2JS7A

Solution nmr structure of human myeloid differentiation primary response (myd88). northeast structural genomics target hr2869a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
160
structure length
160
Chain Sequence
MGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Myeloid differentiation primary response protein MyD88
publication title Solution NMR Structure of Human Myeloid Differentiation Primary Response (MyD88).
rcsb
source organism Homo sapiens
total genus 41
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 2js7A01
4DOMA 3OZIA 4C6TA 4C6RA 1FYXA 4C6TB 3JRNA 4LZPA 1FYWA 4EO7A 1FYVA 1T3GA 4LQDA 2Z5VA 2J67A 2M1XA 3UB2A 3UB3A 1O77A 4LQCA 3H16A 5KU7A 3UB4A 4FZ5A 4W8HA 4C6SA 4OM7A 5H3CA 2Y92A 5FORA 2JS7A 4C7MA 4W8GA
chains in the Genus database with same CATH superfamily
1EGVB 1NM5C 1IXSB 3IALA 3Q7RA 3TB6A 3WL4A 4AO8A 4DJEC 4RTRA 4K88A 3H1BA 2RI6A 2PWYA 4KFTA 3I12A 1DXYA 2GPBA 4QARA 1YTUA 3R9WA 1U2ZA 5BUQA 4GL4A 4RD2A 5B37A 1PS0A 4KYVA 3NHUA 3QWBA 3GLGE 3CISA 2ECOA 3FYDA 2FEPA 4U8GA 4HNSA 4UAJA 4KB5A 1MAAA 5T8KC 4RX1A 5CBKA 5D5QA 3ND7A 4P4TA 4BP3A 3GJRA 4N49A 3PGLA 2DKFA 3O2QB 4QYMA 4RK1A 1L5NA 2QLLA 5EQTA 3FGOA 4PLZA 5AKLA 4NS4A 4QXQA 2O9JA 1VPTA 2W8BB 2OPHA 1W8IA 4ZZ2A 1I2AA 1W2HA 5CLQA 4DRZA 2Z09A 4L6IA 3JQDA 3R1IA 1IMOA 4KX3A 3WGUA 3B3FA 4LX0A 1Y7HA 1BDMA 1T4CA 5IAKA 4BVJA 4L2IA 5K0NA 1H5NA 1XTVA 3N7UA 3VR5H 1ZOOA 4C7KA 4E2WA 1HSZA 4H7JA 5IUJC 4A8TA 2B30A 4MVYA 2OLKA 3SJAA 2NOAA 2ZW9A 3CINA 1FW8A 1PK8A 4ZAGA 4Z0TA 4L5YA 5GV8A 2A57A 1BMFA 3ETEA 1I94B 3L46A 4IQFA 5JSZA 4TTRA 3UV7A 4DSOA 1VLVA 4CN9A 2P7HA 1U1EA 2OV2A 2ZG6A 5JRZA 3GK3A 2VSXA 3DTTA 3GOQA 5FBHA 4MROA 3ZHZA 2HR1A 1T5OA 4LFBB 1IWPB 3ED5A 2EBWA 2R65A 1JLHA 1DQNA 3NM5A 4KO1S 4MR9B 5CDTA 4GEGA 1YB2A 1LH0A 4PLCA 3QU4A 4G89A 2CXTA 4FE3A 2EWVA 2R8YA 3PT5A 5AI0A 5BNWA 3N0TA 4JVNA 3U4QB 1BVHA 4OKSA 1JG4A 1T3GA 1ZI9A 2I71A 3UJ7A 4F21A 1O96B 1OLXA 1PVDA 4FILA 4X6XA 1C41A 1RQPA 2H7YA 2ZAYA 5D5HA 3RPEA 4A6XA 8MHTA 2QQ0A 4P54A 3HY4A 4ER3A 2VYFA 3GFBA 1YVPA 1A1SA 1X3LA 3P32A 2WHYA 1Y8QB 3QLUC 4LS3A 3WRXA 4JI7B 2RGWA 1E1CA 3NHLA 4FEEA 1CE8B 4TRMA 5G1PA 4GGOA 2D7CA 2VCHA 4Y1RB 1JHVA 5EP3A 4ZXFA 2XT9A 3TSCA 1JBEA 3ML1A 1UC9A 5CA1F 3ABOB 3FNFA 4K6CA 4DG5A 3IQDB 2RJ3A 1SCDA 3WJAA 3HRHA 3UKDA 1S1CA 2AF4C 1QGAA 2VJCA 5CR9A 5DP2A 4PWYA 1I4EB 4WKOA 2VUTA 1TAHA 1Q0HA 2PU5A 4Q9AA 1UK7A 3ISTA 3IELA 1ZCBA 5C1BA 4C4RA 2O2HA 3EGDB 5KNDD 1KRXA 1C5KA 2BMAA 4PTYA 2GSDA 3KQWA 4Q3OA 1M34A 2FR8A 1IY9A 2IDJA 2XE6A 3WIEA 1PP4A 4Z99A 1RLOA 1E9EA 1W5TA 3GLVA 1IN6A 3P9QA 2G8NA 1O0CA 3CRNA 2PK3A 1FFGA 3WHKA 4BO9A 2BCJQ 3KAQA 3LDUA 2II6A 4FDVA 3GEIA 4JXKA 3TOVA 1CUJA 1VL8A 4YUWA 5I7EA 4H6PA 1KFKB 3LRTA 4MW9A 2VAWA 4I8DA 3L1HA 5J5AA 3S40A 5G1OA 1MRZA 2NACA 3TTSA 2NSDA 3DQPA 4BC1A 1ZVQA 2FR0A 3EBLA 2CSUA 2QAGA 5DM2A 1D1SA 2FPPA 1ES9A 4K40A 1R8JA 3GCZA 3NRCA 3T1OA 1Y4SA 4HSEA 3UHFA 4H7IA 5EMNA 2Q2WA 5DBFA 1QG6A 2GZRA 4KN6A 1XCGB 3HYSA 5T67A 5AM4A 5KYWB 1W4ZA 5EPUA 4RDIA 4PR3A 3GD7A 5CIWA 4LG1A 4R2LA 3DSRA 2XCTB 1FJGB 1ZGJA 4N7RA 3B53X 3E2IA 3TQQA 5IH7A 2ZT7A 3LXRA 4HH3C 4QO8A 5E2IA 2XYRA 1GADO 3TG2A 5EJ4A 3DPUA 1XMOB 4DSZA 5C8DA 1NVXQ 3NOXA 5HCUA 3RG8A 3L0BA 3MINA 1BYIA 3Q4GA 1YV9A 3DBLA 4R8SA 1TF2A 2ZJ4A 5AH0A 3QTTA 2P4UA 