4LXHA

Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3-cl hopda
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
276
structure length
276
Chain Sequence
MFEQFESKFIDCDGIRTHYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGFGQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNAMGGTTACGAALKAPELIDRLVLMGAAVNISPDDMVANRDDLAAVMSYDGSEEGMRKIIAALTHSYQPTDDIVHYRHEASLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIPQAIGHVFPNCGHWVMIEYPEEFCTQTLHFFGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MCP Hydrolase
publication title The Lid Domain of the MCP Hydrolase DxnB2 Contributes to the Reactivity toward Recalcitrant PCB Metabolites.
pubmed doi rcsb
source organism Sphingomonas wittichii rw1
total genus 89
structure length 276
sequence length 276
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxhA00
2FJ0A 3MUOA 5CXXA 1IMJA 2OG1A 5K3CA 1PV1A 4PSCA 1XRLA 7YASA 4G4JA 5C8VA 1K63A 4L72A 3OPMA 3K6KA 5CT5A 1ZD4A 5JAOA 3C6XA 5JZSA 5ALNA 3WK7A 1B41A 3KXPA 2BJHA 5FPPA 4J0CA 2WG2A 4H7HA 4ZWNA 3BE8A 3RKSA 5LZ2A 5AM0A 4JEIA 2OLEA 3WA6A 3VVMA 2HIHA 1ZD5A 3BIWA 2Q0XA 1WPXA 4FMPA 4D9JA 3B5EA 4B9EA 2AJDA 5DTJA 1CUSA 4RE6A 5HF5A 1LPPA 4HRYA 1NU6A 3G9UA 3V9AA 2IX9A 2HU7A 1CUWA 1TIBA 1Z68A 2RIPA 3R3UA 2QM0A 4NVRA 4BVLA 3ICVA 1EK1A 1D07A 1XQYA 2QUAA 4DNPA 1RYYA 3SWWA 1LGYA 2CJPA 1UKAA 2AJ8A 4MEBA 5ALKA 1XZGA 1MAHA 5LYYA 1ACJA 3IUMA 2WUFA 2J3DA 5AI8A 1O6GA 1CUHA 5ALIA 4G9GA 2YASA 2OAEA 4QLOA 2WM2A 5ALXA 4A23A 2WUDA 5AICA 4ZV9A 4FBLA 3SK0A 2QT9A 2C5GA 2CUTA 1U2EA 5AM3A 1UKBA 3PUHA 1CVLA 2VTVA 3E1GA 5JAUA 3H2GA 2R8BA 5AKGA 1UK7A 3C87A 2G5PA 4KEAA 3D59A 2ROQA 3PFCA 2WU4A 2V97A 2YYSA 5C7YA 3I2KA 4QDXA 2PSJA 1W1IA 3QMWA 5CURA 2OCLA 3M82A 1YS1X 3H2KA 4J0DA 4YPVA 4BC0A 3HYSA 1J2EA 1P0MA 2HA4A 3BIXA 3PFBA 2XMQA 4Y2TA 3D2CA 3AFIA 1YB6A 1QIFA 2BGRA 2O2IA 2B20A 3W04A 3WWPA 1OXMA 5C8ZA 2XUOA 3M81A 1U4NA 4OCZA 2D5LA 5CH3A 5ALSA 3QITA 5CTAA 4WFKA 2VAXA 4OYLA 2Y2UA 2WIFA 3PF8A 4B85A 3WZLA 3NOXA 5JALA 2BGNA 1BROA 5A71A 3HC7A 3I28A 5AOBA 2RONA 3STTA 2J3QA 1CUDA 4KRYA 3R41A 3H19A 3LS2A 3I2JA 5T4FA 1EB9A 3H2IA 4CG3A 3HRHA 4G4GA 3IIIA 4DMCA 3DQZA 2WHQA 2ONCA 2WTNA 1QONA 5FUMA 5AM4A 3PI6A 1H2XA 4K5QA 5DTIA 2HADA 2WIGA 3OURA 4FFVA 4H18A 5KWIA 1CUIA 3LLCA 1W76A 1LPAB 2HDWA 1DWPA 2QKYA 1YSCA 1CUXA 2WFLA 3AILA 1IZ8A 3K2IA 2WKWA 3GBSA 4UFPA 4OPMA 4DSAA 1H23A 3I2GA 1YS2X 4BVJA 4M0MA 3C6BA 3IUQA 4FLMA 1K8QA 1A8QA 1CUJA 1EVEA 1E5TA 5FPQA 3FSGA 5EI5A 3M83A 1WHTA 4UFOA 3C43A 3DL7A 4YX9A 1QO7A 4UFNA 2WTMA 3F8SA 1W75A 3BL8A 3WKAA 2HA7A 2FJPA 3ZLUA 4J0KA 5IVDA 1QO9A 2BCEA 4DTCA 4INZA 3C45A 3KD2A 4PQEA 3V1MA 1LZKA 1FFEA 5A6VA 4BVKA 3OTQA 4P08A 5FKJA 5A62A 3AZPA 3WIBA 2QZPA 1A88A 3Q8WA 1GKKA 4A16A 4B0PA 1BN7A 4V2IA 1BEEA 5LKRA 1AKNA 2CB9A 3VJMA 4PSUA 1SFRA 1P0IA 1UK8A 4NMWA 4UHHA 4Y2JA 1JU3A 3GFFA 1R50A 3TJMA 1ZD2P 2H7YA 5CT8A 2CZQA 2GYVA 5AO9A 4JNCA 4OB7A 1BCSA 2ZJ7A 2BAGA 1E3QA 4M0FA 1XZCA 5HZGA 1XROA 5H3HA 3X3HA 3I2IA 3P2MA 1LLFA 4X6UA 1CUZA 3M3DA 3GUUA 4B0OA 3QZUA 5E2IA 3PE6A 3HLKA 3JYHA 4ARBA 4QDOA 1VZ2A 1DQZA 4EY4A 1UK6A 4LXIA 4IH9A 4EA6A 4ZREA 2OGZA 4EHBA 2YH2A 5DYTA 4FLFA 1DX6A 1LZLA 1FFAA 5AOCA 4GXNA 3GROA 1ODTC 1VLQA 4X3CA 1R9NA 2Y1KA 2VT6A 5D7BA 1WOMA 4WFIA 5ALTA 3I1YA 2VAVA 3VXKA 3FCYA 1CFJA 5AI9A 4CCYB 4FNGA 3T4UA 2Z3WA 3D4LA 2OXEA 5KREA 3HXKA 3B3QA 2HA6A 4ITVA 3F97A 1G4HA 3LIPA 2B61A 5AKYA 3ZLTA 3NWOA 4HVTA 4G4IA 4ROTA 1P0PA 4F21A 1CUFA 1GQRA 1U8EA 3STUA 2OPHA 4OB8A 1E8NA 1QIIA 1CLEA 4H7DA 2RI6A 3WL7A 1MTZA 4X6YA 1T4MA 5LZ8A 1H2WA 1VE7A 2ZYHA 3HACA 2C7BA 2DCMA 5FP0A 5D3ZA 1GT6A 5CXUA 3WKDA 1LPSA 3ESDA 1CR6A 5JAPA 2C4HA 3LP5A 2QXUA 5DLPA 5FRDA 2WJ6A 3FVTA 4BB0A 3ZV7A 2XUHA 3F98A 2XQGA 1S8OA 1LPOA 3C6ZA 2HM7A 1HLGA 4QNNA 1DTEA 4J3JA 1SCQA 3WKEA 5HQ3B 5JD6A 2EDCA 4UHBA 4QDTA 1ZJ5A 1TK3A 4KJXA 3KDAA 2Z5GA 3L1HA 4AMYA 1XRRA 2Y6VA 3WQHA 1UFOA 3B12A 3RK4A 5AK5A 3V1NA 1JJFA 5AKJA 2PUJA 4B7ZA 3H04A 4AB1A 1EDDA 2XMDA 2XMBA 2HHAA 4K6KA 2AJCA 4LXHA 5JADA 1XKLA 4FDMA 5AHXA 2ZYSA 1AGYA 3R3YA 5JD4A 4Y2VA 5T4EA 1VA5A 4KE6A 3O95A 5BWBA 4BYMA 3VISA 2JIDA 3CN9A 3VDXA 4OD0A 2K2QB 2VQ6A 4Y2UA 3RM3A 3VJLA 3ILSA 1XZEA 2WFMA 3KWJA 1B6GA 1GGVA 4Y2SA 1ZGBA 5K5EA 5LZ5A 4JUIA 3G7NA 4UBLA 4BDTA 5ALZA 5DYYA 1SCIA 4JH0A 3H2HA 1WB6A 2DR0A 5JARA 2D0DA 2CEKA 2QS9A 1BRTA 5SYNA 1EK2A 1QIJA 3WK5A 1FFCA 3K9BA 4RNCA 3C5WP 2H7CA 1MX9A 3PDCA 4KYVA 2ZYIA 4KRXA 2ACEA 4I3FA 2VEOA 1TCAA 4X90A 6YASA 5FXMA 2WSLA 1ZD3A 5A2GA 2B4KA 1L7RA 2X76A 2XI4A 1XFDA 4N8SA 2X5XA 4Q82A 1VXRA 4ZV7A 1F0NA 3R3WA 3WK8A 3SC2A 5IH7A 1JFRA 4BAZA 3L1IA 1ZJ4A 1EA5A 2WUEA 4O08A 3G0IA 3H1AA 5CW2A 4BAUA 4WJLA 4BTVA 1CIJA 1BCRA 1VA4A 4WDRA 1YAJA 5KWJA 4B82A 3AZOA 3AINA 4KE7A 2OCGA 5HCUA 4L9AA 4S0XA 1ZIXA 1FSSA 1CUUA 1QIKA 2OCKA 5ALOA 2VATA 4C4XA 3QH4A 1THGA 4N5HX 3D2AA 5AI0A 2WG0A 5EIAA 3E3AA 1ZI8A 3STYA 4E14A 1LBSA 3WI7A 1WHSA 3DCNA 2XQKA 1NX9A 2XLBA 2QRUA 4UBMA 1XZHA 4LXGA 3UUEA 4QLAA 3DEAA 2QUBA 4H7JA 4Y7DA 2QR5A 4FNMA 1W4LA 4PSDA 1VZ3A 2XUQA 4BTLA 3IURA 2XUJA 4MYSA 4FOLA 1KU6A 1LNSA 1QFMA 2R11A 1QIMA 1G5FA 3D2BA 2XMGA 1DU4A 1EI9A 4BATA 4BDSA 3EBLA 5I7UA 2WJ4A 