2XZTA

Caspase-3 in complex with darpin-3.4_i78s
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
140
Chain Sequence
b'DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQARGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3
publication title Caspase-3 in Complex with Darpin-3.4_I78S
rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 49
structure length 140
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xztA00
1RHJA 2QLFA 3ITNA 4IEFB 3H13A 5H0IA 5IAKA 3S70A 1F9EA 1ICEA 2QL5A 4QU0A 2FP3A 4PS0A 2XYPA 3P4UA 3R6LA 4HVAA 5IANA 3GJTA 4FDLA 4HQ0A 3NR2A 4ZVPA 1RWOA 2DKOA 1PAUA 1SHLA 1I3OA 2H5IA 2NN3C 2XZTA 3KJFA 4DCPA 3V4LA 1SC1A 4EHFA 1K88A 3KJNA 2J32A 1M72A 3K7EA 1CP3A 2QLBA 2QL9A 2C2ZA 2H48A 4QTYA 1RHMA 1SC3A 3D6HA 5IC6A 3DEIA 3EDRA 4JJ7A 4D3YA 4EHAA 4JQYA 3IBFA 4QUBA 1BMQA 2HBQA 4QUDA 4QUJA 1RWWA 3GJRA 4ZVRA 3QNWA 4N7MA 4AWAA 2C2MA 2J33A 5IBCA 4ZVOA 4DCOA 3D6MA 2H4WA 1SHJA 1KMCA 3PCXA 3V4OA 1RWKA 4EHDA 5IABA 4NBKA 4N6GA 3IBCA 4PS1A 3R7NA 3SIPA 5IASA 4N6OA 4AW9A 1I51A 3BIJA 2AR9A 4JQZA 3V6LA 2CNKA 1NW9B 4M9RA 2CDRA 4IYRA 4JJ8A 2K7ZA 1RE1A 4NBNA 4N6NA 3UOAB 1I4OA 2C1EA 4JJEA 1F1JA 4N7JA 1QTNA 4NOJA 4NOMA 4NBLA 3EDQA 2C2KA 2CJXA 4EHLA 4QUHA 2H5JA 1RHRA 3D6FA 2CNNA 1RWPA 3DEKA 4FEAA 5IBPA 5I9TA 2QL7A 1PYOA 2J30A 3PD0A 4QU9A 5LU8A 4FXOA 3DEJA 4QUAA 4N5DA 4PRZA 4PRYA 1SC4A 2HBRA 5K20A 3NKFA 4NOKA 3R6GA 3GJSA 2CJYA 5IC4A 4QTXA 2FUNB 3H11A 4I1PA 1CVRA 3H1PA 4QULA 4JR2A 4ZVQA 1RWMA 4ZVTA 1NMEA 5IBRA 5IARA 4D3XA 1JXQA 5I9BA 4EHHA 3H0EA 2C2OA 3OD5A 2H51A 2P2CA 3H11B 4I1RA 3V3KA 2Y0BA 2J31A 2XZDA 4QUIA 4NOLA 4HQRA 1IBCA 3UO8B 3NS7A 2CNLA 1QDUA 3GJQA 4QUGA 5LUBA 3V55A 3DEHA 4QU5A 5IAJA 2Y1LA 3KJQA 4AWBA 2XYGA 1K86A 1RWVA 3R7SA 3V6MA 5IAEA 3E4CA 3R7BA 4JR0A 2WDPA 3SIRA 5LUAA 4EHNA 4ZVSA 5IAGA 2HBYA 1RWXA 2CNOA 3P45A 1NMQA 3PD1A 4QUEA 3S8EA 4EJFA 2H54A 5LU9A 1RHUA 4EHKA 1I4EB 4ZVUA 5JFTA 2H65A 3R5KA 1GFWA 4JR1A 1RHKA 4QU8A 4D3ZA 3RJMA 4JB8A 1GQFA 2QLJA 1RWNA 1NMSA 2FQQA 2HBZA 4DCJA 1QX3A 4FGUA 1RHQA 2XYHA 3R5JA 2H4YA 4LSZA
chains in the Genus database with same CATH superfamily
1ZCZA 1IWPB 3GCWA 2CWWA 4C0WA 3I5YA 1PR0A 1Y1QA 4M8KA 5ALNA 4BZXA 4FGWA 1U81A 3N58A 1GL9B 4YC7A 3TK1A 4UMDA 5JCJA 1C41A 4I9UA 4P3KA 3M6FA 4QYXA 4C08A 1PD1A 2BEWA 3X2SA 5H82A 4JITA 4R2XA 4YV0A 1YRYE 5GZ1A 2TMKA 1PAUA 3FMVA 5BN3A 4DCNA 2NVUA 3H2KA 4X94A 3WK7A 3OKFA 5KIAA 1R6XA 4TN5A 1GLVA 1Q12A 1IBKB 2C0PA 4QTYA 1BJKA 2XMZA 3H75A 3EDRA 4KQFA 4CMCA 4QUBA 3FLBA 1ODFA 5KCMA 1ZCFA 3QBEA 4FNOA 2Z30A 3FIUA 4MVJF 2D13A 5L8VA 1P33A 3BCSA 3KLNA 3PGLA 4JYPA 4KE7A 3LT5A 4MYRA 1FS6A 2V6FA 3SFVA 2MSNA 3BHJA 1Q21A 3CUTA 1V2GA 3IKJA 1YFKA 2F7SA 2FSHA 5BOSA 5C5DA 3KQSA 4RH0A 3MB5A 4IFBA 3H7IA 1U8YA 2ZRPA 4N5MA 4ZEOA 4D4HA 2PUTA 4UVEA 1NN0A 4RJJA 4QELA 4QPZA 4DMMA 1YRAA 4MKZA 2IH5A 1T1RA 3BFPA 3KETA 1C4WA 3HA5A 4B4OA 3TM4A 3EXHB 4ZGBA 3A6LA 2J9RA 3PGVA 4R7TA 5AVXA 3MAJA 3ZDXB 4PNPA 2CT8A 3NXSA 4B35A 3NANA 4HNUA 1WBJB 1WDMA 4MW5A 4MIYA 4E5UA 3VV2A 3OQBA 4YR9A 2EQ5A 1KEKA 4WY8A 3DW1X 1EJ2A 4GQBA 1IJBA 2F9LA 4E09A 2YIMA 1W73A 3VU9B 2MWMA 1ESMA 1Q7EA 3K1YA 4UVGA 3MQ4A 1JJIA 5FA8A 1SCBA 1V9CA 5GJCA 1FYXA 4DJDC 3LOQA 3AVWA 5A9TA 4FDMA 5DWQA 1FJGB 1CLUA 1HV8A 3OJEA 3NJ4A 1T5OA 2WTUA 1IBLB 5DYNA 4Y98A 3GR6A 5HF8A 3SLGA 3UCEA 3GZ4A 3CF2A 4V39A 4O4HA 2O8DB 5TQJA 1B93A 4P34A 5TNXA 2YNMC 4C20A 1XHLA 3HP1A 3CXUA 2RHWA 1B76A 1D5WA 3GUHA 4ITRC 1DBIA 4QNMA 4V2UA 4JEUA 2B8EA 3U5ZB 5CAEB 3D3WB 2HIHA 3O0TA 4G9BA 3QVKA 4A36A 3BXEA 3K5IA 3NEYA 4IMJB 4K0KB 5HUQA 2X4LA 3KV3O 3V97A 3UB3A 4CL3A 1Q3TA 2Y2VA 4U6SA 1PFKA 1AB6A 1QLHA 2CNOA 1U2TA 1TF7A 5MN5A 3R0QA 2J0QA 1KKMA 1Z62A 3DZDA 2C8KA 5E8JA 4ZI2A 4D44A 1WW3A 3HEMA 2I1QA 3IPRA 4YMVA 3UTDA 1QWOA 3PIRA 5A5VA 5LJLA 5E3HA 1OAOA 3BRCA 2YMMA 4GPEA 4PZEA 5GWXA 4DTCA 4WLVA 4O1HA 8OHMA 2ZJOA 4A15A 2Z8ZA 2R1UA 1PDOA 3RSSA 3RANA 3V8PA 1DBRA 1HDGO 2FQ1A 2V59A 4MUIA 4RIEA 3ZDQA 5FV4A 4NENA 1LQUA 4G8BA 1C9YA 1E1QA 4G5RA 2OK8A 2H31A 5AHRA 5FBQB 1C81A 2PA3A 3AESA 5JRJA 2VJOA 4NHEA 1UPBA 1XVUA 4D9CA 2YHUA 1RAFA 2Q6OA 4EPYA 4R5HA 5DHFA 4JLOA 2QPTA 2O6LA 2JCXA 4DV5B 3G7NA 2P77A 1G42A 3LQ1A 4OLHA 1L4MA 4JX8A 2O14A 1CR6A 2WUEA 2IF0A 1EB8A 3BVPA 2OM2A 3CMCO 3GRAA 5D00A 3RJTA 3BL8A 3C1AA 2BC9A 1P18A 2QQFA 3BTVA 3M2TA 4HHEA 1JA0A 1F6DA 4HWOA 4R84A 4CDNA 4F1JA 2FN7A 2ZS8A 2B2CA 3FHTA 4AMUA 3KUCA 3SM9A 1E2UA 2NPOA 4XX1A 1K89A 2P1ZA 2XD4A 1B3RA 2JS7A 5NLLA 5F23A 4YR7A 3Q6MA 4OHRA 1AVTA 1SWWA 4LI3X 4RU1A 4C6RA 5JY6A 3MB8A 3Q8WA 4OXQA 1JEQB 4XYGA 1XRQA 4LC1A 2V4UA 4Y9RA 5CT4A 3WIBA 2VHQA 1EFHA 4CCYA 1HEIA 3L0BA 4D4JA 5IABA 4IG4A 3UT5B 4RF5A 5HZHA 1EHYA 4DBZA 1W1WA 4E0BA 1FNCA 3ELBA 4MUBA 2ORYA 1OW3B 5ICGA 3WOVA 3FZNA 5B1YA 3GFQA 1KFKB 2FPMA 1LJ8A 2FWMX 3JTEA 2FW6A 2HHJA 4YQFA 3NM4A 5KQGA 2W2NA 4G4IA 2W9XA 1KTVA 2H3HA 4CKEB 4L4YA 4Q18A 1JAYA 1EYZA 2WJYA 3H1BA 4UAJA 4R3WA 5E6UA 5F78A 4DV6B 3SXJA 1KQGA 4UZEA 3SKYA 5THQA 3K2IA 3R8CA 4WI1A 3VPBA 3EOZA 1IFXA 4C01A 4DIKA 5TEWA 2Q7OE 1ZMBA 4QUAA 4RDHA 3EHEA 1PJTA 4ZMSA 5HSGA 3RYCB 2WDZA 2H5EA 2NU6A 2HDHA 3VU0A 4MS3A 4MWTA 