4Q5IA 4BNYA 4ISCA 1W85A 3OUZA 4P86A 5ICMA 4KR6A 1XVVA 4O59O 2PRZA 4X7BA 4E09A 4OHOA 1ISGA 2VAMA 3EFBA 1J5XA 2I3BA 3BK7A 1VL6A 3KOXA 3RW9A 1WQ4A 1U3VA 2VDWA 5L4NA 3C4QA 3RS3A 4YTEA 4ZT5A 3MJFA 3HBLA 4FR0A 4YROA 2YTZA 4U0KA 4KR2A 1KJ8A 3ES9A 2OHVA 3OPYA 4Y2XA 4CETA 1CY6A 3GFSA 4KWEA 3PX7A 1SVLA 5EWLB 2E9SA 4PCUA 5KSOA 2QTAA 3DQZA 3JRWA 3KKMA 4OK5A 1J1IA 5CVJA 1EX7A 1FNDA 4PAMA 2AR0A 3KBOA 5DIFA 2J59A 2CUKA 2WT8A 1W1IA 4MS1A 3R6WA 1KVUA 3R5JA 4E94A 5K6AA 1NBMA 2E0IA 4EL5A 1PEAA 1GCGA 1NC1A 2ZSHA 3MJ4A 3OIGA 2ZB7A 4KPUA 4L0DA 1TVKA 5KWIA 3L7MA 5CH8A 1JKIA 1ZN9A 2YWGA 3QPBA 3IA7A 1AGPA 3D3JA 4M76B 3AETA 4G5XA 3C7KA 3WNDA 4MR7A 3NM4A 3ZDDA 2IWRA 1O54A 1QAQA 1WCIA 3G2PA 4D56A 2D1FA 3PEWA 4HQKA 2RFLA 1M1YB 1KVQA 3N8KA 4TSKA 5CFLA 4FYPA 5EQJB 5J23A 2JJMA 3O4FA 2HI0A 4L0CA 1W48A 2J41A 4EI7A 2DFLA 3FWZA 3NNSA 3BWVA 2OV6A 4JC5A 2GWHA 1OROA 5B4UA 2VF8A 2F00A 1WEHA 3R24A 2RGGA 2VF2A 3E70C 4M7WA 1C81A 3V48A 3NALA 2WJ6A 3QZUA 4PYMA 4P92A 3UBMA 2CDAA 2XJ9A 2BTQB 2N0SA 1VIMA 2GB4A 1XA3A 4GNRA 2F55A 3BKXA 4A3SA 2WAYA 4JQZA 4QO7A 4Q4HA 3A26A 1IRXA 4M9XA 4N7MA 5A4DA 3CRRA 7YASA 2XIJA 3KJNA 1UC4B 2Z5LA 3RE1A 2H59A 2XMBA 3EIEA 2C54A 2AJCA 3LUJA 3LUDA 1L3CA 5JNWA 1HOTA 3THYA 2V1UA 1V4NA 3HCPA 5GTDA 3AEYA 4HZUA 3U48A 4EFLA 5B1YA 3L0OA 1Q7RA 2XXBA 3HXKA 2BZ0A 3BERA 1Q5PA 3QW2A 1D2RA 1BD3A 1JAYA 1W44A 1T9ZA 3MFQA 1DQPA 4IIJF 2GFQA 1R5BA 3FKSA 4FI3F 5KOHA 2ZRLA 3D3NA 4KGXA 1QG4A 4BGUA 1V43A 3DTVB 2GEDA 1U3TA 3G9UA 4HAZA 2OG1A 4F0JA 1M2FA 3VZBA 4BRUA 1OWLA 2P3QA 3ER9A 2P1ZA 1JLLB 1WABA 2ZRCA 1KU0A 1OX6A 2JJ2D 2VNHA 3L5OA 4GP7A 4HWGA 4RELA 1D5WA 3ZYZA 5EJ8A 2R00C 2PX3A 3CB4A 4O4IF 1U5CA 1WY5A 4ZZIA 3WOVA 1BKYA 4J75A 4ZT6A 2OFPA 1XJWA 1OWNA 1XZ8A 2HWUA 3B6JA 1QZ3A 4PSUA 3T95A 4BP1A 1XQWA 4ZV4A 1ENYA 3HY6A 3VBCA 5L4SA 1ENZA 1AQJA 3SVTA 4OQLA 4EX6A 4HQRA 4EHFA 4E08A 1UZNA 2B83A 1BN6A 2PLWA 4XGIA 2ZB8A 4TUYF 2YHIA 3L7OA 4F60A 4JDPA 5ALGA 1K2WA 3B1KA 3WGTA 3SDBA 4MRRA 4UDXX 3EQ8A 4CM6A 5JFOA 1HYQA 1JP7A 1NN1A 3ZV4A 4ENUA 1FMLA 1BU5A 2DULA 2JJ8A 4Y1FA 3SDZA 2CV2A 4EX7A 1SHZA 1ZXXA 2M9MA 3ZWWA 2NO5A 1TTHA 4W9RA 4RF5A 3ZX5A 3GX1A 1PSWA 4R1UA 2GRJA 2WAXA 4J2HA 1Z6AA 4RENA 2BL4A 2CL6X 2FGKA 3CF0A 3WMFA 3LHDA 3UFXB 4KAXA 2FG7C 5D3MB 2Q9AA 3LT0A 2ZT6A 2EKDA 4NBWA 1JX6A 3S2SA 4ER0A 1L8LA 2FEWB 5AHXA 3TQOA 2QP3A 4J0CA 1MHPA 3TH5A 3U6KA 1BDIA 2WAOA 4E6EA 2WYWA 4C03A 2XD9A 2ZCVA 4KEAA 4MRMA 4XA8A 1H85A 1E1YA 4DQVA 4Z6KA 4V0RA 2VXYA 1NWCA 1Q15A 3HS3A 1WPRA 2Z3ZA 5I48A 1T5DX 2W2KA 1L4EA 2C5FA 3CCBA 3DGEC 2XZOA 5AOVA 1FQJA 1T6YA 4IDAA 1KJJA 2C04A 3G9TA 1UPBA 1OQAA 4ARVA 1PD1A 1TQ2A 3CLVA 4KOAA 2P67A 5F12A 4D98A 1OXMA 4JHLA 1Q14A 4M3NA 2GEBA 3AI7A 4R2MA 5ICSA 4RKQA 2GKGA 1YB4A 1KWKA 3A3OA 4A16A 1ACLA 1QK4A 3I01M 4LRQA 5DI9A 5AVJA 3P71T 4XSVA 3OQNA 1F20A 1PS9A 4F91B 2CY0A 3K1JA 5LP6B 3DVLA 2XQGA 3H42B 3GUCA 3HUFA 1DHRA 4MDYA 2F3RA 5FDFA 3GGCA 5CXUA 2H1RA 4IWNA 4MWGA 1GVHA 3WBKA 5AP9A 3ZJYA 4D4LA 2XYHA 3I6MA 1E1RA 2YWBA 2H2WA 3UMSA 2TS1A 5CD9A 2ZI5A 3LO8A 3QKSA 2RGBA 4P81A 2ONJA 4EY5A 1DBVO 5HKOA 5EUCA 5KWSA 4Z5XA 1B26A 3PUWA 5G2OA 3K2QA 3KDPA 3O8BA 4MMYB 1K2VN 3PUJA 5CFRA 2AUNA 1KC3A 5JD6A 1C4KA 4XR9A 1I7SB 4GBED 2OO7A 3UH1A 4HMQA 2F3UA 1P72A 4BIMA 1VMKA 2WF7A 4DIKA 1U80A 2PIAA 1EFKA 2I78A 1NJ6A 3MM4A 3OZBA 