4OREX

Cyrstal structure of o-acetylserine sulfhydrylase ternary complex from haemophilus influenzae at 2.2 a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
307
Chain Sequence
AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Cyrstal structure of O-acetylserine sulfhydrylase ternary complex from Haemophilus influenzae at 2.2 A
rcsb
source organism Haemophilus influenzae
molecule tags Transferase/transferase inhibitor
total genus 111
structure length 307
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oreX01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oreX02
1TDJA 5B3AA 4D8UA 2Q3CA 1KFBB 5J43A 2BHSA 2RHGB 2CLIB 1FUYB 5DVZA 3SPXA 5KZMB 3ZEIA 2BHTA 1TYZA 1TZMA 4HPJB 5B53A 5I7HA 1K8XB 2GN1A 3IQHX 4D8WA 5IXJA 1C8VB 3DWIA 4D96A 3IQIX 2TYSB 3IQGX 4JBNA 1K8ZB 4D97A 1D6SA 3VC3A 2CLHB 5IW8A 2C2GA 2ZSJA 1KFKB 4I1YA 3R0ZA 5BW6B 5JJCA 1J0DA 3T4PA 1Z7YA 2J9YB 1K7EB 5I6DA 5D87A 3RR2A 3CEPB 2C2BA 4ZU6X 4D9GA 2JC3A 3SS7X 5DW0A 5B55A 3VSCA 2DH5A 1J0EA 1KFJB 4LI3X 4XUGB 2ECQA 2J9XB 3PC3A 2CLEB 2RH9B 4Y6GB 1QOQB 4L28A 4ZQCB 1KL7A 2CLMB 4QYSA 5DW3A 1PWHA 3IAUA 5CVCA 2RKBA 3L6RA 4HPXB 1TJPB 4LMAA 1BEUB 1CX9B 5JISA 2EFYA 5D86A 5I7AA 3DWGA 4D9NA 4D9BA 2TSYB 1V8ZA 2WSYB 5KINB 1E5XA 4L27A 4D99A 1VB3A 3TBHA 3VSAA 1C9DB 1WTCA 3BM5A 2CLFB 2D1FA 4NU8X 4D9EA 1J0BA 1A50B 2ZPUA 4OFXA 4HT3B 1K3UB 2ZR8A 1J0CA 3PC4A 1JBQA 1CW2B 4KKXB 1PWEA 1VE1A 3L6CA 2ECOA 1KFCB 5I7OA 2DH6A 4PCUA 3FCAA 4AIRA 5C3UA 2V03A 3L6BA 2TRSB 5B1HA 2Q3BA 1K7XB 3AEXA 2GN0A 1Y7LA 3SS9X 1M54A 1O58A 1TZ2A 2PQMA 1K7FB 1Z7WA 1WKVA 2CLOB 1UIMA 1A5AB 5T6MA 1WDWB 5CGQB 1QOPB 1UBSB 2GN2A 4NEGA 5D84A 4H27A 5HBGA 5DBEX 3VBEA 4D92A 5E0KB 1TTQB 1J0AA 1K8YB 5J5VA 2O2EA 4AECA 1RQXA 3X44A 1TZKA 2Q3DA 5DBHX 2CLLB 4ZU1X 1FCJA 5EY5B 4D9CA 3FGPA 4OREX 5B36A 4L3VA 4D9IA 5D85A 1C29B 2EGUA 4F4FA 1TTPB 3DKIA 4D9KA 3PC2A 1VE5A 1P5JA 4L0DA 1TZJA 3VSDA 3PR2B 4D9MA 5I7WA 1V71A 1WBJB 3X43A 3R0XA 3AEYA 1BKSB 2CLKB 1OASA 2J9ZB 2O2JA 1A5SB 5IWCA 1F2DA 4D9FA 1A5BB 4COOA 1X1QA 4D8TA 4HN4B 2ISQA 4WX2B 4HO1X 5B1IA 1UINA 5I7RA 4LMBA 4IL5A 3HMKA 1KFEB 1V7CA 3V7NA 4JBLA
chains in the Genus database with same CATH superfamily
2R4QA 2Q3CA 3K9BA 4MUXA 1BJKA 5D00A 1NVXQ 5JC8A 1OUMA 1LBSA 1Y8RB 2QMQA 3COYA 4KSCA 3OQJA 2I2WA 3N6RA 5CITA 3W6PA 1YI0A 3HCEA 4JU8A 3DVQX 4N1AA 4ZO6A 2EJWA 4ZANA 2XIQA 3JQ8A 3ITDA 3NHFA 2QTVB 5TQJA 2G07A 1L6IA 1V7ZA 2V5UA 3CRVA 3DBLA 4GPAA 4Q1AA 4PIVA 4FWTA 4J0IA 2CNDA 3KQWA 3PVSA 3P2YA 1PI3A 1AG9A 1NIPA 3IPYA 5EUCA 5F5XA 1VCHA 1A27A 1GKIA 2OXFA 3CMCO 3GROA 1SBTA 2UKDA 4H2DA 2ZBRA 3T35A 1MEOA 4CRWB 2ZI3A 3AKEA 3A9WA 4GKVA 4A5OA 4NXNB 1GZ7A 1KTVA 1AGPA 1C8LA 1MX5A 1ZK1A 2V54A 1C1YA 3GEHA 1UPXA 4NENB 1EUCB 2CXPA 3QHPA 4LYDA 4TQGA 4V0MA 1I36A 1A4IA 3JD1A 4YRGA 4HUJA 2GK6A 3H4TA 4RK0A 4L4UA 2DLNA 3ZWWA 4F1JA 2WZDA 1QYWA 4FN4A 4RVSA 2FR1A 4U3JA 5K5EA 1ESNA 2BD0A 4II2A 3G5MA 1NHGA 1YVRA 2VUTA 2VHZA 4XGIA 2C4WA 2X7XA 3NRJA 2EBWA 4RIFA 1HQYE 3EVGA 3GFSA 2GCOA 3BT7A 1L5FA 1E6CA 2ZU6A 2BFDB 3PI6A 4R98A 5DP2A 2GXAA 2NU7B 1OOEA 4TMVA 4LYJA 5IKMA 3EOZA 4U7DA 5ALJA 5KWIA 3MZ0A 2JAXA 2RFLA 2ZYRA 4UULA 2HDOA 4FHCA 3UJ3X 4OYLA 4TYMA 4L4YA 5DCWA 5CTJA 2PKXA 3DE6X 1J09A 1C3OA 1KMMA 4FJ2A 2VQDA 1Q20A 4HS9A 3SKVA 2H18A 2R8EA 1V8OA 3PFCA 4G5YA 4WMLA 3RT9A 3AERA 3FR8A 2WJ4A 3JPYA 2XDQA 1QFYA 2B83A 4EITA 1NUTA 5C1BA 1PFUA 3TMKA 2KLBA 2W2LA 2QQGA 3KK0A 1GZHB 5KSWB 4HXGA 1YRQA 4D4GA 4LQCA 3CVWA 4R9RA 1XMIA 4EKDA 1XWFA 1Y37A 1S9DA 4LY0A 3UVEA 3UXMA 2IWRA 5KC9A 3MQ4A 5BWBA 2VSQA 1EA5A 2FMKA 5DNVA 2VQFB 1Q0LA 1TTHA 1FBTA 3P0JA 1DG1G 4I50A 1EUZA 2JHGA 3I9JA 1XKXA 1YZFA 2JFQA 5F51A 4C3OB 1MJHA 3DM9B 4CU5A 4FSXA 4RPGA 1LX7A 3ECCA 5J5AA 2CJPA 4G2TA 2JI4A 5CTAA 2YNMA 1TTPB 2JFBA 4LC0A 3VDQA 4OLHA 1UJBA 3L8FA 5ALNA 2WB4A 1PVOA 4KC0A 5IJ0B 2WYUA 1NRIA 3NM4A 3PEVA 3DEKA 1SO8A 2EKDA 3NFRA 4GZ3A 1FMJA 4O02B 4Q05A 4HWSA 4YUAA 3A37A 2ZVPX 1EZ1A 2F00A 3HXPA 5IZ4A 2AEEA 3FHTA 1E0JA 1US8A 4I55F 1QG4A 3H19A 4KACA 1DUSA 4KQGA 1XIVA 2XT6A 4LJ8A 4O4LA 5CH8A 1QB7A 1XLVA 5TVGA 1QORA 1KU0A 1Z37A 1UZAA 3IDQA 5DCUA 3HKBB 4BFLA 1KDOA 2X6QA 3EFEA 2A86A 1QR2A 4OHYA 2MSCB 4AJ4A 4EYOA 3WMRA 1WETA 4YAJA 3VV3A 1F2UB 4HD8A 4O59O 5BR1A 5B57C 2CHUA 1FP2A 2P9EA 3QYPA 3EGDA 1HQCA 1NPYA 4IUCS 2WP0A 4NBLA 4ZOEA 1PQ4A 3GJXC 5G4KB 4CMCA 4PHFA 2JFOA 5LLSA 3C2QA 3HWWA 5DXJA 1BU5A 2WMDA 2JIOA 3WGTA 5BPHA 1KYXA 1V16B 4I1RA 4Z5XA 2RI6A 3KZMA 1I2AA 3SC3A 4XXHA 5K4AA 1EDZA 3L1UA 3LUPA 4BE4A 4YXFA 2VN8A 3FMGA 5KJ6A 4FFWA 5KYNA 1KI6A 3DHNA 1LJUA 2IH4A 3Q7IA 3CC8A 1IXZA 4OG2A 3TZKA 4JENA 3DH0A 3MQ2A 4B32A 4XX1A 3NNSA 1M7GA 3E4CA 2F48A 3LBHA 3U4IA 1OWOA 1GQFA 2Q7DA 2PS9A 4IEFB 3DL0A 4MXDA 1VL1A 3LPAA 1RXIA 1J1UA 3SM9A 2O8NA 4PLTA 3RRYA 3H9QA 3U1BA 4C04A 4Z7QB 1KOFA 2V7BA 3IA7A 2WIBA 1VYHA 2DPLA 3PA8A 2ZWAA 1NC1A 3K96A 3NEPX 5CB8A 4HH0A 1SXHA 1T8TA 4KN6A 2P4QA 3EISA 3TOVA 2J6BA 3DWGA 3NBAA 3DT8A 3QLVC 1QU3A 4HMOA 2EBFX 1ZW6A 3IV9A 2GFHA 2OAQ1 4I3HA 3H7IA 1XZJA 4OKIA 2KS6A 4C43A 3P45A 3H9GA 4H6PA 4JLAA 4XIGS 2A4MA 3C6QA 1TU3A 1QGAA 2FZVA 2GJ9A 3I9OA 4J91A 1E7QA 1E3EA 1EEXB 