4NQZA

Crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in apo form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
248
Chain Sequence
b'GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystal Structures of Pseudomonas aeruginosa Enoyl-ACP Reductase (FabI) in the Presence and Absence of NAD+ and Triclosan
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 82
structure length 248
sequence length 258
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nqzA00
4FFMA 1F8GA 2P2SA 1EQUA 4JLWA 1Z74A 4KTTE 2GCGA 4IQ0A 3OJLA 2QW8A 5GMOA 2QYTA 2X58A 3ZCXA 2B83A 1B7GO 3D5QA 4WPGA 4GKVA 3U49A 4KP7A 3SX2A 2HDHA 5BNFA 2RBEA 4W9NC 1ZFNA 3K30A 4K6FA 5B4UA 1IB6A 1PS9A 1U5AA 1U7TA 4N18A 4I9NA 2FP4A 3P5SA 1UZMA 4MPDA 4ZVVA 3M1LA 5JDCC 4TRNA 4M89A 1PX0A 1NVTA 5T64A 2D5AA 1MG0A 3I3OA 4CLXA 4GWGA 1YB5A 2PY6A 5THKA 1NQAO 4BGVA 1LUAA 2JCYA 4DBZA 1BRMA 2I3GA 1V3UA 3GEDA 2VRBA 2CF6A 2Z1NA 3W6ZA 3AY6A 4AG3A 4OXKA 4BO7A 4H16A 3RASA 4ILKA 4ZQGA 3GG9A 3SLKA 3O26A 4IMPA 3ASVA 3LK7A 4P4GA 4WCFB 5JPIA 4YPOA 1U9JA 4B7XA 4GWKA 1FDUA 4OYRA 1SPXA 2GDZA 4A26A 3WFJA 1JN0A 1QYXA 4LRTB 3AI2A 4TZTA 2YY7A 4RLSA 4FSHA 3P7MA 2D59A 2GZ1A 3DBRB 2X9GA 1XR3A 2A35A 3HNPA 2VOJA 2PD6A 4DLBA 4BNUA 1WP4A 3IJPA 5JS6A 3TF5A 4PG7A 2A92A 4KQXA 3MWDB 5T6BA 1NM5A 2DM6A 3E8XA 3M2TA 4CV0A 4CL3A 2NVBA 1RM4A 1M75A 1H6CA 2CNBA 1QV6A 5H83A 1E3WB 2Q2QA 1YB1A 1QKIA 3RJ9A 5BQFA 1IZ9A 3CH6A 3VZPA 4WECA 4M54A 3RU9A 1I3NA 1HETA 1VRWA 4J7XA 3NEPX 1SC6A 3JQAA 2ET6A 3TZHA 3ZDFA 1AXEA 1R66A 5HWSA 4CQLA 3I5MA 5CEJA 1Z82A 4XCVA 2XXJA 3F46A 4IM7A 3LZ6A 2BFMA 1IYZA 2R2GA 1FDWA 4ZA2A 4W99A 2GSDA 1AN9A 3CUKA 3ABIA 3OETA 1SOVA 4YRAA 1B26A 1ENPA 1EUDA 4U6SA 1NWHA 4WLVA 3JTMA 4YT8A 3CZRA 3FCOA 3K73O 2Q1TA 3A06A 4MVJA 2P5UA 2Y1OA 3C1OA 5BSHA 1OC4A 5HTOA 4I1IA 2SCUA 1V3TA 1BXZA 3TRIA 1NFFA 4JBHA 3DZBA 3DOOA 4C7JA 1NQOA 3LVFO 4HY3A 3IQDB 1KVTA 1DJQA 2BHLA 3A14A 3DZGA 2JAPA 3D4PA 4EEXA 4WGGA 3H9EO 4BS9A 1TT7A 1U2DA 5EIOA 3DQPA 4YRDA 3GOHA 2PGDA 4BB6A 2R00C 3GHYA 4IBOA 4XYEA 3WGOA 1X1TA 4M49A 1JTVA 1VSVA 1C1XA 1I01A 2YHUA 3AWDA 3NGXA 2EKLA 1DEHA 3ZHZA 1E3JA 3UAGA 3PZRA 3MCVA 3I1JA 5EQDA 4MP3A 1C1DA 1N9GB 4EW6A 1LJ8A 1N7HA 4NBWA 2GN6A 4E2YA 5ICSA 1W4ZA 1YJ8A 1F17A 2Q45A 1HF3A 4BGEA 1MG5A 2CDCA 4IUYA 2G17A 1KYQA 1YB4A 2X4GA 2NU6A 4CV2A 3ADPA 1PJ2A 2JHGA 3RUDA 3F4LA 3OEWA 2A4KA 2NVUB 4ZRMA 4Q9NA 1O8CA 4EUFA 2J5KA 4CMCA 4RGBA 3PYXA 2Z95A 1UH5A 2VZ8A 1KIFA 2YFHA 1ZMTA 3AOEC 2O3TA 1HE2A 3DXFA 4DC1A 4J91A 3PI7A 3MTJA 2A94A 1XQ6A 1YQGA 2HK7A 5DP1A 4NK4A 1DIAA 4MKXA 5DP2A 4ZU3A 4BGIA 2EEZA 3QSGA 5K6AC 4OL9A 5JCJD 1XYGA 2BI7A 3DZHA 4J4TA 4YQZA 4EEZA 5ENDA 1GTMA 1RPNA 4WUVA 2X23A 1UDCA 3MEQA 5CDYA 2OMEA 2Y1CA 3DDNA 4TROA 2DBQA 3ZZNA 4L76A 3R3JA 2AHRA 3LF1A 4CR8A 4FGWA 4W7HA 4HKTA 3VH3A 2W4QA 4WLNA 7MDHA 4JP3A 1PZHA 3H8VA 3KYDA 4FD3A 4RQTA 3RUCA 5TS3A 1DIGA 1TEHA 4MVJI 2WSBA 1BDMA 4UEKA 1LBEA 2O7QA 2ZYAA 3QVSA 5EERA 4ZN6A 5B4TA 3VH2A 1EK5A 3ZU3A 3JYNA 4JBIA 3WG9A 1VJ0A 1A71A 1E5QA 1LC0A 2YZ7A 3T7EA 3HB4X 3ORFA 3PIDA 4GLOA 3S1LA 4RCVA 3NDJA 2ZKLA 3RBXA 3GEMA 4CODB 4YT2A 3HFGA 3JQAB 4TVOA 3TZ6A 1RJWA 2O2SA 1GQ2A 1I10A 4J0EA 4CQLB 2Y1DA 1IHYA 4CM3A 5TT0A 5I9NA 4YJFA 4QFCA 4PLPA 1P74A 3DTTA 3OP4A 1P1JA 3GFBA 3C1TA 1HDCA 2GGSA 3EW7A 4FJ1A 4R1UA 3WQQA 3DBHA 1LXCA 1R4NB 1W0CA 1H0KA 1S7CA 1Y8RA 4OQYA 1I33A 5IDQA 4KOAA 4ND2A 1X14A 4J1NA 4NJMA 2FHSA 3G0OA 3IKTA 3D3EA 2ZYGA 1R15A 4AJLA 2YHIA 3Q9NA 4CR7A 1FJHA 2PZMA 3UOGA 1CYDA 1YDWA 2D1YA 1DIHA 3R3SA 1UXIA 3PGJA 3JQEA 5A3VA 2HUNA 4QTZA 3RC2A 2FOIA 3QJ5A 1HWYA 4PRKA 2HK8A 3G1UA 1Q7CA 4CUJA 3IKVA 2AW5A 4IZIA 3GC6A 1CERA 1YE3A 6LDHA 3OJFA 1YQXA 4IS2A 5F3RA 2DQ4A 4K9DA 3HDQA 1LSJA 3BMNB 3KLMX 1DC4A 3FNEA 1KBZA 1VL8A 1LDGA 1GPJA 4UEOA 3VPFA 2GZ2A 3T4XA 2DUWA 2GNAA 3BTOA 3D3WB 3DONA 3V2GA 1JWAB 4LRSB 4OO3A 5EPOA 2EWMA 5ILOA 4WOJA 3N74A 3DHNA 4XRRA 3QIVA 1ZXBA 1LSUA 1PQUA 3LYLA 4EJMA 3TQHA 1DLIA 2WD8A 1SOWA 2I9PA 4ZRNA 3QP9A 4CPDA 2O2YA 3JQFC 4Z9FA 1ZW1A 3AUAA 3KSDO 3QRWA 1D4FA 3QLJA 1E1LA 4F3YA 2QRKA 2IEBA 3BMCA 4FOSA 1EMDA 3CEAA 2Q50A 2BFOA 4DBVO 4B8ZA 5TJHA 1H2HA 2V6MA 1VKNA 3V2UA 4FQ8A 3LT2A 1PSDA 3KM0A 2W90A 4B4OA 2CVQA 3HFSA 2HO5A 1DJNA 3GR6A 5KJEA 3BMQA 2JHFA 4DPMA 4OMUA 2OZPA 5L4LA 4IS3A 1SB9A 2E48A 3KB6A 5CPFA 1ZJYA 1ISFA 3S2GA 5K9ZA 2O3QA 1QLHA 3RBZA 3PQDA 4R5HA 3W6UA 1GV1A 2JAHA 3PEFA 3WIDA 4K28A 2FR1A 3N58A 5K6AA 1DOHA 2OHXA 3INRA 2Y1FA 2CD9A 1KEWA 5GZ3A 4ZD6A 3JQ7A 3F6YA 1XEAA 2CVOA 2Y0CA 3DBLA 1YDEA 1SNYA 2B35A 3OHSX 1I8TA 5DN9A 4OSPA 5AXCA 5I7EA 4A10A 3GDGA 1Q0HA 1GZ6A 4DXHA 5JSFA 3PRJA 1OMOA 2JKVA 5A05A 1BMDA 6ADHA 3H7AA 3K2EA 3WGYA 4JJFA 4OGWA 1DSSG 3R1IA 3L4BC 1E3EA 2W2LD 3Q2IA 5KWEA 3WFIA 2HKIA 5ER9A 3CPSA 4YRBA 2DTXA 1OZAA 2PZJA 4BO9A 2OGUA 3FR8A 4DREA 4IDEA 3ZNPA 2PV7A 2FR8A 3B1FA 4KDFA 1IOLA 2FRDA 3ETDA 4NHEA 1JWBB 4XIJA 4RL6A 5FYDA 4CMJA 3QQPA 3IDSA 1PGQA 2W2KA 4WCFC 4XYMA 4EGFA 3DTYA 4WNIA 4AJHA 3ZI0A 1B8UA 3ETGA 3ROQA 1E1NA 4PLGA 5ICMA 2FPGA 2Q2WA 4MJLA 3F3SA 1O95A 4YAKA 1T4BA 5U9CA 4IIVA 3P19A 3GAFA 3LQFA 2FSVA 2CVZA 1UAYA 3WMXA 3D5TA 3SXPA 