3SFVA

Crystal structure of the gdp-bound rab1a s25n mutant in complex with the coiled-coil domain of lida from legionella pneumophila
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
179
Chain Sequence
LGSMSSMNPEYDYLFKLLLIGDSGVGKNCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-1A
publication title Structural Insights into a Unique Legionella pneumophila Effector LidA Recognizing Both GDP and GTP Bound Rab1 in Their Active State
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/protein binding
total genus 56
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sfvA00
1SKQA 5AJYA 4LBYA 1FP7A 5AJVB 2J5XA 4JMPA 4V0KA 1S8FA 4Q19A 1GDDA 4TTPA 2ZRPA 4UXHA 5C1BA 2OV2A 3GLFB 4MQBA 4A0RA 4B43A 1KOFA 3MD0A 5CM8B 5DSZA 1NJGA 4TZ0A 4AYWA 3GLHA 2OHFA 4QC2A 4QGFA 4ZCLA 2QA5A 3CRQA 4Q00A 1JAHA 3L8ZA 4LDJA 5L3SB 2V7QA 3T15A 1XU4A 2ZSBA 1PUJA 4OQFA 2VA8A 3OIYA 2RHMA 2IYRA 3PEUA 2BBWA 3TAUA 1AN0A 1G18A 3IPXA 5FPHA 2D7DA 5F9FA 4KBGA 1YQTA 3DHWC 4W5JA 4HUTA 2C2HA 5FUYA 2ZI7A 3SYNA 2X2FA 4PSAA 1DAGA 1HUQA 2DPXA 4BECA 5JEDA 4RD1A 5C4GB 2RGDA 1CJUC 3O8BA 3QVVA 1UKVY 1PV4A 1SXJB 3L0OA 3OEHA 2H17A 4PC1A 2D4HA 4I1SA 2G88A 2BM0A 2KB0A 2XSZA 3CO5A 3GFTA 1E9EA 2MSDB 4PSVA 2BJVA 1M34E 1XEWY 2B21A 1DELA 1ZM2A 5JHHB 1K6MA 2EU8A 1EX6A 3LV8A 3VKWA 1ANKA 5FTJA 3MSXA 1OF1A 1QRAA 1QHXA 2CEAA 1VG1A 4RD2A 1Q3TA 2IF2A 1DEKA 2YJTD 3FKSA 3IBGA 3IQXA 4QBIA 3WNCA 5TV2A 5G3YA 3SNHA 3Q85A 3QKUA 2BM1A 5EP4A 2IYQA 5SZJA 1XTJA 2QTVB 3I72A 1N0UA 3GMTA 3Q72A 2AR7A 3FMFA 4PAOA 4FMBB 4IDOA 3AKDA 1U9IA 5CJ2A 3SC3A 1U2RA 4AI6A 4DXAA 2VP4A 3L8YA 3IHWA 3RRZA 5H70A 3CX6A 1RE0A 3TLXA 1AZTA 1KI2A 4B33A 2JLRA 4PPFA 2G1KA 4JSTA 3E2IA 1H8ED 4A1FA 1CR0A 4JVSB 1N5LA 4HLUA 4FWIB 3U3JA 2QROA 1W7AA 4OI2A 3SDZA 4ZDIA 4DCVA 1P2TA 3QE0A 4RD6A 1GKUB 2QMHA 1T3HA 2ZR9A 3FGNA 4HB4A 5JJLA 2FN4A 2D2EA 1E2GA 1OHHA 221PA 3CF2A 5BN5A 2GCNA 4BEBA 4DT1A 4LJYA 3ZYCA 1F2UB 4F91B 5C18A 5DYGA 2HCBA 2ONJA 1JXOA 1JAIA 2B8TA 5G53C 5JCZA 5K8UA 5EXXA 2X19A 3IIKA 2CK3A 2G3YA 2GDJA 2ZEJA 1YJ5A 4E09A 5HR5A 3T61A 3CX8A 4TL9A 4GOXA 5G3ZA 1GRNA 2ZJYA 1BIFA 3LVQE 1N3BA 1OFHA 5B2ZA 3UG6A 1OFUX 1O87A 1OYYA 2VO1A 4JL5A 4URVR 4DSTA 4NYMR 3B9PA 3D8BA 3IEUA 2ZRIA 1OIVA 2J7PA 2QQ0A 2HCJB 1AS0A 3AV0B 4LZZA 5B58C 3AVUA 8OHMA 4B6EA 5KDDA 2G0NA 5GJVC 3KKOA 3T34A 2PZEA 4JVLA 1KKLA 3SYKA 2C8VA 5JBQA 1GRRA 1TUEA 1SVMA 3ZQ6A 4TMKA 2NQ2C 1IY2A 3AVXA 2XTZA 4LHVA 1E2PA 3B7GA 4WA7A 2ATVA 4YMWA 3QPVA 2BJWA 3N70A 3T1VA 4BFSA 4Q03A 2J0SA 1S9DA 2G0TA 2BHRA 2CLDX 1XPOA 1IQPA 1U90A 2WWIA 3BD9A 3LFUA 1FTNA 1MKYA 2W6JA 2GJ9A 3PFIA 1H8HD 1JXMA 3BBPA 2WJYA 4HLQB 4D26A 1Z0JA 1KY2A 4LJ5A 5KSOA 1R10A 3C16C 3NBFA 5GJBA 4A2PA 2QRZA 4WBSA 3SHWA 3IIJA 1UBFA 5FI0B 2YOFA 4GL2A 2R62A 3OE7A 4OJQA 5SZKB 2Q9CA 3QF4A 4AYTA 2XEXA 1VIYA 1GFIA 2P6UA 4KI0A 1G9XA 1S2MA 4Q5IA 2GAAA 4Q02A 3NTUA 2RGNC 1YZQA 4K46A 3U4QB 2XSZD 3EWSA 3VX3A 2J1LA 3FKQA 4F92B 2O52A 2H18A 3U3KA 4AC9A 1TQ6A 2EFEB 3WHLA 1XF9A 2EFDB 2FFAA 1LY1A 1HQYE 1NKTA 5GVRA 1G21E 1PLJA 3IO5A 4H9GA 2ZJAA 5EJEA 3IQWA 4D81A 1BMFD 2V54A 5FPTA 1AJEA 1KMHA 4O25A 1XEXA 4B3XA 3W5JA 2H8KA 1U99A 1UF9A 4GDFA 3PUWA 2Z43A 1P3JA 2D7CA 1NKSA 1GL9B 2W2VA 2YNMA 3NH9A 4Z51A 1IN4A 3T12A 3K70C 2BMFA 2OBNA 5LDDC 3W9YA 4QNRA 5AUNB 5CB6A 3TGPA 3N2IA 5LB2A 1ZMXA 3TBKA 1UAAA 1IOZA 5JS7A 5SZHB 3AVWA 1M74A 2IK8A 1L2TA 2AK3A 2P5SA 2XJ9A 5E7JA 3K53A 1P2SA 1S4QA 2A5YB 2G83A 1G16A 2UZ3A 2DB3A 2BMEA 2A5DA 1OB2A 5J5CA 2C03A 2CMKA 1U81A 2PT5A 1CF4A 1XPUA 5FOUA 1Z8FA 4B75A 1W36C 2AXNA 2VP0A 2CXXA 2ZRGA 3GJ6A 3AVVA 3H2YA 2CJWA 4RFSB 5L3QA 2ORVA 5A5GA 4E07A 1US8B 1W5TA 4P4SB 5EZ5A 3P1JA 1T6NA 2QSYA 3ICEA 1AZSC 2VYFA 2JJ8A 2ASEA 4DSUA 2JLSA 1X3SA 2CK3D 1KTVA 2WMNB 3NBZC 1XFAA 2W58A 3R7WB 4KO8A 1Z6TA 3SFVA 1WMSA 4O0MA 2VP5A 4JYCA 2GCOB 2IXFA 5CYOA 4G01B 2ZYWX 2O8BA 1TF7A 2WWWA 2IWHA 3UK6A 4WVFA 1E79A 3PCRB 3ASZA 1R0ZA 3UWOA 4U7DA 4Q4LA 1LVGA 2ZI3A 2GEDA 2J7PD 5A4JA 1G291 1FW6A 3ETLA 1N6PA 2F1RA 1XTRA 3E70C 2VP6A 2YWFA 4G5SA 3W34A 4EJSC 3K9GA 4GOJA 5KTYA 1OSNA 1XMJA 2ZSDA 4RKEA 4Q48A 1G4UR 4X8LA 3WY9A 4AKEA 1GOTA 5FTNA 4MH0R 2OCPA 1KMQA 3GFPA 2H16A 1S3SA 2QEQA 4WZAE 3GLIB 1UJ2A 1QHNA 5J4YA 1CR1A 3W5IA 2P3SA 2PMDA 2SHKA 4MYHA 2QMUA 3WP1B 3VQTA 1OXSC 2ZE6A 3AVTA 2RH5A 1KAGA 1KSHA 3EIEA 4B32A 1Q57A 3IDQA 2GJAA 1SXJA 3BK7A 4N1AA 1Z6YA 4OQLA 2BMJA 4A82A 3DKPA 3OE7D 2GKSA 4IFBA 3CH4B 4NP6A 2RGBA 1OH5A 3UATA 1P72A 3WRYC 4JT4A 1CJMA 1KO1A 3CONA 4C4PA 4M53A 3ZIAD 1XMVA 2V6IA 4CIDA 3G0HA 3CKLA 4WZBE 4KAXA 1KAOA 3THWA 1FZQA 1P62B 4IEEA 5JSZB 4O2RA 3LNCA 4POAA 3AP1A 2WJHA 3TUJC 2H1LA 1FMLA 1W0KA 1JR3A 1GNQA 1AM4D 4BFXA 4TT3A 1C4OA 2ZRNA 1GRQA 1QZXA 4B44A 5IT5A 4F4CA 1E9AA 2ZROA 4BE7B 3B1YA 4GT1A 3A36A 2J9RA 3SJZA 4NMMA 2G6BA 1M6NA 4WXRA 2DCUA 1X1SA 1G5PA 2OAP1 4JIMA 5HKKA 5DGXA 3V4FA 2XOKA 2AFHE 4Q7JB 1YZTA 1EWQA 4HDCA 4A0FA 1XMSA 1M7GA 1VCNA 4IW3B 1W44A 4TMTA 4Q9HA 4ASUA 1ZUHA 1YE8A 5E7MA 2VH5R 2QTHA 1F2UA 1KDRA 1NI3A 3RSLA 1TUIA 1M7HA 1CJKC 3VR2A 2GK7A 2QMEA 3KJHA 1MABB 2JJ2A 4Q9KA 4RY2A 4UNQA 3LQRA 4ARZB 2EYQA 1ONBA 4Q4AB 2IYSA 3C41J 4CEIA 2AKYA 1TX4B 