4ML3A 3MHTA 2ILVA 4WY5A 3DEIA 2J87A 2VT2A 3M6VA 1EINA 4K81B 1GPBA 1VGRA 4MMYB 3VQTA 5CBPB 2IIVA 3PEEA 5HQ3B 1JYFA 1NZDA 5IJZA 1K0FA 4HBGA 1ECFA 1PR2A 4AIRA 3MCVA 1IEQA 1KOJA 2JAPA 3X2EA 2NV6A 1Y3CE 3RJMA 2HN9A 2YR0A 1N2CE 1W0JA 4D43A 1KQFA 2WZQA 3ZGOA 4R3NA 1BEZA 1P62B 4KG7A 1JYEA 1EFDN 3A6ZA 2OUIA 4EJSA 3B9BA 1O94A 3WI7A 2FYTA 2SCUA 1DCTA 5DLPA 2P6OA 4GBED 1VCIA 1L5RA 2O2EA 3EZGA 5CIQA 1UAAA 1DJPA 4MYCA 4JLVA 7ABPA 3ECSA 1COZA 4UDXX 1FC0A 4JIMA 3GGPA 4DMLA 4D9CA 2BBWA 4K87A 2XOKD 1U63A 2HI0A 5HKLA 5HDBB 1SXJD 2ZYIA 1DIGA 1JG2A 1DHRA 1K9SA 2FFQA 4BJ3A 4LXHA 2XNSA 3U5TA 4TLLB 3G02A 3A4NA 2FEPA 3EMVA 1YJ5A 1OH5A 1I94B 1C14A 3NT2A 2DM6A 4EP1A 1GA6A 5JMOA 1N8SA 2JJQA 4MUHA 1RLIA 1RP7A 1ZM4A 4DDWA 5C52B 1X1QA 1OVMA 2ZJ2A 4PVDA 3STWA 4HVLA 3PDIA 4D25A 4HVAA 1DO0A 1VKZA 5LIPA 4REOA 2X0KA 2WLTA 1XL1A 3P20A 1QGYA 2PN1A 2ZREA 4IHQA 5CT5A 1QHHA 1F8GA 2GWHA 3KXIA 3G5UA 3I4FA 3BQNB 3GAFA 4EFLA 2A94A 2Z2YA 3RGGA 1OQAA 1D4AA 2I71A 4PAMA 3W2FA 1TMGE 5CMLA 2X4IA 4I19A 2Y93A 3L7BA 2YW2A 3SY8A 1W25A 1LBTA 4BWYA 1II0A 1QFZA 3DQPA 3M9WA 4F45A 4JXZA 5FORA 2E7ZA 2IOFA 1PN3A 3AB3A 4F3NA 4IDEA 4KHPB 3LDUA 2WJYA 2GK7A 1LH0A 3CE9A 4M8SA 3UHPA 3NHSA 5IYZF 1NR1A 3G8BA 2A58A 2FR8A 3RVKA 4Q3EA 4P2BA 3U39A 3KXLA 4CKWB 1FS6A 4YJDA 1R0CA 2WTMA 2ZJFA 3WGJA 2OSVA 4F92B 2IYOA 3C8UA 3M3PA 4AXBA 4GVPA 1QP0A 2HR1A 4XZ3A 3KD2A 1I7SB 4WAUA 4OMFG 4AY6A 2A0WA 2UYCA 1YQQA 4PONA 1KC1A 1PZFA 3U0VA 4Y98A 4ERXA 1PLJA 2Z9CA 2DEUA 4GVLA 1Z0SA 4BU0A 2GBFA 3H75A 3MJ4A 4KWCA 3I9LA 3LY9A 4WK0B 2JB9A 2YZGA 3TQHA 4CTMA 1VB5A 2H5JA 5I5EA 4A8JB 3MRXA 1UAGA 1RWWA 3AR5A 1D1SA 3DXZA 3GCZA 3O2NA 1YQWA 3O73A 3O9ZA 2OPBA 2IHUA 2X23A 4J1TC 1LF0A 4CIWA 4BZQA 3BE4A 3PHJA 4J90A 3QWBA 4O2RA 1OJLA 3KXPA 4P22A 4M8LA 2Y1XA 5HEKA 5CFMA 4OF4A 1QG2A 3PEUA 4B6RA 1M5TA 3AESB 4NE2A 5AKJA 2FP4B 1PNVA 1T2EA 3HB5X 5JSZB 3JU3A 2A14A 3NWJA 1UWCA 3T12A 2OO5C 1PR5A 1AU9A 1UBOS 3GYGA 3RK1A 1KEVA 3AQ4A 3MTBA 1MB0A 3HBNA 3KPVA 4KKXB 3LHKA 1L7VC 1BYIA 5AK0A 1I0ZA 5C0OE 4F3CA 1QHYA 1W85B 5JU6A 4ETIA 3GUUA 3PQ2A 4DKJA 3QELB 4YBZA 1BRMA 2ATVA 3QSYA 4AZWA 3X1MA 2JASA 4ZEXA 5FWXA 2N1MA 3VDNB 3FX2A 2GCPA 4YIHA 2YXPX 3ET5A 2Q5HA 2WPDA 3NPAA 2QMOA 4HB3A 4C6SA 5E6SB 1WPGA 1Z4QA 4WH0A 3ZS9A 2WTUA 4NOLA 4S2UA 4XR9A 5BQ3A 4JLOA 2OCBA 4BIMA 3J80A 1T0HB 5CLLA 1UT6A 2J33A 3VMMA 1R3DA 4BLWA 4TL6A 4GDFA 3G2OA 1CK4A 5G4LA 1M34A 3UHAA 4ZI7A 3HP4A 3GXBA 4OGLA 1PFVA 3AUJB 4P5DA 2QG4A 2VZ9A 4P32A 3RKUA 3SOPA 2C57A 2D1TA 5JG7A 3VU9B 2H8KA 4RY2A 3F3KA 3G0HA 2EGUA 2ZUBA 4LX8A 5DGHA 4UHBA 2CKDA 1A0OA 1A8IA 4YRFA 2ZSBA 2HC9A 3FCCA 4HWKA 2C4KA 2RGRA 2CEAA 1ZGBA 1MIOB 1J99A 2WKSA 3QX9A 1NJFA 4K26A 3U49A 3HB7A 4L7QA 4JUCA 1CYEA 2BEWB 3O38A 3AONB 3UK6A 1IN4A 3OAAA 2IYNA 3Q3VA 4ZHQF 3H6KA 5IULC 4BQNA 3L6EA 5B3LA 5CM9C 4BCDA 1NM5C 5LYJA 3NTVA 4PTZA 3UW1A 4I5DA 3TNYA 3ZHTA 1O5OA 4WESA 4EW6A 4P54A 1U0LA 1OXKB 1SC1A 2HSZA 3PC7A 3O6VA 3U3OA 4H3SA 1GSHA 1R6TA 3FUCA 4HGRA 3D1LA 2FH5B 5LNK6 4KQEA 4RHEA 1A8UA 4UCQA 3ZWMA 3OBBA 1GVNB 2ZBEA 3EC1A 4G8DA 4UNIA 1LVHA 1QFJA 3K5IA 5EJFA 4MWCA 5MDHA 4DPKA 1SWVA 2OCPA 5EGNA 4AY4A 2Q8PA 2QLFA 4KE8A 3F7MA 3ITEA 3G23A 5AKYA 3VFDA 1SUAA 2JI9A 5K3BA 2ZBVA 1TUGA 2Q9UA 4KE6A 2HPVA 5IXYA 1Q21A 4BLOA 2PZMA 1CUVA 1I2ZA 3U7FB 4TM8A 3ASVA 1EUYA 1RXSA 3DEFA 3AEUB 4D9GA 3F2VA 2P68A 5A02A 1EFAA 1OXBB 3N07A 3KOZA 3G6WA 3RYIB 3NHWA 4LXXA 4NOKA 5ECGC 3TLZA 1FSZA 5B58C 2XZPA 1JQDA 4QXRA 1PWHA 1XCLA 3WGNA 4EPTA 3SWWA 1DADA 1PR4A 2O2ZA 5F2NA 3HCAA 5I9BA 3TPZA 2ONJA 4MQMA 1CKEA 1DAFA 1Y1SA 2CFIA 2X77A 1ZC4A 3PRHA 2DT8A 4W7HA 5JSFA 3KQVA 1ZNWA 2C9YA 4OD0A 3SOZA 4TM7A 2YJTD 1V8ZA 2IELA 2C5AA 3HN7A 4L27A 1V9SA 2VG8A 3TH5A 2WWHA 1USKA 3DYVA 3RGWS 3EUFA 4CKEB 2IIPA 2GBLA 2GYWA 3ASUA 5BMVB 3NMUF 1RAIA 5IC4A 1ESEA 1YBFA 2WNIA 2VBCA 4OQPA 5H59A 4KLZA 1T1EA 3ZZUA 4IPTA 1FZTA 6LDHA 2P2YA 3G2KA 2O8BA 1IL0A 3CR3C 3AMVA 1TYDE 4M86A 1JEOA 1KWKA 1PQYA 4RE5A 1LSOA 1QH1B 3WSWA 5HHTA 1ZIXA 3TRHA 3K6SA 3VBCA 1R5JA 4LSZA 1J07A 1FFBA 1I6LA 3CBQA 4HNRA 3BRWA 4L6IA 4KPEC 3F6PA 2NZYA 2FPGB 5HF9A 1RIIA 4B79A 2AOUB 4L78A 4RNDB 4F4UA 5IC6A 4QASA 1JZQA 4Q4CA 3C97A 4ADSG 3ZE0B 3HDYA 1JHZA 3KQPA 3PICA 3P2KA 1UEXC 1GPMA 2Z2KA 4NYIR 3WFJA 1GGFA 3GRZA 1G4HA 4XWOA 1ATIA 1RCUA 2AK3A 3CZ9A 3L6DA 4XEUA 1JQBA 1ZD4A 3L2OB 1Q6YA 3CY6A 3NIBA 4OBWA 2VBIA 2ZIXB 3AKYA 3MAAC 4WT7A 1G0NA 3M4XA 2FQXA 1D1TA 3IAHA 3ISTA 2ZULA 2INGX 1AQ6A 3ORFA 3AVQA 1GGEA 1ZRSA 4R1TA 2CXSA 1A9QA 3JCZA 2OPHA 2VYNA 1ISHA 1ZD3A 3GPCA 4FKBA 5AVYA 1A9XB 1WSWA 1HRKA 4FDTA 1ZUWA 4TYNA 1ACLA 3OPYB 1QIIA 4ID9A 3W2TA 3HCCA 3E58A 2OWDA 3BIJA 3SF8A 2VHQA 1Q77A 4L8WB 5H81A 1JUDA 2QZ4A 3Q3CA 1O6GA 1ILWA 2QD1A 4E2WA 1TUEA 3AF2A 1KR5A 2FMHA 1PHPA 4EUEA 1JKJA 1TM5E 2NU9A 5AKHA 5TPZD 3KDPA 2C7GA 1VCMA 3AKCA 3C85A 3P4YA 3RU2A 1YQEA 4B35A 2EBUA 3MVEA 5G0TA 4BO7A 1SCDA 3F6YA 3EH2A 2F1OA 3A7EA 1GV1A 1RMQA 2ZJ8A 3CG0A 2Z5FA 4MVXA 5EA2A 4EM6A 2X0DA 4WFQA 1KEPA 1BGVA 2XAUA 3GBPA 5DHSA 3ZDFA 1U65A 5LKAA 3NTLA 2IF0A 3O2JA 3G5LA 1J5EB 2YINC 1XAHA 1SG9A 2ZWPA 3TL2A 1B6TA 1ZM3A 3S2SA 4DLTA 2Z04A 1DB3A 2QRNA 1PVVA 2ZRIA 3OJEA 3UC5A 