5DI3A

Crystal structure of arl13b in complex with arl3 of chlamydomonas reinhardtii
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
EARILVLGLDNAGKTTILKALSEEDITTITPTQGFNIKSLSRDGFNLKIWDIGGQKSIRPYWRNYFDQTDALIYVIDSADSKRLSESEFELTELLQEEKMTGVPLLVFANKQDLVGALAADEIASTLDLTSIRDRPWQIQACSAKQGTGLKEGMEWMMKQVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A G-protein activation cascade from Arl13B to Arl3 and implications for ciliary targeting of lipidated proteins.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 13B
total genus 48
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5di3A00
2RH5A 3FHCB 4IOKA 4TT3D 2QP9X 3U3OA 1S1CA 1G5PA 3S1AA 5A0FA 1XXHB 2R6AA 1G3UA 4U7DA 1P2TA 2X8AA 1KI6A 1AJEA 3M4YA 3NVAA 4AG6A 5HKKA 5JRZA 1XX6A 4TYWA 2ZJ8A 2FH5B 2CJWA 2YWEA 1AK2A 4QNRA 1WCV1 2JJ1A 4KU4A 2HXSA 1AQUA 2Q21A 2FA9A 2I4IA 3KKOA 4ASUA 4DEYA 1MABB 2YINC 1EFHA 3GLHB 3T15A 2GHIA 4GBMA 4TLEA 4ZV4A 2V7QD 3SJBA 2IS2A 2ANCA 2C95A 3FFBA 4CF7A 3FE2A 4LYJA 4ZDWA 3GLHE 3IQWA 1AZSC 2LCFA 1QVRA 2GAAA 3MJHA 3KQLA 1L4YA 4Q1CA 1OYYA 1T9HA 3B8HA 4JL6A 1ZD1A 3QI2A 3KZ1E 2VTKA 1QDEA 2X1VA 3B85A 5FUXA 4JMPA 2ZJ2A 4PO1A 1UKZA 1T3SA 1FFHA 2VHUA 3QXCA 3GLFB 3IBGA 1LNZA 1UADA 4GZMA 4LHXA 4JKYA 4N0EA 4AKIA 3T1VA 1XD2B 4OK6A 1YRBA 3KXKA 4A8JB 5JBQA 2VL7A 3VU9B 1G7TA 3B1ZA 2YHSA 1RC8A 2AN9A 2C04A 1ETUA 2PZGA 4BFSA 1W2HA 4I99A 2R9VA 1II8B 4HAYA 4FCTA 5EQTA 4DCUA 1MO3A 1U0HC 1M1YE 1ZYUA 4JSTA 1N6RA 1NSFA 3WY9A 4CEJB 2CK3A 5TMPA 4QKQA 4CIDA 5SZHB 3BD9A 4DXAA 2D7DA 4PSAA 2H16A 2PLRA 4BFXA 3FB4A 2H7VA 4IRUB 3E5HA 4PAOA 1WE2A 3SBEA 5FH9A 4DHEA 1OH7A 4LJ5A 4DZZA 1JAHA 3FYHA 2KI5A 5GJBA 1E2NA 3KQHA 5E7MA 3HPRA 2FZ4A 4PFSA 4B48A 4B76A 3ZS9A 1A5TA 1V43A 2RGNA 1PUJA 4V0ME 4D81A 3Q8XB 2NZ8A 4WOPA 1ZBDA 2ZE8A 4S35A 3TR0A 5EE9A 3EPKA 3EA0A 1FP7A 2QM7A 4Z8YA 1OB5A 1G17A 2D74A 1E2HA 4PZYA 4CEIA 1EX7A 2ZYUX 2XSZA 4C2UA 3SEAA 3A1UA 4QBFA 3SS8A 1GP2A 1TMKA 4ZDKA 1M7BA 4PQYA 2ZRIA 3X1DA 5JECA 2GJAA 1GKUB 4C0LA 3NHBA 1XEXA 3AVOA 3HR8A 2CVHA 2WJYA 3QBVA 3CZQA 1CJMA 2XTNA 4DRZA 1GL7A 2NO0A 3TSWA 3WBJA 1ZAKA 3BAFA 3EC2A 4JS0A 4W5WA 2DCUA 1E1RA 2A5DA 1T8UA 4B34A 1XTSA 4PO8A 4TLCA 3UIEA 2JJ8A 4LJ9A 4A82A 2GXAA 5BN4A 3CLVA 3VAAA 4LI0A 2ANBA 2ONKA 2GJ8A 1LS6A 3K9NA 5FOSA 4EUNA 5JJIA 4MRVA 2YKGA 2PMDA 2PZEA 1R0XA 3OHMA 2DFTA 2VA8A 2IEYA 3A6PC 3AVUA 1R0WA 4QJ5A 4BGDA 3FHTA 2XJ4A 3B2EA 5JEDA 4EPVA 4YXWD 3M6AA 1YZKA 3FMPB 3N5CA 3SYLA 1IAQA 3EA5A 2A5FA 4ESHA 1OFHA 3SQWA 3D3QA 4B6FA 1EFRA 1DS6A 1R6BX 2CCGA 5DHAA 5JHHB 3HYRA 2J45A 2OT3B 1U81A 4HB4A 1G64A 2WKRA 2XNSA 1HA3A 2IWHA 1OFUX 3RC3A 3BERA 2ZM5A 1RRCA 2D3WA 1W0KD 1CU1A 2A5JA 2E1RA 3AB3A 3BH0A 4FCVA 4F93B 1ZIPA 3L8YA 3ONWA 1UEIA 4IVRA 1AQYA 5FI0B 2WWHA 3AF3A 4MA4A 4KSBA 3K0SA 1T5IA 2GJSA 3KJHA 2IYVA 1M7HA 1G8YA 3GP8A 3W9YA 1G7RA 2QROA 4Q7MB 3U3MA 1SKYE 2O0KA 5FOXA 1W7AA 1T8TA 2QE7D 5ANRB 3G0HA 4PPQA 2O8EA 3KDSE 2GBLC 3H2YA 1CEEA 3HU3A 1NBMD 1XMIA 3OEHA 1LF0A 1M6NA 1ELOA 5EZ5A 3R9XA 5FTMA 2EFHB 3BC1A 4M1KA 4Z51A 4GP7A 5CB6A 1EWQA 3THYA 2ZSAA 4DLXA 5CB8A 2BBSA 5AJVB 2YNMA 5B2ZA 3PG5A 4LPKA 3C4JA 2G0TA 2ZS9A 4NYMR 2ECKA 1R0ZA 1W4CA 2G77B 4UJ5A 4V0MA 4EFMA 1U90A 2ZREA 3B13B 4MRRA 1KAOA 1I2DA 3VMFA 5SZKB 3NBXX 3K9HA 2WSSD 3NBYC 4LJAA 3QF4B 2O8BB 1KI8A 4LRWA 1KK1A 3B6EA 4Q4LA 2ZU6A 3DO6A 3AP1A 4DVGA 5JMTA 4TL6A 3X1WA 1NP6A 2D7CA 2ZRMA 3I5YA 2IYWA 1IJFA 4LSGA 4PC1A 2MSDB 4OI1A 4XOIA 521PA 3A58B 3FMOB 1E99A 3R8FA 4Q4AA 4FMCF 1LB1B 2VLIA 4QBIA 3LQQA 2NPIA 5BXQC 2XB2A 2VRWA 3QKRB 4E03A 1TPZA 5HZHA 1TEXA 3B1XA 5TVKA 1I4DD 3FMFA 4LJ8A 3U3KA 5KDDA 4RD0A 2Q9BA 2O8DA 2GK6A 4TLBA 4D4KA 4US1R 2ZSBA 4B3BA 4BFYA 2OEPA 3ZVRA 2LKDA 1E2PA 1OXTA 4OQNA 1GZSA 3EX7C 1NVVQ 2J0UB 3U7GA 3SJAA 2Y8EA 4PPNA 3ICEA 1TAGA 3UMRA 1KI1A 4B3XA 1IN5A 1DELA 4D25A 4DLTA 1Z2CA 4JVSB 4FWIB 721PA 3IHWA 1DAIA 2JJ2D 3QQ5A 4ZIRA 4E07A 4AD8A 1E4VA 1P2UA 2BJVA 3BBPA 1NBME 2C9OA 4DCNA 4GDFA 1TEVA 4G5SA 4MRPA 5KNBA 1S0UA 1GL6A 2W2TA 4M2LA 1B23P 4ZI2A 1AKYA 2AFIE 3QOFA 3RS0A 3QXHA 8OHMA 1A82A 1IY2A 2BOVA 3EZ7A 3TQFA 2V9PA 1NL3A 5D3QA 2OE2A 2CMKA 5EE3A 1EGAA 3UPUA 4Q4HB 2VYFA 2H5EA 1DE0A 2ZVQX 2H8KA 5G40A 2FSHA 3ZVLA 3RDPA 2BVNA 1EX6A 4C0SA 2BMFA 1T5LA 1DTSA 1KNQA 2R6CA 3FGNA 1QZXA 2PCLA 4M4SA 2VBCA 3CF6R 3K0EA 2AD5A 4B3DA 1XTIA 4EFLA 4BQSA 1E6CA 4B43A 1RRPA 3PUYA 2J1LA 3W90A 2DPXA 4PPGA 3QKSA 1G21E 3AKDA 2JLXA 1KIMA 1VG1A 4TSFA 2F9LA 2FOLA 3CRRA 5KUTA 4LK2A 2GAOA 5SZIA 1MO4A 5EUQB 3OIWA 2ZJZA 5G41A 2IT1A 1Q22A 4CT4B 1OJLA 5DGXA 4MKHA 3TAHA 3V9PA 1MV5A 3KKPA 2PEZA 3LO5A 4BEJA 4E22A 5B64A 4HAUA 1ZUHA 4M9ZA 2UZIR 1KTVA 2PMKA 4AG5A 2ZSEA 3KUCA 3U44A 2JLWA 3GEIA 4KI0A 3LBIA 5JJKA 2P65A 4LV8B 2IL1A 2QAGB 3BB3A 3CX8A 4Q1EA 5AUOB 4BZQA 2GKSA 4GL2A 3K9LA 4OQMA 2PH1A 4R7ZA 2GILA 3MWYW 3OEEA 3GLFA 4FN5A 4C30A 4CZ2A 3I73A 3DZDA 4XSHA 2ZE5A 4XJXA 4IDHA 3BFXA 2WOOA 2WWFA 5FBRB 3IDQA 3K09A 1XJ0A 1OF1A 2XNDD 4L8GA 4ACBA 1CP2A 1QBKC 2NQ2C 3GJ5A 4LGMA 1LW7A 1SVWA 4GFDA 3NEYA 3QEJA 3LH5A 3FOZA 3IQXA 4B75A 4KSCA 5CDFE 3RS7A 4Q48A 1TU3A 1OLOA 4TWZA 3ASYA 4HB0A 4FCWA 3AVTA 1UFQA 2LKCA 5KPJA 1N6NA 4HAVA 5KO2A 3O8RA 2J7PA 