1B15A

Alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-acetone
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALCOHOL DEHYDROGENASE
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
total genus 90
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b15A00
4Q39A 2Y99A 3WDSA 4L4SA 5KNLA 2GF2A 3HQ4O 1YJQA 1ZXBA 2O2SA 4WOJA 4WOKA 4Z9YA 3PHGA 1W8DA 5JDCA 2QHXA 5JPIA 2GN8A 3DZHA 2I66A 1Y81A 3ENNA 3KEQA 2V65A 1O0SA 3VZPA 4Q3EA 4WLVA 3PZRA 5COAA 1LXCA 1K5HA 3LQFA 5KIAA 1E7RA 3G1UA 4KQXA 4P4NA 2Q1UA 4QSMA 4DQXA 4Z0PA 3JQ8A 2YUTA 1UXKA 3EZLA 1BWSA 5KOIA 4GGPA 2TMGA 1AN9A 4FQ8A 3JQ7B 4IQ8A 2JJYA 2GCGA 3H4VA 5A03A 4MOWA 3RI3A 4JP3A 4CMHA 1EE2A 4K9DA 5COQA 3VKUA 3R0IA 5HS6A 2P9CA 4W7IA 5EIOA 1M76A 5JC8A 1V3VA 2VRCA 1DDOA 3F5QA 3D3EA 4JBGA 3TL2A 3P2YA 4IS2A 3W8DA 3OJEA 2NVUA 2GZ1A 5F5NA 5ICMA 2EHDA 3OJFA 1E6EA 3ONFA 3WFIA 4IGFA 2X86A 1E1LA 3F4LA 2C7VA 4RPGA 2FPPA 2NNLD 4XZ3A 4XIJA 1SAYA 3SLGA 4JQCA 3GOHA 4R1SA 4B7CA 2NQTA 1E0DA 2PH5A 3ANNA 4D7AA 2X5JO 2Y66A 4H16A 5AXDA 1ZZEA 4YQZA 5THKA 2DBQA 3STHA 3ZWMA 2Y1CA 4CLRA 1BXGA 2YZ7A 1E1KA 4R69A 4UVHA 3A9WA 2C54A 4E5PA 4RDHA 1HF3A 3AM4A 2O3RA 4OL9A 4GX1A 1OC2A 1Q7BA 1A5ZA 1RYEA 1YOVB 1K6IA 2Y93A 1TXGA 3EW7A 5IN5A 3UHAA 3F6YA 5I8WA 3BHMA 4WGGA 3E6AA 5CDTA 4NJMA 4RV9A 1CETA 3IP1A 1T2DA 2H6EA 5G0UA 4O0LA 1TT5B 1I3KA 3ETGA 2ZB4A 3KYCB 3GN2A 3DBRA 2Y1EA 2D8AA 2WMDA 4QTZA 3I4CA 2IODA 2RAFA 4NU6A 2XXJA 2EF1A 1K3TA 1QV7A 3EUWA 5F1PA 3VOSA 4YAIA 2VWGA 3GAZA 3GEMA 4PLCA 1U4OA 1QXSA 4L74A 4UUOA 3UXYA 4EJMA 5CEEA 1EUDA 3AFMA 3ST7A 5L53A 3KUXA 2O4UX 1ZH8A 3ROMA 1ONNA 4QO8A 3WIEA 3HUDA 3UCEA 2CVZA 1XHLA 1LRKA 1WZIA 1HE2A 4DIBA 1T2EA 2GZ2A 3AOGA 3NYWA 3RFXA 2C20A 2CUKA 2X4GA 2CVQA 1LQUA 3RC2A 3JD0A 1ZUD1 1QYVA 3OHSX 5G0SA 3NX4A 4B79A 3G0OA 4CQMD 1S6YA 3OECA 2FR1A 2PGDA 2O48X 3B6ZA 5JCJD 3DOCA 4AJEA 2QQ5A 5TLSA 3MWEB 3QWAA 3FNGA 3NGXA 1GZ3A 4OQZA 1X7DA 4B4VA 3TPCA 5DNAA 2EKLA 3PHHA 1KOLA 3RC1A 1YB5A 7MDHA 4J2HA 1R0KA 4D42A 4BKPA 2IEDA 2YHUA 4DC0A 4E5YA 3ANLA 2YFHA 4OGWA 2EERA 3LSYA 3JQGA 5LDHA 1N9GB 3M6IA 4DIFA 4M54A 2HU2A 3INGA 3CMCO 4BMVA 3MZ0A 4CMCA 4FD3A 5KCZA 1CWUA 1D1SA 1H6BA 1VRWA 2NACA 2OGUA 1T24A 1PZHA 4ND2A 3PPIA 1ISHA 2YYYA 2JAPA 2Q3EA 5FFFA 4J1SA 4MIYA 3M2TA 2DUUA 2WM3A 1HDGO 2GYYA 3G49A 2CDAA 5KJEA 4B4WA 1RYDA 1DC6A 2H1SA 4Q3NA 2VN8A 5U9CA 2YDYA 4TRJA 6LDHA 1YL6A 3OH8A 1UZMA 4YCAA 2X7HA 4PCVA 1KYQA 1BMDA 1R0LA 1E77A 4AFNA 2QW8A 4J1QA 1O5IA 1VI2A 5ILOA 5TJHA 3Q3CA 2FPIA 4IJWA 3W6UA 2VYNA 1EFLA 2Z5LA 4GMFA 1LJ8A 1OBFO 1YO6A 2HMSA 2X1HA 3Q6IA 1IULA 4J43A 4J91A 1RJWA 2Q2VA 4INAA 5AXCA 3WGIA 3GUCA 1O94A 2Y0DA 4YAEA 3WS7A 4CR7A 3O8QB 5L40A 1IE3A 2XAAA 3GQVA 3MJVA 4R01A 1E3SA 5BNTA 3ADOA 3I4FA 4A5OA 4NBVA 2W90A 2F00A 1XYGA 2ZTVA 4NBRA 4GLLA 5GZ3A 3V2GA 2GZ3A 4OQYA 4XWYA 4RZIA 4OO3A 3OEWA 4QUKA 1TB4A 5L4LA 1GV1A 4EEZA 1JWAB 5LDGA 5KJFA 2CNBA 4RF2A 5TX7A 3DBHB 3GAFA 3GT0A 3S1LA 1ADCA 1ADFA 2PZJA 3PYLA 3MJEA 3LT1A 2RCYA 4L73A 3E5MA 3N7UA 1A7KA 2AQKA 5A4DA 3BTVA 1Q0HA 3JQDA 4UEKA 3HN2A 5A9TA 4BGUA 1UR5A 1DB3A 2I3AA 3UFXA 1D3AA 4OXKA 1DHTA 1UXHA 4M55A 1GTMA 4BNKA 1VL0A 4BKOA 2X5KO 5EPOA 5FI5A 1MGOA 4CQLB 4OKNA 3K8ZA 5ILGA 2Y68A 2ILTA 3HDQA 3AUTA 1EQ2A 1LA2A 4XYEA 4K6FA 4ZICA 3C1AA 1SCUA 1TT7A 4P38A 3OQ6A 4CLOB 4QECA 2O7QA 2DC1A 3JQCA 3QRWA 4KMSA 3JQ7A 4BGVA 4CV3A 1BDMA 4NMHA 1OOEA 1UXJA 5TNXA 4IGEA 5L4NA 1ULSA 3RUDA 4NPCA 1X13A 2I9PA 4GVLA 1HDXA 1P1FA 1PWXA 4GQAA 2BD0A 3GC6A 3V1UA 3BTOA 4BNFA 3VH3A 1JA9A 3KLMX 2B37A 3KB6A 2PFGA 2QX7A 4CUKA 2G17A 3C24A 3IS3A 4KQWA 1YB4A 3WGHA 4PLTA 1UXIA 1XG5A 3V1YA 2WE8A 1B0AA 2C2XA 4IJKA 2GPTA 5CDGA 4NFHA 1LNQA 2QYTA 2PKQO 2Y67A 2Q2WA 1FDWA 2HO5A 3FBGA 3N74A 3NTQA 4JK3A 3WGOA 1BRMA 2V6FA 3LVFO 4BKQA 1EVJA 3HDJA 4AG3A 4NFSA 2XPCA 4IJUA 3IKTA 1A9YA 1WPQA 1KC1A 4FFNA 3RUIA 4AJLA 4CQMA 4ID9A 5L95A 3DZKA 4TMFA 3OIFA 4YJFB 2PR2A 1GFSA 1LDYA 3BMNB 3CMMA 4IXTA 1DIBA 3OEYA 2E6UX 4YB8A 2V7PA 3RUHA 4BO0A 2OXIA 1OZAA 1X7GA 4YR9A 3PJDA 7ADHA 1YWGO 2A94A 2PK3A 4D3FA 1GYQA 5EESA 3WQRA 1C1DB 1QSGA 1XU7A 3A06A 4RLSA 4FJ2A 2O2YA 4D44A 4FGWA 3TSCA 2XXBA 1ULUA 3VVBA 1L7EA 3KYCA 1HSZA 1HE5A 2BMAA 4E13A 5JW6A 3DC2A 3GRPA 5A5FA 2XF8A 3U5TA 3PWKA 3KHUA 3UW3A 4EJ0A 2QZZA 1PWZA 3MJCA 5B1YA 2HMUA 2IDZA 5T67A 1ZSYA 3W8EA 4L4RA 2J3JA 4K1LA 1RKXA 3LYLA 1MG0A 2BGLA 1GQQA 5ER6A 4D0SA 3D4PA 2ZYDA 2E37A 4YRBA 1U2GA 3L77A 1PZEA 2Q1WA 2FZEA 1UUFA 3QWIA 5G2OA 3ZWWA 1OC4A 1IL0A 4M8SA 5DCUA 3GA0A 3RU7A 5HRUA 1DXYA 3P7MA 2DFDA 2LDBA 2VYVA 3C3XA 1N5DA 1HYHA 4CV1A 1HYEA 4Y6PA 1HLDA 1PR3A 1ZVMA 2VWPA 4HWKA 3FPLA 1KVSA 4PVCA 1P44A 3VZRA 3HE3A 3C1TA 4U5QA 1PGJA 3ONEA 3DR3A 5ITVA 2Q1SA 2C2YA 4LCJA 5B4TA 2FSSA 4CUZA 5EQDA 4MP8A 4AJ2A 4BNXA 1E7MA 4HFNA 2JFHA 1E3IA 2HMWA 3KXDA 3OF2A 3M2PA 2FZWA 2IRWA 4BO3A 5L3ZA 1PX0A 2DAPA 4AJHA 3JQAB 3PVZA 3S2GA 1K2WA 1PS0A 1B14A 5KTKA 1PL6A 1JN0A 2AXQA 3OJLA 1N9GA 5IDYA 3WYCA 4PLPA 4R4JA 4BL5A 1PJCA 4GBJA 3ZW9A 5C37A 2E4AA 1T1SA 4XQ9A 5EJ2A 3JD4A 4JNKA 1GD1O 2AEFA 5IN4A 3NDJA 1BXKA 2VRBA 4N18A 2QIOA 4DIOA 5A9RA 1UP4A 3OMLA 2UV8A 4TZKA 4Q3AA 