1B15A

Alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-acetone
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
total genus 90
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b15A00
5DF1A 2I67A 5JAMA 5JYDA 4AFNA 4TWRA 1BVRA 5F3RA 3DBRB 3IP3A 3L07A 1CQIA 3OF2A 2WTBA 2P5YA 4L73A 2F1KA 2BI7A 2GN6A 4IDDA 4LRTB 4PN3A 3ZWCA 3ZWVA 3GZNA 3JYPA 1A4UA 1QKIA 1LDBA 2Y0DA 3GG2A 3WIDA 2IZ0A 1KEWA 4PRKA 4A73A 5IZ4A 4XQGA 4E13A 1JDJA 1LQUA 1Z6ZA 4W4TA 4XR9A 2JD2A 3PHHA 1I32A 3MJCA 1UP6A 4Y98A 3I9MA 4BO2A 4R41A 4EJMA 3BAZA 2GF2A 1CEQA 2UV8A 4R3WA 4AJNA 4XRGA 1OBFO 2WYWA 1EUCA 1IHYA 4OOFA 3I4FA 3VPGA 1C0LA 4BKRA 3SLKA 1GPDG 4U5QA 4A5OA 3STHA 1UAYA 1E3SA 3IS3A 4EDFA 3IKVA 3PWSA 3GVIA 4NI5A 3I6IA 3ZWOA 3HB5X 1ZXBA 3WGGA 3WS7A 4YQYA 5B12A 5EINA 4GKBA 3AM4A 4R3NA 3I6QA 3EGOA 3EMKA 4CQMD 5IN4A 2O3TA 3E9NA 4CJXA 3NV9A 4CLDA 4OQZA 1KC3A 2BRUA 3W8DA 2Y1GA 5F1OA 3NX4A 3WFIA 2W2LD 4MO2A 1HSOA 3PHIA 2WM3A 2XPCA 4PIVA 3LVFO 5JAQA 5DZSA 1SO8A 3R3SA 4CLRA 4JCOA 1NBOA 1IY8A 3RU7A 3WGIA 1VSVA 4DQVA 1TI7A 5L40A 1ISIA 2VCYA 1Y6JA 3FTNA 1VC2A 4EI2A 4CM8A 2IYPA 4AJJA 2UUPA 4L0QA 4UUMA 1M6HA 1Y5RA 2W2KA 2OO5A 1EBUA 3AI2A 5F5NA 4Q3EA 3AW9A 4B8WA 3WG9A 2B4TO 2DFVA 3JQ7B 4XYBA 1ONPA 1T1RA 4IJUA 3V1TC 3VZQA 3RBZA 3LQFA 3PGJA 2FSVA 5MDHA 2W8ZA 3JD4A 1E0DA 1RYDA 5B37A 1KY4A 1XG5A 4HADA 4E31A 4IBOA 2GO1A 4J2HA 2OP0A 4LMPA 3VDRA 1HE3A 2FPPA 1KERA 3U09A 4HXYA 4MVJE 4UVGA 1JVSA 2HAEA 3VVCA 4GAEA 4EEXA 5G0TA 5CP8A 3VZPA 1Z82A 2VHXA 1YBVA 1MG5A 4I1IA 3P7MA 4GL4A 2FPIA 2Y0CA 3WICA 1DC6A 1ENZA 5TT0A 4ZQEA 3OETA 2RAFA 2DPHA 4RF3A 1JVBA 1TEHA 2WE8A 3C1AA 2HMUA 2J8ZA 3U3XA 3DBHB 3H9EO 2V6MA 3PK0A 4E2WA 1XSEA 3TZHA 2IE0A 3GGPA 1YOVB 4UREA 1YE3A 5EESA 1MUUA 3U4DA 2FZEA 3LF2A 1SB9A 3GEMA 4R1SA 4GWGA 2CVOA 1B0AA 5BR7A 2BGMA 2C82A 4DIOA 2DVMA 3GT0A 3GN1A 1EVIA 1K2WA 3ROQA 3IIEA 3UVEA 2AA3A 3GUYA 4GMGA 4MIOA 4F6LA 1NTOA 3FR8A 4MINA 1JAXA 2AEFA 5ADHA 3FPCA 4J4BA 3B20A 2GSDA 4M55A 3DTYA 3ZI0A 1UXHA 4KMSA 3L6OO 1O94A 3P2OA 3OEWA 3K73O 3TFQA 1LSUA 1WDLA 1XU7A 3PQDA 4LN1A 3V1YA 4IUYA 1XEAA 4BNNA 2O4UX 4BNTA 3NUGA 1NNUA 4IDCA 2PZLA 3ZU5A 1W0CA 1HT0A 1S7CA 4WLOA 4YT2A 4K1LA 1PWZA 5I9LA 1IOLA 3PFWO 1FDUA 2QQ5A 5EL0A 1GADO 3UCXA 4K26A 3KSDO 3D5QA 2W4QA 3ASVA 2P4HX 4BV9A 2YFQA 3D64A 4Z0TA 3LT0A 5DT9A 3KYCA 1N9GB 2ZB3A 1R15A 1GQQA 2O7SA 1LTHR 3JQ9A 4QTZA 3ROPA 5K6AC 2OBYA 4OMUA 4BO1A 4D41A 1NVGA 1HTBA 4AJ2A 1QV7A 3MWDB 3ZU3A 4CR6A 1PZFA 4R68A 3DMYA 2GASA 3TJRA 4BNGA 1UZNA 1DC4A 3B6ZA 5JLAA 4LRSB 4JBHA 5J23A 2FP4A 1XDWA 3FNFA 1K0UA 1E7WA 1WZIA 1AHHA 3R6DA 2A94A 3EVNA 3MOIA 2NACA 3ZV3A 4RDHA 2DBRA 3T4XA 4WPGA 7MDHA 1U3TA 3QA9A 4IGEA 4FC6A 1EFKA 3OH8A 4LCJA 1W8DA 2P9CA 1NXQA 3CIFA 1NP3A 3LT1A 3QW2A 4TRMA 4YAIA 3OP4A 2WMDA 4LSWA 4OAQA 3DONA 3TZCA 3C8MA 3H5RA 1I24A 3B1FA 4UVIA 3T7CA 4L75A 3RC7A 3S2EA 1X1EA 4CLRB 3H9QA 4YJHA 2OBNA 2C7GA 3GMDA 2G76A 3T7EA 1YQGA 3IQDB 2HK7A 3FNGA 1DSSG 4FDAA 3PJFA 1CETA 3M2PA 1LC0A 4OXYA 4YAGA 3KOUA 4XR4A 5COAA 1ZH8A 4ND2A 4IZIA 1VJ1A 2C20A 4X54A 1HZZA 1WP4A 1UDBA 2NADA 4O5OA 3HZZA 3I83A 2X86A 1NFRA 4IJWA 5COBA 4IQ0A 3F9IA 2EP5A 1MC5A 4B4UA 2Y93A 1KVSA 2DBZA 1XWFA 1HYHA 4E5PA 2X9VA 3QHAA 5B4TA 1E7SA 1U28A 1NPDA 3ROMA 3JSAA 4KDFA 1E1MA 5JDIC 3GVXA 1TT7A 1YQDA 4PVCA 1P1FA 3ASUA 1M75A 2V7PA 3F47A 3ZWPA 1FMCA 3AUUA 4FFOA 2NSDA 3R0IA 4OOEA 5G0WA 4CUKA 2PTGA 1FDVA 2YUTA 1HXHA 1VKNA 3CUKA 3GG9A 1Z73A 1L1FA 5AOVA 5FF9A 3M1LA 5JNLA 3AU9A 1ZIDA 5F1KA 3DZJA 4NJMA 2NVWA 4NJOA 5JY6A 3GFGA 4ONEA 4CMEC 1C1DB 1YJQA 3RSHA 3C1TA 4QT0A 1G0OA 3U0BA 3S2FA 1GTMA 2RBEA 3ZWBA 4HY3A 5H82A 5FI5A 4DPLA 3OIDA 2HRBA 3IJPA 4DMMA 4EYEA 5AQ1A 2D5CA 3L4BC 2VYVA 3WGYA 3A1NA 1V3TA 4K6CA 1VPDA 5LCXA 4JP3A 1F8FA 1U8FO 2OXIA 4CM1A 1U7HA 3KYBA 3QWBA 1H6BA 1PS8A 1PR3A 3T4EA 3ZHBA 4DRYA 5A02A 1JWBB 1T24A 5HWSA 2C7VA 4XDZA 2XXBA 5TJHA 1T2AA 1BXZA 3JQ9C 3L77A 3MJSA 4AJ1A 1HDCA 5IAAA 4AJKA 2Q49A 1LXCA 2EGGA 1E3JA 1FXSA 4J91A 4BKPA 2H63A 3RKRA 4Z6KA 3Q3CA 1Y8QB 3RI3A 4J1NA 3E6AA 4DPKA 2PR2A 2VT2A 3L9WA 4XYLA 4J1QA 3FSRA 5LDGA 2Z95A 2J6IA 1E7RA 4GGPA 4IGFA 5IXYA 4BKUA 2JCYA 1FDSA 4DUPA 1NX6A 3ZW8A 1O95A 4YBZA 3HDJA 1HRDA 4W7HA 3UH1A 1H2BA 2O3UA 5JDCA 1SPXA 4H3VA 3EK2A 4YRDA 4I08A 3TOXA 1E6UA 3G0OA 4TZTA 4OSOA 1A9YA 1JLLA 1PSDA 4RCVA 1DDOA 1HDXA 4G2NA 4ROSA 3X2FA 4CM3A 4XD2A 1Y7TA 2RCYA 3GGOA 3WIEA 2E49A 4XIYA 1MLDA 5ILGA 2YQ4A 5KVQA 3ADPA 2JFFA 2OL4A 3KEOA 3IUPA 3R1IA 1OC2A 4CQMB 1B2LA 5GY7A 3S55A 3D3EA 3INTA 2Y66A 1Q7GA 1F0YA 2VZ0A 2WEKA 5KJFA 3QWIA 3JYQA 2ZTUA 3RJ9A 3PP8A 4E5KA 2VNSA 4H15A 4ND5A 3QLJA 3U4CA 1EK5A 4O59O 4OM8A 1I3LA 1BXGB 4BO4A 4WE3A 5FWNA 4LSMA 3PJGA 4OL9A 1E7YA 1YDWA 2EXXA 2UVDA 4D42A 4XYGA 4B7XA 1KVRA 4RF5A 2Y1DA 4U6QA 4TSKA 4DLLA 1W73A 3RIHA 2IEBA 4MKRA 3UGKA 4NBVA 2X0RA 2JHFA 5JBIA 1P1JA 3WYBA 5HTOA 1WW8A 4PLGA 3UHAA 4NFHA 1P33A 4HNGA 1P1KA 4AL4A 1A7AA 1NVMB 4W82A 1P31A 3Q9UA 1A27A 3VPSA 4BQRA 2O3QA 2VHWA 4TMFA 1BXKA 3AFNA 3KTDA 1BGVA 2Q3EA 1PGPA 3FF4A 4I8XA 1EVJA 4R54A 3L4SO 2IDZA 5EPOA 2IRWA 2VWPA 5BSEA 5IZCA 5L7WA 3NYWA 5L7YA 4LVUA 