1AGPA 3X1YA 4MGIR 4ZDIA 4D2IA 3NTUA 3ASZA 2EWVA 4WBSA 2BBWA 1F5NA 2EFCB 2WSSA 4DWJA 3CZPA 1KYIA 4AKGA 4XSGA 1FQKA 2BM1A 4LOAA 4QFMA 4TLAA 4B32A 5K8UA 4IVPA 3DZ8A 3K0FA 4QHTA 4D0LB 3T12A 2WSMA 4IOJA 2REOA 3CH4B 1N2CE 1V5WA 2IYRA 3ZDQA 3UXMA 4CEIB 2ZROA 2WHXA 3TW4A 4HLCA 1L7VC 3KJGA 4L16A 1VPLA 2O8CB 4V0OA 2QQEA 2F7SA 3X2SA 2GXSA 3GJXC 4TMWA 3CPHA 4BFUA 3O8CA 4KFTA 5EXSA 1S1MA 1X6VA 2ZANA 3AH8A 2ASEA 4A8JC 4L4UA 1JEDA 3B82A 3LX5A 2F55A 2F1HA 3AVXA 1N6IA 1DVRA 4K81B 1FMJA 2X77A 1KY2A 1RYFA 3C5HA 3H4MA 4PXAA 4KLZA 4EJSB 4DUGA 1Z5ZA 1FUKA 2P6RA 2AXNA 4OJKA 1NY6A 4QGFA 3HR7A 2V6JA 4XD7A 2B6HA 4BECA 4WXRA 5HCIA 5EXTA 5ELXA 2FFAA 5C1BA 4X8HA 3K70B 4F91B 1W5TA 1HTWA 2QAJA 4TL7A 5JJLA 4LV6A 2YV5A 2PBRA 2ZYWX 4Z1MA 1ZINA 4NTZA 3Q5DA 1Q1EA 1Q0UA 1TQDA 2IYZA 3SFVA 2RMKA 1XZQA 1BKDR 4GZLA 2ZR0A 1OB2A 1OFTA 1NF3A 3LXRA 4M53A 2F1JA 1G16A 1NRJB 3SOPA 5JSZA 4HAXA 3ZIAD 3GLGB 2ZITA 2IYYA 4AIIA 4NCIA 4JLOA 1NIPA 1N6LA 3PQCA 2BDTA 4GMDA 5HR5A 2P0EA 2IHBA 2IS4A 4V0LA 1CR0A 1ZM7A 1L8QA 3PCRB 4QJ3A 2IC5A 1JJ7A 1M74A 2G1KA 1D9XA 3IHLA 1PLJA 3VR4A 3LAWA 3RVBA 4QGGA 1QF9A 2A30A 1EK0A 1P4SA 4Q9IA 4HDOB 1JQLB 2QQ0A 4RJLA 1VTKA 2OFWA 1U0LA 2YWGA 1U8AA 3MLEA 4IDNA 1FQJA 1DAHA 1YZUA 1ZNWA 2ZPTX 3KFXA 1FTNA 3T5DA 2H57A 3CM0A 2AK3A 1E2MA 4C9BA 3SYKA 3LX8A 4ACAA 1QHHB 4DBLC 3I92A 1ZVQA 1NJFA 1JXOA 5EP3A 3BRWD 4OHXA 2W0MA 4O0MA 1FNMA 1HYQA 2AD1A 4KFUA 2XZPA 4V03A 3SC3A 3TSZA 3QIAA 4AC9A 5L3QA 2GEDA 2Z5FA 2ZAMA 2VEDA 3P26A 5AUNB 2NZJA 3LBHA 2GZDA 3THYB 4HLDA 2JLRA 2IA5A 2EFDB 1W36B 1DAMA 1KNXA 2QTFA 5DI9A 5J4VA 1WBBA 2ZRJA 4YDSA 3CWQA 4F92B 2VQSA 2P67A 1S2MA 4D82A 5CJ2A 1E1QA 3DDCA 2BMEA 2RB4A 2JLUA 2RAPA 3QPUA 4EJSC 3PITA 3OZXA 2ODWA 1TUIA 2R65A 2V1UA 4H1UA 3T34A 3TE6A 5H8WA 4ESVA 5HPYB 1NN3A 3AF1A 3U4QB 1RRFA 4TZ6A 3QF4A 2GF0A 3MRSA 2E87A 4V0KA 2R6GA 3U7HB 3B1YA 1GRNA 2BBTA 4NMMA 1XTRA 6Q21A 2IXEA 1OSNA 3W34A 3WMEA 2QRNA 3CPEA 3OFND 2IS1A 2ZJYA 4O2LA 2PX3A 2YOFA 3HU2A 3QXSA 3PIRA 1VCNA 3QKSB 3LNCA 4WIAA 2CHVA 2PT7A 2FEMA 4DLWA 5L3SB 1AKEA 2FPMA 4M1MA 5F9HA 2QGZA 3BE4A 1F48A 4PX9A 4Q00A 3ZLJA 2W6IA 2H18A 3A36A 2GZAA 3OEHD 3QG1A 2OESA 4UXHA 5KSYA 5DE3A 1ZMXA 5LDDC 2X2EA 4KV9A 5A5GA 2BC9A 1KZ7B 3NIBA 2RGNC 3U60B 4DEXA 3JZMA 2V55B 2WICA 4DIEA 4PC3A 5F3WB 3AF2A 3AVWA 5FOVA 1NVXQ 3THWA 1N5LA 2J0UA 2BCGY 3BOSA 1HT1E 3SE0A 1YR8A 1CJVC 2PX0A 3P32A 4HZUA 1YU9A 5FR2A 4NYMQ 1KSJA 2JIZA 3W3ZB 4JBYA 1FMLA 4JLVA 1W0KA 1IHUA 2WWXA 4Q01A 1FNNA 3GLFE 1VHTA 3IPXA 2YWFA 4IDOA 4IOMA 5H70A 2B7BA 1KO4A 4FD2A 2VP9A 4RSGA 1Z6TA 2WIBA 2XTZA 4AI6A 4TLDA 3R20A 1CJTC 2RGCA 1NLFA 4BFZA 5FL7D 1NKSA 2KE5A 2VPPA 4KYUA 2QAGC 1GILA 4HEJA 3VNUA 1EXMA 2FFBA 1F6BA 3K9GA 1CIPA 1U8ZA 2EFGA 1AGRA 5FOUA 2YC4C 5DH9A 4B2IA 4V0NA 1T3HA 3EASA 3ND9A 1XD9A 2B8WA 1XXHA 3W6PA 3EW9A 1ZJ6A 1Z08A 5DYIA 3KB1A 1NMYA 1JJVA 3OESA 4H9GA 5B30A 2REXB 3ZS8A 4B33A 1M7GA 1OIXA 4JLNA 1E2EA 4RZ3A 5P21A 2QN6A 1GOTA 2OM2A 1ANKA 1MO5A 2EYUA 1H8EA 4LBVA 1COWD 4DDWA 5K8LA 5KYKA 1GRQA 2DWPA 1KJWA 2O8CA 4UNPA 3RC8A 3MGCA 1GUAA 4M1TA 3C7KA 4OI4A 3E70C 1TQ2A 1YZLA 2WAYA 2ZI4A 2GCOB 4TL8A 2CHGA 4URUR 1RFLA 4EPXA 2Q3HA 3P4XA 4OI0A 3PENA 4JL8A 4EJSA 4RZXA 4XIGS 4PHHA 2XEXA 1SKQA 4G5RA 4URYR 421PA 1N0UA 4TQAA 4L9SA 3V00A 3EXAA 4U02A 4MUAA 4CRWB 3EZ9A 5KDLA 1KDRA 1XB2A 3K53A 4C0JA 2CCJA 1FPMA 2NO6A 2C77A 4IFBA 3BWDD 3PEUA 1DADA 2TMKA 1KOFA 1S4QA 4MYCA 4OK5A 3U7FB 1CR4A 2QENA 4MYHA 1G3QA 1ZIOA 1E2QA 3D8BA 3EG5A 2Q3FA 3GJ4A 4AKEA 2D2FA 4EQ6B 3L0PA 1Q1QA 2JLVA 2XOKA 2Z6VA 5C4MA 5CK5A 2VP0A 4IFEA 4TSFD 2GCNA 2Z43A 4M9XA 2AKYA 1U2RA 3SDZA 3DOFA 3P4YA 4B47A 2QPOA 2CNWD 2F1RA 3N70A 2DB3A 1NVVR 1PZNA 2YYZA 2FDCA 5AUQA 3WMGA 3S1AB 2HEIA 2A78A 3EIQA 1KO7A 4I1VA 4NCNA 3RWOA 1ZCAA 1E2IA 4KITB 1Q1BA 4UNQA 4MUBA 3DM5A 4E09A 4ZI3A 1TADA 2XGJA 5JLJA 5C4GB 1KDOA 1UKEA 2GXQA 1A7JA 3SNHA 4BRUA 3HJNA 3HU1A 4LDJA 3CR7A 2ZI3A 1Q21A 3OIVA 4GOKA 2GF9A 1MABA 1KK2A 5A4JA 2FEOA 3GLHA 2I1QA 4Q9JA 1X1RA 2YOHA 4B35A 2ZETA 1IQPA 1G3IA 2RGXA 2UZ3A 4LJ7A 4C0AC 3KUDA 2JDIA 5TV2A 2DWOA 3BORA 1U8YA 1G5TA 4UXJA 5TY0A 4FXPA 2FPLA 3AQ4A 1E32A 3SR0A 5CLLA 1E3MA 1AZTA 1Z07A 3TBKA 5LPNA 2ORIA 3B9QA 3C14C 4FIDA 5HTKA 1NN0A 2W6ID 3TJZA 4L15A 4BFTA 4MGKR 1X86B 4PHTA 3KJEA 3WP1B 2PCJA 2W6JA 4A0FA 2GNOA 5HKKD 1X1SA 2DBYA 3ADKA 2UKDA 1P75A 2AFHE 1IN4A 2HCBA 4TMKA 5IF9A 2OCAA 3OE7A 3U4QA 1E2JA 5J4KA 1RJ9B 3RSOA 4CEHB 2ZI9A 4KYIB 4TT3A 1S3SA 4Q02A 2ERYA 4ZCLA 4JSYA 1WRBA 3CW2A 4OJQA 3EWAA 3M1IA 3SQXA 2ZRPA 3IKJA 1LY1A 1ZRHA 3VHXA 2K5UA 4WAUA 2VHQA 1ZUIA 2ZTSA 1FP6A 1HY3A 3F5FA 5F98A 3VTKA 3TQCA 4CEJA 3QPWA 2ERXA 4A15A 4ARZB 1ZNXA 4Q5IA 3VQTA 2UVQA 4XH9B 1GM5A 4JJKA 1BO6A 3TUZC 2A9KA 2IHYA 3H0KA 1E0AA 2AXPA 1CBUA 2HT1A 3WYFA 5L3SA 3FKQA 3GJ8A 4XVUA 1NG1A 1NLYA 4OQXA 4A6PA 4D26A 1IXSB 2JATA 2OBNA 3GJ0A 1W36D 3LVQE 1XTKA 4WA7A 4F4IA 3RS4A 2R44A 2WPDD 4W5HA 1KAGA 4TQ9A 1W1WA 3U3RA 4LBYA 1N6OA 1E2LA 5CK4A 3RRNA 3L43A 2QY9A 2J9RA 1N5JA 4PHGA 2IXGA 1UBEA 4MYTA 2JLZA 4LCBA 3UKDA 3CRQA 2AHOA 2BMJA 4FMDB 4NU0A 2WMOB 3NWJA 1NKTA 1KI9A 4LJ4A 1ZNYA 3ZJYA 3GJ3A 2O52A 1W49A 3LD9A 5BN5A 2A5GA 1J2JA 3WNBA 1P72A 