1B15A

Alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-acetone
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL DEHYDROGENASE
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 90
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b15A00
4KZPA 2R00C 1F12A 1SO8A 1E7YA 1MG5A 4OSPA 3KLMX 3FPLA 3KB6A 4RORA 3ROMA 2HCTA 3M6IA 2CDBA 3BAZA 3PQDA 4PG5A 5JCJA 2HMTA 4JBGA 4CQMB 3IJPA 3X2FA 1XR3A 4KQXA 1D1TA 3BTSA 1IPFA 1GUYA 1XDWA 3GAFA 3JQBA 4J1QA 4R01A 5F5NA 4AJ1A 3UXYA 2NUAA 5JCXA 4PG7A 3VVCA 1E7MA 4CM8A 5L7TA 1LBEA 4AFNA 2NSDA 1VJ1A 1J0XO 2E37A 3PHJA 3C1AA 3GH3A 3WYCA 3KETA 4I1IA 2AEFA 3FSRA 2PKRA 1E3EA 1X14A 4Q3NA 1KY5A 2RH8A 3O4RA 4BNUA 5A4DA 3PLRA 3HFSA 2EW8A 1PS9A 4KWIA 4MIEA 1GCUA 3KZVA 3UGKA 4DMMA 2ZKLA 4RV9A 4PLFA 1WNTA 4F3YA 4JNKA 4I5GA 3T4XA 1AHHA 2ZJ0A 2Y0CA 3K30A 4MKXA 3WQQA 4FC6A 4E5PA 4BGUA 1NFQA 3Q1LA 1EVYA 4BKUA 3MTJA 3NDJA 2PV7A 3AFMA 1G0NA 1V35A 3JQGA 4R1TA 4DL9A 3QJ5A 1GPJA 4YWJA 1QV6A 5ER9A 2Q2QA 1IOLA 2D0IA 2GZ2A 1Y8QB 3V2HA 3DBVO 1ISIA 3QSGA 1WMBA 4CV0A 4YJHA 2HK8A 3VTFA 2Y67A 4AJ4A 2ZB4A 4ZU3A 1ZK3A 4NHEA 1PS8A 4PZDA 4HFJA 3WFJA 4D79A 2GF2A 2RAFA 1BTOA 3I4CA 4U0KA 4XB2A 3JCZA 4D45A 2PR2A 2Z1MA 4OKNA 5A5FA 2DKNA 1KC1A 2Q1TA 4YJFA 1T2EA 1O0SA 4YAGA 4GX0A 4IM7A 2X5JO 3AUSA 1QYDA 4AJHA 4CMGA 2XOXA 1FDWA 2IXBA 4P8RA 1R4MA 2UYYA 1XU7A 1F0YA 1NNUA 4UVDA 3SLGA 1NQ5A 3UCXA 4BNJA 4YAIA 3GEMA 4URFA 4NFYA 1QR6A 4ZRNA 5BNIA 4FFMA 5CP8A 3GHYA 3SJ7A 1HYEA 2A4KA 4QO8A 2VHVA 5FF9A 3I52A 3ZWMA 1EVJA 4M54A 1LDEA 2P5YA 1NFRA 4K6FA 2CNBA 2JFGA 3BTOA 4UVEA 3V2GA 4CQLB 2QX7A 4MJLA 4U6SA 3SBOA 3NKLA 2GGSA 4J90A 2JFHA 2VTDA 4ZA2A 4I5EA 1O9BA 4R5HA 4EW6A 5A5EA 1FF9A 1MG0A 4D42A 4OYRA 4NBTA 4AJOA 4BQRA 4E2XA 1GZ6A 4DLBA 4ALIA 2AA3A 5IDWA 1J49A 4B8ZA 3DBHB 1NFFA 2IXAA 4CODB 5CG1A 4LMPA 1I3KA 4PFJA 3F5QA 2HJSA 5CHEA 4MVJD 4DPLA 2AQIA 3DHNA 4CUZA 5ILOA 5JLAA 2DPGA 2X4GA 3LF2A 3OQ1A 3G0OA 1ENOA 4ND4A 1LSOA 1I32A 3BMCB 3WR5A 4OIMA 4DBZA 4CJXA 3DBRA 2HMUA 4JLWA 2HLPA 3IUSA 1OFGA 3H5NA 4I9UA 3PHIA 3FNHA 2VRCD 4MIYA 4NK4A 3ZWVA 4BOYA 2O3TA 3RFVA 4CM6A 2YUTA 3F6YA 3GN1A 3SC6A 1GADO 2QQ5A 2FY8A 4IDFA 4NJMB 3EZLA 1PQWA 3FCOA 4LRTB 4UVIA 4CUJA 1R37A 5G0TA 5IN5A 5G0SA 1X1EA 3GF4A 3KBOA 3HG7A 4WLOA 1E3WA 3PP8A 4NR0A 3TOZA 3KSUA 1N9GA 1KVSA 4AJNA 1DC4A 4JJFA 5L4SA 1BDMA 3KYCA 1DOHA 4H16A 2LDXA 5DP1A 2D59A 5L40A 1DEHA 2AEJA 5JMPA 3TZCA 1X7DA 3I23A 1YQDA 3KEOA 1SPXA 3UF0A 3NTRA 3CINA 3NJ4A 1DAOA 2BFOA 2X9VA 4R4JA 4BNHA 4Z6KA 4KDFA 3ZW9A 4BNLA 3GFGA 4A2CA 1GPDG 1PJQA 1PJSA 4AJJA 1ZUD1 5JAZA 4XX0A 1JW9B 3JV7A 2PZLA 4BUCA 4MP6A 3VPFA 1WZIA 1B15A 5TT0A 5CG2A 3KYDB 3K31A 5HM8A 3BMOA 3SLKA 1GTMA 3RBVA 3D4PA 5KVSA 1IHXA 3LLSA 3UUWA 4BKPA 3L6DA 4PVDA 3ROPA 3WGIA 2FN7A 5DP2A 3PTZA 4OOFA 5G0VA 2VYVD 1GUZA 4GX2A 1IYZA 1EFLA 2VOJA 3G79A 4GVLA 4MPDA 4KUGA 2NU9A 4PG8A 3H9UA 5C3MA 5T67A 3ROKA 3C8MA 1K5HA 1YBMA 5T6BA 4R54A 2XXJA 1N92A 5AXAA 4C4OA 4UUNA 2ZCUA 5TJHA 3DZFA 1M75A 1ARZA 5JSFA 3NTQA 1B8VA 3WYBA 1GZ3A 4ONEA 4LK3A 4I9NA 5KJEA 4D41A 1Y6JA 1PR9A 3W4KA 2QZ9A 4DVJA 2OOSA 4TSKA 2IZ1A 4Q3BA 5JXWA 4CM4B 2HSDA 3RC9A 1H94A 2WD8A 3WFIA 1H9AA 3EHEA 1Z82A 4FW8A 1U7TA 1QRRA 3VAZA 3ZV3A 3BHIA 1R0SA 2BF7A 1EMDA 1HZJA 4PGFA 4DIFA 4PZCA 4XA8A 1AHIA 3GUYA 1F8GA 1OC2A 4UUMA 1BHSA 3QVSA 1HL3A 4YBZA 1I3LA 3L4BA 2PZKA 3F47A 4ALNA 1ZZEA 3ZWBA 3ENNA 4EYEA 5B12A 1V6AA 3JQ8B 2JD1A 1V9LA 3FRJA 4L8VA 4UUPA 4CMBA 1JAYA 2FR1A 1QYXA 2Q45A 5CDGA 3GVXA 1LI4A 4WKGA 1PJ2A 5KNLA 1V3VA 3PEFA 5LC1A 4OM8A 3PDUA 4YRAA 3WYEA 1X0VA 1BSVA 1KC3A 1P3DA 4RF2A 2BFAA 2CD9A 1I5RA 1ZFNA 4BL5A 3WBBA 4A7PA 2PKQP 4XGKA 3ZWCA 3RI3A 3JQEA 1DFIA 2G5CA 3A28A 3LT1A 3LT4A 4BGEA 2Q1WA 1UUFA 3I9NA 3ANNA 4NJOA 3T4EA 1D1SA 1U8XX 2J3HA 3TJRA 1ZXBA 3E8XA 2WM3A 4XDZA 1VJ0A 2HRZA 3OEYA 1Y81A 4AG3A 4JX8A 1H6DA 2GD1O 6LDHA 4DWVA 4PLWA 1NPYA 3UCFA 2WYUA 4E5MA 2IZ0A 2JKVA 4ZQBA 3VH2A 4ROSA 3ZHYA 2VTEA 1CIVA 4BS9A 5IFLA 1LC0A 3OSUA 1EDZA 1KVRA 2Q4EA 1KEUA 4CMEA 4RF3A 1NHGA 4S1VA 3IJRA 2C54A 1R16A 3ZWWA 1PWZA 1R6DA 2NWQA 4RVDA 2BHLA 2D4AA 5BQFA 2AQ8A 4WEOA 3RC2A 4BNMA 5B4UA 3I5MA 1XQ6A 4EITA 1XG5A 2NQTA 4ND1A 3WQSB 3CKYA 1W8DA 1WDMA 4YJGA 4BQPA 3GZNB 3HWRA 1A9ZA 2BGKA 2TMGA 4N54A 3JQCA 3AU9A 3FNEA 4A27A 3EDMA 4CLOB 1H6BA 3LF1A 1GUFA 1VC2A 2WJPA 3GG2A 4LRSB 4WLFA 1E1MA 2GYYA 1BXGA 3JD4A 1R0LA 4NH4A 2DVMA 4MVJF 2NU8A 3T7CA 2J3JA 3JQ9A 3OA2A 2NNLD 2IYPA 5TSDA 3DAGA 3WICA 1A9YA 2UDPA 5EIOA 4A0SA 1UDAA 3IQDB 2OP0A 3QA9A 5F21A 3DBLB 3H5AA 1NXQA 1NBOA 3H4VA 3CUKA 2ZTUA 4Q3CA 1GQQA 2I67A 3KLPX 1E3LA 4E5KA 5L45A 3L9WA 3HB5X 5IZCA 1CYDA 2GZ3A 3JYOA 1DJNA 5A1TA 4KOAA 3ZV6A 3D64A 3NJ8A 4C7JA 3O38A 1UXKA 5DULA 4J49A 3CE6A 1YONA 4D3SA 1YOVB 3NTOA 4WK6A 3WG9A 5I7SA 3CZRA 1T26A 1DLIA 3DHEA 4ALLA 3VZRA 4QFDA 4XGNA 2C2XA 3WMWA 2B36A 2ILTA 3EUWA 3ZHZA 4E33A 3DQPA 4OQYA 4CUKA 4QT0A 3ADPA 1IUKA 1C0LA 1P33A 5ITWA 3U0BA 3UOGA 1ISGA 5F1PA 3PJDA 3CMCO 5TGDA 3BMNB 4DLLA 5ITVA 4ZGWA 2O3JA 3ETEA 3DZIA 3ONFA 1XCBA 3NAQA 2YFQA 4NZ9A 1I01A 3IP1A 2ZB3A 3PZBA 4R9RA 1T2FA 2O23A 3WJAA 2Y99A 3UAGA 3JD3A 2J8ZA 3AJRA 