5DI3A

Crystal structure of arl13b in complex with arl3 of chlamydomonas reinhardtii
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
EARILVLGLDNAGKTTILKALSEEDITTITPTQGFNIKSLSRDGFNLKIWDIGGQKSIRPYWRNYFDQTDALIYVIDSADSKRLSESEFELTELLQEEKMTGVPLLVFANKQDLVGALAADEIASTLDLTSIRDRPWQIQACSAKQGTGLKEGMEWMMKQVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 13B
publication title A G-protein activation cascade from Arl13B to Arl3 and implications for ciliary targeting of lipidated proteins.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 48
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5di3A00
4TMKA 1FFHA 4F4JA 3HU2A 4M1MA 1CJUC 3AGQA 3QG1A 1FL9A 3TSZA 4JLBA 3OFNA 1A1VA 2G88A 5G53C 3F3YA 2UVQA 4G1UC 2NZ8A 1Z3IX 3VU9B 4I1OA 2ZROA 3WYAA 1SXJB 4DC9A 3RWOA 2XB2A 1G4UR 2R9VA 1F48A 1GFIA 5G3YA 3BGWA 2CHGA 1IY2A 2XOKD 4LY6A 5LPNA 1Q0UA 2JIZA 1KZGB 3PUXA 3TE6A 4AG5A 4EQ6A 1MR3F 1US8A 2ZRDA 4DZZA 5FFMA 4C4PA 1XXHE 1Z0AA 2DCUA 4GPTA 3V00A 2FDCA 3B1WA 4FMBB 4JVMA 2WMOB 1Z0IA 2ZRCA 1GVNB 3LAWA 4HUQB 4BPBA 1KI7A 1OIWA 3TK1A 1S96A 3IGFA 2C04A 1Z5ZA 3W6NA 1UKVY 4EUNA 2WWFA 4TLCA 2BWJA 3U6KA 2RGBA 4UXHA 3TVDA 3C5CA 2O0JA 2A78A 3OE7D 5AJZA 1QHIA 1U98A 1DAMA 1GWNA 1XZPA 4QNMA 1W0KD 2VP6A 1K5DA 3AB3A 2VSFA 4KFRA 2E87A 4RZ2A 2A5GA 4IDOA 2ZJBA 1DARA 5AUQA 4NPHA 4JIMA 2IUUA 4YQFA 1N0UA 1TQ4A 1SVKA 1OFUX 1RYHA 4A1FA 4IDPA 1FTNA 1KI6A 3K09C 3KXLA 1HQYE 5J47A 4WW0A 2PLRA 4HB2A 1YZKA 1G3UA 4NMMA 4TZ0A 1SVWA 1UEIA 1PZNA 2CHQA 2OFOA 1VIYA 3BD9A 4LJ9A 1W48A 3QKSA 3RABA 5CB6A 2P6UA 1ZCBA 1XWIA 2JJ1D 3CWQA 1KI9A 3L8ZA 1P9NA 1R4AA 1AZSC 3I72A 1HV8A 4OI1A 5J4KA 5DE3A 5JJKA 5FOUA 2X1VA 3SQWA 3R9XA 1SKYE 2RHDA 2J5XA 3KTAB 3I1FA 2PJRA 1CBUA 2DFNA 1AQUA 2JLSA 2OCAA 3NH9A 2VHTA 4G0NA 3W3ZB 3WBJA 2B6HA 3PCRB 4MYUA 1NSTA 2NO7A 1SVIA 2O52A 4GMXA 4MRNA 1NVXQ 2IYVA 2UKDA 3A37A 3EA5A 4HAZA 2RH5A 4IDQA 4QJ3A 5J4HA 2ZS7A 2GAOA 3NC1C 3ZS9A 4P3YA 3QEOA 3GLHE 1AS0A 2WWXA 1WQ1R 4C0SA 1P2VA 4P4SB 3KUDA 4QL3A 1NMZA 4B3DA 3C15C 1UKZA 4CEHB 1HA3A 1E2GA 3A1TA 3FHCB 3TSWA 4MYCA 4RCZA 1SHKA 4ASUD 1I4TD 4O2RA 1UDXA 5HE8A 5J4YA 1NI3A 3AKCA 5EUMA 4UQOA 1VYVA 2AK2A 4JBXA 3PV0A 4D82A 4YMSA 1TX4B 3DKPA 4Q9LA 2QL6A 1SVLA 4LC1A 3KUCA 5DH9A 1OH7A 1NBME 2ZREA 1IN8A 3EPHA 3ZVLA 4Q21A 3LXXA 4KAXA 5FTMA 1OHHD 4U7DA 1R7RA 2NIPA 4LJ8A 4Y0AA 4DB2A 1TU3A 3EIHA 4TL8A 1N6KA 1IQPA 5FOVA 4O25A 3RSOA 4LPSA 3A8TA 4BFZA 3ADDA 1T3HA 1LS1A 2NPFA 3P27A 1Z47A 2IXEA 1FQJA 1RFLA 3UG7A 2QAJA 1E79D 1YRAA 1TF2A 5E7IA 1E32A 4TWZA 1HY3A 4XVQA 2JEOA 3GJXC 3T1TA 5DLQC 3U60B 2ZITA 3FMOB 4E03A 2W00A 2ZUDA 1R0YA 5B57C 3RYTC 5LD2C 4AKEA 3LLUA 4DLTA 4URZR 1FNMA 1P61B 4HZUB 3T61A 4NYIR 1G7SA 2QSZA 3C4JA 1ESNA 2OG2A 4QGAA 5DGXA 2O5VA 1E9DA 3HPRA 4HAVA 2VH5R 4EQ6B 3ETLA 4US0R 1US8B 2IYYA 2QRZA 2WV9A 4XOIA 2GWHA 3BFXA 1QHNA 1NIPA 3O8RA 2QRNA 4CRWB 1KAOA 2KSQA 4Q5IA 1ZD8A 1BS1A 2DY1A 2GVDC 3NH6A 3CR8A 4Q00A 3OIYA 2D2EA 2ZETA 2R62A 1UM8A 3QENA 1EESA 2ERYA 1QHHA 2P3SA 4G5SA 4ACBA 4YMWA 2DWOA 1WBBA 3TNFA 4OYHA 2DWPA 4JLVA 1QHXA 2PEZA 4D0LB 1WRBA 2W2XA 4F93B 2PLFA 1ZCAA 4BLPA 1M74A 4A0HA 2RHMA 5HKKD 1ZJ6A 2KBFA 3UATA 4D2IA 3K0CC 1ZM2A 2XX3A 2YJTD 5JHHB 5K8LA 2OZEA 2WAYA 2R65A 4OQMA 4B48A 2ZI4A 2GJ9A 1T5LA 4LJ4A 2Z0MA 2JGNA 2Y8EA 4LWZA 4MGYR 1W0JD 3HR8A 1OXSC 1W4BA 1YZUA 2B7CA 1SGWA 2EFEB 3PFIA 4HATA 3EWSA 4LYFA 3X1DA 2ZRAA 2FJUA 4MRVA 2P5SA 4PSVA 4PHGA 4FCTA 2GZHA 1OH8A 3Q5DA 2IA5A 2YKGA 1RW4A 2CCJA 2WJJA 4PQFA 4TL9A 5TV2A 2CE7A 1D9XA 2O8CA 3IHLA 3DDCA 4IDNA 1G5TA 2FSGA 4LC0A 4W7SA 4BECA 4IDHA 1NKSA 2BKUA 2VQSA 2CVHA 4B3CA 1CJKC 1HURA 2XSZD 2Z6VA 1E0JA 3FMFA 1KDTA 3GJ4A 3UPUA 1JR3A 3U7GA 3FOZA 4BFWA 5KNDA 4JLOA 1ZM4A 3P4XA 3X1ZA 3T5GA 2DYKA 4M9XA 2OAQ1 2ATXA 3C14C 2QMEA 5JECA 1VIAA 4DCNA 2YOGA 2QBYA 1ANKA 3U61B 1N6HA 4QHYA 4DLWA 4UNQA 1X8JA 1NBMD 4RD0A 2V6IA 3SR0A 3CH5A 1F5NA 3QF7A 3T34A 4R2IA 4JMPA 3CPEA 2WTUA 4CDGA 1U9IA 5HTKA 1G9XA 1KDOA 4C30A 721PA 4ESHA 5IT5A 4PO9A 3RS0A 4BFYA 2FSHA 4A4DA 2CLDX 5J4VA 4DLYA 1D9ZA 4X8LA 1GOTA 4LUCA 3TUJC 4BFUA 4XWOA 2BM0A 4TTPA 4BEJA 1E9BA 1X1SA 1G3QA 2BMFA 3EG5A 1MO3A 4W5HA 4U02A 2BBWA 2R6GA 1G1MA 3WNBA 3R8CA 4HB0A 521PA 3GCGA 1GL7A 3U3OA 3VKGA 4Q1EA 3QPWA 5A0FA 3DPUA 5B64A 3NEYA 2ODWA 1RKBA 2F6RA 3EA0A 1Q3TA 3GMTA 4WBSA 1JPJA 2RAPA 2V4ZA 3AP2A 3QVUA 4CEIB 3BB1A 3IIMA 2ZI7A 1E1QA 2PT5A 2GF9A 4IEIA 4YXWD 4B3FX 1BOFA 4DIDA 2ZRMA 3W90A 3R7WA 4PC3A 1XMIA 3HU1A 2HXYA 4LHVA 4KI0A 1UEJA 2ZJ8A 1VG8A 1ZD1A 2WJVA 1GTVA 1U0LA 2QTVB 3Q7QA 4MKIA 1AQYA 3SFZA 4OI4A 5EXSA 1XD8A 1IN4A 5BWMA 4FINA 3S1AB 3Q5EA 2IF0A 1XPRA 1Q1BA 2X8AA 1TQDA 3I61A 2NTYC 3B9PA 4QHTA 5JJIA 4V0KA 5B2ZA 2WVJA 4TLBA 3KDSE 4TSFD 2BM1A 1WMSA 3QG5A 5C1BA 4Q1DA 1XDBA 1PVOA 2QP3A 2WJIA 2OXRA 1A2KC 2A3RA 2ZRLA 2XJ9A 5J5CA 1XMSA 3VR3A 1QHHB 2IBMA 5GJVC 3A4NA 2WPDA 2ZRHA 5BQ5A 2QA5A 3W5JA 1RRFA 3U4QA 5E4FA 3O8CA 4L8GA 3OZXA 3GLGA 2Q9AA 2IYZA 1N6RA 4UNNA 1CF4A 4LZZA 5TB5A 1R5NA 2VSOA 1NG1A 3F0TA 1JJVA 2HF8A 4OQLA 4P31A 1DO0A 2ZI5A 3RVBA 1RIFA 2BOVA 5JEDA 3IUYA 4GMDA 4Z51A 1NF3A 4QJ5A 3IIJA 3LQQA 1A82A 3AVQA 1KMQA 2XOKA 4DKXA 5JMTA 2HYDA 2DFLA 1GKIA 2IW3A 