1X8JA 2G88A 3K0CA 4EFNA 3TK1A 1GSIA 1CS4C 4F7WA 2H1LA 1TF2A 5EZ6B 3U5ZB 2XTMA 1AIPA 4HB3A 4AK9A 2Z4RA 1LFDB 4WVFA 4P0TA 2BKEA 3QXXA 2WM9B 2VP5A 1XEFA 1OKKA 1NMZA 2AWNA 4MGZR 2RHMA 3JVVA 5EP1A 3CUEF 4MDFA 1EESA 2HF9A 3NH9A 2WJJA 1KJZA 3DEFA 5CM9C 4B44A 1XD8A 5L3RA 1H65A 1VIYA 2DWQA 2RHDA 2FMXA 4TYNA 4Q9KA 1R5BA 1WDTA 5LD2B 4NYJQ 1R4AA 3H86A 2JLYA 3PR1A 4AYTA 5FFMA 5KTYA 1F60A 2Z0MA 3NDBB 4TMVA 4WZAE 3QG5A 2ZRFA 1YE8A 2QMUA 3SJZA 3VR6A 4JBXA 5CIQA 4Q03A 3OF5A 3X1ZA 1CF4A 2BM0A 4I1UA 1PLKA 4LJ6A 4F4JA 3ZIAA 4HZIA 1KI3A 1HE1C 2WJVA 4KVAA 1E94E 1K6MA 3SFZA 1NVUQ 2G0NA 1US8A 2NGRA 1SHKA 1HH4A 4ZO4A 4JKIA 4D80A 4FMCB 1YKSA 2L0XA 5E3HA 1LTQA 1OT3A 1ZC4A 4CT5A 2HLDA 1GRRA 1T6NA 3DPUA 1XCPA 2ZRLA 3P1JA 3ADBA 4BWYA 1ZM9A 3ZVNA 4GSYA 1OIWA 1JR6A 4DDUA 3Q7QA 2QP4A 3W6OA 1N6PA 3CBQA 1Q12A 1G7SA 1JR3E 1ZP6A 3JVUA 3K0AA 3Q85A 4IDPA 4TTRA 3TIFA 4M9QA 4RY2A 5SZJA 3B1WA 2R8RA 4RZ2A 2I1VB 2BKUA 4DCSA 1NI3A 4LC0A 1ONBA 2OXRA 4PO9A 4EAQA 3CONA 3NDPA 3A1WA 3MCAA 4B2LA 5JHGB 1XEWY 2OAP1 4IEEA 3W3AA 5HZKA 3PEYA 1ZM3A 5KPDA 4YMTA 2BBOA 2ZS7A 4UXIA 5AJXA 4DC9A 5C18A 4BLQA 5GJCA 2PZFA 1HUQA 1S96A 1XMJA 4XWAA 2O5VA 1MT0A 2ODBA 4HZUB 4DJTA 3A1TA 2J87A 3EC1A 1CLUA 1K5DA 2QNRA 2J7KA 1IONA 4G5OA 4B3FX 3TVTA 2CE2X 1IJEA 2NMVA 2GA8A 1IOZA 2ZQ5A 3I8SA 2DY1A 2ZYVX 4IXMA 1WP9A 3GCGA 4JL5A 2VF8A 3I61A 1UM8A 4YC7A 2FG5A 2JCSA 1Q3TA 2Q9CA 2VP2A 1KDTA 5BYJA 4Q7KA 2RGBA 1X8LA 3KXLA 4PAMA 4ZKDA 2OV2A 1R2QA 2BEKA 4HDCA 1N0VC 1GWNA 5FUWA 4EQ6A 4C7OA 2HDNB 1J70A 3SHWA 1F3OA 3TH5A 1G5RA 3L0SA 1QG4A 4AWXA 3KL4A 2GXUA 4DLSA 1QHIA 5K8TA 4NPHA 1WF3A 2AL7A 4UKDA 5EJEA 1GKIA 1KDPA 3HYTA 3KX2A 3THOA 3T1TA 2ZRKA 2KSQA 1U94A 5JFGA 1CKEA 2C9YA 1I4LD 2VSFA 3HP1A 1E9EA 3A37A 1OXSC 1XZPA 4M8NE 4OHYA 1P2VA 1DARA 2N1BA 3NH6A 3NG1A 4P32A 1JPJA 4DB4A 2F9MA 4AYXA 4MYUA 1NSTA 2OBLA 4U00A 1W5SA 2CL0X 4KJZA 4G5QA 4R71A 2ZRDA 3GJ6A 4GPTA 3MAAC 5FPHA 4NCJA 1VKJA 1XBTA 1MOZA 5JWHA 3RRMA 4M9SA 3A4NA 2BCJQ 4AY2A 1UBCA 3C5CA 2XXAA 5FPSA 3RHFA 5IHPA 3KKQA 3MFYA 5BWMA 1Z6GA 3L0OA 2DYKA 2GVZC 3FDIA 2J59A 4NE2A 1EWRA 1P60A 2OZEA 2O8DB 1NG9A 2CK3D 4IJMA 4R2IA 1W46A 4RD1A 3UATA 1N3BA 2I3BA 2FGJA 4X8LA 3QEOA 3T5GA 1DAKA 1J7KA 1DAGA 1WQ1R 5J40A 3N2EA 4ASUD 2YC2C 3R7WA 1GFIA 1F2TA 1G9XA 5AR1A 4KODA 1NBMA 3KKNA 4TMTA 4A0RA 4FWTA 4GP6A 5H68A 4JJZA 4D4MA 1NMXA 1JPNA 3FMIA 1O3YA 5DLQC 4LYFA 5TARA 4DSNA 4DDTA 4NKRA 2FX3A 2XZOA 2NO1A 1R8SA 3UG6A 3I4LA 2IUSA 4B73A 1NN1A 3MMPA 4YDHB 4NBSA 1T4GA 2ORVA 4BEBA 3EZFA 2YJTD 2GDJA 1BIFA 4KHZA 3L0IB 1XCMA 1XNJA 2DHRA 4TTQA 4KAXA 5JEEA 2EVWX 4GT1A 3VX3A 2QPTA 3DVLA 3TMKA 2QT1A 1KSFX 1M2OB 3BIFA 3LVRE 3I72A 4DT1B 1N6KA 4TYQA 4LX0A 3LFUA 1R0YA 1ZU5A 3UANA 2EWWA 1D9ZA 1W48A 4LUCA 4LWZA 5J4HA 2WKQA 5GADl 2O8FA 3EAQA 3MUFA 1YJ5A 3W5JA 2N46A 2BV3A 2Q9AA 3LW8A 2JLSA 5LB4A 3PEWA 3AKCA 3C15C 2WV9A 3EPHA 4XD7D 2CNWA 1Z2AA 3PVSA 5TXGA 1Z0IA 1YVDA 1VG8A 5CITA 4Q7LA 3IO5A 1T0JB 2FF7A 3FVQA 2OUKA 1E2FA 1G4AE 2QGNA 2XJ9A 1G8HA 2XOKD 1Z8FA 1BMFA 3ND8A 1Z0DA 1SXJE 3IPYA 5CLQA 1E9BA 1Z0FA 3Q7PA 1IXZA 2MSEB 1KMHB 1CR1A 3GJ7A 4P33A 3LV8A 4TQUS 1PUIA 1E9RA 3QNUA 3T1QA 4QBHA 2FPKA 2MMGA 1E0SA 2ZUDA 3KQUA 1TNDA 1GITA 3TW8B 1KI2A 4Q66C 3V4FA 1OKKD 5LBIA 3B1VA 2JGNA 4DLZA 3KJIA 5DI3A 4ABYA 1XWIA 1U0JA 1B0UA 5G3YA 4Q19A 2IYTA 4N1AA 3GFOA 3KQNA 2VP4A 3W8NA 5EE0A 2MMCA 1P7CA 1YR6A 5JCPA 3RRYA 5FOTA 4PQFA 1EFUA 4BLSA 3EARA 1WA5A 3BB4A 2EQBA 1CRPA 2WJGA 2J41A 2W00A 4RCYA 3E2IA 4HATA 4JT2A 3PXGA 3GLIA 2YVUA 4OL0A 5G3ZA 3T61A 1R5OA 1OXUA 1UKYA 4MRNA 1P2SA 2G6BA 3BK7A 4B6EA 3PUVA 4LHWA 3KXIA 1XTQA 2CHQA 3KB2A 1KY3A 4PC2A 3CO5A 3EIEA 5FR1A 1UBGA 1HURA 1JEEA 2WZQA 4C0KA 4I4LA 2HXYA 4BPBA 3CRVA 4KFRA 3R8CA 3GFTA 5FTNA 4BLTA 3FKSD 4IEIA 2FWRA 2D06A 1ZNZA 1A4RA 4QGHA 3K0AB 1Z29A 1MO6A 3FKSA 4P4UA 1TQ6A 821PA 2QRZA 1PVOA 1E2GA 3BFVA 3Q72A 2ONJA 2C2HA 1XTJA 4TYYA 3OEED 1D2EA 3NBFA 1NNEA 1JR3A 1RKBA 1CJKC 1VIAA 4I1OA 3WP0A 5C46F 3GEHA 3EZ2A 1Z6XA 4IHQA 3CX7A 3OE7D 2A3RA 3GEEA 4GI7A 4OHWA 4Q4JB 5LB2A 2W6JD 1CXZA 3W8RA 1HT2E 1DG1G 2QE7A 2AR7A 3VKWA 1ZCBA 1NN5A 3UK6A 4A92A 2X19A 3ZQ6A 4BUJA 2VHTA 4R2HA 3IBYA 4ZKEA 1KKLA 2ZRBA 5E7JA 1U9IA 1W44A 2C9CA 5DYGA 1Z0AA 1RYHA 2KWIA 2AKAB 2V54A 1E2KA 1Y3AA 2QZ4A 1VYUA 2DFNA 4M1WA 4KXFB 2XITA 2PJRA 4C7OB 4JLPA 4ZCIA 3IGFA 1UJ2A 4JYCA 1XPUA 4ON9A 5KOYA 2W83A 1EFRD 4C4PA 2OAQ1 3FFAA 4P3YA 5M04A 1OXVA 1IXRC 4A2QA 1QG2A 2JJ1D 4OI2A 1E9DA 4HDQB 3GFPA 3NEJA 2CE7A 2CVFA 1HQYE 2ZE7A 4DCVA 2VSOA 2QI9C 1J99A 3LLMA 1X3SA 3AM1A 3TVDA 4JLDA 4HLUA 4KFSA 2W0SA 3F8TA 1W4BA 1Z63A 3OIUA 4AKHA 1OH5A 4JLMA 3CX6A 5FBQB 2GRJA 4AYWA 1OV4A 3C41J 4IXNA 2ZJOA 4BASA 1SULA 4I81A 3WXMA 2OXCA 1N6HA 2W2XA 5CDFA 5FBLB 1OHHA 2ZSDA 3AGQA 3PJRA 4PTLA 2V1XA 1PV4A 2A5YB 2GJ9A 3MG9A 3TGPA 2NIPA 4QC2A 2VHCA 1QRAA 4MQBA 1SVLA 2GJKA 5FL3A 1G18A 2JIZD 2QG6A 4FINA 4QG7A 1KK0A 1DPFA 2MSCB 3DOEA 2P5TB 3FHOA 5L8VA 3FTQA 1GDDA 1ZU4A 3MWKA 4A1FA 3U2QA 1XPOA 3RLFA 1PLLA 4US2R 4O25A 2ZUBA 4BLOA 1E0JA 1D6JA 2OHFA 4URXR 3NXSA 2P5SA 2IF0A 1XD2A 3C8UA 1KSHA 2QMOA 5B57C 2G1JA 1FX0B 3VU9A 2OCPA 1YHNA 3AEZA 4TTPA 4DLYA 3KFVA 1P9RA 4G1UC 2OCYC 2QTVB 