3SFVA

Crystal structure of the gdp-bound rab1a s25n mutant in complex with the coiled-coil domain of lida from legionella pneumophila
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
179
Chain Sequence
LGSMSSMNPEYDYLFKLLLIGDSGVGKNCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-1A
publication title Structural Insights into a Unique Legionella pneumophila Effector LidA Recognizing Both GDP and GTP Bound Rab1 in Their Active State
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/protein binding
total genus 56
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sfvA00
3P4YA 1XD2B 3RS2A 3A1WA 3K70C 1E2DA 1OW3B 3MAAC 2FFAA 3WMEA 1PUIA 1UADA 4RZXA 3GJ6A 3QIAA 1NKSA 3THOA 3REGA 2CMKA 2FNAA 1TU4A 3I73A 2VP5A 2C95A 3WRYC 1AK2A 4G1UC 2PX0A 4PC3A 3HR7A 5AK0A 5LPNA 4HAZA 4LWZA 4QXAA 1RW4A 3UMRA 3QEOA 2R65A 3CRW1 3ADDA 4YMVA 4MGZR 1D2EA 1VG1A 5FTKA 1OXSC 1SXJC 2J3EA 2VP0A 4QBFA 2CXXA 3V4RA 2ZETA 1KO8A 3FMFA 1CULC 4JYBA 5EP3A 4Q47A 2A9KA 2B7CA 3THYB 2QUZA 5LB2A 5EZ5A 1XDBA 1S0UA 2D7CA 8OHMA 1IM2A 5F98A 4WZ6A 1E79A 3K0AA 1TL7C 4WOPA 5FPTA 4DCTA 5FI0B 721PA 5KTYA 1Z06A 1IXZA 2B21A 2ZS7A 1Q21A 3SE0A 4ASUD 3T1QA 4DDWA 4L15A 3OIVA 1G5PA 3BJIC 1QVAA 4OQLA 3B2EA 3MFYA 2QSZA 4MKFA 2WWGA 1DAKA 4XH9B 3W34A 1E3MA 1NP6A 2QA5A 1QHIA 3L0OA 4IJMA 4EUNA 3WNBA 4RZ2A 1ZM7A 3NH6A 4NHOA 1B0UA 2QN6A 3KKNA 3TW8B 421PA 1M7HA 1U94A 2WZQA 3I32A 2VPPA 4HZUA 3AVOA 1Z8FA 2GAAA 3OAAD 4DJTA 3OZXA 2RB4A 4PZLA 3J81k 2AWNA 4X8MA 2XEXA 1Q20A 4O2RA 3VQTA 2HEIA 4EPYA 1XTIA 1MRSA 3KXKA 3K0EA 4ZKEA 4BLRA 2HCBA 3TSWA 2IK8A 2W2VA 3I4LA 4GZMA 3B6EA 2QG6A 4CRWB 2GZDA 1ZAKA 2C98A 2XB2A 3AF2A 1E99A 4XWKA 1GSIA 4YLGA 1TAGA 4TLDA 4OK5A 5L3VA 3ZS8A 4IRUB 2W83A 2GKSA 2QMOA 5FOTA 3WBJA 2BMJA 1JAHA 4Q4JA 5G53C 1NLZA 1EGAA 3NXSA 3AUYA 1ESNA 3K09A 3LD9A 3PR1A 1RRGA 3QUSA 4LX0A 3NBZC 4BLPA 5BXQC 1UJ2A 1P5ZB 4TLAA 1GL9B 1O87A 1T8UA 1KI3A 2OCPA 3GLIE 5FUVA 2YOGA 2ZI4A 2VH5R 4HB2A 3I92A 2O8BA 3OF5A 1OFTA 3B85A 5E3HA 2RHMA 3K0SA 5EUMA 4B2PA 1SHKA 3IDQA 3WRXC 4QJ3A 1G8YA 4G0NA 3QXJA 1YR9A 3GJ4A 5DSZA 1N6LA 4N0DA 1ZNWA 3KFVA 3NG1A 1D5CA 4AI6A 2B6HA 3QE0A 4TLEA 4V0OA 2F1JA 3KXLA 5TXGA 2C2HA 1OKKA 1N25A 3A8TA 1ETUA 2J9RA 3SHWA 4LJ5A 4B6FA 3LXXA 4KLZA 4WBSA 4F4CA 4FMBB 4NU0A 1TX4B 4RY2A 2GRJA 4C4PA 2IXFA 2ZUDA 1RRCA 2IHYA 2DPXA 2RGEA 2V9PA 4QHYA 2JJ2D 4ZDJA 1S4QA 3SNHA 3BH6A 1G19A 4ESHA 4IDPA 2NZJA 2QGNA 3QF4A 1G3QA 4QM6A 4PXAA 2YVUA 2FGJA 1IBRA 2ZAOA 4FXPA 3PJRA 3B1XA 4Q1EA 2FSHA 2J0SA 2R6CA 2G83A 1G8GA 4Z1MA 1G4UR 3CZQA 1GRQA 3D3QA 3BC1A 1GFIA 4R2IA 5IRCD 3QKRA 1U90A 2A5GA 2RKOA 3VX3A 5KNBA 3IIJA 1HQYE 1NSTA 1G3MA 5D3MB 1NVVR 2BM1A 1Z22A 4FMDF 4OQMA 4F92B 1IXRC 4O3MA 4NYIQ 5CDFE 1KNXA 1XD2A 2GEUA 4WZAE 4AIIA 3U7EB 1W2GA 4MQBA 5CLQA 1GOTA 2YHSA 2A5YB 4ZDKA 2QBYB 4M9XA 4CEIB 3KJHA 3LO5A 1MOZA 3N70A 2OXRA 2DR3A 3B82A 3KTAB 2YC4C 3DM9B 4LBZA 5CM9C 4DLUA 1LW7A 1XZQA 3ZVMA 4AKGA 1KJYA 1RKBA 3SDZA 4RZUA 2J7PA 1KSFX 1ZM4A 3FHCB 2IS1A 4OI1A 5JI2E 4C7OA 4I99A 4JLOA 5B58C 1SULA 1QBKC 1E0SA 2WICA 5FFMA 1EESA 2RGNC 2EFCB 2IBMA 1UEJA 4M1MA 3KJGA 2XXAA 2ZI3A 1S96A 3AF0A 4TN1A 5JHHB 2AX4A 1GKYA 1MO5A 1NVWQ 2GESA 2RCNA 4HB4A 2WWYA 3VAAA 4DB4A 4EPWA 2GXQA 3PVSA 2Q3MA 5KPJA 4IFEA 3ICEA 5DHFA 3NWJA 2YWHA 3LVRE 5J4KA 4CF7A 3THYA 4KSCA 2RHDA 1W36D 2CCGA 4BFZA 1PV4A 2ZRGA 1OIVA 1IN6A 3KQNA 3RWOA 1YRBA 2NO7A 2VA8A 1WMSA 2W6ID 3M6AA 3TNFA 4PHHA 4QGGA 1D8TA 1TF7A 3EC1A 2QQ0A 1SVSA 2GZHA 1UDWA 2OILA 2WKRA 3PITA 4KBFA 4URZR 1BKDR 4U7DA 2CHVA 3ND8A 4FWIB 5JEEA 2CNWD 2YNMA 1HTWA 2Z43A 2ZPTX 4EDHA 3MLEA 2WPDD 3CNNA 5H68A 2IW3A 3LY5A 5CIQA 2FN4A 4L9SA 3MJRA 1H8EA 1G7CA 3W6PA 4KFUA 2NPIA 5BYJA 2BOVA 2ZJ2A 3P27A 1G8FA 3RNLA 4JLDA 3K9HA 1E4VA 1H8HA 4IXMA 4CDGA 3TGPA 4LGMA 1UBFA 4PFSA 4BFWA 1E2NA 3FHOA 4KAXA 3R9XA 4R71A 1AS0A 3EZ6A 1VCIA 2OHFA 3SS8A 2V54A 3LX8A 3SZRA 2NTYC 4YMSA 1S8FA 3IEUA 1R8QA 1U2RA 2IYXA 4OJQA 1E32A 3CBQA 2NIPA 4RSGA 1XP8A 2WWXA 4D80A 1FFHA 3RANA 4AG5A 4BRWA 1EG7A 1JR3E 3IIKA 4EPVA 1JJVA 1KDPA 2R44A 4DWJA 2VL7A 1Y63A 2KWIA 3UG7A 2Q6TA 1R0WA 4R7ZA 2GVZC 5FOSA 4AK9A 2CK3A 1CJMA 4NONA 1II9A 3QJYA 1N0WA 1II0A 2VSOA 2QTFA 5DI9A 3BIFA 2ZE5A 4V0MA 1QDEA 1ZM3A 1YVDA 2EU8A 1P2UA 2N1BA 1XJCA 1BOFA 2ODWA 2BCGY 3VR1A 5C1BA 1P2TA 2PL3A 1ZJ6A 4B44A 4D4LA 1G3IA 1OSNA 1N5IA 2HXSA 4Q9LA 4OI0A 1TF5A 4LUCA 1AGPA 1FP7A 1RZ3A 1OH7A 2ZJOA 5JS7A 5FPYA 5HE8A 4CZ2A 3AKEA 3FMOB 4TZ6A 4B6EA 1NSFA 3SBDA 1S9HA 2PBRA 4DVGA 2IYVA 1U9IA 1NI3A 1OHHD 2H7VA 3WMFA 3CPHA 3T1OA 2CLCX 1QHHA 1II8A 4DLSA 3EWAA 5D3MA 5J4LA 2ONJA 3NDPA 4X8OA 2YZ2A 4V03A 2JASA 4BZXA 1X86B 4WIAA 1NMXA 2EWWA 1BH2A 4Q03A 2QBYA 1VPLA 4A2PA 3AEZA 5C4GB 3ZD7A 4CEIA 2AD1A 2V4ZA 5J40A 2GJ8A 3Q72A 1JR6A 4UNPA 1HV8A 2WM9B 1ZD1A 4G01B 4IDHA 4A82A 1SVIA 1P60A 3C14C 1R5NA 3Q7PA 3AVYA 1Z6XA 5GADl 3GLIA 1NN1A 2Q3FA 2TMKA 2ZR9A 3KB1A 5AWFC 5GJCA 3V4FA 2WAXA 3GLFE 1NJGA 5DI3A 4NCJA 2AXPA 1GKUB 2G3YA 2Q9CA 3SYLA 3PUVA 2WSSD 2FSFA 4Q1DA 1E9BA 1G20E 1LB1B 1P9RA 4KFSA 2Q9BA 1XMVA 1X1SA 1UEIA 3CRRA 1GZSA 1W48A 2IYSA 2IWRA 4E09A 1DAIA 4GMDA 1N5JA 2GXSA 1YZTA 4D4JA 3DO6A 4LOAA 2R62A 2GK6A 