3VR4A 2QEQA 4A0RA 1E3MA 1HUQA 4LI0A 3K0AA 1FQKA 5JS8A 3U44A 4B3BA 3ECCA 1II9A 1KJYA 2IUSA 4U00A 3PEWA 2KB0A 2D4HA 3VKHA 1OFTA 3FVQA 3BIFA 1QBKC 2ANCA 5AUNB 1NRJB 3MJRA 2QMHA 4BFXA 1IXZA 4XD7D 2C9OA 2SHKA 4RD2A 3TR5A 4HYYA 3UXMA 4GFDA 2O8CB 1VCIA 5EE5B 3V4RA 1JQLB 4QGGA 4A6XA 4QBGB 1Q22A 4CT4B 1NVUQ 3OE7A 2OM2A 1E2DA 3A1UA 2VP5A 1XPUA 4Q66C 3LY5A 1QHGA 3AVXA 1W0KA 3Q72A 1ZIOA 2C98A 4DHEA 3CH4B 1CR4A 4OHVA 1GNRA 2OBMA 3CF2A 4V0LA 4B71A 4PSKA 5JI2E 3T12A 4LPKA 5JBQA 3MRSA 1O87A 2QBYB 2ZU0C 2QROA 1TQ2A 1E2KA 1OT3A 2X19A 4P4TA 1NLFA 1XD2A 3UKDA 5JFGA 1MO4A 4D81A 1CEEA 2OBNA 4URWR 3THWA 3CRVA 2IEZA 4NL4H 3BB4A 1KSFX 4ARZA 5EE9A 1UJ2A 5CJPA 1MRNA 2WKPA 1FX0B 3FWYA 4C3ZA 1V5WA 4NYJQ 3LBHA 5E7JA 2CCKA 1Q44A 3D31A 3M4YA 1NVWQ 4J0QA 4EPRA 2EWWA 5BW8A 1EK0A 1W4AA 2JJ1A 4RD3A 3EIEA 4CW7A 4GL2A 3U6BA 3B1XA 2ODEA 1W5SA 1NKTA 3JVUA 1IJEA 1AA9A 2C78A 1G41A 1J70A 2G1JA 1COWA 2ZQ5A 3I32A 2VPPA 1DAFA 3OIWA 1AKEA 1FOEB 3U3KA 1EFTA 3FFBA 2EWVA 4LK2A 2HF9A 2JJ2D 3LO5A 3FGNA 4TZ6A 1FNNA 2XNDD 4ERNA 1XMVA 2GKSA 2OILA 4PPNA 1C4OA 2WSMA 4JVSB 4X8HA 4M1TA 2WJHA 2CK3D 2J1LA 2C96A 3R7WB 1KI8A 2BKEA 3VFDA 5CLLA 4Q9JA 4G5QA 1GSIA 1UF9A 3AGPA 3LBIA 5FL3A 4UNRA 3R9WA 4A2QA 5H8WA 1XBTA 2A30A 4JL6A 2V6JA 3GP8A 1SHZA 2YC4C 1QG2A 4ZDIA 2FFAA 2GCOA 3VX3A 5CDFA 1CXZA 3GD7A 5BN5A 3ICQB 2OFWA 2V7QA 821PA 5SZIA 4ZI3A 3B78A 2G83A 1K8RA 1VECA 2V9PA 2BVNA 3CUEF 2WAXA 3SYLA 4DSTA 5EJEA 1GM5A 3WBKA 1GIAA 2D74A 4C0AC 1OB2A 3K9LA 1HEIA 1ZM3A 1OHHA 1RRGA 2XTNA 1ZU5A 2BJWA 2XAUA 3PVSA 4LJ6A 2GXAA 4NCNA 4CVNA 5D3QA 1NL3A 1DAEA 5LBIA 3I92A 5EXPA 3CNNA 3CKLA 4YDHB 1Q3HA 3D3QA 1DAGA 1DOAA 1FMLA 2VYFA 4GRAA 4YC7A 3U4QB 3GJ5A 4M22A 5EP2A 1E79A 4DLRA 1N6LA 4B47A 2GEDA 5KSPA 3B1VA 3GLGB 3IPXA 2ASEA 2ZU6A 5L3QA 2P65A 2FFHA 4M2LA 3QSYA 3FE2A 3NWJA 4QBIA 2QPAA 4FIDA 5HCIA 5C4GB 3WNDA 4YMVA 1XXHA 4Z1MD 4NCHA 4UXJA 3QF4A 1Q1EA 1G64A 4PHHA 3MAAC 2ZJAA 3IO5A 5CITA 8OHMA 1EFHA 3TUZC 3QXXA 1PLKA 3RRZA 1OF1A 1NY5A 4TMTA 3IO3A 4URXR 2F7SA 1Z0FA 5AR1A 1M34E 3B82A 3I73A 4AURA 2PZGA 5FBWB 2REXB 3ZD6A 4IXMA 2FPLA 5GVSA 2OV2A 2IWHA 3OEED 3SU8A 4LDJA 2ANBA 4JZKA 1U0JA 2XTMA 3K0AB 5KDLA 4XVUA 1KK0A 1IM2A 4JVLA 4M9ZA 4V02A 1IY0A 3R20A 5KYKA 3HR7A 4TL7A 2IS4A 4PC7A 5CIWA 3RAPR 2C9YA 1KYIA 2C8VA 1CULC 2DWQA 2A2ZA 2VF8A 3B6EA 4L5BA 1NVVQ 2H17A 3GPLA 4HEJA 2FPMA 1ZM7A 3EZFA 2DR3A 2WOOA 1E0AA 2ZPTX 3OAAD 4Q7LA 5K8UA 4ZV4A 3BFVA 3RSLA 3N70A 2WKQA 4OHXA 4CEJA 2GDJA 4ACAA 5P21A 2IYUA 4MUAA 3BXZA 2FFBA 2WSSD 3NBYC 4PR0A 4HAYA 4Q7JB 2HV8A 3ND9A 4JLPA 4BQSA 3OIVA 1A4RA 4A82A 3K0EA 1QG4A 1ZINA 4RZXA 4M8NE 1N0WA 1F2UA 4JYBA 2F43B 4N0DA 5FPHA 1SVOA 3QJYA 1XD2B 2PMKA 3B7GA 1KHTA 1T9HA 2W2VA 1X8LA 1E94E 1U94A 5K8IA 2IYRA 3THWB 2L0XA 1W46A 4C9BA 1LF0A 4EJSC 4ARZB 5FR1A 1AKYA 1P9WA 1T8TA 2NO6A 4LJAA 1S2MA 3EXAA 3QKRB 4Q9IA 4GBMA 4MITA 4TMVA 4BWYA 1OXVA 3QE0A 1E9SA 3KJEA 2DFKB 4RZUA 4EPWA 1WF3A 1YZLA 3GLHA 3C8UA 2OLJA 4FCVA 5DHAA 2YWEA 2PMDA 3GLIB 2EYUA 3ADKA 5GVRA 2RB4A 2RGXA 1M8PA 2XSZA 4DDTA 1UBEA 4PPQA 2Q6TA 4B35A 2NG1A 1YRBA 4LRWA 1BMFA 1QHSA 4XVRA 1JNYA 1KO7A 2EFGA 1IONA 4MUBA 3GLFE 2YINC 5AUPB 3REGA 2ZRKA 1M7HA 4HB3A 2AXNA 4V0ME 3O47A 3BJIC 1KKMA 1NBMA 1IN7A 2OUKA 4IJMA 4DCUA 2LWIA 2B92A 1T91A 2RCNA 2ZSDA 2JA1A 4HAWA 3THYA 5LDDC 2VA8A 1FUUA 4JLDA 1NN1A 3B1ZA 2GCOB 2GJ8A 3AP1A 4HLQB 2OCPA 4WXRA 2AKYA 4KVAA 2KI5A 3VHLB 4JJKA 1G18A 3BS4A 5D3MA 1DAKA 1GL6A 1CIPA 2YHSA 3TMKA 3KQKA 4BGDA 3KQLA 2O0HA 2OLKA 4DDUA 3EZ2A 4EFLA 1NY6A 2ZJ5A 2YWHA 2AFHE 3EX7C 3DO6A 2W6JD 3DHWC 3KKOA 4BZQA 4IKEA 2VEDA 2CBZA 4BRWA 5L3QB 1NG9A 1R8QA 1DE0A 1T0HB 4A0GA 4JJZA 4A0FA 4YXWA 3PEVA 1XB2A 5KPDA 1KY3A 2QM7A 1XXHB 2BCGY 4D4JA 1W5TA 2VTKA 2W0MA 4KFUA 3VKWA 3V9PA 3FKQA 5G3ZA 1L2TA 3X2SA 5HPYB 3GJ6A 2QAGC 3IEVA 3HDTA 3BE4A 2PZFA 1Z2CA 2AKAB 4Q4HA 4YLGA 1JR6A 2D62A 2GVZC 2P0EA 1ELOA 1CP2A 4EIWA 2GRJA 3VAAA 1W2HA 1Y63A 2GBLC 4DCSA 3KB2A 1SKQA 2QQ0A 2ONKA 2BHRA 3LVRE 4Z8YA 4D4MA 3PUZA 3AKDA 5DI9A 3ZH9B 1TL7C 1CU1A 4HAUA 3EASA 4TSFA 1MO5A 3RANA 4A8JB 3CONA 2JLXA 3N2EA 4A2WA 4LBZA 4TTQA 1H8HD 2OAP1 3SNHA 1DS6A 2IT1A 2XEXA 4Q02A 3AVVA 4TN1A 3EZ7A 4CEJB 1AIPA 1RZ3A 2WICA 3SJBA 1E98A 2OSBA 5BXQC 1LF5A 1OJLA 1G3IA 4A36A 2VSXA 2G9NA 2J7PD 3W8NA 2I4IA 2R6AA 4KBFA 3WNCA 4G01B 3B85A 1JALA 1NJFA 2YZ2A 1IXRC 2ZIAA 3ADBA 4LCBA 1KNXA 3NVAA 1W36B 2VLIA 5DI3A 2GJSA 5BN3A 2P2LA 3KKQA 1KK3A 4FMCF 1G8PA 1F2UB 5CJ2A 5CK5A 3M1IA 2B8WA 2ONJA 2G3YA 4EDHA 5C2JB 3IKJA 4HDQB 2Z43A 3MJHA 2WIAA 2VHQA 2F9LA 4BLRA 5TY0A 5JEEA 3K53A 2O8FA 3AVPA 1IN6A 4M9SA 5AJWA 1SKYB 4EFMA 1N5IA 5IF9A 1KI4A 3T1VA 2ZR7A 4U5XA 3W8RA 4PTLA 4OJKA 1P2SA 3A1SA 2CEAA 2YYZA 3CIOA 3U2QA 5JRZA 4X8MA 5FBVB 2VHCA 3BH7A 4S2EA 4XD7A 1J90A 2D7DA 1KJZA 2IS6A 4W5WA 3GLHB 2J0VA 3BC1A 4PZYA 1Z6GA 4KXFB 3WHLA 3BWDD 3P26A 4JLKA 2FSIA 2J7KA 3L8YA 4EPYA 3SBDA 3BERA 3VR1A 1OYYA 5J4LA 2PH1A 2QENA 5KUTA 2IEYA 5TVKA 1XFAA 1CR2A 4OHZA 1XD9A 1MV5A 1OFHA 1E2HA 4PQYA 4Q1AA 4EKDA 1GITA 3HP1A 4RFSA 5JZVA 4MA4A 3PUWA 3M0EA 5C18A 3AF2A 3NDPA 1EWQA 3DM5A 2KE5A 2XITA 3E2IA 2WWGA 4IVPA 3FPAA 1C9KA 3NHBA 3THYB 1YU9A 1Q20A 3THOA 4AY2A 2GJKA 