4JLBA 1SVIA 1DOAA 2KBEA 2QTHA 4GRAA 1QHXA 5BQ5A 2ZR7A 2IEZA 1T0HB 4A0HA 4CDGA 5KSZA 1RRGA 2OILA 5FUYA 1WB9A 4URWR 4N3NA 4M1OA 3LLUA 4NZYA 1Z0KA 4KBGA 3J81k 3CB4A 1E79D 5G53C 2HT6A 4HB2A 1F2UA 3VKGA 2V8OA 2KB0A 5EXXA 2R6DA 1VMAA 3U6KA 3F0TA 4A9AA 2ZVPX 3D6TB 2JASA 3AKEA 2BMDA 5EE5B 3WHLA 1FL9A 4G01B 4NDZA 4O3MA 2OO7A 4A0GA 3TLXA 4QRHA 2CLCX 3H84A 3WMFA 3VHLB 2ORWA 4TYPA 1N5KA 1HE8B 1XPRA 5CYPA 4ERNA 4RVCA 1CULC 1SXJC 3U7EB 1W0JD 4NONA 4MKIA 1P3JA 2ZI7A 2CJWB 4OHZA 4UNNA 2BJWA 3CH5A 1Z0JA 4LHVA 2IS6A 2GWHA 2E9SA 1KGDA 5F2EA 3K70C 3VNVA 3I5XA 3GMTA 3WYGA 5JI3E 4BRWA 2OG2A 3MWJA 2XXAB 2CBZA 1GNPA 1XEXB 4D0GA 2GCOA 1SXJA 3IO3A 3TUIC 3AVQA 1G41A 2DFKB 5KNCA 3WRXC 3A1SA 1VCIA 4IDQA 4J0QA 2WBLC 5CYOA 2B8TA 1GG2A 3KTAB 4PAQA 5AJWA 3IIKA 4BE7B 2A7QA 4QOSA 4EPTA 2V7QA 3THWB 3PUXA 2GBLA 1KO5A 3AKYA 2IW3A 1PJRA 3R7WB 4Z54A 1F2TB 1YZGA 3N2IA 1GIAA 1NLZA 2CDNA 4Q1FA 1UDWA 1UPTA 2QT0A 1DG3A 3DL0A 3ICQB 1GNQA 5C2JB 1JQJC 3WNCA 1E96A 3AVPA 2F1IA 4NL4H 4NH0A 2O0HA 1YRAA 3FPAA 2ZRHA 1FW6A 4C0BA 3I1FA 4YXWA 3TUJC 4QHYA 2C5LA 2IYQA 4HUTA 4Q21A 3RNLA 4CVNA 3U3JA 2ZI5A 1M34E 3UWOA 4A36A 3AV0B 3IIJA 3QENA 1UEJA 1ZUNB 3JZAA 3T35A 1AM4D 2DFLA 1OXXK 2FSIA 3BH6A 4M22A 2IUTA 4KCGA 4YMUA 1VDZA 2JA1A 4YMWA 4YMVA 4GNKA 4AURA 4OQFA 4PC7A 4DT1A 2ZAOA 2RCNA 3NC1C 2J3EA 5DHFA 4MDEA 1JNYA 3O8DA 2ZUCA 1MRNA 1P61B 4Z8XA 2O8FB 3PUWA 2ODEA 2F6RA 2ZU0C 4C0QC 1Z83A 1VYTA 2CEAA 1SVMA 4LV5B 3B7GA 2FJUA 2W2VA 4L5BA 4XWKA 3KQKA 1AA9A 5DNYB 2ZRAA 1XFAA 3VKHA 4M1SA 5EP4A 2GEUA 2OLKA 1JBKA 2IK8A 1Z6AA 3DM9B 3SYNA 1DEKA 5EUMA 3SI7A 3VR2A 1S8FA 2FFHA 2QUZA 4HAWA 4KVGA 4PPFA 2O8EB 2DR3A 3E1SA 1Q20A 3DHWC 4C0HA 4PR0A 5GJWC 5GVSA 3QUSA 1OW3B 3SU8A 4NP6A 2IXFA 1Q1ZA 5DN6D 621PA 1VCMA 4G0NA 4LHZA 4MH0R 4O2RA 4D4JA 3EPJA 4B3GA 1TTTA 3VR1A 4IKEA 1RPZA 1J8YF 1X8KA 2O0JA 4PSKA 4RZUA 2P6NA 4UQOA 2WPDA 4MITA 4D4LA 2VHJA 4RCZA 2RGAA 5JCZA 5JWRA 3ZQJA 2EFEB 2HYDA 3REGA 2IBMA 1M8PA 1AS3A 5GVRA 1P62B 2FFQA 3Q5EA 4TMZA 3SN6A 4OKSA 2P3SA 2XZLA 1COWA 1H8HA 1RIFA 3TAUA 1VECA 3CRW1 3LA6A 4XVQA 1OIVA 4JVLA 1Q3HA 2B21A 2LWIA 2X2FA 1EG7A 4TL9A 5HCNA 1XP8A 5J4YA 1JAIA 3ZVMA 1DAEA 3LQRA 4Q1DA 3O8BA 1OHHD 2D4HA 4P31A 4QHSA 1XU4A 2B92A 2XSZD 1DBSA 2P2LA 2C78A 3D7MA 3QKUA 1NVWQ 1CJUC 3ZH9B 1MH1A 1S3GA 1BOFA 1UF9A 2YZ2A 4QL3A 3R9IA 1UDXA 2AWOA 5KDOA 3RRZA 2SHKA 2NO9A 4FW9A 1Z06A 1P6XA 4EPWA 1S9HA 3QKRA 2WOJA 1E4YA 2QPAA 3ZD7A 1R7RA 4PSVA 3F3YA 1G3MA 3RSLA 3SHFA 4MRSA 2R62A 2IYSA 4OQLA 4QJ4A 1HEIA 1R10A 4V02A 3TRFA 2WWYA 2WWIA 1WBDA 1C1YA 2C98A 2WMNB 3AUXA 4LY6A 5D3MB 1TQ4A 1D2NA 3C16C 3DKPA 1RW4A 2QM8A 4Z1MD 4FMDF 1W4RA 3RANA 3A4MA 1N0WA 1W4AA 1XMVA 4HI0E 1KK3A 4JVNA 3VX4A 4DLUA 4PZLA 2ZYTX 4NHOA 2QP3A 4D0NA 1FX0A 4D6PA 1G20E 2N42A 4NCHA 2WJHA 2IX3A 4G5GA 3WRYC 4HLQB 2J5XA 4YONB 2ZRGA 4A2PA 3WBKA 4R9UC 2WVJA 1C9KA 3ZYCA 1OYWA 2ZRCA 4OYHA 3VR5A 4BFVA 2YWHA 4QM6A 2EW1A 3G5UA 4MKFA 3TSOA 1A1VA 2VSXA 4KBFA 3SBDA 4HUQA 2JDID 1XRJA 1F2UB 2IUUA 4QGAA 2QSYA 3M0EA 5CM8B 3WNDA 4QM7A 4LZZA 3RWMB 3QBTA 1RJ9A 4CEHA 3K09C 4NYIR 4NYJR 3EPLA 5HE8A 2O8BA 3ZZ0A 3B5JA 3FWYA 4JT4A 4WXPA 1P9WA 4H1VA 3BXZA 1SVOA 2PLFA 2VH5R 2V3CC 4ZDJA 2HLDD 1E2DA 1OFIA 2FN4A 3LW7A 4G3XA 4JIMA 3VR3A 4URVR 1W36C 1US8B 2ZI6A 2D2EA 2CCKA 3PEVA 4EKDA 2VIIA 1ZC3A 1FUUA 2OSBA 3UMFA 1H8HD 4DDVA 5E4FA 2D62A 2NO7A 4ARZA 5H1YA 2GK7A 3BS4A 3L2OB 4RKEA 4DSUA 3LXXA 3MD0A 1FZQA 2J7PD 4EDHA 4M0LA 3CNNA 4LYHA 2NG1A 2ZE6A 2Q3MA 1DO2A 2BHRA 3ADCA 1RE0A 4DSTA 1ODFA 1CRQA 1LVGA 2OLJA 4Y0VA 3AGPA 2F43B 4HSEA 1E69A 2XX3A 5L3VA 2WKPA 3OAAD 3U44B 2BWJA 3G82C 3DMNA 3LWNA 1SKYB 2BIFA 3ZZUA 2QAGA 3AVVA 1I4TD 2OFOA 4LYAA 3EZ6A 3L8ZA 5E95A 1R5NA 1Z6YA 1ZD8A 1K5GA 2ATXA 2XNDA 4B71A 3K70D 1Y63A 1KZGB 2C03A 1GKYA 4CW7A 2QA5A 4BLRA 1G8GA 3UMSA 1AN0A 1E0KA 1E9CA 2QL6A 2GESA 4GOXA 5JI2E 4S2EA 1JI0A 1KSGA 4C3ZA 4ZIRB 3T06B 3I62A 3CKLA 3LY5A 4JLAA 4LPSA 1SVKA 2NOAA 1UAAA 2GVDC 2IF2A 4HLUC 2B7CA 4RD4A 4RFSB 3R9WA 2QBYB 1JB1A 2C96A 4L9WA 4JLJA 1SQ5A 2OFXA 3HPQA 5CIWA 1QHNA 3I3SR 4Q1AA 3QVUA 5JS7A 1KO1A 5FI1B 1QHYA 3BH7A 3TNFA 4UNRA 2HJVA 1D5CA 3QF7A 4DLVA 1W47A 2WTUA 2HCJB 1G6HA 2GTPA 1YQTA 2JLQA 2ZIAA 4TN1A 5B58C 4YQFA 5AJYA 3THXB 2F3TA 5FPYA 5DSZA 1H8ED 3U6BA 1QHSA 1KI6B 4K8OA 4FI3C 3B60A 2H92A 2NTYC 1LF5A 5IT5A 4GMXA 2PL3A 3QPVA 3O47A 5UKDA 2WWWA 4EPYA 3BGWA 1G4UR 1IY1A 3GLGE 4RD2A 1IY0A 2JAQA 4A6XA 1KJYA 4W7SA 1GL9B 3DMDA 5AWFC 3PFIA 4XTRA 3W6NA 4ZPXA 4WW0A 4EIWA 3CRMA 2C8VA 1KO8A 1SXJB 3VFDA 4X8OA 5FL7A 3A8TA 4B2PA 1NY5A 1SXJD 2ODNA 1UKVY 1P73A 3LBNA 3PV0A 2PJZA 5J5CA 3GD7A 1VG9B 3QXJA 2FE4A 3KTAA 3CWZA 2V4ZA 3CF2A 2JJ2A 1HV8A 4MKGA 1W2GA 4RD3A 3K0CC 4JLKA 1JECA 4PANA 4P4SB 4WZ6A 5FBVB 1IBRA 1KKMA 3ETLA 4EPRA 1E1RD 1VHLA 1W0JA 1OPXA 4TMXA 5IK2A 3AUYA 1XXHE 3IIMA 1SGWA 1RZ3A 1II8A 5TDHA 3DKVA 2WAXA 1TF5A 1DO0A 1LV7A 3RS5A 1Q57A 3I8XA 2G3YA 1FOEB 1GVNB 5AUPB 4JYBA 5BYKA 5KNDA 3MWLA 1T91A 3W5IA 5JSZB 3GLGA 4Q1BA 4R98A 4XTCS 3U61B 3ZD6A 4M1YA 1IN7A 2GZHA 1YZNA 2HJGA 1IN8A 4DKXA 1D8TA 2RGEA 5J4LA 1O87A 4X8MA 1RVDA 2FU5C 1ESNA 1ESMA 5IRCD 1U99A 5LD2C 1AS0A 5EXPA 1NIJA 1E1QD 4DIDA 3RYTC 4RKFA 