2XZTA

Caspase-3 in complex with darpin-3.4_i78s
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQARGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3
publication title Caspase-3 in Complex with Darpin-3.4_I78S
rcsb
source organism Homo sapiens
total genus 49
structure length 140
sequence length 141
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xztA00
5IABA 3H1PA 1RHJA 2CNNA 4JR0A 2QLJA 4NBNA 4QUDA 4DCPA 1PYOA 4N6GA 3R5JA 4DCOA 1CP3A 1NW9B 2CJXA 2QLBA 3KJFA 4N7JA 3EDQA 3R6GA 4EHHA 4N6NA 1QX3A 4NBLA 4ZVOA 5IAEA 3DEKA 1RWMA 5H0IA 3GJQA 5JFTA 4N5DA 4QU5A 3V4LA 2XYHA 4M9RA 4I1RA 3V3KA 4FEAA 5LU9A 1JXQA 4AW9A 1RE1A 3R7SA 2CNOA 4EHFA 1SC1A 1RHUA 4HVAA 3V6LA 3P45A 4EHAA 1RHQA 2J31A 2QL5A 3PD1A 3V6MA 1SHLA 2CJYA 3R7BA 2HBZA 4FXOA 3V55A 2H65A 4FGUA 3NS7A 4IEFB 5LU8A 2AR9A 1K88A 4AWAA 5IARA 4ZVQA 3GJTA 4EJFA 5LUAA 3S70A 3PCXA 2HBRA 3KJNA 3PD0A 4QUAA 4QU0A 4QUHA 3V4OA 1KMCA 3BIJA 2CDRA 1K86A 1I4EB 2WDPA 3GJSA 4ZVSA 3K7EA 3H11B 4QTYA 1BMQA 2H51A 2C2MA 4NBKA 2XYPA 1F1JA 4EHDA 2Y1LA 4QUBA 5IAKA 1M72A 4QUIA 1NMSA 3UO8B 3OD5A 2CNKA 5IC6A 5IAGA 1I51A 4EHKA 4DCJA 4PRYA 3EDRA 1RHRA 1GFWA 4PS1A 1QTNA 2FQQA 2H48A 3KJQA 4NOJA 4QUEA 5IC4A 3H0EA 4JQYA 4AWBA 1PAUA 5IBRA 5I9BA 4I1PA 1NMQA 3GJRA 4N6OA 4ZVPA 3H13A 4PRZA 1QDUA 1RHMA 2C2ZA 2XZDA 3DEJA 4QU8A 4D3XA 1SHJA 3DEIA 2FP3A 3P4UA 3NKFA 4QTXA 4N7MA 2H4YA 2J33A 3E4CA 4D3YA 3S8EA 1SC4A 4QUJA 2NN3C 4JR1A 5IAJA 1NMEA 3SIPA 3R7NA 4JR2A 2HBQA 1GQFA 2DKOA 2QL9A 1RWWA 2XZTA 1RWKA 4EHNA 2Y0BA 5IANA 2CNLA 5IASA 2H4WA 4EHLA 3D6HA 1RWNA 4HQRA 2C2KA 1SC3A 3D6MA 3IBCA 3RJMA 2XYGA 2H5IA 1F9EA 3SIRA 4IYRA 5I9TA 2K7ZA 2C2OA 5IBCA 4ZVTA 4D3ZA 2J30A 4JQZA 4NOKA 1CVRA 2H5JA 4JB8A 4JJ7A 1RWPA 2P2CA 1ICEA 1IBCA 1I3OA 2C1EA 2H54A 3IBFA 3H11A 4FDLA 1I4OA 4HQ0A 5K20A 2J32A 2QL7A 4NOLA 4LSZA 3UOAB 1RWXA 3R5KA 4PS0A 4QU9A 3NR2A 1RWVA 2QLFA 4NOMA 4JJEA 1RWOA 5IBPA 3D6FA 4QULA 3DEHA 1RHKA 3QNWA 4QUGA 4ZVUA 5LUBA 2HBYA 4JJ8A 3R6LA 4ZVRA 3ITNA 2FUNB
chains in the Genus database with same CATH superfamily
4TV8F 4WV3A 5BOVA 5I45A 2NSLA 4YRZA 4KRGA 3V8RA 2GNPA 4UQLA 2QLBA 5J47A 1KK3A 4YV7A 4FSDA 4GWGA 3ESCA 4BKQA 2BFFA 4H6WA 3C6BA 2FSHA 3W8RA 3NOVA 3ZD9A 4YRCA 4Z9AA 2QRHA 1GPWB 1HMYA 1O3YA 2QMUA 2PGNA 3LSYA 4HN2A 9MHTA 3IYLW 2J9XB 1SG6A 4C1BA 5D84A 1OYOA 4UOQA 3VOBA 3BWVA 1EG2A 1M2HA 3EF0A 1P29A 4H59A 4GZ5A 4A5SA 4LDPA 1WBJB 2F00A 4N39A 4BB9A 5JECA 1W88A 1ZRNA 1Y6GA 1PNQA 2OGWA 3N87A 4RZSA 4EA9A 1EBFA 4L6IA 5CVTA 3ELWA 3F74A 1Y8QB 2Q1UA 1USIA 3T1HB 1P74A 4R2LA 3NT4A 3AOEC 1ZA2A 3PV0A 2YFYA 1BKSB 1LLDA 2IOQA 3GPBA 1TF2A 3OAAA 5IK2A 4Q15A 5KNLA 5HQ3B 3LBFA 1SB8A 1JZSA 1VSQA 1GPNA 4C76A 4D9GA 4BNHA 4UPVA 2P1DA 5J5AA 3BGOS 3UAYA 2VDNB 4B0OA 1LWNA 5C46F 1C0PA 3CZAA 3HXQA 2QW1A 3L7JA 2VYVD 1N2CE 1B6RA 5G41A 3RBVA 3ULKA 3ZI4A 5CAEB 1IZ0A 3T7SA 3KG2A 2QN8A 2IXFA 2P7HA 2ZI7A 3KJIA 2D54A 3RAFC 4RFSB 4ZV4A 2RHLA 2YV3A 4UTXA 1EPUA 2P9GA 3RUIA 1UIRA 2QRGA 1BQEA 3UG7A 3G2HA 2BJVA 3F49S 3DO8A 2RH8A 3IAXA 3P19A 4M60A 2VO1A 9ABPA 2HRBA 2NACA 4PG8A 3RTDA 3DT8A 2VLIA 1J42A 2L2QA 5BQOA 1PAUA 2IU0A 4EJMA 4CHTA 3OICA 1AQIA 1AZLA 4ZRMA 1A97A 3BRCA 5CM2Z 4C7VA 4ABTA 2I76A 2H31A 5BN5B 3JARA 1G42A 5LMUB 2Z0MA 1ZUNA 3DS8A 1GPBA 3O9VA 1PJBA 2Y1OA 3MBKA 4W6QA 5AM0A 4QJ3A 1US8A 3HBFA 4JSRA 4OHKA 5SZIA 4CLDA 1T8YA 2BI8A 1HOXA 4YXWA 5C4IA 4BNXA 2B1QA 4MGZR 2GLUA 4JT2A 1J8FA 1GUYA 2DY0A 1E79D 1OWMA 1FTNA 2H1SA 3RKUA 4JUDX 2G09A 3VU8A 2IYRA 5JZSA 3LFHA 1QQ5A 4C4PA 3WLNA 2FFJA 2GK6A 5KSOA 1NI4B 4EVSA 3DEYX 1QR6A 2G8NA 3R76A 4UHEA 4EY3A 1PT9A 1FS5A 1N0VC 5JS2A 1A5BB 5KNBH 2CDCA 1NV8A 2YXEA 3BMXA 1X94A 4FR0A 5J4KA 1XV5A 4GOJA 1EQUA 1XTJA 2GEJA 4HZUA 4IDPA 3ZE8A 4CMGA 3CVYA 1TAHA 4W9MC 4JBGA 2FPXA 5B3KA 3ZY5A 4NZPA 4ER5A 5LZ4A 1KRHA 3IB6A 4OQQA 2R60A 2V45A 2H8KA 2P3QA 3G2MA 4RMNA 2FB9A 1QRAA 3D8TA 3EG5A 3VR6D 3KEMA 3IKVA 4XSHA 1E1KA 3FNBA 1JA1A 1BS9A 1DPGA 1QSGA 4PZPA 4WINA 4BCDA 7ADHA 3RTBA 2G9RA 5KDLA 3LBNA 5EKXA 1XB2A 3WLAA 3M8KA 1X7ZB 3OJCA 4MR8A 4PE5B 5F1KA 1XAGA 3NR2A 4NOMA 1JZTA 4ZDKA 1BSVA 1FA9A 2F3QA 2J0VA 2M32A 4BDSA 3IT3A 2QL6A 4KO4S 1JHAA 5C53B 2VEDA 4LE2A 4DUGA 5B2FA 1I6WA 1NF8A 3AEQA 3OLZA 3R3XA 4YASA 4ERXA 3AF2A 3DE2X 3PQEA 4NDZA 1R6VA 2WJVA 5G0VA 3RJZA 4DRXA 5T6MA 1GTMA 3E3LA 2XBMA 2GTIA 2OENG 4KSBA 3I34X 3IP3A 4KE6A 4CMIA 5EERA 2CUTA 5IDVA 1A9XB 1UKCA 1M34A 2G8LA 3GZNB 3HA5A 3ZCRA 4AIRA 1U9IA 4NKRA 4YRLA 3PU6A 4AW9A 1G8FA 1GTRA 4DQLA 4ANFA 1TZKA 2WWVD 2LUOA 1S8AA 2HOQA 1XCPA 3KR2A 1LV8A 2AVDA 3DMPA 2IF2A 4LK3A 2QM7A 1OVGA 2AFIE 3HLKA 4B6QA 1ZONA 1XZGA 5FOSA 3MGAA 1D4AA 1I9GA 3ZTYA 1AQJA 2OWEA 1C8LA 4G4SP 1I2DA 3HZHA 5E1OA 1FDTA 1AUQA 1FVOA 4B3IA 5IZCC 4J7UA 3HUUA 1CBUA 5L45A 1XHFA 1IJKA 1DEOA 3FKSA 3GLHA 4M1SA 5HQJA 1I7QB 1NHGA 3JQGA 2FR8A 3Q7TA 3SZOA 2PT6A 2O8FA 2VWGA 1CR4A 4A6DA 4LF6B 3QKRA 1VRWA 4MARA 2H1IA 1B7GO 4FLFA 1ULTA 5BNZA 1ZI6A 1WY5A 3FE2A 1SZPA 3R3ZA 4WFQA 3UAWA 3IQHX 2E85A 5LQSA 1IWBB 4J2TA 2H1WA 2W2LA 2V0CA 5JYCA 1N5KA 3OFSA 1BN6A 5KNBA 2JVJA 1PKEA 2FKAA 2YHIA 3FF4A 4RVGA 1L5YA 2H3EA 3HQ4O 4NL4H 4P34A 5K8LA 