1B15A

Alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-acetone
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
254
structure length
254
Chain Sequence
b'MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL DEHYDROGENASE
molecule tags Oxidoreductase
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
total genus 90
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b15A00
3NKLA 1T1RA 2VZ8A 3K6JA 1E7SA 2BH9A 3VZPA 2G5CA 1BVRA 1BDMA 1E1KA 4GX1A 3F47A 3RC1A 2X9NA 3I3OA 4LCEA 5G4KB 5TQVA 2VUSA 4CV0A 2B5VA 2ZKLA 4M86A 3CINA 3R0IA 4UAGA 4AJ1A 2PD4A 4K6CA 2O2SA 2CSUA 4XGIA 4YAJA 1C14A 1PR9A 2C2YA 3NDIA 1V35A 1FF9A 3LF1A 4NMHA 4J0EA 1Y6JA 3EUWA 4J2OA 4P8RA 3HN7A 3OEWA 1GEEA 4KUHA 4Y8VA 1I24A 4XYGA 1NQOA 2NADA 3FF4A 3UH1A 1R4NA 1J4AA 4DQUA 2B37A 3T4XA 1UXIA 3AWDA 5JLAA 9LDTA 3AUAA 1ZSYA 3ZH2A 3F1LA 3OJLA 5CEFA 3CUKA 1I33A 1UXJA 2JFGA 3QHAA 3O03A 3DWFA 1O0SA 4YAIA 3AUUA 1U7HA 5AXAA 3OJEA 2X0IA 2YYYA 3WICA 4G65A 2C5EA 3RASA 4WK6A 5KWEA 1X1EA 4GVXA 2X6TA 2VNAA 1AE1A 2Q99A 1H5QA 5DP2A 1KOLA 4H16A 1NNUA 4GX2A 2GERA 5HS6A 1IZ0A 5CP8A 2O3QA 5GZ6A 2G82A 3B20A 4IY1A 4ND2A 3SVTA 1MP0A 1LI4A 3UICA 1JWAB 1PWZA 4JJGA 3IJRA 2UUPA 4OQYA 1N7GA 1N7HA 3BTOA 1YXMA 2X9GA 3CZRA 3JD0A 4IXTA 2HMSA 2HU2A 4BO4A 1XWFA 1ZXLA 2VUTA 5DBGA 4TZKA 3W4KA 4BNLA 1D4FA 1EK6A 2CDAA 1SMKA 4E2XA 2CDCA 4PLHA 4EI2A 2CD9A 3WYBA 4S3MA 3DFZA 2RH8A 1PQWA 3BTVA 4BV9A 1P1HA 1YRLA 1KVQA 2I65A 2V7PA 5C3MA 4JBIA 4FN4A 4G5HA 3U5TA 4XB2A 1GQQA 1P3DA 1IB6A 4U8GA 1GADO 2VT3A 3PDJA 1UDAA 5DCUA 1UP4A 1ZK4A 4O6VA 4MVJP 4FR5A 1LLCA 2FZWA 2DFDA 6LDHA 3QWAA 5HA5A 1QYCA 3U9LA 3H65A 5DULA 2WD7B 5L7YA 3GR6A 1H94A 5L45A 2QZ9A 4EGFA 2HMWA 4YJFB 2PY6A 1BW9A 5B4VA 4MP6A 3D3WA 4XCVA 2JCXA 3ZDFA 1XSEA 1NHWA 1WAMA 3JD3A 5EL0A 1NFRA 2E48A 4OXKA 4XYEA 1U4SA 5BNTA 1SO8A 2Y99A 3KEOA 2VNSA 4WOKA 4ZICA 3P7MA 3WJ7A 5IN4A 3MJEA 4Q3AA 4BKOA 2Y67A 1U3WA 4UVGA 3AI3A 4D3FA 4AJLA 3ZWMA 5CDUA 2OZPA 2R6JA 4CLEA 3DMTA 1BDBA 3R1IA 1UZNA 4J9UE 2GUGA 2GZ3A 3PHJA 3ZWOA 2BHLA 3GNTA 3ULKA 1ISGA 1LSOA 4K6FA 1GYRA 1DHTA 2PV7A 3PQEA 1V3VA 3B6ZA 4JK3A 1PJ2A 4AJOA 2VZ0A 4FFNA 5EMHA 4BNGA 2O23A 1LDYA 4ZA2A 3VPFA 3OA0A 4YRAA 2OP1A 3QA9A 4CLHA 4DYDA 2FPPA 4L73A 2EG9A 1F06A 2W4QA 1WW8A 1Z7EA 3AY7A 1NQAO 3OIFA 4XD2A 3HDYA 3KLPX 5CFZA 4GKBA 5U9CA 3NX4A 4FCCA 3RFTA 3JYPA 4I9HA 4ALMA 4RLSA 3KYDA 4UUOA 5C37A 2GSDA 4E21A 2OP0A 4IUYA 2W2KA 4NJOA 4RORA 4ND4A 3RJ5A 1SZJG 4JNKA 3PZRA 4Q39A 4E32A 2B4TO 3DTTA 3LT2A 5A02A 2Y66A 5IJZA 4MVJD 1DSSG 3JYLA 4CMJA 3IDSA 3LDHA 3P2YA 3EHEA 4MVJF 1PX0A 3CMMA 3LC7O 3UN1A 3VH4A 1I8TA 3OQ1A 1DIBA 2ZQZA 3GVCA 4Y6SA 2I66A 5CDSA 3JQAA 3FNEA 2Y0CA 5K9ZA 3NGLA 1CWUA 2E82A 2YHUA 1FDWA 1X7DA 2C82A 4QO7A 5JY1A 2VHZA 3R3SA 4BMSA 3HZZA 1KYQA 3V2UA 3SEFA 5DNAA 4U0KA 4I9NA 4ID9A 3RCBA 3TZHA 4CV3A 2HDHA 4FDAA 3VPSA 4BNZA 2B69A 4FJ2A 1IZ9A 3QY9A 3SLKA 4PVDA 3RU7A 5CDTA 5KVVA 4IJVA 2XXJA 3TPCA 3NTRA 5F1OA 3SC6A 3VAZA 2NQTA 3G1UA 4BO0A 4MVJM 5A4DA 3H5NA 3HJAA 2NTJA 9LDBA 1YO6A 2VWQA 3G17A 2BMAA 4E13A 4FD3A 3OF2A 1PR3A 3ORFA 1Q1NA 1ZNQO 3IS3A 1DHRA 1QYVA 8ADHA 5I9LA 3PJDA 1T24A 4AJNA 6ADHA 1N1EA 1DIGA 2OOSA 1ISHA 3PTZA 5DF1A 4PLYA 1M76A 4HV4A 5DOZA 1F17A 1GAEO 5ICMA 2PZLA 4AJEA 2AQHA 4GSLA 3GFBA 1HLDA 3WWYA 2HUNA 1UAYA 3BMCB 1LSSA 1PL7A 3BTUA 5F3RA 2Q45A 1EEHA 2DM6A 4NG5A 3UCXA 3IP3A 4KWIA 5A3VA 1YB5A 1ZVMA 1KEVA 4K26A 3ON5A 3QVXA 1K2WA 2YDYA 4KDFA 4NPCA 5FEUA 3CH6A 5G0SA 2EF1A 1I36A 5FI5A 1EBFA 2FHSA 3EW7A 3H9GA 3HB4X 3QVSA 4JXKA 3UCEA 5MGBA 1KEUA 3DZIA 3SLGA 1HWYA 4BUCA 2ZYDA 2A4KA 2O3JA 1XGKA 4PZEA 3V8BA 2ZYGA 4CM8B 4TZTA 2I99A 3RUDA 4BGEA 2PGDA 4Z3DA 5CEJA 4PIVA 4PFJA 1A5ZA 4UVEA 4ILKA 4W6ZA 4EITA 1VL6A 4OSPA 4YT2A 5IDYA 1PEDA 3HQ4O 1D1TA 3SX2A 4AICA 4CQLB 4DIFA 5JCXA 5JAZA 5JSFA 2JAPA 4TQGA 4FFOA 3OH8A 2JFHA 5TC4A 4RVGA 4CMGA 4O63O 5F1PA 2H5LA 1YOVA 1P33A 3GAZA 1MGOA 1RM0A 1X14A 2R2GA 1KS9A 3EZYA 2FN7A 5A06A 1MFZA 4Z0PA 2VHWA 5ER9A 3AW9A 3JD2A 3CE6A 4HXYA 4LRTB 1I3NA 4ALNA 1PGJA 3VTZA 4DBVO 4D41A 5K0ZA 3OA2A 4PZDA 5A03A 2EP7A 2PZMA 5C7IO 1SB8A 2HK8A 2Z1MA 5BQFA 3NYWA 1HTBA 5IZCC 1LC0A 3T7EA 5B4TA 5EINA 3K73O 4JJIA 4U7WA 3A9WA 4WLVA 1TB4A 5I9MA 1GY8A 2QW8A 2E37A 1TVEA 3LLVA 3D64A 3GPDG 1JN0A 4IGEA 5IFLA 4MJLA 4KWHA 4CMHA 1BWSA 2Q2WA 1HYHA 2WMDA 3TFOA 4YJGA 2OORA 1EUCA 1LUAA 4XQCA 1YKFA 2HRZA 4XDYA 3RFVA 4OM8A 3DR3A 4YA6A 1NX6A 1ZJYA 4ZQBA 1I2ZA 5I8ZA 1E92A 1DC5A 2ZB4A 4YAEA 5L95A 1NPYA 2BELA 4RVDA 4MKZA 1ULSA 1BSVA 2FWMX 1P45A 3E82A 4DQXA 3PJGA 4UUNA 4MO2A 4YEDA 3ICPA 2DTDA 3FWNA 3TOXA 1MA0A 4L76A 1LEHA 3ZWPA 4ZGWA 5TJHA 4JLWA 3RIHA 5I7VA 1YDWA 3KEQA 2VN8A 4F45A 3CTMA 4DA9A 1P9LA 2FR1A 2JL1A 3ROMA 4BKPA 4YQZA 4NBRA 3GZNA 1H6BA 4RPGA 3G0OA 1T2EA 1Q0QA 3W6ZA 2B0JA 5DZSA 4YJHA 2D4AA 1YVEI 2EERA 2FSSA 2Q1WA 1NFFA 1ZUD1 4ND1A 4IZHA 1CQIA 1KC1A 1GFSA 5KVQA 1X7GA 4M1QA 4XYLA 2QHXA 3N74A 2X0NA 3MOGA 3IUSA 4OO3A 5JMPA 4II2A 3UGKA 4N5NA 3K31A 4MINA 4E30A 5B12A 2X58A 3MZ0A 3A14A 3UHAA 1TT5A 1Y9AA 5TSDA 4JROA 4BNJA 3JYQA 4B8ZA 1EZ4A 4A10A 1KERA 1NWCA 2XXBA 1G0OA 1UDCA 1S7CA 2GGSA 3Q2KA 4BO2A 4Y9DA 