2Y1DA 3F4LA 2VHWA 5JC1A 3ROQA 1GYRA 2B5VA 4YXFA 1Y5MA 3WSWA 9LDBA 2OBYA 1Q7BA 1R4NB 2PGDA 3D5QA 4I5DA 3I1JA 5A9TA 1HRDA 4EI2A 1S7CA 1YDEA 4UEJA 3LYLA 1OOEA 4IQGA 3GVIA 4NI5A 1CEQA 4CL3A 1LA2A 4UREA 4L4SA 5HS6A 4IUYA 4NPCA 3SVTA 1IZ0A 2P9EA 3G1UA 4S3MA 2RCYA 2Y66A 3U4IA 4C7KA 3DZHA 1EVZA 4B8WA 3D5TA 3OMLA 3HADA 1C0KA 1SEPA 2DU8A 3K96A 5I7FA 2WYWA 3F1KA 4CQLA 3GAZA 1Q0QA 1Z45A 4DQUA 1PGPA 1P74A 2VYND 4XQGA 1M76A 3H2ZA 4WOKA 2PWZA 1Y9EA 1W6UA 1WZEA 3AU8A 1HF3A 3F46A 2CF5A 4QX6A 3SXPA 1PJ4A 4BVAA 3WBFA 1J4AA 3RU9A 5KCZA 3RCBA 4G81A 5CEFA 3GPDG 1QXSA 4D3DA 2FSSA 3WNVA 2GPTA 4BNVA 5G2OA 1O8CA 3MTGA 4RVFA 4JROA 3HNPA 4IGEA 3M2PA 4XIJA 2C29D 2V6FA 4IXWA 5JBIA 1JDJA 4DQXA 1ZXLA 3F1LA 4O1MA 1B7GO 3AUUA 4RJTA 1CQIA 1EUDA 4J16A 4ZICA 5KKAA 4NMHA 3GGGA 4G2NA 1PZEA 1LLCA 1P44A 1YDWA 2WDZA 1B3RA 3JYNA 3PHLA 2JHGA 4W7HA 3MEQA 4YVFA 1YJQA 4PLGA 1YGYA 1SMKA 1TT5B 1R12A 2X5KO 1E7WA 5DDIP 3H9GA 4E2ZA 4MKZA 5CEEA 3FI9A 1Y8RA 4FN4A 1E5QA 5DBGA 3QWAA 4J1TA 4RQUA 3DMTA 1UZMA 1GQ2A 3WJ7A 4RF4A 5JDIC 2EWMA 2NVUA 1C1XA 3TQHA 2ZCVA 4PG4A 1RYDA 4AVYA 1EFKA 1MV8A 5AYVA 4DQVA 2P9GA 1ULUA 2O48X 1P1IA 3L6EA 4RVSA 3OJFA 1QSGA 4BO7A 2BI7A 3ADOA 5U4QA 1PJBA 1WXDA 3DOJA 4RZHA 4BO0A 4IQ0A 3U9LA 1ZNQO 3AW9A 3QRWA 3QWFA 1CETA 2W2LD 4KTTE 1E6EA 1LDGA 4K26A 5AOVA 5HTOA 1ZEMA 5CPBA 5KVCA 3C1TA 4E0BA 5IG2A 5F1OA 3GPIA 4CM9A 2X1HA 2B83A 2VOEA 3BA1A 3M1AA 1PL8A 3LC2O 2I3GA 1E92A 4YT2A 1YE3A 5ICSA 1YBVA 3OM9A 5GY7A 1GZ4A 5A3VA 3VH3A 4DPKA 1Z6ZA 3NGLA 3JQFC 3Q3CA 2B0JA 2YV2A 1U9JA 1WVGA 4RPLA 3GFBA 3GT0A 5DZSA 2IE0A 1FMCA 3WOHA 2QYSA 4FIZA 4J4BA 1H5QA 2EEZA 3OJLA 5KVVA 2AQKA 3WX0A 1O94A 1BGVA 1HDCA 1UP7A 1XYGA 1UXIA 1EZ4A 4NQZA 3RUEA 4AJ2A 4YQZA 1MXHA 1I24A 4CM5A 1TI7A 4J91A 2FZWA 3H2SA 1HE2A 1F8FA 3JQ7B 4Y6SA 3OEWA 4IQ8A 5K0ZA 1G6KA 5BNTA 2JCVA 1IPEA 3PGJA 1K3TA 2C0CA 3PRJA 3FBTA 2DBRA 1EUCA 4E5YA 1VKOA 5GMOA 4CM4A 1R66A 2P91A 3DFZA 3STHA 2CZCA 3GK3A 3PHGA 1KYQA 1DHRA 4EUHA 4DC0A 3FNFA 4Z9YA 1U3UA 2RBEA 3EY4A 3WWZA 4RCVA 4EEZA 2QG4A 1PWXA 4M1QA 3D3WA 3GZ4A 4RPHA 5CDUA 1DIHA 2Z5LA 2AG8A 2VCYA 3AM4A 4NU6A 1QKIA 1VI2A 4BIIA 4FB5A 2PTGA 3GMDA 1UXGA 4WPGA 4XQCA 4IDDA 1DAPA 1M67A 4HX5A 1IB6A 2ZYAA 3O8QA 1Z74A 4YTEA 4J3FA 4MOWA 2Z1NA 1W4ZA 3QVWA 4ZQFA 4CV2A 4W9NA 2JCXA 2Q1SA 5DBIA 1AN9A 1NVTA 4B79A 1D4FA 5JMWA 3WNQA 3WQRA 5CDSA 2EXXA 3GY0A 1WPQA 2O2SA 4FC7A 4BV9A 1E0DA 4BNGA 4E13A 3AI2A 1ISHA 2R6JA 3U4CA 3JQAD 1E1KA 3UICA 4B4UA 3WS7A 1XGKA 1B26A 1E5LA 4YRBA 1ADCA 3RUHA 2HUNA 1NWHA 3KXDA 5COAA 1A4UA 4RF5A 4NK5A 3DZJA 3L4SO 4TMFA 1P1HA 5L3ZA 2Y93A 1C1DB 5CEJA 3O9ZA 1LQTA 1Y1PA 3CSDA 5CPFA 3CMMA 3JD0A 1K6IA 3AOEC 1L7EA 1CWUA 1T4BA 4NBVA 1HDZA 4IINA 1MFPA 2FR0A 3DL2A 2EERA 1JLLA 3F9IA 4E5NA 5TJ9A 2J5QA 1ZW1A 1WMAA 1DB3A 3BTUA 3W8EA 3QVTA 3ABIA 4NBUA 3KEQA 3OH8A 4J43A 5AVOA 3P7MA 4FFPA 1KIFA 4EGFA 4OOEA 5ENVA 4IJKA 3KO8A 4J2OA 3I3OA 1V0JA 4TRNA 3INTA 3GLQA 5AQ1A 1P1KA 3N58A 2DPHA 1NAHA 2FRDA 2ET6A 2AMFA 3IMFA 1DFHA 3HFGA 4IS3A 4IIVA 3AY7A 3JYPA 4K6CA 1ENPA 3RKUA 5JCJD 3QVXA 4B7XA 4XR9A 1ZKMA 2UUPA 1BWSA 2P2SA 5DCUA 4HFNA 1PJLA 2UAGA 3S8MA 4J0FA 2Q2WA 2DT5A 4IJUA 1P1RA 4UEOA 4UVGA 4EJMA 4ZN6A 3K73O 1ZSVA 3HE3A 1DIGA 3BHMA 3JQBC 1G0OA 3JQDA 4MVJP 1PZHA 4P4GA 4DA9A 3IL2A 1Z75A 2X5OA 5JO0A 1A7AA 4OXKA 1B8UA 1WLYA 3GOHA 1SNYA 3C85A 1SZJG 4BNXA 2VZ8A 3GQVA 1QP8A 4E2YA 4BMNA 1G1AA 2IRWA 1I2BA 5KVQA 2YFHA 4WGGA 3ASVA 2C59A 2GN4A 1GV1A 3RVDA 4PLCA 3BZUA 2R2GA 4E32A 3H9JA 4O5OA 1GU7A 4YT5A 2AHRA 4RL6A 3PXXA 4BNYA 5THKA 2Q1UA 2EV9A 1Z7EA 2DUUA 2RHCA 3DB2A 4H3VA 4ZJUA 4U5QA 2Q50A 5CDTA 1NPTO 4FGWA 4R5MA 1SEVA 4B7UA 2Y0DA 1PSDA 3LK7A 4B4VA 1E6WA 1Z73A 4L9RA 4WECA 3DOCA 1K6JA 1R0KA 4CL8A 2PK3A 3BMQB 4LCJA 3INGA 1EVIA 1LJ8A 1B0AA 1XSEA 2C5EA 4OGWA 2OORA 1J5PA 2O7SA 3NDIA 3MJEA 2CUKA 1RM3A 4U6QA 5A9SB 1RKXA 3WB9A 5ER6A 4GSKA 4OXYA 1Q2XA 1MC5A 4QECA 2YQ4A 1HTBA 4ITUA 4KWHA 1R4NA 1U5AA 4CMHA 2YHUA 1VL0A 4TKMA 4GLOA 2Y1FA 5COQA 1QORA 4HXYA 4WCFA 4XD2A 2CMDA 1E3JA 1VPDA 2OHXA 4DBVO 4F6CA 1LRLA 3JYLA 3VDRA 2LDBA 3R3JA 1DXYA 5JYDA 2BFPA 2WD7B 5L7WA 5TS3A 1HE3A 1ZK4A 1KEWA 3GVPA 2C7GA 1NVMB 1SC6A 1YO6A 3PWSA 2H63A 4Q3AA 1YQXA 2HJRA 2C2YA 5JAIA 5KJ1A 1PIWA 3M1LA 1T4DA 1C0IA 1R15A 4ZRMA 2GRAA 4GL4A 3UVEA 9LDTA 4GGOA 3KUXA 2C82A 3ZU5A 2EIHA 2GN9A 1HSZA 2BH9A 5EL0A 1ZMOA 1HZZA 3QWHA 1QV7A 4II3A 3RFTA 3I4FA 1PZFA 3DWFA 3NYWA 4PG6A 4AICA 5TC4A 3JQAB 1BDBA 3A14A 4CV1A 3INRA 4DLAA 5C7LO 4YACA 4GI2A 2POQX 5G4KB 1ADBA 3TN7A 1JVSA 3TFOA 1OI7A 4GVXA 5HWSA 2G82A 1CJCA 1NP3A 3I9LA 3DAPA 2QW8A 1UZNA 1P9LA 2YHIB 3CIFA 3IDSA 2NVBA 3FF4A 1H6CA 1XU9A 3NRCA 2JJYA 1BXKA 1HYGA 2P68A 2PNFA 4Y67A 3RIHA 3E5RA 1VL6A 4R1NA 3H7AA 4OQZA 5H82A 3ZH2A 1AGNA 2H6EA 4BO2A 3C3XA 2W2KB 5GZ3A 3QVOA 4XYBA 3NDRA 5G0UA 3ANMA 3HDJA 1GQYA 2TMDA 2ZTMA 2O2YA 4FJ1A 4J6FA 4IDAA 1YVEI 4BO8A 3JYQA 1HXHA 3NX4A 3DZKA 3TZKA 1TEHA 2WWRA 2I6TA 4FBGA 4HKTA 3RWBA 5I7VA 1WP4A 2AG5A 2GSDA 3FBGA 3VHRA 3KV3O 2FSVA 2JHFA 4YEDA 1PQPA 1EK6A 3HDHA 1K89A 4XRRA 3GNTA 4RLSA 3CPSA 3HDQA 3H6KA 5DN9A 4IIUA 3K92A 1C0PA 1FJHA 2YY7A 1E1NA 3VDQA 