4NQZA

Crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in apo form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
248
Chain Sequence
GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystal Structures of Pseudomonas aeruginosa Enoyl-ACP Reductase (FabI) in the Presence and Absence of NAD+ and Triclosan
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 82
structure length 248
sequence length 258
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nqzA00
3PPIA 1V9LA 3GVCA 4P4LA 3B1KA 2X23A 3Q9UA 3SLKA 1DJNA 1K3TA 1JVBA 2CD9A 4GL4A 3VH3A 1SOWA 4BB5A 3WGHA 1DAPA 4IXWA 4FGWA 3JV7A 2DBRA 3WFIA 4PG4A 3PFFA 3VPSA 4B7UA 1QRRA 1XU7A 2HCTA 4BO8A 1UDAA 3R3SA 4N54A 1Y9EA 1MB4A 1YB4A 5JYEA 1YB1A 2GRAA 3DHNA 3QQPA 2VZ8A 1I32A 3ZU3A 1ZVMA 4JN6B 1LLDA 5AXCA 2GPTA 3KBOA 5JO9A 3WGGA 1NR1A 3HSKA 3OA0A 4DC1A 4RZHA 4J4BA 2W2LD 4GSLA 4YEDA 4PZEA 3WYBA 2Y1FA 4IJKA 3JQEA 1NBOA 3IKTA 1ADCA 1Y9AA 1U3VA 3U49A 2X0IA 1A4UA 2ILTA 3TDKA 4UVGA 1FDWA 3DFUA 2OO5A 4CL8A 2QX7A 3KYCA 4YBZA 1H6AA 2JD0A 3ZHXA 4TRJA 5F3RA 2WMDA 5CDTA 4D45A 1F14A 1KVSA 2W4QA 3DHEA 4J1TA 5FYDA 2HO5A 1NP3A 1NVGA 1O95A 2VHWA 4RVUA 4TROA 1F12A 3QJ5A 1UZMA 5LC1A 3ZN2A 4AFNA 5CAEA 1LLUA 4LISA 5MGBA 5ICSA 4NG5A 3DR3A 3NAQA 4FOOA 4OXNA 1E7SA 2Y1EA 1FJHA 2HKIA 1X14A 3JQ7A 1JDJA 3DBVO 3IMFA 3KETA 4YCAA 1DC3A 1SEVA 5CDGA 4D7AA 5C5IA 4NH4A 2J8ZA 1A4IA 1OOEA 1H94A 3HDJA 3QW2A 4I1IA 4YJHA 1QV6A 2RH4A 2JFFA 3WNVA 5KVSA 2BGLA 3RCBA 3MZ0A 1ZSYA 2F00A 4R54A 3QV1A 3AI1A 4YXFA 2DLDA 4YAIA 4OSPA 3O9ZA 3V5NA 2Q46A 4BNHA 2FSVA 2EHDA 1EK6A 4TKMA 4CLOA 1Z7BA 5CDSA 3NTRA 1YXMA 4A2CA 3GDGA 2PY6A 4CLRB 2V65A 3KV3O 3OF2A 4J2OA 3HNPA 2ZYAA 5FI5A 2HUNA 4BNXA 2HMSA 2O7QA 5TQVA 1PGQA 1Q7CA 3ZNPA 4AJNA 4MKRA 4PCVA 4TSKA 1ADFA 5K0ZA 8LDHA 1R0LA 4YVFA 1YQGA 4ND5A 4CLEA 3H9UA 4HFRA 2O3UA 3FI9A 5CPFA 5IF3A 5TIIA 3OFSA 3U09A 1CQIA 3JTMA 2WEKA 1GEEA 3D3EA 3WXBA 2NU9A 5F1PA 3TQHA 2EJWA 4BNZA 3U4DA 2H5LA 4I08A 1K2WA 4C7JA 1IYZA 1EUZA 3IUPA 3VDQA 4DPKA 1X13A 3RBVA 1E6EA 3RU7A 4L9RA 1GTMA 2ET6A 2OMEA 3BMNB 1WNTA 1RM4A 3H3FA 3JQAD 3KLPX 2CDCA 2V6FA 2EIHA 1VKNA 3VPXA 4D42A 1WWKA 4BQPA 1J0XO 1JKFA 3K2EA 4Z0HO 4HV4A 3DZBA 4Q3CA 3RSHA 4MKXA 2CF5A 3RUFA 2BGKA 1ZZEA 3QVXA 4NJOA 3ITDA 4BNYA 2BFPA 4MVJH 3VZSA 1ZEJA 4FW8A 1DHTA 1U7TA 4OAQA 2IEBA 1TT5A 2X5KO 1G6KA 3QVWA 5DF1A 1HL3A 1E3SA 1RPNA 1B2LA 2RCYA 3GH3A 3WLEA 3HUDA 5ENVA 4CM4B 4D44A 3JYNA 3R0IA 4FJ1A 3QRWA 3GAZA 4BKUA 4BNMA 3GVIA 4Q3EA 1IL0A 5L4NA 1CJCA 5L53A 1ZUD1 2NV6A 2VUSA 4WEOA 1NTOA 3BHIA 2CDBA 5J23A 2FSSA 5IJZA 3RROA 4G81A 4GMFA 4BV9A 4J9UE 1ID1A 1BSVA 2EKPA 4OXYA 5COBA 3NKLA 2POQX 2I67A 4EZBA 5TX7A 3KXDA 2E4AA 1KY4A 3ASUA 1PL8A 5T6BA 3BIOA 1H2HA 1HRDA 2WSBA 3W1VA 2JFGA 4CMIB 5JDIC 2VOEA 3NGLA 2NM0A 1FDTA 2B83A 2C2XA 3ONFA 4RDHA 4ZJUA 1U4SA 4AJHA 3JCZA 1QYDA 4LN1A 1U8FO 2Y68A 4PGFA 2DQ4A 4HFJA 2Y1OA 1VI2A 4IS2A 4LSMA 3C85A 3ETEA 3RASA 3U4CA 1O5IA 5L95A 1X1EA 3Q6IA 5ITWA 3FHLA 1E1LA 1TEHA 3MEQA 4YJGA 1U28A 3EK2A 4L76A 4OO3A 4LRTB 4BKRA 2BHLA 1LSSA 1QG6A 4RLSA 5MDHA 4KUGA 3OA2A 1O0SA 5IXSA 1KS9A 3BXXA 4NI5A 4R4JA 4EUHA 3HDHA 2J5KA 3D4PA 1EMDA 1BHSA 3CPSA 4AJ4A 2OUIA 4JXKA 4AJPA 5JDCC 1E1MA 2Z5LA 3WFJA 1NPDA 4B7XA 1N8KA 5BSHA 4WLNA 4E30A 2FPPA 2GCGA 2ZB8A 3PLRA 5JDIA 4RPHA 4PVDA 1AXEA 4XQGA 2YY7A 4WLEA 4E5MA 3DHYA 4PLVA 4B79A 4P38A 5DCYA 3RVDA 3GNQA 1B7GO 1JU9A 3L6EA 3S2IA 2GZ1A 3T4EA 3WLFA 3GGPA 1D1SA 1WLYA 1WMAA 4HKTA 3EZLA 1GZ3A 4MP6A 4RF4A 2NU6A 3K2BA 1X7GA 3C7AA 4TRRA 1E77A 4ZQFA 1UXKA 2QYSA 2Y99A 2NVUB 1ZXBA 3D3WB 4TQGA 2B36A 2DU8A 3ICPA 2BI7A 3WGZA 4R5HA 1DDOA 2GSDA 1DIBA 1ZSVA 5JCJA 4CUKA 4XJSA 3VPGA 4OJNA 3VVBA 3D7LA 4U6SA 2OZPA 3HN2A 4PLGA 5TNXA 3RJ9A 2GYYA 4GAEA 4CM9A 5AYVA 2HLPA 3HFGA 9LDTA 1ENZA 2Q49A 1NVMB 1ZW1A 3ROPA 3DZKA 4R1NA 4J4HA 4PRKA 3HDYA 2X7HA 5G4LA 5JO0A 4JP3A 1P1IA 3DDNA 4RV9A 4DXHA 2QYTA 3L6OO 4KWHA 3TOZA 3OBBA 1NQ5A 3SEFA 3ROKA 1MLDA 4IJUA 3H9EO 3DOJA 2IYPA 4CQMB 2W98A 3FR8A 1DO8A 5IZ4A 1SPXA 1R16A 3QA9A 2VTEA 4OYRA 3V8BA 2C54A 2W90A 2WD7A 5EJ2A 2DFDA 4J49A 2PH3A 6ADHA 4U8GA 1SBYA 3ZNOA 1OAAA 1SZJG 2PR2A 4W6ZA 4DMMA 2HRBA 4NR0A 1MXFA 1T2AA 4OSOA 5EMHA 5DP2A 4Y9DA 3FR7A 4WLFA 1C1DB 5DOVA 3LQFA 1UDBA 5B12A 3LF2A 2YQ4A 3K30A 4URFA 2NU8A 4CMKA 1MFZA 5A02A 4P22A 1ZK1A 4S1VA 3GF4A 3DONA 3VPFA 4WEQA 1P9LA 1MC5A 4N18A 2CVOA 3BZUA 3E03A 3E9QA 3OSUA 1LX6A 1K6XA 4OIMA 3B20A 3UHAA 4AJ1A 3DBLA 4MKZA 5JLAA 1U3UA 5THKA 4O5OA 3KUXA 4R5MA 4XYMA 2RHCA 4UUOA 4YRBA 1B14A 4FIZA 1G1AA 1GUZA 2BELA 4K6FA 4NBTA 1MX3A 1XEAA 1C0IA 5L3ZA 3GNTA 2ZJ0A 3GZNA 1I3NA 2ZYDA 3NJ8A 1X0VA 4ALMA 1U9JA 3ICCA 4KP7A 3QHAA 3TFQA 3E6AA 2AEJA 4NHEA 3PQFA 4BNKA 3ASVA 4RVGA 4G5HA 4WLVA 3JQ6A 4PZCA 1HE3A 2Y1DA 4NBRA 2QZ9A 3ZNNA 3WYCA 1E7QA 3MJEA 1KERA 4GVLA 1HF3A 3NGXA 3DZJA 2Q2QA 5A9TA 1U7HA 4BO5A 5IG2A 2FOIA 4J1QA 4BIIA 2HMWA 2I66A 2IZ0A 3EY4A 1H0KA 3NJ4A 1TI7A 3PYMA 1SNYA 4KQXA 3ZCXA 2QHXA 3CUKA 3MOGA 1XWFA 2AHRA 5TRTA 4QUKA 3PXXA 3HZZA 4I8XA 1B8UA 5DOZA 3ITKA 4XCVA 5K9ZA 3AUUA 3SJ7A 1Y8QA 1H6BA 3QP9A 4FJ0A 3JD0A 1PQPA 4GWGA 3I3OA 3B1FA 1K6JA 3DAFA 3AOEC 3OQ1A 2PWZA 