4LXHA

Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3-cl hopda
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
276
structure length
276
Chain Sequence
MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNAMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRDDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites.
pubmed doi rcsb
source organism Sphingomonas wittichii rw1
molecule tags Hydrolase
molecule keywords MCP Hydrolase
total genus 89
structure length 276
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxhA00
1R9MA 3HACA 2PSEA 3DD5A 4EY8A 2Y6VA 3F8SA 4JNCA 4WFIA 5IVDA 4CIAA 5HKAA 1DX6A 4FWBA 5AHXA 3WYDA 2D0DA 3DCNA 1THGA 3M82A 5I7UA 5I9IA 3VJMA 2BKLA 5T4FA 5JZ9A 1PFQA 5AOBA 1JT2A 1ZI9A 3KWJA 1SFRA 1SOMA 4U2GA 3KSRA 5C8XA 4ZXFA 4N8DA 3EQ8A 4W63A 2ZSIA 4J0DA 2RIPA 2AJLI 5I8PA 3QVMA 1YR2A 3PFBA 1CUFA 3FLBA 1U65A 4QLAA 4UBLA 2QJRA 1A8QA 3FSGA 5A62A 5EIAA 4F0JA 4X6YA 4KRYA 1VZ2A 1GGVA 2GYUA 3GELA 1SCKA 1EINA 2D5LA 1CUJA 1LZKA 1NX9A 1XZBA 4Y2XA 3HEAA 4J0GA 7YASA 4M0EA 5CT9A 1K6EA 5CURA 1NU8A 4EBBA 4G4JA 5J3JA 1EX9A 1XZLA 3HABA 4HXGA 1VJ5A 1QIIA 3A2LA 2XMQA 3C6XA 3O9VA 1Q0ZA 2XUGA 1RWQA 2HU7A 4HZGA 1JI3A 4B84A 2GBCA 4BDTA 2PSJA 4Q82A 4B9EA 1EHYA 1CEXA 2PSHA 4D9JA 5C7YA 1OXMA 4C89A 1P0IA 2H7YA 3HLKA 2QJWA 3H1BA 3WI7A 1P0QA 3WKCA 3ICWA 2R11A 4EZIA 5HQ3A 5YASA 3RARA 4IHAA 3FOBA 3V1LA 4OPMA 3JW8A 1BN7A 1ZIYA 4K6GA 2CMFA 1E8NA 5DYWA 2OAEA 2WHPB 5C8VA 1HL7A 1YSCA 2C58A 5EHQA 1AC5A 1XLUA 3STWA 3RM3A 1XRPA 2AXEA 2CJPA 3RK4A 1L7QA 2QTBA 4HRYA 1G5FA 3ZLTA 2YH2A 3ZWQA 1BEZA 4LYEA 3T52A 6YASA 3KWFA 4LXIA 2CB9A 3BDIA 4HXFB 1B6GA 4BVLA 2DR0A 4B81A 4CG3A 4N5IX 5D3ZA 3FCYA 3ZLVA 1QLWA 3UMJA 3WWPA 3A70A 5FV4A 3IBTA 4Q1VA 4KRXA 1DX4A 3WKDA 4ZGBA 3EIOA 2PUHA 3I2HA 3DQZA 2WSLA 2HIHA 5HF5A 4K5QA 4OB7A 1H2ZA 3N2ZB 4MEBA 4NS4A 4OSEA 3W2TA 5JAUA 1EH5A 5AM4A 1MX5A 4H35A 3IUQA 4QDXA 3W9BA 3OOSA 1Y7HA 1XROA 4QZVA 1XZCA 3W9UA 4OU5A 3H2KA 3DKRA 1XRNA 3OURA 1VZ3A 3HYSA 3IUNA 1YAHA 4QLOA 2C7BA 4DMKA 5AKLA 4UFNA 4QNNA 2XMCA 4OUKX 1JJFA 1R4ZA 5JZSA 3G8YA 3Q8WA 4LYDA 3G9TA 5BOVA 3KDAA 2HADA 5AI9A 1GZ7A 1L7AA 4MJ3A 2QXTA 2V96A 4U2DA 4BB0A 3HRHA 3STUA 3I6ZA 3V9AA 1AKNA 5ISMA 2VF2A 2C5FA 1UZAA 3C8HA 4FLMA 3QPCA 1F0PA 4W9RA 3VJLA 4B0PA 1N5MA 5JADA 2AJDA 1ZI8A 2RHWA 2OXEA 2FX5A 3PDCA 2JGFA 1ZJ4A 1QIEA 5CBKA 4Z49A 3WWEA 4WFJA 4WJLA 5HK8A 4PSUA 1HQDA 1IZ7A 1E89A 4G9EA 1XZDA 5FKJA 2O2IA 4U2BA 1DU4A 5JATA 1MU0A 2XQJA 2XB6A 5LZ4A 4DTCA 2HA3A 2HFKA 4UBOA 3VVLA 4Q34A 1BCSA 3BF7A 3H2GA 1GQSA 5ALKA 1A7UA 4UBJA 1BE0A 1WM1A 3B12A 3FVRA 4DMHA 3D2AA 3EQ7A 5ALYA 1AUOA 1JU3A 2AJCA 3B5EA 4HRXA 1EK1A 1TCAA 4C4XA 3ED1A 3PFCA 4UBIA 3VKFA 1VA5A 1SCQA 4DNPA 5KBYA 5E4JA 1QTRA 3QITA 3STYA 5AI6A 4WCVA 4J0CA 1WB6A 1RYYA 2GBIA 2K2QB 3V1MA 5FPQA 5ALOA 3UUFA 1LPNA 3WJ2A 2GYVA 4KACA 2XMSA 5JAOA 2WG1A 4DYHA 2HA4A 5FLKA 3H0CA 2BFNA 3P2MA 5AKKA 4AXBA 4XIIA 4OB6A 4PNZA 1XLVA 2PL5A 3WZLA 2QVBA 5JYCA 3R3YA 4BTLA 4DNOA 1ZI6A 1Q83A 2QUAA 3ESCA 3KXPA 1HBJA 4OU4A 4KJXA 2OCKA 3DJYA 4XWGA 1YB6A 5ALWA 2QUBA 1YCDA 3W05A 5LP1A 4LKOA 4LIPD 4YASA 4E15A 2WIFA 4UBKA 2RHTA 4H7EA 4UHEA 5ALMA 1FFEA 3O9MA 1A8SA 2XUKA 1QTIA 3DYVA 5DNVA 1W76A 2PU7A 5LZ5A 1EDEA 3F9CA 5AKIA 2YYSA 4C6HA 4X95A 2DHDA 3X3HA 4KAFA 3CN7A 1Z68A 3F67A 2JIDA 1CUVA 3PI6A 3BDVA 4Y2JA 4BCBA 1G42A 4W1PA 4FLEA 4DNQA 1RP1A 3G0DA 1UK9A 2XQFA 1QOZA 2H7XA 2BUAA 1VKHA 1TRHA 3NUZA 1EK2A 1CUHA 1Q0RA 2ONCA 1QIJA 1EDDA 2WJ4A 4PO3X 4OB8A 1HLGA 4QEKA 2ORYA 5EIEA 4H7JA 3WA7A 1AX9A 2ZYIA 4N8EA 4IH9A 4UHFA 5A7HA 3GZJA 5CT4A 4H7DA 5A7GA 5CTAA 2B61A 4BYMA 2PUJA 3D59A 3DS8A 3WKAA 5HFNA 4BZZA 2HU8A 4X7BA 3WIBA 1N5RA 3C87A 1K5PA 2HDWA 2PSDA 4X00A 1VXOA 1GKKA 3IUJA 4NMWA 3H2JA 5CT5A 2X8BA 5DLPA 5FP0A 1LBTA 3G0GA 1YASA 2WIKA 2XUDA 3FYTA 1BU8A 4ARAA 1WOMA 3H19A 1BS9A 2QMQA 3Q0TA 2QM0A 3PF8A 2Y6UA 4RGYA 1LLFA 1YS1X 4I19A 1DQYA 3PF9A 3I2KA 2GZRA 1TKRA 5FRDA 4ETWA 1UT6A 1CUBA 4PV7A 2ZJFA 4X91A 4AO6A 5IVIA 2Y2UA 4H0CA 3E1GA 2XE4A 4CG2A 4P08A 5JASA 5SYMA 4BP9A 2IX9A 4FFWA 3M81A 2AJBA 4FDMA 1CUCA 1W1IA 1IUPA 3G7NA 5JALA 3OPMA 2FJ0A 4BE9A 4RE5A 4HAIA 1CLEA 4BCCA 1XKTA 1ORWA 2OGTA 4ZREA 4LHEA 5AH0A 4WDRA 3G02A 4KR0A 5FOQA 5EI5A 3BF8A 5AK4A 3TEJA 1M33A 5CRIA 2G5TA 5JANA 1ZGCA 3O4HA 1CUGA 3AUKA 2HHAA 1U8EA 3H18A 4M0MA 3V48A 3OG9A 2JGEA 3FVTA 3DYIA 5C8ZA 3A2NA 1QE3A 2H9YA 3LCRA 3AILA 4OD0A 3E4DA 1MTZA 4Y2TA 4EY6A 1UK6A 2XMBA 2WIDA 5AI4A 3BE8A 3SK0A 1LNSA 1CUIA 1HPLA 1IZ8A 2JGIA 5E4YA 3AFIA 2UZ0A 4MEAA 5CT6A 5JZBA 3F97A 2QT9A 4ZV7A 1R50A 1CUWA 2VJDA 1EB8A 4X97A 3D2BA 3IURA 3I2IA 2ES4A 3C5WP 2VAVA 4AZ0A 3DKKA 4UPDA 3ESAA 5LKAA 5A6VA 4GHWA 5AOAA 2BAGA 4EY4A 2WFLA 3IDAA 3WWDA 1TAHA 5ALRA 1H23A 5AM0A 1E8MA 4Y2PA 4Q3KA 4AX4A 2ZVDA 3C6YA 1QIFA 2XUFA 2RONA 4X94A 3HSSA 2G63A 5DNUA 3I2FA 3G0BA 5EGNA 4CCYA 2RAUA 5AM3A 4JEIA 4W1SA 4X85A 2VT6A 2Z3ZA 1OILA 4UUQA 5IVHA 4PQEA 1U4NA 3BL8A 2XLBA 1UK7A 2VEOA 3OM8A 3WQHA 4BATA 3AJAA 4Y2UA 1G66A 4C88A 4J0JA 5AM2A 1XRQA 2G5PA 1QFSA 1ZD3A 4JH0A 1CUAA 1U2EA 4DIUA 4UBNA 4X92A 3MGAA 3VVMA 5T4EA 3LS2A 2ZJ6A 1QJ4A 1XZEA 3K2IA 1ZOIA 3C45A 