3SFVA

Crystal structure of the gdp-bound rab1a s25n mutant in complex with the coiled-coil domain of lida from legionella pneumophila
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
179
Chain Sequence
LGSMSSMNPEYDYLFKLLLIGDSGVGKNCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/protein binding
molecule keywords Ras-related protein Rab-1A
publication title Structural Insights into a Unique Legionella pneumophila Effector LidA Recognizing Both GDP and GTP Bound Rab1 in Their Active State
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sfvA00
3U44B 5CM9C 2IWRA 1DBSA 1NNEA 3RRZA 2HCJB 4GFDA 2UKDA 2BMEA 3EPHA 1Z83A 2CHGA 4P31A 1KI8A 1DAEA 1F2TA 2J45A 1EESA 1R0YA 3DO6A 4BLPA 3NDPA 3PIRA 4MITA 4KYIB 4QGGA 1Q57A 4KSBA 4JLKA 3UMFA 4GMDA 1P4SA 4RCYA 1B23P 2P2LA 1DAGA 1RJ9A 3Q5DA 1E0AA 2BCJQ 2ZR9A 4M1WA 3OAAD 4PAOA 5JWRA 2E9SA 3BB3A 1IN8A 2KE5A 5FL7A 3RS7A 4C3ZA 3SYLA 5LB4A 1YR9A 2FPKA 1SVSA 3SJBA 2YWGA 2LKCA 3QXJA 4KYUA 3ZD6A 2IS6A 4JLPA 2ZEJA 2J7PA 5TVKA 4XSGA 2AFHE 3ASZA 1L8QA 1MO4A 3RWMB 3DZ8A 3KUDA 3MWJA 3UG6A 4Q4AA 1HEIA 1E9EA 2OFWA 1A1VA 2JIZA 4HB3A 5TXGA 5DNYB 1M7HA 5JRJA 5JS8A 5F98A 4DRZA 4LBWA 4TQ9A 4DT1A 2FG5A 2ZI7A 4O2LA 1K5DA 1N0VC 3A1SA 1P6XA 1KMHB 3KJEA 4TTRA 4ACBA 2H92A 4MDFA 3L82B 3F8TA 4HUQA 3Q9LA 2O8BA 2V7QA 2ZRMA 3CWZA 1S96A 2ODBA 3GCGA 2O0KA 3IQXA 1KHTA 5GVSA 1W46A 4UKDA 6Q21A 1E99A 3NHBA 3D6TB 3RS0A 4PSKA 4UXJA 4ZIRB 2ZJ2A 1GRRA 3K70D 4MKHA 4KHZA 1U8ZA 3MG9A 2QPAA 3CH4B 2QU8A 3O8CA 1VYTA 2CL0X 1IY0A 3KB2A 1DAHA 1HA3A 2ANBA 2PEYA 1TUIA 5FOUA 2YZ2A 1P72A 4B6FA 2ASEA 3HYRA 4IJMA 1P61B 1NG9A 4HEJA 3B9PA 3BBPA 4G01B 4HLUC 5EE3A 1A7JA 2H1LA 4XWOA 5G41A 3AKYA 3CPJB 2O8EB 1XMJA 5J47A 3GJXC 1KYIA 3U6BA 3CX7A 3HR8A 2GCOA 4DZZA 1NF3A 2EFGA 3BH6A 5J5CA 1Z6GA 3CRMA 3OEEA 2WV9A 1S2MA 4B44A 1U0HC 3I62A 1F6BA 2GEVA 4C0LA 3BH7A 3VX3A 4DSOA 3PQCA 4Q4HB 2WJYA 2QPTA 5G3YA 1DE0A 4FIDA 2UZIR 3MAAC 4JSYA 3U3RA 3A58B 3HWSA 2R6AA 4O25A 1KI2A 1RW4A 3NC0C 2TMKA 1A2BA 3S1AA 2XZOA 2OXCA 3PUXA 2DYKA 1SXJE 3FDIA 4B3FX 3K9GA 3P4XA 4QJ4A 4DBLC 3A1WA 5FOWA 1SVMA 3CPHA 1SVKA 4B47A 2PJRA 1ETUA 1LFDB 1XX6A 2IYXA 4ZKEA 5J4HA 3QPWA 3PUZA 3I4LA 4QBIA 3J81k 4RY2A 4AD8A 1GL7A 3ADKA 2WWYA 2O8CA 4QHSA 2KB0A 1II8B 2C9OA 2ZPTX 2W0SA 4WA7A 2VEDA 3VHLB 2A9KA 4B76A 2BVNA 4P4UA 3K0AB 2GVDC 3I8SA 5HKKA 2BEKA 4JKYA 3T1VA 3K0EA 1UFQA 1EFRA 1Q22A 3OZXA 5C2JB 1OW3B 3KX2A 1E69A 1G4AE 1VECA 2A3RA 2QAGB 1KSHA 5KSZA 4DIEA 2QGNA 2ZROA 1ZMXA 5EUMA 3EZ9A 1H8HD 4PSAA 3CR7A 3QKUA 1IN5A 2YNMA 3LXRA 1NKTA 3CRVA 1KJWA 2JLVA 4KXFB 2BDTA 2OZEA 2IK8A 2VBCA 2W6ID 5E7MA 4N0EA 4B2IA 3CPEA 4GMXA 1W36B 2AWOA 2Z0MA 2D7DA 4S35A 4OK3A 4M9QA 4OBEA 4E5UA 1YJ5A 2OBMA 3LDAA 1QVRA 1ZIPA 2OESA 2RB4A 1EXMA 4QC2A 3KJGA 1YZUA 3A6PC 3TKLA 5L3QA 3B1ZA 1E9FA 1G5RA 4HLDA 2HV8A 5FOVA 4DDVA 4IVRA 3C5HA 2C95A 4TZ6A 1TL7C 3MCAA 5JWHA 1Z28A 4I1VA 2X8AA 3B13B 4OQLA 5KNDA 2R6GA 3U60B 4TYQA 3EW9A 4D0LB 3RS2A 1NBME 4DDWA 2O8DA 4PHHA 3G0HA 1E4YA 1QVAA 3AF2A 3T12A 4EFLA 2QAJA 5FFMA 2QM7A 4LJYA 3U3JA 4R71A 4BLSA 3JZMA 5KSYA 4YONB 4PHGA 1KO5A 2BBTA 1DPFA 4LPKA 3NH6A 5HTKA 1E2HA 4B2PA 3L8YA 2IYWA 5L3SA 5JSZB 1MO6A 2GETA 4C7OB 3TSOA 4CEHA 4GDFA 1Q3TA 5IHPA 3LX5A 4XWKA 4DLYA 2HEIA 2HXSA 3C8UA 821PA 5CYOA 3NBZC 4R98A 3RRMA 1KMQA 1M2OB 3RANA 4MRVA 4A0RA 2Q0HA 2AKAB 1TU3A 2HJVA 3IO3A 721PA 3D31A 3TE6A 3GJ5A 4DDUA 3ZQ6A 5AK0A 4M8NE 1XBTA 1GKIA 5EE1A 4LJAA 5DI3A 1UEJA 1TQ4A 1U99A 2AK3A 3QKSB 4H1VA 4RFVA 4TL9A 1ZD1A 3GQBA 3KB1A 1A82A 1OHHA 2QQ0A 1N6PA 2PCJA 3VKHA 2J46A 1R0WA 4Q02A 4LHWA 2WMNB 5DO9A 1N2CE 3VAAA 3IQWA 1XWIA 3IHLA 5FOTA 1E6CA 4IKEA 4HDCA 3LY5A 1IN7A 4CVNA 2OCYC 4DLVA 1NG1A 1IM2A 4LHVA 3T1OA 1ZUNB 4ZDJA 4OHXA 4XWAA 4C30A 4OHWA 2IT1A 4C0QC 1ZNXA 5FL3A 5HCNA 4HLUA 3UIEA 3JVVA 3QBTA 2ECKA 2VF7A 4JL8A 2D4HA 4CRWB 5JBQA 1Q1BA 1MH1A 1QRAA 5EXPA 4DIDA 3QPVA 4M9ZA 2FN4A 4M1YA 4MRSA 5KDOA 4U5XA 3ZIAA 2FPLA 2IUTA 2ZJBA 2PLRA 2GESA 1G21E 3HU3A 3N2EA 2DCUA 1F2TB 4LBYA 4P4SA 3EC2A 3AF0A 2ODEA 3EIEA 1YZGA 4ZPXA 3AEZA 4D4LA 1L7VC 5BYJA 4EJSC 1Q1ZA 3LRPA 3PV0A 4CYMA 3I92A 3VR1A 5KSOA 2QE7A 1F5NA 1RJ9B 2IXGA 4TMTA 5A0FA 2LWIA 1SVIA 2P65A 5JHGB 4O2RA 1LV7A 4P32A 1W0JD 3R8FA 1DAFA 1E2IA 2AR7A 4N1AA 4A2QA 1JBKA 3W9YA 2CEAA 2DWPA 2VRWA 4LBVA 4JMPA 4XH9B 5SZIA 3F0TA 2GK7A 3IIJA 2A5DA 3QQ5A 1Z08A 2QGZA 2V4ZA 5HE8A 4Q4AB 3I8XA 1W36D 1IAQA 1YE8A 2QT0A 1Z22A 3RC3A 2F9MA 2J87A 3VR5A 3QF4A 4PZYA 3EPJA 1E79D 1SULA 4DT1B 1LB1B 1A4RA 1AKYA 1GNQA 2PMKA 2WKQA 4PC7A 2GJSA 3BB4A 2EWWA 1OYYA 2YWEA 3C15C 4X8HA 4DUGA 2D7CA 1G7RA 1U81A 4HSEA 3LNCA 4HYYA 3A4NA 4TYYA 2O8BB 3ZVNA 4AWXA 4JLMA 2XITA 2YWFA 4HAYA 4TSFD 1ELOA 3VNUA 2BHRA 3SE0A 2MSDB 4Y0AA 3AB3A 1PUJA 3ZVRA 5JCZA 4B3GA 4WBSA 2JJ1D 2W0MA 5TMPA 3DM9B 4M4SA 4DCSA 4F92B 2F7SA 3LW7A 4JIMA 4D0GA 2QP4A 4QFMA 2H5EA 3T34A 2GAOA 1P7CA 4Q4JA 3U3MA 3WMFA 4TYPA 2NMVA 1AK2A 2ZSFA 1LTQA 4GI7A 4LYHA 3HU2A 2RGNA 3WMGA 1OFUX 1C9KA 1OH8A 1II9A 2OBNA 2VPPA 4EPVA 5AUNB 2VL7A 3ADCA 3WHKA 4AKIA 2FGKA 1X8LA 2IW3A 2AK2A 1WQ1R 5C4GB 5FTLA 1N6KA 2ZITA 5L3VA 3A8TA 1N6IA 3SZRA 4WAUA 4NH0A 4D80A 2RGEA 1Z6TA 2H7VA 