1BOFA 5ANRB 3GPLA 2HF9A 2QT1A 2RGEA 3EZ7A 1Z07A 1OV4A 2QE7A 2XXAB 5FL7A 3ZJYA 3EPJA 1SVSA 4DDTA 2ZJBA 3K8YA 3NDBB 3ZH9B 4MKGA 3BB1A 5CLLA 1R8QA 4M21A 1EK0A 1QHHB 4V03A 5FTKA 1G20E 4LBVA 3GLGB 3AF0A 1W0JA 2WJJA 3I73A 2IL1A 3SZRA 1MRSA 4IOMA 1MOZA 1KY3A 1RRPA 2HUPA 1MR3F 4YDSA 1ZNYA 4B71A 4Q7MB 4WAUA 1HE8B 2A30A 1VG0B 2YOHA 3VU9B 3GP8A 2NG1A 1RC8A 2O0KA 1TTTA 4DCSA 4LJ4A 3S1AB 3OIVA 821PA 1NN3A 1XD2B 3HU2A 4JSYA 4OHZA 2CL0X 4PAMA 1OKKA 3OEEA 2ZJOA 1CS4C 4GPTA 5DLQC 4D4MA 5FI1B 1MO3A 2O8FA 1LNZA 3TKLA 1E2HA 3BERA 3RABA 2ANCA 2VP9A 3HP1A 4NPHA 4A6PA 1OH7A 4MYCA 1KIMA 1DAMA 2RKOA 4KFUA 2F1HA 2MMGA 1E9SA 1Z6GA 1GAJA 2CLCX 4BLQA 4EPXA 3AH8A 3EPKA 3GD7A 4QHSA 4YMSA 5TXGA 3PXGA 4KVGA 4NZYA 4GOKA 1HY3A 2FG5A 4XVUA 2PCJA 2CVFA 1X8LA 3VMFA 4DVGA 5FBWB 2R6FA 1SXJD 3FDIA 4DDWA 2WWGA 2F55A 2ZRAA 1SHKA 3RRYA 2LKDA 4IXNA 4F93B 1U94A 3MWYW 3O8DA 3PEVA 2KWIA 1CXZA 2QAJA 3A58B 3KKMA 3U4QA 5J47A 2V1XA 4Q47A 1G8GA 4RD4A 2C9OA 2HF8A 1TQ2A 4JT2A 1E2FA 2Z0MA 2WKRA 4LOAA 2C77A 1Q1ZA 1NVXQ 2D06A 5F98A 3GJXC 3K0EA 721PA 2Q9AA 3EIHA 2PLFA 4UJ5A 3THXB 1Q1QA 4I4LA 1WXQA 4KLNA 3V9PA 1HT2E 1P2UA 5IDVA 3IGFA 2JEOA 1E9DA 4QGGA 4LC0A 4B74A 1RZ3A 4HLDA 1V43A 3RS2A 3W8RA 4YDHB 1AS3A 1PVOA 2OFWA 4G5RA 1KI8A 1XXHE 1OT3A 3Q7QA 4JBWA 2YWHA 1JR3D 2QMOA 2W83A 2WBLC 3REFA 4QM6A 4TTRA 3LBIA 1EGAA 4MGKR 3FMPB 3EG5A 1F60A 2F3RA 1XTIA 3P27A 5J4VA 1SZPA 2ZR0A 5JHGB 4LSGA 2C78A 3NEYA 5AJZA 3RRMA 1ZNXA 1MO4A 3ND9A 4K8OA 4KFRA 4CDGA 1LV7A 2NO0A 4DLTA 4Q9LA 2J0QA 3C5CA 1R8SA 3KB2A 5FR1A 4YMUA 2IEZA 2D62A 2VP2A 2BEJA 1XCPA 4Z1MD 4ZIRB 1P5ZB 3KQUA 2XOKD 2FE4A 4TL6A 3I4LA 5DYIA 2GF9A 1D9ZA 2IYWA 3K70B 2B7BA 2O8EB 2ERXA 4M1WA 4JLBA 3EARA 5JWOA 3T1OA 1DTSA 1YR7A 2GEUA 2J0UB 2V9PA 2ZRDA 2H92A 1FX0B 3FHTA 4ASUD 4QFMA 1VTKA 2ZE7A 5EE0A 2NO1A 5JJIA 3SQXA 4RFSA 5DISB 4HZIA 3A1TA 1US8A 4XWKA 2IHYA 5EE5B 3CNLA 4P4SA 1RYFA 3WRXC 2GJSA 2UVQA 3MGCA 2W6IA 2QGNA 3F8TA 4EQ6A 3O8CA 3FOZA 2Z6VA 4LC1A 1R0XA 2ZS7A 3RAPR 2R6AA 2JJ2D 3NXSA 3R7WA 3BFXA 2ORIA 3U7FB 1NMZA 1W2HA 4PR0A 4TSFD 2NPIA 5TY0A 3VFDA 1IN8A 2GCOA 2AWNA 2GTPA 3Q9LA 3W90A 3K09C 2QP3A 3MCAA 1ZC4A 3SJBA 2P6RA 1E96A 4ZCMA 3DVLA 1C9KA 3KUCA 3I5XA 1OH8A 1UEJA 2OG2A 1LS1A 5BXQC 3FMOB 2HDNB 4N3NA 2Q3MA 1W0JD 3AB3A 1U0HC 4CYMA 3NG1A 3UG7A 4XSGA 4D0GA 3QF7A 1ZNZA 3TMKA 3V4RA 3VNVA 1N6HA 4NDZA 3X1YA 2REBA 4KLZA 4RFVA 1A2BA 4C7OB 1N6NA 4TL8A 1Q21A 4DDUA 3W6PA 3BFKA 1SVIA 4PZLA 3GLIA 5KOYA 3A4NA 2FFBA 4XVRA 4DIDA 3RS3A 3E5HA 4U00A 2CVHA 1GIAA 1XB2A 1L7VC 3D6TB 1TEVA 3FWYA 4FCTA 3MWKA 1IY0A 4IVRA 4XWOA 3KJIA 4TYPA 2YZ2A 3F3YA 5FBVB 3I5YA 3DZ8A 4CT4B 1K5DA 1U8AA 2R9VA 1D8TA 3LRPA 3LBHA 3WHKA 1CLUA 2IHBA 2EW1A 2X77A 4JBYA 4KYIB 1FQKA 2OCBA 4XD7A 3RNLA 3B13B 5JZVA 2QBYB 2EWVA 1E2QA 4ZI3A 3ADKA 2C96A 4PHGA 2ZTSA 3KQLA 4JJKA 1UEIA 4FW9A 4UJ3A 4D4KA 2ZRBA 1X8KA 1T3SA 2QP4A 1Z0DA 4I1UA 1P4SA 1FOEB 1TAGA 3T5GA 5JSZA 4D4LA 2IS2A 1QVRA 3EPLA 4GRAA 2AWOA 1F3OA 1Z06A 2OZEA 4EDHA 5L3RA 4Q01A 4Y0AA 2ZJ2A 4HB2A 3I8SA 4XTCS 1DADA 2JASA 4PFSA 1A82A 2O0JA 1KK2A 2GF0A 3A1SA 3P26A 3L0SA 4DLVA 2QG6A 2RMKA 4KODA 4G5QA 3SS8A 4CEJB 4D0LB 2ZPTX 4L5BA 4EAQA 2HJGA 4BUJA 5FFMA 2R65A 1E2KA 3R8CA 1H8HA 2F9MA 2IWRA 2P2LA 3CPEA 4YMVA 4OK5A 2LKCA 3CNOA 2IW3A 3NBYC 1D5CA 1W48A 4IRUB 4TQUS 2VBCA 2P5TB 421PA 4BFVA 1G41A 3EZ2A 5TARA 1HA3A 1JR6A 1GZSA 5FPSA 2JATA 4EPTA 1TNDA 1E4YA 4LRWA 1XBTA 4JL8A 5FOTA 1ZD8A 2YOGA 4URXR 2WOOA 4S35A 3KFXA 5EQTA 1DAEA 2A3RA 1LF0A 4W7SA 4MRRA 4XSHA 3DPUA 2AHOA 4B3FX 4LHYA 5FUVA 5HPYB 2E9SA 1ZYUA 4L15A 3SI7A 4LY6A 2W6ID 1U98A 4ARZA 4YXWD 1ZAKA 2QAGB 3OAAD 4Q4AA 1TF2A 4BZPA 4YQFA 1ZBDA 2CCJA 4NYIR 1R7RA 5F2EA 5EXSA 4M2LA 1UDWA 3IO3A 4WOPA 2JA1A 2XTMA 1BMFA 3QKRA 5BYJA 2XXAA 1SVWA 1JJVA 4GFDA 2N46A 1G7TA 3GCGA 4UQOA 2GRJA 4BQSA 2OILA 1QHHA 3CUEF 4NONA 2I1QA 3IIMA 1KZ7B 2FSFA 4JLVA 4BPBA 1OW3B 3VU9A 4NYMQ 2EQBA 3S1AA 5HZKA 1B0UA 1TU4A 1AS2A 1XD2A 5LD2C 4RZXA 1T4GA 1ZCAA 1G3QA 1VHLA 2VHCA 2MSCB 2OLJA 1UM8A 4LCBA 4RKFA 1S3GA 1ZC3A 2ZETA 1N2CE 2OM2A 3QG5A 1R0WA 2OEPA 5CIQA 1W4CA 3SR0A 3RC8A 4HB3A 3D3QA 2AD5A 2HLDD 1II8B 4HDQB 1AQYA 1P73A 3BS4A 1BKDR 1P9NA 3SHFA 2BBTA 4E03A 3KKQA 1VCOA 5BYKA 1E98A 1GWNA 5A0FA 4C0SA 3M1IA 4JYBA 3W6NA 4BFWA 3EWAA 3HYTA 1XRJA 4G5OA 2O8DA 3FVQA 1XCMA 1DAKA 5CIWA 4B2IA 1DOAA 1Z47A 3DEFA 5JWRA 2DFKB 2GCPA 1JI0A 1YZNA 1L4UA 3ZVLA 1RJ9B 1WB9A 1O3YA 1W49A 1AGRA 2WIAA 4XD7D 4KHZA 3K0SA 3WBKA 3FB4A 4Q9JA 3CR8A 4M9SA 2XZLA 4Q18A 4NL4H 2ZE5A 4AKIA 2V55B 2VPPA 2G77B 5C4MA 4A0HA 2J0VA 3UKDA 2ERYA 3NKVA 3UPUA 3THXA 1E2JA 2FA9A 2NMVA 4B76A 1KI4A 2GJ8A 4FMCF 4CGZA 3DDCA 3SQWA 1NRJB 1D9XA 4P0TA 4EIWA 4DLUA 4G1UC 1WRBA 3U2QA 2B8WA 3QNUA 3K0CA 4RSGA 3PIRA 2GHIA 4OI4A 1RW4A 1CULC 1N6KA 2W0SA 4ZDJA 1P7CA 1VHTA 4Q1DA 4WW0A 5CDFE 1Q0UA 4JLDA 3UWKA 3U7GA 1YKSA 3HR8A 4LPKA 3CH5A 1VCMA 5KPJA 2QORA 3MMPA 1U9IC 2QPAA 3U3MA 1S96A 3IEVA 3FHOA 3A1WA 2FGKA 1G3UA 1OFTA 4BRUA 4TMXA 4PANA 2ZQ5A 3QENA 1DPFA 4PZYA 3EPHA 4NYJR 2N1BA 1E3MA 2WPDD 5AJXA 5KNDA 4DCUA 2ZVQX 1N0WA 3WYGA 4HLUC 4PX9A 4LYFA 2V1UA 2ZRMA 3PEYA 2FV8A 3CW2A 4C0JA 5AK0A 5KU1A 2KJQA 1Q44A 3UMFA 2IS1A 1CTQA 