4E4YA 2OMEA 2W2LD 2JCYA 3D1LA 3ZHBA 5AXBA 3IOYA 4URFA 4J9VA 4CMEC 1MLDA 5F5NA 4Y6PA 4A26A 1O8CA 1E3WB 5JDCA 4ZRMA 3HWRA 7ADHA 2G76A 2J5QA 2EXXA 3CKYA 1SOWA 1T2DA 3G3EA 3Q3CA 1PSDA 1VI2A 3E48A 4BO1A 3FPCA 1LRJA 3Q0EA 1R0SA 3TL3A 3OEYA 4PRLA 3GUYA 5JNLA 2X0RA 4NI5A 1PJ4A 1DFGA 3GNSA 4I5FA 1VJ0A 2D59A 4YJFA 4RVFA 4XDZA 5G0UA 2GN6A 4R9RA 4O59O 4DWVA 3GMSA 1ZFNA 2GZ1A 4RZIA 3PEFA 4BGUA 4IZIA 3Q11A 2WYUA 2WE8A 1E5QA 5GZ1A 2WJPA 3FTNA 3OJOA 2X5KO 4J2HA 3NJ4A 1OFGA 1EFLA 1IHYA 2NTVA 2CF6A 5KJ1A 5HRUA 2IODA 4RPJA 1E1MA 3K30A 3TZKA 5ENVA 1P1FA 4IDEA 1LDMA 2Q2VA 3PHGA 3HFSA 4MPDA 4NBWA 5THQA 3S1LA 2OO5A 3VPHA 3VH2A 4XYBA 3BMNB 1EBUA 4K9DA 3BYZA 3O8QA 2NLOA 4NR0A 4DXHA 2J5KA 3QP9A 2X22A 5L3ZA 4NBVA 2NSDA 3MJTA 4CQMD 4YR9A 3E5MA 3F4LA 5TIIA 1FMCA 3ADOA 2X23A 4GLOA 4YJDA 3TF5A 2ET6A 1VC2A 1NBOA 3W1VA 4YYZA 3WFIA 3TDKA 3RUCA 1CDOA 4WASA 4TRMA 3DBLB 2P4QA 1H9AA 5G4KA 2QRJA 2O4CA 1GYQA 3E03A 4ZVVA 1VRWA 3MTGA 4PLGA 1GZ4A 4OYRA 2YV3A 1R66A 1U1IA 3ENKA 4DGSA 1LBEA 3NT4A 2CNBA 1ARZA 1PZEA 2IXBA 1NM5A 4A5OA 1N9GB 4KOAA 3NAQA 3PVZA 3WLEA 3PGJA 4WCDA 3AM3A 4KUEA 5ER6A 4QT0A 4FIZA 1U3VA 4FBGA 3D5QA 1AHHA 5L51A 2ZATA 3RUEA 3AM5A 3QVOA 2JCVA 1X7HA 3E9MA 2AEMA 3RBVA 4BGIA 2NU6A 5IZ4A 5ADHA 3K96A 1D3AA 4GSKA 4IS2A 3GDGA 3DZHA 3ICCA 4FJ0A 1QV6A 5GY7A 4JIGA 4CR6A 4D45A 1T25A 3GNQA 2PD6A 1UR5A 4E2YA 1J5PA 1LRKA 3EY4A 4OOFA 4X54A 2YHIA 4XJSA 5JFOA 3DAGA 3EAGA 1DIRA 1ZCJA 2EIHA 3VTFA 1OZAA 3GK3A 3KZVA 4HX5A 2X86A 1MB4A 3D5TA 1PQPA 2O2YA 3QE3A 1YE3A 3IP1A 1I30A 1O9BA 1WNTA 2J3KA 3B70A 1XDWA 3V2HA 2Z95A 3H8VA 3PFWO 1JVBA 1NVGA 2GO1A 3AJRA 3QWFA 3WMXA 3INTA 4BVAA 4XRGA 1Z7BA 1R4MB 1KVTA 1B2LA 4MP3A 3GT0A 3JTMA 4CM8A 4CLXA 3ADPA 4YT4A 2Q4EA 3PHHA 4GVLA 5L53A 1Y5MA 2GF2A 1UZLA 2D5CA 3JQ9A 5T5QA 4J16A 3H5RA 1W6UA 2ZTLA 3IJPA 3V1YA 3W8EA 3VVCA 1BG6A 4R5HA 2Y0EA 2IEDA 1Q7BA 5AYVA 1L1FA 2JHFA 1PGNA 1E3WA 4YQYA 4RF4A 3SJ7A 1EE9A 3HDHA 4E12A 1EDOA 1GCOA 4YCAA 4HKTA 1U4OA 2AMFA 4IDCA 3DBRA 1IPEA 3C7DB 5KKAA 1NVMB 3HFGA 1IUKA 5EJ2A 4OHUA 5BT9A 3ITKA 1OOEA 3PXXA 4NFSA 1ZW1A 3DOCA 3AK4A 1HDRA 1EVZA 2GR9A 1GZ6A 1SBYA 3JQBC 2HLPA 4NK5A 2IE0A 1TT5B 2TMGA 4KQXA 1PJQA 4W4TA 3AUSA 2VOJA 2UUOA 3WNQA 1R16A 3C24A 1V3UA 3DZGA 1DAOA 3E9QA 3E6AA 4M54A 3HE3A 1NPTO 2Y1FA 3RSHA 4D3DA 3L77A 5JCJA 2B35A 2EV9A 1PIWA 2I3GA 1XCBA 1HSOA 1Z82A 2H9IA 4JJFA 3KETA 4R68A 2QQ5A 3DQPA 3L0DA 2ZCUA 4R1UA 4IXWA 3ZI0A 3KB6A 1NAHA 4BB5A 1AUPA 1X15A 3WSWA 1V0JA 4CM9A 3ANMA 2J6IA 5JDCC 3VZQA 3BXXA 4WJZA 2WM3A 3ZU3A 1JKJA 4YBZA 1QG6A 2NVBA 3WR5A 2X8LA 2PNFA 3DAFA 4AJJA 1RM5A 3FR8A 3RKRA 1B16A 1Z73A 3CZMA 3DZJA 4CLOB 4MKXA 5CAEA 5DT9A 2HAEA 2PH3A 3NDRA 2NVWA 1GUFA 1IULA 3QIVA 3WMWA 4CM5A 2D2IA 1NAIA 1ZO8A 2JKVA 3G49A 4XX0A 4ZU3A 2CY0A 3ZCXA 3TZ6A 3JQAB 1WMBA 3JQ9C 3GVIA 4WPGA 1H6CA 2J5RA 4BL5A 3TSCA 2GN4A 1P1JA 2E4AA 3MJCA 3EK2A 3UFXA 2V6MA 1N9GA 4QECA 4BKRA 4L4RA 2NWQA 4UVDA 3VKUA 3W4IA 3WOHA 1X0VA 3SXPA 4A0SA 4RDIA 3I83A 4H3VA 3QVTA 4IMRA 1YGYA 3IKVA 1SPXA 4XQ9A 2CVOA 4D79A 4OJNA 1KETA 4MIOA 3JQ8B 4IINA 2BRUA 1U7TA 2V6GA 4E5PA 4I5DA 4RDHA 3D7LA 3NJ8A 1U9JA 3PDUA 4KTTE 1GUYA 2RBEA 3AM4A 3RUFA 5CDYA 5LDHA 3BHJA 3WGOA 1MC5A 2AQIA 1H2HA 5IDWA 3OM9A 5CG2A 3NV9A 3H9EO 1RYEA 3JQDA 1QYXA 1E0DA 2I76A 3G1TA 3HDJA 1ENZA 1FDSA 4I5EA 4TRNA 2UYYA 3PIIA 3W4JA 4RVUA 1PL6A 2H1SA 3WLFA 4BO7A 3ROPA 5ICSA 3UW3A 1DJQA 4JX8A 1ISIA 3R6DA 2TMDA 2VQ3A 4Q3CA 1XQ6A 4GKVA 4IDBA 3VPGA 4J6FA 3PYXA 3W6UA 1XU7A 5FFFA 4DPKA 5JW6A 4J1QA 5JYEA 4IM7A 4UEKA 2B4QA 2C2XA 2CVZA 4FQ8A 3KTDA 2A35A 2W90A 3ROQA 4YAGA 1R15A 2AEJA 2IZZA 2YFQA 3DMYA 4ZQFA 5A05A 1VKOA 4CR8A 3GPIA 4P4GA 1G6KA 1PJSA 3OETA 4R5MA 3WBBA 4O5OA 3NDJA 2DBVO 4D43A 2OGUA 3CXRA 4GLLA 1DFIA 3PK0A 1KIFA 4NBTA 1Z45A 2X4GA 3P2OA 3RFXA 2OHXA 4L8VA 2FOIA 3M1AA 3DZKA 4C4OA 2XPCA 3QWHA 5KCZA 2AXQA 5EERA 1XQ1A 2FR0A 5DP1A 3LC2O 4CV1A 1BTOA 1N8KA 4JQCA 5KJEA 3L9WA 3WFJA 3AOGA 5IG2A 1N1GA 4CLRB 3DBRB 5JAQA 4DPLA 4KP7A 1HDOA 3PWKA 3U09A 4R01A 3CMCO 3RUAA 1MV8A 3PI7A 1VL8A 2G0TA 5KJ6A 2OXIA 1YQXA 5TT0A 1O94A 2ZB3A 1MG0A 1A4IA 1Y8RB 2NVUA 3DOOA 3LYLA 4TROA 2NU7A 5JPIA 3ZN2A 3HG7A 4CUJA 2NQ8A 1U8FO 4CL8A 2O4UX 4EEZA 2BLLA 4OKNA 3IUPA 2OFPA 1K5HA 3ONEA 4CQLA 4O1MA 2PTGA 1MXHA 4Y98A 4DLLA 1DC3A 4FC7A 4Q3EA 4BMVA 4B79A 4TKMA 1E1LA 5ITVA 3NUGA 1FK8A 4RQTA 2J3IA 3I9OA 2I9PA 1P74A 1PZHA 3GRKA 4YJHB 3FBTA 5A1TA 3ZGYA 4BIIA 4MOWA 2GYYA 1A27A 5H81A 4R4JA 2QRKA 1T2CA 1F0YA 1Y9EA 2VWHA 4Q3BA 4R1SA 5C5IA 1YH3A 3BHIA 2RCYA 3A06A 4TWRA 3S2FA 1CEQA 5DDIP 1B26A 4IS3A 5JS6A 2Y1OA 4CM3A 4YB8A 3FSRA 3UCFA 3QV1A 2OUIA 2O7SA 1JKIA 3ETGA 4G81A 2Y1DA 4XGNA 3TFQA 1ZEMA 1EQ2A 1H0KA 1HYGA 2SCUA 4D42A 4XIYA 2E49A 3AFNA 2HK7A 4JN6B 3ZHZA 1A71A 4IQ0A 1RYDA 1OC4A 5IDXA 4C7KA 4CR7A 5EQDA 3PFFA 3RQSA 5L40A 1F14A 4N5LA 4R54A 4Z9FA 4TVOA 1A9ZA 4J7UA 2D5AA 2BFPA 4XQGA 1E3SA 3JQ8A 5L4LA 2B83A 3U4HA 3VPXA 3WYCA 5A9SA 3SC4A 3AI2A 2C7VA 5I7EA 2P2SA 4EZBA 2B36A 1OC2A 4WLEA 1RJWA 3GDOA 2EWMA 1YBVA 1QORA 1WPQA 4IJWA 5TJ9A 1B14A 1R6DA 3KRTA 4NU5A 4J3FA 3GUCA 3KBOA 3EDMA 4RO0A 4BO8A 3RUIA 4UUMA 4AJHA 4RZHA 3EC7A 2PWZA 3OQ6A 