4XGKA 1Y1PA 2I9PA 3C7DB 4A7PA 4KWHA 1PQPA 1Q0LA 4JIGA 1P9LA 3H3FA 1AXGA 3GHYA 1E6WA 2H5LA 1KC1A 3HSKA 2X1HA 4RVHA 1I10A 3LT4A 5CPFA 2W98A 3KBOA 1XIVA 2EGHA 4GX2A 3OJFA 1TA4A 2ZQZA 1HL3A 3JQGB 3IC5A 4NIMA 3W8FA 4BB6A 1ULSA 4RPLA 4DQUA 3Q9NA 1YH3A 4KP7A 1N5DA 4FQ8A 4DREA 1LBEA 2YHIB 3PGXA 4XZ3A 3TNLA 2VWGA 3ITDA 3ZWYA 5EQFA 2CZCA 2D8AA 3DHYA 3CE6A 2DM6A 4WOJA 1DLIA 2EKLA 3KYDA 2FHSA 3FBGA 2Q50A 3CEAA 1P1RA 2C5AA 3BTSA 4GMFA 2PFGA 3CZMA 5TT1A 3GK3A 2EJWA 1V6AA 4WLFA 2W2KB 3RROA 2W2LA 1NQ5A 5IZCC 5A9SB 1ENPA 3E48A 3WLEA 3PQEA 1V0JA 2NQTA 4PG7A 3JD3A 3GAZA 4ZQGA 5COQA 4GWKA 4YWJA 3GOHA 3H2ZA 4DA9A 1BDMA 4AVYA 4HFRA 3QVOA 1JWAB 5AXAA 5CDGA 5G2OA 3DZFA 4BGIA 3X2EA 3CMCO 3F4BA 3DBLA 4CLXA 4R5MA 3AM3A 1IULA 2CY0A 1X7DA 2CFCA 2DBVO 5TS3A 3G17A 3U5TA 2H6EA 3FN4A 3NGLA 5CDYA 2JFGA 3GC6A 1PZHA 2QX7A 3RUDA 3EW7A 1I3NA 1YQXA 1V3VA 2C0CA 4RPGA 2X9NA 4WUVA 4B3HA 3ITKA 1ZK3A 3MJ4A 4J16A 4PLCA 4BVAA 1VM6A 4CR8A 1CYDA 3JQFC 2VOJA 3S1LA 2CUKA 3NDIA 3FWZA 4HFNA 2BELA 1NAIA 1Y8RA 3SC4A 2Q45A 4FGWA 1WWKA 3JQ7A 4IJKA 4TKMA 3LF1A 1EFLA 1DJNA 1JKFA 1GYQA 1DC3A 4XJTA 3GR6A 4J7XA 5ILOA 2I5PO 4FS3A 3DAGA 4TRJA 2DT5A 1HF3A 1GL3A 4CMAA 1S6YA 4QSMA 3HN7A 4DLBA 5ER9A 3BMCA 4I5FA 1A71A 1RM0A 3HDHA 5DN9A 2BHLA 4MVJI 4RORA 3AOGA 1GD1O 4O0LA 4E2ZA 3UW3A 3NJ8A 3NDRA 4DVJA 4KUEA 1R66A 5IDXA 3KLPX 4XB2A 2QYSA 3E5RA 3OFSA 4GX0A 3ONFA 3RAJA 4CLOA 3E18A 4MVJM 2GERA 4F3YA 5K6AA 3BHMA 4J49A 1J6UA 1P0CA 1PEDA 4Y6RA 2PZMA 3QQPA 5A3VA 3DBVO 5DCUA 2CDCA 5JFOA 2H9IA 2NU9A 3IOYA 3W6UA 3FNHA 3ZHYA 4BMNA 4XCVA 3TL2A 3KVOA 3F1LA 3F1KA 4IQGA 1GQ2A 2VWQA 3ENNA 4QQRA 4J1TA 4NBRA 1O0SA 3F3SA 3IAHA 1N9GA 3WQSB 5DULA 1NPYA 5CDTA 3N7UA 1VJ0A 4IJVA 1PJ3A 1LLQA 2EIHA 2J5RA 4HV4A 5JAIA 3PLRA 4HFMA 2A35A 1E1KA 1N7HA 1E6EA 4CM4A 4HKTA 4DWVA 1HLPA 1GQYA 4OXNA 1BSVA 3A28A 3UICA 3ZWNA 4PZDA 1PL8A 2BH9A 1EVYA 2AW5A 3DFZA 3JQAB 2O3RA 4Y9DA 3WOHA 2UDPA 3QWFA 4D46A 5KKAA 3AFMA 4ZICA 1Z7BA 1ZK0A 4JX8A 1H0KA 4OYRA 3TF5A 4AJOA 3KSZO 3RVDA 1NQOA 3AY7A 3AUTA 3ETEA 2BD0A 5T5QA 1SNYA 1OC4A 5HBRA 1I8TA 4YAJA 1LLCA 1NWHA 1VLLA 2CMDA 2IXBA 3K2EA 3CZRA 1QORA 4DYDA 1Q1NA 1MXFA 4CLEA 2V6GA 3JYNA 4ILKA 4I5DA 1TT5A 5DP1A 4WLUA 4XQCA 4C7KA 1GEEA 1ARZA 1U9JA 1T2CA 5FYDA 2E4AA 5THKA 3SEFA 4CMIB 1ZKMA 4M1QA 3EAGA 5IDYA 3ICPA 5GMOA 3QVWA 1I01A 2O2SA 3TFOA 1D1TA 1T4DA 4WLEA 1M76A 1KOLA 1V3UA 1E92A 2X0IA 5A4DA 4JJFA 1DRWA 2HDHA 1C1XB 4UUOA 4AJEA 1KEUA 2VYND 4FIZA 1U7TA 4J7UA 4W99A 2OZPA 1A9ZA 5IXSA 1HZJA 2X8LA 1KYQA 5L7TA 2AEJA 2ZB7A 3AOEA 5HM8A 1OZAA 2GYYA 4ALKA 5A5FA 5L4NA 4P38A 1KY5A 3NT5A 3QIVA 2IZ1A 5DNAA 3ZDFA 4EBFA 4GVXA 4L9RA 3NRCA 1Y5MA 4IMPA 1C3VA 5ER6A 4CM4B 4JBIA 2PWZA 2QRJA 1YS4A 3CMMA 4NH4A 4IQ8A 1ZCJA 1XQ1A 1X0VA 4XGIA 1E5LA 1XCBA 2BMAA 4ZQFA 2PH5A 3QV1A 4ESOA 4NPCA 2O48X 1MG0A 2R6JA 3WX0A 4J1SA 5I8ZA 5GZ6A 2RH8A 3NDJA 3OA2A 4MKXA 1R0LA 3WGZA 1WMBA 4ALMA 4JXKA 4UEOA 3AWDA 5C7IO 1BRMA 2NU8A 3PYXA 2QIOA 5JDCC 4L76A 5DDIP 3WNVA 3MJEA 5JS6A 3DBRA 1ZK1A 3ADOA 5G0VA 1WZEA 3DMTA 3RQSA 5CEFA 1E3LA 1LDEA 2I65A 1B26A 1L7EA 2H1SA 1ZK4A 2OFPA 3UF0A 1P74A 2JD1A 1K5HA 4XRRA 1A5ZA 2P68A 1ORRA 2UUOA 4WCDA 5ENDA 2HK8A 2QRLA 2Y1EA 1GPJA 4WEOA 1BMDA 3DBHA 3KM0A 4ZQHA 1Q0HA 4CMGA 1GEGA 4MP8A 2PD4A 2ZKLA 1ZMOA 1P44A 3HJAA 5L45A 5FFFA 5CDSA 4E2YA 3KLMX 1PTJA 1WVGA 1WLYA 1MXHA 2C2XA 3NT4A 3WSWA 3B70A 3JQBA 4RVDA 4BQPA 1I0ZA 4RJTA 3D0OA 4YAKA 3HFSA 1BDBA 2HMSA 5KJCA 1HLDA 2AQKA 3SJ7A 1ZK2A 3I9KA 4HWKA 2D3TA 5EN4A 2NTVA 4OQYA 2GZ1A 4FPXA 1I5RA 1H6AA 3BMQB 3C7CB 3PRJA 5AYVA 5JCJA 4O1MA 4WKGA 1B16A 3ZNNA 4M54A 4L74A 5KVSA 1FF9A 3W8EA 4A0SA 1ISHA 1Z45A 1SC6A 4FSHA 1QR6A 1E5QA 5JW6A 3ANNA 1UZLA 4Y8VA 1X0XA 1GUFA 2NM0A 2JCVA 5L9AA 3V2HA 3AY6A 5JYEA 4EUHA 1U3UA 2HRZA 2DKNA 1C0IA 5KJ1A 1PJBA 3B1KA 2XAAA 1PGJA 3MJTA 2Q46A 4OSPA 4ZD6A 3PJDA 3O03A 3CPSA 1DIAA 1M6WA 1FJHA 3E9MA 2NQ8A 4IXTA 2NVBA 3W4JA 1BWSA 4R01A 2Q1WA 4KOAA 2HO5A 3EY4A 1UUFA 3CSDA 1DEHA 3QSGA 4LCEA 1OMOA 4YTEA 4F45A 4B3JA 2NWQA 4M8SA 2VNAA 2QG4A 3NKLA 3BMOA 4BNWA 1ISGA 4TVOA 2A92A 4RVUA 4XIJA 4YJFB 3TSCA 3UCEA 3VPHA 1ADFA 3DHNA 2GRAA 4MVJD 5TRTA 5A9RA 1PL6A 3SLGA 3QVXA 4E33A 4JQCA 5A9TA 4ALLA 4Y67A 1LSOA 3D4PA 4IY1A 1YO6A 2BGLA 3LU1A 2B4RO 4Z9FA 4QXMA 2VHZA 2EKPA 4RDIA 4C7JA 3W1VA 5CFZA 5JDIA 4MVJG 1XGKA 3TZQA 4RQTA 3VTFA 1ONNA 5G4LA 3ZNPA 1K89A 2V6FA 4NBUA 3OM9A 3QRWA 4F46A 2P2SA 1PS0A 4EUFA 3PPIA 1E7MA 3HWRA 2VZ9A 4HUJA 3DAPA 4CQLB 1EDOA 5CG2A 3C1OA 3ZWXA 4CUZA 2FSSA 2R00C 3F6YA 5CHEA 1K6IA 1GYRA 1GV0A 3IDSA 3MEQA 4YT8A 1P1HA 1VSUA 1KVUA 5H83A 3GQVA 4F6CA 1T1SA 3A06A 3BZUA 4KTTE 5HS4A 5KOIA 1BVUA 1NM5A 2B0JA 2PKQO 1DAOA 4IXWA 5AXDA 2GLXA 1DFHA 1ZSNA 3NT2A 3VPFA 2ZTLA 1QV6A 1H6CA 3LC1O 3VC7A 1YONA 1HEUA 1M66A 1IPFA 1YVEI 3WYEA 4CR7A 4OH1A 2C29D 4BGUA 2YV2A 3WYCA 3E82A 3INRA 1RM3A 2PZKA 1HETA 1XA0A 4ALNA 4DGSA 3JQ8B 1PR9A 4CV0A 4ZVVA 2Z5LA 4FOOA 1DIHA 1HYEA 4KQWA 1SCUA 1CDOA 1LRJA 5IDWA 4FJ2A 4NBTA 1VL6A 1D1SA 1F17A 4CMHA 4MVJH 2DC1A 2Q1SA 3HUDA 5L53A 2VRCA 3KSUA 4RVSA 2WD7A 4BO6A 4ALJA 1BW9B 2PGJA 3NJ4A 1ZSVA 3PYLA 1EE2A 1L7DA 3Q2IA 