2V54A 1CS4C 4PFSA 2FV8A 4RD1A 4FD2A 1G8FA 3H84A 3GFPA 1O3YA 2XZPA 4DCTA 3A58B 2FOLA 2REBA 1YR8A 1XP8A 4DT1A 2ZR9A 4L16A 2UZIR 4ZIRA 1N5LA 2IF2A 1S1MA 4B75A 5D3MB 1KI3A 2ODNA 2BIFA 4JBYA 3EC1A 3KJIA 1KK2A 3SN6A 4LBVA 1X8KA 1TU4A 4HDOB 5JCZA 1G5PA 2EW1A 3U7EB 3Q3JB 4Q1CA 2OCBA 4RJLA 4LX0A 3ZVRA 4I81A 2I1QA 1G4AE 2JJ2A 4NH0A 4A92A 3A36A 4C2UA 1N0VC 1G17A 2I3BA 1E4YA 1A7JA 1XZQA 2XNDA 3LW7A 3CX6A 1G8YA 1C1YA 3ZVNA 3RS2A 4QKQA 1I2DA 4L9SA 5FBLB 4V0NA 3WHKA 4KVGA 2CL6X 4BLOA 2REOA 2ZI9A 3U5ZB 1BYIA 2J0SA 4AI6A 2CK3A 4XIGS 4ZPXA 5LB2A 1Z6YA 4KFSA 1KI6B 1R5BA 2RGNC 1W1WA 2QTFA 4MRPA 2IHYA 1E69A 3LVQE 1E9AA 3K09A 4KFTA 5FOXA 2GXSA 1E2LA 1RE0A 5HE9A 4Q4HB 4EPXA 2Q3FA 4OHYA 4ZCMA 1OYWA 4IXNA 3QKSB 1P2TA 1RRPA 2ECKA 3CX7A 3PENA 2GA8A 4HZIA 4TLDA 1HE8B 1KO1A 4UXIA 1S3GA 1ESMA 3TKLA 5DYIA 3TQCA 3K70B 2EQBA 2ZRFA 2ZAMA 4OQNA 5CM8B 5JI3E 4EPTA 3ZD7A 1TEXA 3QI2A 2H18A 2GBLA 2A5YB 3AP3A 3AKYA 3TIFA 5JS7A 2IXFA 5KDDA 1FW6A 1N2CE 1MO6A 4D26A 1T3SA 2YWGA 1II0A 1KI1A 2WBLC 4TL6A 4QNRA 3DOEA 3SJCA 4LJ5A 2VP4A 1LV7A 4IOMA 3U44B 4L4UA 4PPGA 4BZXA 1YZGA 1J8YF 2FZLA 1H65A 4GZLA 4OK5A 3LDAA 3CRMA 1L8QA 2FX3A 4PAQA 1AS2A 4FI3C 3W6PA 4DXAA 1N3BA 4PO8A 1M2OB 4YMUA 1NLZA 2BMEA 3UMFA 4QM6A 4URYR 1ZVQA 5L3RA 1NN3A 1JXMA 4NCKA 4Z1MA 4BFTA 1QVRA 3P20A 3CWZA 2WIBA 1EWRA 2QGNA 1DVRA 4FN5A 1P72A 5DI3B 2HXSA 2IX3A 1DAIA 1XTJA 5BYJA 3RS7A 2JATA 4DRZA 4F92B 5KDOA 3R8FA 2LKCA 1U8ZA 2FGJA 3OEEA 1OW3B 3ZZTA 4HSEA 2O8FB 4OI2A 1LB1B 2FFQA 2GTPA 4D25A 2QN6A 4Q9HA 1XEWY 3EC2A 4X8OA 1TUIA 1II8A 3ZYCA 4AIIA 1VCNA 1E2QA 3CZQA 4G5RA 3ADCA 1P7CA 5CB8A 5DO9A 2XXAA 1S1CA 4NU0A 4KLZA 4B2PA 1JECA 1SZPA 1E2EA 4XTRA 1QDEA 4QOSA 4A6PA 2EFDB 2VF7A 3OAAA 1JEEA 2ZXUA 3EZ6A 4UNSA 2AD1A 3QVVA 5JWOA 1RPZA 2ZSFA 3B2EA 2F1JA 4OJQA 2QMUA 3A4MA 3IQXA 4RD4A 3GFTA 1E0KA 1R0ZA 3VR6A 3NXSA 2HLDD 1P62B 3UWKA 2FGKA 1WBDA 1SXJC 3QBTA 1ZD9A 4PC1A 4MKFA 5JLJA 5L8VA 4B33A 4F4IA 1TPZA 4RFSB 1DADA 1K6MA 4NCIA 4TQAA 4XWKA 5IRCD 3B13B 1HTWA 4PAOA 4BE7B 1YKSA 3WYFA 2JLZA 2QP9X 3DZDA 3O8DA 2IC5A 4NBSA 1T3LA 1X6VA 2F3TA 4LOAA 1TF5A 2OXCA 4DDWA 3DZ8A 4BRUA 3T06B 5C4MA 1GRRA 1XTSA 2P67A 1G5RA 4E22A 3EPLA 2ZRJA 1YQTA 1RYFA 2ZS8A 1R6BX 1WCV1 4RVCA 2O8DA 1U2RA 4JL8A 4B76A 4DT1B 4ZIRB 1VPLA 4DIEA 3RLFA 5HCNA 1Z0KA 3WMGA 1MT0A 4BFSA 2NO1A 1UKYA 1AJEA 1GRNA 2R6FA 2ZI6A 4WOPA 4M1WA 1E96A 4M1KA 3KKMA 1FP6A 4FMCB 3T5DA 2XZLA 4P4UA 1P2UA 3KKPA 2JASA 4ZDWA 2ZUCA 3U7HB 2MSCB 3KB1A 4QM7A 1VG0B 2AHOA 4G3XA 4MGZR 4E07A 3K0CA 1VDZA 2DB3A 1G21E 2VP2A 2ZYUX 4C0JA 2ZYTX 1IJFA 4TMXA 4B34A 3SJZA 4HLUC 4B3XA 3SFVA 4AKGA 2IHBA 2WHXA 4Q01A 2FNAA 2ATVA 1R5OA 4IHQA 2J87A 1OPXA 2C03A 3E5HA 4C0BA 2H7VA 1ZU4A 2VBCA 2GESA 1WE2A 4JS0A 2H1LA 5FTKA 3ZVMA 4KV9A 4TMZA 3ICEA 1D2EA 2OHFA 4MGIR 2HYIC 3ZZ0A 2VHUA 4PXAA 4N0EA 5EZ6B 1GL9B 2WWIA 5FL7D 4Q47A 3SEAA 4LV5B 3SQXA 1VCOA 4Q7MB 2OESA 1GNQA 3GJ8A 4FXPA 1F6BA 3AQ4A 5GJCA 4EAQA 2QMOA 2QSYA 4UJ3A 2OO7A 2ZE8A 3I8SA 2W6JA 5TMPA 1A5TA 1BH2A 5FUYA 1JXOA 2ZS9A 4TYYA 2B21A 1R2QA 3Q8XB 3U3RA 2OE2A 2Q21A 1ZC3A 5GJWC 3CNOA 4NHOA 4P32A 3BORA 3LWNA 4BASA 1OH6A 2BBOA 4JLNA 3UIEA 3X1WA 2WOJA 3QOFA 2IS2A 3A1VA 4IOKA 3M6AA 3PJRA 1OE0A 1X3SA 3NBZC 1JAIA 5GADl 1SVSA 4NYJR 4A9AA 5IK2D 3W5IA 3LBNA 1KMHA 3B5JA 3GJ7A 4GI7A 3T1OA 3L0SA 1NMXA 1Z63A 1I4DD 1T0JB 1U90A 4KODA 1VG1A 3WYGA 2W6ID 1II8B 2BCJQ 3RC3A 2ZE5A 1ZMXA 3CW2A 1T4GA 2XXAB 3RRNA 3G5UA 2BMDA 1Z6XA 2FF7A 4QHSA 5SZKB 1XCMA 5G41A 1H8HA 2FEOA 2FH5B 3X1XA 2FZ4A 3UANA 1OIXA 3LFUA 5CM9C 4K8OA 2IYQA 1CJTC 2YNMA 2QP4A 2EVWX 3AUXA 3FTQA 2CNWD 3GJ3A 4Q4AA 4MGKR 5L3VA 4OHWA 2C99A 4HI0E 2EFCB 4XTCS 2FA9A 3QPVA 4RKEA 3VX4A 3ZDQA 2G0TA 1G3MA 1OXTA 1N25A 4WVFA 3K0SA 3EZ9A 4CF7A 3K9HA 3W34A 2MSEB 1HQCA 4ASUA 5LD2B 2J59A 1LW7A 5B58C 2PJZA 3DMDA 3QPUA 3GEEA 3VNVA 2QE7D 3LRPA 4IFBA 3SC3A 4XWAA 2ZYWX 4B44A 4WAUA 3AF4A 4ZCLA 1TF7A 1IHUA 1VYUA 5EE1A 1L4YA 2J9RA 3MSXA 3P4YA 2J41A 3PR1A 2IXGA 2YOHA 4UNPA 2BDTA 1SQ5A 1U0HC 2H57A 3ZGXA 1E9CA 5JCPA 3CNLA 3QXCA 1FMJA 2W83A 2PCJA 4QRHA 4WXPA 3TLXA 5KNCA 2PX0A 3NDBB 5JSZA 1VHLA 5UKDA 4GP7A 2P5TB 1W4RA 2R6DA 4JLMA 3Q9LA 2O8DB 4O0MA 1MH1A 4FWIB 4HUQA 4AD8A 5KU1A 2Q3HA 3H2YA 1M1YE 3L0IB 3KXKA 4PO1A 5CIQA 3GLFA 1PLJA 4DLVA 3CLVA 5FBRB 4F38A 2LCFA 4V0MA 1LY1A 4NYMQ 4PAMA 4FMDF 4DSUA 2I1VB 4NYMR 3TGPA 4O2LA 1SULA 3TW4A 3AEZA 1E6CA 1ZUHA 1PLLA 1YZQA 5AJXA 1UFQA 3I3SR 4O3MA 4HB4A 4AYXA 4AG6A 2ODBA 1LFDB 3HWSA 2RKOA 3WRYC 3X1YA 5A4JA 4YDSA 3VTKA 4N1AA 3NHAA 1H8ED 1YVDA 3E70C 1K5GA 2WJGA 5E95A 1N5JA 1XJCA 2IYSA 1FP7A 3T35A 1Z08A 1E2JA 2HCJB 3W3AA 4BUJA 2GHIA 2KBEA 4RCYA 1NVVR 1S8FA 2HEIA 2Q9CA 2FG5A 4KITB 2GZDA 4OL0A 421PA 2DFTA 3U3JA 2D3WA 3JZMA 5FOSA 3TVTA 3NG1A 3KQUA 2G77B 2IYWA 4Z8XA 3UG6A 5HKKA 4JSTA 4QFMA 5FTJA 4I1UA 1GP2A 1PUIA 1UBCA 2RGAA 3JVVA 2DPXA 2JAQA 4B43A 2PCLA 4L9WA 2FPKA 3NC0C 1E9RA 3OF5A 1R0XA 1CJMA 1EFRD 1ZC4A 2QZ4A 1ONBA 4JYCA 1OXXK 1W0JA 2FWRA 3CPHA 5IDVA 5H70A 4QBFA 1OKKD 1Z0DA 2QUZA 2VO1A 4GOXA 2J3EA 4CZ2A 5FPKA 3NBFA 4XJXA 4MRSA 4ZO4A 3SYKA 5EP3A 5E3HA 3TQFA 4E5UA 2BEKA 2XZOA 3EAQA 1SXJE 2B8TA 2FEMA 1FTSA 4TYPA 2ZI3A 1ZUIA 4AKIA 1XPOA 1B23P 