3PZBA 5U4QA 1LNQA 3ZHXA 4OL9A 3GHHA 2YHIB 4CM4A 4ZHSA 3MWEB 5IF3A 2GASA 2AA3A 3UOGA 3ZNQA 4B4OA 5KVSA 4CLRA 1QXSA 2Q46A 4CMEA 1HYEA 4S1VA 4Z0TA 2DC1A 2P4HX 1RWBA 4OSOA 3ZU4A 4HADA 4OXNA 4MVJE 1GV0A 1H2BA 2EHDA 3W8DA 1T26A 4PRKA 3SBOA 3D4PA 3F5QA 1CETA 4KDEA 4GX5A 1IHXA 4MP8A 4K1LA 4MVJG 3DO5A 2X5OA 4FPXA 1GV1A 2WYVA 2EGGA 2D8AA 2O3UA 1BRMA 1PU2A 2YQ5A 1DDOA 4INAA 1O5IA 3D3WB 4PVCA 2QIOA 4GGOA 4J4TA 2GCGA 4CLDA 3DTYA 3BA1A 2AQKA 1NQ5A 4RV9A 5KKCA 1ADBA 3TRIA 2RH4A 3PQFA 1VJ1A 4FFMA 1YONA 1QYWA 1KVSA 3NTOA 4CMKA 4QSMA 2A92A 4PG6A 1EQUA 4OMUA 1EVYA 1HDCA 4IQ8A 3D0OA 4GI2A 2IYOA 4DYVA 3PQDA 2DBRA 4KQWA 5L9AA 3LK7A 2GRAA 4TRJA 1UP6A 2DUWA 4OQZA 3VOSA 2AG5A 3O9ZA 3UVEA 4WLNA 1UXKA 2PH5A 4LSWA 4Z9XA 3MOIA 3U62A 2I3AA 3F46A 2O50A 1DO8A 1W0CA 3GG2A 4BNTA 1ZIDA 1IL0A 1ZK3A 4PLFA 4KZPA 3HN2A 4UUPA 3P19A 4NFYA 4CM1A 5JAIA 2DTEA 5A3JA 1R0LA 3ANLA 1WDKA 2C5AA 4BQRA 4NNJA 2B4RO 4CMAA 4DIBA 4OH1A 2GD1O 4AJIA 3GH3A 4B4VA 3KV3O 3D4NA 4UEOA 2IYPA 4YJGB 5C7OO 1HETA 4B3IA 3JD1A 1B3BA 1J0XO 1M75A 3A1NA 1JAXA 4ONEA 3WBFA 2V65A 1IOLA 2CFCA 3BAZA 5MDHA 4K28A 3GC6A 3GZNB 1U5CA 1PJCA 1XHLA 3AUTA 1Z74A 3U4CA 4MVJH 3RC2A 1YQDA 3WGIA 3WXBA 4HY3A 3I5MA 2I6TA 2O3TA 3F5SA 1K6XA 1MUUA 4DRYA 5EPOA 3ZWAA 4RJTA 1U2DA 1ONOA 4NIMA 3PP8A 4HWKA 2P5UA 4D46A 1AXEA 5JYDA 4D44A 1VE9A 1HSZA 3JQCA 5G4LA 4DUPA 4TVBA 1K89A 2UVDA 4ZRNA 2EW8A 4BO5A 4LK3A 1E7RA 1H9BA 3KSZO 1DEHA 5F5LA 1R37A 3AU8A 1QYDA 2ZQYA 3ENNA 4AL4A 5COBA 3PWZA 2ZIZA 1PQUA 1WLYA 3HB5X 5TS3A 4ZJUA 1MFPA 1ENYA 4WE3A 1CERA 1DBVO 1U3TA 4L74A 4E5KA 4XGKA 3OIDA 1YQGA 1PGOA 5TT1A 2HMVA 1B15A 1X13A 4F6CA 3GDFA 4I5GA 1DRUA 1EMDA 1EVIA 3DAPA 1Z6ZA 1KY5A 3GVPA 4YT5A 1ZMOA 4B8WA 4PLTA 5L7WA 2FP4A 1Y8RA 4LVUA 2JD2A 3JQFA 5G0WA 4JCOA 3ASUA 3VHRA 1HDXA 3VKVA 1E1NA 2WDZA 1ONNA 3JQ7B 3E8XA 3DMTC 1KVRA 2Y05A 3RROA 3PHIA 5BNIA 5KNLA 1M6HA 4CM7A 3BMCA 1E7YA 3DXFA 3LT0A 2Y1CA 3H3JA 4FC6A 1E7QA 1A72A 3KHUA 4EYEA 1KEPA 1VSUA 1CJCA 1HRDA 2VHYA 1JDJA 3ZV5A 2E6UX 3LSYA 5U1PA 3U49A 4CMIA 5HTOA 3OIGA 1EE2A 2Y1GA 1NR1A 3F4BA 4RL6A 1C0KA 3I6QA 4J0FA 5DN9A 1L7DA 3QW2A 4I08A 1YB4A 4FOOA 3H9QA 4JP2A 2YFHA 5BNFA 3V1UA 2GN8A 4OXYA 4XKJA 4YWJA 1BXZA 1DJNA 1NPDA 1QV7A 1E3LA 3C1OA 1P44A 1DFHA 5K6AA 2OL4A 4RPKA 1EK5A 1I01A 3F6YA 5ENDA 3OFSA 3GGGA 1DLIA 4Y67A 1BW9B 3L07A 3PIDA 3JQFC 4Z6KA 2VYVD 1X1TA 4Q3NA 2AEFA 2JFFA 2NACA 4IGFA 2DBQA 4RVSA 3WQQA 3ZWNA 1PS8A 4I8XA 4GX0A 2JD0A 2Q1TA 3CSDA 3PYMA 2Q3EA 3I9KA 5G2OA 1W4ZA 2Y0DA 2YY7A 4CMCA 4XA8A 2PK3A 1ZK0A 2UAGA 4LVCA 4PCVA 5DBIA 2Z5LA 1WXDA 4M8SA 1JAYA 3L4BA 1P1IA 3S2GA 2BF7A 3U3XA 5JO9A 1NVTA 1I3KA 1HLPA 4IDGA 4I9UA 3O38A 1QP8A 3ZWYA 1JKFA 3I9NA 4GBJA 5CDGA 4EJ0A 2Y68A 2A9FA 1C0IA 4AVYA 4ZN6A 2PZJA 2XOXA 5F1KA 4LISA 4HFNA 2YQ4A 4PLCA 2QZZA 4IPTA 3I1JA 1J49A 3C3XA 2ZTMA 3JQAD 4TSKA 4UULA 3RD5A 1WZIA 2X0JA 4II3A 1G0NA 4HP8A 1Z75A 1RM4A 1Y8QA 8LDHA 2V6BA 1PJ3A 3GN2A 5AOVA 1Q7GA 3ZWBA 5G0TA 3P5SA 5J23A 3BHMA 2W2KB 3EZLA 3K9QO 4R41A 5A5FA 2DPGA 3DBVO 5HS4A 2D3TA 3WX0A 1R12A 4ROSA 1C1XB 3DONA 2OBYA 3IL2A 1AN9A 3KUXA 2VTDA 3PGXA 5DOVA 2CUKA 2GPTA 2AE2A 2NM0A 4D0RA 1YL5A 1FDTA 3KSUA 5IDQA 2ZCVA 4H15A 1ZEJA 3AY6A 3RBZA 1DAPA 4BNMA 3H7AA 3RC7A 4FSHA 2C29D 4EUFA 1NFQA 3I9MA 3TZQA 3WNVA 4DQVA 3BMNA 1E7MA 4MKRA 1Q7CA 4U0JA 2NUAA 1QLJA 3U4DA 3ZWWA 4YPOA 4WCFA 5JE8A 3UXYA 1B0AA 5AXDA 1LQTA 1IPFA 1HXHA 1GCUA 3O26A 1GZ3A 1Y7TA 3GEGA 3KOUA 4WEQA 3E5RA 1T4DA 2FSVA 3BIOA 4W7IA 1ZSNA 1C0PA 4CM4B 1UAGA 3FN4A 3LVFO 1K6JA 4D3SA 2Q1UA 2PGJA 4A73A 3T4EA 1WVGA 2FRDA 3LT4A 1PJBA 3GZ4A 5DCYA 5KVCA 3QVWA 1IE3A 2NTNA 3GY0A 1PJLA 2C0CA 3RUHA 2BI8A 3FD8A 3ITDA 4J43A 4LRSB 3I23A 3TOZA 5LCXA 1ZXBA 1PZFA 1QLHA 2UDPA 3GVHA 3H3FA 3E1KA 1UP7A 3GMDA 3I9JA 3I9LA 3ZWCA 4FW8A 3INRA 3DEYX 5KTKA 1V9LA 1E5LA 4E2ZA 5FYDA 1CQJA 4B4WA 4NDNE 4FFPA 4BHTA 4PG8A 1HL3A 1DC4A 4RPHA 4F6LA 4ESOA 5THKA 3A28A 3GLQA 3CEAA 3PJFA 5JXWA 1XR3A 2YV1A 1W8DA 1EDZA 1T2FA 4M87A 5TRTA 4IDAA 3O8QB 3WG9A 1P31A 4MIEA 2FZEA 3ZWVA 1PTJA 5T64A 2FY8A 2OBNA 4D0SA 1PL8A 4MDHA 1YBAA 4J7CA 2FR8A 3N58A 2W98A 3M6IA 2VRCA 2X1HA 1BXGA 4FS3A 5T8KC 3STHA 4R51A 1LX6A 3JQGB 3DHYA 3G79A 1AGNA 5EESA 1AHIA 3FBGA 5TX7A 3OJ0A 1NP3A 5IXYA 3M2TA 2XF8A 3ZV6A 1KBZA 2HQ1A 4YRDA 1R4MA 1DPGA 2O7QA 4AFNA 1OAAA 1UXGA 3WS7A 3ZZNA 1XIVA 3X2FA 4LMPA 4BNHA 1E7WA 5L4SA 1SEVA 4ZD6A 1Q2XA 2R00A 3T7CA 1C1XA 3VVBA 5AVOA 2Y1EA 1UZMA 1LU9A 3JQ6A 3RU9A 2WYWA 1WMAA 1Y5RA 3V5NA 4EW6A 3K2EA 3FTPA 4WECA 4NJMA 3TWOA 3EVTA 2J8ZA 2WTBA 3ZNOA 4BKQA 2Z1NA 3BZUA 2ZYAA 2ZTUA 1RPNA 3Q2IA 3ZNPA 4NH4A 4YT8A 4CMIB 2NV6A 3KLMX 3JQGA 3N7UA 1RKXA 2PD3A 3OSUA 1HDGO 4RGBA 1SNYA 3LC1O 3F9IA 5COQA 3S8MA 3KM0A 4BNKA 2F00A 2B5WA 5HWSA 1Y81A 4O0LA 1R4NB 4CMBA 2VOEA 3HNPA 4BO3A 3DDNA 3RC9A 1B8VA 2NNLD 5A04A 5BR7A 4E5MA 3L4SO 5CG1A 4QEDA 2DTXA 1VPDA 4XB1A 5GZ3A 5TLSA 2I5PO 4PG7A 4NZ9A 3FWZA 1ML3A 1SEPA 4B3HA 1LLQA 4J1TA 2HK9A 1ZSVA 2P9EA 4XYMA 1XU9A 2EW2A 2PKQO 1FDVA 1YB1A 5EQFA 1E3IA 4BNIA 1HDZA 3B1KA 3ONFA 5ILGA 4IDFA 3VDQA 1XG5A 4TRRA 5JCJD 2LDXA 4F3YA 1IY8A 5IN5A 1GQYA 4DMLA 5A9SB 1KY4A 1YWGO 3ETEA 3OMLA 2YZ7A 1GL3A 