1AZSC 2Z09A 3MUEA 2C5LA 1EWKA 2Y76A 3E8XA 1ORHA 2B8JA 3GNTA 1U02A 2OBNA 1TU4A 4LJ5A 1GIAA 5E6UA 4LZWA 1KSGA 3DYBA 1RHKA 3KT8A 4DAEA 3I28A 2IPOA 2ORVA 5DYYA 2F9FA 2Y8EA 4NPCA 1C3VA 3VYWA 2IZ7A 1BX1A 1TAHA 3GDWA 2SKCA 4DYDA 4EO4A 2DF8A 4CYMA 3WA6A 1BE8A 2EFCB 2BRUC 2P90A 4MRPA 2EW1A 3RDPA 2FZ5A 4D3ZA 3GRRA 5F9FA 4NU6A 5AQ1A 3S1SA 1B8UA 1N0UA 3BSSA 4ONEA 3AETA 4LRTB 3WMXA 3KYDB 1PK8A 5CFOA 3X2FA 4D7AA 1FFAA 4Q7MB 4EG3A 3PUYA 4B5KA 5JJIA 1KMHA 2UYOA 4Q9AA 1ZJWA 3IEIA 2G36A 2X9QA 1FYXA 3Q3EA 3IP7A 1WDMA 2WQ7A 1LEHA 1SXIA 3EXFB 4RHXA 5GINE 4BEVA 3A0RB 1H66A 5AVTA 4YPFA 5HJ2A 1KA9H 1I5OA 1EMDA 1SEPA 1ZVJA 3Q3HA 4JP5A 4RFSA 3V8BA 1FFXB 2HCRA 3EEFA 1RWMA 2K7ZA 4BVBA 1WLSA 2C04A 1L4GA 4J0DA 3JRWA 3F6BX 5PGMA 2KM1A 5D3MA 4CQMB 1L7XA 4ON9A 2BCJQ 3K31A 2QW0X 3CFYA 4N6GA 4HQNA 3PE3A 2GPYA 5D6OA 3C3EA 5JDIC 3ZGYA 2Y66A 3LOUA 4MPJA 4N39A 3ZDXB 4TWBA 3AY6A 3HXMA 2V45A 1I4EB 2Q5FA 5CA0F 1YVEI 4PR3A 1SU7A 3FYHA 1UBUS 4XFKA 4TTSA 5HWSA 4ODIA 2H9AA 1RWPA 2O3JA 3DBHA 4YAEA 1CJSA 3UJ9A 5J2UF 3WRVA 3MYYA 4Q39A 3IRUA 2JAOA 5CLGA 5AI6A 1WAMA 1YBMA 2C92A 4L51A 1TZBA 5GV7A 3FDJA 2A7XA 4HEQA 1Z56C 3QITA 3DV2A 2IKSA 2WHEA 1LD3A 3GLHB 1YDWA 4QEDA 2E18A 2BR3A 4BNIA 3HWRA 1ZL0A 1JQAA 3UG7A 5EEHA 1WKBA 2PD3A 4NABA 2D06A 4PGHA 3VR6H 2I91A 1E5VA 1SVUA 1E5DA 2Q4OA 4DANA 4AN4A 3D7LA 1PJCA 3KZOA 2ZRGA 4DT1B 2IVFA 2DRIA 4TV8A 1NUSA 1DIOB 1C0PA 1EWVA 1KC3A 2E5FA 2PH3A 1RWNA 5EZ6B 5LBTA 4AICA 3M9XA 3OO0A 2CE7A 4I9GA 1KBOA 3T9EA 4UNQA 4C4PA 2GZAA 2IZ1A 4I1PA 1V2GA 4KUHA 3GGJA 3SI7A 4EY5A 1N9KA 4PRZA 4PYMA 1IM5A 1MVNA 4HK4A 3ZXIA 3CU5A 2RHLA 3PFIA 3EMBA 3ZWXA 4Y6QA 2NSJA 4ZRMA 4MV0A 4PN7A 1DWQA 1DBRA 1P31A 2PLFA 4WZ6A 3GOHA 7YASA 3WR5A 5EHQA 1AKEA 1QFSA 1KYTA 2G9QA 2PS0A 3PJEA 4AWXA 2VJYA 2I4NA 2JGEA 5E7QA 2XLBA 4LYHA 3Q6NA 5BNZA 3ZLUA 1OFHA 2OQVA 1FQKA 3MD9A 5BQFA 4V0NA 4I2NA 1J25A 1XMJA 1I2DA 3WKCA 3U1VA 5F7XA 2GEUA 3N28A 5HGJA 4FS8A 2IYXA 4M49A 3PWKA 2JFUA 4DR3B 3CNHA 4CKYA 2SECE 3QUBA 1R9JA 2XX3A 1KYWA 3VKVA 1THGA 1TW2A 2A1IA 2J3HA 3CWCA 2VAPA 4YJHA 2H7CA 4MHTA 2IITA 2CLEB 5IFLA 4BO1A 1O7JA 3EUEA 3CRRA 1C30B 1OLUA 4E7PA 5CRIA 1YGYA 1KVQA 2JLYA 3ESQA 1E9VA 1T9KA 1BG6A 1UIRA 2NVUA 3IYLW 4RJTA 5J2TB 4CEIB 1BEUB 1LS1A 3OFKA 3PUHA 3D6AA 3NASA 3GDHA 4MPRA 5I3ZA 3AI2A 3KFXA 3UV6A 3B3FA 3SJCA 1YH3A 4GXRA 4EZBA 3ZVMA 1X42A 3S5JA 3F5FA 3L82B 1U7TA 1NI4B 3OKCA 1ENZA 5FAXA 1XZKA 1HDEA 1ZH0A 1PHRA 1SKBA 3BK7A 4BQSA 4CHGA 1D2NA 4YAGA 4ZEMA 3R9XA 1N2IA 4V02A 4RVDA 2ZR8A 1RPNA 3TF5A 4FB5A 5DHUA 5JT1A 4XQEA 5K2MA 3UOWA 3ZXUB 3LWBA 3OQIB 2XOEA 2W43A 2XVAA 3KOYA 1RTKA 4LQ4A 4NULA 5DISB 5ECWA 5C3UA 2NPFA 2WAOA 4EPVA 3TLMA 2KQUA 2JI7A 4CIXA 2OGZA 1IQUA 1HA3A 4PG7A 1V6SA 1N2GA 2O6LA 1GQOA 4RZQA 3SIWA 2YXEA 2P91A 2GAIA 2VHJA 2ZVQX 3DNFA 1D8AA 4DDVA 3I6ZA 1LA2A 5EIBC 5A06A 1ZGHA 5E4TA 4S1VA 3D7RA 4FYKA 1KSHA 2VZEA 1HZZC 1XQYA 3AP3A 5L3SA 4M1SA 2ZW9A 5H4HA 1MHPA 4EI2A 3WLNA 2ZRBA 1Z4LA 1C1DB 5AOVA 1VMIA 1XDBA 1ZD8A 4HYQA 4EQ6B 1NBHA 1BSVA 3PJFA 2ZTUA 1P5JA 1IULA 4DR1B 1SKAA 1JE0A 2NOAA 3CISA 3X43A 1G41A 3WWCA 3FSRA 1EXNA 1GLNA 1F2DA 4G4GA 4RA9B 4XCXA 3DBVO 2WU8A 3DULA 2WMNB 4LX0A 4HYTA 2FQQA 3G1TA 3K1YA 1UKZA 1E1RA 3ZU5A 2X1LA 4GX5A 4BHTA 2V7EA 2R6FA 1AXEA 1TM7E 2NV0A 4QKQA 5IT9A 3O4VA 1FK8A 1UXHA 3IDFA 3KKPA 3FYTA 2PSHA 2Q0HA 2W2LD 3PUWA 4WKNA 3VJKA 5IUNC 2PKRA 1VC2A 5DVZA 5K8CA 2VBFA 3CXRA 3ZEIA 4AP6A 2IX9A 4C7VA 2IUUA 4A36A 4NBVA 1HUQA 2QY9A 4AKTA 1T8WA 3R3SA 3TRDA 2OV6A 2ZT7A 3GJYA 3OG9A 1TUIA 4DXHA 4KMSA 2PRJA 2WPNA 2CXHA 2OB2A 4N8EA 1SMKA 3ZY3A 1U99A 5LL6P 5KYUA 4ZCIA 2VXOA 1AUQA 3RB8A 3CEJA 2VQ3A 3B2QA 2IHZA 2YNMD 3R9WA 2HPAA 2GBPA 1GYPA 5CBKA 4BGEA 3WA7A 3B6MA 1MZPA 1UOEA 2BH9A 4WZBA 1C1XB 1CZUA 1LSSA 3FCYA 1LGYA 2JCGA 3GZTB 3LP8A 3ZWAA 1E5LA 5E4YA 3S68A 2OP0A 4ECEA 1YWGO 1OI3A 3OWHA 4P4NA 3REGA 3N0WA 4AYXA 4ZICA 2JLWA 5KX5F 4RPIA 1LDMA 2I4LA 2VJBA 3FWHA 3N3AC 4YEDA 3TTSA 2IEGA 2YW9A 4L28A 2NUPB 4RGQA 3W6UA 4A0RA 4O63O 1DDIA 3EEBA 1QC5B 3ZU3A 2BLLA 3VPSA 3IIKA 3MGKA 4MUIA 2P9TA 2JLSA 4NYJR 3ZWOA 1K89A 1YIAA 1L7NA 5L7YA 1KY4A 1LDBA 1Z5VA 1XO1A 4LY3A 1VFNA 1GV0A 1DAMA 1N7JA 3RHTA 1E1CB 2QR2A 2VDNB 3QOYA 1TK9A 3KU4A 1EP3B 1ZA1A 3F97A 3IAM6 4R6WA 3EDQA 3V1UA 2GPAA 2PCLA 3W3ZB 4PS0A 1MEJA 3BEOA 2ZJOA 5EEGA 3VSAA 1OLSA 4NCJA 3ZJ5A 1ML4A 2PS3A 3LZCA 4EEZA 2R6ZA 2OLEA 1CQJB 4EYSA 4Q1BA 4XASA 4CM4B 2VZLA 4MI9A 1NY5A 4NECA 2DFTA 1P19A 3WBKA 1UOPA 1A9PA 4QPCA 3FTEA 1OU0A 5EESA 1S96A 4HEHA 3OIGA 2OD7A 4P31A 1XTRA 5B2FA 4MH0R 1HQDA 1MCZA 1S5PA 2AL7A 4IJ5A 5HK9A 1OKKA 1UPAA 3AVVA 3LLVA 1A2QA 3W1VA 2B92A 1IY1A 3AOGA 3W3AH 3YASA 4MO2A 2QMZA 3JVDA 4XIFA 2ILTA 2D5LA 2AFVA 1GT6A 1UBSB 3KJEA 1JSCA 4CLRA 2R48A 1JWBB 2C94A 2QP4A 3DTNA 3ETJA 4L3OA 2HSDA 4Y2HA 3NO4A 1T0BA 1GKYA 3R3WA 2YV3A 3MOGA 4NG5A 2YVQA 3T7JA 5BQOA 4LFAB 4M4SA 5DEOA 3KEOA 5ELLA 3MB5A 2FNAA 5E1BA 1U9JA 4R2JA 3LNTA 1ZCJA 4YK7A 1Q74A 1RWXA 4G0QA 1LQ2A 2ZB3A 2OBLA 3N2NA 5FPSA 3ZI7A 2ZVJA 3H2JA 4WLEA 3IUMA 3U62A 1I7DA 2AJ8A 1FNDA 1AS3A 2FN4A 3DOOA 4MEAA 1XJ0A 4II3A 1QWOA 3NIWA 2ZZMA 1I0LA 3FJOA 1EX7A 3D6HA 5CHYA 1TC2A 1KI7A 1UKBA 4PZYA 3NDIA 4NZMA 