2OBMA 3WYAA 2EYQA 1TX4B 5CJPA 2CLSA 4LBWA 4XVRA 2H17A 1Z47A 2IYLD 2QMEA 1JALA 3I32A 3K0FB 5D3MA 2FNAA 3NBZC 4YLGA 5GJVC 1EFCA 3P27A 3Q9LA 3K8YA 1UBFA 1TF7A 3MJRA 3RAPR 5KU1A 1ZM4A 3CNLA 1YZTA 4W9MC 1QHHA 1YR7A 4RD6A 2Q0HA 5DIFA 3PUZA 2J46A 3EIHA 5FOWA 3TKLA 4NYIQ 2VO1A 2REBA 2WWGA 1Z28A 4DCTA 1II0A 1TL7C 4WZBE 4PHFA 5L3QB 3ZGXA 1DAFA 1GNRA 3CF0A 4Q47A 5DI3B 4UJ3A 4I1SA 5DO9A 5HE9A 5IDVA 2G83A 2VF7A 4MGYR 4PQRA 1CTQA 3IUYA 3B78A 3NC0C 4NCKA 4LJYA 1QVAA 3CIOA 1IM2A 3NKVA 1SHZA 1MRSA 3BB1A 4UNSA 3ZZTA 1XF9A 2ZJ5A 4ILEA 2XB4A 2Z4SA 3RS3A 4A8JA 2WIAA 3UG7A 3ADDA 4OHVA 1Z22A 5KSPA 1CR2A 1G8FA 1HQCA 2R6FA 1L4UA 5AK0A 3SJCA 1J90A 1T3LA 1GTVA 2ZXUA 3GPLA 1MR3F 4QNMA 3H1TA 2RGGA 4RFVA 1K8RA 1P9NA 1E9FA 1YR9A 2J0SA 3IILA 3B9PA 4CYMA 3TR5A 1J8MF 2Q6TA 2A2ZA 4OBEA 2ZRNA 4F4CA 1D2MA 1G19A 2KJQA 1Q44A 3QSYA 1G1MA 1E9AA 1QHGA 1OH8A 2PEYA 1SVSA 1SZPA 4IOLA 4BZPA 1IN6A 3NHAA 3MSXA 2F43A 2CXXA 3CR8A 4DUGD 2ATVA 1BS1A 4BZXA 121PA 1NJGA 2QSZA 3CPJB 1BH2A 1AS2A 5KSOA 1C4OA 4JZKA 2V6IA 4Q18A 2IYUA 4Q9HA 1YZQA 1U9IC 2RKOA 1E9SA 4Q4JA 1Z3IX 5TB5A 4BFWA 3QVVA 4ITRC 4LBZA 1N25A 4LHYA 2QU8A 1KMHA 4KO8A 1G291 2PT5A 3REFA 1ZM2A 4E5UA 3Q3JB 3X1XA 4QXAA 1JR3D 1KI4A 3AF4A 1G3RA 221PA 4JVMA 4DSOA 5IK2D 2R2AA 2FSGA 4Q7JB 4QBGB 5FPTA 4RFSA 3A1VA 4HYYA 3GQBA 2QBYA 2AX4A 2HF8A 1XEWX 2ZS8A 1TU4A 3BFKA 1MKYA 1G8PA 1S9DA 3IEUA 4II7A 2CL6X 4HUQB 2IYXA 3GLIE 4LC1A 2G9NA 3T1OA 1LS1A 2ZEJA 2HV8A 2GEVA 3P20A 5FTKA 3UWKA 3AP3A 3HDTA 2BEJA 3WHKA 2FV8A 4IW3B 1VG0B 4U5XA 1E98A 4KLNA 2QEQA 4PZZA 3GLIB 1ZD9A 2ZSFA 3THXA 4A4DA 2P6UA 4A2WA 4W5JA 5FTJA 5J47A 1I2MA 2FSFA 4DB2A 4CGZA 1BYIA 2QORA 2HYIC 3AVYA 5EE1A 3RABA 3IEVA 3LDAA 5EP2A 2IWRA 1A2KC 1P5ZB 1G7CA 4Q4AB 2CLDX 3OFNA 4OK3A 5FBWB 1WMSA 1WXQA 4PC6A 4C2TA 1XMSA 4P4TA 4Y0AA 5JWOA 1VYVA 5JZVA 3EWSA 1TUEA 3AP2A 5BW8A 3QY0A 3BJIC 3A4LA 3RS2A 2Z83A 4B74A 2FZLA 2CL7X 1E79A 1XJQA 1BYUA 1JXMA 1XCGB 5F9FA 2ZJAA 1A2BA 2W58A 3OIYA 5FUVA 1G6OA 4US0R 1R8QA 2YOGA 2NPFA 2GCPA 1II9A 5JRJA 2WJIA 1N5IA 5DN6A 4TZ0A 1XDBA 1KHTA 1GAJA 2AK2A 2XAUA 4P4SA 1FTSA 3D31A 2KBFA 3L82B 3QJYA 4GOJA 2RGDA 4XWOA 2OCBA 2QMHA 3AF0A 1KMQA 4JBWA 1XJCA 3KKMA 5KHOC 1U98A 1EFTA 5JS8A 1OH6A 4M21A 4POAA 4Q9LA 2ZJBA 4N0DA 3SZRA 3ECCA 5FTLA 1ZW6A 1L2TA 2ZR9A 3HWSA 4URZR 4DLRA 5DISB 2VP6A 4FMBB 5AJZA 1VCOA 5E7IA 3K1JA 2J0QA 4K46A 4YMSA 4IVQA 2GETA 4HAZA 3QKTA 2C99A 3QE0A 4Q4HA 5FPKA 2JEOA 3OAAA 4BLPA 2F3RA 2HUPA 4ZCMA 2EU8A 3V4RA 2J0VA 1BMFD 1KI7A 3CNOA 2FGKA 3LRPA 1OE0A 5K8IA 4B3CA 5BN3A 4F38A
chains in the Genus database with same CATH superfamily
5DM1A 4CUJA 4CODB 3ROMA 1NI4A 5SYNA 2J5KA 4MZDA 3S1AA 5EPEA 1WY5A 3KR2A 5A0FA 1XXHB 5IBCA 1G3UA 1Q1GA 2D8AA 2X8AA 3M9LA 2VDJA 4UCQA 1JVBA 4AG6A 5J2TB 5JRZA 2A9OA 3KQPA 2XAAA 3OFVA 4TYWA 4PYJA 1V3TA 1CY8A 3MMSA 1AK2A 3HVKA 1ND6A 3NO4A 4KU4A 1PL7A 4HMQA 4AWBA 4EHKA 4F6RA 4ASUA 3UH1A 2ZWVA 4EUKA 2ZK7A 4KXYA 3UAOA 4ZU3A 3NIDB 1JQDA 3PA8A 4NE7A 2ZSKA 2VWQA 1W34A 2WKSA 4RULA 1D0IA 3GNSA 4ZEMA 2NUBA 4WCFA 2QTGA 2V7QD 1RQRA 2PDAA 3EMVA 3SJBA 3B53X 4F5ZA 5TR9A 5HDQA 5CDHA 1QOPB 2G63A 1AZSC 3IQWA 5PNTA 4B4KA 5JCOC 3H97A 2YHIB 1QFXA 1T9HA 2JAPA 4UATA 4F60A 3B8HA 1UZUA 3H9BA 3QI2A 5DLDA 1ODKA 1QDEA 3GJRA 4P4NA 1CQWA 4BVHA 3GRRA 5CXXA 1BWSA 2AN5A 2CF6A 1HPLA 1T3SA 5HA5A 2C4VA 1NMEA 3VOAA 1LNZA 5CEJA 4GZMA 1UQUA 4JKYA 1XCJA 2EX1A 5A4DA 5CA0F 2H1OA 1T2UA 5EIBC 2H0QA 1YRBA 4CMIA 3ADBA 1XSEA 1QS0A 3KXKA 5H7XA 3VU9B 1R3UA 5AIBA 3O82A 4LTDA 3U56A 4FYYA 4J7XA 4CMEC 2AN9A 4F8EA 1ETUA 3IT3A 5LQRA 1QCCA 5HIIA 1W2HA 4I99A 4IMIB 4KNYA 4IY1A 5L6MB 3BMOA 3FBTA 1LDYA 3CLTC 1L3BA 4D9JA 3HG7A 2A9QA 4FEYA 1R00A 5CT5A 1NSFA 1YQEA 2CK3A 3O9MA 4QKQA 3T3OA 1C0LA 3JYHA 4CIDA 2LIPA 1XCBA 2C2KA 5SZHB 1NYQA 3BD9A 3AETB 1R16A 1CK4A 1UP4A 4BFXA 1L5FA 3FB4A 5DGDA 3A04A 4PAOA 1QX3A 4NABA 2CZGA 1T0UA 1XZAA 5FH9A 2ZTHA 4DHEA 5IFLA 4D8YA 1RABA 1X0VA 3UV7A 1TIBA 5LNK6 1EAMA 1YB6A 4QOGA 4E1VA 3DA8A 5E7MA 3RJZA 2Z08A 1SBNE 1V43A 3A0UA 1YZYA 3LBYA 2AW3A 4X93A 3Q8XB 1IULA 4WZZA 1NJ8A 1XRPA 3VMMA 4GPD1 1YTLA 3H8SA 5U4QA 2PGIA 3EA0A 2OORA 1OB5A 2PYZA 3GJSA 5EC8A 1XKQA 3IEPA 1G17A 1UC5B 1VMEA 1T36B 2OB2A 3QHQA 4I55F 4H2DA 2OV3A 3JQ8A 3PFFA 4J49A 1ZK0A 2WA2A 3OF3A 3RHZA 1SOUA 1Y7TA 4YMGA 4O8ZA 1NRWA 1SB8A 1TMKA 3MTGA 3DBHB 1JSZA 4QFCA 4BJHB 2Q6OA 3N05A 5JECA 1ZGHA 1GKUB 1T5HX 3GEBA 4C0LA 4JOSA 2Z58A 5BW5A 4WLUA 3LLVA 4B2YA 1BE6A 1G60A 3CZQA 1Z37A 2PIDA 1JGTA 2XTNA 4MUIA 4XLZA 5ITZA 3TSWA 5JQWA 4X91A 2OVBA 2H4XA 3L4EA 1KFEB 2RI1A 3PC7A 4Y9RA 4JS0A 4O2BB 4W5WA 5ESWA 2C57A 3CVXA 2FSPA 2EKDA 1M72A 4RO0A 2QSUA 4CI0B 3ZWDA 5JXIA 1N75A 2E48A 2P4EA 3QTTA 3P52A 4E94A 3U4QA 4TLCA 3UIEA 4HDAA 3OQVA 3I04A 4A82A 4G81A 4K9LA 4F6CA 1JEQA 2VDNB 3V2IA 3CLVA 3F2VA 1XNGA 4H3VA 5GV7A 2ONKA 1XVIA 3H2BA 1JEYA 1L5SA 3MAJA 3AF6A 1U9ZA 2IYEA 1OI2A 2PAAA 4IJUA 5F4ZA 5FOSA 1CUWA 3S55A 3VJMA 1FDIA 1Y9AA 3O8NA 5I4IA 4MRVA 3UMGA 1DFIA 1N2XA 4RJ2A 5LQNA 1BQEA 5C32A 1R0XA 2YKGA 1PQPA 2DFTA 2R97A 5EIEA 3PUKA 4OHOA 3VOBA 3SKYA 1JHUA 1DQSA 4HWOA 1BU8A 1DIRA 4MQEA 1WSDA 1YXMA 2ATEA 1NU8A 4RZSA 3B2EA 2NVUB 2HRRA 4PYQA 4IIBA 