1Q1NA 1FF9A 1P1RA 4A27A 4CLHA 4IJVA 4IQGA 1EVYA 5IDQA 1E92A 4BOYA 4YRAA 4YAJA 4PLYA 2UYYA 4G5HA 2Y0EA 3W4IA 4EUHA 4YACA 4YJHA 4Z9FA 2VHZA 4JJGA 1JAXA 4E6PA 3TZCA 1ZJYA 2VUSA 2BFOA 1NWHA 2NVUB 5G4LA 2HSDA 4AL4A 4R3NA 3E9QA 4I9UA 3TDKA 5DF1A 1DAOA 5BSFA 1YRLA 4J2OA 2GSDA 1SO8A 4UREA 4CV2A 4NU5A 4FIZA 1PQPA 5U4QA 3UVEA 3JQEA 4C7JA 4ZHSA 2WE7A 4DC1A 4BVAA 3L0DA 4BNMA 3UCXA 4BMNA 3KM0A 1N2SA 2ZQYA 1SB9A 5C5IA 4CV0A 1I2BA 1B3RA 2ZK7A 4J7UA 4Z3KA 3HADA 4JCOA 1O9BA 1EBFA 1NVGA 3I3OA 2BELA 1C0KA 1LLDA 3DBHA 3ZN2A 2NU8A 4DUPA 1X1EA 2B4TO 1AHIA 3PQFA 2EP7A 3ROKA 3DZBA 4S1VA 3JYQA 1XIVA 4BNWA 3PFFA 1T26A 3MWDB 5HA5A 4NJMB 3FRJA 3PGXA 5CFZA 2C7GA 3DAPA 3GEGA 4O5OA 4BO8A 5COBA 4P8RA 1WAMA 4XR9A 2VZ8A 1VSUA 4IDBA 4DYVA 3DBRB 4TRNA 5KWEA 4LK3A 4BS9A 2J3KA 3IDSA 3RASA 1I01A 2BFAA 4XQEA 4ZJUA 1QRRA 1H94A 4CQLA 2P9GA 1XQ6A 3NV9A 5HM8A 5IDXA 2QRLA 1NX6A 2NADA 3H9EO 4MVJP 1UDCA 4XRRA 3OJ0A 3D4NA 5JXWA 4ESOA 4GMGA 3HFSA 1I8TA 1IPFA 2EIHA 2TMDA 3WIDA 3VPSA 4XEHA 4ZQBA 3AY3A 3H8VA 1GL3A 3DB2A 3QVXA 1YBAA 1ARZA 4BNIA 1X0XA 3F1LA 1N7HA 2WD7A 3JD2A 1ZIDA 3JD1A 4LMRA 1RWBA 3VPGA 1GPJA 5B37A 2J8ZA 2JCVA 4J1TA 4XGIA 3SJUA 3AY7A 4TSKA 1TLTA 2HRZA 3T7EA 5A05A 4BO6A 1I30A 5EN4A 5JAIA 4FS3A 3ADPA 2QZ9A 5A1TA 1LRJA 4CPDA 4A73A 1F8GA 1H5QA 2GD1O 3RKRA 3PFWO 2RHRA 1F06A 3S2EA 1Z7EA 4I9NA 3M1AA 1DAPA 1O8CA 4L4XA 3H3JA 4DQVA 4KP7A 2JCXA 1B7GO 2VUUA 1X7HA 4PG4A 1M66A 4WCDA 1WDMA 5IF3A 1GCOA 1DBVO 1IZ0A 2FR8A 3OA2A 3VH4A 1KS9A 2NU6A 2Y1DA 3I23A 4XJTA 1AXGA 1ZEMA 2J6IA 3OA0A 4HKTA 5A3VA 5TRTA 4OXNA 3E9NA 3EC7A 3KO8A 3L4BA 3QLJA 3DO5A 1T25A 4EEXA 1RM5A 2DLDA 3AOEC 1EEHA 4A10A 1G1AA 1M6HA 3NDRA 1O6ZA 3DAGA 4Z0HO 1Y8QB 4N5LA 5DDIP 5L7YA 1P45A 1ZMTA 4IS3A 1EE9A 1GEEA 4IDAA 1WDKA 1VKNA 1LLCA 2IYPA 3LF2A 5JSFA 1WLYA 2X9VA 4LRSB 1T4BA 4XYMA 3AOEA 5L9AA 4DLLA 1HDYA 1DIGA 1QV6A 4IDDA 2CDCA 5KKCA 3VTZA 5G4KA 5I7EA 4ALNA 3ZCXA 9LDTA 4W6ZA 4R5HA 4Z6KA 5BR7A 4YA6A 3ZU5A 4CMBA 5KVQA 4CMAA 3D5QA 1JVSA 5DOZA 1U8XX 3RUEA 1NXQA 5B4UA 4KUHA 1ZK3A 1GQ2A 4MPDA 4IBOA 4GSLA 1G6KA 1NAHA 3BHIA 2PGJA 1HT0A 1LRLA 2D2IA 5T6BA 5A02A 1U5CA 4RDIA 2Q49A 4TZTA 1CJCA 1WMBA 2D4AA 3H2ZA 3NKLA 4ONEA 1PS8A 5EL0A 5HBRA 3QVTA 2ZYGA 4PZCA 4H7PA 1CEQA 1HYGA 2YY7A 3PJGA 2OMEA 1BSVA 4BNYA 2WYVA 5L7WA 2CZCA 4XQGA 3JV7A 1U3UA 2ZYAA 3TRIA 4XA8A 2D5CA 2J5KA 1I2ZA 1YKFA 4MVJH 3JQAA 1L1FA 3SJ7A 1YS4A 2P5UA 2ZTMA 1ISFA 3K30A 3U9LA 3C85A 1M75A 4JP2A 1YL5A 1J4AA 4HBGA 2NTJA 1HEUA 3RUFA 4PRKA 4TVOA 4PLGA 4J9UE 3U09A 3GFGA 1H6DA 4MVJD 1SC6A 3C8MA 4I5EA 2VTDA 1ZNQO 4KWIA 2AW5A 2W2LD 2Q1TA 1J5PA 1A71A 3L6EA 3WJAA 4PG8A 1TEHA 3DTTA 5HWSA 4CMKA 3PHJA 2HRBA 3D5TA 4WEQA 2OBYA 4B3JA 4CJXA 5TQVA 4NK4A 3COSA 5JY1A 1DLIA 5B4VA 3K92A 2OP1A 3FF4A 3Q9NA 4GKBA 2GASA 2CY0A 3OETA 4YRDA 1I0ZA 4W82A 4CM9A 4DVJA 4CL3A 2RH4A 4MIOA 1PGNA 3I9NA 2G0TA 1HE3A 4KDEA 3RC9A 1E3EA 4LGVA 3A14A 1EQUA 3VPXA 4CLXA 4DLAA 2ZB7A 4MKZA 4DYDA 5JNLA 4IMPA 4KUEA 2WWRA 1Q0LA 2Y1FA 3DHNA 1K6JA 4P4GA 1UP7A 3QWHA 3WWYA 4CODB 4CQMB 4CUJA 3CINA 1HZJA 2DBVO 2QYSA 3WJ7A 2OORA 1AE1A 3G79A 4JX8A 2VNSA 3GPIA 3TZKA 3T7CA 4CR8A 1R0SA 1NWCA 3AW9A 1I2CA 5IG2A 3WR5A 3NTRA 2VWQA 1NFQA 2VHVA 3GNQA 1T4DA 1O95A 2B35A 3JYLA 3GHYA 1KEPA 5DOVA 3WLEA 3FNHA 2X58A 3ZWNA 1ZSNA 3WFJA 4U6SA 1DIRA 3WGYA 3TF5A 1QYXA 1NVMB 1HE4A 2JD1A 4Y67A 4E3ZA 4RQTA 5ENVA 1LSJA 1GAEO 1FDVA 5ENDA 3AK4A 3LLSA 3OQ1A 1IOLA 1VE9A 5HS4A 1I5RA 1LU9A 3WICA 2P2SA 2BI7A 4IIVA 3L6OO 8ADHA 2X6TA 5IFLA 4JJIA 4LRTB 2B0JA 3AJRA 5TT1A 4S3MA 5JDIC 2I5PO 1LC3A 3PXXA 4RPLA 1KVRA 1BTOA 1KVUA 1E6WA 5CPFA 4WECA 5TC4A 1NQAO 4D45A 3PWZA 1DIAA 3S2FA 4GWKA 1QORA 3AWDA 5JDIA 5KVSA 1J6UA 1VM6A 3QQPA 4KZPA 3JQ6A 2PY6A 4ZVVA 4WUVA 4O63O 1PJTA 4PG5A 4A26A 4XKJA 1DFIA 3DAFA 3H9QA 1E1NA 5CG2A 3FSRA 3O38A 1PEDA 2W98A 4FW8A 3GRKA 1IHXA 1ZK1A 3EAGA 3DBVO 3E8XA 1AGNA 3R6DA 4E33A 4J4BA 3H9GA 4P4LA 3IAHA 4OYRA 5IAAA 4KWHA 1ZO8A 4J7XA 3DFZA 4LVUA 4U8GA 3CXRA 4X54A 2QG4A 3RD5A 3WX0A 1JW9B 4J0FA 2YQ4A 4YDRA 4ALMA 1B8PA 1KETA 2H63A 3VH1A 2I99A 4YT4A 4B3HA 2WSBA 3RBXA 3FWZA 3GNTA 3ZU4A 5AXBA 1DHRA 3T4EA 1Y8QA 4WJZA 1MB4A 3LZ6A 3O4RA 1G0OA 3GDFA 4R9SA 2G82A 4F46A 3DOJA 4YT8A 1BVRA 3AU9A 1ENOA 3DONA 1IUKA 2GO1A 3EVNA 4YJHB 3UCFA 4CMJA 5F5LA 1KVTA 1U7HA 4A0SA 3RCBA 1P1HA 3AI3A 3FD8A 3OJOA 4CM1A 4CM5A 4XYLA 4A2CA 3JQFC 5F21A 2VUTA 3ICCA 1ZKMA 1E3LA 4J4TA 1R12A 3AM5A 4LW8A 5KJ1A 2VZ0A 3N58A 3JYPA 3M1LA 3ZV4A 4OKIA 3KZVA 1Q0QA 4MVJA 2G1UA 2IYOA 4ZRMA 3ORFA 4CR6A 3JQFA 2FWMX 5U1PA 4M49A 3ZWYA 1D7OA 8LDHA 4I08A 2PNFA 4MVJI 4NNJA 4BNLA 3HDHA 3PI7A 3QJ5A 4EBFA 4I5DA 4NG5A 4UEOA 3G3EA 3VDRA 3VTFA 4ND4A 3VAZA 4F6CA 3WGTA 5MGBA 1SZJG 3CPSA 2BKAA 1E5QA 2R6JA 4RO0A 1RPNA 5F1OA 2YHIB 3G1TA 4D43A 3LLVA 2OBNA 5BSHA 1P33A 3DBLB 3D4OA 3A4VA 4RORA 4RVDA 1PJQA 1NFFA 1SOWA 3I5MA 3RJ5A 3EVTA 1VJ0A 3BMQB 4TWRA 2PV7A 4NBTA 2E48A 3Q2IA 4UVEA 1YH3A 2GN6A 3K2BA 2HUNA 3ASVA 3TOZA 3ABIA 1KC3A 3QE3A 2HAEA 3FPCA 1PJ4A 3GG9A 1CIVA 1NASA 2DTEA 3P19A 3QWBA 1C0LA 3RBVA 1E3WB 4XGKA 5DBGA 5JAMA 3DEYX 2DBRA 3LK7A 3BYZA 2WD7B 3ZWVA 4OIMA 1WW8A 1DJQA 6ADHA 