1CQJA 3V2UA 1AN9A 3FD8A 4CUZA 4PG6A 3C8MA 1FF9A 1FDSA 3OETA 4TRMA 1WPQA 1HDOA 1LTHR 3MJCA 4MIOA 4DC0A 5HWSA 1PQUA 1MG0A 1OI7A 3MJ4A 2Y66A 3AM5A 3WQRA 1ZJZA 5H83A 2X5JO 2ZATA 1I2CA 3LT1A 4UUNA 4NQZA 3QVTA 2G5CA 4IM7A 2Y1CA 4J7UA 1ZO8A 1J4AA 3MWDB 3L0DA 3KSDO 3OIFA 4YQYA 1RM5A 2CUKA 5JCXA 1ZBQA 2C29D 3H9GA 3PVZA 3PQDA 3U3XA 3VAZA 4MJLA 4YR9A 1MV8A 1SOVA 3LT0A 1EFLA 4U0JA 3KYDA 2CNBA 1ENYA 2B5WA 4YRAA 3E9NA 4P4GA 4CMGA 4R01A 1R4NB 2Q1TA 5THQA 1I36A 3PWSA 3U62A 2Y1GA 3I6QA 3CKYA 4XYBA 2DFVA 2EERA 3UOGA 4PVCA 2GN4A 3HWRA 4UUMA 2X6TA 1P33A 3AOEA 3B1JA 2FY8A 4AVYA 1HDRA 5I7SA 4KUHA 4EDFA 2YYYA 5KJCA 3UH1A 1UP4A 4CMEC 1VJTA 3OQBA 4OMUA 1R12A 2R2GA 2D0IA 3ZWMA 1YDEA 2Y0DA 1UZLA 2EGGA 1DAOA 1JKJA 4KTTE 3ZHBA 4EJ0A 3OJOA 1PWZA 4J16A 2OORA 4CMCA 2GERA 3JQAA 4HXYA 3MJSA 4GPD1 1JLLA 3NRCA 3MOIA 4HFMA 4BS9A 3NV9A 1I30A 2DM6A 1H93A 4I5GA 1I3MA 4CLDA 4M1QA 1V3TA 2AEMA 2V6GA 3I23A 2V7PA 2WYVA 1EEHA 3IJRA 2BF7A 2P5UA 3ULKA 3M2PA 2YUTA 4IIVA 3QWBA 1CERA 1HXHA 1NFRA 4ZGWA 1N7GA 1YKFA 3V1TC 4ALLA 4CODB 1QYWA 1C0KA 4B8WA 1GFSA 3VZRA 4CM8B 4FB5A 3W8EA 1OC2A 1GZ4A 4AJKA 4CMEA 4KUEA 3G79A 1H9AA 2GASA 4MIEA 1WMBA 4QFDA 2ZYGA 3TL3A 1KVQA 3IS3A 4A27A 3NTOA 1HYHA 1U5AA 4NDNE 2XXBA 1YL7A 3PGJA 3LDHA 4KWIA 4E5KA 1YJQA 2VWQA 3JD3A 2JL1A 1PTJA 4XDZA 3JQBC 5L9AA 1L1FA 4CUJA 1NASA 5K6AC 3EDMA 1XIVA 4XQEA 4Y8VA 4QO8A 3OIGA 4GMGA 1NNUA 4EI2A 2VHVA 4L4RA 2V6MA 4UEJA 2EWMA 1W73A 1XR3A 3ABIA 3P2YA 4BL5A 4EEXA 5JFOA 4UULA 3SLGA 3I9OA 1O6ZA 4E4YA 3C1TA 3IDSA 3FTNA 5KCZA 2BD0A 4FR5A 4CLRA 3TFOA 1E6UA 3DB2A 4BNLA 5C7IO 2GN6A 2WYUA 1ZH8A 4LMPA 5JW6A 1YL6A 4QT0A 2DT5A 3WX0A 3BYZA 1C14A 4C7KA 1DIHA 4FCCA 4NNJA 4B4VA 3IOYA 4LGVA 1A9ZA 1N92A 1R6DA 5U1PA 1S6YA 3IKVA 5JCJD 4J7CA 2FPGA 3WWZA 3JQBA 3IC5A 3TZCA 3DOOA 4CM9D 1AHHA 2BKAA 3L4BC 4DWVA 4GGPA 2ZB3A 1NHWA 2GUGA 2VYNA 2YHIB 3M2TA 2C5EA 4GX1A 3H4VA 4R1UA 1HDGO 4CR7A 1HE4A 5AXDA 2IRWA 2WYWA 4WE3A 5KKAA 3DL2A 1PJSA 2X58A 4GWKA 2H63A 5TT0A 5KJ6A 5G0SA 4PZDA 2NU7A 3WGIA 3W6UA 2BFMA 3A1NA 1B26A 3D4OA 4XZ3A 3K96A 4B3IA 3VZQA 3JQ8A 4YWJA 2A94A 4BO2A 5DBFA 1E7MA 4HNHA 1TT7A 2JFHA 1RWBA 5H81A 2Q1UA 1Z7EA 5T8KC 4D79A 1UR5A 4WCFB 1EK5A 5EPOA 2VHYA 4CMHA 2FP4A 1UXIA 1VM6A 4YT5A 4XX0A 2R00A 2WWRA 2VRCD 1P1JA 3AUAA 4I5EA 4CM4A 3L4BA 4B4UA 1B8VA 3GVXA 1VKOA 2D4AA 3H65A 4TVOA 3UVEA 2WM3A 1PS9A 3E48A 2DC1A 3MJVA 1XHLA 4DIOA 2YZ7A 2PTGA 3CH6A 2C20A 4N7RA 4IZIA 4M55A 4KDEA 5JE8A 1PIWA 3VVCA 1E5LA 1UXGA 3JQFC 4J7XA 2PGDA 1ISFA 1FDUA 1ONNA 2EXXA 1P0FA 2PLAA 4R1TA 5A03A 5JMPA 4BO7A 3F3SA 3WQSB 4Z9YA 1YL5A 3GUYA 1X15A 5T8KA 3EZYA 3HDQA 3I9MA 2ZTMA 5G4KA 2HK8A 3GG2A 5TSDA 2OP1A 2GLXA 4XQ9A 1CRWG 3TZ6A 3CZMA 3AW9A 3GY0A 1EVJA 3RBXA 3EVNA 1PSDA 1EDOA 5IDWA 4N5MA 3CMMA 5A3VA 5L51A 4MP8A 4TZKA 1ZCJA 2VHXA 2WE8A 3GA0A 4LMRA 1I2ZA 5FI3A 2I99A 1EE9A 1N1EA 2D8AA 3WMXA 1LA2A 3I9LA 1P3DA 1ZNQO 2X22A 2NNLD 5TF4A 3BAZA 2EG9A 2HJSA 2VT3A 3W4KA 2AXQA 2Q3EA 4GSKA 3AJRA 2D5CA 3E8XA 1VJ0A 4ZRMA 2B4QA 4BNFA 4DQUA 5AOVA 4OM8A 1M67A 3GUCA 5B4TA 1QKIA 1YBMA 4JX8A 3EW7A 1DFGA 4TVBA 1UP6A 3K31A 2JCXA 1VLLA 2OFPA 1LDEA 2YW9A 1B3BA 1VL6A 4OGWA 3SBOA 5L7YA 1YBVA 2VN8A 3EGOA 1PJCA 3IUSA 4DPLA 1T1SA 2H9IA 1HLDA 4PLPA 4YJDA 2UV8A 1LJ8A 3NUGA 4QXMA 2OBYA 2AW5A 4K1LA 3NT4A 4UREA 1K0UA 4CQLB 1E3WA 3ENKA 1P31A 1BW9A 2AG8A 2GR9A 2NVUA 4K26A 3CIFA 2ZKLA 3LVFO 4O59O 3UCXA 4Y98A 4PRLA 4Z0PA 1MP0A 1DSSG 5ITVA 3UUWA 3L4SO 3ZZNA 1DLIA 5IN4A 5DZSA 2G17A 5CFZA 4DLAA 1E7YA 3I83A 2X9VA 4PLTA 3I1JA 1FK8A 2C82A 4IQ0A 2EF1A 3TZKA 5GMOA 2PNFA 2CFCA 4RCVA 5A9SA 1Y5RA 3TNLA 4BO4A 1NPYA 3DBRA 2J5QA 1PJ4A 3SC4A 1H6CA 1XDWA 4MVJG 4YJFA 4E2ZA 3WYEA 5IFLA 3H3JA 4PFJA 4XRRA 1W6UA 3ZU2A 5CEEA 3PFWO 2JCVA 4RPLA 3ONEA 2D59A 1O9BA 1GADO 3ZWXA 4AJJA 4WLUA 2BGMA 4GQAA 4RQUA 4PG7A 4Q39A 4U6QA 1ENPA 2BFOA 2CY0A 3MCVA 2IODA 5ES3A 4F6CA 4RPKA 2DTXA 1EUDA 4ND3A 1E3JA 1JTVA 1ML3A 4O63O 2AQKA 1SB9A 3KEOA 4UVEA 4J90A 3W8DA 3HB5X 1YOVA 2G1UA 1FMCA 1ULUA 2B35A 4MO2A 3WTBA 3PQEA 5A04A 1X0XA 5HA5A 4KDFA 1I10A 3UKOA 3IP3A 5BNIA 3RIHA 1T1RA 2IYOA 3QWIA 5DCUA 4Z3KA 4MOWA 1MA0A 1QXSA 2HSDA 4OQYA 1U5CA 1GY8A 3TWOA 2C2YA 3INRA 2I65A 3L07A 5LDHA 3PHJA 2QW8A 4QEDA 5CDYA 4R69A 3O8QB 1Q0LA 1OMOA 1P45A 2VWPA 4F45A 5HTOA 5GZ1A 2Q1SA 3WNQA 3OP4A 2FHSA 1ARZA 4LCEA 4KOAA 1AUPA 2AA3A 3K9QO 4GLLA 1N9GA 5IXYA 5DNAA 4GX2A 2VZ9A 3ZWYA 3ONDA 3GMSA 3KEQA 4RL6A 1EVYA 1DIRA 1CIVA 1SO8A 4DTIA 5DBIA 1NHGA 2I5PO 4W9NC 1G0NA 1NFQA 1V6AA 2DBVO 2JHGA 4J0FA 3IP1A 4L0QA 4LK3A 4B7CA 4WECA 2XXJA 1HT0A 3PJEA 3INGA 1KEPA 1WZEA 1A5ZA 4XGNA 4BVAA 2A92A 1WZIA 3M6IA 2GO1A 3S2EA 3MTJA 4EEZA 3GHYA 3VH2A 4J0EA 2GZ3A 1BWSA 2O3JA 2X9GA 3DFZA 3QLJA 3WICA 3ZNQA 4BHTA 4MIYA 3Q2KA 1M76A 1ISJA 4NFSA 3OEWA 4FFOA 1Y6JA 2IDZA 3ENNA 4JBHA 5JAMA 3QE3A 2AEFA 3BMQB 1TA4A 4P4NA 2Q2VA 4YT8A 1E92A 3DTTA 2B69A 5I7VA 4HY3A 1A7KA 3KZVA 5I9LA 2YQ5A 4GI2A 3AM3A 4OHUA 1NR7A 2JD1A 3WR5A 2J3KA 4NJMA 3U5TA 1NVTA 4CM3A 2PK3A 2C7VA 3HE3A 1RM3A 1M2WA 2X0RA 2VYND 4WNIA 5G0TA 1DLJA 5JY6A 1QLHA 5CP8A 4YDRA 5F1KA 5HBRA 1B16A 4RVHA 3Q3CA 4HFNA 4FS3A 3KYCB 4I5FA 2FMUA 4D0RA 4CM1A 1U2GA 