4M87A 4DBVO 1R37A 1LSSA 2RHCA 4LK3A 2NUAA 3VKVA 3OICA 3GNQA 1LEHA 3WJAA 4B8ZA 5T6BA 5JXWA 2DUUA 2JD0A 4OO3A 2X9GA 2Q2QA 4L8VA 4BNVA 4CLOB 4CV3A 3ENKA 4YJDA 4P22A 3LK7A 2FMUA 2C54A 1GY8A 4H16A 5TF4A 1NHWA 1PJTA 4AJ4A 1JKJA 3U4HA 2FY8A 3C24A 4I9NA 1NWCA 1I33A 1D7OA 1UAGA 3IUSA 1E1NA 4PCVA 3ORFA 4IZHA 7ADHA 1C14A 3I9OA 3PI7A 2F00A 3OIGA 4WCFB 3U4IA 1YBAA 3TDKA 3OJLA 5A03A 2AQHA 1YRLA 2JHGA 1B3BA 1CRWG 1CWUA 4E2XA 3FPLA 1ZUD1 3O8QA 5AVOA 4MPDA 4A03A 5HRUA 3V2UA 1YB4A 3OEYA 1B15A 1U2DA 4HNHA 1UXIA 1N8KA 2C07A 2NVUA 5C7OO 2G5CA 3DO5A 3UFXA 3PHJA 3RC1A 1E3WB 4E0BA 5JO9A 1GCUA 3JQBC 3RC2A 1QLHA 2HJSA 1H5QA 3PTZA 1W4ZA 1YWGO 1MC4A 4PLZA 4M89A 4CM6A 2YJZA 5G0SA 1EMDA 5KVVA 1LDMA 1YGYA 3WMXA 1A72A 5A04A 2AG5A 2FR0A 3ONDA 1FK8A 4EJ0A 2DFDA 3RU9A 2X23A 4J0EA 4AJIA 1SB8A 1LA2A 4FW8A 3WGHA 3ZWWA 2GZ3A 2WSBA 1N2SA 3H2SA 3WFJA 2C5EA 1PIWA 4UEKA 1GYPA 2G1UA 1PQUA 1I3KA 4R1NA 3JQAA 4CL8A 3U49A 4PLWA 4D43A 5K0ZA 1WNTA 3CXRA 3PWZA 1IL0A 1AE1A 2X5OA 4YRBA 3I4CA 4DC0A 4II3A 1D8AA 2NTJA 3HN2A 4LGVA 4U0JA 4J7CA 3PJEA 5CG1A 2HJRA 4P4NA 5G0UA 1B8VA 1F14A 3NAQA 4OIMA 1O6ZA 4YAEA 3D4NA 3ZV6A 5L4SA 2ZJ0A 3JQDA 3AJRA 4UUNA 1B3RA 1NFQA 2VT3A 4S1VA 3SBOA 3DXFA 4NJMB 3K8ZA 4KZPA 4RLHA 4E32A 1PJCA 3OSUA 3K9QO 3V2GA 3EZLA 1EVZA 4CM8B 5L3ZA 4DQXA 2WYUA 4DBZA 1DXYA 1DB3A 4D3SA 4J0FA 2YDYA 4R16A 5IJZA 1QYWA 3GRKA 3EDMA 4BMSA 2D59A 2BFOA 2PY6A 1C0KA 4WLNA 3P19A 4R69A 4K6FA 4K9DA 4NFYA 2HLPA 1PL7A 3H7AA 1WDKA 4A27A 4OKNA 1ISMA 2GD1O 1OFGA 5I9NA 4B79A 5IDQA 5BSGA 3ICCA 1DIGA 1EE9A 2X0JA 4RQUA 3PZRA 1B14A 1XKQA 2PNFA 4DMLA 5U9CA 4E21A 1FDTA 3ZU2A 2E37A 2J3IA 1XHLA 1CERA 3E5MA 4IIUA 1HDOA 1ULUA 4YVFA 3W4IA 3I23A 1R12A 4OKIA 1ZJZA 2EJVA 3GDOA 4YR9A 2NU7A 2XXJA 1LDGA 2Y1OA 4M86A 1ZW1A 2HMWA 2DAPA 4N18A 1EDZA 4ZJUA 5TC4A 5CDUA 2WWRA 1YB5A 3JQ6A 4RPJA 4NR0A 4WCFA 9LDTA 4RLSA 1DIRA 4RL6A 4TROA 5K9ZA 4C4OA 3LT2A 4PVDA 4D45A 3ZCXA 2PGLA 3ANLA 4FJ0A 3AI3A 5FI3A 2DPGA 3O26A 1QP8A 3NEPX 2I99A 3FCOA 1LC3A 1QMGA 3LSYA 4AG3A 4GLLA 5DCYA 3VZRA 3QP9A 4QFCA 5U4QA 5I8WA 4LVCA 4PRLA 3HADA 4PFJA 4DTIA 1E3WA 1GZ4A 1QLJA 4FB5A 3DQPA 2AQIA 2AXQA 1G6KA 4NK4A 1DRUA 4BNFA 4J4HA 2BFAA 4UVDA 4D3FA 2VYNA 2D5AA 1OI7A 1X13A 5JMWA 3KYCB 3IKTA 3VPXA 4RPKA 3VZSA 1DRVA 4BNJA 4WGGA 4DLAA 1VJTA 2PV7A 4FJ1A 3TWOA 3INGA 4JROA 4ALIA 5BNFA 4KUGA 4J90A 4W9NA 5BNIA 1N1GA 1DJQA 1Y81A 2HCTA 5IF3A 3LC7O 2VQ3A 3SXPA 4BKQA 4OJNA 1P0FA 2IEDA 4YT5A 4DYVA 1PJQA 1U5AA 3I52A 1DHRA 4B7CA 1HE2A 4TKLA 3SJUA 3TQHA 3OJ0A 2BFPA 2Q1TA 1R0SA 4BS9A 3BXXA 2RHRA 3VH3A 1JAYA 4G65A 4HBGA 1J4AA 3HDQA 3G1UA 3ZZNA 3PDUA 1P77A 1LI4A 3JCZA 4NHEA 3H5NA 5EIOA 4OXKA 1G0NA 4TRRA 3OQBA 4TRNA 3GEDA 1H2HA 1QYCA 2CF5A 5THQA 1NR7A 2GN9A 1SAYA 1MGOA 4Y6PA 4CV2A 4KWIA 1F06A 3FNEA 3EVTA 3MOGA 3Q0EA 4Y6SA 5KCZA 1UJMA 3M2TA 3ZU4A 2P9GA 2ZJ1A 3GFBA 1JQBA 3K92A 4NNJA 5B4VA 5KKCA 1O8CA 3UN1A 2YW9A 4XGNA 3AK4A 4Z0PA 2IYOA 4XYEA 5JPIA 1H9BA 1MX3A 1LLDA 2GZ2A 4R51A 5T64A 4YCAA 1E1LA 2Q1UA 4W9NC 1KVQA 1R4NA 1TT5B 4DIFA 2EHDA 3DL2A 3KXDA 3I5MA 4RO0A 1NAHA 5DBIA 1Y8QA 4PGFA 4CODB 4MVJF 4E5NA 3KHUA 1D4FA 4WECA 3DDNA 3MCVA 4Q3DA 1Y8RB 5T57A 3VH4A 3WDSA 2GNAA 1NR1A 3BMNB 3KUXA 3ULKA 1QXSA 2B83A 3Q1LA 1HDZA 2R2GA 5T67A 2GN4A 2PZJA 3WGOA 4J6FA 1T25A 2AMFA 4Q3AA 3NGXA 1ENOA 1VKOA 1B8UA 1MP0A 4PG4A 4Z9XA 3RUIA 5ITWA 3QE3A 3GA0A 1LDYA 1R16A 5C3MA 2P91A 3JYOA 4YJFA 4BHTA 4BO7A 2HU2A 1UDAA 3D7LA 2LDBA 4I9HA 5DCWA 2R00A 4AJLA 3MTGA 3GRPA 1HWYA 5ITVA 1UP4A 3BTUA 4B4VA 3H65A 4CQMA 5DBFA 4P4LA 1HDRA 2EP7A 1ISFA 1WPQA 3TN7A 3WTCA 3WQQA 4YJGA 4CL3A 3GUCA 2HUNA 1RPNA 3AUSA 1PGOA 2ZYDA 4RVFA 4BUCA 3BMOB 3BMNA 1M67A 4XWYA 1SMKA 5TX7A 2NTNA 3GNSA 3JQCA 1BTOA 2AEMA 4EW6A 4E6PA 5CEJA 4BOYA 1ZO8A 5CPBA 4YEDA 2VRCD 4BGEA 4AJHA 2EF1A 4BB5A 1Z75A 2RH4A 4WNIA 2P9EA 1PJ2A 4JLWA 1XELA 1QYDA 4MJLA 2GCGA 4PLTA 5DOZA 1AUPA 3H4VA 1JKIA 4FFMA 3GNTA 3DC2A 1F12A 4M49A 4JJIA 1Q2XA 1GCOA 2POQX 1LNQA 3H9JA 3PEFA 3TRIA 3U9LA 4BIIA 5L51A 1YJ8A 1SZJG 3A9WA 1ZEJA 3DZBA 3QVTA 4AJPA 4I5EA 4KQXA 4UEJA 2OHXA 3D3WB 4UVHA 1PGQA 3E8XA 1ZJYA 3DWFA 3MTJA 1PQWA 4FBGA 8LDHA 4CMEA 1E3EA 1OAAA 3ZV5A 3B1JA 1BXGA 3UAGA 2FWMX 5JO0A 2QZ9A 3WR5A 2ZATA 4OGWA 2IODA 5A9SA 1MB4A 2QHXA 3N58A 3WGQA 2FRDA 8ADHA 2VYVD 4LMRA 1KBZA 1R4MA 4ZN6A 4NFSA 4WNCA 3RFVA 4IDAA 3LLVA 3K6JA 4GX5A 1H9AA 1ADBA 1WDMA 3GEGA 5ES3A 3V8BA 2CSUA 4D7AA 5IG2A 2OP1A 1MFZA 1SBYA 4LISA 3KRTA 4Z0HO 2HMTA 1DOHA 2X7HA 2X5JO 2V65A 5A5EA 1R0KA 2FR8A 3LDHA 4UAGA 5C5IA 3Q11A 3UCFA 4D0SA 3LYLA 3PQFA 4NDNE 5BSHA 3BYZA 4D79A 3KYDB 1R4NB 3RBXA 3C3XA 2B35A 4GQAA 4E30A 4R9SA 2A9FA 4ZU3A 3UXYA 1HYGA 3ZNOA 1BW9A 3RCBA 4QX6A 4R9RA 4JK3A 3AOEC 4PZCA 2YZ7A 2HQ1A 1T2EA 1NASA 3CTMA 4FCCA 1Q7CA 2TMDA 1U4OA 3E9QA 5ICMA 5JAZA 4QO8A 3K5PA 2DQ4A 4CM9D 4WJZA 1E7QA 4ND4A 1Q7BA 1I2ZA 2BGKA 2D4AA 4L4SA 3PHGA 3LC2O 5G4KA 3ZW9A 3I3OA 1UXGA 2YY7A 4CLHA 4D44A 5LDHA 1I2BA 4ZHSA 4JGBA 4MP6A 4BGVA 1EUZA 3PYMA 1CQJA 1EQUA 2O7QA 2X6TA 2DU8A 2J3HA 4UULA 4ZRMA 1I2CA 4LW8A 3PFFA 3I9NA 4OHUA 3PIDA 5TNXA 3WWYA 5JY1A 2NV6A 4EEZA 5F21A 4KTVE 3RJ5A 3L4BA 2ET6A 