4NQZA

Crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in apo form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
248
Chain Sequence
GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystal Structures of Pseudomonas aeruginosa Enoyl-ACP Reductase (FabI) in the Presence and Absence of NAD+ and Triclosan
doi rcsb
source organism Pseudomonas aeruginosa
total genus 82
structure length 248
sequence length 258
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nqzA00
3GEDA 4J1NA 4TKMA 3VTZA 1RKXA 4J1QA 5CHEA 2W2KA 3LSYA 3PPIA 4LN1A 4YR9A 4J91A 5CDSA 1E6EA 2GPTA 1T2AA 2ILTA 5LDHA 3PDUA 4UEJA 3IJRA 1Y1PA 2YUTA 4J49A 3CTMA 3KVOA 3BMNA 1PJ2A 3G0OA 1A71A 3F4LA 3BXXA 3R3SA 4ZICA 3GAZA 1R0KA 1QORA 3PXXA 4KQWA 3JYQA 4X54A 1LRJA 3LT1A 4HADA 2HJSA 2HK8A 5KNLA 4GAEA 2G17A 4WKGA 3ANLA 2ZB4A 5C5IA 2Y1CA 3QQPA 3O8QB 1U3UA 2EHDA 3OQ6A 1EBUA 5JAIA 1B14A 4B7XA 3NDIA 4A10A 2IZZA 3QE3A 3HQ4O 4AG3A 4OJNA 2OOSA 4WNCA 5COAA 4WUVA 1I2BA 5EL0A 4EJ6A 2X22A 1PZFA 3IP1A 4IDEA 5K6AA 2Q46A 1HYEA 2WM3A 4OXYA 4BGIA 3H5NA 4K6CA 3PZRA 1NXQA 5FFFA 4EW6A 2ZB7A 4EUFA 4NNJA 4U0KA 3ZW9A 3JYOA 1NPDA 3RJ9A 3I4FA 1YBAA 3UXYA 1BXZA 4GH5A 4IDAA 4EGFA 1TXGA 4Y9DA 4Z3KA 1LRKA 2VN8A 3F1LA 4XEHA 3AI1A 4Y98A 3E48A 1A5ZA 3FR8A 2Y1OA 4NBRA 2VNSA 4O5OA 5DCYA 3AK4A 1E3LA 1DEHA 1PGNA 2NVWA 1DFIA 3WTBA 3RQSA 2C29D 4CM7A 4YJGA 4DLLA 2C07A 4BMSA 2W2KB 4KWHA 4YT4A 1BSVA 5FEUA 3VH3A 4GX2A 1QR6A 2V6GA 1F8FA 2O3UA 3E9MA 5I7VA 4CMGA 4RL6A 2X5KO 3AWDA 2DUWA 1P1IA 1B15A 3BMNB 5A3JA 5B4TA 3QA9A 1C0PA 1DIAA 1KEUA 3LLSA 4JQCA 5DBGA 4F3YA 2IXAA 1HSOA 3GG9A 5JY1A 3FNEA 2UAGA 4A73A 1Q7CA 3Q11A 3TOZA 3B1FA 2WE7A 4TMFA 4TRJA 2OBYA 5JY6A 2B35A 1H5QA 1Q0HA 1TT5A 3X2FA 1C1XA 1E7QA 2YHIA 3WJ7A 4JJFA 3JQEA 4U6QA 3JD3A 3QWHA 1O89A 2FR1A 3HNPA 3R3JA 4CR7A 5L95A 2G1UA 4E5PA 4CLEA 4R9RA 4EYEA 4L8VA 5GY7A 2WDZA 4QO8A 4J0FA 1JW9B 3HDHA 2GN6A 3C3XA 2J5QA 1DIGA 3N74A 4IDFA 1T4BA 5KJCA 1LU9A 5T8KC 4DLAA 1CERA 2JD0A 3W8DA 1GUFA 2O23A 4DMMA 4Q3CA 2FPPA 1RJWA 1FDVA 4WGGA 3GH3A 4XYEA 3H65A 2D3TA 4LGVA 4O0LA 4WPGA 4DIOA 2PD6A 4LVUA 1LEHA 4CMKA 3Q9UA 2ZK7A 3O03A 2O50A 1AE1A 4YAIA 1UXKA 5IZ4A 2W8ZA 5JMWA 3FBTA 4G65A 3RUIA 4WK6A 4EDFA 2YW9A 4LRTB 5LDGA 3P5SA 3WFJA 1B8UA 5H81A 1YXMA 4WEOA 4F46A 4GI2A 4D42A 4ITUA 1WDMA 2R00C 1J4AA 1TB4A 4BHTA 2X0NA 3EYWA 4XIYA 3DOCA 4D45A 2D5CA 5B4VA 3BMQA 4LRSB 3DC2A 4J9UE 4ALJA 4U7WA 1I36A 1DFHA 1PJLA 5DT9A 1IULA 2QG4A 1C1DA 1MGOA 2NWQA 3JQ9A 4ND3A 3WGIA 3GFGA 3DTYA 2CMDA 5G0TA 3H2ZA 3GN2A 3GHYA 1TT5B 3OIGA 5IG2A 2YHIB 4PRLA 3BZUA 1HDOA 1NR1A 1YOVA 1T2EA 3E5MA 3ZNQA 2GR9A 1ZEJA 1SBYA 3SJUA 3WGHA 3GR6A 4TZTA 3QP9A 1K89A 2G82A 1AN9A 1IPEA 5F3RA 1U3VA 1V0JA 4I08A 5EIOA 3OA0A 2IE0A 3CKYA 5AOVA 3W6UA 4LISA 4AJNA 5CFZA 3U5TA 3NUGA 1P0CA 4XYMA 1WLYA 1I33A 3DMTC 1ADCA 1K6JA 3K5PA 1V3UA 2V6MA 3WDSA 4HV4A 5DN9A 1WMBA 4R9SA 2A94A 4EBFA 3JQFC 3FCOA 3RC2A 1FXSA 3QHAA 2O48X 4EI2A 5CPFA 1EK6A 2VT3A 4M89A 1EBFA 2VYVD 2FOIA 1BTOA 1QLHA 4IJKA 5EQFA 1Q0LA 1PEDA 4EUHA 3GGGA 4MIEA 4GMFA 2PV7A 3GVIA 4CMAA 1ULUA 1XU7A 1PS0A 3NJ4A 4TVOA 3RFTA 3IL2A 1KS9A 2QYTA 4MPDA 4Y8VA 3BMQB 3UAGA 2VRBA 5AQ1A 4HXYA 1VM6A 1JLLA 2UV8A 1H6CA 2VUSA 3DZIA 5TX7A 4BQPA 3A9WA 4XQEA 2V7PA 3I1JA 4WLNA 3QVTA 1C1DB 4NDNE 1G6KA 4ZN6A 2JCXA 5EJ2A 3KB6A 3Q2KA 3I9MA 4IJUA 3VVCA 2VHZA 4K28A 1W73A 5GMOA 2IEDA 4CMEC 4I5DA 4WOKA 1ML3A 4PN3A 1QG6A 1YOVB 1ZSYA 1JQBA 1DPGA 4UEOA 5EINA 4UVEA 3TQHA 4TQGA 3UUWA 4BNFA 2UDPA 4Y6RA 2I66A 1EVJA 3JQDA 3C24A 2B4TO 4W9NC 4C7KA 4EJMA 3DBLB 5AYVA 1E1NA 3ENNA 3HB4X 5GZ3A 6ADHA 2OXIA 1T26A 3ST7A 5A5EA 2PGDA 1E7YA 1BG6A 3HN7A 4LK3A 2WE8A 1UZMA 4DC1A 3IS3A 1PL6A 4W99A 2OL4A 3TL2A 3W1VA 3ZWPA 5HRUA 1Z82A 4BNXA 4CUKA 1N2SA 1PQUA 4DTIA 3FPLA 3RFXA 4RVUA 1DBVO 5JDIA 2WMDA 3IC5A 5HA5A 1FF9A 5THKA 4BNZA 4BNKA 3AUUA 5KVQA 1X1EA 3FWZA 3IP3A 4E13A 4YJDA 4MVJI 4PG6A 4PLWA 1JKFA 5TJHA 3WR5A 1LDGA 4ZGWA 1QV6A 2YV3A 4KTVE 1HT0A 2ZJ1A 4AJ2A 3P2YA 3PHIA 2G76A 2V65A 2X5JO 4OOFA 4YT2A 5CAEA 3M2PA 4KUHA 3ADPA 1PJQA 2DTEA 2Y1FA 1QSGA 4E6PA 1P0FA 2X1HA 4FW8A 3JYNA 4DIFA 4XJTA 4YB8A 2HDHA 1KVRA 4BS9A 4YACA 4BMNA 3I9OA 1GL3A 3D3WA 3E1KA 4M87A 1C0IA 1LA2A 4FFPA 3WYEA 3VTFA 3QIVA 2QYSA 4FS3A 1HE2A 3EAGA 3PK0A 4QT0A 3ZWOA 2JCVA 2JFFA 4NJMA 3KSDO 5TGDA 4DRYA 3AUTA 2AE1A 5TC4A 3T7EA 1EQUA 4IMRA 1ONPA 4FSHA 1PJ3A 5CDUA 3ZU5A 5AVOA 3QVSA 3LT2A 4OQYA 5JPIA 2YY7A 3INGA 9LDBA 3OM9A 4H3VA 5IZCA 2BF7A 4R69A 5IDQA 4LCEA 1CETA 1Q0QA 2Z95A 4OSPA 3IDSA 5K6AC 3S2EA 3WGYA 2NNLD 5EMHA 1SMKA 4OYRA 1RM4A 4Q3NA 1RM3A 2ZQYA 3BAZA 5BSFA 2GN4A 3K30A 2QZZA 3V1UA 3WQSB 1JN0A 3K9QO 3EVTA 3TZ6A 3ZU2A 4BNLA 2QZ9A 3K73O 3C7AA 3CH6A 1SOWA 3LQFA 3MEQA 4G2NA 2EW2A 3M2TA 5A9TA 4DREA 5I8WA 1WDLA 2I76A 4ZA2A 2Q2QA 3ROQA 1LXCA 4DC0A 3EC7A 1GTMA 1W4ZA 3JQCA 4CM1A 2WTBA 1KVTA 4L9RA 4BNVA 2NQ8A 3PJEA 3AU9A 2O3TA 2JJYA 5DCWA 2E49A 4E3ZA 1NAIA 3EZYA 4AVYA 3FWNA 4L74A 1MG0A 1JVSA 5BSGA 2Q45A 1NWCA 4KDEA 2LDXA 3TL3A 3TSCA 2WYUA 2O4CA 4RDIA 1DC5A 3ONEA 3MWEB 3D3WB 4IMPA 2OFPA 2AMFA 1DC3A 2CY0A 3A14A 2CZCA 3ITDA 3KV3O 2EGGA 4NJMB 1PU2A 4BGVA 3U3XA 1ADBA 1HDZA 