5DI3A

Crystal structure of arl13b in complex with arl3 of chlamydomonas reinhardtii
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
b'EARILVLGLDNAGKTTILKALSEEDITTITPTQGFNIKSLSRDGFNLKIWDIGGQKSIRPYWRNYFDQTDALIYVIDSADSKRLSESEFELTELLQEEKMTGVPLLVFANKQDLVGALAADEIASTLDLTSIRDRPWQIQACSAKQGTGLKEGMEWMMKQVKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 13B
publication title A G-protein activation cascade from Arl13B to Arl3 and implications for ciliary targeting of lipidated proteins.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 48
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5di3A00
3QNUA 1E32A 3KUDA 1XP8A 1WP9A 3I5YA 3UIEA 2ZRHA 2QORA 4RZUA 1ZD1A 3EZ9A 3RWOA 1KMQA 2IUTA 1MH1A 3SFVA 4EPYA 1QG4A 1NIPA 1GILA 4Q1DA 2PX3A 3NBYC 3DM9B 2CMKA 3AP2A 3E70C 4HDQB 4GI7A 2DWQA 4OQFA 3TQFA 3QEOA 4RJLA 1GZSA 4LHYA 4NE2A 2RHDA 4URUR 3KB1A 2XTMA 4AYWA 1Q1BA 4NPHA 5G40A 1LY1A 4JT2A 4JLMA 3CM0A 5D3MB 4PAMA 2ZAMA 4OI0A 2Q9CA 1G7SA 3LWNA 3RNLA 3GLFB 4IRUB 2D06A 3U7EB 4RFVA 3O47A 1NSFA 5JJIA 4US1R 1SVOA 3FOZA 1OIVA 1IY1A 2WJIA 2ZI4A 2VA8A 1KY3A 3QENA 5EUQB 2AHOA 2K5UA 3ZZ0A 1W46A 1E2DA 2YWHA 2B92A 4MKIA 2Q9AA 2A78A 4HZUB 2FEOA 4HZIA 3HR7A 1L7VC 2JLUA 1VKJA 3FE2A 3IHWA 3AVUA 4TMTA 2A5GA 2ZSDA 2KJQA 5F98A 2GKSA 3JZMA 5ELXA 4IDQA 4O3MA 2R9VA 4LJYA 3R8CA 2H5EA 1W36B 1MO6A 2QE7A 3KQNA 2RGXA 3GLFE 1A1VA 1HQYE 4R98A 1XTKA 3K53A 4CZ2A 1P75A 1E1QD 1N0WA 1KKLA 1XB2A 2J0QA 5EXXA 4B6EA 5LDDC 2OBNA 4E5UA 5JS8A 1BO6A 3CRQA 4G3XA 3AP3A 5EE1A 2D7DA 1F6BA 1QRAA 2A5YB 2ZRBA 4NCJA 4Q21A 2DCUA 3Q85A 3X1ZA 4JMPA 4M9ZA 1D2NA 4HAUA 3CR8A 2IXGA 3OESA 1L8QA 1Z6XA 1CJUC 3C5CA 2J5XA 2IS6A 4P33A 1AA9A 2JIZD 1RRFA 1W49A 1VCIA 2ZI5A 3OE7A 1R8QA 4NBSA 5EJEA 2O8BA 2RGBA 2WJVA 5E3HA 3I5XA 1K5GA 3IO5A 4HATA 4JL5A 1MOZA 2O5VA 5H68A 3GLIE 2VLIA 1AJEA 4D82A 2RKOA 2V6IA 2WKRA 1TQ4A 1ZNWA 221PA 2O8DA 2OV2A 2PCLA 2ZJZA 3UMRA 3KKNA 5KYKA 4DDUA 2PT7A 4LCBA 3GLFA 4KSCA 1U8ZA 3L0SA 1WA5A 3DOEA 1OT3A 4M1MA 2GAAA 3TH5A 1DAIA 4OYHA 2MSEB 2HF8A 3LBHA 3LQRA 2XXAA 3RHFA 2OUKA 3NBXX 2BVNA 1C9KA 4QGGA 1XZQA 4XVRA 2JLVA 1NBME 1HT2E 5KSZA 2QPAA 3QPVA 2EFHB 4EPVA 1TF5A 3ECCA 4TZ0A 5B57C 3PG5A 1DAEA 4Q00A 4A1FA 3FDIA 3KX2A 4DUGD 1WMSA 5EP3A 5FFMA 2XOKD 1W5SA 2WZQA 1A7JA 3GLIA 4YDHB 5HZKA 2A5DA 2BDTA 3QXSA 1Z07A 4MH0R 4DC9A 2AX4A 1X1SA 2AWNA 2WPDA 3QKTA 2W2VA 1S96A 3GP8A 3K70B 3BERA 2CBZA 2E1RA 1EK0A 5L3QB 1IN8A 1GL6A 2ORIA 5C46F 2O52A 3K0EA 3CH4B 4BZQA 1RW4A 4C30A 2IXEA 1E2FA 2CK3D 2P5TB 2PT5A 3NC1C 4A8JA 4TSFA 4ZDIA 5FBVB 1LF5A 4JLNA 4DKXA 3CW2A 1JQLB 1XTIA 2VP4A 5EE3A 4UXJA 3TE6A 5DE3A 4EPRA 1RYHA 1W36D 4BLOA 1PLKA 2FDCA 3CWZA 1E9DA 1NBMA 4LI0A 1QHGA 4PPGA 1DVRA 2I3BA 2WWIA 3K0CC 2VH5R 5DI9A 1R8SA 2WIAA 3EC2A 5FPSA 3IPXA 2P67A 3HDTA 4XTCS 5AWFC 2BBOA 4M53A 1EFCA 3C8UA 4LY6A 1EFRD 1QVAA 3AH8A 2JDID 4KI0A 4OBEA 3W6NA 4B3BA 2IWRA 2AKAB 2RGAA 3A6PC 3NC0C 3MWLA 1ZIOA 2OCPA 1YZUA 3OEEA 3RS5A 2I1QA 3K0FB 4L16A 1SQ5A 3RS2A 2ZI3A 2ZSFA 5FOUA 4JJKA 1CR0A 3ETLA 2GBLA 3P4YA 3KJIA 1P72A 2D74A 4PX9A 3IEUA 3REFA 1KJWA 1ZC3A 3PEVA 4JLOA 1W2GA 3I8SA 1HUQA 4HAXA 4TLEA 4OHVA 4EFMA 1OB5A 4FWIB 2DFNA 1X86B 2NIPA 3PUWA 1G3UA 2ATVA 3R9WA 2IF0A 5K8UA 3U7HB 2EWWA 5TXGA 2QP9X 3BORA 4B47A 5BN4A 5JJKA 2YWFA 4P0TA 2XSZA 3KKMA 4MYHA 2X8AA 1XFAA 2DWOA 1TEVA 3ONWA 4US0R 2RH5A 3U6KA 2F1JA 3THXA 3RANA 4LRWA 2QN6A 3T1TA 1Z2AA 2O0HA 3SI7A 3DEFA 2JGNA 4LHWA 1XPUA 1FNMA 1W0JD 2QQEA 3LRPA 1GL9B 2FEMA 5HKKD 3Q7PA 2D2EA 3K9LA 4IOMA 3WMGA 1J70A 1XMJA 2IC5A 3H4MA 4N3NA 4TLCA 5AUQA 4O0MA 1NN5A 2VSOA 4B35A 2R2AA 1NNEA 1KTVA 4P4SA 1KSJA 4BLTA 1OH7A 2V3CC 3SYNA 1MRNA 5IK2D 4KBGA 5EP1A 2QZ4A 5KDOA 3AUYA 4BFZA 1HEIA 2OAP1 3K70D 3AF2A 2R65A 5LD2C 3NXSA 4M9SA 1AKYA 4X8MA 2ZI6A 2FA9A 1YR6A 1TAGA 2IYYA 1QHIA 2BC9A 3ZDQA 2ZE5A 3W8NA 3K0FA 3QI2A 1VTKA 4TMVA 2ZXUA 4D6PA 3PUYA 1U94A 2WKQA 4PZLA 1EX7A 4RD1A 2CJWB 3BFVA 1J99A 1NVVQ 1CJTC 2ZRJA 5F3WB 2BWJA 5AJXA 5K8TA 5DO9A 4TYNA 4QM6A 4ZKEA 4C0BA 4EQ6B 2G1KA 4PAQA 1LV7A 4XJXA 3LH5A 3MAAC 2JLQA 2ZU0C 4M9XA 4RSGA 3QF4B 1VHTA 1R2QA 3IEVA 1YZTA 3GLHB 3QKUA 3UATA 4A0FA 4ZPXA 1C4OA 4ACAA 2D3WA 1T3LA 1GRQA 3L82B 4MRRA 2ZU6A 1UEJA 3FFAA 3L2OB 3TSOA 1KNQA 3KXLA 1T0JB 2IHYA 2XTZA 1KZ7B 2FFQA 3BC1A 2GNOA 4HB4A 3KXKA 3OIWA 2PL3A 4DHEA 1PV4A 3BXZA 4WW0A 2GVDC 4XIGS 1KI3A 1OYYA 4L15A 2IS1A 2ODWA 2GCPA 5JEDA 3U3JA 1O3YA 3H1TA 3GLHE 1NLZA 2IYQA 5EP4A 2ANCA 3HJNA 3Q72A 3FMIA 4AURA 5J4YA 1T8TA 1VYTA 2PBRA 4BFXA 3RVBA 4B3DA 1EESA 3LLUA 1E2EA 3EZ7A 1A2KC 1NVUQ 1R10A 2V7QA 5FTNA 2W6ID 3VQTA 1VG9B 4OJKA 1JR6A 4KVGA 5JCPA 1OFHA 3REGA 3KJEA 1GP2A 1GKUB 2ZYWX 5C1BA 1Z0FA 1Q1EA 2PEZA 2P65A 2X77A 3AGQA 3C41J 1E98A 4JT4A 5FOSA 4NYMQ 5EQTA 3OFND 1UBGA 1WXQA 4YLGA 2ZR0A 4HDCA 5L3SB 4A9AA 2C04A 1KK3A 2ZI7A 3BK7A 2G9NA 4GDFA 4W5JA 3OHMA 2GJ8A 2QU8A 2XTNA 1P61B 2C77A 2IYUA 2RB4A 2JJ1A 2MMCA 1KY2A 2VSXA 1DAMA 1WBBA 3B78A 1G4AE 4HAWA 4ZCMA 2F3RA 721PA 3P32A 3GLHA 3W34A 3NH9A 5A4JA 4UNQA 2PX0A 3SOPA 1P4SA 2W6JD 2ZJAA 3VKWA 2O8CA 3PEWA 1DG1G 4E07A 3TKLA 3CRW1 1ZMXA 1TQDA 2G3YA 3ICEA 4AKIA 1SKYB 4HLQB 2J7KA 5UKDA 4KLNA 3KFXA 3R7WA 1VYVA 