5JEDA 4EPVA 3OCYA 5D01A 1U6KA 4MUJA 1YNOA 3M6AA 3E6AA 3FMPB 1T3GA 3EGCA 3N5CA 2Q1XA 1MVNA 3EA5A 1T0BA 5DB4A 5HWSA 3HADA 3MMZA 2XKKA 3MJCA 5DZSA 3MUNA 4QUDA 1QP0A 1IOLA 1QH0A 1SKAA 2J07A 3D3QA 1EFRA 2CCGA 3N76A 4PQGA 1YBVA 1P33A 2W2KB 3HYRA 2ZIWB 4W9RA 1U81A 4HB4A 3P0EA 2WKRA 3HB5X 3CH6A 3HJGA 3Q3GE 3TG2A 2ZM5A 1OXMA 4KQEA 1RRCA 2O2GA 5JADA 3BH0A 4FCVA 4AJLA 4HNRA 1ZIPA 1U3FA 3NM5A 3HBNA 1UEIA 2E5FA 1AQYA 2A67A 1LLUA 1XE3A 3EXIB 1J8VA 1MFPA 3JVEA 2R8XA 4LVCA 4MA4A 4PGMA 5AM0A 3K0SA 3A2KA 4EO9A 3KJHA 4EABA 3RM3A 3X44A 5JD4A 1G8YA 1VRWA 5IKMA 2XVXA 3E7XA 3R7NA 3W9YA 2V0NA 2HF2A 1KEWA 3L1IA 4BNDB 5F33A 1GL3A 4YP1A 1T8TA 5FOXA 3VNRA 4AQ7A 2KM1A 3IUMA 1LK0A 2P4UA 4K05A 2O8EA 1Q0PA 3WSTA 2PKQP 1JHOA 3KDSE 4W63A 2HR1A 1CEEA 4R1MA 3OUUA 2R79A 5EZ5A 1ONSA 1U2DC 4OJNA 1IK4A 1A5BB 2EFHB 2GD2A 4MS1B 5A4FS 2VXCA 3D1JA 3T54A 3R0VA 2HRCA 3PT5A 4DLXA 5CB8A 2BBSA 2VDWA 3BSSA 2IU6A 2QTBA 4MQFA 3WJ7A 3H5OA 5GAJA 5B2ZA 1XTUA 3T5PA 3K20A 1JHRA 5DNWA 4CU2A 2ZIZA 4MOWA 2W98A 4EJFA 4OIMA 8MHTA 1ZH8A 2GEKA 1W4CA 3HVHA 4V0MA 5K4AA 1YTUA 2CV0A 3KUXA 2FLWA 4URFA 5BVGB 2J32A 4DM3A 1HRDA 4M55A 4X6LA 3G1TA 4J90A 4MPJA 4ZRNA 3RODA 3Q7IA 4QEZA 3OTWA 1KI8A 1N4DA 1EHCA 1Z8DA 2ZU6A 3DO6A 2I0FA 3RGWS 5IF3A 3X1WA 1NP6A 3IXLA 1H1DA 2NZWA 4PF1A 1K3TA 4YRRA 3FOBA 4PC1A 1GTL1 1JLSA 2MSDB 1YL7A 1PGQA 2BSAA 4OI1A 3I5AA 3DKKA 4Y2YA 2WP0A 1GPKA 3AR6A 3FMOB 3FSRA 1N3YA 3F8SA 4R9VA 4R84A 1LB1B 2X0KA 3TLBA 3IB6A 1XVTA 2AYXA 6GPBA 4CM3A 3KSUA 5IJWA 2XB2A 4BN0A 5A5FA 3HRKA 3VYVA 3HDYA 1DXOA 3ZUPA 1TPZA 1URPA 2B4QA 4J43A 4TWJA 3VU8A 4E03A 5HZHA 2QRVA 1ZGAA 3JV7A 3VR4H 3U3KA 5GONA 4GLOA 2O19A 4H16A 1C1XB 2CUKA 4UUPA 4TV9F 1N7JA 3K1AB 4GWGA 5I7WA 2ZSBA 1R74A 1SZDA 3I9NA 2WUWE 4MW9A 1HT0A 1P3Y1 4QGSA 4CL2A 3NUQA 1NJ6A 1EFKA 3ESYA 1OXTA 1E4EB 3MTIA 3OG9A 4NK4A 4RX1A 4WFIA 3RTGA 5CU7A 4H15A 4OY3A 2EV9A 2Z9CA 4LX8A 1XT6A 1C3OA 3ZDFA 3UMRA 2W6ZA 3V9AA 4B3XA 1QP4A 2UZ0A 1KRHA 3MVEA 4P2GA 4UQPA 4EJMA 4KH0A 5G1OA 4D25A 4DLTA 1Z2CA 3F97A 1S4MA 4FWIB 4JVSB 5JS2A 1DAIA 4Z4IA 1L6RA 1G21A 4ZIRA 4MV0A 1KAQA 2FEWB 3WLHA 3THRA 1H4SA 4E07A 2HNKA 1QCDA 1I10A 1NBME 5EJFA 5JO9A 1IH8A 2GBPA 1Z7YA 4J0EA 4GDFA 1U7PA 1JA1A 2D1QA 2W2TA 1B23P 1TCCA 3QE3A 2AFIE 1AKVA 4IDDA 4XD2A 1XA0A 1BDBA 2W6MA 1JG1A 4YRNA 5C51B 3TQFA 5HBRA 5FIUA 4DMRA 2OE2A 1WKBA 5SYMA 2VKTA 5EE3A 4ZOLA 1TB4A 1FFEA 4XLLA 2D4AA 4FGLA 3BN3A 4GVPA 3QKWA 3SZOA 1TA0A 2BMFA 3ESRA 2PSSA 1KNQA 4KWHA 1QZXA 2IHTA 5T8KA 2PCLA 3CCFA 3I2YX 3NDJA 3FMVA 4M4SA 3K0EA 1EUCA 1D1QA 1ZK4A 3O3NB 2G76A 1Z82A 3GR6A 4B3DA 4QTYA 2UXDB 1ZWLA 4NJMB 4BQSA 1JDZA 3PUYA 5DNUA 1CC1S 1GGHA 2PSEA 4BVFA 2I8CA 4GW3A 2HI0A 4K0KB 3QKSA 2FZ5A 2JLXA 3IAS1 1KIMA 3KOZA 2ID4A 4O4IA 1KZHA 3W7VA 3CRRA 4D0SA 3R6TA 1HYBA 1W52X 4CTOA 1MO4A 1TKAA 2NAFA 5G41A 2YMMA 7MDHA 2FJPA 3H65A 3NYWA 4O3FA 1TYAE 4QUAA 5G0SA 4R40A 1MXHA 4C4SA 3AX6A 1ZUHA 4Z9XA 2UZIR 1KTVA 3K05A 3K4QA 3MWDA 3WJ2A 5DBFA 1QRUA 4U5QA 3L6BA 5H9WA 1ECPA 1Y1KE 1V1RB 5K3BA 4UTXA 3DUFB 2QX4A 4TKVB 3ZOKA 4BY9E 4XWGA 1TW3A 4ZYXA 3UBMA 2AUNA 3KBOA 1QGUA 1A97A 2XRFA 4GM1A 4JR2A 1KIAA 4AB1A 4DA7A 3DOUA 4W1QA 3PU6A 3PNYA 4FN5A 2IEGA 3KPJA 1U1DA 2Q4OA 5BN4B 4C30A 5JXWA 4XJXA 1W2WB 2WOOA 1CJCA 4Q3AA 5IZCC 3IDQA 4CDNA 3VDRA 1K27A 2HJSA 1GZVA 2JH8A 1LLQA 2KQUA 2XNDD 3UB4A 1CNFA 2AA3A 4L8GA 1E1NA 3RFTA 5HX7A 1TZ2A 5COBA 4R8SA 4LGMA 4WZBB 3NEYA 3ZOZA 5LFAA 1SU7A 2JD0A 3VKFA 5CDFE 5DHPA 3E0QA 3G89A 3WKEA 1VLVA 3F1KA 3JQGB 1PJ3A 3GFQA 1PT8A 2C84A 2OB1A 3RU7A 2JIPA 1M73E 2VWHA 2FN7A 3LUPA 4O4IF 4QFDA 3TZQA 2RG7A 5I47A 3EPRA 1AGPA 4DMGA 2X9GA 5LMCA 4D2IA 3NTUA 3BYZA 2I80A 5DF1A 1DQRA 2AG0A 2HU8A 4KTTE 1DUVG 4RVSA 4JFRA 3RC9A 3V8PA 5IBPA 2QUAA 3HUEA 1WB4A 2DHCA 2WSSA 1NSYA 2J8ZA 1U7HA 3CZPA 3PGLA 3RBXA 4KHPB 1FQKA 5BSUA 4BVKA 1XP5A 3W1WA 1LGYA 2OCDA 1XYYA 2HWKA 2ZYHA 2BFMA 3NUZA 4QHTA 3FWHA 3QLJA 4HDKB 5TSDA 3RSCA 2WTBA 5A5VA 2XZTA 2H06A 4FNGA 1N2CE 2NVOA 3O4FA 2IYRA 3UAYA 3ZDQA 4RTOA 1IUOA 2WHXA 4H3HB 4HLCA 1JVSA 4UFPA 3OQ1A 1FDSA 2JZCA 5KJ6A 3X2SA 4ZVLA 2GXSA 3NT5A 3OMLA 1QH8A 3DL4A 2O9JA 2BY4A 4IIXA 3O8CA 3TVYA 2YJGA 4YROA 3G5AA 3UKOA 1CS0A 3BGIA 1S1MA 2ZANA 3AH8A 4DA0A 5KYUA 1ZVKA 2MSKA 2OV1A 3QJ5A 4L4UA 4XVHA 2DU8A 2F1HA 2ZIXA 4ZOAA 1X1TA 4ZVPA 1D7AA 2ZIFA 5KVQA 2FKAA 1FS4A 1KY2A 1RYFA 3A10A 3CEHA 1V7CA 3DTNA 4HN2A 4KLZA 4PXAA 4XZ3A 5IN4A 3QEMB 4MS3B 2FWIA 3RHSA 1LH0A 3FTDA 4CN9A 1AQJA 5ISMA 1IBMB 1E1LA 2AXNA 3AIOA 4BCBA 4DV5B 1Z7GA 1AHPA 3HR7A 2V6JA 4NEHB 2B6HA 4XD7A 2NU8B 3ZCXA 1U2PA 4KR9A 4JUBA 2FFAA 3QLUC 1U5AA 2OO3A 3KT3A 4DLNA 4LF6B 1ZEMA 4W5NA 1HTWA 3LUAA 3N8IA 5DWDA 4WGFA 2NVWA 5B1SA 2QQGA 2YV5A 5DT9A 4LMRA 4BJ6A 2Z1MA 3Q5DA 5EFZA 3SFVA 2ORYA 2RMKA 1AB6A 4QDXA 4C14A 1U63A 3IYLW 1ZGZA 3HGTA 4GZLA 2XMZA 2M6LA 3M2PA 3RRJA 5DNCA 3AWIA 3HMKA 2G07A 4RE5A 2X4DA 1GGVA 3RROA 3FM9A 4GI1A 1KL7A 4FFPA 1S7GA 3CKYA 5AD1A 3ZIAD 4CXMA 1SUIA 4MRMB 3HXKA 3DYBA 4KE6A 1I3OA 2VXBA 2ZWAA 4MVJI 3C6YA 4PS1A 2PGXA 3D4BA 4G8JA 1CQJA 1TM5E 5EVCA 4KQFA 3PQCA 2LXNA 4GMDA 1MAWA 3ZWVA 5HR5A 1PQYA 2HDOA 3OZIA 3U4DA 4EF4A 3DFZA 2IHBA 4NVRA 1ABFA 5AHOA 2QKYA 4NI5A 3SYTA 1ATIA 