3RCBA 1QP8A 1ARZA 3Q1LA 1IB6A 2EW8A 3GK3A 1DDOA 1H6BA 3C1TA 2B37A 3V2HA 4UAGA 4U6SA 4DUPA 3IKVA 3WYBA 2B83A 2DT5A 3AI3A 2NTNA 3WWYA 1NP3A 3S55A 1TI7A 4PG7A 2IZ1A 5JDCC 4BL5A 4XKJA 1UDBA 2D8AA 2EIHA 4N5MA 4BNJA 2B36A 4OGWA 3QSGA 4MVJE 4J43A 3PVZA 3N58A 1BVUA 2EP5A 3BHIA 3I9NA 3NEPX 1UUFA 2VYND 1PGJA 3A06A 4ZRMA 2HQ1A 4B8WA 3ENKA 2GN8A 3GDFA 2HLPA 2O3JA 1PZHA 4MP8A 4RORA 4DLBA 1VJ1A 3LT4A 4FCCA 3V8BA 3JD0A 5IN5A 3TN7A 3DBRA 5DCUA 3GDGA 4GLLA 2ZTLA 4CL3A 3STHA 1YONA 3DB2A 1ZO8A 5A5FA 5T8KA 5TT0A 3GDOA 5DBIA 3ONFA 4H15A 4IPTA 1KVUA 1LC0A 1ZEMA 5T67A 4BKPA 4BNWA 4CM9A 4JCOA 5JW6A 1LRLA 1MC4A 4WLFA 1MXHA 2VUUA 4OSOA 3ROMA 5G0SA 5MGBA 2I67A 4E5NA 1ZMTA 3H6KA 4D43A 1ZK0A 3FNHA 3KO8A 3O4RA 2X4GA 2ZCVA 3GVCA 3LYLA 4MVJF 3K8ZA 1HDRA 1XDWA 3U9LA 1ID1A 2PH3A 2R00A 4IM7A 1YL6A 5FI5A 3T4XA 2D59A 4YTEA 3EDMA 4PIVA 5ER9A 3ITKA 1GUZA 3H8VA 3PHHA 5F1OA 3S2IA 1NQTA 5I9LA 1X13A 5ES3A 4MVJA 1LDEA 4NMHA 4FOOA 3PJFA 2SCUA 5JMPA 3MJTA 4QO7A 3PGXA 3OHSX 3GEGA 1ENYA 1U8FO 1HE4A 2JFHA 3ZV4A 5IXSA 3RU9A 2FSSA 4XR9A 2UUPA 1B2LA 2YJZA 2Y0CA 1HE3A 2WWRA 2O3QA 2D5AA 3JD2A 3QWFA 3UCXA 3OJFA 3UICA 1R4NA 2DU8A 2EEZA 2XXJA 3WFIA 4L75A 1QYXA 3H9GA 2YYYA 4PLVA 3TJRA 1H94A 1NBOA 5C37A 4IDBA 2W90A 3DBRB 4IQGA 1BDMA 1BWSA 1MB4A 3JQBA 3KM0A 3VDQA 1LQTA 2JD1A 3MTGA 2VWPA 4I5GA 4NI5A 1GPDG 2GZ3A 5JLAA 4E21A 2HRZA 1YWGO 3VH4A 3ADOA 2Y0EA 3DMTA 5G0UA 3RAJA 3AM4A 4FGSA 3S2GA 3CXRA 4R1SA 4CLDA 3AY6A 3UCEA 1YQXA 3DFUA 3JQFA 2Y1GA 4RF4A 3D64A 1YB5A 2DBQA 1T25A 1VRWA 2QX7A 1B26A 2ZIZA 2O7QA 2NU7A 1HYHA 3ZHXA 3I6IA 4OAQA 4KWIA 1AGNA 1LDBA 1AXGA 1RYDA 4BNIA 1T2CA 1JKIA 4EEXA 2P4QA 1SEPA 4R3NA 2C5AA 3RBXA 3MJVA 3ABIA 4D46A 4QFDA 2HSDA 3UKOA 1EE2A 4RLSA 5IXYA 4IJVA 2EG9A 5L45A 3L77A 1ZMOA 3WTCA 1PWXA 5ITVA 1XIVA 4Z3DA 2OBNA 2AA3A 4PLYA 1O9BA 1Z73A 1CWUA 2YFHA 2FHSA 5BR7A 5HWSA 4UVGA 3LZ6A 1PGPA 4E31A 1VKOA 4JP2A 3VZSA 4YQZA 4OO3A 3H9JA 3TPCA 2E4AA 4CMEA 3LVFO 2PTGA 3AOGA 2PNFA 3OQBA 4IBOA 4M86A 3UF0A 3ZU3A 5JDIC 1DIHA 4TROA 4WJZA 2FPGA 3KRTA 1R4NB 2Q1SA 4DYDA 4IIUA 4ROSA 1EEHA 4UREA 4S3MA 4NIMA 1LLQA 4HFJA 1GZ4A 3VZQA 3WSWA 5KKCA 4B3JA 4FB5A 1M6WA 2JD2A 1SEVA 3OEYA 3DQPA 1LBEA 3NTRA 4E5YA 1UAGA 4IY1A 4UUOA 3UW3A 3BTSA 5K9ZA 1C3VA 2Y93A 5K0ZA 4PLFA 2I65A 5JCJD 1BVRA 1VI2A 1GPJA 3HSKA 4DL9A 3GN1A 3VOSA 5TQVA 1VL8A 3SX2A 3EGOA 1IYZA 1ZCJA 3T7CA 5CG1A 4BUCA 3KZVA 4OM8A 3WICA 2Y0DA 3FI9A 3LT0A 4ND1A 3SEFA 3AM5A 4UUPA 4NFYA 4KZPA 2Y1EA 1YKFA 2HJRA 5GZ6A 5L3ZA 4W82A 1F12A 2J3HA 2NVBA 4FFOA 8LDHA 1OI7A 5AXDA 3ZNOA 1Y8QA 3V5NA 5IZCC 1UXHA 4IDCA 1GCUA 3IKTA 4K9DA 5B4UA 5T64A 5G2OA 2NSDA 3VPXA 1F8GA 2NM0A 4MKXA 4YT5A 5CDGA 1YB1A 3DONA 1YL7A 3L9WA 2DVMA 5H83A 2HUNA 2F1KA 3NGLA 5TIIA 4CJXA 5L4LA 3OQ1A 4XX0A 4YBZA 3AUSA 1A9ZA 1PJSA 1U3WA 4YAGA 2CVOA 1LJ8A 3M1LA 1BGVA 4CLHA 3ASVA 4MVJP 4H16A 3COSA 3GC6A 2DUUA 2NTJA 2P2SA 3WQRA 1H9BA 3RSHA 3GZ4A 2VHWA 3TFQA 4Y6PA 1GYQA 2DQ4A 3SXPA 3BIOA 3JD1A 5C7OO 1DC6A 4R16A 3PHJA 2Q3EA 2YV1A 4BO6A 4QTZA 4A0SA 5EESA 2E48A 1CYDA 2OP1A 1FJHA 3QVXA 2P91A 3H9QA 1QRRA 1EQ2A 3B1KA 3E8XA 4PG5A 4XD2A 1ZSVA 1EVYA 5DP1A 4TRRA 3K6JA 4B8ZA 4YPOA 1LLDA 4WLVA 1GU7A 2E6UX 3VPHA 1Z6ZA 1U5AA 1WNTA 1HL3A 2ET6A 3H3JA 2QRKA 3OH8A 3PHLA 2FP4A 4BQRA 1EVIA 1PGOA 1VC2A 3C7CB 3OJEA 1H93A 2XF8A 1LDYA 3PTZA 2Q2WA 4TVBA 3GUYA 2PK3A 2FY8A 4B3IA 1Y8QB 4BB6A 2IXBA 3QRWA 2WSBA 2VT2A 5AXBA 4EZBA 1GQ2A 4J2OA 3UFXA 4BKUA 3PEFA 4JX8A 1YDEA 3GNQA 4I9UA 4P4LA 4BO5A 5CEFA 4DIBA 2EJWA 3KYBA 5G0WA 1EVZA 1Y8RA 1QLJA 1EFLA 2POQX 3FNGA 2V6BA 3RUEA 2VNAA 3GNSA 1U7HA 3U4IA 3ZW8A 1I3KA 2GUGA 1U7TA 1YH3A 4CUZA 4DQXA 3V1TC 3EK2A 4PLCA 3JQ6A 1SB9A 1PZEA 2GCGA 1ZJZA 4BB5A 4QSMA 4YRAA 1ZK1A 1GV0A 1DOHA 2DBRA 3PHGA 5I7SA 4PCVA 1BDBA 2JFGA 1T1SA 1LDMA 4BVAA 2EWMA 3DOOA 5KJ6A 5L7TA 3IUPA 1RM5A 1WZIA 2FRDA 2J3JA 3K2BA 4GX0A 4XYBA 4IGEA 3PJGA 5IDXA 2O2SA 4MINA 3DAPA 4GPD1 5JDCA 1NAHA 5JAMA 5KCZA 1LSJA 2PGLA 1JKJA 1MV8A 3BMOA 4MP3A 4R1UA 4JGBA 1DC4A 2OZPA 1QYWA 3WB9A 4FIZA 2I5PO 1FDSA 5T5QA 2VOJA 4FC6A 3IJPA 3WOHA 2CF6A 2RHRA 3F5QA 4UULA 2P68A 1R4MA 4R51A 2D1YA 2WYWA 2C7GA 3D4OA 3V2GA 1MXFA 1VL6A 4YRDA 1S6YA 3DAFA 4NJOA 3KYCA 1U9JA 2BH9A 1ONNA 4IXTA 4CLRB 4FJ0A 4Z6KA 3NT5A 2H1SA 3I3OA 1XSEA 2P9EA 3JQAB 3JQ8A 4RQTA 4Y67A 1BMDA 1PJCA 1MUUA 1DSSG 1NHGA 1Y7TA 1D1TA 2ZTMA 4R5HA 3VH1A 2CFCA 4FN4A 1F17A 1VLLA 1Y8RB 2NACA 1VSVA 2C54A 3K31A 2HMWA 1O6ZA 1X1TA 1LTHR 2NLOA 2YQ5A 4HUJA 4URFA 4H7PA 4HFNA 5I7FA 1GY8A 1FDTA 2G0TA 2C7VA 4J7CA 4RPGA 2YFQA 4E12A 1PL8A 1IY8A 2PZMA 4OKNA 1E7WA 4DQUA 1PZGA 1RM0A 1RYEA 3DBLA 3S8MA 3MWDB 1DRUA 1K5HA 1HLDA 1AUPA 4HNGA 4FQ8A 4DQVA 3JQBC 1IHYA 3FPCA 1VL0A 4C4OA 2YQ4A 3BMOB 1DLJA 4MVJG 3RJ5A 1CIVA 1NYTA 3ULKA 1ZK2A 1NWHA 3F6YA 3OA2A 4XWYA 4QUKA 5DF1A 3WLEA 1EUZA 1NQOA 3E6AA 2BI8A 1MG5A 2X0IA 4GVXA 3IOYA 1T2FA 1T4DA 1R4MB 4OMUA 1EE9A 1ADGA 1RWBA 3ZHZA 2DKNA 1AHIA 3I9JA 4IIVA 5KJEA 4E5KA 3FD8A 3HB5X 1LNQA 3KYCB 3LC7O 1P1RA 4XR4A 1ENZA 3R1IA 4D7AA 1SOVA 1UDCA 3L6EA 5A4DA 3IMFA 5IDWA 3ZWBA 4IQ8A 1DRVA 3JQ8B 2ZJ0A 4HFRA 2I9PA 4RDHA 3ROKA 3AU8A 1EK5A 1V3TA 4JBHA 2V6FA 5JBIA 2HO5A 3OECA 3FF4A 