2FPMA 3QXXA 5DI3B 2J0UA 2YV5A 1FX0A 1T9HA 2YC2C 1ZJ6A 3MWLA 2JLWA 5EZ6B 2D74A 4LPSA 1A5TA 4C0KA 1AK2A 1OXUA 5UKDA 3MJHA 1SVOA 1IHUA 4PAQA 4M9XA 4PQRA 2BC9A 3HDTA 1UBCA 3P4YA 4Q1BA 3ZIAA 2IUSA 1LFDB 1G17A 4D82A 4X8HA 2GXAA 4HYYA 4OQXA 6Q21A 4RZUA 4L8GA 2WOJA 4MRSA 2CCKA 4DCNA 2UKDA 2R8RA 2X8AA 5AWFC 1WCV1 1N6IA 1QG2A 1NBME 4WZ6A 4I81A 4PHHA 2JLUA 2QUZA 2G9NA 2OXRA 2XB2A 1JECA 5J4HA 4US0R 3VR6A 1YZGA 2ZXUA 1XPRA 3DMNA 3AP2A 3SBDA 2QT0A 4M1KA 2CLSA 4FMDF 2PZGA 4R71A 1E2MA 3F5FA 1G8PA 3WNBA 3WYFA 2A9KA 1TMKA 1VG9B 2C9CA 1P75A 1ZM4A 4X8MA 4F4JA 2WSSD 1U0LA 3RYTC 1A2KC 1HH4A 2GXUA 1WBBA 1YRBA 1CU1A 2CE7A 4Q4HB 2IUUA 3JZMA 4H1VA 1GVNB 4W9MC 2HYDA 1I4LD 3GJ5A 4TWZA 1CKEA 2RAPA 1SQ5A 1E94E 3AGPA 2AN9A 3KUDA 3GFOA 2V4ZA 1VYUA 2XNSA 3AUYA 4IDNA 5H8WA 1OB5A 1ESNA 4Q1EA 3B9QA 4RJLA 2BMDA 2QBYA 4DB2A 1OYWA 1E9BA 3BFVA 1YR6A 2I3BA 5DH9A 3TK1A 2ZUDA 4Y0VA 2WWHA 4LBZA 1KK3A 3VHLB 1J90A 2J46A 5FUXA 1XD8A 4KJZA 4XOIA 3TE6A 2A7QA 4OK6A 2YKGA 1LS6A 1I4TD 1UPTA 1BS1A 3JVUA 3EW9A 2IXGA 2HXSA 4UXJA 3T1QA 1NN1A 3U3OA 4E5UA 1E2NA 3RS5A 3AKEA 2XJ4A 3GLFA 2ECKA 1J2JA 4ILEA 1TL7C 1CR2A 1QHIA 1QBKC 4OHVA 3BH0A 4JKYA 4FXPA 3ZGXA 4UXIA 5HCIA 2DFLA 3TUZC 3CRMA 4B6FA 4CEJA 1KSFX 2CHQA 3GEIA 1RYHA 4A8JB 2ZRCA 1XXHB 1MRNA 4EFMA 5L3SA 2EWWA 3CF0A 1Q1BA 2ZVPX 1DO0A 1ZIOA 3QQ5A 1E1RD 5KUTA 4D2IA 4GZMA 4TLEA 4NKRA 3LH5A 4QJ5A 3LX5A 2WSMA 4V0ME 1XZQA 1GTVA 4NBSA 4PQYA 1NN0A 1XTSA 2LWIA 4KBFA 4OJKA 3EC2A 3LLUA 2A5GA 1GM5A 1NVVR 2YINC 1UFQA 3U3RA 5DN6D 3K70D 1AGPA 3KQHA 3ADCA 3BC1A 121PA 3MLEA 3L43A 2HT1A 1MT0A 1DAHA 1WF3A 2OESA 2PX3A 1KDTA 1NIJA 3AF2A 1J8MF 1SHZA 3VR5A 1QHSA 1OLOA 2YWEA 3KTAB 2J41A 4KFSA 1FL9A 4IHQA 1JJ7A 1Q3HA 3OESA 2ZANA 2CL6X 4BLSA 2WJVA 4JVNA 2FPKA 4XTRA 1E99A 2QAGA 1IN6A 5EE1A 4A9AA 3ADBA 5JJKA 3TW8B 4AD8A 3PITA 2HXYA 3P20A 1W36D 4BFTA 3BE4A 4R2IA 1G3MA 3K9LA 3KFVA 4DB4A 1Z0AA 1WE2A 1W2GA 4HI0E 2JLZA 1P61B 5KO2A 3LY5A 2ANBA 4PQFA 1N6LA 1R6BX 1BH2A 1NIPA 2GZHA 4LHZA 3AVPA 1E1QD 1XEWX 3EZ6A 5FOVA 1EXMA 3TSOA 4QJ4A 1AA9A 1ZINA 4B35A 4I1OA 3RWOA 1N25A 3LO5A 2AD1A 1PUIA 5AR1A 3ZVRA 1E4VA 2CNWD 4FCWA 3J81k 4Z1MA 3TIFA 1IONA 1IY1A 2DHRA 5IHPA 1II8A 1R0YA 2BKEA 4JZKA 3C15C 3UMSA 1Z83A 2P0EA 2WAXA 3QKTA 3BWDD 2J59A 2I1VB 2PEYA 4JLNA 4JKIA 1TADA 1XMIA 4NTZA 4MUAA 3SJCA 1GITA 2WZQA 2AXPA 4M22A 3GJ7A 5DHFA 3QSYA 1VKJA 4LJ7A 3CZPA 5FPYA 2R44A 4DSOA 4DHEA 3EA0A 4BZXA 1R4AA 4FCVA 1SXJC 4ESHA 3I92A 4B3DA 2F7SA 3B1WA 2ZS9A 3B6EA 2LCFA 1W5SA 1N5JA 2QM7A 2REXB 4JLMA 2DY1A 4MKFA 2JJ1D 5IF9A 4GP6A 1X1RA 4TMZA 3QPWA 1EX7A 1UDXA 3FYHA 3U44B 2REOA 4TSFA 5EE9A 1IXSB 4LWZA 2L0XA 2AFIE 3G5UA 3UXMA 4DJTA 1S1CA 2NTYC 3AP3A 5GJCA 5DNYB 1IAQA 2OXCA 2H5EA 2ZJZA 1GSIA 3JVVA 2WJIA 5JFGA 4C2TA 1RRGA 1ZVQA 4LK2A 3R9IA 2CE2X 2FJUA 2VSOA 3CRVA 3R8FA 3VR4A 3NHAA 3PQCA 1SVKA 5LBIA 3PUZA 4B73A 3RDPA 1NBMD 2B92A 2ZI9A 1P60A 3N2EA 2DBYA 4KYUA 2CBZA 4DLYA 2B7CA 3SBEA 2ONKA 5FBLB 2J87A 3C7KA 1M8PA 5AJWA 4YLGA 1ODFA 4PHFA 2QI9C 4IKEA 4Q7LA 4M1SA 1NSFA 1NG9A 3GJ0A 3GJ4A 1NG1A 2B6HA 4TLCA 3ZZ0A 5K8IA 4B2LA 4QGAA 1DG1G 1G5RA 2VIIA 2XTNA 2ZRFA 5FOSA 4B48A 2PCLA 4N0DA 1X8JA 4ZCIA 3QPUA 2ZU0C 5DI3A 4LUCA 2PEZA 1NL3A 2EFGA 2ODNA 1CR4A 1QVAA 2XNDA 3I62A 4QGHA 1YZUA 3NH6A 4PC7A 4PO9A 5KDLA 2GESA 1IM2A 2R6GA 4HDOB 4TLBA 2JLXA 4QRHA 1A4RA 2OT3B 3FFBA 5CITA 3IILA 3QY0A 2VHTA 3TQFA 2FGJA 5JI3E 3LW8A 5M04A 1P2VA 3EASA 4G5GA 5DI9A 2OBMA 4KSCA 1JEDA 4R98A 5K8LA 2HEIA 5JCPA 3GJ8A 4HAUA 5FTLA 1II9A 1FUUA 5JI2E 2FF7A 5LPNA 3UANA 4EUNA 5JMTA 3KQNA 2CDNA 2RCNA 2FEMA 1SULA 4M1TA 3QVUA 1OFIA 3KXIA 1Z28A 2OE2A 3B82A 2O8CB 1WP9A 1PLKA 4DLZA 4PZZA 1EFHA 4CVNA 4PC6A 1KK1A 4DIEA 1QHGA 4A2WA 4A6XA 2ZI4A 1J70A 5C46F 1B23P 1DAIA 3NWJA 4OKSA 1N6RA 3U61B 1NP6A 2ZU6A 3R20A 4QKQA 1SKYE 1VIAA 3W8NA 1XWIA 2V6JA 4P32A 3ONWA 3EX7C 3TVDA 4N0EA 3G82C 4Q4HA 3ZD7A 3RHFA 3GJ3A 5FH9A 4XVQA 3U5ZB 3RS4A 5SZIA 4BLRA 4OHYA 3EZ9A 4YC7A 4U02A 1DBSA 5EUMA 1CEEA 4IDHA 2H57A 4BLTA 1D2NA 4ABYA 2IF0A 4Q21A 5CK4A 1CJTC 3RVBA 1AIPA 4M1MA 4AKHA 2XGJA 3SN6A 2D2FA 3B1ZA 1J7KA 2BVNA 1E0JA 2BV3A 3LA6A 4UKDA 5B57C 2C99A 4FIDA 3U60B 1COWA 1ESMA 1JB1A 2XX3A 4Q7KA 4QXAA 3OAAA 4YXWA 1NVUQ 1PLLA 4D80A 3CRW1 2JDID 1XP8A 2Q0HA 4QNMA 1J8YF 4CZ2A 1ZW6A 1GL7A 1W36B 2GBLA 4LJ6A 1ZM9A 4MYTA 3KXLA 2JLQA 2CHGA 5IK2D 2WV9A 1JEEA 4TLDA 2Z4RA 3MFYA 4Q1FA 1VYTA 1WA5A 5CK5A 4QBHA 5P21A 4URWR 4RD0A 4NCJA 1KDOA 3A1VA 4A0GA 1T5LA 4Q1AA 5J40A 5D3QA 3K1JA 2Z83A 1KO4A 3PEWA 3LAWA 3EZFA 5HZHA 4HZUB 4DRZA 1R5OA 4ZDKA 1XJCA 2ZITA 5GVSA 2ZSEA 1Q1EA 1E69A 1XXHA 4L9SA 2WHXA 5L3VA 1G6HA 2VSXA 2IYXA 2HLDA 4L4UA 4OHWA 4BASA 1KMHB 1A1VA 4MGZR 3BJIC 2D3WA 1RKBA 1I2MA 1ZUNB 4MKHA 2PJZA 3GLHE 3U6KA 2N42A 3AM1A 3OFND 2IYYA 2O5VA 3QG1A 4FINA 1N6OA 2FFQA 4EJSB 2WMOB 4O3MA 4S2EA 4BFYA 2NGRA 1G1MA 1EFRA 4ACBA 3C8UA 3THYB 4TMVA 3AGQA 4NU0A 4TYQA 3GEHA 4I1VA 2Q21A 3L0IB 3EAQA 3LQQA 5D3MB 1W4AA 3TSWA 2XNDD 3KTAA 4DEXA 1KI6B 1G6OA 4HAYA 2FPLA 5GJWC 3ZS9A 3DOEA 2ODEA 1XNJA 2RGAA 3TAHA 5KHOC 3NHBA 5JEEA 4LJAA 1KNQA 2NPFA 5H1YA 4FMCB 1UKZA 3AKCA 1ZP6A 2ZYUX 2C5LA 4PPQA 1JBKA 2FZ4A 2ORWA 4DEYA 3JZAA 3HU3A 4C9BA 