5DLEA 4E32A 5AHRA 1NYQA 1RJDA 3IX7A 2IUEA 1UMKA 3CSUA 3FGNA 1II8B 2QV7A 2D00A 1Z34A 4OQYA 1RWNA 3S44A 2ZVDA 2UDPA 1MZVA 1FW6A 4LV5B 1AKYA 3R3YA 1MJGM 1SBZA 1OXBB 3HJHA 5KYUA 2ZPAA 5HA5A 3FB1A 2Q6VA 5AVRA 3KR2A 4JELA 3R7LA 1LEHA 3D6JA 4HYEA 4L16A 3OJOA 3VVCA 1VIAA 3BH6A 3MCTA 4YT8A 5JALA 2YV1A 1C4OA 4XW2A 4ENRA 1N7HA 1U4SA 3EXHA 3QUAA 3UWKA 2FFBA 2REXB 4Q7MB 1NPTO 1BX0A 3F47A 2ZRKA 4L72A 3ZU4A 2W2VA 3KQPA 3TL2A 3QMWA 1P74A 2QSYA 3LA6A 3L8EA 4DPLA 1SVUA 4KWTA 3B7WA 4ZO4A 4RGBA 3NHSA 4V0QA 3STXA 5JNLA 4LTMA 4IDDA 1RI3A 1WXDA 4CR7A 2R1VA 4EMUA 4YCMA 3HLYA 5DOZA 3WVNA 3OLYA 1HG1A 3KUXA 3IAHA 4D0GA 2LCIA 3SR0A 1I51A 4EJ6A 2IPXA 1IK6A 4ZEXA 4V24A 4K9OA 1MH9A 4Q05A 1YBVA 1ISHA 1WRBA 1J2EA 1PU2A 3SJUA 5EZQA 3BRCA 4YNBA 1R0XA 3NXKA 4MQ4A 4FC7A 4FWBA 2MCFA 2M6LA 1EVIA 1G6KA 3IO3A 4OP2A 4ZIRA 4BFVA 5LMCA 4KWHA 3OOYA 4KODA 1SUWA 2GA9A 3ELYA 1RXEA 5BSTA 1ODTC 3LT4A 3I73A 4I81A 1NHWA 4DWJA 3FDJA 2HN9A 2R68A 3W2FA 4EA7A 1CSEE 5CG1A 4C2TA 5GONF 4PO9A 2OMKA 3L1JA 2R8OA 4C1BA 1WMAA 3DE6X 5EWMA 3C1TA 1KKUA 1ISSA 2ZIVB 1TC1A 3NWEA 2FZGA 4NKRA 1K9SA 3NORA 2P4QA 4ZT4A 5K01A 3VU9A 5LQAA 3QVMA 2AN4A 2WF6A 1HYEA 2HFKA 2J5RA 4QOFA 3AV0B 1TVMA 3QX7A 5F5NA 5HF9A 4PYNA 2DPXA 4J3FA 3ZLJA 3FJOA 1VE5A 1VCIA 5IASA 2E18A 1UZAA 3NVMB 4R9SA 1W46A 4QQ8A 3PSHA 4LF7B 1UPCA 3FTDA 2QN7A 5LZ8A 1RHUA 2LW7A 2GHRA 3HABA 3RK4A 3WWPA 1BYUA 4NMLA 1B8NA 1SFRA 5C8ZA 2MIIA 4RTJA 1RAFA 4F93B 4MV8A 4UZFA 4BX3A 1U8AA 4Y30A 2DX7A 3E23A 4IS2A 3FPLA 1L1QA 2VUUA 2G3YA 2NO9A 4AWXA 3Q72A 1USGA 4V03A 3CLTC 3ADBA 3MZ0A 4OQPA 3RSSA 4E5DA 4C2BA 1QYVA 1SU4A 2ZRFA 1HQKA 1WHSA 2GYUA 4I66A 5G0UA 2XBMA 4I8XA 5KTTA 2NPIA 1QTRA 3U6BA 3TTTA 2Q0SA 2P90A 3L02A 3D5QA 3JYOA 3LSTA 4G1CA 3ZEAA 4BMYA 2FK7A 6YASA 3Q5EA 4P4GA 2MSLA 3DZJA 3CLUC 1JECA 1X87A 3GEEA 1W0JA 4DUPA 3OPYI 2QW1A 3O4VA 1F0KA 1J5PA 1LXCA 3TZQA 3LPLA 2OT3B 4PX5A 4AX8A 3WJ1A 3FSEA 3FCOA 1PT7A 4IG9A 4KFSA 2NTJA 3H2YA 4GPTA 4JLWA 4HMPA 2ZROA 3QELA 3QVVA 1KDYA 1WV1A 4RY8A 4YONB 4DA8A 2OGSA 2VTBA 4AD8A 5HOEA 2FUG6 1J06A 1FLNA 1I0IA 3NFRA 3LQRA 3WWZA 4E4RA 4QPNA 5E9WA 2H18A 3E6AA 1KI7A 2QLFA 5F2EA 4EYEA 3ELWA 5MGNA 1NMSA 2PAAA 2UAGA 4ON9A 5K0FA 3MWJA 4W8HA 4XSHA 4LK3A 4OSOA 2VNKA 1D4OA 2C2ZA 1O6BA 1SHTX 2A30A 3MJEA 4IHJF 4LTNA 4JUFA 4DNPA 2RE8A 5DTRA 4I6GA 3MT7A 3VNSA 4M0UA 2VKTA 1AU9A 1XTKA 5EL0A 2D74A 2NYAA 2VH5R 1M1NA 4R1OA 5HKAA 2ZAMA 4J0HA 1CR1A 1R8SA 2M2IA 1Y3HA 3F96A 4PC2A 2V7GA 2WF8A 2PDAA 2F1HA 3DHYA 2DBVO 2PLNA 4MYHA 4AVYA 3VC7A 1GFWA 3VPSA 3LWZA 4FFBA 2R4QA 4MUXA 1Q6ZA 4H31A 1ZVMA 4CQLA 1H1LA 4CGZA 2REBA 3COPA 2JAHA 4TSFA 4FX2A 4W9MC 5KKAA 4YRPA 1UXOA 3UJHA 4KI0A 1V5WA 1DC8A 1J0DA 1X80A 1TZCA 3DZIA 2QY9A 4YAEA 5DISB 5EJAA 4QULA 4QA9A 5TQ2B 3PFKA 3TOZA 3DOHA 3ZHYA 4G5YA 4GVXA 2F1OA 3ZK8A 3JARA 3MMSA 4QXRA 3P9RA 4DEXA 1HGXA 5ALYA 1P1RA 1GFIA 2X77A 1L5SA 2J3JA 1FJ2A 3PF9A 4B74A 3LXXA 4YECA 2PL3A 2JJQA 4PPNA 4AB1A 1VZ3A 1VKZA 3FBGA 4ROSA 3L77A 2G9QA 4H60A 2Z6UA 2UVPA 2XNHA 3FTQA 5JQGB 4TN1A 1ZITA 3I2HA 3M5CA 5EUMA 2G71A 3MRVA 4TLBA 2P3OA 2EERA 4HGOA 1E9BA 4LGMA 1R88A 3RAFC 2WZBA 3DWEX 4ESHA 1HFWA 3B5EA 2HOQA 4B85A 1VLJA 4MUEA 2FZEA 4HQNA 4I4TB 1XRPA 3KQSA 4MWTA 5T41A 3WLPA 3I09A 1LX6A 4XVCA 5B1DA 1UM9B 1Z0FA 3V7UA 1Y8RB 1EM6A 1X7GA 2GD6A 3OZDA 1YKGA 1FU7A 1WSDA 2ZJ7A 4BCDA 