2EP7A 3ZH2A 3PDJA 3HFGA 3HUDA 1W0CA 3DXFA 1YQDA 2GNAA 1D1SA 4K6FA 1DJQA 3CEAA 2BFPA 1ZKMA 4GKBA 4ALLA 4N5LA 2IRWA 3LF1A 4PG8A 2A92A 3ONDA 4R68A 4YA6A 1HRDA 3HDJA 1K3TA 5F21A 4WLUA 1U3TA 4DVJA 3JQGA 3PIDA 4OIMA 4YT8A 2OORA 4PVDA 4UVIA 4XRRA 3HJAA 3LU1A 2QIOA 2JKVA 2E37A 1FK8A 2EKQA 3O38A 1WWKA 3H4VA 4FD3A 2EKLA 4NG5A 5F1PA 3L07A 4J3FA 4CLXA 1GD1O 4RVSA 2DTXA 2YV2A 5JXWA 3PYMA 2PH5A 1HDCA 4CMBA 5T6BA 3ZNPA 4XGIA 3I52A 3NT4A 4BO2A 3HDQA 4INAA 1HZZA 3F9IA 4RGBA 4ZQHA 4B3HA 3TWOA 4AJLA 1UXGA 1CDOA 4BO4A 4C7JA 4OL9A 1HYGA 5ER6A 1XA0A 3Q6IA 3GQVA 4KP7A 1EFKA 1R0SA 1XG5A 1R37A 5JSFA 2BGKA 1K6IA 5IN4A 3RVDA 2PR2A 1CEQA 2VHVA 4CQMA 1T2DA 2UVDA 3SVTA 1R66A 4MKZA 3HDYA 4UEKA 2C5EA 5JAQA 1NM5A 1YVEI 4AJHA 1B8VA 4LMPA 1PIWA 2B5WA 3NDRA 2R6JA 3B6ZA 1BHSA 2C20A 4YVFA 4ZQEA 3ON5A 3ZI0A 4I9HA 1NPYA 1Y5MA 2PKQP 1XYGA 1JWBB 4YRBA 2QW8A 4CM6A 4E2XA 1M75A 2HAEA 3NV9A 3TZQA 3CE6A 2EV9A 3VVBA 1JTVA 3BA1A 4PZEA 4I8XA 1HKUA 1WAMA 3JQGB 1H2BA 2ZCUA 2HK7A 4M49A 4AJEA 1YGYA 4CV3A 1NPTO 3OEWA 3AJRA 4OKIA 2J3KA 2BD0A 1ZXLA 4JN6B 2AQHA 5B12A 3FNFA 4IINA 2AXQA 3TFOA 4J16A 3RI3A 3ZWNA 1E7SA 1UXJA 2JAHA 3D7LA 4NK5A 2QRJA 2FSVA 3M6IA 3DWFA 4XZ3A 1P44A 2GDZA 2VRCA 3DZBA 4PLGA 4HY3A 3AOEC 1XLTA 4O6VA 3RKRA 3PFWO 5B1YA 1OZAA 3R0IA 1E6UA 9LDTA 2Y05A 1ZW1A 2VZ0A 4YAJA 4L76A 1KIFA 3ETDA 4NBVA 3FBGA 4BMVA 3BMCA 4QECA 2GZ2A 3WNQA 2NV6A 4QQRA 3WBFA 4Q3AA 1YJ8A 1K6XA 3PJDA 1I32A 2X6TA 1I8TA 1VJTA 2HKIA 3SLKA 3K92A 3F4BA 5U9CA 1HZJA 3NDJA 5KWEA 2WD7B 3LDHA 4JIGA 4CQMB 2IYPA 1OC2A 4QXMA 1XELA 1WP4A 1YBMA 3PQDA 4ALMA 1E1KA 3KYDA 4CUJA 4JXKA 3DTTA 4CV0A 4R1TA 1ORRA 2FPIA 4Q39A 3GVPA 4PG4A 4CQLA 4BIIA 1IHXA 4YWJA 4MIOA 4NBUA 3I6QA 4WCDA 1CJCA 1OAAA 3DBVO 3GFBA 2FZWA 5FI3A 2YDXA 3S2FA 1CF2O 3ZWXA 1M2WA 3A4VA 3CZMA 3KETA 1V6AA 3DZKA 3RUFA 4AICA 5IF3A 2H63A 4E0BA 3CMMA 1BXGA 1Z75A 5HS4A 1U28A 4J1TA 4D44A 3G79A 4ALIA 3VKUA 4XQGA 4XYLA 2RCYA 2AE2A 2PKRA 2B4QA 4PLHA 2I6TA 3TDKA 1EMDA 4B4UA 4DBVO 4GX5A 5JNLA 1I01A 2YZ7A 3DO5A 3W4IA 3U4DA 4F6CA 1LI4A 5U4QA 1J49A 4JLWA 3RC7A 3H3FA 5H82A 4XCVA 4IJWA 5JCXA 4J7XA 5F5LA 1SO8A 1SAYA 2NU8A 4AL4A 3ZNNA 4BKRA 1X15A 4J9VA 3E03A 1DAPA 4TKLA 5B37A 1N5DA 3BMCB 2IODA 4DXHA 1ISJA 7ADHA 3EHEA 3NTQA 3U0BA 3WXBA 2DPGA 1M76A 5J23A 3DAGA 4D41A 1E5QA 1ONOA 3JSAA 3PYXA 3RFVA 7MDHA 1ZVMA 3O9ZA 3RUDA 1A27A 4YXFA 3CINA 3NT2A 3L6OO 4KUGA 1VSUA 2PD4A 1Q2XA 3IAHA 3KYDB 1EZ4A 1MC5A 1HLPA 1U4OA 2ZTUA 1O8CA 2O3SA 3D4NA 2VWHA 3GEMA 1N9GA 5EPOA 4RF3A 1Q7GA 4CQLB 4ND5A 1C0KA 1P31A 3GZNA 5JC8A 4CPDA 2HU2A 3VAZA 4R4JA 1KETA 3JYPA 1B3BA 3QY9A 4KOAA 3D3EA 2YDYA 3NYWA 3UVEA 2ZYDA 4CLOA 1U8XX 1BXGB 4NH4A 3LK7A 4DYVA 4ALKA 4B4WA 1PJ4A 4GX1A 2JCYA 3EMKA 3ZN2A 2A4KA 3WGOA 3WGQA 5L53A 3DR3A 4KTTE 1DXYA 4MVJM 4PZCA 4XJSA 3EUWA 1T1RA 1DHRA 5I8ZA 4GQAA 1H6AA 3RUAA 4WNIA 2TMGA 5ENDA 2DC1A 3KEOA 5A05A 4XRGA 3ZWCA 4NBWA 4B4VA 4ND2A 4WCFC 2EERA 1W6UA 3S1LA 1FMCA 2NUAA 4E2WA 3KSUA 4RZHA 2OGUA 4L4RA 2FN7A 4E32A 4IZIA 1VPDA 4Q3DA 5DOVA 1X7DA 5BSEA 4ZHSA 3ZWWA 2HMUA 3MOGA 3NAQA 4RF5A 4A26A 5L51A 5A02A 2VTEA 3GHHA 4RPJA 3DZGA 4F6LA 4PZDA 4RVDA 3C1OA 1XU9A 4HBGA 3HE3A 2X9VA 1ZIDA 4J7UA 1Y5RA 2JL1A 4JP3A 1HTBA 1F06A 1QMGA 1ENPA 2IEBA 3F47A 1H0KA 1A7KA 1LLUA 3WIDA 1N9GB 1JAYA 2PZLA 2W98A 4UVHA 3OICA 1WDKA 3GZNB 5THQA 3MJEA 1D3AA 4AJ4A 5BNFA 2FR0A 4D0SA 4R1NA 2Y99A 2HMSA 4PRKA 1UR5A 4O1MA 5EERA 4CLOB 5CEJA 2Q1WA 2RAFA 4LSWA 4PLPA 3X2EA 3RKUA 4WLEA 3MJSA 3Q0EA 6LDHA 3UH1A 4UUMA 5JC1A 1TLTA 4XYGA 1WZEA 2X23A 3N7UA 2J3IA 5F1KA 1NVTA 4JBGA 1U4SA 4CM9D 3AUAA 1PX0A 1E7MA 2ZATA 4DPLA 1PS8A 2XOXA 4XGKA 4CMIA 1HXHA 1WPQA 1HSZA 2Y1DA 4FDAA 4IUYA 1XGKA 2X0JA 1GYPA 1SC6A 2X8LA 3D0OA 3TZCA 4QFCA 2B0JA 4WE3A 1R15A 5DNAA 3RUHA 4ZJUA 3PFFA 4GSKA 1SCUA 2HCTA 4BNNA 1E6WA 3W4JA 1NVMB 1KERA 2BFOA 3RBVA 3K2EA 3VPGA 3PWKA 5CDYA 3ZV5A 2AHRA 3PGJA 2VTDA 1UH5A 4GVLA 4OHUA 4AJKA 3AFMA 2XAAA 4WEQA 3CIFA 4BNTA 4D3DA 4MVJD 3D1LA 4ZD6A 4W6ZA 3R6DA 1GCOA 4RZIA 4Z0PA 4EEZA 4NBTA 2AQ8A 3VZRA 5ENVA 2BLLA 1OMOA 1UP6A 3CUKA 4GL4A 4XGNA 5JE8A 2DAPA 4RQUA 5C7LO 4WLOA 4RLHA 3OIFA 1JA9A 4L0QA 4II3A 4QEDA 3PYLA 2IDZA 4RV9A 5ICMA 1CRWG 3C7DB 3CPSA 4XDYA 2CF5A 3F46A 3RWBA 1ISFA 3GGPA 3TRIA 4AJIA 4FFRA 3ETGA 4MOWA 3I4CA 1XQ1A 5A04A 2B69A 2F00A 3VH2A 2IZ0A 3W8EA 5KKAA 1IZ9A 3OP4A 2Q2VA 1K0UA 5TS3A 2Z1NA 4E2ZA 2PWZA 2I3AA 4WASA 3WGZA 2NVUA 4DPKA 4CMIB 1E3SA 3L4BC 5CP8A 3AI2A 3IQDB 1NASA 2A9FA 3AY7A 3PQEA 2Y67A 1G0NA 2NU9A 3A1NA 3WNVA 3JV7A 3QWIA 1OOEA 2VQ3A 2I99A 4B7CA 4CM3A 3NKLA 3C85A 3JTMA 3BTUA 3FTPA 1P1FA 2GO1A 3SLGA 1Y9AA 3EW7A 1C0LA 3E5RA 1MFPA 3JD4A 1DO8A 3ICPA 4BNUA 3KEQA 1U2GA 4S1VA 1X7GA 1JAXA 1XWFA 1XCBA 4K1LA 4W4TA 4XB2A 5CG2A 3PRJA 4BOYA 4CV1A 1ISMA 4XB1A 4BKOA 1N8KA 3DMYA 5JYDA 4W7IA 2CD9A 1OBFO 1P77A 5ITWA 1KVSA 1YO6A 3MJCA 3AOEA 3WBBA 2IYOA 2CVQA 3U09A 1E5LA 2FR8A 4O59O 1IL0A 1J6UA 4LSMA 5G4KA 3WQQA 2X7HA 2Q50A 3LC2O 3SBOA 1IUKA 2BGLA 3B1JA 1MFZA 4ID9A 1UAYA 3QVWA 1D7OA 1Z7BA 1W8DA 2BI7A 5F5NA 5BSHA 3FR7A 5DULA 4CLRA 2NADA 5JS6A 1E3WB 3V2UA 3W6ZA 1GDHA 2CNBA 1KC3A 3JQAA 2OUIA 1TEHA 3GOHA 4NU5A 2NVUB 4AFNA 5IDYA 2D2IA 