4OREX

Cyrstal structure of o-acetylserine sulfhydrylase ternary complex from haemophilus influenzae at 2.2 a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
307
Chain Sequence
AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cysteine synthase
publication title Cyrstal structure of O-acetylserine sulfhydrylase ternary complex from Haemophilus influenzae at 2.2 A
rcsb
source organism Haemophilus influenzae
total genus 111
structure length 307
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oreX01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oreX02
1FCJA 4D8TA 2JC3A 4LI3X 1UIMA 4D9EA 2CLIB 2J9YB 2GN0A 4D8WA 4NEGA 1J0BA 4H27A 5JISA 1F2DA 4AIRA 1K7FB 2BHTA 5D86A 4D9MA 4WX2B 1KFJB 1TJPB 4D9NA 2CLEB 3L6RA 1KFKB 1K8YB 3BM5A 4L3VA 4L0DA 5T6MA 1WTCA 1Z7YA 2PQMA 4XUGB 1KFCB 3PR2B 4AECA 1TYZA 1WDWB 1VE5A 3TBHA 5DBHX 3PC2A 4HO1X 2TSYB 1V7CA 1M54A 3L6BA 2CLMB 3R0ZA 4COOA 3HMKA 4NU8X 4D92A 2ZR8A 3PC3A 1V8ZA 1VE1A 2GN2A 3VSAA 1K7XB 3IAUA 1O58A 3CEPB 5HBGA 3FCAA 3V7NA 2ECOA 1D6SA 2EGUA 4D9BA 5J43A 2TRSB 2CLLB 4HN4B 4JBNA 5B1HA 1A50B 5DW0A 5I7OA 1BKSB 2ISQA 1J0EA 3AEYA 3X44A 1K3UB 1E5XA 1OASA 2J9ZB 3R0XA 4HPXB 1WKVA 2CLKB 1A5SB 2RHGB 5B1IA 5B55A 5CVCA 1TZ2A 1VB3A 1KFEB 5IXJA 5B3AA 4IL5A 1K8ZB 1TZJA 1PWEA 5JJCA 1A5AB 4D9CA 1TZKA 1RQXA 1BEUB 4D9IA 2ZSJA 4L27A 4PCUA 3SS7X 2CLHB 5DW3A 4HT3B 1X1QA 4D9FA 1Z7WA 4LMBA 4D96A 4D97A 5DVZA 2DH6A 3L6CA 4ZU1X 3VSCA 2DH5A 2J9XB 5IW8A 5D85A 2V03A 3VBEA 3SPXA 5IWCA 1C29B 1A5BB 2ECQA 3IQGX 2Q3BA 1QOQB 1K8XB 1KL7A 4I1YA 5J5VA 5I6DA 5I7RA 2D1FA 3DKIA 1J0DA 2TYSB 3PC4A 2O2EA 1Y7LA 1TTQB 2ZPUA 3IQHX 5B36A 4Y6GB 4D9GA 1V71A 4JBLA 4OFXA 1QOPB 3X43A 5B53A 1TTPB 1TZMA 4LMAA 2BHSA 3RR2A 1C8VB 5KZMB 3VC3A 3FGPA 4D8UA 3ZEIA 3SS9X 2C2BA 2Q3DA 5DBEX 4F4FA 4ZU6X 1J0CA 1CW2B 2WSYB 2O2JA 3VSDA 3AEXA 3DWGA 4L28A 1K7EB 4D9KA 1P5JA 2RKBA 5E0KB 5D87A 2CLOB 3DWIA 2GN1A 1J0AA 5I7HA 1JBQA 5EY5B 4KKXB 3T4PA 4ZQCB 5BW6B 5CGQB 4D99A 1KFBB 1PWHA 1CX9B 1FUYB 3IQIX 2Q3CA 5I7WA 1UBSB 4QYSA 5KINB 2EFYA 4OREX 5C3UA 1UINA 2RH9B 2C2GA 1WBJB 5D84A 4HPJB 1TDJA 1C9DB 5I7AA 2CLFB
chains in the Genus database with same CATH superfamily
4F11A 3HJCA 3KOZA 3I9OA 4H31A 4BFSA 1IAVA 2DVMA 2GVZC 3PWKA 4DR2B 2YIDA 4P98A 2ZJ3A 4QYTA 4W8HA 4HDSB 2XX3A 5D86A 4ZOQI 3SEFA 1FFBA 1UXHA 3JASA 3T1HB 2ZUDA 1GPAA 1XTIA 3HJHA 4CIYA 3ZQ4A 2FPXA 2CL0X 1XZCA 3GJ7A 1IOLA 2WJ3A 1H0KA 2H1HA 5CHEA 2VAPA 3B5IA 4HDCA 5HRAA 2H0QA 2QLMA 3A27A 2IYEA 2X58A 5A6SB 2OV2A 4F97A 1R9JA 3EMDA 2H8GA 2QGFA 5DBHX 3JYNA 2VPZA 4HO1X 5IBRA 2VDUE 4NCIA 4TN5A 3NKFA 2I3DA 2YH2A 1KDPA 4FK8A 3GRPA 4J9VA 3NHMA 3DOIA 2VWPA 1TO2E 1L4NA 2O6LA 3AR5A 3MUFA 2A59A 3OQ6A 4NAVA 1YC2A 3LOQA 3RTAA 5LMUB 3BCRA 3GLUA 2JB9A 3BXHA 2QPOA 4NR0A 4NYJR 5EWMB 4R8MA 3P96A 4MJ7A 4N01A 3LQRA 1OAAA 1KS9A 1Y4DE 5IXSA 1OH7A 1JEQB 4EHJA 2H7XA 2Z8XA 5KNLA 2YHIA 3PDCA 5CFOA 4XKJA 3DVLA 1XL1A 3G9QA 3PEFA 5F1KA 1E2QA 2O05A 3OEHA 3W2TA 3ZKAA 1Z4QA 3FYCA 2AI3A 3HP4A 3PUJA 1FU8A 3AF5A 3ILYA 3ZZUA 2Y0DA 4YX9A 4MI3A 5JBIA 4ITVA 1UJBA 2ZJ4A 1E2PA 1TJ4A 5C9ZA 2XR1A 4BO7A 3DBRA 1OIWA 4O1HA 4QPDA 1RPAA 1FC0A 2LGJA 2PUFA 1NJ8A 2HDHA 1N32B 3J81k 1E96A 1GZ5A 2ODTX 1L8OA 2O1WA 2ZT8A 1ENPA 2XAUA 3Q4GA 1MT0A 1U3WA 2V6IA 2DUMA 2R9VA 1ZA2A 4N7RA 4OQFA 4QOIA 2IEZA 3SPXA 2JFXA 3DDNA 4GLFA 1PFUA 3ZWPA 2HLDA 4I1OA 1MRSA 1FY2A 3W2EA 4FMDF 3ZG6A 1HOXA 1ZOIA 3QJYA 3SHWA 4IEIA 4CKYA 1A2BA 1T3LA 2ZTLA 3L7YA 5FUVA 5A1TA 2AX3A 4XIIA 1X19A 3I6YA 4Y1FA 3RFXA 3PJFA 2VKTA 2BDUA 4OJKA 3A4LA 2IHJA 3FGPA 3QI2A 1FDSA 3E0QA 3WLFA 5ALZA 1U1CA 2G1KA 3EMVA 2H57A 4FOLA 1RHMA 2QEQA 3T1QA 2OB2A 3LXMA 3WHLA 1AVTA 4HQFA 4BLPA 2ODPA 3EEQA 3N7AA 3OFVA 1RWOA 4QOSA 5AVTA 3FNEA 1P72A 4PSUA 2BN4A 1WW2A 2HFJA 1EP9A 4ND3A 2N47A 2XT0A 3ISVA 2Q6IA 4I55F 3H2JA 4FE7A 3ELBA 2POCA 4JEMA 4EYQA 1JFFA 4BNTA 3GI1A 2BEWA 1KYIA 1XKLA 2R96A 4CF6A 3MWYW 4ZO7A 2RHDA 4ATNA 3HU2A 1I13A 1RAGA 4B0OA 4HAZA 3ADOA 2E6KA 2WFMA 2G7ZA 3H87A 4QFCA 2JBWA 4DKJA 4QQNA 4KXLA 4BE7B 4FKZA 2VTBA 2UYQA 1JJ7A 3BXXA 3SC2A 5GINE 3JR3A 2GN6A 4TT3A 5BRNA 4ZU3A 4UTVA 5I8PA 1EB8A 5FWDA 5JATA 4W6ZA 1YFZA 3K7EA 4KEAA 1YOVB 2IYXA 3RYFB 1T8PA 1M1NB 4Z7NB 4O4IB 3TIXB 2A2ZA 2VDLB 3FB1A 3THXA 4JVMA 1WW8A 3AI3A 1KMIY 1PNOA 3ND6A 3RK1A 2XRZA 4WINA 3CLTD 1EWQA 2IPLA 1JAHA 1Q15A 5HE9A 1RI4A 4DQXA 1IY1A 2J59A 3KXPA 4LW8A 3HVRA 3GT7A 2Y05A 4BE9A 1M54A 4CMHA 5IVKA 1QE3A 1XTZA 4LFCB 1F8FA 1I9GA 3BSWA 2GM3A 4C06A 5EJEA 4CN8A 2V7TA 3P9IA 3PJEA 1N9GB 3T1NA 3ZX4A 3A2KA 1R0LA 1P0MA 1ZK3A 1I14A 3PIRA 2BFEB 2J3LA 5IDVA 1B0PA 2XIJA 4KDEA 1G16A 1WP9A 1JHRA 2DYKA 3AO0B 4OF4A 4FP9A 4HS4A 4RY9A 3VHXB 4C5AA 1RZRD 4JT2A 2WHYA 1IXZA 1D2GA 2DT8A 3IHLA 3PNVA 5HHTA 2DQKA 4UDOA 1IPEA 3OAAA 1UBCA 4HADA 4P36A 2XE4A 5B2ZA 5G0TA 3MWFA 2R44A 3FJYA 2RHCA 1XYYA 5FNVB 4QQKA 2AMFA 3UV7A 4BMYA 1ZD8A 2QVCA 1X3LA 2VPTA 1V16B 2G07A 1OSNA 5EIWA 3L7IA 4OFBA 1K8ZB 5CA1A 1Y5MA 5LFAA 5SZHB 5AHXA 3QFCA 1TM4E 3RHSA 4HDOB 1G4AE 2GF0A 1CQJB 3OZWA 3ITKA 4R7TA 1E5TA 2F2TA 3USCS 5DLEA 2ZCVA 3R09A 4QYWA 4UUPA 4EM6A 7ABPA 3D8UA 1HA3A 2VXYA 2OXRA 3LRXA 3FPBA 3LD9A 