4N0EA 1KI1A 1N6KA 1TEVA 5F3WB 2C9CA 3RS5A 2GEVA 4IXNA 3LBHA 3EZ2A 3M1IA 1KI2A 1IN7A 5FI1B 2GJ9A 3AKDA 2ANCA 3B1ZA 3G5UA 3ZQ6A 3TMKA 2BCJQ 1G8PA 3C5CA 4IW3B 3IIMA 5A0FA 2VTKA 2EYQA 3ZZTA 1CP2A 1UDXA 4UJ5A 1CEEA 2CVFA 3L8ZA 5LDDC 3AVQA 1W0JD 4A6XA 4PC6A 4BZPA 3A6PC 1XMIA 4PHGA 5DISB 1VHTA 5KSPA 2RGCA 5CDFA 4QJ4A 1OH6A 2CJWB 3W5IA 4B2LA 3KJEA 4XTRA 1MO4A 5TARA 4P3YA 3KFXA 2OLJA 3FB4A 2YJTD 4HB3A 1G64A 4P4SB 2XNDA 4DT1B 2JLWA 2PMDA 3GEEA 5ELXA 3BH0A 4NCHA 2C78A 5JS8A 1G5RA 1MV5A 3PV0A 3ND9A 4CT4B 4JLBA 4FN5A 5G3ZA 2YWGA 3GFPA 1ELOA 2GETA 2XZOA 5HCIA 3UXMA 3IKJA 4QBGB 4A0RA 1XMSA 3HPRA 3FMIA 4D2IA 5FBLB 3RVBA 2FOLA 2ZSEA 2CHGA 4HUQB 1E9FA 1E9DA 1T4GA 2KE5A 2A5JA 3EZ9A 4EFNA 1HH4A 4M1KA 4C0KA 4I4LA 2FFBA 4D82A 3O8RA 4DHEA 4DDTA 5HKKA 4YONB 3DOEA 2QAGC 3TUJC 3GD7A 1WBBA 2ZANA 5L3QA 3A1SA 3EA5A 4R2HA 2HF9A 3LAWA 2EQBA 5LD2C 3EXAA 3LBIA 1LS1A 3AVUA 1DOAA 2ERXA 1G41A 2ZRKA 2CL6X 1GITA 1XZPA 4UXHA 4LRWA 4F4IA 2VRWA 2ZSBA 1GVNB 2GCOB 5JCPA 3I8SA 4JLKA 2XX3A 5AR1A 4JLNA 3L8YA 1UF9A 4G5SA 4BLOA 1X3SA 2R6GA 3IQXA 1XTKA 1UAAA 2BHRA 2ZE6A 3AKYA 1J2JA 4PR0A 1ZMXA 3CR8A 1KMQA 3V9PA 5IT5A 4HAVA 1M8PA 4KJZA 5JFGA 2J5XA 4M9QA 1NBMA 4JBYA 5JI3E 5BN5A 4FCTA 1OPXA 3E70C 4C0HA 1QVRA 4Z8YA 2UVQA 1N6PA 1P7CA 2ATVA 1N6OA 4QHSA 1CXZA 1SVOA 3DZ8A 4B73A 3HYTA 1JECA 3IO5A 2QAGA 4D81A 1ZP6A 5AUNB 4OHZA 1Z0IA 3TLXA 4BFVA 4NYIR 1E2JA 3MWKA 3DMDA 2DHRA 1ZRHA 4UNSA 4HAUA 3AH8A 2GJAA 4L9WA 4Q9IA 2P5TB 5EUQB 3X1ZA 4E07A 1CKEA 4LC1A 5FOVA 3T1VA 2JDID 2EFGA 4H1VA 3K0AB 3GJ3A 2GAOA 4XOIA 2FU5C 3CPJB 3HU3A 3KUCA 1OFUX 4GDFA 2FZLA 2IF0A 2QL6A 4GNKA 5AUQA 4MDEA 3WYAA 3WXMA 3TH5A 3U3JA 4F91B 4M53A 2QPAA 3U7HB 3QEJA 4XWOA 2CDNA 1KHTA 1R5BA 3W6OA 2ZJBA 3K70B 3QPVA 3HP1A 1ZYUA 2DB3A 4U00A 2YWFA 1XEXB 5DH9A 1M1YE 1P2VA 5DE3A 1QG2A 3QG5A 4KXFB 2ANBA 2FA9A 1X6VA 3TKLA 1DARA 1R0XA 4K46A 2OFXA 4UNNA 4TT3D 3B5JA 4TMXA 4WW0A 3G82C 4IEEA 3RABA 4P4UA 2BDTA 5K8TA 4Q01A 3KX2A 3VFDA 1SXJB 2XSZD 3T61A 2QMEA 4BRUA 5IK2D 1NIJA 1SVKA 4LC0A 5KHOC 1XJ0A 2IYTA 4LSGA 4A0GA 1KTVA 1T3LA 2JJ1D 4BECA 4LJYA 4AD8A 3L0PA 4Q9KA 3R7WA 5KSZA 4DXAA 3RC3A 5C18A 1DS6A 3VHLB 3ASZA 4PSAA 1P73A 3O8CA 1E2FA 1E0AA 5FTMA 4KCGA 4Q4HB 2BMFA 2ZR7A 1BYUA 2QP3A 1TU3A 1S3SA 3BBPA 2JA1A 3B1YA 2ZYWX 1TNDA 3MWYW 1M6NA 2W0SA 3BFXA 4ITRC 2CJWA 2O8BB 1XTQA 1Z08A 4QBHA 2A78A 2JJ8A 2XOKA 5F9HA 5IHPA 1UBCA 3KJIA 3PFIA 4HLCA 1OB5A 4CW7A 5JJIA 4DT1A 3TUIC 4YXWA 1CJVC 2ZRPA 2JLVA 4O2LA 2ZI9A 4LV6A 2FFHA 2PT5A 3TQFA 1IXSB 3C7KA 1XCPA 2H5EA 3HU1A 2RGXA 2DFTA 4GOXA 5M04A 1KGDA 4HUQA 4TYWA 3SYKA 1Z0DA 5KSOA 3T12A 3GLFA 3NHBA 2QROA 2E9SA 3QF4B 3FKSD 1DELA 1E9RA 1TQ6A 2E1RA 4QG7A 4FINA 4D0NA 2Z0MA 5GJWC 1Z07A 2H57A 4C0QC 3D6TB 1CS4C 4RFSB 4RD0A 1D6JA 3EPLA 3SQWA 1GAJA 5FL3A 1LVGA 1ZM2A 1JALA 3TR0A 1FW6A 4NH0A 4DCVA 4DLTA 1KI9A 1OIWA 1DBSA 3QKRB 1HE1C 1U81A 2HLDD 3CX8A 521PA 4F7WA 4DCUA 4OI2A 3BB1A 3NEYA 3GEHA 2WMOB 3LLUA 3PUYA 1JBKA 1T8TA 2ZJ5A 3NKVA 1YHNA 1JXMA 4NYMR 4DZZA 1A82A 5CK4A 2BBOA 5FOWA 2N46A 2IYZA 4QJ5A 4BFUA 1RPZA 3SQXA 1E98A 3IILA 3M0EA 1YR7A 2CE2X 2FPMA 3TAHA 2NOAA 2YOHA 2ZRAA 1OH8A 1VG8A 5KDOA 1TMKA 4Q21A 1DAGA 4US1R 2ODNA 1ZC4A 4MKGA 1JI0A 4XSGA 4C7OB 2D7DA 1JB1A 1G21E 4QGHA 5B30A 1CJUC 3U6KA 2XXAB 1M34E 4CEJB 1C4OA 4QC2A 3ZIAA 4G5GA 2C8VA 2EWVA 1N6NA 2WWFA 4TMVA 1TADA 2ZYUX 2WVJA 2AKAB 3DMNA 1NRJB 1PLJA 4B47A 5EE3A 1ZVQA 5DYIA 3QVUA 3GLGA 1KI4A 1BMFA 2VF7A 3HR8A 1F48A 3OE7D 5EP4A 5F2EA 4URVR 1E1QD 4PPNA 5P21A 1Z0KA 2IA5A 3OAAA 2WIBA 3CRMA 4C0JA 1AJEA 4GP7A 1XTJA 3QQ5A 1XRJA 1LY1A 4LBYA 2QMUA 4PHFA 1XMJA 4ARZA 3ZD6A 1GDDA 4DCSA 4M2LA 1RYHA 4BFSA 4C3ZA 2RGDA 4C0LA 2ZSDA 1NLYA 3KUDA 2QM7A 1KIMA 1NJFA 4JZKA 4HAYA 1ZNYA 1KI7A 1XEWY 2D74A 3ASYA 1KK2A 4AYWA 3ADKA 1CBUA 5JRZA 3KL4A 1AS3A 3NC0C 3GMTA 4JIMA 2AWOA 3ZS9A 3QPUA 5EE9A 4DDVA 3ZQJA 4AKHA 4DSOA 1IY0A 4KO8A 4KI0A 1ZUIA 2PH1A 1XEXA 3LA6A 1E94E 5EXSA 4IOKA 2SHKA 1DAEA 1YE8A 1KDOA 5EE5B 3B78A 1P9NA 2G9NA 3TSOA 3R9IA 1JPJA 1T5IA 2VHUA 3TK1A 2FFQA 1N6RA 4DC9A 3LV8A 3LVQE 2Q0HA 4DLYA 4CEHB 5JSZA 2C96A 2WMNB 4PC2A 5H8WA 1LTQA 4MUBA 1JQJC 5CJ2A 1SXJA 4HLDA 1D2MA 4G5QA 3KKOA 4RKEA 1DADA 1G7RA 4QGAA 1CR4A 3WNCA 1WXQA 4CT5A 2IF2A 1KYIA 1XBTA 1U0JA 4NMMA 2IUUA 1S1CA 2WKQA 1SKQA 4LV5B 3LDAA 1PLLA 3EARA 3KDSE 5DGXA 4US2R 1IN5A 3AGPA 1E79D 5DN6A 4OK6A 3FYHA 4TZ0A 4B76A 2F55A 4XD7A 2IYLD 4OQXA 2OFWA 3NEJA 3IGFA 2ZRMA 4LJ7A 1GKIA 1XD8A 3G0HA 3DDCA 3TUZC 1KDRA 2P6NA 3CF6R 2D62A 1FNMA 1T5LA 5K8UA 1W36C 2VP2A 2GF9A 1W4BA 1OFHA 2AN9A 4G5OA 3TVDA 2QZ4A 1W0KA 1ANKA 1Z2AA 1Z29A 1ZUNB 2G77B 3SFVA 1WP9A 4DLZA 1XXHE 2AK2A 4TMKA 4TYNA 3EG5A 1Q3HA 2KJQA 3KKPA 1V5WA 2NO9A 1Z2CA 2DFKB 1MT0A 2BBWA 2D4HA 2HXYA 2WHXA 4LJ6A 4M9SA 2W2TA 4PO9A 1EFHA 5LBIA 3T34A 4EAQA 3PUXA 4P4TA 2YKGA 3U61B 3THXB 1YZGA 3CM0A 3UMFA 5IDVA 1JJ7A 3RS0A 1J99A 3GLHE 1XTSA 2ZXUA 5TDHA 3OEEA 4RFSA 1JQLB 4ZO4A 1KJWA 2PCJA 4KU4A 3W8NA 4GRAA 1AN0A 1ZCAA 3KQKA 4OHYA 3N2IA 3OEHA 2HT6A 1VDZA 1GG2A 4WVFA 1Z83A 1VYUA 2Y8EA 2J59A 3QXXA 4U5XA 3VHXA 3VR6A 4EJSC 3Q3JB 4OYHA 3PQCA 3CB4A 5EJEA 3OFNA 1QHHB 1R2QA 4ZPXA 3SI7A 1II8B 3LBNA 1MH1A 5FL7D 2GHIA 