2GCOA 4JLPA 2G0NA 2ODEA 4TYPA 2F3TA 2R8RA 3EWAA 2F1IA 4G1UC 1CR4A 3N2IA 4OQNA 1Z06A 3MG9A 3V4RA 4D25A 2XB2A 1FPMA 4EFNA 5KDDA 3BS4A 1GVNB 2O8FB 1ZCAA 2VRWA 4PZZA 5J47A 3EIEA 1D2EA 3F3YA 2OEPA 1FQKA 4TL9A 2IHBA 4LV5B 1N5KA 1OFUX 1ZNXA 1IN6A 3QF7A 1XZPA 4PR0A 4EDHA 4ZI3A 4UNRA 5LB2A 4HSEA 1Q0UA 3RRNA 1HQCA 1XXHE 3S1AA 2FSHA 2HDNB 3Q9LA 1DBSA 5CDFE 3E5HA 3JVUA 1QG2A 2V8OA 1KDOA 2GJKA 3NHAA 4QNMA 4JKIA 4MRPA 3EAQA 1SGWA 1AGRA 1XRJA 2J0SA 1H8ED 1KI4A 4B3XA 1P7CA 1UKYA 2IXFA 2ANBA 3QY0A 3KTAA 4LGMA 4XVQA 4C0QC 4DT1B 1VMAA 3ZVMA 4KXFB 4IJMA 1Z2CA 3SC3A 2OCBA 1G7RA 121PA 4US2R 1JECA 4D0GA 3DDCA 3L8YA 3DPUA 3Q3JB 4OKSA 1R0ZA 2OAQ1 1IHUA 1S1MA 3K0SA 4NZYA 1Q12A 1FQJA 3K09C 3GEIA 1P2SA 1M7HA 3B8HA 1KK2A 2VHTA 3F8TA 1YHNA 2LKCA 4NYIR 5KNCA 2FZ4A 2CCKA 5FL7D 1NKSA 1KKMA 2VEDA 3TQCA 1XXHA 3B60A 1E0JA 2IA5A 2XX3A 3TGPA 1WDTA 2QAGA 4URWR 1Q1ZA 5ANRB 4ACBA 5CDFA 5JBQA 2ZREA 4LPKA 4UJ5A 1G8GA 4Z51A 1P2TA 2EWVA 1J8YF 2GF0A 2VPPA 2QTFA 1S9DA 1P9RA 3BOSA 1KIMA 1XMVA 4QKQA 1JJVA 3WNDA 1JQJC 1JR3E 1SXJE 4URXR 2OE2A 2CVHA 1ZM2A 3RS3A 4LUCA 2GCNA 5JCZA 5KUTA 2C03A 1AZSC 1ZYUA 3T12A 3H84A 5KPJA 4WXRA 4ASUD 3LA6A 4C0JA 4MKFA 1G8YA 1YZGA 5JRJA 2XNSA 3QOFA 3VAAA 1HE8B 1NIJA 2FE4A 2I1VB 3T1VA 3LX8A 4CF7A 3K8YA 1DPFA 4DCNA 5KU1A 2PLRA 5IHPA 3EPLA 3L0OA 4LHVA 4F4IA 1ZUHA 1GKYA 2CE7A 3ZYCA 4MYCA 3WBKA 3L43A 2O0KA 3FKSD 2J7PA 4IW3B 1FP6A 4V02A 3K70C 2CNWD 3A1SA 2VO1A 5DI3B 3U3KA 2QGZA 4DZZA 3V9PA 1NN3A 2GESA 1RRGA 1Z6YA 2VHUA 2OM2A 2HYDA 2ZPTX 3ZVLA 3LO5A 5FR2A 3W3AA 3RABA 4EJSA 5CJ2A 3TR0A 1J8MF 3MSXA 2GF9A 1X8KA 1JR3A 1SXJA 1D8TA 1Z22A 3LXRA 3ZLJA 5FOVA 2HUPA 4ITRC 1UDWA 2GDJA 5H1YA 1FP7A 2O8EB 1R0YA 4HI0E 3B1XA 2RGNC 3K0CA 4MKHA 4I1OA 1FMJA 5B58C 3SYLA 4OQXA 2UKDA 3U3OA 3ZZUA 3OIVA 4P4TA 1PUIA 1W2HA 4RKEA 3WNCA 4D4MA 2NMVA 3IBGA 3F0TA 4P32A 1XPOA 4Q4HA 3AF3A 2BMDA 2D2FA 4GNKA 2JJ2D 2GZAA 3THYA 3GFPA 2GEUA 1EXMA 3N2EA 3U61B 4II7A 1ZU5A 2IX3A 4KLZA 3ZIAA 1ZBDA 2VSFA 1BMFA 3ZJYA 4JBXA 3OAAA 2ZRDA 3P20A 1WE2A 4A2PA 3ZD7A 3PEUA 1NI3A 2QM8A 2REOA 2ZRNA 1X6VA 4LYHA 1N0VC 4MGIR 3LW8A 1TX4B 3SEAA 4LJ9A 3VTKA 4A82A 3GEHA 4QHTA 2W2XA 621PA 1IQPA 5FUWA 1D9ZA 1VCNA 3UANA 2FMXA 1XNJA 2XITA 2AFIE 4IDNA 3FFBA 3AKCA 3CX6A 4OK6A 2YYZA 4L9SA 1XX6A 1XMSA 4E22A 1R5BA 1G7CA 3TMKA 1Q3HA 3A1UA 4QXAA 4BRWA 1Z63A 2F55A 1KJZA 3VHXA 4NYJR 3QQ5A 3QE0A 1K6MA 3PXGA 1U0JA 1T4GA 1VHLA 2ECKA 2J45A 3AVWA 1G5RA 4QM7A 4WZBE 3RRZA 3B1WA 4QG7A 4M4SA 4HAVA 4IOLA 3WYGA 4OHXA 3RAPR 1OKKD 4WVFA 2F6RA 1RC8A 1OXTA 1YR8A 3EC1A 1E2PA 2WHXA 3TRFA 3IPYA 1D5CA 4PQYA 1UBCA 4URZR 4B43A 2XB4A 1G16A 1IXSB 5EE5B 2GILA 1N0UA 1DAFA 3EWSA 5IF9A 1N3BA 2GHIA 2CDNA 1UFQA 2PCJA 4GSYA 3EG5A 2QAJA 2BCJQ 4UXHA 4F93B 1OHHA 3QIAA 4PANA 4ZCIA 1UM8A 1GAJA 4HUTA 4AWXA 1KI7A 1SVKA 4Q02A 4NCHA 2JLXA 2R6DA 2V1UA 4EUNA 2JLSA 4I4LA 3SFZA 2O8BB 2EVWX 3A36A 5TMPA 1AIPA 3CIOA 3BAFA 3M4YA 1QF9A 3RLFA 1CU1A 1Z6GA 4YXWD 2XNDA 4ZO4A 4LV8B 5FBWB 2CCGA 1QHSA 4EKDA 1G8FA 2NZ8A 4O25A 4Q9KA 5DN6A 4FD2A 1IOZA 2O8DB 4BRUA 1ODFA 3P26A 2XJ4A 4V0KA 1XDBA 5AR1A 4MUAA 2QMHA 2RGEA 4NH0A 1YKSA 1YVDA 2J0VA 5L3RA 4MITA 5JEEA 4KU4A 2REBA 4BFTA 3KXIA 1S3GA 3E1SA 5CIQA 2XXAB 2CHGA 1W5TA 2YC2C 3KKOA 2GXUA 4F91B 3P1JA 3CNLA 4KV9A 5JHGB 3VR4A 3GCGA 4D26A 1Z0KA 1AS3A 2IEYA 3MJRA 3AF0A 4BGDA 1E2IA 4LYJA 4XOIA 3FYHA 3LV8A 3WP1B 4JL6A 2HT6A 1CJKC 4OK5A 1KOFA 2OCYC 3SJCA 3VHLB 4DCSA 3ZQ6A 1Q21A 4HLUA 1CULC 1ANKA 4M1OA 4Z8YA 4Y0AA 1BIFA 1G5TA 2C78A 2FPLA 4OI4A 1M74A 2KB0A 3GLIB 4DCUA 2ZSAA 1W4BA 3J81k 4YMVA 4I1UA 3FKQA 5HE8A 2P3SA 3HYRA 2NO1A 3QBTA 1TU4A 1D9XA 1VYUA 2GWHA 1OSNA 3BB4A 5E95A 5IRCD 4G0NA 3SBEA 4B3CA 4M2LA 4A8JB 1FNNA 2ZRMA 3Q8XB 1G7TA 5CIWA 3THWA 1ELOA 3MJHA 2IS2A 3ASZA 3QEJA 5CB6A 4Q7KA 2QE7D 3U7FB 5E7IA 5J5CA 3B9PA 4M1SA 2Q21A 5AJZA 4A15A 1RFLA 2PMDA 1XTRA 3A58B 4L8GA 2BMEA 5FPTA 1EWQA 4RKFA 2NO9A 3B9QA 3K0AA 3KDSE 2IYWA 4ESVA 2CL0X 2OT3B 4TL7A 4M22A 3CZPA 3LXXA 4X8LA 1RRCA 1EFTA 3CBQA 1KO8A 2QL6A 2WOOA 3R9XA 2C8VA 1XJ0A 1CJMA 4KVAA 3KFVA 1GM5A 3VKHA 4FMBB 1T0HB 2ZVPX 5LBIA 5JWRA 3G82C 2ZM5A 5BYJA 3OE7D 3W6OA 2CLDX 1JB1A 2BBWA 1JAHA 1E6CA 2NQ2C 1MKYA 2ZE6A 1X3SA 4GOKA 2G1JA 2Z0MA 3GEEA 4DSNA 3G5UA 3R9IA 3GJ5A 1G21E 4DSOA 5JECA 1ZAKA 4R2IA 2CE2X 1ZRHA 5JZVA 2IL1A 2VBCA 5DYIA 1T6NA 4OHWA 4PQFA 1ZNZA 4R71A 3I62A 1E9CA 1COWA 3BB3A 4V03A 1S8FA 1KSHA 1E69A 1NF3A 3I32A 3MWKA 3IQWA 1E79A 1SVMA 4O2LA 5DHAA 2AXPA 2ZS8A 3THXB 1II8A 4NL4H 1P2VA 2FG5A 4UNPA 3RWMB 1AGPA 2ZETA 4K46A 4BFYA 1NP6A 1OIWA 2PH1A 2ASEA 5DLQC 1LNZA 2P6RA 1ONBA 4D80A 3NDPA 1DAGA 2E9SA 4N0EA 1AK2A 1BYUA 3A1TA 4PO9A 2ZS7A 1RPZA 5CITA 4UKDA 1K5DA 3HYTA 1MR3F 3GPLA 1XCPA 3D7MA 3OF5A 4RCZA 5EZ5A 4R2HA 1U8AA 4P4SB 5L3VA 3IDQA 5E4FA 3W6PA 4I1VA 1Y3AA 4QRHA 2V54A 3SJBA 3BD9A 1KNXA 3BIFA 4D0NA 4G01B 4AC9A 3LQQA 2IYTA 2VHQA 2MMGA 1FZQA 1T5IA 2WPDD 4MKGA 2R44A 2ORWA 2ZYUX 1YRAA 1N25A 2J3EA 3IIJA 2Q3FA 2WJJA 2ZQ5A 2HCJB 3AGPA 3BH7A 4DLTA 4FINA 4QJ5A 4B48A 4V0ME 1JNYA 3AF1A 3HWSA 2ZVQX 4XWOA 2QI9C 1Z6TA 5FTKA 3ZGXA 4TSFD 4CYMA 3UXMA 4IOKA 4GP6A 2HEIA 821PA 1CBUA 4TL6A 1AS2A 4TT3A 3AVOA 5FOXA 2FPKA 1GRRA 3UG6A 5G53C 