2WJ3A 1MT3A 1CUUA 2PVSA 3FSGD 4FBLA 2QR5A 5AOCA 1JMKC 2VJAA 4KE6A 4LXHA 4G8DA 4O08A 1TCCA 4PSDA 2BCEA 4HVTA 3ZPXA 3QMVA 1LPBB 3IUMA 4J3JA 5CMLA 1LBSA 5ALNA 4TPKA 4W1RA 1ODSA 1YA4A 2O2GA 2XUIA 4IO0A 3G9XA 3AIOA 1EA5A 2Z8ZA 5AK6A 4HXEB 2XQIA 4B6GA 4XX1A 5DNWA 1ETHA 2XMZA 3PE6A 2YXPX 5HZGA 1WB4A 2P8SA 3AZQA 1ODCA 3I2GA 3NGMA 3GA7A 4UFOA 2QKYA 2XUOA 3OTQA 4OYYA 1J1IA 1VE7A 5A71A 3IA2A 5D6OA 4DMCA 2VTVA 2QRUA 3AZOA 1A8UA 5D7BA 5ALVA 3WWCA 2YASA 3A2MA 5AKEA 1VE6A 1MPXA 3QBJA 1FFAA 2Q0XA 3MUNA 4V2IA 4X3CA 3WK5A 1R88A 1LPPA 2Y2VA 1MN6A 2JGJA 5JAPA 5CXUA 4U2FA 4Y9SA 1XZHA 3I2JA 1ISPA 1JJBA 4BAGA 2V97A 4ARBA 3HC7A 2WUGA 1X2BA 3WK9A 5AK5A 4YPVA 4X90A 3CN9A 3R41A 1ZD4A 1PJAA 4C01A 1WB5A 5FUMA 4AQDA 1SCIA 3I28A 3AIKA 4WY8A 4BE4A 5LKRA 1XRMA 5C81A 5BV7A 3AINA 3ILSA 4G9GA 4QDOA 1P0PA 4UHHA 4FKBA 4P93A 3N0TA 5JARA 3S8YA 1USWA 2HRQA 1AZWA 2O2HA 3WLAA 5CH3A 1UKCA 3C6BA 4AMZA 3T4UA 4CCYB 2QZPA 5HKBA 3C6ZA 1CUSA 2JGLA 1XZKA 5EHNA 3PUHA 3VISA 1MNAA 2WIGA 3TGLA 3QPDA 4MQLA 3W04A 2JGMA 3WL6A 1E5TA 2WKWA 1W75A 4FLFA 5HF6A 5IVKA 4DLNA 4GWLA 3L1IA 2WUDA 2XQGA 3FNBA 1X2EA 1F8UA 4Y7DA 2NW6A 1CFJA 1WHSA 5DYTA 1ACLA 5E4TA 2FUKA 3BXPA 4FNMA 3BIWA 4G5XA 5DTIA 5DTJA 1VLQA 3FYUB 3ESDA 1J06A 2B9VA 4BDSA 4MXDA 3AZPA 3R3VA 2ACKA 2WLSA 4L72A 4L9AA 5JD4A 2J3DA 4U2CA 1LPMA 4BRZA 2WHQA 5AI0A 4CFSA 3WK7A 1QFMA 5ALQA 2XQKA 3A6ZA 4BC0A 1BROA 2QOEA 1DINA 4LXGA 3ZV7A 3CCBA 2BGNA 4Q3LA 4XJVA 4J03A 5ALHA 1T4MA 3DLTA 3LIIA 4DGQA 5LZ9A 4B9AA 4G8BA 5ESRA 1DWOA 2OLEA 1GKLA 1EB9A 4QDUA 3GUUA 3H2HA 1C4XA 2PPLA 3WIOA 4A5SA 2WM2A 4K2AA 3DEAA 4DMFA 3DL7A 2VT7A 3U1TA 3FWHA 3E3AA 5ALEA 4FHZA 5CW2A 3G9UA 3QMMA 2W6CX 1BEEA 1MNQA 2CEKA 1WHTA 3ANSA 2Z8XA 1EDBA 4A23A 1DTEA 3D4LA 4AMYA 5ALDA 4GW3A 1FFDA 2W22A 1PV1A 4Y2YA 3LP5A 1YA8A 1CVLA 1ACJA 2C0QA 1I6WA 2WIJA 3QM1A 3CXUA 1GPLA 4H77A 4C4YA 3IB3A 2H1IA 1EVEA 4IH1A 4EA6A 4X6UA 3STXA 1QZ3A 2DQYA 2WG2A 4Q3OA 2XUPA 1LGYA 5IKXA 4EB0A 2I3DA 2WG0A 4JYPA 1FSSA 2OQIA 4FFVA 1K8QA 1EXWA 3WYNA 3LIPA 3WL8A 2ZSHA 3QMWA 3R3ZA 1GT6A 2LIPA 3JYHA 4OCZA 1CV2A 4WDQA 4ROTA 4BAUA 1TQHA 1TCBA 2B4KA 3C70A 5LLSA 4BC1A 2JBWA 5ALTA 1LPAB 2GBGA 3K9BA 4DSAA 2HA5A 3DDUA 5ALPA 4UFPA 3BIXA 3RLIA 3STVA 5K3AA 2X5XA 1DT5A 4KE9A 1WPRA 2HM7A 4QE3A 4IQ4A 4ITVA 2AJ8A 3D0KA 1W52X 4DM7A 5BWCA 4UHBA 3F96A 4X6XA 2VQ6A 2BGRA 2XMGA 1EI9A 2PKYX 4ZWNA 1SC9A 2J4CA 1ZD5A 3TRDA 5AJHA 2OAGA 1MO2A 3EBLA 1WPXA 5EIHA 1XZIA 3TJMA 1FJ2A 5T4HA 1WCYA 5CH8A 5AI8A 1ZGBA 4GEGA 3CCCA 1LPSA 4FOLA 5AKHA 3HI4A 2DHEA 4KE7A 4EY7A 3HXKA 4F5ZA 2WILA 1E8DA 3STTA 4RPCA 4GBGA 1KU0A 1ORVA 4GXNA 1AURA 2HA7A 1GXSA 2DFPA 1CQZA 3L1HA 4TVKA 4NVRA 1CUZA 2HL6A 5AKYA 3SWWA 4PF1A 3LLCA 4QDTA 2XUJA 4K6HA 4B7ZA 4J0HA 4CIBA 4YX9A 2V9ZA 5K3DA 4WY5A 3PUIA 1GPNA 4UHCA 1MAAA 1UKBA 1E3QA 1JJIA 3ESBA 5AI5A 3C8DA 3WJ1A 1X70A 2HA2A 3GFFA 3WK4A 4P9NA 5AKJA 5HCUA 3I6MA 1J07A 2HRRA 2VATA 4Y2VA 2WTNA 5ALXA 4QWWA 2XUHA 1B41A 3DOIA 2XUQA 2EDAA 1JMYA 3RKSA 3R3WA 1EVQA 5AK3A 5CT8A 2XUAA 1IUNA 5HQ3B 5A2GA 1XFDA 3F98A 4BRSA 3QPAA 5AM5A 2B20A 4J7AA 5AM1A 5KWJA 4HS9A 5ALFA 2WHPA 3NWOA 4H7HA 4CI9A 4BVJA 5CXXA 3IIIA 1CUEA 1GPKA 1XZJA 1FFCA 4BTVA 1UK8A 4KAAA 1VA4A 1THTA 1IVYA 1R3DA 4KE8A 4P92A 3O4JA 1A88A 1H2YA 2XI4A 4KYVA 3O0DA 4AN0A 2VJBA 1AGYA 4BCDA 1XLWA 4PW0A 3QYJA 1XZGA 5JD6A 1ZD2P 5HF8A 1DT3A 3FYUA 3JWEA 5EHZA 2PU5A 1QO7A 4U2EA 5LIPA 4E46A 3SX4A 2VA9A 2HU5A 4L0CA 1HDEA 1K63A 5AIBA 4C87A 2BUBA 3L1JA 4B0OA 3FCXA 4GI1A 5JAHA 3FLAA 2EEPA 3ZI7A 2XT0A 2X76A 2PBLA 3MVEA 3HZOA 5K3FA 1J2EA 5DJ5A 1BN6A 2ECFA 2XMRA 2WUEA 2IIVA 2OCLA 4HTAA 3BJRA 2I78A 4J0IA 2OG1A 3R3UA 5KWIA 3R40A 5FPPA 1YAJA 3H17A 5FXMA 4E14A 3WL7A 3S2ZA 2O7VA 3WK6A 3WZMA 1C7IA 2WFMA 5HF9A 5K3CA 1DWQA 2OCIA 4AB1A 1QGED 3H04A 3YASA 4N8SA 4B85A 5AICA 4X93A 4YK7A 2JEZA 3QH4A 1UKAA 2C4HA 4E11A 3FBWA 1F6WA 2CKMA 1Q84A 4X71A 3K6KA 5AKGA 1MX1A 1N1MA 2GZSA 2JF0A 4CG1A 4JUIA 4QDZA 4EUSA 4DSZA 4MQMA 2QXUA 1YB7A 5ALUA 3WK8A 3G0CA 3D2CA 1DWPA 1QIDA 4F21A 4NZZA 4XVCA 2JGKA 1CQWA 2DQZA 1K4YA 2I03A 4MYSA 4Y2SA 2Y1KA 3U0VA 2C5GA 1QIKA 1H22A 2BJHA 5LZ7A 1CUYA 3M83A 1TIBA 5EHXA 2ZYSA 4J0KA 2OGSA 5ALGA 2WU4A 3R3XA 2WFZA 1UXOA 1O6FA 2CZQA 4S0XA 3BWXA 3G9ZA 4I3FA 3D7RA 4TGLA 3SC2A 2VAXA 1OCEA 1F0NA 1CIJA 1AMNA 4ZV9A 1P0MA 1O6GA 5JD5A 1FFBA 4QWMA 2HA0A 5K3BA 1KU6A 3E0XA 3FAKA 1G4HA 3ICVA 1XRLA 4GDMA 5JIBA 1ZICA 4AO7A 1JKMA 2HFJA 4FTWA 4B83A 2QS9A 3MUOA 1CUXA 3BJMA 1W6RA 1MAHA 1TK3A 1HKHA 4BVKA 2Z3WA 2WQZA 2RGUA 4Q05A 1XZMA 1QIMA 5LZ8A 1NU6A 4MWTA 3OC0A 2C0PA 3WMRA 4KAJA 5K5EA 1E66A 1L7RA 1CUDA 2Z5GA 1UOQA 4W1QA 5LZ2A 2BUCA 2WUFA 4B82A 1IMJA 3M3DA 5EFZA 1VXRA 3WKEA 1BRTA 1LZLA 4H18A 4RNCA 4INZA 4AO8A 5F4ZA 4AN1A 5FDFA 1QO9A 3FLEA 3DL4A 1UOPA 4MWSA 5DYYA 1UOOA 4AZ3A 2J3QA 3B3QA 5SYNA 3ANTA 3VXKA 3I1IA 3IVMA 2PSFA 4A16A 1XQYA 4G1FA 2WHRA 3G0IA 1R9NA 2J4FA 4MYDA 1ZJ5A 4IH4A 3D5EA 4ZI5A 3C5VA 1LPOA 4H7FA 1UFOA 4DNFA 4G4IA 3EF3A 3I1YA 2GBFA 4FBMA 4FNGA 1XKLA 5KREA 3DNMA 5AO9A 3O4GA 2DCMA 2E3JA 5K3EA 2V98A 5HFAA 1XZAA 1XQWA 4BAZA 4OYLA 2GYWA 2RI6A 2PM8A 2R8BA 3HJUA 1VOTA 4PSCA 2ZJ7A 1XZFA 3ZLUA 5AIAA 2ACEA 1D07A 