2C54A 3WDSA 4IDDA 5TGDA 3ZHYA 2WWRA 4E31A 3BMQB 3PWSA 3RI3A 4NU6A 4CM6A 1QKIA 3FRJA 1HZJA 5G0VA 4E0BA 4XEHA 4CQMB 4U6QA 1ISJA 2ZJ0A 3H9JA 4HNGA 4CJXA 3DFUA 1LLDA 4MVJA 4W99A 4ALIA 4YACA 1ADFA 2CVQA 3QQPA 1GEGA 2DVMA 1N5DA 1K0UA 3VZRA 4BGVA 5IAAA 3QLJA 2AW5A 3UF0A 4DBZA 5I8WA 4EUEA 3KSDO 2C59A 3ZV3A 1ZH8A 1DIHA 4EDFA 5B4UA 3AY3A 4GPD1 4ITUA 1LC3A 3JYOA 3WGHA 4KTVE 4U6SA 1GUZA 5BSHA 3WJAA 5JY6A 3KXDA 4BV8A 2O48X 3COSA 2XAAA 1YS4A 2YDXA 4IBOA 3DOJA 4FOSA 5JAMA 1H6AA 1MG5A 2WE7A 3C1AA 3GEMA 4GH5A 3U4IA 5ES3A 7MDHA 3ABIA 4XJTA 2DFVA 2UV8A 3GGPA 3K92A 1K3TA 1JTVA 4WNIA 3JD4A 2DAPA 1DXYA 3H5AA 1ZZEA 3HHPA 4PZCA 4GGPA 1T2AA 2WD7A 1WDLA 1XELA 4Z0HO 3H2ZA 4NQZA 2PLAA 4UEJA 3FI9A 4GL4A 2ZK7A 3DZBA 2IDZA 3WGGA 2ILTA 2POQX 3WB9A 1I10A 1NQTA 1B8UA 3WGQA 4PLWA 1SOVA 3UKOA 3LLSA 3QRWA 2BFMA 4FFLA 4QFDA 4LSMA 1O89A 4DC0A 1TEHA 3K5PA 1NTOA 3AFMA 2DUUA 4XIJA 1ZJZA 1P1KA 2PKQP 3TQHA 5KIAA 1PGQA 1E3JA 1OBFO 2EEZA 1EUZA 3M2PA 4UREA 4WUVA 3V1TC 3KYCB 4L4SA 3OHSX 4LGVA 3JV7A 1A7AA 1EFKA 1UH5A 1YJ8A 1ORRA 4R1NA 4CODB 1OMOA 2IZ1A 1XKQA 1DC6A 3HADA 4PLPA 4B3JA 4G2NA 5F21A 4QO8A 1GR0A 4M89A 3EMKA 2ZTVA 1A4UA 1DOHA 4MVJI 4P4NA 4BQPA 2P9GA 2VTEA 4WNCA 2VYVA 5LDGA 1D1SA 4AJKA 3HUDA 3I4CA 4LN1A 4EUHA 3TNLA 4GAEA 4YXFA 4XRRA 5CPFA 4MIYA 1Y1PA 3I4FA 2Y93A 1KC3A 2VHXA 1LLUA 1U3UA 3GRPA 3S2IA 4ALKA 1LJ8A 2G1UA 3ANNA 3H9UA 1U28A 4IMPA 4UVIA 1WWKA 2BD0A 4CUKA 4QQRA 2W8ZA 4JBGA 1LRLA 4IQGA 4RF2A 2GZ2A 4YDRA 4OOEA 4Q3DA 2EGHA 3FHLA 3S55A 4D7AA 1VM6A 4M49A 4B7CA 2WSBA 2DPHA 2DLDA 1TXGA 1P77A 1UDBA 2VYNA 2QYTA 2VT2A 3ZW9A 1I2CA 2CDBA 3VC7A 2ZB8A 3INGA 3PJEA 4OAQA 2QG4A 1G1AA 1M66A 1YDEA 3JQ7A 4IJUA 4LW8A 1F8FA 2QRLA 3LU1A 3WIDA 1HE4A 3GAFA 4DPMA 2D1YA 4BMNA 1UXHA 2BFAA 1GYPA 3BMOA 4DREA 3NT5A 1GPJA 2GN9A 1MXFA 3ASVA 3BMQA 2BKAA 5AXCA 3S2EA 4XR4A 1LDNA 4NBUA 2IZ0A 2VHVA 1S6YA 3FNHA 5ILOA 3VH1A 1BGVA 1BXKA 1LTHR 4Z9YA 3WTBA 4TMFA 2DQ4A 2RHRA 1ISMA 1K6IA 1C0LA 2CF5A 1O95A 5H82A 5T6BA 2DU8A 3X2EA 4YAKA 3GA0A 4ND3A 3ST7A 4WLOA 3GFGA 4WOJA 4PLZA 4ZQGA 1ADCA 2W2LA 4NHEA 4CL3A 1ENOA 3MWDB 1JQBA 4AJPA 4PG4A 5ITWA 1V6AA 4P38A 2C07A 5T57A 1HE2A 3CIFA 1QSGA 1UUFA 1YL6A 1I3MA 1LDGA 1ZK2A 2VWPA 3KVOA 4HBGA 4RQUA 2VZ9A 1GPDG 2J3HA 1QMGA 4LMRA 5L7TA 1DIAA 4W9NA 5LC1A 1BXGB 4Y6RA 4N54A 5DCWA 2JAHA 1NXQA 1U5AA 4RPLA 4XR9A 4E5YA 3U0BA 2I67A 4R69A 2YJZA 2H6EA 4AJ4A 4DLBA 4GWKA 1YOVB 4WCFB 4NK4A 5I7SA 1GU7A 1DB3A 4GWGA 4A7PA 4YVFA 3JQBA 5EN4A 2HCTA 3UUWA 1DRWA 5TF4A 1LDBA 1ZMTA 1SCUA 4XQEA 3KO8A 3D3EA 3WGYA 3JSAA 3JYNA 4CQMA 3DHNA 1XEAA 3VDRA 3WQSB 4M55A 3C7AA 4HFMA 1ONPA 1T1SA 1SAYA 2JJYA 2VUUA 3OICA 4BNXA 4DMMA 3LF2A 1D8AA 1CRWG 1F12A 2Q4BA 4QTZA 4W82A 4P22A 3DBHA 1CF2O 1PS9A 2Q2QA 1H93A 4J7XA 4PLVA 5KJFA 3F1KA 4E3ZA 1HT0A 2HRBA 1N2SA 3ZU2A 3KYDB 2RHCA 2RIRA 3FCOA 2HJSA 3IIEA 3L6DA 1WP4A 3IC5A 3JCZA 1N92A 2JD1A 1EVJA 3FNGA 3K8ZA 4BB6A 1V8BA 3MEQA 4E2WA 2LDBA 4RF3A 2PR2A 3BMOB 1LSJA 4QX6A 5CEEA 3AOEA 1OI7A 3OJFA 1ENPA 3GOHA 4LCJA 4WKGA 5BSFA 1ID1A 2H63A 1EUDA 2X9VA 4DTIA 1O6ZA 1VSVA 2G17A 3QSGA 3JQEA 5KOIA 1XYGA 1VL0A 3LZ6A 1LSUA 4CLOA 4R9SA 3NTQA 3L6OO 2AQ8A 3ZNNA 4J49A 4TKLA 3NGXA 5EIOA 4A2CA 1DLJA 1W73A 4CPDA 4BO6A 4L0QA 4KMSA 1HKUA 1VKNA 4P4LA 2RAFA 3QWIA 3LT1A 1FXSA 1T4BA 3OBBA 3OP4A 3PYLA 3WSVA 4N7RA 3NT2A 4XZ3A 3RBXA 1TI7A 5C7LO 1I0ZA 1TA4A 1C1DB 2Q50A 4C7JA 2P9CA 1I5RA 3QWBA 2ZJ1A 1VJTA 3MJVA 2VRBA 5DBFA 3DBHB 4YRBA 2X7HA 3F3SA 1C1DA 4ALJA 4EJMA 1LDEA 3B1FA 1JW9B 3Q9UA 2VYND 4HUJA 4OGWA 5FF9A 4BNYA 2O3RA 3Q6IA 1PWXA 5B37A 5T67A 2HMUA 3NRCA 4BNWA 1CYDA 1HEUA 3GF4A 4U5QA 4XWYA 2Q49A 1HE5A 2VRCD 3KYBA 4WGGA 3ROKA 3TL2A 1GDHA 3KYCA 3ZWXA 3EGOA 2PZKA 5COAA 1SB9A 2DT5A 3GG9A 2AHRA 4B7UA 1GD1O 1HE3A 1JA9A 1HF3A 2C7GA 2EKQA 3TJRA 1NWHA 1B8PA 2NU8A 3DL2A 4FB5A 4L75A 2P91A 3LQFA 4Q9NA 4R1TA 3SJUA 4BKUA 1V3TA 1LA2A 2FMUA 4R16A 4QUKA 1JWBB 1I2BA 2HMTA 2WEKA 3L9XA 4IIUA 1GTMA 1PJTA 3WIEA 4BO9A 4PN3A 3WGTA 4CM9D 3BTSA 3RWBA 1E6UA 2BGLA 2AE1A 2HSDA 4QXMA 4A03A 3EVNA 5JO0A 3AI1A 3PLNA 4RF5A 4CV2A 3FR7A 4GQAA 4JP3A 4E5NA 5IZCA 1RM3A 3C8MA 4ALLA 1B7GO 3IKTA 2EP5A 2VCYA 4E6PA 2EJWA 1C3VA 3MCVA 3PPIA 2F1KA 3A4VA 2PFGA 4FJ1A 1ZK1A 1HZZA 4ZQEA 4E33A 4J91A 3VH3A 5H83A 4BNNA 4RCVA 3ZU5A 3D4OA 1ZBQA 4J1NA 4AG3A 3PHLA 4BNVA 2P68A 3IMFA 4BNUA 1PZGA 2YW9A 2DKNA 4OKIA 2D0IA 5CHEA 1KEWA 3FNFA 4J90A 2IXAA 4DVJA 5BSGA 2QYSA 3Q9NA 3MTJA 3C1TA 1XLTA 3OECA 3RKUA 1ZKMA 1VLLA 1BHSA 4PG5A 3ETDA 3WGZA 3Q1LA 5CPBA 1GQ2A 1JU9A 3W8FA 3RVDA 4JGBA 1FDUA 4R3WA 3DHEA 4EJ6A 1P0FA 4PGFA 1KVUA 3I52A 3I6IA 3DZFA 4W7HA 4RLHA 3ZW8A 4F46A 1LQUA 1R0KA 3GQVA 3L6EA 4FGWA 1NHGA 4IIVA 4WEOA 3C85A 4OIMA 5FI3A 4DC1A 1ULUA 4EBFA 1FJHA 1CIVA 2Q1SA 3E9NA 2X5JO 4R3NA 4DLAA 2JHGA 1E77A 1SC6A 5I7FA 2AG8A 2PA3A 1WDMA 4J1SA 3MJ4A 4HFRA 1YJQA 3MJSA 3H4VA 1Q0HA 5GMOA 1PS0A 1TLTA 5JBIA 4FFRA 1Y8QB 3GEDA 5A9RA 1X0XA 4DL9A 3DBLA 1PGPA 4NFHA 2EJVA 2GNAA 5A5EA 3DB2A 4N18A 1E6WA 3GVXA 5HM8A 4AJ2A 3WQRA 1U2GA 1M67A 1M6WA 2O3SA 2VWGA 3IAHA 3TN7A 3GHYA 2GDZA 1J6UA 1MC4A 3H6KA 5T8KA 4CUZA 1I32A 1UJMA 2HJRA 1ISFA 4WCFC 1L7EA 3RJ9A 2HKIA 3ONDA 