4Z1MD 5CVEA 3AWIA 1SULA 3T5GA 3B3AA 1ISFA 4UMFA 3RYFA 1VPDA 1AURA 1ESEA 2DHDA 2M6RA 3ETLA 4HLUA 4UM8B 4PN7A 1P1JA 5LJIA 3UENA 3ZLBA 4H0FA 4JQYA 1AO3A 2BEVB 2JHAA 1PS0A 4MVXA 3K71B 2R62A 3QPUA 1DTWA 2PGOA 1RCUA 4TVOA 1ZC3A 2XV1A 3HXPA 4FYVA 1G0NA 4KMOA 4M88A 4MIYA 5AHWA 3N0VA 4YMWA 5EJ9A 2XPCA 2ZIXA 5JCZA 3T3OA 1VB3A 3C5VA 1T8WA 2PJRA 1UPUA 2C4NA 4NYIR 5CX1A 3RF7A 1BFDA 4BNMA 4ZYVA 3ADBA 2G0TA 3AEUB 3CU5A 4ENSA 1LDMA 3G2PA 2PAAA 1N2SA 4INPA 3TFOA 1NATA 3HKBA 4GT1A 2JLXA 4EHNA 1PJTA 1ESDA 2JIOA 4XYEA 2ALJA 3J7AC 4WN3A 2Q7OE 2NU9B 3K2EA 4A2PA 1H69A 1FU8A 1K7XB 1SUIA 1ORDA 2BHSA 2HZ7A 2WE8A 4G5GA 4EEXA 3GEEA 1UFRA 2WTXA 2PS0A 2ID9A 4KYIB 4M0EA 3L4SO 3ZZ1A 4XVCA 5LLDA 2PUCA 1Y9ZA 4B4KA 4WBNA 2UZ1A 3OY7A 4TZ0A 1T0JB 3D6TB 3NDPA 5IKXA 2OZVA 1MVOA 3D4NA 4JOBA 3RC7A 2IOFK 2WM2A 4AMVA 4DAOA 4JOQA 2FFAA 4X6UA 4C22A 2ATIA 4RK7A 2YFQA 1Q1EA 4BUCA 1UKYA 1A5AB 2P4EA 3ZV6A 4U8GA 3PUKA 5EIEA 5K20A 3P32A 3H9QA 2X0RA 3V2HA 4FYPA 1D4ZA 1UIMA 4LSZA 3UOAB 1O6CA 2VZ0A 3MERA 4I9GA 1CERA 4OMFG 3TRKA 3ZW7A 2X77A 1RQGA 4A26A 3BB3A 3JQFC 3LA8A 1H2EA 1H2HA 4TTIA 4D9CA 4ZI2A 1CNMA 2EZ4A 3M6VA 3R6LA 2WJYA 4Z3DA 1JIXA 2OHVA 3TQSA 3E9YA 4EYGA 3LYLA 1AMNA 4JODA 4L2IA 4UBKA 3BEOA 4K9DA 5FV4A 4D5GA 1PYOA 4R40A 4U6QA 4QYIA 1H1DA 4MLPA 1FUUA 4EKNB 1IAVA 4CODB 2IYZA 1P7VA 2E1PA 2OCAA 4JXKA 5AJZA 3WLPA 4Z0HO 4WBNF 3ID6C 4C1NA 2R6CA 5B53A 4MW2A 4DA6A 5BN3B 1U2GA 1ZK1A 4A3SA 4HI0E 2Q99A 1K1EA 5I5GA 3UWKA 4EK9A 1M1NA 1LPNA 2FPKA 5A0TA 1H65A 4EFNA 3G0GA 3IQEA 1CUFA 3V6LA 3I5MA 3RABA 4WVFA 3U31A 4XFDA 4B3JA 4YMUA 5IUJC 5A6VA 5TGDA 3JQBC 4A92A 2VAVA 3IAM1 1ECCA 1NRJB 4BCBA 3A11A 1EFVA 1AN0A 2AKYA 3H1FA 1N34B 1IHXA 5DMXA 3HSKA 3FETA 2FJUA 3HG7A 4FXOA 3PIIA 5U9CA 3X43A 5DEIA 1TM3E 1VI5A 2C4VA 3CH7A 4LPSA 4G89A 2Y3IA 1BKDR 1FYDA 2F9FA 4TUYB 4N03A 4YRIA 4B2YA 1XZCA 3EXFA 3IIKA 4ENPA 4HWTA 1P9OA 5EJ7A 2NUAB 4E4TA 1DBPA 3PNMA 4OM8A 2YICA 3KJHA 4NR0A 1JLMA 1KKMA 2AV6A 1DEHA 4I8DA 4MVJH 3ZHCA 3GV0A 4TMVA 2RKWA 4KPUA 2VDMB 2MYNA 1FQKA 4TMYA 4Q7QA 1LQTA 2RC6A 3F9CA 1KJJA 3F3SA 3KQSA 3ASUA 4I81A 4ZXFA 2QW0X 1M2OA 4G0MA 1ZBQA 3GYGA 1K8YB 2PO7A 3OX2A 4PAOA 1I1HA 2OORC 3P9QA 4DW8A 2PLRA 1P3Y1 3F8WA 3JD2A 4PQRA 3TSZA 5BNTA 5JAZA 2G07A 4WZ6A 4EG4A 1T6YA 2A9OA 2PSJA 1E2QA 1E9AA 1LDNA 3K6SA 5K7SA 4X41A 4ZIRB 5D5QA 3HCOA 2F8TA 1VXOA 2IHYA 2D3WA 3DSRA 4OUDA 1F0KA 5EWMB 4UXHA 1UBSB 1S6YA 3HJBA 3EGIA 1P77A 2RSLA 3I01A 4UNRA 1KDYA 4X3OA 5BSRA 4B73A 2PV7A 1NVDA 4LISA 1NIPA 3SR4A 4NQZA 1J56A 5JMTA 3F5FA 1I0ZA 3AIMA 1IXRC 3VPSA 2F43B 1YGYA 1ZZGA 2EQ5A 1U1GA 3UV3A 2WUFA 3HSYA 4WH0A 4W1RA 4C4SA 2ZE5A 3GBPA 4GPTA 4N5NA 5ALJA 4KNWA 3IV9A 2I6XA 1CLEA 1QU2A 4W5JA 1G66A 2QL7A 3EYWA 3QY0A 4EY7A 3ACBA 2CD7A 1MJNA 1R12A 2XUHA 3CLRD 4M0KA 3VZSA 5MN4A 4L4RA 4IOMA 4CIBA 4NPAA 1DEXA 4FIZA 4MQLA 2XWSA 1N2OA 2DWPA 4IM7A 4IWXA 2VZ9A 2HRZA 3T38A 3CVOA 1U7PA 3L41A 2ZIAA 4KMRA 3N2KA 2P91A 3AUFA 3TW0A 1GNQA 4N6GA 4X65B 3JZIA 2CJXA 1MEOA 4WLFA 4Q6BA 1VIYA 3TRIA 4HLNA 2Q5LA 4HFJA 2CWWA 1IL0A 1C1HA 4FXPA 3ITEA 3U16A 2YX1A 3QXXA 5BWOA 2VUIB 3H5NA 4JSTA 2DT5A 5E6UA 4CMJA 2IEGA 4XEUA 3KXLA 4LBVA 4BFLA 3REGA 2QD3A 4MJLA 3B3QA 3ZWOA 1S2GA 3KXKA 2LCQA 3IELA 4I5GA 1AKTA 3ZXSA 4DIUA 5D3MA 1WUKS 3ZS8A 2DHRA 3EEIA 4DCSA 2BEUA 5B4UA 3C3DA 4BBPA 2YWGA 3KV1A 4MYUA 1DE0A 1MABA 4HNGA 4EMBA 4PY2A 1O87A 2ODBA 2ZU6A 4RA6B 3C45A 3F97A 2OCPA 4MCHA 8OHMA 1JSZA 3AFNA 3LGAA 3VHQA 4ZREA 4EM6A 3QBTA 3EB9A 3ABOB 1UPCA 1ZK4A 2CEAA 3VAYA 3E5HA 5FHQA 3WLEA 1D04A 3FHLA 2EDAA 2P68A 4GPEA 2UZ4A 4DABA 2FXVA 1RKBA 1YNOA 4MVJF 1H4SA 3M89A 1H8HA 2LV8A 1A7AA 1MH1A 2FF5A 4UCXA 4DNOA 1QIKA 3GWGA 5HIKA 1KPGA 1CX9B 3AINA 2H18A 1QTRA 2XQJA 3C3KA 4JZKA 1M72A 3AOEA 4RHCA 4U7HA 4X97A 3CLHA 2IF0A 4EHKA 4OB6A 1RTKA 6REQA 5BR4A 1IEWA 3S27A 2OZLB 3U17A 2JFBA 3QBEA 5BQ3A 2H2IA 4DARA 4CG2A 1Y9DA 2CNWD 1D6MA 3A37A 3GY0A 2JI9A 2HJSA 4P36A 5CT9A 1GL9B 3RYIA 3TX2A 4CBVA 3M2TA 4GZLA 1OTHA 2VYNA 3RS0A 1AA6A 4DLXA 3BM5A 4Q93A 4FT2A 4HPXB 1QHFA 2XXAA 4MEJA 3LT2A 5EE5B 2RK3A 1DC8A 2OK7A 2GK4A 2WMOB 3MFYA 1E8MA 5CH5A 2V55B 2LE0A 1HFJA 1ST2A 1SCQA 1MC1A 2GX6A 2HJGA 1A0OA 3IOCA 3KD3A 4ERNA 5JCXA 5JJLA 3WYBA 1B8VA 5FP0A 2F17A 4YN3A 5KPDA 4RHXA 4RX1A 4IIFA 1M7GA 2YBDA 4TS3A 1GUFA 5K3FB 3NCHA 5FPYA 1FXSA 3HCWA 3CRNA 3CNOA 3R3VA 3KJGA 5EQDA 1Y7IA 5A7HA 3K70D 2NU7A 4COKA 1DX9A 1CJMA 3O8OB 4B3FX 3FLBA 1YZQA 2Q1TA 4REQA 1GN8A 1EDDA 2O6LA 4OQXA 3VTKA 4ME6A 1ZG3A 3OOJA 4CCSA 5AVYA 2ZXUA 2PR2A 3MQ2A 2D5CA 2DECA 5I3CA 5E9QA 4AJNA 2P2CA 2Y1EA 3W5AA 2QTGA 2NQ8A 3ZWXA 1BMFD 1KI6A 1T8RA 2L69A 4D46A 1E2FA 1KZHA 2PIAA 3CUTA 3H11A 3TXAA 3OQNA 2E0IA 2CB9A 4WK2B 1NQXA 2Z04A 3PGJA 1HOTA 5M3BA 2XMDA 4FLMA 4KDRA 2WUGA 3LFTA 1GLNA 3S2EA 2NV0A 1N7JA 4PS0A 1SCIA 3GFVA 2WNSA 1Q74A 5CLFA 1JYSA 2PGLA 5CT4A 3VH4A 1NBMA 1M54A 3OCUA 3KPYA 4S05A 2FWPA 4LWPA 5WRFA 2HIMA 2NXWA 3U3KA 1HYHA 2F8LA 1GQOA 4G2TA 4HNAA 1EK2A 3R5JA 2D1YA 3SCZA 1H4VB 1NN1A 4FC6A 4BGUA 4LDJA 1J22A 4KZPA 4ZO4A 1V1RA 4ZTZB 4Q16A 4ITVA 3TAUA 3LBIA 2EHJA 4MV6A 3NXSA 3B5EA 5L4SA 3OJFA 4WGFA 3USZA 1RNLA 3LGXA 1VI6A 2DR0A 3FOBA 4TV8B 