1G5TA 2H7VA 3WMEA 3KJEA 4Z54A 2F1JA 4KCGA 4LHXA 3SFZA 3OF5A 4JVMA 2NO9A 4EKDA 1TQ4A 3A4MA 3CBQA 2DWOA 4NYIQ 4TZ6A 2ZRLA 3BXZA 1CBUA 4LBWA 3DM9B 2ZREA 4A36A 1GKYA 4DUGD 3ZD6A 2FFHA 3OHMA 1ZCBA 4DWJA 3B1VA 3BB3A 3H4MA 2GNOA 2ODBA 4QHTA 1CIPA 1IN5A 1KO5A 2AX4A 2F3TA 2RHDA 2WPDA 3KB1A 4HAXA 2XZOA 2P6NA 2BCGY 2PBRA 3NBXX 3KKNA 5HE9A 1VCIA 2V3CC 3BB4A 3QXJA 1T0HB 1MO5A 2OBLA 1FTSA 3T5DA 1KK0A 1FMJA 3AVOA 4MRPA 4UNPA 4IDPA 4TLAA 1W46A 2W2XA 4LYHA 5EP3A 5JS8A 4R7ZA 1JALA 1V5WA 2Z4SA 2FSIA 4LHWA 4V02A 3EXAA 4KV9A 1OXXK 3TQCA 4OI1A 3K0AB 1E0AA 4PO1A 3RANA 2AK2A 2GEVA 1ZD9A 2R2AA 2WWXA 3WMFA 3FTQA 4MDEA 1Y63A 3U7EB 2PJRA 4QHYA 2GZAA 2C04A 3UIEA 1NVWQ 1MABA 1G3IA 4GBMA 1GG2A 1NJFA 1COWD 1XTQA 2ZAMA 3KJGA 3ZVNA 2EFHB 3N5CA 4P33A 4BZQA 4TYYA 3U44A 2PLRA 1NF3A 1ZUIA 2ZUCA 3QIAA 2OCYC 4NCNA 4DCTA 1G8FA 1HV8A 5JECA 4URZR 2G1JA 1DG3A 1E6CA 1NLFA 4I99A 4GMDA 4NCKA 2BIFA 2KBFA 4AKGA 1E2DA 5B64A 1NY5A 3EC1A 4IVPA 4A15A 4II7A 4E22A 4V0NA 2K5UA 3GLGA 3PJRA 5CLQA 4FMDB 1ZU4A 1C1YA 1HT1E 2NZJA 4OL0A 1RPZA 5LB4A 1T8TA 1ELOA 2IYTA 1RFLA 2AL7A 4LJ9A 2ZIAA 3I32A 1JPJA 4F4IA 3THWB 1R5NA 2WSSA 3MG9A 4MGYR 1IJFA 2IC5A 4M4SA 2FWRA 3IPYA 3AQ4A 5KSZA 1ZM7A 1F48A 1WDTA 3KDSE 1CJVC 4B47A 1EG7A 2GA8A 2WWFA 1E0KA 5G40A 4OK3A 3QKSB 1NNEA 2X1VA 4V0OA 1GKIA 1FUKA 1EFRD 4NYJQ 1RVDA 1QDEA 5DO9A 5BW8A 2XB4A 4ZDWA 4P4TA 1WQ1R 2ZRJA 4DBLC 2ZJ5A 1D6JA 2ATXA 3FMIA 4ZKEA 1G7CA 5CM9C 4TL7A 1K8RA 2QQEA 2P65A 4JJZA 4PPNA 1VECA 3OZXA 2OLKA 1Z2CA 3RC3A 5KSPA 3KQKA 1ZIPA 5CYPA 5E3HA 4L9WA 4M9ZA 3TR5A 4LV6A 3I8XA 1TF5A 4ESVA 3DOFA 3VAAA 4C0BA 1M1YE 4GZLA 4MUBA 2RGNA 2JIZA 5AUQA 2YHSA 5JRJA 3KL4A 1GP2A 1YRAA 2O8CA 5K8TA 3QOFA 3LXXA 2WKPA 3AKYA 4JLOA 3HU1A 1FP6A 3L2OB 3PV0A 3VKHA 1IBRA 3PVSA 2GZDA 4CEIB 2GXQA 2NO7A 2WICA 3Q8XB 3QUSA 5KNCA 3PG5A 1E1RA 1RIFA 4IOKA 2IS4A 2YYZA 1LF5A 1JQLB 4D4JA 4GSYA 1ETUA 5BWMA 4ACAA 5F9HA 4MA4A 4ZIRA 4TYNA 1MO6A 2GWHA 2ZS8A 2NO6A 3M6AA 2J7KA 1MV5A 3IBYA 5DN6A 2O8EA 4TMWA 1XTKA 2O8FB 3IKJA 4BFUA 3CM0A 2JCSA 2PT7A 3F0TA 4O2LA 2O0HA 1VG8A 2QN6A 2GK6A 3QXSA 3ZS8A 2OO7A 4IJMA 4OBEA 4CEHB 1AKEA 1HEIA 4W5WA 2TMKA 2V7QD 3RSOA 1IXZA 1Q12A 2JGNA 3VR1A 4B2PA 3BH6A 4P4UA 3B8HA 4B34A 5EUQB 3T1TA 1N0VC 3UMRA 1F5NA 4LV5B 1LTQA 3X1DA 4DLXA 4AY2A 2Z5FA 2R6DA 1EFUA 1XDBA 4GMXA 2QSZA 2VLIA 1FNMA 1KZGB 1JPNA 2V8OA 2A5JA 3HPQA 1BYUA 4KXFB 5IRCD 3M0EA 3HJNA 1FPMA 4UNNA 4PC2A 1PJRA 3OEHD 1AQUA 3E1SA 3M4YA 1E1QA 5CJPA 4AG6A 3K0CC 4TN1A 4HZUA 4PHTA 2OAQ1 2CNWA 5EE3A 4HAZA 4DLWA 2F6RA 1J99A 1W4BA 1Z22A 1UKEA 2NIPA 3TJZA 1L4YA 5CDFA 4C7OA 3LW7A 4PSKA 1OE0A 2WKQA 3GLFE 3VNUA 2QPTA 3MJRA 1KSJA 3FKSD 1Z29A 4OHXA 2FMXA 4FN5A 3CPJB 4EJSA 3CWQA 1BYIA 4PC3A 4D6PA 1Q20A 3PUYA 1DS6A 2A2ZA 3EIQA 4H1UA 1U8ZA 4KITB 4EFNA 3U7HB 3THYA 2FSHA 1S0UA 4XIGS 5BN3A 3RRNA 2NOAA 4XWAA 3FE2A 5D3MA 1HQCA 3NVAA 4GP7A 4C0LA 1EESA 1NVVQ 4OYHA 5FL3A 2JJ1A 1KI6A 2FX3A 1W47A 3LX8A 3AF3A 4Q4JB 5HTKA 2ZI5A 3CZQA 1SXJE 2GVZC 3BORA 2BBSA 4LI0A 4MRNA 3VR3A 4D0NA 3WBJA 1Y3AA 3K9HA 4JLPA 3THOA 1Z63A 2IT1A 5JLJA 3RLFA 1R2QA 3I3SR 4EPRA 1K5GA 5DE3A 1FFHA 1X86B 3PR1A 2FEOA 3CRRA 3QXCA 4TTQA 4LYJA 2VHJA 2VL7A 1OHHD 2XITA 5DHAA 1KI1A 3WMGA 1KI3A 3SOPA 2WTUA 2ZYVX 5TDHA 3W6OA 2JIZD 1G4AE 2XAUA 1II0A 3EA5A 4RZ2A 1NBMA 4QJ3A 2IXEA 3T35A 4HEJA 4EQ6B 4EPYA 3K0FB 4X8OA 3H0KA 4PTLA 2UZIR 1G3RA 3OIWA 3ND8A 3LDAA 1JR3E 1Z6XA 2CCGA 1VDZA 2MSEB 2WWYA 4ON9A 4G0NA 4MGIR 1OJLA 1DE0A 4YONB 3RWMB 4A92A 2YWGA 2PH1A 1EWRA 4KSBA 1YR8A 4BGDA 2IYVA 4DKXA 5GADl 4CT5A 1SKYB 2A5FA 5KYKA 2AKAB 1X6VA 1XD9A 4ITRC 1WBDA 4K81B 1UBEA 4HATA 2PL3A 1Z5ZA 2W0MA 4Z8YA 3ZDQA 2BEKA 2ZYTX 4MKIA 2IYUA 1Z08A 2OFXA 1T91A 2C9YA 2QRNA 3NDPA 4DC9A 4WIAA 4IVQA 3K0AA 3A4LA 2E87A 2RGCA 3MRSA 4V0LA 1HTWA 3VTKA 2MMCA 4HB0A 4EPVA 1D2MA 2WJGA 1SGWA 1NMXA 2VF7A 2W6JD 4HUQB 2ZAOA 2Q6TA 1NMYA 4BWYA 1NSTA 2ZSFA 1UBGA 3CWZA 4WXPA 2F43B 1KGDA 4IDQA 2IEYA 3LBNA 1G8HA 1IN7A 4IOJA 3VHXA 2QY9A 2JLVA 4DSNA 3PUVA 3TVTA 3CR7A 5F3WB 1A7JA 3HR7A 4NHOA 4HLCA 4AYXA 3A37A 4FD2A 2OSBA 1Z0KA 2VHUA 2PX0A 2PZFA 1ZNWA 5ELXA 4IFEA 1F2TB 5E95A 1N5KA 1G8YA 1NLYA 3A8TA 5EXPA 2WAYA 621PA 1KKMA 2DWPA 1EFCA 4B3BA 3CPHA 3HWSA 4MYUA 3B85A 1L8QA 1UKYA 2FDCA 4UNSA 4P31A 3BGWA 1Z6AA 2A78A 1E9CA 2QP9X 4RCYA 4M9QA 4F7WA 2HYIC 2HV8A 3SYLA 2IX3A 1KJWA 1UADA 5BQ5A 3GQBA 2J3EA 3QKSA 5L8VA 4ZV4A 3NIBA 2NZ8A 3TR0A 2FOLA 4DZZA 5LD2B 2DYKA 1ZD1A 1TPZA 2I4IA 4DLRA 3C5HA 3GLHB 4V0MA 4Q66C 3ADDA 1NY6A 3CLVA 3B78A 4C3ZA 1U8YA 1ZM3A 1YZLA 3DKVA 4QG7A 5E4FA 3CIOA 4U5XA 1RJ9A 5FTMA 3BRWD 3VKGA 1ZU5A 1RRCA 4XH9B 3A6PC 2ZI6A 2JDIA 1P6XA 3REGA 3SJAA 4JLAA 4ZO4A 2IYZA 4BLPA 5FUWA 2QNRA 3DM5A 1DO2A 3P4XA 5IK2A 5DIFA 4JLKA 3QI2A 3NC0C 1XEFA 4G3XA 3V00A 3BOSA 1W1WA 2QAGC 3TSZA 3KX2A 2VHQA 3WYAA 2IA5A 2EYUA 5FBRB 3TNFA 3WNDA 5KDOA 1JNYA 5HCNA 3A1UA 3P32A 5E7IA 3ZZUA 4JBXA 5G41A 3W3ZB 4A2QA 4C2UA 1E2IA 1D2EA 1DAFA 3SU8A 4NCHA 2HT6A 1E2EA 1N5IA 1OXVA 3I61A 4QOSA 3AEZA 2GILA 4BFZA 2ODWA 1H65A 4M1YA 2X2EA 1W4RA 3ZLJA 1G7SA 5FBQB 2QU8A 3HYRA 3U6BA 3AVQA 3Q5EA 5FOXA 2IS6A 2Q9BA 4R2HA 2E1RA 3ZQJA 1GNRA 2RGXA 3L82B 3QEJA 3QKRB 2ZM5A 3DZDA 3I1FA 