4UVDA 1QKIA 2P5UA 1O94A 3SJ7A 4CR6A 1CQIA 3GMDA 2A35A 1ZBQA 3W4KA 1UZLA 3DHEA 1Y9EA 3H2SA 2PZJA 3GT0A 4YAKA 3VPSA 3KOUA 1NTOA 4TWRA 5DP2A 4RPHA 1GEEA 1PQWA 1UP4A 4Z9XA 4AJJA 1U2DA 1KVQA 3F5SA 3G17A 3PI7A 4BV8A 5A9RA 1KEPA 5ICSA 1PGQA 5EQDA 1ZZEA 3GMSA 4D0RA 4L4XA 1Q1NA 4MP6A 3O26A 3I83A 1XQ6A 4OXKA 4BO1A 4BNYA 1X0VA 1LLCA 4L4SA 5CEEA 1AXEA 2AEFA 2NTVA 4P4GA 4WECA 5TJ9A 1R6DA 1LX6A 1GFSA 1KBZA 1KOLA 4OH1A 5FYDA 4XIJA 2AW5A 3DEYX 4M8SA 2P9GA 4ZQBA 4GSLA 2VYVA 3KTDA 5HTOA 1V3VA 2HRBA 1A4IA 1PWZA 1X0XA 4XA8A 5G4KB 2J8ZA 2VCYA 1F0YA 4IQ0A 4CR8A 2X58A 4U5QA 4DBZA 3RC1A 5TT1A 2DM6A 4AJPA 4FFMA 5TRTA 4B79A 2FZEA 2X9NA 1H2HA 5G4LA 4NR0A 3GUCA 1EDOA 4Z9FA 1ULSA 1NVGA 4NK4A 1EUCA 1ISHA 2DFDA 3H9UA 1T24A 2AG5A 1OFGA 4D3FA 3LLVA 1E3IA 1V9LA 3HFSA 5L4SA 2BFMA 3HWRA 4BKQA 2D0IA 2PZKA 1NR7A 5BQFA 2ZYAA 3AFNA 5HBRA 1ADFA 1LDNA 4YJHA 4FOSA 4RVHA 4YJGB 2H5LA 4N18A 3WLFA 1SB8A 2GN9A 5TSDA 1IZ0A 3GPDG 1XEAA 4GGOA 4ZVVA 4HKTA 1FDUA 4HWKA 1ZFNA 1E77A 4ALNA 2J5RA 4P22A 2GF2A 3BHMA 1QV7A 3ZWVA 4GLOA 3ZHBA 3A28A 3NRCA 1E3EA 1VKNA 1LQUA 1D8AA 1YBVA 5ILOA 1KY4A 1A72A 5DOZA 4ND4A 4RPKA 2O3RA 5A1TA 3ZZNA 4TRNA 2OHXA 2ZB3A 2PY6A 4FFNA 3GVXA 1PS9A 5JO0A 1P74A 1NNUA 2FMUA 1M66A 4P4NA 3JQAD 3PWSA 3VDRA 2VZ9A 3MZ0A 4NU6A 2CDCA 4PLZA 2Y66A 2RH8A 2DTDA 1UP7A 3I9LA 4QX6A 3TOXA 1C1XB 1NX6A 1PR3A 2EKPA 2FWMX 3ANNA 3FTNA 2C0CA 4YQYA 4DA9A 1I3MA 5IFLA 4J4BA 3GGOA 4WCFA 3DBHA 2AG8A 3QLJA 1SNYA 2QHXA 2OO5A 4OOEA 3ZV3A 2QRLA 4BV9A 1G1AA 3L9XA 2GGSA 3DFZA 2OP0A 2WYVA 1U5CA 4Q9NA 4D79A 2AEJA 2PD3A 3OJLA 3I23A 4JBIA 3RUCA 1ZH8A 3DDNA 1MLDA 1UDAA 2NQTA 4K26A 1PL7A 2GD1O 3H9EO 3NGXA 1P1KA 4WOJA 4AJ1A 2PFGA 4KMSA 1U1IA 2W4QA 1XR3A 4R41A 4EUEA 3G3EA 2VHXA 4FBGA 2X86A 1V35A 2EGHA 3GA0A 4R01A 4YJHB 3OJOA 2BFAA 3HHPA 3WMXA 3H5RA 4AJOA 2ZYGA 2CSUA 4MO2A 1EUDA 4J1SA 4E4YA 3RBZA 3JCZA 4L73A 2JHGA 1HE5A 1LSSA 2RH4A 3ROPA 5BNTA 4HNHA 5IJZA 2RIRA 3Q9NA 3GF4A 1ISGA 1R12A 1YS4A 4FPXA 3BTOA 3L0DA 1UJMA 1N92A 4GMGA 3AY3A 4DPMA 5L4NA 1NFRA 4P38A 3RU7A 2ZB8A 1Z7EA 1YQGA 5IAAA 3QWBA 4FJ1A 1TVEA 4YYZA 5EN4A 1F14A 2DBVO 2X9GA 4HX5A 1H9AA 3QW2A 1PR9A 3GRPA 5L40A 1JDJA 5LC1A 2ZKLA 5ILGA 4N5NA 1I2ZA 1DIRA 3SC6A 5A06A 3MTJA 4WCFB 1P1HA 3F1KA 3DBHB 3NJ8A 4RCVA 4LMRA 3ZDFA 3VPFA 4BO3A 3W8FA 4HFMA 1GADO 5BNIA 4N54A 1QYDA 1L1FA 1OC4A 1S7CA 4A03A 4IDGA 2PGJA 1VJ0A 4CL8A 1C14A 3OJ0A 5C3MA 2O7SA 3GRKA 3TNLA 1KY5A 2G5CA 2B5VA 4J4HA 1K2WA 3EZLA 3PP8A 4RJTA 3I9KA 3UCFA 1KC1A 2WD7A 5HM8A 1X14A 1B16A 1GUYA 4BNGA 4OQZA 4ONEA 3GG2A 1HDYA 3WYCA 1E3JA 3B70A 4FGWA 3U62A 3L4SO 3LC1O 3RROA 2AQIA 1ZNQO 3UOGA 2CUKA 1KEWA 3U4HA 3DL2A 1N7GA 2VWGA 5KTKA 1PJTA 1GQQA 4TZKA 2E82A 3FRJA 1E92A 2QQ5A 5T57A 1WXDA 1Y6JA 5KVCA 5L7WA 1FDWA 2DBZA 2PLAA 4J2HA 4TRMA 1HDXA 4G5HA 1BRMA 2D4AA 4A27A 1HWYA 1GZ3A 1B0AA 4JJGA 1N1GA 1V8BA 3D4PA 3OMLA 1YJQA 5BT9A 1GQYA 5DBFA 3L4BA 1HF3A 3I5MA 2CDBA 3WX0A 4E2YA 2OMEA 3ANMA 4KQXA 3U49A 2VUTA 4J4TA 4A5OA 1YRLA 4E33A 4E5MA 5A3VA 3FSRA 4GBJA 5A03A 2VYNA 4ZU3A 1LSOA 3ZGYA 2WJPA 3G1UA 2Q49A 4HP8A 4PLTA 1ISIA 3HG7A 4CM8A 2O2YA 4FR5A 1DAOA 3TF5A 4I5EA 3BTVA 3JQ7A 5A9SA 3PWZA 2EXXA 3E9NA 2GSDA 5DZSA 1I3LA 3KLPX 1NQAO 3ZHYA 1EDZA 5CDTA 3WGTA 4JROA 3ZWYA 4RF2A 4N7RA 1DB3A 5KIAA 3H7AA 3OSUA 3HN2A 1PTJA 2HMVA 3EVNA 4Y6SA 1GZ6A 3VZPA 4CM4A 1Q7BA 1QXSA 4TSKA 1WVGA 3WWZA 1E1LA 1LUAA 3PQFA 3PIIA 4GGPA 4U8GA 4RVFA 4ILKA 4XQCA 2BMAA 3E18A 3CSDA 3MJ4A 2DFVA 2DLDA 5ADHA 3VC7A 4NZ9A 4R54A 1GV1A 3E9QA 2Q99A 2Q4BA 4DGSA 4ESOA 4CMCA 4YAEA 1MP0A 4NFSA 2Z5LA 2C59A 2VHYA 1NFFA 3PLNA 1YDWA 3GY0A 2NU6A 3INRA 4Z0TA 4CV2A 5TNXA 5KOIA 1D4FA 1RPNA 4II2A 3VHRA 3JYLA 1Z45A 5G0VA 3WJAA 4BO0A 1QYVA 4I1IA 1Y81A 1IPFA 3QJ5A 1L7DA 4B7UA 2EF1A 3KLMX 4Z9YA 4CQMD 4I5FA 5L7YA 1KEVA 4RVGA 1I2CA 3E82A 5AXCA 5DDIP 2XPCA 1TT7A 1I24A 1YE3A 1DIBA 4RPLA 3ZU4A 4CM8B 3BYZA 5KJFA 4JJIA 3JQ7B 5A9SB 1I3NA 2HMTA 4Q3BA 3GAFA 4E30A 1PSDA 2WD8A 2J6IA 1GR0A 4CODB 3SC4A 2Q1TA 1E0DA 2Y68A 3BHJA 3CMCO 4G81A 1ENOA 2BHLA 4FJ2A 2Q1UA 1ZJYA 1A4UA 4CM4B 2XXBA 4I9NA 3LF2A 3GNTA 3RD5A 3K96A 4NQZA 3UGKA 4PVCA 2J5KA 3ETEA 4M1QA 3RASA 2GLXA 3C1AA 4DMLA 4PFJA 1J0XO 1GAEO 5MDHA 1P33A 3MCVA 2VRCD 5CPBA 3PZBA 4NFHA 2WEKA 4IZHA 3H5AA 2H6EA 2RBEA 4BO8A 3KBOA 2JHFA 1I30A 3UN1A 3T4EA 4CMHA 3DOJA 2Z1MA 4BO7A 4IDDA 3UHAA 1I0ZA 4GKVA 4J90A 1ZSNA 4FFLA 1VE9A 5TLSA 4ZQGA 3WS7A 1N1EA 1O95A 4YJFA 2PA3A 2DPHA 3B20A 3ZCXA 3JQ9C 3RC9A 1JVBA 4J0EA 3NTOA 4BNMA 1GEGA 5GZ1A 1B8PA 3Q2IA 2BRUA 3P7MA 3WGGA 4O63O 2TMDA 5COQA 1M67A 4Q3EA 3QWAA 4BGEA 5KJ1A 2P5YA 2HK9A 1O0SA 1L7EA 2BKAA 1DFGA 1GYRA 3KHUA 3P19A 2UYYA 3OETA 1G0OA 2BELA 2EJVA 3OFSA 4U0JA 4BO9A 2UUOA 2ZTVA 3G49A 2VZ8A 3INTA 4BNHA 2W2LA 1A7AA 3CZRA 2CVZA 4IS2A 4A7PA 2LDBA 5JCJA 4KUEA 8ADHA 5JFOA 1YL5A 3ASUA 1XKQA 1IE3A 3U4CA 1SZJG 2GRAA 1BW9A 1PQPA 1XHLA 3KXDA 1HETA 1UZNA 3DZHA 4LVCA 1B7GO 4XDZA 4UUNA 4MIYA 4P8RA 3ZWMA 4EJ0A 4GWGA 5I9MA 5U1PA 3IUSA 1UXIA 2GERA 4IS3A 3F3SA 4B4OA 1JU9A 1E1MA 3AM3A 4JK3A 1M6HA 4M55A 4J6FA 1B3RA 3OBBA 1WMAA 1BXKA 1DLIA 2O4UX 3ORFA 4W7HA 3FHLA 3WG9A 1CQJA 1KYQA 3M1AA 5KVSA 3C8MA 4Z0HO 1E7RA 4MJLA 