4DMFA 4GBGA 5LZ9A 4N8EA 3U1TA 2ECFA 1CUEA 4K6GA 1AC5A 3WKCA 3WWCA 2RHWA 4X00A 4W1PA 2W6CX 4KR0A 3OOSA 4B9AA 1T2NA 4J0JA 3PF9A 4MWTA 3UMJA 5C81A 1YCDA 4CG1A 2XMZA 3W05A 4AZ0A 5CT6A 3PUIA 1WCYA 3WZMA 3G02A 4AO6A 4X92A 4I19A 2QVBA 1QOZA 4OSEA 4X6XA 4NZZA 2G4LA 5K3FA 1WPRA 1JMYA 2WG1A 5AIAA 4C87A 4X91A 5IVHA 2PSHA 1JMKC 4AX4A 1BU8A 3WK4A 1TCCA 1O6FA 2AJLI 3I6MA 1BE0A 1UZAA 4EY5A 4ZXFA 5AJHA 2GBGA 4X71A 5ESRA 2WHRA 5AP9A 2VJBA 5LZ4A 3WK9A 1ORWA 2AXEA 2OQIA 3BJMA 2WHPA 5ALEA 3GA7A 5AM2A 2DHDA 2GYUA 4AMZA 3T52A 4B6GA 3F67A 1TRHA 4UHEA 4WY5A 1MX5A 5JAHA 2ZJ6A 2QJWA 1EXWA 1QE3A 3AIOA 1EHYA 3NUZA 4GWLA 3DDUA 3G0BA 4H7KA 1E66A 3PICA 3G8YA 2VJCA 1QIDA 2DQYA 3QM1A 1CUCA 4E15A 1R88A 3C5VA 3HZOA 4Y2YA 4BRSA 4AN1A 1VOTA 3FVRA 3FYTA 4C89A 5I9IA 4DM7A 4BRZA 4DMKA 2XMSA 4X95A 3A2LA 1QIGA 3AJAA 4BBZA 1UXOA 1K4YA 5ALPA 4XIIA 1DWOA 4B84A 1ZOIA 4KAJA 4U2FA 1PJAA 1BEZA 3DNMA 1DWQA 4HTAA 3L1JA 3A2NA 3R0VA 3WWEA 2HFJA 4F60A 2PKYX 1GPKA 2GZSA 2OAGA 5ALFA 2WFLB 4YASA 4TGLA 1RWQA 2XDWA 2QMQA 4H0CA 1Q0RA 3FYUA 4J7AA 3FNBA 2WLSA 1EX9A 4LHEA 3O4GA 5HK9A 4N5IX 3IDAA 4GW3A 2HRRA 1A8UA 3IBTA 5ALQA 1QJ4A 4QWWA 1HL7A 3S2ZA 2QJRA 3FYUC 2C58A 2ACKA 3C6YA 1NU8A 5AI4A 2WIDA 5ALHA 2WIKA 2OGTA 3G0GA 3FOBA 3E0XA 1XLVA 4BAGA 4PNZA 4JYPA 1EINA 2CBGA 3HABA 1WM1A 4BC1A 2WIJA 2FUKA 1CRLA 1L7QA 5K3EA 4MYDA 2EEPA 5AM1A 4HRXA 1Y7IA 4GECA 4FFWA 1YASA 1MAAA 4X94A 3VKFA 1YB7A 3V1KA 1QFSA 5HF9A 4ZI5A 5AKIA 1H2ZA 2Y2VA 2QXTA 3ED1A 1GQSA 2HA3A 5EHNA 5AK3A 1C4XA 2CKMA 4EUSA 5BWCA 1XZIA 3QBJA 3I2HA 3WJ1A 2E3JA 3DOIA 1DX4A 1A8SA 5A7HA 1CUAA 2XB6A 4Q3KA 4DNQA 4C01A 1THTA 1G66A 2ZSHA 3BDVA 5FOQA 5JANA 3AIKA 2PM8A 1QTIA 4PO3X 2DFPA 1UOPA 5CT4A 4BP9A 3W9UA 1VXOA 1H2YA 1AZWA 3WYNA 3STVA 4MJ3A 4U2CA 4G9EA 4PV7A 4UBJA 1XKTA 4QDUA 2V98A 2PSEA 4GHWA 4G8BA 2NW6A 3YASA 4Q34A 4B83A 1R9MA 3OM8A 4PW0A 5AH0A 4X97A 3LCRA 2HA2A 3C8DA 3IUNA 4AZ3A 1HKHA 3CN7A 2ZSIA 4ZRDA 5IVIA 1XLUA 5T4BA 5ALLA 5IKXA 4UHCA 3D3NA 5ALGA 3HEAA 4MWSA 3G0CA 1LPMA 4W9RA 1KEZA 3MUNA 3EQ8A 3BDIA 3TRDA 2ZJFA 2OQVA 4C4ZA 1IUPA 3A70A 1UKCA 2O7RA 4GDMA 1TCBA 4G8DA 1CUYA 2I03A 4J0IA 5EGNA 1YA8A 2RAUA 5F4ZA 3O4IA 1DT3A 5LIPA 4BE4A 4EY7A 2JGLA 2C0QA 4J0GA 4JYMA 5JATA 1EDBA 1ETHA 1ACLA 2WJ3A 5ALVA 2LIPA 2WFZA 1MPXA 4BCBA 2XE4A 2PL5A 2GYWA 4IH1A 5FDFA 3MGAA 3OG9A 3EIOA 5AOAA 3AUKA 3S8YA 3DYIA 4BE9A 4HXEB 2QTBA 2PX6A 1SC9A 4FBMA 1X2EA 3Q0TA 3QPCA 3OC0A 4H7EA 4UUQA 3DKKA 3RARA 4Q1VA 1PFQA 1ODSA 2PU7A 4Z49A 1UWCA 4UBIA 4W1SA 4AXBA 2GBIA 5JYCA 2PUHA 4UBNA 4LYDA 5ALRA 4EBBA 3H2JA 4Q05A 4FHZA 1GPLA 1BN6A 5CBKA 1VJ5A 4KACA 1TAHA 5D3KA 3W06A 3JWEA 4XWGA 1TKRA 3O0DA 2GBCA 5JD5A 3WL6A 3I6ZA 4OYYA 3ZWQA 3H17A 2Z3ZA 2JGMA 4IH4A 1UOOA 2WU3A 2Z8XA 1KU0A 3BJRA 4G1FA 1Q84A 3G9XA 1ZIYA 4E11A 1MX1A 4Y2RA 1LPBB 1GKLA 3WMRA 1GZ7A 2YXPX 2O2GA 2H1IA 3G9ZA 2OGSA 4KE9A 4UPDA 3NGMA 3ESAA 3STXA 4IHAA 5BOVA 1JJIA 2WQZA 1C7JA 4YK7A 1U65A 1N1MA 5SYMA 4EZIA 4I4CA 5AK6A 3A2MA 1Q83A 5AI6A 1XQXA 4QA9A 1MT3A 5EHQA 3N0TA 4U2GA 3ZPXA 2XQJA 4U2BA 4K6HA 3IA2A 4BZZA 2HA0A 3EF3A 3IUJA 2XUKA 5JZBA 2X8BA 3IB3A 1CEXA 4DIUA 3KSRA 3WYDA 4PF1A 1YR2A 5A7FA 5HF6A 4H7IA 1LPNA 2FX5A 5DNVA 1Q0ZA 4CCWA 5A7GA 3KOOA 5AKZA 1QZ3A 4KE8A 4DMHA 5AKKA 2PSDA 1XZLA 4LIPD 3R3XA 4AN0A 5HFAA 4KAFA 4RPCA 2H9YA 4MXDA 1P0QA 1GXSA 5BV7A 4UHDA 1HDEA 1IUNA 3CCCA 2Y6UA 2JEZA 1HPLA 4UHFA 1USWA 5HF8A 3HI4A 1FFBA 2H7XA 4WFJA 1J06A 1XZMA 3JW8A 3O4HA 1AMNA 4AO7A 1F6WA 3WK6A 3BWXA 4BCDA 1W6RA 2VJDA 4OB6A 4U2EA 3U0VA 3H0CA 1J07A 1XZAA 2IIVA 5ALWA 2AJBA 1R1DA 2BKLA 1MU0A 1JT2A 1IZ7A 4QEKA 1XZKA 1IUOA 3DOHA 4LKOA 5LP1A 3D5EA 5IVKA 5DNUA 3FLEA 2C5FA 5J3JA 5ALJA 1G42A 2P8SA 4TVKA 2XLCA 1WB4A 4DYHA 4Q3OA 1XZJA 1DINA 4GEGA 3UUFA 3FCXA 3D7RA 5E4TA 3ZLVA 2XUDA 2O2HA 2XUGA 1JU4A 2XQFA 5DJ5A 1XRNA 5CH5A 3FBWA 2JGFA 2O7VA 3LIIA 5CT9A 2JGKA 2CMFA 1OILA 5K3FB 1QIHA 1CV2A 5AKEA 5LKAA 5HKAA 1N5MA 5ISMA 2BUAA 3F96A 4WDQA 4BCCA 1CUGA 2XQIA 4A5SA 3DKRA 5HK8A 4W1RA 4FTWA 4UBOA 1XQWA 5ALMA 4N8DA 4AO8A 3I2FA 5EHZA 4OUKX 3RLIA 1ZGCA 4Y9SA 3BXPA 2JGIA 2WHPB 3HJUA 1TQHA 1CUBA 4F5ZA 4MQLA 3QYJA 1QLWA 3IVMA 4IO0A 3H1BA 3I6YA 4TPKA 5DNWA 1MNAA 1AURA 2RGUA 1ISPA 4ARAA 4J0HA 1K6EA 3I1IA 5AI5A 2DQZA 3MVEA 3WA7A 3ANTA 5K3AA 3E4DA 3KWFA 2HU8A 3BF8A 1F0PA 1X2BA 2BFNA 1EDEA 5ALYA 1AQLA 4WY8A 1UOQA 5K3DA 4HXGA 5T4HA 4P92A 2I3DA 1XRPA 4Q3LA 5LZ7A 3AIMA 4GLBA 4C4YA 1AX9A 1W52X 2UZ0A 3R40A 4CIAA 1IVYA 1JKMA 2GZRA 2OCIA 2G5TA 3QVMA 1A7UA 4RGYA 2V96A 2PSFA 4EB0A 2JF0A 3WL8A 4CIBA 1F8UA 2JGJA 5CMLA 1M33A 1C7IA 4XJVA 4MEAA 1X70A 5AKXA 4DSZA 4CI9A 2W22A 1CUVA 4DGQA 2JBWA 1EB8A 2VF2A 3QMMA 2WILA 3D0KA 4GI1A 1FJ2A 3V48A 1HBJA 3WIOA 1ZI9A 3DS8A 4Y2XA 1ORVA 5EIEA 1SOMA 1ZI6A 3W2TA 5E4JA 1R4ZA 3ICWA 3WJ2A 4CCYA 4WCVA 1ODCA 5D6OA 2HU5A 3FYUB 4FLEA 5AK4A 3ZI7A 1R3DA 4G8CA 3V1LA 1VE6A 2HRQA 3QPAA 1J1IA 3ESCA 1EH5A 5HFNA 1VKHA 2PVSA 2PBLA 3DYVA 4IQ4A 4QZVA 2XMRA 3WLAA 1RP1A 3BF7A 2XUAA 1XLWA 5AM5A 1E8MA 5AKLA 4Y2PA 2V9ZA 2I3ZA 5JASA 4ETWA 4NS4A 1UK9A 5CRIA 4CG2A 1FFDA 3TGLA 2GBFA 2HL6A 1BS9A 4QWMA 5FV4A 3VJKA 1DT5A 1MN6A 2JEYA 3CCBA 2XUFA 1ZICA 3DLTA 2HA5A 4C88A 5I8PA 1UT6A 3FAKA 1Y37A 5AKHA 4X93A 3WWOA 