5B64A 3EA0A 3CRRA 1QZXA 4LZZA 1NBMD 5JMTA 3NDBB 1IY2A 2FFAA 1G41A 1KJYA 4MGKR 4PO8A 4U02A 4V0LA 5AK0A 3BJIC 3GLGE 1U9IC 3B5JA 3QPUA 1V43A 1G19A 4H9GA 4OQLA 4PXAA 4Q4JB 3NEJA 4LWZA 1XTSA 3SN6A 3FMOB 1RJ9A 2ZR7A 3AF4A 2WIBA 4Q9IA 4JIMA 4BZXA 5K8LA 3OEED 4OJQA 1SVLA 4ARZB 2IUSA 2RCNA 3QPWA 3KKPA 1UADA 3Q5EA 2B8WA 2ODNA 5KSYA 1QHYA 3EZ2A 3U3RA 5TB5A 3A8TA 1UDXA 1A5TA 2AN9A 3ZVNA 4V0MA 1CJVC 1Q1QA 2WV9A 3OEHA 3WRXC 3RRYA 2OBMA 2X2FA 4KFRA 3RC3A 5L8VA 3SYKA 4MRSA 4A36A 1T5LA 4PPQA 2ZUBA 2NTYC 3W9YA 4GMDA 2FH5B 3FWYA 4HEJA 1JBKA 1XWIA 2XSZD 2FU5C 4M0LA 3AKYA 3MUFA 4K81B 3UG7A 2WMNB 4DWJA 2C98A 3D6TB 2BMFA 3GJ8A 3GLGA 4V0OA 3EPKA 2AD5A 5CJPA 3VNVA 4W5WA 2GTPA 1N6OA 2V1XA 4FN5A 1J90A 5F9FA 5C4MA 3IO3A 2N42A 4G5RA 4PFSA 3B1ZA 5AUOB 5SZIA 1G3MA 3O8BA 4GZMA 2VTKA 3NVAA 2WWGA 4ZDKA 2HJVA 5J4VA 3DM5A 2A30A 2A3RA 3CB4A 4JZKA 1MO3A 1U98A 1NY5A 1ZUNB 1S1CA 2Z43A 2O8CB 1KAGA 1R0XA 3AQ4A 4Q4JA 4XSHA 4CW7A 1TUEA 2G88A 1X1RA 4B73A 1KO5A 1TADA 5HPYB 1NJFA 3DZDA 2IUUA 3W8RA 1UBEA 4AI6A 5P21A 4LBYA 4H1UA 2F9LA 3R7WB 4S35A 4ARZA 2GCOB 4ABYA 3VR3A 1M8PA 2DR3A 2YHSA 521PA 4XWKA 1KGDA 1MO4A 4LJ7A 3MMPA 1W47A 1ESMA 1QHNA 2LCFA 3UWOA 1QHHA 3CLVA 1G8HA 1OJLA 2HCBA 1FMLA 1N2CE 4Q18A 4XD7A 1EG7A 2JEOA 3EPJA 4CEIA 3QBVA 5D3QA 4DLYA 2Q0HA 1JPNA 1LS1A 4Q1EA 3AVPA 1MABA 1IN7A 3X1WA 2F7SA 4PC1A 4AYTA 4CEJB 2WVJA 4B3GA 4BECA 2DBYA 3BBPA 4AK9A 1X8JA 2WOJA 2KBFA 2GXAA 4KFUA 3BH0A 3FB4A 3S1AB 3IIMA 1SKQA 1KMHB 3EZFA 5E7MA 5FBRB 2H17A 1XCMA 1N6KA 2FWRA 1ZINA 2OO7A 3T1OA 4CGZA 1US8B 1W0KA 1SVWA 1EFHA 2FF7A 3TLXA 1KDTA 1DOAA 2ONKA 5CM8B 4NKRA 1N6RA 1ZW6A 2ZYTX 2IYRA 3BGWA 3H2YA 2IK8A 1C1YA 1RE0A 3H86A 4NP6A 4QHSA 5FUYA 4EPTA 1NG1A 2NG1A 1XTQA 3N5CA 4IVQA 1UPTA 1R0WA 3VR2A 3KTAB 4DLSA 1QDEA 1GOTA 2AD1A 2RGDA 2WKPA 5H8WA 2ZAOA 4DRZA 3AVQA 3PITA 2A2ZA 5AJWA 2F43A 5FPHA 3AKDA 4QL3A 2R6AA 3C5HA 3OIUA 1CTQA 5C18A 1E1RA 1AS0A 3K1JA 3ND8A 1OIXA 3UMFA 4FI3C 1OH8A 2H57A 4LDJA 5CM9C 3BB1A 1M6NA 2FOLA 1DO0A 4G5SA 5SZKB 4PHFA 3LNCA 2V7QD 1R5OA 2IWHA 3EASA 1K8RA 3RSOA 4KYIB 1E9BA 1I2DA 4E03A 4PC6A 3HU1A 1B23P 4N0DA 1XXHB 1P9NA 1XEWY 2JA1A 3HP1A 4JLKA 4O2RA 1H8HA 5TVKA 2QAGB 1W1WA 2C5LA 1BH2A 5B2ZA 1HE1C 1GTVA 1E4YA 3MWYW 4Z1MA 2J1LA 1ZUIA 3IHLA 4NYIQ 3PQCA 4RVCA 5IT5A 3EIHA 4C2TA 3DKVA 4LBWA 4LYAA 4Q9JA 4URVR 4JLVA 1WBDA 3B7GA 1IN5A 1NSTA 4KODA 1Q57A 2JJ1D 1Z83A 3AB3A 3CR7A 2QMOA 3LVQE 1X8LA 4KJZA 4WOPA 4A2WA 2HXYA 4DJTA 4CEJA 2QTHA 3K9NA 4GPTA 1S9HA 5GVRA 3T1QA 4RFSA 4AD8A 1R6BX 1KMHA 2BJWA 3QG5A 1W36C 1JPJA 1US8A 1F2UA 1LF0A 4Q4AA 2YJTD 4RD2A 1DAHA 4LJ6A 3KQKA 2QT1A 2IYZA 4QJ4A 1KSFX 4OK3A 1V5WA 2LKDA 3VFDA 4HUQB 2REXB 1ETUA 2R62A 3NEYA 3KUCA 2J0UA 2WSSA 1E9SA 1NVXQ 4ILEA 5CLLA 3FGNA 3KJGA 1E2LA 4IXNA 1EGAA 4HDOB 4QC2A 4QHYA 3U7GA 4XSGA 4EAQA 4GMXA 4JLJA 2G83A 4RD3A 1OW3B 4CEHA 1ZM4A 1QVRA 4D4KA 1E9FA 4EJSB 2YINC 2P6UA 1YR9A 2QNRA 2WJHA 4B2IA 3FMPB 2G77B 4Q19A 2FGJA 1SXJB 4KFSA 2HJGA 2YOGA 1UKEA 3HPQA 2C95A 4XTRA 4LHXA 4PPNA 5BW8A 1G64A 3PENA 1UEIA 3ZS8A 4RZ3A 3IUYA 5SZJA 5EXPA 2FJUA 5FI0B 3SZRA 2J41A 1L4UA 4QGHA 1G6OA 3FTQA 3K9GA 1XEFA 4OI2A 5EE0A 2BKUA 3TJZA 1F5NA 4LV6A 5BN5A 2BOVA 3U60B 1KI6A 5DH9A 4Q1BA 1YQTA 4Q4HB 3U2QA 2NO0A 3THYB 2H8KA 4MRVA 2QM7A 3HR8A 1VPLA 2ZRPA 421PA 1YZLA 1XMIA 1QBKC 1W44A 4YC7A 4CVNA 2QG6A 2TMKA 3CPJB 4FCVA 2H18A 4IHQA 1KAOA 1G3IA 2NO7A 5AUPB 1HV8A 5G41A 5IDVA 3BWDD 2PZFA 3DVLA 1S2MA 1XD9A 2ZROA 5DSZA 2AK2A 4A0RA 4CDGA 4DDTA 1E96A 3EZ6A 2XZLA 5KDLA 3BRWD 3K9HA 1TQ6A 4HB0A 4PAOA 1E9RA 1KSGA 3RRMA 4KAXA 5E7JA 4I1SA 1MRSA 3IKJA 5KTYA 3I4LA 4EIWA 2EYQA 3C4JA 4HUQA 1AN0A 3LLMA 1A82A 2GXQA 3PFIA 1OXSC 2B8TA 4Q48A 1JXMA 5JWOA 4WZAE 2UZIR 4JYBA 1CKEA 3PIRA 3FPAA 5HTKA 4YMUA 2Z4RA 4QBGB 5KNBA 3TAHA 3GQBA 1GNRA 3D31A 5G3YA 1SHZA 1CF4A 4KBFA 4LJ4A 4B75A 2QUZA 2JCSA 1GUAA 3DZ8A 3WY9A 1DEKA 1VCOA 2VF7A 4G5GA 1R4AA 3RSLA 3BE4A 4U5XA 1YU9A 2WWFA 4GZLA 5JI2E 4A6PA 3ZZTA 1TNDA 1RVDA 2WAYA 4DEXA 2OCAA 4DEYA 1ZC4A 1LB1B 4NYJQ 3T15A 4FWTA 1GNPA 4R9UC 2IYVA 1GG2A 2D62A 1PJRA 4YMSA 5EXSA 4JSTA 1ZIPA 2AK3A 3KQUA 4W7SA 4PSKA 4BASA 2OFWA 2CVFA 2KSQA 1I4TD 2J7PD 1PZNA 1P6XA 4JL8A 2ZRCA 5C4GB 1VG0B 2ZUDA 4TN1A 5HE9A 3LW7A 2YV5A 4GRAA 3H0KA 2V55B 4DCTA 3ASYA 5FUXA 1E3MA 5CYOA 2EFDB 4JYCA 3T06B 2D7CA 2QMEA 4C9BA 1EX6A 4HYYA 5HZHA 2HF9A 1JR3D 1LFDB 1SXJD 1U0HC 4QFMA 4DXAA 2BIFA 1FTSA 3Q7QA 3X1DA 2WJGA 3AVVA 1KI8A 4IEIA 4BE7B 2ZRLA 3L8ZA 2DFTA 2Q3HA 3V00A 4C0AC 2V4ZA 4QOSA 5GADl 3U44A 2P5SA 3THOA 1G3RA 2BBSA 1F2TA 4PPFA 4PSVA 2HLDA 1KI2A 4TMKA 1G17A 4TMWA 1IN4A 1HYQA 1UBFA 1A4RA 3LBNA 1Z47A 4LBZA 4GP7A 3G0HA 2CEAA 1AM4D 1G1MA 4GOXA 4BFUA 1NLYA 2WMOB 4HLDA 1H65A 2CHVA 4DLWA 4JLAA 1GRNA 4C0LA 2ZI9A 2NOAA 2Q3MA 2IEZA 1KDPA 1R7RA 3BH6A 1M7BA 4A4DA 2Z83A 2XEXA 3LBIA 5SZHB 3ZIAD 1EWRA 4XH9B 1E0AA 1BMFD 4L4UA 3OAAD 2DPXA 1SVSA 4C3ZA 2ZJ8A 3UWKA 4U00A 3SJAA 3X1XA 2QEQA 4D4LA 2YOFA 4C7OB 1KO7A 1TF2A 2GXSA 1E0SA 4W9MC 3D8BA 3F5FA 2QSYA 2GEVA 2IS4A 3A1VA 1S4QA 4JVLA 1L2TA 4MGZR 3VNUA 3NG1A 2SHKA 2W83A 3I8XA 5J40A 3WNBA 4XWAA 4DDWA 5FTLA 2VQSA 1NMZA 2FSIA 4BZPA 1E4VA 1G9XA 3B2EA 2KWIA 4EPXA 2WWYA 5GVSA 2ERXA 