1PJBA 3HZZA 1ZK3A 4JNKA 3TZKA 2B4RO 3WIEA 1TA4A 4A2CA 1P3DA 3IIEA 4MDHA 3Q3CA 1N7HA 4MKRA 2GYYA 3DZJA 3QV1A 4YJFB 4DWVA 2GASA 3P2OA 2X5OA 3D5QA 5AXAA 2BGMA 3L6DA 2C2XA 4CMJA 1A9YA 4FC7A 1H6DA 1ZK4A 4NPCA 3GVHA 4R3WA 2X0RA 3FN4A 3AW9A 5JYEA 1MA0A 3KSZO 5C7IO 1HEUA 5TF4A 3DHYA 2YHUA 1WW8A 1YB4A 2VWQA 4KDFA 2AQKA 3G1TA 4BGUA 2R2GA 5JAZA 1NQ5A 2C82A 4YEDA 4OXNA 2JAPA 2RHCA 1R16A 4ZRNA 1P45A 1X7HA 5FF9A 5KVVA 1SPXA 1O5IA 3WSVA 3KUXA 3VKVA 3V1YA 3DHNA 1P9LA 2I3GA 4F45A 3OIDA 3ICCA 4M54A 4YCAA 5COBA 3HADA 4NHEA 3GLQA 5L9AA 1BW9B 1ZXBA 3O8QA 5I9NA 4XQ9A 1LC3A 4YDRA 3TZHA 2CDAA 2P9CA 1JWAB 3QVOA 1LSUA 1Z74A 2H9IA 4W9NA 1HDGO 1J5PA 1ZUD1 3NX4A 3DZFA 2PKQO 1NFQA 4MVJH 3WMWA 4IGFA 1I5RA 2C2YA 3ZWAA 5I7EA 2Q4EA 3GPIA 5LCXA 5FWNA 1QYCA 4RO0A 1MX3A 5JO9A 3RIHA 4LCJA 1I10A 3ZV6A 4PGFA 1IOLA 1R0LA 2W2LD 2AEMA 5HS6A 2P4HX 4EITA 3D5TA 3MOIA 4IXWA 1NHWA 4R5MA 4D3SA 2VOEA 4CM5A 1DJNA 2GZ1A 1DRWA 1E3WA 4ZQFA 3EY4A 1P1JA 4GWKA 3OF2A 1DHTA 1AHHA 4LW8A 2ZQZA 3PLRA
chains in the Genus database with same CATH superfamily
2RCNA 5LQRA 2VT7A 5IWAB 5B3JC 2XCRB 4H77A 2M6LA 4DY6A 2FZGA 1XDSA 3HEBA 3A4TA 4X00A 5CHEA 4RXTA 4RKQA 2CJWA 4DSAA 1P6XA 1Y1QA 2VDLB 3ZCTA 3ZDDA 5LZ7A 3I8OA 1K68A 1LZLA 5LDHA 1UIMA 3CEPB 3ISTA 2GAIA 3IJRA 1HYQA 1KI7A 2CXHA 4J49A 3CTMA 4JB3A 2RSLA 1EP9A 4LBYA 4P2BA 1Z2EA 4BUJA 3CR3C 4WNAA 4OA8A 1NJFA 1NKVA 4UTRA 5SZKB 3GAZA 4BMXA 5F7XA 1MBZA 4KODA 4RZSA 1R0KA 3PXXA 1XMVA 4KQWA 4MUKA 4C0BA 2A6PA 5CFLA 3U4AA 3BIWA 2W5UA 3JYQA 4C4TA 1OF1A 2Y1WA 1FP4A 4AF8A 1TYBE 5FQOA 2HK8A 1YIOA 1K6EA 3MUFA 3LBYA 2G17A 4BFXA 2ZB4A 5K51A 5ETJA 4KR3A 1XB2A 1S1CA 2H0AA 3HYLA 4KXWA 3T95A 4QXRA 3UAZA 4Q93A 4M9UA 4A10A 2DHRA 2IZZA 4WY5A 4C4PA 3HQ4O 3WRXA 5BOVA 3OLQA 3HDGA 2LNDA 4JI6B 1C2TA 2OOSA 3O84A 4JB0A 2VK8A 4S35A 3KZNA 1WSDA 2XUPA 3IP1A 1PFUA 3EGWA 1ABEA 3KCNA 3KX2A 3LHDA 2GD6A 5K6AA 1ZWLA 2H9YA 1TA0A 1NZDA 5AVWA 5E9JA 4K6CA 2AFVA 2WYHA 2ZB7A 1ZP6A 4U0KA 2PT5A 1VPVA 5ADUS 3UAYA 3UXYA 4GH5A 3RODA 3FWKA 3BAFA 3DCYA 4MVWA 1ZUNA 4WESB 1C9DB 3MN1A 3I76A 1LRKA 1Z35A 3CR8A 4B3MB 1A8HA 3AI1A 3E48A 2JIMA 2HIGA 3BBLA 1OI3A 3FR8A 5JFGA 4DV0B 1YQWA 5F12A 1SQSA 2FPLA 2X2EA 5KWIA 5DCYA 1DEHA 1DFIA 1L0BA 2MWMA 1A9RA 3F6CA 3PR2B 3WTBA 4BMCA 4F91B 4KXFB 4PCLA 2C07A 5FEUA 1XPOA 3NVKI 2CJWB 4HQOA 4JSTA 4GX2A 1QR6A 3ICEA 1JFFA 2E85A 4FKBA 3P9IA 2O3UA 1EJ2A 3E9MA 5I7VA 1D2CA 3K53A 3PUIA 1XCOA 3MPOA 4L51A 4OATA 4CMGA 2AZXA 4DOMA 3LDGA 4QRHA 1TKCA 2QW0X 5CURA 5IS2A 1OR8A 5FHQA 1SXHA 4ZTBA 2AWOA 3R3ZA 4J29A 1XBTA 3NIBA 4UQOA 4WNAB 4WIAA 3QXJA 1JALA 1JBKA 2PX5A 4OI4A 2ZBUA 5DBGA 4F3YA 3H4IA 3H5OA 4MRNA 3V00A 3TI9A 5IU6A 2FUEA 3HGTA 1YUNA 4DA4A 2R2AA 3QNMA 5KNBD 1FP4B 4I50A 1U8ZA 3QBVA 4TRJA 2OBYA 3V8NA 1YR1A 5JY6A 2B35A 3B3QA 4EYGA 3TLBA 3X1JA 4PHGA 3X1MA 1Q0HA 1WO8A 4W1SA 8ABPA 3DTNA 5FNZA 1TT5A 2R6AA 4ME6A 4W5RA 4BQEA 1GIAA 1H69A 3WJ7A 4JJFA 3I04A 4BYMA 3M4NA 2Q3FA 2P2ZA 5G40A 4HYYA 3G5LA 3R3JA 3DPUA 2Y2UA 1KDVA 3O3MB 4B0PA 2G1UA 5IFKA 3A4LA 1KZ7B 4IIYA 5IKOA 3VA7A 1W25A 1F3LA 4L8VA 5GY7A 2X0KA 4D0NA 3N0XA 1ULAA 2GN6A 4R68A 3NOVA 1V1RA 1S1MA 1DIGA 3N74A 1VA5A 1Y5LA 2OCDA 2PFKA 3IVAA 4KLZA 5KPDA 1QHEA 3QLVA 3RRZA 1XP8A 1YZFA 2WD9A 4ZOBA 2H7YA 3C14C 3EWAA 3SYNA 5IVPA 1F60A 2JD0A 4HWPA 3AL3A 1H9CA 1CUSA 4WMLA 2Z3ZA 3KOOA 3PEUA 3WGNA 3BDIA 1I51A 1SHTX 4WGGA 4XYEA 2VC2B 2D3TA 4LGVA 1EP3B 3CO0S 2PD6A 4QU0A 1U94A 4I1YA 1FBTA 2JCGA 3TMAA 2VJQA 4CMKA 2C95A 1G8AA 3O03A 5IZ4A 1QMPA 2JIQA 4X8OA 5AM4A 1JSLA 3LV8A 1FLDA 5ICEA 4N9QA 3RUIA 3T38A 4WK6A 3LWBA 3VPDA 2YW9A 1RQXA 1UM8A 2VDWA 5DKFA 5H81A 1DQZA 3VR6H 4HHEA 4GPTA 4KRYA 4ITUA 1WDMA 1RE1A 2X0NA 1QUFA 3EYWA 3VGPA 3DOCA 4D45A 1RZRA 1IBLB 4Z4EA 4LRSB 2ZRLA 5DHFA 1KY3A 4ZKEA 4OQFA 4RDXA 2BH2A 4U7WA 3NBYC 2NTYC 2OAGA 2UVQA 1PJLA 1QWSA 4G1MB 4LIPD 2P6MA 2NWQA 1MGOA 3PGA1 4YRSA 3WGIA 5LD2B 2CXUA 5E2IA 2CMDA 3H2ZA 2GETA 4DWWA 1FW8A 3GHYA 1GO2A 1NXSA 1TT5B 1SPBS 3I05A 4RULA 4R83A 1TKBA 4GEGA 1SKQA 1V41E 3DF7A 3RHTA 4I4TF 1YOVA 2FWIA 2FZKA 2WNIA 1FTQA 1GTL1 3AF0A 1HT3A 3ZNQA 1Z8DA 3KE8A 1ZEJA 2OV4A 2Z3VA 4UAJA 1B0UA 3GR6A 4N49A 4TZTA 1UBLS 3RK1A 3RC8A 6GPBA 4F3NA 1IUNA 2G8NA 1AN9A 1IPEA 1C8LA 1SC3A 1KMNA 1O08A 1SK9A 2OHGA 3DAHA 3R6GA 1V1RB 4KG7A 1U3VA 3JWPA 4D5EA 1V0JA 4TWJA 4EYSA 1O58A 5A4AA 5JSZA 3NNDA 2Y3IA 4HWGA 3AESA 3AR6A 1IBCA 5AOVA 2X6QA 1C4KA 4U7PB 5DNDA 4ZVMA 4CIYA 1EVQA 2Q0HA 4ZVRA 4JDUA 2QTWB 4AJNA 2Z08A 4MCJA 3U5TA 3NUGA 2I6UA 4C6SA 4EBBA 4PHTA 5IJAA 4IHJF 1R74A 1X1SA 3AP2A 4KO1S 3AF5A 4MKGA 3R7LA 3FFBA 3LA6A 1KKUA 1V3UA 4F72A 4TTPA 2H1HA 2GNOA 5FLKA 1WMBA 3RTAA 4EBFA 3IEKA 5DWDA 4IIEA 4L27A 2C1XA 1KFEB 4RLQA 1YMQA 3TQCA 2O48X 4TKUA 3ER9A 1IMJA 2J30A 1QDLB 2PBZA 4M89A 2VYVD 1V37A 1J25A 1A2KC 1L3CA 2C04A 3BRCA 3OF3A 2QLBA 3GYBA 2A5JA 2VJAA 1USWA 3GVIA 1BMFD 4N0QA 2BM0A 4YP5A 5EXSA 2C99A 2M1ZA 4MUMA 3JATA 3RKSA 3F74A 3KIPA 5J4YA 5F52A 2PU7A 3NHMA 1KS9A 3PA8A 4MPDA 4MPPA 2NZVG 3RQIA 5EJ7A 4Z4GA 4INZA 4OHYA 3I1FA 4KQEA 1TECE 4FEAA 5CLGA 3KKMA 4E11A 1JLLA 3MVEA 2W2OA 3DZIA 1A4RA 4RFVA 1X7ZA 4BAUA 4HAIA 5ELXA 4ZIRA 1E2BA 1TD1A 4IILA 