1AUOA 4KAAA 5E4YA 3FSGD 3VVLA 4L0CA 4FWBA 4H77A 3TEJA 5HQ3A 1YA4A 5HKBA 4P9NA 5EFZA 1MNQA 2ZYRA 3C70A 1CQZA 2DHEA 4DNOA 3QMVA 1Y7HA 1CQWA 3R3VA 2BUCA 4W63A 2BUBA 3R3ZA 4ZGBA 2EDAA 2B9VA 3FLAA 1E8DA 3WWDA 3W9BA 1QTRA 4AQDA 2VSQA 4L3WA 4F0JA 4X85A 5JIBA 5AIBA 4HZGA 5EIHA 3WKBA 2DSNA 4HAIA 2JGEA 3EQ9A 3DJYA 1N5RA 2XT0A 5KBYA 1XZFA 4DNFA 3FWHA 1XZBA 3N2ZB 1MO2A 1WB5A 2HFKA 4Y2QA 1XRMA 3F9CA 4H7FA 4RE5A 3ESBA 4K2AA 5LLSA 2Z8ZA 3ANSA 4HXFB 4C6HA 1H22A 4QDZA 1EVQA 3AZQA 4BP8A 1OCEA 3O9VA 1K5PA 2XUPA 4X7BA 1XRQA 4OU4A 5CH8A 4XX1A 2WUGA 3STWA 4U2DA 3G9TA 1DQYA 1N8SA 2RHTA 4XVCA 1QIEA 2ES4A 3C8HA 1XZDA 2VT7A 3HSSA 2PPLA 4QE3A 4M0EA 3EQ7A 3SX4A 5DYWA 2C0PA 1QGED 4H35A 2G63A 4B80A 3WL5A 2QOEA 1JI3A 3O4JA 3GELA 2VJAA 5FLKA 3IULA 2J4CA 3H18A 4HS9A 1YAHA 4UBKA 2XMCA 4LYEA 3GZJA 5YASA 5ALUA 3O9MA 4W1QA 5ALDA 1HQDA 2IITA 3G0DA 4OU5A 1I6WA 2I78A 4DLNA 3DD5A 4P93A 2J4FA 3QPDA 3A6ZA 2VA9A 4B81A 3CXUA 1L7AA 1SCKA 1JJBA 4BZWA 3FLBA 4FKBA 1CPYA 2DHCA 2ZVDA 5EHXA 5K3BA 4G5XA 2XUIA 4E46A 2ORYA 1LBTA 3DL4A 4EY6A 5JZ9A 1XQVA 4CFSA 4J03A 4EY8A 5DWDA 1GPNA 4MQMA 1MJ5A 1E89A 5C8XA 2PU5A
chains in the Genus database with same CATH superfamily
2YL2A 3MUOA 5CXXA 4D92A 4XQ0A 4CDNA 1RPTA 3VSAA 1PV1A 1XXHE 5EPUA 3D6HA 1TZ2A 2GEFA 3GT4A 3AJDA 4KOEC 2FUG6 3GFOA 1YKGA 3NWEA 4JUCA 4F4HA 1QR6A 1TKCA 3K6KA 2WK1A 1TJ5A 4RPLA 1Z4LA 5JW6A 1Y3BE 4KNVA 1QG2A 2UVPB 3TOXA 1V9LA 4X8OA 3BGOS 2FW7A 5JZSA 5JDCC 4E2YA 1XEWX 1XTTA 4X1YA 3WK7A 5A4JA 3THYB 2ZIEA 4UM5A 3HP7A 4GZ5A 4XVRA 1MOZA 1GFIA 2JAXA 1KVQA 1YJXA 3JVVA 2CFCA 3PQ8A 2Z2IA 4E88A 2GASA 4EJSB 1JE0A 3ZXXA 5AM0A 3ZWAA 5CK5A 2P6OA 5CNIA 3L4JA 4U6SA 1VHJA 3V7NA 1G20A 1JJVA 2H5JA 4KK3A 1PQWA 4FP9A 3PWZA 3F3YA 5G02A 1TFUA 3BRQA 5CNMA 2C9ZA 1U7TA 4GKAA 4MWCA 5C32A 4R41A 1TF7A 4LDPA 2G9NA 1G21E 2ZT5A 4QBTA 2HQBA 4NATA 1SZDA 4FMPA 1X92A 1G7TA 1IOZA 1R4NB 4D9JA 1G6Q1 1K6XA 2Y66A 3AF4A 3MWEB 4FN5A 3D5TA 4I5IA 4XKJA 4D9HA 3EXEA 3V7WA 4B73A 4J7CA 4IGIA 2M6SA 3A05A 4KSBA 2UXBB 5HF5A 1AS3A 4ER0A 1Q57A 3ACDA 3QOYA 3ZV6A 2MJLA 3V9AA 2BRUC 1YHYA 3GRCA 4OHBA 2QTFA 2R4QA 4L22A 5M2QA 3IEKA 1Z0FA 2V5VA 3JRNA 3AR6A 3I76A 2V4ZA 4GM4A 4QTZA 1KZ7B 1E18A 4XJTA 5D85A 4CMCA 4NVRA 2QLBA 5ANRB 1JQBA 3NUGA 3LXUX 1WVGA 2Q3HA 5F52A 1MTOA 1MIOB 2ZQZA 3AWDA 3UGJA 4WZBE 3WWZA 1E3JA 1HE5A 1EWKA 2NUPB 3UJHA 2V59A 2C7RA 3R23A 3KPWA 1RWXA 4RD3A 3M1IA 4DNPA 1N2EA 1YNOA 3RIYA 1LGYA 4INOA 3AETB 4QYXA 3GLIA 1TK9A 3DAGA 1YDMA 4UUBA 1IBKB 3EIHA 2FRVA 3P2YA 1RZRA 2ZBFA 1GITA 3TLAA 1YBHA 1WPGA 3CKKA 5FAKA 4B74A 4BQSA 3TBHA 4EG4A 1Y4ZA 2Z98A 1CJBA 1U11A 4KR2A 3BEOA 4DY4A 3IUMA 3ZWKA 2WUFA 1HZZA 4HKTA 5JS8A 4HH1A 4LCEA 5B55A 3DBRA 4L02A 3DQPA 3O84A 5BW8A 1S1CA 4U5XA 3GJ0A 5AHRA 2J5KA 1ZY2A 1O6GA 2C99A 2RG7A 3WB1A 3N53A 2VBGA 1BGVA 1H4QA 2UU9B 3MILA 5HW0A 2OAEA 2IKSA 1MDFA 3C7DB 3V2GA 1D6NA 1X7YA 1G5IA 1K2VN 3HB5X 3C1AA 1BYIA 3WY9A 4EB6A 1T2CA 3B38A 2EJCA 2I6GA 3NHAA 4OQFA 3U80A 1PT7A 3QLVA 2R3SA 3HU3A 1ZMXA 5AESA 2FMHA 3MCAA 4ACAA 4LZLA 1GN9A 4MUFA 4Z86A 5BVGB 3NTUA 1NYTA 3TD2A 5AUQA 2C5GA 2OGUA 2YR0A 4YYEA 1LV8A 1WF3A 4IKEA 1U2EA 5LOVB 3ISVA 2K5UA 1UKBA 4CLOA 3GIWA 4QOEA 5JSZA 3FUTA 4FCCA 3WP0A 2PLAA 3ENWA 3P0JA 4PAOA 2QXYA 4DR6B 5KYWB 1QLJA 1OZFA 1PFUA 1F06A 3E1GA 1EQAA 3I5MA 5JAUA 4CM5A 1KTIA 2GLXA 1GQ2A 2X13A 2Z9BA 3I0MA 4DE5A 1P2FA 4KQCA 4YJFB 1T2EA 3TB4A 1TM3E 3L1VA 4BZQA 5L3VA 3I01A 4JKOA 4KEAA 2CJWB 3D0OA 4RPGA 2ZS9A 3CZCA 1HETA 3F6BX 3N8IA 3FDIA 5I9BA 2QD5A 2QTVA 2LTAA 4CUJA 4DLBA 3QVSA 1RLJA 3FPSA 2GB4A 5SV2A 3EMKA 4CM4A 1CY4A 1ZSVA 1KP9A 5L3SA 2O5CA 3U5TA 3MJCA 3KQVA 5H0IA 3EOAI 3VDRA 5IN5A 4BC0A 5HIIA 3EIFA 1WXEA 1PT8A 4K6CA 2WWFA 2DPMA 2Q3MA 3R5XA 3SN6A 1EP2B 3C3EA 3LVFO 1R6VA 3GQBB 4H6VA 1J2EA 1P0MA 4FDUA 5KNCH 3NAQA 3NHJA 1V1RA 4ABYA 2JJ2A 2HA4A 1HMPA 4BNKA 1SVOA 4MI9A 3VR5D 4ER5A 3BIXA 4KMRA 1L5WA 2W8BB 3RFFA 3IPRA 4MAMA 4TS9A 4TX1A 3TOCA 3V4FA 3CRMA 3OEED 4X3PA 2NZWA 3D2CA 5JNRA 4MRMB 4QLBA 4AFNA 5DNAA 4AIRA 3PDWA 4R54A 2B20A 3BZWA 1L5RA 3DCIA 4TT3D 3TX2A 4XD2A 5K6AC 2FMTA 2H4ZA 3VHXA 2XECA 2PZBA 3B1WA 3DE2X 2ZI4A 1GTRA 3E5HA 4E5KA 4PZ0A 5J23A 5E6SA 4GOOD 2QYTA 4PPQA 1A5ZA 4QYTA 4OCZA 5ALSA 1P1HA 2D5LA 3V8PA 1LJLA 4YRIA 2IHUA 5JNSA 5FOSA 1WA5A 4ZCMA 1V71A 1PGPA 1VYUA 1YULA 1Y4DE 3AG5A 1J8VA 3FHLA 1QKIA 4UNSA 5C3MA 4AXXA 2CVFA 2WJWA 1T4CB 4I9NA 3GLFB 1E2QA 1P4HA 2HD4A 1BWQA 1UM8A 2O1XA 2G1AA 3DR5A 3NOXA 4X44A 4L8WB 3WZLA 5JZMA 3F7OA 1XHEA 4O2AA 3GFSA 1SD1A 1C3OA 4YP6A 5F9MA 2PGXA 2AIRA 3I28A 5AOBA 5J43A 2ZJ0A 1YDGA 1U9JA 5IJAA 3NGLA 4B87A 3F8WA 2P6UA 2GFHA 4DWVA 3IQDB 4OAOA 2YZNA 1QHSA 5IVHA 4ZZ2A 2FUCA 3I2JA 4WSOA 5T4FA 1IXSB 3IL2A 3RGGA 1CVIA 1A27A 2PX5A 4MGYR 2CWDA 1M2WA 3DQZA 2WHQA 3OO1A 2YVLA 1RS0A 2ODWA 2ZIVB 1MT0A 1HYGA 4ZYYA 4Z0TA 3I6IA 2P75A 4LF4B 2JD0A 1BEUB 4K9RA 4CPDA 1JQ3A 4IXTA 5T41A 1NW9B 1QONA 1XTJA 4DLTA 3QW4B 1WW2A 5AM4A 4KQGA 1BWRA 3LL7A 3NFYA 1ZFNA 5G1NA 3UT0A 3ILVA 4LV5B 3C7TA 2WSBA 4RPIA 5EY5B 3IMEA 1GRRA 3O93A 4LYFA 1FXUA 4K6FA 4PGFA 4C5BA 3E03A 4LOJA 3FI9A 3OT4A 1W76A 2XXAB 3RGWS 1DWPA 4IJMA 2YRWA 1G6HA 4PAMA 3OICA 1JF8A 1KARA 1K06A 1QANA 2VSXA 3VTZA 4FMDB 4D9KA 