5CIYA 2AZMA 1YZNA 3W5JA 4OQZA 3R76A 4C7OA 1R9NA 1XROA 1EA7A 3N8HA 5KSPA 5EWJB 4HUJA 1IY2A 5G41A 4TT8A 1ZDMA 1NNLA 3IDQA 3HNPA 4JVMA 1Q7GA 4RS4A 3ZG6A 2AYZA 4EG3A 2Q9BA 2PR7A 1KFEB 3DDNA 4JMLA 3CJRA 2JFOA 3ZVLA 4D3XA 2OBLA 5CT4A 4AMYA 3SIPA 4R3UC 4EA6A 1DAGA 4EPVA 2VH1A 1P1JA 1V39A 1M1XB 2V4UA 2WLSA 2HK9A 2NO4A 3H8WA 1RCTE 3FRIA 4AY4A 3B3JA 5J4LA 2JC3A 3JWPA 4QYIB 1ZZGA 3AIMA 1RNLA 4CT5A 3U62A 5K99A 5DM4A 1VE3A 1Z5WA 1CNEA 1N25A 1UJNA 3TX2A 3WGQA 3VAAA 4ZFNA 2QDKA 1EFHA 5AHWA 4M1SA 4KFRA 5I9TA 2WA1A 2FEAA 2HU7A 1KEEA 2C0PA 5C51B 5JS8A 4D9JA 5F1PA 5JMOA 3BDIA 1US8B 4F6RA 4R8KA 2QW0X 3MK31 1DIBA 2ZCJA 3ZHTA 4NZNA 3UC5A 2ZJZA 4BE4A 5D51S 2O8DA 1VPVA 4Y2QA 1NVEA 3ZE1B 1TZMA 3FHTA 2ZTMA 2Q1UA 3DE0X 2OENG 1ZBDA 1XTSA 4KHZA 3VVMA 3UYKA 4DSTA 2XB2A 1KGDA 1HYHA 3Q3VA 4YGYA 3VR3D 4CKEB 7REQA 2J9RA 4EPXA 1GGFA 1H6AA 2I2CA 3GLIE 3TIXB 2PBLA 5HTKA 3WA6A 4BO3A 5AVYA 5TPZD 2OCLA 1L5ZA 1N5LA 3I1YA 1IN4A 2Z5GA 4TZ0A 1KFBB 2I8LA 3NW9A 2QROA 4JZYA 4RD4A 4E13A 3WBFA 4BVLA 4BTLA 1WE2A 4Q93A 4PANA 1Z73A 2NO7A 1U6JA 3BGOS 2CV0A 4B44A 1EUCB 3HUDA 1GNTA 3MQFA 3PDWA 1NLZA 3Q12A 5FL7D 3R7SA 3TTWA 1QYRA 4DCCA 5JWRA 1HL3A 5EPEA 4LC0A 4UASA 1U90A 1DIRA 4B3SB 3CNOA 4K87A 3RVPA 1Z5GA 3HJGA 3TVYA 1F48A 3ZGNA 4LOAA 4DDVA 2FW6A 1Z0KA 2YJ4A 3R7NA 2ZM5A 2YHUA 1P4JA 4ZYYA 4D3DA 3TLGB 3DOOA 3Q1KA 2PY6A 5AT1A 1L4HA 2QSUA 3RVQA 1NVWQ 2QE7D 5C3UA 2IOQA 3V7FA 2PO7A 2DT5A 4BBZA 4BLPA 1Y80A 4C4ZA 1PG0A 2WFZA 4LRTB 4AY6A 4N40A 4FHGA 4JI2B 4GH5A 2Z6QA 5JTTA 4HTFB 1BA3A 5FH9A 1K0UA 2BCGY 1XVUA 2J08A 4ABTA 1IB6A 3Q3EA 4GU5A 1AKMA 2GXSA 3N2YA 1FDRA 1CY7A 2JI4A 4WLFA 1XMSA 2J9XB 1M9NA 3DMTA 3UWSA 2JFQA 2QA5A 1QANA 1MNAA 2XTJA 3HR8A 4Y6SA 4AXBA 1MW8X 4EO4A 1SG9A 5ALSA 3GHHA 3DNMA 4C04A 1ETUA 3BH0A 3D6HA 3D6TB 4IM7A 5ENDA 1Y5LA 3R8FA 4RH1A 4PFKA 5K3FB 3CZCA 2BZGA 1G6HA 5CEFA 1TM4E 3HVUA 1T25A 3KC2A 4LWZA 4WESB 3G0BA 5I4IA 4AYTA 5BYBA 3QF4A 5JHGB 5JD5A 1BH2A 2ZIXA 2HSWA 1OBFO 1MABA 2WD7A 4KXXA 4M53A 5LQNA 1Q0QA 1XXHB 2XCUA 3PP8A 2GSWA 4MW4A 3OEEA 1FBTA 4URYR 2SICE 2HRCA 4J1SA 3UOAB 4G84A 3D8HA 3NBQA 3BMNB 3C5EA 2B1GA 3LH5A 3UF0A 4LK2A 2EW2A 1JI3A 3GJXC 3EPKA 4Z86A 3VPXA 3BFPA 1X8JA 3JQBA 5TNXA 3T5BA 4OJTA 3M1AA 4QBIA 1P2UA 2NSYA 1EFDN 2SKEA 4A7PA 2AYYA 2Q0QA 4AX4A 4CQMA 1RXWA 1SVSA 3NUZA 4J7CA 2YN0A 2RG7A 1GFSA 1LJLA 1RS0A 3FF1A 1E92A 4TZTA 2J1LA 1ND5A 3FH0A 3PYXA 1LLCA 2VQ6A 3ACCA 3NYWA 4D5GA 3KV1A 1JAIA 1K6IA 1ZA2A 2PG3A 1WWKA 2PRKA 2D13A 2O5VA 1DAKA 4NK4A 1U94A 1W19A 4D4GA 1AV6A 3EWAA 3HU1A 2XE7A 2XR1A 5AD1A 2QR5A 3L7NA 1G60A 1MJFA 5FAKA 3HCNA 1IATA 1PL8A 3DLPX 1GQYA 3I0NA 1K6XA 1KH1A 3D2BA 1G19A 3IIJA 4J90A 1XMQB 1RMTA 1VRWA 2AJDA 3AO0B 3I4FA 3SC6A 5JAIA 1MZPA 4NCIA 1XUOA 2GAJA 3A6DA 2O8EA 4MKZA 1V5IA 3PE6A 4DILA 1BKSB 3GFPA 2P30A 2I2XB 1KZ9A 2JCGA 3VOSA 5F2OA 4C3OB 4NHEA 1SU8A 5K9ZA 4IDFA 5B57C 4OH7A 1OIWA 4I8IA 4DV3B 3BORA 4G65A 1WMSA 1HEIA 3DEZA 4N4AA 4LHVA 4R2IA 3WP1B 3L07A 2E55A 3AHJA 3PI7A 4XQ9A 3HR7A 3BIXA 3R8CA 3LO5A 2JD2A 1N5JA 4NMWA 4WFJA 5FOTA 1J8QA 3P9YA 5I7FA 2V0CA 3ON5A 4JITA 5KPJA 4EAAA 2I4TA 2XOKD 2CHEA 3X44A 3Q1LA 5K3DA 3HB5X 1PWZA 1CUYA 3H2JA 4Q3EA 4JFRA 4XJSA 1AK2A 3WB2A 3JQEA 2WILA 8OHMA 3PNPA 4TL8A 4B84A 2GHIA 4BO7A 5KJFA 1GLVA 1F7UA 4QG3A 3SQOA 3THOA 2FPIB 3QKTA 5H3CA 2VFAA 3HKCB 2HAEA 