2C7VA 1QVRA 4HLCA 3RVQA 2IYRA 2WJGA 2INGX 1V95A 2VJQA 1LPNA 3K2QA 4YQEA 5I4KA 1K8XB 4RUKA 3BSYA 2GYVA 2PZGA 3CY6A 4LC9A 4M1TA 1S1MA 1E1QD 4M38A 4E1AA 5B36A 2FMTA 4EIWA 2ZDQA 4RMNA 3WNCA 3W9BA 5BVHA 4BLTA 2QN7A 2W2XA 4PRLA 3JYQA 5EXPA 3Q7IA 4FHGA 3UC5A 1X7DA 4K05A 2C58A 2CJPA 4I1SA 4JOSA 4YGXB 5KTNA 1G9SA 3T9CA 4Z6KA 5KJCA 1XAIA 3DVSX 3G1UA 4W9NA 5EA2A 1EBUA 3UTCA 4K9OA 3I9NA 5KIAA 1BFUA 1VE3A 4FVTA 1OTHA 1JI0A 3Q3VA 1AKQA 3F47A 3ORSA 2PGJA 4B2LA 1CF2O 4EEKA 1GITA 2OOSA 3HLKA 4Y9TA 1RLUA 2HADA 3IALA 2ABWA 3B48A 2CFTA 2OXEA 3H8JA 1R8YA 4G5OA 5M34A 3RSFA 1GAWA 5KOJB 4LSGA 3EQ8A 2V65A 4AF8A 5I9IA 2YWJA 1CRWG 4WNAA 1LNSA 1DJOA 5CYFA 1Q3HA 3UT0A 3MGGA 3SC3A 5A9SB 3CURA 2RH9B 4R69A 4RCYA 1II9A 3Q7RA 2RAUA 1A76A 4EG3A 2BTQB 1FIUA 3V2HA 4LOJA 1DIAA 10MHA 2EJWA 5CT9A 5D1NA 1GCAA 2HWWA 1KEZA 1OUMA 5BPHA 4EVIA 1CXZA 3NHSA 2Q7OE 1T36B 1DUIA 2FPOA 3BFVA 3OQNA 5FR2A 2YBEA 3QJ5A 3T3EA 4DLUA 1Y8RB 2FVXA 2QMZA 3OLCX 3QE2A 4PXSA 1H4TA 2GRJA 4I66A 1QG0A 2UYGA 4IS3A 2V6FA 4X6LA 1J07A 1ADGA 1E4OA 3DXXA 3HUDA 3Q88A 5IBPA 4EHHA 4ER3A 3UJBA 3QPAA 4IHJB 2ZFUA 3ORYA 4MZXA 2HXSA 2FFRA 5K3CA 1UBOS 3Q3EA 2XZDA 2CLMB 2NV2B 2W48A 2V0NA 4FZRA 3VMMA 1MJNA 4Y9SA 5BQPA 1C81A 3CO0S 1QIDA 2XNHA 3TCXB 3CO5A 4KYIB 5A4FS 2YZ2A 4KL8S 4BZXA 2EIHA 2O3RA 2QYHA 4R6XA 4JHXA 2G6TA 4UD2A 3G0IA 2JGFA 2Z4TA 3DONA 4CM4A 2M6LA 1BMDA 1JTEA 4FT4A 1TW3A 2X4DA 3JASB 5SZKB 4OL0A 2VZ9A 3UWKA 4XARA 3VPXA 1E5XA 1GARA 2CLKB 3PP8A 3BERA 4KG7A 1IOWA 4ZAGA 2O2YA 1JQ3A 1S3GA 4RV9A 4E5YA 721PA 1KFEB 2JFBA 2PXAA 3H1GA 5JS6A 1CY7A 4JGBA 2M98A 1DOAA 2YCLA 4H6XA 5LQSA 1NWHA 4XTCS 5DASA 1WKCA 3OU6A 4MROA 3QYJA 1OCEA 4BP3A 2YXNA 4PC3A 4DPLA 4M2LA 1V1MA 4JI2B 1JYFA 1QHIA 4LMBA 3VI4B 3NBKA 4BY9E 3AHHA 3WLEA 4L0QA 2XNSA 5L9AA 1JZTA 3SS8A 3KHKA 1DHRA 2KLBA 3MUNA 3QPVA 1LDMA 5AI4A 2ACWA 2Y6UA 3CC8A 1O95D 2AF3C 2XWQA 4NICA 4UNPA 4ZD6A 1M0EA 1R4NA 3UFBA 3U7FB 1FXWA 4LJ6A 2LIVA 2F1JA 3FYHA 1JU3A 1V5GA 4F2HA 4B76A 2VNJA 2YHIB 1VYUA 3H4MA 4X24A 2W2PA 2SNIE 2ORYA 3FH0A 4KH0A 4AQDA 3J81A 3BEDA 3BFKA 3PQCA 1U0BB 3W3AD 3D5TA 4PVCA 3RJ9A 2PUCA 2BVNA 2C2BA 3ZW8A 2JG3A 3DOFA 2ZJZA 3OH8A 4PXYA 8LDHA 3DBRB 3L3BA 2F48A 4DUGD 2HJHA 1TKAA 2CLOB 4L9WA 4OXYA 5BPFA 1SXJA 1T10A 1P0QA 1EGVB 1T9GR 1DPGA 2R60A 1ZGGA 3N0RA 3WFJA 1DJNA 3D8TA 1LV7A 3BWMA 1YS4A 3MJSA 3QEKA 1MQSA 1EEXB 4NYMQ 5F78A 1KY4A 3NUZA 5TEVA 1Q7EA 3DE0X 1PJ2A 1G3UA 5EKTA 2ZROA 4RK1A 4UJ5A 3KKQA 3R3SA 3HN7A 3GRZA 1T1RA 4TS4A 4XCVA 4ESOA 4LZNA 1UXJA 3B1ZA 4N7BA 2JIMA 2BJVA 3KYCA 4ECAA 1AM4D 2JCXA 4K9SA 1K1EA 3T1YB 5ALXA 3P9RA 5KCMA 1DAEA 1ZKMA 1R0YA 4A6EA 4CMCA 2ZIFA 1U0LA 1V45E 4FFOA 4OU5A 3THXB 1U2QA 3W1EA 4FBGA 1AGRA 1TK2A 1JHDA 2GVDC 4JYCA 4JK3A 2Q2OA 4BVGA 3DP9A 1DKMA 1JPJA 3DWEX 4LOLA 1VCMA 1A5TA 5JVDA 3OG9A 3DZJA 4BMVA 5KYKA 2Z3VA 4AY2A 3LSTA 1Y1TA 2XA9A 3GWGA 4HJRA 6AT1A 1Z8DA 1JRLA 5HG0A 5L6MB 2TSYB 2C5GA 4BNDA 2VP6A 4PYJA 1FUUA 4HFNA 1JFFB 1RQRA 1TD1A 2BEWB 3G89A 3KEOA 1S0UA 5FBRB 4BNZA 3LUPA 4YRPA 1KMCA 4QPPA 4NMMA 2HYIC 3AHEA 2R87A 5IVIA 3I1IA 1M2NA 3IFSA 4UTZA 1GGNA 1U0HC 2FG7C 3HUUA 3LUHA 5JCZA 4RH3A 2G1AA 2H31A 4KYUA 2VTBB 3I9KA 1UPAA 2K87A 5LBTA 4ZQHA 1NV9A 2A3NA 3SC2B 3L82B 1DAKA 1SKAA 4ZVSA 5T8KA 3ROZA 4P9NA 4WDRA 3ZWAA 4CMBA 4EJFA 1ZQ1A 1E60A 4H1WA 5AVKA 2IYSA 3FNIA 4ZI5A 3TXAA 1MAVA 4DGQA 1QO0D 4S2EA 4GEKA 3RQIA 1Q11A 1UBFA 2VQ3A 4W6QA 2RHGB 3KP1A 1XDGA 3NJ8A 4INPA 4M9RA 4RWZA 2AJTA 2Z2KA 4MYRA 3QNUA 4XGRA 3KVYA 2ADMA 4HLNA 1MAWA 1XEWY 3V97A 1ZX1A 5K8VA 4PNZA 1OJ7A 4UE6A 1SD1A 2OPBA 5E6UA 3ELDA 3AL0C 4B3CA 3F7OA 3ZCUA 1EYZA 2XH8A 2JJ8A 1ZC3A 3C8UA 5KC9A 1ZNZA 1U2RA 3NFYA 5ECDA 3D3WA 4W63A 2ZRJA 2VH2A 3KBBA 4M0DA 2QP9X 4EG8A 3HJAA 4ZVKA 5GOZA 1FW6A 3AV0B 3N5CA 5T64A 3BHJA 4CMAA 5BUQA 5JSHA 3TTYA 2CVFA 4Q9LA 3SICE 1NJ2A 1TVKA 1Z6QA 3F5QA 5JH7F 4YRGA 1EH5A 3CLRD 2FE4A 4JMPA 3IQHX 4Q3EA 2O7QA 2Z2JA 3BGDA 4BFTA 5FPHA 2IXEA 3KLPX 4K9PA 2Y6VA 4MITA 5HKKD 5JXJA 5CCDA 5JE8A 3ZN2A 1UXIA 1OIVA 5CA1B 1GGMA 1JR2A 1U5AA 4QEDA 1U9IC 3FRIA 3VHRA 4BFYA 3AI2A 2PU5A 1O6CA 2CVPA 1EGAA 2ZGVA 3Q1LA 3AI1A 4NDAA 5JZBA 5MGNA 3I42A 1EQAA 2PGNA 1NVDA 1R9GA 2NT3A 4EB6A 2VYCA 3CJRA 3ZS9A 4D79A 4TTRA 4U6NA 4Z3DA 1R88A 1HYHA 2GPJA 2VDNB 4GP7A 1YH3A 4HQLA 2XUFA 3OHSX 3VR2A 2ZUEA 2CF6A 1Z0DA 2QTVB 4XB1A 1PSZA 2H1LA 2K2WA 4LJLA 4YIKA 5JCPA 1CVRA 3AINA 1FMJA 4HB0A 4ZOCA 5BR1A 3IVGA 1DBVO 3WGJA 5B57C 3E5RA 5EEGA 2VAVA 3TTSA 4MCJA 3QXHA 2W2LA 2JIBA 5D6OA 3I52A 3QYAA 2OC9A 2OTCA 3FHOA 1E6EA 4Q12A 5BVHB 1GOTA 1ZINA 4ADSG 2QG6A 4IF6A 4AYWA 2BT4A 4Q9DA 5JALA 1FCJA 3LXXA 4BIIA 3LUJA 4YA6A 5EGNA 1BWRA 2NXNA 1TYAE 4ZVLA 2O3QA 1QRRA 2X5JO 1DHTA 4FOOA 2R6CA 4LECA 4EGQA 5CD9A 1RYHA 1HFEL 1V5FA 3EFOA 4UCWA 4Q4HA 4PFKA 4KE7A 4ITUA 4D25A 4H1TA 4UM7A 4B3TB 4OMDA 1G3RA 1XMJA 1Z8HA 1NP6A 2QUIA 2OCLA 1Z5GA 2SICE 3ECAA 3IQDB 3RB8A 1D09A 4W9RA 1NXOA 4NLLA 4WNAB 2YBDA 4BATA 4XUEA 4LVNA 1YQXA 1WY5A 1ZOLA 2PS3A 3QBEA 3S29A 1NIPA 1YFJA 2YV4A 2QS9A 3S2YA 1JDVA 1T3GA 2QAGA 3GCDA 1GT6A 1N6PA 3MPOA 2GJ8A 2C7OA 1A4IA 4IINA 1KVTA 1OWLA 2XQFA 3ODPA 3OLXA 5SY4A 2XE8A 3WIBA 5B6PA 1WUTA 2WD9A 1NTOA 3OECA 4DV6B 4CLDA 