3C8HA 1QRSA 1PJBA 3RC1A 4E5SA 1MA0A 4NENA 2A0YA 4IIGA 1MU0A 4ZPXA 1KO1A 1QYIA 4B8YA 4TTQA 2RSLA 1H0RA 1T9DA 4FFLA 5IAOA 2RD2A 3MGBA 5A05A 3I9FA 5FUBA 3WQRA 3EF1A 1Q2UA 3FB1A 1SQ0A 1X1RA 1XMSA 4XQ0A 5AIBA 5EMNA 2LD4A 1W0JD 2GK3A 3EAGA 1RZ3A 4F1WA 3NNDA 4FFMA 1H5UA 1WX1A 1JFFA 3VNSA 1O94D 1EFCA 2GVZC 4JMPA 2WM2A 3PGVA 1THZA 1IIBA 1JNXX 2DJIA 5P21A 1EWYA 2ESRA 2TMKA 4PLWA 2VK4A 5EJIA 4MPPA 4WBNF 5D5HA 3R44A 5FO0A 3RTAA 4H35A 1KK0A 2BFDA 3W0LB 3Q2KA 4U6QA 1POXA 2NU7A 5LUBA 3VPBA 3ZIDA 3UGJA 5SYNA 2I6FA 5T64A 3RT7A 4F0JA 4K2HA 4Y2VA 3K70D 1VKJA 1W36D 1ZJZA 5IKEA 2HIGA 4IDQA 3KQOA 4XCVA 4DNQA 2AG1A 2J5KA 3T38A 5B12A 4G9GA 1GSAA 1C50A 2FSFA 1M2GA 4RACA 3S2FA 1PT6A 5AKIA 1PGJA 4C0SA 2C1ZA 3TL6A 4EDFA 3MBIA 1JR6A 3KDAA 4KW7A 3JZFA 1V47A 1KFJB 2IPXA 3MWEB 3AV3A 4LISA 2CNWA 1Y1LA 3ER6A 3JASB 4DGSA 4IVNA 4PX5A 5LLTA 1AQNA 4X62B 5FBKA 1TJ4A 1TQHA 3E9CA 4RC9A 3VNUA 3HVUA 5IH3A 3KALA 1UBTS 4GOMD 4MIKA 1E96A 1QS0A 4MV4A 4R2KA 1O1YA 1H05A 5I5GA 4AZ3B 3L18A 3OUZA 4G23A 5FTJA 2PX0A 5IHXA 2C9ZA 2PMKA 1IVNA 2ZIFA 1E6EA 1YRAA 4R8LA 1PZHA 3KKLA 3NC4A 4YJ3B 3OPYI 3WNDA 5IJ0A 1P81A 2GJKA 2V7QA 4YMUA 2POCA 2VJMA 1EVEA 5K0FA 2BONA 2ZJAA 4GC5A 5LR6A 2VDLB 1QPGA 1WUIS 5CXXA 4DIEA 4Y1GA 2E4XA 3WNCA 4TWZA 4YLYA 1HDCA 1CY8A 4C5BA 2HA0A 2WNHA 4RPHA 4C4ZA 3MN1A 4JLNA 2C4MA 4BNFA 2HQOA 3USES 3M1AA 5DBOA 5G3YA 2IOYA 4BZXA 4HB0A 1G16A 3U80A 2P79A 3QPVA 4GYWA 2HPZA 3M4ZA 2RGEA 3T7IA 5KTPA 1F2UA 4GU5A 1QF7A 3DFKA 3EXEA 4RIIA 2PQ0A 3A6DA 4LJYA 1VJDA 2JRCA 2VA8A 2W93A 2X7JA 1W5EA 2J5BA 5G4KA 4X8LA 3BMCB 3AUSA 4WK2B 2VPIA 1DHTA 3I5UA 3ZS8A 1HYGA 1N0IA 1QK3A 4NAUA 1XEFA 3G2PA 4B74A 4V0KA 3HKDB 1JSLA 3OF3A 1KMQA 1QHEA 4MUYA 3FY4A 4JYMA 4OBEA 3WNZA 4MUBA 4UUOA 5I8PA 2JLZA 2HT6A 2WM8A 4GGOA 4HAOA 4XJXA 1ZMBA 2P9BA 2IH5A 4L5IA 4HDCA 1SCJA 3A9VA 1NDHA 5BXYA 3DV0B 1RHUA 3ZE2B 4BUJA 2A5YB 4FYJA 3OE5A 4P98A 3IODA 5HTKA 3GPLA 1GAQA 2DPYA 3WMEA 1U9CA 3FTCA 4UU0A 3T5MA 1CS0B 2P9YA 3W5CA 4D0NA 2BE7A 3NBXX 4KXFB 2P4HX 4JAVC 4MVCA 4LMBA 4X91A 1UL1X 1Y9AA 3MHPA 3GEEA 3G8DA 3L7DA 1YZQA 4JOBA 5ALZA 2XCIA 1ZAKA 3OQ6A 5BYKA 3U44B 3BHJA 4N5MA 1PNOA 1KFBB 4M1YA 1W29A 4PCLA 4EQZA 2L69A 4BLRA 1G7CA 1CEYA 1I3OA 2IOQA 2WUGA 3VVCA 2BGWA 4URUR 5HF5A 4C4SA 2UUOA 2VTEA 4IXWA 4CTJA 1E2JA 4BTLA 4UPEA 1FNMA 2RHTA 3CVOA 4FFNA 4LUCA 1PSDA 3QYAA 4LNHA 4Y2PA 1BVUA 3KJGA 2W2KA 3CV3A 1HO3A 3NLLA 5CB4F 2CJFA 4J6FA 3TLXA 2Q1XA 2JLBA 2YY5A 2IU0A 4UUAA 3ZUGA 3EVCA 4Q0MA 4U9HS 2WZCA 5I9IA 1SCKA 4Q3AA 5F52A 2BR5A 5EMKA 1L1QA 2HF7A 5KYVA 3RC9A 2EIXA 3P26A 1LBEA 3WS7A 4KE7A 4RLQA 2H3EA 4YRBA 3UK7A 5HQ3A 3CKYA 1XKQA 1LSJA 1V1JA 2D59A 1Z83A 2ZDHA 3ENVA 1N6IA 1XA4A 1RLTA 4ZGGA 1XLUA 3JYOA 2OXCA 4MS1B 1J0EA 3R7NA 4ALMA 3OAAD 4CVNA 1FTQA 2CUZA 1ZVKA 4OGWA 1CJUC 5HRAA 3H4MA 4ZQCB 2O4UX 1QHIA 3V4LA 3BAZA 3ORSA 1NOIA 5BW5A 3T8YA 1NGSA 3NVDA 1H94A 2GPNA 4X20B 2QM7A 3LUAA 3R6GA 1XELA 2CVPA 3F5DA 3HJCA 3HQ4O 3KSMA 1EM6A 4TLCA 4H60A 4QG3A 2FMTA 2JCBA 4D9NA 3K1TA 3QKUA 1YZGA 1UXOA 4BKPA 3P9YA 3NBZC 4PHTA 4JEIA 2MR6A 2JBAA 5DBFA 5TV2A 5E9AA 3SBXA 4OB8A 2FVXA 4R3UC 2HJWA 2HSJA 5KHLB 4X41A 3ANTA 3NHYA 4LVNA 1RZUA 3LL7A 1GR0A 2FZ4A 3DB1A 1H42A 4ENQA 1YR7A 2GK4A 1DG9A 4JVMA 3CVXA 2R47A 4JBXA 2O2HA 2N42A 4RPCA 4OHMA 1M1YE 4IR7A 4UNRA 1XDSA 2M6LA 5EJ6A 2BVNA 3R4VA 4XVRA 1SZPA 2RKWA 5C37A 5EHIA 3C6ZA 4IIEA 4ZGWA 1AK1A 2WD8A 1N2XA 3VR6A 1HE1C 2H57A 1H9BA 4FNAA 5KTMA 1O95C 2E1PA 1H85A 5IG2A 4EHAA 2JIMA 5C1IA 2DWCA 4GP9A 4AVYA 5JMWA 3FVQA 4DLSA 5LJIA 2XWJI 3LWDA 5EP3A 1CETA 3RK0A 1CC1S 1CQIB 1C7EA 1IQ0A 4CKBB 5FUVA 2E48A 4IIBA 4LECA 3RFXA 1Y5LA 3KB6A 2C5SA 4UXHA 3GLGE 1XTJA 2A5JA 1BH6A 1JQ3A 3CQ9A 1KJ9A 4ZVNA 4CIDA 2I65A 4Q21A 1SXQA 4ZHQB 2I9PA 4MUKA 5HIIA 2W2TA 2O8EA 3E3NA 1BKSB 1GA4A 1XL0A 4DWJA 3JYQA 4MMZB 4BU1A 2WSSA 4F9GA 3L0DA 2H2GA 3JR3A 4GQAA 1IXYA 3B6EA 5FOVA 2OG1A 1YT5A 4YXWA 4DRZA 2PMFA 4K9OA 1JR2A 4AJLA 1VIDA 4RFLA 3ENNA 1KVTA 1QTQA 4OHZA 1H3FA 3OCJA 1P9OA 4KIWA 2ZPAA 4CI9A 2EP8A 1BWPA 3GQBB 1RYBA 4FYYA 4GVXA 1XEWY 1CUJA 2XECA 5GV8A 3TDMA 3NXKA 4HN2A 1OX4B 3BRWD 1NQTA 5F7ZA 2IIBA 3AIMA 4F9TA 2AH5A 4RK6A 1EHCA 2XGJA 1BN7A 1TAUA 4MYSA 3WJ7A 4GMXA 2AFHE 2NNWB 3AESA 3EIFA 3LCMA 3SZLA 3WL8A 2FW6A 5LXTA 2FP4A 2FX3A 3E8MA 4OP1A 2C7QA 5H9VA 1WDTA 5JSZA 4KREA 1DRKA 1B3BA 3EIQA 3L0OA 4KN8A 3H5IA 1P4RA 3D3NA 3DG9A 2I67A 1ZA2A 3IV6A 4WOBA 3OCZA 4B7AA 5A5DA 1A04A 3R7WB 4E94A 2PT9A 4CR8A 2D2IA 1S4QA 3CF4A 3IOMA 1NMYA 3CNLA 1J2JA 3DBIA 3N7UA 2VK2A 4DYVA 2VYND 1X6VA 1T3TA 5FEMA 1EJ0A 4X1IA 2FN9A 5FFMA 3B38A 5TRTA 1E3TA 4AZSA 3CVJA 2HNKA 5E6SA 2ATXA 3IKTA 1QOQB 4L73A 4P36A 3T1OA 1EJ6A 1EK1A 3CJQA 3H1AA 3GWZA 3HNRA 5EWMA 1H4QA 4MYUA 1YI1A 3S99A 1IK4A 3T0GA 3CH7A 4LXTA 3DZIA 1XR3A 1I7PA 3NWBA 2FW9A 1R2QA 3HA7A 1U4NA 1HOXA 4EHLA 2I55A 1P2UA 2ORED 3KLMX 4GIBA 4HAUA 1AK2A 1XAGA 1R74A 1QZUA 2J30A 3CLHA 4ZP1A 1GQRA 4NOMA 5DRYA 4HVCA 1XDUA 2I4RA 2V96A 5DM4A 2O8DB 2OD9A 4CEHB 3VU9A 3WL4A 4ZODA 1FDTA 1VJ1A 3FPBA 5LA6F 1U0TA 3OEYA 3H5TA 4HF7A 4BVFA 3MELA 4BX2A 4FCWA 4JR0A 4W7SA 5DNCA 5LIRA 2WINI 5K3SA 1DAPA 3M6WA 3N2KB 1A7KA 4OFXA 1E2NA 4FONA 1XD9A 1YZUA 2OZKA 