5FR2A 2J45A 3B1XA 2FNAA 1G7RA 2HJVA 4NCIA 2FH5B 3OFNA 3KKPA 3KXKA 5AUOB 3LWNA 3AF1A 4C0AC 1E79D 4IXMA 4A4DA 4LGMA 3Q3JB 4DDVA 2IYLD 1HURA 4BEJA 2QM8A 4DLSA 1DVRA 2IUTA 2OCAA 5KSYA 4QM7A 3Q5DA 4NH0A 4OI0A 4US2R 1SVLA 2W00A 2ZJ8A 3SE0A 1Z0FA 2FZLA 4CEHA 1MH1A 2ZUBA 4US1R 1YR9A 3IUYA 2QPOA 1VYVA 3LXRA 1GILA 1XCGB 4HAWA 521PA 2ZSAA 3OIUA 3TH5A 5B30A 3DMDA 1XJ0A 1RRFA 2Y8EA 2C98A 2KBEA 3VX4A 2BDTA 1YVDA 4AURA 3RS7A 4LX0A 4F38A 4BLOA 1PZNA 3RS0A 4P3YA 3C4JA 3H86A 2O8DB 1IXRC 4DT1B 2VF8A 2WIBA 3O47A 3TUIC 1T3LA 1YHNA 4GI7A 1KDPA 1FNNA 3DL0A 1DARA 2ZRHA 3ICQB 5EP1A 2RB4A 4IEIA 5AUPB 1QHYA 1I4DD 3B5JA 4DUGA 4QBGB 3GEEA 4LV8B 1T5IA 4PO8A 1R5BA 1VPLA 5H68A 4RCZA 1OXTA 2FSGA 2KI5A 4RD3A 4Q9IA 1OH6A 5J4KA 4KU4A 4LJ8A 3LLMA 4RZ3A 1E0SA 2KE5A 2VTKA 1T8UA 3K09A 2C95A 4NE2A 1NN5A 1EFTA 2EFCB 1HYQA 3LD9A 3AVYA 3W3AA 3D31A 3X2SA 4HAVA 2YVUA 3T06B 1GUAA 2CHVA 1XJQA 2JAQA 2GJKA 2QGZA 2FU5C 1KSGA 1W0KD 1M7BA 4TT3D 4UNRA 3X1ZA 5EXTA 4EFLA 1QG4A 3GLIE 3X1WA 1BO6A 2WM9B 4M1OA 3X1XA 2CL7X 2DWQA 2OUKA 1P9WA 3LVRE 3QXHA 2DR3A 1JQJC 3FPAA 4TQ9A 5J4LA 3R9XA 4JLJA 1KI9A 4Q4JA 5C2JB 1CRPA 1YZKA 4LYAA 2RGGA 4AK9A 5HKKD 1KJYA 1FQJA 1M2OB 1I2DA 4MRVA 4XJXA 1GL6A 3K9NA 4JS0A 1E9RA 1NLZA 4EPWA 3WXMA 3QBVA 5FPKA 4FWTA 1QF9A 2DFTA 2WVJA 1IJEA 4PPGA 4W5HA 4ERNA 5FOWA 1CRQA 1HE1C 3QBTA 2ZRKA 2GETA 5KNBA 4M8NE 4PXAA 3C14C 3KZ1E 5JWHA 4GNKA 1TU3A 2QTFA 4MITA 2ZR7A 4ZPXA 2QENA 2W2TA 2DFNA 3QF4B 1Q22A 1KO7A 2PMKA 1Z0IA 4Z8XA 3R9WA 5KPDA 1G64A 2VQSA 4BRWA 1LW7A 4AIIA 4HSEA 2Q3HA 1S9HA 2GVDC 3K0FA 1KYIA 1KNXA 4B3GA 3QEOA 4MDFA 4ZKDA 5TVKA 4L16A 5CB8A 1OIXA 4C30A 4A8JA 3Q7PA 3O8RA 3B60A 1TQDA 3ECCA 3QJYA 2QE7D 1E9FA 2F9LA 2VEDA 5FL7D 1OPXA 1XEXB 2VSFA 1TEXA 2P67A 2GXSA 4C0HA 1CP2A 4TQAA 2VRWA 4QBFA 1XZPA 3NC1C 1KHTA 2QZ4A 3PENA 1P9RA 4URUR 2OFOA 1Z3IX 3B2EA 4RVCA 5TMPA 2BKUA 2Q3FA 3BIFA 2BOVA 3BH7A 4M0LA 3FHCB 3H84A 3AF4A 3BAFA 1H8EA 2F1IA 3IHLA 2R6CA 2ZE8A 3ASYA 4IOLA 4OQNA 3FFAA 1OKKD 1E32A 2QL6A 3OEED 5TB5A 1S1MA 3CB4A 1F6BA 3CF6R 1OIWA 3H1TA 4CRWB 4ZI2A 3PUXA 5HE8A 1T0JB 4FI3C 3AUXA 2KSQA 4AWXA 2JLYA 4TYWA 1ZRHA 4JL6A 4Q1CA 4HUQA 2BWJA 3DO6A 5EP2A 4CW7A 3MAAC 2F43A 2YC4C 4KFTA 1AKYA 2XZPA 3MUFA 3ZVMA 5BN4A 1G19A 3CNNA 2GBLC 4C0QC 2BBOA 4YMTA 3ZZTA 1XX6A 2CJWB 4R9UC 4B3CA 5L3QB 1VMAA 2BCJQ 1KI7A 4AG5A 1E2LA 2EVWX 3D7MA 3HPRA 4KVAA 2IBMA 4CF7A 1F2TA 5JRZA 4J0QA 3TW4A 4OQMA 3MWJA 1GNPA 4URYR 3TRFA 1KJZA 3CX7A 1U0JA 3GLGE 2GAOA 4QL3A 3WP0A 1LB1B 3SEAA 4D25A 3NEJA 1Z2AA 2O8BB 3L0PA 1YU9A 1KO8A 4A8JC
chains in the Genus database with same CATH superfamily
1SKQA 4L0MA 3JYNA 2B30A 1PSDA 1P4AA 2P1RA 4A73A 4DF3A 3MT0A 4YWJA 3K1AA 4Q19A 1QH8B 4V0KA 1GDDA 4TTPA 3FW1A 3PFWO 3QX7A 4HTFB 3O95A 4ML3A 2X0EA 2Z2YA 4QXPA 4B43A 1ZO8A 3L7DA 5CM8B 2CXTA 5DSZA 7ADHA 2O07A 5IW8A 1NJGA 1W9HA 1WW3A 4B8WA 4X93A 4XR9A 1Z5OA 4Y6LA 4FYVA 3UTDA 2OHFA 4ZZ1A 1UXIA 4DUYB 3CRQA 1W2WB 3VSEA 5F78A 1HKHA 2M2IA 4H7JA 3RBVA 3N0WA 2IOYA 3D8NA 4DR2B 2OCLA 3KXDA 3MWDB 1XU4A 4Q93A 4RC9A 3ZV6A 1BXGA 2NYUA 3I53A 4OQFA 2D3TA 4OP3A 4UHKA 2P6OA 5FPHA 4CUZA 2D7DA 2Z6QA 2ZWAA 3NUGA 3L0CA 3ZTWA 5BMVF 3R6LA 2X2FA 4AF6A 4XEUA 1YBMA 3PQ2A 2ZIFA 2YXBA 2O7NA 3IUBA 3QPCA 2NU7B 1K86A 2AGVA 3EUEA 3I83A 4LYGA 4RD1A 1R16A 2HTEA 2D0IA 3D64A 1KJQA 3QVVA 4GR5A 4NH4A 3DFUA 3SR4A 4CKBB 1PV4A 2DFDA 4Q9DA 4EAAA 2WLTA 4M1EA 2B8JA 1K4MA 4W1SA 5KNBD 2COKA 2MYNA 2MINA 3CO5A 2KB0A 1VL0A 1L9XA 2LCQA 3M3PA 1WR8A 5BWBA 3TXXA 2MSDB 2XNHA 2ZT7A 1T2DA 2QYTA 3AI7A 3T1HB 5KTKA 1DELA 1ZM2A 5JHHB 2HGSA 3JPWA 1I14A 3RIHA 1F9EA 5FTJA 2YASA 3MSXA 4Q12A 1E1NA 1R15A 4CIVA 3IEPA 2ZUEA 1VG1A 1JPVA 3UPTA 3JALA 3VOTA 3FY4A 3IQXA 4GSLA 4E32A 3ZCXA 4LAFA 5EP4A 5C8XA 3PJDA 5C5IA 4YVFA 3CMMA 1E8NA 3DC2A 4IHJF 4LVCA 2W2OA 3IJEB 3LMKA 4DXAA 3WNZA 4CQJA 3NYQA 1J9ZA 5D00A 5H70A 2WSYB 1Y5RA 3TLXA 5TQVA 1CQIA 2QV7A 2NVUB 1NTRA 3N2LA 4B33A 2JLRA 3DUFB 1JFVA 2G1KA 4JSTA 3GCXA 1KJIA 1A72A 2AN4A 2OP1A 4HLUA 4IG4A 4JVSB 4Y2HA 3BDIA 3M70A 3Q6NA 4BKQA 2MYPA 2ZTUA 1W7AA 3R0ZA 2XNKA 3V1MA 1P2TA 1U2DA 3W9UA 2QRGA 4EX6A 3H65A 3ITNA 4RVGA 1EWYA 3ITEA 4ZOCA 1VIVA 1JJAA 1G5FA 3Q2IA 3EXIB 3FGNA 5JJLA 1FW8A 1K6XA 1PL8A 5I7UA 4UFOA 1E2GA 5A5VA 4DT1A 1N32B 1OCEA 4MW7A 2ONJA 2RBEA 5AHOA 1JAIA 3T9FA 3ZV7A 1C9MA 1ADBA 1BWSA 1C3VA 1BVYF 3F7TA 4WX2B 5K8UA 1GVHA 4IWNA 2XCIA 3IIKA 4EH1A 2G3YA 2VQDA 3HYCA 1GFSA 4YRIA 1FNDA 3VJKA 1XAJA 1R27A 4C4ZA 5DULA 4O4LA 2HWKA 1NWCA 1PR0A 1ZZGA 3N6VA 4F3YA 3TPZA 5G3ZA 1SXIA 4GDMA 3RLIA 1PFVA 2B4QA 4R54A 3VR6H 3QLVA 4AO7A 3VC7A 2PUDA 3UK1A 2QJOA 2J33A 2GBPA 4H3VA 5FI3A 3K20A 4DSTA 4NYMR 3D8BA 3R7AA 1N8KA 3IEUA 5G0VA 8MHTA 3DBHA 3GNLA 2HA6A 1ZRMA 2QQ0A 3F6EX 4NEHB 4Q7QA 5A2GA 4BB9A 1GZ7A 3HKDA 5ES3A 4CMBA 1HFJA 1QCCA 4YP7A 3PKZA 1ZD4A 2R47A 4JKOA 2G0NA 3T34A 1I10A 5KMGB 1VGVA 2PZEA 3C5WP 4JVLA 4OAQA 3PEYA 1KKLA 3X1MA 4CG3A 2M32A 3P45A 4ZZIA 4HNRA 1NPTO 1O8BA 4N49A 4E88A 3EDOA 5DK4A 1IY2A 3AVXA 2XTZA 1U2PA 3VNAA 4MYSA 2OORC 4H35A 3N9IA 1E2PA 1UPFA 3GCZA 3H3XA 4WA7A 3WGGA 4BFSA 4GC9A 3TG8A 2Q27A 2G0TA 2CLDX 4DM4A 3DJYA 3IEKA 1JA0A 1IQPA 5BP7A 1XPOA 3LFUA 1MKYA 2Z9BA 4F5ZA 