1ORIA 5I9NA 4IJWA 1K89A 3INNA 1PEAA 3F4KA 5F1OA 3I53A 1GPMA 2QVZX 1Z4MA 2EV9A 1O5IA 2XDAA 1OASA 4BCCA 1HLPA 1T5OA 4JA2A 1EUYA 4RQBA 1MJFA 4V03A 4LBVA 3AY0A 1E6LA 1RKQA 5H0IA 2UU9B 5E9QA 5EHNA 3BKXA 2C96A 4LYAA 4GBJA 3AESA 2H07A 5JDIA 5JZVA 1J8FA 2IZ7A 3E7PA 3AR8A 4JC8A 1RKBA 4R4JA 3TFQA 2JJ1A 5TS3A 4BC0A 5JNLA 1ABFA 3TRKA 2QM7A 3KSUA 4DLXA 3OWHA 4GX1A 4QHSA 4MI9A 2H1RA 1LLCA 4A82A 2R1TA 3RLIA 1L3BA 2FZLA 3CTPA 1CY8A 4MEJA 1QLJA 4YPVA 3CZCA 2PGDA 2I9KA 2ECQA 2WZDA 5G3ZA 4CM4B 1EE9A 5JCJD 4WN3A 4X91A 2E4AA 2FXIA 4MJ3A 1Q3KA 4NBUA 2DR3A 1DAGA 1R8QA 3TINA 4O8CA 1TJ3A 3X1JA 2R00A 2AOWA 1Y81A 3KJIA 4D0NA 5T5QA 1LI5A 5TJHA 3AEUA 3TMYA 4C21A 4F3YA 1A9PA 1LWOA 4LY3A 2BM8A 3AEZA 1XO1A 2E37A 2IBSA 3T7IA 5AI9A 1THMA 1ICIA 1PZNA 2Q7XA 4KR0A 4O2LA 3RVRA 3E8MA 2VPQA 4B8YA 3KKLA 1P5JA 2ZE8A 1V1MB 2AN5A 2GPNA 3MJDA 3V9AA 1NJFA 3OT1A 1SIBE 5C1BA 1WVMA 1CBUA 4JC0A 1GCOA 4JYMA 3B2QA 3RROA 1N92A 5AR1A 1A8HA 4NULA 2A92A 4H9GA 1VGQA 3MMNA 4XUCA 5ERXA 1NVWQ 3ZCSA 4C4OA 4D3FA 2IU4A 2PSDA 2QG9A 3AOEC 3LFUA 5FL7A 4PHGA 1R4NB 3P8ZA 4L5YA 3ZJYA 3GLIE 3PITA 3H16A 1EFHA 2Q62A 2AQ8A 4BLVA 3G0DA 3GR6A 4JIGA 5H9VA 1W87A 4HPJB 2UUOA 3JU3A 5L4LA 5CR9A 1L7VC 3UCXA 1J0XO 1L8QA 1UPFA 2ZB4A 3GA5A 4H18A 3RHFA 2BKXA 3U3OA 3MCAA 1RRKA 2VXCA 4NBVA 1X80A 3A25A 2NX2A 4BAGA 2HN9A 1ZXXA 4MA4A 3W4IA 1T5HX 4E09A 3QUSA 4MWZA 1U8YA 1BN6A 1SXJB 2DKFA 4QASA 3QMPA 5C1IA 1L5KA 1CJKC 1KARA 3IV7A 4NJMA 3OD5A 3OOHA 4ZJYA 3M6FA 4HP8A 2ZJ8A 4LXYA 1GIAA 1ZMBA 4XVHA 2DF8A 5FTWA 3QW2A 2VDWA 3QVLA 4WK0B 4AS2A 2PWYA 4TUYA 4NU8X 4KJZA 5H7XA 2YW9A 3W6UA 4D92A 5G40A 3I05A 4LV8B 4L16A 1DWPA 2Z0MA 1DARA 2FZ5A 4C0KA 3FCEA 3KYCB 4M37A 3WKAA 2D5IA 1NZJA 1T91A 3COZA 3HLTA 3R20A 2BI4A 3IQWA 5GV8A 2V3VA 5A7HA 4ZHQF 5CDUA 3SVLA 1WBBA 1BS9A 1EFLA 1YBHA 3K1TA 1QTQA 4PRKA 2RJOA 5LQAA 3EW7A 1ONNA 3UY4A 3DVQX 4E94A 1O9GA 5DNCA 4PYLA 5EUQB 1PDWA 3BJEA 4H0NA 1BGVA 1R4AA 1T0BA 1UPBA 2QI9F 3P9PA 1W75A 4GX0A 3Q8XB 4RTNA 5FFNA 4OQDA 2M6RA 3FUTA 1DAFA 3K8OE 3OUTA 5ICMA 5JNTA 3U6KA 2CLDX 5H4HA 4H0CA 1UC9A 2YY7A 3KUDA 3IR7A 5DTQA 5JVDB 1M5RA 1AU9A 3GARA 4GLLA 1XP5A 5E1BA 4HAVA 2IUTA 3HWX1 4G0WA 1E0KA 1PD0A 3I6MA 2X6QA 1PV1A 3COYA 1UAGA 4BNDB 1DWQA 2YWXA 1KVUA 1G0NA 2WG2A 2G0NA 3P4XA 4A73A 1CTQA 1L4LA 2ES4A 3FPGA 4II7A 1FYEA 4UVIA 2J07A 3DUWA 3ZZMA 4PRYA 1B6TA 3TM4A 1RMYA 2WG0A 1M1UA 1MB4A 3RTEA 3OTOB 3DYBA 1U80A 3OUZA 4BMXA 2CGEA 4XI9A 4OJQA 4TRMA 1Q0PA 3LWBA 2Q1YA 4CFSA 4JLSA 5DGTA 4B82A 3M3PA 4MR7A 1MP0A 3KHUA 3DDUA 3F7NA 1WE2A 3KDSE 3VZBA 4GUDA 4ER5A 1E1RD 3FYDA 2OBYA 3PPXA 5E6UB 3BT7A 4EPVA 2BFWA 3RUHA 1U4OA 2FRXA 2Q2VA 4QGHA 3V3TA 1PR9A 2FN7A 1HEIA 3OJXA 3RT1A 1RYZA 4D4MA 4BNGA 3D3WB 4WT7A 1GY8A 2W83A 1WLSA 5AOBA 2JCSA 2NV6A 4U6SA 1GGFA 1TKRA 3QYPA 3TZHA 2OHXA 4TWRA 5TF0A 1V41E 1VL2A 1XK6A 2X9VA 4W99A 5JYEA 2FMKA 3H5WA 5EXDA 1EDDA 1MT3A 1P7VA 4IFEA 4Q4DA 1TADA 1TVKB 1Y6ZA 2EP5A 3TZKA 3AVQA 4BVJA 1X1EA 3W5SA 3KFXA 4J2OA 3MWGA 5CVJA 4B9EA 3MTQA 1WEKA 4PLPA 3EARA 2Q2WA 1AXEA 4JZKA 5ALKA 3Q8KA 2WWFA 4KNYA 1X74A 1Z36A 1QF7A 5AO9A 2Z04A 3RS5A 2PH3A 3U40A 3ZQ6A 1E4EA 5K1ZA 1GG2A 1F2VA 1H9AA 1QTRA 2JGJA 1XK7A 3L46A 4QUEA 4TQAA 4YDHB 4A6DA 3EQZA 4NTZA 4UFNA 2B9VA 1CJVC 1KORA 2CL7X 1Z0IA 3S99A 1STOA 2Z9BA 4P7BA 2IWRA 1VM6A 2GZHA 3JWGA 2JH9A 4FKBA 1X38A 1X8LA 4OOFA 4EI9A 5LM3A 1AV6A 4F06A 5ITSA 5JARA 4RGQA 1ULHA 3LVBA 4URWR 3NATA 2QL6A 2D5BA 2JAWA 5EP1A 1JB1A 2GHTA 1XSEA 1WSAA 1WL8A 3IDFA 1JH8A 4DM3A 4E3WA 3AVWA 3HMQA 3K73O 1FSGA 4CCAA 5G0WA 1NSFA 2HF9A 1HL3A 4YRAA 4PS1A 3CLTC 4FHCA 2CFSA 3EGEA 4W5WA 3UOAB 3VI3B 4DNPA 2X0DA 4BEBA 3ESDA 3QX3A 4WE3A 5AJHA 1V26A 3CNBA 1OXMA 4JC4A 2COKA 1UOEA 4IV5A 3U3KA 4MLPA 4GYKA 4LYHA 1G20B 2QLJA 1TE2A 2CLLB 4FFMA 5BP7A 1CE8A 5ISMA 1W2WB 1M6NA 1A50B 5FR1A 5KVQA 2QD5A 4GYJA 5A5DA 3F97A 3QMMA 4X7BA 1TJYA 2B25A 5IEJA 2BR4A 2CFCA 3EFOB 3PQ4A 1MXFA 3O8QA 5FBHA 3O3CA 4JT9A 4Q4HB 3VJLA 2O8CA 2H2DA 4IMPA 4QUJA 1C1HA 4G1UC 1YL6A 2ATCA 5BN1A 3LF2A 2Z57A 4N8DA 3C45A 4RAQA 5DXFA 3L01A 4O2AF 4J0KA 4OHXA 5CFMA 2Z5LA 3TR6A 4F12A 3IT0A 2QR3A 1YNOA 3MGKA 4NJOA 4N0QA 4OUKX 4ZTBA 4UAUA 3MA0A 1J97A 1L4GA 4MB0A 4NZYA 4ND5A 5E4FA 4AVYA 5C7OO 3AIOA 1R66A 1K06A 2NG1A 3CRZA 5HMLA 4N9WA 5K0GA 4KSYA 1SCQA 1T2EA 1ECCA 2PLWA 4Q9JA 2Z6VA 1MBZA 1G1AA 3L5OA 3QUAA 3BZWA 4HGQA 4MP3A 5C46F 2X4LA 3ZY6A 1I4TD 1WD5A 3OSZA 4L4SA 5K0CA 1GXSA 3V00A 4EB6B 1U3TA 4MYDA 1BCSA 5DULA 4QXAA 5BW5A 1JNXX 1Z22A 4K81B 4MYHA 2A94A 3V4ZA 4B17A 2BBWA 4MAAA 2RHBA 4Q7QA 1NX9A 5I7EA 1DTEA 1NVVR 3MJFA 1JG6A 3PTLA 4HN2A 2WWXA 2PJUA 4WOJA 2AZXA 1JQLB 5E1DA 3JY6A 2HMVA 1MOPA 2KMLA 2NVUA 3AESB 1WLYA 4WXMA 2A0YA 2I78A 1J49A 5CA0A 5JU6A 2ISSD 3CEHA 1IQRA 1XMXA 2HLNA 1M73E 2SHKA 3E23A 4FJ2A 4GPEA 4GSYA 4LXQA 4PICA 4FQ5A 2Q1XA 1K97A 5CRIA 2LCFA 2ERXA 1U8FO 4D4KA 5BMOA 5I7HA 2PQ6A 2AT1A 2R1TB 4EUHA 2ZM6B 4PFQA 3BIXA 3DQPA 3O1LA 1TFRA 3IIJA 4XYBA 5FAXA 3SDSA 1C50A 3Q9UA 2VDRB 4WD3A 5HIAA 2PT5A 3DDHA 1VYVA 4EP1A 3K4QA 4M55A 2ZTHA 4IRUB 1P7PA 2M2IA 3D1JA 4XDGA 3VR5D 3AV3A 1LVHA 2A14A 1EFRD 3D6AA 2W6CX 2HMSA 4NEQA 1H9BA 4B3DA 1OAKA 2VTEA 3FOFC 2XVAA 3F6YA 4LWPA 