2HV8A 4CIDA 4YMTA 2W0SA 2HXSA 2V9PA 1IXZA 4IEEA 3OIYA 4PO1A 4DIEA 3HPRA 3R8FA 1OH6A 4TYYA 3CWQA 5C2JB 3SQWA 1IAQA 3TK1A 3CPEA 4B2LA 2J46A 5JHHB 3THWB 3SJZA 3I3SR 4OQMA 1E2GA 3T61A 2QBYB 4W5HA 4JVNA 5DGXA 2GK6A 3HU2A 1ZJ6A 4AY2A 1ZNYA 3K0AB 4FMDF 4IVRA 4UNNA 5KSOA 5M04A 4MUBA 1GSIA 2XZPA 3CONA 4HAZA 4AYXA 1OF1A 4OHYA 2CCJA 3VMFA 1GL7A 1J7KA 2IYXA 4J0QA 4PSAA 3WP0A 3KZ1E 1TMKA 1TQ2A 2G6BA 3CUEF 3C14C 1T3SA 4Q7LA 2WAXA 3I73A 4FW9A 5LPNA 1Q3TA 1EFUA 3CKLA 2GJAA 1OLOA 4FCTA 1OHHD 2DB3A 1P9WA 4ZV4A 3MLEA 3U4QA 3GJ7A 2ORVA 2B6HA 1NG9A 1E2QA 3WYFA 1IM2A 1E1QA 2JJ8A 1GKIA 3P27A 3A1WA 2J87A 2WSMA 1JJ7A 2ZS9A 3WMFA 5F2EA 4OI1A 2FSGA 1CIPA 1DS6A 2XNDD 2GJ9A 5DN6D 1N6PA 2PJZA 3VU9A 3QKSA 4Q47A 4BFVA 1OV4A 2CLSA 4B3FX 4BPBA 3AVYA 2AL7A 1OE0A 3JZAA 2BM1A 1N5IA 2C96A 2FGKA 4C7OA 5JJLA 2A7QA 2BKEA 3MGCA 3SR0A 2KE5A 4TMXA 4Q03A 2ZJYA 1WCV1 1ZM7A 1BYIA 2H7VA 2JIZA 1F3OA 4TQ9A 4Q9HA 4K8OA 4C0KA 4LJ5A 3QG1A 4P31A 5FBLB 1TF7A 1II8B 2BHRA 4TWZA 3SNHA 3GJ0A 4FMCF 3QUSA 4JLDA 3AVTA 3ADBA 2BEJA 4A0HA 4MDFA 1N6NA 4ON9A 1RZ3A 1DTSA 1KI9A 4QGAA 4X8HA 1FW6A 1CP2A 4JLBA 2WICA 1XD2A 2CL7X 4KFTA 2JLZA 1XEXB 4QJ3A 1JI0A 2QTVB 3O8DA 4TL8A 1GWNA 2MSCB 2VL7A 3AEZA 2R6FA 3QXHA 3PR1A 1NJGA 2QBYA 3EARA 2GETA 2QP4A 2X2EA 5AJVB 1OFIA 1OB2A 1ZP6A 3HU3A 4HB3A 2WBLC 1TU3A 2NGRA 4M1YA 2GZHA 1CEEA 4ZDWA 2DYKA 2P2LA 2W00A 4IDHA 3M1IA 4B33A 2RAPA 4IFEA 2C99A 4AG6A 4B76A 4L5BA 1AQUA 3T35A 4G5QA 1NY6A 4M21A 1G6HA 2ATXA 3QSYA 3SS8A 5JWHA 1KZGB 2QAGC 4DUGA 4BEJA 1AKEA 4LOAA 2XOKA 1TPZA 1VG1A 1ZD8A 3BFKA 4IDPA 5D3MA 4YONB 1P3JA 1E2JA 1TL7C 1HT1E 2VP5A 4ZIRB 2UZ3A 1FFHA 3T5GA 3W5IA 3VR1A 1JAIA 1LS6A 1Z0JA 1OXUA 1NMXA 5BWMA 4FCWA 1IXRC 5FTJA 5TARA 2LWIA 3LY5A 3AV0B 1G4UR 4B2PA 2EFGA 4HZUA 2CK3A 1I4DD 4GBMA 2QMUA 4BLPA 4BUJA 3PCRB 2FNAA 1DAKA 3PV0A 3I92A 2IYSA 1RJ9B 1KYIA 3O8CA 4KCGA 3M0EA 4HLCA 2Z6VA 2EFCB 4LJAA 4OL0A 2P6NA 2QRNA 3U3MA 2OZEA 5JI3E 1KHTA 3N70A 2BJVA 3PJRA 4JJZA 3O8RA 4KITB 4EPWA 3VKGA 2CL6X 5JLJA 1XEXA 4YMWA 1RRPA 1EFRA 1S3SA 1U2RA 1IJFA 5BYKA 2JDIA 2VIIA 4IDOA 1ZCBA 4LHZA 4WA7A 1D6JA 1E2KA 1KDRA 1SULA 2ONJA 1COWD 2W0MA 4Z8XA 1O87A 1NKTA 2UVQA 5TV2A 2AKYA 3LDAA 4I99A 1F60A 2KI5A 4TYQA 3I1FA 4LSGA 1Z29A 1E79D 3K09A 2ZTSA 1Z6AA 2OHFA 2XJ9A 4EJSC 4A92A 1A2BA 1Q44A 2O0JA 3TR5A 3TW4A 5J4KA 2B7BA 3GLGB 2AR7A 1SXJC 5KPDA 3GJ4A 5HCIA 4TMZA 3WRYC 4UNSA 4B32A 3CO5A 3QXCA 4POAA 2JLWA 2XZOA 3SQXA 1GITA 2OLJA 1ZD9A 1Y63A 2OFXA 2X1VA 4FMDB 3TUJC 4Q4LA 1DELA 3CH5A 3IGFA 4D2IA 3PUVA 2C2HA 1CRQA 3ZVRA 5A5GA 5KHOC 4M1WA 2BMJA 5CK4A 2ZE7A 4JKYA 4AG5A 3L0PA 2DFLA 4ZIRA 4I81A 1DARA 1W7AA 2N46A 3BFXA 3MFYA 2QT0A 4PHTA 3E2IA 3TAUA 3JVVA 4BQSA 4NDZA 3ZD6A 1FUUA 1XBTA 4JBWA 4S2EA 3IIKA 1YRBA 4MRNA 3IQXA 3D3QA 1KK0A 4URYR 1PUJA 1W0JA 1P60A 3AUXA 4AKEA 5KSPA 2Q9BA 1E2NA 3C15C 3NIBA 2FV8A 4FXPA 4GFDA 3WXMA 5AUNB 5HKKA 3AVXA 1KK1A 5FOWA 4Z54A 2QGNA 1SZPA 4B74A 2GAOA 1ZU4A 2CLCX 1G291 3B13B 4QNRA 3X1YA 1QHHB 4RCYA 4F92B 5IK2A 3TUZC 2ZITA 1KO1A 4OHZA 1HA3A 4TT3D 4CEIB 4QBHA 2YNMA 4TTQA 3QKRB 1MABB 4LYFA 3A4NA 4ESHA 4KO8A 3A4LA 1YJ5A 3KKQA 1YZKA 4FMCB 3X2SA 5L3QA 1P73A 3KB2A 2QQ0A 3QJYA 4P3YA 2HT1A 2YVUA 2QROA 3FHCB 1Z28A 1P62B 2A9KA 2WM9B 3GJ3A 1HH4A 5GJVC 2YWEA 1F48A 3CNNA 4NMMA 2OLKA 3UMSA 5BN3A 1FTNA 5JFGA 4PC3A 4C0HA 4YDSA 4CT5A 4BLSA 1VCMA 3EW9A 5GJBA 2AWOA 3CX7A 1M2OB 2PEYA 4XVUA 1XEWX 2QP3A 2RGNA 3EA5A 1Z5ZA 1QHXA 1U81A 2F43B 2ZEJA 1BOFA 2EFEB 3PUZA 2GJSA 4JBYA 4PHHA 1T8UA 2EW1A 2NPIA 3OEHD 5CK5A 2GA8A 3B1YA 4DIDA 2AFHE 4Q5IA 2J59A 3FMFA 2V6JA 3QVUA 3W5JA 3FHTA 1BS1A 5FPYA 4KSBA 3CRMA 1UKVY 3PUXA 3W90A 2OILA 2F1RA 2H16A 2W2TA 2RGGA 1TUIA 2ZRGA 1E99A 3RS4A 2VP0A 3SHFA 3TVTA 4TZ6A 3CX8A 1II9A 1RIFA 5DYGA 4Q1FA 4WBSA 4BLRA 1U90A 5FBQB 4CT4B 1PLLA 2ZUCA 4M8NE 5A0FA 2H1LA 2FN4A 1AZTA 4P4UA 5EXTA 1ZM9A 3WMEA 1U8YA 3ND9A 5DISB 4X8OA 1XTJA 2EU8A 3I72A 4AIIA 1ZVQA 6Q21A 1SVIA 3DO6A 2D4HA 3ICQB 4C0SA 2W6IA 2ZRAA 3LVRE 2OESA 1XCGB 1PLJA 3NKVA 4IXMA 2A5JA 3SU8A 2QRZA 1N6LA 1UJ2A 3WYAA 3QKRA 2XGJA 1MO5A 4FIDA 4Q1AA 3WBJA 4DLRA 4PC7A 4A2QA 1Z8FA 3C7KA 1OXXK 3OFNA 4JVMA 4RFSB 1CR1A 4B44A 5FH9A 3CF2A 4Q66C 2VHCA 2PMKA 4B71A 2YWGA 1F2UB 4Q4AB 2JATA 3OZXA 3B82A 1G8PA 3VR5A 1HY3A 4GT1A 1J2JA 2YZ2A 4HLUC 3DMNA 2DWPA 1RYFA 2WWWA 2ZJBA 4ZKDA 1ZM3A 2QY9A 3DL0A 5FOTA 3NH6A 4L9WA 2F1HA 2J0UB 3QXXA 4LK2A 1Z0DA 2OFOA 1NRJB 1RKBA 2ZRKA 1TTTA 4ZDJA 1Z3IX 2ZSEA 5KO2A 4PTLA 4XD7D 2W6JA 5K8IA 4NCNA 2QSZA 1NVVR 5CYPA 3A37A 4CEHB 2PZEA 3UK6A 2WWXA 2NO6A 5EUMA 1NL3A 2VYFA 1OH5A 1VIYA 3DHWC 1FL9A 3AP1A 2QPOA 1E9AA 2L0XA 3WHLA 4ERNA 1IONA 2A5FA 3MCAA 1NN1A 1NVWQ 1JXOA 4DCVA 1E0KA 2CJWA 2VP6A 1W0KD 2IW3A 1E94E 4UJ3A 2VHJA 1B0UA 1HTWA 3MWJA 2G0TA 3EXAA 3EIQA 5GJCA 2ODBA 4DVGA 4EQ6A 1ESNA 1TEXA 5BQ5A 2R6GA 1E2MA 4U7DA 3NWJA 4DSUA 1KI6B 3QF4A 4RZXA 1YZQA 3ZQJA 2ZRIA 2ZJ5A 3SBDA 1FX0B 5EP2A 3U6BA 3ADCA 1E1RD 5JSZB 2QPTA 1VIAA 2BV3A 4DLZA 2PJRA 2JASA 3TSWA 4PC2A 4LBVA 1BKDR 1H8EA 2P0EA 2MSDB 1R5NA 3LFUA 2VP2A 5DIFA 1YR7A 2FPMA 2B7CA 4M1TA 4TTRA 5J4HA 4D81A 5FTMA 3QXJA 2QA5A 1OFTA 1LVGA 3ADKA 3T34A 4A0GA 2ZJOA 3CRVA 2BM0A 4LPSA 1P2UA 2PZGA 