1N6NA 1TIBA 5HTOA 1GL9B 2VNSA 1W5BA 1BW9B 1P17A 1JEQB 3X1XA 5C4MA 1MKYA 3DYIA 3FCXA 4KPUB 1GZUA 3P71T 2C4VA 4RTJA 3GMSA 1HQKA 5HNKA 2JHAA 3ZTWA 3BMQA 3T95A 4UTRA 5FL3A 1IVSA 1M2OB 1P3JA 2O48X 1K7FB 2Q3MA 3I2KA 3QY0A 4M7OA 4QJ4A 3DO6A 5K1ZA 1OIWA 1Y3IA 3AEKB 2CV2A 2ATEA 1CCWA 1F17A 1T3HA 1VTKA 2R85A 3E9QA 2OORA 3AHIA 3I4LA 3KX2A 4JI0B 1XNGA 3LOPA 1ZJ6A 521PA 1IHUA 5PNTA 1FU4A 2NNLD 3KZVA 4YIKA 2FHSA 4LTMA 4RTNA 1ULZA 2FPMA 3IILA 1SQGA 4R7ZA 4CNQA 1PDVA 1P4HA 3DFZA 2I3BA 1CEXA 2GNAA 3NRCA 1MR3F 1LWNA 2HUNA 3BH7A 3IKLA 3PRYA 4YDHB 5TY0A 4EX6A 5IN4A 4G1EB 1RKUA 1TO1E 1UQRA 4HFRA 2P5UA 3E5MA 4YUYA 1TE2A 4BXOA 2VNJA 1NTOA 2FUG1 3MOSA 2ZQ5A 3S2YA 2QVXX 2X86A 1UBEA 3ANMA 3G49A 2BM1A 1NVMB 4ZZ2A 5IWCA 3ZKAA 3WAJA 1PE0A 4EBFA 1N75A 3OIUA 3ZCPA 2O05A 5BNIA 2O5RA 4X44A 4YJ2B 2FG6C 4RKFA 2A1TR 3ZE1B 4C0KA 4EJ6A 1QPZA 1B15A 3EAFA 3JWEA 2BJVA 1M6EX 3NGLA 3P9RA 3RYIA 2YRXA 1BMFA 2BJHA 2I0FA 2PRSA 2Y27A 5CA1B 1RXCA 1EGAA 4JBLA 3C3YA 1F06A 3DE3X 5G0VA 3UW3A 2IU4A 2UYGA 2FPIB 3UIEA 1T4CB 1FFCA 4YI3A 2LUOA 4XB2A 4KU4A 1UBKS 1Q3KA 3H6HA 4BRUA 2C9MA 2XVMA 4ZT2A 1FMCA 3TQTA 1GTRA 2OZEA 3OTWA 2O8FA 3OMWA 3IQGX 3T1VA 1T1JA 1N5OX 4LRYA 2C9BA 3EXHC 3WAGA 1R0LA 4YMLA 5FOWA 2XD9A 2JFYA 5BMVA 2JZCA 1RTTA 2PSJA 2RGNA 1XDGA 2XUAA 4YQZA 4EYQA 2P1DA 4JJ7A 4EH1A 4NHOA 2OCGA 1MOZA 1H69A 4RANA 2X8WA 3PLAE 2Q4EA 3CNEA 4N65A 3H04A 5EMMA 4MA5A 3K0EA 5GP1A 3ZDDA 1WP9A 1TQ6A 2J09A 3KZ1E 4FCTA 4C87A 1I1NA 4BO4A 4UVGA 4DHWA 1OAKA 1XC7A 2PMCA 2YTZA 4LF9B 3M6AA 1D8TA 1Z39A 2K2QB 3LL4A 1DIHA 2XT9A 3SC2B 4DLNA 4F6LA 2IHNA 2AOUA 1K63A 5L3VA 3A06A 1ZICA 4FQ8A 2AX4A 4K9PA 2X1MA 1O97D 4Z4EA 2O2XA 3RRZA 1ATZA 5E6RA 3ODPA 1X86B 4ND1A 3PUIA 4DQXA 4ND4A 1QDEA 4JJ4A 3NDBB 5AM0A 4RVHA 5DM60 4TV9B 4DCCA 3AK4A 2ZTVA 3UT5B 2ZIXA 2CUTA 4B84A 3TXAA 1SVWA 3JD4A 3N86A 3T1HB 4Y6OA 5HF8A 2FSSA 5IJAA 3N8HA 1Z63A 1Q1ZA 4YT2A 1XZLA 2MSDB 3V4RA 5DLQC 1PR3A 1DWUA 2B9EA 3EQZA 1M7BA 3T9CA 3HSYA 4RAOA 1RI4A 2R6DA 3G9ZA 4ZARA 4QVKA 1ZNZA 4QVIA 1ZOPA 1E9BA 2I8CA 1GPYA 4HJRA 4OU5A 4B2IA 2X5OA 5JBQA 1Q83A 3IQWA 2I1WA 4LNAA 1E89A 4EELA 1CBUA 3EVFA 1VKOA 3ONWA 3U4MA 1WVGA 2H1WA 3OWXA 4GL2A 1Q50A 3DZDA 4N9QA 3T54A 4E31A 2KB0A 1GSOA 4Y9SA 5CA0B 1XMPA 3KR9A 5HFAA 1ZXBA 5ENVA 2JJ2A 3PDHA 1F7VA 3EZ9A 3PXEA 2OV1A 2XZTA 4DLBA 4RJIA 2EF0A 3DBRA 4GX2A 3HNPA 4WFJA 5JRJA 1E3IA 4BFTA 1T36B 2JGFA 3UENA 3P52A 3N8DA 1K6MA 3MTAA 4LYYA 4R9UC 2I80A 2Q62A 3GIDA 3IP5A 5BSVA 3CB2A 5B2EA 1Z25A 3FGPA 1DKPA 3BMNB 1ODIA 3GU3A 1BXGB 1JMYA 3DZFA 1G18A 4FGSA 3TRIA 1CUFA 4TZ0A 1EE1A 4ZEWA 4JBWA 2HX1A 4R3WA 2PX8A 4JEMA 4UVHA 1FXSA 2NPIA 1MFPA 1T2VA 3PC8C 3ROEA 3WKDA 3NBYC 3WGVA 1ISJA 2W0SA 4F8JA 2VJLA 1UQTA 4GLFA 2PT6A 3EGXB 1V4NA 2D4AA 1T8PA 1KOLA 3F96A 3O8RA 4JY7A 2RMKA 4CLHA 3PV0A 3LC1O 2P4SA 1V8DA 4BZWA 4KXLA 2RCNA 1H2AS 3I0ZA 4R81A 3QKIA 3PL5A 4EY8A 3QVLA 2QXUA 4MHSA 1GP2A 1X1CA 2HQRA 4DM7A 1ISRA 1PR0A 3I9V6 4YRIA 3GUYA 4NH4A 4HDRA 4QBTA 1J33A 2CCGA 4AZ0A 4WK4B 3VKUA 4C76A 1VBMA 2H06A 2ZT5A 5INTA 1MAHA 3MJEA 4IUYA 3VZPA 3M4NA 1P6XA 1XALA 3E9MA 3AC0A 3V55A 1IE3A 1VJ0A 2QRQA 3KYDA 5JV5A 1WVMA 3CZQA 3I5XA 1GRVA 1OY1A 3W6ZA 3ICCA 1P4AA 3VC3A 1ETHA 3DVLA 1E1YA 1HF3A 1U0JA 5AM1A 3GT7A 3KZKA 3AJEA 1OIXA 1SH7A 4NJMB 2IUEA 5AYVA 1T0JB 4C2BA 3RYHA 1HDYA 5BSGA 4D42A 4D0GA 2Z6UA 2YZ2A 3TTTA 1FL9A 5F1KA 2CJWB 5A0TA 2L18A 2QYOA 3T4PA 4NWIA 4ARCA 2I2FA 2P5SA 4JWTA 3RS7A 1U6KA 1U28A 1Y81A 4JDPA 2QV0A 2BIFA 2YHUA 4GP7A 1MA3A 3QU7A 5C4IA 4PAWA 2Y6UA 4H17A 2VFAA 4C4YA 3Q2IA 4O6VA 1U3DA 3SLKA 2J32A 2AR0A 3AY0A 4CQMA 3PC3A 1E1RD 2VP9A 1OCEA 1FFHA 4FOPA 1I13A 1YS4A 4NCKA 4WXYB 5JASA 1U2GA 3WSTA 4EA8A 1OYYA 3FW1A 4GUDA 4RBNA 1BHQ1 3HVRA 5HG0A 3UF0A 3VVMA 2BFOA 1XN1A 3A58B 4PTLA 5DI3B 2RARA 5BPFA 4HLUC 821PA 2P5YA 3S0JA 1ZNXA 3IQZA 4ITUA 3CUYA 1LDEA 1CD5A 2JEYA 3L84A 5JRDS 2ID7A 4KIUA 1NLFA 2NXCA 3GLHA 3OICA 4ILEA 4MWOA 2VHVA 6REQB 5F76A 1M0SA 1O9BA 1N5KA 4BDTA 4CDGA 2B35A 4B5LA 4B3GA 2R25B 1JNYA 4KNWA 4C88A 4DG9A 1HR0B 3A1CA 4FMCB 2IFTA 4FMDB 4U0KA 4X95A 5U4XA 4LJSA 3WKBA 4JWKA 3GFFA 2BGUA 1M2KA 3FF4A 4WPGA 2IP4A 3NKFA 3O0TA 1H6CA 2XYHA 4HGYA 4LKRA 4DEVA 4DRXB 5A4AA 4KIJA 2CFSA 2ENUA 4BLPA 4ZFNA 2DKFA 2RBKA 4F71A 3ND8A 1KYIA 3WYAA 1R27A 3MUFA 3RVLA 3BXOA 4WHMA 5EXDA 1YCDA 4LCEA 4EO9A 1XCMA 4YA6A 1LI7A 5DNWA 2QQFA 1IAQA 1N2SA 3WP1B 1ECBA 1TIKA 4J43A 2PSDA 1O8CA 2Q0SA 3JALB 4EJFA 2O7VA 4DR2B 2QVBA 2ARKA 3O4GA 4UTZA 1Q0ZA 3IMFA 4ZV4A 3KR2A 4DXAA 4HMPA 1PEDA 1XD2B 4EI9A 2RGUA 3EBOA 2EFHB 5D01A 2WP8J 5BR8B 2AD5A 4EI7A 3NIDB 3ND7A 3PF9A 4CM9A 5CT6A 3X1ZA 1E2GA 2PANA 2R7MA 2QAGC 1ADJA 1DDOA 4MJ3A 3WYNA 5ICSA 2C7RA 1H1LB 1PJRA 2C54A 2P8JA 5HCNA 2Q9AA 3G2HA 3S81A 3OHSX 4H08A 4JC5A 4ZVMA 1FUKA 1C30A 1C3EA 1OKKD 3IXMA 2DUWA 3F3MA 3KVYA 3LCCA 3NVAA 3TD2A 4CEIA 2I2CA 1TM3E 3F5MA 4ZAVA 3PX3A 4NBSA 3I23A 3IL2A 4E3WA 1YOBA 3G0CA 2OZPA 5AVZA 4HDOB 3P0RA 3DTTA 4KZKA 4MVJP 3R8FA 4KR3A 1XVIA 4GR4A 4RLHA 1QIMA 1TZMA 1ZOOA 2H0QA 2EP7A 3DOUA 3G0IA 3N2ZB 5IABA 2YJ4A 3RW9A 2XWQA 4IIVA 3PR1A 3QFFA 1NI4A 2QOEA 5FNVB 1XTQA 3FMPB 1UBLS 3I73A 4PSKA 4XYLA 4E14A 3QF7A 2AZXA 4TROA 4QA9A 3CPSA 