4KQWA 1UXKA 4TRJA 3NJ8A 1VJ1A 1E92A 4YACA 4D3DA 1SEPA 1X13A 3GVPA 4BVAA 3PQFA 4NJMB 4FJ2A 1I36A 1E7SA 4R9SA 2WYWA 1PQPA 4CMIB 1IULA 1IPFA 2DBZA 3H9GA 2Y66A 2GUGA 1LEHA 3BA1A 1NFQA 1P33A 3VPXA 1BHSA 1QLJA 3AFNA 3DZJA 1WDMA 4OJNA 4E6PA 2FSSA 2RAFA 3ZU4A 5IZCC 4P4NA 3H9UA 3KYBA 1C0KA 5FF9A 2B4RO 3OSUA 3DC2A 1U4SA 5JYEA 4R4JA 4O5OA 3BHJA 3W1VA 3LT1A 4MVJP 4KUGA 3G3EA 1TI7A 1DB3A 4HV4A 5IFLA 1YQDA 5KKAA 3M6IA 1V3VA 2ZB7A 4Z6KA 4RDIA 9LDTA 1XLTA 4N5NA 1ADGA 3K2BA 2WYUA 4IXWA 3JQ8A 4ZGWA 2JCXA 2R6JA 4LW8A 1EBUA 4L74A 5KJ1A 4II3A 4L4RA 3GHHA 5U4QA 4H15A 1R16A 3ROPA 5IN5A 4F45A 1LC3A 4OIMA 1F06A 4RPJA 3D4NA 3JQFA 4IZHA 4DVJA 1CDOA 1NTOA 2IXAA 1RM3A 3BMCB 3MJEA 1ISHA 4XD2A 1PJSA 1LTHR 3ICPA 4AICA 5A5EA 2BFAA 1XKQA 4CLEA 4ND1A 4CUZA 1AXGA 4I5EA 1MV8A 3HUDA 2YV2A 5AXAA 1DRWA 3DMTC 3FR7A 4XB1A 2EF1A 2P9CA 4U0KA 1LRLA 1LRKA 3AW9A 3AI1A 4CR6A 1QYVA 3PDJA 4NBRA 4W4TA 3RC9A 2HSDA 1DFIA 1KVSA 2IZZA 3EYWA 5B4VA 5TIIA 4B4VA 4BNGA 3H3FA 3VVCA 1HT0A 3UGKA 1LDEA 1ENZA 5IZ4A 3NGLA 4DLAA 1M66A 1GU7A 5AOVA 4ZHSA 2E6UX 1X7HA 3E03A 4FDAA 4E5MA 2GN8A 4J7UA 2GD1O 4PFJA 3GN2A 1I5RA 3IS3A 2FZEA 4YEDA 3IP1A 1JW9B 2NWQA 3ZWWA 2WYVA 1QSGA 2EKQA 1KY4A 4GVLA 2O4CA 1HEUA 3PJDA 1R6DA 1ONPA 3CZMA 3Q2KA 1MLDA 3OQ6A 3QV1A 1XA0A 3SC6A 4DIFA 3R6DA 3L4BA 3INTA 3F47A 1UXHA 3OEYA 4Y6SA 4A03A 4EI2A 1HSOA 2VZ9A 4CLRB 5CDUA 4L75A 4YYZA 2OORA 3JQGB 4MVJM 1Y9AA 1QYWA 1VLLA 1Z7BA 4J4HA 2W8ZA 4KDEA 4PGFA 1FK8A 2C59A 4YT5A 5ADHA 2UYYA 3U62A 1I3KA 3IOYA 3E48A 3UCFA 1TT5B 5A9RA 3N7UA 1U2GA 3SJ7A 4R5MA 3VDRA 1LLDA 3PDUA 4IMRA 1EVYA 1FF9A 4GI2A 2YV3A 4TSKA 5A4DA 4RF5A 1L7DA 1Y8QB 3WIEA 2G5CA 4BNYA 4B3HA 5JFOA 1I2BA 1K3TA 4BHTA 2QX7A 3L9XA 3ZNOA 2GLXA 4J1QA 2IDZA 4Q3DA 4BNTA 1PGJA 1UJMA 3TL2A 3NTQA 2YV1A 5JNLA 3HB5X 2NQTA 2AEJA 2X0IA 3GVIA 1PIWA 1ADFA 1B15A 1NPTO 2EP7A 1WDKA 2NLOA 1MC4A 3DAGA 3I52A 1E3LA 1U3TA 1YVEI 2DT5A 2WWRA 2ZQYA 1RWBA 3PWSA 3E9NA 4R68A 5EL0A 4ALKA 4EBFA 4R1TA 4RVUA 1J0XO 2B5WA 1IE3A 1XU9A 3SJUA 5IZCA 5DULA 2ZYDA 2ZATA 2DFVA 3ST7A 4R54A 4WJZA 1TVEA 4AJKA 2Y67A 5G0WA 3OM9A 3QWFA 3PP8A 2C29D 4I9HA 1BXKA 2AEMA 1CEQA 3NDIA 3QVTA 1DIBA 5C37A 2DTDA 1CQIA 4PLWA 4Q3EA 3VKVA 1EVZA 3NKLA 2O3SA 4O6VA 4J9UE 5CG1A 3H2SA 3K6JA 3LC7O 4AFNA 3DWFA 1D8AA 1V8BA 3AY3A 1H9AA 1QRRA 4JGBA 4W82A 4WEQA 3TSCA 4YR9A 1N1EA 2CF5A 3GF4A 5F1PA 5DDIP 4WLEA 4ALLA 3O8QA 3WGTA 5B37A 3MTGA 4AJOA 1Q0LA 3OECA 5AQ1A 5L4NA 2UAGA 1XQ1A 3ZWXA 2PNFA 2V6BA 2NACA 5JW6A 3H5RA 1SBYA 4RF3A 5BSFA 4RF2A 3C7DB 3W8EA 4F6CA 1DFHA 4LVUA 4ID9A 1YH3A 2GN9A 5L45A 5IF3A 1Z45A 2AEFA 3ENNA 1R37A 3RUEA 4AJ2A 5GZ1A 1LLQA 5JAIA 3RIHA 2EP5A 2AE1A 5TNXA 2D8AA 1LU9A 1LSSA 3VZSA 1PJTA 3GGGA 2PR2A 1VJTA 3DOJA 4D44A 4E2WA 3I83A 4YA6A 1I32A 4KUEA 4NIMA 1PGNA 2PTGA 5KVCA 4L0QA 4J43A 1QR6A 2EXXA 4YB8A 4JBGA 1NHGA 3LF2A 1OC2A 4BKOA 2HK9A 4J2HA 2FN7A 1P31A 1LDNA 1U3UA 3ZW9A 3NYWA 2X9NA 1AHIA 2P4QA 1BXGB 4M8SA 4NFSA 1UAGA 2P5YA 1C0PA 1YOVB 3ZV3A 3ZNNA 5JXWA 3BTSA 1P1FA 3F1KA 1Y5RA 3MJCA 3QVWA 3DFZA 1TB4A 1ZZEA 4CM8B 3AOGA 4BNWA 4DMMA 4NNJA 1PJBA 3JSAA 1BW9A 1E1MA 4XX0A 3TZKA 2PK3A 1U1IA 3JCZA 4WASA 5T8KC 2AQ8A 4XDYA 1K0UA 3JYPA 4IXTA 1JAXA 1EZ4A 2BGKA 4J90A 4M1QA 3S2IA 4W7IA 4YJDA 5COAA 1WMBA 4QT0A 3PXXA 1MC5A 4IQGA 1UZLA 3RBVA 4E5YA 2ILTA 1DC6A 2DUUA 3RUIA 5FWNA 2F1KA 4L8VA 1KC3A 2QZ9A 4HWKA 4YT4A 4MDHA 4WE3A 1FMCA 4L73A 4BO2A 3U09A 1DAPA 1BVRA 5A5FA 2VYVA 4YQYA 1BTOA 1JKJA 5G0UA 4UVIA 4DL9A 1KEUA 3TZCA 5TLSA 3CXRA 2X22A 1T24A 3JQAD 3VH4A 1E6WA 4BV8A 3GNSA 1H2BA 2QYSA 3TZQA 4DTIA 4RO0A 3OFSA 5CDSA 4MIYA 3IUPA 1ID1A 2VHYA 3AUTA 3U9LA 5DCWA 4IDAA 1I2ZA 2HRZA 2OBYA 3UH1A 5L7YA 2J8ZA 2Q46A 3MOIA 3PJGA 4P38A 3VKUA 1ENYA 1OI7A 1EVIA 1ZMOA 3GPIA 1DPGA 2HLPA 4XZ3A 1GADO 3ULKA 3CMCO 2CZCA 4YJGA 1PL7A 1D1TA 1G6KA 1UUFA 4R3WA 3ZN2A 1TXGA 3WR5A 2O4UX 4B79A 4Y6RA 3QY9A 2PH5A 2JFGA 1GUYA 1AGNA 2BFPA 2BRUA 3D64A 3GRKA 3O38A 4GX0A 3ANNA 1DHTA 2VWHA 2VNAA 3H9QA 3K9QO 1YXMA 1DIRA 3AM5A 4J1SA 4P8RA 5L3ZA 3P2OA 1HDYA 1O6ZA 4QQRA 1JVBA 4CMGA 1ONOA 1NX6A 3O8QB 1XG5A 1I24A 3NT2A 1F12A 3U5TA 2DKNA 4Z3KA 3QWBA 5T57A 1HZJA 4U8GA 3AY7A 4D46A 2IRWA 3OIDA 4CM9A 4UVEA 3GMSA 5JY6A 4BNJA 3WBBA 2ZK7A 3V8BA 3OA2A 3RJ5A 1A27A 2UDPA 2RHRA 3U4CA 3F1LA 3U4HA 3DHEA 4W6ZA 4WLFA 1Q7GA 2ZB3A 4I5FA 4QO7A 1YWGO 3AU9A 4UULA 4CM1A 4I08A 1EUZA 5COQA 4BQRA 4W9NA 1LDMA 3BMOA 4IDDA 1V6AA 3PIIA 1HDGO 2AG8A 2Q49A 4L4SA 1WMAA 1R0SA 2JCVA 4FIZA 5JDIC 2G76A 4HBGA 5TQVA 5JDCA 3K8ZA 2XAAA 4PG6A 3EMKA 3H4VA 2VQ3A 3WJAA 5EJ2A 1GY8A 3WICA 3TOZA 3IUSA 3OMLA 3UVEA 4BOYA 2HMSA 1U3VA 1DHRA 3K31A 3NAQA 5HBRA 5I8WA 2G82A 5A1TA 5HM8A 1P9LA 2I6TA 4IIUA 4CV3A 1MX3A 3H65A 4RZHA 1M6HA 4PVCA 1O89A 3IP3A 5EQFA 4NQZA 3FNFA 3MWEB 1T2FA 2TMDA 1GEEA 2B36A 3B1JA 2WTBA 1EE2A 1GEGA 1ISIA 1ML3A 4WLUA 2DPGA 2VUUA 5JC1A 5L9AA 3K96A 4HFMA 3ZWAA 1DRUA 2PZKA 4QFDA 1LQTA 4J2OA 1C14A 2PFGA 5T8KA 3X2FA 3IIEA 1ZEJA 3KTDA 4NR0A 3WLEA 1E6EA 3GDFA 4MP8A 3WGHA 3E18A 1DDOA 1EVJA 1MFPA 5A9SA 4CLDA 4CMBA 5JE8A 4O63O 4BNVA 3C24A 1HLDA 3FPLA 5JCJA 1NFRA 4PLHA 1D3AA 1IY8A 2WE8A 3WGZA 1ZH8A 2CDAA 3ZWYA 4R1SA 2VWQA 4IJWA 5JBIA 3ENKA 