5FUXA 3ZQJA 2ZSAA 4DUGD 1KO5A 4DLUA 2RGGA 1D8TA 2QI9C 1GAJA 4ON9A 221PA 1JB1A 4C0LA 4MQBA 5KOYA 2GETA 2WKRA 5SZHB 2FSFA 3Q85A 2QPTA 2VIIA 3G82C 3QIAA 5DNYB 4US2R 3THXA 3CBQA 4W9MC 2QQEA 1LNZA 3B1YA 1Z28A 3RRYA 2E1RA 4TYQA 4D4LA 3BH6A 4Q4AB 3KXIA 3BB3A 5SZJA 2W2TA 2ORIA 4F4CA 1OH5A 3TAUA 2A5DA 3MWYW 3QEJA 2GZAA 1RC8A 2NO0A 1EFCA 2EU8A 1YHNA 3C16C 2ZVPX 4KHZA 3C5HA 1D6JA 1KSHA 4JSYA 4TLEA 4CIDA 4B74A 4HZUA 5F3WB 4WZBE 1LS6A 5CLQA 5FPYA 2GEVA 3CRRA 1E2FA 2H92A 1F2TA 5J40A 4ABYA 4OQXA 3VR2A 2P6RA 3MLEA 2CVFA 3FDIA 4Q1BA 1D5CA 2QT1A 5EP1A 2GAAA 4ZDKA 1Q1QA 4ILEA 4M53A 4AC9A 2GK7A 1EX6A 5CK4A 5JSZB 4DJTA 3AKEA 1YZNA 4YONB 4AYTA 4ESVA 3VR5A 4DSOA 1QRAA 5HZKA 3W9YA 1HT1E 1KY2A 2RGEA 3GLFB 1IAQA 6Q21A 2PZEA 4A15A 3RNLA 4Q1FA 3QBVA 1N6IA 1W47A 4MYTA 3Q7PA 4GT1A 3U7FB 5TARA 1G7TA 4K81B 3K8YA 2G6BA 2ZVQX 3QF4B 4LHYA 2OT3B 3LD9A 2HLDA 4MDFA 4GSYA 2CLSA 2VL7A 3RRMA 2YV5A 3SBEA 2R8RA 1ETUA 1RVDA 3FHTA 2YC2C 3MWJA 4C0KA 5CYPA 2ZR0A 2XTZA 4B2IA 1Z83A 4G5OA 2R6CA 5FI0B 3D7MA 3WP0A 2F3RA 1GKYA 4BLQA 5EE3A 5HZHA 1W49A 1M7GA 2GXUA 2D2FA 2C2HA 3QXSA 1P73A 1G16A 2QT0A 4LHXA 1FPMA 1XEXA 1XNJA 3PXGA 3L82B 5CYOA 2ZM5A 2G1KA 5E7MA 2C9CA 3I5XA 3SJAA 1S9HA 2LKDA 3NTUA 2PBRA 4LSGA 4WZ6A 3RHFA 3WMEA 2JLYA 4LBWA 4XSGA 2V3CC 2ZJ2A 4R7ZA 1NSFA 4TYNA 1W2GA 4FCWA 1AS3A 5AJVB 1E2PA 1T6NA 4HLDA 4I4LA 4CGZA 2JDID 1FUKA 4IVRA 3LV8A 3REFA 5AK0A 1G7RA 3WY9A 2GJAA 5L3SA 2Z83A 3F8TA 4ZKEA 1G8GA 3D6TB 2HJVA 3TAHA 2GNOA 1P6XA 4TT3D 1COWD 1E0SA 3N5CA 3CF0A 5H1YA 2H8KA 3DM9B 4BFVA 4BEBA 4C2TA 5M04A 1GZSA 3CPJB 1QZXA 2XJ4A 3T1QA 4D4KA 1SXJD 4Q03A 3I62A 3F5FA 3CX8A 2CE2X 3P1JA 3GEIA 5DN6D 2QORA 3H86A 2BC9A 3MG9A 4LJYA 3K0FA 4IOLA 1GDDA 4AWXA 1HYQA 1QVAA 2O0KA 3H0KA 3SI7A 4EFNA 1J7KA 3MCAA 2GF0A 1UAAA 4JKYA 3IDQA 3IHWA 1U9IC 1ZYUA 1J8MF 2NO9A 3QUSA 5FTNA 1G19A 5ELXA 4JL5A 4DLZA 2Z5FA 3K9NA 2RGDA 4DLXA 1J99A 2F1IA 4EJSA 1ZW6A 3C7KA 1PV4A 3BOSA 3IPYA 1KTVA 4PANA 4NKRA 3ZQ6A 5TXGA 3ZIAD 4FW9A 1YR6A 3P32A 1ZNZA 4M0LA 2WM9B 5FTLA 1UPTA 2V7QD 2E9SA 5FOTA 2WJYA 3H4MA 1G7CA 4FMDB 5GJBA 2HT1A 5H68A 4JT2A 5FL7A 4H1VA 2GXQA 3BAFA 4II7A 2VP9A 3ZLJA 1T8UA 3CM0A 2BBTA 3QXHA 4AKHA 2IK8A 1RJ9A 4TLAA 1NNEA 1XJ0A 5EXTA 3THXB 3G0HA 4XSHA 3MFYA 3SHFA 1E9FA 4L15A 4MRRA 4KLNA 2JCSA 3EIQA 5DISB 1S9DA 4NCJA 3FMIA 2CHVA 4Q4JA 3QKTA 4NONA 1XU4A 5EQTA 4P0TA 1W7AA 3AVWA 1L4UA 3LX8A 3DVLA 1QF9A 2FN4A 4CEIA 1CR0A 2EYQA 3TRFA 1VG9B 1MABA 4S35A 3B8HA 3TSOA 2ZE7A 5A5GA 5FUVA 3KX2A 1Z8FA 2O8BA 2NPIA 2R44A 3I8XA 1NP6A 3FKSD 5BYKA 4NYIQ 4ZDJA 2CJWA 3AVYA 3L43A 2ZRBA 1F60A 1I2MA 1DEKA 3PIRA 4HLCA 4KYUA 4BLSA 4Q48A 4OI0A 1F2TB 1ZP6A 2CL7X 2MMGA 4QG7A 5IK2A 1CLUA 4C7OA 3S1AA 2GCPA 3NIBA 2KWIA 2VP0A 1DG3A 1NN0A 1S4QA 3AVUA 1MOZA 3LA6A 4Q4LA 3L2OB 4PSAA 1Z2AA 1R10A 2W6IA 4DEXA 5FI1B 2XB4A 1KAGA 2QY9A 3N2IA 4DB4A 3HYRA 3B60A 1NJGA 3NBXX 3OESA 5EZ5A 2CNWA 4RKFA 3A1WA 1B0UA 1XRJA 2IUTA 4FWTA 4YMTA 3WMFA 1JPNA 2ZJYA 4PPFA 1JEDA 2ORVA 5FOWA 3AH8A 4DSNA 4Z54A 1UBFA 5KPJA 2AWNA 4DBLC 3MWLA 3OEHD 4OBEA 2D7CA 2ZAOA 2ZE6A 1A2BA 1EXMA 4PX9A 2QE7A 3MD0A 2N42A 2BMJA 4K46A 5JJLA 4IW3B 2Z4SA 3AF3A 2QAGA 1CTQA 3KJGA 1W36D 1F3OA 5DSZA 3LXRA 1UDWA 2J0UA 3BFKA 4D0GA 2WWHA 3EPJA 2NMVA 4B3GA 2P6NA 1IBRA 2WZQA 1KDRA 3LNCA 3NKVA 4PHTA 1XEXB 3A4LA 3KJHA 3GFOA 3IILA 4KO8A 4PC2A 2JLRA 4R71A 3CO5A 3ZJYA 1E2NA 2UZ3A 4JLJA 2C77A 2GCNA 2YWFA 3WXMA 1YR9A 2WWYA 1KZ7B 4LJ7A 2IYTA 2NGRA 2V55B 3QQ5A 1D2MA 2C5LA 4LBYA 1G6OA 2VRWA 1U81A 3L0PA 5DYGA 5FH9A 4GOKA 1AK2A 1E1RD 3B9QA 4LYHA 4R2HA 2PT7A 3SHWA 4OKSA 3CZPA 1N6NA 1GG2A 1XF9A 5ANRB 5L3SB 2AFIE 3IBYA 3TH5A 3HYTA 3MUFA 4QGHA 1GILA 4DDVA 5K8TA 1W4CA 4Q19A 4QC2A 3E1SA 4ITRC 1R8SA 3OFND 4AYWA 5BN4A 3DEFA 3UMRA 4RY2A 3PITA 1WXQA 4NTZA 1BMFD 3AM1A 3SZRA 1S3SA 4DEYA 5JHGB 3K0FB 4B73A 5F9FA 2JIZD 1BYUA 1EFUA 1R0WA 1VTKA 2J46A 3KKNA 4RZ3A 3ONWA 121PA 4MH0R 3ASYA 1H8EA 1TADA 3UWOA 1TTTA 2QG6A 4EJSB 4ZCIA 4Q7KA 4I1SA 2J0QA 1CRQA 2WWWA 1VCMA 2ZYVX 2Z4RA 1BIFA 1Z06A 2OBLA 1FX0A 2ZJOA 3BH0A 2N1BA 1JQJC 3I4LA 2J45A 2CDNA 1PUJA 2C95A 2W58A 3LQRA 1WP9A 2X2FA 1NMYA 1OFIA 1OIVA 1IXSB 2WSSA 4KSBA 1XMJA 4KYIB 1RJ9B 4M4SA 3VNUA 3BRWD 5DHFA 2BJVA 3I5YA 4WA7A 3AF0A 2HCBA 4HUTA 2CCGA 5AUOB 4DVGA 2MSDB 3IIKA 3PG5A 1HE1C 4HAXA 1TUEA 4P33A 4Q4JB 4I99A 3PUVA 3LW8A 4JKIA 3UK6A 3SE0A 3TJZA 4LYJA 1EFRA 4W5JA 1S0UA 1MABB 1YJ5A 1BO6A 3MWKA 1G20E 1W44A 1XTRA 2QPOA 3K1JA 1DELA 4LYAA 1KIMA 5F9HA 4B32A 1WA5A 4QJ4A 3UMSA 2O8BB 1OKKA 4QBHA 3L0OA 4IRUB 2RGCA 4WZAE 2CXXA 3RDPA 5KSZA 1U8AA 1MRSA 1U99A 1YZTA 2O8EA 1V43A 1D2NA 2HJGA 1JAHA 2CJWB 2V8OA 5FPSA 1ZRHA 2F1RA 5B30A 2GILA 4DCVA 1I4LD 1Q21A 2H5EA 2PX3A 2YOFA 2ZUBA 3EPKA 4C7OB 2HUPA 1DAHA 1NN5A 2V1UA 4DUGA 4KSCA 1KSGA 2YVUA 2DHRA 3O8BA 3AUYA 3A6PC 5FBQB 3K70D 1Z29A 3KQHA 5JWRA 4OQFA 2A7QA 2BBSA 4CT5A 3SOPA 1ZNWA 3DOFA 1P4SA 1XCGB 4QXAA 4H9GA 2ZSEA 1YE8A 1AN0A 5LB4A 1J2JA 5HR5A 5TDHA 2AL7A 1EGAA 4R98A 2AXPA 5F98A 2QM8A 1KK1A 1XCPA 1NIJA 4D6PA 3V4FA 2QNRA 4KJZA 1RRCA 1HT2E 5KSYA 3J81k 2JLWA 4MKHA 4F91B 1JR3E 3TR0A 2QGZA 2HDNB 2RGNA 5AWFC 2F1HA 2AD5A 2WMNB 2AX4A 5KTYA 2G0NA 2QAGB 1XEFA 1LVGA 2J0UB 1UKEA 