5IDYA 3P2OA 4JBIA 2PZMA 1E0DA 5A1TA 4DQXA 3OM9A 1Y8RA 1NAIA 4FN4A 5EERA 2JCYA 1GYRA 2P68A 1ZK3A 1PX0A 2OHXA 1VL8A 3F4LA 3UICA 1DFIA 5L40A 2VUTA 4F46A 1XGKA 1X7HA 4XDYA 1EUCA 3JQ7B 3KHUA 5JMWA 3FPLA 3BTOA 3DZFA 1KBZA 2GNAA 4FFMA 3RI3A 2HK9A 3DXFA 5H82A 2NUAA 4YJHB 5TS3A 1DOHA 5JDCA 3PJFA 3E5MA 3HN7A 3JSAA 5TC4A 1DB3A 1ZMTA 3AM4A 4IDGA 3L9WA 1Q7GA 1GEGA 1R66A 4HNGA 2H6EA 4CLOB 4D43A 4BNIA 1IHXA 1IHYA 1YDWA 3LLSA 4K6CA 3LSYA 2J6IA 4D46A 4A26A 3GGGA 5EQFA 4UVDA 1KVTA 4XA8A 3VTZA 5I9MA 3NDJA 4XB2A 1QV7A 1KC3A 4YAKA 3WDSA 4WUVA 2VNAA 2W2KB 1ZEMA 1WVGA 2SCUA 1IZ0A 3DTYA 3BMCA 1DBVO 1E7RA 4QECA 3HHPA 4O0LA 4DUPA 1DC5A 1YWGO 1LDMA 1U4OA 2BLLA 3ETGA 4GH5A 3NT5A 4UEKA 1PGPA 1JWBB 4CM8A 4XIJA 4X54A 4PLWA 4DA9A 2O3TA 2E37A 3VKVA 5IDQA 1HDCA 5JC8A 2VRCA 4I9HA 4A0SA 1HSOA 3F46A 3CEAA 3IL2A 2UYYA 2XPCA 4YRDA 3M1LA 4BGEA 1IUKA 2P9CA 2HAEA 2C0CA 3BTSA 4M86A 4ZRNA 2X5OA 4GGOA 3LK7A 4GBJA 1P74A 3BHJA 1VL0A 2GN8A 2DBZA 3GK3A 5KOIA 4MP3A 4L4SA 4R41A 5BT9A 1HDYA 5TJ9A 4BMNA 3VOSA 3FWZA 3DZHA 4QTZA 1AXGA 1T4BA 3GRKA 3HB4X 4GX0A 4H16A 1BVRA 3NEPX 1Q0HA 3RC7A 1VC2A 3JQGA 5F5LA 3K6JA 4QSMA 3DAPA 5LDGA 4G2NA 3WB9A 1GR0A 4NPCA 1VRWA 3TJRA 3FTPA 4WJZA 2VT2A 4Z9XA 5KVQA 1DC4A 2TMDA 1E1NA 3CZRA 4R68A 2O3SA 2D3TA 3FBTA 3AI2A 4QQRA 2EW8A 2JAPA 3PLNA 4CM5A 1BXGA 2EJVA 2P9EA 2FR8A 1EDZA 4KZPA 3CSDA 7ADHA 1DPGA 2FPIA 3HADA 3JYPA 4II2A 3PDJA 3RFXA 4MPDA 1U8XX 3IJPA 2EGHA 3EVTA 1CETA 4LVUA 5KNLA 2YHIA 5C7OO 4B4WA 1ORRA 5ILGA 4DL9A 2PGLA 3S2GA 1PGOA 3G1TA 1JAYA 4M54A 4OXKA 4YT4A 1DEHA 4M8SA 4BNUA 2QRKA 3RWBA 2HU2A 4U0KA 1EQUA 5B4UA 5I7EA 4YJGB 1GUFA 3I9JA 4CQMD 2P4QA 1K89A 2RH8A 3F5QA 4FPXA 5BR7A 3F9IA 2Y67A 3ON5A 5JPIA 1ISGA 1JA9A 1I0ZA 4B4OA 1YO6A 2XAAA 1NYTA 4IQ8A 3JQCA 3BTVA 4IMPA 4BQRA 1UJMA 1HZJA 4JBGA 5C3MA 1E3EA 2X9NA 1CYDA 4CMJA 1R37A 4YPOA 4IMRA 1IOLA 2Z1MA 5TT1A 3P19A 5COAA 1VE9A 2I76A 1V3UA 4TRNA 2UUOA 4AJIA 1YGYA 1J49A 4F6LA 1PZGA 2D2IA 4BB6A 1YB5A 3I6IA 2VHZA 1Q1NA 2J3IA 1D4FA 3I9KA 3PHGA 3ZU4A 2E48A 2AG5A 3PYLA 3WMWA 4XWYA 3ZWCA 2ZTUA 4ZN6A 1N1GA 3M1AA 5LCXA 2DTEA 4IDBA 1LDBA 3O26A 3PIIA 4L8VA 4KTVE 4E6PA 1PGNA 1W8DA 1H9BA 5ER6A 4CV0A 1R0KA 5JBIA 4BGIA 4D3SA 4RQTA 4XQCA 3EYWA 1PWXA 5KVCA 4AJ2A 4FSHA 5CEFA 3OIDA 2O4UX 4L4XA 4R1SA 4WOKA 3D4NA 4W82A 4BGUA 5L45A 3LLVA 5T67A 4E21A 1YQXA 1R15A 2VWHA 1BGVA 5IAAA 3FCOA 3FNEA 3ROQA 3Q11A 5C7LO 2HK7A 2R6JA 3GMDA 3U4HA 3A9WA 5BNTA 2D5AA 3ZWVA 2Q99A 4E0BA 3PJDA 5G0UA 1NQTA 2QIOA 5JAQA 3FSRA 4E13A 3AUTA 1P1RA 5A5EA 4FOSA 2HMVA 2GF2A 3UGKA 3WJAA 3GDFA 3GQVA 3KO8A 3BHMA 3K73O 2WD7B 3H5RA 1XLTA 4H15A 4XIYA 5FWNA 1XA0A 4NFHA 4MVJA 2OXIA 1WAMA 4OOEA 3W4IA 4XYEA 1PZEA 2VZ0A 3TRIA 1PJBA 3STHA 1MFPA 3HFSA 4BKQA 1JWAB 3JYOA 2G76A 3NX4A 1P0CA 1AGNA 2X8LA 4PIVA 1HLPA 2QQ5A 3DMTC 4ZA2A 1L7DA 4NBVA 4NIMA 5ADHA 3C3XA 3VH4A 5JXWA 3DBHB 3QWFA 4DVJA 2BFAA 3DOCA 4G65A 4P8RA 2CVQA 4B8ZA 2FN7A 1W4ZA 3EUWA 3NDIA 4BO3A 1Z75A 4PLZA 3N58A 3F6YA 3DBLB 2GD1O 4A03A 2P2SA 5F1OA 4DYVA 1LNQA 3CE6A 2DBQA 4CPDA 8ADHA 4H3VA 2DPGA 4K28A 2CF6A 2LDXA 2LDBA 4EJMA 4UVIA 3QVOA 3GZNB 1YBAA 4PN3A 3NYWA 2CZCA 4E31A 1T2FA 1LU9A 3QSGA 3D1LA 1T2CA 3ZWPA 5A5FA 1N5DA 1GCUA 4WPGA 1C3VA 1H5QA 2FR1A 3DEYX 5K6AA 1KETA 1ISMA 2AMFA 2DUUA 2PZJA 3ZW8A 4JJFA 2VYVA 3Q2IA 4FFNA 1G0OA 3DMTA 1WXDA 1Q7BA 1OBFO 2O2SA 2ZJ1A 4BO6A 1HTBA 4IZHA 3BMNA 4E2YA 4MVJM 3FNHA 2JKVA 4TMFA 3OJ0A 1Z74A 4JNKA 4E32A 3LT4A 1Y81A 5B37A 3UCFA 1HWYA 3WQQA 5AVOA 3GDOA 1I3LA 1HYEA 1IB6A 1GYPA 5KVVA 3OEYA 4LCJA 1Y8QB 2Q4EA 1KEUA 1IZ9A 5DDIP 1WDLA 1PJ2A 1UAYA 2PH5A 3O03A 2E6UX 2IZZA 2X1HA 4BGVA 4E2WA 5JSFA 3INTA 1TXGA 2J5RA 1S7CA 1T25A 3GVPA 4E33A 1CEQA 5KTKA 4A5OA 2YDYA 4AJLA 1YS4A 4IUYA 4BO1A 2P4HX 4PG8A 4BMVA 1PQWA 1HEUA 1LC0A 4NBWA 4W7IA 1AE1A 1C0PA 1HSZA 4IGEA 1LDGA 4CM6A 4XRGA 3A4VA 3DO5A 1BDBA 3I52A 1LSUA 4FD3A 1XKQA 4H7PA 3N7UA 4ID9A 1T2EA 4F3YA 1PGJA 1PL7A 3L6DA 4YTEA 2VOJA 3KYDB 4II3A 4E5NA 2ZB4A 1TLTA 4RLHA 4BNTA 3EHEA 3H2SA 3VPHA 3DQPA 3I5MA 3ZV5A 4CMIA 2OL4A 2VRBA 3QWAA 2IZ1A 4XYGA 2Q50A 2ZQZA 2WJPA 3D0OA 4J3FA 3UN1A 2ZTLA 3ZHYA 1ISHA 1T24A 3C7CB 3T7CA 1A72A 2I3GA 1E7WA 4DBZA 1IY8A 4DYDA 1NWHA 1T26A 3GN1A 3OICA 2P9GA 5HM8A 4D41A 3H8VA 4E3ZA 1GD1O 4EITA 1ONOA 3EMKA 1GV0A 5COQA 4A10A 3BMQA 2PA3A 1ADBA 1QMGA 3PK0A 4ALIA 1YQDA 1EVZA 1B3RA 3G0OA 3JQAB 2RHRA 1D1TA 3ANLA 1KYQA 2P91A 1SB8A 1LI4A 1V3VA 3TPCA 3AFNA 3WWYA 3ADOA 1CDOA 3I9NA 3AY6A 4ZQGA 2QRJA 4EJ6A 2WD8A 2X4GA 3JQFA 4WLOA 1TB4A 3JQDA 3LYLA 4JCOA 4N5LA 1PS0A 2NVWA 2GZ2A 4FQ8A 5U4QA 3ZWWA 3KSZO 3RBZA 4YACA 3RUIA 3AY7A 2DPHA 4JK3A 3VDRA 1ONPA 3JQ9C 3SXPA 2XOXA 4ZD6A 3PYXA 3MJTA 1BMDA 2Z1NA 1LDNA 4W7HA 1E1KA 2QRLA 2ZIZA 3TZQA 1Q0QA 1YJ8A 2G82A 1U2DA 3GEMA 4XGKA 4BV8A 4I5DA 1FXSA 1M6HA 3GPDG 4FC7A 4INAA 4XKJA 4I9NA 3RC1A 2Q4BA 4FDAA 4DRYA 1JAXA 1BXZA 4NK5A 5AQ1A 2G0TA 3TF5A 1NQAO 1U3WA 1I5RA 1Y1PA 2O50A 3GT0A 4ILKA 3PP8A 2HDHA 3HJAA 4CMBA 5JNLA 4LSWA 4ALNA 1PR3A 3A28A 4QO7A 4J6FA 4ZICA 3ZWNA 3H7AA 3D3WA 4R16A 4RF2A 4RPJA 3UW3A 1BRMA 5HRUA 1SC6A 3IIEA 4HBGA 1QORA 4QFCA 2F1KA 5L7TA 1GL3A 4Y67A 2UDPA 3K8ZA 3UF0A 2VNSA 3P5SA 3LU1A 