3HDHA 1LQUA 4GAEA 3LSYA 5G0TA 4BO3A 2ZB4A 2PZLA 3WBFA 1S6YA 4A27A 1H6AA 2IYPA 2NTVA 3ONEA 4PLCA 1T1RA 4II2A 4BO5A 4BV9A 1T2CA 2J6IA 1H6BA 3ITKA 2CY0A 3GH3A 2ZTMA 5LDHA 3G79A 4Z0PA 3BZUA 3LLVA 3FI9A 1KY5A 4AVYA 2XXBA 1YJQA 4D7AA 1DAOA 2DPHA 1EFKA 4J0FA 3VPHA 5F1OA 5JMWA 4C4OA 3L9WA 4CMEC 3I4CA 5JMPA 1I3LA 5DT9A 4LCEA 3PLRA 4FJ0A 4Q3AA 3VPGA 4BO1A 4JCOA 5A06A 1HDXA 1XHLA 3ZHBA 2NUAA 4NJOA 1JLLA 1G0NA 3KHUA 2CMDA 5DNAA 4OAQA 5JYDA 4ITUA 5BT9A 3FPCA 4JN6B 2E82A 4PG8A 2V6GA 1BG6A 4H3VA 4JQCA 5G4KA 3BXXA 3KBOA 4OM8A 1K5HA 1U5CA 3QWIA 1QP8A 2R00A 4CJXA 3JYOA 4GX5A 3VVBA 4DMLA 1C1XB 2AG5A 4QX6A 1U4OA 4K26A 1WPQA 4UUNA 1PS0A 4WEOA 3LU1A 1GCOA 4AJ4A 1SMKA 1VPDA 3PHIA 5COBA 1C1DB 1EQ2A 4CMHA 1KC1A 4WK6A 1K6XA 2PKQP 4FFOA 1R0LA 1XDWA 2X6TA 2ZQZA 2NNLD 4WCDA 4MVJG 2VYNA 3JD2A 2C0CA 1U3WA 1EFLA 4R01A 5JDIA 1DC3A 3GQVA 5LC1A 5B12A 1T26A 4LK3A 3FBGA 4RORA 4FFPA 3Q6IA 3Q11A 4KWIA 1HDRA 4RVHA 1KVUA 3CSDA 3L4SO 2C07A 2OBNA 3FTPA 3L6EA 4ALNA 4I5GA 2GO1A 1VC2A 5TC4A 3ZWVA 1NNUA 1ULUA 1YBAA 1T4DA 3B20A 4ZICA 3M2PA 2EJWA 3AOEA 4FFLA 3C85A 1SB8A 3GFGA 4BNIA 1NYTA 3OICA 3PVZA 4JK3A 5THQA 1GUFA 1ZVMA 2VWPA 3I4FA 2Y0DA 3JQBC 4CMKA 4CL8A 1P3DA 3UFXA 3OJEA 3DMYA 1RYEA 2JD0A 4FB5A 2VZ0A 3BHMA 1JQBA 4FN4A 3S8MA 5MGBA 2X5JO 1N7GA 4KMSA 3RU7A 2BKAA 4TZKA 3GDOA 2C5AA 1DRVA 4XQ9A 1Z6ZA 3C7AA 2I3AA 3H2ZA 3W4KA 3Q9UA 3KYDB 1PR3A 3ZV4A 1UZNA 2GR9A 5J23A 2RCYA 3I23A 1J5PA 1VM6A 1A4IA 1GCUA 4PLZA 3AUSA 4BKPA 2NU7A 1MA0A 4ND3A 4CQMA 3WXBA 2OOSA 1ZSYA 5CP8A 4WLOA 3PHGA 1LDYA 5DBIA 4ONEA 2YQ5A 3RUAA 3NTRA 3IL2A 2YUTA 1P77A 1PGPA 3GZNA 2ZJ1A 4BNMA 4NPCA 3QWHA 4BNNA 3H5AA 1JVSA 1LI4A 1MP0A 1YGYA 2PD3A 1HRDA 2F00A 1O9BA 1CRWG 3JQ9C 2CSUA 4YJFB 4XWYA 4EUEA 3EAGA 2Y05A 4A0SA 1QMGA 3OH8A 3FTNA 3VZRA 1I3MA 2YJZA 1R0KA 2B0JA 2NV6A 4OXNA 4WKGA 4BKUA 1P0CA 3DBHB 3B1KA 1Y8RB 3AJRA 2X5OA 3ON5A 1IZ0A 2J3KA 2WD7A 5H81A 1ZUD1 1GYQA 3TL3A 4AJNA 3WYBA 1J4AA 3PWKA 2DAPA 3MZ0A 1WWKA 5C3MA 3GA0A 4E13A 4NFHA 2G0TA 3E9MA 2OUIA 3GUYA 3CTMA 2YHIB 4CMEA 2GYYA 1U8XX 2QIOA 3RD5A 1UDBA 1HSZA 2DTEA 1ZSNA 1V35A 4GVXA 1VKOA 3ZWMA 1A7AA 3WQRA 4DPLA 3PTZA 3ROMA 2ZTUA 3RUFA 5JCXA 5G4KB 5KJCA 4CM4A 1HL3A 1JDJA 2WM3A 3C3XA 4JX8A 2C2XA 5F1KA 2V65A 4KWHA 4YAIA 4PZCA 3EVNA 3OJ0A 4ZQBA 8ADHA 4MINA 3V1YA 1T2AA 4BO4A 3DEYX 3BIOA 1Y1PA 3O03A 4ND4A 4YAGA 3TNLA 3E6AA 3M1AA 4BMNA 3GN1A 4IJVA 3TJRA 1KEVA 4XQGA 1MXHA 3ONDA 4CM6A 1ARZA 2P9GA 2Z5LA 5MDHA 4RVDA 2C20A 4KZPA 3KYCA 5I9MA 2UUOA 2GZ3A 4FGSA 1ULSA 4BNZA 3HE3A 4PLVA 2POQX 3RFXA 3TN7A 3ZWNA 4NG5A 5ITWA 3RQSA 3H5NA 3BMQB 1SAYA 3EZYA 3RI3A 5ES3A 3PYLA 4IQ8A 4E33A 1WDLA 1V9LA 1LSOA 2CDBA 3SC4A 3UICA 1M6WA 3V2HA 1GPDG 1NR1A 5KIAA 3PLNA 3UF0A 3EDMA 4IINA 4XYGA 1PS8A 1NASA 3FWZA 3QVOA 4J9VA 4AJEA 4MIEA 2O3RA 5KVSA 2RIRA 2IZ1A 4OSOA 3PJEA 1ZCJA 2UUPA 2AMFA 3JQ7B 2B4TO 3EGOA 1B2LA 5B1YA 5GZ6A 3DBLB 1I30A 2DLDA 2WJPA 5FI3A 3GVHA 3U0BA 2E37A 4Q3NA 5HS4A 2ZJ0A 4DC0A 3I9LA 2VHVA 3A1NA 3W4JA 3FRJA 4ALIA 5CDTA 4YBZA 2BH9A 4G65A 3W8FA 3F9IA 3OBBA 4NDNE 1QYCA 1KS9A 2VUTA 4CQMB 1A72A 1LNQA 2TMGA 2ZCVA 5BNTA 4XQEA 4PZDA 1V0JA 3BHIA 3WDSA 2VRCA 2BLLA 3L0DA 2GPTA 1WAMA 3WX0A 2I66A 3S2EA 2Q4BA 4GKBA 3ZNQA 2W2KB 4XR9A 4FOOA 2RHCA 3KZVA 1RYDA 5DBGA 4HADA 1MB4A 3UUWA 3CMMA 4LN1A 4WCFA 1E5LA 4G2NA 2NSDA 3JQ6A 3KLPX 3DBVO 2OO5A 2QRLA 1ISJA 2D5CA 4CM5A 1A9YA 1GFSA 3HQ4O 1PJ3A 4FW8A 2Q4EA 5IXSA 4UUMA 3D4OA 5H82A 2GN4A 2H1SA 1QG6A 3DBRA 4F46A 1ZNQO 5L7TA 1XGKA 2WD7B 3SVTA 4PG4A 3VC7A 3LT4A 4B4UA 5GY7A 5L7WA 3WYEA 1OFGA 3RC1A 1PTJA 5A9TA 3WSVA 1P44A 4XGIA 3JYQA 1GL3A 1KOLA 4OH1A 1ZK0A 2HJSA 5TGDA 3ROKA 3UHAA 4E5PA 4Q39A 4LCJA 2FWMX 1HE5A 2C54A 1E7MA 3ZWCA 3WS7A 5LCXA 2O50A 5G2OA 1EUCA 1UDAA 1WZEA 4D3SA 4M55A 2C5EA 1E3SA 5TX7A 3ETEA 5A04A 5F21A 3LLSA 2EIHA 2IEDA 2C7GA 2PLAA 4GPD1 1E3WA 4OOEA 3B6ZA 5EMHA 5T67A 3ZWPA 2ZCUA 1Z73A 1DFGA 4MVJE 4O59O 3DAPA 4PG5A 5L51A 4PLFA 1HDOA 4DRYA 1U7HA 2J3JA 1X0VA 2VNSA 3FF4A 4JNKA 4UUPA 4B3IA 4FBGA 3FSRA 4ZJUA 4JJIA 1SO8A 5IDWA 5BR7A 2Y1GA 3TOXA 2B69A 3QW2A 3ZWOA 1DXYA 3JQ8B 2EERA 3PWZA 4NK5A 5TRTA 1LRJA 4NU5A 4D0RA 4DQVA 4R41A 1ZK1A 1PL8A 3SLGA 3WWZA 2VT2A 1Q1NA 4RPLA 5C7OO 4HXYA 2HMWA 4X54A 1MGOA 1UP4A 2Y99A 4HFJA 4E21A 1OBFO 3FBTA 2UV8A 4R1NA 3E1KA 4UVGA 3R0IA 1JKFA 3TWOA 3WNVA 5CEEA 2D0IA 4BMSA 2X9VA 5HS6A 4GSLA 3ZH2A 5JLAA 4AL4A 5TT1A 4A5OA 3DMTA 1O94A 4J3FA 1IHXA 2PH3A 1AE1A 2NADA 2H6EA 5IJZA 3CKYA 3Q1LA 1PJLA 3GT0A 2B37A 2FY8A 1B3RA 3TDKA 3DFUA 1LLCA 1GAEO 2WE7A 5G0VA 1K2WA 4E5KA 1Y6JA 1GDHA 3CE6A 1VL0A 3DO5A 4DYDA 5L95A 3G49A 1FDTA 5CPBA 4XYBA 2H9IA 1C3VA 4GSKA 1Z7EA 4FR5A 4TKLA 5FEUA 1GZ4A 4AJIA 5CEFA 4MVJF 1N9GA 1UXJA 2YYYA 1JAYA 3EZLA 4XA8A 2OXIA 3A28A 3GEGA 1SEVA 2BI8A 3COSA 2NTNA 1OAAA 1BVUA 5C7LO 4CV1A 2VWGA 4BNLA 4TMFA 5DCYA 2J3IA 5TJ9A 4N5LA 2PKRA 3WTCA 5IG2A 5KOIA 1YL6A 3QA9A 1GQQA 4U7WA 1HYEA 2NVUA 1R4MA 1TA4A 1GYPA 5ITVA 3K5PA 3WYCA 4Z9YA 2NQ8A 2H5LA 3VAZA 3NTOA 1E1KA 4J16A 4BNXA 2EJVA 2J5RA 3TFQA 4LMRA 3I9OA 5KKCA 1XIVA 1XCBA 4PVDA 1A9ZA 4D0SA 4CUKA 4U6QA 4C7KA 1CJCA 2FMUA 3GMDA 5I9LA 3VZQA 1NWCA 2X0JA 5U1PA 1K89A 3DZIA 2IE0A 