1XX6A 3QPVA 2QSZA 4XYGA 3P9IA 5B1EA 5CEFA 1BD3A 3FNGA 3UWSA 3ZE9A 3OT5A 5E8JA 3H9CA 1EZZA 2UXBB 2H17A 1Z8HA 3WQQA 4CKWB 4BEBA 3PGXA 3KIPA 4B84A 3LPDA 4DSZA 1U8YA 1JSCA 3ZJVA 1R66A 1PJ4A 2C42A 3HVUA 1LW6E 3NIFB 1Z06A 4HTFB 3S29A 1CR1A 2WF8A 2JGEA 2OPBA 1OD6A 3PC2A 1JYEA 4R7GA 3RU2A 5HKKA 1DV2A 4LS3A 3TQHA 1U4OA 1E5VA 5KU1A 5IG2A 3THYA 2QX9A 5JLAA 3H75A 3ND9A 4LCBA 3A70A 3N9IA 4JL6A 3M3DA 2PZFA 2XXJA 3AZQA 5JPDA 3ZLJA 1QP7A 4P33A 1TNDA 2BKUA 1EHIA 2Q28A 2B34A 3BXZA 5DKFA 5EE3A 3K8QA 4FMPA 4NMMA 5B1SA 3RWOA 2X4DA 4C3VA 2J9GA 2AJTA 2XTZA 4NE9A 4RKEA 5G1NA 3ZCTA 4FFPA 1XKXA 3AYZB 1DIBA 3KJQA 3C7TA 4LSMA 3DOEA 1UFQA 3K30A 1G59A 3DHYA 4HGRA 4BQNA 1DKMA 1T9CA 4TRJA 5DN9A 1UBTS 2GCEA 2R25B 3WWYA 2O0JA 3K0CA 3H13A 4W5NA 2BFFB 4K6MA 3Q5EA 5HA5A 3RG2A 1LEHA 3Q3JB 4TSFD 3W77A 1DJNA 4FDUA 4IH4A 3R75A 4R1PA 3K0BA 4RFVA 1TYZA 3SIPA 4Y1FA 5KYKA 5AVJA 1DG9A 1AKYA 3BA1A 5KINB 4DG5A 5ARBA 1MB2A 3MN1A 1IUPA 2FPMA 1DBQA 4M1KA 1M2JA 1PR4A 2FI1A 3FLMA 4OAOA 5FWYA 3RVMA 4C7OA 5JZBA 4MMXB 1AUVA 4QBTA 3G23A 4O8CA 5CJPA 1PNTA 3BA6A 3EVFA 1RQXA 4J4TA 5IKMA 1OFUA 4RMJA 1TM4E 1Q21A 1A5TA 2WE7A 4BLPA 2OZPA 5L53A 4RU1A 5KSPA 3JYPA 4OYHA 2Z1MA 3SVLA 1BDIA 2VOEA 3BMNA 4QVKA 3T34A 4DA8A 3GPCA 1AKMA 1O96A 2D3TA 5K0JA 4DR5B 2OOKA 3OQHA 5KYVA 3WXMA 2IHJA 4BECA 3AI3A 4KYUA 4MKFA 2PS1A 4MGYR 3SFVA 1QF9A 5F5XA 2GD2A 3L3BA 3G13A 2HQOA 3O5AA 3ZZMA 2BKAA 3G9UA 5ALSA 1GU1A 1U8EA 1UZLA 2BBOA 1XQWA 2VZEA 2Z2ZA 4MUNA 5KVVA 2QBYA 2SBTA 3TQCA 1SN7A 3WB1A 5ALLA 4D80A 1SVIA 2PXHA 1WW8A 2VKTA 4MUYA 3WKEA 4J4BA 1BU5A 3B3JA 2XE7A 5EIXA 2V1UA 1L8LA 2CSUA 3JARB 1I7NA 1ZUNB 3EY4A 1DKRA 3UCFA 1T5HX 4D8UA 4YBZA 4RTJA 1US8B 1JJBA 2F90A 5DHQA 5F5NA 5IAEA 3OE7A 3RVOA 3VYWA 4KWEA 3DE0X 1VP9A 1HYGA 5FTWA 1LJUA 1NFQA 1W4LA 4C4RA 4K87A 1OILA 2QRNA 3SM3A 3RYCA 1E64A 1I3MA 4MPTA 1O77A 1ZCZA 2FW0A 2Z43A 4A0SA 4KK4A 1BVUA 5DYGA 3DXFA 4RV9A 4L3OA 3DGEC 3D6AA 1NBHA 1E1RD 5EP4A 2BN4A 5F1YA 1KSGA 4D74A 4ZEXA 1A9ZA 3K1AA 4JL5A 1E8DA 1B3BA 2GO7A 3FZQA 3LT1A 1A3CA 3KVRA 4G5RA 4OBXA 1UJBA 3RUEA 3VU9B 3HN7A 1ISMA 1MDFA 3T9AA 3MCVA 3VR3D 2JJQA 3STUA 1IEVA 2W22A 3LWNA 4RTPA 1V9SA 2IXDA 1YZYA 4K1XA 4PAMA 2OUIA 2IK8A 3X3HA 4EO7A 1FXWA 1M2WA 3K72B 3STYA 2O5CA 4BAZA 1S8FA 4PTLA 1KO8A 3RT9A 2N47A 1PJCA 821PA 2XJ9A 3HY4A 3T1QA 1TQDA 1FPMA 2PVSA 1E7RA 2P9TA 4MR8B 5E2BA 2DQZA 5H4GA 3OIYA 2GM4A 4IQGA 3H5VA 4WY5A 1CVLA 3ICCA 4LYHA 5AW3A 4LF7B 1EVYA 3OZDA 1LKZA 1MTZA 1BZYA 2OCDA 2PZGA 1CF4A 3AEQB 1O58A 4WA7A 3TAXA 4LWZA 2IEIA 3QMPA 4UEOA 5JASA 4II2A 5AW1A 1RLUA 1T13A 3KZCA 1WCIA 3CF0A 3LLCA 4Q7MB 4ZVNA 3V00A 4DRXB 3CXRA 3OPNA 2W9XA 2LIPA 1WAMA 2I8AA 4FCVA 4CMIB 1TKBA 4XARA 2DY1A 1TA4A 5KWVA 2Q4BA 2JFQA 2VPZA 3A4IA 3BULA 4BBJA 2AK2A 3EWSA 3LLVA 1T0IA 5DNEA 3PEWA 1JKJB 1NMZA 4I6EA 2NN3C 1P0CA 2JCSA 3QX9A 4FS8A 6GPBA 3CLRC 1N77A 3D7SA 4R1MA 3BWEA 2B36A 2L82A 4ZICA 1C9MA 3VISA 1FDSA 3DE6X 3M6XA 4UARA 4XASA 2OORA 1DV1A 2PTGA 3QELB 4Y0AA 1PT6A 1P7CA 3GLHB 2R7NA 4Y2PA 3JQGB 3LPAA 5FQOA 1E7MA 4YO8A 3WHLA 2O8FB 3EZ6A 2DVMA 2JPDA 3JR7A 1EB9A 5EIOA 1OAKA 3QKRB 1VKZA 4O8ZA 3H5IA 4Q82A 5BN4A 1II8A 1AV7A 2PPVA 2FRDC 4NOKA 4OH7A 3KSBC 2EG5A 3OOHA 3BMQB 2VQFB 3OLXA 1P7YA 4G86A 2YHIB 3EJWA 1M9NA 4YP0A 5IFLA 3EW9A 3G2LA 4BXOB 3HM2A 5A62A 1N7IA 1BROA 1FDVA 3SHFA 2J5BA 2Y0CA 2YTZA 3MT7A 4DILA 3ISTA 5BUQA 4ACAA 4BMVA 5IJAA 2V03A 1P1CA 1CG6A 4IFIA 3GRUA 2E7ZA 3UHAA 3V33A 1VE6A 2JBHA 5B7PA 3PBKA 1CY0A 1TLLA 1DTWB 1WQ3A 3I9V1 4R2MA 4E5DA 3U4QB 1FJXA 1UMDA 2HQRA 1E2EA 1IMJA 4PHFA 2ZIXB 4R2JA 5FA5A 4IMIB 3VYSB 5KYNA 3C5HA 1IY1A 5MGNA 2WYWA 3P2IA 3NEAA 1V45E 1CETA 4R98A 5CX1B 4ZVOA 3AR9A 3FNFA 1LDBA 2ZJ2A 4GRIA 2QNIA 1REQA 1SQGA 3KUCA 1NONA 1XMSA 5KI6A 1GTSA 3AF0A 3NI2A 2EWVA 2GA9A 5A02A 5KWSA 5J5CA 3WTBA 5E9AA 2A86A 3EZ7A 5EY5B 2RBEA 1NPYA 4JUFA 2DTXA 1TJ4A 4R6WA 2GXAA 2XTNA 4EW2A 3LY5A 4JHLA 2VYVA 3TW8A 1ES9A 3CJTA 4R8SA 1A2QA 2BR3A 2DPGA 3AJAA 3N2GA 2EP5A 3PQ8A 2YW2A 3WRVA 4WBNB 2UZ1B 3RGWS 2ESRA 2O7VA 4MWEA 3K6RA 3T4EA 4LJLA 4XD7D 4EKYA 2ZQ5A 3B9RA 4HNRA 3Q7SA 4CFYA 2JZCA 3QHPA 2AN4A 3FOZA 4IIVA 4TZ6A 3SFZA 1FUEA 2C07A 5BN1A 3G0BA 2OM6A 3AM4A 1EDEA 2ZRJA 3V8QA 1TYBE 3TLMA 1OGYA 2OG1A 3EA4A 3K70C 4EHDA 1JHRA 1OLOA 1YQGA 5DBGA 3UAZA 1RFLA 2DRIA 3BD9A 3QX3A 3SQNA 3BE4A 3KSAC 4J49A 5IUKC 1L1FA 3ZKAA 2ZWIA 1YBAA 3ZWVA 3HXLA 4PAGA 3RIHA 4URVR 5ADUS 3Q7RA 5I01A 1RM3A 2KS6A 3R9IA 4ZVPA 1BDMA 2VH2A 2C31A 1XO1A 4UHDA 4DMFA 2BTEA 2G4CA 2I22A 1PR0A 1RAAA 3AU8A 2NYAA 3TCKA 2AOXA 4AZTA 3UNXA 2XZPA 4KH1A 4MITA 4FB4A 1JG1A 1YR1A 4U7JA 3T95A 2ZEJA 4MV7A 2IYSA 3BK7A 4IMJB 3LDHA 2O8NA 4YQYA 4DKXA 1JDUA 1RXVA 1EFVB 3N2LA 1Z38A 1P9RA 1YVEI 1ESMA 2RJOA 1UPAA 1C7IA 2WSYB 3G5AA 5EAIA 4EGFA 3ZVNA 3E3OA 2B7CA 4YWJA 3VR6A 4EKIA 3QH4A 1XVTA 2AT1A 4OH1A 4OMUA 1AXRA 2C7OA 3X1MA 1JI0A 1G5FA 1ZI9A 2PBRA 2R8XA 1C4OA 2VQ6A 3OOWA 1JHXA 1CJBA 1FBNA 2W0MA 4MYHA 5D5PA 3NHFA 5DCWA 1EFAA 3ZLUA 1HNWB 4QDTA 5TPWA 3V3TA 3HXMA 1S1MA 2ZYSA 1G2IA 1UPBA 2W0SA 4TX1A 1SQFA 3TD6A 2E3JA 2Q4TA 2WAOA 3W6ZA 1NQ5A 1R4MA 4OHVA 3SS7X 1DXHA 1FVFA 4OV6B 3TG2A 3AUJB 5K0SA 4KPUB 4LC1A 4FR2A 