4UARA 1S3GA 4MQ6A 4ZK2A 1Y8QA 2Q3DA 4MVWA 5AP9A 1HDEA 4TYQA 3HB9A 3MWYW 4IQ8A 3HYTA 4MIEA 3KB1A 1FU4A 5B1SA 2OSBA 4TUYB 1W34A 5KYYB 1NU8A 1N75A 1VECA 1V6AA 4DLLA 5AW8A 1FUIA 1WU8A 4IG9A 3VH2A 4DEYA 5F7ZA 4BP9A 1SEPA 2O57A 5JWHA 4YMUA 1TDJA 3ECSA 4F9GA 2WZBA 2WICA 2JAQA 1INLA 2WM8A 5F98A 4Q4AA 4AAYA 2PGOA 2QU8A 1J2RA 2RI0A 5EINA 4GOXA 1JJBA 4L0DA 2IEYA 2L17A 2PVCA 2V03A 4MWDA 3EDCA 4QGFA 4RIIA 5BQPA 4C4PA 2VDKB 2PY6A 5CFNA 3NHKA 3JSAA 3QGMA 4KQXA 4PLZA 5F5XA 1RI2A 3KV1A 5I3CA 1W6UA 2VHCA 5KVSA 1TYEB 2FCRA 4K2HA 3K0BA 5F4BA 4W4TA 2B35A 2HREA 4WNCA 3BB3A 1EFKA 1R74A 1R0BA 1J2JA 4AT1A 3EEOA 1YIAA 4RHUA 3NRBA 1M5TA 2AI2A 4N12A 1F7UA 5KPJA 2EKBA 4KXFB 2HSGA 3IIIA 3SAJA 5CNMA 4ENTA 1FW6A 3C3MA 3GLFB 4JT4A 4QU8A 4R51A 4E1VA 3LSTA 3VTAA 4MYHA 1P45A 4B0PA 5ADWA 3M70A 1PKEA 2CCJA 2ENUA 3L7KA 3ORHA 5EVJA 1NI4B 1XTJA 5FBRB 4IJ5A 4I8XA 3DP7A 1FFEA 1XI2A 1Z74A 1J9GA 4NRDA 2ZM5A 2GBFA 3U3JA 2YBDA 5CB4A 2EFHB 2BM8A 3Q40A 3TE6A 2QQGA 2PNFA 3GP8A 3DTVD 4A2PA 3HUFA 3ROMA 1F5SA 1I0IA 3JZIA 2JGDA 4AQDA 5AJVB 5JSHA 1U98A 3DHWC 4UXHA 1AK1A 3T0FA 3ZDDA 1C30B 1E4OA 1JUDA 2GOYA 5JVDB 4Q01A 5B1IA 2OY0A 4PLFA 1X7WB 2IUTA 2KS6A 1CUWA 4IDQA 4RPGA 5TSDA 1ZFNA 5ILQA 2ZU0C 3AOGA 3STXA 1QH1A 4EQZA 1OFHA 1RLTA 3JVDA 1V4VA 4HL6A 4BFLA 3USCS 4A8JB 1FFXB 2VQEB 4JI8B 2D8MA 4O2LA 3DTNA 4ZT6A 4IGKA 4NJMB 2CLHB 4LX8A 4YMHA 3ZHTA 3TKLA 2HQSA 1ZZGA 4ZVRA 4ARZA 4I7EA 3K15A 3K5PA 2BHRA 4RNCA 1V4NA 3O38A 1D2EA 2IXTA 5C5IA 4RPKA 4GOOD 1ZK4A 3FSGD 4OAQA 3EIEA 2FDXA 4IFTA 2XXBA 4ROSA 2VSYA 3DEAA 3LUCA 1D8TA 1P1CA 3BMCB 3EIHA 4O5AA 2I4IA 4ZWNA 3UK6A 3DTYA 4C43A 1VSTA 3SK0A 5SZJA 1W85B 3I5AA 3SEQA 3L0SA 3L5KA 1CDOA 2CDRA 1B23P 4HDNB 4OH1A 3W1WA 1G2OA 4P7BA 4E15A 1W9MA 1X6VA 3V1NA 2F62A 4Q19A 5DWVA 1JTFA 4ETIA 4JFAA 2C88A 3ZWMA 3EGWA 3ZH2A 4DJEC 2HO4A 1QGED 4W1QA 1WQ1R 1C4XA 1SIBE 3PGKA 4YP1A 5E3JA 3UUWA 1YE5A 3V1LA 5C1DA 3A6FA 2KHZA 4WBNF 1L4YA 3GQVA 1RACA 4YWHA 1U8ZA 4S1WA 5K20A 1KAGA 4UW9A 3W4KA 2Q45A 1I9CA 3EXEA 5AHOA 2CXSA 5ECGC 4ZT3A 2ZRIA 1QG4A 4RAOA 3UGJA 4PO8A 1A98A 5T4FA 5IC4A 2NQTA 1B42A 1LC0A 1U2ZA 3WIVA 2HQRA 4QE3A 5TMPA 3UMGA 4I5IA 2I7DA 2VJKA 5LMCA 4DDKA 4BMCA 3PDIB 1A0OA 2OHXA 4PR3A 5DXJA 1TMGE 3OPQA 4M55A 5LQNA 1RPAA 1JA1A 2B4YA 1KXZA 2ZVJA 3KZMA 4HDQB 1FJ2A 1P44A 1GTMA 2AW5A 5LQSA 4B7CA 1L7MA 3H1FA 3C5EA 4NBTA 3J7AC 4C89A 4RHTA 2MR5A 2BFEA 1Q1NA 1OI7A 5H59A 5KU1A 4Y9UA 5HOQA 5HTOA 3GJ0A 5PGMA 3OWHA 3HKCB 5EQDA 4ZCIA 2VH5R 4Y18A 2QZJA 1TEXA 1CRZA 3A2MA 3AM4A 3ABZA 4YAIA 2NXCA 2J9GA 4LNAA 4OK6A 1X7XA 4BZWA 4PYIA 1N57A 1R37A 3BHIA 1NQOA 1NUUA 4HPWA 4X1YA 1G7RA 1JQLB 2QU7A 2V7QD 3H9UA 4UOZA 1H2ZA 5ALEA 1IE3A 5GV8A 2FNAA 2QEQA 4HN9A 3LP5A 2B1JA 1GADO 1RZRD 3CUEF 2SNIE 1JMYA 3LPMA 4KAFA 1M34A 1PQWA 5HS4A 5JQGB 3FDZA 4ZQEA 3CLUC 2PK3A 2AWOA 3RS2A 1N7JA 1K7SN 4ZOBA 4YVFA 5BYAA 4MR8B 1PFUA 4YDHB 4H0NA 5EL0A 1IOLA 4MP3A 4MR9A 2ADOA 4FHDA 1TUGA 1RQ2A 4YCBA 3BXGA 3CNNA 1N6HA 1YR6A 3E22B 3EJWA 3QVWA 3UY4A 1OIWA 2WU1A 3K1TA 4LI0A 2YVQA 1E7MA 2CL0X 3H9BA 3WRXC 4RS3A 3RRJA 2JEOA 4QAJA 5A3JA 2GPNA 3CRVA 4GPD1 2GYWA 1E9DA 3MT9A 1MRSA 3NXKA 4M0EA 2A0KA 1IATA 1FYVA 2CXRA 2H1IA 5C8VA 3IURA 2C4UA 3NTXA 4ZZ1A 1JIQA 1X8LA 2FEOA 3RI3A 1DDIA 3RJ5A 4WXHA 5DXFA 1JAZA 4KQCA 1YU6A 1QGUB 4PC1A 1TRKA 2R4TA 5F1OA 2IX3A 4RC9A 1G60A 1AHPA 1A5ZA 1W2WB 3OLXA 3QX7A 4OKSA 3AFNA 4TTVA 4GU5A 2UYQA 1IK6A 4MR7B 3CH6A 1JALA 4LTNA 4ZAGA 1U9ZA 1JSLA 3UKJA 3AKDA 2JFWA 4JOQA 2HCRA 1ZRNA 2VDMB 2HPVA 3R7NA 5K0ZA 3BE6A 4HLQB 3PT9A 2XMGA 5M34A 3QYJA 3IQEA 1HDRA 3PFWO 4GBJA 4YB8A 3V1UA 1E7YA 1PQPA 2WVHA 4QO7A 5ALFA 3ZWCA 3GFPA 3PIDA 1ICIA 3TIIA 1C3OB 2O8VA 3HNOA 3SZLA 5DXAA 3WIDA 2GPSA 1IEXA 3IHWA 3LT4A 3M6UA 3OZWA 4MULA 5EZ6B 1F48A 2O50A 3TI7A 1F60A 4UUQA 3RAPR 2CLSA 3KEFA 5HG0A 2VTDA 4AMZA 3HB7A 4IINA 4INJA 4F5ZA 5AVKA 1YR7A 4B7ZA 4O0MA 4BVEA 4D02A 4JC0A 4R5MA 4F0JA 1T6ZA 2HK9A 2WBLC 3LL4A 5KYXA 3AV3A 3NVMB 3IOEA 3T4EA 3GLFE 1SC4A 1MEEA 1WP4A 3PE3A 4AJIA 5FLKA 1UK8A 2Q4BA 3AKZA 1K7FB 4KDEA 3FTEA 3NH9A 4QICA 3E1SA 1TA9A 4WT7A 3RSZA 2Q3LA 2XTAA 3OZFA 1YVEI 3GRYA 4L7VA 4CU5A 1Y9JA 4JVNA 5BW5A 4ARCA 4G0NA 3EG5A 1NUAA 1T3SA 4LPSA 5ICSA 3FTQA 4H1HA 4L3VA 4LQLA 3F6PA 2UYYA 3AXSA 4KXMA 1BGVA 3ZNOA 2Q5FA 4CE6A 4EB6A 4QUGA 3VVMA 2HD4A 3W6NA 5JJLA 1SCIA 3EZ2A 5C3MA 1KZ6A 3NWJA 3KLMX 4Z2AA 2C9CA 4UCFA 9ATCA 4L75A 2OCKA 1YMUA 4UNQA 5CM9C 1W93A 2IHVA 1XZHA 1UQUA 2B1IA 4WZAB 2DWOA 2NVWA 1H8ED 3ESAA 4XE5A 1IHUA 2JGIA 3A04A 5ALQA 3T9BA 1RZRA 4Z4IA 4DMUB 3RGWS 5CM8B 3BWDD 1EUCB 4QPPA 2BMJA 5A5GA 3NNNA 4R16A 2H2WA 5HS6A 4ZVUA 3P0EA 1JSXA 2WJHA 3A6GA 2FP4A 3LP6A 1QXSA 2DULA 1KEEA 1E9VA 1GQFA 1FVHA 2FPLA 3HO6A 4QQRA 1ZCBA 4UOQA 3RUDA 4GOJA 1F2UB 1P60A 1FP2A 2P1DA 4R2JA 3ZHOA 1VJCA 1FFCA 1DAHA 1O1YA 3RK1A 1VPDA 2F1JA 3F90A 2WFMA 4HDRA 3U7QA 3IMCA 5T4EA 1LSSA 1MG0A 1SR8A 4DYHA 1I13A 2WLSA 1GPWB 4CEHB 4CGYA 1Z5NA 1SUPA 1D4FA 2DHQA 3ISVA 4LWOA 4V1CB 4P5PA 6YASA 5BV0A 4XD7A 3PXAA 1G5TA 3A25A 1F14A 3KJFA 1XE3A 2O3QA 5FQNA 4CFZA 1WZ2A 3BERA 3FHLA 4II2A 1G4UR 1B6SA 2YJ4A 2GN9A 5EJFA 4D3DA 2HSZA 2NTJA 3GZNB 1JWAB 2RB5A 3JVEA 3OTQA 