2YJ5A 1UJBA 4C6RA 3F46A 3K6JA 5CFPA 3BBPA 2VNSA 5AW6A 1PJCA 2VYND 4J8PA 3OIDA 2FZCA 2CFTA 2OQIA 1Z0JA 1KEVA 3LHIA 4QUEA 4B17A 4D26A 1R10A 1U2DC 4G5FA 4WBSA 1I3MA 3W77A 2FWJA 4BIIA 2NZUG 2EQ5A 2OFPA 5E6RA 2YOFA 1I4EB 4D42A 5IN4A 2Q9CA 4BVGA 3NVDA 2JIBA 1XVIA 2DQZA 2XEXA 2P9JA 2P6UA 3VPSA 1DKPA 4Y9TA 3NV7A 3LSTA 1KZ6A 4Q5IA 4UCQA 2QDXA 1VB3A 4UOQA 1EGVB 2C3YA 2IZ7A 3K5IA 4F72A 2HA2A 1M1YA 2OCDA 2R6HA 3EVNA 3EWSA 4Z7QB 3FKQA 4C78A 2R25B 2BFBB 3DV0A 3I9LA 1U2EA 3KT8A 3V48A 5JCXA 2PPLA 5C51B 5CVCA 1K7EB 1WUTA 1PW5A 3QEAZ 1IFXA 1M6VA 1XF9A 3OKAA 5I4KA 1EFPA 1JEQB 2X3YA 2FFAA 2YRXA 1SHLA 3H83A 4AZ3B 1G21E 3IO5A 2ZJAA 5WRFA 5EJEA 4D9NA 4PYJA 4JI3B 1L4MA 3IBFA 3PWKA 5EGNA 4DG8A 3IVGA 4UUOA 1N5OX 3W5JA 1W8DA 1U99A 3K16A 2EFJA 4UAJA 3ROZA 4GDFA 3PUWA 1VJRA 4E5MA 2FEAA 4LF7B 4LCJA 4XDYA 2Z43A 2BFFB 2WM8A 1FUEA 1FYVA 1GL9B 1X38A 4MLZA 4LGYA 1D2AA 3BCUA 3NH9A 2W8BB 2BFDB 1X8XA 2PXHA 3BYZA 2W6ZA 3FFXA 2PRYA 4YJ2F 4BCBA 3QVGB 4N5DA 3RS8A 1O97C 4NAHA 2OBNA 5LDDC 4KN9S 3H5WA 2JIDA 4QNRA 1U2ZA 3N2IA 4RTQA 1ZMXA 2QL5A 1D1TA 2ID4A 2YN4A 1DTWA 1XTPA 3P2IA 4NATA 4PSUA 5JLAA 4ZHQF 1M2FA 5SZHB 4G0UA 3K4PA 3R7LA 1YCHA 1T5OA 3DBRA 3VPAA 2J3IA 2ABWA 3C3CA 3F8SA 4OQDA 4PVCA 2FW7A 4QX6A 4TMFA 3FPKA 2XUHA 3H2SA 1G16A 1PI3A 4JZYA 1YTUA 3AHDA 5ALXA 3X43A 1OB2A 3AY3A 3NBQA 2C03A 3V2UA 1LZKA 3M34A 5DT2A 5FWDA 3VSAA 1ISMA 1SA0B 2MOKA 3I42A 1GFZA 5FOUA 1WKVA 2GZRA 4LWQA 5AW5A 2VP0A 5M7EA 1ATIA 3BD8A 3RFVA 1T13A 1NW6A 4IPTA 3WSWA 1JDUA 3P5SA 4P7KA 1E4OA 2QVBA 1XZBA 3FPGA 1A76A 2I3GA 4HFJA 5EZ5A 4I6JA 1S2OA 1V5FA 4R3UC 3AILA 4KR9A 5JMOA 5J2UB 5A62A 4EYKA 3RASA 3FUTA 1HX7A 3Q7EA 4UDOA 4OA8A 2CUZA 2JJ8A 3CVYA 3Q2KA 3VI3B 4A16A 2HD4A 2W58A 3R7WB 3FYUA 2GBCA 1AURA 5F1PA 4KO8A 1Z6TA 2C7QA 2PSDA 4O0MA 1FFYA 2VP5A 3QTBA 2AI2A 4B79A 1HRKA 1ZH8A 1L5MA 1VPTA 3PD0A 2IXFA 5JJKA 5CYOA 1GTRA 3IPRA 4G01B 2ZYWX 4FKZA 4TROA 3DDOA 3EZLA 2O06A 4WVFA 2XRZA 3HKCB 1KEZA 3ASZA 3UWOA 4EG7A 2OB1A 2HIGA 1FYDA 2CLHB 4L6AA 5A4JA 2P35A 1G291 4FBMA 1OLSA 5AI6A 1NM5A 1U6JA 1KWGA 3HFRA 4OOFA 3DZJA 3DEIA 3LT5A 3ESDA 1WPRA 1PT9A 4DUZB 1NVKA 3AOEA 1A9YA 1SUAA 4MH0R 2OHVA 1WPQA 2H16A 5EJFA 1XEAA 3UHJA 4ZEVA 3PI7A 3I6QA 3GLIB 2QTBA 3A4YA 3AM3A 1CR1A 1J9GA 1I6MA 3O0TA 2P3SA 5AI4A 3SZOA 1N92A 1WZNA 1JSCA 4BNDB 4LY3A 2XMSA 2OZVA 2QMUA 1D1PA 4X1IA 3RU7A 5ICMA 3ERCA 3EISA 1G63A 2C5GA 1KAGA 1KSHA 1TYEB 3ILSA 5K6AC 1KYVA 2C4UA 2DECA 3OQVA 4V0QA 1G8MA 3VSCA 5HRUA 1JEYB 4QUAA 4RJJA 1LKZA 5DTRA 3KKZA 1VOTA 4A82A 1XKQA 2PNJA 1T2UA 2GKSA 2ID8A 1DC7A 2Q8QA 5DM4A 5J2TF 1IHYA 1OLUA 4JUBA 4NP6A 5DBOA 3WADA 3OM1A 1GYQA 1XVUA 2VTBB 1HYGA 4ABTA 1Z3CA 2XB9A 4EI7A 4JT4A 3HBAA 1CZRA 1BX0A 1CF2O 4S1NA 1SUEA 1N4DA 2QQ5A 2FEKA 2Z4TA 4L3VA 3VJMA 4HMQA 1SC1A 2I87A 4KAXA 1NX6A 4WZBE 5GZ3A 1V1JA 4Y9RA 3L02A 3THWA 3NHPA 4O2RA 3VR4H 3OQ1A 3IDSA 3AP1A 1DKUA 2XMBA 2WJHA 3HR4A 1Y8AA 3TTXA 4XCVA 4GX5A 5LYYA 3LUBA 5ARDA 3HE3A 1KEEB 2PUVA 3IPCA 4BFXA 3LP5A 4TT3A 1L5HB 1RWWA 2ZRNA 3PX7A 1QZXA 1KF0A 2VDOB 4B44A 5IT5A 4W7HA 3PGA1 4ITUA 3LOQA 3B1YA 1ZK1A 4LDPA 1V3QE 5LKRA 4YQEA 2H1IA 2BUCA 1TB4A 4E1AA 3NVKI 5DBHX 5IJZA 2ES4A 2RIRA 4Y30A 1USGA 2G6BA 1M6NA 4OAOA 3CXRA 4LVOA 2C4VA 2J67A 1U7DA 1IBKB 2BGWA 1X1SA 5EUBA 4JI2B 1HDYA 1B3BA 5HKKA 3AOEC 2XOKA 4MHTA 4Q7JB 5DEIA 6ADHA 3QQPA 3TW0A 1YZTA 2UZ1B 2A0XA 2IH4A 2HEGA 2EXXA 1CY8A 4IZIA 4M7RA 2UVPB 2IIQA 4NU8X 4R81A 1M7GA 1VCNA 4A0FA 3KWFA 4H1HA 1NXSA 2O4UX 5H7XA 3TOVA 3WTBA 4KH1A 1EP3B 4ASUA 4ZTZB 4X71A 5KQSA 4GECA 2QVGA 2QTHA 3C8HA 3OE1A 5HIKA 3WLQA 2VNHA 5CHEA 1A8PA 1B4DA 1X77A 1R6AA 2IPOA 3QPDA 3VR2A 4AQ7A 1SK8A 1JKXA 3UJHA 3H2BA 4U39A 3KAPA 1JKIA 2EARA 5EQJB 1YRWA 1KVSA 4Q4AB 3C41J 2VDLB 3JVEA 4F5DA 2PZJA 4CEIA 2AKYA 5ANRB 5E0KB 4GX2A 1NBWB 1F2DA 3UF0A 1OV4A 3ANTA 4DA9A 2K4MA 1YRHA 5FL7A 3ZQKA 1FP1D 3LYLA 1NE7A 1Y42X 3ZH9B 2VZ8A 5CLLA 1N1EA 1QX3A 3SF8B 3PT5A 1G20E 3QPAA 1HO3A 5A5FA 4Z0HO 3LYUA 1W0JA 2G1PA 3AWIA 5BV7A 5FX2A 1RRPA 2HUPA 2RHLA 1KDZA 4FGKA 2OHOA 4KO3S 1VG0B 4HDKB 3SMQA 1U5CA 1TTTA 1AG9A 1HYEA 3OIVA 4ZCRA 1LRLA 5LQDA 4ZRDA 3A1EA 3DLCA 1K8XB 3A2MA 4HOYA 4JSYA 3IP6A 1LU9A 4OD0A 4ZQIA 3WDSA 1OKKA 4NZNA 1GA6A 2A57A 1C30B 5HMMA 2BFEA 2I62A 4GPTA 5A4DA 4YJKA 4R9VA 1C1DB 5JDCA 2VATA 1IUKA 2XF2A 4QODA 2XT6A 3P9QA 4IS2A 2O8FA 2ASVA 3TKLA 1E2HA 4BBZA 1IQRA 4TXNA 3VVLA 3HP1A 4A6PA 1OH7A 3L7YA 2G7MC 1L0BA 1E9SA 1SMKA 1Y7IA 2GEFA 2EZ8A 3A6GA 4WY8A 1NQWA 4UTOA 2RCYA 5E9QA 3TPFA 3V1UA 1Z0ZA 5CG2A 4H77A 1C14A 4L8WB 3ESXA 4EYOA 1ZOPA 4O8ZA 3HV2A 1X8LA 4ZGWA 5BUZA 1EXWA 5FBWB 2VUIB 2R6FA 1SXJD 1VLMA 1WV1A 3BFJA 3BWYA 4MWCA 4ZYXA 2WWGA 3GN2A 3RRYA 3SHQA 2XUIA 2C00A 2NUBA 4F93B 4DG5A 4UREA 2QAJA 3B6JA 3KKMA 1HZZC 4Q47A 4ALJA 1G8GA 3FR8A 1E3WA 1T1RA 2C9OA 1TQ2A 3FYCA 1Q1ZA 2D06A 4GP9A 5AOVA 2IUEA 2ZK7A 4DQUA 3GJXC 5KU7A 4IZHA 1REQA 4DLPA 1H5QA 1EZ4A 2XIJA 4G41A 1G55A 4H3HB 1Y1PA 2B8EA 4P9NA 3U3DA 3V9PA 1KEKA 1M6WA 2PUFA 3K1YA 3KHSA 4YMIA 1K4KA 3FVRA 4LC0A 2QLNA 4H2DA 1T8SA 1GD1O 1O5OA 1R0RE 2X6QA 4YDHB 2WINI 3HKBB 4QQ8A 5EPOA 1ZUD1 2EF1A 3EODA 5KYWA 3K71B 3RAEC 2V3VA 1EUDB 1XXHE 2YWHA 3DT6A 2QMOA 3REFA 2GKGA 