2WFLA 1KMIY 3OQJA 1O58A 1IZ8A 4EHLA 4F85A 3K2IA 5C1OA 3WQQA 1Q2UA 3NXKA 2RSLA 4XM2A 4UFPA 3QU4A 2JAQA 2FEAA 4IQ0A 2OBLA 5LP6C 3RHTA 1KOGA 1F1JA 4GI3A 4IX9A 2RH8A 4BV9A 3IUQA 2VS1A 1K8QA 2VYVD 3W34A 4DHWA 5JWRA 4TYYA 5ABPA 1EVEA 3UMCA 3G13A 2PAAA 3M70A 3TIIA 4LF5B 1GJRA 5EI5A 5JMTA 4A6EA 4S1TA 3QVUA 2ZSAA 3DZIA 3FDJA 2ZITA 4MS4A 4ZCSA 5GAJA 5BSHA 4B3CA 3CYFA 1JPNA 1GPDG 3C43A 1SZPA 4YX9A 1O6BA 1LBQA 3DVRX 2D2EA 3F8SA 3ORRA 3FGZA 4I50B 2C3MA 1HEYA 3PGLA 5DI3B 3AUSA 1VC2A 3QBTA 3U16A 3HEMA 4GGOA 2DWQA 4IIXA 1Z88A 3TJZA 4E21A 4EJ0A 5FUQA 3Q8KA 5IAAA 1AGPA 2RGAA 4LMPA 5LXTB 1Q22A 4OBWA 4B3HA 4V1CI 3SF8A 3WNQA 4JBIA 1M6VB 3ZLUA 2I9KA 2IV2X 4HX5A 5IVDA 3OIYA 3WMWA 3MWGA 3PC8A 5AQ1A 1QO9A 5MFZA 3IRUA 3G89A 2C5BA 4INZA 3O94A 2W00A 2ZIWB 5CPBA 2JGDB 2Z5LA 3KD2A 4MCAA 1LZKA 1WZIA 2FPIA 3K0CC 4RKYA 5GM2A 3V4OA 4D9BA 2OYSA 1FFEA 2R5NA 1FSFA 4YGXB 3MT0A 1U9IA 1DRJA 2H59A 1JYSA 4P08A 1O4VA 4WK0B 4XTCS 5A62A 1IPEA 1F12A 5CW1A 2EBWA 1RAAA 3WIBA 1L5VA 3H2YA 4CFZA 4NXMB 4MUNA 1L5QA 3TOSA 2HYDA 2VDLB 4OH1A 3D6JA 1RJGA 4A16A 1CIVA 5CK4A 1EPUA 1IEXA 3BMNA 3W8FA 4NZ9A 4HPJB 2Q2NA 3W5VA 5LQNA 5KYYA 2ZUSA 1RFGE 1BN7A 1UMCA 3PNLA 4HVAA 2CCJA 4N3CA 3HM9A 5EMJA 4LPSA 2OHVA 1KXZA 3V8VA 1RR6A 4ZI7A 5BN3B 4D6YA 4FCVA 3NHPA 4V3CA 2CB9A 2NADA 4XDGA 4LZPA 2YWBA 1UK8A 4P3PA 4NMWA 1ZRMA 2EIHA 1OFHA 2FFHA 5FPSA 4IHQA 2CNOA 3M9WA 4OHWA 3LK6A 3E3MA 5KYXB 1O4WA 1VBFA 1DBWA 1Z6GA 2GESA 3H5RA 4US1R 3X0DA 4FJ2A 1ZNXA 4DIDA 1A1SA 4JQZA 3VH3A 3GLGA 2VH1A 4MUHA 1U2PA 3LWBA 3PNOA 3V42A 3WC4A 4B7UA 4P0QB 2C7PA 1OX4B 4DWOA 4HH3C 3DL2A 1GUZA 1FRVA 2CZQA 5BYBA 3FM9A 4RADA 2WUWE 3TRHA 5AO9A 2WT4A 1NUSA 4JNCA 4OB7A 1AKYA 2P27A 2Q0SA 5HTKA 2QZZA 2BAGA 4EAQA 4CEHA 4O4LF 3KOWA 2LDBA 5AVSA 3VU8A 2YNMC 3TKLA 3HDHA 3VTKA 2A4KA 4F4DA 1DO2A 1DDOA 5HZGA 3GMIA 5H3HA 1GCUA 2ZK7A 1TMYA 3T3DA 1BG6A 4HATA 4FFRA 4R8LA 1UAGA 3P2MA 2LP4Y 3BJZA 4MP6A 1NVEA 2W2QA 5HE8A 2NNWB 1VM6A 3QEKA 4C7OA 4Y6PA 1YCGA 3NTOA 1UXHA 2GKSA 3GUUA 4QEZA 2WI8A 4ARZB 4OQDA 1GQOA 1ZSNA 3CLTC 4OF4A 4TN1A 1EZ1A 4WESB 4C2AA 4C7KA 2O48X 1OGJA 4MVJP 3ZDXB 1ZQ1A 3A6JA 4UW9A 1JG6A 2PMKA 5FV7A 4HZIA 3KYJB 1GTJ1 3BD7A 3QE0A 3Q2OA 4Y67A 2GWRA 3N2EA 4HN9A 2RGXA 4LXIA 1GU1A 4OM7A 5H8WA 1N2CB 1IONA 2BFBB 3AXTA 2EFJA 3NHRA 4F1WA 4EA6A 1M5RA 1QG4A 4IIHA 2Q6LA 4ZREA 1XDBA 3L6DA 4PC7A 3ZNQA 5I4IA 4XWYA 1XAJA 3BFPA 1KAMA 1F6BA 4HWKA 1YR8A 2VXYA 1C3JA 2YH2A 3OZDA 3ZWVA 1VCNA 1UPXA 4TVBA 1Y7TA 5K0NA 1LZLA 3MTAA 1HFWA 3O7WA 1QGUB 3ADPA 3EVZA 4IJQA 1SA0A 2GQ0A 1Z39A 1UQRA 4MRNA 5IM4F 4Z4CA 1C0PA 2HMAA 4X3CA 5A9TA 2XBLA 2VT6A 4MULA 3BK1A 5DLEA 4P7FA 4CT0A 4DMLA 4D82A 2X4GA 1X13A 5ALTA 5D5QA 1X94A 4JP5A 3D8SA 1CLUA 1QBGA 1CFJA 4EPYA 3EAGA 5K8UA 3LOUA 5HGXA 2ENWA 2HF9A 4FNGA 1SBQA 3T4UA 1MJHA 1OPRA 4BLVA 4FD3A 4LNAA 4XJXA 4DHEA 4HQNA 4DREA 1JXAA 1CY1A 1O08A 2OXEA 2VKTA 4PTLA 1ODKA 3H9QA 4QJ4A 4U6NA 2C7QA 1NFRA 1DKOA 1K7XB 4E5PA 4UJ5A 3LUBA 1G4HA 3LIPA 1LLCA 3K4HA 5FEMA 4YJ3F 1KAQA 2I5PO 3ZY5A 1EBFA 5D5HA 3BMQB 2G06A 1CY7A 3EZ2A 1MLDA 1DJQA 3WISA 4J2HA 4D9NA 4MKHA 4BQIA 1CUFA 4OGWA 2OFWA 3P5BA 4ZVSA 1FBTA 4DJFC 4YQFA 4FC6A 1C4WA 1ABBA 1ADYA 3STUA 1KFEB 2WDPA 5JU6A 1QIIA 1X6VA 4P54A 1S2GA 1UJBA 2PRIA 3ZV5A 4NCJA 3HVRA 4H7DA 4PGAA 3RVDA 1VLJA 2RI6A 4HDNB 3WL7A 1ZJZA 2OHGA 3ENVA 2J9XB 3GCDA 1S89A 1T1GA 1EVIA 2GUGA 4X6YA 4M8LA 5CGQB 3KQHA 4XR9A 4ZQFA 2ZYHA 1ZS9A 2DCMA 2GPNA 3D43A 4ZQGA 2G9ZA 4D97A 5D3ZA 4ZK2A 5H82A 4ZHQF 5I45A 5JXGA 2UUPA 1FA9A 3ROMA 1KQGA 1M0SA 1JLRA 4KQFA 3U17A 1Z26A 4A8JA 1F7UA 1GAJA 2AQHA 4U7PB 2Z1NA 4NBVA 4FR2A 2QXUA 2HJ9A 3CA8A 4BNYA 1Q0QA 5BNFA 2Y9MB 5FNZA 1QP8A 1EK5A 1O95D 3INGA 4GXRA 4LJAA 2WJ6A 1Y6RA 1C7RA 2G0NA 3FCEA 4ZJZA 2ZR7A 3TVYA 3WLEA 3DV2A 1DBVO 3AY7A 1JA9A 3ZV7A 5EC8A 4AK9A 2QW1A 1NBHA 1C7FA 2A14A 3NATA 1MQSA 1VCIA 2HWYA 1AA6A 4LJRA 1DOZA 1I30A 1CWUA 3F98A 4BMDA 4CM9D 2QVYX 2RCNA 2ZVJA 3AY0A 2IHBA 5I7RA 4M9SA 5I8WA 3A4MA 2QTNA 1Y98A 1ARZA 1H8HD 3DKVA 1HLGA 1DTEA 3RWMB 2NXJA 1BE1A 2Z58A 1A9RA 3A25A 5CVDA 5IKOA 1WZ2A 2Q3JA 1GZ6A 4C76A 4NZNA 1VLMA 3OX3A 4O5OA 3U2QA 4KV9A 2RJNA 1QDEA 4PC2A 3QPVA 4IIYA 3HDYA 3L7YA 1RKQA 1SMKA 5HRCA 1W8DA 2OCPA 4RMHA 1Z0UA 2HJVA 4ANFA 3PHJA 3VU1A 4ZN6A 3J7AC 3QXGA 4L95C 1JQJC 2V7BA 4RKRA 2FR8C 1SXHA 2WJZB 4AWBA 3TMAA 3HUEA 2Q8NA 5C8DA 1UFOA 4OXQA 2R8XA 4D4IA 2BMVA 1LCIA 2C8JA 4C1BA 2IH5A 2NZYA 3KL2A 2FQQA 2PUJA 3TTXA 4ARCA 4QOHA 3K6JA 5FBRB 1K0FA 2ZBPA 3NTLA 2WF9A 1EDDA 4GF5A 2XMDA 1FX1A 4TYMA 4AB1A 3ZDDA 2C5LA 2NVUA 1CRWG 2XMBA 4HC4A 1AKUA 1KNXA 1XKLA 2KW5A 5C51B 5C9ZA 2ZYSA 1IFXA 3OSUA 1E98A 1TVEA 1WD7A 1YR1A 2P77A 3IOEA 3NHUA 2BMEA 3R3YA 2QRVB 4LCJA 4Q3BA 2WMNB 4Y2VA 4EPRA 4F5EA 2GPAA 5T4EA 1QTQA 1QYIA 1CULC 3H5TA 3IR5A 4O4JF 3Q85A 4C4PA 4KE6A 4GGMX 3O95A 4GVPA 3RVNA 1P18A 4E5DA 3PRHA 3UFXB 3BGIA 4U02A 4HLUA 2R4TA 4BYMA 5IAOA 1AVTA 2YZGA 4PU0A 2EX4A 3ZS9A 4WCFA 2EX0A 5KVQA 3V34A 2H5LA 4NULA 3CN9A 4OA8A 5BSVA 3VDXA 1T1SA 4RPHA 3VSDA 4TZ0A 2F3RA 3QI7A 1FDIA 4I1RA 3E15A 4YMIA 1A3CA 1L5HA 3AYXB 1ZHOA 2VQ6A 5CVTA 4ALIA 2C61A 4WKNA 1GUAA 3RM3A 4PZZA 2W98A 3E61A 3ILSA 5FPTA 3PD1A 1TTTA 1ESCA 2WFMA 3RRMA 1B6GA 2Y1XA 1VHQA 3VX4A 