4DPLA 2P4HX 3PHIA 5GMOA 5K9ZA 4XB2A 1E7YA 1MA0A 3FTPA 5ER9A 5TT0A 3UUWA 1YBVA 1P0FA 4N7RA 1HSOA 1P74A 1KY4A 2JFFA 3JYNA 4FJ1A 3OIDA 3GN1A 1GY8A 2C07A 2C5AA 1D8AA 1SMKA 3WB9A 3WXBA 3WGZA 2NVWA 3FN4A 3PDJA 4NBWA 4HUJA 3ITKA 2WEKA 2VT3A 3KBOA 2VT2A 4IQ0A 5JYEA 4R68A 4IY1A 4EW6A 2D0IA 2AQHA 4U7WA 1K0UA 2NVBA 1ZMOA 4MVJG 4N5MA 3ZNNA 2WDZA 4UULA 1OFGA 3QSGA 4L75A 1RM0A 1JAYA 1EBUA 1HLPA 5TS3A 2EJWA 2FOIA 4PLWA 5H81A 3ETDA 5DP2A 1ZK2A 2BFMA 4XDZA 1QKIA 5B12A 4HFMA 5CG1A 3I9JA 4OXYA 2R00A 5BSEA 5IZCC 5JCJA 1UAGA 4UUPA 4BQPA 4RJTA 4LSMA 2UUOA 1NPYA 3U4HA 3JQBC 5TSDA 4E5KA 3NDIA 1NP3A 3DHEA 2D3TA 3DFUA 2D5AA 2WYWA 5C7IO 5IZCA 1T2CA 4IDGA 4B4OA 3Q1LA 3UAGA 3BHJA 4TRMA 1XWFA 3FHLA 1I3NA 3JQBA 1BGVA 2DPGA 3GG2A 4F45A 3PLRA 1B2LA 5JO0A 1DC3A 1I3MA 2W2KA 1NQ5A 4I1IA 2CSUA 1IB6A 3ZHBA 1DRWA 2AQIA 4J16A 3QW2A 4DBVO 4ZN6A 1CERA 4TQGA 4EZBA 2GRAA 1XQ1A 1Y5MA 4BO9A 1UZNA 3UICA 4AICA 3QVOA 3OM9A 3D3WA 5G4KB 5TIIA 3IKVA 5A06A 4Y6RA 5BT9A 3AUAA 1FDSA 5TGDA 3ZW8A 1AXEA 1EZ4A 1GADO 3NJ8A 1P1IA 4HNHA 4MVJF 4O1MA 3GNSA 5JCXA 1ADGA 1Y1PA 2EGGA 2O23A 2GNAA 4ROSA 4WLNA 4CLEA 1KEWA 1PGQA 2AMFA 3RKUA 3EHEA 3WSVA 3UH1A 3RFTA 3V2HA 1ENYA 2A35A 1ZXLA 4UEJA 9LDBA 2VOEA 4FDAA 2E82A 4EJ6A 4NI5A 1YB1A 3MJSA 5GY7A 3LC2O 1ZW1A 2O4CA 2YQ5A 3X2FA 1KVQA 4NBUA 3ZWXA 4WEOA 4ALLA 5AYVA 3GVIA 3R3JA 2CD9A 3B20A 2X9NA 3RAJA 5JAQA 1GR0A 1U9JA 3E48A 4FFPA 1HL3A 1ENPA 3ITDA 4R41A 3GVPA 1X1TA 2OFPA 3RUAA 1GUFA 4ITUA 3PDUA 4FC7A 4HFJA 1NR7A 2P91A 3Q2KA 2O3SA 1V9LA 3FI9A 3PQEA 3QWFA 4MDHA 3CKYA 4MO2A 1R4MA 5DZSA 2ZTUA 2Z1NA 5BSGA 4BV9A 5EINA 3F4BA 4FGSA 1ZK0A 1ZK4A 3H5NA 4DGSA 4B7XA 2ZIZA 4ZQEA 3DL2A 4WLUA 2I67A 1GUZA 1GUYA 4GX0A 4ZQHA 1U1IA 2UAGA 1GYPA 4II2A 3W4JA 4IINA 2HMVA 5CDSA 1LBEA 4EDFA 2O7SA 2NLOA 2A4KA 1JKIA 4M87A 3L9WA 4DBZA 2X8LA 3HZZA 4RVUA 4XR4A 3WQSB 3PIIA 5BNIA 1Y5RA 2VTEA 2ZB3A 2JD2A 4MKRA 3ZWAA 3WQQA 3D1LA 1MX3A 2CF5A 2ZCVA 3PGJA 4ILKA 3PK0A 4HP8A 1ZJZA 1V3TA 1MXFA 5CEFA 3CE6A 3I6QA 3GVXA 1PGOA 2OOSA 3H7AA 4BNNA 1YQXA 2CVOA 4F6LA 2HDHA 2UVDA 4GI2A 4XRGA 5DT9A 3TZHA 5I9NA 3K31A 3LC7O 3MJ4A 1ONPA 4CMGA 2BGKA 3KVOA 5C3MA 1CRWG 3BZUA 5AVOA 4DMMA 1HDOA 1U3WA 3ASUA 5AOVA 3JSAA 1ZCJA 2GERA 2JFGA 2OZPA 1U8FO 2IZ1A 1WDLA 1A27A 4R54A 3WBBA 2X22A 3I6IA 4OSOA 2VNAA 1PIWA 4CM8A 1QYDA 3NGLA 4DREA 4NHEA 4EGFA 5I8ZA 1QLJA 2YHIA 3GUYA 2C29D 3GZ4A 5I7VA 1LLQA 3DBLA 2HK7A 4JN6B 2PH3A 5DCYA 1RM3A 3PJFA 4G81A 3QV1A 2XOXA 4EITA 3CZRA 5CEJA 1L7DA 1Y6JA 4GKVA 1AHHA 4CL8A 2E49A 3NT5A 3BMQA 4RVSA 3ZH2A 4URFA 4FN4A 4D79A 1GZ4A 4FFLA 1XR3A 3EYWA 1LC0A 2DPHA 2QRJA 1NTOA 1P0CA 2P9EA 3ZWOA 3F5SA 4Q3BA 1U4SA 3GVCA 2RIRA 3GEDA 3Q9UA 4XIYA 4N5NA 4LSWA 1JQBA 4BNUA 3SC6A 4GX2A 1SEPA 1XELA 1R4NB 1E3WA 1LLUA 5L4SA 1HRDA 4DLBA 1YDWA 1QYWA 2IZ0A 1V8BA 1J0XO 1WMAA 1Z6ZA 1X0VA 2YW9A 4ZD6A 3GH3A 3ZHZA 2VZ9A 2NU9A 2VOJA 4FFMA 4Y98A 1Z74A 1UH5A 4I5GA 1XKQA 4XD2A 1XGKA 1ISIA 3F3SA 5DBIA 3IOYA 3H2SA 3ZWPA 3ZHYA 4UUNA 4BNVA 3TQHA 1E5LA 1UDBA 1YE3A 4RLHA 3P5SA 4OOEA 1MFPA 3SVTA 4A7PA 4YBZA 3ZZNA 1V0JA 4FR5A 1F17A 1V6AA 2GDZA 1WXDA 3SC4A 4M89A 4EUFA 4FPXA 1B16A 2WJPA 2YDXA 2DQ4A 1K89A 1P77A 2F1KA 4ND3A 4EUEA 4I5FA 2X0RA 2DT5A 4UVDA 3GGPA 3RIHA 1N1EA 3L4BC 3GGGA 2HJSA 2DTXA 3TZQA 2G5CA 3ZV5A 3C7DB 4CMIB 3PQDA 4MJLA 3IIEA 1JTVA 4JLWA 4OM8A 3WGQA 2X0IA 1N92A 3VC7A 3BMOA 2AE2A 3VH2A 1H6AA 2R2GA 3MEQA 4JGBA 2P68A 4W4TA 3E5RA 5JLAA 1E7SA 1NBOA 3IUSA 4GSKA 4B7UA 4IZHA 3HDYA 2FRDA 2EKQA 5L45A 1GQYA 5IXYA 4G2NA 1X15A 4ZQGA 4UVGA 3QVSA 4WNCA 2EV9A 3FBTA 1KERA 3D64A 4XDYA 1K6XA 1T2FA 4GWGA 1HWYA 4M1QA 3WYEA 1F12A 3ZWBA 4RF4A 5G0WA 1ZBQA 3H65A 2FSVA 5LCXA 2DFVA 3DXFA 2WD8A 4XYBA 2EWMA 2Y0CA 2H9IA 1GU7A 3TJRA 1PJ2A 1C1XA 3GDOA 3MTJA 1I3LA 1DPGA 4NJOA 1Y8RB 2BRUA 2OP0A 4CM4A 4D3DA 2ET6A 2YJZA 2HLPA 2GN9A 4RVGA 1XDWA 4BNGA 3I52A 4TKLA 1LDMA 4ND1A 4HX5A 3KSUA 3E03A 2YV2A 2PLAA 3C7AA 5GZ6A 5KVCA 3I9MA 3VDQA 5BQFA 1V35A 1F14A 3PJEA 4RVHA 4E2YA 3AFNA 3LT4A 3AUSA 1IPEA 3TOXA 4ALJA 4D3SA 2EKPA 1NAIA 1DRVA 1PTJA 3HB4X 4DRYA 3X2EA 3LDHA 2B83A 3OP4A 1LI4A 1HTBA 3KYBA 3K9QO 3AI1A 1CF2O 1T1RA 4QXMA 2J3HA 1NM5A 3W1VA 3WTBA 1EVZA 1VC2A 3IMFA 3ZNPA 3E1KA 4PFJA 1BW9A 3DZIA 4PLFA 3OFSA 4RF5A 3D7LA 1MV8A 4RGBA 2NU7A 4QT0A 1ID1A 1GZ6A 4GVXA 3U62A 3BA1A 3W4KA 2I76A 3DDNA 3U4DA 3BMCA 3TFQA 5JYDA 1H93A 2B4QA 3Q0EA 1Z82A 3V2UA 4DA9A 2EP5A 4XGNA 3VZSA 1F8FA 5JC1A 1E1MA 1RM4A 1I10A 3KRTA 1QYCA 2AA3A 4ND5A 4FFOA 1VKOA 1E3JA 2PZMA 4YAGA 5GZ1A 3RWBA 4HFRA 1X14A 3IP3A 3PLNA 4OOFA 2VYND 5G0TA 4DTIA 4FB5A 3L4SO 4OSPA 3KETA 4IXWA 2ZQZA 1NVTA 3OSUA 1C0PA 4XCVA 1YQDA 4OJNA 2C5EA 1IHYA 2V6BA 1I36A 1M67A 1U7TA 2Y1OA 2QRKA 5LC1A 1EK5A 1G0NA 1GDHA 4RVFA 4JIGA 3KOUA 4PVDA 2X0NA 1KIFA 4M86A 1R37A 4AJOA 3FNFA 3H9JA 1KY5A 1PL7A 3I1JA 3S55A 4BB6A 3JTMA 3KSZO 3WWZA 4DL9A 1AUPA 4ALIA 4Y8VA 2Y1GA 3PTZA 4BO2A 3TNLA 1PL8A 5FI3A 1C14A 2D1YA 1PSDA 3P2OA 4JXKA 2O3UA 1KBZA 1YQGA 2ZJ1A 4ZU3A 3B70A 2OO5A 3IL2A 3KSDO 1PJBA 3VVCA 3SX2A 4F3YA 1YVEI 1N1GA 3QY9A 4Y6SA 2DUWA 1Z7BA 4L0QA 2BHLA 4PZDA 5THQA 4E2XA 1N8KA 2W2KB 2B5VA 3A28A 3BAZA 1PS9A 1UZLA 