3EZ2A 2FEOA 1U94A 1S3GA 1AS3A 1HE8B 2WKPA 3B8HA 1XXHE 4XIGS 1SXJC 1ZINA 5JJIA 2ZRGA 5GJVC 5IF9A 4QJ3A 2AX4A 2EFCB 2V6JA 4MGZR 4BFVA 3LXXA 1TTTA 4W9MC 2PCLA 1G8FA 3S1AB 4LV6A 2XZLA 1E4VA 2XNDA 3P27A 5DYIA 5JEDA 4HDOB 2WSMA 3MD0A 4YDHB 3PEYA 5CDFA 2ZVQX 4M1KA 2OSBA 2OCBA 1T0HB 3B9QA 2DFKB 1UDXA 3A4MA 3ZZ0A 2GCNA 4B48A 4C2UA 1TF5A 5FTKA 2F1RA 2O8CB 2GJ9A 3X1DA 2H18A 4QRHA 3R20A 1XD2A 5FBVB 4Q9LA 2OLJA 3ICQB 1G18A 2BJVA 3L0PA 1HT1E 5E4FA 4TQUS 4TYNA 5KPJA 4NL4H 3DKPA 4KU4A 1PLLA 1P9RA 1KK0A 2X1VA 4CIDA 1QHIA 3D7MA 3IUYA 5BXQC 1I4LD 3LW8A 2ZS9A 5K8IA 1XTIA 4D4MA 4NE2A 2CK3D 1YRBA 1VCNA 3QSYA 3NH9A 4DLZA 4AKHA 4LK2A 4TLAA 2J7PD 1NY5A 2F43A 4BLRA 1SKQA 4CEIA 5L3QB 4KAXA 1E94E 5BQ5A 2PZGA 4JVLA 1D8TA 4G5RA 4I1SA 1MR3F 3NDBB 4ESHA 4AK9A 1RE0A 1V43A 2DWQA 2WOJA 2RGGA 2ZRKA 2P5SA 1G9XA 4F4JA 4P33A 2ZYTX 3SFZA 2HJGA 4DCVA 4IDPA 1H65A 2O8DB 4PPQA 5C46F 2V7QD 4UXIA 5EQTA 1XU4A 4LOAA 2CVFA 1KAOA 2W2XA 4MRNA 4UQOA 4URWR 3FE2A 4I81A 4EJSA 1Z0AA 1HQYE 3SBEA 1UBGA 3ZH9B 1R0XA 2NOAA 4B35A 1OLOA 3O47A 2AKYA 5KYKA 4LI0A 4DXAA 4ZI3A 5L3SB 4BZXA 4XTRA 1KI1A 1C4OA 2LKDA 4L5BA 4CEHB 3LO5A 1R5OA 3WYFA 2IYVA 4B6EA 1KKMA 1NJGA 1DO2A 4LYAA 3KKPA 3AGPA 1CS4C 1KSJA 4S2EA 4ZCMA 2CLCX 3AKDA 4HAXA 3FMFA 4Z1MD 3I3SR 3HDTA 4JLJA 4LCBA 2VLIA 3TGPA 1XPOA 2C9YA 3A37A 2ZS8A 3CR8A 3E2IA 4TMXA 3ZS8A 5BN5A 4FWTA 1NKSA 2AWNA 1TQ2A 2NG1A 4UNNA 4NDZA 2PH1A 3AF1A 1NN5A 1XD8A 4URYR 4W5WA 2ZYWX 5CK5A 4FCVA 4B75A 2ORIA 5DI3B 3NXSA 2G1KA 2DR3A 4AIIA 3AVOA 3OEED 1G8PA 2Q21A 4A0GA 3T35A 1JAIA 2ZSEA 4Q1CA 3GLFA 1XCMA 4MRPA 4XVRA 1NVXQ 5DHAA 3W6OA 4NCHA 2OILA 3E5HA 2J0VA 4QNRA 1ZM9A 1JQJC 4L9SA 2I3BA 3ONWA 4ZCIA 4F4CA 1OH7A 4KO8A 2IWHA 1NN0A 2OXRA 2P0EA 3Q72A 3EASA 4A15A 5K8UA 1LS1A 4Q66C 3BFXA 1R6BX 4B2LA 3IHWA 4IDOA 4RVCA 4BFTA 2ZI3A 2A7QA 3PJRA 2B8TA 4OL0A 3T1TA 2WHXA 4KI0A 1E1QD 3CF6R 4G5SA 2ZE5A 4HLQB 4YC7A 2J7KA 5L3RA 4FXPA 3WYAA 3W3AA 3R9WA 4WZAE 3BC1A 1Q3HA 1ZNWA 4E03A 4EPXA 2GNOA 2GJ8A 1NVWQ 3I5YA 2IL1A 3KKQA 2FX3A 2C98A 2X2EA 2XSZD 1QG2A 4OQFA 5HKKD 1NP6A 5ELXA 2FDCA 1W1WA 2QPOA 3DOFA 5B58C 1SXJA 4LX0A 4JVSB 1TAGA 2JLWA 4BRWA 1W0KA 1U2RA 5BWMA 1OXUA 1KOFA 3G5UA 2KWIA 5CIQA 2XZPA 5E7JA 3VTKA 2R44A 3EX7C 1S9HA 3FFBA 2C8VA 3AVXA 3IPXA 3UXMA 2QM8A 2QENA 4OJKA 3KTAA 2WJIA 1KAGA 2C2HA 5HE9A 5HZHA 3GLGE 3KJHA 2J9RA 4URVR 4RD0A 1FX0A 1QHGA 3QF4B 4GL2A 2B21A 1J8YF 1XCGB 4IOMA 2P6UA 1CJTC 2GA8A 2WOOA 3K0CC 4TZ0A 5AJZA 1RRCA 4TMVA 1BKDR 5GJWC 3GLIE 3O8RA 1EFCA 4ZV4A 4KCGA 3IKJA 4D26A 2QROA 3PITA 4JL5A 1Z07A 1K8RA 4US0R 1CJVC 2NO9A 2ZJ8A 5IT5A 4EPYA 4TMWA 4YMVA 2YVUA 1XJQA 2R9VA 4XJXA 1XPUA 1Q1EA 2NO6A 4MDEA 3KZ1E 5K8TA 1DELA 1TF2A 2JLUA 2IS4A 2IYLD 2XTNA 4ACAA 4JVMA 4Q4JB 3RLFA 2NIPA 4ZO4A 1MT0A 4D2IA 1OXVA 1FQJA 1X86B 2G0TA 3U7FB 5C4MA 3C16C 5BYKA 1EFUA 3BJIC 4CEJA 3U6KA 1CR0A 2NO1A 4KLNA 5HR5A 1NBMA 3H84A 3C4JA 4LYFA 3TVDA 1GZSA 4MRRA 1AS2A 1E98A 4AKGA 2GJAA 4M0LA 4QBGB 3IDQA 3IGFA 5DE3A 3DEFA 2XEXA 4AYWA 4Q5IA 3BFKA 1KY2A 3A1TA 1CR4A 2A30A 3QXXA 1JEDA 1P75A 2Q6TA 2P67A 3CNNA 2O0JA 4AI6A 1KO7A 1OHHD 2ATVA 4PC2A 2JLXA 2CNWA 2EYQA 3SEAA 3W5IA 1MRSA 3B82A 2IC5A 1MOZA 5L8VA 2AL7A 5FOXA 1VG0B 1DTSA 1MABA 2AN9A 3PG5A 1AS0A 1SGWA 1D2MA 2QZ4A 3A36A 4BEJA 2PX0A 3LQRA 1IOZA 3GJ7A 2Z4SA 1UDWA 5AWFC 3FKSA 4C0BA 2ZIAA 2GXAA 4W5HA 2WJJA 2XB4A 2FFQA 2YWHA 3LBIA 4Q1FA 3KXLA 1KSFX 4KFUA 1R5BA 3RS4A 1Z0IA 3CH5A 3GD7A 2QUZA 4B3BA 4DWJA 1XD2B 1QHXA 3TMKA 5CIWA 1ANKA 2HF8A 3FHCB 1EFTA 1G16A 5DIFA 4LJ6A 4LV8B 4XD7A 5JLJA 1G64A 1NN3A 4FN5A 4V0KA 2ZREA 1E9DA 1QHYA 1RVDA 2QE7D 2ZUBA 3QJYA 1T3LA 4RKFA 5EP1A 3GFOA 2W2VA 5D3MA 3P4YA 4UNSA 3ZDQA 2CHVA 5SZKB 1KI6A 2D2FA 1RRPA 2BKEA 3N2IA 1T4GA 1W5SA 2BC9A 2PT5A 1U90A 1E3MA 4IOJA 2DPXA 5FBWB 2C77A 3RSOA 1V5WA 3ZYCA 5KPDA 4EKDA 3CM0A 1TX4B 2WSSA 2F43B 4AY2A 2DWOA 3M6AA 1KZ7B 1UEIA 2FH5B 4JLNA 4CEIB 2PZEA 4FMBB 1BH2A 2QY9A 4G5GA 2GTPA 4IDQA 1FW6A 4B34A 4NU0A 4GZMA 4QM7A 4AG5A 1UKVY 4MA4A 3W5JA 4BWYA 1OFHA 1YR8A 2CL6X 2Q9CA 1EG7A 4HI0E 4DUGD 4IVQA 4NZYA 4EIWA 4YMTA 3W8NA 3WP0A 3DOEA 3IIMA 2EFDB 4F7WA 1S1CA 3VU9A 4EJSB 2Q3HA 4RFSA 2ZE8A 1M34E 3ZS9A 2QP3A 1KI9A 2IX3A 2A2ZA 1YVDA 1Z5ZA 4HB0A 1CXZA 4ON9A 4WZBE 5GVRA 2JGNA 3TQFA 1P62B 5KHOC 4V02A 5LD2C 4TL8A 3OIVA 2IHYA 5FI0B 3X1YA 3HU1A 1LNZA 4YQFA 1N6LA 2AXPA 1DARA 1T9HA 4E22A 1BIFA 1G4UR 3C41J 3GEEA 2QSZA 1XNJA 1VYVA 4TLDA 5CJ2A 1P2SA 1X8JA 1XTQA 2PZFA 1Z47A 3Q7PA 4LPSA 4GPTA 4TQAA 3THWB 4J0QA 4Q1BA 4KVAA 3K0CA 2R6DA 1US8A 3DDCA 1ZM3A 4PZZA 4A4DA 4KFSA 1CLUA 5JS7A 1ZUIA 2GXSA 3NBFA 1SKYE 2NZJA 4WIAA 3L0SA 1ZC3A 2D06A 3GLFB 1JALA 2CHQA 3BORA 3EZ7A 3F5FA 4QM6A 1WA5A 5SZJA 1GDDA 4P4TA 3B1XA 1VCMA 3THYA 3AF4A 1FUKA 2REXB 4GT1A 2IUUA 1GVNB 1ZBDA 3FB4A 3JVUA 3RVBA 5AUPB 3LAWA 1E2PA 4PTLA 1U9IC 2IYTA 4HB4A 2RGNC 1AIPA 1UPTA 1ZD9A 2WIBA 2XNDD 2VH5R 5FPYA 2G77B 3QKRB 4IEEA 1DOAA 3OESA 2GF0A 3WNDA 5E95A 1FMJA 1JR3E 2G0NA 4AURA 3EA5A 4JLAA 4E07A 3AH8A 2WAYA 2VP5A 3VFDA 2J1LA 4DEYA 1NIJA 1XEXA 1XXHA 1VYUA 3WNBA 5B57C 2MSEB 2KSQA 4F91B 3CO5A 1GL9B 3SNHA 2VYFA 2CE2X 3BE4A 2VSXA 5DISB 3T06B 3QXHA 2YOHA 2JEOA 2ZTSA 1LF0A 3TR5A 3W34A 