2WU3A 2WFLB 5ALZA 4WFKA 4UBMA 3WA6A 3WKBA 4B80A 1ODTC 1QIHA 4K6KA 3KOOA 1CRLA 3H1AA 2ZYRA 5D3KA 2WTMA 5AKZA 3W06A 1MX9A 1QONA 4BBZA 4I4CA 4L3WA 4BZWA 1JFRA 1N8SA 2O7RA 1JU4A 4Y2QA 4BP8A 4H7KA 3WL5A 4RE6A 4G8CA 3DOHA 5CH5A 1R1DA 2XDWA 1CPYA 3V1NA 2OCGA 3I6YA 2VJCA 3FYUC 5DWDA 4UHDA 3GROA 4FMPA 4H7IA 1S8OA 2DSNA 5T4BA 5H3HA 2OQVA 2HA6A 2JEYA 2VSQA 4GECA 4F60A 1W4LA 2H7CA 2XLCA 3WWOA 5AP9A 3V1KA 4CCWA 4QA9A 2OGZA 3KD2A 1XRRA 2ZYHA 1UWCA 1XQVA 2EDCA 4JYMA 3AIMA 1XQXA 1C7JA 5IH7A 4EY5A 1QIGA 1AQLA 3D3NA 4EHBA 5K3FB 1MJ5A 5ALSA 3PICA 1KEZA 2XMDA 5A7FA 2FJPA 3R0VA 1YS2X 1Y37A 2ROQA 4G4GA 3QZUA 3NOXA 4Y2RA 1DQZA 5ALIA 1GQRA 5E2IA 4N5HX 5ALJA 3H2IA 4C4ZA 1ZIXA 3VDXA 2PX6A 5HK9A 1CR6A 4KEAA 3IULA 2I3ZA 2CBGA 5BWBA 1IUOA 1H2XA 3C43A 2G4LA 2WJ6A 1H2WA 1Y7IA 3O4IA 2IITA 3EQ9A 5LYYA 1T2NA 4ZRDA 3O95A 3VJKA 2OPHA 2DHCA 1BCRA 5AKXA 5ALLA 4M0FA 3UUEA 4GLBA 3GBSA 2CUTA
chains in the Genus database with same CATH superfamily
3HACA 4IUDS 3TR6A 2Q45A 1OH8A 4JHXA 2CNKA 4IF4A 4GNKA 5U1PA 4PC2A 2IHYA 2CD9A 1YIOA 4JJ8A 3IXMA 4IVQA 5HKAA 5HPYB 4FWBA 1S1CA 3B9BA 2C42A 3WYDA 4YCLA 2FUG6 3H8JA 2H2IA 2LWIA 3RC8A 1RM3A 5FBLB 4QBIA 3OUUA 4ALNA 3SZRA 3M82A 2ID4A 3OLXA 3QLVC 1UXGA 3TDKA 2WYOA 2GCEA 3QXJA 1F0YA 2R1ZA 3CKKA 3IP8A 4POAA 1GGNA 4DB4A 3GMDA 2CV2A 4X62B 4AJIA 4MYCA 2PUVA 4QULA 1GCOA 2ZDGA 1VBMA 5B1SA 5K8TA 3OPQA 2HYIC 1SOMA 1YJ8A 2WSIA 1P33A 2X40A 2YXNA 1VHQA 3U17A 3NBYC 5GJWC 3DQQA 2H59A 3IIEA 4PX9A 3EPRA 3CZ4A 1ZMTA 4F84A 1D2GA 1QLHA 1RWNA 4G97A 4FYIA 2P6MA 3IQZA 3EIWA 1JPJA 1L4GA 4M98A 1BKDR 1ZSNA 3QVMA 4I9GA 4L4XA 3VTFA 2G70A 2CXOA 2W6ID 3OEHD 5HOEA 1JE0A 5E8JA 4TSFD 3RO7A 5FI1B 1YJBA 3HVRA 1E7WA 1N2CE 1RRCA 3PFBA 4HAVA 1Q0SA 1CUFA 3EGOA 3DMFA 1PR4A 3FLBA 3LSYA 4CNBA 4UNRA 4ZJUA 5CVTA 2IHTA 1J1ZA 2I4OA 5DXAA 3VC1A 2JFQA 4AJEA 3HB7A 1A8QA 3WB2A 4DLSA 4DANA 2JHPA 1YJXA 3FSGA 3IELA 5A62A 3PS9A 3U4QB 1E1QA 3WL3A 2Q1XA 4F0JA 5L6LB 1AGNA 1D2HA 2QVXX 5FNZA 4BNDB 1VZ2A 1AM4D 3O47A 3BEDA 1XD8A 5G3YA 3SICE 1NVFA 3R09A 3TCXB 1SCKA 2JJMA 3QXCA 1E6MA 5AYVA 1GDTA 4NCAA 4R0VA 2CJXA 4D46A 3ESXA 2FN4A 1M1ZA 3FHCB 2N1MA 2YWJA 2FSVA 3HYCA 2L82A 1HY3A 2H2WA 3Q6IA 3OT1A 3HEAA 4B09A 2VSNA 3ZCPA 2H1LA 5KIAA 4II2A 5DI3A 4Q21A 3ZX4A 1MENA 2BMWA 2NO9A 4QT0A 2W83A 4F96A 3RKRA 3DWFA 4FT2A 4BGDA 1WZEA 4WFQA 5J3JA 1M1NB 4QYWA 4HXGA 2RHMA 4FI3C 3CU5A 4WD3A 4WJZA 3MWDB 4RLFA 3C6XA 1JGTA 2B4AA 1GAQA 1Q0ZA 3L0DA 3L7JA 5FL3A 2RHBA 2XUGA 3BE4A 3DZJA 5LD2B 5CB4F 4FNOA 3WV5A 4E2WA 1AO3A 2ST1A 3N8HA 3W1EA 4D3XA 4B4DA 2J85A 3F3SA 4GPTA 1Q0PA 1E94E 4QBKA 2X5OA 5DV9A 2FFHA 3O83A 4KSYA 1EE2A 1GPWB 2I71A 4NYIR 5BSUA 3NIWA 4RENA 3SCZA 4RTLA 3SPXA 3I5AA 4I36A 1JI3A 4RXUA 4L8WB 2TMDA 4URXR 1QKKA 3UY4A 3TTXA 1EFCA 2D00A 2RGBA 1ND5A 1EHYA 2IEZA 5KTRA 2G9ZA 4EKNB 3KJHA 3HNOA 4K9SA 4JLJA 4IKPA 4REMA 3I1JA 4P4UA 4ZT5A 1WHSB 3RS4A 4FHEA 2EGUA 2BD0A 4KPEC 1OXMA 1G17A 1F8YA 1TT5B 1P0IA 3E8SA 1TO1E 4ZAZA 4BIMA 3J7AC 2OFFA 1YZGA 2B6HA 3O8LA 3PVZA 4D6PA 2H7YA 4WE3A 4ZJZA 3FOAA 1X74A 1ZA2A 3K5WA 1LVUA 2W2NA 1TZCA 1GNQA 4OLHA 2PGXA 2FWMX 3HGTA 4INAA 2Q2WA 4DQ0A 2B2NA 3D3KA 5HA5A 3WKCA 721PA 3ICWA 3P8ZA 4KTTE 2R11A 4HKTA 1PEAA 1VHJA 4EZIA 5DNCA 4URZR 1E63A 2PUBA 4KQXA 1X8KA 4TSKA 4YRLA 1A9TA 3MWYW 3QVUA 1FP7A 3RARA 4AJOA 4U39A 1MDBA 1PJ2A 3BCRA 4IHAA 4ENRA 2ZJAA 1ORTA 4P5DA 1ORHA 3JW8A 4CMJA 4PBRA 1CRPA 1P77A 4ZCRA 2CL6X 4EI8A 2O2EA 4YUAA 5GOTA 3TB4A 2Q9BA 1OJLA 1U9JA 2CMFA 2ZAIA 3G5UA 1E8NA 1NJ8A 4W99A 5EUMA 5FTWA 5TEWA 3USES 2HRDA 4EJSB 1JWBB 3V2UA 1P1FA 4E31A 4GPBA 3JR7A 2VDJA 1QG0A 1AC5A 1U7DA 1XLUA 2F1JA 3STWA 4D3ZA 1XRPA 1NHWA 2AXEA 1Q95A 2G0NA 3VUEA 5H3CA 4Y9RA 4PICA 1JHMA 5D2CA 2PDAA 4WV3A 5THXA 5H3LA 1Z4KA 1HG0A 5IJWA 1JSCA 4A6DA 2JLXA 3NC0C 4MX8A 3N7UA 2Z6AA 1H2EA 3M3PA 3ND6A 3EVTA 4HRYA 1NVXQ 3TBKA 1GOTA 3WHKA 2F2TA 4U9IS 1OFHA 4ZI3A 3ZWQA 3HXOA 4L9RA 3L0PA 2GVNA 3DZDA 1DDIA 1BEZA 3RAEC 1YV9A 1XMQB 3IEUA 1X87A 5J4HA 4EG7A 2QMYA 5EGSA 5EPUA 5TE9A 1PL6A 4RV4A 2OV8A 3U4DA 2PGLA 5A6SB 1WW3A 3TVYA 1VCNA 4CIXA 4EITA 3U3MA 3IVGA 4LXIA 1OX4B 4UU8A 4RZSA 1PKEA 1I33A 1SIBE 3GGCA 4KBGA 5HBRA 4G65A 4BVLA 2ZSDA 5H4GA 2DR0A 1FVOA 3C5HA 1KJYA 2C5SA 1AS2A 1KSFX 1Q22A 1IPHA 3R44A 4W9NC 2YZGA 4J7UA 3NKVA 3OE7D 5CITA 3FCYA 5LJIA 1M1YA 1U8CB 1QLWA 2BBTA 1NOKA 2ASEA 2AHOA 1HRDA 1AE1A 1OA0A 3FDFA 3A70A 3LOPA 1FUYB 5IUKC 2Q5LA 4JYCA 4KRXA 5T8KA 1DX4A 3WIUA 3IALA 4RHFA 4IXDA 1PNOA 3RREA 2YXLA 1VP3A 4NECA 3VYUB 4MEJA 2VXCA 1KRHA 1W73A 3I2HA 2Q28A 2O2SA 4Z5XA 4XTCS 3OO0A 2GN2A 3N2YA 4I3HA 4K5QA 3AEKA 1YQDA 4BXOB 1ZY2A 3N2ZB 3VU8A 4MEBA 1Z9BA 3SDBA 1JAIA 2WJPA 4C03A 1SU4A 3RC1A 2WR8A 3NM4A 3AKZA 1MX5A 3GPDG 3S29A 2W6IA 3OEHA 2VH2A 3H1GA 3QWBA 3KAJA 4H17A 2JKZA 4BOYA 2RC5A 3N9IA 5A9TA 4Y6PA 5P8WA 4MUYA 1J6UA 5IRCD 4QZVA 4MH0R 3J81A 4RZUA 2B5VA 4P54A 2P0AA 1S89A 5EWMA 4R2KA 1RACA 1YAHA 1NRXA 3MSXA 1FYEA 3RFCA 2IZOA 2WYHA 1ZVQA 2C78A 3IGFA 1AKRA 1R00A 2RAPA 4IGAA 4ZHQB 1X8JA 2Q41A 3UG7A 2C5LA 1MG0A 2RGGA 2QDXA 1ZU4A 1JJFA 4LWZA 3SDZA 4F1JA 2NVUB 3HU3A 3N5KA 3KETA 1DC6A 5CW1A 3L7OA 2IWRA 3L04A 1WU7A 4E5PA 2QHXA 6Q21A 3F7MA 4XJTA 