3WXBA 4HC4A 1JJ7A 1M74A 3IHLA 3VR4A 4BKRA 3GGGA 2RK3A 3VNBA 3HEMA 4PLZA 1S2LA 4E5PA 4QGGA 3DFFA 2A30A 3AHFA 2H54A 4M37A 4ZVQA 1P4SA 3FNGA 1TAUA 4PN7A 1H2EA 4I8IA 3K2IA 1QORA 4LXYA 3PRYA 1VTKA 5DULA 1REQA 2KLHA 3B1FA 3JWGA 4DBVO 3TLGB 3W04A 3BHJA 1DAHA 5AKKA 3AYXB 3PUIA 5IMBA 4DQUA 1HZJA 4YB8A 3R9WA 1FTNA 3GV0A 5BR4A 3T5DA 5HJ7A 2XWJI 1UIRA 4IIJA 1OTYA 2D5BA 3PP8A 3UK7A 5J2UF 4C9BA 1QHHB 3BT7A 3H3XA 1ZVQA 1NJFA 2W90A 3L4BA 4R2MA 3QUCA 4EYEA 1PYDA 1FNCA 2GMWA 2X0NA 5CCBA 2WM8A 4KLAA 4O0MA 1WCXA 1OREA 2XZPA 1K68A 2IZOA 2UDPA 3BE6A 3RIHA 1LI7A 2QSJA 2Z5FA 5JY1A 4ARIA 3P26A 1E3SA 3LBHA 3THYB 3COSA 1UFKA 1FLVA 2JLRA 1T8SA 1DAMA 2XMRA 3RT9A 4DNPA 1E62A 3HKCB 2VNJA 1WBBA 4YDSA 1V6CA 4YAWA 4ECEA 4CUZA 2OHGA 4F92B 2X86A 2P67A 1UINA 5JSHA 1GU1A 1RXSA 2I1WA 5AW0A 2BMEA 4GVXA 3HFRA 5C8DA 2ETVA 2TMYA 3A6EA 3R0IA 5B1EA 1FX1A 3AF1A 1UQTA 4RMNA 3DMPA 4B81A 1KEUA 3A6ZA 4GM4A 1DXYA 4TZ6A 2ZYRA 3QF4A 1OX5A 2C4NA 4ND2A 1NTOA 4MROA 3BG5A 2R6GA 5AVJA 1WABA 2IV2X 2JRCA 2D59A 2OYCA 2BEUA 1ZG3A 1OQAA 4NPCA 1CVIA 1T6BY 1N1GA 2WU0A 1OSNA 3WMEA 1MNQA 2APJA 1OI4A 4UBKA 1OWOA 3L1HA 1VXRA 5ARCA 3CGWA 2W6PA 2AHRA 4EHJA 2C4MA 3HU2A 3WNQA 7ABPA 1AUXA 1VCNA 2HA5A 2IBTA 4TX1A 4I50A 3RAGA 2QVXX 4QWWA 2FEMA 3WISA 3UAWA 1ENPA 1UZNA 2CWWA 5CNKA 3JR3A 3FLMA 2DCMA 5L3SB 1IRIA 4GMKA 1HNZB 4QG3A 2ZIUB 1M1XB 2W6IA 5EJ2A 2GZAA 2ZYDA 5DE3A 3WIVA 1X7XB 3FPFA 5A5GA 1VIDA 4TVBA 3E9EA 3AUJB 1XTVA 2XHEA 3U60B 1K89A 1MOSA 3JZMA 4DIEA 3DLAA 2XMDA 2Z9DA 2GZ2A 1OWLA 4CF6A 3NHFA 3B9RA 4RZIA 1NVXQ 2H1HA 1A9YA 2SKDA 4N0MA 4BZWA 3IOYA 4Q9DA 1HT1E 3BF8A 1LVUA 4HZUA 3M9WA 1P5JA 1YU9A 3UMCA 3ADCA 1RJFA 4NYMQ 1KSJA 1VLHA 2JIZA 3OH8A 5DTRA 2XDQA 2CXHA 3W3ZB 5EWJB 4KR0A 3L7KA 4JLVA 3ITKA 1F8FA 3KSDO 4Q01A 1U0EA 2OO5A 3VOSA 1FNNA 2VAMA 2ZOSA 3BZWA 1VHTA 3IPXA 1SXPA 3C3PA 2B7BA 1KO4A 3TR6A 5SYAA 4QAQA 4FD2A 4QD3A 4BHTA 4EG4A 2WVAA 1ODLA 4FMPA 2Q1UA 4B79A 4EEZA 1YBAA 3M5CA 1NKVA 2GPAA 3Q7TA 4QUJA 2C4UA 1HDYA 1RAFA 1WL8A 4AI6A 3VPXA 1ZX1A 3W5BA 1FB5A 5I45A 1VKHA 2QB5A 3P2MA 4RELA 1NKSA 3WIBA 2QAGC 1GJRA 2V6BA 4HEJA 4LGYA 4N3CA 4W5OA 1T1RA 1U8ZA 3QA9A 3N6RA 3P96A 4HDRB 4IGKA 2BH9A 1F8XA 3AR4A 2HRBA 2YC4C 1GPJA 3U0BA 3IMKA 3HY3A 2FEKA 4V0NA 1XD9A 4EG8A 1Z2NX 3EF3A 2HBZA 4W6ZA 2X0FA 3KB1A 1NMYA 2C83A 4H9GA 4LIPD 4ZO8A 1J6UA 4A5OA 1EINA 4U2CA 3PRJA 4JLNA 4RZ3A 2QN6A 2AMFA 5E8JA 4FKZA 3QW4B 1RHMA 5CBPA 2LTAA 1COWD 5K8LA 4OH7A 3UJ7A 5FWNA 3OT4A 5JTUA 2O8CA 2BR5A 2CJXA 2HIAA 4RA9A 4E12A 13PKA 2Y1GA 3PL5A 4UNPA 3RC8A 3LF2A 1GUAA 2YRWA 2PGAA 4M1TA 4QDZA 3OZTA 1ABEA 1I6WA 1FSFA 2XADA 2G71A 3E70C 3FPHA 1FU7A 3P97A 1TQ2A 1RM0A 2D5IA 3HBFA 1U3CA 4I8DA 1V16A 4UVDA 1OPRA 5E9WA 3FOEC 2IDMA 2I9KA 2QMYA 4OB7A 2VJPA 3AEQB 2HV9A 3L7JA 4BB5A 5MN4A 4EHNA 2Q3HA 2WSYB 5FUQA 3LL4A 3AHEA 5EERA 9LDTA 2GM3A 3GPDG 3PENA 4XIGS 4PHHA 2O2HA 1YACA 2J4CA 1Q7EA 1J9GA 421PA 4P5PA 4HUJA 3A25A 4TQAA 2V6MA 1M6EX 4IKPA 4YJ3B 5AI8A 5LYJA 4CJXA 1P4GA 4B3JA 3BWXA 4U02A 4MUAA 3C3WA 5I51A 1Q7CA 1IFXA 4UHEA 1H42A 1PN3A 4II3A 5KDLA 4RMJA 1CCWA 3WA7A 3MSCA 1UOOA 1FMTA 2X13A 1PW7A 2NO6A 4ITUA 5JYCA 2MINA 2A9FA 3BWDD 4XE5A 1J25A 1PR6A 2BKXA 4B7UA 5JSFA 1NM5C 2TMKA 3FZQA 3PXXA 4EB3A 5A9RA 1Z17A 4UQLA 3UGQA 1KOFA 1S4QA 3DOHA 3LUKA 3EVZA 4E0BA 1N7GA 5KOJA 2B99A 2VCHA 2AOXA 3CTPA 5EJ9A 1B14A 3K15A 1R8JA 4XB2A 1JLLA 1SIBE 4FEGA 4AKEA 1JEAA 2D2FA 5EL0A 2PO7A 2RIRA 1V4VA 2XF8A 4N5IX 1U0GA 2IEDA 2XOKA 4WECA 2J5RA 2OGSA 1RPNA 4NFLA 1G6Q1 5CK5A 5T4EA 3ZI0A 4TSFD 2GCNA 2YV2A 4IZOA 2DTEA 4FP9A 5DX0A 1RDFA 3FTCA 2AKYA 3MELA 1SKMA 4FSDA 3JD0A 1D1PA 5AW9A 3EZYA 4IAOA 4LA4A 4GQAA 3SX2A 4EGFA 4IJWA 5LZ2A 1WIWA 2A9JA 1WLSA 4NCNA 4PLWA 1DCMA 1NZJA 1ZXXA 4MGHA 1E2IA 4KITB 2UU9B 4KR7A 4UNQA 4EW6A 2IJGX 4MUBA 1OZHA 1HEYA 2XIQA 4N9QA 1WKVA 1P4JA 2FW7A 3DFUA 3HY4A 4YRMA 4ZI3A 5C4GB 4JNCA 5JLJA 2RAUA 1KDOA 4FWBA 1LC0A 3FIUA 4R81A 2ZBRA 1L7PA 1KOJA 4IHJF 4P4GA 3SNHA 2YWDA 3JASA 3ZHTA 1DXQA 1JG7A 1TO1E 3CR7A 4A7PA 2O7RA 5DSXA 3ET4A 1DEOA 4GOKA 4BFLA 2PQMA 4BNUA 2A8YA 2I1QA 3NHZA 4IFTA 4M9UA 3B6MA 4C03A 3DZCA 3ONVA 2WTXA 1G3IA 3NPAA 4QICA 1YS9A 1YJCA 1YI1A 2TECE 3MOGA 4POOA 1EUDA 2JDIA 1HYEA 3FNRA 4CQNA 3BORA 2GO1A 3DB2A 5TY0A 1U31A 1VSQA 3A28A 1C30A 3W4IA 2Y0CA 1QMGA 2FPLA 4O2BF 2IOQA 2PMFA 1E32A 2GEFA 3B20A 3SR0A 1L5RA 5LPNA 3VA7A 2ORIA 4ARCA 5EQDA 2EP7A 3VR0A 3F6PA 1SBYA 4HAIA 3KQTA 3C14C 1VZ2A 5HTKA 1NN0A 1FU4A 3SR4A 2X2PA 4H35A 2BGNA 3TJZA 1RZRD 3WP1B 5U1PA 4UCFA 2I4MA 3ADKA 1NUAA 5TQ0A 1P75A 3OU6A 1IN4A 4D9GA 5IF9A 1ZL2A 2ZUTA 3T9EA 3L01A 5A5EA 1B8VA 1AD2A 4X00A 4CEHB 2ZI9A 4LOLA 3IX7A 2ZB4A 4K88A 4N6GA 3UW1A 5BR1A 3L7MA 5J5VA 5A9SB 1TOAA 3PNBA 4LSMA 4OJQA 5DASA 2YXDA 3M1IA 2QTLA 3Q8KA 2ZRPA 4NOLA 3X3HA 3CVJA 3BMOB 2VJKA 5AVXA 1ZRHA 1JDVA 4KXXA 4HQOA 3M9XA 5IAAA 2X23A 2VHQA 3WQHA 1FP6A 1HY3A 1B74A 2DTDA 2Y1LA 3N87A 4KWIA 3JZIA 2GPWA 2WM2A 3NEPX 4AZSA 4YUVA 1ZNXA 4Q5IA 1FXWA 2Z30A 1ACLA 2C2GA 2FPPB 2G5GX 1WMAA 2EX0A 3DV2A 5JH7A 2EG5A 1I7PA 4ZQHA 1E0AA 2HT1A 1TZJA 2DR0A 4NF2A 4MJLA 4XIJA 4DPMA 3GJ8A 3EN0A 2YZGA 1AURA 1R4NB 4D26A 4FDAA 2JKVA 1IXSB 4MUYA 4EA7A 1W36D 1QLHA 4F4IA 