5BNIA 5KVQA 2EW2A 2VYVD 3GK3A 1GR0A 4N5MA 3JQDA 1ZEMA 1JKIA 4S1VA 4CM7A 4BMVA 2PGJA 2Y93A 1KEPA 1BWSA 2GASA 4PLTA 2XPCA 4NBUA 4QO8A 4XGNA 2DC1A 4ZQFA 4NFYA 4RF4A 5EN4A 3WQSB 3MJTA 1JA9A 4QSMA 3A4VA 1D1SA 4Y98A 4CLOA 4OOFA 4I5DA 5I7SA 4E2ZA 4EITA 5A3JA 4LSMA 3NX4A 4NI5A 2P68A 3EUWA 4YJHA 1P1IA 3DZFA 3JQCA 3S2FA 4MVJH 2DFDA 3E5RA 1K6JA 4IGFA 5DF1A 5C7IO 4UUOA 4DWVA 2IXBA 3EVTA 1NR7A 4R51A 4E32A 3PQEA 4PN3A 2ZTVA 4JROA 1PWZA 4IDFA 4MVJD 2X8LA 1CF2O 1IPEA 1L7EA 1PL6A 4ALJA 2VCYA 1P1HA 2BMAA 3LC1O 3OF2A 3PGXA 4LGVA 3UXYA 3IAHA 3MJSA 3E82A 1Q2XA 1R4NA 4CMAA 3GUCA 2LDBA 3L07A 2IODA 3IJRA 4ROSA 4IJKA 1IUKA 4INAA 3X2EA 3FNGA 4HFNA 3QWAA 3ZGYA 4CM9D 2BELA 4B8WA 4U0JA 2WDZA 3C8MA 3DHYA 1JU9A 3FWNA 2VHXA 1WXDA 3WOHA 4TRRA 3PYMA 1N1GA 1Y7TA 1IL0A 5TSDA 3Q3CA 4YAJA 2Q1WA 2P91A 1YS4A 1U28A 5AVOA 5FI5A 3ZU5A 4BKQA 4A7PA 4JIGA 1ZIDA 3KO8A 1E77A 2VTDA 1EE9A 1ISMA 3EK2A 4Q3CA 4BNHA 1H6DA 3HN7A 3PFFA 2Q99A 4A2CA 2IZ0A 4AJ1A 3LC2O 1GV0A 2PWZA 7ADHA 3BMNA 4GLLA 4GMFA 5DBFA 2H63A 4DLLA 4MP6A 3ZW8A 4YCAA 4Q3BA 1Y9EA 3SEFA 3K92A 5IXYA 5EINA 4BO0A 3W4IA 3HDYA 1NP3A 1HDZA 3NDRA 1B8VA 3D3WA 4BNKA 1SZJG 3JYLA 2DVMA 2HAEA 1T2EA 4DUPA 3O4RA 2AE2A 2VN8A 4EDFA 2AQIA 1HLPA 3DAFA 5IDYA 1E7RA 3MOGA 4UVDA 4RPHA 4B7UA 1E7QA 4BL5A 1VL6A 3MJVA 3UN1A 1ORRA 2HMTA 5FFFA 3RFVA 3RKRA 1H93A 4D3FA 3VH1A 4YTEA 1BW9B 3ZWBA 1R4MB 3TFOA 1UP6A 2FPIA 2VUSA 3NJ4A 4FC7A 5BSGA 2NVWA 2EG9A 3T4EA 2Z1MA 3GNTA 3HSKA 1ISGA 4XR4A 1ZXLA 3G17A 4D43A 1NAHA 1YRLA 2PGLA 4F6LA 5JAZA 4E31A 2JJYA 4J49A 4KTVE 1N8KA 4NZ9A 2OFPA 3I9NA 1A4UA 2HCTA 4MKRA 3PPIA 3D7LA 4XIYA 3RCBA 5ILGA 3RFTA 4J1TA 1M67A 4DPKA 3QVXA 3ADOA 1N92A 3WGQA 1T25A 1Y81A 2DBVO 2D3TA 4K1LA 2ZTLA 1M76A 2HQ1A 4RV9A 5KCZA 1E6UA 1KETA 3AUUA 1WNTA 2W98A 4GBJA 1NVMB 1AUPA 3A9WA 4HNHA 3ZU2A 4RLHA 3OIFA 3E9QA 3Q0EA 4YVFA 2YW9A 3KXDA 4DIOA 1E7WA 2I5PO 5C5IA 4EUHA 1TLTA 2ZIZA 3ZHXA 4CLOB 4DQUA 4IDCA 4JXKA 3ASUA 3B70A 2HMVA 1H5QA 2C7VA 2Y0EA 5I8ZA 4IDBA 4B7CA 3FNHA 4YJHB 3PK0A 1MFZA 3HZZA 3H6KA 3RROA 3HG7A 1ONNA 2EHDA 5KNLA 1L1FA 3AM4A 2GERA 2XOXA 3ITDA 4ESOA 4YJGB 1HYGA 3C7CB 2CUKA 1KVRA 4J6FA 4RVSA 4IY1A 2B5VA 4AJPA 2P9EA 3H9JA 1PJ4A 4LSWA 2O3JA 4AJJA 4D45A 4E3ZA 3OQBA 1F0YA 4MIOA 2D4AA 4Y9DA 4BNFA 2AQHA 3H3JA 1FDSA 1X15A 3NT4A 2HRBA 2BGLA 3KSUA 2EW8A 2NM0A 3WSWA 4FS3A 4D41A 1K6IA 4CMIA 3NV9A 3KETA 3QE3A 2HJRA 4QECA 3UKOA 1WW8A 4BO8A 1NQ5A 4OQZA 3ONFA 3L6OO 4J4BA 4Y67A 5L53A 2EGHA 4HNGA 4E2XA 4RPGA 2DU8A 3I6IA 1I2CA 4RVFA 1PZEA 3BMOB 2JD2A 1ENOA 4GX1A 1XSEA 2VOEA 4Z0TA 1I0ZA 3KVOA 4NBTA 2V6FA 3DB2A 3G1TA 4XYLA 2DBRA 3F5SA 3MJ4A 1PU2A 1R12A 3NUGA 4BB5A 2VYND 3KV3O 3D0OA 3F5QA 2D2IA 4DGSA 3AM3A 1T2DA 4DQXA 5CDGA 5AXBA 4GH5A 1LLUA 4XDZA 4OHUA 2Q1UA 4U5QA 4WNCA 1QXSA 4BGUA 1PJCA 5F5LA 3BAZA 3AU8A 4R3NA 2O3UA 3WB9A 4L9RA 1EEHA 1W8DA 3BTUA 2J5QA 1GUZA 1ADCA 3I9KA 4HFRA 1ZJZA 1YBMA 2JL1A 4J7CA 5IAAA 4K6CA 4FFNA 3HJAA 1QV7A 5KJ6A 3CINA 1YONA 3V5NA 1NQTA 4Y8VA 1H94A 4TKMA 1ZK2A 2AXQA 1B16A 1N5DA 1VSUA 3KOUA 4XJTA 3DZKA 4BO6A 3KEOA 3WWYA 1P0FA 3V1TC 3U4DA 5JO0A 4ALMA 3RC7A 1W73A 3E5MA 3KEQA 1J49A 5IDXA 3I6QA 3L77A 3KSZO 1A5ZA 4YXFA 5A9SB 4GGPA 5IN4A 1HE3A 3GAZA 1T1SA 3STHA 1Q0QA 4GMGA 1GD1O 2J3HA 3UCEA 3ICCA 4NMHA 3WJ7A 4CQMD 1O5IA 5CHEA 1E7YA 1X0XA 5A02A 4O0LA 3SBOA 4DYVA 1FXSA 3O9ZA 3RKUA 2PA3A 3FD8A 4EYEA 3WLFA 1GYRA 1KERA 4EZBA 4JJGA 5G0SA 3GLQA 4R16A 1P1KA 4BQPA 1UXGA 4TVBA 2IYOA 4S3MA 2NU8A 2Q2VA 4D42A 3OIGA 1X7DA 4LVCA 4MKZA 9LDBA 3EY4A 2YQ4A 3GGPA 2W2LA 2UVDA 3JD4A 5L40A 4MOWA 4XEHA 1NAIA 4DIBA 4CLRA 3WNQA 3JQGA 3TPCA 4XRGA 3T7CA 1PQWA 4RDHA 1B3BA 2ZB8A 2Q3EA 1M2WA 3PJFA 1QYDA 5LDGA 1EK6A 3DL2A 1TT5A 2RH8A 1ADBA 4N7RA 1B8PA 4I9UA 1N2SA 4BIIA 3FHLA 8LDHA 4TRMA 1Y8QA 4N54A 1DC5A 3S55A 1ZO8A 5AXDA 4UVHA 3JD1A 3OA0A 2BGMA 1C0LA 2P4HX 2RH4A 1F14A 3QHAA 2OP1A 4PIVA 3IC5A 4GQAA 1MUUA 1DO8A 3BYZA 4P22A 2YDXA 4TQGA 4XQCA 5CAEA 3VDQA 3GPDG 2A9FA 5TF4A 4WOKA 5JAMA 4IJUA 4D79A 5AYVA 4UEJA 3JD0A 4NBVA 1G0OA 1SCUA 3KRTA 5I7VA 1MXFA 3GY0A 3HHPA 4RVGA 3VHRA 1WLYA 2VT3A 1WVGA 1EBFA 2Q1SA 4QUKA 2I99A 1D7OA 3CIFA 4HUJA 2QG4A 1DLJA 4MO2A 4NH4A 5JC8A 3PHJA 2HMUA 2Y68A 1DBVO 2C2YA 3ZHYA 3JD3A 1W6UA 1NHWA 3DOCA 1CQJA 1PWXA 1YBVA 2GRAA 4FCCA 3GNQA 1LDBA 1BGVA 4A73A 1EDZA 2EKPA 3DR3A 3ZV5A 1Z75A 1VE9A 1RKXA 5F5NA 4GGOA 1PR9A 2B4QA 4IGEA 3ZV6A 1PZFA 3VTFA 3WTBA 4YWJA 1J6UA 3GVCA 2I76A 2OL4A 1PZGA 5JY1A 4FFRA 1ZK3A 3JV7A 1YL5A 3OJOA 4LISA 1ZKMA 4Y6PA 3GVXA 5BSEA 1AHHA 5K0ZA 1VI2A 2V7PA 3JQBA 2I67A 5A03A 3ANLA 1CETA 3FN4A 3WGGA 1X7GA 3AK4A 1RM0A 3UW3A 1YL7A 3ANMA 1HKUA 2G1UA 2VHZA 2EV9A 4PRLA 4P4LA 2EGGA 2Y1EA 2JFFA 1HYHA 4RZIA 4G5HA 1KVQA 3RUHA 3W8DA 1ZBQA 4UAGA 2BD0A 4DA9A 3PFWO 2XF8A 3OQ1A 1UP7A 5JAQA 2JFHA 4R9RA 3RSHA 3WMWA 3I9MA 1UR5A 3VTZA 2X86A 1B0AA 1XELA 1NPDA 2VTEA 4XGKA 2FPPA 5ENVA 4E12A 1H9BA 2QZZA 3P2YA 3GRPA 5KTKA 3AI3A 5KJFA 1PEDA 2JD1A 2AA3A 4PLYA 4YDRA 5T5QA 2VRCD 1ZK4A 4HP8A 3GZNB 4XB2A 2OP0A 3U4IA 1O0SA 3V1UA 3F4BA 1Y5MA 4R69A 2GF2A 4L4XA 1BSVA 4PCVA 5HA5A 1NBOA 4H7PA 3GG2A 4GL4A 1YKFA 3WGIA 2FZWA 4IPTA 1BXGA 2VHWA 4B3JA 3JQ9A 4CLHA 5CG2A 1NVGA 