2BMDA 2IYZA 4LWZA 5FTNA 1UKEA 3CRRA 3L8ZA 4LBZA 1J90A 3T1QA 2RH5A 4NBSA 4ASUA 1HY3A 4M2LA 4BFSA 4FWIB 2FEMA 1R5NA 5FBQB 3RYTC 3VKGA 4CT4B 2BM1A 1QHHA 4ARZB 1FTNA 2IYQA 2FSGA 2SHKA 4PC1A 5CITA 3CONA 5LDDC 4Q1AA 1A5TA 1ESNA 3KTAB 5M04A 4G5QA 3MMPA 2FGJA 2EVWX 2CCJA 4C9BA 3BD9A 1GWNA 3IPYA 1NVVQ 1KK3A 1XP8A 3K9NA 3EPKA 4RD3A 5H70A 3GP8A 5EXTA 2VTKA 1Q20A 4M53A 1P2UA 5KNCA 1YR7A 3QVUA 4YDSA 1IBRA 1GL6A 5EP3A 5DI9A 3U2QA 1DG3A 4TL6A 4LJ5A 4QJ5A 2REBA 4POAA 2HXYA 121PA 5C1BA 5KU1A 2Q9BA 5DHFA 2GXQA 2IXFA 2FPMA 3MGCA 2IEYA 3QVVA 1DO0A 2A5FA 2BIFA 2ZS7A 1GIAA 3BK7A 3CF2A 3BOSA 1E9CA 1OV4A 2QQEA 2CXXA 2VSOA 2HLDD 1XJCA 4IRUB 2IYYA 4AC9A 1BOFA 2ODNA 1Z29A 4JLDA 1WRBA 4N3NA 4Q1EA 3CZQA 4BFZA 3RNLA 4Q7KA 3SJAA 5JZVA 3PR1A 3I1FA 4HAUA 3OIYA 3KQLA 4JBXA 3GJ0A 5EJEA 3QF7A 4CEJB 1W47A 4HZUA 4B43A 4DLTA 2XTZA 4JBWA 4Q9KA 1GG2A 1KDOA 1S1MA 2N42A 3GEHA 4F38A 2QI9C 5E3HA 4FCTA 5J4YA 3KJIA 3QG1A 1HUQA 4M1MA 4DB2A 4A2WA 1RFLA 3B2EA 3I5XA 1KNXA 4QXAA 1DVRA 4FMDF 5F3WB 2NO7A 3RC8A 3U5ZB 2VF8A 3V00A 1S3SA 1FOEB 3Q5EA 4TYWA 3ZJYA 1ODFA 2ZU6A 2AD5A 2QBYA 3WHLA 3AVQA 3V4FA 3PUVA 4LJ4A 3MJHA 1JJ7A 1MABB 3WBJA 1GFIA 1WP9A 5DLQC 2CJWA 2HYIC 1SZPA 4OKSA 3A1UA 4FI3C 4CW7A 2KI5A 5JJLA 1ZAKA 1N5KA 1Q21A 2GKSA 3KKNA 4ZI2A 4OI1A 2QL6A 4KBFA 4FMCF 2JLSA 1JJVA 4KBGA 1HTWA 4HDQB 4KSCA 1E2LA 4HUQB 4MQBA 1QHNA 1COWA 2G6BA 1CR1A 3U7HB 5CLQA 3K9HA 2JDIA 3OIWA 1PVOA 1JB1A 4LDJA 1OF1A 1AZSC 3R9XA 4Q9HA 5CYPA 5JI3E 2L0XA 3ZLJA 2AD1A 3W8RA 2DHRA 3H2YA 3WXMA 2QMOA 2W58A 4CT5A 1ONBA 2O0HA 1T8UA 1FP7A 1OJLA 1ZNYA 4TN1A 2BMJA 1E9AA 1F3OA 2OFOA 1E0SA 2QEQA 2QMHA 3I32A 3QY0A 1Z0JA 4NYJR 4Q01A 5CK4A 3SHFA 1EX6A 4A6PA 1UBCA 4YMUA 4RZUA 2V1XA 2GRJA 4GSYA 5D3MB 3ZQJA 1W0KD 2VSFA 3TAHA 5LPNA 1G20E 1AQUA 4PANA 3U3KA 1EFHA 1KI6B 1U9IA 4MKGA 3FHTA 4M1SA 4Z8XA 4M21A 4W5JA 2JA1A 4Q47A 5JHHB 1TUEA 2D3WA 4DB4A 1OKKA 4KVGA 1AZTA 4Q00A 4CGZA 1GKUB 2GCOB 4LHXA 1DAMA 4QGAA 1LF5A 2GEDA 3OF5A 1RIFA 1J7KA 3QG5A 3PUYA 1XEWY 2FZLA 1KDRA 2LCFA 3RWOA 4DLWA 2WAXA 4RZXA 5B2ZA 1T5IA 3TBKA 2EFHB 2GDJA 2OHFA 1DS6A 2ZRFA 2ZR0A 2EW1A 2Z43A 1G291 1NMXA 4KLZA 1BYIA 4UJ5A 2CVHA 2HT1A 1N5IA 4PX9A 2BKUA 2OLKA 1FZQA 1Z6YA 3AUXA 3EWAA 2DBYA 3VU9B 4C0SA 1ZYUA 1AN0A 2ZRJA 4RFSB 3TIFA 1E2JA 4LJ8A 4JBYA 4WZ6A 2PMDA 3QKTA 4XVUA 4WVFA 3ZZTA 1K6MA 1KNQA 4BFYA 1ZVQA 1N6HA 3GLGA 2Q3FA 4D4KA 1J8MF 1H8HA 2A5JA 2EU8A 4EPRA 4US2R 2FA9A 3MWLA 1NI3A 4FW9A 3K09C 5FUYA 4ZDWA 4IW3B 3B5JA 4PC6A 5J4KA 2W6IA 3SU8A 3WP1B 1JXOA 3GLIA 3FYHA 4NYJQ 4BLOA 5JMTA 3FGNA 3WYGA 2ORWA 3NTUA 1GILA 3VNVA 4DLSA 2WPDA 1CF4A 4HLCA 1AGPA 1F48A 1OXXK 1HURA 5DSZA 3P26A 1ZM4A 4QKQA 2DFTA 1KO4A 2ZJOA 3EXAA 2HCBA 1US8B 2DFNA 3WBKA 1P9WA 3T5GA 1KI4A 1MRNA 3UPUA 4C0AC 4A2PA 3EG5A 1AKEA 1VG8A 2PL3A 3P20A 5AUQA 3TVTA 1G7SA 2FJUA 2XOKA 3OFNA 5TARA 4ZDKA 5FL7D 4NCKA 2QRNA 1NLYA 2BMFA 5FH9A 1ZRHA 5FPHA 3THYB 4U00A 4C2TA 4DC9A 4YMWA 5J4VA 2JLYA 4QOSA 1OE0A 5B64A 1CULC 2CNWD 4TLEA 3FMOB 1GKYA 5FOSA 2XXAA 2I1QA 1E2NA 3LX8A 1R2QA 1G3RA 1UKZA 4YMSA 4R2IA 1R0ZA 3KQUA 5AJYA 2V9PA 1NIPA 5CB8A 1HYQA 2JIZD 2WWWA 3W6NA 4GOKA 3RHFA 3FFAA 4DCUA 3K0SA 1BS1A 3B7GA 1XMVA 3B1WA 3QEJA 1X1RA 3FKSD 3VR6A 2BV3A 1XEXB 1XXHB 1EGAA 2ZM5A 2CE7A 2JATA 4I1UA 3P1JA 1RPZA 2ZXUA 4OHZA 4GZLA 4KJZA 4A0FA 3BWDD 4BEBA 4HB2A 3LA6A 2D62A 3W6PA 2O8FA 4EAQA 4LGMA 3Q3JB 1KI3A 4PQRA 1VHLA 4MYUA 4XD7D 2P5TB 2W6JA 3GPLA 2OV2A 3QUSA 4URZR 4UNQA 1IXSB 1S9DA 3BERA 3QPUA 1OPXA 1XDBA 1MV5A 3U7GA 3OE7A 4JS0A 4ESVA 2Y8EA 2Q3MA 1LW7A 4LV5B 4Q7JB 1MKYA 3SJCA 1WBBA 3KQHA 1NSFA 2DY1A 1SHZA 2IF2A 3TUIC 4EQ6A 1CTQA 1I4DD 4PC3A 1NRJB 4DCNA 3EZ6A 4LJ9A 5IDVA 2BBOA 1W5TA 3WNCA 4FD2A 3WRYC 2GZAA 3CKLA 2FE4A 1II0A 4AG6A 4RKEA 1G41A 2XGJA 2F1HA 1A2KC 4EPTA 1DG1G 2V54A 2VP6A 2BBWA 2W2TA 1FP6A 1II8A 2FZ4A 4OHVA 4B3DA 2QTVB 1ZP6A 2JJ2A 2OO7A 2JCSA 3SJZA 2ZJZA 5DYGA 4BE7B 2ZJYA 2DB3A 2R65A 1P3JA 3AP1A 4QHYA 2IA5A 2GEUA 4XOIA 1D6JA 2FU5C 2QG6A 3R8CA 2G1JA 4OJQA 4IXNA 3FMPB 4RZ2A 2NZ8A 2OT3B 2R6FA 4YXWA 1W44A 4MYHA 3DMDA 1UBFA 4IEIA 5JFGA 3CUEF 4IOLA 4DSUA 3PEUA 5DH9A 2VHCA 4BFXA 2IYRA 1CJUC 4MYTA 4B74A 2VQSA 4L8GA 3GLHE 3KFVA 2IS2A 2OAP1 4BASA 1E2MA 2RGBA 5JI2E 3KQKA 1CRQA 2A5GA 2CL7X 1KK1A 4R2HA 4HZUB 4P4SB 1TU4A 4I99A 3B60A 5FBRB 3GMTA 4Q4LA 1AJEA 1E79A 1R8SA 1NN1A 4IOKA 4BLTA 1DAKA 2R8RA 1JAHA 2WKRA 2V3CC 4M1OA 3M0EA 4LC1A 3UG7A 4CDGA 1EFRD 1YHNA 2YYZA 4X8LA 4KFRA 2F1JA 1YZLA 5KUTA 3AP2A 3THOA 1IXZA 2F6RA 1OXSC 4MGKR 3SBDA 2QT1A 2QTFA 4BFWA 1N6NA 4OQNA 2RGXA 3QENA 2JLZA 3PVSA 2J3EA 5FPSA 4Z51A 4V0OA 4ZKDA 3I61A 4K8OA 1G7TA 4MGYR 2QBYB 2MMGA 2J41A 3AUYA 1E9SA 1Z6XA 4JKIA 2QRZA 2CJWB 4C4PA 2VIIA 5LD2B 4IXMA 3BGWA 4JSTA 2QNRA 1XTSA 4JJKA 3K09A 5EP2A 4K81B 4C7OA 3PCRB 2WTUA 1NLZA 4RSGA 1YZTA 1TMKA 1XRJA 2FFBA 3FHOA 5KTYA 3CRQA 1D9XA 2ZAMA 1NMZA 3JZAA 5J40A 4MH0R 1D2NA 3UATA 3QE0A 1JXMA 1L4YA 1ZJ6A 5HPYB 1GRNA 4ITRC 4DKXA 1H8EA 3WMEA 2QN6A 2VP0A 3NEYA 4G1UC 4X8OA 2V6IA 3D3QA 1E1RA 2BM0A 2NPFA 2OBLA 2GBLC 5G3ZA 5IK2A 1W4CA 3VX4A 4QGHA 4OI4A 4Q03A 4WXPA 3L43A 4ASUD 4Q9IA 1CJKC 1JR3A 5JECA 2ERXA 1TEXA 4DLUA 4NCNA 5EUQB 3L2OB 5AR1A 4M22A 1OIWA 