3QHPA 1UOPA 3FDZA 1HL7A 2WT4A 3P27A 3SYNA 4ETMA 4YAGA 3V7WA 2PT7A 3JX9A 1Y4ZA 2NNLD 4KC0A 3BSWA 1OYOA 2MSKA 3HGMA 3RTGA 3AERA 2GCPA 2WWXA 4XOIA 1EG2A 2C2XA 2O57A 3O8QA 3JR7A 4ZI7A 3CS3A 4S2EA 4TYQA 1ZONA 5BMVA 2OD9A 1VGRA 4UNQA 2QRMA 2O19A 3UMBA 4E12A 3UAGA 3I2FA 1H0HA 2ORVA 2H4ZA 1ZP6A 2VF5X 3JQCA 4Q18A 4PG6A 1PHPA 3ZE8A 4C5AA 4YP0A 5LOVA 4CEIB 3DMGA 4RZ2A 4BNDB 2EBFX 3UXYA 3CNLA 2FUKA 3PHGA 5T3UA 2E21A 3O7WA 4HB4A 3BBPA 4ZI5A 4N5DA 2IK8A 1FMTA 4M21A 1I6MA 2WIFA 3OTQA 3AUAA 4GE0A 2VP9A 2VR1A 2GCOA 3HI6A 4JP2A 2AT1A 1UFQA 2QW8A 1U7XA 3WLNA 2WSSA 1GUDA 2XWQA 1Q92A 3JD3A 3EBOA 4LZJA 1A2QA 3LUFA 1D9ZA 1WZNA 2ADOA 3QH4A 1UAGA 4LV8B 3ZXIA 4ACBA 2JRCA 4IH1A 4JFAA 3T1HB 1IWBB 2FR8C 3NETA 5BPHA 4U6NA 1ZICA 3SQWA 2HDHA 3NIBA 3HU2A 1QHXA 3WYEA 3SQMA 2RIRA 3AY0A 4HY3A 4JASB 4XGNA 1CRLA 1R4AA 1HQDA 1W94A 2R751 4X5OA 2OD7A 2HV9A 2H4FA 4OMDA 4Q1EA 3RVDA 2JLUA 4ZO6A 1NOKA 3U44B 2O2DA 4ZO9A 2PS3A 2ERXA 1QO9A 2AXQA 4AFNA 2RH8A 3KQVA 1I4DD 2ZUSA 4Q9HA 4KQWA 3V1KA 2D2EA 1VSBA 2QAGC 4ALNA 2BV3A 4DLKA 5K3EA 3LW8A 2C29D 5GP1A 4ZT2A 4DLZA 4NI5A 3KQLA 1Q1AA 4E22A 4GOMD 2HHAA 4FT4A 4B7CA 4C9BA 2GZSA 3DF9A 2R6FA 1O7JA 2C83A 1E59A 2F4NA 5A9RA 4I3FA 1M6VA 1QVZA 4YRGA 3DAGA 1ZVVA 3M33A 3N7AA 3CJTA 1QF9A 3IKJA 3HMQA 4E70A 1OWPA 3R7AA 4YJKA 4E21A 2J67A 2ZJAA 3RYFB 1XK6A 3EZ6A 3HA7A 4ASUD 4V1CA 2RH5A 2PH5A 3N8IA 3EPPA 3UT0A 5KIAA 5JYCA 2I4LA 4MQUA 3G2HA 3N53A 2FE4A 2BAGA 2MSNA 3F3YA 3H9JA 4LRXA 3UK6A 3X2FA 4DIOA 3UMYA 3TW4A 4IDQA 1Y6FA 4EBBA 2ZYAA 1EDBA 3GF4A 1E69A 1QUFA 1T8UA 3ORFA 4RFVA 2NXWA 1AUVA 1U0OC 3KYDB 4RZSA 5HUHA 1L7EA 1XRSB 3LJKA 4N48A 3H9UA 4HATA 2Q1XA 3WHPA 3SG0A 3ZW8A 3L4JA 4TLEA 1X7HA 2NYVA 4PRKA 3W1WA 3AQIA 4OQMA 4XB2A 3QG1A 4UTOA 5H82A 2BEVA 2DBZA 3UHOA 1KAQA 3W2EA 1X70A 2NUBA 1RP7A 5JXJA 4LHEA 2VNAA 5A62A 1J8MF 1C4WA 2IJGX 3AL2A 3LVBA 3PGXA 1O9GA 4NYMR 2YZ2A 1S8AA 3A7DA 4CF6A 4MOWA 3ONNA 5ARBA 4GM0A 1A9PA 4PGMA 1NBOA 3EUEA 3OIFA 3F7MA 3RRMA 3A14A 4Y0NA 3RJMA 4RPHA 3U40A 4PIPA 5JS6A 2XUDA 3G23A 3VHQA 5IJ0A 2ZI4A 4FZVA 3QVTA 3F3MA 5EGNA 3J7TA 3W5SA 4RD3A 3ETDA 2IEAA 2WTXA 3IULA 3LRXA 1WKVA 4KACA 2Y71A 4M0LA 1IBRA 4NZ9A 1WZUA 2ID7A 2X4GA 4M98A 2O3SA 4S24A 3RS0A 4Y9TA 1NSFA 3NC1C 5A9SB 1JQ3A 4H3SA 1TMKA 2ZS7A 1D07A 3JW8A 4ZEOA 2IPAB 1UEJA 4WCDA 4BP9A 5J1SB 1NDHA 2WINI 5KKNB 1JPUA 1SCKA 2KQUA 2O2YA 4GOOD 2R85A 1EAYA 4I08A 4HH1A 3WNCA 3GEPA 3TINA 3WYAA 3CR8A 3ZEIA 1JDUA 4EBFA 1UXKA 2XCQA 2G6BA 3ADCA 4O02B 3T1VA 2B25A 2LCQA 4Q7KA 1JEJA 3LNCA 4KTTE 1CUBA 4OXQA 4YHHB 1U7PA 4WLEA 3FSGA 5D1NA 2IGTA 3Q0EA 4F3RA 4J2OA 2C5SA 2QVCA 1AY0A 4JBYA 1EQUA 2UZAA 4OIFA 5DBHX 3SZLA 3ZBQA 3AI2A 4B2LA 4BBJA 4CN8A 4QHTA 4EUKA 2GESA 2HCFA 1EB8A 1V1JA 2VATA 2SKCA 3KUDA 4G09A 4N1AA 1Z39A 3G59A 2YJGA 1HDYA 3UFBA 3PQ8A 5DBIA 3ESCA 1P39A 5LMNB 1H2BA 4TV9A 2RHMA 5G40A 4I50A 2VPYA 4KKXB 4BWGA 1S2IA 1EG7A 1T0JB 2WU3A 3FRHA 5JY6A 1RYYA 3N0RA 2FJPA 4EG6A 1SN7A 4KMOA 1P17A 4YWHA 3IEVA 1FZQA 3AJ9A 3J7AC 3N28A 5T6MA 1P5RA 2PAFA 3MQ4A 3N75A 2RDMA 1OTXA 1QZTA 3WYBA 2PKWA 5AXAA 4JP5A 5EC8A 1MP0A 1VMEA 1TAGA 1YHZA 1PTKA 1RRVA 2CVFA 2QMYA 3COSA 3LKVA 2GEVA 3LUGA 4XLLA 5IC4A 1FNBA 4MI6A 3UPUA 5LIRA 1SC4A 1N7IA 2P6MA 4IIYA 3TKYA 1G2QA 4W4TA 1P91A 2Z6VA 3WO1A 3QEJA 4C01A 4DCNA 5A4MS 2VDQB 1KZYC 4INJA 1X7YB 2MU1A 2Q2OA 4X8LA 