1PVOA 1H8HD 1I4LD 4NCKA 4DB2A 4F4JA 3TVDA 4Z1MD 1WB9A 4NYMR 2FFHA 4N1AA 5DHFA 4BEBA 5GJWC 1MV5A 5FUVA 5F9HA 5HCNA 4C2UA 2FSFA 1SKYE 3QVVA 3TUIC 3ZS9A 1T9HA 1WF3A 1NLFA 4MDEA 4R7ZA 4WIAA 4F4CA 1W4AA 1DE0A 5FL7A 4AKHA 3EPHA 1IJEA 1CXZA 5EZ6B 1XU4A 3GMTA 3Q5DA 4A8JC 2H92A 3CPHA 4JVSB 4QGFA 2XAUA 3ADDA 3RS0A 3VR6A 4RD0A 2JLRA 4D0LB 4YQFA 4NCIA 5L3SA 5FI1B 1YE8A 1DG3A 1SHKA 3P4XA 2EQBA 4DLXA 5FR1A 4MYUA 1MT0A 3W3ZB 1HURA 1UF9A 3PEYA 2IBMA 1LTQA 2RHMA 5J4LA 5KOYA 2Z5FA 4GOJA 1OYWA 3TW8B 1DADA 2NPFA 2WJYA 2BCGY 2WSSD 3V4FA 4DB4A 1S0UA 4MA4A 1I2MA 2E87A 1CR2A 4IVPA 4M9QA 2GRJA 3UKDA 1VECA 1FX0A 4NTZA 2F9MA 4TQUS 4ASUA 4UQOA 3CF6R 4NONA 3B85A 1Z0IA 2VF8A 1N5JA 4F38A 3ZH9B 1KI1A 5JSZA 2EYUA 2VP9A 3TSZA 3MD0A 1XPRA 2GBLC 1JEEA 3SHWA 4IOJA 5FPKA 1W4CA 3GFOA 1G3QA 3LAWA 4WZ6A 4V0NA 3WHKA 3FKSA 2CXXA 4KHZA 1GIAA 3GJXC 4PQRA 2CNWA 1W4RA 1IBRA 2Z4SA 2O8FA 2YOHA 3MRSA 3RYTC 3U44B 4BWYA 1F2TB 4Y0VA 2ZIAA 2IF2A 5H70A 3TNFA 3R20A 3EX7C 1GNQA 4LC0A 2GZDA 4BFSA 3SDZA 1IY0A 4LX0A 4D4JA 2YKGA 1UAAA 1Q22A 2DY1A 1N5LA 2HYIC 2JLYA 1FOEB 2ZRFA 1Q20A 1M7GA 1CRPA 3NBZC 4TTPA 3TIFA 4E09A 4TLDA 5BXQC 3U5ZB 4QBIA 3CF0A 4IKEA 4DLVA 4TLBA 4TQAA 2Q6TA 4DT1A 3KQLA 2CHQA 1Z08A 3IILA 4PHGA 2JAQA 1Z0AA 1WQ1R 2I4IA 3CZQA 4RD6A 2J9RA 2OXRA 2NZJA 4HB2A 5KNDA 2IYLD 2FX3A 1GDDA 3KJHA 4HAYA 3GD7A 4KYUA 4NU0A 4GL2A 2JJ2A 2YC4C 2KBEA 2ERYA 3IBYA 3C16C 4RD4A 2BBTA 4C4PA 1D2MA 4NHOA 4ZCLA 3GJ6A 1KO4A 3UPUA 4B6FA 3T5DA 4LJ8A 4BFWA 3I61A 1XD8A 5LD2B 1JALA 3TBKA 3KQHA 5G3ZA 1N6HA 1NN0A 1XF9A 1E2HA 2GK7A 1U99A 3AKEA 3LD9A 4F7WA 2FZLA 4JS0A 2IT1A 4LC1A 3DOFA 4Q1CA 3CNOA 2ZANA 1T91A 2W58A 4ZI2A 1FUKA 4DDVA 1VG8A 2OSBA 4MQBA 4WAUA 2PLFA 2WWHA 4G5OA 4TLAA 1CS4C 2DHRA 4DLUA 3AM1A 1XJCA 2GEDA 4Q01A 2B21A 4Q9LA 4DSTA 3PVSA 5AJYA 2OBLA 1DO2A 3GFTA 3B6EA 3NTUA 5JRZA 1U9IA 1N6IA 3VX3A 1M1YE 4UXIA 3KL4A 3FVQA 3SE0A 1JEDA 3U4QB 5LB4A 5JS7A 3NBFA 4RZ2A 5B30A 2GVZC 1OKKA 1YZNA 1XJQA 4EFLA 2FFBA 3LX5A 4Q7JB 4IFBA 1NMYA 2OXCA 5CLQA 2ZR9A 2R6CA 1OPXA 3DMDA 4MGYR 2N1BA 5DNYB 2RMKA 3VU9B 3FHOA 3QKSB 4TYWA 5TDHA 1UKZA 1W48A 3RDPA 4PZYA 4QBFA 2OG2A 1T3HA 3NHBA 2ZYVX 3B1VA 5EE9A 3RC8A 4CRWB 4AKGA 1GFIA 2WTUA 1G5PA 4MYTA 2C9OA 5DI3A 1E9EA 5CB8A 4JSYA 2Y8EA 1WRBA 2ZJ2A 8OHMA 5FL3A 2HLDD 1L4YA 4M1KA 2ZSBA 1AQYA 1LW7A 4WXPA 4YXWA 2QENA 3DKPA 4B34A 5TY0A 1M34E 2C9CA 4RY2A 1U0LA 3A4MA 1XD2B 3M6AA 4A6XA 1CLUA 1II0A 4Q7MB 1P5ZB 2BEKA 3L0IB 2ZE8A 1OXVA 3RS7A 1G18A 3VX4A 2O8EA 2C9YA 1G20E 2DFKB 4H1VA 4BLQA 5HR5A 4DBLC 2AXNA 1VDZA 2X19A 2RGCA
chains in the Genus database with same CATH superfamily
3QNUA 4NI5A 3AONB 1E32A 1CQZA 4Q4CA 4MIEA 1WP9A 1MC1A 4DYDA 2PLNA 3K1AB 3UOWA 1WX1A 2QORA 3SVLA 1WHTB 3CF4A 3LY9A 1PR0A 4TS3A 4WDQA 1ZMOA 3B9RA 3FSRA 2QNBA 2AMVA 1SG9A 1BWPA 3DM9B 4OQFA 5T4BA 3JQ8A 4GI7A 5J43A 5LQDA 4KQ1A 3HVJA 3A9CA 1DJOA 2J08A 4RJLA 4NE2A 3DZCA 4KUGA 3A4TA 1A9SA 2EHJA 2RIRA 4R1UA 3ZZ1A 1FYDA 3IUSA 1NQOA 3D43A 4RJKA 4X61A 4YR7A 4B45A 3H11A 4HRVA 1G7SA 5C3MA 2B0CA 3GLFB 5EKUA 2D06A 3NQ41 4RFVA 3L4BA 2I4RA 4LSZA 2EATA 2RI0A 1SVOA 5JJIA 4XQ0A 3IKTA 5IJ0A 2WJIA 5TRTA 1UCFA 2AHOA 2K5UA 3ZZ0A 4J3JA 1W46A 4PRYA 4FILA 2YWHA 1G20A 1I0LA 1SA0B 2A78A 3SMVA 1ISSA 4CLRA 2DPMA 4AJEA 2XDQA 4AY5A 3AVUA 4M37A 3WA7A 1EUCB 1USWA 2D5IA 2KJQA 3EVBA 3U4HA 2R9VA 3R8CA 1PGNA 3H2JA 3RREA 1PJAA 2X13A 1BGWA 5GV8A 1PT6A 4F1KA 3A31A 2RGXA 3KTDA 2XYHA 1XGKA 1A1VA 1IATA 3HS3A 1XTKA 4AJNA 2QJOA 2DSNA 3VTZA 4AG3A 1W8DA 1E1QD 4KO2S 4UBKA 5G0SA 1UM9A 1XWWA 5AKXA 3U9LA 4N65A 3G1UA 5DNVA 3TL2A 4R9SA 2H5JA 3RSZA 2YVAA 5AKYA 1A9ZA 4KQMA 5JS8A 3ZCSA 3AP3A 5C8ZA 5IANA 1QRAA 2A5YB 3QK7A 5CNIA 3TOCA 2P2ZA 2XWBF 3SICE 3SX0A 4YV1A 2XMGA 2HPAA 3MB8A 4RA6B 4YACA 5L45A 3CR8A 3GA5A 3UV6A 4MR7B 2PXAA 3PFGA 1XA3A 3E2PA 1CJUC 1R00A 3A2NA 1LBQA 1PD0A 4HL6A 1RRFA 2ZI5A 2WG0A 3OE7A 3R5XA 4L08A 3PNVA 3USCS 2A57A 5JNRA 1VA4A 5BV8A 1DBVO 5EJEA 1K7FB 1UMKA 3I5XA 2JPDA 1ZH0A 4PCVA 2O5VA 3KQTA 4KYVA 2IEDA 1PJCA 4GMFA 1Z4QA 1TZBA 3CZRA 1L6IA 5K6AC 3KR9A 1TQ4A 2V7VA 1V1JA 3O93A 4ZU1X 3UMRA 3IQGX 3R3XA 4UE2A 1QYIA 3VXKA 3BZUA 2PT7A 1RM4A 4LCBA 5EZQA 3MTGA 2OXFA 2VNIA 4G2NA 1RWBA 1WA5A 4CL3A 3TH5A 3IEIA 2MSEB 2HF8A 3LKVA 3TFOA 2NU9A 3PWSA 2ZDGA 2OUKA 3UXEA 3IMKA 3NBXX 3TQTA 4ZJUA 2CNOA 1QLHA 2C2ZA 3QEAZ 4LNUA 2X3FA 2QL5A 5AOBA 3QV2A 3ILXA 2G04A 1HT2E 1TYAE 3MJCA 5KSZA 3ZU3A 5T5QA 4Q93A 2EFHB 2WFZA 3KKEA 4CR8A 1TF5A 1GZ4A 2PPLA 3EGOA 5M2QA 3V2HA 4HQNA 4FZRA 4CM1A 3IAM1 3E9MA 2ZUSA 3U7RA 3FBTA 3KX2A 1WSAA 3C70A 3T3NA 1RM0A 1F0PA 1XCOA 1JW9B 2Q6VA 4O4JA 4X44A 4BV9A 4YB8A 2HK9A 5HZKA 2I4NA 4DV3B 3QXSA 2P0AA 1Z07A 3LYLA 3MM4A 4MH0R 2AWNA 5CLFA 1A9RA 2PZMA 4NBRA 3TBHA 5TF4A 1S96A 3A0UA 4BNJA 2COEA 2IPNA 4EKNB 1AKTA 2E1RA 2PO7A 3ZGLA 4G56A 1XEAA 1IN8A 4HV4A 4OKNA 3UJAA 1PV1A 1X38A 4OU4A 5C46F 2IXEA 2P5TB 1Y9EA 2W93A 1VI5A 5TQ0A 3ICWA 3B5EA 2NYUA 5A03A 3K16A 3USES 2NW6A 4UHEA 1QE0A 2NV2B 2WWRA 4ZEWA 1Y98A 1ADGA 4BGEA 5FBVB 1QYRA 4CF6A 2PD6A 5ISMA 3AEKA 4WV3A 1EZ1A 4DKXA 4X84A 2G72A 4LVCA 1U2SA 3TE6A 3ELBA 4CM8A 5DE3A 5I3CA 4BLOA 3CU5A 4UM8B 5D7NA 3JALA 2FDCA 4M60A 1E9DA 4J0JA 4MW1A 4X7PA 