5FIUA 1LBIA 1F4PA 2BEKA 3Q3JB 5B3JA 1LF0A 4BUJA 4EI7A 4DEYA 5FAXA 4IMJB 4HAOA 2HMSA 4MS4A 5AMXA 1HI9A 1VFNA 1TLTA 1E9FA 5B3LA 1L7AA 4RHUA 1KE2A 3LVRE 3BTUA 1FTYA 2WWXA 3BICA 1E1KA 2XHEA 3PWTA 4HYQA 4KWCA 1J5EB 2UYYA 2DOKA 1KY5A 1O95C 2NYAA 3A3OA 3AY7A 4UKDA 2FR1A 3T0IA 1X80B 5EPOA 3ZGOA 4MIEA 4LC0A 2J6HA 1X6VA 1JQEA 2W93A 4RVFA 3RIGA 4E4YA 4QAJA 1Q0LA 2E4XA 1VCIA 1GQFA 2CNNA 2C5FA 3IAEA 4ZO6A 4JELA 3VFDA 1HNNA 1UM9A 4YJ3A 3C8HA 1R27A 3VYTB 1CS4C 3ZCQA 3A8TA 5ARCA 5AJWA 1IOVA 3W3AD 3AC0A 3DL2A 2R6R1 3ENWA 4JBIA 4B0PA 5KTNA 2IXEA 4RHTA 4F9GA 4UQLA 3E82A 4JI7B 4M9RA 1G6OA 3TZLA 2I33A 1A98A 2RHWA 1IWOA 3LI2A 3VX3A 2H1OA 3GJYA 5HNKA 1W0KD 3LOQA 2GCIA 2JGFA 1ZJ4A 4Y1RB 1XU7A 4ND6A 2UXBB 1I13A 5CBKA 3SXJA 1B93A 5DCLA 4Z49A 1IJEA 3M3HA 2I6GA 1NNLA 1ST3A 3TOVA 4L57A 2RMKA 1VGVA 1ZIPA 1WQ1R 1FE8A 4P7BA 1RLUA 1NZDA 4WFJA 1SUIA 3PJDA 5LQSA 3I61A 4WJLA 4DCTA 3I8OA 1SBYA 2OVBA 4NK5A 4ZJPA 2GNOA 3F74A 1WL8A 5IF9A 4FZVA 3EEBA 2DWQA 3K9QO 4ZQEA 2OQRA 3B51X 5FYDA 1LDBA 1ZWLA 4E94A 1GL3A 1VE5A 4WCFC 3RS7A 5TIIA 2BGJA 2O2IA 3SX0A 1DAFA 4BYGA 3OLWA 2QMEA 2O2XA 4RMIA 3COZA 3SQNA 5KSZA 2FWJA 3EXG1 4R9UC 3RCBA 2Y05A 5DYIA 3MFQA 2XB6A 3PB3A 3HDVA 4HFNA 3OPYA 4Q4HB 4GWKA 1MF7A 1QVAA 1QU2A 1N7IA 1T36A 3BF7A 2QP3A 1TT5A 2RH5A 4NWIA 3KB2A 3T4XA 4IZ6A 1WM1A 2YYZA 1PSWA 5FUBA 4RMHA 1E7RA 1UH5A 1XWWA 3WHPA 2IELA 3EAQA 2GHTA 2BRUA 1DG3A 3PFNA 2FWBA 3PPWA 3I32A 3GRFA 1AUOA 3DBIA 3Q88A 4RPHA 2KHZA 3FNRA 3B5EA 4TLLB 2RKWA 4HRXA 1M2JA 1IZ9A 3SIWA 1EK1A 3KHKA 2PGOA 3P2JA 2QA5A 3BILA 1VJDA 1SOUA 2ZK7A 2BMEA 2VT3A 1W30A 1TCAA 4O4JF 3UJ8A 1CULC 4L85A 2O8BB 1MH1A 2WICA 3PFCA 3GMIA 1XNGA 3V97A 4F1KA 3PC2A 4DIFA 1SCQA 4DNPA 2GA9A 5KBYA 4UC0A 1RRVA 2VXBA 3QITA 4R2JA 3STYA 3TL3A 1B8PA 1GQYA 2QEQA 4LJSA 4WCVA 1Y8QB 4YV1A 1SC6A 1QVVA 4KAXA 4QSHA 4LVNA 3V8EA 2V6MA 2R00C 2XYHA 3IC5A 4DW8A 4PN3A 4YAKA 1DZIA 1AXGA 5K8IA 1YS9A 2ZI9A 5TSDA 3TW4A 5JAOA 1XA3A 1T9HA 1DDOA 1GSOA 1LTHR 2QN2A 5DF1A 1TE2A 3WGKA 2EJCA 4R2IA 3R7WA 5KTPA 2IU3A 4B40A 2CVHA 2DPMA 3HCRA 2A0XA 2VYCA 4FZJA 4ZODA 4IAOA 4AXBA 1WUJS 2EXXA 2ZSJA 4XIIA 4OB6A 4DHWA 4KNYA 2I8AA 3CLRC 4PNZA 4C4RA 3U61B 5BO5A 1V8PA 5D86A 3WZLA 4BX2A 7ADHA 5KSYA 1FDSA 2QTGA 4D0SA 4BFYA 1CP3A 3EBOA 4C2TA 3KUDA 3I9NA 4FSXA 1KFBB 3R3YA 2F59A 4ZANA 3BFJA 4DN6A 2QK4A 1BDJA 2P9JA 4M9SA 2C20A 4R2MA 3U39A 5HXAA 1E1YA 3TS1A 3F6YA 3OIVA 1VJTA 3AW8A 1GU1A 1L4FA 4OU4A 5JWRA 2HB6A 1OX4A 4DQUA 4QG3A 3PZBA 2PLFA 2PS0A 3AF1A 5HRUA 1C30B 3BTOA 1CWUA 3KQQA 3D31A 5B6JA 1H4VB 1N6KA 3CUTA 1I51A 3FUCA 3GVPA 3MTAA 4D92A 4P98A 3AL3A 2P4EA 4U9UA 5LP1A 2QTRA 2ZTVA 1JEDA 2JGNA 2L2QA 3RS3A 4LC9A 3S27A 1FA9A 4B3CA 2ZBPA 2WIFA 3GJSA 4BL5A 4BBAA 1Y5IA 2RHTA 3DUFB 4C0AC 1C2YA 4A2PA 4XIJA 5I9SA 1CIVA 2D59A 1FFEA 1GDHA 5TPWB 1LK5A 1IOLA 1MIHA 1VMEA 2AUNA 5TQJA 5DNVA 3HDYA 3VV3A 2Q3CA 4NENA 3GEHA 3GYBA 1GUAA 3BZUA 1Z38A 2OSBA 4WN9B 4XJSA 3ZQJA 4ZCMA 5LZ5A 4BQQA 5JSHA 3WFIA 1CP2A 2I7VA 2NPIA 1JFSA 4XWWA 2BFWA 4AY2A 4KXVA 3P4UA 4UMVA 1G4AE 1O4VA 2BBWA 2FDRA 2O0HA 2G08A 4U7FA 2PZLA 1Z08A 2AR7A 1NMSA 2VAWA 4HTFA 5EZQA 4MUXA 5DM0A 1TTTA 4D0LB 4IJ6A 3V1YA 1RJ9B 3ZU6A 3T5GA 3OZIA 3R9WA 3X3HA 1CY4A 3KTAA 3PGLA 3TR5A 1OYVA 4KAFA 4R2HA 4PN7A 3AOEA 3QTLA 1LU9A 1IXYA 1QHHB 1B23P 2XCUA 2WD9A 3AWDA 4KN9S 4I3GA 4TS9A 5B3JC 1ZYUA 5JPCA 1JZQA 4M49A 1SOWA 3PT9A 5EWMB 4N3BA 4AZ3A 1XAHA 1ZNYA 4Y2JA 4BCBA 2FWAA 4OOEA 2YVLA 1CERA 1KVQA 3JD0A 2OFPA 4MV1A 4QIHA 3DLPX 3EWSA 3KRTA 5FHRA 4CKXA 4W5RA 3NLLA 3WOHA 2PH5A 3B38A 3DAOA 3R77A 1FDIA 1R6XA 4Y2HA 3VU0A 4DNQA 3K71B 4M8SA 5DGIA 5G0SA 3QP9A 3TRHA 2ZCUA 3G8BA 3PHGA 2VHUA 2QXYA 1JZSA 2B7BA 3G0DA 5EYPA 5IMBA 4CM9A 4D9NA 3DDZX 3BK1A 1UK9A 2NADA 3NT4A 3K1JA 2P1ZA 4ER0A 1SGWA 3ONNA 2FUEA 1ZRMA 1Y8ZA 4G85A 1EK2A 1JR3E 1TYAE 5GQSA 4BFZA 1WUTA 5D5PA 4B1FA 3GNQA 3OQMA 5DTQA 3OCVA 2ZB2A 3ANMA 4AWXA 2ONCA 3ZG6A 2BRUC 5CYGA 3AUAA 1PF7E 4ZMRA 5AHOA 4P2GA 2QTTA 4O59O 4ZOLB 4GBED 1RHUA 2OYRA 5C2JB 2H57A 5ICGA 3O73A 2ORYA 2V6BA 2CJWA 1RBQA 2M98A 2VEDA 2QR3A 2J09A 2ZYVX 3LOUA 4M0LA 2O5VA 5LA6F 5C1BA 4DG9A 3C1TA 3DEKA 1IWPB 5DBFA 1PX2A 2ZYIA 5KNCD 2V5VA 3BL5A 5ITZA 2PZFA 3OP4A 4DA6A 4H7DA 4LJYA 4J7CA 1UF9A 1EBUA 2VZLA 3GFOA 4V39A 4X9XA 5A3VA 2VF4X 4FMDB 1D4FA 3OZFA 5B7GA 3M5WA 2A33A 4ZPJA 4OATA 2R66A 2R1TB 3OE5A 4NU0A 4Q66C 1U0LA 4RY8A 2PNFA 1JP7A 3MJDA 5DIFA 1EWRA 3U3OA 3W5UA 4IOMA 3GZNA 1SBNE 2VSOA 1HMYA 1U1CA 4X7BA 2P6OA 3MK31 3C87A 1E5LA 4JXJA 3T1VA 2PSDA 3WFJA 2LDXA 3ETDA 5EERA 3ESZA 1WNTA 1J21A 3IO3A 1YH3A 1GKKA 3IUJA 2DWPA 4NHOA 3HA2A 4U7HA 5FOXA 5CT5A 4R54A 3PD0A 3HLYA 1NJ1A 3NX4A 3AUYA 3IPXA 2JA2A 3G0GA 1T5IA 4BJHB 5LLTA 1WO8A 2WIKA 1MZVA 3R6GA 1GLGA 3AFOA 1PR1A 4NBSA 1MP0A 1NSYA 4FONA 1EVYA 4PBTA 3L6OO 3WHIA 1SO8A 5J5AA 3OQPA 5KQRA 2BR4A 3Q0TA 3G6KA 3GGDA 2QX6A 4DKJA 1RPTA 1O5OA 2JARA 4Q4HA 3TLYA 4G1UC 3DE3X 4OFZA 5C52B 3J81k 3UJNA 1KQNA 3K70B 5DHRA 1YHZA 5FNVF 1M6EX 5C5IA 3ORFA 4M1OA 2JD0A 3WGIA 3I2KA 4Z0NA 1Y1SA 3RVOA 1TKRA 2H1SA 4UD6A 4IPTA 1U8UA 3K1YA 2DBRA 3K6RA 4BB6A 4N54A 5FRDA 3O1IC 4TLBA 1J8VA 2I1LA 1DJNA 2F3TA 3KZXA 4NBWA 4JXKA 1K6MA 1GZSA 1Q7GA 