4OQMA 1FUUA 3MLEA 1G1MA 3LBHA 3KQNA 1XPRA 3ZVMA 3M1IA 4LC0A 1XCPA 2AXNA 4O0MA 1YRAA 2YJTD 1WDTA 1IN4A 2ZAOA 5HCIA 1U0JA 1FL9A 2B92A 3NVAA 4HZIA 4Z8YA 1G3IA 5A5GA 2HYDA 4V0ME 1LY1A 5H1YA 3TR0A 5EE5B 4A92A 2ATXA 2XX3A 4GP6A 1Z6AA 1JR6A 3QIAA 4B33A 3VR2A 2H57A 2YOGA 5GJCA 3KUCA 3SC3A 4Z54A 1IY1A 4B32A 3T15A 4D6PA 1G5TA 1TQDA 3DL0A 4HATA 3T5DA 5KSPA 2B8WA 2E87A 2JJ8A 3HP1A 3TUZC 5CLLA 3RRNA 4LHZA 1HT2E 3IILA 2YINC 1LS6A 3AQ4A 1PUIA 2UZ3A 2C78A 2VHJA 1JECA 3IBGA 1IN6A 4QL3A 3GLGB 5H8WA 4EPWA 2J0UA 4QHTA 3B85A 5D3QA 1DADA 1K5GA 3SS8A 3LFUA 2CK3A 1HE1C 1Z2CA 4A8JC 3KL4A 4KITB 1Z0DA 1SVOA 5JCPA 2OG2A 2WM9B 2FMXA 3V9PA 2RKOA 1NY6A 3TK1A 1RRGA 3GLIB 1FQKA 1E2FA 1T0JB 3ZIAD 4PQYA 5LB2A 3VQTA 1FMLA 2KJQA 1Y63A 2E1RA 2OCPA 2QA5A 3X1XA 2ZYUX 1PZNA 2QTHA 1Q44A 3UKDA 3NC1C 1GTVA 3H86A 1XD9A 1R8QA 1AA9A 4D4JA 1W48A 3GJ4A 4C0HA 1VTKA 1ZNZA 1BMFA 3BXZA 1IY2A 5CM8B 2GJKA 5J4LA 1R7RA 2ZU0C 3LD9A 2PT7A 5EXXA 1XJ0A 1KJYA 4URXR 4OYHA 5BN4A 3ICEA 3ND8A 3FKQA 2ZRNA 3NBYC 5DN6A 521PA 1LVGA 1XFAA 221PA 3CX8A 2WICA 2RHMA 1RYHA 2VP2A 3C7KA 5AJWA 3WY9A 5CB6A 3AV0B 5FPTA 3TSZA 4PQFA 3TSWA 1X8KA 2BCGY 3LVQE 2XXAB 1P9NA 4M9XA 3R7WA 2OM2A 2ZRLA 1UAAA 1VMAA 4A82A 3A4LA 2HF9A 5FR2A 3GLFE 4OI0A 2D74A 3EIHA 3ZZUA 3CF0A 5JJKA 4TT3A 4QNMA 2ZANA 1EK0A 1FNNA 4JLBA 3QXCA 4I1OA 4O3MA 4Z1MA 1ZD8A 4DHEA 2FOLA 3TH5A 2ONJA 1COWD 2Z83A 2X2FA 1GNRA 2JDID 3ETLA 2I1VB 2EFEB 5EZ5A 3O8DA 3OIUA 3EIQA 5UKDA 3K70C 1R10A 1N3BA 1XF9A 1CP2A 2IYUA 3PUWA 2O8FB 2GILA 2ODWA 2PX3A 2XAUA 1N6OA 1ZUHA 2ZRHA 2WJVA 2CCGA 2ZJ5A 1YR6A 4XVQA 4XTCS 3SR0A 2FSFA 2Z4RA 5EE9A 2YC4C 4R9UC 5TDHA 1Y3AA 3IBYA 1EX7A 1WXQA 3L0OA 1TF7A 4TTQA 1N0WA 3BS4A 3SOPA 3K53A 2OFXA 2ZVPX 2WJGA 3E70C 3FPAA 3LBNA 4DSNA 3AKEA 3GEIA 2VHQA 4EQ6B 2IS1A 4DSTA 1G3QA 1XB2A 3DVLA 3SN6A 1OKKD 1XZPA 5KDDA 3O8BA 1KGDA 1E1QA 1T6NA 2B7BA 4GOJA 5F9HA 3NKVA 2FSHA 3FVQA 4Q48A 3U4QA 1OFTA 4D82A 4C0JA 4C0KA 2G3YA 1E2KA 1TPZA 3RDPA 4D0NA 4E09A 1OFIA 3G82C 4G3XA 1NVVR 4KV9A 2GHIA 3B78A 1YZQA 1S4QA 1ZCAA 2DFLA 2XSZA 3MSXA 1G19A 4P0TA 3ZVLA 3FTQA 4D25A 4B73A 2P6RA 3BIFA 1P5ZB 2GBLA 1EWQA 5FUWA 1ZCBA 1OT3A 1JNYA 4URUR 3SFVA 1AGRA 2EQBA 3NEJA 1CKEA 1KDTA 1PLKA 1XEFA 621PA 3DKVA 1UF9A 1G6OA 3PFIA 3CX6A 1L4UA 4G0NA 4QGFA 2VHUA 1KTVA 3ECCA 3I73A 4PPNA 3EC1A 2ZI9A 3M4YA 3TLXA 3U3OA 4NPHA 3LLMA 1G3UA 3PENA 3RRYA 5BW8A 1RZ3A 4WXRA 2YOFA 1JI0A 2O5VA 5LBIA 3ADDA 3HJNA 1B0UA 5P21A 1O87A 1W2HA 4UXHA 2FV8A 3RABA 2IEZA 5AJXA 2WPDD 4JT4A 3DMNA 4L4UA 1VPLA 2ZI6A 4FINA 2J0SA 4BZPA 5DGXA 4TWZA 4PAMA 3PXGA 1O3YA 3RS3A 1SXJB 1IJEA 3MFYA 4EUNA 3V4RA 1G8YA 1E2QA 5FBLB 1AM4D 5FUVA 1VKJA 1I2DA 1ZW6A 2ZQ5A 2ZSAA 3OEHA 2Z5FA 2JAQA 4CZ2A 2XOKD 3OFND 1YQTA 2A5YB 4W7SA 2JLQA 1Z8FA 1F2UA 5EE0A 2X19A 1NVUQ 5CJPA 2NQ2C 4FCWA 2ZR7A 2ERYA 4PO9A 2AFIE 3H4MA 4NYMR 2UVQA 4XSHA 4GRAA 1W4RA 2GVZC 1XTRA 3C14C 1FX0B 3AVTA 4PHFA 1E9RA 1RYFA 1KZGB 2XB2A 1TADA 4ERNA 2YHSA 2V55B 4A8JA 2BJWA 2A78A 2WWXA 4OI2A 2NTYC 3F3YA 4RZ3A 3PEVA 1N5LA 1VHTA 4GOXA 4OK5A 2V1UA 2N46A 1SKYB 2WWGA 5EZ6B 3SQXA 1SVWA 2XJ4A 3IEVA 1E96A 1J2JA 3HPQA 5GJBA 1U0LA 4LJ7A 1CIPA 2EYUA 3CB4A 1L2TA 3AKCA 4BUJA 2RAPA 2CBZA 5F9FA 3Q8XB 5KOYA 3OAAA 1ESMA 3DZDA 2BOVA 5FI1B 3HR7A 4TMKA 2FWRA 2IBMA 2GZHA 4MUAA 5F2EA 1X1SA 2ONKA 3EWSA 2ZE7A 4DVGA 3ZD7A 3K0FA 3DHWC 1T91A 3KKMA 2WVJA 1W2GA 2W6JD 2D2EA 2QMEA 1KIMA 1ZU4A 2ANCA 1M8PA 3BH0A 3BRWD 2ZI5A 2XNSA 4Q19A 3THXA 3MWKA 4AYTA 1RRFA 2IYSA 1GITA 3B1YA 1HQCA 3X1WA 3QOFA 4LSGA 2IHBA 3OE7D 4L9WA 4H9GA 2P3SA 1P73A 1P60A 3CZPA 2FF7A 2ZRAA 4PO8A 3T61A 2FNAA 3GJ3A 4JYBA 3I72A 4TLCA 1P2VA 4A9AA 2C5LA 1YKSA 5AUOB 1W7AA 3X2SA 1G8GA 2WJHA 3SQWA 1D5CA 2B6HA 1G5PA 1SVLA 2QORA 3Q7QA 4NONA 5K8LA 1WB9A 1CBUA 1CJMA 1KSGA 1XEWX 4NYMQ 4CF7A 2ZUDA 1PV4A 3U61B 5TV2A 3ASYA 5EXSA 1HV8A 1WMSA 4BZQA 4PZLA 4NCJA 2JJ2D 3AVUA 4LYJA 4PFSA 3BAFA 4U7DA 3QBVA 3AGQA 3P32A 4P3YA 2EWVA 3RAPR 2NPIA 1CEEA 5E7IA 2ZETA 4YXWD 4Q1DA 4EFMA 1MO5A 4YLGA 5FTMA 2O52A 2J0UB 4RD4A 2OAQ1 3TJZA 1PLJA 1E0KA 1KO1A 4X8MA 1NLFA 4L15A 4DDTA 1QG4A 1CU1A 4H1UA 4Q18A 1TEVA 1XMSA 4Q21A 3VR3A 2GAAA 2WWIA 4MGIR 1E9BA 2J59A 3FMIA 2F55A 4R7ZA 2C04A 2W83A 3IIKA 4GNKA 3TW8B 3W90A 4I4LA 3AF3A 4B3CA 5EP4A 1GRQA 3CNLA 3MUFA 4NMMA 1J99A 1G3MA 5HZKA 4MUBA 1VCOA 3SYKA 1SXJD 4PPGA 4L16A 1E32A 2QAGC 2REOA 1NMYA 1GUAA 4PO1A 3CWQA 3IEUA 3VKWA 5KO2A 4K46A 1Z0KA 3SI7A 1Q1QA 1W4BA 5ANRB 4F93B 2GWHA 2YV5A 3GFPA 1VIAA 3GLHA 2WIAA 4LHYA 3R7WB 4PSVA 1W36C 2ZJAA 1UJ2A 4OK6A 4AYXA 2GF9A 3C5CA 3TUJC 5KNBA 1Q0UA 3U44A 3BFVA 3AVYA 4A0HA 2H17A 1IHUA 1T5LA 4DJTA 2C99A 4TL7A 1VCIA 3A1VA 1IXRC 4QBHA 2N1BA 4ZCLA 4BLQA 5TY0A 1KO8A 3KFXA 2R2AA 2JASA 1FPMA 3FOZA 4OHYA 1GNPA 1AQYA 3MJRA 4KFTA 1ZIOA 4IDHA 4V0LA 1OH6A 2X77A 1GAJA 1VG1A 4IFBA 1IONA 1H8ED 1FTSA 4RD2A 5C18A 1HH4A 1U98A 1GSIA 2ZYVX 3B6EA 1E1RD 2BWJA 3GJ6A 1D2EA 2XTMA 1G7CA 5IK2D 4IFEA 4Q7MB 8OHMA 4IHQA 3VR4A 1E2GA 1UM8A 2BEJA 4JT2A 3LQQA 3TNFA 2VP4A 1M6NA 2ZRCA 2C96A 1JR3D 4TTPA 2ZRIA 1SQ5A 3HYTA 2HDNB 4RJLA 2YC2C 4M1TA 1X6VA 4HAZA 5JEEA 1NBMD 3NHAA 2J0QA 2QP9X 1QF9A 2RGDA 3D8BA 1U8YA 2IF0A 2ZRPA 3R9IA 1KMHA 2OUKA 2FFAA 