5LC1A 5E3JA 1DQSA 5I8PA 2CHUA 4PPGA 3QBJA 3K0CC 3SM9A 5KAMA 2P2SA 3K71B 1VZ3A 3GUYA 2P67A 3HDTA 3IPXA 3W78A 3V7NA 1RAGA 3LQKA 2DQYA 4TZKA 4X45A 1UMDB 2R60A 3C8UA 1QVAA 4BNDA 3L46A 1J23A 1LCIA 1IDN1 1XQ1A 4OBEA 4E2ZA 1XRNA 3AI7A 2PX6A 4IIEA 4YRTA 2X9LA 1T6ZA 2RGAA 1ORRA 3NC0C 3A6PC 1Y34E 4D5GA 1QE3A 1DNPA 1Z7EA 2QE6A 3F96A 5CA0F 4FFWA 2Q1XA 4L16A 3V4PB 5BUSA 4PW0A 2ZI3A 1R4ZA 2R4TA 4RVDA 3L41A 2ZATA 4JSRA 4EY3A 3D64A 2GBLA 4GUAA 1F14A 4TPKA 1GY8A 3LFHA 4UHKA 4K87A 3REFA 1UMBB 1GO2A 1KJWA 1RBYA 1SUEA 3OPQA 2HEGA 3PEVA 4GAEA 3HUEA 4GX5A 2OOSA 1WMFA 1GCAA 3TLCA 1YA8A 3C3AA 1EIZA 5G4KB 3FGPA 1JKJA 1L4HA 3OZWA 3QX8A 3SF0A 3HDHA 4D97A 5J2UA 1ZKDA 2COUA 3ABZA 4LY0A 3PUWA 1G3UA 1WHSA 2Z1DA 2IF0A 3D2AA 2WM2A 2ZJ1A 5BN4A 5A4FS 4RTPA 4QAQA 4JI3B 1E92A 1BVYF 1UOPA 4H0FA 1CZHA 1ST2A 2R5WA 2DT8A 2QTCA 1Q1AA 4CIYA 2QJWA 3K5HA 1K98A 3QPAA 2P1RA 4JITA 2HA6A 4LGVA 5LP6A 1BA2A 1JQDA 3I45A 2QMZA 1ZK2A 4Y7DA 3LPAA 2VF2A 3EQ8A 5I51A 3AUAA 2F1JA 3H17A 1HKHA 1N1EA 4CL0A 4INJA 4KI7A 3K72B 2PBLA 1V5FA 3GC6A 4K3UA 2H4JA 5BPFA 2DUUA 5LN1A 2PAAA 3I58A 5HG0A 2UYHA 2IU4A 1JQEA 1HFKA 3K94A 2QT9A 1W0JD 5JSKA 1ENZA 3IOBA 3LRPA 5JCJD 5AKZA 1GL9B 3EB9A 5BNFA 4AY4A 1QGDA 2D2EA 4E5SA 3MJTA 3H4MA 4TLCA 2BLLA 3SZLA 5KKNB 2AQKA 1RQLA 5JAOA 3M6WA 2WI8A 2XT9A 4KPUB 1YVPA 1KSJA 4QULA 4LXHA 2O2IA 1QTNA 3ICPA 3M9XA 4B43A 5D86A 1VL0A 3GHYA 2ONZA 4ND5A 5JFTA 1XROA 2A0UA 2VJYA 3A6ZA 4RTNA 3OOYA 2D2IA 4BNMA 4BMOB 2X4LA 4HDMA 4CMEC 4CUJA 3K70D 1OJ7A 2OVFA 1A9PA 4JI5B 5LD2C 4BYMA 4M9SA 3T9BA 3TG8A 4DR2B 3KALA 2ZI6A 3CYFA 5BQXA 1PJBA 4DV2B 3ZDQA 1ZWKA 2LDXA 3SC2A 2ZXUA 4FYYA 3PDJA 1OWNA 3LM8A 4E0BA 3SXUA 2V7XA 3A1CA 4Y2XA 3BFVA 1EAMA 2XCSB 1ACLA 4XSVA 2P2YA 1LVHA 2F3PA 5T41A 1TJ4A 5DO9A 1WW3A 4D3ZA 3T4XA 5LQAA 1ZLXA 2WSBA 4ZKEA 4EQ6B 1G98A 1YMUA 1PZXA 3LCCA 2XIQA 1WVIA 2ZR8A 3LK7A 3O4FA 4JVOA 3QE4A 4WJLA 4M9XA 1I7NA 1MA3A 1PK9A 1NULA 4QYMA 1QIHA 3T7SA 1UANA 3G6KA 3JX9A 3HWRA 3F8SA 1LI4A 4MGHA 2GO1A 5A71A 3TFWA 4YECA 4ACAA 3ZI4A 3MHTA 1GRQA 3GBPA 3S1LA 1F0NA 1UEJA 3L8EA 4JX9A 2PXXA 1IWOA 1KNQA 1Z3CA 1T0JB 2HLNA 2IHYA 3BWVA 4ND6A 5DYWA 5NLLA 4EDFA 5LCXA 1KZ7B 3W2TA 5I4BA 1IWPB 5FLYA 6CHYA 2JIRA 4DHEA 2PL3A 4I5IA 3OQBA 4IIYA 4L9AA 4WW0A 2DF8A 2GVDC 4L2IB 2EJUA 2Q45A 3VOSA 1JH9A 2JGAA 1KI3A 4N3GA 3AHCA 3RM3A 3HJFA 2ZB8A 4IY1A 3IUMA 4BNLA 1FFEA 4MPTA 4JCOA 1OGYA 5FNVF 1O3YA 3ETCA 5I7OA 3UJ8A 5AESA 3GLHE 3LVBA 4AJIA 4CKYA 2UU9B 5ICGA 1NLZA 4FT4A 1BWQA 2CXOA 3FMIA 4AURA 5IJXA 3WTCA 1XFDA 1V8ZA 4TTAA 3H5TA 3PHIA 4EG8A 2IYPA 1VDMA 1R10A 2TRSB 4CT0A 1Y8RA 1RLTA 1EE2A 1ORWA 1A9OA 3VQTA 2OL4A 4OJKA 4RQUA 3REGA 3RSGA 1J2RA 1LDBA 3A6EA 4BO8A 2RB5A 4ZPJA 5DJ5A 3C41J 1JMYA 2J0EA 4GBED 4NWIA 4DJFC 2Y1GA 4NYMQ 4CODB 5EQTA 4LVOA 4RYLA 2O7QA 1CEQA 1IMOA 1STOA 2H1VA 1WXQA 4YLGA 1YVRA 3DWIA 5L4LA 2UYGA 2BD0A 4BCDA 4A9AA 1RU3A 5A5FA 1RHJA 1PGJA 3QELB 4W5JA 4YRFA 1PR4A 1DINA 3OHMA 1ZI8A 2GJ8A 3P97A 4E12A 4EY8A 2XTNA 4RM3A 1P61B 2C77A 1PZMA 5KSWB 1XZNA 1P0PA 2DH6A 3EGIA 2VNJA 1DFIA 2C4MA 5DOVA 1TM2A 3GLKA 4PAWA 2ZIXB 1WBBA 3ZHXA 4RANA 4EA7A 3DV2A 3VR5A 2M1ZA 1BEZA 3BULA 4YJFB 3TCKA 1RI2A 3D4NA 3GLHA 3AJAA 4UNQA 2PX0A 5TGTA 1CFJA 4DUZB 5AM1A 2ZJAA 4R2JA 1CUFA 5G0TA 2BKVA 3IOYA 1KAMA 2J7KA 1R0CA 5C8YF 1K3UB 4QPDA 1QQ6A 2F62A 4KLNA 5LZ7A 1XT6A 1A8IA 3AR4A 2IE0A 1GTMA 4JLPA 3LHFA 2ACEA 3VSDA 5I7SA 1NBOA 2G0NA 3FNHA 3QVOA 3T7JA 5FLXA 4ZFNA 1I0ZA 1WCYA 1RXUA 2F3TA 4YRMA 3EWAA 4F04A 1N4AA 3N2IA 4W1PA 3MG9A 4TVBA 2NVWA 5KDDA 3GFGA 1GVNB 3FX2A 1JL3A 1JQAA 4FEYA 3GLGE 3OZSA 3IIEA 2VSQA 4BKRA 2J6BA 2OEPA 2ZBPA 5GQSA 2IHBA 4LV5B 1NC3A 4CFYA 2QRVB 2XUQA 5L40A 1R64A 3ZV5A 1KXZA 4UFNA 3L7JA 2IP1A 4EDHA 3KYDA 4RIHA 4Z7OB 1Q0UA 5FXMA 3RRNA 3GRKA 1HQCA 3IXQA 3WIVA 2OHGA 4ZQGA 4ALIA 4I1PA 4FR2A 2D13A 3JVUA 3B6ZA 4P83A 2IOFK 2FKAA 4NE9A 4JKIA 3PFWO 4ZJPA 1D2CA 1BRMA 1JEOA 3CUTA 1V8PA 5JRJA 2ANBA 1RKUA 3KTAA 2WHPA 3VJLA 5F35A 4DA7A 3ZVMA 3ZCXA 2B3TA 3Q41A 2ZDHA 2GT1A 1QP0A 1IVYA 1V1RB 5F2OA 2OCBA 1SHLA 1TLTA 3ISJA 1RWPA 1E7YA 1G55A 3RYIB 4ZQCB 3WWEA 1BW9B 4KUHA 4X00A 1CJSA 5G1OA 2V65A 3MAJA 2FB9A 2MWMA 2E4AA 1GNTA 4OKSA 2VXYA 1KZ6A 2BGWA 3GCDA 1S1MA 1WNFA 2Q49A 1JHUA 1ENYA 2Y9PB 3QUBA 2OM6A 3ROXA 4DIFA 1Q12A 1FQJA 1NW3A 1RQ2A 3E61A 4EX6A 1M7HA 1ZZGA 1PEKE 3ZWCA 5CA0A 2H85A 4CKEA 1PRYA 2D5AA 2G4CA 4OLHA 3BMCA 3RTBA 2JZCA 4D5EA 2VHTA 3F8TA 4YNBA 1OLSA 3MTDA 1A96A 1QWOA 4KQXA 3BCHA 3HDQA 1PL7A 4DTCA 1LWOA 4ZICA 5FL7D 3F4KA 1BD4A 1NKSA 1KKMA 1G6Q1 5JXHA 3QWAA 1B6GA 3B60A 1NASA 3T7EA 3SLKA 3G2MA 4D46A 1Y9DA 1HOXA 2ODPA 1WDTA 4URWR 3FDXA 3AI2A 3HXTA 1W52X 4ZVPA 1JDUA 2C4WA 1TZKA 3EG9A 3DT6A 2DE0X 4ZVQA 1QU2A 4BX3A 3U0VA 2GF0A 3ITDA 2PUWA 4KMOA 5EQDA 6YASA 2VPPA 1I7DA 1LPOA 3PCTA 2BEUA 2K6GA 2BFDA 3BOSA 1J42A 1HL7A 3GGPA 4PWZA 3ZWDA 5K3OA 2IH4A 4NULA 3P9QA 2HA4A 3ZHBA 3OMLA 3RU3A 2FZCA 3MJFA 2QR2A 4G1CA 1XHLA 4N5MA 1D4ZA 5LZ8A 3VPBA 2YIJA 1POWA 4JB2A 1NYQA 2GCNA 4N5HX 5F5XA 3U4CA 4HO1X 4A5OA 1AQJA 1HR0B 3A06A 4MUGA 5LL6P 1ZYUA 2ZTMA 3T12A 2J4FA 4WXRA 4FJ2A 3SJUA 2NU6B 1G8YA 3QOFA 3PHGA 1NIJA 3C5VA 3LX4A 5E6UA 3MPOA 4BGVA 2W2NA 2WJZB 3K8YA 