3WLFA 4PLPA 4EITA 1YL5A 1MV8A 4XDYA 3AUAA 3HDYA 5GZ3A 2Y1FA 2VOEA 4U6SA 4IDBA 2GUGA 5JC1A 4WK6A 1NHGA 5LC1A 2O3SA 3CINA 2PH3A 4Z3KA 4XYMA 2O2YA 1C1DA 3ROKA 5IFLA 1K6XA 1DAPA 1H6DA 3K2BA 5AXCA 2ILTA 2PD3A 1GUZA 2P4QA 1DO8A 2ZYAA 4CM5A 1KIFA 2ZCVA 2VRBA 3OIFA 3F4LA 3TL3A 3P2YA 2Q4EA 1JN0A 3WWZA 1X7HA 3CKYA 3EUWA 1U2GA 4II2A 3D4OA 3VDQA 2BLLA 4AICA 2FZWA 3ETDA 4WOKA 4ZA2A 2YYYA 1SEVA 2QRKA 3WB9A 5KNLA 4L4RA 1LQTA 3COSA 4KUHA 3ZHZA 1HE5A 1FDWA 4UUPA 4U0KA 1I30A 4JBGA 4ND3A 4ZQBA 4JJGA 1J0XO 4IS2A 1EK6A 3KETA 4D3DA 1XQ6A 2HK9A 4YYZA 2SCUA 2AE1A 3PWKA 1RM5A 1GFSA 3JQEA 4O63O 2Y05A 3DBLB 4G5HA 1IZ0A 3GDGA 3S2GA 3F5QA 5EMHA 3PZBA 2WE7A 2CDAA 3QJ5A 3NTOA 2B4QA 2PKRA 3F5SA 2VZ8A 4CMJA 1P45A 4UVEA 3CH6A 5KWEA 3RD5A 4NK5A 2PA3A 1LU9A 2VN8A 3HE3A 1ENYA 3VKUA 4GH5A 1O5IA 1JU9A 3O38A 3RUHA 3UKOA 2CDBA 2JFHA 2ZTMA 4QUKA 2VWHA 4WEQA 2GGSA 3JD1A 9LDBA 3SX2A 2I3AA 1V35A 5EQDA 1HE4A 3VH2A 2EWMA 5I7FA 2PKQP 4R1TA 2I6TA 1YOVA 4YACA 3O4RA 2QYTA 2PK3A 3MJVA 4FFRA 3FR7A 2YV1A 3EHEA 3DEYX 3VVBA 3G49A 2YHIA 5IN5A 2V6BA 2EERA 4IDGA 3I9LA 3ZHXA 3GPDG 1PGNA 3L6EA 4QEDA 4Z9YA 2DBQA 3D5TA 1GU7A 3PVZA 1C0PA 2O3JA 4GX1A 4BKOA 2VUTA 3RUEA 4BNIA 1RJWA 4Q39A 4IMRA 3RUCA 1SEPA 2Q99A 4XJSA 1XYGA 3DOJA 4NMHA 4RPHA 4CMKA 1LDNA 2EKQA 3GN2A 2W90A 1IZ9A 4XA8A 1N7GA 4FFPA 1B8PA 4A26A 2OOSA 2I66A 1EZ4A 2AG8A 4IPTA 5H81A 4CV1A 1WAMA 3ZWMA 2WD8A 3OQ1A 3JV7A 2EW2A 3JTMA 2B5VA 2B36A 4N5MA 3ZGYA 4GBJA 3GVHA 3EYWA 1ZVMA 2BFMA 5I7VA 2BKAA 1RKXA 1UDCA 4EUEA 3AI1A 1B7GO 1ZBQA 2PD6A 1CF2O 1DFGA 1WXDA 3TOZA 3WTBA 3RASA 4MP3A 3KO8A 4IM7A 4I9UA 3ZWAA 4B7UA 3BIOA 4R4JA 2Y99A 2ZB4A 3IJRA 3HB4X 1K6JA 1YBMA 3ETGA 3SC6A 2JAPA 3KV3O 4BNMA 1K3TA 3ABIA 1LUAA 1R6DA 2NNLD 2E48A 1DLJA 2OMEA 3OHSX 3GVCA 1HDYA 5F5LA 3FRJA 3ONEA 3ZH2A 1U3WA 1LJ8A 3OMLA 4ND1A 5GZ1A 3GVPA 5JSFA 3HHPA 2X58A 4D0RA 4IDEA 1PX0A 3I9JA 5EERA 3RKUA 1C1XA 1XLTA 1Y9EA 3DMTC 1P1IA 4GI2A 3UUWA 1GUYA 1SOWA 3BHIA 3VAZA 1UH5A 1F8GA 1TXGA 2FPGA 3C7AA 4RZIA 1XR3A 2VUSA 3OJEA 1NYTA 4CMIA 5EJ2A 1VE9A 3E03A 3MWEB 1O89A 1DIBA 1NFFA 1YL7A 2C59A 4R1UA 4BO5A 5C7LO 1NQTA 4RZHA 4RF2A 3ANMA 5B4UA 3WGTA 3WNQA 5KJ6A 1A4IA 1RYEA 4NQZA 1GZ3A 1KETA 3RC9A 4PZEA 1LSJA 1ZFNA 5HA5A 1MFPA 3OJOA 4HX5A 3W6ZA 3EC7A 4U8GA 4QO7A 3O9ZA 1PZGA 3VTZA 3C85A 1DHTA 1T26A 1AN9A 3K96A 2YFHA 4K28A 4GSKA 4E3ZA 1HSZA 4DC1A 4FC7A 3M1AA 1UP7A 1X1TA 3OECA 4DIBA 1TB4A 3DFUA 2DTXA 3DHEA 4MDHA 4NBWA 4YJHB 1HKUA 5A06A 2GPTA 3VOSA 3BHJA 3VHRA 1U8XX 2PLAA 2QW8A 2XOXA 5HS6A 3GF4A 4FFNA 4J9UE 1ZZEA 1T4BA 2OUIA 2VTDA 3KEQA 3QVSA 4FD3A 1I3MA 5C37A 3G1TA 1RWBA 1JA9A 1W6UA 2BI8A 2VHYA 4YB8A 5TIIA 4ZRNA 4Q3BA 1TVEA 2OORA 1ONOA 4BNYA 2ZCUA 4PLFA 4BO0A 1N92A 3GPIA 1H94A 5BSFA 3FD8A 1XU9A 4FGSA 4MKZA 3V1UA 3L9XA 1ZMTA 2DUWA 3H9UA 5L95A 3WMWA 4GPD1 1VL0A 4FR5A 4TVBA 1GV1A 1DBVO 2ZK7A 3G3EA 4PLHA 2HMVA 6ADHA 3AM5A 1ADCA 3JQFA 4BO9A 3JD0A 3WBFA 4GKVA 1GDHA 3V5NA 1DPGA 4BNHA 2HSDA 3H6KA 5BQFA 4L4XA 3F46A 4IDFA 4U7WA 2WJPA 2EG9A 4XQ9A 2EV9A 1YDEA 1T2DA 4ID9A 2J5QA 2Z1NA 4B4WA 5ICSA 4B3IA 2QZZA 1U1IA 3QWAA 3TZKA 2OGUA 1A7KA 4IS3A 3NTQA 1NQAO 3WSVA 1WMAA 1X15A 2X4GA 3DB2A 1CJCA 4E12A 1DC5A 1QSGA 5KIAA 1R4MB 3Q6IA 4HFJA 1UXJA 2X22A 1J5PA 4NG5A 5KVCA 4FOSA 4BO3A 4CMCA 2VTEA 2I76A 5U1PA 3DAFA 3GH3A 3LZ6A 2GN8A 3I1JA 1NPTO 2WD7B 4ITUA 3PHLA 1U5CA 4A10A 3GAFA 3BMCB 3JD2A 4TQGA 1V8BA 5KJEA 3GZ4A 1JW9B 2Q2WA 1Y9AA 3RUAA 2B37A 4J3FA 3H3JA 4CUJA 5JC8A 5TLSA 2IXAA 4KDEA 3GY0A 2Y0EA 4BMVA 2G0TA 2G82A 4J2OA 4DXHA 1PWXA 2O4CA 1OOEA 2DTDA 4MIYA 4TZKA 2JAHA 1IHXA 1IYZA 3RFTA 4RVGA 1UR5A 4RF4A 3ON5A 3GHHA 4N5NA 4HP8A 3KB6A 2JCXA 2J3JA 2J5KA 4R5HA 1P3DA 5CAEA 3GGGA 2CVZA 2ZQYA 4INAA 3PXXA 2AHRA 4RV9A 2X5KO 4CMBA 3JQ8A 3KZVA 3G79A 1TLTA 2DLDA 4E4YA 1GZ6A 1KEPA 2EEZA 2YDXA 1EBFA 1N1EA 2GDZA 4BNLA 5B1YA 3PIIA 4N7RA 1AGNA 4NU5A 2X0NA 1GAEO 4FN4A 5T8KA 1KVTA 1M2WA 2AE2A 5FEUA 1T2FA 5JMPA 4IINA 3ZNQA 2D2IA 3OQ6A 2CD9A 2DTEA 3H8VA 4J43A 4BNKA 3JQAD 5TGDA 4GGOA 1Z74A 2JKVA 3BA1A 4WCFC 2UAGA 5ENVA 4YJGB 4PG5A 2CF6A 4NZ9A 3K30A 4DPMA 2AQ8A 5I7EA 4GVLA 3WXBA 5JCXA 4J4TA 4BNXA 2FOIA 3SVTA 1LLUA 3GLQA 4XKJA 3BTVA 4MVJP 3FI9A 2FN7A 2TMGA 5DOVA 1DFIA 3FHLA 3S2IA 4CQLA 1GR0A 3RBVA 3GDFA 3DOOA 5JE8A 1Z7EA 3DTTA 1EUDA 4A2CA 4W6ZA 1PS9A 3M6IA 2FR1A 4MIEA 2LDXA 1KEVA 1J49A 4BL5A 3QWHA 3P5SA 2ZB8A 1I36A 3K31A 1IPEA 1ID1A 2D1YA 3WQRA 3DZKA 3RUFA 3WJ7A 3TPCA 3R3JA 3FTPA 4P8RA 2VHVA 3OA0A 3OBBA 5CEEA 4XQEA 4GLOA 4YA6A 1VI2A 2ZIZA 1BG6A 4Z3DA 5L4LA 1D3AA 1SOVA 4DL9A 4G81A 4BNUA 3IL2A 5A1TA 1QRRA 2BF7A 3W4KA 3D3WA 5A3JA 4YQZA 6LDHA 1BHSA 3IMFA 3ZV4A 3A4VA 3AY3A 1X14A 1ZEMA 4MVJA 5BT9A 2E82A 4IIVA 3RFXA 4YDRA 4PLVA 4YPOA 5TJ9A 3PLNA 3HQ4O 4EZBA 1NVTA 4N54A 5BNTA 1PU2A 3E1KA 4GSLA 1LRKA 2ZYGA 3EZYA 1ZSYA 3FWNA 3A14A 5JCJD 5TSDA 4JNKA 4BNZA 3DZIA 2YQ5A 4PG6A 4URFA 3GMSA 3H5AA 4YXFA 1UZMA 3DZHA 1ZXLA 2ZTVA 5G4KB 3RWBA 2NU6A 3IP1A 1QG6A 2B69A 3FBTA 5A05A 1EEHA 4BO8A 3N74A 4W7IA 1O9BA 4Q3NA 2NLOA 2G17A 2YV3A 1LRLA 2B5WA 2UYYA 3Q2KA 4N5LA 3O8QB 4E5MA 3AU8A 2WDZA 3VH1A 2XF8A 5AXBA 2EW8A 2WYVA 3HNPA 2A4KA 