1E0DA 1YOVA 2AQKA 2WMDA 3PHLA 4E30A 2HU2A 2I65A 2YFQA 1HXHA 3INGA 4ND5A 4QXMA 2E49A 1NPYA 3AFMA 3LDHA 4CM8A 4BUCA 1NXQA 1LX6A 1P45A 4IDGA 4G81A 1Q7BA 5DOVA 4XJSA 1GZ3A 2NU9A 4YAEA 1XWFA 3KUXA 4RPKA 5ER6A 2O23A 3PHHA 4O1MA 2PD4A 4E4YA 4FPXA 4E0BA 2QHXA 5G4LA 3UCXA 1QORA 5I7FA 3I9JA 4Z9XA 3GZ4A 2QRJA 4LMPA 4OXYA 4RJTA 1EDOA 2WEKA 1F8FA 4TWRA 1HE4A 1GQYA 2O48X 3PZBA 4HX5A 4RQUA 4CM4B 5DOZA 1WZIA 1BDBA 1PGOA 3GGOA 3VPSA 3L6DA 1HZZA 5DZSA 4M86A 1G1AA 4ZQEA 3HDJA 2O7SA 3NRCA 3VOSA 5HRUA 4FC6A 2X0NA 3HN2A 2X0RA 5DCUA 5EESA 1ZSVA 1FDVA 1OOEA 5L4SA 1B14A 3EHEA 4XKJA 4KUHA 1CWUA 1E3IA 4OKNA 2BF7A 4B4WA 1A7KA 3C1AA 3LT0A 2CFCA 2X7HA 1LA2A 5JO9A 3KYCB 3U3XA 3EC7A 4URFA 4Z0HO 4BKRA 4EJ0A 5KVVA 1XU7A 2X5KO 1C0IA 2YDYA 3D1LA 2C82A 4NU6A 3RVDA 2NTJA 1RM5A 2PKQO 3HWRA 1CIVA 2FR0A 4M87A 1YO6A 4EJ6A 1U8FO 4OKIA 4Z3DA 3RAJA 4E5NA 4PZEA 3IMFA 3HADA 5CFZA 3BTVA 1X1EA 4GX2A 2QQ5A 2E4AA 4UREA 4ZQHA 4QEDA 3RWBA 4JP2A 1P1RA 4I8XA 1PJQA 2LDXA 2X1HA 3NT5A 1HTBA
chains in the Genus database with same CATH superfamily
1K9VF 4IHJA 1F8GA 2B9EA 1ZD3A 3TE7A 4TMZA 1VLMA 2XA2A 3S1AB 2QVLA 2P2CA 3QX3A 3OJLA 2X2FA 2NYRA 3H7IA 3K9WA 2X58A 5LWHA 2ID9A 3U49A 3H05A 4KP7A 2C9OA 3PXGA 2RBEA 2TRSB 1VG1A 4PANA 1RXUA 1ZFNA 4W9NC 4NX2A 1XFAA 3M83A 4Q0MA 3S6JA 1CR4A 2J9YB 3OIWA 5IVIA 1Z33A 1U5AA 1YU9A 2ATIA 2PH1A 4N18A 3MS4A 3GD5A 4EHDA 4D9KA 1ECBA 3OCYA 1J7JA 3ODPA 3IFSA 4MAMA 4CQNA 4B84A 2P40A 2O9JA 5F4ZA 3BHNA 4GWGA 2QUZA 3HMKA 4JUAA 5EG5A 5THKA 1NQAO 2ZOSA 5IS2A 2ORED 1BRMA 3CF4A 2B8JA 4JEMA 3UJAA 4AG3A 3A4YA 2VATA 3AY6A 4I1VA 1SK8A 2RHGB 4F11A 4ACBA 3IA2A 4JOQA 4BO7A 5J23A 4ILKA 4P32A 3GG9A 4GRAA 3SLKA 4YPOA 3ASVA 4P4GA 5LB2A 2QVCA 3MNFA 4PCUA 2WM2A 1I3CA 4OHXA 3WB0A 2P6NA 2HIHA 1M2OA 4KJZA 1FDUA 4OYRA 5PGMA 4A26A 4JOSA 4EWLA 1N78A 3NFYA 4TZTA 1BD4A 5K7SA 2NVOA 2YY7A 1F8YA 4RLSA 4F93B 4NAVA 4HDRA 1SUBA 5LYJA 1Y7HA 4X9XA 2F8LA 2GZ1A 3PA8A 1U3DA 1XZKA 3U7JA 2D1TA 3OHPA 1FTGA 2GPYA 1PVOA 4KNVA 1G66A 1A96A 4BMZA 2HUPA 4BQOA 3DYIA 4BNUA 4Z4FA 4FUQA 3SZGA 3DFMA 3E5NA 3UMRA 1DX6A 5JS6A 1KJIA 2HCRA 1ZS9A 4OB8A 2J87A 4P4SA 4PG7A 3R8XA 721PA 3GFOA 4KQXA 6ABPA 3TF5A 3Q3VA 4EG7A 4M22A 2HRRA 3JPYA 3U6BA 4I4TF 1NM5A 2DM6A 1BHJA 1DXHA 1OXKB 1C9NA 1H1DA 3FUWA 1NVWQ 1EUCB 4C03A 3ZDDA 4OI4A 3ZZTA 1QGED 1NN1A 3CLVA 3RS3A 1GAQA 1JJBA 2HIAA 1QV6A 2WUEA 4UM8B 5CCDA 1UMKA 5HR5A 1ZJWA 1BQEA 3I09A 3OQHA 5SZKB 4EIWA 1W36B 1BU8A 3ANYB 1MIHA 4QD3A 3T1QA 2GKSA 1H8ED 3CH6A 4L6AA 4TN1A 4GXNA 5LP6B 1GG2A 2ZUDA 3HA7A 4M54A 1DMSA 2J31A 4CETA 3OZAA 4QUDA 3FLAA 4DMKA 2HWUA 3IQHX 1GXSB 3T3PB 1PV1A 3NEPX 1SC6A 4OHVA 2ET6A 4I50F 4B2YA 1BMFD 1GT6A 4CQLA 3I5MA 3II6X 4DSNA 3FOFC 2OGSA 3NMUF 2GBGA 1EE1A 4CF4A 2XXJA 1L5GB 3ZLVA 1J00A 4KGDA 5ELMA 4UBIA 4Y7DA 3EXG2 4ZA2A 2IPXA 3S1SA 5KX5A 2GSDA 1AN9A 2Q4OA 1T1IA 1L4YA 1GUAA 1O2DA 1O96A 1TPZA 3ABIA 2X1VA 3AG6A 1B26A 4XIIA 1EUDA 4YRAA 4MHOA 1DKRA 4JA2A 4WLVA 4RKQA 5AI8A 2DWOA 2QT1A 3AIMA 1H8HA 2OCYC 3HABA 4R0NA 5EFOA 2SECE 2WHPA 3GXBA 3SZLA 2EL9A 2BKUA 3RV4A 1EFAA 5HPYB 3NHUA 5JLJA 2AZMA 4XWAA 1V1MB 1A9XA 4BY9E 4CEIA 3UG7A 3IVRA 5E4FA 4C14A 2OQ2A 4YV7A 2ZBFA 3AF1A 1CB7A 1CS0A 3TRIA 1NFFA 3AEZA 4H0CA 3DZBA 1FUIA 2JAOA 3P2JA 4HY3A 4KWCA 1G2IA 2UUAB 3RTAA 2QN6A 1DJQA 3C7KA 3A14A 4DNPA 4FGLA 3HUFA 2CFIA 3DZGA 3FSJX 4NEGA 3X1DA 1GGFA 4EGAA 4F96A 4NSNA 3B6JA 1YNSA 1NQVA 3LWNA 3HP4A 4V39A 4LRYA 3TVTA 3OOHA 1Q1EA 1C50A 3M8KA 5CB8A 2B1GA 2D2VA 4M49A 1JTVA 1VSVA 4MW6A 2ZSAA 1A0OA 1I01A 4RMJA 2YHUA 3AWDA 2QQ0A 4JLAA 1DEHA 3H11A 4BU1A 3T7KA 3ROZA 5I9IA 3PZRA 3ZQ4A 5AKIA 1PD1A 3T5TA 4EVSA 3IBGA 3P0EA 2ABWA 1N9GB 1LJ8A 3O7MA 3VYSB 2GN6A 4ZI7B 5ICSA 2CLEB 4F38A 3UMFA 5AESA 2CDCA 4PQYA 5B58C 1XN4A 2Q6OA 2X4GA 2NU6A 3KFXA 3RUDA 1QU3A 5DXAA 4RAQA 3LRTA 4FMCF 2A4KA 4NYJR 1SVIA 3HFJA 4MGHA 3V4LA 1EXDA 3OSZA 2D7CA 2NVUB 1RMQA 4FHFA 3WDMA 3V8MA 4RD1A 4TXNA 1GCIA 4K1XA 4BU0A 2OM6A 4FGJA 4CMCA 2PSJA 4YMVA 5JJLA 1UH5A 3FCXA 2HIGA 1KZ1A 1E3MA 3AOEC 4JYMA 2O3TA 1M2OB 1U0RA 3RHTA 4DC1A 4DJJA 1E79A 4HNTA 2F62A 3MGCA 2A94A 4UTNA 4DCCA 2HK7A 5ERXA 1NBAA 3VX4A 5BVHA 4MKXA 3KKLA 4HDRB 5DP2A 2Q28A 1P7VA 1CDDA 2FQQA 1NQXA 4ZEOA 1W52X 1UMDB 2PU5A 3HKCB 3OZRA 1VI6A 4XIFA 3SHOA 3DDSA 5J47A 5J3JA 1QF6A 1VSTA 1GTMA 2EX4A 1VMEA 3PE3A 1TUBB 4ZO8A 4MWOA 5J5AA 1I7QB 2PVSA 2R1VA 3DDNA 3G5UA 4TROA 4YRCA 4O2AB 4UU1A 5LQCA 3FUXA 1CEEA 2Y6VA 3CISA 1KO4A 3M82A 4MW0A 3IQZA 2JRLA 3QX8A 3GRZA 3I53A 4AUKA 4HAUA 4W7HA 5BW4A 1ZR4A 3WV4A 4WLNA 3DXXA 4JP3A 1PZHA 3H8VA 4OPMA 4ARVA 3D0QA 2O5CA 4FYVA 4FD3A 4RQTA 5KB3A 4F71A 3CF4G 1EX9A 4F2HA 1NJ8A 2WSBA 1COWD 2VDUE 2XCRB 1LBEA 3OZVA 4OJKA 3HB9A 4IG4A 2HB6A 1XTVA 3E9DA 4PE5B 4QVKA 5EERA 3VH2A 4B4KA 2RSLA 1GQRA 2C0PA 1QH1A 3ZVKA 3WG9A 2YZ7A 4R2IA 1LC0A 3ORFA 3PIDA 4W9MC 3S1LA 3RBXA 1BA2A 2OZKA 4YT2A 2FFAA 4M1EA 5H3LA 5C8YF 5LR6A 2AL7A 1VE1A 1UXOA 1A9PA 3OPNA 1E1CA 3BRWD 4HD8A 3OZFA 5C4MA 3I34X 4CQLB 5DHAA 5E6SA 4CTKA 4CM3A 4X0EA 2GPNA 2R60A 4RD3A 5JVDA 3IAS6 4YJFA 1HQCA 3WLOA 4EF6A 4ZHQB 1ORVA 1I1OA 1VE5A 1ZZGA 4GLBA 1P74A 4EF5A 4CKCA 5AKGA 2CD7A 1L8LA 3JRWA 3TQFA 2VZLA 