4J4BA 4L9RA 4ND5A 3ZV4A 2PKRA 1IYZA 4FGSA 5JDIC 4I1IA 3GGOA 2BI7A 1H6DA 1E3EA 2GLXA 1BMDA 1NR7A 5JC1A 4W9NC 2PGLA 4YTEA 1HDYA 5A9TA 2BGKA 5L4NA 2V6FA 1AXGA 4HFJA 4N5MA 4B7XA 3PLRA 1NASA 1Q0LA 3WTCA 2WD8A 2NU9A 4JBHA 2R00C 4BOYA 4A27A 1YL7A 4KUGA 2A94A 2P5YA 4BS9A 4Z3KA 1B3RA 3TZCA 1QRRA 1QR6A 1F8GA 1ADGA 3FPLA 2DBZA 4NJMB 3QJ5A 1MX3A 5AQ1A 5I9NA 5IXSA 1A7KA 3EYWA 2J3JA 3WWZA 1DRVA 4DIOA 3V2GA 3H2SA 3IQDB 5JMWA 2FPIA 2FPGA 2IEBA 2C20A 2EKLA 1P0CA 4H7PA 1WZEA 4BNFA 3NEPX 1D7OA 3HSKA 1TT7A 2CMDA 3M1LA 2EKPA 5K6AC 1JVSA 4GMFA 4EEXA 1A9YA 5JDIA 1I3LA 2BGMA 2NVUB 3RAJA 3E18A 2IRWA 3O4RA 2YUTA 5FWNA 3PRJA 4GMGA 3DC2A 3AOEC 3VZSA 1M2WA 3B1JA 3L4BC 3UAGA 4B4UA 4QFCA 1BVUA 5TNXA 5HBRA 3K2BA 2HO5A 4RVHA 1P1RA 3C7CB 3CPSA 4L4XA 5KJCA 1YBMA 3GN1A 4ZQHA 5BSEA 5JC8A 4J4HA 1NYTA 1LXCA 4UVHA 3R3JA 3AU9A 3OQBA 1E6EA 4IJKA 5B1YA 2CZCA 1U8XX 4WLUA 2YV2A 1JLLA 3HDQA 3WYEA 1XA0A 2BFOA 4HNHA 4WLFA 2QX7A 2ZB7A
chains in the Genus database with same CATH superfamily
1JHZA 2OO5C 1L4MA 1T1RA 2H1WA 3T99A 4HYEA 1CQJB 4XD7D 1BE8A 4KV9A 1CEYA 2ID8A 1BDMA 1QZ3A 1WSDA 2F9MA 2YS7A 5JSYA 4AFNA 2JLUA 1L5KA 1IMJA 3A31A 3F47A 1RRGA 2X9NA 1O6BA 3NIDB 2VUSA 3PCXA 4J75A 3X2SA 1QH8B 4KQ1A 4CV0A 3MMSA 2JFOA 1NC1A 3CINA 3EEFA 1E94E 4UAGA 1IJEA 1QZUA 3H6GA 1KEEA 3TQCA 5JBQA 2O1WA 2FCRA 3JRNA 2AR9A 4AO8A 1GZDA 3GD5A 3HPRA 4YAJA 2C2YA 2B25A 3NDIA 3LF1A 4CCSA 2CCGA 3LX8A 3ET4A 3R0VA 5IJ9B 1TYAE 5KSOA 1WETA 1KYWA 3EUWA 4JJ6A 2PSDA 2FZCA 3C97A 3QFHA 4P8RA 3PRKE 4TS9A 1F0KA 4UASA 1GEEA 2GBGA 4Y8VA 3SS9X 1QNLA 4LC1A 4B6GA 4G1MB 1E1QD 2TECE 5K3FA 4P36A 3EULA 2JLSA 3PNLA 2BUBA 5ALGA 2F48A 1YUNA 3OQMA 2PL3A 3H1EA 5LBIA 4EI9A 5JLAA 1XRQA 1MT3A 1XBTA 4IDOA 3AUAA 1ZSYA 3RHSA 2VDOB 5B1HA 1V16A 1UXJA 4YC7A 2C03A 2XNCA 4EQZA 3L7MA 3DWFA 1G5TA 3HDVA 4RBNA 5KMGB 1J70A 2YYYA 3TOCA 2VDQB 1X1SA 1E5TA 3GGDA 2Q9BA 4MR8A 1PZMA 2X6TA 1KJJA 4ZANA 4RTJA 1E9SA 2DB3A 1P6QA 1H5QA 2BR3A 5I8PA 3C3BA 1KOLA 1F0PA 3KSRA 3W5HA 1L1QA 3UJAA 1OREA 4EQ6B 2CL6X 1SQGA 2O3QA 3GLFB 1I3CA 2G82A 5T6MA 1ZNYA 5F2EA 4ZQIA 1WBBA 3SVTA 2I6XA 3UICA 3B2EA 3U81A 4F9GA 3EIEA 1JWAB 3JR7A 3OQIB 1S0UA 1KI7A 1VYHA 5FBLB 2ZS7A 3V32A 4D8XA 1JR6A 3F5FA 3AESA 1N7GA 4FDLA 2V03A 5EP3A 3BKXA 1E2MA 3JD0A 4IXTA 5AUOB 3HWSA 4LXQA 3HI4A 2GT1A 2CXSA 2OUKA 4CZ2A 3VR6D 2ZSFA 3EEIA 1XWFA 1VOTA 2QB5A 1P18A 3K0KA 5DBGA 4IKPA 4MMYB 3W4KA 1D4FA 2HWKA 4AYTA 4MB6A 4Y0VA 1S3SA 5BV8A 2CDCA 3G2IA 1WABA 3HC7A 4HQLA 4RHYA 3SD7A 1FVOA 3THXA 2ECPA 3QEAZ 2Q3MA 4BV9A 2HU5A 4MTLA 1DCMA 1MJ5A 1NN1A 1O6FA 3V8EA 1P62B 1KVQA 1YKGA 1YRLA 2HW8A 2QR3A 3GLTA 1YQTA 2IK8A 1H2EA 2JH9A 1U28C 2P9JA 1GQQA 4G5OA 3GFPA 1IB6A 2QD4A 4KMOA 4RSGA 1BH6A 1PE0A 3NWJA 3H18A 4R1MA 5DCUA 1GU1A 1ZK4A 3Q0TA 2CD7A 4PHGA 3L1KA 1L5FA 3A7EA 4FR5A 5C81A 5ELLA 2E2WA 5HMLA 5T41A 4EHNA 1XN1A 1SUAA 3QWAA 3QXSA 4IHJF 3TI7A 3ZBPA 1BHO1 3H65A 5DULA 1X7XB 3OBIA 4F3RA 1P1CA 3GR6A 2V74B 5EFOA 1Q57A 3BBLA 2IOHA 2R7KA 4BYMA 4TV8B 4CQJA 4F5EA 4Y0AA 1OYYA 1YI1A 3D3WA 4XCVA 5IT9A 2BVNA 5LNK6 1Q1ZA 2YY5A 3I45A 2GK4A 3JD3A 3JRXA 2O07A 2WSSD 1VA5A 2YJ6A 2F1IA 5KYVA 1U4SA 3JXEA 5LLTA 2NYUA 2AHOA 2Y99A 3O92A 3Q72A 4MVCA 4WOKA 5KMGA 3HA5A 2YXDA 2HBZA 2WF8A 5IN4A 1HO3A 2ZI6A 5E38A 3WJ7A 4DANA 1PTJC 3GJZA 2QZSA 4JS0A 4Q3AA 1XZQA 3NHSA 2MJLA 3F73A 5E6SB 1KS2A 3CX8A 1PWHA 4RDCA 3ZWMA 1MIHA 1PK8A 1NUHA 2AK2A 2VSXA 5EMLA 4BIMA 5K4HA 1I2DA 4MQ6A 2GZ3A 3ZD6A 3P94A 3DVAB 1P4GA 2TS1A 3OPYI 3UMCA 5D87A 2EZTA 4TMYA 2FF5A 1N7JA 3MSXA 2JI7A 1ISGA 3UQYS 3EPHA 1W5BA 2QWXA 1T0JB 3PQEA 1OXUA 1V3VA 2C4UA 4QGHA 4F9FA 1PJ2A 4AJOA 4FFNA 1GLGA 5EMHA 4DVGA 1PSWA 3OA0A 3QU2A 1WB4A 4JOBA 3DW1X 1XKTA 2FPPA 1YR3A 5K8JB 2IOYA 3SHQA 1ODLA 5EUBA 2ZI9A 1P72A 5C46F 4WZBA 3EUAA 1SA0A 3OIFA 1T8UA 5L3QB 3WYDA 2CNLA 2Q6TA 4IDNA 2EFEB 2PBRA 3CGWA 5CYOA 4FCCA 2NAFA 3JYPA 4XDGA 5GP1A 5EWLB 2H4FA 2JFYA 4D8WA 1EXWA 4F04A 2JLZA 4UUOA 1ZR2A 2XIJA 1GGKA 4AZTA 4Q4AA 3MBOA 1CR6A 4B75A 4KL8S 2W2KA 4NJOA 4JKYA 2G4VA 4LJRA 2BM8A 3FYUC 3IURA 1ECCA 2VJBA 3IPRA 1D2HA 3IIIA 1TKBA 2PG3A 3Q8WA 5A02A 4P0QB 5AW8A 2C3YA 5IJZA 4MVJD 1U5BA 1DSSG 3ZR4B 3SX4A 1O7JA 2RAUA 1U3DA 5CT9A 4CMJA 4DSAA 3P71T 1X94A 3UN1A 1MAVA 2PKCA 1I8TA 3DF7A 1GL7A 5FT9A 5HZKA 2ZQZA 3GVCA 1C7JA 1G38A 3W7BA 5HPYB 2G80A 2AOXA 2C92A 2IZ6A 2VPWA 3AF3A 3FNEA 4RKQA 1QPBA 1XNQB 3JARA 4J3NA 4PGHA 2F3SA 1GDTA 1CWUA 1XPJA 4INOA 1CEEA 4QO7A 3KSMA 3EGWA 3L7OA 1CKEA 3SS8A 3ZDAA 5CBPB 3O2SB 3WK4A 4IDPA 2VI5A 3WL8A 2VHUA 1AS2A 2Z3VA 2OBFA 3MXTA 4MV4A 3KYIB 1FQWA 4JB0A 4GE0A 4B3GA 2IT1A 1G17A 1S9HA 2J9FB 2Z43A 4BNZA 4K87A 3L8YA 3HS3A 3LUPA 1RMQA 2D74A 4IIXA 4WBXC 2UUCB 4EG6A 4UC0A 1U98A 5LU8A 1DDGA 2OYSA 5CDTA 3V1LA 2WIKA 5CDFA 4EWLA 5F1OA 3SYRA 3SC6A 2NQTA 1W48A 4MVJM 5A4DA 2AW3A 4RMIA 5KQPA 1ZH0A 5HF9A 1JHRA 3HJAA 1LWNA 3OURA 3V7YA 3N0RA 2WJ4A 4J0DA 2OHHA 1VECA 1DJLA 3G9XA 5KNCH 1MEEA 2FX2A 4RS4A 2P67A 4MV9A 2BFDA 4QRDA 1W25A 1PR3A 4X7BA 4D2IA 2CFIA 4MRSA 4N1AA 3TIXB 1ZNQO 3P2KA 1CBUA 5TQ0A 8ADHA 2PV0A 3IALA 1THMA 4L2IB 2G1PA 4HCJA 1N1EA 3FX2A 3U7EB 3F98A 4RTPA 1OB5A 2BGWA 5TF0A 1CZNA 3PTZA 