4RPKA 3WZ2A 1EE9A 3KEMA 3DC2A 3GEHA 3LWDA 2UV8A 4OBBA 3UQYS 5ALHA 5IKXA 1QBKC 4JI8B 3JWJA 4DBLE 3FAZA 5AJZA 3WYCA 1M5TA 2QNIA 3H13A 4OL9A 1V3QE 1IQUA 1E1MA 3MXTA 3OCXA 4Y9DA 1GGHA 3PJDA 5ICFA 1BXRB 2YWJA 3EVDA 2DOKA 3FOAA 3HKDA 4AZ0B 5LXTB 2JEZA 1KETA 4RJJA 1TRKA 1DCFA 2WLTA 3OKCA 1GYQA 2AXEA 1CUCA 1Z0DA 2ZTSA 2P5TB 5FIUA 1YCHA 1WZ2A 2AG8A 3W1VA 2VDKB 5JXIA 2O52A 1XN1A 2PZMA 3S55A 4F3NA 5ITSA 4QQKA 1FS5A 4H6WA 4YRFA 4EY6A 3KE8A 1I13A 4QYSA 4J0DA 1Q17A 5DOVA 3A9SA 4RIEA 3AHCA 4KN5A 3U4CA 5IXJA 1K5HA 2NO6A 2IU6A 1L4BA 2RJNA 3ITEA 4NBKA 4ZCIA 3ZGOA 1FLAA 1KY5A 3CX4A 1V4BA 3IBSA 3ICVA 4P0TA 4Q0MA 3WV4A 5CXSA 3A70A 1G5TA 3EASA 5K0LA 4EHKA 4PVDA 4QWMA 1K97A 4O2AB 4R6XA 1ZJWA 2QY6A 1LF0A 3NH9A 4WLVA 3T38A 5IHXA 2H1OA 1POWA 1QV9A 1RZUA 5T57A 3B82A 4IUBS 4RVDA 4WW0A 4A10A 1DS6A 4OIMA 4Y3UA 2NU7B 3DVAA 4PAQA 4PYLA 3FFWA 1RXUA 5TQ0A 5KYYA 2Z8XA 2J0SA 5D01A 1FFBA 3C1UA 5IAOA 4FW8A 2X6TA 1LJUA 4KO2S 3ESYA 1IYZA 1V2GA 3QF7A 3DJFA 2J9GA 2QMHA 4E7OA 2DM6A 4DR3B 1GSIA 1JL3A 2C5LA 3EMKA 2PHZA 3KO8A 2HKIA 2FZKA 1A8UA 5KVSA 4WZZA 3FUCA 4OU5A 3SS9X 1XZIA 4EY3A 2JHPA 2SCUA 2K5UA 3JVUA 4WUTA 4BNTA 1YA8A 1IQPA 2YXLA 3UW1A 4XAQA 4EJSC 2EEZA 2OLJA 1X39A 2OBYA 1NLMA 3GGGA 4LJ5A 3MF4A 4JBIA 2AYXA 3M4ZA 3IAM6 4KIUA 2FSVA 2IZZA 2WIDA 2R4UA 4NV1A 4OD0A 4P58A 4U8HA 4BZZA 4BQFA 3VKGA 2QV0A 1GG2A 2QAIA 2ABWA 4J1QA 4YT4A 5ALOA 1K4MA 5IEJA 4LJYA 5JSHA 1GQRA 2OBFA 1KYYA 4H1VA 2VP2A 4R1TA 4ZVMA 3ZU5A 3BGWA 5JD4A 5JAPA 4CLHA 3QI2A 4QELA 4G2NA 4IJQA 5HMLA 5CA0A 3E7DA 1XRJA 1VPWA 4H0CA 3DWGA 2FEKA 4QTUB 1GVNB 4ERXA 4ZVOA 2D6FA 1XR3A 5BQOA 2JFVA 3KWJA 1E5DA 4ZOLB 4CG1A 1IBKB 4AIRA 2A7XA 3DDCA 1DAMA 4PO3X 2XXAA 3NNDA 5EEHA 4BNUA 5BNIA 1XO1A 5DNVA 3BMXA 4DDUA 1SO8A 5A5DA 1NZDA 2HL6A 3EXHC 4MGIR 4PLHA 1GQSA 1ESEA 1QTNA 2PXCA 1JKJB 3HCOA 2WJVA 5L7WA 4BNJA 4A4DA 1EQ2A 2VRCD 3CLTD 5FPKA 4IUDS 2NP7A 2EXXA 5KREA 1A96A 2NYRA 4WDQA 1BX3A 1W75A 2Y1GA 3O83A 1NU6A 1DBRA 1WSAA 1RAGA 1KXJA 5ECWA 5E4JA 2R6JA 2V6FA 1VP3A 3KHKA 1NY5A 2C5HA 2G07A 4P2GA 4B6QA 4PNEA 5H1YA 2I1LA 1NV8A 3DKPA 1XEXB 4LRYA 4G07A 3RTDA 4D0SA 3R9IA 5A6SA 2IIVA 3BCSA 4WSOA 3CLUD 3MFYA 3QKWA 2CBZA 3HJNA 3X1JA 3V4PB 1ACMA 4LFAB 2XUOA 4I1IA 4IZOA 2MJLA 421PA 1X77A 2IYFA 5K0TA 1HE3A 4DBZA 5AVQA 2CMGA 4MICA 3VAYA 2HXGA 4QGBA 2A9OA 2QX8A 2FMFA 4RAQA 4MEBA 2FH5B 4NBSA 1SUCA 1GN8A 3LG2A 1PT6A 2OZLA 3FPBA 3R40A 4M88A 4AUMA 4IUYA 5CEEA 5TLSA 1CRPA 1Y6RA 3DBIA 4EZIA 2WM3A 4N0DA 1T1SA 1RHQA 4RTPA 2XUJA 2XNKA 2L69A 3IVMA 4MP3A 4BGEA 4F3CA 2A3NA 2G1JA 1E2PA 3TI7A 1R6UA 4LCJA 1BQ3A 4ZDJA 5KHLB 1RKQA 2Y77A 4YUXA 1C2YA 1E0KA 3DUWA 4UTVA 1QE3A 4TMXA 1WPGA 4QM6A 2NXEA 5BV1A 1Z8FA 5EIAA 5HUJA 4OI2A 2IHVA 5HRUA 1NPYA 5K0BA 4FDLA 3UY4A 2I4IA 1XFAA 2BZSA 2I6SA 2J5BA 1DAHA 5B5SA 1I7QB 5CB0A 1NVUQ 4M9QA 1NW3A 1M2EA 1NXTA 4RK7A 1CP2A 4BTEA 4HEA6 3OEHA 4UU0A 3UK2A 3KYJB 2R62A 3NHAA 3V8RA 5A5FA 1YIOA 3ORQA 3M81A 1OI7A 3AH8A 1DC7A 1T5BA 3BCRA 4FNOA 3VRHA 3GLHE 3WV5A 3NC0C 5F76A 3GH1A 2ZIGA 3P0EA 4RCVA 1E2NA 3X2EA 4QPDA 4RD0A 5JAQA 4PAWA 4DCJA 4IMJB 5EJ7A 4YYZA 1XTIA 2W8BA 1LZKA 2HC9A 1X2BA 1TJ3A 3KPVA 3HN6A 1YZYA 3PHHA 4ZK2A 4G5RA 2NPFA 3ZCRA 1FC0A 5D6NA 1GCIA 1LLQA 1V11B 2V6MA 4KLNA 3P94A 3NFYA 3K4PA 4B9EA 1P80A 1AE1A 3I6IA 2GNAA 1DSSG 1XMVA 3LPDA 4HB3A 4F4DA 3VYVA 5BRNA 