1CRWG 3WGTA 1FDSA 4DIBA 3RUAA 2A35A 3KSZO 4FJ0A 3PFWO 1OMOA 5F3RA 3HHPA 5EQDA 1KS9A 4E30A 3DONA 4FPXA 1ZJZA 3UN1A 1NM5A 4LVCA 4BNWA 3MZ0A 3ZHXA 2AQHA 4DREA 4A10A 2C7VA 2F00A 2OL4A 4M8SA 4HV4A 4NDNE 5L4LA 5T8KA 1U4SA 4K9DA 4B3IA 1C3VA 3DHYA 4R3NA 4YPOA 2J5KA 2XXBA 3KSDO 4YAJA 3WXBA 4XQ9A 4CLRA 5IXSA 2PGLA 4CM8B 5DOVA 1TVEA 3UHAA 1DC6A 3RUCA 5L7YA 4H15A 1BW9A 3GGOA 4BNFA 1WAMA 1EDOA 3GNSA 1T2CA 4TQGA 4B4OA 2C5AA 3WGQA 3ZV5A 2QRKA 4XEHA 2IDZA 5HA5A 3OIGA 2NV6A 5A05A 3MJTA 1AXGA 2X58A 4B3HA 4A26A 4YDRA 2E48A 2X9NA 4DYDA 5DCWA 4N5MA 4GH5A 2X8LA 1B16A 2NQ8A 3FR7A 1ULSA 3EZYA 5IDYA 2UVDA 2PD6A 2PH5A 3Q2KA 2NU6A 3PJGA 5IJZA 3PJEA 2BELA 5ILGA 3RBXA 4OH1A 3ETDA 5HS4A 2HAEA 2EHDA 3JQGB 1LRKA 5JYEA 1DRWA 3JD2A 4ESOA 1GAEO 4ZQHA 2GCGA 5COBA 1O89A 3JSAA 4JGBA 4D44A 3ULKA 5I8WA 1U8FO 1LLUA 2H1SA 1GDHA 4HFMA 4Z9XA 4YJHB 5TLSA 3EGOA 2VWQA 5JNLA 1LX6A 2GN6A 3ZWAA 1W73A 2X22A 3NGXA 4HNHA 1N7GA 3RAJA 4IZHA 4BMSA 4CQMA 4Q3EA 5IXYA 1M66A 1FDTA 4UUOA 1RM4A 2DQ4A 4MP8A 4A03A 4OXNA 3OP4A 4TRJA 4QTZA 3P5SA 4GLLA 1Z7BA 2X9GA 1UZLA 4XZ3A 3HDYA 1YWGO 3RC7A 1LU9A 3ZWOA 3L4BC 4L75A 4CM7A 1GEGA 1R4MB 4Z0TA 4RVUA 1I2ZA 3I6QA 4G5HA 3D3EA 2ZB7A 4GKBA 3VTZA 2V65A 1X15A 2GZ1A 2HKIA 4GSLA 4JN6B 4GX5A 4LSMA 2G17A 4HP8A 1EEHA 4MINA 2OZPA 3TZQA 4MO2A 5ES3A 3ZN2A 1RM0A 4B7CA 2Q46A 2HRBA 1Q0HA 4W6ZA 4D0SA 1ZBQA 2HK7A 4ZQEA 3K5PA 4GAEA 4ZD6A 1UAYA 3C7AA 5DNAA 8ADHA 3E6AA 3VPSA 3IP3A 5I9LA 1U7HA 4EEXA 4Y6PA 1IULA 3FWNA 1M6HA 1ISJA 5KIAA 1LUAA 2RH4A 4QUKA 3AK4A 4ZQGA 3OICA 3RQSA 3Q9NA 3BXXA 3SX2A 3WGZA 4DIOA 3AOGA 4EUFA 4JJIA 5JS6A 1DIAA 4BV8A 3GA0A 1C14A 1Y8QA 5I7EA 2YDXA 2CF6A 4KQWA 2X0NA 1YBAA 1F17A 3RSHA 1AUPA 4PLZA 4MP3A 5ADHA 5U9CA 2OO5A 2Q4BA 1VE9A 4FS3A 3A9WA 4W4TA 2CVOA 1QLHA 3DBRB 5HBRA 3PFFA 4WCDA 1HWYA 3WMXA 4O63O 1ZO8A 4Y6RA 3H65A 1LSUA 3IUPA 5ICMA 4J7CA 1EQ2A 5JDCA 3OJ0A 2O3UA 1NX6A 4XB1A 2QZZA 4MKRA 5MDHA 4XJTA 2O3QA 5FEUA 4CMEC 4Z0PA 4U7WA 3EC7A 4J1NA 2NLOA 1EBFA 4TKLA 3DMYA 4FFNA 4J9UE 1E1LA 1XEAA 3P2YA 3E18A 2BGMA 3L77A 4BMVA 2WSBA 3CTMA 4PZEA 1F14A 1E3WB 2YZ7A 5DF1A 4J9VA 3RUDA 2EG9A 1N9GB 4CQMD 5IAAA 1XA0A 3LT0A 1DBVO 3K6JA 4P38A 4O6VA 3MJCA 4LGVA 1JQBA 1ZK1A 4GWKA 2GN8A 2AE2A 3S1LA 2Q99A 2HMWA 1TA4A 2E6UX 3OJOA 3WTBA 3GDFA 3QE3A 1IY8A 5FWNA 1DC5A 2DAPA 2EGGA 4LVUA 4A73A 3E9MA 3JQ9C 4XWYA 4FJ2A 4LCEA 1B2LA 4ALJA 4B3JA 3TOXA 4DUPA 5EERA 5F5LA 4BKRA 1ZSNA 3DBHA 3X2EA 1I10A 1KERA 4IDEA 1XELA 3Q0EA 3S2FA 5CAEA 3BMOB 3QW2A 3TNLA 2VRBA 1N2SA 4AJLA 1GL3A 3WIDA 5IZCC 4HWKA 4ND2A 4YT4A 2VHYA 4RLHA 4K1LA 3BMCA 4JJGA 4MDHA 2P4HX 2PD3A 5IN4A 4W82A 4GBJA 2O50A 1WDLA 1LNQA 1BVUA 5K6AA 1LSSA 4NBWA 1A72A 3H9EO 4FOSA 2JD0A 3U49A 4BB5A 2ZYGA 3R0IA 3NUGA 4XGIA 4NJMA 2W90A 3QY9A 4MVJI 2GO1A 5JPIA 3GMSA 5L51A 2YV3A 4DMLA 1HLDA 2OP1A 3ITKA 2D2IA 4BO3A 1DIBA 2R00A 2CVQA 3ICPA 5A9SA 3IC5A 3LDHA 3RJ5A 4I08A 1GYPA 4BHTA 4CV3A 1PJ3A 2O3RA 3S2EA 4ALKA 3PIIA 4CLXA 1HE5A 1BMDA 2DTXA 2J5RA 3V8BA 1GR0A 2DUWA 1I36A 2D3TA 2Y1CA 3M2TA 3SC4A 1TXGA 4E12A 3U09A 1YB4A 1ONOA 5A9RA 1KEPA 5CDYA 4P22A 1YQGA 5A04A 2B37A 3PVZA 4ILKA 4L0QA 4YAEA 4KTVE 1PGJA 2FP4A 4GGPA 3D4OA 4FFRA 4II2A 2CY0A 1PGQA 1U3WA 2VZ9A 4NU5A 5A03A 4INAA 4BNTA 3ZU3A 2Y1EA 1P77A 4YYZA 7MDHA 1VL8A 3QHAA 3KYDA 1E7RA 2V6GA 4D46A 2RIRA 4W7IA 4WUVA 5C7OO 4KDEA 2QHXA 1B3BA 2W4QA 4GKVA 4HADA 3DEYX 4IS2A 1Q0LA 1DFGA 4AJIA 2DLDA 2VNSA 2YYYA 2X7HA 2QYTA 4Y8VA 1UXHA 5EPOA 1MXFA 1KEVA 1I2CA 3ZDFA 4E4YA 4N7RA 3OF2A 3S55A 5BNFA 4IJWA 1OC4A 2Y05A 7ADHA 4QO7A 3EYWA 5TF4A 4UAGA 4D3FA 1LDYA 2WE7A 2BGLA 3K8ZA 1ISMA 4R41A 2D5AA 1V8BA 3FR8A 1RYEA 2FWMX 4PLYA 2W8ZA 2JAHA 4J4HA 2A94A 5TT1A 3E48A 1UR5A 1O95A 3KM0A 1SOVA 3Q2IA 3P19A 1PEDA 2W2KA 3GR6A 4E31A 1CF2O 1Q7CA 4OMUA 1AXEA 3C7DB 4R9SA 1I30A 4OO3A 3L07A 1ONNA 2OUIA 2HMSA 1WW8A 2EGHA 4M87A 1I8TA 6ADHA 1EE9A 4R69A 2VUUA 3DDNA 4EDFA 3HN7A 2XF8A 3ST7A 1LTHR 5A3JA 2WE8A 4BNIA 2NACA 3EAGA 5L95A 1PGOA 5JAQA 5KJ6A 3WGOA 4CMIB 4YR9A 4U0JA 3VPHA 4TROA 3PHHA 3A1NA 1U3VA 2DFVA 3S2IA 3U4HA 4RQTA 3JQ8A 3ONDA 3AY6A 3CZMA 4WE3A 1QG6A 1QLJA 3W6UA 4CMKA 3DMTC 1X7HA 2J3IA 1N5DA 1LEHA 4BNKA 4YJGB 5LDHA 5I9MA 4WLNA 3AM5A 4DC1A 5AXCA 2BKAA 3I83A 3DR3A 4IDBA 4F6LA 4BO1A 5MGBA 3GVCA 1BXGB 3UH1A 2EP5A 2EKPA 3GN2A 4FFOA 2J6IA 3VPGA 4YCAA 4CR7A 4YQYA 5FI3A 4M86A 1FK8A 1S6YA 2EP7A 3G1TA 2X0IA 1FXSA 2YDYA 4CM9D 4PIVA 4MVJG 5J23A 1NQOA 2GUGA 5EINA 3R3SA 3MCVA 4FQ8A 3U62A 1J6UA 2CDAA 2DBVO 4IDGA 3UW3A 3ETGA 2I3AA 1LDBA 2YQ5A 3DAFA 3Q11A 4YRDA 3PPIA 4BO4A 4UEKA 4UVHA 3D4NA 1JA9A 1UXJA 4NG5A 1O5IA 2OFPA 4MVJA 3LSYA 4R1UA 1BXZA 4PLTA 5KTKA 4R3WA 4HY3A 3LU1A 3HN2A 4DGSA 2VWGA 3DO5A 2BMAA 3FHLA 3BHJA 4MVJE 4WEQA 3IS3A 1YS4A 5K9ZA 3I9JA 3I6IA 3ZU4A 4WNIA 2FR8A 3AI1A 3I9MA 1JAXA 5C7IO 1B14A 2VRCA 2BLLA 5BSGA 1E7SA 1XWFA 5GZ6A 4JXKA 1GD1O 1H2BA 4XKJA 2YV1A 2PZMA 3JTMA 4M49A 1IE3A 4JP2A 4IDCA 2F1KA 4K28A 4Q9NA 2HQ1A 3ASUA 4ND5A 3ZNOA 1IL0A 3QIVA 4IMPA 2I99A 4LISA 3GZNA 3HZZA 4YAKA 4M89A 5B4TA 4OSOA 3G17A 3LC1O 4RDHA 1XLTA 4N5NA 4CLOA 2QRLA 5JC8A 3FN4A 1BRMA 4HUJA 3AY3A 1RPNA 4X54A 4Z0HO 3WWYA 2XPCA 