1QTRA 1EESA 1L6RA 3T3NA 2J46A 1KQGA 5DF1A 2ADOA 1P2FA 1M76A 1IBLB 2FWNA 5DOZA 4AWBA 5HGXA 4G23A 4ZKDA 4E1AA 3HNOA 1F17A 3K2IA 1SKAA 4NICA 2AQHA 4YUVA 3T5BA 3JWPA 3FTFA 1QVZA 3MN1A 1QH9A 2HUNA 3RIXA 3S70A 4JVSB 2ZYHA 2CGEA 2IPOA 3BMCB 1FYDA 4P3OA 3FNQA 2Q45A 4Q5IA 1SUPA 3B7PA 3FTEA 1U2DC 4KWIA 2QUBA 1YB5A 2XAUA 1I3OA 2NZ8A 3OQHA 3RR2A 2XF2A 1K2WA 3BRCA 3R41A 5CB4F 4NPCA 1R5BA 1V2HE 1L4LA 1MCZA 3HMKA 3FSGA 3ECCA 3M4ZA 4J76A 3EW7A 3UWKA 1GVNB 3HB4X 1I9CA 2IUYA 4JXKA 1C29B 3QTLA 4AKGA 1KEUA 1G20B 4IIJF 4MQFA 2ZSBA 1HWYA 3CTPA 3SLGA 1IN5A 4BUCA 2QV7A 4N0MA 4DMHA 4BXOB 2WTUA 3GXOA 4K3UA 2RC5A 2I2XB 3OU7A 5HEKA 3N2GA 4FKZA 3TTWA 3V8BA 3B2NA 2J59A 2ZYGA 5EJEA 2I99A 2ZLBA 4IV0A 2PGDA 5DI3A 3WGMA 1W2HA 1YE5A 4PIVA 5AHXA 2R97A 3SS7X 5CEJA 4I4TF 4PFJA 3RVSA 1DOZA 1N0IA 1VL6A 3MAGA 4GO1A 4OSPA 4I4CA 4UBMA 3NIFB 2BSAA 1L3IA 2ERXA 1PEDA 2SKCA 1D1TA 2WUDA 3BIJA 1DTWA 1RJ9A 3A58B 3SX2A 4AK9A 4CQLB 4DIFA 5JSFA 4OTZA 1R7RA 1VLQA 3D31A 4QXRA 5KS2A 4FFOA 3ORYA 1WY5A 2JFHA 3BD8A 4NCBA 2CHFA 2NMVA 3OIYA 4WBNF 3UAOA 1R00A 3RC3A 1TDJA 1VHWA 3LPCA 1E98A 3WKCA 4H7KA 4RA6A 4B76A 4X1YA 5CW2A 2P3QA 1MGOA 4AUEA 1QYIA 5SV2A 1EFVA 3EZYA 4JYMA 4MWTA 4BV3A 1YZFA 4OXXA 4DN6A 3JD2A 1VCIA 3CE6A 4LRTB 5D1HA 1I3NA 1OAOC 2BGRA 5K01A 1PGJA 1CUIA 2GQ0A 5EUMA 1ZDMA 4U7HA 4AX4A 2BEKA 2KQUA 5JQWA 3PD0A 2PZMA 2GHRA 2HK8A 3EY9A 4KN6A 3ERCA 1L4BA 5BQFA 2QPTA 2VF7A 4ND6A 5TQJA 3G7SA 4YRMA 2IYUA 2P35A 5HFAA 3D7SA 4BN0A 4FLEA 3O94A 4I8IA 2F1RA 2CUNA 1Z88A 4LEIA 4MUBA 1EFPB 1FQKA 3NU1A 3UJDA 4C5BA 1EUQA 3EEQA 5J4VA 4PYIA 2E37A 2ABWA 1JVNA 1NN3A 1G5PA 1V25A 2JCGA 2P0YA 4H4DA 4IJMA 4L28A 4RIGA 2PJRA 2O9JA 1L5VA 5AJVB 1XRNA 1JN0A 1Z39A 2GTPA 1TU3A 2OCIA 4NCIA 1YT5A 5B58T 4YMIA 1C80A 2QQGA 3D7RA 5IFLA 1RACA 2Q2WA 1A98A 2YV4A 4EH1A 4NDZA 3VHXB 4X6YA 1D09A 4YJGA 3NFRA 2X19A 5FOXA 2GEFA 4IZ6A 1T43A 2C00A 2HRZA 4YA6A 3DR3A 4MRNA 4TQAA 2R25B 4I8DA 1I2ZA 2WPDA 4F8EA 1DC5A 1Z4IA 2X9LA 1Q0ZA 1X8JA 3E22B 2A9RA 2CDNA 3O4JA 3CVYA 3FNIA 1J99A 4D02A 3H4TA 2YQZA 4HLNA 3E2MA 5CJJA 2DWOA 3TJMA 4EDHA 3PJGA 3X1KA 4UUNA 5B2FA 1MIOA 3OZIA 1C3EA 1E2DA 2G9QA 3FWNA 4LVOA 2EGUA 1LEHA 1KQOA 3BWDD 5CXXA 2HPVA 1G9TA 2R44A 4JLWA 5LU9A 4EFNA 5A3SA 2G36A 2FR1A 4A5SA 1GNQA 2Q3BA 1M8JA 4ABTA 4DC9A 3NP9A 4MXDA 3M34A 1JDVA 4YMHA 4N48A 4EEKA 3Q6MA 2J0QA 3SLRA 3NRBA 2A9JA 3A1TA 2BFEB 3G0OA 1BA2A 1T2EA 1W2GA 2R6R1 1JU3A 1VHTA 2CLLB 3EXHA 3U61B 2XZLA 2Q1WA 1X7ZA 2FSSA 2XNDD 2JIDA 1GKUB 4NZPA 1ZUD1 5KU1A 2GTHA 4JH0A 3QLUA 2ZI3A 1IEVA 1MB3A 3HLKA 3OTQA 4LBYA 5DRTA 5LBTA 5TR9A 3ZTWA 4AJ9A 2MMGA 5TPZA 3Q3VA 2FK8A 4XYLA 4UPDA 3KOZA 4RK6A 4FZVA 2HU7A 2ISQA 3ZJ5A 2AOUA 1NG1A 1SXJE 1X9GA 1TECE 1JG1A 2JB9A 4MINA 4BFYA 4E30A 2QNBA 1TTHA 4WW0A 4TYYA 3A14A 3AL3A 1JF8A 4LMBA 3UHAA 5C8XA 3I01M 1R18A 4JLVA 1Q3TA 1RLJA 1X8XA 4B8ZA 4AI6A 4KBFA 5B2ZA 4A10A 4ZYZA 3HEBA 4RK5A 3SY8A 3TECE 2XMBA 5FHQA 4BASA 1V9CA 2OYRA 5KZMB 5EQTA 1THZA 4D4KA 4BE9A 4PX5A 1W5FA 1S7CA 2BZGA 4BO2A 2B82A 3RVPA 4EBBA 5HGJA 3ZWQA 3LMKA 3OLCX 4UD6A 1A96A 1Z2PX 2BEJA 3CQ9A 3E2IA 4ZO9A 4GICA 2O8NA 5AXBA 1JFTA 2XGJA 3N07A 4HAYA 2ZDGA 1ZAKA 5F5NA 3VISA 2XVZA 4IZOA 2CSXA 4HDKB 4D4JA 1D6MA 1SURA 3L0PA 3LL4A 1JXOA 5JWRA 4AQDA 5EE1A 2GPNA 3MERA 4P0TA 3DZDA 5FADA 3DMNA 5K3EA 2CHEA 3W90A 1XDZA 1T2VA 2AOWA 2P1RA 4BO1A 1AKYA 1GGMA 3TL3A 1J2YA 2JH3A 4U2KA 5FPYA 3AJEA 2X0RA 1FFAA 4NI5A 5JSQA 2IX3A 2G6BA 1VBKA 1SUBA 3NKFA 3O74A 5ECWA 1VXOA 4I5FA 3AFIA 3F97A 2IHBA 3JWHA 3NJRA 3OZXA 5LA6A 1MQAA 3KVRA 3WBJA 4RVFA 3DLBA 2J6HA 5JHHB 2QN6A 1X7WA 3G0CA 1FBTA 2XYVA 4KQMA 3Q7IA 4M9ZA 3NM6B 2AWNA 3U3OA 4DWVA 3GMSA 1Y9DA 2JDIA 1Z15A 4TGLA 5LKRA 2WRZA 1OROA 2Y2VA 3QF4A 4RZIA 4A6EA 4IZIA 4GM1A 4KKVA 4KPFC 3Q11A 3DXXA 1H9CA 2WE8A 1Z4PX 1QGZA 3NVAA 5GZ1A 1A8QA 4Q9AA 2CJWA 3EASA 3L8FA 4V39A 2EZUA 2ZJFA 3MCTA 4GMHA 4BX0A 1SCJA 2BGUA 1EFLA 3CB4A 1YR1A 4FYMA 5HRUA 1KXJA 1QFZA 2WJ3A 3PQ5A 4RPJA 4V24A 3QMWA 1MABB 2XB8A 2PZAA 4ZVQA 4TWBA 2IEZA 4ZPJA 1EK1A 1YRWA 4IDEA 4XLZA 2VRWA 3HFSA 3V8PA 4XYBA 3CF4G 3BYZA 3EVFA 4DSOA 3ZK8A 3N9IA 2AUNA 1V5FA 3ETCA 3JQQA 4NR0A 4DXHA 1AIPA 5JIBA 1YULA 4OAPA 5BN5B 4PEVA 3MIIA 3OE5A 1M2HA 1XZPA 2NSDA 4CQMD 2CXUA 3BC1A 4YR9A 2R48A 3F4LA 2ZUFA 2DHRA 5FBVB 2X23A 4FI3C 1GNRA 1ZN9A 1FNMA 2JVKA 4NXNB 1ZOSA 1XOIA 2NXJA 1NBOA 2IPMA 2DRIA 1BE1A 3WFIA 2R5FA 1DBPA 1WXFA 2Z8YA 4BX9A 3BJIC 4KNWA 1MHPA 3D7NA 3DBLB 2P4QA 4J1TC 2H4ZA 3OX1A 5DU2A 2QRJA 2MU1A 1UBOS 3W5JA 1CC1S 4ZVVA 1SG9A 1VRWA 3KVVA 3JZMA 4EELA 1RPJA 4G4GA 3T34A 2WNHA 3FWKA 3N1UA 1SKYE 1QGDA 2JAOA 2IUSA 4OYRA 5FBQB 2YV3A 1R66A 4KG7A 3A0UA 5H9VA 4E4RA 3NT4A 4RWZA 3RDPA 4K7JA 4LTMA 4MQLA 3S81A 4MKFA 2B5OA 2BMFA 2UZ3A 4IWNA 1JP7A 1JFFB 3SKVA 1MB0A 4FGJA 4IHAA 3PGJA 2IS6A 4ZYTA 3UWMA 4TUYB 1E79A 3C39A 3AM3A 4KUEA 5ER6A 4N5HX 1XVUA 5BSTA 4D4MA 4PZAA 2REQA 3ACDA 4GDFA 1PT8A 2QU7A 1U3VA 1E5VA 1USVA 3TYXA 5IKMA 1XX6A 3RS7A 2E18A 4LGYA 3STTA 4QXPA 3RUEA 3QVOA 4MYDA 5AHWA 1W76A 1OIWA 1YHNA 2JFVA 4AN1A 1X7HA 2IOFA 4MHTA 1TYZA 3C3CA 3USZA 4BGIA 1SELA 5KYNA 2I0FA 4WOBA 5IZ4A 1C41A 3UTCA 1XCLA 1YNSA 4ND7A 4BRUA 3GDGA 