2WWIA 3EW7A 1O96B 3FVVA 2WSYB 3KUKA 3QOYA 3QXJA 1KMCA 4KQCA 5LIRA 5A0VA 2YNMA 1Y8RA 3O47A 3TQRA 4Z4QA 4EPWA 1I33A 1PV2A 3CJRA 5ITZA 2PSEA 3AJAA 2VJLA 3M4XA 4H27A 4O5AA 1N0IA 1N33B 4NARA 1KI6A 2WHPB 3VR5A 3IKTA 2CZQA 2FWAA 4M0UA 4IP0A 3AVUA 1FFAA 2OC9A 1L4HA 1JU3A 4TLMB 2UU9B 4ZYZA 3Q6NA 2YHIA 1CY1A 4N01A 3EIFA 3UOGA 1YDWA 5JH7A 1SXHA 1M8JA 2P9BA 1L7BA 3A1UA 2DB3A 5IAEA 4CKBB 3JQEA 5A3VA 3LCCA 4WXHA 1U9IC 2HUNA 4QTZA 3RC2A 3QJ5A 4JR2A 2JVIA 4IV0A 1Z5GA 4QDTA 4RYLA 4Q3LA 1W7AA 1Q7CA 2OCAA 1QK3A 5CVEA 1AO0A 3IV9A 5HKLA 2B2NA 1ILWA 5CIYA 2JLUA 2WQZA 2HGSA 2IBTA 5GINE 1WXFA 1YVRA 4TXHA 6LDHA 3OJFA 5E1OA 1EK0A 1R6VA 2Z2YA 5DK4A 4PF1A 2A9OA 2DQ4A 4GZ5A 5JCPA 3DD1A 2R48A 5B1EA 5KCZA 3HDQA 3AIOA 3BMNB 4BCBA 5BRJA 1T8SA 1Z06A 3HI4A 1XLTC 3GB9A 5AI9A 3H11B 1VL8A 1GPJA 1JHPA 4EFMA 2O20A 4UEOA 1EAYA 1JHAA 1SD1A 2O2IA 1RQXA 5EP3A 4JIMA 3T7SA 4DB4A 2NIPA 3DONA 4LRSB 2BFCA 5EPOA 2EWMA 4QM6A 2NXWA 4M0EA 3VTKA 2F2TA 1JNXX 4C4TA 1NRWA 2I3BA 3LYLA 5CM9C 4NPHA 1EESA 3L43A 1L5QA 3QP9A 2UYQA 3W1WA 2NU6B 5JZSA 1SKYB 3AUAA 1JB1A 2KSQA 3QLJA 4F3YA 3ICEA 3R9KA 1EMDA 2ATCA 2Q50A 4JVNA 1BAPA 2YKGA 2EARA 1YZLA 1EDDA 4B8ZA 2ICAA 1D2GA 1MHPA 1Y1SA 1H2HA 4HRVA 4MIKA 5AHRA 1VKNA 1R9JA 4FQ8A 1FFXA 1PSDA 4GECA 4LDJA 4PC6A 2W90A 2YJ6A 4B4OA 3CF2A 2X0KA 1FMJA 1Y4AE 3GR6A 4ZJYA 3E7PA 1FQJA 4DPMA 1H66A 2PS0A 4R8SA 3I04A 3P52A 2TMYA 4LJSA 4Q9KA 3EPHA 3UPTA 1SB9A 2JDIA 4LOJA 1U8EA 3KB6A 3FB4A 1ISFA 4BBAA 5BVHB 2O3QA 3QG5A 3T7RA 1QLHA 1RBYA 3LHSA 4FBLA 4KAFA 2JAHA 3OEHA 1OKKA 3WIDA 1R7RA 5HQTA 2XUKA 4JHLA 5K6AA 3FVWA 1DOHA 2Q8QA 2ZRBA 2ZU6A 1Z4JA 5LBTA 1KEWA 3TW8A 5KHOC 2IXFA 4HTAA 3C3YA 4ZD6A 2R1VB 3D3QA 2DE0X 3JQ7A 1NC3A 4D4GA 2ZYHA 1PCXA 1P3Y1 5EE9A 5K6TA 4F84A 1VE6A 2ALJA 4P92A 1BYIA 1VHWA 3NWPA 1RHUA 2GD0A 2H1RA 2OD7A 2ON6A 1GPBA 1Q0HA 1XCMA 3N3BC 4U9IS 3DT9A 1HRKA 3B3FA 4X8LA 4H18A 1OMOA 4PNEA 4UTPA 1RTTA 2EFYA 4BZXA 1ZIYA 1SIBE 3R1IA 4IOJA 3G0GA 3UQZA 4CTNA 5BSVA 1QO0A 1P73A 1MTOA 4NZNA 2W2LD 3PI6A 3PJRA 1CDZA 3DB1A 3A7EA 2HKIA 2NAFA 5AI4A 4JXJA 3CPSA 5DB4A 2PZJA 3SVZA 1QH1B 2IHYA 3FLMA 2ZS9A 3FR8A 3I30X 2PV7A 2FR8A 1KNQA 4EAAA 1EVEA 4NHEA 4XIJA 3ETDA 4RL6A 5KVAA 1Z6YA 2FPWA 3VR3A 1VJDA 3IDSA 5BXQC 1KEZA 4LMAA 1PGQA 1TMYA 2W2KA 4EGFA 3DTYA 3GLHB 4AJHA 1E1CB 2OV3A 1QP0A 1L5OA 1SVLA 1F48A 2XTZA 1IHPA 2OCBA 1DAGA 1XJ5A 2VJMA 1LWNA 1XB2A 1KI3A 1OTYA 1ZAKA 3F3SA 3G89A 4UXIA 5JVDB 4DVGA 2FFBA 4ARSA 1GUDA 1SUFA 2XWSA 4IIVA 3GAFA 5U9CA 1RAFA 3LQFA 5DK6A 2FSVA 5FT9A 4CKCB 4R2JA 3O3CA 2C7PA 3ND5A 3PX2A 3A1DA 5CYFA 4Y9TA 2ZYIA 4KQWA 3LZCA 3CWZA 2W6ZA 2GI4A 2BHTA 3F7NA 1E92A 1MQ9A 4BLPA 3TTYA 4ARUA 4BKMA 4LHSA 3HR7A 4BVAA 1U7OA 4PRZA 1KYWA 2W6NA 2CLOB 1I36A 1ZC3A 4R9SA 2WYWA 1EWVA 5LL6P 3NBAA 5EYPB 5B1SA 3ZCSA 2ZUBA 5B6IA 1OI2A 1U2ZA 4FFDA 5DE3A 4NS1A 2BCGY 2WPNA 1DPFA 3RQIA 1P33A 3VPXA 3AFNA 1QLJA 3NHJA 4E5DA 3T3HA 3DAYA 4R1LA 1WDMA 5A7GA 7MHTA 1LPNA 2FSSA 1TYAE 2GK3A 2P9ZA 3E0XA 3PC6A 3ZU4A 4IIXA 4P4NA 3H9UA 2ROQA 4CF3A 3IKJA 1O0CA 1ZITA 1EP9A 3W5HA 5AVQA 2P3LA 4PWYA 1QZXA 1H4TA 2K7FA 1YI0A 1X38A 3WKEA 3A1CA 1TI7A 1CE8B 2GBLC 3AHIA 4HV4A 3SJAA 1NUSA 5EOVA 1FVHA 2BE9A 1P19A 2Y27A 4WXMA 4YRFA 4BIMA 5IFLA 3ECCA 2IYVA 1CVLA 4C04A 9LDTA 2IYRA 2HLDD 2FRVA 3K2BA 3AP2A 2WYUA 3IIMA 1CUAA 4H7DA 5DWQA 5E2AA 3T7IA 3K70B 1KARA 2AKYA 3W6OA 1JTEA 2QG9A 4LW8A 1EBUA 2BGNA 4L4RA 4II3A 2FRXA 2KHZA 4H15A 3UAYA 3L0OA 2W22A 1XD2B 3UMSA 3WGKA 3LQQA 4BZQA 3T38A 2FOXA 3D4NA 3IOBA 3JQFA 3KKEA 5FBWB 3FZQA 4ZVRA 3MJEA 4XD2A 5FEMA 1VHQA 4EY7A 3ICPA 1C7RA 4MUXA 5CGQB 2PXAA 1TU4A 2IIPA 4IF6A 4Z7NB 5A5EA 16PKA 2O2ZA 2Q4TA 1VZ3A 4GEGA 4ND1A 2MTBA 3A36A 1WDTA 2PL3A 3MRSA 1FFGA 4I5EA 4TQ9A 1FFXB 2EYUA 2YV2A 2B3TA 2FVYA 3JQRA 2IELA 4HQ6A 1DRWA 1PFYA 4NEQA 2FN8A 4NYMQ 3VPAA 1WKCA 1Y4SA 2FHPA 3FYCA 2LKCA 3HJHA 1RAIA 4HDSA 3AW9A 3CLUD 4RHEA 4ZU6X 4ANFA 4NBRA 3QEKA 1B41A 3COPA 1P4AA 1DFIA 2E4UA 2GEBA 4KE9A 3C8UA 3RVBA 1KTVA 3AV0B 4B4VA 4BNGA 3BEOA 3KQOA 4WACA 4RH0A 4YONB 1HT0A 4AKTA 5JYBA 1KAHA 1ODIA 5J63A 1ENZA 2X4LA 3NGLA 4ZVTA 3TLXA 5IZ4A 2D5IA 4MYRA 2D5LA 2OO7A 3FDZA 4W5JA 2HXSA 2WZQA 3GFSA 2AX3A 3TW8B 3G2JA 4ZHSA 3GMIA 1PNQA 1X7HA 3E03A 4L15A 4E5MA 2R25B 4EMUA 3IDZA 1USUA 2PUWA 4S0XA 3OU2A 3NATA 1ZH6A 2GD1O 5EHGA 2CVFA 1Z7GA 2N42A 3IS3A 4FDMA 3TIFA 2AC7A 2YW2A 3P9SA 3ZY6A 1JW9B 2BCEA 2BTOA 4M2LA 1G8JA 4MCAA 1QSGA 2JEOA 4YV1A 5AUOB 4B3GA 4HLUA 2NU8B 1RWQA 1P18A 4RY9A 5IC5A 3ICVA 1VGRA 4D0GA 4DNOA 4YXWA 4WBNB 3TLKA 3U4QB 5K51A 2C3OA 4YY3B 2ZSUA 1IZ7A 4E46A 3L4BA 5LXTB 3FSGD 3OMXA 1N6HA 4DIEA 2VZ9A 4CLRB 1HM5A 2J6HA 3EUFA 5J4YA 4X1IB 4HGRA 2QTCA 4MLZA 4L75A 2QVYX 4YYZA 4ZJZA 4MVJM 2AFIA 1H3EA 1VLLA 3BXHA 3R3HA 4B85A 1R6TA 1FK8A 4P54A 2UYYA 1WQ3A 1VPVA 3E48A 4RMIA 5EKSA 5A9RA 2IBMA 4FE3A 4EY6A 5IBPA 1CPYA 3LLMA 1CCWA 4UXJA 2VPIA 3EFHA 4IMRA 4YGXB 1EVYA 4GI2A 3W8RA 2B94A 5A4DA 4RF5A 3NHFA 4LZAA 1Y8QB 3I9V1 3D02A 1QWSA 5FBKA 3AP1A 2Q27A 5BN4A 5KWJA 1JHUA 1I2BA 4BHTA 5E2IA 5HFNA 3L9XA 3K0FA 3UANA 3ZNOA 5FLEX 1NBIA 1VP3A 2H92A 4G4GA 1SIOA 4BNTA 1PGJA 2LNDA 1P7WA 2ZIXA 7AT1A 4OLHA 3C43A 3HB5X 4DR5B 1RYNA 