1KI7A 2DQYA 2WYOA 3KQVA 1IVNA 1EXWA 3OY2A 4MYSA 4DIBA 3G9QA 2NZ8A 5CDGA 1O6ZA 1AT1A 3HVKA 1M2OB 2QN7A 4JVOA 1HFEL 1GV0A 2JIRA 2OV1A 1EUDA 4XUDA 1Z8NA 3GP8A 2B78A 4OQPA 4JVNA 4FPXA 3PJFA 4D81A 1UPFA 5K3BA 3VXKA 3WLTA 2P9ZA 3ZOKA 1IG0A 1ARZA 5DT9A 4Q00A 3ZDFA 4DS3A 2Q45A 2HDWA 3HVJA 1NNEA 3K6SB 3NHKA 2WVAA 1AN9A 3VPFA 2X19A 3ETGA 2V5AA 3DLIA 4FCWA 3RFFA 1BXZA 5AKHA 4ER3A 4GXRA 2CN1A 1P7PA 2I6GA 2YUIA 1SBCA 1QGDA 3BJZA 5EVJA 1YK1A 5FPPA 4JLUA 1G8AA 5A5FA 5HEKA 3A3OA 5K51A 1U0TA 4IQ4A 3NB0A 2EZ8A 1DU4A 1C0LA 2CFSA 4FDVA 1G6HA 3RVBA 3VV3A 1INLA 8ADHA 1XNHA 1C7JA 4OP2A 2OCBA 2WJ6A 2FDRA 5CYPA 3WB9A 2WIGA 3FROA 1E0KA 1PDWA 2VNJA 1QIMA 2UKDA 3FRJA 5K8TA 1C9DB 1FCJA 3EIEA 2ZM6B 4HXEB 2ADOA 1E20A 3A2KA 1SUCA 4D8XA 1JDBB 4IDEA 1HETA 4NU8X 3PWTA 4Z1MA 3E9NA 4M0UA 4L0MA 2P9FA 1FRZA 3BGWA 1U1DA 4HN4B 5IBQA 2ADMA 4P0TA 3RPEA 4NCAA 4JB3A 3DT6A 2D1QA 1S01A 1G8PA 4R41A 3FB1A 1QRUA 3N0TA 2EERA 4RF4A 4XE5A 4EYKA 1HE5A 3O74A 5IAKA 3FPBA 2NQ2C 1AH2A 3FSGD 4IW3B 1N9GA 2ILVA 4TWIA 3ZJ5A 1QG0A 2B5WA 2HSEA 5DNDA 2DU8A 1P62B 2JLSA 3EQZA 3EXG1 4OA5A 4PPGA 1P0MA 4WXHA 4CYMA 3QXGA 3ZWDA 1UBKS 3K20A 3DL4A 1VL6A 3AFGA 3N2KB 5C34B 1HQCA 2H2AA 1G18A 3I09A 4EUNA 3IVCA 1IOVA 1CJCA 3PFKA 3VYVA 4CLXA 1DJQA 4Q9IA 5F2EA 3GPLA 2C5FA 1U65A 1ZD9A 3ESDA 3BGIA 5DM0A 4CM7A 2PH3A 5DYTA 2UVQA 4Q1AA 5DCUA 4YT8A 2QXUA 5IDXA 2GN8A 3QBJA 1VLVA 5DNVA 3ZNQA 1N2GA 1XN1A 1WRBA 1YASA 4F3NA 1LRKA 4H60A 3G9TA 2ZPUA 5FFFA 3CKLA 2BEUB 1U7HA 2WU3A 3OPQA 4Q02A 3JQDA 4GF5A 3PG5A 4PO8A 4M0FA 4PRLA 5FOXA 1MABB 3QHAA 10MHA 2G3YA 2GRAA 1U4NA 3QJ5A 4JFAA 1WB6A 2I4LA 1NF2A 3A1EA 5DBEX 3MWJA 5LIRA 2O57A 4XB2A 1Q1AA 3FYDA 5T6BA 4O25A 2I2AA 4DV3B 2ONYA 1HQDA 4BRSA 1PZMA 2FPWA 4F7DA 1T9GR 2C20A 2AG6A 2PGXA 1DJPA 3L0SA 4NE7A 3PFHA 2I4NA 4FD3A 1D1PA 1H2XA 1I8TA 3JD3A 4Q7EA 4B7AA 4HKTA 3WA7A 4UW9A 1ZISA 5M34A 2QVCA 1WXDA 2UZIR 4F5ZA 1HTTA 1TKRA 2WILA 2HXSA 3H17A 3PNVA 1U8UA 2W98A 3DO6A 4OLJA 4E1BA 1UZUA 6REQB 5LZ2A 1K66A 2BL4A 2JKZA 4NS1A 3R3JA 1GEGA 1NPTO 2G6BA 3EGWA 3L7AA 3OMXA 1M6HA 2C7QA 2XT0A 2EFYA 2VSYA 1X14A 4KAFA 5H3HA 2Z6UA 2VCYA 1ZU5A 3JD4A 1BCSB 1U11A 1ZGAA 3KPWA 4DPKA 3CPHA 2XXAB 1RHJA 2K2QB 1GLVA 1QUEA 1CW2B 2IKQA 2BMDA 2HC9A 3O4HA 2ZB4A 3D02A 1F8GA 1SCJA 3LUCA 5CA1A 3ZDEA 1OB2A 4MP6A 1EQAA 2I4RA 3N6RA 4HEA6 4LKOA 5E7IA 3SC2A 1Q14A 2YYYA 2ZT8A 3R3HA 4N1AA 3ADPA 2D4AA 1XEWX 1IULA 2AN1A 2JGLA 4L22A 1R18A 3MZ0A 2FCAA 2GDJA 4D82A 3W2IA 1TQ2A 1YGPA 2NU7B 4UTVA 2UUBB 2COUA 3RIGA 4JGIA 2RHDA 1YCDA 2V6GA 4Y7DA 1QF7A 2IU3A 3CT6A 3NJ8A 4REQB 2K87A 5F4ZA 4J2OA 1RADA 1EK6A 4I5EA 2VJPA 3HM9A 3FLEA 3GLTA 3KJXA 3DAPA 3EZGA 1GL7A 4L0CA 3S44A 3WGGA 1BH2A 4K8RB 2B61A 1DL5A 3G2NA 4AJOA 3AVTA 4C78A 5CCDA 4D7AA 4I3GA 1H8ED 1KI6B 2ZJFA 5F77A 1MB3A 1QOQB 3H2IA 1WPXA 2ECKA 1EB8A 4QFDA 3H11B 2C7PA 2B8WA 3B85A 4J0JA 1YK0A 1EGHA 4DUPA 4JV5B 1FU4A 1QB7A 2GAOA 2RGNC 3GL9A 5CA1F 5JQWA 1PNOA 4AICA 2OHGA 1Z0UA 3BVPA 3H1AA 4TYNA 2IXBA 3Q7IA 1Z5NA 1G5IA 1D2NA 4BNKA 2QS9A 3GRKA 1GL3A 2XLBA 1AB6A 3LHDA 4BE4A 1EWKA 2H8GA 4E1AA 1T36A 3AVVA 4NK5A 2YZNA 3W5DA 5CPFA 3WLOA 1E6WA 2G1PA 4KQJA 3T3GA 2HLDD 4QOEA 2GJ9A 4BP9A 4MW0A 3HK2A 1EFRD 1IHUA 1XVIA 4HNAB 3R9WA 3BYZA 2RKOA 4NPHA 1J8DA 4O1HA 1DDOA 4FP9A 2Y9PB 1KR5A 1RAFA 2BFMA 2WV9A 1D0IA 2XWPA 4MJ7A 3DVAA 3H99A 1Z63A 3MT0A 3OLVA 1LZKA 3DEIA 3P0IA 1V1RB 4X8LA 1GO2A 2AN5A 1IUOA 1ODCA 4DC9A 3S2SA 1RPZA 1KBOA 3L4BC 5DP1A 3WWEA 3UHPA 4IGFA 4QWMA 4GPIB 4AS1A 4OJQA 2FK8A 4AY5A 3EGDA 2F1JA 2I6FA 5KJ1A 2A35A 2QRJA 2JGDA 4G56A 1YRWA 4RSRA 3T8YA 3U37A 1O7JA 5IMSA 2Y92A 4UPEA 3P5BA 3FGNA 5IAAA 2OAQ1 1ZQ9A 5ELLA 4R0VA 2BGMA 3OIVA 2FWNA 2CNLA 4YVFA 4CI0B 1Y7PA 4O5AA 4WKBA 4E5YA 3HJRA 2V7TA 2YL2A 4H6PA 2J5XA 2P6NA 3EOBI 4I1YA 2NPFA 1TIPA 4HGPA 3HH8A 4RVDA 3DOFA 5LB4A 3T7JA 4C5BA 1JGTA 1PF7E 1YZFA 1YRYE 5FI1B 4RQBA 2HQSA 1Y5RA 3DKRA 1UXKA 5LZ8A 5J4LA 1NKVA 4JNCA 1F48A 3DZDA 3THYB 1WDTA 3MCAA 4Y98A 1YL7A 1Y63A 2CZQA 3E27A 4KE9A 4KFUA 1PSZA 2RBKA 4E09A 2JCYA 2DPXA 3I1YA 1JLHA 3E58A 4OBWA 3FFTA 3OKAA 2DH5A 3JQCA 2V6MA 1UBFA 1VE9A 3ZEAA 2WJ3A 5CM9C 3IQFA 4K6FA 3FZGA 4YRSA 5REQA 1A8UA 3TOXA 3G6KA 4KV7A 1ZOPA 3C98A 2X41A 2JZOA 4G9GA 3CF6R 5DE3A 2WRZA 1PVOA 2ZDQA 4IH9A 3RUPA 4ZQEA 4P38A 1SQSA 3NUGA 1XWIA 3D6FA 4XEHA 2B99A 5ADVA 4NARA 3ZLVA 4EGCB 2FRDA 4UQPA 2X0FA 3H9JA 1GCUA 3F0TA 4G4GA 3UJCA 5C37A 2I9PA 4L4SA 1I5OA 2YV2A 1QG2A 1I1QB 2BLNA 2OEPA 1NDQA 4TZTA 3PDIA 4H7DA 2Z5GA 4OHRA 1YQXA 1F7VA 1LRJA 3EIHA 3G5UA 3CE9A 3BXGA 4KAXA 3V4LA 2VSFA 1HRDA 1Q7TA 1T8UA 2FRVA 2GKGA 4PLFA 5HW0A 4MUEA 2FA9A 4KPGA 1X1AA 4PZCA 2ZSAA 3O6VA 4D02A 2Z56A 2W70A 3DL2A 4RM2A 2PJDA 2C2HA 3BOSA 3WAJA 1O5OA 2FN7A 3NC4A 1P4SA 2Y1WA 3LAWA 1DO8A 2FUCA 4FGSA 5JQGA 3X1KA 3K0AA 3P7MA 4B45A 1CZLA 2DETA 1BU8A 5FOVA 3CEHA 2YHUA 2L19A 2OHXA 2EHDA 3BMNB 3PNKA 4BQRA 4I7EA 4M6WA 4BVFA 3B6IA 3VKWA 3PNYA 3BDVA 1O96B 1UMKA 3IFSA 1COWD 221PA 1Q1NA 4DJJA 1JXMA 2EV9A 3MJHA 4IVNA 1C9YA 1H93A 3A9CA 3G8DA 3QOWA 1E99A 1WABA 2GKSA 1XUOA 5A4DA 3B36A 1DJOA 2CNWA 1K86A 3FR8A 4HQKA 2EATA 2GK7A 3MBOA 5T64A 3I2JA 2VHXA 1EGQA 4ITRC 1KEPA 3WJ2A 