3QLJA 4UBOA 4AJ2A 3TF5A 4JFRA 4U2EA 1ZUHA 2CE7A 3UH1A 4XQCA 3LT5A 3ROFA 4TX1A 1NZFA 3GT0A 2Q6IA 1I1HA 1MB3A 2GS9A 3PC6A 3IBTA 5BQ3A 2CNWD 2A94A 3ISTA 2VO1A 3AC0A 3T1HB 2QGZA 4R1QA 3V9PA 3I04M 3VU1A 1MOSA 5DGDA 1RLJA 5FADA 3B1FA 3DA8A 3R3WA 1JEYA 3ZVLA 2ZSJA 4UASA 3HFSA 1MNAA 2DY0A 1DT3A 2H7XA 1DIGA 3LO5A 3NGXA 5FR2A 4ICIA 5L6MB 3UK2A 5BQPA 4EG1A 1XVVA 1ZSVA 4PBRA 5CJ2A 1TFRA 2X0FA 4B6QA 3GDFA 1D8TA 1YQXA 3MRXA 1Z22A 4KHPB 3LXRA 2GUWA 1O1YA 2HUPA 4ITRC 4JKOA 3WRYA 3UB4A 3DVSX 3L40A 1FP7A 3NHRA 3PNYA 1SCDA 4HI0E 3UBMA 3RKUA 2MYTA 3B1XA 2RGNC 3OT4A 4L57A 1FMJA 3SYLA 3QW2A 2SKCA 3U3OA 1TM1E 1USKA 3BQMB 2C2MA 1PS8A 4C7KA 4E6EA 5A4DA 4S05A 1EGMB 1W2HA 2VBGA 4IUDS 4RKEA 4XM2A 3UAYA 3WNCA 3WB1A 2VJOA 1AKVA 3SS7X 1AKMA 3ZJ5A 1P4AA 3L8GA 4K88A 2IY7A 1T0PA 3AF3A 2EJCA 3RJTA 1HLDA 5K2MA 2YVKA 2Q4RA 2D0OB 4HYEA 4B46A 1L4LA 4YLYA 5F7OA 5A9RA 5F33A 2H3HA 1P5JA 2IDKA 4K40A 2PZLA 5IC5A 4UE6A 1ZBDA 2VSFA 3QLVA 1KJ9A 3ZJYA 4JBXA 2LV8A 3AZPA 5E2BA 5I9BA 2WR8A 3MGAA 3P20A 1JDPA 5TGZA 1C7ZA 1RYDA 3SYTA 3T95A 1EFVB 4INPA 2ZM5A 2O4UX 1ZRSA 4YCNA 5FNVA 2BUCA 2JGRA 2VEOA 2QVGA 3OJWA 4NZZA 1E2UA 5FUWA 5LKRA 1RXCA 2XLBA 4GLJA 1DEXA 2JH9A 4LRTB 5DTQA 2OHJA 4ARVA 2M6KA 5I7HA 1XAJA 4DV6B 5LWQA 1BFDA 4F45A 4BLVA 2AFIE 1OVMA 2B82A 3AKCA 4Y18A 4BNWA 2YYZA 3RIMA 3IVXA 2G9QA 1G7CA 2FMIA 3CUKA 4GPIB 5C7IO 1Q3HA 2GAIA 4ND3A 2FN3A 3A1UA 4NFYA 4QXAA 4G0XA 5EYPB 5LQSA 3UGQA 2YWBA 4BRWA 4CG2A 4J4BA 4NYJR 5AM5A 5AKIA 3PXGA 5A5VA 2PL5A 1C29B 1EXDA 2ZIEA 3K3PA 4FGUA 2ECKA 1MFPA 1DC3A 4J9UE 4RS3A 3E1GA 5AIBA 3B1WA 2HD4A 3TW6A 2PPVA 2VXBA 2ONCA 4HAVA 4UQPA 4BDSA 2OBFA 1F0YA 2PFKA 2ZAGA 3I1IA 1Z15A 3OCZA 1SPXA 4YUYA 1OKKD 2PLAA 2F6RA 2FLKA 3OMWA 4UHJA 5CVCA 3K8QA 4HQ6A 5A4IS 3WL7A 4OREX 5CHEA 1E2PA 1V8OA 2WHXA 3GNSA 4PQYA 3RUIA 3AIOA 2RAVA 3PPXA 2XB4A 3T5CA 2JFUA 5E9AA 3WGMA 1WTCA 3QX3A 4W5QA 1ZUWA 1N0UA 3H8JA 3HLKA 1I1NA 3KV1A 1DAFA 3OP4A 4MEBA 3AKZA 2VNKA 5LDGA 2PCJA 3EVGA 2HADA 3CRNA 3DONA 3I04A 3RUPA 5GZ3A 2BEVA 4PANA 4P53A 1NKVA 1OVGA 3Q3VA 5DBOA 1MG5A 2MSNA 3COSA 4NCHA 4HVAA 4PZ0A 3MCZA 2VWQA 2V1UA 1I01A 2YICA 2PQ6A 3ASUA 2QN1A 1NNUA 3N2NA 1QKIA 2XQVA 4FS3A 4JN6B 4MMZB 3ZK7A 4J2OA 4E70A 2EVWX 3NTRA 3CEPB 3CA8A 1HORA 1BXGB 3JQAB 4TKMA 1U8TA 2W9XA 3RLFA 2R7LA 2X0EA 4JT8A 1QHSA 2WD7A 4ENVA 1YNSA 5H82A 4O25A 2Q7XA 2OP1A 2O8DB 1GV0A 4KQEA 1EVZA 4E4YA 4NECA 2X42A 2XJ4A 1GLNA 2NUPB 1YI0A 3BJZA 3E4CA 3D59A 4I66A 4PLYA 3UPTA 4X5OA 5REQB 1ZIYA 1RXSA 2D5BA 4FOSA 2J0VA 1JPVA 5L3RA 3I0NA 2XVXA 1PFYA 1YR1A 2H4YA 2REBA 4YJ3A 1WDWB 5FO0A 3RVPA 1DGQA 4PYOA 5AI0A 1Z7GA 2YJ6A 4WA8A 5CIQA 2OCKA 1ZK3A 3AW9A 3OX3A 3CNLA 2Z09A 4LFCB 4KV9A 1FU8A 4P6VF 2X8LA 1UP7A 1Z4PX 3FDFA 2DR2A 4D26A 1Z0KA 2HX1A 2BFCB 1SOAA 1E1NA 1YRQA 3HDJA 3HH8A 1QB8A 3JZIA 3LP5A 4BGDA 4WLVA 5JBNA 2J67A 2GK4A 5GAJA 4JL6A 2HT6A 3RE1A 4RTRA 1CJKC 4OK5A 4GH5A 1E2BA 1DQPA 4IHJB 2NZUG 1B8OA 4F6RB 2OV6A 1AHHA 3ZQ6A 2CL5A 4HLUA 5T64A 4F6CA 1ANKA 1J21A 3G3EA 4JA0A 3EGXA 4Y0AA 1BIFA 1G5TA 3N6RA 2EZ9A 4YV7A 2KB0A 5H3CA 5KOJB 1EUQA 4DCUA 5J1SB 4QAJA 2C29D 2RC5A 4MR8B 5ED0A 3DH0A 4I1UA 2WF7A 2W98A 2P3SA 3BSSA 4A8TA 1LPPA 3ZXIA 4J3FA 5IXYA 4N5LA 2V5UA 4HKTA 4J1TC 1WVMA 3FPHA 5EWMA 5KTKA 4RDIA 1VYUA 2HQRA 3BB4A 3DTNA 5IRCD 5CTJA 4G0NA 2H7CA 4PFQA 1D0IA 4M2LA 1LK7A 4A8JB 1ULTA 5IDYA 1QV9A 2XLCA 2AR9A 2Q8PA 4FYPA 4MVJH 3T5BA 5K20A 4RACA 4N3AA 3ICCA 4QUIA 1QQTA 2NN3C 3NAMA 2XTAA 4M55A 2AKEA 3ORQA 4J76A 3ASZA 5AQ1A 4RZQA 5AKKA 2QX6A 4F2DA 2Q5FA 3KVRA 1GYRA 4Q7KA 5JVDF 2QE7D 4KC0A 2AT1A 1MJHA 5J5CA 4R0MA 2NWQA 1LBIA 2XNHA 4CM4A 5EMKA 4DOMA 5KQGA 2RAUA 2RJOA 1U9YA 4ZAVA 2BMEA 3O9MA 2EG5A 4RKFA 4TWRA 3K0AA 1X7HA 2IYWA 4LXIA 1E1CA 4ESVA 1E3IA 3D1VA 4TL7A 3CZPA 1JJFA 3HDYA 3LXXA 4EB6A 1ZSYA 1RP1A 2C2KA 2I99A 3CBQA 2WOOA 4EHDA 2VPTA 1KEWA 1X9IA 4BNIA 2C8VA 4RF4A 4KFCA 1J00A 4ZV9A 1CJMA 2WIJA 1P29A 2XYVA 4TSRA 5CFMA 3L5KA 3B2QA 1D6MA 3LWBA 4IO1A 5T67A 5L51A 1PDWA 2RBGA 2NXCA 3OLXA 1P3Y1 1RCTE 1Y4ZA 1H0SA 2CLDX 2D8MA 2P8JA 4I6JA 1E6WA 2YRXA 1YOVB 2R8YA 3BF8A 1G1AA 3H2ZA 1DDOA 3GNTA 2H1CA 1CUAA 3G5UA 4YAWA 3R9IA 1X7GA 2H4XA 4I4CA 5JZVA 3LBYA 1ZRHA 5GONA 2IL1A 2VBCA 2OQVA 5KX5F 5H83A 3I62A 3A9RA 1FRFS 1IQ0A 2UZ4A 1C9YA 3B3AA 1SHJA 1OZAA 1ZD2P 4UU7A 4WOBA 3TLZA 1KSHA 1E69A 1EHYA 1NF3A 3Q0EA 3PLRA 2CFOA 3WGVA 3BT7A 1MAWA 3IQWA 1U9CA 4CBVA 3TYXA 3OC6A 2XUKA 4HDRB 2JGLA 4EZBA 1DBPA 3A4VA 3LGAA 4NL4H 4V0RA 3RWMB 1AGPA 1RPTA 4K46A 3QMPA 4M99A 1NP6A 3SIPA 3ZN2A 1RZVA 2ASEA 1TUBB 2P6RA 1H1LB 1ZOLA 5HA5A 3U7QA 3U62A 2ALJA 3L06A 3NDPA 3AR2A 4OV6B 3Q4GA 4ZI5A 4D80A 4PO9A 5KNDH 9MHTA 5C0OE 5HS4A 2FUCA 2ZS7A 5A9SB 3RQSA 1SU4A 3RYHA 5AW5A 4UKDA 3HYTA 4FQ7A 4EECA 3JR3A 5EZ5A 2DHEA 3U3XA 4R2HA 4RMGA 4JXJA 1I7PA 1U8AA 4JNKA 1A4UA 4P4SB 2OKGA 5IVIA 3HGMA 1SHTX 4OXYA 1DP4A 1UBLS 2V54A 4TXHA 4UCXA 1KNXA 4MV4A 1A8SA 3ENVA 4AC9A 2V03A 3LQQA 1SG0A 2MMGA 1FZQA 3VPFA 1ZVVA 1WO8A 2ORWA 3EXHB 3R7AA 1BN7A 5AVKA 2BFMA 1FSGA 1O94C 2O14A 3T94A 2IODA 1ZCFA 2C7BA 3GFFA 3CNEA 1X7WA 2PD3A 2HLHA 2ZQ5A 1Q7RA 1L5ZA 4P7GA 1J8VA 3AGPA 3BTOA 3PNKA 2EFJA 3Q8KA 4YO8A 3HVUA 4FINA 4J0KA 3AF1A 4UU8A 5FTKA 