2FMUA 2NO4A 4AO6A 1XXLA 4RZIA 5EP2A 1FUIA 2FRDA 3BE6A 2I54A 4R31A 4CM7A 1MLDA 4CEJA 1VIMA 3AVPA 3KU4A 3N2IA 5HZMA 1KMCA 4H16A 4J0QA 3LQKA 3PPVA 2IX9A 1AKVA 1M2FA 4ZOEA 1ZL2A 4CM8A 3RUHA 5CD1A 3LQ4A 2VUUA 1GTG1 1CUCA 1W44A 4XGKA 2FPGA 1NVWQ 2FKNA 2OHJA 2Z08A 5JALA 4KRGA 5JMPA 3RVMA 4B46A 2I7TA 4I1SA 3LTNC 2FJ0A 3LRXA 4BMNA 1GM5A 2ATCA 4BE9A 3HKBB 2C2HA 5ELLA 4I4LA 4LV6A 5JOQA 1U7UA 1RU3A 1CLEA 2WU0A 2OXFA 3R6DA 4Q3EA 3SJBA 2DPHA 5FUVA 1FXWA 1NVEA 3ETJA 3IOMA 6REQA 3KYCA 3PFKA 1U9IC 2HLDD 2FUNB 3I0MA 4XCXA 1XKTA 2AUTA 2L42A 4HI0E 1GEEA 3GK3A 3NDBB 2WSSA 1EP3B 3II6X 4R0NA 4ZREA 4Z3KA 1T26A 4E13A 5HJEA 4RULA 3DE6X 4RJLA 1COWA 1Y4SA 2BHLA 3NBQA 4KR0A 5FOQA 7MHTA 1IEVA 1PFVA 2AUMA 4UQOA 5JRZA 2D1YA 3TEJA 1M33A 3MLAA 3PFFA 2G5TA 1K5GA 1ZGCA 2V7BA 1U90A 2Z2XA 3A3YA 3O4HA 3GR6A 1DTWA 4MKXA 5EPEA 3TMKA 4F3KA 3DEFA 4N3CA 1CR4A 1QG4A 3AUKA 2HDHA 4C7XA 3JX9A 4KGDA 4W8GA 4EW3A 4C0WA 2BGIA 4AZSA 1GN8A 4QTUB 1R8XA 4DUYB 3VPXA 2SBTA 3FPKA 4QODA 4M0MA 2QL6A 2NZYA 4G67A 1HLDA 2WU1A 3I9V6 3KEQA 2NVBA 3OG9A 3QVWA 1TM5E 2DP4E 1KAHA 3FVTA 2AVNA 3O1LA 3HU5A 3LC1O 3DYIA 3U7QB 1XMOB 4BNXA 4QPDA 2YCLA 3IEXA 4G56A 3A36A 3R9KA 2CNBA 3EZ6A 2WKRA 1U2PA 1OA1A 5H70A 1B00A 3TDMA 3TTUA 2XKKA 4Q1FA 3CVXA 4P0PB 3W8FA 3OX4A 3B1KA 3KYIB 4BNVA 3T1HB 2Q62A 3SXPA 4BTEA 4D97A 2ONKA 2JVIA 4G37A 4HSGA 2H00A 3SHTA 4N4AA 4ABYA 4DVJA 3CVWA 4WOKA 3MG9A 2NIPA 3JALB 3ZHZA 3WYEA 1AH2A 3ASYA 3GLTA 3GWGA 3G2IA 4AY3A 1Z15A 1V5WA 2A5GA 3NGLA 1UFKA 3U16A 5DYNA 4DIEA 2VH1A 3BE8A 3N0WA 3CFYA 5E3HA 5A0TA 2PWYA 3K0AA 4YAIA 2IUUA 1WABA 3TJRA 2F1IA 1JX6A 3LWZA 1E1RD 4NYMQ 4Q9HA 1REQB 2HJSA 4NV0A 3NG1A 3ZCSA 3AFIA 5CNIA 4K9LA 1DFHA 1CKEA 4GGOA 3WLKX 2UZ0A 3RU7A 1CF2O 5JZBA 3F97A 5JDIC 1LV8A 1WXFA 2PIAA 1ADFA 4FKMA 2HJ9A 3RV3A 3NALA 1CEYA 2QBYA 1QHNA 2Z6QA 4CDNA 4E5DA 3IURA 4GKAA 4Q00A 2IOYA 3P9IA 8GPBA 1P18A 3W3AH 4ZOBA 1UJBA 3C5WP 5IK2A 1U0GA 3H3JA 4OH1A 4CTOA 4OI4A 5K8JB 3AHCA 1ZD1A 1N34B 2XTNA 1KKUA 1M0SA 3W3AA 4ZK6A 4IRMA 1S02A 5LQKA 3ESAA 1U7TA 2FP4B 2QSZA 2VZEA 3GRYA 1XX6A 4WOCA 5B58C 1XYGA 5L8VA 2QI9C 1EXDA 1FRZA 4I55B 2BAGA 5AOAA 3RRYA 1OI7A 1TK2A 4Q4LA 3IDAA 4EY4A 2QZ4A 3CNBA 2FN3A 1U3WA 4K0RA 4XEUA 4F6RB 1TEHA 1WXDA 5AM0A 2YWXA 4BO2A 5IDWA 4AX4A 4CL8A 3T5AA 4GH5A 4R98A 3OOJA 3WGGA 4IWYA 5EXEA 4LZJA 2J0UA 1UDCA 1CE8A 4HDRA 4RC9A 3CVUA 2C9CA 3G5AA 4QKQA 1V71A 2RONA 3SAJA 4PAQA 1SBQA 1D2EA 5DWVA 1KYZA 5KTKA 4BO6A 1IQUA 2GFHA 2FG5A 1QE0A 1ADJA 1VPEA 3N05A 4MAFA 4Q3DA 4PAMA 4Q48A 4ZOLA 1CFZA 1Z56C 4L5AA 1EVJA 3T7RA 1J9GA 2RAUA 4OY3A 4CCYA 3KIPA 3GLFB 2NP7A 3QVXA 3RYCA 3IQGX 3T3HA 3LK6A 1OLSB 1P60A 3U2QA 4DWVA 3B6JA 3S2GA 4A5OA 4AQ7A 1DWUA 2FPIB 2OFWA 4YP0A 4J94A 5F33A 2P3QA 5EUQB 1LS6A 1LVGA 1OI3A 2RG7A 2X14A 1LSSA 4Q3BA 4D8XA 3C48A 3EGWA 3IUYA 3ILHA 2XCTB 1HNWB 2Y8EA 4LY0A 2HHCA 1NW7A 1GGEA 1G60A 3EC2A 4UUQA 3D5QA 2GKGA 4J07A 4AECA 4DF3A 2CYCA 1SKAA 3V8MA 1GCIA 3LDUA 2XLBA 4S0ZA 2I2DA 1UK7A 3FNEA 3L6CA 3WQHA 5M04A 1GAXA 1MPTA 3PL1A 4W9MC 4K3UA 5FPKA 1RAHA 2I6QA 1KFEB 4LOHA 2IU4A 5CX1A 3GRUA 4Y9DA 3ZEAA 3ADBA 3I5UA 2PD3A 1WY5A 4DJFC 1OWNA 2WVGA 5AUNB 3K6SA 1PS8A 1Y3CE 1F48A 2C04A 2HWXA 3AJAA 5F12A 2QN6A 1JZTA 2B8EA 3FUWA 1T43A 3O7MA 5FUQA 2X1VA 2QD5A 1G8JA 3JQGA 1U2GC 1GITA 2YHSA 3RJTA 3JQ8A 1XT6A 3FVVA 3LX4A 1W25A 3C7CB 3DVAB 4JH0A 5CPFA 1ULUA 2VNHA 3KJQA 3TNLA 2C8JA 1NTRA 3OLQA 3ET5A 1U3TA 1VLHA 3GCDA 4PS0A 5E7JA 1XDWA 2HPVA 3EFBA 3RYHB 1CVIA 2Y66A 3TFQA 1S01A 4XCQA 5BRNA 1Z88A 2OPBA 4LEIA 4QJ5A 3RASA 3UOWA 1IXRC 3MGCA 5GWXA 2QUKA 2ZJ6A 2I1QA 3QXXA 5EKUA 3OWOA 1QMGA 3ZGNA 1NBAA 4FC6A 2PZJA 1JB9A 2X1MA 4LJ4A 4R1SA 5KCMA 4WEOA 4M7OA 3WGYA 4ARSA 2HWWA 2GN0A 3KCNA 2HMVA 1FF9A 4ASUA 1DCTA 1JDPA 1MT3A 2C00A 2PVSA 4M38A 4CMHA 1VE3A 4GIBA 2PL1A 4PX2A 1YZHA 4A8PA 4DC1A 1YOVB 2G36A 2QR5A 3K09C 2FG7C 1JMKC 4GMXA 3VO9A 1FXSA 5BPHA 1AQJA 4LXHA 1G21A 3PR3A 4G8DA 5C51B 2CK3D 2XEDA 4CF3A 2K87A 4UAVA 2CFCA 1SEPA 1XMXA 3GVHA 3A6JA 1M0TA 2GO1A 1GTL1 1KJWA 2BCEA 3DBLA 2C5AA 3O90A 4BN0A 4ZKDA 1JH9A 2BMFA 1PE0A 4KK4A 4GLJA 2FSGA 1L7EA 2OM2A 2NO0A 3L7CA 3W7VA 5LMZA 3TH5A 4XWTA 4OQMA 3DWEX 2G83A 1CDZA 5HCNA 3ZQKA 2FY8A 3HVJA 2FSFA 2C29D 4Y0VA 1TYCA 1TAUA 5EEGA 1RKXA 5C5CA 5IC4A 2ZYAA 3K9GA 1LSOA 1QF7A 3U44B 1ZGJA 1Q2UA 1WVIA 5DCUA 4AMGA 4GX0A 4GQIA 2BFDA 2EJWA 4EMTA 1MGPA 1PJTA 1N1DA 2X9NA 2O2GA 2FGJA 2ZJYA 5K05A 1SUPA 4Q4DA 1RMYA 2GJKA 3C3AA 3T1TA 1EFRA 1KERA 4IGFA 3FW1A 4CTNA 1JFTA 2G0AA 5EIOA 1N33B 2Z8ZA 1RXYA 4RHYA 3NBMA 4S05A 3ZDCA 1DTWB 4HDSB 4TRMA 4BPRA 4TZKA 2IZ6A 4KGZA 4B6GA 2ZP1A 2W4QA 5A4MS 3BSYA 4XX1A 3CW2A 5EJ8A 4PG5A 3CBGA 2FMKA 2PTGA 4HLQB 4K6OA 1JR6A 1VHDA 4B3HA 1T29A 1YOBA 2P8SA 4EI9A 2HHHB 3Q8MA 1G3MA 2O9JA 2IKQA 4F2GA 2VXYA 4G0MA 1Z0AA 1WZCA 2CXPA 1J1IA 4DL9A 4AKHA 3IA2A 4LHVA 1KFKB 5D6OA 3T9CA 2VJQA 1BGVA 1JHOA 1HURA 1XU9A 1H9BA 4EVQA 5B37A 4FOPA 1D1TA 4TLDA 5DBGA 3PNBA 2WPNA 1UWLA 3A2MA 1DIOB 4PY2A 4ZALA 2G71A 3DVLA 3DMYA 1R74A 2IZ5A 1VE6A 4KYUA 2B0JA 3KPVA 4RKYA 5BYJA 1V39A 2C7PA 3ECSA 1J24A 4ALMA 5I7RA 1FFAA 3MUNA 4MAAA 1J8FA 3HCOA 1BW9B 2JFNA 4KKVA 4TYPA 4QXRA 3E9ZA 3MSCA 1AOXA 1AA6A 