3UEOA 3W2GA 1WCIA 3RS8A 1PQUA 2GLUA 1LB1B 1BXGB 4GX1A 5BNFA 3STTA 4IHQA 4ER0A 4ZI3A 2FY8A 4PSAA 4X1KA 4PIPA 5T8KA 2PUDA 5DISB 5FPTA 4J0DA 4WK2B 1ECJA 2EJWA 5EE5B 5IYZB 5GJVC 1SUEA 2BFAA 2GYUA 3FJYA 1XBTA 1E6EA 5CK4A 1VLJA 2GH1A 1NJ5A 1R6UA 1RJDA 5FV7A 4S1NA 2X0DA 4C1BA 4M0DA 1CG6A 3EUAA 1NLZA 4YK7A 2VHVA 4OI0A 3HJGA 2QAGA 3H2GA 1AQJA 4C0QC 3NOXA 3S2EA 2V1UA 2FSVC 2OBYA 3H2IA 5AI5A 4YV1A 5K45A 1ADGA 1C3EA 1I4OA 4J1TC 4LRXA 4LY9A 2CFSA 3FKJA 2H9IA 3V9AA 2FAXA 4LZAA 2UUAB 1VL8A 1PJZA 2ZAMA 4Q6WA 4QOGA 4KW7A 4MAFA 3ZLBA 2J3KA 3N2EA 2FZLA 1OVGA 3CCFA 4HEQA 5TLSA 2FPRA 3OCJA 4D1YA 1NFFA 3ZX5A 4QFCA 4G6ZA 4IIHA 1CV2A 3X43A 1Q1GA 2BTQA 3CF0A 3Q88A 3GOQA 2OV3A 3RR2A 1GNSA 1WAMA 1QIHA 2YVUA 4OM8A 3NVDA 2DWCA 2V3WA 1O6GA 1WTCA 3IIJA 3IJEB 1II0A 2AXEA 1LDEA 1G8MA 1XD8A 2IPAB 5JD5A 4FDVA 2P67A 1VLMA 5T6MA 1IPFA 5F3WB 2QMZA 3JARA 4O2RA 4HNVA 5LMZA 1IXYA 3AR7A 1Q92A 5LP6A 2FWIA 2V6GA 4J1QA 4M9SA 1YCFA 2YWBA 1Z5OA 5A3QA 1Z15A 1GLGA 5FHRA 1WUJS 3ULKA 2OMKA 4D8YA 5TGTA 2XGGA 1MP0A 2RK4A 1DEAA 4NBWA 4LFAB 1YBVA 2VPZA 2CHFA 2NXWA 1CY1A 2XYGA 1N6KA 5HK8A 3GJ7A 2BKXA 2QR3A 3DLTA 1AKQA 2VDRB 3OCYA 4ZQBA 5EPUA 3JQFC 2WDPA 3KS9A 3SVLA 3L7YA 4XLLA 2OBBA 4QX6A 4JLVA 4WLUA 1U28A 5EJEA 5BQ5A 1ZCJA 4IILA 1F2TB 4XQCA 3NGMA 1BDJA 3CEMA 1PCXA 3R7LA 1KI1A 3VO9A 1GNQA 3O0DA 4ZGGA 4WUVA 3RT9A 4AY2A 2IUSA 4DLWA 3L7DA 1LK5A 3DTVB 3H83A 2J5KA 2ACKA 3T4PA 2AQKA 3K9GA 3TZHA 4D8XA 3AHHA 4EEXA 5BNWA 3CKLA 5DNAA 4ALJA 1SGWA 1PZHA 2DH6A 1ISSA 4IZIA 2XE8A 4N49A 2NTVA 1NI3A 2D2VA 5LN1A 1PR4A 2NV2B 3OIYA 4TSKA 4RK0A 2YWDA 3E27A 2IYSA 4Z4QA 2I67A 3EW9A 1SHLA 3A1DA 3CTMA 5KSOA 4D41A 3TM5A 3UJ7A 2XZLA 1FLDA 1T4CA 2HWYA 1KGSA 3BTOA 2ZBVA 1Z8DA 2FWAA 2AJBA 3C5WP 3GUZA 4UD2A 3B1FA 4BU1A 5KREA 2AKEA 5JG7A 1UMCA 1YBAA 5AUPB 2O2EA 4LDAA 2CD7A 2HPAA 4FYVA 1PL6A 2PUWA 5L40A 3FVVA 1Z34A 4QUDA 5L3SB 2XIQA 2VYFA 4OHFA 2ZCJA 1RLJA 2CSUA 3D6UA 3MAAC 4GICA 4BECA 4D57A 1IBMB 1XD2B 3UK0A 4FJ0A 3KKQA 4Q3CA 5JTUA 2I8LA 5AXAA 3U19A 4WWHA 2FCAA 1CIVA 3HWX1 2HK8A 3LQRA 3NKLA 5FEUA 2OPBA 4N0MA 1FP4B 4I4TF 1VKJA 4IP0A 4JZYA 4Z9XA 2I2DA 3HMKA 5LB2A 3AU8A 4AKEA 4OJYA 2W2KB 4CL8A 2QTHA 4X71A 5IASA 2RHMA 1IHDA 1ZK1A 3EQ2A 3ZJTA 5FL7A 3SWWA 2QTAA 1HE5A 2WP8J 3L49A 3FPJA 2GHIA 1Y33E 1RXUA 5FBZA 3CPSA 2NTNA 3RNLA 4XUEA 4WZAE 4OCZA 4JJEA 2PM8A 2EYUA 3LH5A 1YB7A 1JQDA 3GGOA 3QLUC 3PXGA 4QDTA 4NJEA 4J90A 3AUJB 4DZRA 4OXRA 3UK7A 4RDIA 2RGNA 4XIGS 3DBHA 4R2WA 2BHNA 1E63A 4AICA 4P38A 4H7HA 1WY5A 3FCSB 4XI9A 2WJAA 3K3PA 4XX0B 4CI9A 1EQUA 2N47A 2D3TA 1YHZA 4MI6A 4Y2UA 4J7UA 4KGXA 5KMGB 3EIOA 2CUTA 4C9BA 4KZPA 4BLVA 5KCZA 4F3TA 1NMEA 4LGVA 1QGOA 3KSRA 2P65A 4M7PA 1T5TA 1N2EA 4XTRA 1WXXA 1HE2A 2J7PA 4B34A 4DUZB 3V4PB 5FNVB 4D0SA 4QUIA 1MB0A 2BFDA 5JRZA 3LZCA 5JDCC 1K2WA 2ALJA 3BWEA 4WADA 2G09A 4LK2A 4Y1FA 3L4KA 1LNZA 3ICPA 4LQCA 2BR4A 3BIFA 2A6PA 4NFYA 4BYMA 4DMRA 3PEYA 2W22A 3IJRA 1RM4A 5T4HA 5IJ0A 4ND8B 4TTAA 5I9NA 3AU9A 1L5OA 3CNOA 3IE2A 3K0EA 4P54A 4ETMA 1NXVA 1T8TA 3MA0A 2A1TS 4J07A 2PGDA 4I1VA 4IQ4A 2QTFA 2EL7A 1JNYA 1IQRA 2OV8A 2JAXA 2CF5A 4HT3B 2NO1A 1G4AE 1ZC3A 3SE7A 2DTXA 3EYWA 3RARA 3OQJA 3UFXB 2H1WA 3GDOA 1DWPA 4BC0A 4O4IA 2QVZX 3O47A 4RTQA 2WVJA 3T7JA 3F71A 2GN1A 1W96A 1UXJA 3QU5A 3AF3A 3WSVA 3COVA 2RHCA 3FVRA 4K6FA 4GQAA 4QYTA 4RXUA 4G4JA 1HDOA 4G1MB 3RYFA 4KBYA 2Z6VA 4N3BA 3CB2A 5AHXA 2CN1A 2PUHA 1WABA 1TAQA 2KLHA 2RKOA 4LJYA 3B7PA 1ZD1A 4NJOA 2OB1A 4ZI7F 2NYRA 5JV5A 3WK6A 4Z7NB 1H42A 1AGNA 2CFRA 3V7FA 1SXJA 1UBNA 3AVUA 1TF2A 4C87A 3Q6NA 2WFZA 5FADA 1WX1A 4TVSA 2KMLA 4ZDIA 4YCMA 3AR8A 1FNSA 2QLBA 3WX0A 4YBZA 4WCVA 5D1NA 1GRRA 2AN9A 4TROA 3D6HA 3SJAA 4AJNA 2BONA 2FFJA 1GA1A 4RMNA 5FIUA 4D3YA 5JCJD 3WZMA 4CDMA 4C3OB 1ZOOA 3WNBA 4X85A 5K3EA 1ULBA 3P52A 3U3OA 3WIEA 1G8FA 1OBHA 2G83A 4MMYB 5KUTA 2RG1A 4KFRA 4NBSA 1H0SA 4KG7A 1NJ1A 1NSYA 1ND5A 1V16A 5IDYA 3UM9A 5B7QA 4UQPA 4EGQA 5GONB 2BFNA 4DIEA 2UUOA 4WOJA 2C8VA 3MWDA 5D84A 1X92A 5FUQA 4ROTA 1UXIA 5AVSA 1MIOB 2AQ8A 3GC6A 1NHWA 4H1UA 3RYIB 3RQIA 4RESA 4KE8A 1CUCA 3A9VA 4RWEA 2P68A 1SKYB 1L5YA 4YAFA 1J0DA 1N2ZA 3ZD6A 1PNQA 1IIRA 1D1QA 3ZHCA 4TTJA 9LDBA 2Q29A 1LLQA 1O54A 4PZDA 4P58A 3KAPA 3NHMA 2VJMA 5KYGA 2YWJA 4GYWA 4YT8A 2Q3JA 4C0JA 1X2EA 2PJUA 2JIRA 3IKLA 1HE4A 1NXQA 5EN4A 2EXXA 2GARA 5C8YF 1JXMA 5AVOA 3BSFA 3LBIA 4PFKA 3ZE0B 1O6CA 5HKKD 1KEPA 4QBIA 3MJCA 2GBGA 5JJKA 1P7ZA 1XP5A 2RK3A 2WHPB 3S8YA 5JXIA 1CRPA 3PSHA 2EGHA 2D0PB 4EMSA 1FPMA 3NV9A 1J00A 3EFOB 2NU9B 1NSFA 4NOLA 4KRXA 4NABA 3UMFA 3USZA 4EKIA 2XUDA 2XB8A 2Y92A 4ZHQB 4E5VA 3DFUA 2YZKA 5K4HA 1LZKA 1NHGA 5A1JA 3IHLA 4KEAA 5AICA 3M81A 1IQ0A 1DTWA 4ES6A 1ZBDA 1QM5A 1IDOA 2WWXA 2YIVX 3DUFA 5AW9A 5I6DA 3HCFA 3H2BA 3I45A 4REQB 2XNDA 5TMBA 4OMFG 4K1LA 1VIDA 3QVOA 1C0EA 1IVYA 2D54A 4NKRA 4QPDA 4PPGA 2ZJYA 4EAAA 3JR7A 4W99A 5TMDA 4OQ4A 1EFDN 2HWUA 1QOPB 2YIJA 3IUMA 2ZG6A 3OCCA 3WYDA 4EJFA 3O9MA 3L40A 2EKPA 3OZEA 3VYUB 1N2CB 2JGFA 4BNIA 5ADUS 1YOBA 1M2GA 2DBZA 2WV7A 1Q0LA 1OR8A 2G5TA 2O59A 1HO3A 1XJ5A 4G4GA 2RDMA 4IGIA 2R6FA 4JHLA 5K0GA 2CJFA 3KOMA 4D9GA 3THYB 2XCIA 3RSCA 2I78A 4A73A 1KAQA 1AGXA 2Y1WA 