2Z83A 4KFTA 5EE1A 1A1VA 2I1QA 3K9GA 4DCNA 5HPYB 2ONKA 2QEQA 3CZPA 4MYUA 2ZU6A 1ZBDA 4KBGA 2OE2A 3EC2A 5FH9A 3ZLJA 3CUEF 4V0LA 3AKCA 4PSKA 1XB2A 4ESVA 2D2FA 1GNRA 5J4VA 4BASA 1KI6B 3CRVA 3DKPA 3LRPA 4MRVA 4JT4A 2ZRNA 3MD0A 2F1RA 3MWLA 2LKCA 3GLIB 3QKTA 3Q8XB 1RIFA 3UATA 2DWOA 4FMDB 4Q1FA 1KY2A 3RSOA 4CEJA 1LF0A 2RH5A 4G3XA 3E2IA 4IEIA 3GJ5A 5DI3B 2BV3A 3U2QA 4MRSA 1E0KA 4A6PA 3BFKA 4YMWA 4Q19A 1ZIPA 2PZEA 3K0FB 1HY3A 1U99A 2Q9AA 1WA5A 4LJ4A 2HYIC 3IPXA 4JLJA 2UZIR 4LHYA 5JJLA 4Z1MD 4M4SA 2JAQA 2QI9C 1HUQA 1A2BA 3K9NA 3EASA 3VKGA 1ZNZA 2ECKA 3REFA 4EJSA 2PZFA 4RCZA 3ADBA 3MG9A 4NYJR 3P26A 2XZPA 2FSGA 1US8B 3KQUA 5AJVB 1FL9A 5HE9A 3RSLA 3AVWA 1E0JA 3H0KA 3I5YA 1R8SA 3I1FA 2JLQA 1ZIOA 2G1JA 2VO1A 3UANA 1OH5A 2WOOA 2ZRHA 2F1HA 3BS4A 3P20A 1WQ1R 4Q66C 1TQ4A 5FOXA 2LWIA 4B3CA 4PPQA 4ZIRB 2PT7A 5FTLA 2ZUBA 1D9ZA 3F0TA 4LYFA 4ACAA 2W0MA 5E95A 5JWRA 2C9YA 4WZBE 4LBWA 3ZZUA 2RGNA 2V3CC 3AVPA 4CEHA 4UJ3A 4B2IA 2OXCA 2V1UA 1SQ5A 5FBWB 2J0VA 5J4HA 5G40A 2FDCA 2IC5A 5C4MA 1W7AA 1R0YA 1Z0AA 1LNZA 2ORVA 4BLSA 3VU9B 2QT0A 3IPYA 2CL7X 3EAQA 4U02A 1L4YA 2VSXA 2EFHB 3I5XA 1NVXQ 2RGBA 2REBA 4A4DA 3EPKA 2OEPA 1GM5A 1NY6A 3X1XA 2ZRIA 3SJZA 1UBEA 4C2UA 3F8TA 1SZPA 1Z3IX 5KUTA 4NZYA 3VR2A 2J0UA 3AP1A 2BM0A 3Q9LA 4FWTA 2P6RA 4M1TA 1W5SA 2OV2A 2QMHA 3SJBA 2MSCB 5CIWA 5L3QB 3VKHA 2AL7A 1COWA 1TEXA 2BBTA 2GZAA 3A1VA 3BH7A 1UKYA 2NO0A 1TUEA 1EFTA 1YZNA 2F7SA 2X19A 4RD3A 2JLYA 2V55B 1OHHA 3GP8A 3MRSA 2H17A 4I1VA 2X2EA 4UQOA 2IS4A 3X1YA 1RRFA 4NYMQ 1EFCA 3QPWA 1J7KA 3SBEA 2OUKA 1H8ED 4M1OA 1E1RD 2BMEA 4ZDIA 2KB0A 3RYTC 2H8KA 3ICQB 1YZUA 1B23P 2WIAA 2ZI5A 1KAOA 2O8DB 4PO1A 3THXA 1ZD8A 1KSGA 1H8HD 1N6IA 5C46F 2ZI7A 2DFLA 4B3FX 2XITA 1PUJA 1KZ7B 2ZR0A 5JWHA 4RKFA 1DTSA 5TVKA 3TBKA 1EFUA 2FF7A 5CITA 4G5RA 1FMJA 2J45A 4IDOA 4KYIB 1E9SA 4Q7JB 4JLAA 2X8AA 1NLFA 3JVUA 3I72A 3L43A 1P4SA 2ZRCA 5DYGA 3I61A 2IEZA 2V1XA 2QAGB 3PUZA 3ZDQA 3CIOA 4POAA 2CK3D 2EVWX 2IYYA 1Q0UA 1UKEA 4FD2A 1F2TB 3DPUA 4P0TA 1F5NA 2QGZA 5LD2B 4KVGA 4V0NA 3NDBB 1KI6A 2DYKA 4Z8XA 2QT1A 2Z4SA 4MYCA 4JL5A 1JEEA 3BB4A 1KK0A 4MYTA 4WXPA 3Q7QA 4DSUA 1FTSA 2JGNA 3K0CC 4HZIA 4LI0A 2FEOA 2IYQA 2GXUA 3EX7C 3QXCA 1MO6A 1YZLA 2V8OA 3K0FA 4E03A 3LQRA 4DSNA 3QF7A 2VP9A 3BRWD 5CB6A 2G1KA 3ECCA 3FGNA 1ZUHA 1GNPA 3IHWA 1QHYA 4OBEA 1IY1A 1EWRA 4ZKDA 1SVMA 1IONA 4DSTA 5AJZA 2ZJZA 1FMLA 1N6HA 5AUOB 2ZE7A 3AQ4A 1US8A 4BUJA 4M22A 4Q48A 4MKIA 4QHTA 4Q00A 1FUKA 1XF9A 1W49A 1KKLA 4DRZA 1PJRA 2BEKA 4JBXA 1K5DA 4S2EA 4ZCLA 2VHTA 1DG3A 5L3RA 3WHKA 3R7WB 4KV9A 2VSFA 4K8OA 1Q44A 5CK5A 1ESMA 4ZIRA 1OXUA 5B2ZA 4I1OA 3U7GA 2Q3HA 3GFTA 4PC7A 4LYHA 5CJPA 4BLTA 3CO5A 1N3BA 3CR7A 5L3SA 4MA4A 3VMFA 4PZZA 3IQWA 4WA7A 4DBLC 3TRFA 2EYUA 4GZLA 3RAPR 1E4YA 2JIZA 2F9LA 1L8QA 1G17A 3JVVA 3TE6A 3GQBA 1BS1A 3C15C 3BD9A 2G0TA 2ZS9A 3AF4A 5HZHA 3VU9A 4P32A 3CNLA 1P75A 3KQHA 4DEXA 1HT2E 4QNRA 1J90A 1KO1A 2WWWA 5A5GA 2PEZA 2J1LA 3B9PA 4TL9A 4TQ9A 2VYFA 2C5LA 2YV5A 4CGZA 2V7QD 4JVNA 1E2PA 3GLFB 5JLJA 3WP1B 2I1VB 4W5WA 3QKSB 3QY0A 3QSYA 1S3GA 1YQTA 2W00A 1FTNA 2FV8A 2GCNA 1EXMA 2QY9A 1E69A 3QI2A 4GL2A 5FUXA 4MRPA 4LK2A 1SKYE 1NMYA 1T0JB 4KHZA 4TLBA 4F93B 3AVXA 2ZRDA 2FX3A 4Q7KA 1PZNA 4D26A 1N5KA 1DO2A 4GP6A 2QSYA 1E9EA 2RGGA 4W5JA 4C0SA 1XPOA 1GRNA 1KMHB 5EP1A 5KSYA 2XJ9A 3QBTA 2JLZA 3B60A 2RAPA 3VTKA 4ILEA 1EFRA 2O8DA 3H2YA 2P6UA 5EXPA 5TMPA 2O8EA 1XFAA 1U0HC 4RCYA 2W6JD 1JPNA 3C4JA 3U3RA 3EIEA 5J47A 1AM4D 4ABYA 1OXVA 2O0KA 4IOJA 2IS2A 4C0BA 2JLRA 3EZ7A 4LPSA 1N5LA 3D31A 4AG6A 2C03A 1MR3F 5SZHB 2ZUCA 4Y0VA 1VYVA 1PVOA 2REXB 2WWHA 4RVCA 1IJEA 4TSFA 2EFDB 4H1UA 3F5FA 2YWEA 3HU2A 1I4DD 4D0GA 4B75A 1S9DA 3TW4A 5HKKD 2ZITA 4I1SA 2J41A 1KO4A 4DUGA 5F9FA 2X2FA 3C8UA 3LFUA 3GLGB 5GJVC 3HWSA 1N2CE 1GTVA 1YR8A 2QE7A 3ADCA 2I3BA 821PA 4NYJQ 1IY2A 1F2TA 2DCUA 3SC3A 2VHQA 2EFEB 3CW2A 1EK0A 3PEVA 2NPFA 2ODEA 1P6XA 5SZJA 3U5ZB 4GI7A 4ARZB 2NGRA 1WBDA 2LKDA 1ZU5A 621PA 3LWNA 4QRHA 4NCNA 4PAOA 4IVPA 5C2JB 3LX5A 3O8BA 1E9AA 1RRPA 4CIDA 1JR3A 3K9LA 4DEYA 3CNOA 2XSZA 4RZ3A 4NCIA 4UNQA 2HT1A 5FPHA 1HT1E 3TSZA 4DLXA 1KOFA 2HJGA 1TF2A 4QOSA 3QG1A 1O3YA 1CJKC 4JL8A 3A58B 5HR5A 4R98A 3PG5A 3O8DA 2V6IA 4JLPA 3RC8A 1VECA 3ZVRA 5G41A 3PUWA 4B33A 4URYR 4GPTA 2XNSA 3B1WA 3R20A 3ETLA 1LFDB 4QBIA 2J7KA 3NIBA 2UZ3A 1BYIA 1NBMD 5JJKA 1GL7A 5JHGB 4HLUC 1MABB 1WE2A 1IJFA 5JSZB 1CRPA 2QENA 1CR2A 2AFIE 1G7TA 3VR5A 4DDUA 2RMKA 4J0QA 4JKIA 2ZJAA 5SZKB 3W90A 4XVQA 1QZXA 1J8YF 1DE0A 1NY5A 2XB4A 3CPEA 3MCAA 2GJKA 3W5JA 3MSXA 1NMZA 1KZGB 1W1WA 3KZ1E 3DEFA 1KNQA 2R2AA 2QNRA 4URXR 3T35A 4B34A 4D4MA 2Z6VA 4URUR 1ZC3A 2ZM5A 2KSQA 5CLLA 1U0LA 3PENA 3ZVLA 1FX0B 3WY9A 2FMXA 1FNNA 2GDJA 3CF0A 1W4CA 1CU1A 3GJ0A 2MSEB 4PC1A 4PAQA 5BW8A 1VCMA 2HLDA 5J4YA 1G8HA 4LDJA 3RRZA 3AV0B 2FE4A 1U8ZA 2FPKA 2R9VA 3A4NA 5DO9A 2NO1A 2ZI6A 4JYCA 2F1IA 3DKVA 1G7SA 2NZ8A 2KBFA 3QKSA 4YMUA 4TWZA 1ZNXA 1Z28A 4FW9A 1AA9A 2IWHA 3CX6A 2QRZA 3BXZA 3BFVA 4KYUA 2REOA 1S2MA 4RFVA 3TVTA 3TIFA 1OJLA 3EA0A 5EP2A 4EKDA 1D9XA 3IO3A 1QHNA 2WBLC 1G6OA 1DPFA 1P61B 2ZRLA 2VEDA 1UBGA 1C9KA 2QP4A 1YZQA 2ATXA 2VF8A 3KKMA 3GFOA 4ZDWA 4XTCS 4JS0A 