1MZVA 1Z4JA 3LPMA 4CR6A 1T25A 1EDDA 4HWRA 1B41A 4G5QA 4IRUB 4E2YA 4OOFA 4HNTA 1E79D 4BQIA 1EQAA 1EG2A 2YHIA 4CEJA 2WABA 1E6CA 4XJSA 4MRPA 2DCUA 1LNSA 1V5WA 3O8LA 1BEUB 1XF9A 4YO7A 1XQXA 1SCNE 1OZAA 2X86A 1TM3E 5DBHX 4X00A 3K94A 3WRXC 2WT9A 2AZDA 4IFEA 4J16C 2FB9A 4P81A 2FRDC 4H7EA 1I30A 4PC1A 1VCOA 4MS3B 3KB8A 1PTKA 2F43A 1JZQA 2Z95A 4DCGA 4B0PA 1JVBA 3A6GA 2GO1A 4UM9D 5KYWB 4QOSA 5JU6A 1UEXC 1U8CB 5BV1A 1P75A 2YJTD 1W7AA 3AJRA 3IHLA 2H3EA 1UBUS 5CNIA 1Z7BA 5FJJA 4ZCPA 3SQXA 1I1OA 1V1MB 2AKYA 3GT0A 3ZDQA 2AFIE 4YT4A 1TFUA 1ATIA 3LX4A 2H7XA 3RTBA 4RTMA 2D5CA 1KO5A 1BVYF 3K70D 3LRPA 2QUIA 4WKCA 3IJPA 3OLYA 2CLOB 4HS9A 3VVCA 2G8NA 1CF4A 2C96A 2Y0EA 1THTA 4O8CA 1MX9A 1PGNA 2ZPAA 3QPVA 1YZKA 3DWGA 3CYFA 4MQ5A 3EQ7A 3OM0A 4OJMX 3QPCA 1QOPB 3N59A 1Q3HA 1EGQA 4E12A 4RY2A 2IHYA 1EDOA 1T15A 5KSPA 1MTOA 3WLHA 1OBOA 3SSOA 4E5DA 3DBRA 3CUWA 2ZFUA 4PYQA 1PQYA 3HFGA 5D5QA 4OX9B 5EJ2A 5GV7A 3CPJB 3PXXA 2JJ8A 2C4MA 4NFSA 1U2PA 1XLWA 2QT0A 3LPLA 4G2TA 1AMNA 3AK4A 2C83A 2WHEA 4ZEOA 3AQ4A 1C7RA 1ECGA 4KNVA 3JQBC 4QWMA 4PFKA 3EQZA 2HLPA 1T6XA 1CY0A 2YNMD 3ONWA 4OQLA 2TMGA 1O6CA 4KQXA 3SK0A 1N5KA 1BU8A 2VOJA 4FE4A 4XWAA 5B7QA 4HNSA 4X1IA 4XARA 1UPFA 2O2HA 3QF4B 3CZ4A 2FQYA 3DZGA 1PZXA 3HBFA 1I4WA 1NPTO 1EXVA 3BFXA 3HWWA 3RSHA 3RYHB 2G0NA 3L77A 2PUFA 3OZTA 2JGLA 1MU0A 1PR5A 2W48A 1XCBA 4KXYA 2ZPTX 3TRKA 1W30A 1P8AA 5JSZA 2QMEA 1KKUA 3L0DA 4K6KA 3N2GB 5CFOA 1N6PA 1ZCFA 5EJ4A 2GRUA 5EJ5A 2P2DA 4Y7DA 4DV5B 1WXEA 3TLAA 1NAHA 4WZ6A 1E2IA 1RI4A 3DWEX 3PPXA 2ECKA 1SR8A 3P96A 3CNOA 8ATCA 2WM3A 2HLDD 2QVYX 3LQKA 4QGAA 5FJIA 3KAKA 2PM8A 2X8LA 4HLCA 4RDXA 1FFGA 2H4HA 4FDVA 1RM5A 1P2DA 4REMA 1XZDA 1P9OA 3DZJA 3U40A 4DB4A 4MKXA 2IP1A 4EO7A 2X3UA 1KU0A 2HAEA 1EFVB 3DL4A 2NVWA 4PYMA 1Q7EA 2IXFA 3FVWA 4AKHA 2OFOA 4K9QA 2I29A 1NAIA 2XYRA 1BAPA 1P7ZA 3OQJA 5EXXA 5FR2A 3SEAA 4AX8A 5B7GA 2V1UA 1PW7A 1BQEA 5LQSA 3FUVA 3LS2A 3ZCXA 1ZAYA 4ILEA 3TZ6A 4B2PA 2BISA 2RHDA 4GBMA 3WV4A 2NV0A 1X3LA 4ZCRA 4HSEA 4WPGA 5LA6F 3AUFA 2XW6A 1A2QA 4FP9A 3SQOA 2B6HA 1P1JA 2ZRLA 4RYDA 3VYVA 4LZLA 1RYNA 1A8IA 4C0JA 3TTXA 3A6LA 4L4RA 4EKEA 1U94A 2BWJA 3NBFA 2QAGC 1DPFA 4NJEA 5A7HA 2C5LA 2EJCA 5JZMA 3IP9A 1RLTA 3EVAA 3I83A 5FB3A 2HA4A 3ZIDA 3NWOA 5F12A 3EN0A 2R8ZA 1PEYA 1TJPB 3EMVA 1GNVA 2CVOA 4Z1MD 2Q5FA 4WXHA 5L8VA 2P5TB 4TLCA 1QG4A 2FFJA 4MDEA 1U7TA 2V6GA 3QE2A 4OA5A 4I5DA 1XCOA 4E5PA 3D7LA 4MGEA 4BLPA 4JODA 4MWBA 4TSRA 4A0GA 3AB3A 1C4XA 2I87A 3MB8A 5LNK1 3C6KA 3RUFA 1A9QA 1YNOA 2ECOA 4YP7A 3HH8A 5IDWA 3BN3A 3PX2A 2H54A 3BCHA 3NV9A 2UZAA 1LV7A 1QYXA 4IEFB 5B1SA 4E22A 1L4NA 1SKQA 1SH7A 5TMEA 4R31A 1ZD8A 1FDSA 2M6RA 4IVNA 4X8MA 5JV5A 2UYYA 1XB2A 1ZS9A 3O1LA 1WXXA 3CU5A 4KN9S 2VTVA 3E1GA 4ON9A 3OF5A 4D3XA 1RVV1 1YOBA 3ROPA 3TR5A 4BFZA 4JSYA 1NDHA 4JX8A 2EL9A 1ISIA 5D51S 1MABA 3D4IA 1T9ZA 3GEPA 1VGQA 3K9CA 3WHLA 1M6VA 3AVOA 4G1BA 4QBHA 3PQCA 4J6FA 1ORIA 3CNBA 3HXMA 3HO1A 1JUDA 3ADBA 4JLDA 5FFFA 3BDIA 3T0IA 3BBPA 2CMFA 3D2AA 2IHTA 1W5AA 3PDIA 1QO0A 2CLCX 1P5RA 3TINA 1XK6A 3A4IA 3CZ5A 4WADA 2HV9A 3ROQA 2I8CA 4NNOA 3TW0A 4Y6QA 3WOVA 5M04A 2IZZA 3QJGA 1VQ1A 3UPUA 1BOFA 3DMYA 2I78A 2Q3FA 3KQWA 1FRQA 3EAQA 4FU0A 4LJ7A 2C88A 3B6IA 3Q41A 2J0VA 3IAUA 5ALUA 3AZPA 1EHIA 2WJIA 4WXEA 2A1IA 5DMXA 1SC1A 4IJ5A 4ZOAA 1CLEA 2NPIA 2X41A 3DV0A 3NDJA 1DT5A 3KFXA 3QW4B 4D43A 4GLLA 2RD2A 3PK0A 4UE6A 3RS2A 1Z45A 3IAFA 1FP1D 2HN9A 1VJDA 4G25A 3DP7A 3SHTA 1JR3D 2XTJA 2ORIA 2FPLA 1CW2B 5BUZA 4NOLA 4P4SB 2DHDA 3M1AA 1B0ZA 4Q4LA 3VSEA 2JLVA 1R64A 1P6UA 2XPCA 5BYBA 2QW1A 2WU0A 3KKPA 3LL7A 2V8BA 1LKZA 1N2GA 2G1JA 2JLYA 3ETNA 4HPXB 3P9KA 3LXXA 5CVUA 4JQCA 1Q14A 2XNKA 5GINE 2B3DA 3IVCA 4KFRA 3DBRB 2OB1A 1L4YA 4CCWA 4KP7A 5HJEA 5AVYA 1P2UA 2CJYA 4R01A 2FWIA 1MV8A 1V37A 2WU4A 1VL8A 3ZY6A 4PR0A 1IVSA 4X44A 1MR3F 3VMFA 5KC8A 2QD5A 1YQXA 5TT0A 2NUPA 1ULAA 5JPIA 4EF4A 3H5TA 2NU7A 4CUJA 2R3SA 2H8GA 2H51A 3BWBA 3UJBA 3CVWA 2V7QA 4DY4A 4AN4A 3O8CA 3SEQA 1XTBA 4OKNA 1W93A 1T3LA 3IUPA 4WOPA 5E0OA 3T41A 3ONEA 1GNPA 4O1MA 2OSBA 4ND8A 1OWPA 1DC3A 4FC7A 4C0LA 3C5CA 1J1IA 1Y48E 4F21A 1FL9A 1AB5A 4TKMA 2QTBA 4EPRA 4C0XA 3I9FA 3O1HB 4CU2A 1B6SA 1FNCA 5T3UA 3I9OA 4CKEB 4KMMA 4O2BF 4AULA 3GBVA 1B1CA 1ODTC 3SNKA 3ZGYA 1V41E 1RQ2A 1X7ZB 1H2RS 4KYIB 2KM1A 4JWKA 4X8OA 2W6ZA 1A27A 2QIPA 4G63A 4R4JA 3M9XA 3QM1A 2OZEA 4XWOA 1ODJA 1Y9EA 1YACA 2GETA 4MR8B 1SUIA 4PPYA 2RCYA 3AG5A 4GYJA 4TWRA 2ATVA 2RONA 4EKNB 4C0BA 1B26A 5JS6A 2Y1OA 2Z04A 2V97A 3FNRA 1S8NA 1QOZA 3W9SA 3QV1A 2OUIA 1R5JA 4G81A 1T1GA 4RY0A 4Q6WA 7GPBA 4V0KA 3ENWA 4I4IA 3GJRA 5JI2E 1EQ2A 5FUBA 4TZ0A 2HK7A 1H1LB 5HBGA 3BFKA 1SXJD 2H57A 4M0FA 3WZMA 3EZ7A 5BSWA 1G18A 1CNMA 3HB1A 2WIGA 1AQJA 3IAS1 1J1ZA 1ECJA 1RYDA 1OC4A 2J7PD 4OGLA 3SQWA 3FPJA 1GPUA 1RHUA 4EA7A 3ESBA 5F2NA 1NJ5A 1AV6A 1NA5A 1F14A 1GTJ1 4N5LA 3HP1A 5DK4A 2DETA 5KWJA 1UJ5A 4J7UA 2Q41A 2D5AA 2BFPA 4FW9A 4XQGA 5KREA 1NSTA 1E3SA 1GG9A 1J06A 1H65A 1NY6A 4JOSA 4ZP1A 3UK7A 2G9ZA 5L4LA 2IELA 4Q1AA 2OQRA 5FUMA 2QTGA 3OZSA 4RUKA 1XCGB 3BXOA 5THXA 4TTTS 4WZZA 4EZBA 3O6VA 2B36A 4HUQA 4ODIA 4GEGA 1JIJA 1RJWA 5F7ZA 1HC7A 3ZCUA 