3RUDA 1V8BA 1XU9A 5B1YA 1L7EA 3NT2A 4XR9A 5IZCC 3JQ9A 1R4MB 3BTUA 4RVFA 1XQ6A 4GVXA 1OFGA 3AFMA 4DREA 5IN5A 2E82A 5CEJA 1I24A 4XD2A 3ANNA 1ZK2A 4IJVA 2PD3A 1MUUA 3GR6A 1PZFA 4XEHA 1X7DA 2Y0CA 5KWEA 2IXBA 4LRSB 2IEDA 3WGQA 3FNFA 5T64A 5DP1A 5KKCA 1PJ3A 3QVSA 4J1SA 4J9VA 5EL0A 3COSA 2J3JA 5TJHA 1BG6A 4DBVO 4JQCA 4CQMA 2W2KA 3VC7A 3C1AA 4BO0A 3BMOB 2EV9A 1AHIA 1C1XB 3KYBA 5JY1A 1J6UA 3CTMA 1LEHA 4TWRA 2OBNA 4J4TA 1IULA 4BNVA 1KC1A 4IJWA 1J5PA 1EVIA 1KOLA 2EW2A 5JS6A 1GDHA 1GQYA 2D1YA 4HWKA 1A27A 4O6VA 1DC6A 4JLWA 5A9RA 2BMAA 1NAHA 2FR0A 3RKRA 5CPBA 5CG2A 4IXTA 1C1DA 4NK4A 1QYVA 4IPTA 5IZCA 3GVHA 3S2FA 4ZQEA 4CLHA 1QYCA 3UXYA 3SVTA 2YHUA 1ZJYA 4B3JA 2X0NA 3ZHZA 4N5NA 4WGGA 2IE0A 4CL3A 3S1LA 3CXRA 2AQ8A 3R1IA 4IDFA 1LQUA 1PU2A 1YRLA 2HQ1A 3JQ8B 4BKPA 1EBUA 2ZQYA 3C1OA 5FF9A 2OP0A 3DZIA 1A9YA 4JROA 1PZHA 2YJZA 4MVJD 3OQ6A 4RO0A 1VSVA 1U3TA 2BH9A 3GOHA 1XQ1A 2PV7A 3G3EA 3X2EA 3NTQA 3PZRA 4R3WA 3MTGA 3PWZA 4CM7A 2DVMA 4MINA 1HYGA 2V6BA 2C07A 4DPMA 1ENOA 3PZBA 4E5YA 1HDZA 2PZLA 2B5VA 3F47A 3G1UA 3PHHA 4BNJA 3S55A 3F4BA 4HP8A 5AXAA 1RM0A 3OH8A 3DMYA 2PFGA 3PRJA 3O4RA 1I2BA 3GEDA 4RVDA 2CDAA 5DBGA 3QY9A 4XB1A 4ND4A 1VPDA 1NWCA 3ROMA 1XELA 2CVZA 1ADGA 3ETDA 3ZV3A 1B15A 2NTVA 4YAGA 1GAEO 2QZZA 3GAFA 3D5TA 1EQ2A 1I33A 3Q9NA 4FC6A 4Q3NA 3PGXA 5DCWA 4AG3A 5TLSA 1O8CA 1JW9B 3KVOA 1IPEA 3DAGA 3JD4A 3AUSA 4IBOA 3ZI0A 1NXQA 1YE3A 4IDAA 2NTJA 4WCDA 5DULA 4M87A 4WKGA 4Y6SA 1LLCA 4W9NA 1PJQA 5G4KB 1D3AA 2VYVD 1E3IA 3QWHA 2IXAA 4GKBA 4D0SA 3OJLA 4Y6RA 4XYLA 1H6DA 2PD6A 3KLMX 1I8TA 5ER9A 4EUEA 2I6TA 4YYZA 3GZ4A 5CHEA 1R0SA 3L77A 1LBEA 3WGOA 4FBGA 2BI8A 4U7WA 4A7PA 4IY1A 5GY7A 5EINA 3WBBA 1PS8A 2JJYA 2ZTVA 4WOJA 2FWMX 1ZSNA 4LW8A 5GZ6A 5I9NA 3NDRA 3ADPA 2C59A 4YB8A 1M75A 4OH1A 4GKVA 1NX6A 5L4SA 1HE5A 3F1LA 3RFVA 2UVDA 1HDXA 2RAFA 2I3AA 2Z95A 2VTDA 4CJXA 3N74A 4PLYA 1D7OA 1Y7TA 1BTOA 3AK4A 9LDBA 1R4NA 3TZHA 4UVHA 5I8ZA 1SMKA 4UUPA 4AJEA 4BNNA 2HMUA 4ND2A 5KIAA 5HS4A 4EYEA 1Z82A 1BXKA 3O38A 4OKNA 3B6ZA 1HE2A 3WTCA 3G49A 1EZ4A 2YDXA 1ZFNA 7MDHA 3VHRA 4OQZA 4MVJP 1GV1A 1T2DA 4W99A 3LC2O 4AL4A 1E3WB 1MC4A 2GDZA 1DRWA 1BW9B 2DAPA 1RKXA 3I4CA 1UP7A 3ST7A 4J91A 3V1YA 4R51A 3FBGA 4DGSA 1VJ1A 3U4IA 1Z6ZA 1XCBA 1DXYA 2XF8A 3KSUA 3AI3A 5EQDA 1QLJA 4M49A 4HUJA 5I7FA 3Q0EA 1P1HA 3VH1A 5KJFA 1NPTO 1Z73A 1Z45A 3Q1LA 4ZQBA 1LRLA 3PHLA 4C4OA 1JN0A 2ZK7A 3E9MA 1UZNA 5A9SB 1ISIA 3DZGA 1FDVA 1SEPA 4QX6A 5FEUA 5A4DA 3DBRB 1GCOA 4FFPA 4YJFB 2B4TO 3PWKA 1YH3A 5DT9A 2HMTA 2NTNA 3U0BA 3W6ZA 4UAGA 1MXHA 2ZCVA 4RGBA 4Q9NA 3KB6A 3GG9A 1QP8A 2PD4A 1QR6A 3U9LA 2EP7A 3UFXA 3P7MA 4Q3BA 3JYLA 3V2HA 3IAHA 3D5QA 1UUFA 3FPCA 4Q3DA 4B3HA 3WGTA 4ALKA 1YOVB 4S3MA 3SJUA 1LSOA 3PHIA 1JQBA 1GYQA 3JYQA 4CLXA 4EW6A 1E3LA 5CG1A 1ZIDA 1NQOA 3T4XA 1QYXA 4YQZA 4Z6KA 4BO9A 4LVCA 2Y0EA 3VZPA 3WGYA 4W4TA 1XG5A 1TT5B 3CINA 3RUEA 4MVJI 4ALJA 3FRJA 1Y5MA 3ZDFA 6LDHA 3RJ5A 2VUUA 4RF5A 4ZHSA 4FJ2A 3RC2A 4CR6A 5JAZA 3DBHA 4R9SA 3FNGA 5A3JA 1YONA 5ENDA 2O48X 3GRPA 2DKNA 3GGOA 3GHHA 4DQVA 4RPGA 4NFYA 2RBEA 1KVUA 1DHRA 2AE1A 1N9GB 2FZEA 2NSDA 4R3NA 1WW8A 4XR4A 3WOHA 3WS7A 2UAGA 3TOXA 3UCEA 3ZWAA 3FN4A 1UH5A 1I01A 4ESOA 4TZTA 3H9JA 1P77A 1SAYA 2O7SA 4KMSA 3RFTA 3GFGA 1GQQA 4ZVVA 3I4FA 2VCYA 3KOUA 3VTFA 2FZWA 1F0YA 4WCFC 4ND1A 1VSUA 3ZW9A 1ZXLA 2W2LA 2NWQA 5F5NA 1T4DA 2B0JA 2UUPA 3E1KA 4RVSA 2HRZA 1PEDA 3R6DA 4OKIA 3SX2A 4Q3AA 4BMSA 2C7GA 1HZZA 3V1UA 2I9PA 2P5YA 4U5QA 1IPFA 1EFKA 4J2HA 2AQHA 4ROSA 4YAJA 4IINA 3RKUA 3X2FA 1DRUA 2YFHA 5ICMA 1HKUA 1PR9A 1BDMA 5T5QA 3WIDA 2Q1WA 1ZKMA 1P44A 3C7DB 4YA6A 4FFLA 1RYEA 2E49A 4ITUA 3PEFA 4PLHA 3V2GA 2YFQA 4DLBA 1PJLA 3KRTA 4D3FA 2A35A 4NJMB 5KJEA 1GZ6A 2DUWA 2PZKA 1UAGA 4MVJF 4AICA 3AY3A 3GNSA 4WCFA 3WSWA 4BNGA 4ZQHA 1X1TA 4EGFA 2EP5A 4JJGA 4GX5A 5FFFA 3ZH2A 5EESA 4CMAA 1MG5A 1DRVA 5BQFA 4K9DA 5KJ1A 5GZ3A 3VKUA 5EN4A 4BOYA 1XYGA 2O2YA 5A05A 3GEGA 4E5PA 1KIFA 3FF4A 1LRJA 4XGIA 2QG4A 3R3JA 1B8PA 1GPJA 1Y8RB 1LRKA 1V35A 2Q45A 4R9RA 4MVJE 3TN7A 3H2ZA 1W0CA 1B0AA 1U1IA 4GLOA 3WJ7A 5I8WA 4WK6A 1GUYA 1DIGA 1A7AA 4IDDA 4IS3A 4DMLA 4XJTA 5JAIA 2YV3A 4PG5A 1KEWA 2RIRA 4YAEA 3PDUA 3RC9A 2Y93A 4UEOA 4RJTA 2ZCUA 3H9QA 3JD1A 4ZU3A 1A71A 3FWNA 1DJQA 1JKIA 2VQ3A 3RAJA 3DC2A 2TMGA 3ZU5A 1JVSA 1CWUA 3IQDB 3EC7A 3PI7A 1H2BA 1N2SA 2FRDA 3RU9A 1LQTA 1PJTA 3WSVA 1DIAA 1NM5A 5B4VA 1DFHA 1F8GA 1LXCA 2CSUA 4CV1A 5ILOA 4WNCA 2GN9A 3LC1O 4OOFA 3W4JA 4IGFA 4FFRA 4ONEA 4DIBA 2NQTA 2WE7A 4E2XA 2YV1A 2NACA 2BRUA 3BA1A 4RDIA 3ZV6A 5BSGA 4PLFA 1MGOA 2O4CA 4Z3DA 4CV2A 4CV3A 4L74A 2AQIA 1EE2A 4HX5A 1EBFA 1IE3A 3AWDA 2O3QA 3G17A 2NLOA 5IDXA 3WBFA 3F5SA 3ANMA 1K6IA 1UXJA 3GN2A 3BMCB 1HETA 3GC6A 4M89A 2WDZA 4NBUA 4IIUA 4L75A 3PJGA 1LC3A 3OHSX 1O94A 3LC7O 2JAHA 2AE2A 4Z0TA 5HS6A 4D3DA 3KTDA 5U9CA 3ZWOA 2YV2A 1OZAA 3F1KA 3LZ6A 3TSCA 1OC4A 3OJEA 3GFBA 4PLCA 4EUFA 3RQSA 1M66A 3A06A 3C24A 4YT2A 2PKRA 3E5RA 1LUAA 4DIFA 2VWGA 1BVUA 1I3KA 3ZV4A 3DWFA 2WTBA 1D8AA 2JHFA 3K92A 4CQLA 4E12A 3MWEB 4IDEA 5BSEA 3PIDA 1PL6A 1ZMOA 2A4KA 3HG7A 1XSEA 2H1SA 1KEVA 5T57A 4HADA 4RORA 3L9XA 3WG9A 1KY5A 3WIEA 2B4RO 3EAGA 3E82A 4BNWA 