4GYKA 4XQEA 2V7PA 4YCBA 1VKRA 3QVTA 1QZ3A 1G6KA 1ID8A 2JCXA 2NXCA 2ZSBA 1B42A 4OLHA 4Y7DA 1R64A 5CLIA 2RDMA 1U02A 5LQNA 5LB4A 1JHPA 1DEXA 3Q8MA 2H57A 2MT9A 4WOKA 8GPBA 4JODA 1QG6A 1R8QA 1YOVB 1ZSYA 4GT1A 4ZARA 3H2IA 4RSRA 1JDBC 1WBDA 3Q7SA 4UVEA 3TQHA 4BNFA 5ED0A 1GGFA 3SBEA 3O6VA 3V7UA 3C24A 4EJMA 4QVGA 4C7KA 4YIHA 2ORYA 3CB2A 3T1YB 5GAJA 3FYHA 3O4GA 1PVDA 2VVTA 3QVMA 2BKXA 3LOQA 5FI0B 3NJRA 4EI9A 2Q8QA 5IKMA 1Z7GA 1J2EA 1WCXA 2Q5FA 1IVNA 3C6ZA 1DQYA 1BCSA 3BJMA 3IBTA 1JR3E 4PTLA 3AESB 1VG1A 5CDFA 4BAZA 2WE8A 1KFBB 4HJRA 4FE4A 5KX5F 2HWWA 1PL6A 3PR1A 5SZIA 5TGZA 4ZQIA 5AVYA 5HRUA 3VKWA 1NW3A 4OHBA 4FI3C 1D2GA 3RFXA 4RVUA 5E1OA 2OFXA 2WMDA 3IC5A 1FF9A 2HIHA 4QDJA 2JF0A 3AXTA 1F1JA 1XNHA 2HQOA 4XD7D 1RD4A 4AXXA 3FWZA 2X1LA 4PSUA 4TKUB 4BECA 4E13A 1VLMA 3VI4B 5A4JA 2FQYA 4ZGWA 3OHPA 2QJWA 3DVLA 1E0AA 1HT0A 2ZJ1A 4JT9A 2Q8PA 2QW1A 5J2TA 1BD3A 2I87A 3CF0A 1GLVA 3DV0A 3P2YA 4W8GA 5DTEA 3JATB 1XZCA 1WE2A 2NT4A 5AKGA 4YT2A 3F6PA 2R8BA 3ZD6A 2KM1A 4EFLA 1LI5A 4W5TA 3FCUB 4YUAA 5ESRA 2IUSA 2NIPA 3L7DA 3ADPA 5ELLA 2DTEA 1OX5A 5D5HA 1R6XA 2ZI9A 1SCJA 2X1HA 4JHXA 4ZIRB 1J90A 3WE7A 1EFHA 3AHDA 1CS0A 2B94A 1G17A 3GUVA 1GL3A 3EDCA 4LHSA 4CI0B 1FQJA 2OCXA 1FFDA 4QT0A 2GEVA 2OHJA 4ERNA 3MIZA 4R31A 4Y6LA 1KR2A 2LGJA 4IFBA 1ILEA 1Y4ZA 5EKXA 5TC4A 3T7EA 4HR7A 2PVPA 1PJ3A 5CDUA 5JLJA 3ZU5A 1PZMA 1J97A 3V48A 4OQYA 3LGXA 3HI4A 2O2JA 1M2OB 4KGZA 1LGYA 2BF7A 4BP9A 1QGDA 4PX2A 3N07A 3ZCRA 5IDQA 3LWZA 1CETA 1Q84A 1Z88A 3W6NA 4E15A 4IDQA 5KTTA 4FB4A 2Z95A 4LVNA 3IDSA 2P41A 3OIUA 4R2MA 4W5JA 3WGYA 4AZ0A 2H52A 1SMKA 4OYRA 5GOZA 3GMIA 1BCSB 4HGRA 4POAA 4NTZA 5FWXA 4UFPA 1QRDA 1JEDA 2IPOA 1JN0A 3K9QO 2XUIA 1VHQA 3EVTA 1TEXA 5EUCA 5IAJA 3TZ6A 3ZU2A 1W34A 3DL0A 4AX8A 3NYIA 5FORA 3CH6A 3LQFA 1SOWA 4G2NA 4I9FA 5C4IA 2EW2A 4L28A 1GTSA 3ZX4A 3SOPA 3SOZA 1U63A 1I1OA 1V7PC 3O1JC 3T52A 2I76A 3N53A 4CKWA 3JW8A 3PFKA 2Q2QA 1RZUA 3F98A 3PUKA 1O5TA 1Y3FE 3QLUA 5J2TB 1W4ZA 3DV0B 3I39X 3R2JA 2PRJA 2NQ8A 5AIBA 1I7PA 4D9EA 2V74B 3VNVA 4LDAA 2O3TA 1CBUA 3RC3A 4I1VA 3KVNA 3Q5GA 2D5IA 4HF7A 4JSRA 2JJYA 4K86A 1C7QA 1KP3A 3L06A 4E1BA 1XZQA 3R7DA 2ZGVA 2G77B 3K35A 3EZYA 1OBOA 1ZI6A 2EZTA 3BWDD 3BRWA 2AI3A 1XZFA 4G23A 2C9MA 2DR0A 5BSGA 2H7VA 2O2EA 1CS0B 2GI4A 3HJRA 4K6HA 2ZRPA 2ASEA 4RDIA 3TPFA 2QD4A 2OHFA 1SKYB 1HLFA 2CY0A 2J09A 2OFPA 2YS7A 4NL4H 1Z5UA 3TQRA 3U4QB 4C0WA 2OC4A 1DWQA 3WAGA 2Q62A 2PMCA 4K2HA 4YROA 4ECEA 4ZI7A 2EGGA 4BGVA 1E4VA 3NVDA 1KARA 4J0QA 1QP8A 1ARZA 1CR6A 2PUTA 1HL7A 3P96A 1IB6A 2EW8A 4DA6A 5FWYA 1H6BA 5HUHA 4K0KB 3MNFA 3V2HA 2R62A 2XQVA 3GJSA 2IC5A 1JB1A 3UKDA 4FYPA 3NFRA 1BH2A 1ZR2A 4AZ0B 4HGQA 1RI3A 4QOIA 4S2EA 2QQEA 4DXDA 2DT5A 2EBUA 3AI3A 1EESA 4ARCA 2NTNA 3PF8A 3E7FA 2D0DA 4YP0A 3RRXA 5FWXB 1VCHA 2FWRA 5A3RA 3IQFA 2IZ1A 4BL5A 2K5UA 1UDBA 2PPLA 1GCAA 1W4RA 2D8AA 2OTCA 3KT0A 4M9SA 4RBNA 4TYPA 1JHOA 4L07A 2B36A 1THTA 3A7EA 4F3CA 2Z5VA 1BHJA 4DJJA 2FMFA 2BMJA 4PZUA 1SXQA 4ZRMA 4B5LA 2M9MA 3KC2A 4B44A 3EDOA 4CKWB 5DM2A 5CM2Z 2HHAA 3EPRA 1PZHA 1WZNA 4LY0A 4RADA 4WXEA 5ALGA 5E7MA 2WFZA 4CTNA 5HF8A 2YMLA 1IG3A 3WL5A 4WADA 5D3ZA 2Q7DA 1VJ1A 3SM3A 3JD0A 1TPZA 1YU9A 4GLLA 2X5XA 2O8BA 2C8LA 3DB2A 3U4HA 5A5FA 5K01A 5TY0A 3QHPA 2J45A 1E4OA 3ONFA 1KVUA 1LC0A 4BKPA 2GPJA 2AMYA 4QQ8A 2PX6A 1ZGCA 3ESYA 4B8YA 4FEYA 3DV9A 1MC4A 4G0NA 1IEXA 4WLFA 2DWCA 3OFJA 4YK7A 3P9RA 4W8HA 2QA5A 2QF7A 2XQIA 1MH1A 1QIJA 4Y6QA 1QR2A 2IVFA 2VAPA 3QUAA 5KAPA 3ADCA 3HN6A 3UWOA 2H85A 1GSIA 2VEOA 3KLNA 1CZUA 4IKEA 4ZI7B 3UGJA 4JUBA 4R98A 4FDMA 2XTZA 4UNSA 4QL3A 1J8MF 2Q0XA 1WUTA 3DA8A 1NXPA 2X4GA 2ZCVA 3I72A 1AQIA 2GMWA 1F4VA 1FU7A 2PJZA 5FWYB 1ZUHA 4JU9A 2B7CA 4HH1A 3TOCA 3DMDA 4YMLA 4RHTA 1QIFA 1YL6A 5FI5A 1C9KA 2D59A 1E2IA 1HEYA 2GF9A 2NO4A 2QNIA 3EDMA 2QYHA 1JQEA 3IOEA 3ITKA 1C3OB 5EJIA 5ARDA 3TMYA 1NQTA 3QUCA 5ES3A 1JXMA 4MVJA 1D03A 3E8MA 1ZA2A 4TWIA 4BV2A 1VYHA 4G5SA 5BT8A 1TTTA 4M21A 3MJTA 1ESZA 1MOQA 2B92A 2W6NA 1T4CA 3FYUC 3PGXA 4OAPA 3ZH9B 4V0LA 1NVVR 1SVKA 2JGEA 1QG0A 2WG1A 4GM4A 4M0KA 7YASA 2D4HA 4XI9A 5EJFA 1M1ZA 5DE3A 1JZSA 3TW8A 4JL5A 3G9ZA 4Q4DA 4G1VA 2UUPA 3LUBA 2AFIE 1YHYA 2ZDGA 3V4SA 2Y0CA 1V1MA 2WWRA 5I3ZA 4KGXA 3TLCA 3NRBA 1K6MA 3M1IA 4A8TA 2NGRA 4RD4A 1PBTA 4Q3LA 3OJFA 3UICA 1WLSA 3AB3A 1MQAA 4BQIA 4JA0A 5C46F 2XXJA 1SK8A 3NAGA 4V0RA 3RS5A 2J9ZB 3AEYA 1R8YA 3N8HA 1AIPA 1QYXA 2PSJA 4MQEB 2V7WA 4EG6A 2YYYA 4JAVC 4K6MA 3TJRA 1KNQA 2VPPA 5M29A 2AOUB 2FEWB 2WF6A 4HZGA 2W90A 2J67A 5AKIA 4IQGA 4JVNA 5K7SA 1JHYA 1OTYA 2O8BB 1MB4A 2WIAA 4LV8B 3KM0A 2QTGA 2Z2XA 3BCSA 4FCWA 1GQSA 2V54A 4DG8A 3D3NA 3MTGA 2VWPA 2WHPB 4IICA 4NI5A 1DQNA 3RVSA 2D7DA 5LWQA 3L6CA 1MX9A 1MZVA 3DMTA 3PBKA 4FYIA 4DSTA 1FCJA 4JXZA 2G63A 1XQVA 1JMYA 3CXRA 4HL6A 3T3DA 4LDQA 4EJ2A 3TM5A 5JH7B 3KSAC 2BEWA 3OZEA 5ECWA 4IO0A 1VE6A 2H2AA 1XDBA 4AWXA 1B26A 2ZIZA 4FWBA 2BYTA 1EFTA 2NO7A 2NU7A 4RVOA 2NN3C 4YS6A 4OAQA 2ZI6A 2VDKB 1LDBA 3B9PA 5KNDA 1O6BA 3OU2A 1UJ2A 2BJHA 4BNIA 5H3LA 4ZYTA 1JKIA 2GZMA 4QBIA 2XMZA 3RVQA 2P4QA 4K40A 5IRCD 1Y9ZA 1SEPA 1E64A 2X3FA 4NHOA 4R3NA 2GEUA 4FONA 1KZ4A 4BFYA 1XKTA 3QEOA 4R7GA 3GEHA 