5BT9A 1UDBA 4GWGA 2Q3EA 1L7DA 1E3IA 4YT8A 3PK0A 2VT3A 1KVQA 2ZQYA 3DBLA 2NTNA 4LSWA 3G3EA 2VWPA 4MVJH 3PQFA 3ZNQA 1UAGA 4W9NC 4Z9FA 4PLPA 5KKCA 3COSA 1A71A 1ZMTA 3TL3A 3JQ6A 1OAAA 3ZNNA 1I33A 3BTVA 2FPGA 2IEDA 2P4QA 4EJ0A 2VUSA 1YOVA 2FPIA 1N7HA 3N7UA 2PZJA 3MOGA 3W4JA 5BSHA 4P4NA 4M55A 4E6PA 1LLDA 2VYVA 2SCUA 1XIVA 1TLTA 2NTJA 2IEBA 5A06A 2IZZA 4WLVA 2AE1A 1JU9A 1ONPA 3RD5A 5CFZA 3RROA 1Y5RA 1LLQA 4XYLA 1WWKA 4U8GA 3CXRA 1FDVA 3BMNA 3IKVA 5DBFA 5IDXA 2GR9A 1VKNA 4TRRA 2VWHA 5T5QA 3BYZA 3E1KA 1D8AA 4J0EA 3OBBA 2JD2A 3U3XA 3PGXA 4YA6A 1ORRA 1KVTA 3W8FA 3K2BA 4RO0A 3O03A 1ZSYA 2IYOA 4PLHA 3C24A 3PJFA 1W0CA 3B20A 2GLXA 3PWZA 3TWOA 5TX7A 2H5LA 4RZIA 3RBZA 2ZJ1A 3U5TA 3GVHA 2B69A 4WOJA 1Q7GA 2NU7A 4OAQA 3LVFO 2VUTA 4RVGA 3H3FA 1V3TA 4NFSA 5KJCA 1MA0A 4XQEA 3KTDA 1ADGA 3PLNA 3HJAA 1JKIA 1Y8RB 1YL5A 1LQUA 2BD0A 2GNAA 3MJSA 1AE1A 3MWDB 3PWKA 4XR4A 5JW6A 3FNGA 3EMKA 1SAYA 4N5LA 3RU7A 3R1IA 1LDNA 4FOOA 2PD4A 1YJ8A 3H9QA 1CDOA 2NVUB 1C1XB 4PCVA 4BO6A 2ZTVA 3W1VA 2A92A 1KOLA 4BNZA 4G65A 5BR7A 4ALMA 1H6AA 3PYLA 4L73A 4RVHA 3BIOA 4I9HA 1VSUA 3ORFA 4EUEA 1B8PA 2CDCA 2GASA 1MC4A 1PJCA 4BB6A 1PGNA 3ZHBA 3ZGYA 3VKUA 5AXDA 1MP0A 1E7QA 2FPPA 4QEDA 5DOZA 3D1LA 1HT0A 1A7KA 2O3SA 4DYVA 4XRGA 3A06A 2PLAA 4KMSA 3KYBA 4Z3KA 3AFNA 4TRMA 2FHSA 3B1FA 3B1JA 2Q49A 3WLEA 2G1UA 1KY4A 1YH3A 5L4NA 3ONEA 4JIGA 4W99A 1A27A 4NIMA 3IOYA 1YL7A 3LZ6A 4DTIA 3GC6A 2E49A 2Y1OA 1UDCA 3NEPX 3PZRA 1U2GA 2NVWA 3L6OO 2PA3A 2B4QA 4NFHA 4CR8A 2EW2A 1NASA 5C37A 4IBOA 3KHUA 1JWBB 3KOUA 1TT5A 3VC7A 3O26A 5H83A 1MLDA 4BNNA 2V6BA 2NTVA 4D7AA 3NV9A 3W4IA 4FCCA 1X13A 3WIEA 2A9FA 4N18A 1P0CA 3PYMA 3Q6IA 4J7UA 3WTCA 1EE2A 3TZ6A 3V1TC 1ISFA 3TF5A 4I5FA 5L53A 1L1FA 3OIDA 4E21A 3AM3A 3MWEB 2AW5A 3F3SA 1DDOA 3OQ6A 4L76A 3W6ZA 5A02A 1BVRA 2DTEA 2V7PA 3ZV4A 4XJSA 2VHZA 1HSOA 1E6UA 1K6XA 4Z3DA 5F1KA 1M2WA 4GMFA 4BKOA 1VLLA 3D3WB 1VM6A 2XAAA 2O7QA 4TZTA 1P45A 4OJNA 3RUFA 1DPGA 5EESA 4WCFC 3OFSA 2WYVA 3IKTA 1HE4A 2JCYA 3GEDA 4IY1A 4R51A 3I9KA 1X0XA 1DC3A 3O8QB 5TIIA 1PZGA 1V3UA 4PN3A 3PDJA 3PIDA 4J4TA 4LN1A 3HSKA 1P31A 4WNCA 4F46A 5EN4A 1LDMA 1SOWA 3K9QO 5KWEA 2D1YA 1GY8A 1PTJA 2HMVA 3F4BA 4D43A 5BSEA 2HDHA 1A4IA 4BO5A 3TSCA 3FTNA 4CLHA 5BSFA 3CH6A 1VSVA 5TNXA 1H2HA 2Z95A 3TPCA 3WLFA 1IHYA 1MFZA 2QIOA 1U2DA 3RFXA 5JY1A 1YB5A 2ZIZA 5DCYA 2JL1A 4IJVA 1HEUA 4BGVA 3DXFA 3QV1A 3MJ4A 1YB1A 2FOIA 2RHRA 4TVBA 1UJMA 3OQBA 3VZQA 1JN0A 2CVZA 5FFFA 3ZCXA 4ZHSA 4QFCA 4IGFA 4ND3A 1D3AA 4TVOA 3WDSA 1T25A 1LSJA 1Y7TA 1DRUA 1T24A 3RJ9A 1PL7A 2DC1A 3JQ7A 1MUUA 3AI3A 4OL9A 3SJUA 3E9NA 3EK2A 4WJZA 2EJVA 1QMGA 3H8VA 3WGGA 1T1RA 1GFSA 4HNGA 3UCEA 3ZWNA 1EUZA 1XKQA 1ZH8A 4FDAA 2HO5A 2Y1GA 5TRTA 3GGPA 2I5PO 3RC1A 1ZCJA 3VZSA 4OKIA 4R16A 4ID9A 3LLVA 3ZZNA 3EVTA 4KP7A 1OBFO 4Y98A 1GCOA 2FMUA 3AUAA 4L4RA 2EF1A 1SB8A 2V6MA 4CMIA 2VZ0A 4P4LA 1TT7A 3VVBA 2X86A 3QWBA 4YJFB 2I9PA 2OXIA 3JD1A 5TQVA 4O0LA 2DTDA 1NPDA 2X0JA 2ZYDA 3LC7O 3QP9A 3VPXA 5IZ4A 3NT4A 1ADFA 3B70A 5KOIA 3NT5A 1X7GA 3V2UA 5AXBA 1KBZA 2O4CA 1T2AA 4NNJA 3TFQA 3V1UA 3HB4X 4HBGA 2VN8A 2OBNA 2H9IA 4FFLA 5LCXA 1SB9A 3UFXA 2PGJA 2QRJA 5B37A 4CLDA 2X6TA 1NQAO 3GDOA 5T57A 1U28A 3W8DA 3OIFA 3PYXA 5H81A 1ZVMA 2G0TA 3P2OA 5L9AA 2UV8A 4Q3DA 3OETA 2EKLA 1GYQA 3PI7A 5U1PA 2X0RA 2CFCA 3NT2A 5T8KC 4WASA 2VYNA 1O6ZA 1OZAA 4IMRA 3IAHA 3OECA 1ZJYA 4R1SA 4LMRA 1MX3A 3GRPA 5JFOA 1C1DA 1YXMA 4I8XA 1YL6A 4TWRA 1U3TA 1ZK2A 3OJEA 2B5WA 5FI5A 3VZPA 2ZTLA 4EBFA 1PS0A 3GHHA 3K2EA 1I0ZA 5B4VA 3DZBA 3OHSX 3DZGA 4XYMA 2Q2VA 1JWAB 1K2WA 2EJWA 1T1SA 2G76A 1YRLA 2FZEA 1ZK0A 3Q9UA 3KVOA 4XCVA 5IF3A 3ZWYA 3VH4A 1ID1A 1ML3A 4YJDA 3S2GA 3H5RA 3WGYA 2GDZA 4CLEA 4EZBA 3V5NA 4KUEA 4BKQA 2VT2A 3FTPA 5LDGA 1FDUA 1JVBA 2NM0A 4J1SA 1UP6A 2X23A 2PY6A 4FD3A 3TL2A 2OGUA 2B35A 2E4AA 4MVJM 4UULA 4E2WA 1I3NA 1LXCA 4AJKA 3LQFA 4BGIA 5JDIA 3E9QA 3GEGA 5EMHA 3GG9A 1NR7A 4D0RA 3QWIA 4XDYA 4CMCA 1XQ1A 5KJFA 3C7CB 1P1FA 2HK9A 1U1IA 1KETA 4PLVA 5I8ZA 5THQA 4DPMA 1P1JA 1JKJA 2YJZA 2AEMA 1HDXA 4AJPA 1MGOA 3KYCB 1BG6A 4J2HA 4L74A 5EJ2A 4GQAA 1ENZA 4RPJA 1JKFA 4RDIA 2DBZA 4WCFB 3G49A 4NBRA 4ZVVA 4DRYA 1EBUA 1HLPA 4JCOA 5FYDA 3DOOA 2C20A 2CSUA 3SEFA 1N1GA 2BFMA 1N8KA 2W2LA 1NQTA 1K0UA 4E3ZA 4CMJA 5GZ1A 2D8AA 4QXMA 4IZIA 2EKQA 1N1EA 3C1OA 2Y0EA 4B4WA 4O59O 4XYGA 1PQUA 3I9OA 3AUTA 3ICCA 3JQFA 3TZHA 1QYVA 2DFDA 3FD8A 1P0FA 4FR5A 1QYWA 1PX0A 3KRTA 4HFRA 4Y9DA 4GPD1 2YW9A 4H7PA 1X1TA 4PRLA 2WTBA 4FGSA 4AJEA 4JK3A 4A5OA 1CQJA 4RGBA 1H9BA 4PRKA 5EQFA 2O4UX 3IIEA 1NTOA 5JO9A 1E77A 1HDGO 2B4RO 2I66A 3HQ4O 1WDKA 2ZQZA 1CERA 1U5CA 3PQEA 1HDRA 1DO8A 5JAMA 1HKUA 3RUIA 3CEAA 4PVCA 1NR1A 1F06A 3BMQA 2PFGA 1GEEA 2DM6A 3FPCA 2W98A 3H3JA 1DJQA 5JE8A 3EVNA 3E5MA 2VQ3A 3E82A 3L0DA 1LC3A 1DHTA 4CMAA 4KUHA 3TDKA 1IZ9A 2P9CA 4LW8A 3TRIA 3QLJA 4QSMA 4JBIA 4QQRA 4YB8A 1U4OA 3UKOA 3ZI0A 4WLEA 1QYCA 1NVGA 3B1KA 1TB4A 4JQCA 1I3MA 1M6WA 5DT9A 1EK5A 4CR6A 3QQPA 1PR3A 3MOIA 3ZWXA 2HU2A 3ZU2A 2BI8A 3GNQA 4WLUA 1GV0A 1YKFA 3L9XA 4JP3A 4R68A 5JDCC 1A5ZA 3WSVA 2C07A 1ENYA 1Y9AA 3HUDA 2UUOA 4CM1A 2WD7A 1HETA 2PH3A 1LRJA 