3TN7A 4DPKA 1DC4A 5TF4A 1DOHA 1R16A 1U3TA 3WLFA 3H3FA 2A9FA 3D3WB 1P1KA 3EGOA 4H3VA 5F3RA 1R4NA 3ULKA 4AJ4A 3H5AA 2PGLA 3I83A 3PYMA 4J0EA 2J5RA 3VKVA 3E18A 3EDMA 4E2ZA 1DSSG 2Q46A 3AI2A 3H5RA 4L8VA 2Q45A 4C7KA 4LISA 1Z75A 2JHFA 1SB8A 3CIFA 1GCUA 4XB1A 2HK9A 1ZFNA 1ZEJA 1R66A 5KJ6A 4R3WA 2Q50A 3UOGA 3ZWCA 3HG7A 4ZA2A 2ZTLA 4NQZA 3WGGA 2O3JA 2AG8A 1F0YA 1XA0A 2OUIA 4IIUA 4BO5A 2DM6A 1MXHA 4H15A 2GN4A 1R15A 3F47A 3R1IA 3K2EA 4WCFC 3NTOA 4JBHA 3DOOA 2JKVA 1H6CA 2EG9A 4K26A 1HDZA 3GZNA 2JD0A 2BI8A 2CMDA 2VCYA 2HJRA 5A9SB 4YJDA 4KTVE 1DO8A 1R4MB 4MINA 2IXAA 4WCFA 4U0KA 3CEAA 4U6QA 4HXYA 3ROPA 3MCVA 3F1KA 4RF3A 1KEVA 3JQ9C 4QEDA 4B3IA 4AJPA 5JFOA 3RSHA 4CMIA 3I9LA 4BHTA 1DLJA 1HETA 2A92A 5L51A 1OMOA 3CZMA 1LDGA 3E9MA 5TJ9A 2W8ZA 4AJ1A 4BKRA 1O89A 1E7WA 1LDBA 3B1FA 2D59A 3JQ9A 3VZQA 3R3SA 4XX0A 4PG6A 4PLZA 4LMPA 3EY4A 5I7FA 3DMYA 1VJ1A 2HQ1A 2PKQP 3SEFA 1WNTA 2B5WA 1I24A 2EEZA 3MOGA 1ORRA 1Q7GA 4R51A 5AXAA 3TWOA 5JMPA 5CPBA 3UN1A 3O03A 4JBIA 1LEHA 3RBZA 3ZU3A 1GYRA 1YDEA 5T64A 4E5NA 5EMHA 4QO7A 4E32A 1C0IA 3QA9A 3OICA 2Y05A 5DP1A 4GH5A 2V6MA 2NSDA 1VL6A 3DHYA 3LU1A 3LT2A 4P22A 4J7CA 4B8WA 4K28A 3UGKA 2W2LA 3GVHA 2VYVD 1Y8RA 3BXXA 4FFRA 3SXPA 3IUPA 3ZU2A 5C7LO 4W9NC 1I33A 1SPXA 4FOOA 5IXSA 2HMTA 1WP4A 3GHHA 3O26A 3HWRA 1LDEA 1MG5A 1ISMA 1PJLA 2ZCUA 5A04A 4E31A 2FHSA 4MP6A 1CYDA 4E5MA 1Q7CA 3AM3A 4QFCA 4BNTA 3B1KA 1DC5A 4W9NA 3HHPA 5J23A 3CUKA 2H5LA 4WLEA 4CM8B 3PHLA 4Y9DA 4BMSA 3IJPA 1EVIA 4B8ZA 1EUCA 3OIGA 2HCTA 4N54A 2HKIA 1ADBA 3Q11A 4WLOA 1JVBA 1JWBB 4MVJM 1PJSA 3DZGA 2PKRA 3GY0A 2PA3A 1QP8A 2PTGA 4DXHA 1HDRA 4XYGA 4JJFA 4YPOA 3C1OA 4GAEA 3ICPA 1NQTA 1NPDA 1U5AA 3AU8A 4FOSA 5K6AC 2FPGA 4L9RA 1DFHA 1LSUA 2AE1A 4ZQFA 2C59A 1B26A 4CM7A 1B8UA 2PD3A 3KYDB 2B69A 2P5YA 2RBEA 4WNIA 4WE3A 5K6AA 4G65A 1VPDA 1VLLA 5DBFA 1MP0A 4BGEA 1LX6A 4D46A 2AG5A 2X5OA 3NT4A 1LSSA 3ZDFA 3JYOA 2SCUA 3BIOA 5K0ZA 1EDOA 1WZEA 2FN7A 3FCOA 5H82A 5JY6A 1LQTA 3QHAA 3B1JA 4TVBA 3CTMA 4BO7A 3OQBA 2W4QA 5KKAA 1SNYA 3S8MA 4DMLA 5ICSA 3SBOA 1A4UA 1WWKA 5FWNA 4ZRNA 1R6DA 1W6UA 2GUGA 1HDCA 5DN9A 1BDBA 1U28A 5KJCA 2RHCA 2BF7A 2VWHA 1E7QA 1H9AA 1YGYA 3GR6A 4BO4A 1FJHA 2R00C 3HN7A 4BNHA 1BG6A 2PWZA 4L76A 1Y9AA 4R5MA 4E21A 3U3XA 1HKUA 2Z1MA 1P1JA 2C82A 1DFGA 2JL1A 4QQRA 5JAZA 1IYZA 2PD4A 2ZB8A 4DQUA 1Y9EA 5C7OO 2AHRA 4KTTE 3A1NA 4R1NA 1MC5A 3MTGA 3ZV3A 4GGOA 3GDGA 1W4ZA 4BQRA 1T2AA 4TRRA 5EERA 3BMOB 4PIVA 2OHXA 4HNGA 4PG7A 4YYZA 4NDNE 1EMDA 4D41A 4R9RA 5ES3A 2Q4EA 4BUCA 3EMKA 5FF9A 5DCWA 1B8VA 3CH6A 2IZZA 1XCBA 4BIIA 5CHEA 3IJRA 4O59O 4PGFA 4R16A 4YAKA 1YOVA 2I3GA 3GMSA 3K96A 1DRUA 4YJGB 2PD6A 3FR7A 3V1TC 1LDNA 1XLTA 2EW8A 2EJVA 2FY8A 4LVCA 4UVIA 4Q3DA 2EGHA 2NM0A 2O3QA 1Z73A 3ZHXA 4DPMA 1Q2XA 1PJ3A 1TT5A 5A3JA 3OBBA 1QG6A 1NPTO 3SLKA 1P31A 4C4OA 2FMUA 3WNVA 1C1XB 3H9UA 4GL4A 3FR8A 3RFVA 3PP8A 4PLVA 1P9LA 1FDUA 2B36A 3WNQA 4CM4B 1IZ9A 1BHSA 3NAQA 2AEJA 1S7CA 2Z95A 4PLHA 1GEGA 1I32A 1ISJA 1UXGA 4HADA 4WK6A 3V8BA 2Q4BA 1CQJA 4FBGA 4MKXA 4LN1A 2O3TA 1UAYA 4GPD1 4WKGA 4I9HA 1PQWA 1PR9A 1SEVA 4J6FA 4BB5A 3RUCA 4RCVA 4OHUA 3JD3A 4CLDA 3NRCA 1A72A 3GK3A 4KDFA 4CM3A 3K5PA 5FEUA 4UUMA 3KV3O 3L9XA 1Z45A 4J3FA 1WVGA 3ZGYA 1GV0A 1VJTA 3CSDA 3ETEA 3KEOA 4QFDA 2WTBA 2DKNA 5A9SA 3DTYA 4RQUA 3H6KA 3DQPA 4DWVA 2PZLA 5JS6A 4MVJE 1BW9B 4YVFA 4IUYA 3IC5A 4WLFA 3PIDA 4Z9XA 2YFQA 4O6VA 2WYUA 5JMWA 3GF4A 4IDCA 3I9KA 4PN3A 4Q3CA 3LF1A 1YONA 4MP3A 1N7GA 3ONDA 2ZATA 3BMCB 3PYXA 4FSHA 3L6DA 5ITWA 2GLXA 1PGPA 1QLHA 4NR0A 1A9ZA 1H9BA 1W0CA 4FJ0A 4E12A 3PWSA 2FR0A 4E2WA 5CDYA 3U4CA 4E4YA 3TZ6A 3D0OA 4Z0TA 1HXHA 3IQDB 4RL6A 4AJJA 1DIHA 1LUAA 3QIVA 1PU2A 2G76A 1W73A 1EDZA 1H2BA 4CMEC 3JQ8B 5BNFA 3HNPA 1NHGA 4BV8A 2I6TA 1U3VA 4KUGA 4U0JA 4AJKA 3VPHA 3TL3A 4WASA 4I8XA 1NNUA 5JO9A 2BGMA 2Q2QA 4YWJA 3GFBA 3NT2A 3MOIA 1NFRA 2ZJ0A 4W99A 4CMEA 2I65A 3VPFA 3ZV6A 3UF0A 5CAEA 3FWNA 2NTNA 4NK5A 4IZIA 4J90A 4UAGA 2P4QA 3NUGA 5T5QA 1U2DA 1P3DA 4RPKA 2HK8A 5HTOA 1JLLA 4NZ9A 4OAQA 4IM7A 3AY6A 3HB5X 3KLPX 5CDUA 3WTCA 1BXZA 3U49A 4Q9NA 3GMDA 1DJNA 1ZSVA 3O8QA 4NH4A 2ZKLA 2NWQA 4QX6A 4NFYA 3JQAD 4YT2A 1TA4A 1PZGA 1NHWA 4BNZA 1NQOA 1MFZA 3FNEA 4CLRB 4J4HA 2IXBA 3W8FA 1BXGB 3QP9A 1M2WA 1V3UA 1H2HA 3WOHA 1YL7A 2YV1A 5IZ4A 5G0VA 4IDEA 4B4UA 3EK2A 2YV3A 4D0RA 2VHXA 1LTHR 2VHYA 1Y7TA 1EFKA 1UJMA 3C7CB 5CP8A 1PZFA 5T8KC 3ENKA 2VQ3A 3KYDA 1BVUA 4JROA 2X23A 1FK8A 3GPDG 1B3BA 2X0JA 3JCZA 4BGIA 4ZGWA 1YBMA 1XU9A 3F9IA 4GX5A 2EW2A 1MC4A 1ENZA 4XQCA 4EYEA 1B15A 3G17A 4FC6A 1ML3A 3RROA 1J49A 5T8KA 4YQYA 1CDOA 2BLLA 2VRCD 3UKOA 2J5QA 3WBFA 3LC1O 2FP4A 1QMGA 4CM6A 1HZZA 4AVYA 5MDHA 1YXMA 3NJ4A 5KVVA 4CM9D 1IY8A 3K73O 2AQ8A 3RQSA 1FXSA 2DTDA 4AJNA 1TVEA 4CLOA 3DWFA 1NR1A 4TROA 2BH9A 1PQUA 4NIMA 5H83A 3F46A 2X9GA 3ZNQA 2VHWA 4IPTA 1MUUA 2NUAA 2JHGA 4YT5A 2JCYA 4E0BA 5JE8A 2BFPA 3RC7A 3GZNB 1H0KA 1QR6A 2NV6A 4YTEA 4GLOA 4RPHA 2GR9A 1MLDA 3HJAA 1EUZA 2DBZA 4OH1A 1A4IA 4WCFB 3NEPX 4A03A 4LCEA 3VHRA 3ROQA 4BNJA 1D4FA 1E6UA 4BO1A 1FMCA 3K6JA 3INRA 2POQX 1ONOA 3MJTA 1DEHA 3ANMA 3DZFA 1LSOA 3HFGA 1M6WA 3DMTC 1YJ8A 3W6ZA 