2A5JA 5DIFA 3KFVA 3BBPA 3MGCA 3SS8A 3H1TA 3VQTA 3IBGA 2BV3A 3HPQA 2PEYA 3TBKA 4R9UC 2QU8A 3IQWA 3PEUA 4LV8B 4A8JC 3FHOA 1Q1ZA 2GEUA 3U3MA 1M7BA 3FFAA 2H16A 3PQCA 3TW8B 1U8YA 1Y3AA 2JLUA 2CMKA 1P3JA 4A2PA 1TMKA 1XJQA 2A9KA 1CKEA 4H1UA 4RD6A 1AM4D 2ZEJA 4TMWA 5G40A 3AVTA 4DLSA 2N46A 2FE4A 3DL0A 2JJ8A 4GZMA 4C0HA 5KNBA 3C41J 3FB4A 4BZPA 621PA 5JRJA 1W36C 1PJRA 1ZNYA 4F7WA 1QHYA 4KCGA 1EG7A 2TMKA 3W6OA 1EX7A 1JI0A 1OB5A 4KU4A 4CYMA 2F43A 1M6NA 2IL1A 3CRW1 4Q9KA 2OFXA 3K9GA 2NOAA 1OSNA 2NQ2C 2X2EA 1XEWX 2CLCX 4RFVA 2OCYC 3AF1A 1CJVC 4PHFA 3CF6R 1Z6TA 3CB4A 4NZYA 1N6PA 3IEUA 4G5GA 3KZ1E 3QKRA 3QXJA 5EUQB 2XGJA 3NEJA 1T5IA 2ZRGA 3AV0B 4Q18A 2JLQA 4URUR 2JDIA 1XTKA 2X77A 2Q9BA 4JT4A 3CR7A 1ODFA 2J7PA 4NDZA 2HT6A 3HJNA 3LH5A 5JWHA 4D80A 2DBYA 3GLIA 2IYLD 4TT3A 2AN9A 1VMAA 2CL0X 1KGDA 1BKDR 2ORWA 4ZI2A 3ND8A 4TQUS 3ZZUA 2IS1A 4MKGA 3VU9A 1X86B 1SXJA 2IWRA 1L7VC 5DN6A 1DTSA 1LTQA 1N5KA 1P60A 1VKJA 2R2AA 4LV6A 4US1R 3GLGE 2W0SA 3EWAA 1OXUA 2F9MA 1E2MA 1WDTA 4IOJA 1TNDA 5IHPA 3KFXA 5KSOA 4OK6A 4POAA 4N3NA 4GOJA 2O8EB 5EXXA 4BLTA 2AR7A 1ZIPA 2ZRNA 4M9QA 4V0OA 1YR7A 1DO2A 2FU5C 3ZIAA 1VHTA 2EFHB 2A5FA 1TQ6A 4UKDA 5KHOC 3QKUA 2AK3A 4I1VA 2Q3MA 1XX6A 2B7BA 4LHWA 3WP1B 3GJ0A 1X1RA 1Z07A 3LLMA 3PEYA 2IYXA 3VHXA 1VYTA 1KO8A 1Z6AA 3PUYA 3FMPB 4V03A 1GUAA 4GDFA 4UJ5A 1JR3D 1XTQA 3EARA 4PC6A 4TQ9A 4ZKDA 1SVMA 3SDZA 1TAGA 3RS3A 3ZS8A 1Q12A 1ZBDA 1Z0JA 4EPVA 1KSJA 4JBWA 3VMFA 3R9IA 1P5ZB 4HLUA 3RS5A 1KKLA 2OEPA 2D06A 2VHJA 1GKUB 3FKSA 2FMXA 2PL3A 5F2EA 2ZRPA 3FYHA 4B6EA 1UBGA 3RC8A 3GQBA 3DKVA 2GK6A 3EW9A 1E4VA 1TEVA 4PZLA 3DMNA 2ZRIA 3WRXC 3K70C 1AGPA 4RSGA 1ZUNB 2KJQA 4LHZA 3SYNA 4M1SA 1G6HA 2BEJA 4URVR 4JLAA 2AWOA 3CRQA 4A8JA 1CR1A 1MKYA 3KL4A 4PZZA 3LX5A 3KTAA 4NE2A 1GRQA 3BK7A 3OIUA 4OK3A 5EP4A 3OHMA 2F55A 4B6FA 3QY0A 1DPFA 1Q57A 5FUWA 1UADA 2ZTSA 1IOZA 1HH4A 2MMCA 1OLOA 3QNUA 4B2LA 4IEEA 4MDEA 1WB9A 4KBGA 5EE0A 1DBSA 1E1QD 1KNQA 4DWJA 2V1XA 1AZTA 4P4SA 5FPTA 1AGRA 3GLIE 1IN5A 1KO4A 5FR2A 3OEHA 2JLVA 1P9RA 4M21A 3KQNA 4CEHA 1JJ7A 4GP6A 2K5UA 4TTRA 1ZM9A 4E09A 4HDCA 1KOFA 3RS4A 3D8BA 1KI2A 1JBKA 1GNPA 3TUIC 5C46F 4Y0VA 4WIAA 1KMHB 1DG1G 4GNKA 4LGMA 5KO2A 4TYWA 3RWMB 4M1OA 1KJWA 1G291 4C0QC 3HU3A 1XTIA 5AJYA 4AK9A 3MMPA 1G3RA 3ASZA 4IFEA 1Z22A 1N6OA 1ZAKA 3GEHA 2QTHA 2XNSA 4JVNA 1IY1A 1KDPA 1OV4A 3AVOA 4MYHA 1E2IA 1E99A 4M1YA 4NP6A 1G8HA 1P75A 1FZQA 1NLYA 4IVQA 4D0NA 1E9EA 2RMKA 5CDFE 3T15A 1CRPA 2ZSBA 2ZJZA 4PQRA 2WPDD 2NZJA 1E1RA 4XH9B 3JZAA 2ERXA 1ZNXA 4QGFA 2Q0HA 2ZANA
chains in the Genus database with same CATH superfamily
5EC8A 1CQIA 1SCJA 1JA0A 1I2AA 4NFHA 3QG1A 1FL9A 2R8ZA 3USCS 4JLBA 1A1VA 2G88A 4ZMSA 2UVQA 2NZ8A 4CKXA 4IO0A 4YCJA 5IZCA 4UE2A 4DC9A 3BD8A 4IV0A 1G4UR 3PDHA 3RWOA 4D9KA 1L5MA 3IJ5A 3RVDA 1GFIA 1SNYA 3VO1A 4F4FA 1NBIA 3BGWA 4HR7A 2CT8A 1IY2A 1GR0A 1V4BA 1MPXA 1Q0UA 2ZSIA 3DOUA 1KZGB 4L8VA 1RYNA 4I3GA 3QE2A 5A6SB 4MV8A 4B7CA 1C3OB 3RYIB 2XHEA 4J2OA 1AV7A 1TVMA 3JZIA 1F4PA 4FB5A 3K5IA 4IF4A 2FDCA 4QARA 4HNUA 3ZBPA 2R47A 4JVMA 3DWFA 3HEAA 2EGHA 4Q3NA 4F9FA 3R7BA 3DA8A 3QVSA 1KI7A 1IHDA 4E2XA 3TK1A 1VIMA 3OJEA 2C04A 1Z5ZA 2I8CA 1ID1A 4MP8A 1I13A 3O1IC 2ON6A 4MPJA 1V4NA 2Q5HA 1I7SB 5SYMA 3B7WA 3D0KA 1DDIA 2WWFA 3L1VA 1KS9A 2RGBA 2P6MA 2GN2A 3RUIA 2QXUA 3DFIA 3U3DA 1AE1A 2CNNA 3DO8A 5SYNA 2ZWVA 3HYCA 4JWTA 2XGMA 1PT9A 3T7KA 4PYKA 4AUMA 1BHO1 3O2SB 1F7UA 3WAKA 4A16A 2Z5LA 5CTJA 1ZR4A 1W0KD 3GGJA 1XLTC 4PSUA 5FPSA 3STUA 3U4CA 2BMWA 2FPIA 3A10A 3PNVA 3Q88A 5CTAA 1QV7A 2Q5OA 3ZY6A 1J2UA 2A5GA 4BGIA 4YJHB 5I45A 5KTSA 4LQDA 1N7JA 2NUTB 3PI6A 2BZSA 4D9NA 3NRBA 3PRKE 1RE1A 3DE5X 1ZMOA 4JIMA 5DX0A 4YQFA 1KIFA 3FJOA 3E0QA 3EJ6A 3PD0A 1YA6A 1IUPA 1VRCA 2QSJA 1KI6A 2PBZA 3OQHA 2Z9DA 2PY6A 3NCHA 1SUPA 5E2BA 2QRGA 2R00A 2QJFA 3GQBB 2I29A 5CURA 5L9AA 4ZOAA 1TLLA 3G2HA 3UN1A 1XL1A 3K9CA 2WEKA 3HP4A 3JPYA 4LJ9A 4FX2A 3PC3A 4RNCA 3QKSA 4YRGA 3OCWA 4BV9A 4CN9A 5LWHA 1WEKA 3RABA 4CLHA 2RONA 3EVDA 4EHAA 5LSAA 3UJPA 3IL2A 5KYXA 1YJCA 5J4KA 1L5WA 1P9NA 1AZSC 3QEMB 5DEIA 1FXWA 5FOUA 4HNAB 2VCHA 1SKYE 4JZYA 3ZNOA 3SQWA 1QH1B 4D9CA 1W581 2Q5JA 2DKFA 3I1FA 1CBUA 1NGSA 1AQUA 1QC5A 3HFSA 1U8CB 3G88A 3I5MA 5CXXA 1M8JA 5KTRA 5C53B 4BEVA 3PVCA 3W3ZB 3WKBA 2FN8A 1NSTA 3AU9A 1MX5A 2O52A 3LFHA 3C1UA 2EEPA 2ZJ0A 3O2QB 3EA5A 4HAZA 4MB2A 2RH5A 5IAOA 3UMMA 2GAOA 1G60A 3ORSA 2Q8QA 5BVHA 3GLHE 5KWVA 4W5QA 4QUHA 1IQ0A 1REQA 2XPCA 4O4JA 5GONA 3TLBA 5EJ9A 3WQHA 4C4XA 5DM4A 1FP1D 1KOLA 4B0PA 4YT8A 1Z5VA 4D8WA 3FPJA 3CZRA 4EGFA 4CEHB 1N92A 2RGRA 4F11A 3CBGA 3DYVA 1VKOA 1XTTA 3FHCB 4MYCA 1SHKA 2ATCA 4RCZA 3ZI4A 4ASUD 1E6EA 4UAJA 5J4YA 2WJZB 1UOPA 4W99A 2WMYA 2WHEA 5L4NA 1OX6A 2Z57A 1CEQA 1VYVA 2AK2A 3OJLA 4I55B 4ZO7A 4GVLA 4JI5B 1GV1A 1W19A 4FNOA 4QYMA 1Q17A 2AQHA 2PTGA 4JDPA 4YMSA 1I4WA 1TK3A 3IH5A 2C3OA 1FDRA 5CPBA 1XVTA 1KF0A 5EZYF 1IOVA 1BCRB 1NBME 5CT5A 2EJBA 4KRYA 4XQ9A 5E4JA 1UPAA 4RJKA 1GPBA 2DTEA 1RIIA 2JHFA 3M3PA 3MJ4A 3ZVLA 3QMMA 5FTMA 2IEIA 3SSNA 1R7RA 4H3HB 4AULA 4Y0AA 3W2HA 5E7QA 2PGAA 4JR0A 4DC0A 1CUZA 3G0GA 4BMZA 3A8TA 4PW0A 4N3GA 3BXEA 1T3HA 3ADDA 1PQYA 2IFTA 1YUNA 1Q7CA 