2PGJA 3JD3A 4R0NA 4X61A 2NOAA 4DUGD 1GIAA 4JL5A 3GFQA 1QB8A 2Z6UA 2PMEA 2I62A 2EJTA 3D3EA 1ZH6A 3U4QB 2DEUA 1XTBA 5LZ5A 1B8PA 4BPRA 2K6GA 5ICCA 2E82A 1H0RA 2G04A 4RDHA 2V6IA 3LSTA 4UBLA 1EJ6A 4KSCA 4YHBA 5DYYA 2IHYA 3UK0A 4HNUA 1SCIA 4NCXA 1WP4A 3WHIA 4JXKA 1GVHA 2O8DB 3EPRA 2WA1A 3KL4A 3PNVA 5B1DA 4AZVA 2QRLA 3COYA 3UV6A 1KJYA 2I29A 2HREA 1WB6A 2IXTA 2C2ZA 3NU1A 4RS4A 1II8A 5LQJA 2D0DA 2CEKA 1QGYA 1T4DA 3AJEA 3CHYA 4FE3A 1JLSA 3ESRA 3KSMA 3DPIA 4Q5IA 1TJYA 1BVYF 2GAFA 1OFUA 3NHSA 3SAJA 4ESVA 3PFWO 4DCNA 3ZNOA 3Q1KA 4Z4HA 2VP6A 3TRIA 5EMNA 3IMGA 4HDSA 4REQA 2B8WA 4ZPXA 2ZRNA 2V9PA 1QPGA 1SULA 1SBZA 4JEUA 3NG1A 1KI3A 4TWZA 1DELA 3D4OA 4B3MB 1RRVA 2HAEA 4C21A 2IH4A 3C5WP 3WHPA 5HZMA 4DQVA 3PJEA 2AB0A 3D6VA 3AI3A 4C4SA 3RNLA 1I3CA 5A04A 2ZXUA 4MVJG 3AI2A 2GDZA 2X0FA 5CAEA 3FZQA 1TCAA 1C81A 6YASA 4GQBA 2JNWA 3CX7A 3EDMA 4YAJA 3MWDA 2HBRA 3OLXA 1P5RA 5H4HA 3VR5A 3ESYA 3R9KA 4BMZA 2B8TA 1RYNA 1XVIA 1U3CA 3GLHA 5B4VA 5KNDH 2JAHA 1SU8A 1E7RA 1RHMA 3FJOA 1YZHA 2RBEA 4HQFA 3MCVA 2QMUA 2X76A 4O2LA 4RAQA 1RXCA 2XI4A 1NGSA 2YJGA 4HFMA 2LCQA 4TT3A 2X3UA 3V2IA 3VO9A 3LAWA 2P7IA 2FWJA 2X5XA 4Q82A 1E20A 2ERXA 2C9MA 2PXCA 5F77A 3T1OA 1VJRA 1SXJB 5E7JA 3JASA 5HMMA 1BDIA 1RMQA 5JNTA 2RHBA 3BRSA 5DP2A 4FI3F 4C3OB 1TUIA 3WQSB 3SC2A 2ZZMA 3VQTA 4P7GA 1VPVA 1DTSA 3AR5A 3MF4A 1E5QA 1YH3A 2IHZA 3A58B 1FP1D 4JT2A 4G0QA 2GEUA 3R8XA 3UB2A 4YXFA 1GPUA 4S2UA 4JA2A 4ZOCA 5ADWA 2WUEA 3FD8A 4LNUB 1ULUA 4MV7A 1Z2NX 4AG3A 3W7VA 4FFPA 1XC7A 2Q4OA 3Q7EA 4FT4A 1KL7A 2P69A 4R1QA 4Y1EA 3E8SA 1SIOA 1U1IA 3M4JA 3GDFA 1CIJA 1DKQA 2H2DA 1XMSA 2CL7X 3LDFA 4YR7A 2GS9A 3EK2A 1IBCA 4UE2A 5KNDA 3RADC 3V3TA 3UATA 4NEQA 1E1CB 1ELOA 1U28C 2ORVA 4NARA 5FHRA 1FQKA 5KWJA 3W8RA 1F7VA 1MW9X 2F43B 4IRMA 2BFEB 3WRXA 4OQLA 3PI7A 1J2TA 3U7RA 2MT9A 3GRAA 3SS9X 4AS2A 4CCSA 4LBYA 5ES4B 1G21B 1R9GA 3U7HB 1JG2A 5A2QA 1NN1A 1F2VA 2PLFA 4A0QA 2ZIZA 3P2EA 3PX3A 2QZJA 2RGNA 2C2KA 1EAYA 1HFEL 2WYIA 1UZUA 4G5YA 4UE6A 5EQDA 1CUUA 1TYZA 4MV9A 1CE8B 4IDFA 4OK5A 5EWJB 4JLWA 4N6NA 2HRBA 2QZ4A 3IAFA 4GM1A 4RQAA 2P62A 3CEHA 2CK3A 5LDDC 2QENA 1KGSA 2FPMA 3ZGVA 1GZDA 2EL7A 1T6BY 4P33A 2OO5A 1KJZA 3EF0A 3V33A 4CM6A 1Z4JA 2JEOA 4G1CA 1QQ5A 4GSYA 4S3MA 4LUCA 5CU7A 3GARA 4XGNA 3T5GA 3EISA 4EB8A 5IYZA 2WVGA 5J58A 1LBSA 3QBDA 3WI7A 2LW7A 2NAPA 5KKNB 2XEDA 3EGXB 5CCXA 4UBMA 2G7ZA 2D8AA 3G8BA 1T0UA 3RAEC 3K9CA 3OCUA 3LX8A 2GCIA 2QDKA 3EFOB 3KZKA 3IUEA 2ZRPA 3GDWA 3C2QA 3PD7A 4QLAA 3SQDA 5FOXA 1NPTO 1V37A 4H7JA 3B9BA 3ER6A 1N7JA 3A1UA 4G1MB 3TDMA 3L8HA 1ATZA 2QE6A 4FNAA 4DTIA 2BF7A 2QW0X 3LGSA 4N18A 3BT7A 2Q5OA 2ZI3A 4QHSA 4D02A 4TTPA 3PUWA 4DKJA 1VG1A 1Q19A 1F4VA 3CWZA 3G0OA 4I8XA 4JI5B 4HV4A 3G0HA 1SIWA 1KQ3A 4JD5A 4I0WB 2XUJA 1G4UR 1R6AA 1AG9A 1WAMA 1Z13A 1G16A 3CLKA 3P97A 4ZEVA 3VSEA 3NH6A 4MYSA 3V8RA 1ILEA 1B7GO 5KVCA 1AIPA 1F5NA 4TQGA 2BJWA 2F8LA 1LU9A 3C3KA 4DIKA 5AD1A 5G0WA 4R8KA 2Z4RA 4F5DA 3AEUA 1E9SA 4BATA 4C0XA 1I4DD 3BH0A 5JVDB 3T7TA 2IHKA 2R6HA 3IT0A 3MJ4A 3WG9A 3GBPA 4BDSA 5JFOA 3SYMA 2SNIE 4S35A 3TECE 5KWIA 2E55A 5I7UA 3RCBA 2QLMA 3VR6H 2L18A 3WGOA 5JCOC 4B6EA 4DMFA 1D8TA 5LU8A 5JNUA 1D4OA 1P1FA 3L0DA 3OMLA 1O6ZA 4JJ8A 4N8EA 3VZQA 3AF2A 3Q3HA 3U1TA 2VSNA 1ORDA 3UJAA 2ZT6A 3GGGA 4K6GA 4NONA 1AC5A 5EZYA 5B57C 2DHQA 4RTSA 3WWCA 2P2CA 4PEVA 1DZ3A 3DULA 1U4OA 2FW6A 3H7IA 4PC3A 4X00A 3I72A 2NGRA 2HV9A 1V4VA 2HTEA 2VSYA 1D9ZA 4GOXA 1OT3A 2W6CX 4DB2A 1NULA 5IJ9B 1B2LA 1FX0B 3MYRA 4KYUA 5CEEA 1LRLA 4PYMA 1Z08A 2K4MA 2ZBUA 4KBGA 3NEJA 1AF7A 4J0JA 4IIGA 1X7WB 1U3WA 4TN5A 1F60A 3R5KA 1CG6A 4OIMA 4YJKA 3AK4A 2YDXA 5JYDA 1G41A 3B36A 3W05A 4UARA 1MGPA 1N6NA 4LV6A 3DGEC 3LLVA 4AZ0A 1BTOA 1PT9A 2CDNA 2XNCA 2IYOA 3AG6A 3DPUA 3GJ4A 3WZMA 3EX7C 2O0HA 1S3IA 2EHDA 5IARA 1WRBA 4GZ6A 2BY4A 4EYGA 3U3ZA 2PX8A 3Q3JB 1ZM7A 3GIDA 3L7LA 2JFYA 4EFNA 4Z3KA 3ZDCA 5FUYA 3T12A 1M34B 1QOZA 3NHKA 2XWBF 5DYGA 2ZIGA 4BZXA 4CT5A 4F3RA 2BPOA 1HZJA 2J85A 3LKVA 1BXRB 1C1XB 4Q00A 2ZTHA 5DCWA 2AG6A 3O3NB 3RUCA 2WHXA 1SCUA 3ELBA 5HEKA 2PSHA 3EVNA 4ND2A 4DANA 3S6JA 1P39A 5IT9A 1EMDA 1IPFA 4LOLA 4RA6B 5EL0A 4H1WA 2ODBA 2YIVX 4RANA 2HHHB 2J3EA 2UVDA 4IYRA 1IN5A 5L51A 1O6FA 1P3JA 3I4FA 4NE2A 1EXNA 1KH3A 2PD4A 2BFCA 3HRKA 3PX2A 2XB2A 4Q9LA 3AVWA 2HEIA 2YWRA 3W8EA 3ZTTA 1V5GA 2JI6A 3L8DA 1Z6YA 3RS0A 3NBMA 3NTRA 2R47A 3IMKA 5AJHA 2GBGA 3GEBA 4X71A 1EE1A 4J1TC 4EJFA 2ZI9A 3PQFA 4ZCQA 4U8GA 1TUBA 1ABEA 4BNVA 4TQ9A 4WN9A 1UPCA 3S1LA 1FBNA 2X14A 1TTPB 3FDFA 4MQEB 3DVLA 3WK9A 1PDVA 4CU5A 4XYLA 1ORWA 4PIMA 1WXXA 3C15C 2EWWA 2H06A 3DYBA 3GHHA 3AWIA 3NETA 4NF2A 2O2EA 1KEWA 5ALEA 3RYHA 3GA7A 1Q0LA 3JD1A 4RZSA 3HNPA 2Q6TA 4S0ZA 1DCKA 1JR3D 2DHDA 1RCUA 2K87A 1E9VA 3F6YA 3FTEA 3CR8A 4QAJA 1CB0A 1VBKA 1P62B 2ABWA 3K16A 2L17A 3OETA 4M2LA 5LYJA 3RASA 2O8BB 2JAUA 3ORHA 3TGWA 4B6GA 1MABA 1VIAA 2X8LA 2CVQA 5I5EA 4HFRA 4IJWA 1RWMA 2JFBA 1Y8ZA 4G5QA 3ZHOA 1MX5A 4GI5A 1JB9A 1ZMBA 2FOLA 3NIBA 5KJ1A 1UBTS 4U00A 4N3AA 1QH1A 3HPQA 1EXWA 1T3TA 2PZ8A 1HUQA 1S9HA 1QE3A 1BHSA 3QY0A 1V5IA 4RHYA 1HY3A 3IV7A 2ZYDA 1EHYA 2MSNA 3LCJA 4OFWA 4Q7LA 4TKLA 5KX5B 3NUZA 4R98A 4QOIA 1M2JA 1TIPA 3PUJA 2GNAA 3OPYA 5K8VA 5KO2A 1SQ5A 