1B1CA 3I62A 1BXZA 3KQMA 3OIFA 5DI9A 1W36B 2CKMA 3FKSD 1KKMA 3SFZA 3L49A 2R8OA 3H9GA 3AEUB 3M4JA 4B85A 2Q2NA 4KKVA 4DJ5X 1JYEA 2QMUA 4D80A 1E9EA 1T5BA 2ZSKA 1H65A 3NORA 1GTZA 1QE5A 3HVHA 3FPSA 4BFVA 1UDWA 3MMXA 4HTFA 1SBYA 5ESRA 4ARIA 3R6TA 4I8XA 1NMEA 4J0DA 3T4XA 5I7SA 3M6LA 4JQYA 4BNIA 4EG7A 3BGWA 3EWNA 3OT1B 4HN9A 2ZBRA 4KO3S 1A27A 2E2WA 4PAMA 2UDPA 2XQKA 1L4MA 1XVTA 2BGJA 1Q1ZA 2KX7A 1P31A 2L18A 1E3SA 1HDOA 2D0PB 3FSJX 2CCJA 2QD1A 5AM5A 4B2YA 1PNVA 2WQZA 3UJAA 2IU6A 1PLLA 3OO0A 2IS1A 2CB9A 4TZ0A 1IOVA 4CTOA 4GPBA 1PS8A 2QRVA 3H1BA 5B6IA 4E5KA 1WXXA 3CVYA 1U7TA 2DQZA 1F5NA 3OQHA 3R6DA 2VQEB 4LBYA 1N78A 1PFQA 3VAAA 1LW7A 4FIDA 4QDKA 3SBEA 3S28A 1N36B 3GMSA 4H0FA 4IZIA 4R05A 2GWRA 2QD3A 2GZ2A 1KC1A 3F74A 3ASUA 5AW4A 1HLFA 2KJQA 2CN1A 4G5HA 3LIPA 4YUXA 1QZZA 4Y9UA 3PWSA 1FRFS 1X80B 421PA 4DV5B 2FAXA 3NNSA 3OC6A 4FR2A 3MK31 2G77B 5CG2A 1N1MA 1NTRA 3DMTC 3QK7A 2M32A 3EA4A 4NJMB 3VGJA 1GPLA 4UBNA 4LVCA 4QX6A 1UFQA 3BUSA 3H9BA 4FYHA 4J03A 2Q4RA 4MLDA 2VDWB 1Z39A 2PZKA 1I2MA 4G4GA 1JVNA 2WF6A 1I3LA 4TUYB 4YRQA 4XE5A 2B8WA 5G3YA 3UJCA 2HEIA 3TTXA 1UWLA 3GBSA 5DOZA 1KAMA 1PN3A 2ZRGA 1PBTA 1YE5A 3KB2A 4MQ4A 3REGA 5JAZA 1WOMA 3R3JA 1BQ4A 2WVHA 5DYIA 3HS3A 3N7UA 1IUPA 2VNKA 2G9ZA 1JG7A 1NA5A 4Y2RA 5J5CA 2D7JA 3VR3D 1S02A 1ZOSA 1N57A 5CLFA 1AGXA 3EY4A 2I5PO 3EZGA 4WBNF 5JS1A 2O2EA 2C7RA 4DR7B 3M5DA 1L7NA 4V0LA 1DIGA 4LRTB 1IYZA 3H19A 2EAUA 3U81A 1O95C 4JNCA 4OHMA 4EG5A 1SKYB 2IEDA 4KWHA 5B1YA 2KQUA 3QA3E 4C89A 2HA0A 1QHYA 3E3MA 1SHTX 2NSDA 5DIZA 4BFCA 5INTA 3PVSA 3OZDA 4GD3Q 1F14A 5FH9A 2C7GA 4JCCA 4MEAA 4OJMX 1JKXA 3MHPA 3UZUA 1UZAA 5CXSA 4DVJA 3OX1A 1L6RA 1PJ8A 1XZ8A 1O03A 1EFVA 5EY5B 1M10A 1AV7A 1GNPA 1PX0A 1Y5RA 3PWZA 3K92A 4K2AA 2X19A 3NHZA 4GR9A 4BZZA 2ODEA 3R0VA 1DBIA 1GV0A 2ZJFA 2I91A 4B80A 2GBPA 3SX0A 1RHQA 5ED0A 3T5CA 1C0KA 1MV5A 5T6BA 4HNAA 5TC4A 2N75A 5I01A 3MT0A 4MMZB 2BHNA 4MR7B 4Q1BA 4L4XA 5DHPA 1Q0LA 5L7TA 4ER6A 3ZW7A 1QP0A 7YASA 3AY3A 1BX1A 1DDOA 4K9LA 3U7JA 3TLCA 1MFZA 2FLWA 2FP3A 2HWYA 1DS6A 4RTLA 4Z3KA 1B0ZA 2LUOA 5E9AA 5JADA 2XB4A 5JISA 3UOGA 2D54A 2CVOA 4KQ2A 4UVDA 4NENA 1V5WA 2JH3A 1WSDA 1BH2A 1R0CA 4A27A 4JT4A 2O5VA 4NAHA 3NOOA 3U4GA 5FNVF 1ZRMA 3PR1A 2JPDA 3PQ6A 3RVLA 5CIWA 2ONZA 3SDZA 5SYAA 1QFZA 3O4RA 1KK0A 1YHYA 2GN2A 4MKGA 4V1CA 2Q3MA 3LUKA 1JDBB 1T0PA 2CHVA 3P4YA 4RD3A 1ZC4A 2GTIA 2AV6A 3HXOA 2OYSA 3KEQA 4A0GA 1ZUNA 5KTSA 5B7NA 4XQCA 1AMOA 3EVNA 2WE7A 4S2UA 4AJ4A 2XVYA 1E4EB 3HI4A 4JXKA 3CUEF 3LUAA 3ZK7A 1FVFA 4E03A 1NSYA 1V8PA 4EZIA 4F4CA 3PTAA 2DUWA 1II0A 1RAEA 1Y98A 2O0KA 3G2JA 4L9AA 4KPFC 4RABA 1D2EA 2C9MA 4BFZA 4ZRNA 5FV4A 1RADA 3PEWA 4KNVA 3ZDAA 1DGQA 3C70A 2DHDA 3ME5A 3OLWA 3A3NA 1ZIDA 3WY9A 1PYOA 4A8TA 2MSKA 4YV0A 1DJLA 4FS8A 1DO2A 2NVOA 5FTMA 2UZ0A 1OYWA 2RH5A 3R8CA 3STUA 4EHDA 3P1JA 2R2AA 4OU4A 5HJ7A 1SUBA 3AWIA 5B58C 1SB8A 3PUWA 4DQVA 2ECPA 5C1PA 1VPTA 3BMQB 2XMBA 5HS6A 5CITA 3F8WA 1XPRA 2B83A 3U3XA 4CFZA 1A77A 3DF9A 1RRMA 1Z3CA 1ZK0A 2EG5A 4IKPA 4M0UA 1IG0A 5EE5B 1IAQA 3ABOB 4U39A 2RHTA 4RVOA 1VGRA 3OC0A 3OF3A 1P6QA 1PBNA 1XZNA 2H51A 2QN8A 1UJCA 1HDXA 5AH0A 4C88A 2R79A 2YXEA 3W05A 5D85A 4CV1A 3H2KA 1P73A 1V3TA 2FZ4A 3M1LA 4JJAA 1ECLA 4QC2A 1CE8B 1J4AA 4WCFC 3QVGA 4CM1A 2NUPA 1HEUA 2J5KA 2WU3A 3IP6A 3U7EB 2H2IA 2XA1A 4Q6BA 2O4UX 5KDLA 9LDBA 4KIFA 4OAQA 1P7YA 2Y1CA 3VH4A 3TUZC 1QGAA 4LC1A 1CEEA 4ZO8A 1FLVA 1S89A 1YKFA 3O8QB 1AURA 4U9HS 4DEYA 3RR2A 2PKEA 1BE1A 3CLRC 1B3BA 1OTYA 1UPUA 3AP1A 3DOHA 1OY1A 2GBIA 3NCHA 2O0LA 1ZU5A 3ORQA 4MCHA 4NCNA 5IJWA 4ZU6X 3LCCA 1C2TA 4P83A 1G18A 3AUYA 2ZT5A 4KX3A 3ANLA 4WZZA 5EMKA 4HAXA 1QIGA 4G0PA 2AR9A 1O6FA 5IG2A 1Q1BA 1T5LA 4NIMA 3TGWA 1Z4JA 5ALEA 1USWA 2DPMA 2BKLA 3CX7A 3MEQA 4FINA 2EBUA 1CCWA 2QAIA 2Y4NA 3N2IA 2Y1KA 4FFWA 1GU0A 1L7XA 2GEKA 2I6GA 4PZZA 1Z0SA 3O8NA 3W4JA 2O7SA 3VPCA 2QI9C 1GXSB 3LK6A 2BF4A 1BCSB 4G67A 4EJSA 1DKPA 2AJ8A 2VHTA 4P3OA 7ADHA 2JHGA 1MEEA 4RD6A 1IHOA 2M6SA 2YJNA 5CFRA 1P4GA 2F55A 4EI8A 2L69A 2P9YA 3O4VA 3R0QA 4YO8A 4RXMA 4PX2A 4PPGA 5YASA 3HR4A 2PYIA 1QC5A 2HX1A 4MVJE 4KO2S 2NVUB 4ZDIA 3F1LA 5CA0B 2FQWA 4D9MA 4L76A 1Q91A 1R6VA 1U1GA 3DS8A 3EVBA 4QXMA 4AYXA 5IDXA 5IVHA 1U0NA 3OCXA 5B64A 1JFSA 3M5CA 4U7WA 2JFFA 2W6ID 4XPZA 4EPYA 3F73A 2C04A 3A1CA 1JQAA 2X0IA 5FP0A 3RK4A 4YLYA 3RSZA 2IZOA 2CL6X 2I0FA 3FE2A 2PH1A 4EFMA 1U90A 2ZATA 4D41A 1WB6A 3WB0A 2G72A 4QUAA 1E6MA 1YDMA 2OAGA 2KBEA 4LZWA 3V46A 1G9TA 3ZE2B 3OKFA 2BEKA 3UKOA 3ZEAA 2PZEA 2OOKA 3P97A 4GI2A 4KGZA 1Q20A 1RM0A 1VLHA 3GGPA 2I7TA 1J2RA 2ZE6A 3AKZA 4D8YA 1M2VA 3K16A 5GY7A 2YCBA 1PFWA 1VQ1A 3IBFA 2JKYA 4MVJF 2QSJA 4HTFB 2GEUA 1XQVA 3IMCA 5IARA 4P31A 1IK6A 3W8FA 4MGKR 2Z5GA 3C3YA 2HIGA 1S2NA 1QORA 5B55A 2RB4A 1WPRA 2VP3A 3Q6IA 5CVCA 4DQKA 3JQPA 4FC7A 4XW2A 2Q0HA 3RF6A 3F5MA 1XTPA 2WNIA 3IQEA 4MMXB 1ID1A 1WMBA 4LAFA 1CWUA 1S8AA 3CNNA 5CEFA 2ZM5A 1JHXA 3O38A 4KSCA 2VQSA 3TD9A 1SCAA 4DXAA 4E2WA 2QRVB 3VU8A 2PNJA 3OP4A 3DLIA 5AW8A 2UXBB 3RFCA 4IJKA 4ZYYA 5C81A 1SAYA 3SKXA 3W9SA 3L6CA 2PFKA 1FFXA 3IKLA 2PRJA 4B2PA 1M0SA 3BD8A 2OQRA 3A3KA 3O03A 2BZ0A 4EMTA 3RAEC 5EJ5A 4MJLA 2H18A 3REQA 3HVJA 3JQRA 