3VBCA 5AVXA 4JOSA 1NG9A 1EE2A 3C3JA 4TOIA 1K8YB 1IXKA 2EG9A 2UVPA 1A7JA 1L6RA 3PUWA 3L77A 4NU8X 3VPAA 4BFTA 3LH5A 3TGPA 1Z06A 1GDTA 1XIVA 1T4CB 1O9BA 1PKXA 1XD8A 3WRVA 3F3YA 3GFVA 3VO2A 4K0RA 1WXGA 2AKAB 3LZ6A 1VKOA 4A9AA 4E31A 2C2MA 3GARA 4YQZA 3EA0A 4FOTA 5AHRA 3TPCA 3IUEA 1V1MB 3ZU3A 4DLSA 2PNFA 4M86A 4DMUB 1LZKA 4TV9F 1SXJC 4I6EA 1KOJA 1EZ1A 2Q1SA 2NUAB 3NMUF 4IVPA 2L17A 4IIUA 4ROSA 3D3JA 2Z1DA 4U4AA 2WU3A 1LLQA 1GP2A 3C43A 4OLFA 1KI1A 3SMQA 3UV7A 3ENQA 4JEUA 4C76A 4M4SA 3ADDA 5TPWA 2CUTA 2YOGA 4O8CA 1WXHA 5BO5A 3H99A 3WMEA 3R24A 2J08A 1VHJA 1PG5A 4UUOA 3UW3A 1E3MA 3IPCA 1ILWA 3V1LA 2O2IA 4KQGA 2OPBA 2PJUA 3K0EA 2JBAB 3HSKA 1OD6A 3GN1A 4G1CA 4LOHA 3VOSA 3LBAA 4JVMA 2P2GA 1ZM9A 3WLAA 2BEWB 1IYZA 3C6BA 3VKGA 1ZCJA 3KZXA 3KWFA 2OECA 4FUQA 5AVJA 3SICE 4IP0A 2G4LA 2ZJ2A 2NU7B 2OGTA 3KZVA 3AR7A 3I01M 3ZV7A 4ENUA 4XWOA 3W2HA 2OHIA 2QLLA 3N0VA 3SEFA 4NFYA 4KZPA 4URWR 3K09C 5AM3A 2Q6IA 1U2ZA 4S1NA 1E79D 2J3HA 1XTZA 4M7RA 5AXDA 3VUFA 5DTIA 4ZYXA 3CRZA 3ZNOA 1NATA 4R0NA 4A8JA 4IDCA 3IKTA 5KYNA 3T61A 2UVPB 2XVMA 2EWWA 4PZPA 1Q19A 2WSMA 3DCJA 4S1WA 5G2OA 3R8XA 3RTCA 5K2OA 2FMHA 3MTEA 1F8GA 4QOJA 5CVTA 3HSSA 3HEMA 5CDGA 4D26A 1H8ED 2ID9A 4L72A 3D0RA 1Z62A 1I94B 5IKXA 4OUDA 3HA5A 5J40A 2I2BA 1MJGM 2O0LA 4YBZA 1YR7A 1V6SA 4TTJA 1U3WA 3JYHA 1TTPB 4QREA 2GAAA 4L02A 4ZANA 1YA6A 3ROZA 5BW5A 3TNJA 1VYTA 3G0GA 1BGVA 3LCUA 4KN9S 4MQBA 1QWOA 2JS7A 1YDGA 4B1FA 2O8EA 4JUCA 3I2GA 3ASVA 2QY6A 3IESA 5TPWB 3HB7A 3KDSE 3GC6A 1JP7A 2QN7A 2W6CX 1N4DA 4EB0A 1T9GR 2P2SA 3H0KA 3RSHA 2VJLA 4DV7B 3EQ6A 4OM7A 1GYQA 1KAOA 1SFRA 2A14A 2CYAA 1V4VA 4B7AA 3OY2A 4PX5A 2CZGA 5K2MA 1MKYA 5CGQB 1IQ0A 2XRFA 1O6FA 5EESA 4A0SA 2W6MA 2QM8A 4AYTA 1X7YA 4O2AA 1CYDA 2OP1A 4J94A 3EY9A 5E1MA 1Q20A 2IF2A 3B82A 4B8ZA 5JVDA 2KPOA 3ABOB 4UHKA 1HG1A 3KV1A 1IAQA 1GU7A 5KAMA 4MZDA 4UUAA 3TR6A 2BKEA 1U5AA 4GQIA 5A71A 4ZMBA 1CUJA 2QL6A 4BWYA 1KSFX 3PHLA 5B1IA 5H59A 5BQXA 5BSMA 5LZ4A 2EQ5A 3C7CB 5BWLA 4RY0A 5KYTA 1R0CA 2O6HA 3OJEA 1H93A 4YBRA 2XF8A 1JPJA 3CFYA 3PTZA 3JTEA 4QOFA 2M6KA 2PKCA 1AUQA 3VO1A 2FN4A 5C1BA 4A8JB 1VDMA 4HPWA 3HK2A 4KO3S 2ZULA 1U1FA 4GZMA 1O6GA 4N7BA 1GQ2A 1KPGA 4GSYA 3H0CA 4J2OA 1QU3A 1RVDA 1XA3A 3EUEA 4BKUA 4G4JA 2A0YA 2P67A 2JVKA 3A1SA 3PB3A 5CEFA 2GEDA 5JANA 4D4LA 1V71A 3OPMA 1OLOA 3BFPA 1Y82A 3VNUA 2YJ5A 3LCVB 3I6YA 2CUZA 4OUDB 2AN4A 1T29A 3RUEA 2VNAA 4MVYA 4CG1A 3SQWA 1BYIA 4ZI3A 1I3KA 1ST3A 1ZJ6A 2GUGA 4RWZA 4TN5A 1J2YA 1R5OA 4CUZA 5A5VA 4RH0A 5SY4A 4DQXA 3EARA 1XFDA 5AI6A 3IBFA 2NG1A 2OHOA 1VE1A 4IFTA 5JCOA 3WMFA 4ZYUA 1R0ZA 3RNLA 3HBMA 3WL8A 2R1VA 2QTHA 3IPYA 3LYUA 4YRAA 1ZK1A 2O8EB 5HGJA 3VPCA 3OM1A 3A2LA 4OLJA 1OBVA 1BDBA 5FNVA 2JFGA 4UE2A 1GQFA 5C34B 1DO0A 1QE5A 4EOGA 1IB0A 2OYRA 3RW9A 4ZFNA 5KJ6A 1R9GA 1H65A 1PR4A 1RM5A 3RWOA 2MSCB 4IZOA 2J3JA 3AKDA 2AC7A 1KSHA 2FW9A 3K2BA 3MILA 3MWDA 3OG9A 2PANA 2BM9A 4IGEA 5JSHA 4MINA 1MZPA 2JGJA 5LPNA 4EL0A 4RMNA 3CVXA 5JDCA 3CVVA 1B0PA 2OC9A 5GM2A 3ZE2B 4ZEXA 1VP3A 1ZD3A 4OBXA 2PYZA 4X7BA 1XKXA 2ONZA 1JKJA 4IOJA 4ZO7A 1P1BA 2QMEA 1XNRB 1X7YB 3IV6A 4O2AB 4OF4A 5FJIA 1AZWA 1SIWA 2OZPA 5BYJA 4BCCA 1O54A 1QYWA 1SRQA 5EIHA 4EGCB 5KWSA 3S2YA 5B55A 5JVDB 2BF4A 3GZTB 1O96A 3PRHA 1Y7PA 3ZX5A 1A8UA 2CF6A 2RHRA 1OU0A 5KPJA 1OBHA 4MWDA 3MSCA 3TECE 2C5LA 1E98A 3V4RA 2WYWA 2Z8ZA 1BN7A 4C08A 3V2GA 3D4OA 4AKIA 1MXFA 2YMPA 1F4LA 3ICWA 1V5EA 1MEJA 3KYCA 5A4KA 1LPNA 4YRLA 1KRWA 1FSSA 1ZY2A 1G5PA 1ATIA 2H1SA 4DDMA 3I3OA 1BROA 1EVEA 1L4GA 4CIVA 4QM7A 4RQTA 4Y67A 1BMDA 3OX3A 5DX8A 5JALA 4L5YA 1Y7TA 1D1TA 1WQ3A 2H07A 2YRXA 2ZTMA 4ZREA 5F7JA 3SR3A 3PD0A 4C9BA 3HDTA 2OQ2A 1KDYA 3UT6A 3LTNC 2O6LA 3U7QB 4DLNA 1EPUA 1Z36A 3KG2A 2A33A 1F17A 2RGCA 2EX0A 2WF7A 1FZQA 2PUFA 2EL9A 1WQ4A 2FK7A 3QLTA 1L5KA 1ZCAA 4BZQA 4XH9B 1VSVA 2C54A 1T5LA 2IYSA 1Z6XA 3K31A 3LKDA 3MBKA 3PNLA 1O6ZA 4M22A 1LTHR 3NB0A 1VGRA 2DT8A 4PNEA 5BN1A 2ZXUA 2X76A 3PKZA 1Z15A 5I7FA 4EK9A 1FDTA 1OTHA 1Z18A 2CMGA 1TZKA 2R1VB 2WZBA 3HMQA 1IDN1 3FKQA 4P3OA 4P33A 4E12A 1RNLA 3EH1A 1PL8A 2XOKA 4JC5A 2PZMA 2PUCA 5FNVB 5K1ZA 1UPAA 1LBIA 1PZGA 2V6IA 3QPUA 4WZZA 4DQUA 1RYEA 2OESA 3MB5A 3S8MA 3MWDB 1QZUA 1DRUA 3HUEA 1AUPA 2CHFA 4HDKA 3JQBC 4LDJA 1IHYA 3FPCA 2Z83A 1JKJB 5BMVA 3WL4A 2IJGX 2DKOA 2GJAA 1CUUA 2WNHA 3H7IA 3AEQA 3OOHA 4GI5A 1NYTA 3WK5A 1PFYA 1QOQB 3M4YA 3N6XA 1AGYA 3GEBA 1REQB 2O8FA 5FV7A 1JJ7A 1MPXA 3G88A 3K6RA 3WLEA 1EUZA 1QAMA 2BL4A 1O96B 5JROA 4A6DA 1KP9A 2A5GA 1MG5A 1ICEA 2X0IA 2XA9A 3IOYA 2I1VB 4GVXA 3FAZA 5AKHA 1L8OA 4RA9B 1EE9A 3ZHZA 2C31A 3EA4A 1WULS 3K9WA 1AHIA 3I9JA 3MFQA 1SA0B 1FJGB 5E95A 4CWAA 1LNQA 1BEZA 2QZ4A 3KYCB 1VIAA 4XR4A 2XWPA 4DR3B 4AY3A 1T3HA 3L6EA 3AUFA 4FYYA 5A4DA 2ADOA 3RK0A 3CURA 3H8SA 1UDRA 2W6IA 3O8BA 2Z5GA 2WT9A 4RDHA 3AU8A 4BEBA 5FUQA 3K5HA 1VGQA 4UBKA 3RFCA 2GPAA 4ZCIA 5GIPE 1YRQA 2PMWB 3ZH2A 3PCXA 3S5JA 5I45A 2B8NA 5TB5A 2Z0MA 6PFKA 3VMFA 3HFGA 5FPTA 2AJLI 3GCZA 4IHKA 4CTJA 3HUDA 4P58A 3FSJX 4HAXA 4H1HA 3CVUA 4NULA 3KL4A 4LX8A 4EHKA 2CXRA 4JOBA 4QATA 2A92A 1NZJA 3CPJB 1M1NA 1RADA 4EB6A 3HDJA 3BX1A 4JVOA 1XWWA 4EB8A 3LRTA 3HEAA 3EB9A 3A04A 