3N74A 2E82A 4RPGA 3ZW8A 3MJVA 4CM3A 3B6ZA 3ITDA 1NYTA 2P5UA 4AL4A 1NWCA 4BO9A 1DIRA 1NAIA 2VHXA 5JY6A 1VJTA 5I9NA 2OMEA 4RPKA 4OHUA 1E3SA 4IPTA 2NADA 3LT2A 3RASA 5G0WA 4TZKA 4J7XA 1MB4A 2ZB8A 3ANLA 4IXTA 4EJ6A 3DFUA 1DSSG 2JAPA 2I76A 2IODA 3GRKA 2Y68A 2PKQO 1D7OA 1XHLA 3JQAA 3VOSA 3DC2A 4GX1A 3DTTA 2D5CA 3WGHA 5G4KA 3OA0A 1RWBA 4F45A 1EQUA 5HRUA 3AWDA 3EW7A 3ZNPA 1UH5A 2ZK7A 4CLRB 1KVUA 2WEKA 2J3KA 5B1YA 1H0KA 1BW9B 2YHIA 3GDGA 1DLJA 4JBHA 4MIOA 3ZWPA 5C5IA 3RKRA 2WMDA 3AOEA 1Q1NA 1HDYA 4DXHA 2ZATA 4XYEA 1PU2A 4XIYA 2JFFA 4L4XA 3U4DA 3V1YA 1SCUA 1ZEJA 3R6DA 2I65A 4CPDA 3D7LA 3ENKA 2DBQA 5ENDA 5G4LA 1SBYA 1VRWA 2B4TO 1RJWA 2GERA 5T64A 3VH1A 1JTVA 3A4VA 8LDHA 5K6AC 3FWZA 3F5SA 3T7EA 2VNAA 1HYHA 1UP4A 3E03A 3ON5A 1NHWA 1DRVA 3D0OA 1T2DA 3VKVA 4FSHA 5IDQA 1H93A 1HDOA 2AXQA 1PJTA 2BRUA 3DTYA 1ZIDA 1PL6A 3GUCA 1RM5A 4Q39A 4GMGA
chains in the Genus database with same CATH superfamily
4S2EA 1J2EA 2C2HA 3Q85A 1F12A 3A9VA 3A6LA 5DNEA 1PT5A 4PBSA 4DDUA 2GF9A 1T2NA 5DSZA 2CDBA 3M4NA 5FP0A 1KBQA 5JCJA 2I2XB 3LFUA 4KQXA 3IKJA 1IPFA 1GUYA 3FYHA 5D51S 4Z7OB 5JWOA 1Z16A 2X2OA 4FNMA 2JCGA 2WZDA 3UG7A 5KX5B 2WHYA 2QIPA 2V6IA 3WNCA 3GRFA 2JFZA 4HI0E 3V7UA 4J0DA 4I3HA 2PWYA 2NSDA 2C94A 1JEQB 4J0IA 4HYEA 5K6RA 1NULA 3GH3A 3WYCA 5JQWA 4I1IA 3FSRA 5LWQA 4L8FA 2PKRA 4EMSA 4BNUA 2XRFA 4BU0A 2OZLA 4YMSA 3IEXA 1JFTA 1E9VA 3WRXC 1YVUA 1N2HA 1Q7RA 2EW8A 3DZ8A 3H1TA 4LSZA 4MIEA 4Q34A 2G07A 3KZVA 4I5IA 5A1JA 5J40A 3UGKA 1U0EA 2ZKLA 4RV9A 4ITVA 4DLKA 1VA5A 3HTXA 3D8HA 4N48A 3LX4A 4GOLD 2VJOA 2ZT5A 5ALZA 3P9XA 4Q4LA 3UQZA 2ATVA 3HEBA 3ZTWA 4HNTA 5CVDA 4ZHQF 1IQPA 4FKMA 1Q92A 5EMKA 4Q93A 2YHBA 3UK6A 3IBGA 4MW4A 2BGIA 2EJUA 4BGUA 4HDOB 3OOSA 1HURA 4IXNA 1YD7A 3HXPA 4NKRA 3SC3A 1MW9X 1QO0A 3ITEA 4RJLA 4BKUA 2ERXA 3C39A 3JQGA 4V0LA 2WZBA 4XCQA 2HRQA 1M6VA 3BCSA 1JBQA 5TQ0B 2DOKA 1UDXA 1S0UA 2R7MA 1X3SA 4JJEA 4OP1A 1ZL0A 4Q48A 4F9TA 1VPWA 3IMKA 3NHPA 4LMBA 4PYLA 3W6NA 1BQ4A 2CFIA 2D54A 3VTFA 4AJ4A 1JAIA 1E9DA 2K6GA 4J0QA 3TTUA 1JLHA 5L6MB 4KO4S 1F4LA 4ZU3A 4WV3A 1PLJA 3B36A 5CLJA 4DMKA 2XBMA 4D79A 1YJCA 2GF2A 4IMIB 3U39A 5I7RA 2AOVA 4NPHA 1B2RA 1JEOA 2J0UA 2Z1MA 1IN1A 5EKXA 5A5FA 2BDUA 1Z2PX 4LZNA 2IDMA 2JDID 2O1SA 3ENZA 4RKYA 4AZTA 5BSWA 2WR8A 2ZJOA 4YJFA 1EB8A 3TQRA 2OCGA 1P4HA 3C3AA 4PYOA 3ZTTA 4BEBA 3L4JA 1E6KA 4Z2AA 3HKBA 2IWRA 3ICWA 2BYTA 5E7JA 3AVUA 2AUMA 2OGWA 5M5BA 5JG7A 3WGMA 1JGTA 4OFXA 3GLTA 5CA1F 2BR3A 3WWEA 3R7WA 3FYUB 5JD6A 3C8ZA 1OVGA 3T7IA 3DVAB 2XRMA 3L2OB 2EFGA 4YAIA 1FYXA 4NFYA 4YDSA 5IT5A 4GS5A 5CP8A 3SJ7A 3GJTA 2PS9A 2QMYA 3L5KA 1CUUA 2JIPA 5CYFA 2OCBA 3I52A 2I91A 3GLFA 6AT1A 4HSEA 1RW4A 2WMYA 2L69A 2CNBA 2XUDA 1VGQA 2FN4A 2R1UA 3BTOA 3EPPA 4K6FA 4M99A 4TV9A 1RLMA 4MJLA 3HB0A 2BR5A 2GGSA 4J90A 1ZGHA 1MTZA 1JHAA 4TQAA 3GLFE 2Q5IA 2JFHA 2W71A 2KI5A 1FQOA 1UJ6A 1XJ5A 1FF9A 1Z17A 2HF8A 2OBXA 4I1SA 3U56A 3V1NA 4I4TF 3FVRA 2FZ5A 1TQ6A 4KQ1A 3Q9LA 2FPSA 2FW7A 3TKLA 3EBOA 3E22A 4UU0A 1P9RA 4BQRA 2IUSA 4DHEA 1XRNA 4UHHA 3QKSA 4CVNA 4RXTA 1PWYE 3TB6A 2IXAA 5CG1A 2VF2A 5FUMA 3WMFA 2NNWB 3F5QA 2HJSA 3LAWA 4GSYA 2VP3A 5BRJA 4C4ZA 4DPLA 5E0OA 4CI0B 4CUZA 2WWFA 2ZBEA 3R7FA 4GPZA 3AR7A 5JLAA 1RQXA 2X4GA 1LF5A 1XTTA 3GEEA 1ENOA 2HBQA 3IRVA 5F64A 2HW8A 1D2AA 2HY7A 4TV8A 4TVKA 5GOZA 2KLHA 3IRUA 3AI7A 4LJYA 3NW9A 4WXPA 1CUCA 2JFNA 3OLQA 1B76A 4LDAA 3H5NA 2H5JA 4JZKA 2XTZA 1FUIA 4FEEA 4MMZB 3TLAA 1XD9A 5ALFA 2IZ6A 2WHRA 1NG9A 1GADO 1IQ0A 4IDFA 4KO3S 4B76A 3FSJX 1VG0B 3TLJA 2JFYA 1ZLYA 4OUDB 1R37A 2H1CA 2FMHA 5G0TA 5DLYA 5IN5A 5AIAA 2VP6A 2VLIA 3EMVA 2CFRA 4GZ3A 1R0ZA 3EWSA 2XI4A 4Q7LA 3PP8A 4QOHA 3PL5A 4N3BA 4WLOA 3TIGA 3KSUA 1DRKA 1WCYA 3GFVA 3WB2A 3I72A 3MT0A 2OKCA 4O1HA 3OTIA 4RX1A 1EJ0A 1R27A 1DOHA 1G17A 4O3FA 2LDXA 3PV0A 4LBVA 3RG8A 2BUBA 1QG2A 3QVVA 1X7DA 2VFAA 3CUYA 3I23A 3KEOA 3D6FA 3NTRA 16PKA 3OCCA 3FGZA 1GHTA 2FQXA 5LP6B 4HRXA 1Z6QA 2Z08A 3FPBA 3UATA 1G8AA 2H0AA 3ZW9A 3SAJA 3NBKA 4M1EA 4UBJA 1RYFA 3ZD9A 2V5UA 3CEPB 4AJJA 3DYVA 4Q18A 5FIUA 5JAZA 1V8OA 2PS1A 3KXKA 3BE6A 1FLVA 3SYTA 1MBZA 2YZMA 4O2BB 5CG2A 1N34B 4LF8B 5FBHA 2FSUA 5C5DA 1DDGA 5FUVA 2OHJA 1DKMA 1L1EA 1UBGA 1CY4A 1QC5A 3Q40A 1JJBA 4TMZA 3RLFA 2UZ1B 4E5SA 1P5JA 4EVRA 5A4FS 3QV2A 3VA7A 5KVSA 1HDEA 1NP6A 5LUBA 3WISA 4BKPA 2D2FA 4EENA 4G9EA 1REQB 3AHEA 4B0OA 3WGIA 1PNVA 5T4FA 2FN7A 4ZCTA 3GH1A 4MLDA 4FYJA 5KQMA 5HP4A 3K0EA 1SCBA 5G0VA 3E1SA 1V2HE 3A6PC 2G1KA 1IYZA 5ALGA 3I58A 3RAGA 1KFCB 4CHGA 4PG8A 3NBUA 3E4CA 4H7IA 2PEZA 2VUIB 2DMRA 2E3JA 5T67A 4B9AA 3M8KA 1X77A 3C8MA 2AJBA 4LXHA 3BFKA 5CVEA 2OVFA 2QL5A 3NH9A 2XXJA 4JP1A 4R54A 2IOQA 4RH0A 4GGMX 1WB4A 1VIVA 1M75A 5TJHA 2H00A 2GZMA 4AECA 3O4VA 5JSFA 1QCCA 3M1IA 2G70A 2V7UA 1XZKA 2Z1DA 3P20A 4G6ZA 1XZQA 3L8ZA 4ONEA 4LK3A 1WCXA 2PX3A 4I9NA 4PSUA 4Z5XA 5HKBA 3I39X 2PXCA 4X1YA 4OHOA 4YP9A 1PQYA 1VYTA 2N75A 2RHJA 3E2IA 1AO0A 1JV2B 1AF4A 1MEJA 2QROA 1MGPA 1PT8A 1NYRA 5C1IA 4RPIA 5HRCA 1L5SA 3HCEA 5CDFA 3NWEA 1RAFA 1YZTA 3RC9A 3UWSA 1NQXA 5IDVA 2IUUA 4UOQA 1I51A 1TZMA 3SJCA 4U2EA 1Z82A 3A2MA 4JYCA 3L5OA 5SZJA 3VAZA 5ALPA 