4PLVA 4QFDA 4QO7A 1ATZA 1NAIA 1X1AA 4V39A 4I8DA 3HB4X 3Q1KA 4K9NA 2WSMA 4R1UA 1DEOA 1DZIA 3FHCB 5ADUS 1MFPA 3FHTA 1KYZA 2JLXA 3LLCA 4OQEA 4QPNA 2AK2A 2PX8A 4MARA 4WY8A 3PPIA 4U63A 1RI1A 4XWKA 1FMFA 4NOKA 4BUZA 4Z1OA 3PIDA 4ARBA 3WBBA 1DO0A 2GYWA 1SUCA 2HC9A 3C0KA 1O5OA 4LY9A 3UICA 2XADA 4MUMA 3QSYA 2XMQA 3DMPA 4AZWA 4YRZA 1FSFA 2J3EA 5C8ZA 1ARZA 2MU1A 1O4VA 1DV1A 2BSXA 4G89A 4KVFA 2BGLA 2I8AA 4W7IA 4RTOA 3FPEA 2OB1A 4YCJA 5ALSA 3QLUC 3TB6A 2IZ5A 1ZIYA 4B0PA 2IS6A 4TQGA 4CV3A 3CLSD 4PYKA 2OO5A 5BN4A 1QHFA 5IC5A 1HNWB 5LC1A 1P17A 2WT9A 2BFNA 1GP2A 2P9TA 4CMJA 2JIZD 2JFUA 1KHTA 1DX9A 4KQMA 4ENQA 3OIDA 3VXKA 5HGXA 4LGVA 2BRUA 3IE0A 1I32A 3CVOA 2O3UA 3QKSA 1JG3A 3V1LA 2IS2A 1YS2X 1Z07A 4OH1A 4FYIA 1KXZA 4Y6LA 3OA0A 4M0PA 2I2WA 2BIFA 5DHSA 5EYPB 2IUUA 4R40A 4AP9A 4YHHB 4RVSA 4W5RA 4EGAA 3L40A 1NASA 1JXMA 4JBGA 3K5IA 1EFVB 3CZRA 3HCAA 4ZQIA 5TEWA 3TLBA 4GM0A 3TJMA 2EJBA 3ZWDA 1POXA 2ADOA 1KY5A 3B1WA 3C7KA 3J7TA 1R5BA 4EG6A 3CNQS 1UMDA 1OI3A 2NSJA 5K6TA 1WCV1 1Z8FA 2WVAA 4QYXA 4Z8XA 3WWPA 4DVGA 4V0RA 2QW0X 4KQWA 4L6IA 1RJFA 4HNAB 1Y6JA 3A1UA 5FV7A 5FQNA 3WE7A 4COOA 4EY8A 1ZK1A 3CBQA 4L3WA 3STHA 2V1UA 1HE4A 3K6SB 3DEFA 3WGGA 4EKGA 1D4OA 3CGWA 5FEUA 4E15A 3TXXA 4JJ4A 5BSVA 5B7PA 1JKIA 1MORA 2PA3A 2VDVE 2W22A 3BJZA 3MAAC 4RSHA 5DPMA 3QHQA 4FR5A 1B6RA 3S2EA 4NU6A 1JFVA 3I5YA 2ICAA 3IURA 5BUZA 2BMJA 4A2PA 5BWOA 1U8UA 2HQBA 4NENB 4CKCA 1WB9A 2ESRA 3NTXA 3LQFA 1UBKS 5D5HA 3ZI4A 2Z3ZA 4HV4A 4U2BA 3QHPA 4M9CA 3JQGB 1YZKA 1J33A 3V48A 1KDRA 2R11A 3OKAA 2H2FA 1P29A 3A9CA 4WERA 5JAMA 1V96A 2JCGA 2VPIA 2VRNA 1EFCA 2P30A 3P0RA 4N0PA 5CA1F 5KUTA 2ZUVA 4U7GA 2I87A 4V1CB 4ZRMA 1J2YA 1XP8A 3QEBZ 5FKJA 3M89A 4IHKA 3DZFA 3UT6A 1BYIA 4LYDA 1G2PA 1HE2A 1ZUNB 1F0NA 2AN9A 2HIMA 2SBTA 3GXOA 4L95C 3D7KA 4JSRA 4L72A 2ZAMA 4AIIA 2WRZA 2C5LA 1VMKA 3BMCB 4IVQA 4EJ0A 3DKIA 4Q15A 1OA0A 3GAZA 4OXQA 3ZIAD 3EPJA 1TAHA 1UP7A 2D1TA 4MCIA 4BU1A 2FCRA 4J2HA 8OHMA 3NMUF 3NHWA 3TH5A 3S7ZA 3G5UA 1DRJA 1F4PA 2OQ2A 5C37A 2HO4A 4RULA 3LLUA 1QKIA 3ZDQA 3T41A 4LRUA 3BIOA 1Q17A 5JMTA 1WUKS 1K7SN 1J8DA 2HPAA 5EIAA 3SI7A 2EEZA 1I6KA 1DVRA 4LRWA 4D7AA 5JLAA 1G5HA 3DMYA 1JIQA 3ENQA 3DFUA 3GMDA 3K1JA 4B2IA 5I47A 5IJZA 2F8SA 3VYTB 2QVLA 2P5YA 4L3OA 5H9WA 1K4MA 1GTG1 2FFQA 1XDDA 2FWJA 4F1KA 5JV5A 3ZOZA 5LQKA 3QBJA 4E5NA 5CCEA 1S8FA 1H23A 2QTTA 4ZOAA 4ER7A 1LBQA 3CV3A 1IJFA 1E2JA 1JR3E 1ORWA 4RKFA 1YBMA 2AN3A 4QNNA 4JI3B 1R3DA 3I9MA 5FOQA 2I6XA 3EVFA 2Q4OA 1ZK4A 2NUPB 2WTXA 2H4YA 3IJ5A 3QVGB 5JBNA 3A11A 2JASA 1KU6A 1A04A 1RAAA 4YCNA 1GQFA 2H4XA 4YP5A 4HWRA 3EN0A 3NIWA 2ONKA 3CKLA 1NLUA 1WX1A 2X41A 4JUBA 3F96A 4G56A 1KTVA 3KV3O 2IDKA 2XSZD 4J7XA 1OBVA 3KQYA 3BK1A 3QEMA 5HGJA 4O5AA 1QVAA 2HBQA 4JI1B 1A9OA 3K1YA 1XJWA 2HNBA 2IY7A 1QJ4A 3OLZA 5H81A 4ZJUA 3ZV7A 2VH5R 4C7KA 1U98A 1XD8A 4ZHSA 3NWEA 1LK7A 4DA8A 3Q41A 5GGXA 4MXDA 2WHQA 1X7ZA 3CB4A 2YS6A 4FQ8A 3SEAA 1WR8A 4M53A 4GRAA 3HE3A 3SYMA 5K7SA 2ZBDA 3M6MD 1DQZA 1T5DX 2Y68A 3RNLA 4EJSB 1QK4A 1E59A 3QKRA 1KMNA 1SEPA 5DH9A 1XMQB 1N6IA 1EFDN 1SPXA 2BF7A 2SECE 3BIJA 4OXIA 3JD3A 4FGZA 1NUUA 2XZOA 4RTRA 1N75A 1FFHA 1P1BA 1TAGA 4UEQA 4XPIA 5JAQA 3VAYA 3GB9A 5KTKA 4MV4A 1QC5B 5FI1B 1W25A 1B8UA 4S1WA 5HSGA 1OZFA 2DPHA 4X6UA 4DSAA 3GF4A 3S8YA 1GILA 1F0YA 1YZGA 3LQQA 2H1OA 1RYFA 1P7ZA 4HPXB 3VAZA 2VCYA 3HB1A 4D43A 5MHTA 1Z33A 3A6PC 1OU0A 5K3AA 1O9BA 4RFLA 3HU1A 2XUOA 3NXSA 4F2GA 4S1TA 2ZSBA 1GCIA 1N6KA 1TZJA 1O7JA 3CZQA 1RWMA 4M1WA 5LLTA 2YQZA 1BQ3A 2WPNA 4DLBA 1FBTA 3D1VA 2WTAA 2OBLA 2I6TA 2XGSA 3A28A 4EPRA 1IXYA 4N41A 3ZU6A 1JNYA 3GNQA 5GM2A 5JRZA 4O4LA 3KO8A 1Y89A 3FGOA 3TUJC 4XVRA 1VSVA 2RKOA 1OBFO 2OLJA 3D4BA 3VRHA 4RVHA 4IGAA 1M2VB 4WGFA 2RONA 2NSYA 2VPWA 4JX8A 4R7GA 2XGMA 3FTDA 3ZBQA 4Q3NA 2Q3BA 1JVSA 2Q28A 1MVNA 4EHAA 5I7RA 2ZTMA 3NDBB 1R27A 2VSYA 1H3NA 1RVV1 4RL4A 5C7LO 3ABQB 2QV7A 4K6GA 4J76A 3K1AA 5B1SA 5C1DA 4ZTZB 1BH6A 3FWYA 3FZEA 2PRKA 3LGXA 4XIGS 5CFPA 3UWSA 5KVVA 4ZQGA 4RGBA 4S1PA 3B51X 1XD9A 3CLKA 4RJIA 1HNNA 3C6BA 4I1IA 3SR0A 3AFHA 4HBZA 2YNMC 5TPZA 3SS9X 1W8IA 4XDZA 2DB3A 3LGAA 1NW7A 1QYXA 3SEZA 1P9WA 3ROEA 5IP5A 4BQIA 3AL3A 4YK7A 1J00A 1RZUA 2NSLA 1T13A 3D6NB 1O2DA 1XCBA 4YRFA 1WA5A 4KP7A 3HDJA 3M6UA 4TLAA 3V2UA 2ZVDA 1BROA 5BWBA 1WZIA 5CT8A 1JAXA 1D2AA 4BDTA 3GUVA 4DR5B 3OP1A 5FB3A 2B98A 1JLLA 1X3SA 4IY1A 3REQB 4LJSA 4N3GA 3L93A 2YRWA 4WCFB 5BUSA 1DQSA 3ZWCA 1RCTE 2P3SA 2DBRA 2XTZA 4H2DA 5ALPA 1J20A 3UT5A 5I51A 1I7SB 3USES 3MFQA 2GNAA 1ISHA 1YDFA 1E2KA 1GKUB 2C0QA 2XJ9A 1K6XA 2Z2ZA 1IIRA 4E51A 3L4BC 4HK4A 4AMGA 2YZMA 3EEIA 3T99A 1PQPA 4BB0A 2ZVQX 1ST3A 2NTYC 1J56A 4MKZA 1T8UA 4EGSA 3GLFA 3PPWA 2J33A 5CLQA 3C3WA 4QELA 1KR5A 2J4FA 3VPHA 1A9SA 3KQHA 1IBKB 2Q5EA 3VUFA 4KOAA 3DLHA 4HDNA 4NF2A 4A3SA 1U0OC 5FYDA 5AK6A 1KOLA 2ZR9A 4JQSA 2FX5A 2ACVA 3HFRA 3L7JA 4L5AA 3UK2A 3GJRA 1A98A 3L6BA 5FA6A 1TYBE 1K98A 2PFSA 3G6WA 4PPQA 4Q21A 5BN4B 3NWBA 1VE1A 4ZVOA 1VPVA 4OKNA 4OLJA 5SY9A 4MLCA 3G2IA 4JI7B 1TLLA 1P7WA 1FVOA 1JKMA 1TEVA 1TJNA 2IOYA 2WKWA 4RF4A 5IYZF 1SXQA 4DB2A 4XJXA 4QDTA 4ZT4A 3DGEC 3PUXA 1E2DA 3QKSB 3HA3A 2W93A 3TZQA 4E2FA 4BN4A 4S3MA 