3WSWA 1XSEA 2LDXA 1SOVA 2NQ8A 3DZJA 1UDAA 3PZBA 3INTA 1JKJA 4WPGA 3ON5A 1JKFA 1UP6A 2DVMA 3O9ZA 2PZKA 2GGSA 1VSVA 2RH8A 3U0BA 4RPJA 5AQ1A 4HY3A 4BKUA 3BTUA 3JQGB 1CQIA 3T4XA 3KTDA 4YJFA 3BMNA 3DMTA 3PRJA 5JBIA 2JAHA 1XEAA 3S2IA 3FTNA 4XJSA 5ADHA 3ZI0A 4E30A 1FDTA 3U4IA 4J1NA 4YJGA 3WYBA 5I7SA 1KEUA 1C1DA 5IDWA 5F1KA 2Q99A 2B4RO 1OI7A 3HSKA 4J49A 4W7HA 1NYTA 4PZEA 3WMXA 3L07A 2CDBA 1EK6A 5L7TA 2UUPA 4MIEA 3I9OA 4YXFA 3TFOA 1ISGA 3AUUA 3E82A 5I9LA 2O50A 3WMWA 5T57A 1TI7A 4YEDA 4Z3DA 1JDJA 4K6CA 4KOAA 2C0CA 3V5NA 3EZYA 3RVDA 2NTVA 4ALKA 3GLQA 1OAAA 2IEBA 2IE0A 4PRLA 1A7AA 3RJ9A 5EQFA 4OMUA 1VL8A 1GPDG 5I9MA 4TKMA 3QVWA 3BTSA 3GGOA 2OL4A 4IDFA 4EI2A 4II3A 3PEFA 2UDPA 2CFCA 2J3IA 2CF6A 4J9VA 2DU8A 5IJZA 5FYDA 1C3VA 1D1TA 4HV4A 3ZNOA 4FCCA 2V6GA 4R1UA 1SBYA 4RZHA 3LT0A 4R1TA 3RU9A 5A5EA 1JU9A 4AJIA 2EXXA 3WG9A 5JDCC 2AEMA 4IMRA 5DULA
chains in the Genus database with same CATH superfamily
2FWBA 2GOYA 4Q39A 1L0BA 5JU6A 4IDQA 1T3TA 1XEWY 4L4SA 3HHEA 1COWA 1K75A 2VHTA 3QF4A 2FUNB 4WOJA 1ID8A 1M9NA 2O07A 3PQ6A 3UFXB 5F33A 1MHPA 1Q7EA 3P9NA 2QS9A 1N25A 2CMFA 3H2HA 3ZK8A 1IXZA 1OWOA 1EFPA 4NKRA 2I66A 3KEQA 4JUDX 3SSNA 4M4SA 2V65A 4ISBA 4RPCA 3R7BA 1T0UA 2PMDA 3WB0A 2QSUA 3QPBA 5K0CA 1XTTA 1LXCA 2GKOA 5FUXA 5H5JA 3WP0A 4X45A 3LQFA 5KIAA 2B82A 3KJIA 5JSZA 4DQXA 3EEOA 4N47A 2YUTA 4TL7A 1H4SA 5B6IA 5K3AA 2WU4A 3NBMA 3VNBA 5KOIA 3U9TA 1OXBB 3PV0A 5JEEA 3D6MA 4R8KA 4DR7B 1AN9A 3AILA 4FQ8A 1JLHA 4MKGA 3TI7A 2JJYA 3ISJA 2O14A 5A03A 1T34A 3N07A 4MOWA 5CXSA 3RI3A 4KHZA 3RWMB 1G2QA 1M2FA 5KS2A 1XRMA 3FWPA 1U8CB 4A91A 4TGLA 3VKUA 2XNKA 2O0JA 2VP6A 4JYMA 2Q7OE 3QEMB 4QZVA 4FYVA 3NONA 3ACDA 4X6XA 3THYA 5K09A 1WF3A 5DNEA 3OJEA 5F5NA 3SN6A 2EHDA 2RGRA 2YC2C 1JHPA 1E6EA 2DFPA 1I4WA 3WFIA 4IGFA 4L1KA 2X86A 2WJGA 4Z8XA 3EG5A 5E6RB 1J9EA 3V4OA 4C5AA 3TW8B 3MTAA 4XZ3A 3FB4A 4RV5A 4XIJA 1L7VC 4Q4LA 3TLGA 4BVHA 1LJLA 1OBVA 1YS9A 2NQTA 5TPWA 3JZAA 3OF5A 4D7AA 1T4MA 1AK1A 4WSOA 3L7OA 2Y66A 2C94A 4C7OB 1ZZEA 4RHEA 4TTTS 4N76A 2XVZA 3ZWMA 1XDSA 2Y1CA 3MOSA 2CVHA 2YZ7A 5DPMA 3QE2A 1E1KA 4CF5A 2WZBA 4DMRA 2Y92A 2C54A 1MH9A 3RO7A 3BGSA 1GJRA 1ZNXA 1FEZA 1JFTA 1OC2A 3EFOA 3TRFA 1YOVB 5AOCA 2GT1A 3R41A 3HXKA 1BKYA 1OW3B 1TXGA 5DISB 4KG7A 2HRQA 4O2LA 2RC5A 2FN3A 3OZBA 3LC0A 4G0QA 1Z5NA 2D0OB 4YUWA 3ETGA 3BRSA 3VU3A 3GN2A 5GM2A 3BM5A 5JXJA 2HF7A 3C39A 2CXSA 1P39A 2IYFA 1QUFA 3M6XA 3SYMA 4F93B 2D8AA 5FAKA 2ANCA 4QTZA 3VNVA 2IXTA 2QE6A 1DEKA 4A0GA 2RAFA 2XWQA 2XYPA 1PHPA 2XXJA 1JZTA 1K3TA 1QV7A 2PS9A 2ZIAA 4NU6A 3T7RA 4C22A 5IJ0B 3VTAA 1MJGM 2IDJA 1ZD9A 2GBLC 1U2PA 2V5AA 1TQ2A 2VEDA 1QXSA 4G0YA 2QT0A 3X1WA 5DWVA 2ENUA 4QWWA 1JSZA 4PSCA 1YBHA 3GEPA 5MN4A 5L53A 1G3UA 1U9IC 3KUXA 1CQJB 1MEEA 1Z29A 1ZPDA 2G8NA 3AGPA 3EQ8A 3JZDA 3ROMA 1UZUA 5AO9A 4Z4HA 4D92A 4MQFA 1IH8A 1ANKA 3F78A 4BATA 3UCEA 4BFTA 1USIA 4WBNA 1XHLA 4OQPA 1WBDA 3EXFA 1GXSA 1NVAA 1T2EA 2GZ2A 3I12A 4PV7A 3GU3A 2C20A 3D43A 4J0HA 2G9NA 1V5WA 3WMWA 3S27A 3PXCX 1H2YA 3FVWA 3JD0A 3EZ2A 3OHSX 4TSRA 1EFUA 1U90A 3AB8A 3NX4A 3Q7QA 1DX6A 1ZS9A 3MSCA 5EVJA 5DNDA 1XPUA 5J2UF 1LQ2A 1U7ZA 3W5SA 2WWFA 1Z6AA 2PGDA 2PGIA 3WK9A 2OAGA 5BVHA 3ISTA 5JCJD 3DOCA 2KM1A 4MB2A 2EFEB 2G80A 3W1WA 4EECA 3X1ZA 3WA6A 5TLSA 3P2IA 4MJ7A 5EIWA 3WE7A 4DB4A 2C1XA 4GO1A 1L8LA 4LVOA 1OH6A 2NZXA 2PU5A 4OQZA 2QPOA 3TPCA 3ZIDA 3PHHA 3UC5A 4D3XA 2PUGA 2IUEA 3DFIA 5AKZA 2YRWA 4BLUA 1XMSA 1WW3A 1RBZA 1UM9B 3KVNA 2PG3A 1YVRA 3QU4A 4XPIB 4NZZA 1VFNA 2DLNA 2IEDA 3WQRA 2PX8A 3UT6A 2IA5A 2B1JA 4OGWA 5LDHA 1JDBB 3PTLA 1LWNA 4DIFA 6AT1A 1IVSA 4M54A 3A2NA 1EM8B 1WPXA 3HLYA 3MZ0A 2OPBA 2ZQ5A 2DPYA 5F7ZA 5K2OA 2CNWD 2I7VA 3IOCA 2J87A 4FD3A 4FVTA 4UTNA 5J4KA 3B3GA 2R8BA 1D1SA 1Z0AA 2CD7A 3QKWA 1T24A 5EJEA 2WAXA 4ZTBA 1ISSA 3TRJA 1ISHA 1O8BA 3MXTA 2W6JD 2ZBQA 1LBHA 1R5OA 4J29A 2Q3EA 4F2PA 1KJJA 1A69A 4J1SA 1AJEA 3SEAA 1HDGO 2GYYA 3G49A 5KJEA 1JR4A 4BAGA 4Q3NA 1GA4A 5ALMA 4OUDA 4CEJB 3TEMA 2W6QA 2YDYA 4GBMA 1NI4B 4TRJA 1YL6A 3OH8A 1UZMA 1COZA 1K7SN 3RR2A 2I91A 2X7HA 4JU9A 1BMDA 4NX2A 5MFPA 4AFNA 2E4ZA 2XBUA 5ECWA 4DQKA 5C5EA 2HWYA 3IAS1 3DE6X 3T1QA 1BROA 3PFGA 4KVGA 3UB2A 3IJEB 5BNWA 1X9IA 4KO8A 4DJTA 4JXJA 1SA0A 3R3ZA 2Q41A 1CIJA 1TTQB 4IJWA 4MJXA 4WXHA 2ZUUA 1M34E 4M7OA 3RS8A 1IULA 4NWIA 1JQ3A 1RJWA 5B1DA 3GUCA 2V54A 4NH0A 4K7JA 5PGMA 1RR6A 4G1FA 3WGVA 4H59A 1YS1X 2JFVA 2OZLA 2RJNA 1XDDA 4TXHA 1I4TD 2X41A 5L40A 2XAAA 3GQVA 2PUFA 2XOEA 1E3SA 2F64A 4OGKA 3SM9A 4E1AA 5JRZA 1CHDA 5D3MB 5FBZA 4YCLA 3I4FA 4M21A 3R40A 4L51A 4ENSA 3OE7A 4G09A 4NBRA 4WZ6A 3FFBA 1YOBA 4GLLA 5GZ3A 3R6LA 9GPBA 3PQ4A 2BJWA 4Z3OA 3OEWA 2I8AA 3EF3A 3EQ7A 4KXLA 3C1UA 5L4LA 2PS3A 4YO8A 1GV1A 2Q5JA 3RAFC 4RF2A 1JSLA 1XNGA 5BXQC 3GAFA 3IHKA 2JLVA 1C81A 2YOFA 4KYTA 1V71A 3BTVA 5C9ZA 3JQDA 4UEKA 3HN2A 4BGUA 3D8UA 5LXTA 1UR5A 1DB3A 2KB0A 3G0CA 1SURA 3MRVA 1BVHA 1MA3A 3OM0A 4RIGA 1GTL1 2YWGA 3RS0A 4RCYA 4DV5B 2DHQA 3OESA 4BNKA 4BKOA 3SICE 4TLEA 4LE1A 2YNMC 1JU3A 5FI5A 1FJGB 1RKQA 4QATA 2Q3BA 1SBZA 1U2TA 3K8ZA 2BEWA 3Q7TA 5EUBA 1EJBA 2W6ID 1Q3KA 1Z6PA 4CHGA 2V9PA 1VLHA 1IOVA 