3GV0A 3D64A 3R3VA 4G36A 3T9AA 3TSAA 5A5FA 1RKUA 2ZIGA 1PJ2A 3KC2A 1QKIA 4B7XA 1UWCA 2IHYA 4AKTA 2JJ1A 3COJA 1Z6AA 3IHTA 3TNJA 2GN8A 2PMBA 5EP2A 4ZVPA 4B47A 5CEJA 4MVXA 1Q22A 3HVUA 4DA6A 1MABB 3KYDA 3NALA 4MWSA 4GMGA 4NULA 4R1UA 4W5HA 4EQ6A 3VI4B 1KY5A 3ZI7A 3SBXA 3O8LA 4HZUB 2JZCA 2IOFK 3IIMA 3ONVA 4PLPA 4GECA 4Y9SA 3VDQA 4PQRA 3DGEC 1DJNA 5CX1B 3TN7A 3NNSA 3TZLA 1MQAA 1HEUA 4XSHA 4UVDA 2VJQA 2XUZA 2J59A 4GXRA 1XNJA 1NJ8A 1P9LA 5EWMB 3FROA 3FPBA 3BWXA 3PV0A 3AEUB 4JGIA 4RPJA 4PIMA 5FPYA 3A6JA 3WMRA 3PC7A 1RBZA 4DMCA 4KSCA 1VYHA 3VVBA 5AW0A 2VBGA 4JJ4A 4UBJA 5E0KB 4CI0B 2H1VA 2C4KA 5CYPA 3BIJA 3PHHA 2JZNA 3PR2B 3MTGA 2CXQA 4HXEB 4MAMA 1YACA 4RQUA 2ODNA 2ZKIA 3P1JA 3C8DA 5LQRA 1UXHA 1K8ZB 2D1SA 3A28A 1U2PA 1U7WA 3DUWA 4PRLA 1GN9A 5ENZA 1JEYB 2J85A 3LLSA 3MJRA 1BRMA 2R8RA 1CUFA 4OI4A 2NZWA 1KOLA 1AA9A 3WGVA 2JAWA 2P3OA 1I6WA 1FQKA 2JJYA 5GAJA 4BPRA 1ENZA 3ZIAA 4M0LA 3Q8KA 5KOIA 5CLLA 4IXDA 4O2BA 2L0XA 3A1WA 1HURA 4DN6A 1EM8A 1XQ1A 3FNQA 3K4HA 3S68A 1UFOA 2FE4A 3HZRA 4AN4A 2AHOA 3OU2A 5TJHA 3HK2A 5C1BA 1V3TA 1MC4A 4LHEA 4LJKA 1EJ6A 4PG5A 1CJTC 2IYTA 4H4EA 3N0WA 3UW1A 1UBMS 1Y7TA 2H92A 3VGPA 4EA9A 5DK6A 2IZOA 3IEIA 1YFJA 3LFTA 5DLEA 2HU7A 4DDHA 3H0EA 1UDBA 2AW3A 4OHVA 4EVQA 3P5SA 3ECAA 2WEKA 4M8NE 3E9ZA 5CH3A 4DSZA 1W0CA 4K9QA 1WP9A 2EHJA 2MSDB 2XB9A 3WAGA 3GYGA 1YQEA 3OM9A 5SV2A 5KI6A 1IAQA 4YT4A 5C7OO 3FRJA 2G0NA 3UC5A 2BGTA 3LDHA 4MROA 1JHAA 2FX3A 4NR0A 4HS4A 5GPBA 3FKQA 1VZ3A 4KFTA 1E6UA 2NTEA 1NNI1 1WHSB 2R6DA 2CLCX 2C7VA 4R31A 1YZGA 3WWOA 1CIPA 4JUFA 2CUNA 5I4IA 1CUVA 5ENDA 2BMFA 1UKEA 2P3QA 4HDMA 5KNCA 1E7WA 1UANA 3ZHSA 5A4DA 2Q7XA 4KITB 2JJ8A 2F9FA 1A9XA 5LDDC 3ELWA 4KCGA 2XCRB 2COKA 4A8HA 2NLOA 2I55A 4H1WA 4HFRA 3G2OA 4ZANA 2ERCA 4O3FA 5DLPA 4E5MA 1B2LA 1N3LA 4HZIA 4FUQA 1IBSA 1V1MB 2B30A 1KH2A 3LDGA 4O0LA 1YK0A 4NXMB 3A6EA 3R5XA 1H85A 4M83A 5IH3A 4WPGA 4ACAA 5IXJA 5KYWA 3IALA 1D5CA 3HC7A 2HCFA 3A1TA 3P2YA 4NYMR 4ER3A 3EH1A 3OJCA 5K0SA 5JADA 2X2PA 2FR8A 1XIVA 1CUSA 4G5SA 1YUBA 2IIPA 2NUTB 5BR8B 1SKYE 1QFJA 1OX4A 2VYND 3JWGA 2IYQA 2CC2A 3GG9A 1E2IA 2C9MA 1UF9A 3O4IA 4U2GA 1IPEA 3GWZA 3QF4A 1SC1A 2IEZA 5DM2A 4TYMA 1ZD9A 1WZUA 3VO8A 5BN1A 1TYZA 4KRYA 4BQSA 5BSKA 4QATA 4FD3A 3DKRA 3AWDA 4IRMA 4X1OA 5B36A 5DI3A 3A3PA 3AC0A 1GD1O 4QA9A 1VE9A 1DUVG 1S8FA 3ODGA 1KOJA 2YC2C 3UWDA 3W6PA 5E7JA 1BXRA 1MC5A 1L5QA 1OAAA 3F98A 3L1KA 2DH5A 4U7WA 4X62B 4EGCB 3IVMA 4AL4A 5B12A 3QVVA 1KJIA 3H65A 5F9MA 5CW1A 5IP5A 4ZEVA 5FOSA 5MHTA 4Y1GA 5LYJF 2QG4A 3RRNA 4GMHA 1Z4PX 2EBUA 3L05A 5LD2C 3TPZA 4RVDA 2IZ7A 5LWHA 3CZCA 3DJFA 4N47A 3A3NA 4ZYTA 4NCJA 3T52A 3JU3A 1JGTA 2FLKA 2PWPA 2QWXA 4IIEA 2W6CX 4KQ2A 1XDGA 3RC2A 1R4MB 2EYQA 3CQ9A 3EF0A 3G82C 3GDHA 3KO8A 5BWCA 3RUAA 2JG3A 4OGGA 4TXJA 5EIOA 1CS4C 3BB1A 5BMVB 1EE1A 5IBPA 1TMYA 2ZTLA 3WLIA 2AZTA 2X86A 3ON5A 3ASYA 4Q00A 5C8ZA 3HU3A 2NUAA 1AV7A 5I9MA 3QEOA 3GRZA 4TS9A 1N2CE 1TM5E 4IDGA 3BCHA 4OM7A 1TQHA 3WWYA 3ZY6A 3WR5A 1EESA 2FEPA 3ZE1B 2PIAA 3CPEA 2C98A 4IHJB 1TI7A 1K6MA 1H2AS 1MEJA 1O95C 2OXRA 2XLCA 2ZIXB 3NU1A 1FQWA 4FLMA 1JV2B 4JJZA 1QAOA 2C2WA 2HJVA 1LRJA 3AJRA 3C3BA 3CFYA 4R2KA 2HMSA 1KI6B 1NURA 4H7KA 1RI5A 3T35A 2VJPA 5DLYA 2J9FA 2RHDA 1PT5A 1SUFA 2UZ1B 1CE8B 3PNQA 4R8LA 2EZ9A 4Y2HA 3WHLA 5K0BA 1TO2E 4OP1A 4BNTA 3LQYA 4F96A 2A94A 1JEJA 3HVHA 4KSYA 3WO1A 4AZVA 4C7VA 5JMWA 1XXHB 4IIGA 4ZIRB 3T5DA 3RRXA 4JZKA 4JLNA 3SQOA 1RAEA 2E4WA 3VTFA 3W34A 1I3NA 5JARA 2IL1A 1H05A 2WKWA 1OJ7A 3A9UA 3DE7X 2RI6A 4R1SA 4KQ6A 2GVNA 4KQMA 3S8EA 1MF7A 4TMFA 1B6TA 1LXCA 1M8GA 4OSOA 4GZMA 2FMXA 3R3UA 1XU7A 3NONA 3PVSA 2EGUA 4GOMD 5CG1A 3DEYX 1VGRA 2DUNA 3H18A 4P3XA 5IX8A 4EITA 1RHJA 2QG9A 2Q3MA 4M1MA 4RACA 5EUQB 1XCMA 5F64A 4KVAA 3NBYC 4BLUA 4C0SA 4Q4HA 4S2EA 5CMLA 5HA5A 1YTUA 3FYUC 1C1DA 4GMDA 2CXTA 1FDRA 1PWZA 1EX9A 1RP1A 2A0YA 2IEDA 3FTPA 3KKNA 4PS0A 4ZZ3A 1PWXA 2QTRA 3E9CA 1TT5A 3TSOA 5F4ZA 2JLQA 3TBKA 3DPUA 5EFZA 1FFGA 3GWGA 4M0CA 1BE8A 3MHTA 1T9AA 4B6PA 1ZM9A 2Q5QA 1XZCA 1JJAA 2BEWB 2R60A 3NOQA 4EPRA 3HYSA 4OA8A 4NHOA 4YJ3F 5KPDA 4BJ5A 2Z2IA 2QMHA 2BDUA 4P2GA 5CXSA 4B6EA 1ZGGA 3N0XA 2Q4RA 2O2YA 2I8AA 3Q7QA 4RH1A 4PLYA 5BN3B 2NVUB 2JZOA 4EY6A 1U3DA 2AFHA 4MUNA 5MFPA 3OZTA 2PKCA 1H2HA 5DYIA 1O08A 2C54A 5B53A 3WWEA 2Z4TA 1HT1E 1P1RA 2PYDA 1S01A 2B94A 4HAOA 2FEWB 5LA6F 1JILA 1VKHA 3LTEA 4LQ4A 2JI9A 3UGTA 3IP3A 3KWJA 6GPBA 5JZOA 2H9AA 2TRSB 3O75A 4EG6A 2AQIA 2BMWA 2J6HA 3OPVA 1P3DA 5E2BA 5HYVA 1E7RA 4EVSA 2J46A 3DKKA 5BOSB 1XUOA 2WB4A 4L8FA 2Z09A 1X74A 3KAQA 3Q6IA 1OWOA 3DOEA 4AUEA 5FUMA 1MN6A 3H9GA 4EYKA 3VJKA 3OC0A 1DCKA 2QJWA 2D8AA 3DFIA 2AN4A 4KQHA 1H8HD 5AJUA 2Y3IA 4FR0A 3L8GA 5DN6A 4QG3A 3RJ9A 5L95A 3EXHC 4G8CA 2QD3A 4KX3A 3PPVA 2DMRA 1DL5A 4C5BA 1RYHA 2W11A 5CA0A 2ZR0A 4EY4A 4UNIA 2X23A 4NK5A 1Q50A 3NKVA 3AERA 3PRHA 2EZ8A 1GT6A 4R3UC 1PNRA 1KYVA 4FILA 4NFLA 3BFVA 1X1EA 4G5FA 4EW3A 5HJ5A 4PX2A 3QU7A 3COZA 3P0RA 5K6AC 1WMDA 1QF7A 4H0CA 4GEGA 4GVPA 4W82A 4B7AA 1BRTA 3EAQA 1PUIA 2SKCA 3D8NA 3NBXX 3QLJA 2MCFA 2B2NA 3LOPA 4FQ7A 4E4YA 3N8GA 2GESA 3O84A 1UEJA 3ADKA 3KTFA 3L7IA 3ADCA 3VDMA 3MLAA 1YJXA 2PKYX 