3RD5A 3A14A 3OMLA 4BUCA 1F8FA 1P1FA 4NU6A 1ZK4A 4J1NA 1P1KA 3JD2A 4J43A 2GGSA 3E18A 5BSFA 1F06A 4IDCA 3JQGB 4AJOA 4FGSA 5TGDA 2PGJA 3S8MA 5JYDA 1R4MA 4RZIA 4Z9FA 3CMCO 5F21A 5BNFA 3QIVA 2EKQA 5JC1A 4NZ9A 2NVBA 3B70A 4RF3A 1RYDA 4BKOA 3OJFA 4A73A 1LLQA 2W8ZA 3ORFA 1TVEA 3K5PA 3LF1A 3HQ4O 4KQWA 4Y6PA 3T7EA 2NADA 1C0LA 3ZGYA 1ZK0A 1GU7A 1YVEI 2CMDA 2X0JA 3W8FA 3UAGA 4DLLA 2OOSA 4L73A 3BMOA 3SC6A 5C37A 1C1XA 3AU9A 4TKLA 5G0WA 5EIOA 3LT2A 2O23A 1NFFA 1BXGB 2Y05A 1ULSA 2ZB7A 3PTZA 2R00C 1CF2O 3H5NA 1WP4A 3RUCA 1E6WA 5L7WA 4NU5A 1SCUA 2JD2A 5CDUA 5DN9A 1F17A 1N7HA 1WDKA 2HJRA 4CR8A 1M6WA 3TL2A 1LDYA 4EBFA 5G0VA 4JIGA 1GQ2A 2B37A 3H6KA 2EKLA 3RUHA 4WASA 1V0JA 4I9UA 2DTDA 3GLQA 4JJIA 3ZWBA 1O89A 1UXHA 1UDCA 2A9FA 2PKQP 3GPIA 3AOGA 2EEZA 2OGUA 3O8QA 1GPDG 3OECA 1E5QA 4OL9A 2NQ8A 1QSGA 3KM0A 2X86A 1Q2XA 3H5AA 5A06A 5L4LA 2PKQO 5AXBA 4NMHA 3D64A 3AU8A 2Q2WA 4MDHA 2O3RA 2J3HA 4JP2A 3RUAA 1K5HA 1KVRA 1RJWA 4O1MA 1LSJA 4IQGA 5G2OA 2C5AA 1WDMA 4JGBA
chains in the Genus database with same CATH superfamily
5IC6A 1ZGGA 2FPMA 4DFDA 4MX8A 3QKRB 2QPOA 2VNHA 3IQFA 1AH2A 5C5DA 2X23A 1XTUA 3Q9UA 6REQB 1K3TA 1QU3A 2XVXA 3M81A 2QMUA 2P1ZA 2JFBA 1MX9A 2Y6UA 2OO5C 4G5XA 3RS4A 3OT5A 3O74A 4P93A 4V39A 3H0EA 2BFWA 4EG1A 4FGWA 3R74A 1NBWB 1FMTA 2H17A 3PQ7A 1KY2A 3SD7A 4BDTA 2WJAA 5IC5A 5HQJA 1K8YB 1GPWB 1GQFA 5L3RA 4JBXA 2XSZA 1HC7A 1QRRA 1XU7A 1CFZA 1VE7A 1SXJB 3CH5A 1EGMB 3O3CA 4NYMR 2HCTA 5C4GB 3SR4A 4BC1A 4NAVA 1ZESA 1PG2A 3PD7A 2WW8A 1Y9EA 1YB4A 3WKEA 5B55A 5FL7D 3DHNA 2D0PB 4MQEA 4YP5A 5B1IA 1TZKA 3ZU3A 1ORHA 4JN6B 3UWSA 3WSTA 1K75A 2PH7A 4JT2A 3WWDA 5HIAA 4J4BA 1OR8A 2F8TA 1MABB 1DT5A 2A0XA 1ZZGA 5A0VA 4QJIA 2CCJA 2SNIE 3H04A 2RJOA 2RK6A 4IJKA 2DQKA 4L5AA 3N5KA 5HJ2A 5FNVB 2WTEA 3I04A 3K1JA 4PNZA 4KR2A 2QL5A 1F9EA 3OCJA 4EJSB 1Y9AA 1JIKA 1SH7A 2FSVC 2ILTA 2KX7A 3DFUA 4M1WA 2XB8A 2C2OA 4JEMA 3AY0A 3QPAA 3WXMA 1Y7HA 4HUQB 2FWBA 3O2QB 4FZ3A 4DADA 1KVSA 3PC2A 3DE0X 4D9GA 3KR2A 2ZYRA 4US2R 2O2DA 2ZIWB 3ESXA 1AKMA 4O4JB 4RFLA 5DGTA 1FTQA 4FR2A 4QEKA 5ALGA 4AFNA 5CAEA 3GMTA 4P7BA 4B3SB 1TGVA 2BKLA 3TQFA 4FOOA 4NYJR 4PYMA 5AW0A 3U3KA 4AKSA 2O7VA 4RGYA 3ZWKA 4ZVQA 2D5LA 2WMOB 1HG0A 3DBVO 3TLEA 4TOIA 5JJLA 4NV1A 1SEVA 5IDVA 4IJ5A 4D7AA 1QE0A 2YN4A 3QKSA 2FE1A 3CWZA 2VHUA 3U3JA 1OU4A 2C31A 4JS0A 4DZRA 2J8ZA 3OO1A 1A4IA 3HSYA 4MCAA 3IFSA 4Y9SA 3B36A 2H18A 4Y18A 4QFBA 5KVSA 3RCBA 1Z39A 3WIOA 4YXFA 2B4AA 5B3AA 1QS0A 3AI1A 2WHQA 3C14C 3FFAA 4RY8A 5CMLA 5F3DA 3BFXA 2PWBA 2BL4A 2EHDA 4TKMA 2ZXUA 1Z7BA 2FMHA 3VDMA 3OCWA 3D7KA 4DA7A 5A5DA 3Q88A 4A2CA 4B34A 3WYDA 1BMTA 3M4YA 3DLAA 4B40A 4O4LA 4J2OA 4K0KB 1PP4A 3HNPA 3ESAA 4KV9A 1A5TA 5FI5A 3EA5A 2QJFA 2HUNA 4D0LB 5AI5A 3LCRA 1OWMA 1SA0A 3RFFA 3L7LA 5IEBA 5EY5B 221PA 4R2LA 2VAXA 1Y37A 1F48A 1JQ5A 1ADFA 1EHIA 4U8HA 3NH9A 5B7GA 3FUVA 2QN9A 4OK5A 1X7ZB 4L6IA 1YQGA 5IBRA 4D56A 1JPJA 3AF4A 5T4BA 1FP6A 1Q50A 4JVSB 2O3UA 3FI9A 1YZFA 3GFFA 4KIWA 3OFSA 5CPFA 1E66A 1GQSA 2PIAA 3OLYA 3UKJA 5E2BA 3H8SA 1M0SA 2NU9A 3X0DA 1EXMA 1MHPA 1XJCA 3TQHA 1RQ2A 3U4DA 1S7GA 2C88A 4YJ2F 1KXJA 3AHGA 2R3SA 4I08A 1E96A 3OIUA 1NN1A 1V95A 4C7JA 1LK0A 1RXUA 3IUPA 3VU0A 1USKA 3K5WA 3L7IA 4DPKA 1E6EA 3I58A 3K1ZA 2FEKA 4R1MA 4V24A 3IUNA 2ET6A 5DHPA 3SQXA 3E9YA 1GUBA 1N3LA 1UKCA 1WNTA 3H3FA 2FF5A 1L7XA 3JQAD 3MIZA 2CDCA 3GFSA 5EJIA 1CXZA 3AXSA 4D02A 4D42A 3LQQA 4TQ9A 2H4FA 1JKFA 1QZUA 1VP9A 1YCGA 2IW1A 2PRIA 3ABOB 4QG7A 4UU7A 2J4CA 2BI4A 2OHGA 4Q3CA 3BL8A 2QTMA 2FSFA 3FZQA 4FMCF 2BGKA 4HGPA 3Q3HA 4S0XA 1O03A 4MVXA 4B2LA 4IVRA 3O8LA 4MVJH 1V1MB 1YU6A 1O94D 1ZEJA 1XQ9A 1T5LA 2OMKA 2P2GA 3GLSA 4FW8A 3ROEA 3VR5H 2X42A 3KXPA 4X65B 2ZSAA 1TT5A 4IOMA 2QTFA 3VR3A 5CFLA 3RS8A 2PSSA 2WOJA 4A3SA 4TXLA 5DF1A 1N33B 1HMYA 5FADA 2JIZA 3M1YA 4KRGA 3SJCA 3RU3A 1HUQA 4KSBA 4D9HA 3PGMA 4OL0A 1B2LA 2RCYA 3O4IA 3LW8A 5DW0A 3DF7A 3WLEA 4CM4B 4ASUA 3R0IA 1H1LB 6ABPA 3GAZA 4BNMA 4F06A 3DE7X 1VHWA 1E8MA 2IY8A 3GVIA 4Q3EA 1GPH1 1XTJA 1ZUD1 2NV6A 2QNRA 2VUSA 4GI3A 4WEOA 1EWKA 2MCFA 1XV5A 2DWPA 4I6GA 5HZHA 2GF9A 3DT9A 1K4YA 3DVQX 5LQUA 2IYFA 2QL9A 4G81A 4YGXB 3RROA 2OGZA 4IV5A 4BV9A 3PDHA 4V1CB 1Z0ZA 1AURA 4KSYA 1DG1G 2UYQA 3LW7A 4LQ4A 1YVRA 4OXYA 5EFZA 4BZQA 2UUBB 3E9EA 4X6XA 2POQX 1H1DA 4KXVA 5CX1B 4CI9A 5IWAB 1P72A 2QY9A 4DC9A 4I1PA 3UEOA 4DCNA 2EKBA 1CUXA 2QN1A 2YRWA 3ORSA 3OIYA 4PF1A 5LKRA 2H29A 3CU5A 4KIJA 1Y3BE 1GCAA 2E4ZA 4LBYA 2VOEA 5FEMA 2H92A 5CLLA 2WJYA 1AQJA 1ZOSA 2YXPX 2CC2A 3BD9A 2MR5A 3QBJA 4RDHA 3GRUA 4DM3A 1XN1A 3K15A 3S1AA 4J0DA 4AJHA 4M4SA 2E7ZA 4C04A 2GETA 2VP2A 4PGFA 2DQ4A 4HFJA 1THGA 3BRCA 4WBNA 1VI2A 3TIGA 4QYTA 4EL0A 1X1EA 5B2EA 4ARCA 1WXQA 2Y71A 1M7HA 2EJUA 3Q12A 4LHEA 4YDHB 4AZ3A 3QLUA 1TEHA 5ITWA 1O57A 1LTKA 5K1ZA 4BKRA 2QUIA 4ZAZA 1U80A 3BB4A 1OXTA 2CWDA 2QP4A 5BR8B 1JIUA 1LVHA 1JPUA 2BM9A 4KUGA 3RTGA 5IXSA 1OZHA 4IUDS 3BXXA 4R4JA 4BFLA 1B0ZA 1H3EA 1U5BA 3D4PA 4ZEWA 4PC7A 5BUQA 1FFXA 1BHSA 4M8NE 3W7BA 2OZVA 4JXKA 3D81A 1KI4A 3KQKA 3ECCA 2VI5A 3LXUX 4AX8A 1V47A 4B7XA 2PBLA 1DAIA 2J9YB 3QW4B 1FNDA 1GRVA 1L8OA 1IONA 1U94A 2FW8A 2J09A 4WLNA 2QJTA 2ZB8A 