1XCMA 4LHZA 4LJ9A 1KMHA 5BWMA 1UM8A 4A8JB 4PTLA 4C2TA 3EWSA 4PQYA 1FP6A 4RD6A 3T15A 2XOKD 5KU1A 3WYFA 2OSBA 3I3SR 3T06B 1X8JA 1M7GA 3OHMA 3PEUA 2KI5A 5FUYA 1GUAA 2ZSFA 1NG1A 1UFQA 3LW8A 1N0UA 4GFDA 4YXWD 1W36B 3Q5DA 4GOKA 4P31A 1UPTA 3KB2A 4ERNA 4A2QA 4B43A 1EX7A 3HPQA 2VIIA 4TMTA 4ZI2A 1HEIA 4ASUA 3BGWA 221PA 3NBFA 2W2XA 2X1VA 3UMSA 1CF4A 2J46A 4JJZA 4HEJA 2ODBA 3C5HA 4EQ6B 1Q22A 1X1RA 4YC7A 2BBSA 5FR2A 3ZH9B 1E2IA 2P65A 3LQQA 3RDPA 3EPJA 3H4MA 5FTJA 4QM7A 4E22A 3A4MA 2CBZA 1W4RA 2WJYA 4LJ8A 4NL4H 3EZFA 2ZU0C 4PAMA 3UG6A 5K8LA 3GJ8A 1RE0A 2CEAA 3BORA 4DIEA 4ZCIA 1G3RA 1Z6TA 1Q12A 2ZTSA 2VBCA 4MH0R 5E7JA 4EJSB 3U3MA 3IUYA 2XJ4A 4LYAA 4PANA 1XU4A 4P33A 4RJLA 1KSHA 3AVVA 5JCZA 5FBRB 3IEVA 2IX3A 1M74A 1DG1G 3T5GA 4IFBA 5L8VA 3THWB 3KKQA 1F3OA 4PQFA 3RLFA 1KK3A 4MKHA 4OI4A 4YDSA 3K09C 2ZJ8A 4V0ME 1NL3A 3C41J 4M9ZA 4NBSA 3IBGA 3B1VA 4BZQA 3NVAA 3SYNA 2NO6A 1Z5ZA 1NF3A 2IXEA 4JT2A 4MRNA 5KDLA 2P5SA 5FPKA 2H1LA 1A7JA 3A1UA 4AWXA 4B3BA 1MABA 2ZAMA 4N1AA 3ZIAD 4AKIA 1E2QA 4NCKA 2IHBA 3R8CA 4LV8B 1K6MA 3RWMB 2J0QA 2AK3A 4MRRA 5BQ5A 1BMFD 4AYTA 4BWYA 1R0ZA 1QG4A 4GOJA 1R7RA 4PHTA 5A4JA 1YJ5A 1HYQA 2DY1A 2VQSA 2JJ2A 2QPTA 3RRMA 4JLVA 3QXHA 3CRQA 1VMAA 3FKQA 3OIYA 2IL1A 1DVRA 5KOYA 1TTTA 2J0UB 2J87A 3X1WA 2FSIA 4A8JC 2IS6A 1GRRA 3FMPB 4LY6A 4JVMA 4JJKA 2OAQ1 3PIRA 1FX0A 2D06A 4Q5IA 3K70D 4YDHB 1AKYA 2HJVA 2OZEA 2PZGA 4PX9A 2L0XA 3BB3A 4UNRA 2CVHA 4HLQB 2A7QA 3B7GA 3WYGA 2PLRA 1Z0JA 5FL7A 2O0JA 1XWIA 3H84A 4OJKA 2O8FA 4TYQA 3AM1A 1CR1A 1Z47A 4US0R 4NE2A 4O25A 2NQ2C 2QAJA 3V00A 2GILA 1RC8A 2H18A 5FR1A 3ZGXA 3NC1C 3O47A 4N3NA 1SXJD 2PLFA 3SJAA 1HA3A 5FBQB 3ZJYA 2ZYVX 4PSVA 5G3YA 4EFMA 2ZSAA 4GMXA 3WNDA 2VP6A 1E2HA 2WAYA 4OHWA 1T3SA 4Q9HA 3P4XA 2CL0X 3QXSA 3UWOA 2LCFA 4A0HA 3A36A 4A0FA 2A30A 3QOFA 5HZKA 1T9HA 4LZZA 3PCRB 1IN4A 5EQTA 1PLKA 4QNMA 2IUSA 1P9WA 3CLVA 1F2UA 5CYOA 1G9XA 4PZYA 5DN6D 4A8JA 2A5DA 4XD7D 4HSEA 3FFBA 5GVSA 2AXNA 4Q18A 2ZE8A 3E1SA 1ONBA 1X8KA 3L0SA 2PJRA 1KI8A 2FWRA 3FFAA 3QVVA 5JECA 1AS2A 1OKKD 5JWOA 1W0KD 1DO0A 4XIGS 4Q4HA 4ZCMA 2W6IA 4KFRA 2GA8A 1YZKA 4NPHA 4KSBA 4YQFA 4EQ6A 4OQFA 1E96A 3U3KA 1NN5A 4Q02A 3TQCA 5H70A 1R4AA 1QHGA 1Z0FA 4NKRA 5J5CA 3AF3A 3RRYA 2CCJA 2CNWA 3NH9A 4EPTA 3VNUA 1NG9A 2MMGA 4RD2A 3OEED 2O0HA 1T6NA 1SVWA 3FPAA 5JMTA 5AJXA 1KSJA 2WPDA 3OEHD 2WOJA 4OKSA 5DNYB 4I81A 4TYPA 3A1TA 1XXHB 4HI0E 2ZEJA 3I8XA 4OHVA 1TUIA 3WP0A 1S1MA 3ZVNA 2O5VA 4WXRA 3OFND 1R5OA 5KNDA 4BEBA 3U44B 1Q57A 1TQDA 1YR6A 1Q1BA 4C9BA 1W4AA 4MGKR 4JL6A 3GLHB 2OT3B 2OO7A 2OESA 2XAUA 1YRAA 2DWQA 2IYWA 1RVDA 1IAQA 3DL0A 1CTQA 3THWA 2A5FA 4D25A 2ZVPX 3WBKA 1OYWA 4M1YA 4L5BA 3SFZA 2P0EA 1E9CA 2CLSA 2GNOA 3BERA 1I4TD 3UIEA 3PEWA 2P2LA 1IQPA 1OXTA 3L82B 2HYDA 3MUFA 3RS7A 2R6FA 1SHZA 2J7PD 4TL6A 3R9WA 4MITA 5L3SB 2XTNA 4V02A 2OG2A 1MO3A 2XTMA 1IN8A 4Q7LA 4MDFA 3FVQA 4Q4LA 1C1YA 2JLUA 2O52A 5DIFA 2OFOA 1OXXK 4L16A 2Z4RA 4D0LB 5UKDA 2IYRA 1QRAA 2NG1A 3TJZA 3LXRA 3CF2A 3LH5A 1DAFA 4L8GA 1L2TA 2P67A 3CH4B 5JBQA 1VCOA 4UXIA 2YC2C 1LF5A 2QP9X 1AZSC 2ZRFA 3A37A 1W46A 1NN0A 1QF9A 1M2OB 1SGWA 2GWHA 1NBME 1E1RA 4JVLA 2GXAA 3SR0A 4HUTA 4IDQA 3LNCA 4B3XA 4LBVA 2ASEA 5FUWA 2CCKA 2G0NA 2MMCA 1FUUA 1H65A 4KODA 4AURA 4XWAA 1E2EA 3BAFA 4V0KA 3HYRA 3QNUA 2BWJA 5HCNA 5B57C 4W9MC 5EZ6B 2K5UA 1U9IC 5TY0A 4B48A 3D7MA 1V43A 2C9OA 2VHJA 4A9AA 2B92A 3DHWC 4HDQB 5E7IA 4Q4AB 1BIFA 3FOZA 4FCWA 3WHLA 2YINC 4Y0AA 2FPLA 1F60A 2CLDX 4IHQA 4A36A 3SJCA 4TMZA 5HTKA 2ORWA 2P3SA 4BEJA 2O8EB 2BIFA 2ZJYA 5ANRB 3AGQA 5KYKA 1CR0A 2WJVA 4LPKA 1OT3A 2GK7A 3SEAA 2AHOA 3CH5A 3QENA 3KXIA 1VIYA 4MUAA 2F3RA 2F6RA 2VHCA 4DLVA 1Z6YA 1DAHA 1QHSA 5CB8A 4A15A 1KY3A 4F38A 1WF3A 2OCAA 4AKEA 1XNJA 2WSSA 4IOMA 2GF0A 1R6BX 1E2LA 3SN6A 3RS4A 1P62B 2N42A 4NP6A 1M7BA 3HJNA 2QRNA 1I2MA 1Q1EA 4HYYA 1COWD 2OBMA 3NHAA 3ZZ0A 4EIWA 4TTQA 4E5UA 2ZRBA 3UPUA 1OF1A 1JAIA 3W8RA 1R10A 3L0IB 1ZINA 1OFIA 5D3QA 2OCBA 2AFHE 4DIDA 3AP2A 3U4QB 4D4KA 2JCSA 1G5TA 1K8RA 4UXJA 3NTUA 4BQSA 1U98A 1A5TA 1HURA 2BEJA 1BO6A 2HF8A 2ORIA 3CX7A 5GVRA 1L4UA 4ACBA 4A92A 3H1TA 4EPRA 2A3RA 2C99A 1P72A 3KTAA 1W47A 4OQNA 3HDTA 1OE0A 2UKDA 5DHAA 2PX3A 3OESA 2BC9A 4UKDA 4NDZA 1W0JA 2BKUA 3F3YA 4AYXA 2IEYA 4DLWA 1XXHA 4ON9A 4EPXA 3S1AB 2O8CB 4D6PA 2IUTA 1T3HA 4GT1A 3U44A 1ZD9A 2B8WA 1G1MA 1GWNA 1Z6GA 4W5HA 2GBLC 1VYTA 1FPMA 2WJIA 1AIPA 4IVRA 1GILA 3K1JA 4BFTA 3GLHA 1XD9A 3A4LA 3KQLA 1W44A 2VLIA 3TR5A 1T0HB 4M8NE 1TPZA 3MMPA 4TL7A 2IT1A 1U8YA 1KO5A 2WJGA 5E7MA 5KDDA 2V7QA 2QTHA 1DEKA 4QGFA 4EFLA 4BPBA 4DKXA 3U7FB 2FH5B 2QORA 1A2KC 2GEDA 4HAXA 1Z63A 1XJQA 1GP2A 2WKPA 1OLOA 3K0CA 3T5DA 2OBNA 3CWQA 3DVLA 2DWPA 4LHVA 3SU8A 2HUPA 3C16C 3P32A 1LV7A 2OBLA 4S35A 3W6NA 3GJ7A 1KDTA 3AP3A 3VR3A 3RS3A 4PPFA 4C30A 2XTZA 1HQCA 4H9GA 4TYYA 1YKSA 3GJXC 3X1DA 1NNEA 3IBYA 4LHWA 1F6BA 2F3TA 3GCGA 4HDOB 4KITB 3AF1A 4C0AC 4BE7B 3U6BA 1W5TA 2EW1A 2ZS8A 2NMVA 2BKEA 3L2OB 1W2HA 3T1TA 3ONWA 2V6JA 1L7VC 4TLCA 1UKVY 4FMCF 1KO7A 2OCYC 1P2SA 2GBLA 2KBEA 4Z51A 5DLQC 1ZW6A 2WWIA 1JNYA 6Q21A 1I4LD 1G3UA 3MGCA 2BMDA 1P3JA 1J70A 4YMTA 5EXTA 3GLGE 3B9QA 1FQKA 2DFNA 4LCBA 4URWR 2W6JA 