2XVAA 3ZV3A 5CDFE 3BHIA 5C31A 2O1WA 3HCBA 4NZZA 1EMDA 3H87A 4KPYA 5DTJA 1A8SA 4DIFA 1OLUB 1QV9A 1HOXA 2B98A 4EYQA 1ZCZA 4DR2B 3QOYA 4TWBA 5MGNA 1JXOA 1LFDB 1W25A 2P79A 1BHSA 1JIUA 1GILA 3L06A 3MILA 3QVSA 4Q9IA 4B3XA 4EZIA 4YBZA 5JAHA 5T7BA 3L4BA 2OV8A 3KCNA 2YOGA 4HPWA 1PEYA 4R8MA 3AL3A 3M4ZA 5J2TF 4C6TA 1W36D 4Q9JA 5LBUA 3FOZA 4QGAA 1TEXA 1JDNA 2XTJA 5B12A 4DOMA 3JQ8B 2DH6A 2JH9A 5SZHB 2XT9A 2RGCA 5JT1A 3T3MB 3EC1A 4KGVA 1XA3A 2WK1A 4CMBA 1TEZA 2Q45A 3ZU6A 4BP9A 3TPZA 3ICQB 2CFTA 2ZITA 2XB6A 3GVXA 1K27A 1L5ZA 1UBUS 2YJGA 2ODNA 3HO8A 4EG7A 2VXBA 4XE5A 3NHWA 3BA6A 4MA5A 5LC1A 2WUFA 4PR0A 5TMEA 5ALQA 1L4KA 3AVYA 3BEOA 4EGCB 1XDGA 4YRAA 1DC8A 3ET5A 3OZUA 4F93B 2C7PA 1KC3A 1TJYA 4LY0A 3F9RA 4ZV9A 3WRVA 2RC6A 3WC4A 2UVQA 1W2WB 1I7PA 1XAHA 3KOWA 1ZFNA 4MRNA 4XEUA 2FGJA 1T6YA 5SICE 4HR7A 1WB9A 4A7PA 1YFLA 1K08A 3KBBA 4AMGA 3BCRA 3Q6MA 1WO8A 3T8YA 1WS6A 2HWWA 3JQEA 1XLUA 2PJZA 2HJGA 4ZTZB 5MN4A 2Q1WA 2R62A 2VDWB 2PX2A 1P7YA 2R8BA 1D1SA 3IAEA 2J3HA 4OVKA 3T9EA 1YR3A 3DL7A 3VSAA 1X87A 2GPYA 2BMJA 2SBTA 2B92A 2HRZA 4MYDA 1N2IA 2IIVA 1N2CA 3OM0A 4KXUA 1UM9A 5K1ZA 2AXEA 3O1HB 3E7PA 3CF4G 4Q0MA 2OEPA 4B3TB 1DXOA 1CJVC 3BX1A 4HTFB 4DWVA 1HT3A 2ENUA 2J3DA 3NNDA 1JYSA 1NPYA 1N5MA 3UCFA 1N2CE 4KDRA 3DR5A 1COZA 2CV2A 1X1QA 1CIVA 4YC7A 4BS9A 2Y1LA 3AEKA 4X8OA 1LC0A 2PNJA 2Z6QA 2UXCB 1KVRA 1ORVA 3CF2A 4DEVA 2P8JA 2OYRA 4CKEA 4S1VA 2XBUA 1AZLA 1ZIOA 5BW5A 3NFRA 4QOEA 2C54A 5ECGC 1R16A 3ZWWA 4TWJA 4E2WA 3R2JA 2AR9A 2NWQA 2XMBA 2P62A 5CVTA 1Q1GA 3LKVA 4FINA 4XM0A 4JWTA 2OQVA 3RC2A 1YQ9A 2PZ8A 5B4UA 1FTWA 4EITA 3NDPA 1XG5A 2EOAA 4KACA 4P98A 3AWIA 4TZ6A 1W8DA 1X92A 3QHPA 4U7FA 1NF3A 2WJYA 2JS7A 2Z8YA 5CMLA 5JV5A 4N54A 3H86A 2P41A 3EDMA 5TGZA 3QXXA 1H6BA 3BD8A 4FQ7A 3WLNA 3O8NA 3MD9A 1HT2E 3GOQA 1IXSB 1E1MA 3QPBA 3KHSA 4LRSB 1BXGA 3WAGA 1CNFA 3KSRA 1SOAA 4JLAA 5K8JB 3E8SA 2DVMA 4MVJF 2HWKA 1TW3A 2BEJA 2NU8A 4EUNA 1L7OA 1CY2A 1J42A 4FYHA 4TN1A 2B94A 2C92A 4WXMA 4EKEA 1JG7A 1RVDA 1YF3A 3KG2A 3QA9A 4LG1A 1ZH0A 3DBLB 3H5AA 3VOAA 5T41A 1JX6A 3QLTA 4L6AA 4N41A 4HBZA 1MAWA 3LBFA 3O1JC 4Q3CA 1GQQA 2I67A 4KX3A 4CEJA 2BFDB 1E3LA 1D4OA 2NZYA 3KLPX 3MJFA 4RHUA 3V7NA 2H4HA 5L45A 2C9MA 2ZM6B 3N5CA 1BDHA 5K3FB 1M0SA 4Q3LA 1MQSA 3F96A 1VIMA 5KEIA 2GZ3A 4ZI3A 4E09A 2OWEA 1DJNA 1U3CA 5UKDA 5AI9A 3NJ8A 3STYA 3ZV6A 3HCWA 5CH3A 4C7JA 1K97A 2FPGB 3L6RA 3KAPA 2J08A 4EB8A 4ZT6A 1DKNA 4IIJF 1N2EA 4FCVA 1DGQA 3ISTA 2FPIB 1ESCA 2MJLA 1WIWA 3H4IA 1T26A 1DLIA 3U19A 3CHYA 1XTUA 3O92A 2ILTA 1O97C 3H84A 4QBTA 2QMQA 4CUKA 4QT0A 5SYMA 3W2TA 5JLJA 1RIFA 4UATA 1VJ5A 1C0LA 1P33A 4RULA 5LMUB 2IUYA 5ITWA 3ND6A 3U0BA 3D3NA 3IPRA 3RS8A 4KLCA 5ITVA 1RC1A 2O3JA 4FFBA 2WJZB 4BATA 5I8PA 1XCBA 2NO9A 3NAQA 3QFFA 4BLUA 4F9FA 4R9RA 3M70A 2QM8A 5KTMA 2FPKA 1SUCA 1T2FA 1V1RA 2YN0A 1B23P 5K2OA 3WJAA 1FDIA 4PIMA 3UAGA 2ZSEA 2H11A 1LTQA 1SRRA 3CNHA 2VHWA 1L4GA 4WFQA 2EQAA 3ROQA 4NP6A 2P4EA 2ZE7A 5CIYA 3IEMA 2PO5A 2WKQA 1GVHA 4YXFA 1QGED 2XCOA 3QUCA 4Z7QB 3A26A 4MIKA 2YVAA 2BN4A 4YMWA 2ZRKA 1TU3A 1T9GR 1S7CA 2BKEA 2DWCA 2J46A 3DCIA 3H16A 1V2GA 4O2AF 3GJSA 1W0JD 1OOEA 2V55B 4IEIA 4PZAA 2GEJA 5HFJA 5HKKD 2VSXA 4RHFA 5JARA 1XRJA 3KD2A 1MAHA 2REBA 3UMSA 1LA2A 3BBLA 4UREA 4L4SA 3HJTA 1T5BA 2DQSA 2G1JA 5GM1A 3SVTA 4NPCA 4QPZA 5LNK1 2P9EA 4IYRA 1HA3A 1ADJA 4S3MA 1M0EA 4FONA 1KY2A 1QTNA 2XNSA 4YUXA 2EKDA 1KK3A 5A4AA 4LF9B 4O8CA 4C7KA 2DZDA 1ZNWA 3MUFA 4MW2A 3OMLA 1SBTA 4ZPXA 2IS1A 1ND6A 4UASA 1DCTA 2C42A 1JZTA 1RKBA 2CLDX 4KOEC 9ABPA 4EHIA 4O02B 4LBZA 1J07A 5J4KA 2ZUFA 1U28C 3Q8WA 4MW0A 1P74A 3UFBA 3OWXA 4YMHA 1AC5A 3ZDYB 5AW8A 3H2ZA 3KHKA 3T35A 4EB3A 1KOJA 1YRBA 2BW0A 1HF3A 5IWCA 1QR2A 1ZI8A 2LR0A 2VYQA 1KZGB 5FA5A 3JVUA 1P73A 2Q6OA 4Z4IA 3RCBA 4F97A 5CVCA 2AV6A 1DPFA 1NW6A 4H7DA 4KIWA 3FKQA 3D0QA 4BNVA 2RARA 4F0JA 2XUGA 4JX9A 1QDUA 3T7RA 4JROA 1Z12A 5D84A 4UQOA 1B1AA 2PRZA 4KQKA 4MV1A 2OCIA 2ZVDA 5GAJA 3GLIB 4RJTA 2YICA 1Z2AA 1BMQA 4OGFA 3BZWA 1E2LA 3B13B 1TPZA 3KELA 3A11A 1KAHA 4Y2RA 5BN3A 5KO2A 2WJHA 2C1EA 2R6R1 4BRZA 2P6UA 2RHBA 4OGGA 2EDAA 3KJFA 5HUJA 2NO7A 3HC7A 4OREX 2YN2A 1GN8A 1YJQA 4KBYA 3L04A 1SMKA 2YIDA 4P33A 1TT5B 1R12A 4YIKA 5BV7A 5FTLA 5AKLA 4MYRA 4D2IA 3ZR4B 3FI9A 4FN4A 1E5QA 3IQZA 4OHPA 5DBGA 4FFSA 2GCOB 2I4MA 3E0XA 3WLSA 2IOHA 4JGIA 2FOLA 3DMTA 4R2LA 1NRJB 3HB7A 4GR5A 1GQ2A 1KPHA 3O4IA 1F7UA 3LUCA 4RF4A 3DP7A 3HACA 3H5VA 4BEVA 3G2IA 2YCLA 4WADA 2TYSB 5AOAA 5AKHA 1EFKA 2VDNB 4L5IA 3TCXB 3U7JA 1MV8A 1E0AA 1U2TA 2H7CA 2HNBA 2V9CA 4LIPD 2OCYC 2O48X 4RVSA 3P97A 3TDMA 4LGCA 1GXSB 2R86A 4MI6A 3QXHA 1I1NA 3VX3A 1AVTA 1QDEA 3DOJA 5DXAA 4PPYA 4RZHA 2GK3A 1UODA 5GONB 3THOA 1J06A 1SA0B 3JZFA 4ZO8A 5AJHA 3QRWA 4C5BA 4XTCS 3ZVNA 4BVBA 4Q4HB 3P32A 4UFOA 4KKXB 3U1TA 5MF6A 1SQ0A 3EUEA 1ZEMA 3A7DA 3D6HA 5CPBA 4G4GA 1HFWA 1NMZA 3LHDA 2Z6UA 2F1RA 5IG2A 2ALJA 2BWJA 5IKOA 4V1CI 2X1HA 1CUXA 3L0IB 3LC2O 2VPTA 5DASA 4WESB 2XNDA 5GJWC 1JDUA 3SYKA 1F48A 2GPWA 3NVDA 1YBVA 4JI5B 1J33A 4CTKA 5ICSA 2PUVA 5JR3A 4D97A 2QLMA 2YV5A 3VAYA 3K2IA 1I0IA 4UBMA 4R1OA 3VC1A 4ERNA 5JTUA 2H1VA 3GLHA 4HO1X 