2ZULA 3PLRA 5ITSA 3G1WA 1G20B 3PI6A 1AXEA 4B6SA 4XQGA 1QH9A 2EBUA 3RQIA 1J5XA 4Q1VA 3ZHSA 1TAUA 4B79A 1R18A 3VTKA 1N36B 2AB0A 1KXZA 5EI5A 3RVDA 5FTJA 4EHJA 1Q3TA 4ADSG 1IRIA 2GZ1A 1U7ZA 2JH8A 3ZIAA 4Q4JA 2JFQA 1BMFD 1UFRA 2FW9A 2ZJ3A 1WLYA 2R7AA 3JYHA 2TMKA 1BX0A 5EXPA 4K3VA 1IBMB 5BQXA 2FEAA 2ODPA 3EZLA 2ZUDA 1TKBA 4X92A 1X7GA 5EWMA 8MHTA 3QE0A 3FMVA 1Q17A 1UXKA 1DAFA 3K1TA 1U8ZA 2R5WA 1KI3A 3KQVA 4HF7A 3UH0A 5AFSA 1C9DB 3RJTA 1RCTE 1WMDA 4AWXA 2BTQA 1AQUA 1I4LD 3SZMA 2PX8A 3VVBA 4N5DA 2QG6A 4Q4CA 5DHFA 4U6SA 1KR5A 5CB4F 3PCRB 1WQ3A 2OZPA 5KTTA 1BEUB 2BEJA 1T34A 2GYYA 4GAEA 2QX8A 4GEKA 4ILEA 2EHJA 1JU3A 4HVTA 3KKOA 3W2GA 3QYFA 4CDGA 3NPMA 3H3XA 3HFGA 4GWLA 1ZP6A 2J7PA 2B8WA 1L7RA 3MB5A 4YXWD 3DA8A 4I4LA 3ROPA 3DZKA 1KYTA 2R6AA 1D4OA 4J4HA 4NEGA 4PRKA 4RNDB 4C0BA 4JP3A 4H1WA 4IKPA 3EXG1 4FLMA 2VP5A 5CB8A 2GXUA 3DDNA 4LV8B 3N2NA 5LKAA 3L6OO 2CDNA 2ZBQA 4KV7A 3REGA 4QJ3A 1N6OA 5K4GA 1AVTA 4G5SA 2IS1A 3D9QX 5CXXA 1W2WB 4UXJA 2WYHA 1P8AA 2EKDA 2IUSA 1D2AA 1NI4A 3H9EO 3S2YA 3SBXA 4N0EA 1QG2A 3GZJA 3IPCA 3BMXA 4Y2GA 4GOND 1U8AA 4RHCA 1R16A 3QA9A 2VTEA 4OYRA 2IITA 2C54A 3V8BA 3SDSA 3FMOB 4ZAFA 2QRHA 4CTKA 4IICA 1E79A 1Q0ZA 2OUKA 1PD1A 4ZKDA 4AROA 4U8GA 2WTNA 2HIMA 1NBHA 1IN8A 1OAAA 1SZJG 3SXUA 3T7AA 3NORA 4DMMA 2HL6A 1D2RA 1UC9A 5ESWA 4EI8A 2C4NA 2I4LA 1G3RA 2C83A 4QSHA 3N0VA 5E1OA 4DMRA 5DP2A 4Y9DA 2X5XA 4NLLA 4LYYA 2PUWA 1E5TA 4YJ2B 3GLFE 4NXNB 3WRWA 1P4RA 2LWIA 2YQ4A 3KTOA 4JSYA 2EJTA 1ZCFA 4CMKA 2RBKA 2I1QA 1ZGBA 5JH7F 1E2MA 2ZT8A 1BNCA 3DONA 1UM8A 3VPFA 4WEQA 3MRVA 3FLMA 4S04A 3FPBA 3KXIA 3BZUA 4RFSB 2R8OA 3CCCA 3E9QA 1CUAA 5GJVC 3WHKA 3F49S 3NIDB 4OIMA 3OPYB 2C4VA 3UHAA 4UAUA 1F2UA 3DBLA 5THKA 4GVPA 4JB3A 4NP6A 1WZUA 5BMOA 4UDNA 2JK1A 3NHSA 4UPEA 2XUZA 4O5AA 4QDTA 4NE9A 2Z6AA 1ZGHA 4UUOA 2V6IA 3PNLA 4YRBA 5D01A 3NPAA 1GHTA 1GUZA 2BELA 4K6FA 4NBTA 3PV0A 1D0SA 3OE7D 5ULLA 3RHZA 3CX4A 3GNTA 1B8OA 4TWBA 4DRXB 4PZYA 5DXAA 4Z9BA 3R20A 2ZYDA 2YXNA 3NJ8A 3A9UA 4HDAA 3RPEA 2OHJA 1U6JA 1TKRA 1XP5A 1FVXA 1SVLA 5LBIA 3PPWA 5KHAA 5FDFA 2AEJA 4BAZA 2CLIB 4ZXPA 1P2TA 3K72B 1PDOA 5B53A 3OE4A 4G0PA 4NBRA 2QZ9A 5AIAA 4OM7A 2EX4A 3UGQA 3WYCA 3HKBA 3M70A 1J99A 2QLMA 2BCEA 1QK5A 3LX4A 1C3OB 4DLPA 1UAAA 1QHEA 2JFYA 2FGJA 1MJFA 1SU6A 1U7HA 3HNOA 1CR6A 3IOMA 4J1QA 5HG0A 2WFLB 1RTTA 3FTQA 5IRCD 3WQBA 3U19A 3UJDA 2PQ6A 1NMYA 2PEYA 1YMQA 3JAKB 3W7AA 4PYQA 2AIRA 1DEXA 2PKWA 2CW5A 2WA2A 1TI7A 4P08A 3A1TA 4DWWA 4WRRA 3PEWA 1GGNA 3ZCXA 1HT1E 4BU1A 1ZIPA 3AVOA 3RC8A 5DU2A 1B0PA 5TRTA 4FHDA 2PGXA 2G1AA 3D8HA 4FFBA 4QUKA 3HZZA 1B8UA 3ITKA 5YASA 5K9ZA 3AUUA 3KQSA 3OHMA 4FJ0A 2NSJA 1A5SB 1KFKB 1PQPA 1SOUA 4GWGA 3O7MA 4JWKA 4D9BA 5EJ4A 4LZZA 3A6GA 3L04A 4ARBA 5K8CA 3V2UA 2FCAA 1CQJA 2PWZA 4Z4EA 2XBLA 2W00A 3CZAA 3D0RA 4PG6A 2QQ0A 3CXUA 1N6RA 3OETA 1JHZA 1K1EA 4GE0A 3MJCA 5HWSA 5EMLA 2VL7A 5DVZA 1PQUA 1KQPA 3CIOA 5CM2Z 5TY0A 1G66A 2OQVA 3AM5A 1CZKA 3WQRA 5AJHA 2I4RA 2ZWIA 1IATA 3QVTA 4LNAA 2C5FA 2PX5A 2VDMB 3LUGA 4EARA 4UDYX 2EF0A 1J4AA 3R40A 4ZODA 3L0DA 1ICEA 3EUEA 4ZRDA 2XUIA 2IDMA 4H7EA 2EVWX 1A77A 3CNNA 5I48A 5JSQA 1XEWX 2H54A 1ZBQA 1H4QA 3PQDA 3OQNA 1R0CA 2X19A 1XZDA 2Z9BA 4XXHA 1PV4A 4PRYA 4JX9A 2JARA 4A6DA 3R75A 2K5UA 2B5WA 4DT1A 3FA2A 4OK3A 2OV4A 3T3DA 4AS1A 1MT3A 4OXQA 1R4NB 1NV8A 3RRYA 5THQA 3HBAA 2G4VA 3PWSA 4XVHA 3U62A 4RTNA 3CKYA 5AM2A 1P0MA 2EERA 2NYVA 3NHZA 4ZCRA 4XB6B 4OP2A 4RV5A 4UUMA 2BFEA 3SQNA 4GW3A 3IDZA 3B1JA 2FY8A 5P21A 3UMVA 2FOLA 2BFFA 3KDSE 5REQB 2YYYA 4BWFB 1U1GA 2YTZA 4EQ6B 1IVNA 2VJPA 4M7PA 1WBBA 3WVNA 1QMPA 3K16A 4YPVA 3NC0C 4MA5A 1TUEA 2R6FA 2Y0DA 1UZLA 1J70A 1JKJA 1Z2CA 4L4UA 4LDQA 5IAGA 3ZHBA 1E3MA 2ISSD 2PSHA 2FA9A 4J16A 4CMCA 2GERA 3JQAA 3DUFB 4GPD1 4AKHA 3LOQA 3NRCA 2Q2NA 4PIMA 3VX4A 4BS9A 1Y6FA 4IW3B 2GLUA 4S35A 5DYGA 4FYVA 1H93A 1YR1A 2EL7A 3Q3VA 4I5GA 4M1QA 2AEMA 2V6GA 2F90A 1ETHA 2V7PA 2QY6A 2CMFA 1EEHA 3DVAA 1GGMA 1OFIA 3BE5A 4BGDA 4X7RA 3V32A 3ZDEA 1J1UA 1E2QA 2V7WA 5DM2A 3QX8A 3UTCA 4ZDWA 4LKRA 1J0EA 1RBQA 3LGAA 3RW9A 1DQSA 1N7GA 1YKFA 5HIMA 3W5SA 1FYEA 4ZGWA 3DAYA 5BRAA 4ALLA 1EU1A 1MCZA 4S1OA 4C6RA 4CODB 3WO0A 1QYWA 1R9MA 4B3CA 1AKYA 2L19A 1Q57A 2XUAA 3L01A 4B8WA 3HJNA 1X7XA 4CM8B 4MGZR 5I47A 3OF5A 5BN3B 2ESRA 3W8EA 1H3NA 2GQ0A 2WVHA 1PWEA 3D6VA 5DHSA 1H9AA 1IHOA 1P91A 2FZGA 3LFUA 1SCJA 2AK2A 4BAGA 1JJFA 1F8YA 3BGOS 4BZZA 4UHDA 2O0KA 3NTOA 4MYDA 4OJQA 4AS3A 2XXBA 1K86A 5FLXA 4B44A 1RIIA 2VWQA 5ECDA 2QL7A 1T2UA 1PTJA 3G0DA 4KK3A 1L1FA 3GJ4A 2J46A 2I6UA 2N46A 1NASA 4Q9HA 3IMEA 5G41A 5K6AC 4GQBA 3ZK9A 2CT8A 2JGJA 1G8MA 4XQEA 3PXCX 3NM4A 1EWRA 2VPPA 4NHOA 1NNUA 2D5IA 2QQEA 4EI2A 3TDNA 4UEJA 2D1SA 1ORIA 2V6MA 4FNOA 2Y8EA 4KXUA 4DV0B 1W73A 4X44A 5G1PA 3P2YA 3UJ6A 5DYTA 1GL7A 1YULA 4UULA 3SLGA 3Q7QA 2HT1A 4E4YA 4TMXA 3R9IA 1RPTA 1TYEB 5DBOA 3VYWA 4EA7A 1MO6A 5IJ0B 3RYFA 4FR5A 4M1ZA 4HWOA 5JANA 1RBMA 2VBGA 3TFOA 2WYUA 1XTPA 4WT7A 5CH8A 1SBQA 3HV2A 7ABPA 3OTOB 1NVVQ 3K3PA 3MAAC 4MNTA 3K0HA 1P0IA 3KYIB 1QH8B 2Z3ZA 3CRMA 5KYGA 1OX4A 1RYYA 1Z0UA 3IOYA 4KSCA 3E7PA 5IJAA 4ZJYA 3NM6B 3UMSA 1S6YA 3IKVA 5EUBA 5JCJD 1N8SA 4J7CA 