1CLUA 1RYFA 2WV9A 2ZQ5A 2YYZA 4HAWA 5FPSA 4O0MA 1G18A 2XZLA 2FGKA 4NTZA 2YOFA 2Z5FA 3UWKA 4AY2A 3NBXX 3B8HA 4FI3C 4BGDA 3CWZA 5K8IA 2JLSA 1OIXA 1JEDA 2HCJB 2WJJA 4X8LA 3Q85A 5EE0A 3K53A 1N0VC 2BJWA 4M0LA 4Q4AA 4XJXA 1AZTA 4A2WA 4FMCB 3FDIA 1E2KA 4W7SA 4BFXA 2F9MA 1XTRA 3E5HA 1IHUA 4X8HA 1RJ9B 2D2EA 1XEWX 5FTNA 1KJZA 2JIZD 5EXXA 2XNDD 1EWQA 4JBWA 2ZREA 4PO8A 1UKZA 4OHXA 3SHFA 2H16A 3TAUA 4B35A 5AJYA 1NVVQ 4FIDA 2JDIA 2AD5A 2R6DA 4RD1A 2IYUA 1NKTA 1LS6A 3BK7A 2FG5A 3RRNA 2JEOA 1VKJA 2D3WA 4XSHA 1AQYA 1KAGA 3MWJA 5FBVB 2F43B 1I2DA 1Y3AA 3N2EA 4IKEA 4K81B 1QHXA 4TTPA 3RHFA 1FOEB 1OYYA 5KNCA 4PPGA 2GVDC 3OIWA 1SXJE 4TMWA 1TQ2A 1NVUQ 2X77A 3B13B 4B74A 1XPRA 4JSYA 4B32A 3MJHA 1WB9A 5BYKA 3I62A 2OAP1 121PA 3EIQA 1E6CA 3N5CA 2ERYA 2H92A 2Q21A 4TT3A 2ZIAA 2ZRJA 2FEMA 2PCLA 5JEDA 4AC9A 4OK3A 5E4FA 2I4IA 2VP4A 5JRJA 4MYHA 3U60B 3EPHA 5B64A 3U4QA 4Q1AA 1G291 1GIAA 3W3AA 5IK2A 4KLNA 5KPDA 1GL6A 2MSDB 4WAUA 3GEIA 2FJUA 3FE2A 4A1FA 3FTQA 2JJ1A 1ZCBA 1FZQA 3AUXA 3BWDD 1EFRD 4JLMA 4RD4A 1U8AA 5LB4A 1SKYB 1NIPA 2XGJA 3UKDA 3CONA 3EW9A 2JLXA 2QU8A 4QL3A 1SVLA 3BOSA 1T91A 4Q9JA 5BN4A 3JZMA 3FHTA 2O8CA 3S1AA 4TL8A 4TQAA 4CYMA 3R8FA 5JZVA 1ZU4A 3JZAA 2R8RA 1VG0B 1VCNA 3QBVA 4FCVA 4B71A 4CVNA 4TSFD 1OV4A 5GJBA 3IHLA 1XPUA 4F4JA 1ZM9A 1FQJA 3M4YA 1IOZA 4MGYR 1KKMA 1OB2A 4DUGD 5IF9A 4DB2A 1G16A 4OL0A 3EIHA 1WCV1 2PMKA 1G6HA 1G4AE 2GCPA 2GTPA 4GBMA 1JXOA 3VR4A 2QE7D 2DBYA 3QKUA 4HZUB 2ZVQX 3X2SA 1E2GA 4IOLA 5AUPB 3Q5EA 3BE4A 4DLRA 4JVSB 5CYPA 4XVRA 4TTRA 3CKLA 3DOFA 1A4RA 2A2ZA 2C04A 2OM2A 3FKSA 4HATA 4LYJA 3W9YA 3FWYA 2PJZA 2ZYTX 1JR3D 4ZI3A 2IXGA 1AKEA 3LLMA 2HDNB 1ODFA 1Z6AA 2OLKA 4Z54A 4JKYA 3SOPA 1NN3A 3DZDA 2BVNA 1MKYA 4Q4JB 2C77A 4I1UA 1DAMA 4BLQA 1XCGB 1VG9B 5TV2A 4QKQA 3UK6A 1K5GA 1AGRA 1GNQA 3PXGA 4MGIR 4Q1CA 2O8FB 2QM8A 2WTUA 3VNVA 2E87A 3WMGA 4ZV4A 2W58A 1CIPA 1WDTA 2RGAA 2BJVA 3P1JA 5AJWA 4M1SA 2PEYA 3AB3A 4HLUA 2R6AA 2QQEA 2G6BA 4P4SA 5KO2A 5H1YA 3D8BA 4IDNA 4II7A 1D2NA 2QPOA 4HB0A 3VX4A 4HDCA 1RFLA 1Q3TA 1WRBA 1EX6A 4B3DA 1HE8B 2B7BA 4Q1BA 5CM8B 2CHQA 1MRNA 2QTVB 4LJAA 3AVTA 4GSYA 1J8MF 5FOUA 3K8YA 4M1WA 3U3OA 3GPLA 5TB5A 5BN3A 1VTKA 3PEYA 4JMPA 1Q1ZA 3H86A 4KVAA 1F2UB 5SZIA 2AKYA 2HV8A 4B3GA 1YU9A 2WJHA 3LW7A 2ZROA 1X8LA 3OIUA 2CE7A 4XVUA 1RJ9A 3OE7A 2B8TA 1KK1A 1E1QA 4LHXA 3W3ZB 1VHLA 1CRQA 4Q7MB 4R9UC 4TQUS 4JSTA 1CJTC 3DM5A 1Q1QA 4L4UA 2G88A 2JATA 4M21A 1E2MA 1XX6A 1XEFA 2AR7A 1AQUA 2FZ4A 4IVQA 4PQRA 1VIAA 4QFMA 3NBYC 2GJSA 3ZYCA 4BFYA 3VKWA 2F43A 2GCOA 2WSMA
chains in the Genus database with same CATH superfamily
3HNOA 1XD2B 5LNK6 1F4VA 1JDNA 1FRFS 1WTCA 4WFIA 5I01A 5KYYA 1QOQB 4KNVA 3MT0A 2FFAA 1WJGA 3IJEB 3U1TA 1N7JA 1UADA 2Z5GA 3WYCA 1VLZA 1TIKA 1JDTA 2NAFA 3HWWA 2D6FA 1JT9A 5DCLA 3THOA 1Y6JA 4FNGA 1EWKA 4P3KA 4X61A 3PEFA 1ATIA 2PYZA 2QX4A 4G1UC 4ZQGA 2ILTA 2PX0A 5LPNA 3HR7A 5AK0A 5EG5A 1G6KA 5IT4A 4DNXA 2OAEA 4HAZA 4MAMA 3W6ZA 3THSA 4NE9A 4QXAA 5EYPB 3UMRA 4BJHB 3FSGA 3QEOA 1GXSB 3CRW1 3RTDA 1O5TA 4R16A 1E92A 1N34B 4C6SA 2VP0A 2XNCA 1QFJA 4E21A 1E5VA 4P92A 2VZ8A 1O8CA 1UZAA 1A76A 3NVMB 1N0HA 1KYWA 2ZXEA 3FMFA 3IELA 3L6RA 2G06A 1RM3A 4OL0A 5CLFA 1QS0A 1P1CA 1KOJA 1IQ0A 1XN4A 4RS4A 1LI5A 1VPDA 4CDNA 4FP9A 4Q47A 5I5GA 3TEFA 3THYB 3D4OA 3RSGA 5K2MA 3UC9A 3W1EA 2ORYA 4GF5A 1Y8CA 5EZ5A 5HFJA 1UKAA 5C51B 1PGJA 2WJ4A 4WZ6A 3K0AA 4CTKA 1VHJA 4H1TA 2PL1A 4KO4S 3E0XA 4WOPA 4YRNA 1DIHA 4ASUD 5CM2Z 3T1QA 3TTYA 4CCYB 2E4AA 1FSPA 2FPUA 1PR3A 4MVJD 3MCWA 3WLFA 3KT8A 1GG8A 3JQ9A 3KQQA 3DCNA 3MFYA 5ECWA 1LXCA 1CR6A 3ZPXA 3I0ZA 2J3IA 3Q3IA 4H7FA 3W1WA 3WNBA 3N0XA 3EXEB 3NH6A 3O0TA 5HFNA 4D9MA 3BTSA 1B0UA 2JRLA 3ONDA 4EH1A 4HWPA 5EHXA 1YTUA 2XMRA 3V1LA 4DLBA 3ADOA 1KRHA 3NOVA 1X7YA 3G0OA 2B69A 1V7PC 1MX1A 3BWYA 3OZXA 5FORA 2ZP1A 2AWNA 5IYZB 4G5XA 1RZRD 3CBGA 3VKVA 4DL9A 4EPYA 4YV0A 1DC5A 4ZKEA 1KL7A 3I45A 5DULA 2HCBA 4HWTA 4F2DA 4RIHA 5GONF 3VC3A 3DL7A 2QG6A 3IP6A 3VDNB 2YH2A 2FLVA 5IVIA 3GC6A 4LA4A 2XB2A 1E99A 3RPEA 3Q6IA 1D2CA 1GSIA 3I9MA 2JFFA 4QU0A 4CQMD 5L3VA 4KR2A 3CNQS 4Q4JA 3UXHA 3U09A 4K1LA 1V3QE 1YONA 3PR1A 3K09A 4PAGA 1J07A 2AE2A 3IPAA 4LX0A 4RMNA 1F6DA 5DX8A 1SELA 4GYJA 1GAQA 1P5ZB 1UJ2A 4TLAA 1QIDA 2YV4A 3L0DA 1Z5GA 4GP9A 1OROA 1WUKS 3AB7A 3JQRA 1AKNA 1U1IA 2RD2A 3I92A 3J80A 4RNDB 1OFTA 2A9OA 2VK8A 2RHMA 3B85A 2E4XA 3D3WB 3QLVC 3DBLA 4G1FA 4JFAA 2YDYA 4PZUA 3CMCO 3IDQA 4PLVA 4BNTA 4QJ3A 2MU1A 2EATA 1QB7A 2QD2A 3G1UA 5ECYA 3T7KA 3TSCA 5IZ4A 1E5QA 1HNXB 3NG1A 4J0JA 4AI6A 3UC5A 2R7NA 4TLEA 3I6BA 4HWSA 3B6JA 3A8TA 2ZVDA 2J9RA 3SHWA 1D4FA 2H0QA 2VXYA 2XB8A 4KLZA 1PHPA 5CFLA 1V1MA 3T3DA 3UKJA 1CQJA 4NU0A 5JCJA 3FVWA 1LQUA 3KKEA 1RJWA 4PIPA 2V9PA 3PPVA 4QHYA 5DCWA 3E3NA 3SNHA 2PX8A 3HWRA 4IDPA 4ESHA 2NZJA 2QGNA 2AR0A 3P52A 1GL3A 1KC3A 2P9YA 3VGJA 4F8EA 1WP4A 4YUAA 1XT6A 2NTNA 3I5MA 4PXAA 2AFIA 3WLAA 4FXPA 1EA5A 3LLVA 3FFTA 4PLFA 4WECA 5DYNA 2SBTA 1PI3A 3F9IA 1A9XB 4TLLB 4F1KA 5HYVA 1KQGA 5J3JA 1G8GA 3IQZA 2QAIA 1SCNE 1D7AA 2EBHX 4IHJB 3FYCA 4N3AA 5C31A 5TF0A 1NF8A 2OHXA 1XA0A 3D3QA 4YXFA 3B48A 3BC1A 3BULA 4R2IA 4QYSA 5FLYA 2XKKA 5HKAA 1DBQA 2C5BA 5CTAA 