1CJMA 3AVOA 1VRCA 3IAS1 2Y2VA 5CIWA 1M2VB 5HDBB 5T6BA 1SQ6A 3GGGA 5KKNB 4D8VA 4OXKA 3H5WA 1DAEA 1MN6A 1SN7A 2TECE 5ENVA 2D54A 2JGJA 3EDOA 3MUEA 5JAPA 3AYZB 2JC3A 2XA1A 2O8NA 4ZVPA 4F46A 4MZDA 1F17A 3TUJC 4KQFA 2JCXA 2NPOA 1AZTA 2C95A 1P31A 3CA8A 1XZHA 1ISPA 2R00A 2BLLA 4MPRA 4DDWA 5EJ6A 1U3GA 1VKJA 1ZM3A 3MMNA 2YZKA 1JJBA 4BAGA 1U9CA 3EDMA 3B85A 4LI0A 3FSEA 4BZPA 4AKTA 2D2IA 1IBRA 1T34A 3HC7A 3MJCA 3S2YA 1OBHA 5DU2A 1G8GA 1X2BA 3N5CA 1S3GA 3L6UA 3U4CA 1JVSA 3AERA 1THMA 5AK5A 3SZLA 1KY2A 3IFSA 4GM0A 2DULA 4B47A 5JAMA 3GBVA 2UKDA 4AW9A 1K2WA 4C0BA 4ZI7F 2CCJA 4U00A 3T1QA 4HWGA 1U2GA 1XZPA 3SZ3A 3CJTA 1YZVA 3OPVA 3I9MA 2O50A 4REQA 2Z2YA 4D4GA 5LKAA 4JZKA 4P4SA 3PQ2A 2EYUA 2PK3A 4JLSA 4ZVNA 1W34A 1WRBA 4RZXA 1XRMA 1NVDA 2X8JA 3PRYA 4WCFA 4CQLA 3GFPA 2BEWB 2XTZA 1CJBA 1BEUB 4G9GA 1BA2A 2ZBFA 3PV0A 2G7MC 4L5JA 5JXJA 3FJYA 4FKBA 2Y92A 3DC2A 3X2SA 3PUVA 2ZLBA 3H2ZA 4P93A 1I1QB 3L8HA 4QJBA 3KZ1E 5I3CA 4CODB 3S8YA 1YQXA 3GY0A 3U09A 1N77A 1J8YF 1AZWA 4BECA 5KYUB 4L95C 1TEXA 3WLAA 5CH3A 4FU0A 3C6BA 3TAXA 2DFLA 2IGBA 4HUJA 4RH1A 5AW5A 4C3VA 1N2IA 4NYIQ 5BUZA 1JDBC 1UJ2A 4NCBA 1EFVB 1Z6PA 5H8WA 4BMPB 1NUAA 2GKSA 1JEOA 3CINA 4NAUA 1KC3A 2AVDA 2HGZA 4UAJA 1T1GA 4CCYB 4YYZA 2GJ9A 5L4NA 4XI9A 4KHZA 2C98A 1CUSA 4GU5A 4CV3A 2K6GA 4JLVA 1A3CA 4K8OA 2BMVA 2OORC 2Z2JA 3WADA 1SKQA 4TYYA 4LVCA 4ZGBA 4MR7B 4C7OB 3AVVA 2YJ6A 1KI6B 3PUHA 5KQLA 4F45A 1BTOA 1P9WA 3ZWBA 4YV7A 3VISA 1MNAA 2OUKA 1JG7A 1XXHB 2WIGA 3TGLA 3ENVA 3PX2A 4BGVA 4G1VA 1Y33E 4PXYA 3LGSA 1DXQA 3IR5A 1C0KA 2C31A 2VZ8A 3V32A 2CLIB 2JGMA 4HADA 3L8ZA 2JJ1D 3W04A 1W75A 4FLFA 1X7HA 3RJMA 3UK0A 5ARDA 4B6PA 4Z4EA 4UTVA 1JLLA 2BI4A 5HF6A 1KAMA 4PNHA 1A82A 3AHFA 4LVOA 2XF2A 3FIJA 4IJUA 3MYYA 4AURA 2R0QC 4FMCB 1Z8NA 2XXJA 3SBDA 3VU1A 3L5KA 4HNUA 4EJ2A 1VI2A 4KSCA 2AXPA 5CCEA 2PA0A 1HSOA 1WMBA 1OBOA 1W5AA 2XB9A 2BR3A 1CFJA 3EEQA 1Q1NA 1TM1E 2ZB3A 4RADA 3OIFA 4E09A 4QUEA 4ZYYA 2CLLB 5DYTA 2I0FA 2FR8C 2FUKA 3OA0A 5JWHA 4D1YA 1H6BA 1FJXA 1D6MA 4GEKA 1TZJA 4GZ5A 1YRLA 4TTSA 2R25B 2X5KO 3LHFA 3UB4A 5BN3A 3O4FA 1Z29A 5DTJA 5EN4A 4UOQA 1P6QA 3D8SA 1J06A 1JLSA 3ESDA 2J9GA 4JJ6A 4JI6B 4BDSA 5FTMA 3R9IA 3H9BA 1MFZA 3EC7A 3PIRA 5AHWA 2V3CC 2QRVB 2YWDA 3HCEA 3HYNA 3Q87B 3KLPX 4NU8X 1UBEA 3ELUA 3JQ9A 1P74A 1UJ6A 3NWEA 1Q44A 4IXNA 4L9AA 2AGVA 3BORA 4U2CA 1WETA 1LPMA 1PJLA 5C7OO 3IT1A 5K3SA 2LVBA 4YP9A 3KKQA 4RESA 2WHQA 5TS3A 2DCUA 4L4ZA 3RPEA 3WK7A 2QN3A 2C2YA 4MI3A 2PUAA 1RYBA 2GPBA 4DNFA 3O8QB 1JRLA 1BXKA 1EM8A 4OA8A 3OEEA 3OOYA 2XQKA 8OHMA 1Z83A 4NNPA 3ORHA 2H1RA 5H59A 2OEPA 1GV0A 1E1RA 1XXHE 1KEUA 1M7GA 2JIZA 1BROA 5NLLA 5A4FS 1NMZA 5T8KC 3UV7A 3DCJA 1VIVA 2HO4A 3F3KA 2BGNA 1S7GA 2RK6A 4HQ0A 3ZH9B 4Q9IA 2W6MA 4LF4B 5TGZA 3LP8A 4RF2A 4R5MA 1G18A 1MW8X 4NJEB 2GN4A 1KBZA 2PKEA 3H84A 4C3OB 3BXOA 1FDTA 4MAMA 1X7WA 2GARA 1GXSB 1V35A 2FCAA 3MTGA 3RANA 4JT4A 1U5CA 4DGQA 5FLEX 1ZO8A 1A5ZA 3IMCA 2QE7A 2DAPA 3ZTTA 1N0WA 4D6YA 1Y6FA 5CJ2A 2HUPA 3KM0A 2XD4A 3I5MA 4CM4B 1VL1A 3BE5A 4YJGA 4QDUA 4ATNA 4LOIA 1VL0A 4BY9E 1PGQA 4TWBA 3BZWA 3TW6A 2ZRNA 4F3NA 1BX1A 2QU8A 2WJYA 3UMSA 1T5DX 3V46A 2QPLA 3TWOA 1RVDA 4K2AA 3QU5A 2N42A 3I3OA 4QXAA 4XB6B 4QBGB 3B6EA 4DMFA 4WBNF 4ZC8A 3FDJA 2VP3A 2BL4A 3FWHA 4D4IA 3L40A 4PQYA 3AEQB 2MMGA 2Q27A 3E3AA 1DRKA 4CXMA 4OQ4A 5EA2A 2WKPA 3AOGA 2VPXA 3F4KA 1KP3A 4GVPA 1BEEA 4P32A 1MNQA 5AVRA 1UP6A 4ZJYA 1NUUA 1Z62A 3ANSA 4D0RA 3MPUA 2C3OA 2OWDA 2JPDA 1X0XA 3H11A 1B0UA 4Y6QA 2P62A 4MA0A 4R68A 1V8DA 1DTEA 1FFWA 5CXQA 1PR3A 3D4LA 1GG8A 4YJFB 2AD1A 5FPYA 2O0KA 4PAOA 4TUYB 1FFDA 4IIXA 1W46A 3GFGA 1AZLA 2PBRA 2ZPTX 4P1ZA 3I5XA 2FW8A 2PMDA 3FUUA 4BMCA 2E1RA 4DXAA 1GVHA 2O0MA 2VHTA 4R7GA 3T94A 4CZ2A 2Q07A 1I9CA 3ASZA 4QPZA 1CVLA 3OX3A 1XGKA 4KDFA 4P7JA 4XLLA 3FWNA 3TIXB 4E5NA 3KCQA 4NU6A 3EAFA 4UNQA 3CXUA 2QJFA 3SEFA 5IAEA 5A1TA 5BN1A 4LGVA 4P82A 4WKCA 3ZE8A 4US2R 1NGSA 4PNEA 2QRJA 3ZE9A 2R6FA 1KY3A 3NJ8A 1CF4A 2QMUA 2PGIA 4H77A 1KMNA 5JYEA 4DDMA 2YVUA 3KX2A 3AERB 4O0MA 4CL3A 4Z6KA 5DP2A 1N2EA 1EVEA 4IH1A 4IM7A 2KLHA 3M4JA 3GUZA 4EA6A 3I64A 1XCJA 1OLUA 4S1TA 1YS6A 2FEAA 1IM2A 4X6UA 4YXFA 2YXEA 3G2OA 5IKPA 2P5TB 1JTEA 3MWJA 4AUKA 1RXIA 2XUPA 3GNTA 1QWSA 2ODBA 4OV6B 1XN1A 3FFTA 4DOMA 5L4LA 3TQFA 4FOSA 4BHTA 3GLHA 4EL5A 4YCNA 2WT8A 5JU6A 1SBCA 2QM3A 2HHJA 2GJ4A 2X5JO 2PS9A 2XCQA 4NJOA 1K7XB 1U31A 5IBRA 2X9QA 1K8QA 1EXWA 4EJ6A 2BEVB 5LD2C 3T5CA 2A9OA 3WYNA 2AMLA 1XB2A 1TM3E 4P53A 2JAWA 4IMPA 4HN4B 4Q9AA 4B3BA 2IYYA 3GARA 2FH5B 3QG1A 2LBPA 1IFXA 4XWKA 2GZ2A 3MXOA 3TTWA 2QRLA 3A14A 2JW5A 4JLAA 3JYOA 4JLMA 2ZAGA 1YI0A 1GFWA 3CH5A 4G0QA 6CHYA 3ZLJA 3IIJA 4OCZA 1ZHOA 2X13A 5BVHB 2OG2A 1ZH4A 4PCLA 2BGMA 3KQWA 3HPQA 4Q3CA 3PDIA 1ZPDA 1TCBA 3VYWA 3ZJUA 1W8DA 4J29A 2OV4A 2X3UA 1SEVA 4M7RA 4GOKA 5A5EA 4NZOA 2DY0A 3SEQA 1XN4A 1Z6YA 1Y7PA 1ZCJA 4RKQA 4YAFA 5K1ZA 1LPAB 4EHFA 3RUCA 4DSAA 4FEAA 1T5SA 1K7EB 1ZGHA 3DDUA 4Q93A 1MG5A 2J0VA 1VL5A 1C7QA 1V1JA 2DFDA 2WD7B 3M7IA 2GCPA 4ZQGA 5KDLA 1QB8A 4PLWA 2N1BA 2VHXA 1VB5A 1JLLB 2GO7A 2WEKA 3G2KA 3NAGA 4C6SA 5FX2A 4IQ4A 5EP4A 2H65A 1U04A 3D7MA 3X1JA 2ZJ2A 3ISVA 4MV0A 2GS9A 1AUPA 