3DOCA 1V9LA 3HG7A 2JJYA 4Q9NA 1AHIA 4BV8A 4MOWA 1JTVA 2CVQA 1HDGO 2E6UX 2O23A 3L6DA 2PGDA 1U4SA 4XEHA 5F1PA 4E5YA 4YT4A 3ZN2A 2C2YA 1H93A 1ML3A 5T8KC 2J3KA 4PLYA 4CM7A 4I5GA 1QYXA 2D0IA 4PG8A 5MGBA 1ZNQO 3JQGA 3GZNB 3U62A 1E3IA 4WASA 1YXMA 1LX6A 3LLSA 1RM4A 4XB1A 4CM9A 3S8MA 1QYVA 2Z1MA 2NVUB 4O6VA 1IUKA 2IZZA 3BMQA 4P4GA 1Q0QA 4XX0A 2CNBA 1KS9A 4EGFA 4S3MA 1EQ2A 1MA0A 4NU6A 2VUUA 1YL6A 4ZGWA 1PJSA 3D1LA 2P5UA 1PJ4A 2O50A 2Y67A 2I3GA 2JL1A 1X7GA 3BTOA 2YHUA 1IB6A 4FFLA 4J9VA 3DR3A 1U3VA 4QFDA 1CIVA 3DZGA 5I9MA 4WLVA 3UOGA 5DP2A 4YRAA 1YKFA 4CPDA 1YB1A 1PZEA 3MZ0A 3H9GA 5KTKA 1ISJA 4QECA 1VRWA 2GR9A 2RIRA 4Q3CA 3JYLA 2Q2VA 1E77A 1PJLA 5TQVA 3WBBA 4JP2A 1ADGA 3L0DA 1IE3A 3TZ6A 2HKIA 1UXKA 3ST7A 3PDJA 3HFGA 1VL8A 3QY9A 4JN6B 2Y1CA 4H7PA 5DBGA 4EJ6A 5I7SA 4RGBA 2Q4BA 4B4OA 1G1AA 3NTRA 2Y68A 1AXEA
chains in the Genus database with same CATH superfamily
5DF1A 5JYDA 5F3WB 2QR3A 1KJWA 1EWKA 2QJWA 2YTZA 3OKPA 1RCUA 4N6NA 4WCVA 3W2EA 4E11A 5JR3A 4FWIB 4QU8A 4CGZA 3IUYA 4FZ5A 3QEAZ 2WHQA 3OF2A 4ABYA 3A04A 4B3MB 4MUJA 5AHOA 2UZ3A 1VYTA 4ZTZB 4L73A 1VBKA 2GN6A 3FYDA 2DECA 4ID3A 3IJEB 4LOHA 4MR8A 4NOLA 3V34A 1U8AA 3VBEA 2C84A 2XA2A 3OX2A 3JYPA 3RANA 1Q19A 2OAGA 5LYYA 1QKIA 1Q83A 1AC5A 2RGWA 1LDBA 5G02A 3GG2A 3IR7A 5BUZA 3BIJA 4C4TA 2JPDA 2WSLA 4XQGA 2E5LB 5IKPA 1LQUA 4RDXA 2R3SA 4XR9A 4BRSA 3LQRA 1G291 1I32A 4JEHA 3ED5A 5AKJA 3BE6A 3I9MA 2OGWA 1WIWA 4YMGA 3BAZA 3EQ7A 4YRLA 4KR6A 1WCV1 2E4YA 1CLUA 2P3LA 2FN4A 3NTLA 1S4QA 3N2GA 4ZOCA 1RMTA 4DJDC 2WYWA 1EUCA 2ZE6A 1ZHFA 5ALVA 2ZJFA 3COJA 3ESBA 4OOFA 3QVJA 3VPGA 1Z16A 1E4YA 3QHPA 2X6RA 4U5QA 5ALGA 2ZAMA 1XCGB 1NY5A 1GRRA 1ORTA 5KWIA 3ZQUA 1YMVA 2QDKA 2WF5A 2C4KA 1OBCA 3DEHA 4I8IA 5FOSA 2IIBA 4TV9B 2H2IA 2HXYA 2XKBA 2GD6A 3PDIB 3H6GA 4JL8A 4IDPA 1ZXBA 2AMLA 3WS7A 3LYAA 2NO1A 1HOXA 4YQYA 5BOSB 4GKBA 4RMGA 3JWJA 5GOZA 2ZRGA 4B43A 1W36C 3I6QA 3TFWA 3F6SA 4M3NA 3VZBA 1E5TA 3ZDZB 3A4LA 2O3TA 3MSCA 2D8MA 1J2YA 3E9NA 1W35A 3O2JA 3NV9A 3UK0A 1QH0A 3LWNA 3N2KB 4CJXA 4KR3A 2BRUA 5EZ5A 3SZGA 1NG1A 2J30A 4EY4A 1WUKS 2QUKA 2VTKA 3CN9A 4V3BA 4UMEA 4B3CA 4D4JA 3FETA 4P2BA 3WLSA 3PHIA 2ZULA 4RKQA 1ITZA 1GKKA 4CIBA 1U1FA 3OCYA 4JYCA 4KJXA 4KQKA 4KMRA 5IUKC 1YRBA 4RTSA 1SO8A 4LGYA 4CLRA 3EXIB 3F3KA 4JCOA 4C7OA 1IY8A 2FPGB 4UNQA 3WGIA 2JVIA 3SYRA 1GQRA 4JSRA 4D9EA 4KH0A 4BZQA 4DY4A 5CXQA 1EINA 1SUSA 4C89A 1SC9A 5DK4A 5TPWB 2JRLA 4JLBA 1ZMXA 1R0XA 2B8TA 4B44A 4H0FA 1VFNA 1Y5RA 1P73A 2W0MA 1EBUA 4L3VA 4UC0A 4KR0A 2C2HA 3AGPA 4AK9A 2AJBA 4PGAA 5GGYA 1WCIA 3AW9A 4IO0A 2C3OA 9ATCA 3PRKE 5B3LA 1B6TA 1ONPA 1T1RA 3VZQA 3RBZA 3HUTA 3EGVA 2FSVA 2YMLA 4TWBA 3DYBA 2CHQA 2OFXA 1R50A 5FA8A 5JANA 4DCJA 1KRHA 1RXYA 4EFDA 4IBOA 4YCMA 2VLBA 2EKZA 4B7ZA 4ZT5A 5IEJA 5LN1A 2CLFB 3D8BA 1KERA 3KJQA 3ZJ4A 4OFBA 1LZKA 3ZCQA 1P18A 5CA1F 2AOXA 2BEKA 5LU9A 1IBKB 4GAEA 3LGAA 521PA 1O94C 1Y3HA 4MR8B 1XZLA 4UUAA 1Y3IA 2I6SA 2VHXA 2BEVA 3LKBA 1PQ4A 1U7XA 1TCVA 4IIYA 5SZKB 5H4HA 3P7MA 1ZD5A 1O96B 5GIPE 2I1VB 2UVPA 5EMJA 1E2PA 2AOVA 1ENZA 3LBNA 1J8DA 3V4FA 1B1AA 3C5WP 4KG7A 3MTAA 4RS4A 5CFLA 5JMTA 2DPHA 4HQ6A 2XY4A 3TEJA 2FJPA 3URMA 2VDLB 1JVBA 1JILA 2DPXA 4JODA 3PXBA 1I94B 3H9EO 2V6MA 1S2IA 3D31A 3K9GA 3G2LA 2PVPA 4E2WA 1WE2A 3YASA 3HYRA 2IF0A 4YIHA 3T7JA 1F2UB 3GGPA 3CPEA 2ALJA 2XYPA 1EJBA 4OREX 3QKSB 5EESA 2BAGA 2ZRDA 2XE6A 1IXYA 3IELA 1SB9A 2PZ8A 4MAFA 2QTHA 5ALXA 2ACKA 1DQNA 2JK1A 4TWZA 2XCOA 1MC1A 3OLZA 3QM1A 2H1CA 3HV2A 5IH3A 1RVDA 2C82A 2GFQA 4KXYA 3BIWA 3ZHTA 3IUMA 4DIOA 4S2EA 2BKLA 2QRMA 3GT0A 4J2TA 4OH7A 4OU5A 1X77A 5IWCA 5JNVA 5BSMA 2X1VA 3GUYA 3RK4A 1SH7A 1KJ9A 4MINA 4IIBA 3O3NB 1T4CA 2P2LA 4CF6A 1IJBA 2CGEA 5LL6P 3V1KA 4DV4B 3BILA 3GLFE 3C3BA 3P2OA 4KQMA 3UUEA 3KU4A 2GFHA 2H2DA 3K73O 4QDUA 3T5CA 1J8MF 1XTZA 4LN1A 3TFQA 5BXQC 5KTYA 4ESHA 3CLTC 2XUKA 3LT5A 4HLDA 1NNUA 1UFKA 4BFTA 1W0CA 1SCQA 1G41A 1J70A 4L2IB 1PWZA 3RWMB 1EHIA 5GONF 3PFWO 1NULA 1FDUA 1O9GA 1VBMA 2DR0A 1GADO 4QUDA 3HVJA 4CT4B 1Z2OX 5CYPA 2ZVDA 4XSVA 4YRSA 2QJOA 1MEOA 3B1XA 2YIMA 5EKUA 3NVMB 3T06B 2HADA 2YFQA 1UT8A 2VJPA 4Z0TA 3LECA 1MVNA 1OAKA 5HCUA 4MQEB 2WMOB 4XLLA 2O7SA 1LTHR 4JZYA 1QHSA 1NLFA 1GTSA 2OBYA 3K53A 3FY4A 5K0NA 5I5GA 1HG0A 2JATA 1IXSB 2NQ2C 1G8FA 1G8MA 1PV2A 2ZB2A 3C6MA 3KZMA 1EFRA 2EFEB 3L1VA 4GDFA 1K5DA 1V8FA 4W1PA 1XD8A 2OBMA 2VFAA 3ZD6A 2DY1A 3B9RA 4BNGA 3AEUA 2DCMA 5JLAA 4JOBA 2CB0A 3H1EA 5FFNA 2XCQA 3F4KA 4TWAA 5EKSA 4JOQA 4UE6A 1DARA 3U3MA 5J23A 3DJYA 5DMHA 3IX7A 1MR3F 1FW8A 1QGUB 1MAVA 1W75A 1D6NA 5AJWA 2AVNA 2RHGB 1GSHA 3EUFA 4I2NA 1HFWA 2A94A 5KOYA 4MHTA 1BCRA 5DE3A 2BM0A 2IHUA 2NACA 2DBRA 2VS1A 1GPMA 2QLBA 4IGEA 1N4AA 3SYKA 1SBQA 3IPRA 3Q72A 1NUTA 4TRMA 4YAIA 2WMDA 3EDYA 4AN1A 4DFDA 2HGSA 4B0OA 2PYDA 2XCRB 4UVIA 1WU8A 2D0DA 1XLVA 4U2DA 4ZXFA 3S2EA 3W2FA 3QY0A 3C8DA 3T9FA 3FMIA 3H9QA 4QNNA 1WDWB 3G2QA 3IJ5A 1HC7A 2CZGA 1SD5A 1MVOA 4OHYA 2DUMA 2WOJA 2G76A 2AX4A 3S2UA 3WRXA 5CDHA 2HK7A 3FNGA 1NDQA 4FDAA 1P4HA 4QT4A 3EXEB 3EZ9A 1LC0A 4OXYA 4X5OA 2OECA 3WLRA 2C9ZA 1PDOA 2PUVA 4FGJA 4L50A 4LTNA 4XR4A 2TMYA 