1U04A 3I1YA 1Z47A 2OV3A 3A6ZA 5HFAA 5J63A 4I55A 4PO3X 1RI4A 3VX4A 4WINA 4HN9A 4CLOB 4WBNF 2JLAA 3Q9SA 1BDMA 5JNSA 1Z3IX 3LPCA 5FTJA 4B85A 1RQNA 2QR5A 1Z7YA 4ZYLA 4J7AA 5TNXA 4EPVA 5L4NA 1YK1A 3LUHA 2NUAB 1NNSA 2ID9A 3RUDA 2EBWA 1TOAA 1X13A 5E0KB 1PWXA 4KPUA 2DUJA 4HDNB 2AD5A 3AUFA 4D3YA 2YRXA 3L3BA 3PC3A 3DE7X 4WACA 1OAKA 3V1UA 1AO3A 5EXDA 2ZFUA 3KLMX 5D85A 1GGKA 3KB6A 2VSOA 2JLSA 3LXMA 2AK3A 2QX7A 3LY9A 2G17A 1LPPA 2ZI7A 4ZGGA 3IS3A 3GPBA 4LOLA 1TYEB 2OG1A 3MINB 1UMKA 5EJ9A 4QLAA 4CV2A 4W5QA 3UB3A 1JH9A 3FROA 5IVKA 3SXUB 5H9WA 3SBEA 5KQLA 3C43A 1B0AA 3SU8A 4LSZA 4A16A 4NZYA 1C41A 4EMSA 1NBMA 3M70A 3UBMA 5FTMA 2PKQO 2RHWA 2Q2WA 1CXZA 2EWWA 2Y67A 3HJGA 1BEZA 2DGDA 2V6FA 1T0IA 3O3MB 1EVJA 4HHEA 2X1MA 1II9A 3TX2A 4ZIRA 4F7DA 1T2VA 3M83A 4QM7A 2PX5A 2PA0A 3ROEA 3UQYS 3DZKA 1TYBE 3GO4A 5HGJA 3BMNB 2IS2A 3OEYA 2PSDA 4LQLA 4HDSA 7ADHA 1OZAA 2OGWA 2VDWB 3C3YA 4LA4A 1J25A 2FJ0A 4UUAA 1YWGO 4I46A 4R0MA 2A88A 1GYQA 2GUWA 5KYVA 1C1DB 1QSGA 3A06A 4RLSA 1N6NA 1SUIA 4DABA 2Z08A 1RI1A 4KI0A 4FGWA 3TNDA 3TSCA 3ITNA 2J9RA 2UVPB 3MLBA 3VVBA 4X3OA 1L7EA 1TDJA 3UXHA 5JW6A 1HE5A 1X19A 2QMUA 3D02A 3ZXYA 4C0KA 3CS3A 4CKWA 3EGDA 1K8RA 1Y1RA 2C2MA 1Z2NX 5FO0A 2X0DA 5A5FA 4JI7B 3K1TA 4LI0A 1RLMA 4Q6WA 4P4UA 4EJ0A 1C4KA 3CPEA 5EAIA 3MJCA 1PFGA 1GL6A 1N3IA 3I9V1 1ZSYA 2ZUEA 3B36A 3J81k 4HWSA 5CFLA 2VJDA 3HYNA 3LYLA 2DLCX 1EP2B 1GQQA 3OLVA 3EXEB 4EEKA 2XMZA 1FFDA 5GIPE 1FQJA 1Z62A 2Q4TA 3RU2A 3ZK7A 1XF1A 3L77A 1C4WA 3M6UA 2ZSFA 2Q1WA 3PFBA 1H66A 2ZUBA 4PSKA 3QWIA 1IJKA 4IJQA 3ENVA 4QQNA 5EZYB 3R76A 3LO8A 2AW3A 3ZWWA 4F84A 1USUA 4M8SA 1N77A 4FOLA 2K5UA 2Q5FA 2FRVA 1QTIA 1FQOA 2DFDA 2XDQA 5KTRA 4TN1A 1HYEA 2VATA 2PZAA 1PR3A 2H0RA 2VWPA 4RJ2A 2OVBA 3TKLA 3Q2OA 4RELA 2OFOA 1KVSA 4Q1DA 2FMXA 2H2AA 1PBNA 4LK2A 4D0NA 1N8SA 1OIVA 2WC1A 2Q1XA 2J85A 5A7FA 5ALYA 4BMDA 2FW8A 4FNAA 1I4DD 3UO8B 1JQLB 2C1EA 2H08A 4YJ3B 5L3SA 4LCJA 4CUZA 4AJ2A 4NAHA 4S1OA 4Z2YA 1E7MA 3TS1A 4X1IB 2W6NA 2NTEA 4M1YA 4TXNA 5MN6A 3QUBA 1E3IA 1GQRA 2HMWA 3P0RA 5JJIA 1MB9A 4JT9A 5LXTF 5C5CA 3M2PA 2FZWA 5F7XA 5DXAA 4FX2A 1W47A 3UXMA 5L3ZA 2IYRA 4BO3A 1PX0A 5CYPA 1Y3CE 3DLHA 1NXVA 2GETA 5C8YF 2DAPA 4P0QB 4ZMRA 3RIGA 3AL3A 1J33A 4PFQA 1WV0A 3HKCA 1NMQA 3QMWA 2ZBGA 3AINA 5IDYA 1JLKA 2I78A 1QLWA 5FQNA 3V4ZA 2VK4A 3K9FC 4FI3C 3ADBA 4L57A 2GEFA 4Q4DA 1NI3A 2EKZA 1PJCA 3ZW9A 4Y1RA 2E4AA 2OD7A 3TIGA 1Z2AA 2XCSB 2D0PB 1NVVQ 4JNKA 2AEFA 4I55F 1G4UR 1CS4C 2ZIVB 3NDJA 4E15A 1E6MA 4NATA 2QIOA 1TVCA 3EGXB 5A9RA 3OMLA 3OCJA 2PBRA 3Q3GE 2UV8A 4TZKA 3FJYA 4A27A 1SGWA 4IJVA 4IQGA 5JSYA 2YVQA 5B1EA 2XMPA 4YAJA 5FPHA 4YRAA 1HC7A 1T4CA 2WI8A 3PPVA 5HFJA 4HB0A 4JR0A 2VHZA 4PZYA 1T3GA 2LNDA 4AX4A 2HFKA 2IBMA 1YHYA 3OJXA 2PSEA 1OGIA 1ZJYA 4DR1B 3FCSB 1UBJS 5KSYA 1KEZA 5G4LA 2NVUB 5G53C 3LQ2A 1S3SA 1YC2A 4KX5A 5HHTA 1DAOA 1V6CA 4XSVA 2XQJA 2QTBA 3JZFA 4A3SA 2FPPB 3QH4A 4MKFA 4Y2VA 1SC3A 1PQPA 1QKJA 2VAWA 4MW1A 2V3VA 1XFDA 8ABPA 1ZH0A 2WE7A 3PFKA 5DV9A 4EGAA 4L85A 4R05A 1XQVA 3PCTA 4IJ6A 4PYLA 3N2ZB 5IAEA 5I3CA 2KPOA 3GLFA 3VKGA 4MQBA 4AW9A 4EM6A 2PCJA 3AVQA 1JDVA 3KM0A 2GAAA 3V8RA 4CEHB 2A7QA 3T3OA 3ZY3A 3L7LA 2ODBA 4CV0A 3JRXA 3JASA 3ADDA 4J7UA 1Y5IA 4KKVA 4JCOA 4F9FA 1O9BA 3I34X 2Q8NA 4HS4A 4JVLA 3ZQUA 1MTOA 3C6QA 3G6KA 2C5SA 3OG9A 4KWEA 5JUWA 3Q6MA 4RSGA 1E2GA 3ZN2A 2NU8A 3GI1A 1CUYA 2VJKA 3ROKA 4UOZA 2QTFA 2R25B 4S1VA 1FNBA 3OE4A 4NABA 4R2HA 2QL5A 3L8YA 4V0SA 4AQDA 3DPIA 2G72A 2ZXUA 1RXSA 4EI8A 1ZGGA 2I7XA 4GXQA 2H9YA 2FWAA 4HWTA 3MB5A 2VPZA 1PR6A 4P8RA 1MVNA 5CK4A 4TYPA 2OO3A 2VZ8A 4IDBA 3C5WP 4DC9A 4F71A 4KNVA 3ICQB 1TGYA 4KYUA 4ER7A 1DCMA 2J3KA 2BFAA 1H94A 1TJ5A 4IKOA 4KWTA 3PWTA 5CRIA 4CQLA 2WHYA 3UA4A 2FDRA 5I5EA 2DHEA 5KTTA 3M9LA 3WKAA 2CVFA 4RW0A 5JXWA 1EUDB 1XFAA 2CUNA 1DTWB 5KYWA 4GG1A 3HFSA 2EQAA 5C7YA 2EIHA 1PUIA 2NXNA 3PUHA 4PCLA 3N59A 4XEHA 5G1OA 2ZYTX 3H8VA 2RONA 1GL3A 3DB2A 2RB4A 4K87A 4BNIA 3HVRA 1X0XA 2WUDA 1MHTA 3OCZA 3P9QA 3WL7A 1XV5A 3BSYA 3LUJA 3EMVA 5BSRA 4D8TA 3ZHRA 4FYHA 5CB8A 1P2VA 1VB5A 5BMVB 4QT4A 2ZT8A 3RKSA 2O8DB 5FTWA 1VG9B 2HIMA 5F3DA 4KXYA 4RVOA 3G0GA 4OHXA 2J8ZA 2E87A 2JCVA 1E2IA 3CT6A 5C4IA 1ZKDA 3A4TA 1TF2A 4BLPA 1QFYA 4TSKA 3BSWA 4L5YA 5AJUA 1W34A 4OXQA 3DP9A 2KLBA 5LP6C 4F9GA 3TLAA 1P7PA 5EN4A 5CFOA 1KO8A 4A36A 3I2IA 1JYFA 1T6BY 4NNPA 5A1TA 2KBFA 4A73A 2R7NA 1H5QA 5GJBA 5AI0A 2O9JA 1N6PA 2BZGA 3IIIA 1EFDN 2BAGA 3GUVA 3WKDA 2JDIA 4YFYA 3TPFA 1DXHA 2RHRA 1GN9A 1UFVA 1V9SA 1Z7EA 3MA0A 4F38A 1AQJA 3ZYZA 2TMYA 1YZVA 2WUVA 4I9NA 3M1AA 1C7FA 1DAPA 1FVHA 2CK3A 2LIVA 3LK6A 5BQPA 3R7DA 4EO7A 3BVPA 1XZQA 4R7GA 4UM9B 2WMNB 3A70A 4PG4A 4W1RA 1FYEA 2PIAA 1MJNA 2QL6A 3EIXA 3QMMA 4WCDA 1L9XA 2FKNA 3LS2A 3GJ0A 5IF3A 4G8CA 3M5PA 4RVNA 2PVCA 3O1JC 2XGJA 2OAP1 3H5WA 3DPSA 1U0GA 2V5VA 2Y1DA 4XJTA 5I7HA 2BBOA 1AXGA 2PT5A 1GT91 1SVSA 4GU5A 4M6WA 5A3VA 2GNOA 3L7YA 2GM3A 1IBCA 1X7YB 3EC7A 3L4BA 5FL7A 4Q7QA 1I1OA 5IEBA 1EDEA 1RM5A 3KR2A 2HBRA 2XMCA 1V8PA 2GVZC 4LQCA 3HO1A 2QAIA 1G1MA 1M6HA 2R2AA 4H4DA 5CYFA 4JASB 1O6ZA 3DAGA 3DL4A 5DGXA 1YVPA 1Y8QB 1E62A 1RRGA 4N5LA 5AOBA 