4DLUA 5SYAA 1GITA 2OO3A 2HIHA 2B7BA 3JWJA 1JKMA 4TWAA 1L5HB 1KMHA 2ZQYA 3RBZA 3NDRA 3NU1A 4RSHA 3T0IA 1QPBA 2AC4A 4M98A 1O97D 3L92A 3C85A 4U3JA 1BHO1 5JQGF 4P82A 3WHIA 4POAA 2DPYA 3R20A 1J2YA 3A1TA 3O84A 3MBIA 4CMHA 3DOUA 2W6MA 3VO1A 1MC5A 2BR5A 1V6SA 1RS0A 1V47A 4CDNA 1YJCA 2ARKA 3FVVA 4BMPB 1NU6A 3EXEA 2CF6A 1YA4A 2Q3CA 3OP4A 2RIPA 3HSSA 4JROA 2GNOA 2VNSA 3QFCA 1X7YB 5H3CA 2X76A 3T9CA 4MAFA 3R7NA 4C29A 1G2OA 2OXRA 4M1YA 4DY4A 4LDRA 3ICVA 3K96A 1DHRA 3DOJA 1NJSA 5JMOA 3ND7A 1FQWA 3HYTA 5C81A 6Q21A 1EM6A 1MG0A 1SBNE 3KOOA 2QTVA 5IXYA 1BMFA 2X42A 3K1AB 3ZK9A 2RDMA 4DEXA 2Q3JA 3O8LA 1Z07A 3V2UA 4JBWA 4BFYA 1OHHD 1LNZA 2K7ZA 2HU8A 2Y77A 1PEDA 3I2YX 2KHZA 1P2DA 3K4HA 2DPLA 3KK0A 3R8FA 1NW7A 1CUHA 4LNUA 2FEPA 4WACA 1V2GA 2XE8A 4CV0A 2I91A 2JDID 4EW1A 1JUDA 2CE7A 5BWNA 3QF4A 2N42A 1CUGA 1OI3A 3HR4A 3I5UA 2WZCA 4G0QA 5E4YA 3L40A 5JPCA 3PEVA 3Q2OA 1SQ5A 1Y82A 3KEFA 2G5GX 4IDFA 3J81A 2O2CA 3PQDA 4QREA 1VLLA 4RFLA 4M0CA 2UYCA 1I01A 1KH3A 1DRKA 3LX4A 2EWMA 4KQWA 4Q19A 1WXXA 4X9XA 2QQEA 1PK9A 3IUPA 3IIJA 5LQMA 1VBMA 3SHTA 4MUGA 3V4ZA 3X44A 4CUZA 1WCIB 2YRWA 5CT6A 2Z9CA 5FWDA 3OEYA 3KQKA 1OH7A 4XWOA 2ODQA 1N0UA 1ISPA 3M70A 2E6UX 4G01B 1OXMA 3OZRA 1JDSA 2PL5A 5D2CA 4L8WB 3GUZA 1V6CA 3IPLA 3X1JA 2QLMA 1R8XA 2ZZNA 2YY7A 4Y2VA 3UK2A 4R51A 5K0ZA 4GBJA 3IP8A 1X1DA 2CBZA 5IPFA 4OXXA 1GUZA 2ANCA 1YS4A 3IJRA 5LQNA 4JMLA 3UA3A 3VGPA 1KEVA 3LKZA 3CS3A 4IFEA 2O2SA 4MW9A 3VAZA 5G3ZA 2FNAA 1AMUA 4B4VA 4EB6B 1SNYA 4HR7A 3ZHVA 1BHJA 2BUBA 4DLAA 1M66A 2VT6A 3B1JA 2EEPA 4D0GA 4A9AA 4JQCA 1NZDA 1II8B 5BN4B 3VTZA 1YQDA 1JFSA 1EE2A 1OCEA 3LP5A 1LLQA 1RM5A 2QLTA 1L4HA 2OPHA 3STVA 1MX3A 1G0OA 1ONPA 1U1FA 2PX8A 2WWRA 2XUAA 3DFIA 3BIJA 4MRMA 3I42A 4BHTA 3QEBZ 2MIIA 2J3IA 3IALA 1HFKA 4HO1X 1SOWA 3QHQA 4L28A 1KP3A 5E3HA 2ZI5A 1EJBA 3MILA 1I7SB 4J6EA 2QIOA 2Q3MA 4C0XA 1YRLA 4GMFA 3PUHA 1OT3A 4IJWA 4TSFA 1EGAA 1ZYUA 3PXBA 5AOBA 3WY9A 1GSAA 1GVNB 4RHUA 2O3RA 4RPLA 2GXQA 3WDMA 4PYRA 4HRVA 3ZWAA 2I8LA 2P90A 4HY3A 3W1WA 1IM2A 4BE9A 1XDSA 4DTCA 1V9CA 1YR7A 4RABA 2Y1XA 3RS4A 1UMDB 1ZH6A 5KTNA 2QXTA 3P96A 3HB4X 1U9YA 1Y7LA 3EULA 1F17A 2BW0A 4Q3AA 3TK1A 1LF0A 3ES9A 1MB9A 5F1PA 3CNQS 2IW3A 3R9XA 5AD1A 1REQB 2IOHA 4QTXA 2OD2A 3HMQA 5AHXA 5K0CA 4D4LA 2C9CA 3KELA 2GHIA 3G2KA 3ZBQA 4YRJA 4Z53A 2FZGA 3KQOA 1CJTC 1HV8A 1IBSA 4UD2A 4LZAA 3FTQA 4B3MB 4IVQA 4QPJC 4ZOCA 3TW8B 1N36B 4YPFA 4Z4GA 1RABA 4P35A 4MDHA 4B7ZA 1KS9A 1XZ8A 4OX9Y 3R5TA 3ZKWA 1RYEA 1T9BA 3HO8A 3N2GB 1OXVA 1Z34A 3DZKA 3QQ5A 2V74B 4PFQA 3VSEA 4GQBA 3EZXA 2PSFA 1VMKA 1P2SA 4LFAB 2XE6A 1N5DA 1Y5NA 5DBHX 5BNIA 1HA3A 3COWA 1TGVA 4MHOA 3V7UA 3VR4H 2YRXA 2OA0A 2QG4A 5ALZA 3LC0A 4EZBA 4XM1A 1RXIA 2DULA 4NBRA 3OC0A 1MC8A 3B9BA 2NZ2A 1VHJA 3H05A 5L7TA 4EOGA 4WLVA 1L4MA 3QSGA 1SRQA 3GR6A 4R8RA 1O5IA 3IP7A 1QZZA 5HCIA 3SZUA 3ZBPA 2WMYA 2V5UA 2XAAA 3K5IA 4KL8S 5TT0A 4ETMA 1Z7GA 2WT9A 4ENWA 4Q3DA 1XDUA 4XYLA 5HKBA 1T2DA 3LF2A 1Y8RA 1GCAA 3QUSA 1ZD8A 2GUGA 2ZI6A 4WCVA 4ZCLA 4F4UA 3GLIA 3EY9A 3TRJA 1RI4A 2AN3A 4F3YA 4B75A 3FSRA 4PZUA 3TUJC 1NYLA 2FPIA 3L4JA 3PQCA 4Q03A 3U9SA 1VHDA 3I0MA 3GJQA 3PGLA 2ODWA 3PJGA 1N9ZA 4LTMA 5JAPA 4KVAA 1C0IA 2UV8A 2IHZA 5JALA 5A05A 1CJVC 4KR9A 4GOXA 4W63A 3WRYA 2YH2A 2YRFA 3RODA 1WUYA 1QFXA 1YJQA 3OUZA 2ZVPX 1IVSA 3AONB 3BTSA 5AHRA 3SG0A 4DB2A 4B3GA 3D5EA 2WMDA 2IPOA 1P80A 4IIGA 2AXEA 1BWPA 3MXTA 5B4TA 1EWRA 3B1XA 5JARA 3SDSA 4LZNA 1P91A 1PSWA 4CF6A 1EX7A 3P97A 4YK7A 5TPWB 7MDHA 4A15A 3ONNA 1NZJA 5ES3A 1K8ZB 2NZUG 1YB4A 3PITA 4KWIA 4G1EB 4UJ5A 3ZUGA 1NTOA 4Z9FA 5G3YA 1U6IA 3W6OA 1ZIXA 3BXHA 4D9JA 1AGXA 3SYNA 4XUCA 2IYVA 3C3YA 3ONDA 5GZ1A 1BGWA 1G20A 3AKEA 1B8NA 4GI3A 3GT4A 1EAMA 3ORQA 5KTYA 1UAYA 3VR1A 4AJEA 4H17A 4GAEA 5E95A 1BRMA 1EUDB 1H2WA 1QKJA 3HPQA 4GR4A 4D98A 2ZROA 5KDOA 3IAHA 3K5WA 5KX5F 4TWZA 1CRWG 1E9RA 3M1YA 1UC8A 2C1XA 2L42A 3LCCA 1ORTA 2OKGA 3L6EA 4H7IA 4Y7CA 3RREA 3U3RA 4R0NA 5TQJA 2R0QC 2KBEA 3I73A 4X90A 5FDFA 4OSPA 1HLPA 3WR5A 1FW6A 1OA1A 5BWMA 4MPRA 1K7CA 1GKUB 1JQJC 2TRSB 3HDVA 3ISVA 3ABZA 5LSAA 1V8DA 3GRRA 4IPTA 4JVMA 3CO0S 4N7RA 3NDIA 1NYRA 4MVJP 5DYNA 5ELXA 4I4IA 2WTBA 5BRJA 2TMGA 3EQ6A 3QWHA 4WZBA 3R77A 5BXYA 4G1CA 1FFAA 1QFSA 4I1UA 4M7WA 3RVJA 2GN9A 5BR1A 2HLHA 1YFJA 1PGNA 1JEQA 5GOTA 4RK6A 4JA0A 4NNPA 3A9SA 1J06A 3A6GA 3CZCA 3TECE 1G7SA 3U09A 1CUUA 1SRRA 3Q3EA 3ICEA 4R71A 1R5OA 5DHRA 1GYQA 2E4YA 2I6SA 3L4BA 3DZIA 1KDOA 4I9NA 1IXZA 1IWOA 4BP3A 4RCVA 3R6WA 3F8TA 3GN2A 4L5BA 4CNQA 4BLSA 1S4QA 2PEYA 1TZCA 3VR5H 5IU6A 4AN4A 4UFPA 2Y99A 2I1WA 3N5KA 1I3OA 4LF5B 1P75A 1SGWA 5EKUA 1NOIA 3D8SA 3X1WA 1N9GB 5FOUA 4BKRA 4DNFA 4JA2A 2DBYA 4PAQA 1E63A 3KUUA 4XA8A 1GNTA 2BP7A 2QYHA 2WUWE 3BL6A 3E5NA 4ZQCB 4QRHA 1D4FA 1YI1A 2HLNA 2WJWA 5LQAA 1RAEA 3QNWA 4BOYA 2FZLA 5KNCH 3IT1A 2HV9A 4ZT3A 1E3JA 2O2JA 3K9HA 2YNMD 4HCJA 2DM6A 4ZI7A 1O0CA 4D25A 2PQ6A 2X4GA 2YY6A 3SK0A 3N5CA 3HDGA 3H8VA 3BE6A 3GOHA 1P1KA 2CMDA 1ZK0A 2FEKA 2IEYA 5DMHA 4RZ2A 3OZVA 1LF5A 3LK7A 4TXLA 4AC9A 4OKSA 4WXMA 5HGJA 5I7VA 2H63A 2HHHB 1GM5A 2A9QA 2RI6A 3D6NB 4XD7A 3AF4A 4Q9DA 3SLKA 3SXUA 1DCTA 2ID7A 4LCEA 1UANA 