3EVNA 3L84A 3IDSA 4B3IA 4L78A 3A6KA 3HZZA 1Q17A 1G8YA 1T8UA 1OFUX 2C3OA 2IYPA 5K3FA 5U1PA 2ZSBA 1JFSA 3BWYA 3GA0A 1J33A 4H16A 4W9NC 1KAHA 4MEAA 4O4HB 5REQA 1C8LA 3BJEA 1L4HA 4ND7A 1Z0JA 2ZBFA 2P1RA 3U3ZA 4BFXA 5AVTA 3IVRA 3L8DA 2WYHA 2YY5A 2X0RA 2ONJA 3JYPA 1P73A 5IAAA 2ZUVA 4C30A 2VPXA 5I3ZA 1EXMA 3DONA 4I08A 3TB6A 4UM5A 1FRZA 4GOND 2ORIA 5LQMA 2BCEA 4EFLA 3Q0TA 4EUFA 3HB1A 1KHHA 1H6CA 4KVFA 4X24A 4XQEA 4Z3KA 2XUKA 5CVDA 2HTFA 2VEDA 2PRIA 3AP3A 1JAXA 3LBHA 4PC2A 1I3CA 4K5QA 3UWSA 3ZQUA 3ASZA 3LXRA 2YZNA 3EUFA 3CNLA 3BTSA 3K5WA 5C4MA 1Z5WA 5IDWA 3MPOA 1A5AB 1J6UA 3OY7A 1QG0A 2OCIA 4Q15A 4MKRA 3WNCA 2FMUA 3EQ6A 5AI0A 3BRWD 1B26A 4WLOA 1UPUA 3EPHA 2ETVA 3ONWA 5CJJA 3G2HA 5KAPA 1ULAA 4MUGA 3AJ9A 4S0XA 5KTRA 1SELA 2BZGA 1T1GA 4HRXA 1LVHA 4L22A 4NENB 4ND1A 5FJJA 3ETJA 3RT7A 1Y6QA 2HEIA 2C8LA 3AESB 3MCWA 1NF8A 4Q9IA 3V4VB 1CUGA 2DOKA 3UKDA 3U60B 1R6DA 1VDMA 2VDJA 3H05A 4EOGA 4QNNA 3EZXA 1E1LA 2O54A 4YPFA 4ZCMA 4F97A 2C2ZA 3HMQA 4CV0A 1H65A 4NNJA 2F67A 1XVVA 3DMFA 4MW0A 3RHZA 4N01A 1GPMA 3I4LA 4BNUA 4JB2A 5IVHA 5C1OA 1L9KA 1ESZA 3DP9A 4KWIA 1Y4AE 4POAA 5G40A 1R66A 2G82A 3GUVA 3NETA 1ND6A 4V24A 5EXXA 3M3HA 1N8TA 1VG8A 3QU4A 1QPZA 4PS1A 2K2QB 4EG1A 2E4ZA 3C6ZA 2NYVA 4GM0A 4CCYB 4UTPA 4B3GA 1S3FA 1Y9DA 4N7BA 5IKMA 4CM8A 5I8WA 1FA9A 1YQGA 5JJBA 3RTGA 2JCSA 4X20A 4ZVMA 4K87A 5CNJA 4YH1A 1XXHE 3OA0A 4ENRA 1PKXA 2AS0A 2P27A 3OEWA 4E51A 4DKXA 1QVAA 1W5TA 4QPCA 2OUKA 1UBRS 3FNGA 1Z39A 4NNOA 1X9HA 4DIDA 3DDZX 5IKEA 1IN6A 3RRYA 4DXDA 1PP4A 2UVDA 4D97A 1TLFA 2GXAA 1NYQA 2GZMA 1M7HA 1UM9A 3ZTYA 4PTZA 2OAEA 2NZUG 4L76A 3ELUA 1A9RA 5HF6A 3IDQA 3S4YA 5FTMA 4J0IA 4IDBA 1UKZA 5T57A 1CHDA 1SQ5A 3D0OA 3WKCA 5BWMA 2HRBA 2NU6B 1D03A 4MS3B 4ZVTA 5CXUA 3AX6A 5KNBD 1THZA 1Y8QB 5BY2A 4TX1A 3DOHA 3OHSX 2QQ0A 3HCBA 2VF7A 1EFTA 2ZIAA 3URMA 2J0SA 3TQRA 3OX4A 2PS3A 1LBQA 5IK2D 2ZUUA 1R16A 3PQ6A 5EG5A 3KOWA 1WEHA 4CEJB 1J09A 1A8PA 1Z4IA 1X9GA 2VHTA 2VHYA 1NSTA 3JVIA 4Q4AB 1EIWA 1YZKA 4Q3DA 1MJ5A 4BJHB 1HQYE 1P5ZB 2J67A 2Z5VA 2O23A 3T7AA 3BM5A 4DDVA 4C7OA 2LTAA 1SG9A 1R88A 2X42A 3L0CA 2A9QA 4BHTA 2QTCA 3JZFA 2ATXA 3ZI0A 3DVLA 2BGKA 4BCBA 3GFFA 2Y0DA 4U2DA 4WSOA 3N2KA 1K68A 3EVDA 2AVNA 3AL3A 3I4FA 4MXDA 3ZGOA 4HUTA 5CXQA 5J2TF 5B57C 4PGAA 5KBYA 1SRQA 3RC7A 2CWDA 1FY2A 3U7GA 3QPWA 1Z5VA 3DV2A 4G1BA 1PSZA 4TVBA 1A9ZA 4IEIA 1X7GA 3VC7A 3CRMA 5IVDA 5KWIA 4UFOA 2JLZA 1UJMA 2FFHA 1ABEA 2H63A 2OAGA 4PQGA 5DTEA 1AQIA 3AGPA 2XVXA 3Q0EA 3PTAA 3OZAA 3OE4A 1JPVA 5CB4B 4BLWA 5EGNA 3QUTA 2VIIA 1PFQA 3P7MA 1RQ7A 2VTKA 3FBTA 1E8NA 3OIUA 4RZUA 2IHNA 1A71A 2JGDB 3M7IA 1QIIA 1WBDA 5DCUA 3ILHA 1JIIA 2GBLC 4WK4B 4GUDA 4A2WA 1ORIA 4XVCA 3AXTA 4X63A 1OXSC 1XMQB 2Z4SA 3M4JA 2EJUA 1L1FA 2P9JA 3FNRA 2OKCA 4QEKA 4GBED 1QLJA 4A8JC 2HHHB 4BUJA 2X0EA 1QH1B 2CDAA 2GRJA 4B44A 3NAQA 1OZAA 4C4TA 5BSTA 4BQNA 4GI2A 1WWKA 2CCKA 2HXYA 2X1MA 5LQJA 4D9EA 1EFRA 1EWYA 5CVVA 2XEXA 2CNWA 1Z7BA 4M7OA 4ARZB 3K30A 4WOCA 1GGKA 4O1MA 2A58A 4UU0A 2EJCA 4GS5A 5AJYA 2R8PA 4EO4A 3O8RA 2QIOA 4N6GA 4LF6B 2ZE8A 2X58A 3I6BA 4NAUA 1Y0BA 3R5TA 4K40A 4N3AA 5CTAA 2IOHA 1P9OA 4H27A 4K9PA 1A2KC 4GI7A 4MYDA 3V8BA 1U2SA 1EUYA 1Z3CA 1S89A 1BD3A 3C70A 1K3UB 4FWBA 4YA6A 1PQYA 3B5IA 3WL6A 3GMSA 1I5OA 3CINA 2D62A 2FMKA 4Z4CA 1A4RA 1EXWA 4IO0A 1Z0AA 4MLZA 4JLDA 3OP4A 4D4KA 5JSZA 3I1FA 5A02A 1MH1A 1VP9A 1L5SA 4CF4A 5I48A 5TPZD 1E69A 1K0FA 3MGBA 4YFYA 3DMPA 1DC4A 1GL3A 3BXXA 5J4LA 3ORYA 4IGAA 3KJIA 1U8TA 3GUCA 3ZS8A 3T0GA 4RLQA 1FLAA 2MYPA 1JHPA 3EXEB 1HFJA 4KUEA 2IYUA 2VUIB 4KKVA 3AG5A 5BXYA 3ZUGA 4ZKEA 3OD5A 1MB3A 3GCGA 1LBEA 4G1EB 5BRJA 2VLIA 3RHFA 3UAOA 3TECE 2VTEA 2YUTA 3NV7A 2VCHA 3K8ZA 5LQCA 2ZATA 3P5BA 2XMBA 2YVLA 4WXYB 2LRHA 1JMVA 4DSOA 1DAFA 2Y6UA 4AG5A 3BHNA 2I3AA 1RI4A 1TB4A 4ABYA 3DOUA 2OCPA 3FOAA 3M83A 3VPHA 1L7QA 1JQ5A 2PKXA 2QP9X 2ZU6A 4H17A 4KREA 2BFEB 1NRJB 3C1UA 2B9VA 3UJPA 5AUOB 1OE0A 2PX8A 3ZNNA 3O94A 1RXIA 4XVHA 3PD1A 2CHQA 2CNBA 2GEVA 4NVRA 3LKZA 1X7XB 1PJ3A 3S7ZA 3ICWA 1FJXA 3BMNA 3I9NA 4NATA 1S3IA 3PSAA 3INTA 4X1YB 2ZBUA 5HRAA 4DTIA 1AF7A 5M2QA 4CG1A 3Q5EA 2O0LA 5I8PA 4YRDA 3VPFA 1XLUA 1R8SA 3GLIA 3D2BA 1AIPA 1M34B 4IJKA 1T5LA 4JP8A 3G0OA 3FDZB 4I55F 3K8QA 1PNVA 5FWXA 5EXEA 2IEGA 2YXEA 5T64A 1L5NA 4LV8B 4NG4A 1OZGA 4NI5A 2OA0A 1JXOA 1TUBA 2HAEA 3ND6A 3QHPA 4LZNA 4CG0A 4LBVA 2GA9A 1PGQA 2KYRA 2FF5A 4MR9B 4XQGA 4CFSA 4NMLA 4R8MA 5LDHA 3TI9A 2FRDA 4KIGA 4TMZA 3VUEA 3BJZA 3EZLA 5KKNB 1RBYA 3C41J 4RK6A 2ZSHA 3GJ4A 4LXUA 2VC2B 4G0UA 1BYUA 1HA3A 4DM3A 4URFA 4H6VA 3RVOA 4C4OA 2HUNA 3I2IA 3ZW7A 3V2UA 5BR7A 1WB9A 4YDRA 3D3JA 3KQYA 5B58T 3T9EA 3Q3CA 4TTQA 3VR2A 1LGYA 1XWWA 3PUKA 5KTTA 2PR2A 3T9FA 1EINA 3GNTA 4RL6A 2H5LA 3FTNA 5EWLA 4BNJA 2G4CA 2B5WA 4I50A 4LC0A 1YBMA 5AI6A 2OKGA 3MMZA 4CTMA 1XMOB 2WHQA 1M6WA 1RWKA 2FU5C 1HDYA 1PO7A 5FNZA 4B17A 1N9GA 2OLJA 1SBYA 2NQ2C 4TGLA 1YDWA 4RIFA 5JFGA 3OJOA 3DKVA 4M1ZA 4L4XA 1I9GA 4DWJA 5JSYA 1YVRA 3H2YA 2I1LA 4MB0A 1ADCA 3KIPA 3DAPA 2GEBA 1PEDA 3FDXA 2VYVA 4YV7A 1P0IA 1YRQA 4X7PA 2OCGA 1RQPA 1Y4SA 2PTGA 3VR3A 4L5IA 4NBLA 5ALZA 3EY9A 3OTWA 1ITZA 2HU8A 3EVEA 5CYOA 1TQDA 2JAHA 2ZPUA 