1ZH6A 5L7YA 5CXUA 2WP0A 4QUJA 4IS3A 1EE9A 2OZEA 1DJOA 4I1SA 1VKNA 2WKSA 3KZ1E 5EWJB 1N2HA 1WLYA 4LRSB 1T4BA 5C3MA 2YN4A 3OEHD 4V3BA 3AEQB 4DLLA 4DLTA 5A5VA 1KMHB 2VLIA 4IIJB 1QV6A 1YE5A 4ACAA 5KKCA 1NBEA 5I7EA 3LW8A 4KE9A 1WM1A 4Z6KA 4G0OA 4YA6A 3AQIA 3HUUA 3KQOA 4AUMA 1R8XA 2BEVA 2Q4DA 4JEUA 1TW2A 1JVSA 2G08A 1U8XX 4P3KA 3RUEA 3W8NA 1KYYA 4PN7A 1BEUB 2ZG6A 5AHOA 3RRMA 3GA5A 3GH1A 2Z3ZA 8MHTA 1IJBA 1Z0KA 2YIJA 3L7CA 4P5DA 1GO2A 2AD1A 5ARCA 2Q0QA 3GBVA 2GRJA 5E9WA 2WINI 3NHMA 3SM3A 5T6BA 3A4LA 4H7FA 1RAFA 1U5CA 2EBHX 3E1SA 2Q49A 1RWPA 2M1XA 4JI5B 3DTVB 3U2QA 3ZJVA 1F6BA 1CJCA 3AF0A 4M98A 1N6OA 1D2HA 2GAFA 3BEOA 2G07A 5C2JB 2Z9CA 1PG0A 5HBRA 2ZYGA 1XNRB 1G21E 3OCCA 1OXTA 4N49A 5IK2A 1USGA 2WPDA 3PJGA 2OMEA 3FUUA 4PSVA 1ZMRA 1ZL2A 2WJHA 3JV7A 2W70A 1RRKA 1VIMA 5CVVA 1YZUA 1S8FA 5LSAA 3IKMB 1N2CA 3CEJA 1GTZA 1YKFA 1QK3A 4PY2A 3FH0A 5E0OA 4CIAA 3LWBA 2QJOA 3NCTA 1EXNA 2YY5A 1U6IA 3LM8A 3ZLVA 2ZTMA 3OCXA 5BW5A 4ZALA 3A7EA 2QBYA 4JP2A 1YL5A 1NYQA 1AA9A 1KNXA 5HG0A 1WDWB 1QDEA 3HJUA 4DMGA 5JIBA 2O54A 3V7NA 2NTJA 2J41A 4MK4A 1YZKA 3BULA 4PRKA 3VJKA 4AF6A 1M2VA 3VNUA 5KQRA 2F67A 1H6DA 5E6UB 1RYMA 1L4LA 2A2ZA 1ILEA 4HBZA 2PMCA 5EUMA 2GJSA 4YMHA 3SKVA 2Q1TA 4KVZA 5AHWA 5AW3A 4H3HB 2YWXA 4PG8A 1AB6A 1TEHA 2UZ1A 3TOSA 4L27A 3T4UA 3DKVA 2Q62A 2VXBA 3PHJA 1W2HA 1C30B 1GNPA 5CDFA 5WRFA 1G8AA 2HRBA 3SZ3A 2OBYA 4LYHA 4NK4A 1OVGA 3HGQA 1DLIA 1FCJA 4CHTA 4MV9A 3IDZA 5CGQB 5B4VA 3K2IA 3FF4A 5M7EA 3Q9NA 4GKBA 5C8VA 2ZJOA 1BEEA 5ARDA 3BD9A 4DA6A 3WIOA 3FKSD 2QAGA 1RI3A 2G77B 1FFSA 3H18A 4I3GA 1PGNA 3I9NA 4HH1A 2G5GX 1V2HE 1IEXA 1NN0A 3ZE7A 4EQ6B 1HE3A 3AEZA 3BK7A 3E9YA 4OAOA 1XRNA 3TDNA 1AGPA 3VPXA 3CONA 5ECYA 5EHZA 3G8DA 1UBGA 4QLBA 2R8OA 3T3NA 4KUEA 1E5DA 2WWRA 4HX9A 4AT1A 2HZ7A 3DMHA 2AEEA 3H2YA 1K6JA 2G5PA 1M6EX 2EWVA 4B80A 2DBVO 4JU8A 4CCWA 1W36C 2WIDA 4UM7A 3BCHA 4C88A 3NKVA 2OORA 4DCMA 2XKJE 1L7NA 3EDRA 1IN5A 4QUIA 3TZKA 1EQAA 4L9WA 2ZRLA 4U9UA 3WKEA 2JATA 1HNZB 3ZUGA 4LJRA 1W2GA 1R0SA 1IN4A 4N4AA 2FPSA 2D2XA 2OQVA 3X1KA 5IG2A 4PXYA 3HBLA 2F3QA 3QEAZ 1WUJS 2NZVG 2EZUA 3GNQA 1OX4B 3QPUA 2B35A 4LDPA 4NFLA 4QWMA 5LA6A 3FNHA 4MI3A 3LKZA 4KB5A 3KT6A 2PWPA 4RS3A 2QVLA 2PEYA 2Z09A 5DLYA 3PFCA 3IBCA 1NVMB 2YICA 3QF7A 2IOHA 1HE4A 1K6MA 5TMBA 3GQBA 3ESRA 3G2NA 4UTRA 1T1IA 1GAEO 2H4XA 3BL8A 5ENDA 3AK4A 3LLSA 4BTVA 1RQXA 5SYMA 2D62A 3G8AA 3EXG1 3Q5EA 1XZNA 1NQVA 4JC0A 1QFXA 1Y3HA 3F8SA 3WICA 3G88A 2BI7A 2XSZD 4LZZA 3TQCA 1HUQA 1UF9A 2MSLA 3H75A 8ADHA 3KHKA 5JTUA 2XIQA 1GN8A 2RHLA 4H1VA 4E94A 1WF6A 3ORYA 1HFKA 5AW1A 4H6XA 4EFKA 1LC3A 1QCCA 2WUGA 2DWQA 1BTOA 5ARBA 3SFVA 3C2QA 3CU5A 3P0JA 4NCJA 1PVOA 1FYVA 1L1EA 2YQZA 4D45A 2ATXA 3H99A 1QZUA 3BH0A 1SN7A 3ZEIA 4C4RA 4GWKA 1JIUA 3G7NA 1KFJB 1YMQA 4B17A 1S2LA 2EAUA 1L5YA 3AV0B 4IX1A 1Z83A 4Q7JB 1FU8A 4LNUA 3L0ZA 3UJHA 4AWXA 4DG8A 5JDIA 3U60B 4W5NA 1IHDA 3QQPA 1ZNZA 1JRLA 5I48A 2PQMA 5A4IS 3WMGA 3UJNA 1N33B 1IK4A 4PW0A 1QIHA 2PY6A 2PUVA 3PGMA 4ZVVA 4WUVA 4OKSA 3TQFA 3M1IA 3W1EA 5JD4A 2A30A 1Y42X 4A26A 5KREA 2Z0MA 1TTTA 3EAQA 1N78A 3CUEF 3CSUA 3NS7A 1EUYA 1NATA 1W87A 2I7TA 1K4MA 2F4NA 1IHXA 5EXTA 2QIPA 1WSDA 3EAGA 3E8XA 1U2ZA 3U7RA 4KGDA 1GCIA 4CTOA 4E33A 5DN6D 4J4BA 5AWFC 2ESRA 4JBYA 3PNKA 1ELOA 2WHEA 2EG5A 3A4YA 3IAHA 4P4LA 4JEIA 4J03A 3T7DA 3UHJA 1J07A 5CURA 1XLVA 5CA0B 4U8GA 1QX3A 4LDZA 4WXYB 3CXRA 3A9SA 2PZBA 4QSHA 5G3ZA 3GLIB 4F56A 4XI9A 1GFWA 1YIDA 4MRNA 1PZNA 2WLTA 2QI9C 5EC8A 3RD5A 3WX0A 2ETXA 1U0EA 5ALZA 3GT7A 1TEVA 3HXTA 3FMFA 4FGKA 3CUUA 1BCSB 3IFSA 3KJFA 3W2GA 1CE8A 4CTKA 2H63A 2ASEA 4NE9A 4EKDA 3KKZA 1I0IA 2NO6A 1OA0A 3C3JA 3Q8XB 3CVVA 3RBXA 2HV9A 2M1ZA 3FWZA 1W581 2WIKA 3TTVA 4F8EA 3T4EA 1LF5A 1OH8A 1TAQA 4LJKA 3O4RA 2QJWA 3GDFA 1WHTA 3DB1A 1I7QB 4RTRA 5LUAA 3EC2A 2DWCA 3UCFA 4YJHB 1IUKA 2GO1A 3CX4A 4RD2A 2GXSA 5KNDD 5AKHA 3I6ZA 3K4PA 4ARZB 4MW9A 1R10A 2ZDQA 3REGA 1CTQA 3JQRA 5FL3A 5C5DA 2H9AA 3FYUB 4LBWA 1L2TA 5CXXA 5F21A 1YS6A 3CE9A 3BRWA 1XTBA 3AM5A 3P52A 4O2AA 4C4TA 2EFDB 3ZV4A 3M1LA 5DSXA 4H7KA 2ZRQA 4JSRA 2Z6AA 3TXAA 1NUQA 5FBKA 2ZKIA 4L16A 3FUVA 5DJ5A 5KNCD 4CR6A 2FWMX 1YKSA 5KZMB 1PR2A 5IRCD 3RVKA 4M49A 4UHEA 4TTAA 4D9MA 4RHFA 3VSCA 1M1XB 1REQA 3HDHA 2YJ5A 4EL0A 3PI7A 4HQNA 2BKVA 2P27A 3PEUA 4NG5A 4UEOA 3OLYA 2X1LA 3G3EA 4H4CA 3WGTA 4DA8A 3CVYA 2BKAA 1GOTA 4NYIQ 5K3SA 3FUXA 5EGNA 3U0VA 4OLAA 2VBIA 3NW9A 5PNTA 2X9QA 3LLVA 4D43A 5FWXB 3GJSA 4PS0A 1XVAA 4EIWA 4PQGA 1YJBA 3BDIA 1ZMBA 1W35A 2V59A 1T36A 2XADA 3U3RA 2XGGA 3NHKA 5LA6F 3AR4A 1QU2A 3DMFA 2P9HA 2XEDA 3QOFA 1P6UA 4NLLA 1CY4A 4G9GA 3N2NA 4EHJA 1YRWA 2E48A 2Z4RA 4UNSA 3Q2IA 3FDIA 3R9WA 1G3QA 1YHNA 4UVEA 2H51A 4DMFA 3ASVA 1G3IA 2Q5CA 2BEJA 3MT0A 3ABIA 3FGNA 5AK5A 3QE3A 4W63A 2R6DA 1HBJA 1AB5A 4MS4B 1T5IA 4S35A 2WJIA 2V7XA 4QOJA 4B34A 1NW8A 4JI2B 2ONCA 2K7FA 2DX7A 1C0LA 2JIQA 2HGZA 3TLXA 3NO4A 4AN0A 3ZDCA 4YRQA 1E32A 4TS3A 1E3WB 1TM4E 2YJ6A 1B0UA 4XGKA 3UK6A 4EPYA 2DBRA 3I1FA 3IV6A 3O3OB 1EB9A 1FQKA 4M8LA 4MS1A 3KCQA 4YRZA 1AMUA 1X80A 4U3JA 4OSEA 6ADHA 2I2FA 5CX1A 1F38A 1MIOB 3PHIA 4XB2A 1E7YA 2C5LA 3I64A 