3U4QB 3CBQA 2CDNA 2PLFA 2OE2A 2P6NA 4OQXA 2OCAA 1ZC4A 4UNRA 1OIXA 4LRWA 4TLBA 2VA8A 4BPBA 3AVPA 4ZIRA 4NKRA 3LH5A 4U02A 2QSYA 3LV8A 4QG7A 2OEPA 3AVVA 3EA0A 4D81A 2I4IA 4EDHA 4G5OA 3TQCA 3TW4A 2RCNA 1YU9A 3NG1A 2PBRA 1Z3IX 2FSIA 5JWOA 3KXKA 3N5CA 4HUTA 1QBKC 4IVPA 2GXUA 3K1JA 1J70A 5GADl 2RGCA 3W3ZB 1DEKA 4US1R 3GFTA 3SHWA 3EZFA 4JJZA 3QEOA 4MKFA 4V0MA 3NWJA 3MWYW 3VHXA 1XZQA 4LUCA 4TMZA 4JYCA 1CR2A 2K5UA 5G40A 2O8EA 3EARA 4NCIA 3RSLA 2WWHA 1G17A 2G83A 4UNPA 4PPFA 4JLOA 1E0JA 1U8AA 3DM5A 3REGA 1KJZA 2WBLC 3NIBA 1KI7A 2KBFA 3UWOA 4ABYA 1RC8A 1IJFA 2G9NA 1OB2A 5SZHB 1KK2A 4BECA 2F3TA 2HT6A 1G8HA 2ORVA 3L0IB 4Y0VA 1P2TA 4Q4HA 1BO6A 3HPRA 1UADA 1BMFD 4JL6A 1ZM2A 1TNDA 1QHHB 1EWRA 4BFUA 4DEXA 1CRPA 3UK6A 1RKBA 3FWYA 3ND9A 4MYCA 1OIVA 4RD6A 1F2UB 4DLXA 2PEZA 1IQPA 5DN6D 1I2MA 1QZXA 3BB1A 4PAQA 1WBDA 2H8KA 2RMKA 3EAQA 2QMUA 1G6HA 4M9SA 2CCKA 2NGRA 3CRW1 1TQ6A 4JZKA 4KODA 1X3SA 1S8FA 2HLDA 1NSTA 4QBFA 2GZDA 1VDZA 2ZI4A 2CMKA 1YZKA 3GJ8A 2WSSD 4PHTA 4Q9JA 421PA 4A8JB 3DPUA 3B1VA 3EPLA 1Z06A 1DAIA 1XMIA 2ZSBA 3K8YA 3OHMA 5AJVB 4ZDIA 1M1YE 1XTKA 3CW2A 4TT3D 3H0KA 1D9ZA 3TAUA 2ZSDA 3RS5A 1Z2AA 1OB5A 1M74A 5BN3A 4FMDB 3K0AA 5JRZA 3UWKA 3THWA 4V0NA 4BRUA 3LLUA 3IO5A 5FTJA 1S0UA 4GBMA 2CLDX 2G88A 5H68A 2R6CA 1I4TD 2IXEA 4MKIA 4B71A 3AM1A 1W0JA 2QAGA 2VP9A 1XTJA 2RHDA 2FFHA 2F1IA 4B3XA 1NJFA 2ZRBA 2F9LA 2W00A 3K0FB 4GP7A 4A1FA 3VMFA 2GK6A 5FPKA 4FMCB 3THXB 1GM5A 1BYUA 4ILEA 5A4JA 5G53C 2PJZA 4WOPA 4NYIR 2B7CA 3KXIA 4LZZA 1NL3A 1OYWA 4NTZA 4A36A 1GOTA 1M7GA 1UKYA 2C9CA 2ZRDA 3NBXX 1KDPA 4EFNA 2Q9AA 1F60A 1WE2A 1JEEA 4BGDA 2GCPA 1UBEA 1W4AA 3QKRA 4II7A 3CIOA 3REFA 3UANA 1N25A 2ZE6A 4RCZA 3UMRA 3K9LA 4LY6A 1WCV1 2KBEA 1KY3A 4TSFA 1JPJA 3Q85A 2VO1A 3CLVA 1Z63A 1YZNA 3ZGXA 1T3SA 3AP3A 3K70B 4F4IA 2JJ1A 1ZM7A 2MSCB 1QDEA 2CLSA 1KKLA 2AHOA 1T3HA 2IUSA 1JQLB 3AVWA 1OSNA 3MRSA 4IDNA 4PXAA 1WF3A 4HAVA 5FR1A 5JSZA 1PJRA 2YKGA 4BQSA 2H16A 2BBSA 2V8OA 5KDLA 2MMCA 3X1ZA 4PR0A 4NP6A 4ARZA 3PEWA 3QXSA 3SYNA 4RD1A 1FNMA 5B30A 4JLVA 4Q7LA 2WMOB 1VG9B 3KDSE 2XJ9A 3LWNA 1OH5A 4N0DA 5FUXA 2R62A 3LVRE 4JVNA 2NO0A 3N70A 4V03A 5CDFE 1M7BA 3KKOA 4DLRA 1MO3A 1QHSA 3ADBA 1N0UA 2RGAA 3CNOA 1ZU5A 2HUPA 2C03A 1T8TA 2WWFA 4NYIQ 3QKSA 2JLRA 2F3RA 3TRFA 1Z0FA 4A6XA 1C1YA 1GP2A 1VIYA 4HAWA 5IRCD 3QI2A 4NHOA 3OEHD 2ZUCA 2Z6VA 1FFHA 4UJ3A 3WRXC 2J5XA 3E1SA 1OXTA 1R4AA 4DCTA 2VHTA 2WZQA 1E2DA 1N5JA 3GLHB 3SDZA 1N6RA 4WW0A 1JPNA 1W49A 1Q12A 3H1TA 3UMSA 5TB5A 3U7EB 3QNUA 4AKEA 1SHKA 1E2EA
chains in the Genus database with same CATH superfamily
5ABPA 4ZOLA 5AW3A 3U44B 2IWRA 1JQ3A 4D79A 1IM5A 5DM60 2HCJB 3IQFA 5K0LA 2OP1A 1WG8A 3EPHA 1Z83A 2CHGA 4P31A 1RXWA 2QTTA 1KF0A 2G9QA 4QYXA 4TMYA 5HXAA 1VLJA 4FZ5A 4L57A 3GBSA 2X5KO 3N8IA 3DO6A 3NDPA 4G4IA 4IJWA 1YVRA 2W5UA 2P3QA 2SCUA 3NHJA 4KYIB 4UDNA 3D02A 3P97A 5H82A 5JMPA 4Z7NB 3IP9A 3UMFA 2XA9A 3HJRA 4IDEA 1P4SA 3SZGA 1K08A 1T24A 2ZIVB 3BRSA 1UMCA 3OAAD 2A0KA 4KN6A 1SCUA 1X1TA 2O3TA 1BX3A 2Y4OA 2XIJA 4EP1A 1W19A 2HPHA 4F97A 4RVHA 3DFIA 1WM1A 3I9V1 4MZDA 4Q1VA 2IPOA 2YWGA 3QXJA 4KYUA 2IS6A 2JAOA 1JWLA 4XSGA 5JASA 2AFHE 5JDCA 1L8QA 1MO4A 2HA5A 2VAMA 3CUKA 3KNZA 1GQOA 1T2UA 2AF3C 3H83A 2OFWA 4H59A 3OZGA 1A1VA 4HB3A 3FCOA 5TXGA 1NATA 2R1ZA 2GWRA 1HMPA 2H11A 3KAJA 4NBKA 1GYPA 1ARZA 2JG3A 1CEXA 1B6SA 3OPQA 2XQKA 4YV1A 1YIDA 5ELMA 3A1SA 3TBFA 5BV1A 2XVXA 3KJEA 4OMDA 4MDFA 3VR6H 5I01A 1YZVA 4KWTA 5C31A 2I67A 3Q9LA 5CDTA 2O8BA 3CWZA 2RONA 3H42B 4HDKA 4J7AA 2ODBA 2BEWB 1SB8A 1KHTA 1IZ9A 1H5NA 1T15A 2QWXA 3F5MA 3PCTA 3HB0A 4PBRA 4IHJB 4XJVA 1E99A 1JH8A 4FD3A 3COVA 1Z15A 1COZA 3S2EA 5DU2A 3OPXA 2ZJ2A 4I7EA 1DOZA 4PFJA 2MCFA 1GRRA 2QYSA 4E7OA 2A84A 3K70D 3NTLA 4F56A 3MG9A 2UYYA 3BDVA 3CH4B 4CIBA 3TZEA 3TGLA 3BPSA 2E5WA 3O8CA 4TOIA 3HSKA 3LY8A 4P4GA 5LQJA 1DAHA 2W2LD 1HA3A 3BX1A 1V6SA 3FPEA 2PEYA 3WDSA 4IZOA 2YWDA 3OURA 4KL8S 2YZ2A 5FOUA 1P0FA 1WX1A 2VYND 3MRVA 4TXLA 5JDIC 3TF5A 1LLFA 1Y6GA 4DW8A 1NG9A 4QARA 4TXJA 1WTAA 4D74A 3PD0A 3RJ9A 5EE3A 1ZXXA 3PIDA 4IMPA 4IZIA 2PUAA 5G41A 3AKYA 4YFYA 4KGVA 2JAPA 1EKXA 3T5CA 2E48A 5J47A 4ZAZA 2CBGA 1FLAA 1T2AA 4ZJZA 1R0BA 1VXRA 3WQBA 2J3IA 2OO3A 1WW3A 3IQGX 2GCOA 1DL5A 3UXEA 2EFGA 1ULTA 3F9IA 5B1EA 3HXMA 3BH6A 5J5CA 3STXA 2UAGA 4MWOA 5CHYA 3UB2A 1UH5A 4NBRA 1NR7A 3TH5A 1U0HC 3I62A 3NRBA 2CN1A 3BH7A 5IEBA 1JDBC 5DM4A 3PQCA 3OOHA 5G3YA 2ACWA 1WOMA 3HHPA 5YASA 3HJGA 4JSYA 4NNJA 4YRRA 4EI8A 1PV1A 3HWSA 4RM3A 2BGNA 3UA4A 5L6MB 5HTOA 1RW4A 4JUBA 2GKOA 1A2BA 1AKWA 1O5OA 3S1AA 2OXCA 3PUXA 2ACVA 5CD1A 4IIBA 1W34A 4ZVQA 1JL3A 4IRXA 1UBMS 1Z17A 4EF4A 3FDIA 2Z1MA 3WFJA 1JJFA 3CPHA 1CRWG 3RFTA 1ETUA 2PWZA 4ZKEA 3ZHZA 2BE9A 1QFJA 2Y1EA 3D54D 4HYQA 4QBIA 5KYUA 4ENTA 4I50F 3ZYZA 1DC4A 3CVOA 4CIXA 2YMMA 3M82A 3V2HA 1QHFA 3IBFA 4RY2A 3T4PA 4CLHA 3N53A 1GL7A 3ADKA 3QBDA 3UV6A 4YY3B 1Z2NX 3SXUA 4FNOA 1NNI1 3COPA 3F4KA 2C58A 3KFLA 3NS7A 1A71A 2VEDA 3OZEA 4XWWA 4NCBA 1GKKA 5BN3B 3AB8A 2ZPAA 4B76A 2ZYDA 2BVNA 2FFJA 3RUPA 2GVDC 3MWEB 3A4YA 5T4EA 4Z3KA 2JVIA 3ABIA 5HKKA 3LWDA 1BRTA 4KAFA 4IDBA 1KYWA 1GN8A 4XLTA 1Q22A 1Z0ZA 3OZXA 4F84A 5K0EA 