4HNQA 4U7GA 4RE5A 3IBFA 2VJQA 1U9JA 1WVGA 2I6FA 1K8XB 3E2PA 3PS9A 3IHWA 4MKHA 1OPXA 2CB0A 5DZSA 5JFTA 1FMCA 2R5WA 4HNUA 3B3AA 4FIZA 1P5FA 1CDEA 3GLHE 1XEFA 1H5QA 4J4BA 5IEBA 5KVVA 1AKYA 2Q5EA 5AQEA 3V34A 1UP7A 3Q10A 2QRMA 1XYGA 2WU3A 5JZ9A 1QJ4A 1NW4A 2CBZA 4YQZA 1MXHA 1PYOA 2WJ4A 4CXMA 3O2SB 4G09A 3P4UA 4RIGA 4ZVPA 4ARAA 4CKBB 3ADCA 4HWTA 5GPBA 1H5UA 2X77A 3UB3A 2JCVA 3F8TA 1K3TA 4MCAA 4PGGA 3BXHA 3P9IA 4QGFA 1EUCA 1ZC4A 4O4LA 4YCLA 4ZV4A 3HA3A 3VV2A 4EKGA 5BVGB 1E59A 1TX4B 4JYZA 4LY6A 1U0NA 2J0QA 1G8SA 1N2OA 3A3OA 3CVJA 3JWIA 3TRJA 1KYQA 4EUHA 5JANA 5J58A 3FNFA 1RWWA 3N2GB 4CT0A 2YOHA 4FEYA 1YZYA 4RCVA 4LZWA 5D5HA 1PWXA 4EEZA 4DMRA 1XZHA 2YJ4A 1YUMA 1DIHA 2A0FA 1SZCA 4MQ4A 2AG1A 2PMKA 4BE4A 4ESEA 1ATIA 3QFHA 4QULA 4PAQA 1DQYA 1Z6GA 4JI8B 4XDHA 3PXEA 1B4DA 1PJAA 4TLAA 4XQCA 3RR2A 1DAPA 4EY5A 3QSYA 1AJEA 2ZYAA 3O8QA 1Z74A 3IP8A 3EXHA 4LZAA 5NULA 1GGMA 3OQIB 4B74A 2AR0A 3QF4B 4YTEA 1PE0A 1W4ZA 1A95A 3L7OA 4ZQFA 5EZ5A 3DMPA 3UK0A 3RLIA 4TTAA 2Q1SA 4YAFA 5F7JA 5DBIA 5LQAA 1NVTA 1YVPA 3BD9A 1CRLA 1ZMBA 3U9TA 3NOQA 2RGXA 5ESDA 3EXFB 3KC2A 4C0KA 1E0DA 3WK6A 1T6BY 3AI2A 1ISHA 1I7NA 1ZWKA 2CLFB 2R6JA 2YS7A 1ZVQA 4DQKA 3UICA 3ZYZA 2AC2A 2XMPA 3BCHA 1T9ZA 3OCWA 2M2IA 5HM6A 2XZTA 4Q9HA 1JIVA 4F4HA 4YRBA 5B3LA 4X66B 2HUNA 1NWHA 3JWPA 3KXDA 3KP1A 3MRTA 1C3OA 4FCTA 4EG5A 1G21B 1NG1A 2P0YA 3O8DA 2CDRA 4UCFA 5K8TA 2KSQA 1U99A 3LCVB 1IXYA 2J30A 3Q12A 1WEHA 4L02A 5HMMA 3AIOA 3RAFC 5L3ZA 3IAXA 4QAJA 3ZLJA 3ISJA 3U3JA 2AWNA 2NSJA 2RI1A 2YMPA 5CPFA 4CKWA 2XB2A 2ISSD 3GYGA 1RQ2A 1TE2A 2X1MA 4NG4A 3IR5A 4NYIQ 1MB2A 2R1VB 2VF5X 3RTEA 2CLEB 1GR1A 1OTYA 3AOEC 1L7EA 2JB9A 1T4BA 1MA3A 2IYRA 3BJRA 1HDZA 4IINA 2ACEA 3DL2A 5JXHA 2GAAA 3F9IA 5JUWA 4E5NA 4F4CA 5FNVF 5JNRA 4HQ0A 4I50F 4RA6B 5F4BA 1F2DA 1ESDA 1L3BA 4A6PA 1SZDA 1NOIA 1DEAA 2QUJA 3CPHA 4NBUA 4YCCA 3KEQA 2JJ2A 3OH8A 1A1VA 4J43A 1DARA 4QWWA 2YVUA 3OKAA 4RYLA 3QMPA 2XWJI 4C3ZA 1LPBB 3AHGA 3NWOA 2P40A 2P69A 2GPBA 3KO8A 4Z1MA 4J2OA 4NMMA 1T1GA 2BR4A 1NRXA 1RBYA 1QCZA 4ZDKA 1NI4B 1RRVA 4MCHA 1H0SA 1P1KA 4HVTA 5EMJA 3N58A 2E4YA 5E8JA 3KQHA 2DPHA 1V1MA 2FWIA 4D1YA 1WB5A 2FRDA 2PR7A 1N5JA 2ZE6A 4DSOA 4EATA 4EK9A 2ET6A 3ZZ1A 4GHWA 4B2YA 4F6RB 3PVSA 2TMKA 1L1RA 1UPAA 3ENQA 2AMFA 3ENWA 3H6HA 1DFHA 4IS3A 1E2DA 3W6PA 2BKVA 2WKSA 3DF9A 3BSFA 4K9MA 3URKA 3CCCA 3JYPA 2V9PA 3NC1C 4K6CA 1ENPA 3FFWA 5TY0A 3V00A 1Z6YA 4EKNB 3LVRE 2J7KA 3C3KA 3HN6A 2P2SA 3ZCUA 5DCUA 3K1JA 2Q6KA 3KJQA 5HF9A 4CWAA 2P0AA 1VRCA 1UBEA 1YZVA 2DT5A 2HC9A 2WG1A 4UEOA 5CLQA 4MUKA 3D6NB 1UC4B 2B82A 3K73O 4PN7A 4FWTA 3JRWA 4IHJA 4OF4A 1QVVA 3FIUA 3G0CA 3D2AA 3JQBC 5JROA 3VYTB 5EUQB 1ZGBA 3WAJA 4KN5A 1JR6A 1WLYA 3GOHA 1FP4A 1RTTA 3B9RA 4XM2A 2VA9A 5C3UA 2IYVA 2QAJA 4UEWA 3ZHOA 4RK5A 1WB6A 2Y4OA 3V4RA 3D4LA 3OOWA 1I2BA 1R9GA 2B8NA 3BD7A 1E3MA 2C59A 2WDPA 1GV1A 4D4JA 4H18A 3FWHA 4LJ8A 3EPRA 5CNJA 4ZK6A 2PMCA 4U7JA 1C29B 1GU7A 2AHRA 1CR6A 1MCZA 5EHQA 4K1XA 2PJUA 2BGUA 3PXXA 4LZLA 5ISMA 1VJRA 2BEKA 4REQA 2BDEA 5EMNA 2OCAA 4TTJA 3X1YA 5IM4A 2NVOA 4JU9A 2Q50A 3AVOA 2ACWA 4XIIA 3H18A 1QHIA 1W2GA 1NPTO 5LYJB 2GTPA 4NENA 1T9AA 2PMWB 2Q4TA 4ER3A 5AHRA 4B4VA 4JIMA 2NOAA 5J4VA 2ZYIA 4EG8A 4L9RA 1QNLA 1ZH2A 4ICIA 4URUR 3KZ1E 5HBGA 3U7HB 2CLOB 2C8LA 3AKEA 3OX4A 4H4DA 1C7JA 1JJFA 3C5VA 1I3OA 4LCJA 2VA8A 3K0HA 3QFRA 3F67A 1R9NA 1U2SA 1GAXA 1RVV1 1H42A 3LHIA 1B0AA 2MT9A 3CRVA 1JHVA 3CLKA 4QXQA 4XLZA 3A6HA 3MJEA 4WOPA 3FTEA 1E3TA 4JKIA 1ESZA 1S2IA 2JJ2D 5DHPA 5BURA 4WCVA 5DN6A 5A9SB 5ER6A 4GSKA 2WPDD 2Q1YA 2N47A 3KHTA 1RXCA 2VAVA 1X7XB 2GM4A 2YQ4A 1HTBA 4ITUA 3JARB 4TKMA 1M7HA 4GC9A 2WSSA 3OPQA 4JLKA 1M8JA 1FC0A 5ERYA 1MU0A 2AG0A 4J2TA 4WCFA 3LT5A 2TSYB 1XMIA 3QEJA 4M8KA 4F6CA 2QLNA 1NU6A 4P4SB 3VDRA 4KVZA 2LDBA 5K09A 3KEFA 1XTVA 3R3JA 4KAJA 2BEWB 2Y76A 4EFLA 5JYDA 2DPYA 3DTVB 4GEGA 4PHCA 3ZEIA 4ZFNA 1HNXB 1BA3A 5LLDA 1KEWA 4JLDA 1KP9A 4RK7A 1YO6A 2DUJA 3UANA 2A0KA 1TO1E 4YJKA 1AQNA 1IBKB 2HJRA 3MBOA 5E6UB 3S27A 1OX6A 4B5LA 1XMSA 3DL0A 3QKUA 3QVMA 1YZUA 2W6QA 4UKDA 5FA6A 4FKBA 3GGSA 1CUHA 1C0IA 3M1LA 4MWBA 4IILA 4ZRMA 3UVEA 9LDTA 5IT0A 1NW9B 1JPVA 2C82A 2W2MA 3KUXA 2GN9A 2ZFUA 5CXUA 2EZ8A 1ZMOA 3GXBA 4HXEB 1L5HA 1J0DA 3RFTA 1I1OA 1HNNA 2CL5A 2G88A 2QAGC 3I4FA 1WD5A 2WWGA 4L5JA 4KWEA 4E2FA 1E8MA 5TC4A 1UK9A 3HB9A 3JQAB 4CV1A 2NO4A 4RENA 3DBIA 4YACA 4UM5A 2FW1A 2P0EA 4TUYB 4W63A 4WIAA 5CXSA 3TN7A 1JVSA 3VPDA 3TFOA 2ZUEA 3DTNA 4D98A 3CKKA 4D4LA 2JGFA 2XCUA 4ZMBA 3ZY2A 1CZUA 1P9LA 3CIFA 1W75A 3IDSA 1WCIB 2C3MA 4CFSA 4K86A 4DN6A 1D2EA 5FUXA 1H4QA 5DM2A 2NGRA 3TE6A 1YFKA 1ZUIA 4JC5A 1GPH1 4Y67A 2DFKB 2OC9A 2IX9A 4R1NA 3OOEA 2OCKA 2VHQA 4H6PA 3C3XA 4MQ6A 3QVOA 5G0UA 4MRSA 2QX6A 1GRCA 4J6FA 3ESXA 2PO7A 3J80A 1ZPDA 2EP8A 2VNJA 2QJTA 2HREA 1HXHA 5EJFA 3AVXA 3NX4A 2H1RA 5LA6F 1RWMA 4LWOA 1Y42X 3IQIX 1UBCA 4B8YA 1EGAA 3IUYA 1WP4A 2AG5A 5IH7A 3HO1A 1XFAA 3TJZA 3KV3O 1E5XA 1EK6A 4QUGA 3TS1A 3HDHA 4H6XA 3R5KA 4KE8A 1K89A 1K75A 4XRRA 3H6KA 5LZ9A 5F51A 2XLCA 4M7RA 1C0PA 1FJHA 1SK8A 4F38A 1S96A 2YY7A 3RG2A 2XYPA 4XR4A 4MLCA 3GJ3A 1CRWG 2ODPA 4RK0A 