SWWA 1JNYA 3C3DA 3T5BA 4AKEA 2BGRA 2AYYA 3KKLA 5CA0A 2ES4A 4MDEA 3KE8A 4RZ3A 3O4FA 2O2CA 4Y1FA 1G8PA 5JDCA 2BFMA 2HSZA 3UKOA 4BBZA 4OLBA 4IRMA 1TM5E 4MCIA 1RYHA 5IVPA 2W48A 4MW0A 2PGLA 4AKGA 1C9NA 3E23A 2FSFA 1GYQA 4R2WA 2YMLA 3ZWXA 1Z2EA 5JI2E 1SG6A 4NXNB 2IYNA 3HP7A 3QUBA 1UK6A 1BWPA 5AI9A 2O6LA 4IILA 1RWBA 3K70B 5JXJA 4J0QA 4UMEA 1KVRA 2EIHA 2R7NA 4G5RA 1GG2A 3Q8MA 2JJ8A 1KPGA 4TWBA 1GNRA 1NBMA 5E6SB 3GFPA 2D3WA 3FUCA 4NDAA 2W2XA 1NG9A 5FPKA 3D7KA 3KJEA 1H66A 3I45A 2P0YA 1J21A 1U5BA 3A3NA 4HJRA 4ND2A 1JDJA 4ZXFA 3JYHA