3TRDA 4BX2A 3HYCA 4PG7A 2BKEA 4W1RA 3RUAA 4TS1A 3BVPA 4GZ5A 3X2FA 1HETA 4PZUA 4OFZA 2WJ6A 5IH3A 4ZAVA 4I81A 4U5XA 1BWQA 5F98A 1B3RA 1PTKA 3O91A 2KSQA 4IVNA 4QUDA 1OJLA 2Q1SA 3ZHUA 3K0KA 2EQ5A 4WKOA 5H80A 1UWCA 2D2EA 3ZBPA 4ZCTA 2XKJE 3TFOA 4CCSA 4X97A 1JJFA 2W42A 1TZKA 2VDJA 4B4OA 2P65A 4PCUA 1AS3A 1UADA 1W2GA 3L0OA 1GZUA 4YREA 1RYMA 4IIJA 3TLXA 3PG5A 3BHNA 1GNSA 5TY0A 4A6XA 5DM60 4MI6A 4R8VA 4UUNA 3KJXA 3DJFA 3TQOA 1NF8A 5JXIA 1S2MA 1QBKC 3EOZA 2Y8EA 4G9GA 3GRVA 2QAJA 1P1KA 2VPYA 1SD5A 3VSCA 3VYUB 3WSWA 3WJAA 4EZBA 3QKIA 4LZAA 3VU1A 2Q7DA 16PKA 1N5LA 1ORVA 1VPLA 2J6BA 1MJGM 2KBFA 2PVPA 2QM0A 1GL9B 4OM7A 2A78A 1OILA 1Y7LA 2OBMA 2PBFA 4G8JA 1O3YA 4RPJA 4ZVRA 2LCQA 1I3OA 4CKCB 1XRRA 1RYEA 2QM3A 5AVVA 1DTWA 5AW6A 1XV5A 4IO0A 4O3MA 1PFVA 3JPYA 3DTVA 2O0HA 3HA2A 1KR2A 3A1NA 3GQBA 3K0BA 3P32A 4FZVA 3UV3A 4Z1MD 5J2UA 3SXJA 4RTJA 1G20E 3CFYA 1JU9A 1XNHA 3IDZA 1VSUA 1MZVA 4H1UA 4EG1A 1H6CA 2ECKA 4URVR 5HQ3A 3QVKA 3KEMA 2DBYA 1HDGO 3I72A 2Y92A 4K9MA 2JZCA 3GG9A 2Y0PA 4OLAA 1CUEA 3BE8A 5DXAA 2DPLA 5KNDD 3JWHA 4B3SB 1P1JA 1XVUA 3VNVA 5IN4A 1RFLA 2I03A 4BNFA 4F1JA 5B5SA 5L3QA 3AM1A 4GWGA 1I2AA 2BCEA 4YMHA 1NDHA 3P2OA 1XKQA 2IDMA 4RLHA 1DQYA 2EKQA 4ENWA 4CVNA 4EHIA 5BOVA 1PJRA 3JQFC 3Q7QA 2FUCA 2XHEA 3EBOA 3UMBA 2FUKA 3DV2A 4LCEA 1JH9A 2JHPA 1A9TA 1FTWA 4C4RA 3LNTA 4IIEA 1ZGBA 3QPDA 1AXRA 3HY6A 4X85A 3STTA 3LHKA 4JBYA 2BCJQ 5EXSA 4G01B 2YXPX 4FYXA 4U0JA 1WVIA 4H7IA 1E89A 3AHFA 3HO6A 5G2OA 1CJMA 5K9ZA 1XL0A 4RIHA 5FI5A 4JP8A 5BV1A 4YFVA 1SHJA 2QENA 5AQEA 5A1JA 2N0SA 4LSWA 3CVUA 4DCJA 1TF7A 4Q5IA 1XZAA 3FHJA 1ZMTA 4DMUB 4TSRA 3Q7SA 4DIUA 1YVPA 3GAFA 1Q1EA 1F3LA 3I8XA 4TZKA 4KTVE 1KOJA 5C7YA 2EEPA 1PTJA 2G28A 3I58A 5CMLA 3ABRB 1GJRA 1P44A 3GV0A 3K2IA 4HB2A 1U4NA 3CF4A 4W4TA 4PYNA 1GZVA 4YT2A 2R6AA 1N8TA 2P67A 2OGSA 3MG9A 5C8YA 4OUDA 1IZYA 2OG1A 1NJ1A 3M33A 3HUFA 4FZ5A 3S70A 4C7BA 4F4JA 2G1JA 3L2OB 4IEEA 1GGVA 1HXHA 1Z6PA 2J7PA 1VSBA 2TRSB 5DX1A 3FTCA 4ERXA 3L8YA 3TI9A 5CHYA 3QEMB 1TK3A 4JR2A 3C3EA 3H5VA 3ET4A 1PG0A 1YZNA 4XWYA 4ZYUA 3P9CA 2VRBA 3NU1A 3HR7A 2KHZA 5TB5A 3B9QA 3OIGA 4JN6B 1P4AA 4G4JA 4MRVA 4DLAA 3CW8X 4CM5A 3ZDDA 4ME6A 3NWOA 1ZH2A 2GEDA 1LX7A 3RBXA 3UC9A 1X7ZB 2RHMA 4LWOA 3OBBA 1PWEA 3EFBA 4NESA 4CR6A 1Y7IA 4BN5A 4L51A 1JSZA 2WTMA 3T3DA 2Z58A 2DQYA 4BNWA 2IPXA 5LMZA 2ZAIA 3DOEA 3DFFA 2EDCA 1WB5A 4XJSA 4Z54A 2VIIA 1JMKC 1WTAA 3E9EA 5E2BA 3ZH2A 2DAPA 3FA2A 3LW8A 3QKRB 1W0JD 3GP3A 3B13B 3J80A 3TW4A 4WXHA 3I6BA 3LY5A 1NXVA 2VG8A 3O3MB 1KGDA 3C97A 1GG8A 4XPIB 2FFJA 4HWKA 1BDHA 4BLSA 3HTXA 3FZYA 1E3WA 4HSEA 1F8UA 3L41A 4MGIR 2ADFA 3FW1A 3AQ4A 2XW6A 2LDBA 3HU5A 4NZ9A 2GF9A 3ILXA 5F21A 1ISMA 3IEKA 3DOUA 1X87A 3H1EA 3DD5A 1RWBA 4ERNA 4M83A 1USVA 2QN2A 2UZIR 1U2GA 3VKFA 2C8VA 1TQ8A 1TZMA 4QXRA 4DNXA 4DC1A 2DPYA 3BXOA 3KWLA 4I8IA 2WW8A 2C97A 2QU7A 3X1YA 4EYEA 4LXIA 3PPVA 3M8KA 2PD6A 2LRHA 4XASA 5KNCA 5JAOA 1HTWA 2Y1OA 3O93A 3KHTA 1VHDA 2BZGA 1XU7A 3T4UA 3ZV4A 4O4LB 4GT1A 4RQTA 4EQZA 2FOLA 1XA4A 2FMIA 4RHEA 2PX4A 5ALOA 1G66A 3FLEA 1HQKA 5ALJA 4DMKA 2CT8A 2Y93A 2VCEA 1U7XA 4QU0A 3TL3A 1IEQA 2Q2QA 4RIGA 2H1WA 1H6DA 1YASA 3X2EA 1UBSB 1W4CA 3L0PA 1ENYA 3BXEA 5DTRA 1UZLA 3L8CA 4HAIA 4P92A 1RLJA 4AFNA 4EUNA 1ZGZA 3K1AB 4V0QA 2VATA 2HQSA 4Q9KA 5DLYA 1NGSA 2ANBA 3H6GA 3OQBA 5AKYA 2FWAA 3PHHA 4EA7A 4QBIA 4HNTA 4YIHA 5K51A 5C5DA 1L1RA 1QQ7A 3O2JA 2VHWA 3NHKA 1RQ7A 3NTVA 3L8DA 4MVJP 2J9YB 4Y7DA 4TKZA 3RF7A 1TC1A 2RKWA 1Z7BA 3Q0TA 2VNHA 5TVGA 5HKOA 1CUVA 4OX9B 3FYUC 4LJYA 4UULA 1HQDA 5BQ5A 2HK6A 2DX7A 1YQEA 2P2DA 3GFRA 2H0AA 4GI3A 5JCOA 1G60A 1GPKA 4YROA 3NOQA 3EZNA 3IAEA 5HKAA 5JLJA 3Q0EA 4ODIA 1P18A 1G4UR 1THGA 3RIGA 3UWDA 4KDFA 4YJKA 4Q9IA 1V4NA 1RLMA 5I9SA 1SKYE 3WA6A 3O1IC 5K45A 2W6NA 3KZMA 3V3KA 1L0BA 3TCNA 4DDVA 1JLLB 2RK4A 3R0ZA 5K0FA 1VA4A 3P71T 4YBZA 3DZCA 3NBQA 1A7AA 3UT5B 1ZL2A 1P2GA 2AWNA 1N5RA 2HIAA 3HB9A 5LUAA 2GBLC 1XN1A 5C1OA 2LNDA 4Q05A 2ZIXA 4Q4AA 4AX4A 5AUNB 3F90A 3BJRA 3PR3A 1ECFA 2IUEA 4LPSA 3S68A 5A7GA 4O4HA 1I6LA 2HRBA 1YCHA 5BSKA 5CLGA 1D2CA 3S7TA 4AMUA 3GLFB 2HZBA 2PSEA 4JDUA 2IOFA 4BYGA 4B83A 1JWBB 1LPAB 4TV9F 3G5TA 3T5MA 2B2CA 3R9WA 1EE1A 4HDNB 1X86B 2XUGA 1LTQA 3ENZA 3W5IA 2GF2A 4F04A 3AVVA 4W9MC 3JW8A 4C4AA 3WWOA 3IAAA 5DE3A 2X0EA 4X90A 2OA0A 4ACAA 3O84A 2DHQA 1K86A 3ETCA 3RANA 3SS7X 4YS6A 4TWZA 3CUYA 4A2CA 5HA5A 5LR6A 4BQFA 4R1TA 4WW0A 3NBAA 1DXHA 3PHCA 3GBVA 4TKUA 1FU7A 3P9YA 4Y3UA 1BX0A 1PUIA 2B4AA 3ESAA 3RC9A 3FI0A 4C04A 1L6IA 2KI5A 3GC6A 3W8RA 3JZIA 4W7SA 2R8RA 4CQLA 1G3QA 1Z5WA 3L6OO 1DT5A 2VF5X 3PGLA 4WEOA 3VJKA 4ZICA 3BIWA 1E6UA 2V97A 4WOCA 4TMYA 1P5HA 1VPEA 2LR0A 2RGNC 1XMVA 4JP2A 4MQLA 4XA8A 4AUEA 8ADHA 4DAOA 1J21A 2NO1A 3KDPA 4KAXA 1B73A 1LJ8A 1XR3A 3CG4A 3ESCA 3G8DA 3RUEA 5BSHA 1T26A 2FX3A 1KEEA 1GHTA 1Z6ZA 1ZK2A 1EAMA 2OENG 5EKDA 3ZHVA 5EZQA 3WKCA 3ZDYB 4E6EA 3WLAA 2VBGA 3DE2X 1GQ2A 2IYAA 3BK7A 2JGMA 5AUPB 5DFAA 2G8NA 4IIJB 3VYVA 2WAAA 2MIIA 2H4ZA 1BE8A 1G8GA 3B1KA 3OZRA 4CLHA 1V4BA 4XM0A 3FFTA 1L4BA 2PAAA 3ESXA 5B7QA 1TU0A 5FNZA 4BRWA 3KDAA 2FDRA 4QL3A 4ND4A 1XOIA 2HYDA 4OHKA 3OMXA 4J2TA 2ZRMA 3LH5A 4QOFA 3NDJA 3R7SA 