4JI5B 1MX3A 1U6IA 2R44A 2QR5A 3TLZA 4M8IA 3AUAA 1VGRA 2W6CX 5C8YB 4HP8A 1QKJA 2C42A 3JARA 4PINA 4C76A 1C4WA 2QN7A 5HJEA 5KKNB 1N5JA 4LCBA 3KO8A 4BQQA 3CRQA 2PX5A 5CCEA 2WMOB 1WDMA 3JQ8B 1KI9A 4TS4A 1ZNYA 1GEEA 3MB5A 2O52A 4UBJA 4RK6A 2A5GA 1J2JA 3ZQKA 5FI5A 5CG2A 4MUGA 1DO8A 1X8JA 3WNBA 2VDPB 3EQ2A 2JH9A 4R2XA 2FSVC 5LZ7A 1XYGA 1NW7A 1YE3A 4WGGA 1M0WA 2IW1A 3FRIA 4AK9A 1IEQA 1P31A 2Z4RA 4MVJG 3A6DA 4ZYUA 3HKEA 4WVFA 2BKEA 2II6A 3OPVA 4PYKA 1RWWA 3VJLA 4LW8A 1ESCA 1RRVA 4R9RA 4ALKA 2QYHA 1NMZA 1DFGA 4DAOA 5ICEA 2VA9A 1P0FA 1BGVA 2LPMA 3QU2A 3G7SA 3Q4GA 3GX1A 1KJZA 2AW5A 5IAJA 1YZ3A 1VIYA 1HETA 3GUVA 1A3CA 1ICIA 4Q9KA 3TL3A 2XLCA 3U26A 3WDSA 3JD2A 4PIVA 4ZP1A 4AYTA 4ZI7F 2YVKA 2Z0MA 3LO8A 3ZIDA 5FXMA 4C2BA 3DC7A 3LPNA 2F3PA 5EJAA 3GVIA 3SJZA 1F5SA 4Q03A 1QDLB 3L1VA 4GGMX 4QPPA 1ULBA 2W43A 3HXLA 2G80A 4LJ6A 1BHJA 3ZEAA 1GPDG 1X87A 5AI4A 2AXEA 3PQ3A 4Y2UA 3CZMA 4N4AA 3R2JA 3NIFB 1W6UA 3IKLA 2YHUA 3QWFA 2ZIGA 3AI1A 2ZP1A 3EHEA 2NGRA 4MQEB 4E88A 4YCSA 4DJAA 3E9QA 2NVUA 4L6AA 2PNJA 3BWCA 1G5IA 3MS7A 4BX3A 4ER6A 3CUKA 4XM1A 3PYXA 1Q0QA 4FUTA 4XDZA 3AR8A 1GRRA 1SQ0A 4EUHA 4PSDA 1FFAA 2FEAA 3AIKA 3P1JA 4I9UA 4Y30A 4BWYA 4AULA 5AICA 1IZZA 3I6QA 3CBQA 3R5TA 5K4GA 1CVLA 3Q85A 4QYIA 4TTRA 4WBXC 4IMPA 2M32A 1EFDN 1O5TA 3BA6A 1IWPB 3B1WA 1QFJA 2R8RA 4U7TB 3PBKA 4EY8A 1NXVA 2I1VB 5U4XA 4DCSA 4H18A 3QU9A 3OJLA 3ZWAA 5B1DA 1BXKA 4N5MA 1XROA 2D1RA 3SZUA 1JX6A 3T7DA 5B4TA 2V6FA 1R6DA 4IEEA 4L28A 5HZKA 3PEYA 1ZM3A 5JZOA 3JR7A 4WLVA 4ZCSA 5AJXA 1WLYA 3GAAA 4DC9A 5C18A 1PDWA 5KC8A 5DSTA 4IQFA 1C8VB 1JHVA 3ITNA 2QUBA 4LSWA 2OY0A 1LUAA 1VA5A 3A3NA 1WTAA 1TZCA 3IXQA 4MV9A 3ZU2A 1K5DA 1QQTA 3ZJTA 4AF6A 1J0CA 4CM4A 3H11A 5T67A 3E81A 4TS3A 3A1CA 1EJ0A 1THMA 5AW4A 3K0BA 4QDKA 4OLAA 2FG5A 2WABA 3TNDA 2VP2A 4QYTA 3J81A 3MBIA 2QM0A 1UXGA 5AHWA 4ZKDA 3ESQA 1ZIYA 3ZHBA 4ER0A 2Q5JA 2WFLB 1E64A 1GWNA 4KK3A 4CKBA 5IABA 4C7OA 4MYRA 3B3JA 2A9VA 3SHWA 2AC4A 1TUGA 2FX2A 2JAUA 1ZFNA 3TH5A 3L0SA 1QG4A 4RTMA 3IP9A 4JJAA 5K4HA 1BA3A 2X8BA 2GXUA 3N2YA 2DM6A 4TLLB 1QHIA 3OT1B 1SIOA 2IGTA 4R0NA 3RW9A 2AL7A 5K8TA 1DZIA 3BMCB 3CEMA 1TT7A 1HLPA 1KDPA 4ZYWA 4TRRA 5ELMA 2D1TA 3WDLA 2OCKA 2J08A 2OD7A 3UV6A 2OK8A 4P3OA 4KQGA 2INGX 4CL8A 2E5WA 2HXGA 1E9EA 2JJQA 3K30A 3MRXA 4I4CA 4HH0A 1XZPA 2XE6A 4OUKX 4GEGA 1YCFA 2P91A 3VI3B 5JRDS 3E5MA 3GO4A 1WXXA 5TQ2A 3NG1A 3NUGA 1JFVA 3G2PA 2D5AA 4LF9B 2F9MA 5IXJA 5LP6B 1W5SA 2C2ZA 1AY0A 2YRFA 3FF4A 4REOA 4PAGA 2YFKA 4G5QA 4R71A 2ZRDA 5BVHA 3MAAC 2H0RA 1V8FA 3KU4A 1V9SA 5JWHA 3NJ8A 2DRIA 3RRMA 3WIOA 3TTVA 3A4NA 1ORRA 1KFKB 5FP0A 4COOA 4F06A 1UBCA 2AE1A 1HO3A 4KQCA 4U0JA 2XXAA 4AY2A 3C0KA 1NI5A 4LY0A 1KBQA 1OY1A 5FPSA 1ZMOA 3UA3A 5IHPA 3KKQA 5BWMA 5TIIA 2JFBA 3U16A 2E4ZA 4NE2A 1QKIA 1P60A 1VIVA 3AEYA 3O74A 5GONB 5M34A 1NMSA 1NG9A 3VDMA 2AJBA 4IJMA 1PU2A 4JP1A 3ZTTA 5CDYA 3DTVD 1JSLA 1TD1A 3NX4A 2FCAA 3DQQA 4MSUA 1TZBA 2FGJA 4X8LA 3LGAA 3T5GA 3TG8A 3MPOA 3FOCA 4X1IA 4F4FA 2JD1A 1KDZA 3MLBA 4GGOA 4ASUD 1HM5A 4QYWA 1CF2O 1F2TA 1N2CB 3LQKA 4RC9A 5AR1A 5EJMA 1DC6A 4TMTA 5LA6A 5LM3A 2VAVA 2VTDA 3QU5A 4UDNA 4A0RA 4DUZB 4MB0A 5CX4A 1NMXA 4LE2A 4BVLA 2OCXA 4MQ5A 1ZMTA 4QUEA 1TT5A 5DLQC 4M89A 3ZZMA 4KQJA 2PVSA 4AP9A 3KAPA 3KEMA 2NYAA 2XZOA 4N8EA 1QXSA 1PNTA 3IAUA 4E33A 1QKKA 3FNIA 1KY4A 1OZFA 1J7JA 2FZKA 2XYHA 3I4LA 3PKZA 4B73A 5EMNA 3NV7A 3MMPA 2YUIA 4YDHB 1T4GA 2HRQA 1JKFA 5F4BA 3EZFA 5L9AA 5AVRA 3AU9A 4MVWA 4E32A 1FZTA 1XCMA 4F9TA 1XNJA 3DV9A 1O97D 3NWPA 3VX3A 5B2FA 1KSFX 3LVRE 1WEHA 1N6KA 3UANA 2EWWA 2Q46A 5BP7A 1P0CA 5GADl 1H2XA 4G36A 4LZAA 1O57A 2ZULA 4KNWA 5EUCA 5FV4A 3SXJA 1YJ5A 5AI0A 3W5JA 4NG5A 1LPOA 1TAQA 1I7NA 2XVYA 2ZUEA 2JLSA 1C1HA 2ZUSA 3CZCA 3DLTA 4JB3A 3AKCA 3C15C 3DZBA 3D8RA 3LUDA 1AKTA 3O2NA 4TMFA 4BWFB 4PV7A 3NHWA 3UQYS 1ZH0A 2BF4A 2HRDA 1R6AA 3BQ9A 2AOVA 4N0QA 1OBCA 5ERGB 1Z0IA 5TXGA 5KX5F 3QMWA 3ZCQA 5CITA 3GF4A 3FYCA 4L78A 2FF7A 1Z12A 2D1FA 2QIPA 3COWA 3SYRA 1E5VA 1E2FA 5CD9A 2WB2A 1G9SA 1Q11A 2HMUA 2WQ6A 1G8HA 1SG9A 1VLLA 3PWKA 1RT9A 2ZAIA 3R40A 1KBOA 1SXJE 3GBVA 3SIRA 1Z0FA 3BJMA 3ENNA 3BTSA 4JJ7A 1ZXBA 2B25A 2NU6B 2QUHA 1E9RA 3T1QA 4O6VA 4BKMA 1FUEA 4KUHA 4RE6A 2J6IA 1TNDA 4EG0A 4XA8A 2P41A 2ZB7A 3V4FA 1OKKD 1E7YA 2HC9A 1U9CA 2P0AA 1UPFA 2ECOA 5LXTA 3KJIA 3KZKA 4P3XA 1F4VA 2IZ1A 1XWIA 2CT8A 1U0JA 2O2DA 2MDTA 4XW2A 3ZI7A 5KIAA 1T29A 3ZHSA 4N1AA 3KQNA 4IMRA 4NJEA 1FYXA 2W2NA 2X1HA 4GKVA 2ZT6A 1EIZA 5L45A 1P7CA 1YR6A 4BWGA 5JCPA 5D5HA 2O2JA 2W4IA 3DDSA 2EQBA 2G0AA 4L8WB 2V7BA 1RI3A 2C8KA 1EBUA 2H63A 2WJGA 3OBIA 2W00A 4MVJA 4NECA 4X20B 4X9XA 5IDYA 3RC1A 3ZW8A 3PXGA 3VNSA 3VXKA 2E3JA 3AY3A 3JQAB 3PJGA 4PY2A 1YDHA 1EBFA 1UKYA 2PGOA 3IV9A 4Y2JA 1ZXLA 3RTDA 4Z7JA 4LHWA 3KXIA 1TA4A 3MHTA 2CHQA 5ICCA 1ZOIA 3CO5A 3WL8A 2O8VA 3EIEA 5FR1A 3T94A 1GV0A 1M2EA 3PQ5A 2WLTA 3JRWA 2R1TA 1KPIA 1HG0A 2B5OA 1CNMA 2VSQA 4HQKA 3Q9UA 4UAUA 2HA4A 4C0KA 3COYA 3LC0A 3L4BC 4X95A 3SLGA 3U3ZA 4ZO6A 5L4NA 4KFRA 1ZJWA 4HGZA 1O6BA 2HSDA 2J9XB 2JIDA 3AZPA 2OVFA 3FH0A 3ML1A 1YQXA 2M9MA 3KE8A 5FNVF 4A23A 3FKSA 5NLLA 5C7YA 3DE0X 5IXYA 3TIIA 1PVOA 3HCBA 4R8LA 1JDPA 2ONJA 2R87A 4JDPA