5COAA 4ND2A 4GF5A 1XTTA 1MRNA 2C20A 4Q37A 4X54A 4AJ9A 3QXCA 5LMNB 2NADA 5H8WA 4AY4A 3BQMB 3I83A 2FX3A 3HRIA 4KFSA 4I2VA 5B1EA 1NP6A 3LY8A 4IQ0A 1TUIA 3F9IA 4DARA 2XZPA 4FDUA 2O0HA 1RCFA 1Z39A 4NBSA 2IXFA 4PZ9A 3E3NA 1KJQA 1KU6A 1H65A 1V71A 2XGMA 5EIWA 3RS8A 4ZI7B 5HZHA 4PANA 5B4TA 2X9VA 1IN4A 2PH1A 1E7SA 2Y1WA 3KPJA 1ZGAA 3B85A 2JI8A 4KQ2A 2PZAA 4MH0R 5E2IA 2ONCA 2GJAA 3GVXA 3D7SA 4GI7A 3T1QA 1MOQA 4PVCA 2OG2A 2V7PA 3TIIA 3GPCA 2CFSA 5DNVA 1R8XA 2J0VA 3AEUB 3DF9A 2VRNA 4QARA 4GPTA 2XRYA 1HXHA 3GG9A 1QIHA 3KJEA 5JNLA 1UINA 2J9FB 2E4UA 3M1LA 2XHZA 3X1ZA 3BAFA 2XB2A 2OAQ1 1QP0A 2WTMA 3IBGA 3EGWA 3F2VA 2ATIA 1C3LA 2NVWA 4NJMA 4O8CA 2YWDA 4UNRA 4OHMA 2AJ8A 4LOKA 2EL7A 1ULAA 3D6AA 4ONEA 3TXAA 5HP4A 3HM9A 2Q5QA 1IUPA 3HZHA 3M4ZA 3OFVA 3C1TA 4D1YA 1H5UA 5K0FA 4EJSA 1EQAA 2EKBA 3U0BA 2KWIA 1GTMA 4MR9B 2RBEA 2LP4Y 3S2FA 3WK6A 1QQ6A 2QMHA 3FKSA 3HY4A 1XCLA 2I2WA 2ID8A 5FI5A 3OIDA 4DLYA 4ARIA 1LPMA 4EYEA 3O82A 4FCTA 4DMMA 5AQ1A 1HMPA 3W78A 3L4BC 4B5KA 2QU7A 2VYVA 3LBHA 3A1NA 3L40A 4YP5A 5TT0A 2PJDA 5LCXA 1VPDA 2OBFA 3B36A 3ED1A 3EISA 2PMFA 2WA2A 3ISTA 3A7EA 2GYVA 4KE9A 1ECPA 3T4EA 4DRYA 4LF7B 3IT2A 1JWBB 4GGMX 3IAM6 3AUYA 4KDCA 3PLAE 3IUNA 5H68A 4C3ZA 5HWSA 2G04A 2H4HA 5DYYA 2N0SA 1A82A 3L77A 1YU9A 5JSZA 3B5EA 4GL2A 3I73A 3GLTA 4AJ1A 1ULBA 2ZIVB 1EU1A 4ZT3A 1AG9A 1PT5A 3NNNA 4IF6A 2ETVA 2PA0A 2O20A 2YJ4A 3KXLA 3L6UA 3QUTA 1BKYA 4YJ3F 1E3JA 1X2EA 3LUJA 4J91A 4EH1A 4F56A 1U1CA 1SCKA 1SKBA 3Q3CA 4YCCA 1OV4A 4FGZA 4HWTA 3GNLA 3ZQ6A 1KQGA 1JP7A 4I9GA 1LPSA 3UAWA 2VT2A 3QZUA 4J1QA 4OSEA 1F4LA 5LP6F 3FX2A 3UEOA 3MFYA 5K1ZA 3TBFA 3ZTWA 4ZCRA 5AQEA 3EA5A 1CULC 2ZUEA 4MUEA 3DV9A 1FDSA 3LX6A 3DJFA 1I9GA 1R5BA 1SHKA 3GLSA 2NV0A 2W43A 2YCBA 5G3YA 1O95A 1LX7A 4RA6B 4FCVA 5T41A 3LMKA 3O8BA 1DKQA 4W7HA 1WLSA 2XDQB 3UH1A 3RYCB 1AGXA 3JX9A 3H5IA 1TEZA 1PD0A 2HCFA 3LDAA 5JDCA 1M0EA 2OV6A 4YRDA 2Q3FA 1PV1A 4LRWA 5J47A 4KFRA 4JASB 4O2AB 2Q4DA 4W5OA 3EQ2A 4OSOA 3O8DA 2GTHA 2VPPA 4IW3B 4RCVA 4B82A 5K03A 3KAKA 1HDXA 2J9YB 4UDYX 5D5QA 1L5YA 3X2FA 2FMTA 3AVVA 4XD2A 2A59A 1MLDA 3L8DA 5ADUS 2YQ4A 3RSSA 5KVQA 2OHHA 3R1IA 1TZKA 4LWQA 1KA9H 4QAJA 1C0EA 4OATA 5AVWA 3UB4A 1MD9A 3D3EA 4R2WA 3EFBA 4O1HA 3ZWKA 2X19A 1F0YA 4QYXA 5JD6A 2VZ0A 2WEKA 3T95A 2ZTUA 1DOAA 3ELYA 4JXJA 4PQRA 3PP8A 3RJ9A 3P2IA 1TD1A 4E5KA 1IJEA 3BF8A 4ZC8A 4RVNA 1I14A 1AH2A 4G37A 2G09A 1EUYA 4Q1FA 2UZAA 3AY0A 3KYIB 1VPLA 4OL9A 1E7YA 1OREA 1YDWA 2BCGY 2AZDA 3E0XA 3RAPR 4F97A 1TVKB 4XTCS 4JYBA 1Z17A 1TVCA 5JAUA 3UAOA 3ZIUA 1QOZA 5I9TA 2IEBA 2BSXA 1OYYA 1OROA 3CXUA 5LBIA 4D4LA 5CFPA 1ORIA 1P1JA 3TW6A 1G3MA 1DS6A 1FNNA 3WYBA 2OCKA 5EJ7A 1O5OA 1TLFA 2IGBA 4PLGA 4MLDA 1P33A 2XQVA 5CVEA 3UHAA 3PHBE 4HWOA 4KKXB 4FHGA 1FNBA 4MUHA 2ZIXA 4RGVA 1ORVA 1P31A 1QKJA 3EFEA 4G0OA 4G0VA 3NJRA 1P7PA 4DMGA 1O97D 2FFBA 3QTLA 2ERYA 2EFGA 2ACVA 4U3JA 1AV6A 1UBMS 2NUAB 2AZTA 1ZG3A 4BVJA 3LM8A 1UEXC 2HRRA 4I8XA 1EVJA 1GPWB 2JIPA 5L3SA 5LD2C 1WEKA 2LV8A 4QWWA 4WY5A 4EY8A 2Q6IA 5AKIA 3W5UA 3CLHA 1VE5A 3WISA 5L7YA 1A8SA 4XGKA 2PUDA 4U2CA 1Y1PA 2NV2B 2J0QA 5T6MA 1K7XB 1PQPA 3L7CA 1P9LA 2AJTA 2QLNA 4IUCS 2H5LA 4WERA 2GHTA 1JJ7A 5TDHA 8ABPA 4JCCA 4RVHA 1IEXA 1H2XA 2J67A 1I10A 3CVJA 3GA5A 3LT4A 1Z3CA 1XE3A 3R8CA 4B74A 2H7YA 4D4MA 2W98A 4NE9A 1AN0A 1XIVA 2EGHA 4BB6A 5I3CA 1N9ZA 5FI0B 1JLMA 2YQZA 5K0BA 5K0JA 3SJCA 2CXXA 2ZYUX 4R1MA 1QS0A 4NIMA 5JPDA 4ODIA 3AFOA 4HAZA 4FZJA 2C5GA 1FB5A 1DJPA 3HV0A 4OD0A 4MXDA 4P1ZA 4QQFA 4RPLA 1YH3A 2QAJA 4MWDA 4DLWA 1EWYA 4HGOA 3AEQB 1N5DA 3RYIB 2CE7A 2ZJ6A 1CV2A 1BWPA 1DJOA 1DKMA 3KKKA 3PGXA 2VWGA 4QIHA 3S5UA 1M34B 3I8XA 5LYJA 2J08A 3ZWYA 5K0TA 2QL9A 1Q84A 3ABZA 2PL5A 4M99A 3BKXA 3Q8WA 4X7RA 5LXTB 3CO5A 1N77A 1Y6FA 4EG5A 3PGLA 4QBGB 1N2BA 1CK4A 1KK1A 2EKLA 2P6RA 3CPJB 4MQBA 2W6CX 2IOHA 3BT7A 4BGDA 1USIA 3BTSA 4XWOA 1MEEA 3ORQA 1Q2UA 1NUQA 1O5TA 3CZMA 3SCZA 3V8MA 4RQBA 2CXHA 3H87A 3M3HA 3VUEA 1FLDA 1V6AA 1XQ9A 2H4WA 2F8MA 2W2KB 4WLFA 3RGGA 4ZCIA 3K0SA 5D5HA 1PK8A 2C1ZA 2FFAA 3E48A 1ZMBA 2W2PA 4N1AA 1V0JA 2JIOA 4QXPA 1SG0A 2PXHA 3ZXXA 4CL2A 1JB1A 1JE0A 5LA6F 3KAQA 3KHTA 4F84A 2XIJA 3HFRA 1KYVA 4YWJA 3QEMB 4YRRA 3OKFA 4L16A 4EI9A 4AVYA 3NWOA 1P81A 4LRQA 5E8JA 5CDGA 3DZFA 4ISBA 1DDIA 1F2VA 5G1NA 3KT8A 3DBLA 4E08A 3VISA 4IV5A 1E9BA 2ZQ5A 2XCLA 5DN6D 2RC5A 3PITA 5EHGA 4B3TB 2DHEA 4NFLA 2APJA 2CFCA 2ZT7A 3G17A 4DOMA 5F35A 2C4VA 5E4TA 4JI6B 3SG0A 1JDPA 1P2VA 1AKNA 2AR9A 3UKJA 1HQCA 2JFGA 4P33A 4V0LA 3GC6A 1RC8A 1EFCA 4M8KA 2ZR8A 4HZIA 5DGDA 1YQXA 3CKLA 5A0FA 4EVSA 1QYRA 4B3HA 3ITKA 3MJ4A 4PLCA 4CR8A 2YWEA 4I4TF 4TMWA 4TLAA 4Q9JA 2G36A 4IDQA 1HFEL 2A1TS 1VSQA 3O90A 4WOCA 4HDRA 2POCA 4ZKEA 3STTA 1SCIA 3GU3A 2CHGA 5K8IA 1JEYB 2Q3JA 4D0LB 3LXUX 2W11A 3RLIA 3SC4A 5KMGB 1K1EA 2Q45A 4IJKA 3H3XA 5LZ4A 5FLKA 3NB0A 4TKMA 3LF1A 1EFLA 3MBKA 1ICEA 5IWAB 2BMFA 3V4PB 2C0QA 4YCNA 4F4CA 1N2HA 1LKZA 1OASA 1X19A 4J7XA 1L5NA 4EFKA 3GCXA 1YB2A 1SK8A 3DAGA 4TRJA 4WNYA 1ULZA 2Z2IA 3WL3A 1CG6A 2H1OA 2IPXA 4OAPA 2PQ2A 4DLBA 1FFEA 2R1UA 4EHHA 3QPUA 4I5FA 2ANCA 1YHNA 4QOIA 3RU2A 2BHLA 4RIGA 4RORA 