4PZCA 1CDZA 1IN7A 1XG5A 3DDUA 3G0BA 3W2GA 1E66A 4PZUA 1PFGA 2FUNB 3HGMA 1E3LA 1YZGA 2BFDB 2Y93A 4DLVA 2VPQA 5KMGB 4OXRA 4DILA 1PNVA 3H5AA 5T5QA 1EDOA 1Q7RA 1CQXA 3QWFA 4ATNA 3RU3A 1VB5A 4UXJA 1U6JA 3JVDA 5IDVA 4WZZA 2FWNA 4G24A 4GL2A 3QKSB 2GYYA 2VPWA 1R88A 1Y6QA 4XPZA 1AGRA 1W93A 3C5VA 2OMEA 1SU7A 3HZOA 4K28A 1F2DA 1GL6A 1L7MA 2BH9A 4KPFC 1ESNA 3LOQA 1E6EA 1NMQA 5DKFA 1ZN2A 5IH3A 1KYVA 1A9OA 4AN1A 2FZ4A 1B93A 3FVRA 3PYMA 2G83A 4NU6A 4U7GA 4CF4A 2VNIA 3I30X 2OV4A 4UUPA 4C89A 4CIXA 2DOKA 1WSWA 4HL6A 4MQ6A 4REMA 1MB4A 1NV8A 2GD6A 4IPTA 3B9RA 1ZD8A 1LK5A 1N9KA 4BRZA 1KKUA 1C9KA 1YTLA 3L6UA 2XMSA 3EIUA 2GO1A 5EERA 1KDYA 5A4FS 2IYRA 2XCSB 1FFYA 1AT1A 3B1JA 3A2LA 3FPCA 2ZRGA 3ONNA 4JLPA 1QIGA 1DRVA 3AJAA 4NYIQ 4TUYB 4PLCA 1YVUA 5AOVA 1K4YA 2J7PD 2VO1A 3U37A 1JFTA 3DE4X 4BIMA 2YOHA 5BV1A 2VZ0A 2YFHA 1B6RA 3REGA 1KEPA 1ZOIA 4JGIA 1JR4A 3E05A 1YQEA 1FTQA 4TRRA 2H1LA 1DFHA 2OWDA 4YJHB 1A2KC 1RCFA 3A2NA 1P77A 2V4MA 3DUFA 3WRVA 4YXWA 4RTMA 5EE0A 2YZKA 3R0VA 5LP6B 4G3XA 5E9QA 4F97A 5KDOA 1E64A 3IVGA 4OMDA 1Q44A 4R31A 4EUKA 2A92A 3DWIA 2BR5A 3U49A 3VNQA 4FOSA 2C2BA 2OPBA 4XUGB 1PEAA 4JOSA 4PBTA 2IZOA 4UDOA 2P5UA 2OAGA 2R4UA 2ZBQA 1X42A 3JWGA 5ALFA 3HO1A 1O95A 5EQJB 1WG8A 1GAXA 3C3MA 2XDWA 3CUWA 2CF5A 4NV1A 3ZU2A 4YUAA 5J2UA 4QATA 1X38A 3B6IA 1E2PA 4Q02A 4FFDA 3NM6B 3HNRA 4DV1B 4ZT3A 1PJ8A 2NO1A 4DCUA 4PS0A 2QL5A 1RBZA 2IL1A 4W8HA 1I94B 3I9NA 2FX2A 1GNSA 1EX9A 2RAPA 4LHEA 1UFKA 2JFVA 5HK9A 1M6HA 3IDAA 4BLUA 2HRRA 1H8HA 4OUDB 2H11A 2O3QA 4RVGA 3IBTA 1MH9A 5ALQA 1QJ4A 2J6HA 1VE9A 2FETA 3QHPA 4QWWA 3UH1A 4CV2A 3OZCA 3RC2A 1P5FA 2FF7A 4LZZA 3ER9A 1HL7A 5DMXA 2VJNA 3V2UA 2QJRA 4D8YA 5EHGA 4DF3A 3CPSA 1PEKE 1XCBA 3GYGA 1XEWY 3L82B 1DAPA 4MGZR 3OZRA 3L7KA 1QP0A 1N6KA 1HT0A 1TM1E 2PD3A 1HLFA 1I0LA 3JWHA 1C0IA 2WIDA 1A2BA 2WTXA 4LVCA 1MVOA 1GPMA 3Q10A 3RC7A 1YT5A 3B13B 3FOBA 1LV7A 3I9OA 1JL3A 3C4VA 3I37X 2REQA 2NTVA 3HY3A 3PFIA 4JI3B 5FOTA 2C95A 4UU0A 4PNZA 1IHPA 1GQQA 3F4BA 2NV2B 5C18A 1PX0A 3VOTA 1N8TA 3KT8A 4D44A 3OE7D 4YMHA 3N7AA 1NNEA 1DGQA 3GH1A 2HU2A 4DV4B 3N75A 3ZE0B 2WEKA 1WM1A 4CF3A 1E3SA 4K03A 7ADHA 4JV5B 2WINI 1KBQA 1PR1A 4IRUB 2IC5A 2V1XA 2X3YA 3OH8A 4OK6A 4M0KA 4AQYB 3DEIA 5FYQA 3PNPA 4ID9A 2O8EB 1DCMA 2KYRA 3KB2A 1YI1A 4LOHA 1HL3A 3PUXA 1T91A 5BSTA 4DIFA 1LXCA 2EEPA 3HCRA 2EP7A 3IBFA 3MSCA 4HRXA 4MDFA 3T3NA 5AYVA 5DSZA 4FFWA 4AJ1A 1MAAA 4GOJA 2RHMA 4RZUA 1TA0A 4X94A 2EYQA 3VKFA 4IYJA 1FDRA 2PKXA 3V1KA 3PJRA 4I81A 3RUHA 1QFSA 4DUGA 4XGIA 2PZAA 1TAUA 3SJ7A 3LKBA 1Y8QB 2J9GA 5JBIA 4EGQA 3TE6A 1MJGA 4H1UA 1W581 221PA 3AVYA 3FZYA 3KQTA 4P83A 2OB2A 1EEHA 3T34A 3VPAA 1L4UA 3TF5A 2Y2VA 3KSUA 3TE7A 3ZY3A 2J32A 3SMVA 3ED1A 3FSRA 4K0KB 4RY8A 4RLSA 1LB1B 2JCVA 1YBFA 1A4IA 3LCMA 4PO8A 5LB2A 3JQRA 1DPFA 2PVCA 2NVWA 4C7BA 2NU9A 2RKOA 2CKMA 3GJZA 3X1DA 1RWKA 1NV9A 2ZJ2A 1L4MA 1NW6A 5CDGA 4M46A 4KQXA 3USZA 821PA 1JSZA 1Y1TA 3DOIA 1KFBB 1UDXA 2RJ3A 2HZ7A 3LZCA 4Q7JB 1DX4A 2IXFA 3ZXUB 4DIBA 5K0FA 3KT0A 4G36A 1IQRA 2GHRA 3V32A 2Q5QA 3PENA 4WECA 4B3GA 3RYCB 3ZE8A 3BUSA 3QVKA 1C5KA 2G25A 3CNQS 4PAWA 3EDCA 1THTA 2LZ0A 1G66A 2F90A 4ZOEA 4EP1A 5E7QA 3KQLA 3ROQA 7MHTA 3RYFB 3LW8A 3DMRA 4B43A 1VPLA 2GN0A 3CBQA 2WPNA 1NBWB 4YUYA 3OEHD 1A5AB 4NPAA 2H51A 4FQ5A 2RHOA 2FMKA 2QGNA 4HWSA 4A1OA 2Q2VA 1KYXA 3ZU4A 4OSOA 4HQ6A 3V55A 3HJAA 2E4UA 1NASA 1UMBA 3I61A 5CLGA 4MJ3A 621PA 2BVNA 2FQ1A 5I6DA 3P9YA 4G9EA 4PV7A 1VJ0A 4UBJA 2P9BA 4QDUA 5AJXA 5JSYA 3TWOA 4AP5A 4DDWA 2XA2A 3G8CA 4BJ1A 2VYQA 4V0KA 3FMIA 2O3TA 2V7PA 4R9RA 4IDHA 4X1IB 1U2RA 4IMJB 3L93A 2AMVA 3FPEA 4BNZA 3QVJA 1VIMA 4QRIA 5H68A 2JD2A 2GN1A 1O97C 4NI5A 3P9PA 3Q5GA 4DB4A 1R8JA 3DH0A 5FBHA 1AHHA 1SRQA 2OM2A 3GCXA 1R9MA 4IEIA 4PW0A 5GJBA 3D8RA 3QLEA 4X97A 5FWAA 1KWGA 2BR4A 2P79A 1VPTA 3H4VA 4DRXA 5K0GA 3CVOA 1ZUNB 3NIWA 1HOXA 2PS3A 4RX1A 4BMNA 3TDNA 4CR8A 5EESA 1D09A 1NMZA 2JVJA 3PQDA 5IVIA 5CBPB 2YZ2A 5L6MB 3OTHA 2LCIA 3IESA 2A5DA 2QF7A 2HXSA 5FF9A 4ARIA 2GSDA 3KYCA 1XQ1A 3ISJA 1NVAA 1RHUA 2PFGA 3OFVA 4UHCA 1KDZA 5IKXA 4PLZA 1KAGA 1PJRA 4H0FA 6CHYA 2VUHB 1N92A 1DV1A 3FPKA 3HEAA 1XEAA 4M0DA 4MKZA 3L8YA 5ALGA 3WLRA 1NDQA 4B7CA 1ID1A 3A7DA 5BMVA 2W6IA 4ES6A 3SJBA 4DZRA 3G0CA 4PSAA 2B78A 2HCTA 4O3FA 4ND6A 3MUNA 1XP5A 4M6WB 1F48A 3B2QA 3RQSA 1Z6TA 1JBQA 4ZDWA 4ENTA 1J0AA 1NVMB 2GZ3A 2ZU0C 3BFXA 4GDMA 1TCBA 1FUUA 2B6HA 5HBGA 1CUYA 2I03A 2H29A 3B85A 3FVWA 2VHWA 4FYWA 4QC2A 5EGNA 6REQA 3L4EA 3S3TA 3Q9NA 4GYKA 3Q2IA 5AW3A 5HZHA 1KYIA 3IT2A 2CNKA 2WTEA 5EJIA 2AV6A 2QPOA 3AEQB 2V6BA 3U61B 4XUEA 4D4LA 3MWYW 4AY6A 2C0QA 2J9RA 5JATA 1W7AA 1W4BA 3HKEA 2QN1A 2J3HA 2QU8A 4Z0NA 2ZBDA 3PB3A 3AR8A 4L7QA 1R6UA 4DJAA 3ZEIA 1Y81A 1KE1A 3A1DA 3SIPA 3BJIC 1FSPA 1TU3A 5I9SA 1UPTA 1WSDA 2YJZA 1PVDA 3JVIA 3OP1A 5JY1A 1B1AA 5EIXA 4YP7A 1JDVA 3N87A 4ZMSA 2PZJA 4LSZA 2AMJA 5C7LO 2XNSA 4YRFA 2YY5A 4XGRA 1CU1A 4Q4HB 2AWNA 2CE2X 2Y1DA 4EM6A 4KUGA 5DCLA 5A02A 4IH1A 3IVAA 1M2VB 3LG2A 3MGAA 2C4KA 4ZODA 3QELA 3OG9A 3STHA 2BEVB 2JVIA 3FB4A 4MGKR 3AUKA 4YREA 3S8YA 3R7WA 1S8AA 2B0CA 2QTBA 1VE1A 1QKJA 1UZNA 1UJNA 2HT1A 1FS6A 1NJ1A 1GGJA 1OQAA 2CLMB 2LE0A 1RRFA 4BP1A 1NOKA 2PNJA 1A77A 5BQ5A 