1OBVA 3UTCA 3WGTA 2Z6AA 2PX0A 3KSZO 3PENA 1LK7A 3C70A 1H1LA 4Q9DA 3DOFA 5FRDA 2VXOA 2LZ0A 3I2KA 1QGDA 4TKUB 1HEYA 3DONA 3P9RA 3PQ5A 3JZAA 1ZJZA 3MWKA 3MTAA 1WVMA 3GRZA 4BX3A 1ZRHA 3MOSA 5LNK6 2EKBA 1E3DA 4PQFA 3W78A 2WAAA 1CBUA 4LVCA 3NLLA 3I5YA 3I62A 1KWGA 2AQHA 4BJ5A 2A3NA 1O9HA 3B3JA 5CLGA 2ZIAA 4EH1A 4LFAB 4ID3A 2F00A 4HV4A 3EFBA 2HCRA 2Y27A 4NDNE 3IVMA 4IOKA 3MJHA 1PR6A 3EAFA 3RYTC 4K9DA 2NUAB 4B3IA 1C3VA 3DHYA 1U8ZA 3S5JA 4DUGA 2XKKA 2J5KA 1KIAA 1OROA 4CLRA 1A2BA 1GIAA 4OSEA 1BD3A 2Q2NA 1ZD2P 2V7BA 4CM8B 4OEHA 3RUCA 5CNMA 1XZPA 2P2DA 3FUVA 3QBEA 4OQDA 1RJ9A 4M1TA 1QRAA 2QTTA 5L4LA 3OPMA 5AW7A 3OP1A 5F12A 2EJTA 2C5AA 3DT6A 5TPZA 3K6SA 4NF2A 1SK9A 1Y7IA 3UZUA 2HM7A 2IDZA 3BWXA 4RD4A 4MR8B 1B93A 2OSBA 3IPYA 4G3XA 4LNAA 4OFZA 1A2QA 3K35A 1JEJA 5A05A 3VC2A 3WDLA 2HHLA 5I4CA 2GBLA 4JBXA 2P2NA 1X1DA 3D8UA 5E4YA 1OH6A 4MR7B 2B7CA 2VSQA 2ICAA 5EYPA 1E2PA 4N5MA 1S2NA 1B16A 1BXRA 4DCVA 5JH7F 3WLTA 2N1BA 2QTGA 4H1UA 1M2EA 1ULSA 4K81B 1I5OA 4EGQA 5CX4A 3TBHA 1UKZA 3VR6A 2QM3A 2NU6A 3PJGA 3VPCA 1ZWLA 3PJEA 1CTQA 3N8GA 5LKAA 4OH1A 3ETDA 4YNBA 4JT9A 5BQPA 4D4MA 2O9JA 4KMMA 5I51A 1WQ4A 1G3UA 1E79A 3TIXB 1DRWA 1BX0A 2EL7A 3QJGA 4I1PA 4ZQHA 2VHEA 1LZKA 4GBED 2DHDA 2GEVA 5PGMA 3JSAA 4UTRA 1CUIA 3AGQA 1Y6RA 1U8FO 1ODKA 3A9RA 3FUCA 3U80A 1GDHA 3AVQA 4HFMA 1NLMA 4RABA 2ZE8A 3C3JA 4GQIA 3GLUA 9MHTA 1W73A 3CZQA 2N3ZA 4BMSA 4Q3EA 3UPUA 4HWSA 2O8BA 1M66A 3H75A 4I7EA 1ZL2A 4I6JA 1FDTA 3NXSA 4IUCS 1RM4A 4UUOA 4DMUB 1GPWB 2AZ4A 3P5SA 4GLLA 4M1SA 3VKFA 1J7KA 5KX5A 5D7NA 2X4IA 3GQBB 2XUAA 3KZXA 4K6MA 5DYWA 1R4MB 2AYZA 4R7TA 1JEQA 4WFIA 5JPCA 4YYEA 1CC1S 2RKWA 3M49A 4ZCSA 5DO9A 4DG8A 1SWVA 5CFOA 1G3IA 4YRRA 4GKBA 3KKKA 2F3QA 2V65A 4GSLA 4QXPA 5IS2A 4LSMA 4AQYB 2R7LA 4HP8A 3UA4A 4ZVQA 3KVVA 3GJZA 4IVQA 1UMKA 1EFTA 3CNNA 2YMQA 3M9WA 2XCSB 3VKHA 4OMCA 4CF6A 2I34A 3FOBA 3AP3A 4MUJA 2VNKA 3FFAA 4XUCA 2VKTA 4D0SA 3HU2A 2AH5A 4YLGA 4DAEA 4BFSA 2W48A 1P5HA 4ZQEA 4GAEA 4ZD6A 2X0FA 1EH5A 4AS2A 4F3TA 2I8AA 1TF5A 3GMTA 4BE9A 3IP3A 3RSLA 4EEXA 3QNUA 4Y6PA 2KM1A 4M0EA 4URXR 1Y3DE 1P17A 1ISJA 2DKFA 2R11A 5AHWA 5TPZD 4ZOEA 2CHFA 4LC1A 4YLYA 3A2NA 2Q0HA 3RQSA 4YT8A 4WN9B 3R5HA 4YECA 5EKUA 2C7OA 1GA4A 1V7CA 1W35A 1ISPA 2G36A 2ZVQX 4JJIA 1BGXT 3VPBA 5BP7A 5REQB 3LKBA 1SKAA 1O2DA 4B81A 2COEA 2J0EA 1ZHHA 3QNMA 3AC0A 2A9JA 4LPKA 5EXXA 2JLVA 4UM9D 1PZXA 1RACA 2CF6A 4K2AA 4M60A 1GA6A 4F04A 1YBAA 3BWCA 1I4TD 3RSHA 1FOEB 2W6ZA 4MP3A 5FYQA 5HTKA 4BIMA 4AIRA 2NN3C 2PBFA 5AOCA 3A9WA 4RY8A 4YR7A 4W4TA 3UAVA 3EF0A 3GJ5A 2BE9A 2RGRA 3ZGZA 1YI1A 3O75A 2ARKA 4P9NA 3WMXA 4Y6RA 1ZO8A 3WIBA 1JHPA 1LSUA 1E2JA 2IHZA 3H65A 1R88A 3CEJA 3KVNA 3Q5GA 4NEGA 4D9NA 1E79D 1JEEA 2O3UA 3ZY5A 5LZ2A 3ZQKA 2B3TA 1YUBA 3JWJA 4MKRA 4TV9F 2NPOA 1C7FA 3FDZB 3QVKA 4W5WA 4XJTA 4QHYA 4CMEC 1BA2A 3EC7A 5FEUA 2JIZA 4MARA 3S40A 3C7KA 1CLUA 5J2UB 5BOSA 1X2BA 3NEAA 2A0UA 1D03A 2ODAA 1OFHA 1RXWA 4D82A 3L77A 3FYUA 4A0HA 2R2AA 1KYWA 1JR4A 3AERB 4UMDA 2QPTA 2YZ7A 3ILSA 3KPYA 5CFRA 4F86A 5SV2A 4INJA 1XA0A 2HUPA 3LT0A 3P9NA 1DBVO 2GVDC 3PQ7A 1R4AA 1TM4E 7AT1A 4KB5A 2PSEA 3HVUA 5H70A 2HA3A 3EIFA 4O6VA 2R0QC 2OCPA 3U17A 1WULS 2HYIC 2X42A 4N76A 3MRSA 4EIWA 1C50A 4W5HA 2QS9A 5FPHA 3QE3A 2G5PA 1IY8A 1RHMA 4NCNA 1Z4QA 2DAPA 3NBXX 2ZG6A 2YJ3A 4ZKDA 3E9MA 3K5HA 4TV8F 4K6KA 5F4ZA 4MW6A 1P7CA 3WY9A 4DADA 5IAOA 3QE9Y 4PM4A 1RP7A 3HB1A 4ALJA 3RUPA 3LYUA 3TVTA 3X2SA 4KFUA 4DUPA 3WNDA 5KSWB 2IOFK 4DDMA 1VP9A 4XX0B 5EERA 5FUBA 1DZIA 2D8MA 1XZLA 4MUIA 4C0JA 1Z37A 2IITA 3T4UA 3X2EA 3E53A 1KERA 5BSVA 1XELA 4WRRA 1G7CA 2W5UA 3T3EA 1Q1BA 4C3OB 2UZ3A 2WV7A 3EGXB 4F1JA 3BMOB 2J59A 2LV8A 3NEYA 1RZ3A 2GYVA 2VRBA 3TNLA 3BQNB 3UUEA 3OZAA 5E95A 3MW8A 4KAAA 1T3GA 4K1LA 3UJAA 3C3CA 1UC9A 2ZS9A 3LTEA 4MUAA 2RBKA 3VFDA 4CKYA 4UMVA 1TMYA 2PD3A 2HBYA 1N3IA 1GFIA 4GBJA 4W82A 3IE1A 2I7DA 1IVNA 2BL4A 3PUXA 3WFZA 2B2XA 4JSYA 5K6AA 1A72A 1U5BB 2GX6A 1NN3A 2AGVA 4PZUA 1AOXA 2F1IA 5DVZA 2A3RA 4DV4B 2FPRA 4BB5A 1OWPA 1M2VB 2O2IA 2FJUA 4L50A 3TIIA 3ZH9B 3N0VA 1UKEA 3CBGA 2CHUA 1CCWA 2QVYX 1ZD1A 2R68A 4H6WA 1L9XA 4LGMA 2QN2A 1J8VA 4XSVA 2PMBA 2JFWA 3DZDA 2CXUA 2J48A 4OUDA 5AKKA 4ASUD 5AVYA 3ZD8A 2OP1A 3VHQA 3L7DA 4BO3A 2YIMA 2R00A 2W2PA 3RE1A 5KYKA 2JA2A 3RJ5A 2JFPA 2I3DA 4BMOB 3B9BA 5B58T 4CV3A 2O3RA 2PUEA 1KI1A 3NO4A 1QOZA 2LTAA 1BMDA 3H2YA 5H68A 1QHHB 1Z83A 1GR0A 4E12A 4DNOA 1TXGA 3PC7A 5LP6A 1YB4A 1XEXB 3RFCA 5A9RA 3OZEA 3PR3A 3QY0A 1EBBA 2BPOA 3F6CA 4YBRA 1T9GS 1Z0ZA 1L9KA 2B37A 2FE4A 2I87A 3PVZA 4ILKA 4R2WA 5L6LB 4L0QA 2VDPB 3IP7A 2MDTA 4S1PA 3D4OA 4FFRA 1GDDA 4MW5A 2CY0A 4IIYA 4INAA 3WGKA 4A6DA 3ZZTA 4BAGA 4BNTA 5BOVA 1W49A 4EPVA 2EG5A 1VL8A 2GF0A 3HP1A 3QHAA 4O2BA 1VB5A 2V6GA 5EJ7A 1OW3B 3EIEA 4D46A 3F5FA 4QDJA 4GL2A 1RQPA 4HWOA 4QUHA 2UZ1A 1FNBA 5KTNA 4ERXA 3DEYX 1PR2A 1IEQA 3B1WA 5JIBA 1W581 1YI8A 4H1HA 4XUDA 3QFCA 1RZRA 5TQJA 4BFZA 1FVXA 4Y8VA 4FN5A 1UXHA 4UDXX 4Y2JA 1DBPA 3T1HB 3UXHA 3ZDFA 4DUYB 3K8OE 1KZ7B 5ALVA 4AC9A 2FK8A 5E3JA 1WPXA 3AXTA 7ADHA 1LK0A 1OKKD 3EYWA 3CUWA 4PRZA 4JVMA 4HAUA 1F2UB 1Z29A 2ZVJA 3KX2A 4IDNA