3CF4A 4ID9A 4MNTA 4ISBA 2NGRA 4MRVA 4DRXB 1VC2A 4MJXA 3F96A 3I8SA 3GPLA 3VDRA 4X6XA 1C1XB 1K5DA 3C3BA 4GZLA 3ABSB 4RVNA 2V55B 4UASA 3W79A 1ID8A 3GT0A 3RRJA 4IF6A 2W42A 2IYTA 1EI9A 2PKYX 1ZUHA 4QFBA 4KPFC 1CR0A 1ODFA 1SC9A 4J2OA 1B26A 4LRUA 2JJ2D 3GFRA 3UKDA 3M6VA 4DCNA 4HY3A 5IH3A 2EL7A 3KQLA 4XGIA 4PFKA 4WNIA 1EK5A 1KOFA 2GN9A 3TSAA 4FGUA 3UMBA 1PT5A 5C8DA 1RZRA 1FSZA 1OC4A 2OAGA 1MO2A 3AJ8A 5FBVB 3ER6A 4OHKA 3AGQA 3RHFA 3L8GA 5IYZA 4BU0A 4HDMA 1NBMD 4IOJA 3CSUA 4NZYA 4BKQA 1RFGE 1F8FA 2Y67A 2AEEA 2E5FA 4ER3A 2Q9UA 5IXJA 2C9YA 3BXXA 4JLPA 3COYA 5BNFA 1WQ3A 5CH8A 4RD6A 2VA8A 4ARIA 2XZTA 1ZGBA 1XPUA 4FMDF 3NEPX 2QN7A 5CDGA 1LPSA 3UAGA 3PL5A 3T12A 4ZRDA 2JBHA 1TAQA 2IP1A 1P5ZB 1TCVA 2OVFA 3RBXA 1W85B 2HQSA 4EY7A 5BRJA 4AP9A 3ESYA 1BSVA 2JJYA 4FI3F 1EQ2A 2P2ZA 1IHXA 3BGWA 4GR5A 5KMGA 5FFFA 4NEGA 5INTA 3H86A 5DLEA 2FK8A 2O48X 1T3HA 2NUPA 4OJKA 4OI1A 1GRNA 1P1HA 3MM4A 2N47A 3IOBA 4F06A 1XTPA 3F4LA 3HADA 1RVV1 4TSRA 3D4IA 1J8MF 3QLUA 1T8PA 2VNJA 4RH0A 4JHLA 4MUJA 4Z3OA 3OFND 1ORVA 4GXTA 3X1ZA 3TZBA 1I5OA 4K6FA 1YUBA 4JAVC 1AURA 4IIHA 4EL0A 2DX7A 1ISFA 1M9NA 2XNSA 3PA8A 4RK6A 1TJ4A 3OFJA 4QQNA 3Q7RA 2HKIA 2YWFA 2A9QA 4B6QA 3N2GA 4ZIRB 3SFVA 3LYLA 4GX2A 2DFPA 4GICA 3DLCA 4HDQB 2JCSA 3OETA 2PEZA 4TVKA 5G2OA 4XX0A 3R7DA 3WRYA 3ZZMA 3S81A 4YCCA 4QUGA 4RKWA 2FR0A 4DEVA 6GPBA 1IZ0A 3AF2A 2ORED 2AMJA 5BQFA 1J9EA 4P86A 1M76A 2HRBA 1QAQA 3R5JA 2JAPA 4PF1A 4DWJA 1II9A 2AYXA 1KETA 3OZRA 3HXQA 3VR4D 2J9XB 3EVEA 1FCJA 3SOPA 3W5IA 1P1RA 1U94A 4D3SA 3EA4A 4J0HA 5COQA 1AT1A 4YX9A 3C98A 1ZUNB 4EEKA 4R7TA 3ILVA 2FRXA 3N87A 2H52A 2AQIA 4M1EA 1Q7RA 2VP0A 5K0ZA 2PUCA 1HDYA 2EBUA 3F9IA 4WY5A 3PUIA 4QOHA 3UH0A 5IFKA 4DV4B 1MAAA 3WLJA 4KN5A 4D81A 3KT8A 1R6AA 1KI1A 3ON5A 3DJFA 5JCJA 1OD6A 1YZUA 1M54A 1VHTA 3C8DA 3OY7A 2JCVA 2BVNA 3WJ1A 3GUVA 2HA2A 4X1YB 1FDVA 2CFTA 4PPNA 3ZDZB 2GA8A 3HRIA 4GKVA 4C76A 4P9NA 2CSUA 4RLSA 1Y48E 1LWNA 3I6MA 4D5GA 4EECA 1J07A 1E2PA 2VATA 4FZ3A 2BFFB 3ASVA 3DXYA 5BQ3A 5JJLA 3E9DA 3OZSA 2WTNA 1JNYA 4HTFB 4Y2VA 1KOLA 2XUHA 3NHMA 3U7IA 1VKNA 3HM2A 3NJRA 1E64A 5EJ7A 2QN1A 1EXNA 1CJTC 2P9ZA 2PAAA 3IDQA 5A9SA 3RKSA 1EVQA 4KVFA 5AK3A 1XTJA 4IUYA 4N49A 4HYTA 2NTVA 5U4QA 1QHHA 3P97A 2HQRA 4A82A 2SKEA 1J0EA 5A2GA 5HQJA 2QMOA 2G40A 4AS1A 2NMVA 3PUWA 3C3JA 5AM5A 4ZTZB 4CT0A 1B7GO 3NEYA 5TQ0A 2Y3IA 1PLLA 3LBIA 4TKZA 4JI3B 5AM1A 4JB2A 5FO1A 1HF3A 3DC7A 4CM3A 3ZK8A 1WEKA 4OHUA 3SC4A 4JI8B 1QO0A 2YS6A 4WCDA 1IYZA 2DFVA 3COWA 4BS9A 3NWOA 4H7HA 3RI3A 5TY0A 5CXXA 4BUZA 3IIIA 1O95D 3ZQ4A 2HSEA 4WGFA 1CUEA 3GUYA 3WOVA 4LBYA 1XZJA 1HNXB 2IE0A 1BXRB 3OMWA 3EY4A 1C4KA 2D62A 4MUEA 5E7IA 4RQBA 2FX3A 2AYZA 4XW2A 4KAAA 1NUPA 3TM5A 3WGUA 1MFPA 1AK2A 1YVDA 1THTA 4RY0A 4YLGA 1M6NA 2HTFA 3M1YA 5DISB 3FMIA 3K20A 3C5EA 4M87A 1YJCA 1CY1A 3AQ4A 2XKJE 4KE8A 1WY7A 2ZBEA 1TPZA 1UPTA 4HWSA 3E2PA 1H1TA 2OESA 2P9YA 2OGUA 4QUIA 4E22A 2CV0A 2QVCA 3HL0A 3VHRA 4B3GA 1D5WA 1OWOA 1NQTA 2TRSB 3NPMA 4GL4A 3AGPA 4HZUA 3REGA 2QT1A 1PT8A 4OQEA 5EZYA 2EFCB 5I7SA 2PUGA 4WXRA 2OO3A 3HP1A 2RCYA 5KDDA 4RHEA 3O0DA 1K6IA 2PJZA 1NVAA 2V74B 4L4YA 5BR7A 5IBPA 2Z9CA 3AI1A 1ZR2A 1A1VA 1UC9A 2ILTA 3LWNA 3PQ8A 1QO0D 3BSWA 1BWRA 3C3KA 4PW0A 1R4MA 4OQNA 5LXTA 4U9HS 2FVYA 3QFHA 2I4LA 5HGJA 3TMAA 1N5JA 4EAQA 2BFBA 4ZC1A 1FP6A 5HF8A 2MSLA 1DT3A 1JFLA 4RELA 1T6ZA 3TKYA 1B8OA 3VPFA 2D1QA 3ZI0A 4RPGA 1Q2XA 3OTWA 4PHTA 5DK4A 3I92A 1Q77A 3KXDA 1QO7A 1SBHA 1RSZA 4E5VA 2J1LA 1EJ0A 2HU5A 1A76A 2RGNC 1GWNA 1PK7A 2PNJA 4DREA 4EMBA 5KNBH 4QGGA 3DWIA 4QATA 4OFWA 1UPCA 1OROA 2BUBA 1Z45A 2PJUA 3L1JA 3VKVA 3N0RA 4IOKA 1S3SA 3FCXA 5AJXA 4CKWB 4EGAA 2ECPA 2EEPA 3THXB 4RNDB 1OREA 4X8MA 1HTTA 4A8TA 3T0FA 3NDJA 2I6XA 3MVEA 4QG7A 2A7QA 3AEKB 3NVMB 1ZXBA 3HZOA 5K3FA 3WLFA 4DJEC 5J2UA 2IYQA 4PONA 3CEHA 4P8RA 4IXMA 2ZRIA 4PZLA 1ZISA 2H54A 2XMRA 4KH1A 2C82A 2EG9A 5HS4A 1CB0A 3O4RA 4BVAA 4P33A 3FGPA 3C6KA 3ONDA 3MWEB 1JLMA 4J0IA 2OG1A 1CJCA 3OECA 1L5MA 3F6SA 3R3UA 3SYRA 1ZN7A 1DUIA 4N47A 4WY2A 2HMWA 2JFPA 1L5SA 3TTVA 1Y3HA 2G9VA 1I6LA 2XWSA 4Z0TA 3H17A 1MV8A 3FIUA 3LQ2A 5FXMA 2I6TA 3K4QA 5TC4A 3WL7A 3FOZA 4LJ9A 4P0TA 1FOEB 3BMQB 3HYTA 5EIXA 1OB5A 4PSAA 2CB0A 2AG0A 1QFXA 2HF2A 1BVUA 3MJ4A 4YR9A 1C9JA 2WJVA 3AUFA 3ER9A 3RR2A 3MHTA 4YXWD 2PMBA 2ZB8A 4TMVA 3H04A 1Z4MA 1NBHA 2H18A 5AVSA 2QQEA 3YASA 1NQOA 3CE9A 3EXEA 3CX7A 2P41A 2IZ1A 4B85A 4FT4A 5KEIA 5JVDB 2O8EA 1CRWG 1NKTA 2QSUA 4FFNA 4IDBA 5IANA 4HDCA 4Z4FA 1A27A 2JEZA 1UDWA 2NXNA 4MTCA 4E11A 3E5RA 1X19A 2WF8A 3OFNA 2AZMA 3FBWA 2XYGA 1F6WA 3K32A 2E4UA 2Q50A 3OICA 1TL7C 1H0KA 4FYXA 4RLHA 3F7TA 3QI2A 4CIYA 3LY9A 4PRLA 3WNCA 1SCAA 2QDKA 5KHLB 4LGYA 5B64A 3GDOA 4PVDA 2HIMA 1RXWA 1MX1A 4LZNA 5FWAA 1E3LA 4R1TA 4BX9A 4LTNA 3TL2A 2G76A 4LK3A 2FZKA 1L0BA 4LF9B 4JUIA 1Z0SA 2HNAA 4OG2A 3WLTA 1GPMA 2PL9A 5DTRA 4ZP1A 4DJDC 4EUSA 1NONA 3CSDA 3P71T 3OIGA 3RTCA 2ISSD 2JGAA 2W6OA 3AV3A 5KX5A 2I29A 2C9DA 2IU0A 2BFEB 3CO0S 1JHVA 4TS4A 3GJRA 4KQMA 4WK2B 1YB7A 1WJGA 5ALUA 4Z9AA 3PKIA 4TWRA 1Q15A 2F7SA 2I4MA 3ZD8A 2J87A 1WA5A 1EUQA 3GD5A 3C39A 2G8NA 2QV0A 4PTYA 4UE3S 1DWPA 3E9CA 3GJXC 1NIJA 1QIDA 3IRVA 