3JWPA 5TT0A 3UUWA 2FA9A 1CUAA 1HSOA 5TPZD 1PZXA 4FJ1A 3OIDA 3OZEA 1ODLA 1ZOSA 2C07A 4FZVA 4Q82A 2DQKA 1JSCA 2GHIA 3D2CA 4QC2A 4OHZA 3RRZA 3IQFA 4ZVRA 3EGVA 1SOMA 3WGZA 3WXBA 3ND6A 5AJTA 4X90A 3PDJA 1EESA 1CB0A 2A5GA 3N8HA 3CR3C 4M99A 4IQ0A 1ZD8A 4F5YA 1FNCA 4F4HA 1TM3E 3H6GA 5I4KA 1WMEA 4IY1A 5CW2A 4AY6A 3CRW1 2D0IA 2AQHA 5D3QA 1K0UA 1LLFA 1RZUA 1YCFA 1Z4MA 2X77A 1TVMA 1A98A 3SXJA 3TTSA 5AW5A 1KSGA 1NZDA 1RRFA 1OPRA 4RULA 1GFZA 3CEMA 1Q0PA 2FOIA 4D0LB 1E1DA 3NP7A 3T35A 1UFRA 3WIUA 2D6FA 2BFMA 1C9EA 1OBOA 1PFUA 1OFVA 1Z34A 5B12A 1QHYA 5I51A 2R3SA 3D3JA 4ZZ2A 4MLCA 3I9JA 2JW5A 4GT1A 2ZVPX 1PK8A 3O82A 1DT5A 5IZCC 2ZRDA 3KQPA 4EB0A 3HNRA 4B0PA 4RJTA 1AA6A 3UFBA 3U4HA 4B87A 2VTBA 2IZ7A 3PUWA 3NB0A 4K2AA 1NW7A 3NDIA 3AYZB 2ODPA 3ZW7A 1E3QA 1PE0A 4JYPA 5C7IO 2R4QA 4OI4A 4UU8A 2EJUA 2P67A 4QYWA 3R3YA 3RSCA 1ES9A 2B21A 2QMEA 1XWFA 1KAGA 1QFZA 4TRMA 4UMDA 5FPTA 1BGVA 2AX3A 3GG2A 3HXLA 3PLRA 1NJSA 4NV3A 4X0EA 4ARVA 3RF7A 4MYSA 2W2KA 5IDVA 1H69A 3HS3A 5EHGA 1PR0A 4ZVOA 1H5UA 1R4ZA 3W9SA 3R3HA 4EZBA 2QZJA 3C8HA 1I6MA 1XQ1A 1Y5MA 5H3LA 1UJ4A 4DWJA 3LP5A 5EJ8A 1QFMA 2CLFB 1O6FA 3BGWA 4O2AF 3NOXA 1VXRA 3A9RA 2ZPTX 3DKPA 3MNFA 5FWYA 1FNNA 5FP0A 1FDSA 4DIKA 3E3NA 4IO0A 1GZDA 1K0FA 1EZ4A 1VCNA 3C8DA 4HNHA 1KZ1A 3OTWA 4LHSA 1TRKA 3GNSA 3QLUC 2NZJA 5DEIA 1ACMA 3A0UA 1S01A 4R31A 3WB2A 2GHTA 3RYCB 5BN1A 1SHKA 4ROSA 2CFIA 1ORVA 1KEWA 4AMZA 1PGQA 3K6SA 3UH1A 4TPKA 3RFTA 2RHGB 4LOAA 9LDBA 2VOEA 3G5UA 4MITA 1QF9A 1DTEA 1EXMA 2CFTA 2NYVA 1CD5A 4ZVMA 3ONVA 4L9AA 3K9HA 1VL2A 5CNMA 1QIFA 5EHNA 1RAIA 3C3EA 1KI3A 2WFZA 2HEGA 1H8HA 5JAQA 1GR0A 1WULS 4FFPA 1ST3A 4MUNA 3ELBA 3JWEA 2FPRA 3OO0A 3AKZA 3GVPA 1X1TA 2BFWA 2H0QA 1IUPA 2KW5A 1U31A 2OFPA 3FUTA 4IQ4A 1J1ZA 2CFOA 2WVGA 1Z07A 2BHSA 1OHHD 2D1FA 2PQ6A 4UZEA 2VBFA 3H3XA 1DO0A 1JSXA 3EDOA 1QS0A 4EA6A 3L8CA 3KR9A 3DLAA 3SE7A 2I80A 3SJBA 4BV9A 1ZJ5A 2AK2A 5EINA 4U9IS 3AHHA 3C3BA 3F4BA 1E5TA 1IB0A 1NYLA 1V1MA 1JPNA 4DGSA 5DKFA 3FOEC 2JLUA 4ZT3A 3LPNA 3CVWA 3N6XA 1AUXA 3LO5A 1K66A 3DL2A 5EMJA 4BX3A 4B43A 3GRYA 1GYPA 3W4JA 1KYWA 1SHZA 4HVCA 2CC2A 1LBEA 4CFYA 3NWPA 1YQQA 4LRUA 3DFMA 2C78A 4QFBA 2O8FA 2R8XA 5C8YB 2A9VA 1RZVA 5K3FB 1AO0A 4OG2A 3RSFA 4J3NA 3L9WA 1JF8A 3OZAA 4G0MA 3GLHB 4RVUA 4XR4A 4EHIA 1YZYA 3OAAA 3PIIA 4AO6A 5BNIA 3SVLA 4H31A 4MB6A 1Y5RA 3THXA 2VTEA 3T1YB 1NIPA 1U8YA 2BE7A 1GU1A 2OWEA 3IBFA 4QG7A 3WQQA 4O4JA 1MABB 3D1LA 1TFUA 3DUWA 5CUQA 1MX3A 2CF5A 2V1UA 3OZFA 3SF0A 4XASA 4I4IA 1MJFA 5FR1A 1VBMA 2XB6A 5CEFA 3HABA 3I6QA 2YWJA 2OOSA 2AKAB 1R8QA 3WGNA 2W42A 1YQXA 2CVOA 4F6LA 1FBTA 4DLKA 1QGUB 2UVDA 3RDPA 1BKDR 5DT9A 1NN5A 3D6FA 2ZT5A 3MJ4A 4C3UA 1LVHA 2RGYA 3AUJB 1ONPA 4Q03A 1RMQA 3CQ9A 3BZUA 5AVOA 4DMMA 1HDOA 1W85B 3JSAA 2GERA 1XWIA 1U8FO 5TPZA 3AEKB 4JNCA 4F12A 5AFSA 2IZ1A 4QRIA 1L8OA 1W46A 3WBBA 5BN5A 4ZV7A 1GPAA 1GKLA 1DUVG 2Z2XA 3G7UA 1YRBA 4Q6BA 3EGCA 4Z7OB 2QP3A 3GYBA 2C29D 3GZ4A 4IHQA 4Z7NB 5I7VA 4QU5A 1LLQA 3RK1A 3DBLA 2G4LA 2HK7A 1KJIA 3IAAA 1UWKA 3O4HA 3K3PA 2PH3A 3TSYA 1RM3A 4G81A 1M2OA 2NGRA 3QV1A 2F4VB 1V9CA 4TV8A 5AKJA 4EITA 4GKVA 1PLLA 1Y6JA 3MC1A 3CGGA 2FK8A 4F72A 3QVJA 2YXLA 1EWKA 1UMDB 2O2DA 3CCFA 3JVUA 3ZH2A 3W5IA 3KKEA 4FN4A 2FWNA 4FFLA 3W3AD 2VDVE 5FCDA 3U4GA 1VBKA 1NBME 3L8EA 4X41A 1MW8X 2GI4A 1NTOA 3DEAA 1BJTA 4KDCA 2OBMA 1MV5A 3EPPA 3ZWOA 4D9KA 5IT5A 3F5SA 3VJRA 4LYGA 2WSIA 3TYXA 1KK3A 1U4SA 1DP4A 2QGNA 1WA5A 3FHJA 1PNOA 4LSWA 1WTCA 3DMRA 3WWEA 1VQ1A 4GX2A 1SEPA 1XELA 1R4NB 2IOFA 4RD1A 3STXA 1LLUA 1JZQA 1HRDA 1U0JA 3CH7A 4PQEA 4U63A 2CLSA 1QYWA 5DCLA 4X20B 1J0XO 1WSWA 1X0VA 1KZ6A 4MUBA 2IP4A 4X66B 4FFMA 3VR5H 4JLPA 1T9ZA 3ET5A 1SIOA 4IAOA 1UH5A 4C6RA 1Q1AA 1E2MA 1XGKA 2G1PA 3O3CA 4RBNA 3PUKA 4OMFG 2BDTA 4IMJB 3UZUA 1PAUA 4M1TA 1MAUA 5IKMA 3CCBA 1E5LA 3D4IA 6PFKA 3FYDA 3B3FA 4R9UC 4RLHA 1PV1A 2P2GA 4A7PA 2L69A 1NYRA 1V0JA 1ATZA 1VHDA 1XJ0A 2HDOA 3U7QA 3E84A 1WXDA 2VT6A 3SC4A 4EAAA 2AUNA 1HQDA 1U7DA 2C8LA 2V7QD 2ZJ4A 3CO0S 3IA2A 4JFRA 2F62A 5ILQA 3RIYA 1AV6A 1X94A 3BN3A 2WJPA 5T3UA 2WWHA 3BXZA 3VU0A 4K40A 2YDXA 2ZRAA 3MM4A 2DQ4A 5C4MA 5DHSA 4YWHA 4Q9LA 4EUEA 4DJ5X 4Q12A 3N2GA 2DT5A 4CTJA 1EHIA 4UVDA 1XT6A 3L4BC 1YS2X 4J0DA 4AM8A 1U80A 3CF0A 3GIWA 3OIUA 4HB3A 3ZVKA 1DELA 3H0KA 2G5CA 4QDZA 5GVSA 1EWQA 3COYA 4I2NA 4DLPA 4ZT5A 4EVQA 4MJLA 2HWXA 2OENG 2ZE5A 2OCAA 3D6HA 2P65A 3IIEA 4LRYA 4G5YA 3STUA 2V7GA 4DEYA 4B9EA 1SU8A 1XCPA 4X93A 5JXGA 1Q15A 3NBUA 1H6AA 2R2GA 2P68A 3ND7A 4OHMA 2YR0A 2P0YA 3DE5X 4L4UA 5FTNA 2R86A 2FRDA 3RSGA 3TUIC 1GQYA 1ZRHA 4YPFA 4BVFA 5IXYA 5L45A 4ZTZB 4WQMA 1VPLA 2VG8A 4ZQGA 2FSVC 5CH5A 2EFYA 3OQPA 1XMIA 2X9LA 1KERA 1XCJA 3D64A 3FBTA 3FNRA 4UHJA 5CJJA 1F1JA 3WLOA 4BMXA 2GJKA 3RWOA 5AMXA 1Z12A 4O4JF 1QDUA 5J1SB 3AF2A 1POWA 1VCOA 1RE1A 4UATA 3LBHA 2PRIA 3ZWBA 1IZ8A 2J46A 5IVDA 3I9V6 5IW8A 5LCXA 2H57A 2XQFA 3OMXA 1JHZA 2EWMA 4QLOA 4WERA 2ZBDA 2P35A 5EKDA 1UK8A 1W1UA 3B9PA 2XJ9A 1X2EA 1RQLA 1TTPB 4J3JA 1Q20A 1SH7A 1BIFA 3IDFA 4YP9A 2P78A 3QKRA 4HVAA 3ANTA 2V8BA 2QTMA 1HQYE 3CF2A 1J23A 2ZR8A 2ET6A 3L06A 4IFIA 3TR0A 1TGVA 3G2QA 3AVVA 1XDWA