4GI3A 4NNJA 2BY4A 3T5GA 5CA1B 1W2WB 1X0XA 4R9NA 1OH5A 3R8XA 1XU7A 3SQXA 2XRYA 3DULA 2YIJA 2WV9A 3ZCPA 3O82A 1Y1LA 2ZK7A 3D43A 4LPKA 4X8MA 3UB4A 3ZWYA 5B55A 4HR7A 5E1BA 4DY6A 5ITVA 4HGYA 5JY1A 3WGJA 1RU3A 3OP1A 4COOA 2HCJB 4FZJA 3G0OA 5I9BA 3STVA 2UYGA 3ZK9A 1K88A 2Z1DA 4F8JA 2BEJA 1JDTA 4FHFA 4ZQBA 2J3IA 3BIWA 4DC1A 2H06A 2H1SA 4MR9A 2F1JA 4I4LA 3T0IA 1D6SA 2JJ1D 4JLJA 5EP4A 1AA6A 2GKSA 1MB2A 5C4GB 4QUKA 3VYUB 3DLHA 1XX6A 2N9UA 4IOJA 4ZC8A 3U4QA 3V7YA 3WGLA 2OCDA 1P18A 2GTHA 3JQ9C 3HA3A 1ONSA 4U5XA 4CXMA 1O96A 4FR2A 4CKWB 4OGGA 3AHHA 3UMGA 2BKVA 3EFOB 4XLTA 2FQXA 3P8ZA 3BMQB 4OV6B 2YFYA 3DH0A 3TRHA 1H22A 1LUAA 2ASVA 3MTBA 4LWPA 4DNXA 2ZPUA 3ILVA 1GFZA 1Y8QA 1Y5IA 4UEJA 2X0EA 2ZJYA 5JJIA 5FADA 5AVWA 4BN5A 4Y1RA 5E4TA 3LLUA 1VKHA 3WY9A 1ICEA 4IIXA 4P3NA 4R54A 3PGKA 3Q3GE 4IIGA 4A36A 1T1GA 5HP4A 1N6OA 1ZH6A 1KYZA 2QI9C 3DR3A 4D9FA 1ILEA 5K8JB 2WPDA 3GQVA 4Q37A 3DE1X 4MKIA 4YRRA 4IV5A 1YL6A 2WWVD 3T4PA 4EO7A 1T5LA 5KOJB 1PFVA 3EGDA 4TYYA 1DPGA 1AM4D 3N5KA 3PDUA 4II3A 5EIBC 3QVLA 1PQ4A 1XCJA 2V96A 2V0NA 3QA3E 2RHCA 3S1LA 1FXSA 1MEOA 2XUKA 1EH5A 4KH0A 1KAOA 1VJ1A 2XVZA 1V41E 4PF1A 4OM7A 2LIPA 3GP5A 3FZYA 4MVJI 1TIBA 1FXWF 2YMQA 4B33A 5LQUA 2AZ4A 1H9AA 2QRPA 3QYFA 2C95A 3U60B 1XJQA 1PUIA 2E3JA 4ZMBA 2YNMA 3SYMA 1DUSA 2IYVA 2R11A 4H1UA 1KOGA 1FDUA 4RH3A 3M3DA 2K4MA 4YRIA 1EFLA 1F3OA 3GRYA 4URHA 3ROTA 4UAUA 2W6JA 1MD9A 3K1ZA 2ISSD 2DUJA 3PKJA 1YWGO 4HDMB 4BB6A 2VJOA 4C30A 2ECPA 3ZDRA 2H00A 4YXWD 5I3ZA 1PSDA 2AHRA 3I9JA 1R3DA 1Y1RA 3ZV5A 3AG5A 3ZXYA 5KINB 5KYWA 1J20A 3VSAA 1IM2A 1FP4B 1NVVQ 1TKRA 1VECA 1FRFS 1L6IA 1SM4A 1T15A 3PNOA 2OLEA 1CZOA 1OFTA 4HJXA 1OPXA 2YCBA 3AF5A 7MDHA 3EVFA 3DWIA 2B0CA 2AMFA 1Z75A 2WIGA 3N2KA 4TS3A 2GBLA 4I9UA 3WYNA 4XJXA 1I6KA 4CIVA 1N6KA 2ADMA 3E9NA 4QDOA 3DHEA 1G98A 1ESMA 3QMMA 4I14A 1P2TA 4NARA 4IXNA 4F56A 1Z22A 3S8MA 4FLMA 2VHEA 2EYUA 1NLUA 1PLJA 4CL2A 4ZVTA 1NXVA 4HADA 3QE9Y 4GS5A 3WZMA 3ROQA 4GYWA 1AHIA 2HYIC 1WNTA 3T99A 2D4HA 1VKRA 1U0EA 5ANRB 1I2BA 1MG0A 2OPBA 4P22A 2IYSA 1A72A 4LDAA 4G1FA 3LA8A 1WSWA 1XL1A 4LJSA 3SXJA 5AVVA 2WQZA 4Z3DA 1JEOA 3A9UA 1N0IA 5C31A 2ORYA 3L0CA 4CF3A 4DREA 5TEVA 1NQTA 3LM8A 5FBKA 4FKZA 5ICCA 5EWLA 4Z4CA 3QOFA 1RKVA 3AV3A 3SYTA 4IRMA 2OVBA 2V8OA 4P7FA 1AUPA 3V00A 1AK1A 2DQKA 3KLBA 3OLWA 4P36A 3VHXB 3WDLA 2CK3D 3HP4A 3B51X 4LGCA 4F6CA 2WU1A 5JC1A 4ALKA 1SXPA 2AZXA 3ZWKA 2Z83A 1L2TA 3AUKA 2XLBA 1WIWA 5IEBA 4IIJB 1KSGA 2WRZA 3ACDA 1J70A 1ZN7A 2V65A 4OHPA 4RDCA 3U80A 4OLFA 2K87A 4CYMA 5LIPA 2MR6A 1EZ1A 1M1YA 4JT9A 3ZJ5A 4MIOA 3AF4A 4MVXA 3T3OA 2JIRA 3ENQA 5GIOE 2Q3LA 3VPAA 1AA9A 1MIOB 2IF0A 4JAVC 1MTOA 2IXFA 2GH1A 2JHFA 4U63A 6ABPA 1CJBA 4F7DA 4B5LA 4O4IB 1H0KA 3JTEA 5CBPB 2DCUA 2R1ZA 3BZBA 3KQMA 3MN1A 3OT5A 3RVJA 2Y92A 1H5QA 4JX9A 3I30X 2B36A 5HBRA 1WNFA 2FR1A 4U2FA 4AURA 2XD4A 1CNMA 1PGQA 5CVUA 3FWHA 1NULA 3LK7A 2X1LA 3L8FA 4P4SB 2C9DA 1FL9A 2BTQA 2NX2A 1RPNA 3CH5A 4TUYB 1F8YA 1QYDA 5M7EA 1JA0A 1FFSA 3A11A 2O5RA 5HZHA 1PJLA 3PVSA 2F43B 3RJZA 1EB9A 1NDQA 1N6HA 4DV5B 4MWDA 2HF7A 3CR3C 3LX6A 1X3SA 3PE4A 1GPMA 1T3ZA 3LPNA 4OSEA 1IY0A 3KR9A 4INZA 4UNPA 3WSWA 3X1MA 4PLYA 5FI0B 1NN0A 5JR3A 5A02A 1Q77A 3RC8A 5FFNA 1GITA 4ME6A 1T9GS 1NW4A 4DZRA 1A4UA 2DRIA 5JXHA 1C9DB 2Q5QA 1UQRA 3NHMA 4MWZA 2XKAA 2DVMA 1KVRA 3LT5A 