4GOLD 3C24A 1U02A 3D8HA 3GJ5A 5F12A 2V74B 1SZDA 3WL3A 1I4DD 5LQKA 1IN1A 3QNMA 1WULS 1YZTA 5KYXB 5J63A 1I7PA 1WD5A 4UMFA 1NOKA 4QTXA 4OI2A 3GL9A 3ASVA 1HFKA 1OVMA 2UYGA 2B21A 4U7FA 4KPGA 3O4FA 2PSDA 1CHNA 2XYQA 4D81A 2H00A 2XNSA 2V5UA 1OTYA 2DR3A 4KGVA 1DXYA 1F0NA 1KKUA 2GEUA 4XFDA 3HO8A 4CIAA 1OWPA 1JZTA 1ZHHA 2Q1YA 1GAQA 3O74A 3E7PA 4JV5B 1YIOA 4ND2A 4LXHA 1KMHA 1R18A 1PNTA 4EB6B 3GZTB 2Z83A 3EASA 1DOAA 4GPIB 5BR1A 1WZEA 1G8JA 5HWSA 4HBZA 1P62B 1XTQA 1ZW1A 2GUGA 4F4IA 1ZN2A 4QHSA 3L7BA 4EHNA 5HRCA 3FNEA 4JJ6A 4H6XA 4XD2A 3SVZA 3T9CA 1QORA 3HWWA 4P98A 1T2FA 2DLCX 3MVEA 1MVOA 1SK9A 3RASA 4ZMBA 1DJMA 3IXQA 1UBOS 3N70A 3RCBA 3CCCA 2HDNB 1UP6A 2OE2A 1G3QA 4DNOA 1MRNA 2FP4B 1GDHA 3KPYA 1QIGA 2FZCA 2AKYA 1KEEB 2V0CA 1O4WA 2IDZA 2VEOA 1JHOA 2VYQA 3COYA 4PX5A 3NATA 5GOTA 1LPOA 2HSEA 4FCWA 2Q3EA 3A1NA 3HJFA 2X5KO 4L72A 3K1ZA 2ZRAA 3PICA 3U13A 3VNUA 5G3ZA 5K7SA 2WC1A 3QFFA 2AEEA 4HDRB 3U7QB 2V7XA 4EEZA 1EJBA 1KVTA 2KPOA 5ALIA 5CFZA 2CEKA 4PLVA 1R6BX 4B73A 4L8GA 4C29A 3VVCA 2ATVA 4ISBA 2FPUA 1EHIA 2C2XA 3D6TB 4R2IA 1GO2A 3MMNA 4G0MA 4NMMA 5FR2A 1XA3A 2NSYA 1CYDA 1IH8A 3ZU2A 2C3YA 3PC3A 3SKVA 1C0PA 1ZY2A 2IP4A 3BJMA 3ENVA 1DTEA 2H85A 4BNWA 4TMVA 4CMAA 4NMWA 1AX9A 3JYQA 4WVFA 4F2PA 3KZ1E 2V7VA 3PVZA 4WH0A 5EP4A 4QUJA 3F6YA 4YLEA 1NM5A 4ASUA 4TL7A 2IIQA 4DUGD 1D09A 1WCIB 3GCDA 4KRFA 4IIJA 3UH1A 3CZ9A 1EXNA 4X1KB 3RSLA 2PUEA 2JJMA 2NOAA 1XHEA 3L06A 3RUHA 1XN1A 5EKXA 3RS7A 4LE2A 4DCSA 5JHGB 3LT2A 3LHSA 2LE0A 4NSNA 2C83A 1RKXA 4CV3A 1GCOA 4OXIA 1U7OA 4Z9FA 1GUDA 2SKDA 4WLNA 4A8PA 4ZQGA 1ZUHA 4JC4A 4AP5A 3EGCA 3AYXB 1W4LA 4FN4A 4RJTA 1FZTA 2QAGB 3ORRA 4Q7QA 2D7CA 1D6SA 2V96A 3LAWA 2DFVA 3ZE8A 1T9ZA 3II6X 1Z9BA 4TUYF 1U2GA 2Y1CA 4ZCSA 3VYTB 4C5AA 5H9WA 4CF3A 1KZ4A 3MJTA 1T0BA 2P2DA 1AO3A 3PUHA 3WQRA 4BO8A 4D9JA 1J0CA 2PL1A 3IEUA 3O90A 3SJUA 1C1HA 2Z8YM 2RHBA 4YBRA 3VR4D 1TUIA 1SD1A 2YV2A 1QCYA 2OO5A 3WK4A 1L8XA 2XVAA 5EIBD 2BTQB 3K0CC 2JGMA 3LCRA 3R9IA 1GU1A 5CHYA 3UWPA 1KSGA 1M34E 3QFTA 3ZIAD 3NMUF 2P6MA 4OQPA 2QAIA 1AG9A 1K92A 4Q1VA 1S9DA 1LPBB 2CK3A 2XAAA 3GFGA 3QA3E 4I2VA 2HK7A 3UUFA 4LHSA 1H6BA 2GFQA 3K96A 2DBQA 3P0JA 2ACVA 3FPSA 3PHGA 3R3HA 4DZZA 3JARB 1MENA 4RFLA 3C3YA 2C78A 2ZSEA 4L6CA 5SYNA 1IHOA 2F2TA 1DKPA 1QVVA 4FB5A 5I45A 1ZUIA 5LP6B 5JO9A 2HLHA 2BKUA 3DG9A 3MCUA 1P3JA 1G19A 3QLVC 4MUFA 4Q9NA 2B61A 2XE6A 2XRZA 4NWIA 4BO5A 1BDIA 5MGNA 2GXSA 1E3SA 2PSSA 1CVIA 2WOJA 5CD1A 3RRMA 1EEHA 4FDUA 3ACCA 4WJKB 2FSPA 4W5OA 1QLWA 3WWZA 1N1MA 1CB7A 2A57A 2AD1A 1XJCA 2H65A 2HMUA 5DCYA 5E3IA 4PICA 1IZ0A 3ZV4A 4R40A 1U1GA 3VDNB 3FPGA 3VVLA 4DXHA 2KX7A 4AZSA 2GSWA 3KKOA 1XNHA 2EATA 5JVDF 1Z4JA 1BWQA 2PZLA 4CLRA 4F4UA 2XYHA 5B6JA 3IEMA 2YWGA 4KRGA 4L5AA 2OQ2A 2PUCA 4D6XA 4G0PA 4PRKA 4OP2A 4Q5IA 2PE5A 5ALTA 4ZAFA 1B0UA 2IF2A 3KTOA 4M86A 1R4ZA 4ZC1A 3ROZA 3VQTA 3M9WA 2Y1XA 4ZXFA 4LVUA 4FWTA 4KIUA 4ZQFA 1VCOA 5ED0A 4OUDA 3C39A 1E62A 2P2ZA 3EEIA 3GIDA 2H0AA 1UT5A 3UAWA 3DVAA 3IQIX 4LGCA 3CISA 1SH7A 3NYRA 3HFRA 4KU4A 1N6LA 2R44A 3G9ZA 1LNSA 3R8FA 3CO0S 2WOOA 1GOTA 1T4CB 2QMEA 5F51A 4JDPA 3ND8A 4JJ7A 4K88A 5EE0A 1EWVA 1CWUA 1UMCB 2QSZA 4AVYA 4C0LA 1OV4A 1AHIA 1LCIA 3GJRA 4HEJA 1KEWA 2ZUTA 3WB1A 1X1DA 4EUEA 1PZNA 1ZWLA 1L4GA 3KAKA 5K0EA 3RVSA 1UDAA 1GLNA 2ZJAA 1KL7A 1UBSB 1RKBA 4YJFA 4Y6RA 5BSMA 3ZNPA 4AY4A 3W4JA 1KE2A 3PCXA 4P0QB 2QG6A 3IAAA 1V3QE 1AA6A 2XA2A 4TV9F 1YKSA 5AKXA 1HL7A 2I22A 4TWIA 2FETA 3HQ4O 1OC4A 4LRSB 3H2HA 4L8YA 1OKKA 1YE8A 1E2BA 1YVPA 2X8JA 2RCYA 4H18A 2VK4A 4RS4A 1OSNA 2HC9A 2PJRA 3V3TA 1UZAA 3EXG2 4JUAA 5JPDA 3HHEA 4MWBA 4EZEA 1JQ3A 1E5TA 3L0IB 2VSOA 4L9SA 4P4UA 5THKA 4Q4JA 2W37A 3BF8A 3RTBA 4ER6A 2Q3CA 3AMVA 4HQ6A 4OMCA 5JMPA 3D4PA 3MOIA 1Y3HA 1ZZEA 1GPYA 1QH8A 2ZEJA 4I9FA 4M9ZA 2NSLA 3R0IA 2ZWVA 4NJEB 2XTNA 3CH4B 1WM1A 4F6RA 3AT1A 4RM2A 4XWGA 4MQ4A 2J0UA 3PL1A 1EUZA 1M2OA 3DBHB 4MHSA 5IMSA 3AQ4A 4MW9A 1O94A 1EG7A 4L73A 4C2TA 4YMLA 1PHPA 3D8BA 4LHYA 4Z8XA 4ESOA 5AW1A 4HOYA 5A62A 3AFMA 3D6VA 3QJYA 4CHTA 4EHHA 2J0VA 1QYCA 3AUAA 2XQFA 5CFMA 4JT2A 1FSPA 1ONNA 3NIDB 1DJOA 1MLDA 2BGMA 4KR0A 2DERA 2BM1A 4XUCA 3TIGA 3K09C 3IOMA 3SQWA 2BCGY 1SBCA 5F77A 3QVTA 2BFDB 1QYVA 3K2EA 3X1KA 4B09A 3DMHA 4CUKA 4GPTA 621PA 2ZJ5A 3IP8A 1NW6A 2AG1A 4BS9A 1SJ9A 3KUUA 3TOCA 1VXOA 2JRLA 1JKIA 3V4FA 1RI1A 1DEHA 5JQGF 4L2IA 2EBFX 3MXTA 3MRSA 4TWJA 4W1PA 5IJ0B 1Q7RA 3HSSA 3BWMA 2WHEA 4Z8YA 3KQOA 1I7DA 4AKGA 1ESCA 2GNOA 4YV2A 1ZMXA 1RHUA 4JI1B 1XCJA 5EHXA 5G4KA 4RY9A 4KE6A 3OEYA 2IY7A 2MMGA 3EQ8A 3N53A 2PIDA 2R1TA 4MPRA 3O4JA 1WSBA 4TYNA 5JLAA 4IQFA 1CRQA 5GM2A 3FSRA 1GEGA 3QOWA 1ULUA 5EEHA 5C8XA 1DGQA 1DWOA 1N5RA 4FW9A 2LDBA 1M3SA 3F9CA 3FYTA 4O4IB 5C4GB 2CY0A 1LDYA 3SG0A 1F9EA 1KKLA 4IXMA 1SKMA 1UINA 1IXSB 1HZZC 5C53B 3SC3A 1SQFA 2N1BA 4IMPA 2YYZA 1QGDA 1IQPA 3GJTA 1KO7A 4JYBA 4D98A 3FOWA 5ALWA 1DI0A 3RYFB 1H6DA 4PGMA 3W5CA 3UATA 1RPJA 4OMDA 1V4BA 2DVMA 1K3FA 3KL4A 1ACJA 2A5GA 3RUEA 4CKXA 2Z6AA 2OQIA 2YWCA 3AHJA 3GZJA 3DAHA 3IPLA 1SXJB 2PN1A 3K16A 2V6BA 1SC3A 2PZGA 3EBPA 3STWA 3DAYA 4I3FA 1ULTA 1R27A 1ZM2A 3ICOA 1HRDA 4X64B 4F45A 2EW1A 4JI7B 2REQA 1GZ7A 3SN6A 