2V6GA 4FKZA 2OCDA 4KPYA 2OVBA 2O2YA 3EHEA 4LXQA 2J5XA 5EJ4A 2H17A 2FFBA 4F7DA 1I33A 2BJWA 2J3KA 2GCGA 4WVLA 2RH8A 4IOLA 5B1YA 4J1QA 4E03A 4B4KA 4CCSA 4MV6A 3ZIAA 1JF8A 4FS3A 3OX4A 4BV8A 3PHCA 8AT1A 1GZVA 3DE0X 5KNCH 5KWEA 2HL6A 4KRGA 4XI9A 5I3CA 1Y3BE 1XCGB 1WY7A 1VG1A 2HF8A 2X4LA 1JMVA 3TD9A 1H2FA 3Q10A 1T8SA 3QYFA 3RM3A 4Q1FA 4JLJA 4ZREA 3T06B 3RQSA 3EEYA 4TKUB 4UASA 5LZ5A 1FSGA 4L07A 1HL7A 1H8EA 2BGMA 2HJRA 1NKSA 2CYCA 3VUFA 1UKEA 5G53C 3A6EA 1D3AA 3RYFB 4QSHA 4EQ6A 3G13A 2C4UA 4REQB 4TUYF 3JS5A 1C0IA 1QQAA 2BFPA 1YFKA 5ITZB 3HXTA 3GAZA 1AS0A 4H1VA 2V59A 4H4EA 3RVNA 2QZSA 1CW2B 3VYUB 4RA9A 1FNSA 2HHHB 1T5LA 4RYLA 1GNVA 5EZSA 3W2HA 4EHHA 3M70A 1GLVA 1U9IC 1EJ2A 3LWNA 4IQ0A 2WICA 1SULA 1LNZA 1UP6A 2JIQA 2BKLA 4JLSA 5B1HA 1IN8A 1C4KA 3HR8A 3MYRA 1NSTA 2FSHA 1MC4A 1VHTA 2REQB 1PZXA 1CUXA 1ZUNB 4GLOA 2IHYA 3IHKA 4YRDA 1ZEJA 3GJ3A 1UKCA 2CNWD 5KI6A 4XX0B 1FW8A 2F8TA 5KYYB 2XQFA 2VCHA 2YJ6A 4FPXA 3ZBPA 1GXSB 1LW6E 1Y8CA 2IYLD 3VHXB 5CYOA 2J0QA 2R87A 1WW8A 4UBKA 1DT5A 3BS4A 1RYNA 2FRXA 1LJLA 2F1KA 2CSUA 1N2JA 3BIOA 4TLAA 1BKYA 1YZHA 2X14A 3O31A 4S12A 1DAHA 1ISMA 1TQ8A 3E7FA 1LZKA 3FNHA 5EKUA 3ZW9A 4ICIA 3MPUA 2A84A 2PA0A 3M6MD 4RY8A 1V2HE 4U7FA 4UDYX 3EXG2 1KEZA 3T9FA 1JGTA 1P1HA 2D2FA 3E5NA 4OEHA 2FPXA 2H4FA 5ENDA 1C1XA 5HUHA 1JG6A 1Z26A 3KUKA 3R0IA 4B7ZA 5L4SA 3Q15C 5BP7A 1SVMA 4YWHA 5CPFA 4DG5A 4UTXA 2WUFA 2GSDA 1NVUQ 2EX4A 3D0OA 1AUOA 3HBLA 3L77A 4LHSA 4TMZA 4BGUA 3PTLA 2NUPA 3CH5A 2ROQA 4KQ2A 1SBZA 4RKYA 1ZS9A 3T7KA 5IKPA 2RGDA 4XFDA 4GYJA 5BSHA 3NH6A 4WBNB 1QOZA 3AZPA 4L5AA 1L5NA 2VQ6A 3OJOA 4EKGA 1QZTA 1RHMA 5BVGB 4EA9A 1VLMA 3B3AA 1XZBA 3F7NA 4U00A 5J9FA 2P9FA 5FOTA 1E1CA 2PAFA 1TF2A 2V7GA 3BILA 1Y6RA 2XYVA 3P1JA 4HQLA 3KWMA 3WK5A 1BA3A 3LRXA 4DLXA 3GNLA 4M99A 1U7OA 2PKQP 1P0QA 2X8JB 1RT9A 1RD4A 3GRYA 3MWKA 2VK1A 1JR3E 4JC0A 1BCRA 1CQJA 1ULUA 2GAOA 4M37A 4C3VA 2IGBA 1RKQA 3Q8XB 3ZCSA 1EUDB 5C1DA 3IIMA 5BW6B 3IAS1 3ZHBA 3AU9A 3I01M 3ZNQA 1VPWA 4N5HX 4Y1FA 1N1EA 4M9CA 1IHPA 3D6VA 5JARA 2F3RA 4W63A 4KP7A 2PIDA 4QDZA 4CM8B 3C41J 3BD8A 5AK6A 5F77A 2WF5A 4RGBA 4KSYA 3W5DA 5TDHA 3EDOA 4Y2QA 4EYGA 1JQJC 4O4HF 2NO4A 3KHTA 4QOHA 2X5KO 1FE8A 3GUZA 4JGIA 4PO9A 4B3SB 2H9YA 2W90A 4KR9A 2AQHA 4G01B 4TMFA 3ER8A 4Y2GA 1XUOA 4PG4A 2J3JA 1GL6A 1NVWQ 3T9BA 1UBRS 4MAAA 3T7RA 4C03A 4ENTA 3D3EA 5HKBA 2QN2A 1SOAA 2BMAA 2HB6A 4D9BA 3NVMB 4UPDA 1N34B 2RG7A 4TTPA 1CV2A 4F8YA 3L07A 1KVUA 3Q6IA 2GM5A 2IYYA 3RROA 5EZYF 3GX1A 2QU7A 4YRRA 2P6MA 2QUKA 3TQCA 4LOIA 5EWJB 4CFSA 2IYSA 4CMJA 1IJEA 3QHQA 4NV1A 3KVVA 5JTTA 1A71A 4PQFA 4ZYTA 3GPIA 3OI7A 1Q3TA 2BDTA 3NT5A 3BA6A 3L1KA 1MMFB 4JC8A 3PGLA 3HJHA 2W70A 4BV2A 2WAMA 1PL7A 2OQRA 3FHOA 4IBOA 4XLZA 2AUMA 1QTNA 3ELUA 3FYDA 3HJBA 4Z3DA 5GM2A 1CE8B 4D02A 1X8KA 5AKLA 2C2HA 2P6RA 1VXRA 3M5DA 4S1WA 1M1YB 4IEIA 1B14A 3HJFA 1T3ZA 4FE3A 4FZ5A 1IY0A 3BWCA 3KTAA 4LHXA 4Z0TA 2EWMA 2CLLB 1NYLA 2KLHA 2AI1A 4WZAE 3QJYA 3RSSA 2JKZA 4PNEA 3DAPA 5F2EA 1N78A 3EXHB 3DVRX 3QJGA 1WRBA 4AG5A 4TXNA 4E32A 2QTTA 1L4KA 2BGJA 2D2VA 5B36A 2HMVA 1K6JA 5C34B 2GN9A 1Z0ZA 3O7MA 2ZI9A 3H8SA 1TXGA 4BVJA 5KCMA 4EBBA 1R37A 2E1RA 3UQZA 4LMRA 5IDXA 4Q3DA 2ZIWB 4S0ZA 3WDKA 4D0LB 2J9ZB 3BXZA 1RRKA 2GETA 3MG9A 1W30A 3O1HB 5IAKA 3T15A 2WK1A 3LO5A 1HE2A 4LHZA 2FRDC 2AS0A 1Z5ZA 3MT7A 3OCUA 4ZK2A 3GLGB 3ELYA 1Y1RA 3F9CA 3JASA 2WJ3A 4ISCA 2FWMX 4HTFA 3UAXA 2Q6KA 1YUMA 5AVJA 1P7CA 3VNQA 1ZGGA 2WWXA 1KZHA 1FJGB 1WXQA 3EDRA 4PWYA 1G8FA 3B1YA 3JQ9C 3SQDA 1GYRA 1DI0A 3DR3A 3VR6D 1E7WA 5TPWB 1YF3A 2HJSA 5TLSA 5P8WA 1EVYA 4G5GA 3ASZA 3OKFA 1DC6A 1GG5A 5B53A 3Q7EA 4D1YA 4MB0A 5KTRA 5HIAA 2I7CA 1U0FA 1JSXA 1SD1A 1DEKA 2PUDA 16PKA 3HDHA 2JGMA 2OB1A 2OV3A 4YJ3A 1D6SA 1DXYA 3NCHA 4HATA 2BMEA 2WJAA 3TIFA 5CLJA 2ZE7A 3W5VA 5KYKA 3QLEA 1ORWA 5AHOA 2ZRQA 5A2GA 1F8XA 2WHRA 1XTPA 2ONKA 1NR7A 5IH7A 1NP7A 4MV5A 5LKRA 4R31A 4XUCA 3TG2A 3IJ5A 4OQMA 4PPNA 4A1FA 4YPOA 3EGOA 1KH1A 1NW5A 5EE0A 3PUKA 2P4UA 1PZMA 1MAVA 2AMFA 5FA8A 3ZGNA 5ICEA 3T1YB 1KHHA 2WSSD 2C1XA 1SU6A 4RD2A 4UKDA 5CVDA 4R1OA 1J20A 4TLEA 4MVJH 5H1YA 3Q8KA 4YXWD 1KJWA 1PYGA 3A1FA 4HNQA 3NATA 2OK8A 4LVUA 1K7CA 3RTBA 3NTOA 4BX9A 4O4IF 4MGZR 3HZZA 3QX8A 4Z9YA 1T9HA 1U94A 3HACA 1J24A 1R8SA 1U8XX 4AWAA 1JR4A 3AUKA 4AN1A 2PWPA 5D86A 2H2FA 3RFUA 2JJMA 5JZVA 3TRKA 4LF4B 5GJBA 1L8LA 1O87A 2NZJA 1X7XB 2R1UA 3WC4A 4IDBA 1QLJA 1VPTA 3X0DA 4YTEA 4CUZA 1Z0DA 3FB4A 2HWKA 1I4OA 4Q12A 4NFYA 1CUWA 2AX3A 1J8DA 1BHO1 1LVUA 2GX6A 2I78A 2TECE 3OJCA 4CR7A 1H5QA 4MCJA 4MO9A 1Z62A 3MAJA 3OJWA 2Q5LA 1V4BA 3AXSA 1BH2A 1VE7A 5K51A 4BUCA 1BKDR 3Q98A 2ZSIA 1F8FA 4X45A 1AHPA 2Y77A 1QGED 2HO4A 3RHZA 2CL7X 3WWEA 4M9XA 4FYMA 5K3CA 1NNUA 2WA1A 4WJLA 1CJMA 1CS0A 4X00A 4BMXA 2XKAA 2XTMA 1SUWA 3FPJA 3AVXA 4DOMA 4ZCRA 2WJJA 2QJFA 1P0CA 3KQQA 2IYFA 1VIMA 1A5AB 3PEYA 3W6NA 5KQLA 4RL4A 4E2YA 1I3KA 1WTAA 4IAOA 3CNNA 1SELA 3GR6A 5F4ZA 1G5QA 2Z9BA 2G82A 4GBMA 4MMXB 3Q8WA 4CDRA 3TXXA 1FRFS 1T9ZA 2KX7A 5FO1A 3H2GA 5T3UA 4W5HA 4YCAA 4H7PA 3CRMA 2C88A 2V7PA 1R0WA 3A14A 2XUPA 4WKCA 1N2EA 3LXMA 4J7AA 1QCCA 3K6JA 3RVJA 1QRTA 1MO2A 2G8NA 3KC2A 4I55A 2PO5A 2A9QA 2PX3A 