3Q6IA 1O97C 3R6DA 4UBJA 1OWNA 2IEBA 2VYFA 1R6BX 1JWLA 2UDPA 1ZC4A 4Z0PA 4BASA 1JIJA 4ENVA 2DSNA 4QPZA 4FGUA 1RJGA 2AMJA 2AR9A 2ZTSA 1CK4A 4EELA 1CUBA 4IX9A 2OFFA 4C4TA 4AY3A 2IOFA 2ZYTX 2PQ2A 3IXLA 4OFBA 3RC2A 4OBEA 4QU0A 3AZPA 1L7EA 5L3QA 4REOA 3B6JA 4P4UA 2ZIFA 4AMYA 2B82A 3Q2IA 2HHJA 1H2BA 2NSYA 3A7DA 4EARA 2MR5A 1FSPA 4RS4A 4MS1B 1YMVA 1E3WA 3W06A 5AM2A 2ZU0C 2MSEB 1HDRA 3N53A 3V7FA 4H27A 2WG2A 2P0EA 3QMVA 3RHZA 3VR5A 2QPLA 3LQFA 2ZAYA 2H48A 2HLPA 2FFRA 4DCUA 4Q4HA 3N3AC 4KIUA 4NJMA 1DAHA 1CS0A 1OFIA 3D0RA 1P2BA 4P81A 4P83A 5EUBA 5A0FA 4A5OA 5B7GA 5KEIA 4YRNA 1FSGA 1KNQA 1W35A 5CA1B 1K0UA 1D9XA 2GF2A 3U7QA 1ZVKA 2Z9BA 4PLGA 4BVJA 3SC2B 3FSJX 5HUQA 2I1VB 2Y1FA 3AM5A 3OPXA 2IUUA 1P5FA 2YJ3A 4LBYA 4ZT2A 2DR3A 5BNFA 1B76A 5BV1A 3GLGE 3O38A 2XLCA 2HT6A 5HM8A 1DQNA 1RYNA 1M2EA 2GJSA 2J9FA 1PS9A 2QDKA 5F9MA 5LQUA 5KMGA 1DAFA 3DUFA 3E2MA 2HDHA 3W9SA 5IASA 3QRWA 4CR6A 2EU8A 2I4OA 1MO6A 2P9QA 4PZDA 2RHBA 4Q4LA 4S3MA 1G1MA 3ONFA 5CXSA 4YCSA 1AM4D 1BS2A 5FTLA 2SKDA 5B1DA 5I9TA 3OTGA 1G5RA 4CM1A 3RADC 3U40A 4AYXA 3NH9A 3ER8A 1DT3A 4V0QA 4OLAA 3BZWA 4GM4A 2HEIA 4LXYA 4DGQA 3OM8A 2PBZA 3CKKA 4D41A 5K3OA 1GZ7A 3HKCA 3KLOA 4LVNA 4EABA 4EL5A 1BTOA 2AK3A 4RHYA 2HK7A 4Y9RA 3EXAA 1UDBA 3RRBA 4DLYA 3H9GA 3U7FB 2D13A 2WSBA 2QT1A 3ACDA 2DP4E 3DFZA 3KZ1E 4FLEA 4UBMA 2VHUA 2NO5A 3K05A 2J41A 4QRDA 1T36B 1WD5A 3GYBA 4RGVA 5A3SA 2ONKA 5ETJA 2AWNA 3Q8MA 3H5OA 1LI5A 3DQPA 3IEMA 1TEXA 3ZGZA 2EX1A 3RUFA 5J23A 1T4BA 2FW6A 1UJMA 4P3NA 5I9IA 2OCXA 1LSSA 2MDTA 4QVGA 2Q5EA 3EFOA 2PZMA 4WKGA 2HDOA 4AF8A 4BO1A 1LPPA 4L3WA 3KUDA 1IRIA 4MMYB 4K5QA 4UVGA 4BNFA 3NG1A 1VKRA 3LYAA 2AFVA 4YPVA 2YJNA 4BLWA 1RRPA 3UMFA 3EGDB 4DNPA 1AKVA 4DY6A 2JGDB 4OU5A 1EUYA 4Z9BA 2QHXA 1RBYA 2VUUA 1GXSB 4AQDA 2NTVA 1U99A 4PC1A 2C88A 3SLRA 1XBTA 1E2KA 3TW4A 2A5DA 2BKLA 4B40A 1LSJA 1UBCA 3ROZA 3NRCA 4V0RA 2IDZA 3R2JA 4NESA 4PLYA 3ZD7A 1SHLA 5FBHA 3IP6A 2EJCA 2VHQA 2KPOA 4UMVA 3V55A 4U2KA 121PA 2NTNA 3FSGA 3D4PA 3JSXA 1SK9A 3MTEA 4J0HA 4DSOA 2G9UA 1DG1G 2H7YA 3GLUA 2WNHA 1KYYA 4LMRA 2CXRA 1GP2A 1T1GA 2Z98A 4UFOA 5FO0A 1I0IA 4MK4A 1G5QA 3SNKA 3RRNA 1SIBE 1O89A 3OFVA 3QVKA 5REQB 1UK8A 1E94E 3L7DA 3NPAA 4Q9KA 7ABPA 2YWCA 2E4AA 4YGYA 2VRCD 2FVXA 3KQLA 1P18A 2FCRA 1ENZA 1QPGA 5LCXA 2Z4TA 1A2OA 3RU3A 1SBQA 1I4DD 3PYMA 2G82A 3X1YA 4AMGA 1P61B 4CWAA 1GFZA 1M75A 1VIVA 2CL7X 2PZBA 3C87A 3F78A 3IUEA 4O4JA 4X63A 3NASA 4G65A 3SQMA 3Q8XB 3TLGB 1EZ4A 2RB5A 3OOSA 4IIEA 4HT3B 1L5HA 3PDIB 1WQ1R 4MUFA 1E3DA 3PPYA 2QAJA 3P4UA 1SBZA 3VNRA 2O05A 3HYNA 4BZWA 3AHHA 4M37A 2WQ6A 4JKIA 1ECBA 1KFKB 4IIDA 4A0FA 5L4NA 3LUPA 3PUJA 3H4IA 1TAQA 5ANRB 2HJ9A 2RGRA 1E1CA 1MPTA 2HHCA 4U5XA 2NUTA 1CUIA 4FUTA 1G8JA 5CLGA 5JQGB 1QVRA 2AEEA 3H5TA 3K0AB 5L3SA 1RMYA 1USUA 5JXJA 3VUEA 2OHIA 4G1BA 4EGQA 4J1TA 1N3YA 1NRWA 2DBVO 2EFGA 2H1CA 2YC4C 3VNQA 4DA0A 4FOLA 3NTRA 1A71A 4KOAA 4GKVA 1Z74A 2A78A 4O4JF 3LBHA 4EX6A 5JBIA 4QM7A 1U5BA 3PCTA 4BO0A 3CVUA 1ZNXA 2RGUA 4LHVA 1RU3A 1WTCA 2BMVA 2PNFA 4MVCA 1VLQA 5I9MA 1O9BA 4YFVA 1NFRA 4H1WA 1Q0PA 3OQOA 2A9JA 1EUCA 1IBCA 3IHTA 4MWOA 2VA8A 1Z7EA 3GFGA 3UA4A 1QFZA 1TM1E 1P4GA 4ETIA 3EC7A 3KQMA 1XLVA 3SZGA 4F2GA 5IH3A 2YYAA 3WFIA 1KMHB 2OK8A 1MMFB 1GKKA 5ICSA 3MRXA 2TSYB 5CLIA 4ZAFA 2GYYA 4U3JB 4TXHA 4UNQA 5H83A 2ZI4A 1FEZA 2HK8A 1ML3A 3ZUPA 5AW0A 3QVMA 3WLRA 3JPWA 3EXEB 4ENRA 3Q85A 1ZOOA 3UYLA 4DBLC 1EIWA 4FEEA 2F3PA 4PU0A 5KUTA 1KETA 1FNCA 3W3AD 5IEJA 3L8DA 4IVPA 1W5BA 1ZZEA 4YQEA 2IS4A 1QHEA 2TMDA 3WRWA 4MWZA 2J59A 3OEHD 3GZTB 1Z6TA 3SJCA 4CDGA 1NASA 2AZTA 1H8EA 4YX9A 4FYHA 3G9ZA 2QTVB 4DLSA 2CCJA 4G2NA 3Q7PA 4BFCA 4ZI3A 5CDYA 5JZOA 3W2GA 4LRUA 1CIVA 3JAKA 4RWZA 2R86A 5CYGA 3HYCA 1HGXA 2EKLA 4IDCA 2G0NA 3LUFA 1YDFA 2ZWOA 3KJEA 4MQEB 1W85A 1SEPA 3CE6A 3M33A 4FBGA 1XXHA 3I4CA 3IBTA 4KKVA 4NICA 1TCCA 1G64A 2C78A 1JEOA 2NQTA 4LNUB 3AR3A 3THOA 2ZT5A 3WGYA 3ZEIA 5BT8A 1SXQA 1E4VA 2WM3A 3CRRA 3QU2A 1XZEA 5BRNA 5EMNA 3KT8A 4TTPA 2HLDA 1EFRA 1U8CB 3G79A 3OQBA 4FZVA 4NBKA 4DMCA 4S1OA 1PW5A 1KTIA 3A9RA 2BI4A 2YY5A 4IQ8A 2V0GA 1G3IA 4DR4B 4MJXA 4UHKA 3NUQA 2XGJA 4AUKA 2C7BA 1GCIA 1NY6A 3E03A 3HABA 1QJ4A 3H4TA 4PONA 1C3VA 1YONA 1W93A 2C2GA 3T5PA 4IMRA 1C14A 3R5XA 4JT8A 3NV9A 4HFRA 4J9UE 1XTQA 3FOAA 4Y2XA 1GNVA 4AG3A 1TXGA 5A4JA 2AFHA 1FJHA 3EXG2 3FR7A 1ABBA 2HU7A 4XGRA 3H5RA 4G09A 2A58A 2VK8A 3DPSA 4D45A 3SE7A 1JMKC 3IV7A 1N2CA 3L7LA 4I1SA 4J4HA 1NUHA 3A1FA 3HZZA 4MA5A 3L8CA 5DGXA 4ER6A 2PUJA 4FHCA 4ESEA 5K8VA 3EFHA 2GD1O 1Q6ZA 2ACVA 3WLMA 2RC5A 4OI0A 4TRNA 5CXXA 2YMQA 1T3LA 3ICOA 4XR4A 4DR2B 3SHQA 4Z0NA 3L7OA 2YNMC 4EB0A 3B3GA 5D00A 1UP7A 2BELA 3DAOA 5K1ZA 4CTJA 3LUHA 5CW1A 2P1RA 4L0QA 2FKNA 5CCXA 1RPJA 4ILEA 3RJ9A 3B6MA 2XTMA 1CUDA 5AUPB 3SNHA 1AC5A 1L5MA 1O03A 4C0WA 3KAQA 1E59A 1ZJYA 4PPYA 4CL0A 3IO5A 3UCEA 2BBSA 2VTVA 3LUKA 4UDOA 3C4VA 4GKBA 1XRQA 3JYOA 4LHSA 2ZJ0A 3FCCA 1NYQA 4MYCA 2CV0A 4MR7A 3PUIA 4R9NA 4UM7A 4RGYA 4XWWA 3P71T 4R8KA 4Z1OA 2XWBF 1KPHA 1IY8A 2EKZA 3MJRA 4UHFA 4X8HA 3S7ZA 4OQLA 4DTIA 3S81A 3AFMA 2XDQA 3L0DA 1VM6A 3VSCA 4FILA 1MOZA 1VDZA 3UGKA 1RWVA 4Y2UA 1Q5PA 1J8VA 