3QFSA 5LBTA 1UFVA 1YJAA 1JA0A 4WBNA 2Z6AA 2YHSA 3LHIA 1KO8A 5G40A 4KUEA 1K5GA 5IDXA 3QVGB 3AQ4A 3KLPX 3USCS 3E5RA 3OFSA 1OZFA 2HB6A 1CQXA 2CLEB 2DJIA 2OR3A 1E5XA 1OVMA 2FVYA 3B6MA 1AKWA 3FOCA 3L7AA 4ZCQA 5CNKA 4Q7QA 2B25A 5G1OA 2J41A 4JUBA 4PO9A 1R4ZA 1PT6A 2ZUCA 1Z37A 4HG2A 5DCUA 4ZPXA 1V7CA 2VDMB 4FZRA 2W71A 3OCVA 3GYBA 3UMCA 4EKIA 1S2LA 3EC1A 3MT0A 1E8NA 1R9NA 2VHTA 4IXNA 4YI5A 3TL2A 4BMNA 3F1KA 5AJUA 3VR0A 3QFTA 4EB0A 3UAYA 3U7GA 3GJ3A 5E6RA 1ZQ9A 3E9EA 3ECSA 1EFPB 1L7QA 5PNTA 1G55A 5DI3A 4QTUB 3F3SA 1N9GA 1JIQA 4LF5B 4MS1A 2O7RA 4CN9A 2BKXA 3M6XA 3EGXB 5FOQA 4IJVA 3SXUB 2X7XA 1H9CA 4G5YA 3NRBA 3OIWA 3ORYA 2A35A 2ENWA 1E1KA 1T6XA 2CCJA 2FJUA 3BULA 3EJ6A 1K8ZB 3M8KA 3FCCA 1A5AB 1Y7HA 5F9FA 1HFKA 1BSVA 1IQ0A 1E0KA 4Z2AA 3FJ1A 4PZDA 4O4HB 1PL8A 3H86A 2BH9A 2J3EA 3KYJB 4V38A 2WT8A 3DFZA 4Y1RA 4RNDB 4F3CA 1KR5A 4Y9DA 1AQIA 1OKKA 2PGXA 1UFOA 4K6HA 3I9V6 2BVNA 2CXOA 4DV0B 4HVTA 4H4DA 4GBMA 1JPNA 3EWAA 1KO5A 3L49A 5I4IA 3MWFA 4FLFA 2A9VA 1A97A 1H0KA 2JFBA 3L0IB 5IT5A 4HLCA 3TF5A 4H6PA 2VSFA 3RVDA 2JAOA 1KXJA 3AUTA 1FW6A 1F0KA 1NOKA 2QGNA 4RSMA 1NX9A 5F78A 5HJ7A 4HI0E 1QB7A 3S70A 4WW0A 4D9IA 1I8TA 5KNBA 1LLCA 1EXDA 1ZA2A 4L28A 3UMJA 5L3RA 2QM3A 1YR9A 1QORA 1RBYA 3P4UA 5B3AA 3WYAA 4DLPA 4M37A 4CLEA 2IOQA 1LPAB 4MKHA 4ILKA 1ABBA 3JASA 5WRFA 1GEEA 4CFSA 3SHFA 2H2HA 3HLKA 4Q1AA 1U9JA 2V7VA 3HJHA 3EEYA 5ALSA 3RSLA 3ESDA 1HQDA 2Z98A 2FZCA 3GCGA 1Y4ZA 1EGVB 2D0OB 1ZKMA 2JGJA 3O9MA 3EAGA 3JS5A 4B3SB 5IDYA 1SKYE 2A14A 2O2SA 2ZRKA 1XRLA 3ZCUA 1C1HA 3DZDA 1T4DA 1V3UA 3HJGA 4TT3D 1G5IA 4DA8A 2ZRAA 4ZCPA 1IHPA 1WXWA 4N5DA 1KEUA 3A27A 4JQSA 4LTDA 4U1RA 4J7UA 4W99A 4MWBA 3V7NA 2OZPA 5L6MB 5IXSA 1HZJA 1OX5A 1KYQA 2X8LA 4FYMA 2OM6A 2QVBA 1U8EA 1OZAA 3I0ZA 3RTAA 4FI3F 4P38A 3NT5A 3BL8A 4EBFA 3OVMA 2VEDA 4G5FA 3NRCA 1Y5MA 3CUEF 5UKDA 4JJEA 1C3VA 4DR6B 1YS4A 4X41A 1Y3CE 2YASA 3WA7A 1XQ1A 4NOKA 5JNSA 1A7UA 4GOLD 3UMMA 3KS9A 1E5LA 1XCBA 2A5GA 2BMAA 2PH5A 3QV1A 3VPDA 3SFTA 2PUTA 4ES6A 3IAXA 1N4DA 5DLQC 5A4MS 1MG0A 4K9QA 2GPJA 2R6JA 3B12A 3WX0A 4B6GA 2Z5GA 1ZIXA 3IBCA 4B31A 1L7XA 5GZ6A 1RBZA 3NHFA 2BMEA 2RD2A 1R0LA 1ZN2A 4JXKA 2VYFA 4UEOA 1DADA 5BWBA 1ESMA 3AWDA 7MHTA 2B9EA 3AEYA 3PYXA 5JDCC 4A1FA 4L76A 1ZIYA 4E7OA 4A0GA 3GJZA 2XYQA 5LP6C 4ZYTA 2HOQA 3MJEA 5JS6A 3I09A 3A8TA 3T7SA 4D92A 2FWRA 3ADOA 1N0VC 2FEPA 2L69A 3C8ZA 3LK6A 4YFVA 4G8JA 4OYLA 1E3LA 1L7EA 2I65A 3IAS6 1BEZA 4PX9A 1KQFA 2Z8YM 1P74A 2JD1A 4AZTA 1MQSA 2QTWB 4XRRA 3EXHC 5LXTA 4TV8A 2QRLA 3FROA 2R6HA 4N8DA 3OLQA 4NV0A 2O5CA 3F3MA 3GRVA 1BZYA 1LPBB 1NATA 4I1OA 4EW3A 4CEHB 1R6AA 3O2NA 2PQMA 2WU1A 2VHJA 4CMGA 4YRTA 5KHOC 2VPTA 1M1NB 3ZOZA 1JHQA 1Y4UA 4K9NA 1KAGA 3IUQA 2WUDA 4JKOA 5BVGB 4LWPA 4X1IA 3C7TA 5B3KA 3CCFA 3WK8A 4WZZA 2C5HA 1PTJA 1PX2A 1AKRA 1FX1A 3B70A 1B93A 2GCPA 1TTQB 3JQBA 4RVDA 1Z4NA 3D0OA 2XDYA 4RD3A 2JGMA 3ZE2B 3S8EA 3WLAA 5KJCA 1XZMA 5E3HA 4DR4B 1D03A 2WFAA 2WMNB 1ZK2A 3I9KA 1UM8A 3WKCA 4CF3A 4JP5A 4OQYA 5I3ZA 1UMDB 1B4DA 4XVRA 3FGOA 3U7EB 1UJ4A 3EARA 3PXUA 3BMQB 4PC7A 1KI9A 5JCJA 3BWBA 5DM2A 3IIKA 5CT9A 5JBNA 1B16A 3ZBTA 1JECA 3EB9A 5HKAA 2C77A 5KVSA 1FF9A 2OHVA 2WWIA 3W8EA 1PLLA 3ZHQA 4YV1A 2RHTA 5ICCA 1Z45A 1SQGA 1Y33E 1UPAA 4FOPA 4AT1A 4N0EA 1E5QA 3FYUC 1UZLA 4J07A 1X0XA 3QELB 4ASUD 2JCVA 1TIKA 3PV0A 4J0KA 5HF6A 1Y3AA 4K9PA 4RZ2A 3ZW7A 4ARBA 2GDJA 2C1XA 1DKRA 1PJBA 3MJTA 2Z58A 3REFA 2GAIA 1DIAA 1PZMA 4JAVC 1T6YA 2SCUB 1CY8A 3EASA 1EP2B 1K2VN 3W4JA 3WB2A 3UMSA 4O2BA 2HO5A 1U2ZA 1UUFA 3KZXA 1G4HA 5IDVA 5AIAA 4B3JA 3L5KA 5EIHA 5HBGA 3OESA 4B3DA 1P4SA 3LY7A 1WSBA 2WZBA 4LGCA 5AKLA 2X41A 4HOYA 5AHWA 4IH1A 2VDQB 3VHLB 3K6SA 1FA9A 4UU7A 3MPOA 1ZU4A 4HYQA 2GRAA 3EEBA 1DDGA 4MVJD 2BISA 3JVEA 3L05A 4QASA 5F2KA 4F8EA 4RK0A 5FL7D 3H04A 3QVXA 2AG6A 1U0OC 1YC2A 1S89A 2I7TA 3QFFA 4Y67A 3SWWA 4IY1A 4YJKA 3P9CA 3ZE8A 2B4RO 4N6OA 2WPDD 5EPUA 1DG3A 4RDIA 1ZWKA 4N8EA 4OQDA 3W1VA 4C7JA 3J80A 3BQNB 3DE1X 3ZE9A 4TTRA 3QTTA 3A6LA 1UADA 1JYEA 2HBRA 2AXNA 3NORA 4MVXA 4N6GA 5ABPA 1DAGA 2HIHA 3R0QA 3QRWA 4HQFA 1YGPA 1Q91A 3W6NA 4W1RA 1QKKA 2BY4A 3KTOA 5LD2B 1M8JA 5TPZA 5JAHA 3G1WA 3DAPA 1Z5UA 2EQAA 2QENA 3CRMA 3HU1A 5J4LA 3DLCA 3I9V1 3ZWXA 4W5TA 1QIIA 1SHJA 2G0AA 1QWOA 4AWBA 1Q17A 5CHEA 2QTLA 1K6IA 4BVLA 1GYRA 4WESA 1GV0A 3IDSA 1K3FA 1CS0A 1M0SA 2CL5A 1P1HA 1VSUA 4CL0A 1KVUA 1QNFA 2PRIA 3KKOA 3VU1A 1W76A 5AJXA 2ZAIA 1KJ8A 4F6CA 5KOIA 3BZUA 3V48A 1KAMA 2PT7A 1KY3A 2GESA 2CT8A 2PKQO 4IXWA 5K20A 3KQLA 4I81A 3QFRA 2X0DA 1KIMA 2GLXA 2YWRA 1TFRA 4PYLA 3W6PA 1KI4A 3N8IA 1MW8X 2FSIA 2ZTLA 2IBTA 1H6CA 4P5DA 1EB8A 2QX8A 4J6EA 3FRIA 2B94A 3PVCA 1ZNXA 3LH5A 5EJFA 3C5HA 1M66A 2GVDC 4OUDA 3WYEA 1T36A 4HTFA 4W5QA 1Z7GA 1GZUA 4RHUA 1BCSB 3QLVC 1YR8A 3TGWA 3INRA 3W04A 3T7KA 2PZKA 4EPTA 1BQ3A 2H5IA 5HIMA 4ALNA 4DGSA 5K51A 4CV0A 3LTNC 1FDOA 3DUFA 3OM1A 3O8OA 5FTJA 3HSSA 2HYIC 3NIFB 5KAMA 1SCUA 1LRJA 1W2WB 3LOPA 5IDWA 3O8RA 1N6PA 3GLIA 1L7BA 2O2GA 1VL6A 1D1SA 3H8WA 3KZ1E 3U80A 2Q0QA 4CMHA 5JROA 1Q57A 3FNIA 2HF9A 2WD7A 1SVIA 4ALJA 1U8ZA 2V0GA 4L08A 2VHEA 2ZUWA 3K1TA 3WBJA 1ZSVA 4INOA 