1I3KA 3OCJA 4DMLA 2XQJA 2QV7A 1NVTA 3SNKA 3RYCA 2QAGB 3NXKA 1KSHA 4QJIA 1LK0A 1Q95A 3RVJA 1U02A 2PKCA 3DLTA 5JJCA 1F0YA 2KHZA 5I3CA 4PSAA 3CR7A 4CQMA 5DULA 1IN5A 2YNMA 4BP3A 1JMKC 3UTDA 2WC1A 3OTIA 3CRVA 5U4XA 1WMBA 2JLVA 3N86A 4NAVA 4RVDA 2IK8A 2VBCA 4N0EA 2VUTA 3AMVA 4MV7A 1MAHA 3G7SA 4NJEB 1GEGA 2AWOA 4NG4A 4B2IA 3DNPA 1W36B 4OK3A 2JFUA 3F7OA 3IALA 3LQ2A 1QRUA 4OBEA 4E5UA 3O4HA 4FNMA 1QVRA 1ZQ1A 2WZCA 2OESA 2RB4A 2Z3ZA 4AY6A 1P29A 2GN8A 4AU1A 2DR2A 3FSJX 3B1ZA 1E9FA 1D5WA 2WA1A 2HV8A 3A9WA 1NQ5A 1DI0A 3P0FA 4D9CA 1C14A 3ANNA 4TXNA 1M34B 5JWHA 4HPJB 4NDAA 4X3CA 4PLWA 4ALMA 2X8AA 3B13B 2QJOA 5AXBA 3U09A 1DC7A 4TLLB 3RNOA 2NSLA 5IM4F 1M6YA 1NBME 4IWXA 4DDWA 3AOEC 3BGOS 3E5MA 3GR6A 3R6LA 4QFDA 1P7YA 5T8KC 3ZTYA 3G0HA 3T12A 1TAUA 1PJSA 4A6DA 2BYTA 4DNPA 1TCUA 4QBKA 1FP1D 4UVGA 3JZMA 2A3NA 4FZVA 5DNWA 3G2LA 4YONB 4IV5A 3RYHA 4BNWA 4DM7A 7GPBA 5IHXA 1UFOA 2A33A 5KTMA 4HNHA 4K6MA 4MK4A 5HTKA 4P38A 4E5PA 5IAJA 3ADOA 4GPZA 1KAEA 3JAMA 4G8BA 3SYRA 5EMLA 3TSOA 4BJ6A 1Q0ZA 2OUIA 5FUBA 3FWZA 3HCBA 4KR6A 3KCQA 4X64B 1Y4UA 1IQ0A 2WSBA 5EINA 4RVNA 3KHSA 3C8UA 3NBZC 1LPNA 1YAHA 4JWKA 1HOTA 4EJ0A 3ZCPA 5JISA 1PGNA 1U2ZA 2Y0BA 3RRMA 1M2OB 2EIHA 1WU8A 2HQRA 3UM9A 1JE1A 2P90A 4I3GA 721PA 1JZQA 3D31A 4GU5A 4RU1A 4BU0A 1CRLA 3H0CA 3K9WA 4H7FA 4BJ1A 4M8NE 1XBTA 1GKIA 3HGQA 4WEQA 1WSDA 3C97A 1OWLA 5K0TA 5KMGA 4LJAA 4GBED 2PMBA 5DI3A 1AQNA 1EUCB 1SQ0A 1XNGA 2AK3A 3DVQX 3FPHA 3GQBA 4TL9A 4X95A 5KQRA 3UUWA 4D8VA 4V1CB 3VKHA 4E3WA 4YMIA 2AUMA 1EAYA 2Z2JA 3TRJA 4LHWA 3W05A 4JI0B 3B89A 3OY2A 3VAAA 3VZRA 4L02A 1Z2EA 3OZ7A 4KK3A 1QZTA 1XWIA 3GJTA 3IHLA 2YXLA 4JNCA 5IDYA 5KI6A 5JMOA 1QU2A 2OCYC 2ONZA 5EJFA 4DLVA 1NG1A 2HCFA 2OD2A 1H23A 3VNQA 1OPRA 5JDIA 2JFBA 3A6ZA 2E6KA 1IMOA 1K2WA 2IT1A 1H2AS 4EGCB 1MX1A 2HLNA 3ND6A 4OLFA 4F9GA 4KH1A 3WGHA 1GPUA 2CFRA 1SKMA 1QONA 5ERYA 3NAZA 2OCIA 2Q8QA 2V5AA 4FYPA 4KBYA 1W96A 4G8CA 4PYRA 1L8AA 1DBVO 4PZ0A 4PS1A 3KZCA 3H05A 5AM0A 2VDRB 5E2BA 2I8AA 2J3KA 2GESA 4IL5A 4R68A 5FOVA 1EFLA 3LHFA 1W8IA 1Z5GA 1UC8A 3EIEA 5E4YA 3SWWA 1KR2A 1KOLA 1NNSA 3AEZA 4PLVA 4YT5A 2G4CA 3FDZB 3MUEA 3U48A 5LM3A 1T0IA 4DILA 1ZN7A 3GRCA 1W0CA 4LF9B 2VDPB 3K1AB 5BYJA 3EIUA 1AQIA 5IAOA 4EJSC 4EKGA 4D9MA 4CTNA 3LRPA 5C7LO 4P81A 4FQ5A 3RQIA 1RJ9B 2AFIB 2BRUC 4QEKA 1NBOA 2PRKA 5HKOA 3TZHA 5LYJB 1FXWF 4BXOB 4FYYA 2YDYA 3NNDA 2WB2A 3I76A 3AONB 1BHO1 5I4IA 5T4FA 5TPZA 4B4WA 1S5PA 3R8FA 1E2IA 4U63A 4L4XA 3GAMA 3Q4GA 4A2QA 1BS2A 3COSA 2CEAA 2DWPA 4GSLA 4CM9A 1JSXA 4W8HA 1EIZA 1L7XA 1TVKB 1M1YA 4FC6A 2GK7A 1R4NB 1X38A 2A5DA 2JHCA 5AKZA 1XN4A 1NX9A 3DA8A 3KIPA 2QL7A 4I9FA 1I0LA 3LF2A 3NJRA 3PPXA 5HE8A 4BE4A 4IMIB 4EW3A 4IZHA 1IAQA 1XL0A 3GLRA 1JZSA 4OG2A 1Z22A 3KQVA 3VR5A 2VDMB 1BMDA 4DT1B 1PK8A 4MEJA 2ORED 4ZAFA 1DRJA 1LB1B 1Q11A 3QWBA 5JSQA 5ALSA 2UVPB 2JFXA 1YAJA 2QIPA 4YIHA 2YWEA 4XIFA 1I1NA 4Z99A 4FSHA 4LZOA 2D7CA 2QUIA 2WZDA 1E4EB 3A4NA 4C05A 5KOJB 1PWZA 4FKMA 3L92A 4BFLA 3UVEA 3BD6A 2QTLA 1CFJA 1ELOA 3T9DA 2BHRA 2O3QA 3SE0A 2O1SA 4HRVA 2EL9A 1UK7A 2MSDB 3IAS6 2IOHA 2AJCA 3F1LA 4G63A 5HKLA 1RBZA 5G0TA 4F0JA 4KXYA 3DM9B 3T9FA 2JHFA 2O4CA 4JIMA 3LW7A 2FWBA 5IJXA 3I83A 2X9NA 1TC1A 4QFMA 2YIDA 1GPDG 1DRKA 1OI3A 2GOYA 2VDOB 3SAJA 2YZGA 2WDZA 3ER6A 5T57A 4Q4JA 3L41A 4IGFA 3G5LA 4KWIA 1CCWA 2PQ2A 4Y3UA 1LTQA 2NMVA 1MB2A 4IV0A 6AT1A 3VPXA 4Q4DA 4LYHA 5TRTA 5BY2A 2N1MA 5AKYA 5ALOA 1DKNA 1C9KA 1EP2B 4BU1A 3UK7A 2DQ4A 3PFFA 5AUNB 2VL7A 4FONA 4ZO7A 1L3CA 4AKIA 3IHKA 3QLJA 2IW3A 3R5HA 3U3XA 2HCTA 4QUBA 2HMYB 3DMHA 5GGXA 1L0BA 1REQA 2R8XA 3NHPA 2PX5A 4I0WB 3WIVA 2NW6A 3QBJA 3UXYA 1LH0A 3V1MA 2O7RA 3FVRA 5D7BA 3SZRA 4D80A 2RGEA 1Z6TA 4I1IA 1J6UA 1ULHA 1S3GA 1U94A 1HE8B 5F1OA 4XIGS 3AOEA 2Q2OA 5T8KA 4OHKA 1XZNA 3UO8B 2BJHA 2QW8A 2ZRGA 4KAJA 3VU0A 1KVTA 5GJVC 2V6JA 2PJUA 3HJTA 4MYDA 5SY9A 3UBMA 2CUNA 1A69A 3LXXA 2EBUA 5AHWA 5B3KA 1VL6A 2O23A 1OLXB 4UREA 1E4VA 5AJUA 3OZUA 3U13A 4PXYA 1M5UA 2WSMA 1Z2PX 4GGPA 4XM0A 3D2CA 2WY2D 2QW0X 2OSBA 3I37X 1VRVA 2AYYA 1NONA 2P6OA 4ARAA 1Z2OX 1K3FA 1UJ4A 2BMVA 2V7WA 3DFMA 1I2BA 4JYAB 1BDMA 2H8GA 3K1ZA 5LMZA 1RWOA 3LU1A 3X1DA 1KEWA 1M33A 4N01A 3G13A 1OBHA 5CNMA 2QYHA 3DEJA 3MT7A 3V3KA 1NBIA 1XQXA 1YC5A 2ADFA 1K9VF 2FETA 2Z58A 4HS4A 5ALIA 2NYRA 3WWDA 1ZGGA 1IVSA 2OLJA 3LPLA 3SLGA 3ICQB 4WFQA 3WYBA 1NYRA 1R3DA 2WDPA 4RX1A 3E7PA 1WSAA 5BUZA 2EKPA 1FDOA 2JGIA 3O8OB 4TQUS 4EI9A 3PWSA 5KPJA 4NL4H 1V25A 1P7PA 2XT0A 2YV3A 2B36A 1PLLA 2BW0A 2HRBA 3GDWA 2ZUFA 3VH2A 5HGXA 1X0VA 3B12A 1U5CA 2X1VA 1KAQA 3R4VA 1Y6FA 4B83A 2ATCA 4OUKX 3HR4A 3O9VA 3P0RA 5FA6A 3G2NA 3NAMA 1HRDA 5EJAA 3AYZB 1I4LD 2Q07A 3ROZA 3KOMA 2ZS9A 4IJVA 2DETA 2Y1DA 3FGOA 3NZEA 4NE2A 4TV8A 3K9CA 4UTOA 2A1UA 5CFMA 1NJ2A 2YCLA 1VJGA 2YV2A 4JDPA 1NP7A 1SXHA 5HZGA 3LIIA 5JCXA 3QSYA 5CNJA 3L49A 1KP2A 3TLYA 1CUJA 4KIFA 5HNKA 3EK2A 4RGYA 4RMHA 4DCCA 5IUJC 1HE4A 1WKBA 2VPZA 2F43A 3ETEA 4BLRA 3DWEX 3S0JA 5L3QB 1XPJA 2PZGA 4DWVA 4G5RA 4C4AA 4AK9A 1V43A 2DWQA 5TPWB 2RGGA 2ZRKA 1R6VA 2W90A 5B2EA 4OFXA 1LKZA 1WHSA 3KUKA 3ZTWA 1CQIB 4EG1A 3V9AA 4DCVA 3NIDB 4DQXA 2YIMA 1H65A 2QZ9A 2YR0A 2V7QD 1QRSA 1ACLA 