1HDOA 2OB1A 2GFQA 2YZ2A 5GPBA 5TQVA 4TKVA 4TWBA 1KZ4A 5AVOA 4YCLA 4ZGWA 4RH1A 3HL0A 3QXSA 4JR0A 1FFEA 4KUGA 3TXXA 5IABA 3RUCA 3R9XB 4TKUA 3USES 1ZW6A 1YJBA 2RJ3A 4C08A 2DQ4A 4QPPA 2ZTHA 1MO2A 1YE8A 2HA7A 2VXBA 3H2JA 5B1HA 1JQDA 1JT2A 1XYVA 2GJ8A 2A3RA 3F4LA 5JFTA 2PUFA 4LJRA 3PX2A 2OM2A 3QUAA 2Q49A 1U0FA 2FLWA 1COWA 3D5TA 1MUUA 4YCBA 1OZAA 3RTCA 1VHWA 2O6HA 4P2BA 2Z3VA 4EYEA 1G291 2B25A 2YYSA 5KYYA 5EZ6B 3GLFA 3ZKWB 1SPBS 4KW7A 4V0MA 2QVLA 2YIMA 4E2FA 2P2ZA 1KY4A 1OR8A 5FADA 4C3UA 4DXHA 1R8JA 4HAOA 2ERCA 2WU0A 1ZVVA 2HW8A 3LQKA 4PGMA 4WZAA 2LDXA 2PZLA 3ZK7A 3HU1A 1HYQA 1KAHA 2YJGA 4BP8A 5KOYA 1CB7A 4X6YA 1GKYA 1BNCA 4OY3A 5I9LA 1Z5WA 1ZSVA 4OMCA 3TQFA 3MTDA 4G6ZA 1JHUA 4ZU6X 3EVZA 3C6MA 1GPJA 5BWBA 1IM8A 5F76A 4XD2A 2L0XA 3SN6A 2IZ5A 5A1TA 3PNLA 4MKRA 4JLDA 1GAQA 5DGTA 2Q50A 3DTTA 2AFIA 1P19A 4E08A 1QIJA 3DLBA 1V7CA 4OFXA 1J2TA 1ZN9A 2P9HA 1G5HA 5EFOA 3KDAA 4TQAA 4UBIA 1YE3A 1Y8RB 4UEJA 1E3QA 1D7OA 1M76A 1PX2A 2VFAA 2YIJA 5AKJA 4LQ4A 3RASA 1PYDA 2VR1A 4EW3A 3ANXA 3MT8A 1G4UR 4GWKA 4W7IA 3SHWA 1Y5IA 1AF7A 2ZJZA 1TZMA 3B8HA 2PFGA 4E7PA 4AURA 3CQ9A 2FSPA 1DFIA 2RHMA 1Y9AA 2FPIB 1QCDA 5GGXA 3QLVC 5ALIA 4XOUA 1RXEA 1G9XA 2IYUA 4GSYA 4IH1A 3S0JA 1JG7A 3TR5A 3SYLA 1Q17A 2B37A 3C6ZA 2IPAB 4AY6A 1XXLA 3DZJA 1YJ8A 3ZJUA 2CHFA 2VRNA 1OHHA 2X8LA 3K9BA 3K9QO 2YFKA 1R6TA 1UWCA 2A9KA 4IDOA 4LHXA 3CWCA 4P5DA 3IOYA 3FY4A 4KN8A 2BGKA 3GMDA 3RK1A 3QPWA 1Z47A 1R4AA 2DXIA 5E2IA 4NAVA 5ECWA 4A2WA 1H9AA 3DDSA 5F51A 2JDIA 2OHHA 1N6HA 3A6DA 3UJ6A 2YOFA 1XC7A 1QV6A 4RNDB 3N3BC 1FSZA 1MT0A 1ZSYA 4MWSA 2GQ0A 4RELA 3T3HA 3O1LA 3NWOA 5HCNA 2DE0X 3E18A 5F98A 3C3JA 3RTGA 3ZBTA 1UJ5A 2PKCA 2QEQA 4BNIA 3AU9A 4B32A 1W5EA 5K3SA 3IDOA 5JYDA 4D92A 1XA0A 3CX4A 4D3FA 4YRBA 1G20B 1QS0A 2XMGA 3CC8A 2ECQA 4G67A 3JV7A 3QEKA 4G4IA 3H9BA 2XB9A 4AJHA 4EY6A 4TSRA 4ALMA 2HWWA 4KLRA 3WRXC 4RV5A 3QGMA 2NZYA 4YDQA 2B8NA 2DWQA 1Q95A 5EPEA 1BJRE 5J5VA 5MN5A 2W6QA 2Q1SA 2X8WA 3KKOA 4R54A 5JD5A 1QYDA 4LXQA 1PNRA 1E3LA 1XRRA 1IATA 1YHZA 1UKZA 2I4TA 3DZHA 1KDRA 2WJ4A 5FF9A 2C97A 1NQWA 4JY7A 4IRUB 2XJ4A 3B53X 3L05A 5H4HA 1GNSA 4AUNA 1ZD4A 4N7JA 3K6KA 3ZNOA 4E1VA 3JQ8A 1PL6A 2BEJA 5J3JA 5EWLA 1KVTA 4FWTA 4WZBB 4YJ2A 3EBOA 1WBBA 1CTQA 1G17A 1V39A 1YB5A 2BF4A 2OILA 3JWPA 5ITZA 1JEQB 1Y1RA 2P2NA 3D43A 1XA3A 1A9QA 1JHPA 2IIBA 2NZJA 4KGVA 2XVMA 1VZ3A 1P9NA 2RCNA 3UBTA 1DWQA 3INYA 1RE0A 1W96A 5EHNA 4K8OA 2AD1A 2PMWB 4KKXB 2CJYA 3EYAA 1PR9A 4L5YA 4QYMA 1SUFA 1JKXA 2R6HA 3PZRA 3IQZA 3DDOA 2F1RA 1Z26A 1NNI1 1XCBA 2VL7A 3R24A 4QUKA 4WDRA 3RKRA 3RRJA 2JH8A 4UVDA 1GN9A 4QFCA 3CRW1 2FUG1 4J1QA 2W4QA 3AJRA 4DPLA 2OV3A 4TYMA 1JDTA 1GFIA 1XOIA 2JKYA 4HAZA 4JENA 1LLCA 3F46A 1ZVMA 4L95C 2Q1WA 5C52B 3TCXB 3QI2A 1JNXX 1DELA 1FFDA 1GRRA 3IVGA 1OZFA 1MX9A 2B3DA 3Q15C 3R0JA 4OI4A 4JBHA 4YJ2F 1GQ2A 3A1UA 2OQVA 1TIKA 1CY7A 4V2IA 5D3QA 1M8JA 2VQSA 3ZCXA 2GEVA 3KQYA 2C03A 2MCFA 4DCTA 4P4SB 1QHIA 4A23A 2I3DA 2WR8A 2FG6C 1GAXA 3OSUA 4LJSA 2PLWA 2ZRHA 3TYXA 4IXDA 1AGNA 1FDRA 3KSRA 4DLVA 3DMNA 1YFKA 4IGKA 2A5JA 4QYSA 5EMKA 3UUWA 5KQMA 3EPRA 3A1NA 3ANLA 4OGLA 1YR8A 1G8MA 2GBFA 4RETA 5EHIA 2WSLA 4ON9A 4YMSA 5FORA 4OFZA 4BWYA 2J33A 1QHXA 3LLMA 4MB2A 5C51B 4EUKA 4BNGA 3Q3HA 4LMPA 1U2PA 1D7AA 2F62A 4JYBA 1UKEA 2O1WA 4XFKA 3SXUB 3T3EA 1KI8A 2WLSA 3AX6A 3O0DA 2H85A 1PHRA 1Y34E 2J67A 4D6YA 2FMXA 4ZYUA 1GTZA 1R5BA 3IPCA 3UV7A 1XZLA 2D7DA 2PJUA 2W6OA 4L8GA 4F38A 3RHSA 2VXYA 5I7FA 1NVKA 3HWSA 4MKGA 4QEZA 1PTJC 1L4KA 2IP2A 5FV7A 1OI2A 3RVPA 3EUAA 4RD4A 4ND7A 3OIDA 4IHAA 2HPAA 3GA0A 5L95A 4HEQA 4CKBA 3PNQA 5IBCA 4IRXA 2Q6OA 2UUAB 1YA8A 4FI3F 5ALWA 5L3QB 2VJNA 3BMOA 4UE6A 2HRDA 3P94A 1XZKA 3GNSA 2ZRNA 4B2IA 4IV0A 4NBUA 2XB4A 3EEOA 2QX8A 1WPRA 3PSAA 2ZM5A 3ZH2A 2WP0A 5F4BA 5EXDA 1E3WB 2OO7A 3TAHA 3FTFA 3LNCA 5A4AA 3UJNA 5DULA 1PLKA 4L85A 3B6ZA 3C6KA 3KT6A 4D9NA 2VF2A 1OB5A 1UDAA 2AXQA 3QVWA 4Q4HB 2A3NA 2BHLA 3GJ6A 5DW0A 1YIAA 3FJOA 5EVCA 3C1UA 3S28A 3T0GA 1WPGA 1LRLA 5CNKA 2HBYA 4OXIA 3Q98A 1MOSA 2VWHA 1T6NA 1FP6A 1ORVA 4H7PA 3PQ7A 3Q8KA 1U8ZA 2QROA 4V38A 3HPRA 1L3CA 4P84A 3F7TA 2QTCA 1RM0A 2E5LB 4E6EA 1GSIA 1U28A 3OX4A 1T3HA 5ENZA 5FT9A 1FFXA 1PL0A 1P8JA 1IUNA 1JIQA 2UVPA 2BKXA 3VNSA 4Z4HA 5BVGA 3TGLA 4NABA 3R8CA 5KQPA 2PN1A 4H1UA 1SXIA 2XGOA 2O0KA 1G5PA 1BVRA 3CEAA 3CZMA 1VL8A 3LDGA 5LLTA 3V5NA 1HX7A 4G0ZA 3DUFB 2JFFA 4Q9JA 4LE0A 4B44A 3JQPA 1KL7A 1JP7A 3S1LA 4CF5A 2ZWMA 2FEWB 5F9FA 4NZZA 4A10A 1XZBA 2PA3A 3DDWA 5LU8A 5IRCD 4QODA 4H08A 4UU1A 3NBXX 3K4QA 1WX1A 3TLJA 1PQUA 1Q7BA 3KJNA 3QYFA 4ZMBA 1BWSA 1E2LA 1EMDA 1ZK3A 3HKCB 4Q9HA 2H9IA 1T2NA 2NG1A 2VAXA 3KKKA 3LW7A 4G63A 1PIWA 4GR9A 4KO2S 4EFLA 4ILKA 4J90A 3UFBA 2FOXA 2V58A 3BUSA 4U5QA 4HQLA 5FHRA 3ZHYA 2JVKA 4Y2QA 3H16A 1U3VA 3BSSA 1GQQA 4FQ7A 1CS4C 2GBLC 2OXFA 1LW7A 2OV6A 4E2WA 1BVHA 3BGSA 3T9FA 1I94B 2VPIA 3AR8A 3OPYB 4N8EA 2ZJ3A 2D0OB 1HT1E 2AC2A 4P3PA 1XNRB 4B6RA 1EP1B 2H1OA 4X1KA 3UHFA 3A6KA 1E4OA 1G4AE 2Z95A 3EFOB 1J0AA 3QUTA 1X38A 1Q6YA 4CVNA 4M1MA 1CP2A 4RTQA 2XQGA 1P2UA 4HP8A 3TTTA 1DCKA 1IUKA 1WTAA 1U5CA 4U39A 5G40A 3REFA 4AP6A 5KKCA 1N6IA 1M0SA 2G7MC 1I36A 