3SNHA 3VRHA 1JR6A 5HVNA 4RXTA 1VBNA 4GYKA 2QYOA 2F8SA 3U7EB 4P0TA 2OXCA 2AHRA 1IZ9A 4K9MA 1N8KA 4N3GA 4OJNA 5C0OE 4YCSA 2KW5A 5C51B 4QYSA 2A59A 2WYVA 3LV8A 2ECFA 2NUBA 4Q1BA 4LOIA 1U1FA 1SB9A 5C5EA 1QAMA 3FVQA 3QYPA 4M99A 3UC9A 2LIPA 2WG1A 1W44A 1J21A 3AHIA 4HDAA 3H1EA 4EG5A 1AUPA 1ZIDA 5J1SB 3B9QA 1MQ8B 1V16B 4FIDA 5DPMA 1HSOA 1YOVA 3PENA 2QR5A 3FR7A 3BE5A 3FRHA 3LBNA 3MWDB 3TFWA 3GLQA 4EBFA 1O57A 3WA6A 5EMNA 2W2XA 3IP1A 2D2XA 1GFSA 2DG2A 4OXNA 5KNBH 2K5UA 4RYLA 2CNNA 2H7CA 2I3ZA 3DDOA 4FFMA 1Q0TA 5AKYA 1USGA 1V3UA 1Q16A 2C5SA 3TJRA 3IMFA 2XRFA 1XMPA 5GINE 3CE6A 2XWPA 5JZSA 1TQ2A 4FKZA 3F7MA 4R0MA 2VJMB 3MF4A 5JASA 5AIAA 4DMLA 1NLFA 3N8HA 3QBJA 3HTXA 1U2DA 4B6RA 3ADBA 3IB6A 1FYWA 2YIDA 3AR5A 3HL0A 4M53A 1RYZA 2G0AA 5JNTA 2RBEA 1R50A 1L5GB 1C9NA 1T8PA 2HLPA 2EFYA 1W19A 5G2OA 1JAIA 2H4HA 4BASA 1YUMA 4MS1A 4NV1A 4OG2A 4G1VA 2MDTA 3B38A 1MB2A 2YN0A 4NAHA 4ERNA 1BU8A 1N3IA 4ND6A 3H1GA 2PSFA 4U63A 4OSPA 1IYZA 3ETEA 4E5YA 1GG2A 3EC2A 2Z43A 3DUFB 4G09A 4LYJA 3N8KA 3ESQA 4QUEA 3A58B 4V0QA 4HX9A 3FG9A 2MHCA 2QZ9A 3GG2A 4GSLA 2CVFA 1Y1SA 3AI1A 4QC2A 4M1OA 5HM6A 3OJLA 3WE7A 5K8JB 3UWOA 1QQAA 3ILXA 3LKVA 4RGYA 1I2DA 3O8QA 4DIUA 5BV8A 1ZJWA 3AFGA 3WICA 1KMNA 5B30A 4U00A 4V0SA 3MCVA 2NYUA 5B55A 2QM3A 2XCSB 4EUKA 4WOKA 1Z2DA 4Y30A 1X1SA 3PC6A 3OE1A 5D5HA 4Q0MA 3SR3A 2P91A 3OJXA 3CS3A 4DUPA 2OWEA 1X1AA 2I3GA 1J5XA 2B4RO 2C2BA 2QVBA 2XHEA 2H9YA 2XQGA 3FN4A 3D7RA 4KQKA 4WASA 3DFKA 1ABBA 1IMJA 2IELA 3ZY4A 4KI0A 2EF1A 3FI0A 1Y4UA 2ASEA 4HFJA 3MYRA 1XHFA 1RYMA 2ID7A 2P9CA 3IQGX 2JB9A 3KD3A 3KYDB 5CPFA 3TCKA 5I8ZA 3ZVLA 4EQ6B 1TLTA 2WSSA 1UJNA 2PL5A 4JVSB 1CY4A 1N7GA 2CFCA 4LMPA 1CUJA 2WAOA 1ZXLA 4R9RA 4BGEA 1LEHA 2G71A 4LK3A 1BA2A 2DQKA 4EG4A 3H86A 3GD5A 3HDQA 3O4HA 1L4BA 2PQ2A 4MICA 4KO1S 3UK2A 5AJTA 3OLYA 4K05A 4DVGA 2PVSA 1E3JA 1PTKA 4MRNA 3V8MA 4FKMA 4QGGA 4AD8A 3WMFA 5CYGA 1X0XA 2IU3A 3FB1A 3O1LA 1NIJA 1U7TA 3PC4A 5IF9A 4QGSA 4PZLA 3IOBA 4BMYA 2XSZD 3FETA 1EFCA 2AF3C 2WE7A 3WRYA 1ID8A 4ECAA 1V9SA 4ESEA 2E55A 5DLDA 1S1CA 3O9ZA 4PAMA 1QTRA 2HI0A 2JLSA 4UXJA 1M6EX 3BQMB 1QKJA 4YJ2B 3UPUA 5K3DA 2IU6A 1RRGA 5JD4A 4RM3A 2B5VA 3IAUA 3A3YA 1E2QA 2C0CA 1KVQA 1N2OA 3N7UA 3QYFA 2OAQ1 2RGEA 1Q7BA 1SXIA 1TK2A 1ZOIA 3R3ZA 1PX2A 1UPXA 4GP9A 4DIMA 1YQXA 2AXNA 3NRJA 4FINA 3FTFA 2I4MA 1M67A 1E5LA 4M1TA 2E21A 4O2BB 1VRCA 2C82A 4N4AA 5ENVA 3E2IA 1Z25A 4MVJA 1S2MA 5H81A 1EM8B 1J22A 4KLAA 4NY1A 3SIWA 3G1WA 2AMLA 3WXBA 3WY9A 5CLHA 3VKVA 2R62A 1TZ2A 3IDFA 1QTIA 2EZUA 2C3UA 4PG8A 2G17A 2FEAA 3G5UA 3TR6A 3S8MA 1YNOA 4GP7A 3AONB 2FDCA 2J4CA 1G6OA 4MUYA 4ZCTA 2A92A 3B7WA 1Y3DE 4HNRA 3CRRA 4TZKA 1O0CA 1XU4A 4S0ZA 4JEHA 1OYYA 1C1XA 4GL4A 1WMAA 1XDDA 3FSJX 4IJQA 4C7BA 4ED9A 3PNKA 1A7JA 1DOHA 3E9NA 1FOEB 1UBFA 2BE9A 5CRIA 2E82A 1SXJE 1Z3IX 5A4FS 3NIGB 2OQRA 2PVPA 4WEOA 4YAKA 4G2NA 3CNEA 4F6LA 3OZCA 2YOFA 4RABA 2Q27A 3QUSA 4B3MB 4XARA 3HBLA 5HQJA 3CWCA 2D5AA 5HXAA 4HDMB 1AF4A 4NU6A 5LNK6 4JB8A 4BOYA 1A9XB 1NW7A 2PX6A 1U0TA 4XRRA 3ES9A 5G02A 5LZ8A 3AJEA 4C0HA 2Q8QA 4YLGA 5FH9A 3SEAA 4LZOA 3LGXA 3V80A 3RE1A 3W6OA 1FK8A 3ZE6A 3NC0C 3NP7A 2E0IA 4QARA 2FVXA 2VHJA 4JS0A 5DNDA 3SIXA 3ANYB 2A9RA 2PLFA 3DPIA 3EVGA 2FRVA 5KYWB 3I9LA 4CU2A 2CGEA 1WS6A 4KOEC 4CNBA 2IC5A 1ZXBA 1T34A 3L0OA 2L69A 5H3LA 3THXA 1OX4B 2IPOA 4CQMA 1W4ZA 1Y1KE 4BFCA 1COZA 3BFXA 4LXYA 3LYHA 3G8AA 5K99A 1NT4A 1JT2A 3QF4B 3KWMA 5CFOA 1FYFA 1G41A 3IH5A 4O4LA 4TYPA 3RFTA 4BTVA 4DSUA 1O3YA 2VO1A 4OB8A 1I3KA 1YZ3A 5HJ2A 3AHEA 1ZISA 2X7JA 4QEDA 4FTWA 4W5QA 3ZK7A 4HZGA 5CGZA 4KQWA 1DHRA 3OPYI 1KR5A 3GIWA 5IDVA 4BKUA 1BXRB 3UAGA 3IR6A 4Z99A 2FN8A 3A36A 1P2SA 2DUUA 4ENVA 1NTOA 3A9SA 4P1ZA 5FLXA 4FE4A 3IV7A 1CEXA 2W2LA 4P5DA 4MKXA 1Y5LA 4ENWA 1OFTA 2AR7A 2GKGA 2WIFA 2VQSA 1QIMA 2I1WA 4HDOB 4IV8A 1V5WA 2HA5A 3OM1A 4REMA 5JAOA 2D4HA 5BWBA 1J2TA 2G77B 4PCVA 2ABWA 4ODIA 3V8VA 1YH3A 1RJWA 3OOJA 2P2GA 4RJKA 1KO1A 4H6WA 4D56A 5DHQA 5LDGA 1QOZA 3I37X 3U4CA 1ZJ6A 4ILEA 4PG4A 4D4IA 5JCZA 4IKOA 1YJAA 4BO6A 1IY8A 5BP7A 1NXOA 4FFVA 1A5BB 3GMDA 2FSFA 3R3YA 4FVTA 1C9JA 1NNSA 2R6R1 5FNVF 1M9NA 4UZSA 4HWSA 1YDFA 3PL5A 4RVNA 2NUAB 2Z58A 3ANMA 2H8KA 3U62A 4ZOLA 3OQOA 4LYGA 4HJRA 4M88A 3EXG1 3A6ZA 3DZIA 5BW8A 4RFVA 5F73A 1XV5A 5BSWA 4YJGB 5LC1A 3EE6A 1EFAA 1FSSA 2H3EA 5J4YA 3S44A 5GJWC 4NMXB 1NWCA 5LLSA 2F1KA 5IJ9A 2Y99A 4UUOA 4M8SA 5UKDA 1U6IA 1Q0RA 1GGEA 3GHHA 4HRVA 4EJ6A 4ZKDA 4DV2B 2Z2YA 4KWEA 3T38A 1P19A 3KK0A 3TKYA 1DIGA 1W87A 2J3QA 3OQIA 3R41A 3M3DA 1A72A 2FQXA 1PVDA 1EGHA 1ZS9A 2GAJA 3OLCX 4RD4A 4HYYA 4YQEA 2J9FB 5JRDS 1LW7A 5GMOA 2Z6UA 1E6CA 4UMEA 2HEGA 3KFXA 3CLUD 4DILA 3OFKA 4KFCA 2UVPA 1KPHA 1OFVA 1WLSA 2BISA 4O4JA 3TUZC 5J2UA 2IRWA 1SU6A 4KLZA 4E12A 5GTDA 2JJQA 1DEKA 4ZC8A 1EM6A 1J5PA 3WLHA 1ZX1A 2F43A 1M1NA 3NCHA 2O9JA 1ZVKA 3KT6A 4IDAA 4KXYA 4M0FA 4WN3A 5IEJA 4JT9A 3BCRA 3TQSA 4DNXA 3DMNA 3AY6A 2NW6A 1RP7A 3HB0A 3RWMB 1Y8CA 2QX8A 4OBWA 3QTLA 1V71A 2WA2A 3PIIA 3H2ZA 4MQEA 4RBNA 5C46F 3QTTA 3KE9A 3P2EA 4A2QA 4RZSA 4ZEXA 4DG5A 4O8ZA 1VCNA 2ONKA 4LTDA 1REQA 4DJ5X 3VAAA 1UT6A 1UFVA 3JZMA 4QU0A 5AKLA 3UUEA 1NE2A 2FPXA 5ABPA 