1P2BA 4H4CA 4BVEA 4F4IA 1KZ1A 1ZQ1A 4I4TA 3BGDA 2VTDA 2GQ0A 1GCOA 1I1QB 2WFZA 3KZNA 1UDCA 3P9ZA 2I1LA 2C9CA 3EULA 4U7HA 3UJHA 5C80A 3ZQUA 3PJRA 4MVJI 2GSWA 3F7TA 2FMUA 1RQPA 2WWFA 4GMGA 4BJHB 2EJUA 2G0TA 1ILEA 2P8SA 3MM4A 1BHJA 1MN6A 3PYLA 3U3XA 4MAFA 2XF8A 3AFHA 2V98A 5IT4A 4M0CA 2F59A 1RE0A 4RXMA 3R3XA 1EEHA 4OHWA 1SQSA 3PJDA 1JA9A 4IIYA 4QVGA 1MX3A 2CK3A 1EK6A 4TPKA 1IBLB 4KAXA 2FFJA 3A1SA 2FE4A 3PGXA 5KTOA 4PYLA 3RJ5A 2FZEA 1ICIA 1WW3A 5CH3A 4EKYA 1FTWA 4Y2UA 4EFKA 1P7ZA 1EWQA 3FVRA 1JJBA 4KXYA 3N2GA 4O2LA 3QPCA 4TMKA 4E5DA 2UYHA 1VA4A 4Z4IA 3UEOA 4IGEA 1A9ZA 2O1WA 2FB9A 2YMQA 4Q34A 3H2HA 1SCNE 4RZXA 3DZKA 5D87A 1Q1BA 1BNCA 2EG5A 5IASA 1H3EA 1BXZA 1UMCB 2WSIA 2W4QA 4E51A 4UZSA 1AGYA 3G0GA 4NZOA 4D9HA 2Q8QA 1JFLA 3D3KA 5AOAA 1RR6A 4IFBA 1KEKA 3VR4H 4FCCA 3GDFA 4IDOA 2JAQA 4XD7A 3QPUA 2A9OA 4QGGA 3RO7A 5L53A 1M1UA 4P0QB 1E4EB 1BMFD 2FFAA 2PMBA 1SA0A 4GQBA 4I3FA 3TW6A 4ER6A 5IXSA 3BE5A 1ZBDA 3MIIA 3IUYA 2J9FB 3NDRA 1X2EA 4LMAA 1DKLA 1GQQA 2FUKA 3I9MA 2IL1A 5FRDA 1CQIA 1P1BA 1G20E 3K5HA 4QE3A 4CKBA 1ZGJA 2GTIA 3MNFA 3RFTA 2B61A 5C8YF 3BREA 1P0MA 4P7JA 1WNFA 4PYIA 3ZQ6A 3S29A 3P9QA 4DWWA 4XWAA 1C4OA 3BM5A 3HMQA 3UAVA 1KR2A 1S1MA 2LV8A 1QTIA 5AJXA 5G1OA 5JD4A 4PPGA 1AB6A 1T5OA 5DNEA 3WMFA 4ACAA 1EVIA 2P2GA 3ZNNA 1MOQA 1OYVA 2CVFA 3R6WA 4DBLE 2O4CA 1ZR2A 3UCEA 2QAGB 4OHOA 1EQUA 2X6RA 3IV7A 3QXHA 3VC7A 5BOSA 1H6BA 1JRLA 4G0OA 1VE9A 4PCUA 5CAEA 4CL8A 1OREA 3HFJA 2IEZA 2YVAA 3FAKA 3L7MA 1T2FA 4B7XA 3Q0IA 2FF7A 3GVCA 1EBBA 4WFIA 3GQBA 5LZ8A 1WKVA 1RYZA 3A04A 2PWZA 1OX4A 5AJVB 5F3RA 4B48A 3FJ1A 3KIPA 4DUZB 3VBEA 2R4UA 4B82A 4YHHB 2MYTA 2G0NA 1QRAA 2QJRA 4MIEA 4RH0A 1L5SA 5KU7A 1UXGA 4JHLA 3IAFA 1QMPA 1E3SA 4AECA 1KO5A 3ZV3A 1IN6A 1AO0A 5TE9A 3STTA 2BUCA 5EC8A 2Y0EA 4NEQA 3JQGB 1YZKA 4JB8A 1O54A 4ZOCA 4AI6A 5ARBA 1P18A 2W6OA 4JROA 3V6MA 3ROKA 2BY4A 3X1WA 5I7VA 1YB2A 2HCBA 4GICA 2WUWE 1OILA 2Q2OA 3PR2B 3R7WA 4CV1A 5CD1A 2QTAA 2AYXA 2Y1DA 1GEEA 3SMVA 4H0FA 4D9FA 4JI8B 3B20A 3RD5A 1IJKA 3NIFB 3G2IA 3FDFA 4RZIA 3VOTA 5A3RA 4D98A 5CH5A 4JT2A 1E63A 4D79A 4N01A 4QQRA 4Z8YA 4NI5A 3D7KA 1C0EA 3N74A 2WSYB 4G9BA 2D1SA 3C3AA 1JMKC 4GRAA 4IUBS 1UXJA 1SUFA 2WD9A 1CEQA 1OAOA 2HK9A 2J07A 1K8QA 4OJNA 2DX7A 1P39A 2JJ2D 3MTGA 3LD9A 1TYZA 4CEHA 1WQ4A 4K40A 3I9V1 3CA8A 1ZGCA 4HH4A 3IQIX 3UHFA 2GF9A 2OFOA 3CLUC 3FZNA 1KAOA 2CVOA 3B1FA 4AFNA 4KXXA 1FX0B 5KYWA 2P3OA 1TM4E 3WXBA 1YA8A 5JZ9A 1TJ3A 4FZ3A 3TAXA 3VTFA 1UJ2A 2APJA 3JWIA 3HN6A 1BW9A 1Z6AA 3ADPA 4PVCA 1JEQA 2Z2JA 1EE2A 4XGRA 4A73A 1RC0A 1UKYA 4B9AA 2I2BA 2EOAA 2GCNA 2Q5QA 4KPUA 5JR3A 1NTRA 1M3SA 2H1CA 2ZETA 3FMOB 4ZU6X 3SSMA 3U5ZB 4WUTA 1FFWA 4R54A 3I01A 4HZIA 4FX5A 5TIIA 2WIKA 3AR7A 3WDMA 1PEKE 2D5AA 3QMVA 4JXKA 4QYIB 2XV1A 5J58A 3KKMA 3NDJA 3NYWA 3FG9A 5BORA 2D1YA 1WZ2A 1J2RA 1XE3A 2XQVA 3KAQA 2HA3A 1KAEA 2OOSA 4LHWA 4CCAA 3ADCA 1ADYA 1FEZA 1GUFA 3M1YA 5A9SA 3T1TA 3MC1A 4G81A 1YK0A 2HQBA 3LUBA 4ZO7A 2D13A 2Q99A 3RVQA 3OESA 1GGKA 1OHHA 2R44A 2OBMA 4L4RA 3HYSA 3HL4A 2ZZKA 1LK7A 2NXNA 4ETWA 3JQCA 2G09A 1U2SA 3PQ5A 4LDZA 5BT9A 3GLIA 1NA5A 1VB3A 2Q5OA 2ZIUB 5ER6A 5TMBA 3UOGA 2X40A 1C9DB 1ZZEA 1II8A 2X3UA 1Q1NA 4JUAA 4P08A 4RZ3A 3VZSA 1ZINA 1ZLYA 4V3CA 4JR2A 4PLGA 3PDWA 3KJIA 3VPAA 5C3MA 3IDSA 2YS7A 4XIYA 3UYKA 2NXWA 4EGJA 3HA3A 4X1KB 5EGSA 2ZSDA 4YJ2A 1L7OA 3PL1A 3TMAA 2YWHA 4BVHA 4AQYB 2IE0A 1O4VA 2BKXA 3E1SA 3FHCB 3A9SA 5CA1A 1D6JA 4PZEA 2VUSA 1U0RA 4QNMA 2JJ1A 4QGSA 4TMTA 1U3WA 4CQMD 2LW7A 3ZY5A 5CGQB 1TGYA 3FZEA 2FPIA 3DFMA 5KVCA 2ZRHA 1T4CA 3AI1A 5TJHA 5GVSA 5JZSA 2VXCA 3PQCA 3T94A 5HIKA 4K6GA 4F1KA 2HXGA 2R8OA 4PFSA 1EUQA 4DY6A 3GFOA 2WIGA 4FIZA 4B6SA 1YFLA 3CLKA 3HA5A 4L9SA 4S35A 3JQ6A 3VYSB 1ZGZA 2VF4X 4LRSB 1IBRA 3KQMA 3U4QB 2DQKA 2CWDA 2HK6A 2D8AA 3ZKWB 3OLVA 1PTKA 5ALGA 2W22A 5A0FA 2WBLC 2VDUE 4MUAA 4ZU3A 5SICE 3DJFA 3SICE 1H4TA 2ODAA 2DBRA 2VPPA 3HDVA 4HQFA 4HRAA 4YV0A 1UK9A 4BEJA 4XGNA 5DRTA 1EBUA 3BD7A 3EE6A 1LQUA 1JXMA 1XP5A 4R1SA 4MS3A 4FD3A 4FGJA 1CR1A 4CV0A 5HE8A 4WINA 3EZXA 4PWZA 1XNHA 4JMLA 4ENRA 2NUTA 3QPDA 3UV3A 1WDLA 3VNRA 4WX2B 3SC2A 1KETA 2JLAA 2EDAA 1TAQA 3HMKA 1JL3A 2EERA 1W4CA 3LM8A 4CG1A 4RK4A 3WGGA 4ROSA 2EQAA 3AOEC 4KOAA 4DBLC 4CMEC 1GZ5A 1XZGA 4HGOA 3OZCA 2O7RA 2PUGA 2IPLA 2ZXFA 5I7HA 1V35A 2B2XA 4HP8A 2H2IA 4TV9A 5DLEA 1H9CA 3LKBA 3B1VA 3ENKA 2O59A 1EVLA 2RGGA 3P9SA 4QARA 3TK1A 2LCIA 4WOJA 1NXOA 2R6JA 1BXRA 4KQIA 4L6CA 2HK7A 4DKXA 2NTYC 4BCCA 4XJVA 4IXMA 4KYVA 1UWKA 4PX2A 5DHFA 3LPCA 4BVGA 3QY9A 4DMMA 4DM4A 4QXOA 4N7JA 3QNMA 4FFDA 3G8AA 1H6AA 4R83A 4LDPA 1UDBA 2W98A 4MYTA 1GVHA 1DJLA 2DMRA 3SFTA 3SFVA 1PFYA 2BGTA 2E87A 1VPEA 2AE1A 4CM9D 3W5JA 1E9RA 2F2TA 2WDZA 4YDRA 2JC3A 3QBJA 2UVPA 2D7DA 2QQEA 2WV7A 4HEA6 1A9OA 2C0PA 1SCAA 3DB2A 4BLSA 1G2PA 4Z7NB 4XYEA 1GG2A 3WGOA 4W9RA 1K92A 2Q5EA 1ACMA 1B43A 1CQZA 1J22A 2YFYA 4KGXA 4XDZA 1JDNA 4X1YB 3G89A 4ZTBA 3FOEC 4P0PB 1U2TA 2C77A 3RQIA 2P0YA 1X7YB 2H51A 3WLEA 3W9SA 1BDHA 2HRBA 5H3HA 3WXMA 3KEMA 3BMNA 1YJCA 3BF7A 4DQLA 1BXGA 4O4JF 2D0OB 4B83A 1N36B 3FTFA 2BEKA 3OP1A 2GZMA 1Q57A 2YZKA 2PZFA 3JQDA 3G59A 1Z35A 2EWWA 3OH8A 2VWPA 3BD9A 1N6LA 