2X0IA 5AVXA 4EA6A 4LV8B 5I01A 1AKNA 1B15A 1G6OA 4YPFA 3U40A 3P2EA 1RRKA 4G8DA 2DJ5A 3AYZB 3I52A 1G3IA 1BJKA 1YVEI 1H3FA 2Q5IA 3H1PA 3P9YA 4JLOA 2QY9A 1GFWA 2DT5A 2WF5A 3CUYA 2VKQA 3OX4A 5TY0A 2P1RA 1VG0B 4KAAA 4QDXA 1PYGA 5AVRA 1DV2A 4E7PA 2WAMA 4S1OA 4G84A 5HIJA 3EGEA 4LE0A 3MWJA 4M0DA 1IE3A 1GJRA 1XU9A 1Z13A 2CLSA 2BEWA 2GZMA 3SJUA 2ZYDA 5GONA 2ZATA 4UTRA 2EFHB 2DFVA 3RS9A 1RRPA 5A3SA 3ST7A 4ZO6A 4R54A 4CN8A 5K0TA 1LVHA 4TKUB 2BYTA 3IDFA 3TX6A 1Q44A 4MRMA 5EXEA 3W78A 4OUKX 4R1UA 3QWFA 4F56A 3PP8A 3EEYA 1AV7A 1TCBA 1ZOIA 2Z5GA 4XW2A 1RHQA 4ZTBA 2OA0A 1M83A 3S68A 3SD7A 5TMEA 3NYRA 4EARA 1WXXA 4Q3EA 2M6KA 3GYGA 1WABA 2AOVA 5DM1A 3T5GA 1B42A 1HC7A 2OCKA 4WKCA 4DARA 1U1FA 3K8YA 3K6JA 3AQIA 3LC7O 3OTGA 3DWFA 1D8AA 1R8SA 1U9CA 2XXAA 1H69A 3DBOB 4OHMA 5E9JA 3QOFA 4WEQA 3R9XA 3W8NA 2CF5A 3HGQA 3K1AB 4LCBA 1HYBA 3K53A 3E3LA 3WGTA 2H1LA 4KVFA 5B37A 3OECA 2R4TA 3PPWA 1C3OB 3ZWXA 3CG0A 2PNFA 4LDZA 1GTSA 2I8CA 3H5RA 4YRSA 1SBYA 2PX6A 3MGKA 4G2TA 4RF3A 4EI8A 3C7DB 1TLFA 1GDTA 3C3CA 4F6CA 1FP7A 2PL9A 4LWPA 2J0VA 3IP6A 3PEVA 4ID9A 2AN3A 2H9YA 1YH3A 1GPYA 3FTCA 3MCZA 2WJVA 5AK6A 1YFLA 5JJKA 1RRCA 1XAIA 3C70A 3DR5A 1KJ8A 2CXTA 1HT3A 1NR5A 2JZNA 2ZBUA 2I2AA 3FFAA 4EZEA 2QRVA 1M2JA 4NQRA 1R37A 3N75A 4WRRA 3PITA 1RWMA 4OA5A 3V4PB 3KS9A 3RIHA 1I4LD 3G8CA 1HNXB 3TLAA 1XU4A 1JLMA 5CX4A 2UZ4A 1SD5A 4QODA 5K2OA 2QQGA 1VJTA 3IOCA 2PN1A 4D44A 1JYFA 1ZONA 2ZE7A 2WB4A 2EHJA 3R7SA 1PGNA 4F1WA 3CX3A 3X2FA 4QVIA 3B78A 2BGRA 4FKBA 4JBGA 4NMMA 2DYKA 5KOHA 3O93A 1L4BA 1QLWA 1I6LA 1M6NA 1CHDA 3QBTA 3VISA 1XTZA 1S8AA 1U3UA 5DCLA 2FFJA 2F8TA 5BVGA 2X9NA 3B7PA 3KWFA 3AR6A 5ARDA 4M8SA 2MMCA 4M0LA 5JXWA 1YOVB 1JHYA 4QYWA 5FA5A 3ZEAA 3ZNNA 4RTPA 4NCAA 1BH6A 1P1FA 4F8JA 1YZGA 1YDFA 3MJCA 3AOGA 2HDNB 4BNWA 2ZYTX 4YJKA 4L95C 4NNJA 4DMMA 1D5CA 1SKUA 2C84A 3JSAA 1BW9A 1J2EA 5BW8A 5KQLA 4D8UA 3CWQA 4DLYA 5BOVA 4WASA 5EGSA 4G1BA 2PGXA 1M1YE 1U8CB 4I8DA 5C1OA 1FSGA 4X7MA 3DMDA 4G86A 4H17A 5CFOA 5JZBA 5ALPA 2FOLA 5FUYA 2GFHA 5COAA 2H2DA 4JBLA 1GTG1 1WMBA 2ZXFA 3PXXA 1JBQA 1PSZA 3OCJA 4ON9A 1NBMA 2V7QA 2RGAA 3RBVA 4AQYB 1UJNA 3ZIUA 2R8XA 3RUIA 1G55A 2XUAA 4UBOA 1L9KA 4AW9A 2B25A 2MU1A 2ODNA 2QZ9A 4HWKA 3U7IA 3HLTA 4WE3A 1O1YA 2O54A 2ZIXB 1LKZA 5I7RA 3NH9A 3TR5A 1BVRA 4OMCA 1N2GA 5ECGC 2IQIA 1V9CA 4OXXA 5LLTA 5IM4A 4UC0A 6REQA 3ZUPA 4RULA 1UODA 1XLUA 3V8RA 5G0UA 4DMFA 4UVIA 3P4YA 2ECQA 5EMNA 3PC8A 2CB9A 1T24A 2G77B 1E6WA 1UBKS 2BE7A 2QQEA 4GC9A 2P67A 4MWEA 1RMYA 3GNSA 4Q7QA 1U6IA 2LGJA 1NXWA 5IYZB 4DTIA 4DJ5X 3OE7A 2ZM5A 5LD2B 4KK4A 3IUPA 3HACA 3AUTA 4FHZA 3FETA 2ZAYA 2R5FA 3A2MA 2V1XA 5JSQA 1LH0A 4I1PA 1A5SB 1UQRA 4ZDKA 1QB7A 4DLUA 3QJYA 3GX1A 1KYYA 4W63A 1JB9A 4ZQIA 3U80A 5CA0B 2CXXA 2FUCA 1OI7A 3UPUA 1U8UA 2A6PA 1HLGA 5F1YA 4PZ0A 2ADOA 4QXQA 5GOZA 2AVDA 4X7PA 5H4HA 3W2FA 4FTWA 1G6KA 4H60A 1F4VA 1BXRA 1L8XA 2QRQA 2WVHA 2YOFA 3GZTB 2GEJA 1OE0A 3PGKA 4GZMA 4B79A 4PZPA 3O8NA 3D7MA 3SYLA 1YI8A 1EWYA 3GRKA 1E0SA 2VHEA 3O38A 4GX0A 3ED1A 2AUNA 6AT1A 1W88A 2XXAB 2VNAA 3KOXA 4X7BA 1YXMA 1XPUA 1K8YB 3QKWA 5L3ZA 4AY3A 1U8AA 3C0KA 3P2OA 1I7DA 3R9XB 1PO7A 1TF2A 3RYFA 4AQDA 4ZXPA 1NX6A 4YMLA 2QMUA 3FCUB 3NT2A 4HAYA 4FSXA 2Q0XA 5T57A 5HIKA 1M7BA 4U8GA 3SLRA 1TKRA 1KXJA 2IRWA 3M3PA 4AI6A 2BDUA 1Z18A 2DY1A 2XTNA 4LJ9A 4EYGA 3BX1A 1K7XB 3EDYA 3G6WA 4O25A 3C5HA 4PV7A 2ZZKA 3NHZA 5FOUA 3W9SA 4BNJA 5J43A 1II9A 4F9TA 2RHRA 3P26A 3K20A 3LUKA 3ABOB 2A0UA 3X2SA 3DHEA 4RVOA 4P9NA 1G8KA 1N57A 1R50A 2AFHE 2L19A 5FI1B 4C89A 4CM1A 3BILA 3PQ2A 4R2XA 4UZEA 3NRBA 5COQA 5EMJA 1Z2OX 2D2EA 3DEFA 4S24A 4W9NA 5GJVC 4ZI5A 4KR9A 4DZTA 4B3MB 2FP4B 1G63A 1XVAA 3H9BA 3A9UA 2HNBA 3L01A 3HRHA 5HILA 4EUNA 4RLFA 2JCVA 2YIVX 5H16A 2IOQA 4JENA 2AXPA 3NEJA 5CNKA 3N86A 3H4VA 1IVSA 3DG9A 5IKEA 2X3YA 2NXJA 3VNBA 5KOHB 3VNUA 1Y63A 1KDOA 3UVEA 3MLBA 4LBZA 2H48A 2UZ0A 4FT4A 1U3VA 2HA6A 3K31A 3NAQA 3PQ5A 4GZ3A 1C7EA 4WUTA 4CU5A 2OBXA 3SJZA 1UDWA 4B6FA 4IIUA 3LX6A 3VPBA 1S4QA 2WSSD 1Q95A 1N75A 1AY0A 5EQFA 7ABPA 4MPTA 3W5IA 1Z0IA 2TMDA 4X60A 1KDRA 1DADA 1QYRA 1F2VA 3EOAI 4NCNA 2QTHA 4IVNA 5JC1A 2VUUA 4DV2B 2I87A 2RHWA 3QNWA 4HFMA 4QPJC 2AI1A 5JANA 2V7WA 3PQ3A 4ZO7A 3LA6A 4QFDA 2JGRA 4QHSA 2C5LA 3WAKA 1RZVA 4J2OA 3WLHA 1LLFA 3BWDD 3WBJA 3IIEA 4Q3KA 1E6MA 1ZEJA 1GUBA 2R7KA 2XHZA 3F7OA 3IT3A 3LY8A 3SPXA 3WKDA 1Z2NX 2A57A 5FAXA 5G40A 3RB8A 1DQYA 2SNIE 3F2VA 3JR7A 2V7EA 3WGHA 2PGAA 1Z2DA 5F98A 2AFRA 1DDOA 1GPH1 3T52A 1T9AA 3HBMA 3NTXA 5JE8A 2EJCA 4XARA 1EH5A 1RHRA 4MR7A 2JI4A 4FE7A 3AEUA 4B6QA 5LYYA 3ZG6A 5JXJA 3OD1A 4KN9S 2IYWA 3P8ZA 5CRIA 3RAGA 3AUFA 4QUBA 3GEHA 2WC1A 2IZOA 1IY8A 1T5BA 5SZIA 2CDAA 3BE5A 3ZWYA 4F12A 5KQSA 4R1SA 1X8LA 2HX1A 3ENKA 4PR3A 3T3EA 3CNOA 3OVMA 3LSYA 5ESDA 3VO2A 4BO3A 3MG9A 2CHEA 3WBFA 4B5KA 2AI3A 3RVMA 2GEVA 4A27A 1H6AA 2NTVA 3ZXSA 2V7TA 4PLCA 1RWWA 2W6OA 4F85A 4MWZA 2YXEA 3FTFA 3OPYA 4KN5A 3K9BA 3VNSA 4XLTA 1UIRA 3UWMA 4B6JA 1SXJE 3R7FA 3NP9A 3SJCA 2P2LA 4CQJA 4EHAA 3BZUA 4A4DA 3WYGA 2BJWA 1NZDA 1ORTA 4PYIA 1XZCA 3AL0C 3V7UA 1V8DA 3S44A 3G8YA 3M9WA 2XXBA 1YJQA 1GSIA 5DKFA 3WQBA 2DPHA 1YS7A 4ZCLA 1EFKA 