3FWZA 4HADA 1SRQA 4BAUA 2E21A 2E7ZA 3EG5A 1FSSA 1ONPA 5J4VA 2Q5OA 5JHGB 4U2BA 2W2MA 5AJZA 4CKXA 3NP7A 4NV3A 1MO4A 3JQAB 4KFRA 4CDGA 3DAPA 1LD3A 1I0LA 3M6UA 5CDTA 3GHHA 5JSUA 2EX0A 4GPIB 3C5CA 5DASA 4M0EA 2W4MA 5EFZA 4I1RA 4FT2A 1UXOA 3M6VA 1NBIA 5FLYA 1XCPA 4HCJA 2M6RA 3MTQA 3KQUA 4OKIA 3I4LA 3RU3A 4OUKX 1KJJA 3K70B 2O8EB 3PT9A 5IM5A 4MR7A 5JWOA 3T1OA 1GKKA 1YR7A 3WC4A 3L6BA 2IXBA 5K6RA 4WTOA 1XVLA 2ZRDA 3FX2A 3GFGA 4BVAA 1YB1A 2ZB4A 1VTKA 2VP3A 3E7WA 4LZNA 4N8EA 4YJ3F 1T1IA 5EJMA 3CTMA 4HZIA 3A1TA 2PLAA 3EH1A 4Y1RB 3RK4A 2B6NA 2AZDA 5FEMA 5JFTA 3VTAA 5IYZA 4P4SA 1RYFA 3WRXC 2UVQA 4M8IA 4F5EA 5BNTA 2C2OA 4XIIA 3FOZA 3G9UA 4HGRA 3VC2A 2QSJA 2YIMA 2Z6VA 1EX1A 1X1CA 4UVIA 1Y3CE 3FPHA 3L6EA 9LDTA 2GK4A 2JJ2D 3KZCA 3BFXA 3D6UA 3H18A 4EGQA 2ORIA 3K2BA 5KWJA 1W2HA 1XWWA 4TSFD 2NPIA 3MGGA 3PXEA 5LYJA 2GPBA 2XMQA 3HWRA 1P1BA 3Q9LA 3W90A 1GCOA 3RFCA 4XX0A 2QSUA 1ZC4A 4BWYA 1NW5A 3DVLA 1C9KA 3KUCA 3W7VA 4CT0A 1LS1A 3FMOB 5FI5A 2GUWA 2HDNB 4KPUA 1W5AA 1QONA 2YRFA 4MVJE 2V97A 4N3NA 2PMBA 5EUCA 3SIXA 4HXGA 1U0HC 1SNYA 1UQTA 3CLTD 3GVCA 2VZ0A 1P29A 3O8OB 3OZCA 2L19A 4G8BA 4RVSA 4XSGA 1GZDA 3R9IA 3UG7A 3QF7A 3TMKA 3VNVA 4M49A 5JNVA 1JHAA 3GAAA 1N6HA 2DVMA 4NDZA 4REQA 5B37A 2REBA 4LDNA 4PM4A 6AT1A 2JCGA 4M0PA 1A2BA 3OPYB 1Z25A 4RFVA 1Y8CA 1RHUA 2CEKA 2R1VB 3R0VA 5C1IA 3T7RA 2BYTA 3SP1A 4DDUA 2DMRA 2NUTB 4DGQA 1V2HE 1VBKA 1V2GA 3B3QA 2WQ7A 3PYXA 2DBZA 4I4IA 5I7AA 1P4GA 3EEBA 3IOYA 5T4HA 1GQYA 1JHXA 2B0JA 4J1TC 2P27A 4GQBA 5K4GA 2CVHA 4X6LA 1EWVA 1XB2A 2JFGA 3D6TB 1XUOA 1YOBA 1XZCA 1JWAB 1ORTA 1TU0A 4XWOA 2YZ2A 3JQGB 1JDNA 4QAQA 4YRTA 1Z2EA 1JHZA 1XCOA 3F3YA 3JQCA 1JZTA 3QBJA 3WIOA 5FBVB 3W0LB 1PKXA 1Y5NA 4YPOA 4CT4B 2PQ0A 1N9GB 1MDFA 1D8TA 3LRPA 3R3HA 1K92A 2R60A 4XD7A 4JBYA 1C1XB 3JZIA 3S27A 1ZVKA 1RHKA 3GARA 3ADKA 3OFVA 3CUWA 2YY7A 4JJKA 2IV7A 1JHRA 2V58A 2LUOA 3V1LA 3AJ9A 3IAM6 3ICOA 4NZPA 1TJ5A 3ND7A 3DPSA 4MV6A 3ROTA 1WXXA 4CIYA 1CS0B 1JTVA 4IH9A 5DWDA 2WNSA 3H8JA 2P30A 4XJTA 5TIIA 4EUSA 2PQMA 1AQJA 1W9MA 1YR3A 3L8HA 2IS2A 1N2HA 5A7HA 3U5TA 3EPLA 4GRAA 1ULUA 4EENA 1OWOA 1Q11A 1WPGA 2AWOA 4OHKA 5C7IO 2OZEA 5LA6A 2Z58A 3I8SA 4ZVOA 3DZBA 4M98A 8LDHA 3HDQA 1G21B 1TQHA 4KR0A 4ZQGA 1K3TA 2HQOA 4PFSA 5JW6A 3IAAA 3TB6A 3PQ4A 4H7KA 4R7GA 3UT5B 4CV1A 4EABA 5AOBA 2GF0A 3A1SA 3M49A 1UT5A 1E7RA 1X9GA 2XKJE 2ZPTX 2M98A 1SK9A 3S99A 4KN6A 2R65A 1E2KA 1ISGA 1RKQA 2EX1A 2HTFA 2H6EA 2CDRA 3N76A 6ABPA 4QU0A 2P2LA 3CPEA 3MCWA 3PPXA 4EHLA 4RY0A 3WYEA 4YCLA 1T24A 1TC2A 4IIHA 1N8SA 5CB0A 7ABPA 1F0KA 1YB5A 2OOKA 4GMGA 3EG9A 4QOFA 4TQUS 5AHRA 3OLVA 4F6RA 4BFVA 1WUYA 2UUCB 1G41A 1VIDA 3VJRA 1FXWF 1JR6A 2ZDQA 4UDYX 4JR0A 4L5JA 1E4YA 4FEYA 3DOUA 1XZ8A 2G6TA 1KZ9A 2V7BA 4D5GA 3FTFA 2WOOA 4GZ5A 1RR6A 1XU9A 3QYFA 1JWLA 4FFWA 4QU8A 2PA3A 3KEQA 3OT1A 4WBXC 2A3RA 2ZT5A 1LF0A 4WK2B 4XSHA 5ERXA 4LHYA 1E9VA 4B6OA 3G1UA 4OXKA 5FUVA 1Y8RA 4AFNA 5ITZB 1V7ZA 2AOVA 1MJGA 3X44A 3CJTA 2PGLA 3B7WA 3O2SB 4WSOA 1R7RA 3IO3A 2JA1A 2XTMA 1SKMA 3H99A 3R41A 4JX9A 1A2QA 5CT8A 1JHQA 4GFDA 2PKCA 1FDSA 1H3NA 1T5HX 2IOFA 3EXHC 1VXOA 3GCGA 4UQOA 4BQSA 4D8WA 3ZJUA 2OILA 1QHHA 4AJ1A 3S8YA 1Y3DE 4BWGA 3TZ6A 2OHIA 2XB6A 1JLKA 2CKDA 3GG9A 2FSFA 1YMVA 1DMSA 4FFNA 3ROPA 1VHJA 2Q5HA 2NU6B 1OYOA 1ZK0A 1OW3B 3I3OA 3VU9A 4B3MB 2YWDA 3WGJA 1C3OA 2H1SA 5LDGA 4EY3A 3S0JA 3Q8MA 1TYAE 1RWPA 3ORHA 4RPCA 3MERA 4B4OA 2IYOA 3HY3A 5IP5A 1PHPA 3IURA 3VOBA 2C7RA 2IDMA 4AWBA 4C87A 3D8SA 4LCBA 2IY8A 4EI9A 5GTDA 1N2CE 2OM2A 4FILA 1R0WA 1JKMA 3C43A 1CY0A 1C50A 1I5OA 1NDQA 3EQZA 2V7TA 4JA0A 3BK2A 1BVHA 4QATA 3PQFA 3TDMA 2H7CA 4TX1A 1VL5A 3AEKB 3NANA 3VU1A 3M1IA 4GXTA 1RWVA 4Q3EA 4AS2A 2VJMA 4LISA 4S3MA 3DVQX 3WICA 1ZZEA 1XQ6A 4U3JB 4YJGB 5FQNA 3T5AA 4NFYA 1XCMA 4QBTA 2ZWPA 4B2IA 1DOAA 3DWFA 2KYRA 2IXDA 3D4OA 2Q50A 3LKDA 3DBLA 4IJQA 5J23A 1XZEA 3N2GB 4ND1A 3PVZA 3QMVA 3NT5A 5JWRA 5ALLA 4HQLA 3ZVLA 2IPAB 1PJAA 1V35A 3U9TA 1XK7A 4KHZA 4RWEA 5TMBA 1V7CA 3FB4A 1DFGA 5DWQA 2P5YA 3DVAA 2XUAA 2ZE5A 3HRKA 2XZLA 1T9ZA 1E3SA 1Z82A 1P2BA 2G77B 3BD7A 2DUUA 2J0VA 3KOXA 4XYBA 3K32A 4WQMA 4WERA 4ESOA 3IDZA 2W98A 4FT4A 3SJ7A 2NMVA 1BE1A 3F78A 4GYJA 4HPXB 5TPZA 1ECLA 3TD2A 1M34A 1RYBA 3HUFA 4MQUA 4RK5A 2PUJA 1NRJB 1D9XA 4P0TA 1PEDA 4X1YA 4Y2JA 5EYPB 5TMDA 3RVKA 1U02A 2B8WA 4WZBB 3RUHA 3KSDO 1U1EA 4H6PA 4H7EA 3DMTA 1DC4A 3KM0A 1XRQA 2QJWA 2XA1A 1EUCA 4Q1DA 2NO4A 3L77A 4JLDA 4WEOA 5AP9A 4BEWA 3EOBI 4B6JA 1YKSA 1SQ6A 2REQA 1VCMA 2G63A 4PG7A 3VPDA 1FLNA 3ZCPA 4D9FA 1U9IC 2NXCA 1QIKA 1S96A 3TYXA 2BGKA 2OZLB 1TMGE 3EDRA 4KXUA 5EJGA 5IXJA 1OFTA 3AR4A 4PR3A 5JAPA 3Q1LA 5K3FB 2PZ8A 4WFIA 1RT9A 1RKVA 1SHTX 3BGOS 4NYJR 1EAYA 3P9YA 2EERA 5JQGF 5EKUA 3ILVA 5GGXA 1VKOA 1YS9A 2VDVE 1KYXA 1FP4B 2FV8A 3CW2A 1R5JA 1U9ZA 5AKLA 4OGLA 2A35A 5DM2A 3UMFA 2JAPA 2PRSA 5H82A 4BQRA 2J0UA 1O89A 5IFLA 2BR5A 1FX0A 1T9HA 2YC2C 1ZIYA 1ZJ6A 3V7YA 1KRWA 1RBMA 4YIHA 3W5AA 3CCCA 1OXUA 3GJTA 3HJHA 1XIVA 3KDAA 3IXMA 2CT8A 3TZKA 2A14A 5MF6A 3SJUA 1QH0A 1ID8A 2BMVA 1UBCA 1J42A 3P4YA 3FWHA 4AUKA 4ZCPA 4Q1BA 1XZKA 3E5NA 4Q6WA 3RKRA 2LDBA 2Q4RA 4D82A 1DJPA 2PR2A 3G3EA 4NK4A 4I7EA 4HYYA 4OQXA 3UHAA 