3WDMA 2CDCA 5FWYB 4EQZA 2GZMA 1Y5IA 3KSMA 5FB3A 3B1JA 5JNUA 1CBUA 4FYMA 4BMCA 3Q3HA 3EBLA 4TT3A 1VE7A 4DG5A 1ODKA 2OKCA 2Q4TA 3N76A 5G53C 2C92A 3UG6A 4JV5B 1EA5A 4L22A 2VWGA 1NBMD 3WLJA 3IRVA 3ILHA 3GLQA 3L18A 1G41A 1KJYA 3PGXA 3Q6NA 1EFDN 4J43A 4U02A 4V0LA 1WXWA 1GCIA 2EBHX 5AK0A 4O4IF 4D02A 3IYLW 1U9IC 3LQ2A 4R8SA 1DB3A 3PFNA 4LXXA 2ZW9A 1G19A 2G71A 4OQLA 4PXAA 1D7OA 3F71A 3UCXA 3NEJA 3WDSA 1XTSA 2FOXA 1EFAA 3L8FA 3LLCA 1RJ9A 1NU8A 1OAOC 4HMPA 4B85A 2AI3A 1H0RA 2BTQA 1XA0A 3B3FA 3GR6A 3OEED 1SVLA 4JJEA 4LKOA 4MV6A 3EMDA 4ARZB 5CEFA 4OAOA 2IKSA 2JJYA 1WMEA 2VCHA 3HO1A 1KTIA 4X66B 2PA0A 2VDRB 1UADA 1VJCA 3Q5EA 3VUEA 2ODNA 5KSYA 1XJWA 3VPSA 3DGEC 3A8TA 2G09A 1M9NA 1H6CA 3JR7A 1FFXB 4D3YA 2Z5LA 4MPDA 5JSFA 2P90A 3O6VA 1Q1QA 2WV9A 1HQDA 2DVMA 3OECA 2EP7A 1C0PA 2VBIA 3V2IA 1ECGA 3LO8A 4IR7A 4OBXA 2QVCA 4HR7A 1DRKA 2AGVA 3QWHA 2FPPB 3WGOA 2GGSA 4JC8A 1Y1TA 2VZEA 2Q5EA 3JQFA 1JBKA 4FFBB 1U0EA 1GV1A 1R0BA 2XSZD 1QLJA 4OLAA 1X7DA 3OFVA 5CDSA 4K81B 5EZSA 1LDNA 1X9GA 3N7UA 2WMNB 3UG7A 2C98A 5AVOA 4YRAA 5KC8A 1WABA 3HUDA 4P3OA 1DWUA 1JSXA 2JKVA 3QH4A 1T5BA 1L1RA 4QASA 3T54A 1PKEA 2GEKA 4YAUA 3VNVA 2P4HX 3KT6A 3CLTD 4G2TA 5AW2A 1JSZA 4CQLB 1REQA 1C8LA 5E2IA 1ZNQO 3OVMA 1HG0A 1J90A 5F9FA 4OL9A 2GRAA 4YPVA 3U1BA 5KTTA 3HEMA 1EZZA 1I33A 2XADA 4IZ6A 2EEZA 2XRFA 4PFSA 1P7YA 1G3MA 5SZIA 3USZA 4O4LB 2OK7A 3PQFA 1UP4A 4GZMA 5B4TA 3QI7A 4ZDKA 1ULZA 4DJAA 3NUGA 3FAZA 1UFRA 3BXHA 2SICE 3CB4A 5JPDA 2I54A 1X1TA 3VKFA 1U98A 5ERXA 1XLVA 1NY5A 3QEMA 1S1CA 4RTLA 2GCGA 3VA7A 4QOJA 2O8EB 1KAGA 5ADUS 1T13A 4II3A 5J23A 4Q4JA 4BGIA 3BD8A 4FSDA 1I4OA 4B73A 5HPYB 4R3WA 1RR6A 1O89A 3NT5A 4CNBA 1AO0A 2VYVD 2JCXA 4LBYA 1EP9A 2F9LA 3R7WB 4S35A 2QLLA 3ZX5A 2J48A 4GZ5A 4GIBA 4HQKA 2XOEA 3EA4A 4PSUA 2K87A 2YHSA 4K05A 4PHCA 4XWKA 2FJ0A 1W47A 4D9HA 3UWOA 3L4BC 3KKKA 3G0BA 1E4EB 1OX6A 1SBNE 4NOMA 5KQRA 3RJ9A 4ZCTA 4XX1A 4QFDA 1EG7A 1GPAA 4WKOA 4M86A 3GAFA 1P4JA 3SZOA 1JPNA 1ID1A 1WL8A 2BZSA 4L9RA 3RJMA 4Q3CA 2F7SA 1CY2A 1R88A 2HN9A 3UWPA 4AYTA 2WVJA 1WU8A 2DBYA 4AK9A 4I19A 1JDNA 2KBFA 2WOJA 1UJMA 2YBDA 3BGSA 4WXMA 2HWWA 2O48X 1UJ5A 2EGUA 1SKQA 3AIKA 3EXIA 1M2FA 4MUHA 4WMLA 5HIAA 4KQ6A 1XCMA 3WRWA 4CGZA 1LRLA 3JRXA 1P80A 4RPIA 1US8B 3R3SA 4ZZ0A 3FR8A 5HM8A 4DA9A 1OU4A 2Q7DA 1DOAA 1I6KA 4WGFA 5CM8B 3TLXA 1ZW6A 5C7YA 1NV9A 3H2YA 4NP6A 4JI7B 1C1YA 4QHSA 2W2QA 2WILA 3MLAA 2C7OA 3RTGA 3NWPA 1L5VA 1E8DA 4P9NA 2EBFX 3BX1A 3EQZA 1O4VA 4FYKA 4CKWB 1QDEA 2J5BA 5AVJA 1OXBB 3ZV7A 3QEKA 5DHQA 1L7OA 4K9LA 2WKPA 3NONA 4DRZA 4N5IX 4Z49A 2A2ZA 1GPMA 1XQVA 1MDFA 2GN8A 4BV8A 3GFQA 3EF3A 2R6AA 5JT1A 2AG6A 2O7NA 4BKPA 2I2CA 1DXOA 1T8YA 3C5HA 3O31A 3OIUA 3T34A 1BGXT 3W05A 3UMFA 4RTOA 4FI3C 1WPGA 1BFUA 1C5KA 5K45A 1NVAA 1R6TA 1NVGA 4N41A 4N6GA 2A7XA 3QE3A 3KU1A 2V7QD 1R5OA 2QLBA 3AESB 3QPDA 4IL5A 2SCUA 3SKVA 3BCUA 3D7RA 5FYDA 4CV3A 3WBFA 3KJXA 4PC6A 4UTXA 1B23P 4MI6A 5U1PA 1RHMA 1XXHB 2GN9A 2Q4EA 1XEWY 4N0DA 2JFVA 3COYA 4XM0A 1AXEA 2QAGB 1JKXA 2GASA 1ZICA 3NKLA 1E4YA 2G9ZA 5KX5A 1W76A 5JG7A 1ZUIA 5BN5B 4NYIQ 1AH2A 3IESA 4HBZA 4MVJE 4PX3A 1YS1X 3DKVA 1P44A 4Q9JA 3UMYA 1AXGA 5LYJB 2IBSA 3OM1A 4CV2A 3B7GA 1IN5A 1NSTA 3Q3IA 2Z8YM 4C7BA 1HYGA 3WKBA 1LSSA 1VMEA 3OUTA 5EJFA 3HCNA 3UHJA 4GX0A 1F06A 4A2WA 2ZB2A 4KIJA 1KBQA 1P81A 3R3ZA 4GUDA 1P0IA 4QD3A 4BLWA 3OLVA 1X0XA 5TPWB 1N2JA 4RFSA 4AD8A 1KMHA 3HLYA 3ELWA 3QG5A 5JALA 5F4BA 1CRZA 1JYSA 1K5PA 1EDZA 5LA6F 2ACVA 5E6SB 3H99A 1T8SA 1LF0A 1IB0A 2BM9A 2I6UA 2YJTD 4HBGA 4DIBA 2DUMA 4PLFA 1DAHA 1JE1A 2QT1A 3E5MA 1KSFX 4UMEA 5C7LO 3LHIA 3ND7A 1H4QA 1LBTA 1V5WA 1C3OB 2B8EA 1W93A 2P4UA 1ETUA 2V97A 3NEYA 3OO0A 3F1LA 3RU7A 5I01A 2D2XA 4PLZA 2Q0SA 2WSSA 4OM8A 2VCEA 1USIA 4EL0A 1A50B 2J33A 4IXNA 4U3JA 1NURA 3W2GA 3LL7A 2XB8A 3HJUA 4G0MA 4XSGA 3LQYA 5TX7A 3W2HA 1YMVA 4MVJA 1W5AA 1D2RA 4CEHA 1BVHA 1KVQA 5CBPA 4D4KA 4H15A 1N77A 1P0MA 4RK5A 4K03A 3COJA 1YR9A 2WJHA 1O6BA 3C6ZA 4UUPA 3UJBA 4EVSA 4LF7B 5HJ7A 1WXHA 2GRUA 4K6OA 4Q19A 1CUEA 4KFSA 4J16A 2LXNA 4HWSA 3TOZA 1QP8A 1UKEA 5LZ9A 5F7ZA 2QNIA 4LHXA 1SZJG 5BW8A 4JI0B 4UBNA 3MB5A 3ZS8A 4XDHA 1JHMA 2XRYA 4QU0A 2WIFA 1UOQA 1GAXA 3X2EA 4F9TA 4B4DA 3IT0A 4HYQA 4RZSA 4QTTB 3HB9A 3R8XA 3C8DA 2BKUA 1LC3A 1ZOIA 3BHJA 5C7OO 3P2JA 4OMCA 3PC2A 1QYXA 4Q1BA 3AY3A 3U7IA 3HZHA 2D59A 3EQ2A 1QORA 3FCAA 4IXTA 2ZBRA 2FK7A 4MRVA 3IUEA 1LBSA 2QM7A 3GRUA 3HR8A 3NR2A 4DKJA 3EMVA 3IT3A 5D8DA 1I80A 1FXSA 4AX8A 3CGWA 4B6GA 3E1KA 4OQDA 2K2WA 4CVNA 2QG6A 1PJ3A 2CT8A 4DIOA 1R1DA 3EVEA 3HY6A 5FI3A 5JY6A 4X95A 2XUPA 1A88A 3TGWA 3BWDD 2I65A 2P3QA 2PZFA 2OECA 1EVQA 2PKQP 2C2BA 2AK2A 2XCLA 3LE8A 3S40A 3NANA 1E96A 1MNQA 3UN1A 1C2YA 3EZ6A 3AM3A 3FF1A 3DL2A 3TTUA 1PUXA 4WCVA 1W1IA 2W6PA 4EYKA 1JILA 1JXAA 3IKJA 3NRCA 3H3JA 1VKZA 4FS8A 3W2IA 1JJAA 1E5DA 1H6DA 2O2HA 3ITEA 2EYQA 2Z8YA 3LQFA 4HUQA 1AN0A 4JU8A 2RG7A 4DAEA 1A82A 4UDNA 4XKJA 4O59O 2AYZA 4MUYA 3RBAA 3Q40A 5I47A 5GGYA 3TQOA 5JWOA 5JZ9A 3BHNA 3G49A 1SMKA 2QS9A 4GDMA 4WERA 3UUEA 3FPAA 4RXTA 4XDGA 5I3ZA 5KNBA 4QPZA 1ZHHA 3DPSA 4MW6A 5DK6A 5BWLA 3WLTA 5BSEA 4YO7A 2GD0A 2M6SA 4KBFA 4XDZA 4LJ4A 3N05A 1PNRA 3NHYA 5F4ZA