5J2TF 4BLQA 4JI2B 3R44A 5F1OA 4RK5A 1WCYA 3N2YA 3HYCA 4GHWA 1GGEA 3VYVA 2BT4A 3H1GA 4LCEA 3PLRA 5DT9A 2AC4A 5BW5A 4P83A 1W88B 2WKPA 1KYIA 3V3TA 2ZSDA 4PHHA 3ADCA 3T4PA 1TZMA 3VR1A 3R0VA 4DCPA 1OZGA 3PNVA 1XEWX 3SHTA 4JITA 4JN6B 1OB2A 2E82A 3MTAA 2XWPA 4ENVA 2OHVA 5E6RA 2G7MC 1XRLA 3B6EA 2LV8A 4M76B 5KTOA 1FCJA 3IAXA 4KPYA 2EEPA 1Q0UA 1IUPA 3V55A 2AG5A 3DKRA 4K26A 5GGYA 1LBQA 1X2EA 1TC2A 4RABA 1GCOA 2F64A 2UZIR 1VPDA 5TVGA 4CHGA 5FO0A 4CMHA 2Z0MA 1KC1A 5JT1A 4YROA 3FH0A 1QF7A 1X86B 4AN4A 1KEEB 3ZXUB 5K20A 4C0QC 2DFLA 2IY7A 4BX8A 3AIIA 2KLHA 2NNLD 4B7AA 1SZDA 4WCDA 2VYNA 1H3NA 1ORIA 2C0CA 3QYJA 1KH3A 1SA0A 1SUEA 4YJ2B 3U4AA 5JDIA 3W2IA 3UJ3X 1DC3A 1ZAYA 1T26A 3KJHA 3LTEA 5CH5A 2H06A 5EZQA 4PX9A 4UU7A 1N2ZA 4A0FA 3I73A 2OG1A 2HQSA 2IGTA 1CT9A 1NNI1 4TGLA 4KWIA 1HDRA 4OLJA 3CLTC 1KVUA 2FSHA 1SQ0A 2FGJA 3UWPA 2MWMA 3HCBA 4DWWA 3NIDB 3C8ZA 1VC2A 2I78A 3BH6A 2B8TA 4N5IX 1YBAA 3QE2A 3KT0A 2XYGA 2Z1DA 3FAZA 4ZICA 1KPHA 4AO6A 3AOEA 3HN6A 2PO5A 3C85A 3G0DA 1NYTA 2AFHA 3TQTA 5LZ4A 4KXNA 5THQA 1QGYA 1RC1A 4HLQB 4I4IA 2IEIA 2Y0DA 3ENZA 3JQBC 2YMPA 5C81A 3TCNA 3CZ5A 2IZ6A 4WGFA 1X9IA 3LKDA 3A9CA 4F7DA 2XOEA 4F3NA 4DANA 3PSAA 2VZ0A 5H68A 2IPMA 2NOAA 3LQ4A 4M3NA 3S8MA 4DR3B 1Z5PA 4RTQA 2BDTA 3O0TA 1IJFA 5FWXB 2O2CA 3COVA 3RU7A 1L5MA 1XXHA 4L8GA 1R27A 2OD9A 1XQXA 3GDOA 1I4OA 1UIMA 4UZSA 4DZRA 3PNMA 1DRVA 4XQ9A 3CRRA 3C7AA 3H2ZA 3W4KA 2VPPA 3FGNA 4O8ZA 4RA6A 1T9BA 3B2EA 3ZCUA 1FNBA 4TXJA 2QQFA 3D3KA 3E61A 2YHSA 2H0RA 1PR3A 1H2FA 3QVKA 2GR9A 4NLLA 4WADA 3ZV4A 4MR7B 4Y0AA 9GPBA 3I23A 3VNAA 2OC4A 4TTJA 3DOHA 4HAOA 4YDHB 3DBIA 2WNHA 1GCUA 3CGGA 2Z8YM 2C99A 3PGA1 4JLMA 4BKPA 4C0AC 4ZT3A 3U81A 1HNNA 1KQOA 4OCZA 5CP8A 3X43A 4ZODA 5DBIA 2OK8A 3WIOA 4GOJA 5EUQB 1R1DA 1NU6A 5AKXA 4DSZA 2HXYA 2GYUA 3P2KA 3KWMA 4IWYA 5D1HA 4ZGGA 4H3KB 4Q21A 2K2QB 5SYAA 5EXTA 3RT9A 1LI4A 2FLWA 4C2BA 3QMPA 2UZ3A 4IIGA 2RD2A 3E3OA 4WK2B 3ER9A 2FPUA 1HRDA 3C5VA 3L7BA 3FVQA 4TUYB 1O9BA 3JQ9C 1E9DA 3KL2A 1QBKC 2CSUA 1Y5LA 2XKJE 1XZ8A 3F74A 3O31A 3PICA 4A91A 5AKZA 5JNWA 2NO5A 3NCHA 1HDEA 4A0SA 2XGGA 3MMXA 4BQEA 1G2PA 1VG8A 3C41J 1PK7A 1I3MA 2C5HA 2VAWA 4UPEA 2B0JA 2P0AA 3L0ZA 1P0CA 3DBHB 2H1CA 3D3NA 3AJRA 4IICA 5H81A 1GYQA 1PTJC 1KR2A 1J8VA 1BNCA 1CZOA 1NJ1A 1WWKA 2BMFA 2N1BA 3B85A 3I8OA 3KT3A 4M0KA 4NABA 1MZPA 1V5FA 2GBFA 3VHLB 3E9MA 3UYLA 1UEJA 1WUYA 3CQ9A 2KWIA 4BPRA 4DV0B 4KRFA 5G02A 3UMVA 3TZLA 1SKQA 3L2OB 1JHVA 5TB5A 2QIOA 4CMEA 4QDKA 2HU7A 2GHQA 3ABSB 4GBMA 1K4MA 1HSZA 2C03A 1HA3A 3G0BA 4FOLA 1ZSNA 4HDMB 4GVXA 4B6RA 3QF4B 4BN4A 3VC3A 2X9LA 4KFRA 1W35A 4Q03A 2CBGA 2J45A 5FUXA 1U9IA 3LCUA 4PFSA 3BRQA 1KOGA 2HK6A 2ZTUA 5CA1F 4MARA 3CY6A 4FZVA 1RCTE 3OZSA 3TE6A 1PNOA 3C3XA 3KT8A 5GJCA 3WLNA 4KWHA 1HZZC 4OL0A 4JUCA 4PYLA 3K2QA 3NTLA 3D7NA 5B1HA 4G5QA 3GP5A 5B30A 5C1DA 4PYKA 1ZCZA 1M0SA 1Z2AA 2OXRA 3OLQA 5AK5A 4LJRA 4BO4A 2ACKA 3BIOA 4WZBE 4ND4A 2FSIA 1KDTA 1RQRA 1GA1A 3B7WA 4FXOA 4BMNA 3GN1A 4D9JA 5IJWA 1V47A 2C96A 5CURA 5IAJA 4PPGA 1C3LA 2I8AA 1N2JA 3K0CC 1O3YA 3A6KA 4Z53A 3GDWA 3PRKE 4PXAA 3KWJA 3LECA 5BN5A 4BFSA 1A3CA 2OPBA 4F4CA 4JKYA 3UG6A 1XZQA 5KOYA 3VMFA 3BIWA 2YZ2A 4B09A 2IXEA 1GTJ1 4YFVA 1GPKA 3HE3A 5CT4A 4CGZA 3ORSA 2BM9A 1AXRA 1W94A 3OZXA 3THRA 4R9NA 3RS8A 4BNDA 1IFXA 2GPWA 3QFSA 4IVPA 2WT8A 4UW9A 2AZDA 2Z6UA 4L02A 4NG5A 4BFYA 1Z56C 1M7GA 1XZPA 1W5SA 3BMQB 3RI3A 4CCSA 2R7AA 4C7OA 4LNAA 4YUYA 5AKJA 4IQ8A 2IU0A 1OX5A 1V9LA 1LSOA 3EGWA 3HM2A 1QANA 2CDBA 3RU3A 5FTWA 1YC2A 4Y2UA 3UICA 3V2HA 4NTZA 4ZANA 3NOOA 1SHJA 4B2IA 5KIAA 2Q3DA 3UF0A 4WT7A 4UM9B 3LRPA 3O90A 3IBFA 4TLEA 1YRBA 1W1UA 2H8GA 3QVOA 3W0LB 5I7HA 4M1WA 1DJPA 4YJ3B 3MUOA 3GRCA 1ODFA 5C4IA 1E2LA 1JI0A 1JHQA 1B2LA 2B98A 4Q15A 4FT2A 2DLDA 1Y3BE 3HDVA 4UKDA 2NN3C 4MGIR 4COOA 1W2WB 1UWKA 4WQMA 4LDQA 3WVNA 5J5VA 3U0BA 4CG0A 3MFQA 4HQRA 5B3JC 2EKDA 4DC0A 3KKOA 4QGAA 4FEGA 2VHVA 2CBZA 2DHDA 3KCQA 3HLYA 5LZ5A 1U1GA 3KOWA 1L5VA 1NI3A 2AZ4A 3GFTA 3R3VA 2XCOA 4ENWA 2YCBA 3WP0A 1USKA 4G65A 5DYIA 3FPEA 4NWIA 2O8FA 1RWNA 2VUTA 2XWQA 5IHPA 1A72A 1GGJA 3H99A 2FG7C 4L7VA 3TD9A 1LNQA 4XH9B 2H07A 1OI4A 3O4JA 5BNTA 4D26A 3FY4A 3UBMA 4WZ6A 2BKVA 1QFZA 3AHHA 1TM3E 2BLLA 3RRYA 3L0DA 3S2EA 3MCAA 2Q4BA 4GKBA 2ZR7A 3JATA 1XNJA 4IHJF 4HAZA 4C7VA 4AT1A 4HADA 1P2VA 1JIIA 4KBFA 1E5LA 2ZS7A 2NSDA 5C0OE 2BKXA 3K0AB 2UKDA 1Q21A 4WZAE 3G5LA 2QRLA 3GIDA 1ISJA 1P1BA 1X19A 4K2AA 2IYLD 1A9YA 1PJ3A 2R8OA 4FW8A 4YUAA 2D6FA 1PKEA 3S2UA 1RQGA 3SFVA 2Q4DA 3DMNA 4HXGA 3QEAZ 1XGKA 4CIWA 5DLDA 3LT4A 2V55B 5GY7A 5LDDC 2ZI5A 3WYEA 1P44A 5J40A 4DKJA 3HL4A 4I8IA 3IO3A 2HJSA 3UHAA 5IJXA 1XTBA 4MLDA 1K1EA 4E5PA 3S28A 2CV0A 4GBED 3R6GA 2B34A 3N8KA 4P33A 3SICE 1H42A 1HBJA 3TJZA 4RIEA 4QSHA 1U11A 2QB5A 1UDAA 3BXPA 3IEKA 5DHTA 2BEVA 2EIXA 1IWBB 2CNOA 4D3SA 3T1HB 4D8TA 4CEHA 1Z29A 2PYZA 1TYBE 3C6XA 3W7VA 5KPDA 2NUPB 5F21A 1KK2A 3LLSA 1G2OA 4H4EA 2L18A 3T35A 2IEDA 4WI1A 1F2DA 2PLAA 5ECYA 2VG8A 4G6ZA 1NJSA 3PENA 1FDIA 1EGHA 2G08A 2ZCUA 3HHEA 3NONA 4O59O 4PG5A 3DAPA 3FPGA 4L4YA 4PLFA 4RTMA 2PHZA 2V8BA 1N36B 1AJEA 2RHOA 1RAHA 2J3JA 3EZXA 1AG9A 5LYJF 3RVSA 2V9ZA 5IXJA