4HNSA 2V6FA 4P7FA 2WE7A 3DYIA 1EVQA 1KAOA 3UF0A 4C0WA 4URWR 5IZCC 4I81A 4EJSA 1C7ZA 1ZEJA 4PYOA 1HQYE 2QRHA 2WV7A 1WTCA 2XUOA 3SBEA 2BRUA 4H0NA 4JBNA 1B6GA 2I6QA 2AFHA 2RGWA 4M98A 1SD1A 3O47A 1OLSA 3AHCA 4R1NA 5CCXA 4LI0A 4DXAA 1MTOA 4QUJA 5L3SB 5FUQA 4XTRA 1DBWA 5IKMA 6ABPA 2Y6UA 2XT9A 3WYFA 4B6EA 7YASA 1BDJA 2DU8A 3ZW9A 1BHJA 1NJGA 1Y3FE 1ECCA 4DEVA 4B6GA 3DHVA 3G88A 5CHEA 3AGPA 5DLPA 1PL8A 5EIBD 3RVMA 5EIEA 3UUFA 4Y2PA 4S2EA 3C98A 3KD2A 2VWHA 3QYPA 4INPA 3ROGA 2J31A 5CA0F 2UYHA 2SICE 3PNKA 4A1OA 4HGYA 1KS9A 3CINA 2FP4B 1LV8A 1VKZA 2H06A 2ORYA 3HDTA 3I3SR 4JLJA 4MB0A 1B8VA 1FDWA 4JJ7A 2Y0PA 1SBTA 4FDMA 3E2IA 4TMXA 3TL6A 4XYGA 1U63A 3IP1A 5IDQA 5CU7A 5E8JA 3LCUA 1XD8A 3QU5A 1IZ0A 2ZYWX 4B75A 3JAKA 2RHLA 2VK4A 1QO0A 3NXSA 1C8BA 2VKTA 2HF7A 1MVNA 4ZVSA 4JYZA 2ZSEA 3GV0A 3SD7A 1RBQA 1JR4A 2C3MA 1WB5A 2QI9F 3FTDA 2OC9A 3OPYA 1YRQA 4Y6RA 1KBOA 4CCWA 3E5HA 1IRXA 4MDYA 5BV2P 1YJBA 4GX5A 4OSEA 2I0FA 2C29D 4F4CA 3TKYA 4A15A 3AG5A 3KZVA 4UULA 1V1RB 4JI7B 1C5KA 2W98A 3CA8A 1UOEA 2NT4A 2CVOA 2IZ0A 2XOXA 3H16A 1U0BB 3IHWA 4IDOA 1B7GO 1JVBA 3I34X 5E8RA 1NC1A 2Q5LA 4GGOA 2WHXA 3A6DA 2CHUA 4BQFA 4KI0A 2YRXA 4REOA 3GRFA 1J4AA 2MJLA 2ASVA 4HLQB 4YC7A 3IR6A 4GM4A 1IL0A 4RHFA 4FXPA 2AC7A 4N5IX 5LLDA 3IV9A 5C7IO 2GEKA 3N39C 5EEHA 3R9WA 2XGGA 4LF6B 3BC1A 5FNZA 4C7KA 4S2UA 3IAAA 4EPXA 3EF1A 2WEKA 2IL1A 3KKQA 2DQSA 1WV0A 1QKJA 4OY3A 4BX2A 3T3NA 4ZOCA 1JI3A 1QFXA 2BFAA 2PKQP 3LKDA 4MVJP 4K8RB 1XHEA 3OO1A 3GGJA 1C9DB 1E3WA 1M0TA 5A5FA 2WZBA 4OF4A 2JLWA 3U62A 3IQZA 1IY9A 4J0IA 4QRIA 4ZOEA 4BRWA 3EXFB 4AJ4A 1OXUA 5JYDA 1RXEA 2BGMA 4ZVTA 4KQHA 4L72A 2A92A 2PUVA 3IV7A 2VA9A 4MGEA 5E7JA 3VTKA 4BNXA 1S9HA 2DWUA 1PSWA 3DZFA 1PT6A 5EWMB 1P7ZA 1ZD4A 3PA8A 3KPYA 1QRTA 3F9CA 2N3ZA 2QENA 4OJKA 1NBAA 1K4YA 4XA8A 5FJIA 1I5RA 1Z16A 1NUPA 2P2CA 4PYNA 1J8QA 3QF4B 3CLTC 3NOXA 2IVFA 1XCGB 1GLVA 4IOMA 4X7PA 3TTXA 1JDPA 1C1XA 1PUXA 3UHJA 1X87A 2RHHA 2JGFA 3BGIA 4NS1A 3EMKA 2XT6A 4GE3A 2Y4NA 4QYIA 4J7CA 3FNBA 3GEDA 3O91A 1IEQA 1Z75A 1QLWA 3HB5X 1QFSA 2QROA 3LUPA 1K8RA 3IUNA 3GEGA 1QVZA 1Y42X 5HJ2A 1D03A 1W5AA 3X0DA 4E70A 1C3OB 5ITWA 3NGLA 5IT5A 5C1IA 3COYA 1CDEA 3D2BA 1SD2A 3OZCA 3Q9SA 4IIXA 1XJQA 2R6HA 4IXWA 3T5MA 3KZ1E 2OHJA 4ZT2A 4X63A 1XA0A 1LRJA 3E0XA 4KIJA 3VH4A 2B5OA 1EJ0A 3EHDA 4QATA 4R2XA 1WVIA 2IYLD 2IS4A 3N0WA 4E4TA 3ZDDA 1KEUA 3EXIB 5LFAA 2PKQO 4DANA 1QK3A 2RI0A 1V11B 4F21A 2G9VA 3U9TA 1U8TA 4QDKA 4JELA 1PJ2A 2P79A 1DHTA 4RENA 4W9RA 4DSAA 1TM3E 4ZQEA 4XJTA 1CR0A 1L4NA 1NBMA 1YS9A 2GPJA 4L75A 2RD2A 4BP8A 4RM2A 4WY5A 2HHHB 2V65A 3EEBA 3TZ6A 4QQ8A 4CETA 1ZISA 1QSGA 3HJBA 2C84A 3W7AA 4M0LA 4QBGB 1V2GA 3IDQA 2COUA 2MOKA 2FPPB 3FTCA 2FVXA 3IGFA 4CNQA 5L40A 3COJA 3CMMA 3BFKA 2H4WA 2GHQA 4MDHA 1HGXA 1QKKA 5IAGA 1D1QA 3OUZA 5HUJA 2G70A 1JLSA 2R1TB 4KR0A 4XDGA 4AAYA 4AI6A 4OHFA 1OHHD 2ATVA 4XWYA 5JAUA 5IZCA 4WA8A 2CNWA 3SEAA 2B1IA 3KK0A 4YCBA 3W5IA 5B3JC 3KS9A 4RZSA 1HKUA 1N2HA 3B82A 1EYZA 2IC5A 2R11A 2FWPA 3U80A 1NWHA 1E1MA 3L4BC 2PR2A 4RAOA 4BX3A 3PHBE 3PG5A 1AS0A 3EE6A 1B3RA 3WIDA 4RQTA 1IPFA 3GJQA 5JC8A 4BEJA 3DZCA 5IU6A 1DXQA 5E4TA 1QP0A 2Z4SA 2GO7A 4C14A 1T1JA 3KALA 2GXAA 2QLNA 4IAOA 4LOKA 3P2JA 2WJJA 1L1EA 2WF7A 3T4XA 1MX5A 2FFQA 1M2EA 2CLHB 4WJKB 1K06A 2VNJA 3KXLA 4KFUA 1R5BA 2JKYA 3KHUA 4B7ZA 4MVCA 4EB6A 1BJKA 2XDYA 2C2XA 4LE1A 3IODA 3C24A 5LDHA 2C9BA 2FLVA 4PRZA 2V5VA 1K5HA 1JDTA 4RLSA 4LXYA 5CIWA 2W6ZA 2BGRA 1MVLA 2YVLA 2DHQA 1ISRA 4IQFA 3PNOA 5BW6B 1RHQA 3FG9A 2YHBA 3VV3A 3TFOA 3PPVA 1AGYA 1O7JA 3WADA 2FW7A 2H4XA 4DE5A 3O4IA 2EP8A 4L5JA 4MWGA 5BWCA 5K03A 2H2IA 4XVCA 3EEFA 2PLAA 4FFPA 1CZLA 3BWYA 2QXYA 2Q28A 4RJ2A 2YICA 3P4YA 2EGGA 4NULA 2XUPA 2CHVA 4I50A 1DEOA 1V5EA 2DUUA 2XQVA 4ROSA 1L7MA 2NAFA 3AWIA 3U9LA 2VDNB 5F1KA 3FLEA 1YBVA 1BFUA 1LI4A 4FGKA 4DLWA 1E3MA 1TFRA 4ZK6A 4IOJA 1C9NA 4WDRA 5FBWB 1UODA 5DHUA 2GPSA 3BGDA 5KPDA 1V5WA 4EKDA 3CM0A 1NFRA 1TX4B 2WSSA 3IH5A 4XR4A 4CEIB 2PRSA 3ONFA 4JLNA 3RU3A 2PZEA 4C6TA 3LBFA 3N8GA 3W9BA 4DR1B 1C0PA 1QYIA 3PI6A 4Z9BA 4HD8A 1UXOA 4YGXB 4F2WA 4ZYTA 1QWSA 2X76A 2F3SA 3I23A 4AG5A 4CFZA 1PK9A 1UKVY 5HFJA 1N1MA 2EJUA 4RQBA 4A0SA 4F85A 1TGVA 3TSAA 2V4MA 3WB1A 5EA2A 4TRMA 2AHRA 3AUFA 5TQVA 1EG7A 3D6AA 3GFSA 3UGTA 3WICA 3PNLA 4YMTA 3H5LA 3WP0A 1JQAA 2RGUA 4HEA1 3IIMA 1BEZA 4OQ4A 3GROA 3M8KA 3P2MA 3WIEA 1M5TA 1S1CA 4EG7A 4F7WA 2P8JA 3E3MA 4CI9A 4OEHA 2HCRA 5DHRA 5JFTA 1NSYA 4J0EA 1DWPA 2QP3A 1FNCA 1E5LA 2A2ZA 5GVRA 3GA5A 4E5VA 5BOSB 3TQFA 2CT8A 2QJTA 1ORWA 2D5LA 3X1YA 5FI0B 1XRSB 4HRAA 1N6LA 5K0ZA 1EFDN 3DTVD 3NBKA 1XKTA 4CF4A 1DARA 1HLPA 2XODA 2FE1A 1T9HA 3A25A 4KRGA 3IESA 2BP7B 3C41J 2YWCA 1FW8A 4MWCA 4RS4A 5DOZA 2DBRA 2BI8A 5EI5A 4XASA 4J0KA 5IM4A 1P2SA 3W5AA 2ZYIA 3C3KA 4QPDA 1Z47A 3EDCA 3HE3A 4LPSA 4GPTA 1F0KA 1T13A 3THWB 5BN5B 4YBRA 2QX6A 2YYYA 3C43A 2R6DA 3LKVA 1US8A 5C32A 4FFLA 1C1HA 4Q12A 2CJXA 4IGIA 2I4RA 1VI2A 4N8SA 4RIEA 2JFGA 2GXSA 3ZJ4A 1AUQA 3RHZA 3T4UA 1SKYE 4WIAA 3A27A 3L0SA 4LDAA 1MVOA 3IMKA 2ECOA 3T3DA 5G4KA 4RLHA 4MPTA 1CUSA 3RUIA 4L0QA 1HQDA 3DBRB 3OQIB 4FYJA 4TQGA 4KVFA 4WFIA 2R7LA 2REXB 4HQ6A 3RVBA 3F96A 