4WOBA 4AS2A 1FYXA 4EHIA 5BW6B 1MO5A 2BEUA 1YASA 2IYYA 4OIMA 4B3CA 3UANA 1LX7A 3PT9A 1Z3IX 3DWEX 3HJAA 5EE3A 2PQMA 1PZNA 1WMDA 2QIOA 3WVNA 2JKVA 1E9AA 4HDKB 4YRPA 1ODJA 3GJ0A 3AQ4A 5IVDA 1QCDA 3U17A 4J3FA 1BX0A 4FFWA 4K9MA 1LKZA 4HGYA 4RVSA 3DLCA 4KO8A 5AH0A 4PPFA 2QORA 4F7DA 5BMVB 2RE8A 3AEQB 3IVXA 2YV2A 1LPOA 2H2DA 4MW2A 3PYMA 4QE3A 4P4UA 5EQJB 3NBQA 4CMBA 2O8FB 1G6Q1 1NOIA 2H2WA 4RY8A 2C7OA 3LUFA 2N3ZA 4C05A 3N0WA 4ZQHA 2W6OA 2A3NA 3QPAA 3TWOA 5BUSA 3KKOA 5MN5A 5HKLA 4OL9A 2CE7A 5BV0A 1H1TA 5ER6A 3Q6IA 2GILA 4R9UC 1U8EA 1A76A 1NYQA 1OROA 4BU1A 9ABPA 3DGEC 1A1SA 4R8RA 4CF5A 1PAUA 1XG5A 2W2TA 1UBJS 2QP3A 2Z4SA 1OUMA 4JI2B 1TW3A 1Y6GA 1NBME 3EZ6A 3KU1A 4HNSA 3MBOA 4IXDA 2WAXA 4CQMA 2VPXA 4MUFA 1X7WB 1J0EA 5M04A 1T2DA 2VJDA 2JHAA 3ZZ0A 1G6HA 4WK0B 1R66A 2GZSA 4MQMA 1P29A 1K92A 2HF2A 4MW4A 5JAQA 1M6YA 1NM5A 5IM4A 2CV2A 4MYCA 1FFYA 2DERA 3QXCA 3TQTA 1XVIA 1ZOSA 1PIWA 2B5WA 3NWOA 2NV0A 2R6JA 2C20A 3I0ZA 3KJIA 4JASB 4C04A 4G0OA 4RZXA 1NV9A 4US2R 5CBPA 1Y5MA 1E6CA 1XYGA 1VZ3A 2BCJQ 5HCNA 2JGMA 3HXLA 2QW8A 5LSAA 1L8LA 1QGZA 5IT0A 1JZQA 4KK4A 1B8NA 1M75A 2AN9A 4PGHA 3FF1A 4US1R 1NU8A 1Y9JA 1KAEA 3ZR4B 4A3SA 4EB6B 2VH5R 4GPIB 1JTVA 1NTRA 3PUZA 4KRFA 4GUDA 3KVVA 1HKUA 1RHRA 1WAMA 2WINI 4I8XA 3KQUA 2ZCUA 3BFKA 1U8AA 2HK7A 2J1LA 2QR3A 1K75A 2BEUB 1IEVA 3OWHA 3UJBA 1P8AA 2Z8YM 3BXPA 3TXAA 4UPDA 1ZZGA 2O8VA 3H1AA 4B4DA 2LP4Y 4PO8A 1OA1A 2ZRDA 2BGJA 2HA6A 2AB0A 3AJ8A 2AQHA 5CA1F 4S1PA 5FTWA 1XV5A 2NVOA 4IINA 1T8WA 2H4YA 5ALJA 1J23A 3KVYA 4PRZA 1ADJA 3ZWNA 1G21E 1XJCA 2E18A 2GK7A 1UBMS 3RTGA 3ZLUA 3T06B 2KJQA 2QRJA 3HU1A 3VR1A 3WDLA 4BLVA 3R76A 1RHJA 3DZBA 3RLIA 1XLTA 5LMUB 4NZYA 3O91A 5B1YA 3BEDA 4H31A 5KTMA 3HU5A 1YK1A 2WSSA 2A5LA 4YAJA 1LPPA 3ZCPA 2AHOA 4L76A 5AOCA 5JT1A 1OLSB 2FA9A 2OV6A 1RSZA 3ETDA 3FBGA 4UZEA 4X61A 1M1YA 2IPNA 1JUDA 3BMCA 3IA2A 4JBNA 4P6VF 4PAGA 4V39A 5FT9A 2R7LA 4A1OA 3WBFA 4Q3AA 3DT6A 3R7WB 3CC8A 3U19A 3K9HA 5DSXA 1C4WA 3PJDA 1I32A 5F73A 4HLCA 2HKIA 1QHFA 5AO9A 4A0GA 1BDJA 3E2MA 2OGWA 4JIGA 3EVFA 4CQMB 4Z1MD 3O3OB 2VTBA 1PR1A 4R2IA 1MU0A 2YOHA 3BGIA 4GM0A 4KQKA 2V6JA 4ALMA 1SKBA 1E1KA 1K8QA 1HORA 2R8OA 4XE5A 3T8YA 1YRWA 3MGCA 2BMEA 5UKDA 3DTTA 4RIIA 1PSWA 1QF7A 1SXJD 1ORRA 2IWRA 2FPIA 4Q39A 3ZCQA 1XRMA 2B21A 2PTHA 1DS6A 5CBPB 1R00A 2YY6A 1AM4D 1SIUA 3CX8A 3BQMB 4MRMA 4BIIA 3FLBA 4CQLA 4DNXA 4DA0A 4RUKA 5DGTA 1OAAA 5FI3A 3GFBA 2FZWA 4IVNA 2VJBA 2YDXA 4Y9TA 1CF2O 3LP8A 3S2FA 3TRDA 2HXYA 3A4VA 3UT5A 3WK7A 2HYIC 5HZHA 2A9OA 3VR0A 4AICA 3MCAA 3LMKA 1U2DC 3IRVA 3R4CA 4R2HA 1P2UA 3CMMA 4GMDA 3WRYC 3WWCA 5HS4A 3R5TA 1U28A 2FG6C 4ZVUA 2VDQB 2B7LA 2R25B 1SD5A 4F9TA 3QE4A 2RCYA 1T1JA 3F5MA 4NZOA 2PKRA 3PXDA 1ZD4A 1QNFA 4PLHA 5HKOA 3KT6A 1UJCA 1SU7A 1OQAA 3EJ6A 4EFDA 5E0OA 4YY3B 4H9GA 4D02A 1I01A 2YXEA 2GFQA 1N2EA 1JLRA 1R6BX 2OCKA 2YZ7A 2RHGB 5HEKA 4D9IA 4P3KA 1IQPA 3BGVA 4HDRA 1J49A 3P0FA 4H18A 2OV2A 4JLWA 4EO7A 3R7FA 1VIVA 5FBVB 4J7XA 1GRVA 3ZTTA 5HPYB 1EU1A 2NT3A 1SO8A 1VBKA 4B6OA 3GFRA 3H2KA 3M82A 4F5YA 1SAYA 1MRZA 4BKRA 4KL8S 3WL7A 4S04A 4UAUA 4JC0A 5J5VA 3QNUA 2K6GA 1JIIA 4FDLA 4PSVA 1M1YB 3BMCB 4F1WA 4YCLA 1PFKA 3EHEA 4CZ2A 1YCDA 1OHHD 3WXBA 1F6WA 1KO4A 3DAGA 2WZQA 4QARA 1E5QA 1KYIA 1ACLA 3CNQS 1GRCA 1XTRA 3QPDA 4NF2A 7MDHA 3BHNA 1GG5A 4EX7A 3O9ZA 4Y1FA 3GT3A 3ZJVA 4RIEA 1VHWA 5CXSA 1FYEA 3AETA 4QIHA 5ALRA 3E1GA 2PD4A 3IAHA 2YV4A 5B7GA 7ABPA 3TSYA 2VFAA 1GTG1 1A9SA 3THRA 1T9GS 1P5ZB 4MHTA 1O8CA 1IK4A 2CXXA 2VWHA 2FPIB 4UTZA 3LUDA 3EMBA 4RF3A 4CQLB 6REQB 3O9MA 4MRMB 1OLXA 4ND5A 521PA 1P31A 1LS1A 3BXOA 2VJNA 4BVLA 1EM6A 1R0YA 5SY9A 1NXTA 2HU2A 2I78A 1I6WA 4ZZ0A 1RMYA 3D7RA 3OCCA 3UVEA 4YUYA 4K8RB 2PKXA 2YVUA 4U8HA 3BKXA 2H7CA 1EGVB 4B4WA 1MJNA 4UHJA 3FHCB 3LUKA 2ZM6B 5A4IS 3VC1A 1IWBB 1V5WA 1SVUA 4KE8A 1WA5A 4MW0A 1L9KA 4DMFA 3KB8A 2O1EA 1DXYA 2QSZA 4O0MA 3QMWA 3AW8A 2WJVA 3B8HA 4PZCA 1ZOLA 4RMGA 4XJSA 1GUDA 2FLWA 4URZR 5I8ZA 1ODCA 1L5FA 1UOOA 2FZCA 3ZGLA 2YIJA 4GQAA 4H6PA 1K63A 2YVKA 4YQFA 2Y76A 4HDRB 3KEOA 5A05A 3C3EA 4TL7A 3TAUA 1UK9A 4F93B 2XUAA 4ND2A 2IUFA 3BSYA 4U2BA 4FYXA 2UZ3A 3FJYA 1KAMA 3S1LA 4Z7OB 1TLLA 2P4EA 4R9VA 2VJYA 1PUXA 3LDFA 4FZJA 4G5YA 4L4RA 2FN7A 2HRQA 4WVLA 4G09A 2P2CA 4DGQA 1YD7A 1PO7A 3ZUPA 1RFLA 1VPDA 5BSEA 2XSZD 2P4UA 1Y3DE 4MEBA 2C4MA 2YNMA 3BM5A 2BJVA 3IQZA 4LXTA 1FTWA 1YR8A 3ZWWA 3MOGA 1SVOA 3NU1A 1DRJA 1GA4A 2PN1A 4Y1EA 5L51A 2X2PA 2IF0A 3DXZA 2P6OA 2VTEA 3U7IA 5HJ2A 4EAAA 4MPTA 3CZQA 2O06A 1R8SA 5F2NA 2F90A 4XWKA 4F6LA 4UDOA 1CUGA 3AETB 1XU9A 1XPUA 3HE3A 4PYOA 3C7TA 3OU6A 2X42A 1K27A 1F8UA 1SBCA 4UCQA 2PZEA 4XOUA 3CWZA 4AMUA 1D2EA 1CY4A 1J8DA 1A7KA 1RAAA 1Y1SA 4C5BA 5A5DA 4MPJA 2C96A 4ZHQF 2WNSA 1V7CA 2JAUA 2PZLA 3RVLA 3W2FA 3WRWA 4AT1A 4HD8A 3K70D 1OLXB 3CLRC 4IJMA 3BD6A 3LCMA 4BZXA 3G5MA 5CYGA 3MJEA 4FBMA 4NV0A 4AJ4A 4L8GA 2R7NA 2HTEA 3JQRA 3OZXA 2AC4A 4IGKA 4KN6A 4R1NA 5DM4A 3MRXA 4B09A 1WUYA 3F6EX 2Q2OA 3BGOS 4O1MA 3SJZA 3CCFA 3CEHA 1RXYA 4MIKA 4PLPA 2XT9A 4WLEA 4W5OA 3BXHA 2FDCA 3Q0EA 5LU8A 1RQLA 1MDBA 2DUJA 1WZEA 2V03A 2BPOA 2J3IA 2F62A 2B78A 5IM5A 1U4SA 2IU0A 4CM9D 5JHHB 1DO2A 1L1EA