3UQZA 1E9AA 4P3NA 4MPTA 4KREA 3B6MA 3JQBA 3DL4A 3UGJA 4QM6A 4P9NA 4EW1A 1KQNA 3TZCA 1W1IA 2BKAA 3QU4A 3RBAA 4I9GA 4DWVA 1XZCA 3RJZA 4MA0A 2R1ZA 3WE7A 3E8MA 3NOVA 2GUGA 3CLUC 4LOJA 2A5DA 4LTDA 2A84A 3P9CA 1E2LA 4YI3A 3R77A 4GX1A 4R1UA 1Z4NA 4RDCA 1L5MA 1HE4A 5AXDA 5I9SA 3SC2A 4L5CA 3F8SA 1MZVA 3I01M 3BFJA 1Z22A 2XCLA 3THSA 1CUGA 2H63A 2PEZA 4RD1A 4Z1OA 1UFQA 3ESZA 3OOWA 5JI3E 3W79A 1E4OA 1NJ5A 4QT4A 1RWWA 1I4TD 2WF9A 3IBYA 2HBYA 2BEUB 4PZPA 1B26A 3P27A 1UBNA 2NAFA 1BMFA 1JJ7A 1KAMA 1SQGA 1U0JA 1UKYA 4L8WB 4YWJA 1JHMA 2C9OA 2H07A 4G85A 4P3KA 1G7SA 5LZ8A 3K0AA 3TW8A 4E5VA 1W7AA 3LPLA 4KO4S 5DBFA 1A82A 3O4GA 4HNHA 4X24A 2Z2IA 5KHLB 3VR2A 2ZJ8A 3NMUF 4HNAA 1UL1X 5TPWA 4MYTA 5T8KC 2Q1UA 4D79A 3A4LA 1EK5A 1CU1A 1UXIA 5DCLA 4EUSA 1II8B 3FDZB 4L3WA 2ZJ4A 4XX0A 2XNJA 1DELA 2D7CA 4N0PA 3AR5A 3OLXA 1V8OA 2WU8A 4FFDA 3WGKA 5FH9A 3UJNA 5ISMA 4B4UA 4M1MA 5GVSA 1NQUA 2A1UA 2AOVA 1Z33A 5IABA 3G6WA 4YIKA 5AD1A 3Q72A 4MPJA 1YNSA 1HM5A 2VXYA 3H65A 2PBZA 3KELA 3UMGA 5FA8A 3A6EA 5LL6P 5CH3A 1ILWA 2QTTA 1E58A 1JHAA 4B74A 2NSHA 3JZIA 3ZGNA 4WKNA 3IAXA 5AJVB 5ALIA 3CLVA 2MYUA 5BV7A 4O4LF 2FQQA 4N7RA 3HFJA 5AHXA 3RANA 4NTZA 4P7JA 2O9JA 1V5EA 2YIJA 3BBPA 4K5QA 4YXWA 3UT5A 5HDBB 2IKQA 3JQFC 16PKA 2PGDA 2R1TB 2EXXA 3DXZA 1UPTA 4RTOA 2FUG6 4I0WB 3WRYA 2QU7A 3SF8A 5LP6B 4PBRA 2QZPA 2W6PA 3TM5A 2MR6A 1UJ2A 3VHXB 4Z9YA 4GZMA 3VR6A 4WFKA 1EJ6A 1TECE 3E7XA 3TZLA 2O54A 1FB5A 1T1EA 4DE5A 2JBAB 2FQWA 3IBSA 2G4LA 2ZTMA 2OGTA 3KZ1E 1L5WA 5TSDA 1Y3IA 3TSAA 5C4IA 1L9KA 4XQ9A 3U6KA 1CRWG 3TZ6A 5AICA 6NULA 2D7DA 2BTOA 1JXAA 1GPAA 3HV0A 4JT9A 4MWEA 1L5LA 4EF6A 3EVNA 1PSDA 2I8AA 3ZJ5A 5CITA 4N6OA 1H22A 4WDRA 1G59A 1F2TB 1C80A 4Z86A 5L51A 2ZUEA 2GPAA 5BSMA 1C9NA 2ZIAA 1HURA 1I2ZA 1SVKA 4K40A 2V3WA 3BORA 2I99A 1J0CA 5M34A 5CA1B 1P3DA 5TF4A 2JLWA 2A9VA 1OT5A 3BAZA 4IOLA 3B8EA 1S0UA 4KYIB 4N40A 3AJRA 4NZMA 2D5CA 4JT8A 4GLBA 3T3NA 3T1NA 2CLCX 2B4QA 3GCDA 1SK8A 1DAMA 1UBFA 3ANSA 3OX2A 1VL1A 3OWOA 4K9QA 2EP8A 3T9DA 4DQUA 2RGNA 1CY2A 2BKEA 1AC5A 2GEJA 3GUCA 3Q4GA 2COUA 4JX8A 4O4IA 3LIPA 4YRJA 1KJJA 3EW7A 1DFGA 2W37A 1RPJA 4TVBA 5FUBA 3COZA 3THRA 4BAUA 3LWBA 2ZAIA 2O59A 1W29A 3TQRA 4DMGA 2QL6A 2QQGA 1ZINA 3C6ZA 2IS2A 2GUWA 3TRJA 5JATA 1FUIA 3N53A 1ZUWA 1EWQA 4YJDA 3LXXA 4OHMA 3W9YA 1BWQA 4IFBA 4LXUA 5I8PA 1O4WA 4QXMA 4XFKA 2OBYA 1IIRA 2YJ5A 5EUQB 4YLEA 2LTAA 1KJNA 1CQXA 5EXTA 4A1FA 2NQ2C 5K0BA 4BWVA 2O2GA 7REQB 1ZC3A 3ENKA 3EOZA 4MJ3A 1BW9A 4DUZB 2GR9A 1U7DA 1G291 1ZH4A 4FEEA 4GC9A 4IFEA 3R7NA 4K26A 5AESA 1G8HA 3CCFA 1SZPA 3L7MA 4O59O 3BH0A 3WYAA 1JDNA 3MT8A 4Y98A 3BXHA 3UCXA 1PJAA 2AXNA 4Z0PA 2C3MA 2XWBF 1PFVA 4JELA 1WCXA 1ULZA 2JAWA 1MIOA 4V0QA 2G17A 1F6WA 2MDTA 5SZIA 5G1OA 2YY6A 2WUFA 3JATA 1AGYA 4HDRA 2OBLA 3L49A 4EYSA 2H08A 3FVQA 1PL0A 4RIEA 1ESEA 5L3QA 4A1OA 2PNFA 2LKCA 3E84A 3Q6NA 1EFRA 3TI9A 1TTHA 4BO4A 1ZUHA 5KNBH 1KYIA 1UEIA 4WBNF 10MHA 3DBRA 3KOXA 5K8JB 1PJ4A 5SYMA 1Q14A 1V37A 2GD6A 2VHCA 2HFJA 3TBHA 4M1KA 1XXLA 3DDZX 3CE9A 1FP2A 4OHWA 4UBLA 3RAFC 2FZKA 4J0QA 2JCVA 4PC6A 1GADO 2YVLA 3HXLA 3O9VA 4AJJA 4U7TB 1VMEA 2SKDA 1PYGA 3O75A 4GQAA 4HLUC 4HQOA 4U6QA 1ENPA 3CH4B 4XCXA 3TSZA 3HO8A 5B1EA 1TMGE 4QA9A 3MCVA 5CUQA 2B7CA 1GA4A 4NDAA 4RPKA 2DQSA 2GI4A 4HZUA 2RHBA 3JVIA 4DR2B 4XVRA 4EHAA 1CBUA 1R6TA 4G5OA 1J8DA 1UKVY 3BIXA 3T1QA 4ZDIA 4J90A 1OLSA 4IIEA 3I2GA 5AJWA 3HB5X 3IXMA 1SCUB 5E9WA 3SMVA 1T0IA 1ULUA 2IIVA 2RBGA 3MMZA 2Z9CA 3OZTA 3QVMA 2QU8A 1X0XA 2P5SA 5HA5A 5SICE 4COKA 3AETB 4ER5A 5A04A 5HQ3A 1T8SA 3ZUGA 4DV3B 2C7OA 2GKSA 1DO0A 1NW7A 1T1RA 3IAM1 3CEJA 3AFIA 3RV4A 4NKRA 2HSDA 3KPWA 2DLCX 1GY8A 2O8FA 1G3IA 1W85A 5FOQA 2AT1A 2I65A 4RMJA 3W1EA 3PHJA 4Q9KA 2QRVB 4YUZA 4MS1B 4B84A 4QEDA 1ZQ1A 3GEPA 2G63A 1Q0LA 1V11B 3DEAA 4UDXX 4KODA 3QG5A 4QHSA 2WZCA 1E59A 1Q12A 1A95A 3QYJA 4AMVA 2FHSA 3ZDCA 1IM8A 2R5FA 3DP9A 3OP1A 1FFDA 1ZBDA 4M7OA 4JLOA 5HJEA 2H4JA 2H31A 4GLLA 5DE3A 2BAGA 1N9GA 2VZEA 2AFIE 3F3MA 5D1NA 2QAJA 2VZ9A 2XGGA 4CE6A 4MRMB 1J23A 2JVJA 3G8DA 3C6KA 2OO7A 3GMSA 3B12A 3KEQA 3O94A 5E0KB 3DE3X 5ERGB 3U7RA 5BV8A 4BX2A 5DBIA 2Z5VA 2PMBA 3HBMA 4F86A 4RAOA 4J0FA 2XYHA 2DBVO 1TZMA 4O2RA 3EQ9A 3IP1A 5EZYA 2ES4A 4A8JA 4CF7A 4B7CA 4WECA 2WPNA 1HT0A 5KOYA 3UT0A 1N57A 1SM4A 4JJ8A 3PFGA 4M9CA 1A5ZA 3WWCA 3THXB 1F4LA 5IYZB 2A92A 1WZIA 1T6YA 5B1HA 3ROZA 3KQTA 5IH3A 4EEZA 5AVKA 1H4SA 1WETA 3HCNA 4J0EA 2GZ3A 4OI1A 1XCLA 3CEMA 4BHTA 3QLJA 4IHQA 1Q1BA 3OF3A 4C6HA 2OT3B 4PNHA 1CUBA 4U9UA 4BPBA 4NFSA 1FEZA 2GPNA 3L2OB 1VHTA 2HNAA 5DGDA 2W5UA 1D03A 1VKZA 2IDZA 1BN7A 3ENNA 1UOQA 1VI6A 4BBAA 1K97A 3QE3A 4RADA 2VR1A 3RGWS 3SM3A 1R74A 3BQ9A 1C30B 2O6HA 1ZY2A 2WIGA 2FWIA 4P4NA 1XEXA 4C0WA 5I7HA 5ABPA 1TPZA 2B69A 2R751 2BM0A 3DTTA 4HY3A 5I7VA 3VC3A 3L79A 1NIJA 2HIAA 5I9LA 2JIBA 1PSWA 4FCTA 4RH3A 1MB2A 1GKKA 3WIVA 3WR5A 3STYA 3T1VA 1GTSA 1MAVA 1V6CA 1X3SA 5KMGA 1Z07A 1FMJA 2PDAA 3IILA 4GC5A 5HTKA 2CHUA 3AEZA 3HE3A 1YACA 2X0RA 2PAFA 1Z4JA 1DLJA 1KI6A 3P9IA 5C0OE 4RENA 2J45A 5F1KA 3V8VA 3QM1A 3JS5A 1T6BY 3ZKWA 2AD1A 3IURA 3SJBA 3BCSA 4W9RA 4I5FA 4FS3A 4D0RA 3NBXX 2FMUA 4WHMA 1AA6A 1H2AS 