2ZKIA 4OP3A 4XOIA 4BMXA 1CY2A 3O8CA 3HO6A 1X9HA 1U1IA 1TQHA 2KWIA 1CY4A 3LC2O 1J00A 2V6IA 1Q7EA 3RARA 1ZUD1 2OC4A 4KB5A 2WIFA 5JS7A 3OIUA 4ZQIA 2AF3C 1C8BA 4ZO6A 2ZRMA 4AG5A 5D8DA 4ZZ3A 3NHPA 4TLCA 3HZOA 1B4DA 4AB1A 1VYUA 3X1DA 2C2KA 5EMJA 3O4FA 3RJMA 1CNFA 3WIDA 1VMAA 3CFYA 1RT9A 2CDNA 4Z99A 4ISCA 5C3UA 3WYFA 4B85A 5ESWA 5AQEA 4CM9D 4D4IA 4IZ6A 1IK6A 5DISB 4EP1A 5IM4F 4C2TA 5ER6A 1FTSA 1IG3A 2O20A 2AJDA 3IT2A 3S6JA 2XF8A 3KQUA 3IOMA 2E4XA 3W0LB 3OECA 3WL7A 2YNMA 1EJ6A 1ISSA 3FF1A 1H0KA 2WM8A 3OG9A 3I01M 3NOQA 1IDOA 2ZS9A 4L6AA 3NW9A 4F6LA 1LQUA 1JFTA 2HMAA 1UWVA 2VKQA 3P0JA 4HB3A 4O4JB 3VNBA 1W6RA 4F04A 3EMKA 5CR9A 1XL1A 5DLEA 3GFOA 4W1SA 1NXSA 2DHEA 3WMFA 4QEKA 1VZ2A 1BWQA 4QATA 3WLQA 2YCBA 1UXIA 4RY8A 4YB8A 2Y6VA 2NPIA 1NVWQ 3R40A 1T3GA 1YQWA 2XQVA 3WMWA 5LU9A 3T1TA 4CN8A 5KAPA 5GOZA 4OJNA 1DEAA 1E1CB 1U31A 5FOTA 3RG8A 2VDKB 3K73O 3ND6A 2NVUB 1A9SA 5MHTA 3QTTA 3ZIUA 5L3SB 4O4HA 2JFWA 2EWWA 3AKCA 1ZUWA 3SBOA 4K6HA 4Y2RA 1M7BA 3FTEA 4HNUA 5LIPA 1EFUA 1KZ9A 3G2QA 1S1CA 3BRWA 1O9GA 1YZGA 4MP8A 4IEFB 2B1GA 1B0PA 3TRDA 1U5BB 1XZAA 4E5MA 3HXOA 5JWOA 2G5TA 3MRVA 4G85A 4FR5A 3TR6A 1FSFA 1JEYB 3FUWA 1Z7WA 3Q88A 3LNTA 3UJ8A 3QE9Y 2QI9C 3QA3E 4S1TA 2Y67A 5AKLA 1ENPA 1QONA 4NHEA 5THQA 4QASA 2DWOA 2X2PA 4L6CA 1NLZA 2IXAA 1WNFA 5ECDA 3RNLA 1YF3A 4TLLB 1WV0A 5ESDA 4DA9A 4WFKA 2YJ5A 2ZE7A 1N4DA 2QM3A 3RH0A 5AJVB 3WKCA 3H0KA 3AVUA 4HUTA 3ZX4A 4O4HF 1Z29A 5CVDA 5IF3A 3N2EA 3PS9A 5HMMA 4M1EA 4C06A 1EXVA 1EWQA 1S3GA 1G7CA 4BO7A 3GD7A 2O07A 3IHLA 1PT8A 5KCZA 2W2PA 2PRYA 3K2QA 2WVGA 1VI2A 2WUVA 4LWQA 3ZY6A 2IYNA 4DJEC 7AT1A 4X7MA 1N5JA 3KO8A 1XP5A 4FTWA 2G77B 2GPTA 3EGXA 4KPFC 4WMLA 4RQAA 4J1SA 1XA4A 1J0CA 2EQAA 2GETA 2ZR0A 4S35A 2Z6AA 1RYBA 2DKOA 2CLCX 2EL9A 1KI9A 1HEUA 2PL1A 1SKQA 1M1YE 4L50A 4ZK2A 3FPLA 2HUPA 1LJ8A 3BWXA 5JAUA 1OJLA 2VP4A 1ZAYA 1TF5A 4LQCA 2P2DA 4GQAA 1YVUA 5DTRA 1AG9A 4FU0A 1W85B 4R2HA 1XXHB 2FZ5A 2OV8A 4LJ9A 4D9EA 4RJTA 2O59A 1UBGA 4FDMA 4RQTA 5CB6A 4CLHA 5EZQA 4EG8A 2C96A 2G63A 2P30A 2UAGA 3ONVA 4NCJA 5EGSA 2ST1A 3C8UA 5FJJA 3ELYA 3MS4A 4IDDA 4Q48A 3NAMA 5ISMA 3N8KA 1RTTA 4OM7A 5AIAA 5HR5A 3L18A 3H9EO 2YMPA 2YQ4A 4MQBA 2O50A 3VUFA 3TTSA 4BN4A 1MV5A 1WKBA 3GH1A 1H4TA 4DANA 5JZMA 1E9FA 2R96A 3NTLA 4O6VA 1RBZA 4PCAA 5IBPA 4YAWA 2WEKA 2UYHA 1JFRA 4RK4A 1SXJE 2WKQA 1A76A 5TT1A 3H04A 3KKZA 2Q6VA 4BVEA 1M5RA 3I3SR 5LZ7A 3F2VA 3OQMA 1O0SA 3LXRA 3OTQA 3TRFA 1N2CB 1U0EA 4ZZ0A 4A7PA 1K7YA 1Z6AA 5BYJA 1E2NA 5BQFA 1K6JA 1EX1A 4XIYA 4HTAA 3L7MA 3DEKA 3WRXA 4XSGA 3T7AA 3Q9SA 1KJYA 4JSYA 1NVGA 4LDNA 1XTPA 4RZHA 5BW4A 2GBGA 5J2UF 4FGKA 2ECOA 2I1QA 1MO4A 3R7SA 2F7SA 1SC1A 4BNYA 4BPRA 3AK4A 1OF1A 5BQ5A 3C3MA 1QQ7A 3DB1A 3G7UA 2V3VA 1V1JA 4RIGA 5BQXA 1QV9A 4MAAA 1RHQA 3QFHA 3L1UA 2A1UA 3I64A 3N8HA 2ZQZA 1OFUX 2F48A 1KI3A 1FPQA 3MWLA 3D7LA 1MXFA 1TPZA 3CUSA 1QGOA 3WJAA 1T0UA 4PZEA 3GT0A 4IY1A 2JLZA 4X7PA 3O21A 3TTVA 1GR0A 4QKQA 2Z5LA 2NO1A 3FFWA 2QE7D 4MR7B 2JIBA 4RANA 1E2PA 3HJTA 4BQQA 4AYTA 2ZUVA 3E9RA 1KJZA 1F5NA 3O4VA 1C9EA 2EKDA 1R3UA 2PY6A 2EKBA 4IR7A 1L5FA 1RXUA 2J7PD 2V7BA 2EYUA 2O3QA 2XDQB 4HVTA 1CD5A 3E3AA 3NT5A 4DM7A 5BSEA 5KQGA 2PRZA 4LJKA 1I2AA 1E60A 2DOKA 1Z68A 3CT4A 1WZUA 1QHNA 3MELA 2KYRA 3NBUA 4TKVB 5FI5A 1MORA 4FFLA 1HE3A 3I8SA 4AS2A 4P7GA 2Y1DA 5BOSA 2P7IA 4KQMA 4H6XA 3EEQA 3D81A 5HIIA 5IT5A 4TKUB 3WBFA 3AV3A 3LY9A 3SPXA 4DCNA 4DJDC 1NC3A 1NMQA 3PWZA 1XN4A 1GNLA 1OH8A 4GM0A 2XQIA 1KO4A 2YJZA 3FX2A 4QU8A 5D87A 3DGFC 3IVMA 3OWOA 1MG5A 2WAMA 1Z4LA 3PXEA 5AO9A 1V4VA 3SU8A 4ZYWA 1C2TA 4DIFA 2QUZA 3UT5A 4U4AA 1P6XA 1E5XA 2R6FA 5BUZA 1CUXA 3LWBA 4N3BA 3WMEA 5KYYB 1IHPA 2HBQA 2QRMA 3EARA 5F12A 4HPJB 2MYTA 1RWWA 3GQBB 1ACJA 1HLFA 3M34A 4KQ6A 4J3NA 4Z4CA 1YD7A 2G04A 1C1DA 1DAIA 5AVWA 3ESZA 2QKYA 4J29A 4WZAB 1JEJA 3U4IA 2WFAA 4I3FA 4ZAXA 4B7CA 1D5CA 3HBAA 4XPIA 2BSQA 1H22A 4M1QA 3U81A 3UW1A 1PE0A 1XCJA 2H0RA 4R3UC 4O0MA 1B6SA 4F2WA 1SWWA 1JHVA 3SYMA 3KV3O 2I03A 3N76A 5ADWA 1TJ5A 2ZSEA 1WXHA 2A88A 5EFZA 2W6CX 5IT9A 2JFHA 3ZW9A 2AFIB 3IJEB 3E9QA 3ORHA 3TXYA 2RAFA 3VDNB 1ND6A 3GNQA 3QLUC 1PTJA 3H2KA 5H7XA 3AVQA 1DWOA 5HIJA 3GLIB 1TVEA 1V16A 3R0IA 1Z2DA 3D4LA 2AEMA 1Q16A 4MRNA 4RZIA 4QL3A 3DMRA 2QR2A 2AWOA 3FMGA 1L6RA 2COKA 3VDQA 5KTSA 4QT0A 3HVRA 4RVOA 1XTRA 3UUGA 2DFDA 3LV8A 4UTRA 5HUJA 2ZRAA 3A2LA 3D64A 3OEHA 4I36A 4M9UA 5JCOC 4H31A 4LNAA 1OREA 2Q5HA 4RVFA 3ZS9A 3UN1A 4BLUA 2NO7A 3URKA 3GBSA 4BL5A 1EFLA 1M67A 4G9EA 4C7MA 4DJ5X 1UOEA 1V8OA 4NV0A 5DZSA 4I4CA 1GTG1 4Q4DA 4ZEVA 5HQTA 5IX8A 1SEVA 3HN2A 1CQPA 1T1SA 2C4KA 3H2GA 3SBEA 1ZL0A 1SZDA 3OF2A 1J70A 1SMKA 4NMHA 3GGOA 4RZUA 4WGGA 2BISA 2OP0A 2P11A 4UNIA 1OA0A 2X4IA 2EP8A 1K7FB 4A73A 2ZZMA 2EARA 3PC7A 3KSZO 1IM5A 5ALXA 2HA6A 1ULBA 4C6SA 4MJ3A 1K2VN 1PVVA 5MDHA 1XG5A 2OGTA 1YL5A 3BXOA 3FWNA 2W6JD 2BPOA 4FFDA 1A8SA 1SA0A 1G98A 1DWPA 1YBHA 2D0DA 3G0DA 2VPWA 3M6MD 4MQ5A 3NHAA 4UXJA 4ZEOA 5LYJA 3VVMA 4NYIQ 3G5LA 4U8HA 4QPNA 1WCXA 2Q3HA 2PUBA 1QS0B 2X0JA 3PEUA 3ASVA 4PXYA 3MMNA 4H3HB 2DHQA 4QTYA 5AOCA 2JGNA 2QMYA 1K7SN 2BFCA 4BCCA 1DX4A 1QH1A 1QZTA 2GDZA 1F1JA 1EP2B 1GVHA 1RWQA