5HNKA 2WFZA 3DNPA 7REQA 5EWLA 1R6DA 3IKJA 4MO9A 1KMNA 2X77A 4Q00A 4J3FA 3WMGA 1ABFA 1OX5A 1ZGHA 2IY8A 4NTZA 3EDMA 4BFWA 4RO0A 4BQFA 4N47A 3OKAA 2BFFA 2PLWA 1HT2E 1CQZA 2V9CA 4DDKA 4F5DA 4GL2A 3PZBA 2PWZA 3OQ6A 1E2KA 3ILHA 2ZWOA 4RXTA 5U4QA 5BT8A 5B3JA 1TU4A 2AH5A 1JECA 3W6PA 1R5NA 4FQ7A 5LMUB 3HVJA 4JVMA 3TCXB 3A2NA 4CM4A 4F0JA 4XTCS 5I3ZA 2XADA 5IMBA 2AA3A 3UOGA 4QJ5A 1W581 1N3BA 1WHTA 2J30A 1OYWA 3UJ7A 3KJZA 3H75A 3PGMA 1DBQA 2ZIXB 3ZU4A 1NLFA 1NBHA 1SOAA 4HADA 1Y1TA 4NOJA 4YRQA 5AVUA 4YI5A 2AMJA 2VVTA 3W8DA 2DJIA 3RVOA 1T26A 2D00A 2H1LA 1RI3A 1PEAA 3D4PA 4F97A 4KDEA 2BCJQ 1HX7A 1LTKA 3FMPB 4MP8A 2LKCA 2RGNC 2KWIA 1HORA 3DO5A 3W5SA 2ZBPA 1N5IA 1MQ9A 4FPXA 3UWDA 4KQJA 3I53A 4ENUA 2ZR8A 3GJ8A 2HNKA 1R6BX 4KH1A 3UA3A 2DY1A 1DDOA 4KYVA 4RHXA 1EHCA 4REOA 3PCRB 5ALFA 3N0VA 4NG4A 4TLLB 1WTCA 3QVGB 4QBIA 1SKUA 1WXIA 2FGKA 2QIOA 3VJLA 1F5NA 2GCGA 3OLQA 5EXEA 1QIKA 4FM9A 1Y3AA 5BRJA 3RREA 3BA1A 3QG5A 1FBNA 3ZHOA 3IUJA 2AQKA 4YCJA 1DKLA 4R9UC 4DLRA 1K5GA 1Y34E 4OV6B 4ARZB 4HPWA 1YONA 4D0NA 2VAMA 1JG6A 4IV8A 1NW4A 2YN2A 3R76A 4D4HA 1BZYA 1RXEA 2ZULA 4PQRA 2P2NA 2A92A 2O2IA 4PG6A 4PSAA 4IQ8A 4G5GA 3TIFA 5JBNA 3MJFA 1BXRB 2W58A 2R8BA 1LBTA 2UZ1A 2GRAA 1YVUA 4DXDA 3VOSA 2MSNA 1BE6A 1G20E 4HGNA 4LJ9A 3OPVA 4WJLA 4LZPA 3EXG2 4WLNA 1UXKA 4LSWA 4V0MA 1YZUA 3U62A 4CRWB 3OJXA 1DO8A 1Z4MA 1YTLA 1W0CA 3EB9A 3GG2A 3QVKA 4KGVA 4P7FA 4Q7JB 4ZJPA 3GFVA 4AKTA 1ZK3A 1K0FA 1IQPA 2V4MA 1PJRA 3PITA 4KZPA 3P19A 5E6UA 3RPEA 1U65A 2XYHA 3QMVA 4H6VA 2BM1A 3ROXA 5JAIA 1M2VA 5CDHA 5KTMA 1CIJA 4RHUA 4BQRA 4NNJA 2EFCB 1IC6A 5TDHA 4ZVSA 2BN4A 3LW7A 2FX5A 3D3NA 4LYAA 4ID3A 4PXSA 3ZCVA 2QZ4A 4CMAA 1IBSA 1MEJA 2BV3A 3FMOB 3PC7A 3GH3A 3NHBA 3C70A 4G5HA 4HGQA 3W7VA 2J9YB 4DNFA 3D4NA 2J7PA 4WDRA 4YJGB 4Q4DA 1XQVA 2QTAA 4BZXA 3JD1A 4BKMA 3L06A 1B3BA 1ZRHA 2ON6A 4RZ2A 5EIWA 4H3SA 3LUBA 2NN3C 1SHLA 4HOYA 2O0LA 2ZRQA 3A1NA 3E9DA 4A2QA 1W5EA 4OQMA 1D8TA 2PRZA 3NUZA 3NTUA 2ZRIA 4JA2A 5F35A 2JVIA 2P11A 1K7SN 2I80A 3QLEA 2O0KA 5JR3A 1VPLA 4ECEA 3K5IA 4DKJA 4KJXA 4YP1A 3OHMA 3BAZA 4K28A 2ZJBA 4Q4HB 2OR3A 4EK9A 1U5CA 4YV0A 3EPJA 4WT7A 3M4NA 4IFBA 3WGIA 4FINA 4JGIA 1V11B 4LKOA 2AZMA 1P61B 4Y6GB 2IS4A 2YMLA 1WSAA 2CB0A 3DFFA 1OH7A 5BV7A 5CFNA 1U2DA 4D9BA 1QB7A 1ND6A 1RHMA 3QFRA 4HWKA 3KOMA 5KTRA 5CCXA 4MGHA 1VE9A 4TZ6A 3TB6A 5C35A 1NC3A 4RMHA 3SC3A 4YUZA 3OWOA 4I7EA 2M6KA 4TVBA 3RF7A 1K89A 1VLMA 4CKBB 4UZEA 2J5BA 2ZRDA 2PHZA 5I4IA 1YQ9A 5KSZA 3LDGA 1W19A 2D5LA 2I6FA 3VR6A 2A67A 2Z5VA 2ZIWB 2HIHA 2VKTA 1FUUA 1Q0PA 3KSZO 1P60A 1DEHA 4LNHA 3U48A 3U44A 3HCWA 3DEAA 2DH5A 3T94A 1PLLA 2GM5A 1DKMA 2H0QA 2OZKA 4H0NA 4AL4A 3DE6X 3SEZA 3PWZA 2QG9A 2WG2A 3K09A 3ZWDA 1XDGA 1N3YA 3LPNA 4JBNA 4LZAA 2O2ZA 1FOEB 1C30B 1UBCA 4ZJUA 1MFPA 2WKQA 3TO5A 1ENYA 2X8JB 4CG0A 5J4LA 5MFPA 4KIGA 1ZU4A 2ZT5A 4HAVA 1BMTA 1XQYA 4E5KA 3OCUA 1Y9ZA 1YQGA 2Y92A 1B15A 4YRFA 5EZYF 2LE0A 3JWGA 2ONCA 3ZWKA 1DQPA 3NPAA 3GDFA 3MTAA 1EFPA 1OFUA 3IBYA 1EX6A 2HF9A 1FSZA 3PXEA 4DDWA 5TT1A 1QCYA 4OFBA 3GVPA 4PAWA 1P4JA 2WAOA 4YT5A 5D00A 4YWHA 2X13A 4EI8A 1AHNA 3UH0A 4A2WA 2C7BA 1JDPA 4PLTA 1QRUA 5G41A 2WWXA 1J8MF 1OAOA 2JD2A 3A6DA 3B3GA 3C7TA 4MQEA 4D96A 5G0WA 4MUGA 1HDXA 4HQOA 5IH3A 4EW2A 4Q1DA 2WDZA 1JLHA 1PR2A 3VBCA 1RBZA 3K5HA 4MWZA 2Y05A 3TXAA 3HN6A 4MUYA 4DR7B 2X0DA 1M6HA 4LS3A 5IARA 3PT5A 4DCCA 2Y1CA 2REXB 4L78A 5BV2P 1A72A 1E7QA 2R6DA 3KHUA 4AUKA 1JEEA 1VSUA 2QVGA 2WWGA 3M5DA 5LZ4A 3REGA 3VA7A 2DBYA 1SXQA 2WJWA 4MW5A 5AM5A 5U1PA 4INJA 1BO6A 1HE1C 4HLUA 4ZVMA 1YQUA 2O06A 3TBHA 3U49A 5HTOA 3AM1A 3LY7A 4N8DA 1MV5A 1VG9B 2RJOA 4J0FA 4L0CA 4LWOA 3AR6A 1FFBA 1YB4A 1CQPA 2QLBA 3D8NA 4FOOA 5LZ5A 3V1UA 2WICA 4BB0A 1QBKC 4XKJA 2AS0A 5B53A 1HQKA 4GECA 4IL5A 1IEQA 2A1UB 1LS6A 3C1OA 3EVZA 1R27A 4XUCA 1EK0A 2Z83A 5F4ZA 4RPKA 1EK5A 3F6YA 3OZEA 2JEZA 3ZG6A 2GS9A 1XZLA 5M29A 1C50A 1D5CA 5FV7A 2IC5A 5E0KB 4Y67A 1BW9B 1JJAA 3QUCA 3TSOA 3RSGA 2VYVD 1XCJA 1ZLXA 2H4JA 4Q3NA 2NACA 3V1MA 3E9EA 4BBJA 4POOA 1E1CA 2JG3A 4RVSA 5CH5A 1NP7A 3PUKA 1FRNA 3G5AA 4L72A 1N6IA 3K1ZA 1PS8A 3VTKA 1AKMA 2QE6A 4DG5A 2P2YA 2HSGA 3PYMA 3WLKX 5HKKA 2GK6A 2Q3EA 3F9RA 3M5PA 4XSGA 5JZSA 2QPLA 5A3QA 4LF8B 1OBCA 2ZGVA 1VHQA 4PZ9A 2YY7A 5AWFC 3K53A 2CMHA 2HFKA 3E7DA 1WXDA 3ROTA 4N5DA 1QU2A 3HACA 1JAYA 4JJ7A 2FVXA 3VAYA 4QG7A 3U3XA 3NAMA 5JO9A 2UZ4A 2C97A 1EYZA 3U9SA 2PSEA 3A9SA 4IDGA 4CR7A 1IBCA 3NH9A 1ESEA 5CDGA 3I05A 2EQAA 1TC2A 4UNNA 4FHEA 4RHCA 1Z2CA 3N8GA 4FX2A 3RLFA 1SXJB 4AVYA 2E89A 4I4TA 3ZD9A 4BFLA 3ESYA 5F1KA 4C04A 4HFNA 1M34B 1UADA 1YJXA 2QZZA 2YQ4A 4IPTA 1X39A 3RS8A 3C3XA 2ZAOA 2FK7A 3L5OA 3AC0A 1OZHA 3KJXA 1VLJA 1QC5B 1YC2A 2J87A 3EDCA 1Z5GA 1C8VB 4O4IF 4II3A 4TWIA 5NLLA 1RYFA 4ZO6A 4LY0A 1RM4A 1Y8QA 4LZWA 3KTOA 3QEMA 1Q7GA 4EHLA 2VXOA 4CEIA 6CHYA 3N2NA 2ZE8A 4M8LA 4QPZA 3LDFA 4WZAE 4EY7A 2W2KB 3EZLA 3R3XA 2OBMA 5HS4A 3VO2A 2VQEB 2FCAA 1FS4A 1KI6B 4MROA 4ROSA 3VNQA 4FE3A 1E99A 2Q1XA 1AN9A 3CPHA 2BAGA 3IUMA 3P4YA 3UWSA 1L7QA 2VTDA 1BHJA 1CJSA 2GPTA 3G0IA 4G8JA 3BGDA 4D0RA 1CUBA 2P27A 4ETNA 3PT9A 2IYNA 1US8A 4GT1A 4MGYR 5D5PA 1RWOA 4O4JF 1E0JA