2QX9A 9MHTA 2Z43A 3ABSB 3RVMA 3L4KA 3WDSA 2GF0A 2J85A 5CJJA 1S2GA 1K75A 1C0LA 1QIFA 4UOQA 1O3YA 3H5NA 4IINA 5CXUA 4ZTZB 4E30A 3WWDA 1ZG3A 2F3UA 5T4EA 5HVNA 4P9NA 2Z6AA 3N2EA 5DTRA 4DR5B 3CUSA 3ZIAD 1ISIA 1T6XA 5FWYB 1L4LA 2PYIA 4MLCA 2EKLA 2VNHA 4JFAA 3ZV5A 3FIUA 1IEXA 4L08A 4BQRA 3TZQA 2FCAA 3F71A 3SJ7A 4LV6A 1WMDA 3FOBA 4P3NA 3HU3A 1WR8A 3H5VA 2D62A 1KDYA 1ZXLA 1NXQA 2AJDA 3E1KA 3FNBA 2IYRA 4JBYA 1N7HA 1H8ED 3QVGA 4KXMA 4ZAGA 2B34A 4IJMA 3U3MA 1J9EA 1M8PA 4NFHA 1Q0QA 2QTZA 3WBJA 4K8OA 3PFWO 1YB5A 1CB0A 4M2LA 1SC4A 3U7HB 1SB9A 2XCUA 5BR7A 5L6MB 2GVDC 1W88A 2QGZA 3BWEA 4EKNB 2IBTA 1QG0A 3N1UA 2RHDA 5U1PA 3HEAA 1CUBA 2QXTA 4C2TA 4BKOA 3EDYA 1U80A 5DYNA 2BEUB 1R12A 3QA9A 4KWHA 2PGIA 3L02A 4M7PA 3CX3A 4GXQA 5EXSA 5HFNA 4ARSA 2VPQA 4OQLA 5B6JA 4IWNA 3FTPA 1M2JA 4M9ZA 4W5WA 4W1RA 2ZUFA 2CUKA 3HRIA 4U2BA 2NVWA 3KVRA 1PEYA 2VUIB 4S05A 4NICA 1K4YA 1RJWA 1YOVA 3AVPA 3LXUX 4JBHA 5AXAA 4YVFA 3VXKA 1XKLA 4M21A 4Y1RA 4Z0HO 2P0AA 1U04A 3FUXA 4MVJA 4OSOA 1Z33A 3GZNB 2Q6TA 3EJ6A 3G0DA 3SXJA 3TCKA 3H7AA 4R2XA 3L40A 4B3CA 4LZPA 3B51X 3GH1A 1AQUA 4D96A 1VGQA 2O0HA 3JY6A 3HLYA 4D46A 3A9CA 4YGXB 5T5QA 5B4UA 3TNFA 4YDQA 3V9PA 4RL6A 1N1MA 3OT1A 3CINA 2G06A 5BWNA 4B09A 1RMYA 2GS9A 3NYRA 2LXNA 3CUUA 3A6JA 4IG4A 4PLFA 3HKCB 3L1HA 4CV3A 2BELA 3QBEA 2FDXA 3T7SA 1KERA 2XWSA 3C39A 2Q3FA 1TJ5A 2NVOA 2ZJ5A 1YCFA 2JA1A 1F48A 3OTGA 5LQCA 1QNLA 2O2GA 4DRXA 4IDNA 5JWHA 4ZDIA 2BGRA 4BV3A 4KQCA 5KBYA 5KOIA 3PBKA 5AKEA 3UO8B 3QZUA 2RK6A 3LDAA 4NX2A 3IP6A 3DE1X 4XH9B 2C7PA 4IS2A 3PQ8A 3D7SA 5NULA 1KL7A 1QE0A 3NTQA 1THMA 3MCTA 3R41A 5FJIA 2AKAB 4CLDA 1T34A 4CKCB 5M2QA 4FWIB 1JLKA 2AFIA 1SBNE 2DUNA 2R96A 1ZNYA 3LMKA 3PGJA 1U0SY 8MHTA 2Z5GA 5JJBA 3FPHA 1LS6A 3JALA 5HCUA 3WHIA 2OENG 4W6QA 1R66A 3KKNA 3KR0A 1E18A 1ID1A 2TSYB 3VR5A 4A2QA 1CUCA 1JSZA 5KINB 5LMCA 1NVDA 4TKLA 4RHYA 2QNRA 1CUDA 1MP0A 4Q02A 5EVCA 1XD2A 1OXVA 2EZ9A 4V3BA 4C0JA 5M5BA 1BE1A 2EIHA 3OETA 2HGZA 2WMOB 3GVIA 4WA7A 4LDAA 2Z4TA 2FDCA 3B1WA 2ZATA 4HADA 4BKUA 3FWYA 4GPBA 4DNOA 1SUPA 3W90A 1FSSA 2D00A 2QTRA 4K9LA 3D5QA 1ZK4A 1TYBE 1PT8A 4MICA 3TM5A 1H1LA 4EG1A 3UAWA 2HY7A 4UMVA 1RLJA 3A3NA 4J16A 2P2DA 2ZWOA 1PTJA 1M5UA 1T4MA 1W93A 3I9NA 4OYHA 1LW7A 2ZAIA 1DKMA 2H1LA 3HUTA 4PCAA 3UKJA 1R5NA 2ZRNA 4MKHA 2I1QA 5K6AA 4NPAA 4KLAA 5AHRA 3COVA 4D4HA 3LUDA 4NU5A 4Y30A 2VDRB 4M7RA 4DCVA 3ORRA 1WV0A 4JJ8A 4S04A 1JIIA 1MORA 2ZI4A 2F64A 1DKRA 4FR5A 5FNVA 4YWJA 2HLNA 2XJ9A 3NBMA 2HIAA 1HG1A 3PR3A 2JFFA 4WZZA 3W2EA 1FJ2A 3EZYA 1C29B 3AEZA 4ACBA 1KS9A 3ITNA 2QRGA 1YXMA 3I42A 4FUQA 1Y5IA 4PC1A 3PPWA 4RWZA 3ADBA 3AEYA 3AUTA 4QDJA 2IY7A 4US1R 4YB8A 4XUDA 1ULAA 3UPUA 3FDIA 4PO3X 2Q0QA 4R8MA 1VXOA 4FOSA 2K7FA 4HN4B 2NZVG 2JPDA 5CT9A 2IDKA 4E46A 4ESEA 1S89A 4JUDX 1J5PA 1WLYA 2QW8A 3NTXA 4CF4A 4W5RA 4EVRA 4QBHA 1MNAA 5JAPA 5LZ9A 5TXGA 2CV0A 3EG9B 2YC2C 4DFDA 5B3JC 1VJCA 3HY6A 2ZT6A 4NBRA 4BMCA 1IBMB 4F4HA 4MLZA 1WUYA 2YWGA 1Z22A 3JTEA 3PF8A 1FUYB 4TKUA 2OTCA 4G4JA 3CW2A 1B1CA 4HZGA 3ZCVA 1LI5A 1E94E 3NOQA 2DC1A 1W48A 2AFRA 2RHOA 2AQKA 2G9ZA 3AF1A 4ALKA 2OCLA 3ZY4A 5T41A 4REQA 3ZLBA 1AKRA 3MJRA 5IVPA 1DAIA 4W9NA 4CMHA 3T5DA 4CT0A 1J5XA 3TECE 4N40A 1XPJA 3WRYA 3JD2A 1NRJB 2O3RA 3CLRD 5E3JA 1ISGA 4YAIA 3ES9A 3NAMA 5AUNB 2FW8A 1I3NA 2XYQA 2O1XA 5IX8A 1VP9A 3RC7A 1PJ8A 2IHKA 5C18A 1JIVA 4O4HB 5K3OA 5KB3A 1MXFA 2ZIGA 3IQEA 4KH1A 1ZUIA 2XCTB 2B8TA 1E99A 3WK9A 1OYOA 2REQA 3OZAA 1T5BA 3ECAA 4BMZA 2Z4RA 4HQOA 5DM2A 2KW5A 2HAEA 3AFNA 3DL2A 2WOJA 1UP7A 2A0UA 3F6SA 3O03A 3Q1LA 4MUEA 4QUDA 3IBFA 1XJWA 1GXSA 2IUFA 3MTQA 3VHXA 1EVQA 1D0IA 1OT3A 3KU1A 4QLAA 4ROTA 3ZWBA 4M0DA 1Z08A 5EZYB 1YA4A 1VPLA 2QQ5A 2XPCA 2I3AA 2XMPA 3I2FA 721PA 2ZP1A 2IU3A 4TZTA 1RCTE 4UARA 4RK7A 4K6OA 4ZKDA 1KPHA 1P9WA 2CHGA 3OA2A 3K0HA 1TCCA 2D1FA 2ORIA 3IPRA 1P33A 5JJKA 5AM5A 3BTUA 3FKSA 2V6IA 5DGTA 1YCHA 1HKHA 4JI6B 3CVUA 4OI0A 1BJTA 1O9HA 4JI5B 1GO2A 4IV5A 1XTTA 4DSTA 2BSXA 2ZLBA 3UWSA 4EMTA 2R5NA 1F14A 2WWVD 4ZQFA 1PG2A 3UGKA 4ENPA 4W4TA 4EB0A 1DMRA 4IEEA 1TZ2A 3E2MA 4YUZA 3GP8A 4RETA 1SOWA 4IS3A 4EAQA 4A16A 4H15A 5BVGA 4Y7CA 3X1DA 2JLUA 3ROPA 3BZUA 1XLTC 5EIXA 3CLVA 3OPMA 3W7VA 3AUYA 3IAEA 4G4SO 1T15A 2IS1A 2X2OA 4LXIA 4FMPA 2ZR0A 1T0PA 2X8JA 3E70C 5EY5B 4WCFA 1GNLA 2B7CA 1JVBA 3CRW1 4G0WA 5JCOC 1CRZA 2H1IA 3U40A 4KN5A 1A4UA 1X80B 2RK4A 1CIVA 2BISA 1TZCA 2CF6A 2LIPA 2WYIA 2CLCX 3FLBA 4MWEA 3UTDA 1KGSA 5GONF 1REQB 1V5GA 3K9HA 4GLJA 3EVBA 1WXDA 1LB1B 2QLJA 3F49S 3M4YA 1RYFA 3KZCA 5C5EA 2BUBA 2VNAA 2W71A 2WTNA 1Z5NA 2WY2D 3W8FA 1G21E 4CM8A 4QRDA 4XRRA 1QHNA 2YJNA 2MR5A 1WWKA 4WJKB 1DEXA 5K8TA 3NP9A 2YN0A 3GARA 4L8GA 1OC4A 2JJ8A 3MXTA 3AP2A 1W5SA 4K0RA 2BFFB 3NYIA 1VKNA 5IAAA 1RWVA 2CFCA 4JLWA 4CJXA 4YMWA 3WBFA 3K09C 1KK1A 2UZIR 1J97A 4H6WA 2WU0A 2QL5A 4GBJA 5K8UA 2C2ZA 1IXKA 2QLBA 4D26A 5ALPA 2RI0A 3TSAA 5BXQC 1G8KA 2OC9A 1QUFA 4W1QA 4RLFA 5J4VA 2GYUA 1NHWA 1P72A 2J7PA 3LF1A 2TYSB 4GX0A 2O07A 4ZQHA 3TTXA 3PHIA 2JGNA 3D81A 3RODA 4FUTA 3HDTA 3ZXSA 5K3AA 5CVTA 4YPVA 1YR1A 5EWJA 4NMWA 3F6CA 5JXIA 3L1VA 3U09A 1KRXA 4MP8A 2CDRA 3GBVA 1RZVA 1QGZA 2RHCA 4LGMA 5I8ZA 3E05A 5DGXA 5CDFA