2NPFA 1Z47A 2I7TA 2IYNA 2ZQYA 2ZR8A 1P1BA 1FQJA 2NXWA 2R60A 1D5WA 3UJ9A 4LF9B 1Z6PA 2G40A 2XHZA 1E32A 5E7IA 4E70A 3LBAA 2IHNA 4AJ2A 2H8GA 3LFTA 4NK4A 2JEOA 4IYRA 4BO8A 3U60B 4W7HA 1PL8A 3FMOB 1QJCA 4UU8A 1VL5A 2H4ZA 4BN5A 4ZALA 1OR8A 1R0YA 3L04A 3D3JA 1CQIB 4LSZA 4AJ1A 4F56A 3A4TA 1PI3A 5HUHA 5K51A 3REOA 2AE2A 2EIHA 3E5NA 4HZUB 4OHKA 5GP1A 5AM3A 4M8IA 5B1DA 3T61A 5CB4F 3O4RA 2AJBA 1K2VN 4B1FA 5LLDA 5JSYA 5D00A 1DQZA 2O5VA 3B8EA 5ED0A 1E9DA 3HPRA 4HAVA 4UM9D 4A3SA 2DTDA 2PQ0A 2VH5R 3ETLA 2J33A 5MFPA 2ZYHA 3ZZMA 1J24A 2GUGA 4RHYA 2EXXA 5C5CA 3BFXA 5K0SA 3E7PA 3FCOA 3PZBA 4G1BA 3O8RA 4CRWB 1KAOA 1YSCA 4ZVVA 3IXQA 3BCRA 1K6JA 4MUNA 4RL4A 3WK8A 2FZEA 2DY1A 2GMWA 4CQLA 4FBLA 3WGOA 4BO4A 4DKJA 2CUNA 1A2QA 4BKRA 2C7RA 1UM8A 4BGVA 4RO0A 1WZ2A 1OA0A 3QWFA 2YJ4A 2P3SA 2PTHA 2QDKA 3X1KA 4ACBA 4ZZ3A 1ENZA 3C3DA 2DWOA 2QUAA 2YFQA 5F7JA 2YN2A 4HC4A 4OYHA 1WNTA 2DWPA 1GRCA 1NJ1A 5TF4A 3EMBA 2EFJA 4JLVA 4A1OA 1ZCAA 5B7PA 2QRPA 4K8RB 1DX6A 4A0HA 2WE8A 4BNVA 1G9TA 3C5VA 3IDAA 2RHMA 3P9RA 2Q8PA 5HKKD 4AMBA 4OO3A 3D5QA 3UHAA 1ZR2A 1L4EA 1ZJ6A 2FPIB 1LDEA 4D2IA 2ZPUA 4FIZA 7ADHA 3K0CC 4ODIA 1ZM2A 1QOPB 2XX3A 2YJTD 1MUUA 3C1TA 4N5DA 1OOEA 1KE1A 5K8LA 2E6UX 4J0DA 1IZ0A 1Y1RA 3LYLA 2CJXA 4I4CA 2X8WA 4NIMA 4MB0A 3TBHA 2ZI4A 5E6RA 2GJ9A 2JCGA 1ZO8A 5CX4A 3FLAA 3I9KA 4KWIA 4LWZA 1MG5A 1PQWA 1ST2A 3C6QA 3NNNA 4UUPA 4AZ0A 5F78A 1A9QA 3OPXA 1QYCA 5DTQA 3WLHA 1YZUA 2B7CA 1CRZA 1MBZA 1SGWA 1Y5RA 3F9IA 5IC5A 3RTAA 2HBYA 3QU5A 3UXEA 1PJCA 2FJUA 4ZQCB 3RF6A 5HIAA 2F8MA 2H00A 2VBGA 3T4PA 4PHGA 1C9EA 4C7BA 4NE7A 3Q5DA 1AKNA 1L4LA 1OH8A 4HWGA 5TIIA 1E4EA 3M5PA 3PICA 1P0CA 4FYKA 2I33A 2F8TA 4TL9A 3INNA 1NXQA 1J5EB 2GD2A 1D9XA 1K7CA 1SC9A 2DAPA 3IHLA 5E4TA 5A3SA 1IBMB 1V16A 4BKQA 1A9XB 1T0IA 4IIJA 1SB9A 3L7IA 4U1RA 4BECA 1X74A 1RQ2A 1KWKA 3PGVA 3EY4A 1YB6A 1CJKC 1WXHA 2XSZD 4KXMA 1RFGE 3NI2A 1QC5B 4OSOA 2HKIA 1M0TA 2M9MA 3FOZA 4P3OA 4BFWA 2XT9A 3VDQA 4F6RA 5KNDA 4JGIA 1OGJA 1Z62A 4AXXA 4BL5A 4UATA 3AWDA 2XE7A 1E64A 1H23A 3UJ6A 5F4BA 4B6OA 3IBCA 2ATXA 4F06A 3C14C 5JECA 1E7SA 2HWUA 1VIAA 2VJAA 3ZLTA 5BVHB 4CMGA 4O4JB 1V5IA 3Q41A 1B15A 4ZC8A 1X7GA 2OV8A 1D3AA 1V39A 5GONB 4EW1A 2P9TA 3Q0EA 3BMXA 2J48A 4QRDA 1YRLA 5CM2Z 4ZODA 2VPWA 2AEEA 1SCAA 2V6IA 4K1LA 1JHRA 5ADVA 4X66B 1U9CA 2EF0A 1WBJB 3CH5A 1L7AA 3UMJA 2P68A 4D8UA 4C4AA 3OICA 2EDAA 2QXTA 3RHZA 2WTUA 721PA 2I3DA 2ZBUA 2QL7A 2W6CX 3MTAA 5ELMA 4WGFA 3DL4A 1NPYA 4BAUA 4DIUA 3W78A 4EUSA 3ISVA 2C94A 4QBTA 1OX5A 4BFYA 5KYYA 2FZ5A 1CR6A 1D9ZA 1SUWA 4B79A 1GOTA 3IE2A 1DRKA 2BFEA 5BMOA 6AT1A 4M36A 4G2TA 4B6JA 2GTIA 1FFDA 1X1SA 1XUOA 1G3QA 1JVBA 2GN6A 3EG5A 1VIVA 1EX1A 3FETA 3ZHSA 1B1AA 2B2XA 3GV0A 3BTVA 2NAFA 4HB0A 4XM1A 3R8CA 3KO8A 3ZCRA 2XCRB 3OX1A 3M33A 1GL7A 5BURA 2R1TA 2CL5A 4ZRMA 3DPUA 4RQTA 3QYFA 5CEJA 1IIRA 1GPLA 1HNNA 2P8SA 3R5JA 2G82A 4DR2B 3EIFA 5LM3A 3WKAA 3Q8KA 3VZPA 3S28A 1RKBA 5KX5F 3EA0A 3QVUA 3ZHRA 2I6UA 2O2ZA 4KWEA 1V3UA 3T1YB 2YH2A 4XOUA 2ACEA 3WHPA 3G23A 4BZWA 4PHCA 4MHSA 4WFIA 3T7CA 3ONFA 1YS2X 3OQPA 2UVPA 1XMIA 3PT9A 3OT4A 4PC3A 1F20A 3ZGVA 4CDNA 5MDHA 2JRCA 4S05A 4ZTBA 3HU1A 3NHLA 5C7OO 4HNSA 1UEJA 2ZJ8A 4REOA 3H99A 1BQ4A 2WJVA 1U2SA 1V6CA 2FZGA 5LC1A 1MV8A 2QTVB 3STVA 3SFZA 4QA9A 4D3ZA 1ZMBA 2JJQA 1TKCA 4Z7JA 2OYCA 1XD8A 5BWMA 1A8SA 4C03A 3GLKA 1N1MA 3Q5EA 1PDVA 2ZIEA 1WMEA 3NQ41 3WSTA 3GVCA 1Q1BA 1HSZA 3JWIA 4KIGA 4L8LA 3D9QX 2C7BA 3PRJA 1DRWA 4OYRA 2A57A 4MSUA 4QHTA 4F96A 3UJNA 1VB3A 3T41A 5JJIA 4C29A 3BQNB 2XIJA 2JHPA 1Q19A 1XDBA 3C6MA 2PFKA 3JCZA 4NEGA 4WCDA 4IWNA 5ILGA 3KSAC 1FYEA 2A3RA 1LGYA 1TZJA 4N7BA 1GCIA 1IVNA 2JGMA 3VR3A 3ES9A 5GJVC 5BQ5A 2QA5A 3UT0A 3MWDB 1RRFA 2W6PA 5E4FA 4L8GA 4MUXA 3PNYA 5IWAB 1CEYA 3RADC 3GVIA 1DQNA 3OZXA 3GLGA 2PUEA 2FP3A 1J49A 2IYZA 1FPQA 4YAOA 5DLDA 2GBCA 4JEHA 5HFJA 4DBVO 3D6HA 4E3ZA 1CF4A 1TCUA 3QUBA 1R5NA 2G04A 2VSOA 1VJCA 4XGQA 2ZJ7A 3WGZA 2ZI5A 2WAAA 4MO2A 4MVJI 2V7UA 3PRHA 2V8BA 3I9MA 4FUTA 2O6HA 2JIRA 3VNQA 1NF3A 3CVYA 4QJ5A 4ZQIA 1CUGA 1PTJA 1VJRA 2JAUA 2JEYA 3AVQA 5E6RB 4A0QA 2XOKA 5A1TA 5MN5A 4WXEA 1YZFA 2Q62A 1OGYA 1OC2A 1RXIA 4HUJA 1N8TA 2WD7A 4AZ0B 5F7XA 3H7AA 4ZT5A 1EUDA 2Q28A 2CYBA 3DDHA 1FQKA 1LRLA 3JALB 1JFSA 4B3BA 4OXNA 1II9A 3SIWA 4J94A 2AOVA 3A1CA 3R2JA 3WK4A 1OFTA 1TUGA 1X70A 3FR8A 1UBHS 2ANCA 1NRJB 3MJRA 1Y3DE 1ISMA 1E4EB 1IXZA 3EFHA 2JZCA 3H2GA 5T7BA 2SHKA 3PQ7A 1JU3A 3UXMA 4GFDA 2HBRA 3WLNA 3R3UA 1V16B 2WFLA 4K9SA 4AY5A 2V3VA 2BKLA 4IIJB 4QGGA 5KVQA 1V9SA 4QUDA 4ZV7A 4RJTA 4XXHA 3P0IA 1NVUQ 3OE7A 3UAGA 3Q1KA 4C7KA 2H0RA 1E2DA 1QONA 2QW1A 5BN4B 4F6RB 3DV9A 4Q66C 1WXGA 3G59A 4K3VA 3CH4B 1X9HA 1CR4A 2M6RA 1GNRA 2OCGA 3PX3A 4OHVA 2Q5IA 3MINA 1Y8AA 4R1QA 4V0LA 3U1TA 4ATNA 3IUPA 4B71A 4C7JA 1RHKA 2QN7A 1VKNA 3NV7A 1FNCA 1IPEA 1HL7A 2W6QA 3HMKA 2QROA 3PFBA 2OBFA 2ZTUA 3UKDA 1N8SA 4DTCA 1JEQA 1E66A 1U0SY 3GB9A 1MO4A 5JFGA 4B9AA 1S2GA 1P17A 2JLAA 3TOVA 2F1KA 3CRVA 4ZMBA 3M2TA 3BB4A 3AUUA 1LJ8A 4ARZA 5EE9A 2OBBA 3DEIA 1SG9A 3K5PA 3GCDA 5KYYB 5K2OA 3FWYA 1MA3A 2BFEB 1O6FA 2JAPA 1V5WA 2VTEA 2YZKA 3PE6A 1MVNA 2OV1A 3CNBA 5IX8A 1E1KA 3V2HA 3FRIA 4I9FA 5IFKA 2EWWA 2O1XA 