1RBMA 4IX9A 2C7PA 1LX7A 1U3CA 1Q14A 1SHJA 4PTLA 3OE4A 4L9RA 5J63A 1XRQA 2GN0A 2RGNC 5LQDA 2Q9UA 1AIPA 4IIJB 2WYVA 1VMEA 3KP1A 2XNDD 1VB5A 1K6EA 3PGXA 4FPXA 4BNZA 3ZHVA 2G77B 3MCZA 1W76A 1SUWA 2AXEA 4C7VA 1D7OA 3K6SA 5K0SA 4E07A 3AH8A 4LYGA 4JJ4A 3A7DA 2WAYA 5TT1A 2QUHA 4XLZA 4QDJA 4U2GA 2HMVA 2BHLA 2MSEB 2WILA 2ZM6B 4F91B 1FVFA 1M1NA 3SNHA 2CKMA 3BRCA 2ZRQA 1DV1A 1B76A 1Z74A 2VSXA 3BE4A 4EJ2A 5E1MA 1QB7A 5FBZA 2ZTSA 1DKLA 1AKTA 4LWZA 1RYYA 2D1FA 2XUKA 4OSPA 3CRRA 4BMNA 4LBZA 5ILQA 1LQTA 3ZY2A 2FJ0A 4IIGA 2RH5A 1QYWA 4KQFA 1P1CA 5JLAA 4A5OA 2FZGA 4CLEA 1KZ9A 3HV0A 4M1ZA 1WF6A 4UBNA 5ALQA 3S28A 3WMRA 3H5AA 4HHEA 2DULA 4MW9A 5B3JA 3REQB 1DV2A 3L4BA 1R16A 3WR5A 5CITA 5LDDC 3CONA 2XIQA 3G9UA 3JASA 3G59A 3LC0A 4MMXB 4EHNA 3H5WA 1J5PA 5E0KB 4MAMA 3I2KA 1JZTA 2LV8A 4LNUB 2W4QA 4LRQA 5E9WA 3IE0A 1GWNA 2GS9A 3SBOA 1XP8A 3K9NA 1XMQB 1TTPB 3T3OA 8MHTA 5FYDA 5H70A 1D1PA 2OWDA 2J3MA 2YFHA 5EXTA 3TMYA 2AOUB 2VTKA 1MA3A 1R0KA 3PC2A 1DJPA 1Q20A 1Q15A 1J39A 3A6EA 4Y2TA 2WUDA 1Y1KE 3QVUA 2QTVA 2A58A 4YDSA 1MLDA 1ZJYA 5ER9A 1UMDB 2B4YA 1YHYA 4M38A 1EVJA 4TT8A 5EWLA 4FB4A 4ZQGA 5C8DA 4O2AB 1JT9A 1NMSA 2BZ0A 3C1OA 4QJ5A 4F3CA 3IMEA 5A06A 3GGPA 5C1BA 1SBHA 2JAUA 4X66B 2EFJA 1XZIA 5C5CA 3CWCA 1BC5A 2WI8A 3VOTA 1B42A 3KC2A 1DO0A 1V8ZA 1ABEA 1TJ3A 2ZS7A 4G86A 1KFKB 5B53A 3BK7A 1FFGA 5BR8B 3CF2A 1LDBA 1UINA 2SKEA 1E9CA 2Z8YM 1OV4A 3RFVA 4KX5A 2VSOA 4QQKA 4IRUB 5LJLA 4DIBA 4MQEA 4WGGA 1JN0A 1WRBA 2RHOA 3F7NA 4Q1EA 4BKUA 5JOQA 1UOQA 2VUUA 2E18A 4Q7KA 3RNLA 2PUHA 2RGRA 2PGXA 2FSPA 3A2KA 4DNFA 1H9CA 3KQLA 3GJ0A 3PQDA 4BO2A 3DCYA 3LZCA 4QZVA 1ECFA 1W47A 3DS8A 4TWAA 4B43A 3UB4A 4BBJA 1EVYA 2WTEA 3IJEB 1A98A 3ZNOA 1MD9A 4F38A 1Q0PA 3FXAA 4BNYA 2QI9C 2G9ZA 4N48A 3VPBA 1ZONA 3KJIA 5DX0A 3KVVA 3LYUA 1SR8A 4M1MA 4A2WA 1G2PA 3WE7A 2OPHA 3VAYA 1NFFA 1F9AA 1K66A 2DJ5A 3H1FA 3QPBA 1Q0TA 1BFDA 1H66A 4QXAA 4TXMA 4GOOD 1DVRA 3U17A 1PS9A 1FSZA 2BFEB 5F3WB 2O2SA 2QMYA 3V00A 3Q5EA 1FOEB 3FVVA 3MT8A 1W4ZA 4J0JA 4RL6A 4RJJA 5P8WA 1ODFA 2H3HA 2ZU6A 1F0PA 3W79A 5K3EA 5HILA 3NALA 4AO7A 1H2XA 4GZ3A 1ZXBA 3JQPA 5ITZA 4V0SA 3MJHA 1JJ7A 3ZU3A 4B6QA 4CLDA 5B1SA 1GFIA 3C45A 3HBFA 3WBJA 3KPUA 3E3LA 4KQMA 3UJAA 3DBLB 2A9RA 1E3QA 2O7QA 2ONCA 4BIMA 2GKSA 4ZI2A 3UCFA 5U4QA 2QL6A 1FJGB 2VKQA 2R3SA 2OSVA 1GGJA 4FMCF 2XMRA 2NU9A 2JLSA 3NKLA 5LA6B 3EXHB 1E2LA 2YN4A 4HUQB 3NV7A 4L5IA 1CR1A 1TD1A 4IS3A 5DDIP 4F5ZA 5JXJA 1JB1A 4LDJA 3VHQA 3R9XA 2BSAA 3EVZA 1HQKA 2QLFA 4R40A 1JRLA 2PSDA 3L18A 1SXIA 1N2CB 3W8RA 1U2SA 4YJ2F 1VDMA 2QMOA 2E4AA 2W58A 4CT5A 4WY2A 3U4AA 3TXYA 2O0HA 3K72B 2F2TA 2G1UA 4G6ZA 4N0QA 4X6UA 1HSOA 2ZUWA 1GUFA 2QMHA 2QEQA 1E0SA 2XCLA 4NYJR 4OIMA 4OXXA 4RXUA 1PR5A 4OFZA 1E62A 4N39A 1EX6A 2H7XA 2M6SA 1C50A 1W6RA 2V1XA 4FDUA 1XHFA 1XJ5A 1P1RA 3K6RA 1MQ8B 2OWEA 2R68A 2VZ8A 1FFXB 1W0KD 4FLMA 4QTTB 2VSFA 4QXMA 2EF0A 2J3DA 1G20E 4PANA 2REQA 4UU1A 4HRXA 4AZWA 5LPNA 3FHTA 1B8UA 1SIOA 4M1SA 3EGEA 3MC1A 4J16C 1RPTA 2VDWA 4Q47A 1RPAA 1N3LA 1A9RA 4NZPA 3SHTA 1A4UA 1G21B 1Z34A 2X5NA 3N6XA 4K40A 4KVGA 4X24A 5A6SB 1X14A 4L22A 3WK4A 4B6OA 3O31A 4GBJA 4GX2A 1DAMA 4LHXA 4QGAA 5EMJA 1TMGE 3OF5A 3VKUA 2V7VA 5JPIA 1RIFA 4QICA 13PKA 1J7KA 4KH0A 3RWOA 4D41A 2XMBA 3ITKA 4LNHA 2WAXA 3U4GA 5ECGC 3TBKA 3KR1A 3MW8A 1DS6A 1JX6A 1RLUA 2ZR0A 1M3SA 2ZRFA 4OYLA 1J2UA 1FDTA 1NMXA 3BL5A 5JYBA 2BKUA 2PU7A 2PD6A 3FZGA 3R2JA 5DBEX 3FMVA 1O96A 5JR3A 4TTTS 1AN0A 1UBHS 3LYHA 4YP7A 2OFFA 1YI8A 1LPMA 3KVRA 3OZFA 3SOZA 5JMWA 5ISMA 3N2KB 3AW9A 1WXWA 3CEPB 2VFAA 1N6HA 1M8JA 1TW3A 2I22A 3R7AA 3NP7A 1CZOA 4A8HA 5ELLA 3K31A 3M3HA 1E3DA 5LQUA 1GGFA 1AA6A 3CVVA 3MWLA 1NI3A 5AK3A 4L4ZA 5EMKA 5FUYA 4P7BA 3VAZA 4DPLA 1V1MA 1DPGA 1WB4A 3NAQA 4YA6A 4BN4A 5A4KA 1ZHFA 2Y1KA 1HL7A 4AVYA 5BVHB 1A97A 3FYHA 4NYJQ 3EISA 4U7GA 1T5TA 3C39A 3NTUA 3NYRA 3M6VA 4GYJA 5CXQA 1G0NA 2AZ4A 4DLSA 4DLAA 2G76A 4IJQA 5CXUA 1UIMA 3RTGA 1VPWA 4HLCA 1AGPA 1OXXK 2BFOA 3JR3A 5DSZA 1ZM4A 3P9KA 2CUTA 2XCSB 1T26A 2EG9A 2IITA 2FRXA 3KRTA 1ZG3A 5EJGA 1M10A 2XGMA 3LQ4A 3X1KA 2IU3A 3VDXA 3UPUA 2C31A 1XQVA 2QUAA 2ADOA 4EGAA 4A2PA 2C8LA 3JZDA 4KR2A 4DPMA 3P20A 1UBKS 2XTJA 3TVTA 2VAXA 4E2XA 4M0PA 4PCLA 4C5CA 4FFRA 4YAGA 2BKXA 3PC8C 4BLVA 3L06A 2IUYA 3D8SA 1QE5A 1ZRHA 5FPHA 3THYB 3H11A 1MDFA 2JHAA 4BY9E 4QOSA 2EBWA 1X7XA 2WQZA 5HSGA 4TLEA 1KZHA 5B7PA 3UUGA 1MT3A 1WVMA 1XDGA 2I1QA 2JGRA 2QB5A 5CA0A 1JPUA 5J58A 1PV2A 4R2IA 3E5NA 2R1VA 3QFCA 4IIDA 2GERA 1JJBA 1PT9A 3TRHA 1HYQA 1IPEA 2WWWA 3G9QA 2NUPB 1JF8A 1NWCA 2JGKA 1GHTA 3C3BA 2MSLA 2RHJA 3BE6A 3R5KA 4GOKA 3S27A 5JFOA 4S1OA 1OX4A 3R40A 2UUAB 1OWNA 2HAEA 4DCUA 4YLEA 4MW7A 3G8YA 5E2AA 3Q3IA 4LXTA 4X6XA 1XEXB 5FV4A 5IAAA 4NV3A 5BYAA 1AXRA 3R0JA 1EQAA 3HMQA 3VV2A 2CE7A 2AJLI 2JATA 4I08A 4WGFA 4L6AA 3LM8A 3GRKA 2P2YA 3V7YA 4A0FA 4HVLA 2C2GA 1UXJA 2PZJA 2UVDA 3CKYA 4X90A 3PNPA 2D62A 4X65B 5KYXA 1PNTA 5B2FA 2O8FA 4MVXA 3WLMA 2X0FA 2I66A 1N5DA 1VHLA 3KYCB 5DN9A 3GVXA 2P5TB 4IHJF 1DKRA 3QUSA 4W99A 2GNAA 1XZBA 2O50A 2J6BA 3G1WA 3GP3A 3IEXA 2ZIZA 4RUKA 3CLHA 5CBPA 3IVXA 1Z5WA 4E88A 1I2ZA 2F3PA 4G09A 2RJ3A 3L1JA 4IJKA 4Q7JB 4YHHB 3KQHA 1JKJB