3QKRA 1U90A 5LZ2A 3JAKA 5FP0A 5KNBA 2WC1A 1HQYE 1NSTA 1G3MA 2Q27A 4C5BA 4FMDF 1Z22A 1I6WA 1IXRC 3NIFB 5A6SA 1PBTA 4O4HB 3TZQA 1YIDA 3CVUA 3FSEA 3EGWA 3IBSA 4AIIA 1W2GA 2EOAA 3OKCA 1GOTA 5CLQA 3QTBA 3UT6A 2DFDA 4M9XA 4ZDKA 1TYEB 4BE9A 4CEIB 5E1OA 5IZCA 3KJHA 1UXGA 3SSAA 2DR3A 3KTAB 3UAGA 4E5PA 5GMOA 2WSYB 1YE3A 3DMTA 4LBZA 3UB2A 4L78A 5F5NA 5JSZB 1TU0A 1UXJA 4MROA 4YT8A 4AJ9A 5LZ9A 2EF0A 3C87A 1S2IA 5FFNA 2WG0A 1KSFX 3FHCB 5D87A 2NZYA 2IS1A 5JI2E 2VPWA 7ADHA 4I99A 1QQBA 1BKYA 1QBKC 1RHQA 2H6EA 3DFZA 2DEUA 4UEWA 2EFCB 2IBMA 3MOSA 2VJCA 4FNOA 4G0OA 3LRXA 4TN1A 4Y2YA 5ALDA 4ZXPA 3NHMA 1FYVA 1A8IA 2WWYA 4NXNB 5CVTA 2OV8A 4EPWA 1H22A 5REQA 1T0UA 3EGXA 5KPJA 5C8YF 1OBFO 1T2DA 3DEHA 1NVAA 3AOEA 5L7WA 3A6JA 3AUUA 4QE3A 4YBRA 2OHHA 1TM1E 4E46A 1LK5A 5HOEA 2WPNA 3P9PA 4MW4A 1NRWA 1QNLA 3JQEA 3O1LA 4KWHA 3M6UA 2CCGA 1CB7A 4BFZA 4C4OA 1R0LA 4N4AA 4EG5A 1P2FA 1TMYA 1XZLA 1DFIA 2WZBA 3EXIB 2VA8A 3M49A 1RBMA 2Y9PB 4BNUA 2PS0A 2P9BA 1XRQA 5ILGA 4MARA 4CJXA 2ZJ1A 1PT6A 4EJ6A 2AT1A 3ZEAA 3EZGA 3R0IA 1T2NA 2GZHA 3AIMA 3DXZA 4H35A 4L4ZA 3H18A 4CUKA 2ZBQA 1Q6YA 4D9FA 4URZR 4ENSA 5BSGA 4OGGA 3CEHA 3B89A 4YPFA 3OT5A 2I4LA 2H7CA 4X6YA 2DBRA 2JFPA 3PDHA 1HTWA 1UOQA 2WVAA 1GNTA 3ITNA 2ZPTX 5CH5A 5FPQA 2XQVA 2I03A 3FWZA 1MQ9A 2HSZA 2OVBA 4IMIB 2YWRA 3MJRA 4NBUA 4U9HS 3BA6A 1T1IA 1DKRA 3KVOA 3TI7A 5E6SB 2ZJ2A 2R7MA 4DMRA 2AXQA 3DE5X 2FMUA 1DFHA 4LOIA 1GSOA 3CF4G 4TV8F 4YQEA 4CDGA 3FWKA 4LGMA 1NJ1A 1ONPA 3EDMA 2EW8A 4MNTA 1BGWA 4E6EA 1E2NA 3SZLA 3R9XA 1VMKA 4NAVA 3UFXA 3SS8A 1KOGA 1WSBA 1MB4A 2V54A 3B5IA 2IZZA 1TLFA 3LX8A 1ADFA 5E6RB 3ZIUA 1QQ6A 2BUBA 1S8FA 2C0QA 2SNIE 3HJGA 4L2IB 1U2RA 1IH8A 1ITZA 3EHEA 4JJ8A 1C1DA 2NIPA 5C5IA 2ZWVA 2GOYA 3B1FA 4D80A 5COAA 1DJNA 3WTCA 1JR3E 2Z5VA 3I2YX 3L18A 5GONA 4EPVA 1JJVA 2EDAA 4B8WA 1C9YA 1ZXBA 2KWIA 1WSWA 3VVBA 5FUMA 4OHUA 4R9RA 4X00A 3OCJA 4AJ1A 5K4HA 5FOSA 3D1VA 3MJVA 3PU6A 3PGA1 4YT4A 2CV1A 3A9TA 2E6UX 2I6QA 1PG5A 1N0WA 4JOSA 3F6CA 1K7YA 2HH9A 1JEYA 2ZE5A 1YTLA 1UBUS 1VPWA 4JJAA 2L82A 4UE6A 1XZGA 4WACA 5DK4A 5DWQA 4XQ0A 4DUYB 2EU8A 2OGWA 2N1BA 1BS9A 5ALKA 3VR1A 4OQYA 3LP8A 5JAHA 5C1BA 1E1DA 1P2TA 2PL3A 3VC7A 5HF5A 1G3IA 1OSNA 3INYA 3QU9A 1AKQA 1TJ5A 4JBLA 2XWJI 3EGVA 4MSUA 4BAZA 1TF5A 4WEQA 2CV0A 5JD6A 3HBJA 5TE9A 3DA8A 1V8OA 4JWKA 3SYTA 2BR5A 2R7LA 1JSCA 1EE1A 2J8ZA 3OKAA 1QMGA 3TDMA 1ZMOA 5FPYA 2A92A 3C6ZA 3V8MA 3WQQA 3NJ8A 1T4CA 3SBDA 4GPIB 5L6LB 1RXIA 3ENNA 4YPOA 1QO0A 3DF7A 4Y18A 3WMFA 3VPHA 3T1OA 1X7WA 3T4UA 2A5LA 1O4WA 3Q0EA 4HDAA 1II8A 3GRVA 5HXAA 1W1UA 1PJBA 2WWVD 4Q7QA 5BUQA 3O90A 1GGNA 3A3OA 3MYYA 2H08A 1VKNA 1C9EA 2PV0A 2YZ2A 4M6WA 2XRYA 4IJKA 3RAEC 2JASA 4IXTA 3ESZA 1FZTA 1FIUA 3VH3A 4FUTA 1BH2A 1HT3A 4NDAA 4D8TA 3AEZA 3ZD7A 4JVOA 3RG2A 4V24A 2V4ZA 3PT5A 3QUQA 1XELA 4L3WA 5KQGA 3S5JA 3TD9A 4DADA 3S81A 2JBWA 1AKMA 1RACA 2JA2A 3AY6A 4JKOA 3X1JA 2ZJ7A 4IDHA 4PSUA 1MIHA 1UDRA 1YA4A 2XH8A 4D8VA 4JY7A 2G09A 3GLIA 2AZDA 1KEEB 2J9ZB 3UUWA 2BFFA 2Q3FA 2X58A 1GU0A 5AWFC 4DC1A 4EHAA 3L8GA 2PU5A 3LY9A 4CR6A 3PXAA 4NBRA 2OBFA 5DFAA 4ZD6A 1P1RA 3JQ7B 5CFZA 2AXPA 3K92A 2G3YA 4KX3A 3GYGA 1J8VA 4NESA 3PUVA 5C1IA 1UUFA 4Q1DA 3GV0A 3WGMA 5HRAA 5LMCA 1KEKA 1LB1B 5IKOA 3CCBA 4JH0A 2Q9BA 1F06A 1A77A 1P2BA 1X1SA 3EGOA 2YYAA 2WD8A 4FE4A 1IBKB 2ABWA 1MLDA 5JC8A 4LZOA 2HY7A 4A03A 1JHVA 3LDGA 4EX6A 2GXSA 4CXMA 4KK4A 3NHFA 1F12A 1VPVA 1Z3CA 3DO6A 4LOAA 1WBBA 1WXDA 4JVLA 4YWJA 4YX9A 4G1VA 1INLA 3GMIA 1QQ7A 3F5SA 4PM4A 2GEVA 2G9QA 3RS5A 3FF4A 4CKWA 3EMKA 1XJ5A 3VSBA 3EZ2A 3H5OA 4BNHA 4MYDA 3M1IA 5C8YA 2X6QA 3SQOA 2UZ1B 1EAMA 1YZHA 1Q7BA 3CN9A 1MX3A 3T3GA 3VSCA 4AY6A 3ORQA 1WMEA 1BSVA 2O1WA 3MGBA 4MUYA 4HXGA 1JUDA 3RS8A 3TMKA 4EYEA 2BCJQ 1G8PA 3L9XA 3IIMA 3YASA 2PT6A 1YGPA 5GM1A 1WBJB 5AVTA 1EHYA 3DO8A 1BMQA 3R0XA 4YHBA 2ADFA 2GKOA 2XUKA 3EZLA 3RVRA 4RETA 5A4KA 3AVQA 3UO8B 4A6XA 3QYPA 4PC6A 4BZPA 3KSAC 5BNFA 2V7VA 3LTNC 1WEKA 4PRKA 1GCIA 5CDFA 3NBQA 4O0LA 1OH6A 1ONNA 1T6BY 1VJRA 4GPD1 1M8GA 4B2LA 4R0VA 4R1UA 5J2TF 2H54A 2EWMA 2O2SA 2Q5EA 3A6DA 1L7PA 3LQFA 4YCLA 1Y9EA 5KNBH 1Q0TA 1MB0A 1ILEA 2XNDA 4UEOA 2BD0A 3RTBA 3G79A 3A2LA 3GEEA 2WUVA 5ITZA 1G5RA 3IH5A 3X0DA 2CNKA 4CTOA 5EJ9A 2HSDA 3FYUC 4FN5A 1MJ5A 2QIOA 1G5QA 3GFPA 4EBBA 2GETA 5CT9A 5CDHA 3UXMA 1ODSA 3A3NA 4U6QA 5H4GA 1IPHA 5KTYA 4QLAA 2ZSEA 2CHGA 1TTPB 2WJAA 1T4GA 1L4MA 4RJTA 1REQB 1QVZA 1YIAA 4QATA 4C0KA 2LGJA 4I4LA 1CRWG 1PW5A 2I99A 3LIPA 4MVJP 4RVFA 2YIDA 1FDWA 4KN9S 3OQMA 4BX0A 5JO9A 4MHSA 4DV5B 3DOEA 1V4BA 4KVZA 4TV8A 5MF6A 1JTVA 3GD7A 5EPUA 4MZXA 3AHIA 4JD5A 5B7QA 5JJCA 3EA5A 4UBIA 5L3QA 1V16B 2GZ1A 3BSFA 1ZUWA 3W7VA 4IDFA 2HSWA 1N1EA 1B6GA 2XQKA 4E11A 3EXAA 4PRZA 1UWCA 4WN3A 3LBIA 2OBYA 1JFFB 1LS1A 1GR1A 3G8DA 4EB8A 1BGXT 4IDEA 1OI4A 4RTPA 4KVFA 4WX2B 1YB7A 1ZIYA 1XZPA 3GK3A 3P9YA 4YMIA 3AY7A 1JFVA 1E1KA 5C8VA 2AN5A 3JWHA 2GHRA 1OFVA 4K6FA 1R6AA 5ER9A 3R7FA 4N03A 4ETIA 1KTIA 1IXYA 1JEJA 2C59A 2VCEA 3MQ4A 3OLVA 1H4SA 2KMLA 2YXEA 5A02A 3ET4A 1UF9A 1G0NA 4P7FA 5FI5A 2WNHA 2H8GA 3CE6A 3DTVB 4M38A 5CT4A 5B3AA 3VSDA 4V1CA 4D9EA 3OJXA 5IP5A 1ZAYA 5LZ5A 3IQXA 4A5OA 1XTKA 4Y0NA 3HGMA 