5BW8A 3D8NA 4AJKA 4RD3A 3EIEA 2EJUA 4HMPA 4GR9A 2XMZA 1CP3A 1NKTA 1T6YA 1THMA 3L8CA 4B31A 4L5JA 4DDKA 4YT4A 1AA9A 2C78A 2R1TB 5I9TA 1YZHA 2EL9A 4GL4A 1G41A 5EJGA 2H4JA 2OGSA 3V3TA 4HVLA 2VPPA 4QG3A 4I5FA 2VQ3A 3OIWA 5CT9A 2QBYA 2FEAA 1V47A 3A9UA 3U3KA 2HSEA 1PTKA 3DL2A 2IP1A 4MW0A 1SJ9A 4MGHA 1SBZA 1T10A 1LK0A 3WVNA 1DKPA 1R74A 1S4MA 2JCBA 3FPLA 4FILA 3T7TA 1S2NA 1EB8A 3SD7A 5F9MA 2UYGA 2O8NA 4PX5A 4K03A 3BCSA 1JLHA 1M2GA 2QHXA 1GN9A 5K8JB 1RKUA 2CK3D 1W9MA 2FUEA 1GQQA 4F7DA 5JYDA 1HLDA 1PHPA 2QM3A 2UVPB 2VJKA 4BV3A 5FL3A 3LBIA 3H9EO 1BXKA 3ZI0A 3AOGA 2XYRA 2IDZA 2B4AA 3LOUA 3GP8A 4UCXA 1SHZA 4S04A 2L17A 4EATA 3U5TA 4ZDIA 2XQVA 3GQVA 2GCOA 1Y80A 2J85A 1O95C 1VC2A 5BN5A 3HRIA 3WLEA 4JJ8A 1N2JA 3H13A 4Q12A 3L6RA 3U4HA 3HXTA 1VECA 3CUEF 3NYIA 4RHCA 4RLFA 3A4VA 4JOBA 3SYLA 3T4UA 4BNFA 1GM5A 1OYOA 1NURA 2D74A 1NNSA 3IMGA 2IHTA 1OHHA 3D64A 2BJWA 2I4LA 2LE0A 2YZGA 2VJBA 3QBEA 2GXAA 1HDYA 1U3CA 4TRJA 1NL3A 5LBIA 3WFIA 1O2DA 5BR1A 4RTOA 2BSAA 3CNNA 5CVUA 3RVNA 1KPHA 3VBEA 4AM8A 2O9JA 3RG2A 5IKMA 5EP2A 1XTPA 4DLRA 1E79A 3HV0A 1N6LA 4HS4A 5GPBA 3GLGB 2VJNA 4WESA 5FFFA 4Z4FA 3QSYA 3KAPA 1JDVA 3FE2A 3OOWA 3KVNA 2JRLA 3C3EA 3B9BA 4J0FA 4MQEA 1KZYC 1O7JA 2D0OB 2EJCA 2PT9A 2W8ZA 4BNZA 3PKZA 3STYA 2QMQA 1PQPA 3GN2A 3IO5A 3IQGX 4FFRA 3RYHA 5CITA 1GTRA 2DLDA 3H16A 3QXXA 4DXDA 1PLKA 3KSZO 4DMFA 1OF1A 4F5YA 3BCHA 3D7SA 3FLEA 3IQIX 4S1TA 3V4VB 3K2IA 4EHKA 3B82A 4QUEA 4AURA 3HB4X 4IFTA 5FBWB 3FNQA 3HYLA 2WD7B 5HXAA 3MNFA 3PGA1 4KMMA 4CQJA 1EM8A 3OEED 1EUDB 2IWHA 3TZ6A 2G36A 1RBYA 3HUEA 1L7DA 3T3MB 4XVUA 2VAMA 2Q9UA 3PXXA 3WB9A 4JVLA 5D86A 5IAGA 4Z1OA 2B4QA 3R20A 1NUUA 2AN1A 3P0JA 4N6OA 4RAOA 5CIWA 2C9YA 1LVHA 2J8ZA 1XRMA 3NEAA 5FTWA 3RAPR 1CRLA 2C8VA 2WJ3A 2DWQA 3RU9A 2A2ZA 3BIXA 3B6EA 3H65A 1DT5A 2H17A 3L07A 1NPTO 3M34A 3IX7A 2WOOA 1Z34A 3HBJA 1JLLA 2ZPTX 2INGX 2Y9PB 3D7KA 5GZ6A 1V35A 1T8SA 2WFLB 1C2YA 3A04A 2RGWA 2WFAA 2WKQA 4UDNA 3T5AA 4CEJA 1RRMA 1YQUA 2J9FA 2IYUA 3QV2A 3BXZA 2FFBA 3FNRA 2AF4C 4QU8A 2Q2OA 2WSSD 3NBYC 3SX2A 3TBFA 3MSCA 4UOZA 2HNAA 2J6BA 1EWYA 1Y1TA 1QLJA 2HV8A 4JNCA 4J90A 1DRVA 1JE0A 3MINB 3DT8A 4IXTA 4L3OA 4J2TA 3AR7A 4ZFNA 1JJIA 3EAGA 1EFVA 1FLAA 4OSEA 1EP9A 2I4MA 4OJNA 8MHTA 1O9HA 1ONOA 5FPHA 2WG2A 4XQEA 2DPLA 1DQSA 1JEQB 1T9HA 2I87A 1MB3A 2UYOA 4UDOA 2QRHA 3ABIA 1E94E 1U94A 1GG5A 1UPBA 1VHWA 2IYRA 2V7VA 4NZ9A 3QTTA 5K8IA 1FB5A 4G0WA 4ARZB 1AKYA 1T8TA 4ZEWA 2CF5A 3IJEB 3HLTA 4ID9A 1ZI8A 2G1UA 1EH5A 3EF0A 4HXGA 4NLLA 4Q9IA 1ZA2A 3EA4A 4GBMA 1ZOLA 3FJ1A 4MITA 2DPYA 4BJ5A 4JXZA 3QE0A 1I3CA 4FDVA 1YVEI 3SEFA 4EDFA 1MB2A 3HJBA 3KPWA 4QUIA 2OQ2A 4QLBA 1I14A 5DHAA 3ZEIA 1E8MA 5AKLA 4DRXA 4FDAA 1TJ3A 3K2BA 3W1WA 4YMGA 3ADKA 5GVRA 2RB4A 4LYEA 1M8PA 4RTKA 1UK8A 1GSOA 3KTOA 4PPQA 1V41E 3A70A 3HVUA 4B35A 3CCBA 1KXJA 4FJ0A 2VXBA 3MGGA 3VYVA 1YRBA 1BXRA 3FLMA 1BMFA 4MR8A 3HLKA 5HA5A 1WPXA 3E3AA 1PWHA 4KYTA 3ENVA 3JQ6A 4CR7A 1H22A 1CUWA 5CVCA 3NNDA 5TPZD 4V0ME 3WBFA 3BJIC 4KYVA 1IN7A 4KR2A 3R8XA 1THTA 1W87A 3AIMA 1M1UA 2DULA 4FS8A 1OZAA 1I30A 4FP9A 3LPNA 2HMSA 1R0BA 1E18A 5EIEA 3THYA 2DBQA 3K3PA 3ZUPA 2OHXA 2VHZA 2GCOB 1R6AA 3BEOA 4HLQB 3BK2A 5BN5B 3DAFA 3LUCA 4EI9A 4NV3A 2OCPA 4EG6A 2AKYA 4KVAA 2VNJA 3VHLB 1W5EA 3HCOA 3HO8A 1U2PA 2XDQA 4YCDA 1K7XB 2E49A 2YHSA 4BU1A 2WQZA 1CZUA 3WOVA 4YRMA 1N2BA 2O0HA 3KQLA 4EFLA 5DU2A 1F0PA 1GZ6A 2YWHA 3L5OA 4MEAA 4RK7A 5COQA 4EMUA 3IEXA 5ITZA 3EX7C 1SZCA 2AUTA 1LH0A 2BLNA 4LMBA 2W6JD 5BSEA 5C80A 1QQBA 1WLYA 1H2FA 2A0UA 3RUFA 3EUAA 4OOEA 4P84A 5A4IS 4CL2A 4ARIA 4YR7A 4JA2A 1B42A 1TFUA 1DE0A 1PT6A 3O9ZA 4UAVA 3SMVA 4C4ZA 2ZRQA 4A0FA 1I32A 1XB2A 2X86A 3PEVA 1W94A 4MQEB 4CMCA 3LCCA 3QEAZ 4LWPA 1Q2XA 3L5KA 4HGOA 5EA2A 5JNSA 1BQEA 2W0MA 3K8ZA 3KETA 1GGNA 3RYHB 5HTOA 3FKQA 5G3ZA 1L2TA 2APJA 2NXCA 3EGEA 3GJ6A 3K6JA 2CNKA 4KDFA 3IEVA 4X1OA 4WLNA 1YI0A 3V7FA 5DHQA 1BS9A 1SBIA 1JR6A 3NRCA 4KQ2A 1CUJA 4IIVA 4OM7A 1O0SA 1OWNA 4YHBA 5IMSA 3IURA 3AR3A 2FPRA 1EM8B 4CNBA 1ZZEA 1AX9A 5ALGA 1W2HA 2GBLC 3VAAA 2HGZA 3WRXA 1YJQA 2BHRA 3JQDA 3OLWA 3QKIA 1FX1A 1XU7A 2HB6A 4HAUA 3RANA 3EASA 4ILKA 3CEMA 4LJKA 4GR5A 3KT0A 5T64A 2JLXA 5HIMA 4QQKA 3H2IA 2IOQA 1H8HD 3AEYA 3LE8A 5AT1A 5LXTB 2VP3A 3AEXA 2XEXA 1UXIA 3NFYA 3U9LA 4JI8B 4CEJB 2J9FB 3ABRB 2BFMA 4X3CA 5TJHA 3H4VA 2V3WA 4EVQA 1G3IA 1D2RA 5EKSA 3AEUA 4M0PA 1MNAA 3W8NA 1NXWA 2R6AA 1LPBB 3AFNA 1DIHA 1U1GA 3LRXA 4HGZA 4NZNA 2PWPA 5EFOA 1JALA 1DX4A 2YZ2A 1IXRC 3JRXA 2WTXA 1OX4A 5G1OA 5JQWA 3VAZA 1RI1A 2IKSA 5K8VA 1YULA 3ADBA 1JDBC 5DI3A 3DDZX 1EFVB 1KK3A 4FMCF 4ZVLA 1XQWA 4RWEA 3WDSA 4F97A 1ZGJA 4B4KA 1HLFA 4JVOA 3EVZA 4NS4A 4MRMA 4HDQB 1PV1A 3NHFA 4NX2A 4JCOA 4I4TA 3HU5A 5TLSA 2F9LA 5BR8B 3PE3A 3CT4A 5KJEA 3LP8A 1A5BB 3T7SA 2O8FA 2EZUA 1V45E 1GDHA 2XWSA 2PWBA 3D4OA 4R16A 1Y34E 2P79A 2Y1WA 2EJTA 5AJWA 5C8XA 5K0EA 2CNBA 3A9SA 3T1VA 1TMYA 4U5XA 5JQGF 3A1SA 3CIOA 1BJKA 2RAUA 4X5OA 1DDOA 4X8MA 2D7DA 1J90A 3ACDA 1KJZA 1D2GA 1SOMA 1TKAA 5J9FA 4ZVOA 4EQZA 1OAAA 1X1CA 1QIHA 4U2EA 3IAXA 1U0GA 3UAXA 3K1AA 4DRXB 1S2LA 4CMEC 3TSCA 5ECDA 3QLVA 4ZJUA 2XUJA 1I0ZA 3EPPA 2PUVA 3SBDA 3VR1A 2GN8A 1AMOA 1FRQA 