1EE2A 2O7NA 3KOXA 1USKA 1N2CA 2AJCA 5CFNA 5LIRA 4LK3A 3VKVA 4RJIA 4NDAA 2ZYSA 4BJ1A 1BX1A 4JQYA 4ZVPA 1IATA 1GCIA 3TOSA 5T6BA 5TPZD 3T3PB 2ZG6A 1IM8A 1Y1QA 2X9GA 2Q2QA 4L8VA 4OBEA 3WWCA 4CLOB 4DCTA 4JVLA 4MV8A 1X39A 5H4GA 1CR6A 2IJGX 3LK7A 1N0IA 3AL0C 3NNDA 3RS4A 4B47A 1GUDA 5EJEA 1CQPA 3GLHA 1TZBA 2Y1XA 3I76A 3HP1A 3QU9A 2O8VA 4TKUA 5TF4A 1NHWA 2G9NA 3EEOA 2CXSA 2ZWPA 3U4HA 1P72A 2Z04A 5AJVB 3LRPA 1TK9A 4I9NA 5AW3A 2KSQA 1UC5B 4AROA 3TRJA 2BHRA 4NBKA 3G2IA 1AUOA 1UAGA 3EAFA 2O19A 2A1UB 2XWPA 1BE6A 4O4IB 4P93A 3CR8A 2P9FA 3OQHA 1CP2A 5JUWA 3TDKA 1FFYA 2YWCA 4DV7B 5A03A 1YQQA 1YRLA 3CH7A 4TKUB 4UXJA 5JCZA 4KX5A 4DA7A 3LWZA 5AVOA 1FQOA 3HZOA 1D6JA 3DXYA 4RCYA 1ZVQA 3IO5A 1RLIA 4K40A 1UC9A 5ADVA 4EMTA 4HNHA 4OP2A 3HCEA 1X9IA 4C21A 2G5CA 1EAMA 3PICA 3UFXA 3U44A 2PMBA 4YBRA 4YMIA 3N6VA 1U04A 2ZRPA 2G5GX 2JHPA 5EIAA 1QCCA 1Z6YA 4COKA 1RIIA 3JQBC 3RC2A 2FKAA 2FR8C 4LXYA 3ETHA 4RTQA 4UD2A 2V7WA 2HJSA 4RJKA 3PTZA 3RHTA 5GADl 3DOUA 2C92A 5CFQA 2OXCA 4JMLA 4UM9B 5KVVA 3QQ5A 1UBTS 3LCVB 2OCYC 3WMXA 1A72A 4L8GA 3DSRA 3I32A 4M7OA 5C7YA 2AN1A 1MO5A 1KZGB 2YYZA 3TD2A 4BRWA 5ALPA 1HRKA 1WXXA 3ZIAD 2GN1A 1USGA 1OXSC 1D0IA 5SYMA 4O29A 2O8NA 1ST2A 2VAMA 1KHTA 3SZLA 4AF8A 4EJ0A 1XZJA 5I9BA 1R0YA 2ISSD 3UWOA 3C74A 1N5JA 2XUAA 4QU0A 4X7PA 2DKOA 3RU9A 4DXAA 4XVQA 1YS1X 3HVHA 1ID8A 4TLDA 2ZJOA 3CY6A 4JS0A 1X7ZB 3ZWWA 1L5KA 2X14A 1NXWA 1PG5A 1JFLA 1CUBA 4H6VA 2ZS7A 3DV0A 2FLKA 3BWDD 2Z4SA 4FMCF 2CEAA 3OHMA 5REQB 5TQ2A 1JIXA 1E60A 1K88A 1GYPA 1I3KA 1KP3A 4R1NA 4CYMA 3U49A 4KC0A 5K0ZA 1M5TA 2QF7A 5CA1B 2HR1A 4HWRA 4GZLA 2A7XA 5AK0A 4Q9DA 1NE2A 1FDRA 3J81A 3K70D 4H3KB 5LZ9A 5ALZA 2IZOA 4GSYA 3I04A 1D8AA 4YO8A 1H2YA 2F3QA 4PPYA 4F86A 4UAVA 2I03A 1Q0SA 5KPJA 4LEIA 4P4NA 3ZU6A 1B8VA 2JH9A 3ZXUB 4ZZ2A 1F8YA 1QOQB 3TTTA 2R8BA 2V5AA 2E0IA 3K4HA 1Y0BA 2ZJ0A 3AJRA 5D3ZA 2F9LA 1B3RA 1DBWA 1NFQA 3CLVA 5EMLA 5KTNA 1NXXA 4S1VA 1RRGA 3K8ZA 4CKBA 4IOKA 4KZPA 4RLHA 3OSZA 1LVUA 3H42B 1KK2A 2VAVA 2VHUA 3K9QO 3S6JA 3TQTA 2JVKA 3A58B 2ZXEA 3V2GA 4AMYA 2B61A 3K0CC 3NYQA 4TMTA 4ARVA 2WYUA 5M3BA 1SIWA 4S1TA 3ZXYA 4IUBS 1DXYA 3GLUA 1SCDA 4IIHA 3PSAA 1TYBE 4DWJA 5K0EA 1BJRE 2JARA 4R16A 1PRYA 1UBGA 2HJVA 2XBUA 4LCBA 4QLAA 5JZVA 4N41A 4ENWA 3HMKA 4ZMRA 3L01A 5DYWA 4D8UA 3P19A 3QVGA 2B99A 1T1GA 3A1CA 2RK6A 3PCTA 1RLJA 4GMHA 1DAFA 2IS6A 5EJMA 4B40A 1OVGA 4KZKA 4DCUA 3GLFA 3PEYA 3FVTA 5NULA 5IABA 4O4JF 3S81A 3BXHA 1OFGA 2HSEA 1VCHA 3ICCA 1ABEA 4P34A 3NM5A 1TVKA 1XRQA 3AP3A 3PZRA 4RQUA 1R9GA 1KMCA 2OV2A 1O95D 2PNFA 3ER6A 1Z25A 3TMAA 3X44A 1AB5A 3ZU2A 4E21A 2J3IA 1CERA 1WCWA 1Z6AA 3EXHB 1M6YA 1SHUX 1ULUA 2NZWA 1UKVY 1RVV1 2EATA 1AT1A 3GDOA 3LAWA 3PFGA 1ZOPA 3QNMA 4DDWA 3FTEA 2NU7A 2Z8YA 2XXJA 1RRPA 1VRCA 2GUWA 3IH5A 4Y6GB 4M86A 2ZBQA 4MUKA 4PN7A 1WB9A 1E62A 2ZUDA 3B5IA 1BS9A 1J9GA 1MENA 3PNLA 4JLPA 4N18A 2FQQA 4E3WA 5K8VA 5TC4A 5DM0A 3TRFA 2VJCA 1UMCB 4WCFA 1OU4A 2HSGA 4JUDX 4AF7A 4B2YA 5JISA 2F8TA 2ZWIA 5H3HA 4RL6A 1MJHA 2QD1A 2AW3A 5K9ZA 1HURA 4PVDA 5CT8A 2M9MA 4D45A 3WQHA 2B0CA 1AQYA 1V48A 1RKQA 3CFYA 3AHIA 4D8XA 2DPGA 1QP8A 2XB6A 3KJXA 1UPTA 5I6DA 1EA7A 3H2KA 4B73A 3KFXA 4RX1A 2BR5A 1LC3A 1QMGA 1YSCA 3UWSA 4AY2A 3SPXA 4LVNA 1ZVJA 1PTKA 4AG3A 3QP9A 1X7ZA 3PC4A 3R20A 4P81A 5U4QA 4LVCA 4BFLA 3NC4A 4PFJA 4ZO4A 1E3WA 3TJMA 1JV2B 4B3XA 3OI7A 4DNXA 5JZ9A 1YF3A 2GNOA 4ZO8A 4A8JB 5CB0A 1G6KA 4NK4A 2O2DA 1P8AA 2GAAA 3NYIA 1CYEA 1RJ9A 4CKCB 4BNFA 4J4HA 1IAQA 1ZHHA 2VYNA 2HYDA 4IKEA 5BN5A 4UOEA 3LVBA 4XEUA 1CBUA 2Z2XA 3IKTA 2CMFA 2DT8A 4RPKA 1XMQB 1AMNA 3VJLA 4KFCA 4AZ0A 4JROA 4ALIA 4C1NA 1OH5A 4X92A 2XX3A 3H75A 3VVMA 4OM7A 5MN6A 5TMDA 2JS7A 4DW8A 3MJDA 1ZIPA 2H1HA 2QTVA 3E1SA 2P9HA 1FJ2A 2XGGA 3UFBA 2HA6A 2VBIA 5K8CA 1YA8A 1N2XA 2RGYA 4DYVA 1OTYA 3V7UA 4NEHB 4B0PA 1VSTA 2BEUA 1DHRA 1UJ5A 2A88A 4B7CA 2PRKA 2QT1A 5G41A 4BS9A 3F6CA 1R0SA 4NX2A 3FLMA 3BXXA 4DDKA 3I01A 3S0JA 3CR7A 1A95A 2CLCX 1G5TA 4IVPA 4RABA 1W5AA 1NRXA 3G1UA 2WWHA 3H5NA 4RFLA 3D2BA 3O94A 4CIWA 1J42A 4TRRA 2IQIA 3OFKA 3TTUA 5KYYA 2I6UA 3QXSA 1M1ZA 1ZP6A 2WYOA 3Q7IA 3QG1A 4LSZA 4WZ6A 4LXIA 3GEDA 1A5SB 1YVRA 1PEKE 5JS7A 5THQA 2RGUA 3JAKA 1MX1A 4YQEA 3KSBC 3I6YA 4CV2A 4DM3A 2XNSA 3Q0EA 3TPZA 4D8TA 1TYCA 2OGTA 2M1ZA 3M2TA 3ZU4A 2P9GA 2XDQA 1F3LA 5GJCA 4OK3A 3RTEA 1TMGE 5B4VA 4QU9A 3K92A 4NNJA 1OA1A 1TCBA 1Q1BA 5C2JB 3WYDA 2YW9A 4XGNA 1GR1A 4M0EA 1T6BY 2LRHA 3RSFA 4Q4CA 4C0XA 4U02A 5CYGA 1CVRA 1MPXA 1OGJA 4XYEA 4D3YA 1MX3A 2RH9B 4F5EA 5JWRA 3K0HA 2O2EA 2ZVPX 4FX5A 2PU5A 3BRWA 3CEJA 3W8RA 3R5HA 1XRJA 1V11B 2VVTA 3QU2A 4KSYA 5DGIA 1AM4D 1DTWA 1R4NA 4EBBA 3B7PA 1G5HA 1NJSA 2J9FA 4KQ6A 5ALHA 4B33A 4B71A 3BJRA 3KXDA 2PO7A 4TKVA 3I5MA 4UTXA 1RE0A 1N5RA 2XWJI 5DGTA 5ALYA 1AOXA 4OPMA 3SQLA 2BYTA 5FJJA 5BV8A 5JEEA 1W88B 5HGXA 4RD1A 1F2TA 1P9WA 5HCNA 4TGLA 4IFBA 2RGDA 1RW4A 3MS7A 4Y2QA 3V2IA 2RHJA 4UNPA 3T9CA 3MCVA 2QZSA 4TL8A 3FOWA 1HT2E 4U2EA 3WDSA 4U7FA 1NR1A 3NP7A 3BMNB 3L1KA 3FHOA 5JSQA 3F6RA 3P9YA 1EXMA 3VOBA 1QXSA 2IUYA 4FEYA 1LQ2A 2QTCA 1QK4A 2GPNA 3H1FA 3K2QA 4PR3A 4PYIA 5T67A 4IDNA 3SKVA 3OZ7A