4Q4HB 4DC0A 1AE1A 1O9BA 4ADSG 1BYIA 1C1DB 4E03A 2P35A 2REOA 4ZRDA 1JIJA 3U4IA 1WSWA 5FQOA 1TT5B 2XZTA 2X9NA 4LJAA 3U26A 1QF9A 4PZUA 1Y7HA 1ZK0A 4YHHB 2QNBA 1YDHA 2DQSA 3LX6A 1QCZA 2I6GA 3L8HA 4BQRA 2Z3WA 3EY4A 5GONF 2V6MA 1C2YA 3EQ9A 1SHTX 3FCEA 3JSXA 3D3EA 2AFHB 1VL0A 2Q4DA 4AZTA 3IUPA 1YRWA 2VT3A 4A5SA 2V4MA 4I46A 1DC3A 1U80A 2PGNA 2W4IA 1J7KA 4WECA 5JU6A 1QK5A 1RPNA 3Q72A 1BU5A 2AJLI 2O5CA 4BATA 1MAAA 3GJ6A 2FMFA 3N7TA 4MV7A 3B48A 4N3CA 4N8EA 2YWXA 5H80A 1VMDA 3VR2D 1KY4A 4BIMA 1HE8B 2HNBA 4QYWA 3VR4H 2Y9MB 1OGYA 3ABSB 1TGYA 3KZKA 5JAIA 3TYXA 2DKNA 3GRCA 5SZKB 5TVGA 1O77A 3F1KA 3S7TA 4MKGA 4RDCA 1ECFA 1FQOA 3SJCA 1XAIA 2GTHA 3JVUA 1YULA 2GK3A 3AK4A 5KTSA 5DMXA 1WQ4A 3F6RA 5L6LB 3PXEA 5FTWA 5LOVA 1PYOA 2A67A 2WTNA 4QU9A 5CA0B 3NHFA 3D7KA 3E3MA 3MM4A 1ZJZA 4ZHQF 3AERB 2I3BA 4HEA6 1NUTA 3RC9A 2WA1A 1N6OA 3CUKA 3GGGA 3HN2A 1EGMB 5K8LA 4AUMA 2CXHA 2JCYA 3V4ZA 5HOEA 3AI2A 1JIXA 4IDHA 4X44A 6NULA 1FLNA 4II3A 2AJTA 1BE6A 1PX0A 5K9ZA 1VJDA 3LWZA 1JAHA 4YRNA 1SZCA 1UBLS 3DBIA 2ST1A 3OWXA 1F3LA 1LJLA 5C1IA 4BAGA 2UYHA 3HVJA 3GNLA 3K9WA 1E2HA 4RZQA 4ETWA 1CTQA 1BMFA 4BNZA 4CM9D 2IHTA 3PU6A 4Y0AA 3QW2A 5CCXA 2I4NA 3KEQA 1X70A 3TAHA 1Z2AA 3BGVA 5LZ4A 3K8OE 2WI8A 3ZDRA 5K01A 4PINA 4A6DA 5K3FB 2POCA 4L57A 2VKTA 2V3VA 1DQSA 1EA7A 2D1RA 2DHDA 2FMIA 2XZPA 2ZXEA 2XA9A 3GJ3A 5REQB 3EZ7A 3OOEA 3SEZA 1WCV1 2YMQA 1DP4A 3I32A 3QFCA 4FMDF 1DJPA 1UAAA 1GU0A 4WBNA 3G2JA 2VR1A 4FI3C 2OYCA 1SD5A 3V4SA 2XGJA 3T5AA 3V42A 2PRJA 4O08A 4BQFA 2WM3A 4D3ZA 4ZEWA 4XUGB 2YV4A 4P3YA 1RJGA 3SOZA 4B8ZA 2PZFA 3Q98A 2X1HA 4YRJA 1GRVA 1N6IA 1UOQA 2ZYIA 4FZRA 5DM1A 1RJEA 2H4FA 4GR9A 2V5VA 2O7VA 4MV3A 4YXWA 1JP7A 2BFCA 1PT6A 1OMOA 3BRSA 1E58A 3I2YX 1I14A 2A9FA 1HH4A 2JATA 2Y0EA 2IDMA 1NVWQ 4C22A 4PZPA 5LVAA 4BNGA 1XGKA 3VC2A 1XZLA 3SC2A 3JQBA 4D0LB 3BA1A 1GAJA 4IDDA 3G5LA 3W8EA 1MQ9A 2H1FA 3K70B 1QRAA 4QLAA 5A3RA 3GUUA 3ZV7A 1Z47A 3K9QO 2OECA 2WFAA 4HGPA 1BA3A 3BGDA 4LBZA 5K4GA 1OTXA 2BCJQ 3FH0A 4EM6A 1VHDA 4PY2A 2V7WA 3VSDA 3KB6A 5KNDA 5TMEA 3PBKA 4MP6A 4GMFA 3OPMA 4JLKA 1QFSA 1Z22A 2HN9A 3FA2A 2HJGA 4GR5A 1KAOA 1XDZA 3WL4A 1GGMA 2ZT7A 4R6WA 2WZCA 4H60A 4R1TA 4F38A 5CLIA 4Q6BA 2IGTA 1R0XA 2PUGA 1WXFA 2EQBA 2PHZA 4Q3KA 4QGBA 3AB8A 1KK0A 5EJ7A 3DL7A 3GEBA 1F9AA 1KDPA 1K8RA 2QTBA 2YYAA 1OX5A 4TOIA 4JFRA 2AUMA 2BMDA 1RFGE 3IEKA 3WNQA 4ASUD 1J8QA 4R7GA 1CXZA 2FGJA 1Q19A 4CM8B 4EARA 2MINA 1Q6ZA 2JFVA 2XTJA 2H59A 1OY1A 1AQ6A 1RYBA 3E9RA 3O3OB 4X20B 5U4QA 1KZHA 2M6RA 1UC8A 4FC7A 1WY7A 3JD4A 5F7JA 3TKAA 3GH1A 1UODA 3PD0A 4Y0NA 3LW7A 1K9VF 3MUOA 1AM4D 3K9HA 2RBGA 3VJLA 4M0MA 4CMHA 1E77A 4DNFA 1GPDG 2VATA 3HCNA 5FL3A 4P7JA 1SUDA 1UM9B 1TFUA 1DS6A 3I8SA 5A6VA 1DO8A 4RANA 1VB5A 4LF4B 3PRJA 1UXGA 2IZ0A 4M1YA 4LF5B 2W43A 1EZZA 4TKMA 3IE0A 2ZI4A 3F78A 2B98A 2M6LA 3W5SA 2CVOA 2O7QA 2P75A 3W2IA 3DOJA 4YGYA 2F3SA 4O5OA 1QIKA 2CXPA 3HZHA 4JSTA 1VSBA 1IL0A 2CFIA 2D1QA 1I3LA 5CX4A 4ATNA 3UT0A 3PGXA 4OXKA 1CUYA 4MO9A 3CA8A 3PFKA 1TTHA 1M6VA 1DKUA 1H3FA 2YHSA 3M33A 2NYAA 2EP8A 3G6KA 1MHTA 3AR6A 3F9RA 2VHWA 1OOEA 5D7BA 3WFZA 4E1BA 2NU8A 2P2YA 3HKBA 1JU3A 1K7CA 5TGZA 4C06A 1WMBA 2ID4A 3JD1A 4F86A 1K6EA 4I1IA 4C7OB 4MEBA 2AFHE 3MT7A 4URXR 3C3CA 1X86B 4GI3A 2F3RA 1Z0KA 1VM6A 4OQDA 1RCUA 1ZINA 1E94E 2DFTA 4S35A 2YNMA 4MW1A 1ADYA 3N2KB 1N8SA 2O2IA 5IHXA 4HTAA 1R0SA 2PT7A 1OU4A 2WIKA 3BMXA 4LZLA 4RZ3A 5AH0A 2IWHA 4KN8A 4D2IA 4BE4A 1YJQA 4R05A 2GKOA 5AT1A 2XBUA 5H5JA 4UCQA 3SKXA 4U2KA 2P3LA 2R9VA 1QFYA 4DHWA 1JHRA 2HT1A 1JHXA 3ZBTA 3EF3A 1NTRA 3TNDA 1E18A 2FLVA 4IIBA 1XJQA 5DT2A 1A7KA 1NJSA 2OMEA 2PXXA 2EOAA 2XXJA 1VJ1A 3F7NA 1EXVA 4RTKA 1Z2PX 1PTJA 1QUFA 5ALKA 3COSA 2PS9A 3EVFA 4NF2A 1KZ1A 2IPMA 4DQLA 4AQYB 1GU7A 3FR8A 3RSFA 4BVLA 3BK7A 3VYSB 3WSWA 1K5PA 3ZZTA 4G26A 4L4ZA 5EMHA 3I5UA 4R8KA 2XQIA 2JDIA 2P9EA 3LL7A 1PUXA 4PGHA 2FZKA 3I92A 4C7XA 4Z4EA 1SOUA 4PAOA 5AOAA 2H4ZA 3Q1LA 1Z06A 2AK2A 2NXEA 4H7EA 4ZP1A 4Z0NA 1T2UA 4OLJA 2W2OA 2X9GA 4NCKA 3KT3A 1A50B 3SX4A 3EUWA 1LX7A 1KZGB 1GCUA 3VPSA 2SECE 4CTOA 4Z9BA 2OBFA 2GKSA 2E87A 3D1JA 3FUWA 3PB3A 2VHXA 4NH4A 2WZDA 2GK7A 1UC5B 4X7RA 5BMVF 3TLXA 5KINB 1HTTA 3H8JA 5EZSA 2BGRA 3RVBA 3OZVA 1Q5PA 1ZWKA 2XDYA 2ZJFA 2ZI6A 3EEFA 1U8CB 4EB0A 3Q3VA 1O96A 1PRYA 4GZ3A 2P9FA 5SICE 3ZWAA 3IBTA 5BMOA 1XT6A 1E1CA 1G5IA 4ALNA 5CIYA 2FXVA 4C04A 2D74A 4EKYA 3SYRA 4N5HX 5I9SA 2VNHA 3QY0A 2BUBA 4EMUA 2DUMA 1T2CA 3MBIA 2J5XA 1Y1TA 1E9SA 4MTLA 1SXHA 1YD7A 3CGWA 4RHXA 4YMIA 5I7AA 5CDSA 2Z9DA 1OT3A 2V55B 4PSUA 1U3WA 4N5DA 3M5WA 3UH0A 3NUQA 3NHJA 4POOA 2UDPA 3P32A 2P5SA 2QLMA 1UC4B 4PPYA 1GILA 4EW6A 4MMXB 5LBTA 3OP1A 5A1TA 5JSZB 3TDMA 1R3DA 3R3WA 2F17A 3CJRA 3H1PA 3ME5A 5G1OA 4RTOA 4HLUC 2NO4A 1VE6A 3IE1A 3WLEA 1G6Q1 1TUEA 3D6AA 5EJGA 4MH0R 1E6KA 2LZ0A 2VHZA 3D1VA 1ZH0A 5FOWA 1VJRA 2RHOA 3MTEA 4GYJA 1HQDA 1OFUA 3NS7A 3UO8B 4ZZIA 4FGZA 1BH6A 2W6IA 1Z0SA 2Q5IA 3EYAA 4KFUA 1E9CA 3W0LB 3LHKA 2VCYA 2BY4A 4W1SA 2QN9A 4XZ3A 4Q12A 2JNWA 2A9VA 1FX0A 1N0UA 2DJIA 3G2LA 1N2HA 2GX6A 3ETGA 3ZWBA 3K92A 4D96A 4GO1A 3NIBA 4RJ2A 3WGLA 4J3JA 1X0VA 1BN6A 5ERGB 1IB6A 2C92A 1CR4A 2QS9A 3I58A 2OP0A