1R00A 1WHSB 3LBYA 1E0DA 3AF3A 5IUJC 4OP3A 1NAIA 1TJ5A 1LCIA 1YE5A 2HXYA 2JRLA 3MWDA 3ZIUA 1VYVA 5EERA 1WP9A 4D44A 4PXAA 4CKWA 3QMWA 5HMLA 3UICA 3RS9A 5L40A 1XCMA 1DG9A 2VUTA 2XCQA 2QRPA 1XGKA 1LPMA 2B1QA 4J07A 4LVOA 2OFWA 4TL7A 5H5JA 5IP5A 3T15A 1SIBE 1SPBS 2VHJA 3T9AA 1G5RA 4G0YA 4QJ5A 5FORA 1GPMA 4F2PA 1PFGA 2ZSDA 4MWBA 4TM8A 3UMYA 3K4HA 3ESRA 5TS3A 1JZQA 2HJGA 4DJTA 5JDCA 3PJFA 4DSTA 3E5MA 3HN7A 3NNNA 1JQDA 1WS6A 1NJGA 2JFXA 3L9WA 1IN5A 4ZAYA 1VCHA 4GZLA 4F4JA 1R66A 3ZJUA 1GT6A 4HNGA 2IPXA 4LXXA 1M0TA 3PF9A 1OY1A 3HJUA 4BNIA 3K1AB 4G36A 4I50A 3OLQA 5K20A 3LLSA 1BHO1 1WZCA 4ZV9A 1US8B 3LSYA 3DKRA 4YNBA 3NKVA 3LS2A 5ED0A 2C5BA 4QXAA 4MTLA 5D84A 1USUA 5HOEA 1YRHA 1JF8A 1DTEA 1KWGA 1FFEA 5IASA 1QBKC 2PQMA 4WGFA 3R7WB 4E46A 5I9MA 3ZPXA 1YTLA 3FE2A 3NDJA 4XB2A 4M99A 3KEMA 2HA4A 2ODNA 4TVSA 4YAKA 1HTTA 1RWOA 3SBEA 2VJOA 3WDSA 2D13A 2W2KB 1ZEMA 2P62A 1NLMA 2X13A 1XOIA 3WZMA 3N5CA 3DV0A 1TGYA 3LTEA 4K05A 3DEJA 4F11A 5JAHA 2ZYIA 3FOBA 5KYWA 1E7RA 4Z7QB 2ZJBA 1JZSA 3T4PA 2VP3A 3W05A 1YWGO 1U4OA 2BLLA 3ETGA 4FBLA 2NTEA 4KRYA 5ALUA 5EWLA 1SU7A 3NHPA 3BVPA 4H17A 1ULTA 3NASA 1J7JA 2QLTA 5LOVA 1IN1A 4X54A 1Z4LA 2XRZA 2E37A 3VKVA 3VMMA 1K9SA 3PRKE 5IDQA 1BFKA 4A0SA 4EH1A 2RHMA 3CNBA 3VNBA 3F46A 5JC8A 1V16B 1JHVA 4EB0A 1G5QA 3VYSB 4K46A 2BGNA 1JFRA 4KVGA 4TYQA 3TRFA 4BGEA 3QI7A 4DHWA 3GELA 4NE7A 4HH0A 1SHUX 2H0AA 3MWEA 4M86A 1PI3A 3UOAB 1G7TA 2X5OA 2EZTA 3EJ6A 3QOFA 4GBJA 4CXMA 3CF2A 1KU0A 2AI2A 3GBSA 3KE8A 4D5EA 1FNCA 2GN8A 1R5BA 5KOIA 2P3QA 3VJKA 2OCBA 4L4SA 4DAOA 4NZYA 5TJ9A 4BMNA 3VOSA 2RGDA 3L4JA 2BMDA 1SWVA 3ISJA 5SZJA 1AXGA 4GX0A 2BBWA 4WJLA 1Q0HA 1QCDA 2GTPA 1A5BB 2H1IA 4B2YA 4DLNA 4ER6A 4EM6A 3SVLA 3MG9A 2R8XA 1LPPA 4QSMA 4HYTA 5CYFA 4Z7OB 2DKOA 1AM4D 2GEDA 5FJJA 4DANA 2C3PA 2OBXA 5IJXA 3NNSA 3JVVA 1BE0A 2BFDB 3WB9A 2W48A 3IDOA 4GR9A 3KZXA 4FYPA 3T5TA 4BJHB 4AF7A 4Z9XA 2FDRA 4XSHA 4QOJA 3U26A 2QROA 3N7AA 3V8QA 4R68A 4D3ZA 4ZHQA 3WQHA 1KOFA 4E1VA 2Q6IA 3SKYA 2TSYB 5CBPA 1UC4B 1YK0A 1CJUC 2ANBA 1QVZA 2ORVA 3SNKA 5AKHA 4PX2A 1FRQA 1CUSA 4X93A 5B6JA 2QTCA 4I1SA 2YJ4A 1F8UA 1FYVA 1DPGA 3FGNA 2Q4OA 3N2GB 5AJTA 3BD6A 3O2JA 1RYMA 2VTKA 3NBZC 2BEKA 3PDJA 4MPDA 4MLZA 3IIJA 3ZY5A 1SXJE 2QLFA 4DLKA 5HR5A 5JJBA 4EYOA 2AN9A 4DS3A 5EJ5A 1GSHA 3H2KA 4PQRA 1ORRA 2Q07A 1Z2OX 4PX3A 2R7MA 4ZOCA 2E89A 1B6GA 2K7ZA 1NMQA 4K6HA 3GD7A 3L0BA 4M8SA 4BNUA 1EQUA 2UZ4A 1T6ZA 1KRXA 4YJGB 2P4QA 1XXHA 3F5QA 3QMPA 4PZAA 2GZAA 3PKJA 3VU9B 4KQCA 2WSLA 2CLEB 5DV9A 3PPVA 1JA9A 4B4OA 4C7XA 1PK8A 4A8HA 3PDWA 3EQ6A 4JU9A 1OBVA 3C5CA 3CX6A 1VLQA 1B93A 2BR5A 2E85A 2FZCA 2QGFA 3KTAB 4IMPA 4A5SA 4O2BA 1EHCA 1M3SA 3D2LA 1TA0A 4JOCA 4FMCB 1E2KA 3VSAA 1IOLA 1KIMA 3TIFA 1F51E 2GJAA 1Q74A 1IHDA 2FPPB 2Z5GA 4LGYA 4W5NA 4CL0A 3EXFB 4F4IA 3QEMA 4I1RA 4IXMA 1PZMA 2P2ZA 4QGGA 1EFDN 5GIOE 2UUOA 4ZVPA 1M1YA 5M5BA 1FXWA 1ECLA 2ZJFA 1DAHA 3NAMA 3I6IA 5DXJA 3TZBA 4C5AA 2V1UA 4JXJA 4FHGA 1FSZA 2IZ5A 3TGWA 3VZCA 2DP4E 4Q12A 4BTVA 1Q1NA 5HUQA 3I9KA 3YASA 1N4AA 1RE1A 1Z0IA 2E48A 2AG5A 1HMPA 3FVRA 3IQHX 3PYLA 4IH1A 4L15A 5DHTA 3D6JA 1UBOS 3M1AA 4FE3A 2NZWA 1LK5A 1BE1A 3EIXA 1SQ5A 1JQLB 2OFXA 3HA7A 4WOPA 4BVJA 4KTVE 1OBHA 3I5UA 3ZI7A 1PGNA 4H1TA 2WLSA 4E6PA 3KT3A 1E64A 1K98A 2KJQA 4CV0A 1RQGA 5B36A 5JBIA 5F7JA 4BGIA 4LVNA 1P81A 2XAUA 3PT5A 4FSHA 1NZJA 2F4NA 4OREX 2GJKA 5EE1A 3FVWA 3RG2A 4BV3A 5LQAA 3OIDA 4JL5A 4AIIA 1RQXA 2QX9A 2H4ZA 3EF0A 4JJZA 4EG3A 4R1SA 4WOKA 3T1OA 4CF5A 3I72A 1M8JA 3PC4A 5TPZD 1DXOA 1KH1A 3IDFA 3LLVA 3E9DA 2VWHA 1R15A 4E21A 5FAKA 3EGDB 1K27A 3FNEA 5JSUA 1ORDA 1Z26A 2XGJA 2ZQ5A 3GMDA 1RZRD 4JNCA 4MVYA 1UT6A 3OJCA 2ZZMA 2OOKA 1MAHA 2GPJA 3U3DA 2FN9A 3W2TA 4YCLA 4NSNA 2Q99A 3CA8A 1KGDA 3QVLA 2YMPA 4LXGA 3PJDA 3OEHA 4HXGA 2HMYB 4JQSA 1SGWA 3FX2A 4C5CA 1JEYB 2G9RA 1KK1A 3T7TA 4DUGD 3RLFA 2GF2A 4XWAA 5FA6A 4MUGA 3UGKA 5A2QA 1VGVA 1FP4A 1CJTC 3Q5EA 1T1JA 1U0TA 1UANA 3UWMA 1JEOA 2FEOA 2XMSA 3H86A 1M83A 3IBCA 3KDAA 3RT1A 1MVLA 3U7GA 1Z18A 3AL3A 1H2RS 2DY1A 1Z8DA 1EM8A 1JBQA 2OA0A 4BFUA 4ENSA 4XIYA 5FWNA 4CCWA 1NNSA 2YBEA 1FY2A 3I01A 3MS2A 2WTUA 2WM2A 4MVJA 1GDDA 1MOZA 1CE8B 4G4IA 3W4IA 4XYEA 5AKJA 3VR5A 1KQFA 4Y1RB 1WXHA 3T35A 4EI7A 3HFSA 5LU9A 5CW1A 1U7OA 1A69A 1G8GA 4EECA 3JYOA 5MFZA 2ZXFA 4QLOA 1P0CA 1QH1A 1AGNA 2VT6A 3LPMA 4LI3X 4MITA 1QIIA 1HLPA 1P80A 2Q5HA 3KD2A 4ZA2A 2H3EA 5ADHA 1ZHOA 2H7YA 1FS6A 2IP1A 3DMNA 3O91A 1E61A 3FUTA 3QWFA 4WNYA 4G65A 1PO7A 3X1JA 4EPRA 2CVQA 1I13A 1E89A 1XJWA 3GJ6A 2FN7A 3H13A 3IPYA 3QOXA 3UWDA 3EEQA 4G0XA 2RGXA 3N58A 3F6YA 2GD1O 5CVDA 4BFWA 2YWHA 4A03A 2QVYX 2VPTA 5F1OA 3OIWA 4BP1A 1TLFA 4DYVA 3CE6A 5CLJA 1A2OA 5EZ6B 4K28A 2CF6A 2LDXA 3MA0A 2LDBA 4IIDA 2YWEA 5BXQC 5BWBA 1ABBA 1L5SA 3ZCVA 3OWHA 4CQNA 2X8JA 3GZNB 3R6TA 4FYKA 1NW4A 1CUDA 2HJ9A 2V8BA 2ZR9A 3S5JA 1IJKA 1WW2A 4GRAA 4RJIA 5E2AA 3I1IA 1H5QA 2FSPA 2GXAA 3IQGX 3V8PA 4MQUA 1SUFA 1BQ4A 2EDAA 2WKQA 3ZHUA 2AMFA 1R8SA 4KQGA 3HCPA 3LYAA 1OD6A 2DUUA 2PZJA 3Q3JB 4BP3A 2VYVA 2OKCA 3Q2IA 4F97A 4A0RA 3NOXA 1G0OA 3DMTA 3EXIA 3G8BA 3RB8A 3ORYA 1Z7YA 3UG6A 3AM1A 2O2SA 3O8DA 1N3IA 1QHXA 3WLPA 1FNMA 2ZYHA