1SQSA 4FBMA 1QHNA 4FQ7A 4L75A 3BB1A 5TSDA 4N0MA 3OCJA 1N6IA 1Z35A 1ADGA 2VJOA 4GPBA 3VO2A 2Q50A 3LC7O 4Q66C 5TGZA 2VRWA 4JR0A 2AOVA 4RABA 4ZVVA 1R8SA 2JFHA 2UVPA 3QHAA 4QU8A 2N46A 2ZYAA 4Z8YA 1QXSA 3THYA 2QTCA 3HR7A 1A95A 4K0RA 4RMNA 2BEKA 1K3TA 3FWNA 1P9LA 4F9TA 4ZK6A 1E6WA 3A9TA 7GPBA 3TAUA 2PU7A 4EJSA 2QP4A 2G82A 3MUFA 4FW9A 5A05A 3KWLA 4C0LA 1P1IA 1WXQA 5DRYA 2ETVA 3RVRA 4A92A 3WQRA 1LRKA 2C4WA 3GRUA 4DA8A 1F5SA 2X58A 4WOCA 4XRGA 3GFBA 4YV1A 4BFUA 3SHVA 3UXHA 1KP2A 3VPXA 2ZWIA 2B25A 5DHTA 1DPGA 3PKJA 3P4XA 3UEOA 3ZJYA 1MFPA 4K9OA 1IG3A 1RRKA 2GBIA 3EYWA 1H4VB 3PNSA 1L1FA 4R6WA 4CR6A 4OHUA 1J7KA 2FZLA 3CT6A 4UTOA 5JMWA 4LYDA 2E0IA 1R4NA 2IY8A 1KKLA 4EBBA 1M75A 1S8FA 3MWEA 4EG5A 3WGLA 2HGSA 4Q05A 4F3CA 2UV8A 4U9UA 2IGBA 4XUCA 3EEYA 3ZBUA 2JIBA 1PZGA 1TQDA 1T3ZA 1VJ5A 3BKWA 5CBKA 4KACA 3INYA 5F2OA 4ETMA 2GCGA 1TAHA 4BX3A 1GCGA 1M7HA 5D3KA 5LUAA 2A3NA 3SHTA 1YS9A 1N75A 3CZAA 1EA7A 2EWVA 3JQGB 3O0DA 3AM3A 1YWGO 1DC3A 4M1QA 3F9RA 3KEGA 3UWSA 1J1UA 2PL1A 2WM3A 3EDYA 2I54A 1DIGA 4RGQA 3H1TA 3AMVA 4I99A 3JAKB 3TNJA 4EI9A 1N2SA 4YCBA 4IIDA 4OYYA 4PXAA 1U0EA 1CFZA 3ZWQA 1GL7A 1AQYA 4EG0A 4FYIA 2JGMA 2GRUA 3CRNA 4ZEMA 1ADJA 2IW1A 4JVNA 1MIOA 2AZTA 4MIOA 5HIKA 1QQ6A 3RKRA 1JV2B 3DZDA 4HTFB 4RELA 2Z8XA 2NUPA 3DMGA 4CV0A 1V6AA 2A9RA 1Q84A 2XD4A 4KBFA 1B76A 1O6CA 3LA8A 1CR0A 3VHRA 3EFEA 1U6KA 3AETA 3ZK8A 3G2QA 1J22A 4E11A 3QLUA 5KYNA 4F8YA 1MX1A 4NOJA 1LPBB 1XJ5A 1YIOA 2A2ZA 2IZZA 3ZJTA 1GZ7A 1U0NA 1BMFA 3DE5X 3K0EA 5C8YF 1GQYA 3H1FA 2P5TB 4BX2A 3R7SA 3SQNA 2OGSA 1E6CA 1HA3A 4D0LB 2NZJA 4PZEA 4JQOA 1GYRA 1YL7A 2VHTA 3HU1A 2D62A 3KALA 4N54A 4ZQIA 2Q8QA 2CHGA 5I9MA 3BXHA 2E9SA 1U65A 2QRNA 3CGWA 4YK7A 2C00A 3C6KA 3DA8A 4W5NA 2KLHA 3CSSA 2GXAA 3JQQA 3SU8A 3LT1A 2CSUA 3QWAA 1NAHA 3DLCA 3BGVA 3HKDB 2R00A 3NUQA 1NJGA 2O8FB 3MIZA 1P2VA 4BKOA 3HNOA 1JR3A 2HK7A 1UZLA 4IIJB 1SVMA 1XQXA 1CZRA 1Q95A 1RHKA 1GOTA 5I7EA 1J21A 2YIMA 4A9AA 2VWGA 2IYFA 3KT3A 3ORQA 4EL5A 4MUAA 4EECA 3DDWA 3HYTA 1PFWA 3QVVA 5B5SA 1JNXX 1V8OA 5BVGA 4U2BA 2ZWAA 2O19A 3PGJA 1VMAA 4QDJA 4RV5A 3ENQA 2VDNB 3H8JA 3R5JA 3W6PA 1N2JA 1DIAA 3IA2A 3WGKA 5LOVA 1NF8A 2I7TA 2C03A 1AZLA 3I23A 3LWZA 2YWCA 5CD1A 1TYDE 1J6UA 2XUKA 5JZBA 1DO8A 1R2QA 2C9CA 4TV9B 4MRPA 3IB6A 3W5JA 5KYWA 3IB3A 4BVHA 4TSFD 2JLWA 1G7CA 1HDOA 3EEBA 1LH0A 2I33A 1RAIA 3FWPA 3OUZA 2XMPA 4ZCRA 5FI5A 1YR2A 5HA5A 3TM4A 4YJFA 5A7FA 5ESWA 2CMKA 5IKPA 3RFXA 3LC0A 5DHAA 1ZK1A 3MMNA 3SF0A 1C3EA 1D3AA 5JLAA 2ZZNA 2E87A 2CLKB 1NQUA 2CJWA 3N28A 3RR2A 1AKEA 3CG0A 4AQ7A 2L0XA 4NTZA 3AGPA 1BOFA 1V26A 3I39X 3KELA 1USGA 1QHFA 2EF1A 2SBTA 4G37A 1TQ8A 4OGKA 2HNBA 1X77A 3W5HA 1Z15A 3SI7A 1NW3A 3UKDA 5DNVA 4GGPA 3E82A 1P9RA 3BHJA 3G5LA 2X2PA 3PLRA 1K6JA 1AUVA 1BCRB 3KOZA 3S4YA 4V0LA 3ZWBA 4PG5A 2DBQA 1QZ3A 4M1TA 3MHPA 3IEIA 2QD2A 3UNXA 1JSCA 3HJTA 4C0BA 4LTNA 3GQBA 4DYDA 1UKZA 4EPTA 1NF3A 5EP2A 2Y3IA 4A8HA 1FTNA 3VPHA 1DRKA 3C3JA 3SXJA 1YI8A 2W8BA 4LIPD 1NJ2A 2ZE5A 1L8QA 3T4XA 4PSVA 4Q3AA 4E2XA 4S2EA 3R3XA 4I14A 1Z4PX 1XL0A 4HEHA 2GHQA 3IQIX 4MRMA 3TZHA 4ZJUA 4IUYA 1VPWA 1W0KA 3K7EA 4MB0A 2MYTA 4KAFA 4IVRA 5HFAA 4AN0A 1KMCA 4JLUA 2H5EA 4EVQA 3M34A 2RK6A 3H9CA 4HDOB 3UGKA 5C5CA 4UVHA 3IO3A 4MW5A 4D8UA 3ZWPA 2ZW9A 3FN4A 3HZZA 3B1FA 1IUNA 3CCCA 5ITSA 4BBJA 2OHXA 4KVGA 4Q1BA 1HPLA 1XDUA 2R86A 1GO2A 4UHFA 2HRCA 3PJGA 2VP0A 3A3NA 5HIJA 3W3AD 4J3FA 4MPPA 4QG7A 1RRGA 1T4CA 4IBOA 3GLFA 2YVUA 1IY8A 3GYBA 1DQSA 4GBJA 4RIIA 3UN1A 3EH2A 2Y1CA 1OB5A 2BF4A 1I5RA 1KJJA 1STOA 2QLTA 3K53A 5B3KA 5CYPA 4M3NA 4EENA 4YMGA 3N6VA 1J06A 1XZMA 3O4HA 3ZNNA 3MS2A 4F12A 4KHZA 2WT9A 3PGVA 3FG9A 3WK6A 3R09A 5IASA 4D56A 4NZPA 4IQFA 5HNKA 3L41A 1E77A 1MW8X 3N70A 2HF7A 1GZUA 4HWOA 4P3OA 1VE3A 4B71A 3TLXA 3CPEA 5CHYA 3TL6A 2ATVA 2XE8A 2UYQA 3Q7PA 5E9JA 5BUSA 4ZVKA 3ABIA 2RGDA 4B3IA 1COWD 5C1PA 4S04A 1MQ8B 1AN9A 3P94A 4QGHA 1MH1A 3CUVA 4ZIRB 1WCWA 1CEQA 2VQFB 2JFZA 5CA0B 2AJBA 1T36B 3L01A 4NFHA 2RIRA 5EMKA 4QO7A 1RJDA 1DXOA 4LZWA 2BKLA 4EJMA 5GTDA 3F6CA 4R9VA 4UNQA 1OAKA 3QXXA 1UFQA 2PGAA 3TXYA 5A9SB 2WICA 3AYZB 5TPZD 2AG8A 3S7ZA 2ACVA 3A9VA 4M9ZA 1RLOA 2LKCA 2YINC 1C3VA 3O1JC 4QEKA 4A10A 2IEGA 4IOLA 1Y4UA 2VK8A 1CSEE 2OECA 3BTOA 3GBVA 1X7GA 5CLIA 3IEVA 2GNPA 4LF6B 2WQ7A 4NMHA 2VCYA 2YY7A 4BNNA 2KWIA 3D5EA 2EFGA 3DFFA 1XA4A 2B5OA 5TEWA 1U80A 5TVGA 5J3JA 2ZWVA 5ALJA 2XXAA 2BGUA 4YAKA 3Q5DA 5DU2A 4ZC8A 4YYZA 1JSXA 4R5MA 3SZRA 4HP8A 2FMFA 1HG1A 2XLCA 4DADA 4YPOA 3I45A 1OU0A 4RAOA 4WY2A 1ECLA 2A0UA 2F48A 2G9QA 3U9TA 1ODLA 3TQCA 2HMTA 3AFMA 2BCJQ 4WGGA 4W5RA 1OMOA 1YVRA 2HSEA 3GCZA 4TTAA 3PLAE 3MD9A 3HZRA 4S1OA 3T0GA 1NR5A 2I6QA 3D7RA 3JYNA 2WWRA 5E4TA 1I9GA 4I36A 2A9OA 2FDRA 1RDFA 2Q9AA 4PTYA 2NUAB 1MV5A 3RTEA 4BVBA 2VDRB 3DF7A 4B6RA 3O8DA 4K9KA 5DJ5A 2GZ1A 4EI8A 3TCKA 2HIMA 1N25A 1FP2A 1M6EX 2GCEA 1U8YA 1NDUA 1WKCA 3IEXA 4FIDA 1JEOA 1Z29A 4BPBA 3K0KA 4UQPA 5K3FB 1CV2A 2QGFA 4XOUA 5AKEA 5HKAA 4Z2YA 1BNCA 5L45A 1ST3A 3NM4A 1FDUA 1FW6A 4I50A 4S1PA 1PVOA 2PGIA 5DI3A 2DUWA 3AEYA 1LDBA 4LS3A 4CMIB 1NY6A 2VQ3A 3OZIA 5LXTA 5FR2A 1M2GA 4KGVA 4F45A 4LJYA 1M6VA 1TEZA 4AUNA 3DKRA 3LDHA 3NV9A 1L1QA 2GXUA 4FTWA 4OOFA 5DXAA 5JC1A 