5KWIA 1FSSA 4RESA 3GCZA 3QM1A 1JL3A 3TLAA 4RD2A 4AU1A 1Z74A 3I1YA 1PYGA 2Z43A 3PRKE 4A26A 5C52B 2C0CA 2WHXA 5CP8A 1DTWB 3UOWA 2VXOA 3E18A 4Q18A 4C76A 3DTVB 2ZB2A 3BMXA 3AJDA 3PK0A 5I7AA 5BSTA 2F4VB 5CJPA 1SVOA 5EJAA 1M33A 2HA2A 3CLSC 1T8WA 2HM7A 3T0IA 3OHPA 4EX7A 2RHOA 1H8EA 4HLUC 3NJRA 4JB2A 3SF8B 3UAVA 3WLNA 4EYKA 3X0DA 1XMIA 1P91A 1WXEA 5JW6A 1AGPA 5HQ3B 2Q41A 1MHTA 1JKJA 5BRAA 2IZZA 3QLVC 5TMEA 3AVTA 3T15A 2RCYA 3TR5A 4DANA 1X2BA 2IYUA 4TXJA 3WC4A 3O1HB 5JI3E 2ZRIA 4AJNA 1RBZA 1RXIA 1WTCA 1T9DA 4NOJA 1AS0A 1JIXA 1SVLA 4UZFA 4ZCPA 3TTTA 1E9BA 3BB4A 4B71A 5BV0A 1O89A 5L3QB 1YE3A 2JH8A 5FOVA 1C41A 3VX3A 4L74A 3MILA 1NMXA 1YCGA 1L1EA 1X8JA 3NYWA 4GQIA 3QOWA 1J5XA 1ZYUA 1SY7A 1H69A 2NSHA 4TV8A 4OBWA 1F7VA 1J8QA 4R7ZA 5D3MA 1XXHA 1SZPA 4HWSA 1DIHA 5J40A 3SYKA 5L51A 1K4YA 4K9KA 1L8AA 5DCYA 2ENUA 2QMQA 3K05A 4BE4A 4QEZA 4B6QA 2WJIA 4YQYA 4QKQA 5BT8A 2E82A 5ICCA 3ZHZA 5KU1A 1EX9A 2D1YA 4ZZ3A 2A9VA 4GPTA 3P2MA 1KDTA 1U11A 2QIOA 4D3SA 4DLSA 4CIDA 4ZV9A 2CD7A 3AB3A 2UYYA 3ZHOA 3RK0A 5LP1A 1B2RA 3ZIDA 1JKFA 4QU8A 2IC5A 2LTAA 4X60A 4BX8A 1V5IA 1UPCA 2CHGA 1GN8A 2EZ8A 1OGIA 2ACEA 1Q0UA 1NUHA 2WVGA 5WRFA 2ZXUA 1SBIA 1C0IA 3OE4A 2TMGA 1BWPA 3KLNA 1E1DA 1Z2OX 5ECWA 3H3FA 3TLEA 3WWDA 1YU6A 5CB8A 3PHJA 4IQ8A 5DW3A 3QEAZ 2EFEB 4DR6B 5A05A 1WXFA 2HXYA 3H05A 2Z83A 2HSZA 1SQ0A 3I04M 3PLAE 4MRRA 3IP9A 2ISCA 4OUDB 1P19A 5C8YB 5HZKA 3Q3IA 3WYDA 1EX6A 2Y2UA 5AW0A 4FW8A 2R6DA 4A91A 5DZSA 4POOA 3AL2A 5BO5A 2QTRA 3MVEA 4R1LA 3CU5A 2CHEA 3I37X 2R66A 5E4JA 1CFZA 2ZRHA 2ZVPX 5EPUA 2DCUA 2DWUA 4CL8A 4EOGA 5K09A 1M7GA 2C2OA 3Q3HA 1HYGA 4YT5A 1DT3A 3U7GA 3ZQUA 2AYXA 4C7OA 4TYQA 2QL5A 2WQ6A 1T0JB 5F2OA 1EM8A 3V80A 3FDZA 3ABIA 3CWCA 5EZSA 4MQMA 3HXQA 1VP9A 1YB2A 2JGKA 3IJPA 2R0QC 4F2DA 1QMGA 3WKEA 5DBFA 5E1MA 4D9KA 2C2KA 3TYXA 3HJBA 2Z1NA 4O8ZA 4WLVA 4BJ1A 5JEDA 4WCDA 1M2HA 4YUAA 1TA0A 4HMOA 2HWXA 4LN1A 4FEGA 5B3JC 3HCOA 3AF1A 1NUQA 2BGTA 3NV7A 3O83A 4MP6A 5GJWC 3A1FA 1RC0A 3P7MA 3HZOA 3OPQA 2P6MA 5I9MA 1CX9B 5B6JA 3LT1A 3KIPA 3M5WA 4ZC1A 1E3WB 1QK3A 1QH0A 4LQDA 5KHAA 1MQAA 5KQMA 4A36A 2CYCA 3E9YA 1GRCA 2NPIA 1NP3A 1R0KA 3DYVA 4B43A 4DIEA 1ML3A 1UJ2A 2AOUB 4P6VF 4YNBA 3R3WA 1MKYA 4LGYA 2ZZKA 5JWRA 2CXUA 4LX0A 4TL9A 1OE0A 1M2OA 4C4SA 1MHPA 2QDKA 3FNRA 5G1NA 1YNSA 1L4FA 4CIBA 1JU4A 1CNFA 1T2FA 2MSEB 4UMDA 3AUXA 2FQQA 1S01A 1CNEA 1HKHA 1L5FA 2ZJ1A 2ZR7A 3BCUA 4LE2A 2R62A 2WKQA 5EKSA 4NYIQ 1CUZA 4C7MA 2JJQA 3N05A 3E4CA 3ZCVA 4BB9A 2VHEA 2FW0A 4X94A 4IZHA 4NYMR 4QJ3A 4HNRA 3PA6A 4NCBA 1YHZA 3B70A 1Z82A 2WYWA 1KYTA 2I4MA 1T5IA 2QZJA 2YC4C 3LA6A 3N2KA 4Z4FA 4MYCA 5LZ8A 2CHFA 4QLOA 2HF2A 2D5AA 2CDAA 3OF2A 2I99A 1CQPA 1R6TA 2VHQA 2ODQA 3QU7A 4MA0A 1PS0A 2M9MA 5KEIA 2B7LA 3KLBA 1OR8A 4IHQA 2XXBA 4MQFA 1AA9A 3PUVA 4S35A 1G2IA 3AH8A 1PFGA 1BMTA 2Q0QA 3IUMA 3ONDA 3OY2A 4Y8VA 5ABPA 4OEHA 4Y7CA 5FLYA 1JQBA 1KPHA 5CDYA 4RTPA 1NC3A 2QE7A 1F51E 1SCDA 3I4LA 3TE6A 5D5PA 3PCRB 1PT8A 4JKYA 3CLUD 1SRRA 4XDYA 2EWVA 1OZHA 5A0FA 3AP3A 3S1AA 1SQFA 1SUPA 4QAQA 1NFQA 1WUYA 5J3JA 1VZ2A 1NBHA 2OHFA 3R5JA 4R3WA 1Z0ZA 2BD0A 3U7IA 3AWDA 1J90A 5ICEA 3L84A 2H06A 1RXSA 1ISPA 1NLYA 1OAOC 1YTLA 3D8BA 4PTZA 3VDMA 1M8JA 3DCJA 4IDAA 3A0RB 3DEKA 3I4FA 3U49A 5LQUA 2YJZA 4CKWA 2V5VA 1W5FA 3JQ7A 4R8SA 3KTDA 5AW3A 2ZIXB 4Q4AB 2FN3A 1J8VA 3OEEA 4HFMA 3SZRA 1CUDA 3T94A 4N7JA 4RNDB 1NUPA 4N7MA 4TROA 1QB8A 3JV7A 4O4HB 2Q1UA 1APBA 1XWIA 4DV1B 4JVLA 3EULA 4MUNA 4E70A 3KU1A 3N8HA 5KSOA 2I29A 4KR7A 3ZI0A 1Z6GA 4NZPA 3T7AA 1UJMA 4ZEOA 4HUJA 1PNRA 2JEYA 3AC0A 4IW3B 1MO4A 1X1DA 2RBKA 121PA 1NG1A 4ARZB 4N47A 4N5IX 3VFDA 4P7FA 1M74A 1KIFA 2PANA 2Y4OA 5GGYA 3IIKA 1CY0A 4TYPA 3VH3A 4CG1A 5AIBA 3BWBA 4BWVA 5E4YA 2G25A 3T6KA 1CR1A 1NVMB 2FPWA 1BE0A 4J0FA 5BSMA 3RS7A 4CTNA 3EJ6A 4LFBB 1DXQA 1EEHA 4TKUB 1DDIA 2G6BA 1XHLA 1XLTC 1ZI9A 4PONA 3LDGA 3T7TA 1BKYA 1TCCA 3N7TA 4KUEA 1SOWA 5A71A 4CQLB 1T4GA 3CM0A 2P77A 2VHUA 1H1DA 5JY6A 1ONBA 2VLBA 1KSHA 4FNMA 2GCEA 4HH1A 4RYDA 4GEGA 3PKIA 4IXTA 3WX0A 3A9SA 4JNKA 4M87A 5K3OA 3EEFA 5JBQA 2MINA 1VIDA 4BP1A 3U09A 1W7AA 4ESHA 3TLGA 4UVHA 3HYLA 1G3MA 3QVVA 2MMCA 2F3UA 1KEEB 2CDCA 2E48A 3CPSA 1IBCA 3JZMA 3VOSA 3ZK8A 2VFAA 4PHTA 5DT9A 4C30A 2GCNA 3I0NA 1NQWA 2NV0A 1Q1GA 3LHFA 1X9HA 3BFPA 1ZHOA 3L8EA 2QYSA 1ZUIA 3LC0A 2VP5A 1I5EA 3PQDA 4QUIA 4BRZA 1KFKB 1UBUS 4YRDA 1EFKA 1ZJ6A 5FOUA 1UANA 3AFIA 3SDBA 5J4LA 3ZGZA 3WL4A 1Z5VA 2WVJA 3H4VA 1OH5A 1XCPA 2G8LA 3EQ7A 4I1UA 4MHOA 4AECA 4EAAA 1NDQA 2IY8A 2VDKB 4ZKDA 2ECFA 4D82A 4D02A 3MINA 4IWNA 4F2WA 4OL9A 4U4AA 1K92A 1ZS9A 4C5CA 2I3AA 3H2YA 3AHDA 3T52A 3TQTA 2QRQA 2EQBA 3DQZA 3QITA 2GKGA 1N4AA 5JFTA 4JBHA 4BBZA 2QF7A 3V7NA 3MS4A 3FOZA 1PNQA 2W11A 2FR8C 4TVBA 1YKGA 3TMKA 3V6LA 4YAFA 4ZMBA 5JPCA 1Y6QA 1NMQA 2V6GA 3S2UA 2MYTA 5E7JA 4QFMA 1NN0A 4BBAA 5DW0A 4EPTA 1RD4A 1XDUA 2CNLA 3BRWA 2HPVA 2R25B 3AILA 1H8HD 1JKJB 1MAUA 3ZX5A 2BLLA 3GLRA 4Z0TA 3NPAA 3V1NA 4DG9A 5KYWA 1V8FA 4OMCA 1TEXA 5LVAA 1M1YA 3DDWA 3O82A 3ZQJA 3SKYA 2IL1A 1UMBB 1H0SA 4U7JA 5DBOA 2P40A 2VT7A 1UKBA 5ELMA 3WGNA 3UKDA 1C14A 2VHXA 4DM7A 3UGJA 5M7EA 4I19A 1GDTA 4J16C 2A0WA 3D5QA 2V4ZA 5HDQA 