2CCKA 4RSMA 3WWYA 1XCJA 2FQ1A 2R8RA 4G0PA 1N6IA 3HEBA 1H69A 3K05A 2QZSA 3NHKA 4I81A 1Z74A 4AO6A 4GR4A 2A9QA 2Q28A 2JLUA 3D6VA 5AJUA 3E9RA 1VPEA 1HF3A 3L1IA 1NXTA 5DLDA 2HU5A 5D51S 2G9NA 3O4GA 4BVKA 2XB2A 5J4HA 4US0R 1HL7A 2F8MA 1O58A 2WZBA 4FFLA 2ESRA 4I9NA 4PVDA 3WX0A 3BA6A 1NBAA 3UKOA 2K2QB 4X3CA 2H2FA 2D6FA 3AP2A 3PC8C 4IFTA 1RQNA 1XL1A 3NW9A 2XVXA 3BIJA 3MCUA 4ZPJA 4UBLA 2PZGA 4BBAA 5LUBA 4YNBA 3F5FA 1G20B 3QKIA 3HB5X 2ZLBA 1NI4B 3ZTTA 1FYXA 1PP4A 3FNEA 4N12A 1WJGA 4BLUA 1DJMA 4GPZA 1A2KC 2BLNA 1M1NA 3PJGA 4MUJA 3AY0A 5JXGA 1FRQA 1WBBA 2YJGA 2CE7A 4Q4HB 5HOEA 3JZMA 4H1VA 2LIPA 3EDYA 4W1QA 4PU0A 4F9EA 2F4NA 3A9RA 5AIBA 2RAPA 3T94A 4JJEA 4PLVA 5CNIA 1VA5A 3GUHA 3RQIA 3QBDA 2IIPA 2XGSA 2AJDA 1ZR4A 2AN9A 1Y9ZA 4PFJA 1VYUA 2EG5A 1TYCA 2EIHA 2AE2A 4JQYA 2WDPA 2FZGA 1JFFB 1G60A 4FEAA 4NY1A 1HE2A 1ADFA 2P41A 1F0NA 2ADOA 1L4FA 2QI9F 2CXHA 5TPWB 1XZGA 4DB2A 1E9BA 1RXVA 1CUHA 1XE3A 1TT5A 1EVYA 1PGJA 2I3BA 5TJ9A 2RD2A 3KJNA 1NVFA 4LBZA 1E89A 1J90A 4B6RA 1H93A 1Z4QA 1IE3A 4XCXA 4EA7A 4Q24A 5JD5A 1TO1E 3KBBA 4I46A 2YQ5A 4J0KA 4GMHA 3DZHA 4OK6A 4RX1A 1LS6A 5SY6A 2YKGA 2QZ9A 5K45A 4AJ4A 1I3CA 4ESEA 2G5CA 2XWBF 1BS1A 2PTHA 1I36A 1Y37A 4WDQA 1KZYC 1VFPA 3X2EA 4D1YA 5HQ3A 3T6KA 2CHEA 1MOQA 2HXSA 4J9UE 4UXJA 3T1QA 3UAVA 4C0XA 1KL7A 4AICA 4E5UA 4OXXA 3NMUF 3B12A 4YCJA 3MD9A 3AKEA 2XJ4A 2Y1OA 1UT6A 4ILEA 1SBZA 2UYGA 3RGWS 3VYWA 3PHGA 3CRZA 5IBQA 1SKUA 4HH0A 2DFLA 3TLZA 1ORIA 1K3FA 4NU5A 2CHQA 1EE9A 1ONSA 3SS9X 3TLJA 4EYEA 1JDTA 1XXHB 1IB0A 4EFMA 1XVAA 4QTZA 4UTRA 1Q1BA 3TLGB 1ENZA 5KNCD 4FD3A 4RDIA 4GZMA 3KSMA 1DQNA 3C97A 3FZYA 4MI1A 5HS4A 2WSMA 4TZKA 2BH2A 1GTVA 3SHTA 5KI6A 1LWNA 2XBMA 2LWIA 4OJKA 4ZEOA 5JSQA 4G8JA 1QYWA 1GM5A 1ZGBA 2AN3A 3ANXA 2HMWA 2NU7A 4MS4B 5EHGA 2QRPA 1U7HA 3U3RA 5DN6D 3A6ZA 3PHIA 4JUCA 1O97D 3DCYA 3FUUA 3W6ZA 2VJCA 3H6KA 1SZCA 4CKBA 4MULA 1YBAA 1Z33A 3HM9A 3QITA 2EJUA 5F21A 5JPIA 1EBFA 1ZJZA 2PX3A 4W8OA 3WB1A 1WB6A 1OFUA 1HDEA 5EWMA 1FU7A 1U7ZA 3VR5A 1QHSA 1TGVA 3K1ZA 2B4TO 5B58T 4WKPA 2CL6X 2IX9A 1KMNA 4OFBA 3WJ7A 2Y67A 4YCMA 4DQLA 4IZ6A 1J9EA 2QAGA 3GJSA 1IN6A 2AR9A 2I4OA 3MAJA 2RGWA 4JJAA 1SIBE 4CCYB 3GT0A 4EG4A 1OI3A 3PITA 2HXYA 1G2PA 5IHXA 4LXXA 1EEHA 4B85A 2WF5A 4PZUA 5JPCA 4ZN6A 4FGUA 2Z3ZA 3RPEA 4BO5A 4CKWB 3B8EA 4KK4A 4B7UA 8GPBA 2NYVA 3N3AC 1BCRB 2PD3A 3AFIA 3EEQA 3UYLA 5EL0A 3O9VA 4WGFA 4LA4A 2SKEA 1R6BX 4UHBA 4OXQA 1V48A 2IZZA 4RTPA 2GZHA 2P77A 3FCOA 1XEWX 3EZ6A 5G40A 4DV3B 3Q5GA 1VSVA 1T9KA 4QJ4A 4JYMA 5A71A 4KQHA 4F3KA 3LO5A 5A4IS 2O6LA 3O74A 4I4TA 1N7HA 2AD1A 2DT5A 2H9YA 2RBGA 2QY6A 1E4VA 1DOHA 3GT3A 3O4RA 4XGQA 1MEEA 3MBOA 2QVCA 3U40A 3C1AA 3GBSA 4TVSA 2YFYA 4F5WA 5BY2A 2EBWA 4ZARA 4G63A 2RHCA 3AY6A 4CM4B 2HA0A 4NTZA 3G2LA 1TADA 4JKIA 4AJLA 2N3ZA 5H9VA 2C1EA 2V7EA 4MUAA 4AUNA 4BNNA 2AMVA 3IV9A 4PY2A 1GITA 1U0RA 3EXIA 3PYMA 1U8EA 1NQUA 4KQFA 3QSYA 3DFFA 5I9BA 1VKJA 1BZYA 3ORYA 5BR8B 4CMCA 3EBLA 4J2TA 3UWSA 1H4TA 1FU4A 3UJDA 3HDJA 3PCTA 4DHEA 4O63O 2H29A 5B2FA 5BV1A 4TTVA 2OA0A 4BZXA 3H2KA 3EC7A 3AEQB 4HC4A 4B3DA 1ZH6A 2F7SA 1T5TA 2Y0PA 4CM3A 2XRYA 1NFQA 2AEEA 2JJ1D 1RRMA 3EVBA 2FFJA 5IF9A 4GP6A 1X1RA 1YE5A 4KDRA 2FZVA 4TMZA 3M7IA 5BRAA 3DV2A 3MBKA 1UDXA 3FYHA 3C87A 4RH0A 5EE9A 3VR3D 3EQ9A 2W2KB 2QW8A 1K88A 1SIOA 2V6GA 1J24A 3ICCA 2AFIE 2VDPB 4QEKA 4U7HA 3GV0A 4F96A 2FKAA 5AJTA 5DNYB 5GJCA 2ZCVA 5IJ9B 1USUA 4ZV7A 2AUMA 1NUAA 2OXCA 3DW3X 1GSIA 4NESA 5EPEA 5JFGA 3P71T 1BS9A 1OX6A 1ZI9A 2IQIA 3RIYA 3WZMA 4DABA 5LOVF 1I7LA 2NNWB 3NTLA 2JD2A 2W2NA 4MR9A 5KYVA 3IAFA 4NEGA 4E14A 2QUAA 3MTJA 3NHAA 5LBIA 5KMGA 1RZRA 1BDBA 4TTSA 4Z3DA 1PEAA 1QVZA 4WINA 1GZ4A 2BEUB 5LZ9A 2E18A 4KYUA 1GU0A 4ZODA 2PUEA 3OWXA 4B4WA 4XGNA 2D8AA 2XDYA 2XWQA 1ZISA 5IKPA 3GJYA 5AK5A 5AJWA 2VNKA 1T9BA 4RPGA 3LP8A 3W7BA 1X2BA 1UFOA 3H0CA 2FMUA 3Q7SA 3R0JA 4M1SA 5HBGA 1DB3A 2QTLA 1A4XA 2B6HA 3FOBA 1N7IA 3OCJA 4CL8A 4EHKA 4TLCA 4RJ2A 2GN4A 3ZZ0A 4ZMSA 5I4BA 3QUTA 4BNLA 2GLTA 1DQPA 4ZTBA 1CUZA 1Q50A 1C0IA 1SKBA 5FOSA 1M8KA 4B48A 4BUCA 1JAYA 1GNLA 2PS9A 1GGHA 1JUDA 2Q8NA 2X2PA 2PEZA 4LUCA 4J0HA 3FWKA 3IR7A 1NL3A 3R5TA 5IKOA 1HDIA 1GYPA 3A32A 1CIJA 1UODA 2CB0A 3IC5A 1FFCA 4PO9A 5KDLA 3H2HA 2G09A 1IM2A 4HDOB 1R9NA 1U0NA 3OZSA 4ZYZA 1B8UA 1Z8NA 2QOEA 4IP0A 1A4RA 4QRHA 2A6PA 2OT3B 4IKPA 2JAOA 2WTAA 3IILA 3Q0IA 13PKA 3G1WA 1KR5A 2BZGA 1A9PA 3ESCA 2CUKA 2PYIA 4UMVA 4BVEA 1WMEA 2W42A 1T9GR 2H4ZA 1L3BA 2YICA 3FSJX 1JEDA 5JYCA 3JAKB 2HEIA 4AZTA 3GJ8A 3ZLTA 5K0TA 1FUUA 3KKKA 2MU1A 2JVKA 5LPNA 1E1YA 5JMTA 2I2XB 5K99A 3KQNA 4C4SA 4ZP1A 3K8ZA 3IOBA 2RH9B 2YR0A 1DT5A 3KXIA 2J3HA 4KL8S 1Z28A 4M1TA 4QSHA 1VPWA 5CDYA 9ABPA 6PFKA 1GNTA 2BFFA 1U4SA 4PZZA 5SV2A 3THSA 3IPAA 1ABBA 1E5DA 5I8ZA 5A3JA 3ZHYA 3JZDA 3T7CA 1N3LA 1NUPA 4YBRA 4AP5A 4A2WA 1I32A 2BSXA 2NUPB 4BZWA 3KD3A 3HA3A 3GEGA 5F4ZA 3NWJA 4OATA 1N6RA 1DV2A 2I80A 2YMQA 3QSGA 1CZKA 3RQSA 3R20A 3PGVA 3WK5A 4HEA1 4QKQA 1VIAA 3W8NA 4E0BA 1U2QA 3F4BA 4UPDA 5EMKA 5BMVB 5JYBA 1A7UA 3ONWA 1EMDA 4F8JA 3TVDA 4N0EA 4E5YA 4JEMA 5A4FS 1NUUA 3CYFA 1GKLA 2O7VA 4D8TA 2XCUA 1BA2A 5FJJA 2ONZA 1PU2A 5DNCA 4BV3A 1FLAA 3EZ9A 3LHKA 1N2CB