1JAXA 1NNSA 5JY6A 1MIOA 1PE0A 2QR5A 3AR3A 5K05A 4ALIA 3CR8A 4K9MA 4BNGA 3TRJA 2JCBA 1CY7A 1B0PA 2Y1XA 3FPLA 4Y1FA 5ARBA 4M9QA 5JFGA 1V95A 4C87A 2W5UA 4GXNA 4WI1A 2GLXA 1NBMA 1X15A 4JBYA 3OX3A 4I4TF 4FCTA 1OPXA 3E70C 3R3XA 5GZ6A 4BWVA 4FFLA 4K9NA 2C0PA 1Y80A 2HWYA 4Z8YA 5COQA 2QRPA 1SHLA 1FMTA 2VOEA 4FCCA 3DZ8A 5MDHA 4JGBA 4MRMA 2NP7A 4DV7B 1SD5A 2QAGA 3KR2A 2RHCA 1ZP6A 3TLXA 1UQUA 3NQ41 5FNVA 2QMZA 4DQDA 3TZLA 2VQDA 1IHOA 2XXBA 2W37A 2VXOA 1F0YA 4RY0A 1JG1A 2QYSA 3BX1A 4IF4A 3NEPX 4HXFB 5GINE 4KG7A 2QQ5A 4PIVA 2PWBA 3ES9A 4ZOBA 3I6IA 2EJUA 3K0AB 1XAHA 1V45E 4QPDA 2P0YA 4YREA 2FU5C 3KUCA 4TM8A 2CVQA 2IF0A 3OO0A 5HDBB 5EJGA 3TFQA 3U3JA 1F38A 3CQ9A 4M53A 4LXHA 1C3XA 2Z08A 5COBA 3AR4A 3QEJA 1J2UA 5C1OA 3T7DA 3ZDAA 3CX3A 3M4XA 1AC5A 2ZJBA 4CPDA 3OURA 2D1SA 2HWKA 4FYIA 1Z4PX 4J0KA 1XEXB 5DT9A 3PUIA 3ANNA 3C24A 2BGNA 4RHUA 1QG2A 2NUBA 5THQA 1ML4A 1DIRA 2ANBA 1TAHA 1X7YB 4Y2RA 2R8XA 4LRUA 2O6LA 1OD6A 2G82A 2OGZA 2OFXA 3OMXA 4ND1A 4TMXA 4IICA 4WW0A 4IEEA 3RABA 2E21A 3KQWA 5TGZA 4IILA 4Q01A 3KX2A 4LW8A 1AXRA 1FX1A 1QQTA 1Z8HA 3DTTA 2P78A 3VFDA 2CFCA 5HG0A 1SXJB 3STHA 2O14A 3FIUA 3O3MB 3W3AD 2YHBA 3PI6A 5IMBA 3ZQ4A 4CLDA 1NIJA 1MC4A 4LC0A 1XJ0A 2IYTA 1KERA 3HM2A 4LSGA 4A0GA 1RMTA 4ZEXA 3TG8A 1O4VA 4LJYA 3RC3A 2CFIA 3IP7A 3ASZA 1KR5A 3VHLB 1E2FA 1NYQA 5JYBA 2NU7B 4WXHA 4X7BA 4KCGA 4LKOA 3QLEA 3PX7A 2MYPA 2WF6A 2BMFA 1BYUA 1E59A 2QP3A 1TU3A 1JYEA 2AFHA 2HREA 1T26A 3A1CA 4RQBA 1Y7PA 4X54A 5D5QA 3B1YA 1BX1A 3VI3B 3MWYW 4H27A 1TIPA 2YV3A 1M6NA 4HZGA 3B1KA 5JYEA 2GEFA 3DUFA 1E1LA 4E1BA 2O8BB 1XTQA 1JVBA 3AL2A 2A3NA 4NPAA 5IHPA 1RKUA 3LRTA 3PFIA 4HLCA 1P7VA 1XTBA 4WN9B 3KM0A 4N65A 4PTZA 3TUIC 1JIIA 4KREA 1XC7A 3NV7A 2N3ZA 2NUPB 5ENDA 2BH9A 5EJ5A 3GUZA 2ZRPA 1IK4A 3NTXA 5FWYB 3PL1A 4O2LA 1QFMA 2HPVA 4IJ6A 4D97A 1IXSB 2ETXA 3F5QA 3VR4D 2BL4A 3AU8A 1TJYA 2GEKA 2H5EA 3G88A 1KEVA 3A4IA 3MJTA 3VO2A 1R12A 3ZHCA 4GOXA 3MAJA 2V9ZA 3HO6A 1UOEA 2B25A 4MGHA 5EIBC 1Z0DA 4CHTA 3KPVA 3AJ8A 2FQWA 3D81A 3NHBA 1N0IA 3OWOA 1Y1PA 4HTAA 4HEHA 4RDIA 4ZRMA 5J2TA 2JFYA 3FKSD 4J03A 1FJGB 1E9RA 4F5YA 4C3VA 3NDIA 4P38A 1KE1A 1HRDA 4ZQFA 3K2EA 1OWPA 1TA4A 1Z07A 3E2MA 3NU1A 2Q0XA 5T57A 2Q5OA 1K63A 1ZN9A 4H3KB 4XYLA 2KM1A 3D6TB 2ID7A 4HDNA 1ZGZA 2B9EA 2BI4A 4IHAA 1RXCA 2WHEA 1LZLA 4C4YA 4LF9B 3O91A 3VHXB 3TR0A 1JALA 1E77A 1DBSA 2XT0A 3QKRB 1U81A 3NHYA 2I6UA 2J07A 3NT5A 3ICOA 3BB1A 3NEYA 1F0KA 3GEHA 4X5OA 4KO3S 3PUYA 1BN7A 1JBKA 2FSUA 3E9ZA 3DEKA 3NHUA 1W2WB 1KVQA 2DQSA 3PQDA 5LLDA 2BBOA 5GGXA 5BXYA 5CNMA 3WLSA 2POCA 4E2ZA 4ZVTA 3M0EA 2YUTA 1U1CA 4BN4A 2NOAA 3WSWA 2WNIA 2I2XB 4JK3A 4QEDA 1QZ3A 4M89A 1L5VA 1X1AA 3CUTA 1Q11A 1G55A 4H6XA 4WLOA 3DMFA 3FNHA 3GJYA 2ZBGA 4MPRA 4R2XA 4QPZA 4ALMA 4B4DA 3UXYA 4QGHA 2QLMA 1RZVA 2XB9A 2I6TA 2QGFA 3DDWA 4YN3A 2XT9A 5B30A 5BQ3A 4GLJA 5JPIA 4G5GA 1NUPA 2LIPA 4TRJA 4X66B 5EN4A 4AMBA 4OAPA 1NRJB 4ZVMA 1PLJA 1C7FA 5REQB 4B47A 3GLGA 2Y0CA 3QVUA 3E9DA 2YJ6A 5F2EA 2G7ZA 3BAZA 1WUJS 4TN5A 1U8CB 1XZKA 1OI7A 1U7DA 3BRQA 4NF2A 3PKJA 4HS4A 4S3MA 2XVXA 2WIBA 3LUFA 4NOLA 2ZCJA 4GP7A 3TSYA 3PQ2A 2ILVA 2QMUA 3OIFA 3ZKWA 1C2TA 1F8GA 3ZD6A 1B1CA 4I4TA 3G2MA 4DCSA 3C0KA 4I5EA 3NHZA 4M2LA 2VUHB 1NLYA 3UMBA 1TFRA 3R7SA 2J6BA 3BICA 3KUDA 1XEWY 4EHKA 1X7GA 1Y42X 5H9VA 4PZPA 1KJQA 3ZD8A 1W59A 4MUFA 5JATA 2AWOA 2YHIA 4J16A 2HU7A 3ZIDA 1MF7A 2I2CA 4AULA 5FUBA 4KO8A 1JF8A 2PG3A 4KI0A 4CBVA 3QZUA 4N6NA 1E94E 4UVEA 4NC9A 4BLWA 1EWVA 3HFJA 2NXCA 4Y2PA 1DAEA 2E4WA 5LQKA 1JU9A 2YXBA 5F4BA 1U0BB 5AKYA 5JISA 4NV3A 2ZDGA 1BHSA 5IH7A 1P9NA 4G09A 2G9NA 1KDVA 2VHUA 4OU5A 1H2AS 2CBXA 4RVNA 2FFQA 3JQ8A 2NV2B 3LVQE 4B6OA 2Q0HA 1DBWA 1SBTA 4DLYA 1YHZA 5JSZA 5AOAA 5LQUA 3BKWA 1JQJC 2H29A 1ZD3A 4Q05A 4EW3A 3BL8A 1S2NA 2BEVB 2GAIA 4G5QA 1KXJA 2Z58A 4G26A 2MINA 3EAGA 3UV7A 3SQLA 1DADA 4UUBA 2VH1A 3KSZO 4QGAA 1CR4A 3L8CA 4KDCA 1WXQA 3KOMA 3SC2A 4IIXA 1DKPA 3SJUA 2QJOA 4DQVA 3TTTA 1XPJA 3V80A 3JTEA 2I78A 3I34X 4YP7A 1A7UA 4ZU3A 1X7ZA 2WKSA 2WKQA 4LV5B 3VDMA 3WOHA 1FS4A 3D6UA 4KL8S 3EARA 5CR9A 5LMZA 1QDUA 3KDSE 3HLKA 5DGXA 2GR9A 2CZCA 4YAOA 4L07A 5TX7A 2LD4A 4TZ0A 4B76A 1XHFA 4ND8B 5FV4A 2FZVA 1DC6A 3LKZA 2OENG 4LJ7A 1GKIA 1GRCA 2DX7A 1R9GA 1XD8A 2LV8A 1NYLA 3PFNA 1KDRA 4R8MA 2FUNB 3ZE7A 1KBQA 4G4JA 1AKWA 1B3RA 3CF6R 2D62A 4L4SA 4YO7A 3CKYA 1FNMA 4TTVA 1L8OA 5ELLA 1W36C 2VP2A 1OFHA 2IYNA 1V0JA 1JEYB 1AK9A 2BFCB 3MJFA 1W0KA 3ROXA 4G4SO 1W75A 3H05A 1Z29A 1LLCA 3MWDA 1CQZA 1ZESA 1C50A 1QCDA 2HRZA 2HXGA 4IX9A 2PPVA 5GAJA 3U4CA 1V71A 3U4AA 5EXEA 4AJEA 1XXHE 4FYMA 4L5IA 3OQJA 4YAKA 5DU2A 4TYNA 2MIIA 1MJNA 3EY9A 1CUEA 1Q3HA 4PXYA 2NO9A 2VZ9A 3UV6A 1N2GA 1Z2CA 4ZQHA 4FGZA 3WFZA 2PJUA 2D4HA 3O8QA 2B3TA 2HXYA 3L4EA 4M9SA 3QEMB 2W2TA 4B83A 4PO9A 1EFHA 3KZCA 5LBIA 1NE7A 4P4TA 5AH0A 3CM0A 3HTXA 3FNRA 2ZSIA 3EFEA 1J99A 4UCFA 1JILA 5TDHA 1C7QA 3OEEA 3AHDA 4RFSA 3TXAA 3F97A 4D3FA 1KJWA 3PEEA 3W8NA 4BVBA 4OHYA 1ZCAA 3N2IA 1CY0A 2HT6A 1T4CB 1GG2A 5FA8A 4Z53A 3WADA 5DXJA 1Z83A 4F85A 4U5XA 3FHLA 4OXYA 2RG1A 1IL0A 1IC6A 5EQFA 4AO7A 1PVVA 1CUSA 1Y1LA 4JB3A 3PQCA 4L74A 3U17A 1WDLA 1II8B 1SPXA 5IWAB 1MH1A 2GHIA 3HCDA 3PP8A 