3VU9A 3ZUGA 4BVBA 2IBSA 1Y3AA 4NZZA 5SZKB 1THZA 3L8EA 2JGKA 3CNQS 2PH3A 3X0DA 2DQZA 2YDXA 5K0JA 1QRTA 2CXTA 3MD0A 4AN4A 3Q4GA 4M21A 4RACA 3I83A 4PLTA 3BQNB 2V6FA 1N1GA 4GSKA 1T9GS 4LHWA 4LZOA 4M9UA 1ZQ1A 4K40A 4MYSA 1O89A 1OFGA 4A2QA 2E37A 4EZEA 4GX5A 5LMNB 1QYCA 1C9EA 4BNTA 4H60A 1U11A 2C5GA 1V48A 4K9QA 2B1IA 5TGTA 2G07A 2QAGB 1O97C 3H2SA 4MARA 4L0DA 2BJHA 5G53C 3EPKA 3AKEA 3E7WA 3C3MA 4JSYA 4NFSA 5EE1A 1X13A 2WMOB 2NU6B 1ODJA 2WSSD 3ENKA 1PAUA 2VKQA 3CF6R 4HXYA 2OGSA 4J0KA 4MQUA 5JO9A 5C37A 4MV6A 2WU4A 2VF8A 1ID1A 3KL4A 3TO5A 3WO1A 4BFWA 4ZVUA 3NTRA 4D0NA 4JQOA 3UIEA 4EI2A 1NVTA 1UXOA 1O6FA 2YY5A 2PCJA 5DIZA 1S9HA 3O8BA 4IOLA 4S0XA 1EVKA 1O1YA 4TGLA 4YP1A 4YJ2B 2PH7A 3S2FA 4GP9A 3HV0A 2PBZA 3VSCA 1XEXB 5KNCH 1S2DA 3RS5A 2G82A 3JZMA 1O6GA 4MGHA 3PPXA 3BXZA 1FFBA 5LL6P 3A9RA 4QWMA 3OQ1A 3WGOA 1X1BA 3JZDA 1VHWA 5K3BA 3DV9A 4DUPA 2EBWA 2O3JA 4HVAA 3T5PA 4JKIA 3IMEA 4FYPA 4NFHA 3GG2A 3NT5A 4AUNA 4FCTA 3FHTA 3KJGA 3OTHA 5C8YF 1ZSYA 2QPOA 3MC1A 1Z3CA 3LLVA 4YRDA 2WIBA 1NKVA 4O8ZA 2O0LA 4CQJA 1ICEA 1CU1A 4LZPA 2N46A 3QW2A 2ZVPX 4RZ2A 5H4HA 5J1TB 5ILGA 1HNZB 2WDPA 1JQLB 1ZICA 2HN9A 4MPDA 3ILXA 1RIIA 1KEKA 1PJRA 5C31A 4MQ5A 5B1DA 4FTWA 2QS9A 3P2KA 2I7XA 3R5KA 1OTHA 2GERA 2AKAB 2H08A 2GCOB 2Z95A 3AY6A 1OLXA 2ZRBA 4RU1A 2NU8A 3ADDA 2IBMA 3L46A 4RFVA 3HSYA 5DT9A 2AFHE 3H3XA 5ADUS 3VTKA 1HKHA 2J6BA 1J09A 3VO2A 3SC3A 4LBZA 4NSNA 4DCJA 2ZE7A 2RHCA 3PD1A 3NTLA 1HT2E 4B7UA 4ENPA 2VTDA 3WSVA 2WTUA 4NXNB 1NX6A 1J22A 1PR6A 1LI5A 5BMVA 1JS1X 4XYMA 4TV8A 9ATCA 2HGSA 5DM4A 2BFBB 3ZZTA 1ULTA 3N8DA 8ADHA 5G1PA 1V11A 5IBCA 3QF7A 3EVCA 1SC4A 4FVTA 1UDRA 4JXZA 1YGPA 3IAUA 3OC0A 4IJVA 1RD4A 3VPDA 1Q0QA 4DBZA 1Y1KE 1OYOA 2YZMA 2Z6UA 3JZIA 1M2NA 5BVGB 4PO8A 2AOXA 2Z3VA 2EF1A 3AR2A 4C0JA 3PSAA 2ESRA 3DUFA 3WLMA 1YCFA 3DZCA 4IJWA 3GVCA 1X1SA 3D64A 2R8OA 5LZ2A 4B3DA 1KJIA 1M7BA 3CEJA 3OIDA 2BUCA 1XMSA 2WUFA 3QJGA 5A4JA 3EAGA 1ESEA 1GZ4A 4NENB 4CFYA 3PC7A 4BP1A 4D9CA 1VXRA 3R7LA 4YR7A 3NTOA 5D1HA 3F3YA 2J9RA 5E1OA 4FWIB 1BRTA 1LX6A 1JFFA 2Y1XA 4H1VA 3EDQA 3QEMB 1UQRA 3SYTA 4H18A 5BW8A 3UOAB 3I01A 1KTVA 3P4XA 3FYDA 2HHLA 5F4ZA 3AW9A 4F4FA 1PSZA 3FLEA 3BWEA 3RS0A 1E20A 3JARB 3BFXA 3ER8A 4PZ0A 5BWOA 2GXUA 1AQNA 2XXAA 4TLAA 2M1XA 1H0RA 2B5WA 2R5NA 4TS3A 3HDHA 1EFDN 2J3QA 3B3QA 4KLCA 4W7IA 1G2PA 4HEQA 2YUIA 3ITEA 2AWNA 4QU0A 3T1YB 5LQJA 1QPZA 1NBWB 2J7PD 3AR6A 3CZ5A 2GK6A 4J90A 2VHEA 2GD1O 3JAWB 1NDHA 1QG6A 3G0IA 2P7IA 3R0XA 4L8GA 1X14A 4R6WA 4NMXB 2RGEA 4OGKA 3S2UA 4C7VA 3LHDA 1D9ZA 3GLUA 5DLYA 4QOSA 4K46A 621PA 1EQAA 2D7CA 2OMKA 3SKYA 4RBNA 1SB8A 3O1HB 4Z7OB 2C9BA 3DBLB 4UQPA 1C4OA 1WF6A 4Z99A 3RYFA 1T10A 5AVZA 1GGHA 1G2OA 2M6SA 4TQGA 3EH1A 1LPOA 1RJEA 5FWDA 1O9HA 1M66A 4QAQA 4H7FA 3HBJA 2YVKA 2WYWA 3IBSA 4ZDJA 4CYMA 2HX1A 2VP9A 3EF3A 5HE8A 1H1LA 4JJEA 4YMSA 2WUWE 3IPLA 4FBMA 3N6VA 4UTPA 5AESA 3LC2O 1DKPA 2CVFA 3NWPA 1SULA 1N25A 5AO9A 3T41A 1GZUA 3WAKA 5K3EA 2V8OA 5CDFA 4I50F 4Q19A 5F1YA 5BXQC 3AF4A 3VR3D 3QBTA 5D85A 4RK1A 1E3MA 1P9OA 3HXTA 5JCZA 2FPSA 4DLTA 1JEYA 3D7KA 2CJWB 2YFKA 3QY0A 4NG4A 4YP5A 1WW2A 2GYWA 3WLSA 1QAOA 2II6A 1RXUA 3QHPA 3QGMA 1RPZA 4G2NA 3RUPA 3OVMA 5B7NA 1E6EA 2D2VA 2BONA 4LSGA 4LZAA 5KSWB 2ZJ7A 3DKIA 3UC5A 4BVFA 2XBUA 3TPZA 1PNQA 4HPWA 2BE9A 1UBOS 1US8A 3HNPA 3ZNOA 2YFHA 3QPBA 2WFLB 4PLGA 1BH6A 3ZGYA 1K3FA 2QM7A 2DPYA 4EABA 4ZQIA 1ULBA 3WDKA 2VDNB 2NTYC 3TXXA 5G0TA 4YMVA 2VWGA 3DR3A 3WQQA 5GZ1A 1V4VA 1GQOA 1RRGA 1QOQB 2CVPA 4W5OA 2J5KA 3ZI4A 1ADCA 3AUTA 3DFFA 1W49A 3PHIA 2ZYRA 3H0KA 3VKGA 1BW9A 4Z1MA 1GZ6A 5KJ1A 1DSSG 1E2IA 3EPHA 3HXMA 2WTMA 5AKZA 3EXHB 1MX9A 1Y89A 5FL7A 3Q0IA 1Q0UA 1MEOA 4J16A 1MJGM 4BLTA 3UCEA 1G5TA 3KB1A 3RABA 2JFOA 2BJWA 2WWGA 1QORA 1ECLA 1WWKA 4BLPA 2BTOA 3NHFA 4KQIA 4EGFA 1RAAA 3P9NA 2BDTA 4JYBA 5JAZA 1N7HA 2CY0A 3MJTA 1PEYA 2OHHA 3BTSA 1P1CA 4BP8A 4MWBA 1D8AA 4IZOA 4EMUA 5BP7A 3SIXA 5F35A 1QGAA 2ETVA 4H2DA 4WBSA 5F3DA 3EZXA 1I3MA 4I1UA 1FVFA 3DOHA 5IPFA 5CH5A 3NV9A 4CL0A 4L75A 1R1DA 1HDZA 4L8FA 5L4SA 5CDUA 3MWLA 4YJKA 3I6YA 2JGDB 1QMPA 4XD7D 2G80A 4OL0A 3L82B 1GGMA 5DWDA 1FTWA 2OCBA 4FMPA 4H7IA 2FEKA 1USUA 2AEFA 4E7OA 3OZXA 2DSNA 2JAQA 5CA1A 4D3FA 2BGUA 2W4MA 4BNNA 5H3HA 4D9MA 2V6GA 5KKCA 2YOHA 4LF5B 2JEYA 3FFBA 1F12A 4A0QA 1NG1A 1XZNA 1NAIA 4QFMA 4WLEA 4XSVA 3UUGA 4M9CA 4K9OA 5KUTA 3TF5A 4WH0A 2QVYX 1KOJA 4F60A 4MW0A 5IDYA 5BW5A 2A4MA 3PXXA 2AJTA 1RPNA 3GP3A 1JECA 4NBKA 4RF3A 2GEKA 2EX4A 4GMHA 2QI9F 3V1KA 4U5XA 4Y1RA 2FW6A 4EG5A 1DEKA 2AK3A 3CR7A 4D5EA 5K4GA 1XQVA 1J42A 3K0FA 3PUZA 3RUIA 3U9LA 3V34A 4TYNA 5BPFA 2HXGA 3AIMA 3IYLW 3WBFA 2HWYA 3UGQA 4Z53A 4HX9A 4Y0AA 1M0EA 4M76B 3VPBA 2VPWA 3W5JA 3ZHVA 2GTHA 4CF7A 4KFUA 2VTKA 2QORA 3V8BA 2ET6A 3E9RA 4CNQA 2OC4A 5IH7A 1EFVA 2VPQA 3R74A 1QIGA 3ZE7A 4IGEA 2AS0A 1KQPA 1LV7A 1A5BB 3D1LA 4XIYA 5EVCA 3QPVA 4ZYWA 3PSHA 4EHBA 1T0IA 3L0OA 3NTQA 3LG2A 4WKBA 3UAYA 2I91A 1BVHA 1B8VA 1KEZA 1VYVA 4MS1A 1I2ZA 1RWPA 2GVZC 4IWXA 4MCIA 3OPYB 3OLVA 2Z5VA 2Q0QA 3Q3HA 4JA2A 1Y37A 4ARZA 4LFAB 3AVYA 3KG2A 1UMBB 5EJAA 1O77A 3RHZA 4OKNA 1SPBS 4NS1A 4KN8A 4ECAA 3KR1A 4MUMA 2CE7A 4JUFA 4QUKA 1FY2A