3CVVA 1WWKA 2IYEA 1XQWA 1QHXA 3DHYA 1RWOA 2XZPA 4JELA 3SJAA 2JGDA 2RKWA 1X7XB 5GV7A 2ENUA 1IN8A 3DKIA 5TR9A 3I2FA 3TQIA 3UH0A 1T8RA 2V5AA 3VYTB 5EHZA 1UM9B 3L7AA 3OCZA 3SHQA 4IWYA 1ZQ9A 3BH6A 3RLIA 1ZGCA 4Y9SA 2X5NA 3KTDA 3RBZA 5KNLA 2X1HA 1GV0A 4M8SA 3Q0IA 2WHPB 2QRJA 2B21A 5ERGB 3L8ZA 3H0KA 2I3GA 4MQLA 1P75A 1PYOA 3Q3GE 3IQGX 3H1BA 3FTFA 1HT3A 2I71A 2GOYA 1MNAA 1AURA 4OXKA 2RBGA 1YZNA 4YB8A 3L43A 3RFUA 1BA2A 2QX4A 3OEHA 4YCCA 5AJYA 1K6EA 4QUIA 5BN3A 2DQZA 3ZKAA 2IIBA 3PHGA 4PQRA 4J16C 2Z0MA 3PQ6A 3ANTA 3K8OE 2RAVA 3JXEA 3NRBA 3AY6A 3IYLW 4NEHB 5CVEA 4YDSA 5B2FA 5BY2A 5KYXA 1QX4A 3NOOA 5FOWA 2HU8A 5A0TA 1Z7GA 3ASUA 4FS8A 5HDBB 4DC0A 3GW8A 1F0PA 2X8AA 1LLUA 1SEPA 2J9ZB 3B60A 3GPBA 2BFNA 3P9QA 3RRJA 1H4SA 1H2RS 1AQLA 3CUYA 1OX4A 4WD3A 5EPOA 5SY4A 5JZVA 4MVJF 4OLJA 4XIFA 3ZE9A 1UOQA 2NPIA 1UEJA 1Y7PA 4AKGA 2FWRA 1V2GA 2AFIE 1GUYA 4HXGA 2GLUA 1I1OA 1NYLA 4F84A 4KQ6A 3TTTA 3IH5A 2KI5A 4B3FX 4DBZA 5LD2C 4X7RA 2GM5A 4IHJF 4P22A 3T7KA 4Q3LA 1ZK4A 3AKEA 2XGOA 1U8ZA 4MW7A 3BHMA 1OSNA 3PFHA 3PT5A 1OX5A 4QJ5A 2XTNA 1RJEA 4J1SA 4XLZA 2YV5A 4HGRA 3K1ZA 2Z2JA 3HSYA 5F1PA 2QTGA 3COVA 3DO8A 3SJUA 1X1TA 1J5XA 3WRYC 1MPTA 4ODIA 2ZPUA 3MK31 4ARZA 5AUNB 3JZIA 4WESA 2PSFA 4V38A 2UYHA 2PLWA 2HB6A 2JF0A 1BFUA 4XYMA 1IATA 1OXTA 5FPYA 5E0KB 2FG5A 5FBVB 1RAEA 3WLHA 2NN3C 3OEWA 4FFSA 1TZMA 2GM4A 2CVZA 3NQ41 1I2ZA 3TQFA 4IGFA 5G2OA 1QP7A 1X8KA 2PJUA 1M33A 1D0SA 2WAXA 4DR4B 3LF2A 1N2CA 1PG0A 2BFBA 2FWIA 2WE7A 1XTUA 1T3SA 3AL3A 2VWPA 3HKBB 2GZMA 4DSZA 3EGVA 4MUYA 4KXVA 1CUVA 2GF0A 4OQXA 4DGQA 2AOWA 2H2IA 3HH8A 2LR0A 2F1OA 4Q7MB 1QGUA 3MT7A 4YAWA 2OXCA 1J8FA 1W30A 1R0LA 1U7HA 4MI1A 4YV2A 2HCBA 3WIOA 1ZIDA 1AHNA 3BFJA 1B3RA 3BSWA 1P3DA 1HXHA 2QGZA 3PSHA 3CQ9A 5B53A 3OZEA 5P8WA 5REQB 3W2TA 2H9IA 5E4JA 2P6PA 5IC6A 3FB1A 4DCMA 1ZWKA 3H1PA 4P84A 4Z9YA 2EV9A 1DAHA 3HCAA 3AI7A 5COAA 3RABA 3WJ2A 5ITZB 2CDCA 4ZI2A 4EG8A 4RD2A 2OUKA 4ER3A 2GEDA 1UKYA 1QGZA 3FUWA 1K8XB 2FPKA 2KJQA 4C5CA 2ZLBA 3SE7A 4EYSA 3EASA 3EG9B 2ZANA 2JRCA 1W1WA 4FGUA 1TT7A 1UT5A 2JI7A 2H2AA 3SEAA 4XGKA 1NJ8A 3AESB 1ECBA 3ZI7A 5DMHA 2BI4A 1Y3DE 3BMQA 4TMVA 1VE6A 2A8YA 3IVCA 2WTBA 4U3JB 4FHGA 3B2EA 4WLUA 1J1IA 3ESCA 3FTDA 4PC6A 1OV6A 3AX6A 2GRAA 3O1IC 1XK7A 3TLMA 2H9AA 1XKXA 3MPOA 4NJEB 5HFNA 3GJYA 2PUDA 1A8PA 1ISMA 1MO6A 3BYZA 3L05A 2PVSA 1XTKA 3ZCVA 1UFVA 1JFSA 3DCYA 3RRNA 1E2NA 4HDNA 3TW6A 3DT9A 1KRHA 4R1TA 2YCBA 4OAPA 3WLAA 4FU0A 3VVBA 1JDBC 3GZNB 1P91A 1EP3B 1DJOA 4JJZA 2J0UB 3FNEA 3M6WA 1BW9B 1P9WA 3UK2A 1CZKA 1CZNA 5BNWA 1VCMA 3TNYA 3H1EA 4FSHA 2IEBA 3CRW1 3H5WA 4EHJA 4H59A 4RD4A 4Y2PA 5TMBA 1Z47A 1P7VA 3MFQA 4OMUA 4ZQEA 1QFXA 1OWNA 1ZPDA 5JASA 5ARDA 5JPCA 3PVSA 2PEZA 1W2HA 5CRIA 4KDCA 2OFXA 3UTCA 4YCLA 4E2ZA 1E1LA 1NBME 4GL4A 1XTQA 3GGSA 2JKYA 3EW9A 2I3BA 5CLHA 2EARA 3BSYA 3CCBA 1R5BA 2XUFA 2JC3A 2Q28A 5NULA 5EEGA 4W5QA 4UQLA 3RPEA 5IRCD 1QHGA 2JH9A 3QLTA 4W9NA 1UT6A 2JFQA 4BQPA 4YRKA 1PWZA 4Q7KA 5AKHA 4Y6GB 1K7FB 1XMOB 3WWOA 2FSGA 4BECA 3MMSA 2FQXA 3AQ4A 3G49A 1ZNZA 1AUOA 1RM4A 2QYHA 2P0YA 2GVZC 3DNPA 3WAGA 4XSVA 1T8SA 4TV8F 4JLJA 2R87A 5DM70 5EIBC 1YA4A 4P9NA 2QVLA 1XCPA 3F2VA 4OG2A 2SHKA 1JVNA 4OHFA 4IIFA 1RLUA 1FLAA 2J4DA 2ZBEA 3N76A 2IPAB 3LCCA 3LFTA 5DSXA 5FA5A 4IO1A 4DZTA 1NVXQ 2DKFA 9MHTA 1SXIA 2P4SA 3OZTA 2O2DA 5GQSA 1MB3A 1CS0B 4D46A 5AJUA 1UBSB 1VJGA 2IDMA 2VNSA 1PP4A 2XDQB 4YJ2F 5B3AA 4OBEA 2BUBA 2DUUA 5BRJA 2FPLA 1R0KA 1JFFB 2MWMA 4ZEXA 3UJPA 4LY9A 3AW8A 3W9BA 2FW9A 4EYEA 3RC9A 3T3MB 2IHNA 1LDYA 3WMEA 4WWHA 4EH1A 3DEJA 2G0TA 2MINB 2W4IA 2R6R1 1NIJA 3ZK9A 3ROKA 4EK9A 5JUWA 4J6FA 4WCDA 3HEBA 4GFDA 2C0CA 4L3WA 3WLMA 4F0JA 4FB4A 3VO1A 5GVRA 1NQWA 1QS0B 2PL9A 4QOJA 1U8UA 3ADCA 3FNRA 1ZDMA 1UC8A 3BWCA 2YW9A 2QRVA 2ZTVA 4CW7A 4O4LB 3AHJA 1RQ7A 2DSNA 3L4BA 3PE3A 3U7IA 3WKBA 3K70C 3CX3A 1AUXA 3L2OB 1DMRA 1VP3A 2XT0A 3UFXA 1RACA 2P30A 2D59A 3Q7QA 3ZDEA 2XCIA 4N3BA 5ECYA 1RLTA 5DX8A 4Y2QA 1XRMA 3WFZA 1ECGA 1FNNA 4O8ZA 4URXR 3KUDA 5FA6A 2BBSA 1N8NA 2FPRA 1IPHA 3DAPA 1G8JA 3E48A 3S2SA 3DXYA 3SIRA 2Q4BA 2WA2A 4H7FA 4IUDS 4R9UC 4RE5A 2G6BA 3KQQA 3RWOA 1QB7A 4TM7A 2Z8ZA 3DLHA 4R69A 2YNMD 3S2YA 1PJ2A 1S3FA 3HXTA 3UWDA 3PKZA 1I2DA 4F3KA 4QRHA 1UBLS 3O03A 1ZW6A 4FKMA 4E09A 2INGX 2ZBGA 5GWXA 3L7BA 1S0UA 2J09A 3U4QA 2AUMA 1GGFA 1EVQA 1WXDA 3ZC3A 3ZGZA 2HQ1A 1WTCA 3R6LA 4XB6B 1UODA 4BP8A 3LBIA 5DISB 4C20A 4OX9Y 2P3OA 3O9VA 5E7MA 4AC9A 1K5PA 3F46A 4IJKA 4C0WA 2WWTA 2X77A 2ZG6A 1XRQA 2O8DA 4QECA 1O0BA 4PPFA 4XX1A 3V8QA 4TSFA 4FNOA 3QW2A 3RFCA 1FLDA 3STWA 4XQ9A 2Y77A 3PWSA 1UWLA 1FTWA 4U2DA 4ZQHA 1ZGZA 5H3LA 1SZCA 3N8DA 4XVCA 2ES4A 5AVWA 1EGAA 2BIFA 2J67A 2PWPA 4N7MA 1V25A 1XZDA 4R2HA 2EJWA 4KPYA 4Z3OA 4QE3A 2ZI5A 2WBLC 2Y0BA 4AZ3B 1C0LA 2RI0A 4G0NA 1P8JA 4QU5A 2IZ5A 3V6MA 2VQSA 1KEVA 4F1KA 1BHJA 3ADBA 1I2MA 3CVJA 2Q62A 3EPHA 3TLYA 1QGED 3T8YA 2H1OA 2EHJA 4HLDA 2VPZA 4NV3A 2G63A 2QROA 3WL5A 3SQWA 1JJAA 1H94A 5JLJA 4DARA 4NFYA 2XB4A 1Y9DA 2PJZA 2ZATA 3B9PA 4ZD6A 2P4HX 4P7JA 4DAEA 1OOEA 2VJAA 4Q93A 3QY9A 3DEKA 2ZUUA 3K6RA 3OZAA 3H18A 3PHHA 1Z9BA 1L8OA 2AOTB 5CFNA 1YR9A 1KP3A 5HDQA 5JWOA 4AYXA 5JJIA 5YASA 5ALUA 2X9VA 1WABA 1KA9H 1LF5A 3O9MA