1U5BB 1XAIA 1UKCA 2X3UA 3K9GA 4V1CI 4M6WB 4W5OA 3UJCA 1BFDA 3IKLA 1JX6A 2OE2A 4IUYA 3EC2A 3JALB 4K6GA 3ZLJA 3GB9A 1ZHOA 4Y98A 1GV0A 1Q84A 3OZDA 3ESQA 1M67A 2VK2A 4KH0A 4CMIB 2IHNA 2RKWA 3KPJA 3GDFA 5J4VA 1KI6B 2FUG6 3DKPA 3RUIA 1DJOA 1ZXLA 4U0KA 3FYDA 1W87A 2B0JA 1RHRA 1U8XX 3L0BA 4MI9A 3GLIB 1HC7A 4FMDB 4NU5A 4P3XA 2ZUVA 4Q1FA 3PTAA 3RK0A 3WK4A 4X7PA 4A16A 3RSOA 2JK0A 3MCVA 4TKLA 1LF0A 4CEJA 1N5OX 3U2QA 3GJ5A 1U2QA 3TQSA 4LF4B 3P0JA 1QE0A 2DTXA 1E0KA 1ZX1A 4NFHA 3RM3A 3AI7A 1VLVA 2QKYA 4DXDA 1W5FA 1Z16A 4WTOA 1Z6PA 4JZYA 2X40A 5CDUA 2J5KA 3ZDRA 4AFNA 1A4UA 1XDWA 3PA8A 5AP9A 2UZIR 2GZ2A 3GT3A 4RC9A 2HOQA 2AW3A 4EYKA 4F2PA 1VSQA 1JIJA 2MOKA 2MYTA 2O5RA 4BJ6A 3I2JA 1XR3A 1BH6A 1ZFNA 2GYWA 2W2MA 1HDZA 2X3FA 3REFA 2EJBA 4AICA 4EJSA 4HL6A 4YRPA 2XCTB 1SFRA 2CNOA 3P26A 3WLJA 1IQUA 1US8B 4PYNA 4MIKA 3WYBA 4J1QA 2A94A 3CZRA 1GGKA 1QPZA 2E48A 1H93A 5ADWA 3I42A 2BCEA 4IDAA 1W6UA 3QPCA 2B35A 1WDMA 3ZR4B 4C4RA 4E31A 2PRKA 5C8YB 1OH5A 1GNVA 1FBNA 2Z6UA 3B3GA 3D6HA 4C4ZA 1SKAA 4BNMA 3BHIA 1CQPA 1P9OA 5DNVA 1U3TA 2B5WA 1M2GA 2ENUA 1LSUA 4P4NA 4B17A 2H2GA 4PYKA 1ESCA 3P9KA 2F3UA 4ATNA 1YULA 2H5IA 2QLFA 4ACAA 4BDTA 5EERA 1SY7A 3LK6A 4P53A 3AM4A 2C9YA 4MWSA 1FRNA 3ZZUA 1N36B 4HDSA 7MDHA 1J25A 3AVPA 1T6ZA 5A2QA 4CEHA 2X9NA 3OLQA 1JA0A 5FBWB 1J22A 3ZXSA 4K2AA 1FP4A 2PKYX 2IC5A 3W5SA 1R6TA 1FBTA 4N5DA 4HVLA 5F1YA 2AN1A 4BLSA 4JUBA 2Y67A 1KFCB 4MVJI 4PYMA 3EAQA 3T7TA 1L4YA 3BZWA 3T9AA 4NZMA 2EFHB 2J4DA 5EAIA 3IRUA 7REQA 2SCUA 1JLLA 1NBOA 3N0TA 3ONNA 4EUKA 2RGBA 2CYAA 2V7WA 2REBA 4M1ZA 3EPKA 3CA8A 3LHDA 1GM5A 5JNSA 1EJ2A 3X1XA 3EH2A 1V9LA 2ZRIA 2HU8A 3G8BA 1SC4A 5KUTA 4D3YA 1N7IA 4NZYA 4RM3A 2AJCA 4RMGA 1C9JA 1O95C 2BM0A 2PBLA 1ODJA 3T7RA 2ZT7A 2ATEA 2DPGA 4JQOA 1CNMA 4TV8B 5CIWA 3L7IA 5L3QB 2ZJ6A 4FJ2A 3BWCA 4ZJUA 1M3SA 3FXAA 3BH7A 1XZNA 2NO0A 5ICSA 1TUEA 3UN1A 3ABSB 4E2FA 4ZOCA 5I4BA 9LDTA 1OHHA 1CZUA 2X8BA 1WDKA 3MRSA 2VT3A 3OX2A 2X2EA 2Q46A 3R6TA 4OMCA 4XWYA 3T5AA 4DEVA 4NYMQ 2YUIA 4CM9D 5HM6A 1IN1A 5TQ2A 3RVDA 4JLUA 1CUVA 1LJ8A 4L5YA 4F1WA 3GAFA 4GPZA 4M1OA 2OTCA 1U1EA 3N7TA 4KGXA 3FMGA 3RYTC 1PJ2A 2GYYA 3SKYA 4CKEB 2EKDA 1KAOA 3EGEA 1PK7A 1ZD8A 4FGWA 1H8HD 1N6IA 1G8AA 2ZI7A 3HZRA 4L08A 4BGEA 1AGNA 1UC4B 2KLHA 1MIOB 3S7ZA 3S2SA 5CP8A 3H4VA 4ZT4A 1CW2B 2Q2VA 2AJLI 2ZR0A 3I5UA 4NV1A 3QTLA 3TD2A 4QLBA 5KYWA 4JJIA 2D1FA 4ZT7A 3MYRA 2D0IA 2X76A 5TVKA 3TBKA 3IERA 2AN3A 3ZLTA 1SCQA 5CITA 1GDTA 2YHAA 2P6MA 3UPTA 4KYIB 3SF8A 4JLAA 5ICGA 5FBZA 1XZDA 3L43A 3CN7A 3V3KA 2ZRCA 5DYGA 4OU4A 5DJ5A 4G97A 2IEZA 1LGYA 1L7QA 2QAGB 2ATCA 3AMVA 3JQBA 3PUZA 4WGGA 4BMOB 4D43A 3M9XA 1H3FA 2B37A 1H69A 4POAA 2CK3D 2EVWX 4UM9B 1PWHA 4FBMA 3P0RA 1RNLA 4FD2A 4P0TA 4IS2A 1F5NA 1T5OA 3TZKA 3COJA 3NDBB 2QK4A 3AETB 1PG2A 3OE5A 5H83A 4BCDA 4JYZA 1OX5A 4FYHA 2QT1A 4O4LA 3OX1A 5LA6B 4MYCA 3GH3A 4JL5A 1RI3A 1DUIA 4P1ZA 1KK0A 4WXPA 1M8KA 1GHTA 4HTFB 4S24A 1YDWA 1NBEA 2LPMA 4KIWA 2JGNA 4IQFA 1WXXA 4P08A 5TS3A 3TAXA 2Q7OE 1APBA 3HLTA 1Y3CE 2IYQA 4XW2A 3CCCA 3DFUA 1MO2A 4WKCA 9ATCA 1YZLA 4C7MA 3WIOA 5A7GA 2NQTA 2PMBA 3R44A 1R18A 2O2IA 4DR1B 4JC4A 2XRFA 4OH1A 5K3EA 5L4LA 3HI4A 1JDVA 4N9QA 4I8DA 2AG8A 4TKMA 4ZI7F 3JAMA 3O82A 4OBEA 2J30A 1SVMA 1IONA 4W1QA 2ZJZA 4UZFA 3LI2A 3K4PA 4UE3S 3COYA 3T4XA 1Y9AA 1TRKA 3G2PA 3ONFA 4WSOA 2C8KA 2PIDA 4HFRA 2G4VA 3WYDA 4O2AB 4MV0A 4Q00A 4LF6B 2XUFA 1K8ZB 3R4VA 4YRSA 2QUJA 2CWWA 2D2VA 2WAMA 1D1QA 3AR7A 3EQ9A 4TWRA 4JBXA 3OI7A 2XPCA 4F7DA 4HXYA 2X0DA 4KKVA 3D6JA 1OX4A 2A67A 5AKGA 3FUXA 5E38A 1XQ6A 3TTWA 3OFKA 1XL0A 3F4KA 5FRDA 1R8JA 2BGUA 3HUEA 4KV9A 1E3LA 3O83A 3QVSA 5DWDA 5CK5A 1DI0A 2A86A 2A84A 1NXSA 4PC7A 1R15A 4HMPA 1Z25A 3EIUA 3T41A 3EVFA 3LFHA 4HRVA 5CJPA 2G67A 1XVUA 3I37X 2VG8A 2LIVA 3GRRA 1HL7A 4ZYYA 3IQWA 4WZAA 4RL6A 4PX3A 3ZJ4A 1R9MA 2YJ4A 1FFWA 4EDFA 2JIZA 3TE6A 1G17A 2CD9A 3H13A 3BD9A 2XE7A 2FQQA 3AF4A 3SSNA 1C4XA 2JFNA 3VU9A 4P32A 4ZO9A 2QSJA 3FX2A 3ANLA 3BXPA 1P75A 5D1NA 3TN7A 2GMWA 1GRVA 5SYMA 1WEHA 4XX0A 3SNKA 3WWDA 3HFGA 3MJCA 5CB4A 5AXBA 2PGJA 1J90A 1L7DA 2OGSA 2WWWA 2PEZA 1ECJA 3V8QA 5HGXA 1L9XA 1JHZA 2W6OA 4X71A 4PG4A 4AN4A 5AIBA 4DJFC 1E2PA 2BELA 5ERGB 1UKBA 2JJYA 5IAGA 5J2TB 1JQAA 1XQWA 1PQYA 1XVTA 3CLRC 4Z5XA 2VPXA 3CINA 5IKMA 13PKA 3QSYA 3D2AA 3ETNA 4QQNA 2WQ7A 3T3EA 4M83A 3PSHA 1HI9A 2FV8A 3LZDA 5BUZA 1C2YA 2GCNA 1XVVA 1RPNA 1E69A 2ZZMA 4HJRA 2IDZA 4KTTE 2VVTA 5I7OA 3HCEA 4G2NA 5CEJA 1WF6A 3RT7A 3CZ5A 3WHIA 2J32A 4MQEA 5AI8A 1ZR2A 2IZ1A 2XOXA 1T0JB 3EXFA 5AW5A 3R3SA 3TRHA 3E7XA 1BGVA 3I30X 5EIXA 1GNLA 4B84A 2YASA 1E9EA 3FMVA 4B0PA 2RGGA 2EX1A 4QVKA 4M8IA 5EP1A 1ZR4A 2O06A 4J29A 3PK0A 5FYQA 4X62B 4U2GA 4KN5A 1I2CA 2QB5A 3Q2KA 2B5OA 1ECGA 2VJMA 2XF8A 3U4HA 1PD0A 2DHCA 3G0DA 2ZWOA 5TMPA 2O8EA 4RLHA 3BSSA 3Q7SA 5B1YA 2GLTA 3Q1KA 1MPXA 3M83A 3FBGA 3VZQA 2OSVA 4BP3A 1KJJA 4OJTA 3JASB 2WF8A 3EIEA 1C1XB 1WCYA 2G1AA 4IOJA 5B4TA 2X5NA 3DLAA 1J09A 4I5DA 4QARA 1VFNA 4TKZA 4B9EA 4BQQA 4Y0VA 1VYVA 1L4KA 1QFSA 5LCXA 6AT1A 3U9SA 4ZZ0A 5HBGA 3RB8A 2NSJA 1Y5NA 4D0GA 5HILA 2WSLA 4FZVA 2C7GA 3F96A 4I1SA 2JPDA 4NICA 2AKEA 2X2FA 3GLGB 3LFUA 3DHEA 3UOGA 3HCOA