1OYYA 3TFQA 3FB1A 2Z1MA 3LPAA 4J9VA 5BUCA 13PKA 1BXRB 4MR8B 1M6YA 5AOVA 3NUQA 3GLUA 4C78A 1MV5A 4M49A 1E2HA 1GPAA 3RT7A 1FJHA 1XNQB 1NFRA 5LDGA 3HI4A 1JFRA 1Z35A 4U7FA 3PUWA 4BNMA 3ROTA 2J3LA 1ZXXA 3NDPA 3ZBUA 2PRYA 1P4JA 3FVTA 2KE5A 1EWQA 4CDRA 1UWVA 2WWGA 3E2IA 3WJ1A 2RC5A 3JD1A 3RRXA 3QW4B 1RHQA 3QEKA 3THYB 1QV6A 1VKHA 1YD7A 1ODTC 4Y2SA 1XHFA 4AY2A 1CE8A 4ZVMA 2QX7A 3LY9A 4PFSA 2V4UA 5AMXA 3EUEA 4FD2A 4COOA 1G8FA 4LCEA 4QJIA 5KTTA 3TCXB 1XTUA 4LE2A 3K4QA 3A58B 4JP3A 2REBA 4GC5A 5BSWA 1YR8A 3O73A 4G63A 1XP8A 4L16A 3V1LA 5HM6A 1V8BA 1ZLYA 2XDQB 1CQPA 1ZVJA 3LO8A 1MN6A 2IELA 3WLLA 1F0NA 1YHYA 4L3VA 4BMDA 1CETA 1ULAA 3Q7SA 4P81A 2I55A 4FTWA 4H1WA 3ECAA 1YA4A 1T3TA 5LOVA 3U7EB 3Q3JB 3HCBA 3OQBA 3DONA 4RJLA 3E6AA 4PWZA 4FYMA 4W6ZA 3TG8A 2I1QA 4P36A 4XX1A 4N40A 5FYDA 4C2UA 2D54A 1LRJA 1N0VC 1OBFO 1AQNA 4UFNA 3LW7A 3BL6A 3CX6A 3QPAA 4QATA 3FYUC 5T4EA 3SYRA 5FBLB 3WHKA 2EW2A 2RHGB 2X5JO 4BLOA 3NEPX 2M6KA 2YFHA 3TB6A 2Z6AA 3UAWA 4XIGS 2VWHA 5BUSA 2C4MA 3OKFA 2CXOA 5JW6A 1OZFA 3R6TA 4GW3A 1W1WA 4JK3A 4U8HA 5HGXA 2F00A 2IHYA 3LVQE 3OQIA 1NJ8A 1VLQA 5KVAA 1MLDA 1E1CB 4OAOA 4RQBA 5HE9A 4MW6A 1Z8NA 2PJUA 2PGIA 2Q3FA 2HSGA 2BUBA 1L5KA 2O50A 1ZISA 4V38A 1JIVA 2OZPA 3EY9A 3M6MD 4IXNA 4QEZA 1Y8ZA 1RRPA 4TLDA 2GA8A 3DDWA 5HJ5A 2MYPA 1HE8B 1R8JA 2G5CA 4OKIA 1YK0A 2HRBA 4OAQA 5BNWA 5JAUA 2PFGA 4BIIA 5JMOA 4I6JA 3QI2A 2H18A 1GGEA 2A5YB 2GBLA 3AP3A 2VYQA 4MNTA 1NR5A 2QSUA 4TTIA 5LZ5A 1BSVA 1Z39A 3E9EA 4RPJA 3TIFA 8ATCA 1TKRA 3QWIA 2WBLC 4Y98A 3U44B 2FQQA 1AXGA 3G9UA 3OT1A 1LV7A 2VOEA 4IOMA 4LJ5A 4NH4A 4A5SA 2QZJA 5KBYA 1JN0A 3FWZA 3IUBA 4BUCA 3CG0A 4FB4A 1YZGA 1J8YF 4R6WA 5M2QA 1H65A 1WB6A 3UNXA 4OK5A 3RUEA 3MPUA 2G9RA 4Q4DA 1L8QA 3PNLA 1UK7A 3D4PA 3W6PA 3DLBA 1SO8A 2PO7A 4M99A 1KYQA 3UMFA 4QM6A 1HE5A 4FFPA 4URYR 5L3RA 3BGSA 5T8KA 1NN3A 3SFTA 1JT2A 2W7TA 2I6TA 1V48A 1RQXA 1QQTA 1QVRA 2YJNA 2H0QA 3DDNA 3DCJA 3GIDA 2WIBA 4GUAA 1EWRA 5KOIA 1DVRA 1JEOA 4FN5A 5DI3B 3GPIA 2VDMB 1O9GA 5AHRA 2BSXA 4MP3A 4P08A 1V9LA 1L0BA 2IX3A 1XTJA 5DVZA 3RRFA 3T9DA 1XCBA 3WWDA 2JATA 1Z33A 3K2EA 1ORTA 3ICVA 3MSXA 2XYVA 3NBUA 3Q11A 4HNHA 2JLBA 4I3FA 4LXQA 4C88A 4B3SB 2HOQA 4M0FA 3STXA 2H1SA 4D8VA 1YWGO 3JAWB 5I5EA 2O8FB 2FFQA 4LFCB 5DM0A 4CQMD 2PD6A 1B1CA 3SF0A 5H81A 3PYMA 1JV2B 3RLIA 1BDHA 3A6EA 2COUA 4HRYA 4PRLA 4TXHA 4Z2AA 1C3LA 2Q1XA 3IE1A 5FORA 5AO9A 4JC5A 4B2PA 2PYIA 3NFRA 1QDEA 4ND4A 3AR6A 2ZAYA 5DYTA 3VR5D 2VF7A 3OAAA 3WJ2A 4R05A 1SCIA 3V6LA 4C6TA 2ZXUA 4UNSA 2UYHA 2AD1A 4GMGA 4M1ZA 3K1AB 3RNOA 3FZNA 4RULA 1LX7A 1TK9A 3B2EA 1WDKA 2AVDA 3GFGA 2LUOA 1DAPA 2BN4A 1EVEA 2CW5A 2QMUA 3A4MA 4OQEA 1K98A 2G1AA 4RD4A 3VTZA 2SECE 3DEHA 4R1PA 1K6EA 3LY8A 3VR6A 5BUZA 2FPUA 2C3YA 3NXSA 3UWKA 2QX4A 4UHEA 3WIOA 1X42A 1G6KA 3GFRA 1RM3A 1WF6A 4KQIA 1XEAA 2SCUA 1ZD9A 1RLUA 2I9PA 4LXGA 4PC1A 3REQA 3RAJA 5JS1A 1DADA 3NT5A 2PZLA 1RXUA 4TQAA 5IRCD 3A1DA 5IJ9A 1NRXA 4BHTA 4RZIA 2DM6A 4BMSA 2Z3VA 3DXXA 3PF9A 4BE7B 1EZ1A 3FVWA 5HK9A 2JLZA 4KVFA 2IC5A 1N5RA 1X6VA 1Y6JA 1QX4A 2F3TA 4GI3A 4LOAA 4RFLA 4I0WB 5E38A 3QFHA 4GYJA 5IYZF 3T06B 1NC1A 4WA8A 1GRRA 4DDWA 5C4MA 2J09A 1GQYA 1G5RA 4HEHA 4E22A 3EPLA 1CE8B 5DTMA 4A8HA 1M2KA 1JVSA 3WLAA 4RVCA 2O8DA 2QD2A 3C8HA 4EG5A 1SKMA 1ZEJA 2RK6A 3PPYA 4JL8A 4OB7A 4B76A 4N12A 1VPLA 3PDJA 3BGIA 1YBAA 1ZD3A 3PDCA 2QOEA 3EDRA 2MR6A 3GOHA 5HCNA 4DG8A 2FF5A 1Z0KA 1QYVA 1FSFA 2C8KA 1MT0A 5AJTA 3V80A 1UKYA 4E21A 5AHOA 3LSTA 2ZI6A 1JIKA 4WOPA 1GFWA 4WZAB 2H2HA 1K75A 2Z04A 4MEJA 4MCAA 3EIUA 1VLLA 5AK6A 1ZH2A 2YMQA 5I47A 5LOVB 4FJ2A 1R37A 1DO8A 3TDMA 4ZDWA 2ZUCA 2ZBEA 2PYDA 4B09A 2A58A 3U7HB 3KB1A 4LFAB 3KEGA 1VG0B 4X7MA 1NE7A 2X0IA 4E07A 4HMQA 1JX6A 1WU7A 2M32A 3G2JA 4KAJA 1G21E 2VP2A 3H0CA 1UPCA 3H8VA 3OJ0A 2HMYB 4NQZA 4Y1RA 3C3MA 1I94B 1Y6FA 3JQ7B 1NC3A 4MVJM 4XB2A 4TMXA 3SJZA 1LK7A 4C01A 4HLUC 1FQOA 1UOQA 4P7JA 2IHBA 4Q01A 3SFVA 1NHGA 2O14A 2BT4A 3OQIB 4IHQA 3QZUA 2J87A 3QLEA 5JPCA 1U04A 1XRLA 1QX3A 5LMCA 1QGED 5A71A 1VE3A 1WE2A 4H0FA 5ERGB 2H1LA 5FTKA 4PN3A 1P2DA 2WD8A 4IGEA 3ZNQA 1RKXA 4GH5A 1CW2B 2Y93A 3EXEA 5B7QA 2FLKA 1O8BA 5HRUA 4TWBA 5DXFA 5GM2A 3TRJA 4FLMA 3DJFA 2Q6VA 3ZCUA 1PG2A 3AI2A 4N0EA 1P4GA 1ZGGA 1E3LA 1YQ9A 1R88A 4K9OA 5HMMA 3SEAA 4ES6A 1VCOA 4D45A 2GM5A 5JAMA 1WSDA 1YFLA 4RLSA 4MV1A 1M76A 3K92A 1T2UA 1QS0A 5C51B 4EAQA 3IRVA 4YJ3F 2C4WA 2AQ8A 3DFUA 1WVIA 3OT1B 1P9OA 4H7HA 4IICA 4UJ3A 1C9MA 1SUBA 3R5KA 3U7QB 3F4LA 4TRNA 4ZU3A 4FDTA 4QT0A 1A5TA 4IO1A 1YV9A 5LKAA 1L6RA 3CINA 3F1LA 1DV1A 1JXOA 2NW6A 2ZS9A 1CRWG 1KP2A 5IUJC 1LLFA 1ZOIA 2UZ4A 2B0JA 2B21A 4J6EA 1R2QA 1X38A 4H6WA 3PUHA 1KEKA 2Q21A 1WCIA 3H5OA 2WTBA 3TLAA 1XZMA 2OCXA 1PHRA 5F77A 3SHOA 4E94A 1EFKA 1XN4A 5LP1A 4EYGA 3LWNA 1U0OC 4R31A 3HB7A 3V7YA 2Q2VA 3V8NA 1WW3A 4DIBA 2EP5A 1USVA 3SMQA 4PLCA 4DGSA 2J9GA 4H2DA 4OBBA 3RBXA 2KS6A 5EJ8A 1JSRA 3WQQA 2RARA 5EUBA 1I9GA 2WF7A 1Z5NA 2WB4A 2PMCA 1SVSA 3KYDA 3LBNA 1KVRA 2QR3A 4FGLA 3B5JA 3EZLA 3GJ7A 4AO7A 5EEGA 4M87A 4UUOA 5ALLA 1Z63A 4D92A 4B7ZA 4CT0A 3WYGA 4A6DA 2W6ID 5HIJA 1OD6A 2BCJQ 3MOGA 3AHDA 1H3FA 1N2EA 1QHEA 1T4GA 3DBHA 3NT2A 4FT4A 4REQA 2FF7A 3GVHA 4QHSA