2F43A 2X22A 3E84A 3SXUA 3OX3A 5CDSA 2IHTA 5EIEA 4HRAA 3GEMA 1W8DA 4TV8B 3BIFA 2QT1A 1VJDA 2BEVA 2Y1WA 1MQ8B 2Z9DA 1XXHB 3MS2A 5D3MB 5KJFA 1PEDA 4ZXFA 5KWVA 2QUZA 5FBKA 3WK9A 4EHLA 4QPCA 4I08A 1NP7A 1P0IA 5LU9A 4EI2A 1I01A 3PLNA 1WF3A 3D6VA 1HL7A 4QREA 3I28A 3SQLA 1TTQB 3BF7A 1KZGB 4FU0A 2AZMA 1TOAA 2QWXA 2WU8A 2XRMA 4AXXA 4DUYB 3H0CA 4MV0A 2D3WA 3SLGA 2PUAA 1W34A 1W1UA 1OHHA 1GZDA 1U8TA 1J39A 3DCIA 4GM1A 4BRSA 4E0BA 2NO5A 2IHKA 3GLHE 3KOXA 4D42A 5IAKA 3FLAA 1NQOA 3M83A 1M7BA 1KAHA 1XZQA 2CJWA 4IPTA 3V1UA 5CB4F 1MPXA 1W9MA 1OLUA 2PPVA 2HWKA 1HF3A 4Q1CA 4UKDA 4DEXA 2QSZA 3DZGA 1E7MA 1R18A 2V6JA 2EVWX 4RDIA 1BHQ1 5E0KB 3RRNA 3ZKWA 1LZKA 3IP7A 4YR7A 2IPMA 5K0LA 5FPSA 3EPLA 3ROPA 4EZEA 3M1AA 1HI9A 4ZOLF 4ZCMA 3FPKA 4RVDA 2B1GA 1I2DA 3FUVA 4RF5A 3SJAA 3FPJA 1N1EA 1U9IA 3KOMA 1URPA 5DCUA 4KMMA 4UHJA 4FFBA 3ZBTA 1FZTA 1V8DA 3F2IA 1NJSA 4TTQA 2FXVA 4TLLB 1SVSA 1ZRNA 2HRCA 5B58T 3KZXA 3CZ4A 4B45A 1OREA 3FUCA 1L7AA 1BJKA 1T0UA 5F2KA 2RK3A 2WNHA 4WLUA 1E69A 3P45A 1XVLA 2FPRA 4KQCA 1EM8B 2R8BA 3QKWA 4JJKA 2PKRA 3FDZB 5EZYF 3MT8A 5P21A 3IPRA 4DDHA 1EXWA 4HD8A 1WHTA 2PIAA 3ED5A 5JAIA 1HNXB 2C8KA 2QL7A 2QRLA 5TT0A 1Z06A 3FVTA 4C0SA 5DISB 3HWSA 1GUAA 1TTHA 5DGHA 5EGSA 1TCVA 2JGEA 3PE3A 2Z9CA 2A9PA 2CLEB 1U6JA 2WC1A 4GFDA 3QG1A 4OP1A 1HMPA 3T3OA 3SZGA 5FJIA 2HHHB 5AVXA 4WZ6A 4WNIA 5AKJA 5CW1A 3RC1A 2XZLA 2PH7A 3L0BA 2D1RA 2P3LA 4QTUB 5P8WA 4DQDA 5L45A 3QV2A 4RFSA 4RELA 4QVKA 3AJAA 3AVYA 2CXQA 1MW9X 1E1CA 2YRXA 4DY4A 5A4MS 2QRJA 3JD1A 1TKCA 2EF0A 2X9NA 3UAXA 1SVMA 3G68A 3VV2A 1M2OB 4K87A 1TZBA 4WFJA 1PLJA 3SK0A 4YXWD 2A8YA 3GQVA 3LPCA 5JYDA 4ND6A 1AO3A 3UXMA 2H29A 3KJQA 1QLHA 4FBMA 1XDSA 1MJGA 4C2AA 4GE0A 3QQPA 1BEZA 4MRPA 3QLEA 2XIQA 4EFKA 2JEZA 4GIBA 5L4SA 4LC0A 1FYVA 1QG6A 3OPYA 5H1YA 1GD1O 4JJFA 2VJCA 1QGYA 2IV2X 3G3EA 4CPDA 3GCGA 3S2GA 3C6YA 13PKA 3NANA 3ZW9A 4P86A 4G1FA 4RTMA 2UZ1A 3HDTA 4N8EA 3IOEA 3A6FA 3N2KB 3S8MA 3I61A 3TQFA 3E2IA 3AETA 4OBBA 3I30X 2QRKA 4EARA 2JLYA 4YR9A 2Z1DA 2EC5A 3RD5A 3ZHBA 3FHLA 3QW4B 7REQA 4CXMA 4YY3B 2C2HA 4LGCA 3KQKA 3HZHA 3PRYA 5I48A 1KAQA 2OAEA 4MQFB 4XSVA 4Q6WA 5CVDA 4C0JA 5KNBA 3AUFA 3RG8A 5SICE 3KJZA 1JLSA 1AE1A 2DFLA 4RE5A 3VNQA 1BHSA 1BOFA 3S1AB 3L77A 1AHHA 1XHFA 2FUNB 3EDCA 1Y8CA 5C5CA 4EVSA 3M9XA 1MEOA 4ZZ2A 5EJ6A 5TR9A 1DC6A 2DTEA 1RRCA 1KYWA 2HDOA 1SIUA 4FIZA 3OJ0A 1WAMA 4PZLA 5K2MA 2OHHA 3G23A 1JA0A 5HOQA 1SK9A 4TRJA 5A0TA 1IHPA 4M9XA 4ZO4A 1M8FA 2ZAYA 2G4CA 4RZIA 4E5PA 4CKWB 4PNHA 5J63A 5IKMA 3KKEA 3JQ7B 5AKXA 3WRYC 1R4ZA 1ZUD1 2JW5A 2Z8ZA 3PQ5A 1AHIA 1KZHA 5H82A 3K2BA 4HNUA 4RZQA 2X6TA 2Q9AA 2WSSA 1C8BA 4FSXA 4RNCA 1YZVA 3DE5X 2G9VA 5K0JA 2QU8A 2OL4A 2CDBA 5ALUA 1Y63A 3KV1A 4O0MA 1KZ1A 4M7OA 1SBTA 1E1NA 1YQUA 3L7BA 1SCIA 3GRCA 1YZQA 3PXXA 4X0EA 1Y9DA 4YRKA 4CFYA 4MR8A 4EHKA 3L1UA 4KREA 2B6NA 1DAIA 3CZMA 4B3FX 2QDXA 4MW4A 3EBPA 3T3IA 1R8XA 1ZUHA 4JLOA 4EFNA 5KVSA 3AOEA 2Q9UA 4F9EA 1Y6FA 4B44A 3IEIA 1UBNA 1RLTA 1H4QA 3RS0A 1ZY2A 4PCLA 1K2WA 2F1KA 3WMXA 3V8MA 5LMNB 3CW9A 1V25A 3P19A 1J2TA 3T3MB 1XTJA 4H3KB 4RWEA 3SAJA 2VHYA 2VT2A 1GUBA 3VX4A 3W04A 2YIMA 2RI6A 2GAIA 1T2NA 2VVTA 3AVOA 3MT7A 4HZUA 4ENTA 3O8OA 4ZCIA 4OLHA 4MICA 5FBWB 1C3EA 4TRNA 5ER9A 1KEWA 2X14A 3V7YA 5AYVA 3BB3A 2MINB 2OK7A 1CHDA 2CNWD 3W5HA 1W29A 1KAEA 3WS7A 2AI1A 3TLGB 1KO1A 2JFZA 4ND8A 3V8QA 1PSWA 2PN1A 3KAPA 3IX7A 4QICA 5F4ZA 4BVKA 4PLTA 1ZCFA 1U65A 1KF0A 2OCKA 2PX3A 5IC6A 4DRXA 3CA8A 5KOIA 1UBMS 4A1OA 2H00A 5HILA 2V7WA 4I99A 4CMEC 2J0QA 2ON6A 4RU1A 1YV9A 3N5KA 4MP8A 4BGDA 2PS0A 5CJJA 1GPYA 4Q3KA 4UAVA 3LTNC 4MW7A 2WHEA 4X84A 4RKYA 2DE0X 4TTAA 3UO8B 3JVIA 4MWDA 2A1TR 3AOGA 2GEJA 1VI6A 2P62A 3IT2A 1UT8A 2J0EA 2ZJ2A 3HHEA 1A95A 1F38A 3KSMA 1GGHA 3MINB 5AM0A 5DT2A 2O23A 1T15A 3ZE6A 2WOJA 4M36A 3NAZA 2ZRBA 3ZOKA 1LX6A 5C53B 5E2IA 1TMGE 4ZREA 2BDTA 2H9AA 1O08A 2VL7A 3LPNA 1AQIA 1JILA 2P7IA 3MLAA 3O9ZA 4LKOA 5KTOA 3EPKA 3OCZA 4N3AA 4JYAB 5HDBB 3SLRA 2BGIA 3IILA 2PZJA 1Y4ZA 1DOZA 1R15A 3IKVA 3PNSA 1B8VA 2AYYA 1YA4A 1S3FA 2XLBA 3EA5A 3QU4A 3IUEA 4G4SO 2C31A 4UAJA 1ACMA 3QVOA 2JD1A 2BR3A 1JG1A 1V2HE 2YWHA 3GPBA 5KYWB 2PZAA 3ETDA 4ZOBA 3WHPA 3SE0A 2E9SA 3O8CA 1M1YB 4HRXA 1F06A 4UNQA 5EJ7A 3EEOA 2CNKA 4JLDA 3G88A 3OPXA 3IMEA 1KMMA 5E2AA 2L2QA 2RJ3A 5AM4A 3LZ6A 5EP2A 4PAWA 2OK8A 3SBXA 3TIGA 4AJLA 3ERCA 2F43B 4MHSA 3SXUB 3ZU3A 4QT0A 2RGBA 1T2VA 2WM3A 4GKKB 1IJEA 2NAFA 4Z0PA 3W8DA 2JAXA 4Q1VA 4CM8A 3H2SA 5IN5A 2BEVB 3M6AA 2H59A 2FPIA 4W5OA 3D1LA 3ETGA 1NW5A 3DBHA 1ILWA 4PGAA 1H3FA 5HK8A 4FYJA 4MQEA 4LDQA 1RABA 2BMFA 3ENVA 3SHFA 1U2EA 4HYYA 4PSDA 2PJZA 3OMLA 2QYTA 4EABA 1QRAA 3WOHA 2N9UA 1RJGA 1QKKA 1QO9A 5TMPA 5DYYA 4EITA 2WFLA 5LIPA 1EPUA 4Y2XA 1L5HA 2OLEA 5K4HA 2ZYWX 2DLNA 2ZJ6A 2FHPA 3L0YA 4KQEA 4GBGA 2W2OA 5CW2A 4X00A 3RDPA 1R0ZA 4BVBA 4RO0A 2AG8A 2AMVA 2JFGA 4WK2B 1PL7A 3TSOA 3TG8A 2V7XA 5AW5A 2GN0A 2XEXA 2ZIVB 5TLSA 3SVTA 4DQ0A 1VP3A 2CJWB 3P26A 1OLUB 4E11A 1V6CA 2RE8A 2XODA 3W4KA 5E1OA 1NMZA 1CKEA 3ZKWB 3JQ8A 1S7GA 2WYUA 4HB3A 3AW8A 4B4WA 1ZWLA 5JZOA 1VBKA 2QT0A 2QZSA 4RKEA 2L19A 1V48A 5M29A 1H0RA 2ZIUB 1A8QA 3RHZA 1T1GA 1NYRA 3GFSA 3JAKA 4G86A