1EWQA 2FG6C 3GH3A 4G1UC 2ZBFA 2EP5A 1Q1ZA 3DTVA 3DMTC 5KTMA 2JI7A 3R5KA 1GQOA 1SUBA 1PG5A 1JLLA 5E8JA 1J6UA 2CE7A 1UZUA 4MJLA 3JWGA 4N9QA 1O1YA 2RGUA 3I76A 1BMFD 2VBCA 3SZ3A 3UK1A 3AILA 2X8WA 4A8JB 2IZ7A 2WFLB 2H1FA 3PR1A 4QHYA 2D1QA 2A4KA 5SYNA 4QTXA 1AZLA 3MTGA 1E7SA 1NVMB 1KR2A 1DUIA 1L4UA 3D3WB 5AKGA 5ESRA 1UZMA 5FL3A 3PQCA 2TMKA 4JBHA 2RAVA 3WKAA 4UXIA 3NIWA 5EIFA 3KSDO 4UOZA 1IEQA 4ILEA 2V7BA 3E27A 4MYDA 3KEQA 5TMPA 1INLA 2PZGA 4Z2YA 4F3YA 3FTCA 3LOPA 3W05A 4LF4B 3DM9B 3JQBC 4JYCA 4XJTA 2IDZA 4OKNA 4ZVRA 2NIPA 4CI9A 4EHIA 4IFEA 4I19A 5EZ5A 3RIGA 2V7PA 3P52A 3NT5A 5MGBA 2HQBA 1ZGBA 3KZKA 1MBZA 4CV3A 4EFNA 3WP0A 3OKFA 4MAFA 4NYJR 4YPVA 4G5QA 1TQDA 1V9LA 5D3MA 3O2JA 4BAUA 4JXJA 1F2DA 3M9LA 4Y1GA 5LQKA 1CFZA 3OQIB 4BEJA 2EZ9A 2QUIA 2UKDA 1CZHA 3C39A 1IM5A 4HLUC 2ZUEA 5ESDA 2B6NA 4PS1A 1KMCA 3CIFA 3T4UA 4EUSA 2R8RA 2FQWA 4F06A 4KGVA 2QP9X 2VWHA 3ND6A 4TLMB 5C2JB 3JD2A 2I22A 4KR7A 2DFKB 3H0KA 4ZVQA 3SHFA 4DCUA 2WT9A 2FPXA 1AV7A 4Q9LA 5AW4A 2C8JA 4NDNE 1Y5NA 2C5AA 3HB4X 4M0MA 4B6GA 2C3UA 4D0NA 4QKQA 5F23A 2CXPA 2O3QA 1E9SA 2G0AA 2OXCA 2CBXA 4G23A 5EKTA 3VBEA 4QLOA 4EHBA 5DX0A 1ULBA 1J21A 3I9FA 2I6FA 4WNAB 5EKXA 1ABFA 3UJCA 2R6DA 3VO2A 3NYQA 1PX0A 2CHUA 5THKA 1GNRA 4FE7A 4ZWNA 3P4UA 1YBAA 2O6LA 5LP6A 3HADA 2ISQA 3CZQA 3O8CA 1FS6A 2P62A 1G1MA 4KDCA 1ID1A 4W1RA 1FF9A 4D5EA 3H9QA 1WCYA 2LE0A 1WL8A 2IHTA 1XZNA 2Q5IA 1RPJA 3GJ8A 4LWQA 4W1PA 3BD7A 3BWXA 3LWBA 3E58A 3VJMA 4G9GA 4C0LA 1UBOS 2VT3A 4BOYA 4RETA 2I4NA 4YCJA 2A5YB 3EB9A 4LBZA 5EIWA 2I34A 4K81B 4R05A 1UH5A 1Q83A 4CMKA 3S28A 5DWDA 3LECA 5EP1A 4I2NA 5IZCA 5AICA 1YL5A 2NTYC 4TXLA 1JLRA 5F21A 4D57A 2FEOA 3D2CA 3K9CA 3GDOA 1II8A 4HVAA 1G5IA 3SAJA 3E1SA 3OOSA 1MOQA 3Q98A 1Z9BA 3OJFA 5FJJA 1U4NA 1QX3A 4F72A 4EK9A 2ODEA 3EEBA 3L8CA 4HH0A 1C30B 4RQUA 1SC1A 3EIQA 2FYTA 4HPJB 1RXSA 3V1UA 3TZEA 3FG9A 4LSWA 1J9GA 1BJTA 2N46A 1E1KA 3NBXX 5GONB 3G5TA 3OWHA 1BG6A 3V32A 2RCNA 3L9WA 4J16A 4X97A 1Z7WA 1TFRA 4G1MB 3ZLUA 2BR5A 4Y7CA 1JR3E 2PXXA 1Z5ZA 2XQKA 2IIQA 4PE5B 2MSCB 5A9TA 2WYIA 3L93A 4G85A 1L4MA 3DQQA 2ZB4A 4Q9JA 2GF2A 3QIVA 4TXHA 1E5TA 3LCJA 1AN0A 1LNQA 1FRVA 2GN8A 2P2DA 3JWEA 1UKVY 4WK2B 1I33A 1NBMD 2XCIA 3G02A 3Q87B 2FUNB 1TM5E 1QP7A 3E9RA 3OM0A 5EESA 2I3DA 1HORA 1FTQA 1JU4A 4CKXA 4X93A 4RULA 4FQ7A 1COWA 2GBPA 3SEFA 3T1QA 3AI3A 4G8DA 1RAAA 4WOBA 1LS1A 4KREA 1A97A 3KYBA 4M8IA 4OYRA 4ABYA 4PLPA 1D2NA 2XAUA 5CFZA 1ATIA 2UZ0A 2Z95A 4OATA 5AK3A 1PT5A 3GUZA 5CGZA 2W0SA 4DWVA 4YY3B 3RC9A 3ETNA 3EBPA 5AKHA 3LYAA 3HJRA 3IUQA 2BGLA 3GJ7A 3R7BA 2O0HA 1QDEA 4FCTA 1E3SA 4XRGA 4NZMA 2ATCA 1TC2A 1VKOA 1NMYA 4LHZA 4Y2TA 3WKDA 2XCLA 1CZUA 2I2BA 4I4IA 4WCFB 2FPGA 2OYCA 4QPCA 2MDTA 4E31A 1L5MA 3VTZA 1QHSA 4FCVA 4AJHA 5BRAA 2BGUA 2CNNA 1IHXA 5D3KA 5TF4A 4YHBA 1BFKA 2FWNA 1RHRA 1ODIA 2ZLBA 3NPMA 2AR9A 5DO9A 3ESDA 4BJ6A 3K3PA 2EKLA 3OUUA 4YV0A 3WS7A 5JPDA 4MVJH 5KYTA 3KJXA 1OC4A 2M6SA 3QMVA 5AKZA 5JCJA 3I2GA 3H5IA 1VIYA 3MNFA 3VDRA 1DIAA 3ZCUA 2FQ1A 1B16A 3WLQA 5DSXA 3SYKA 1FDIA 5KCMA 2I55A 3V2IA 1U11A 2BBSA 1FTWA 4FNMA 4WA7A 1V8ZA 2XMPA 5CXXA 3FKSD 1Y6ZA 4UD2A 3NHKA 3LF2A 3TTVA 4BMZA 3QWHA 4IHJB 1YZKA 4MVCA 2JAXA 1EVJA 2QPOA 4Y6QA 3I37X 5D2CA 4QXOA 2I9KA 1Z45A 4CPDA 3QYPA 2IU0A 5K8VA 1UBHS 3A27A 3IPRA 1A8QA 2PJZA 2WA2A 4KUHA 4U9IS 2ZBPA 1TU0A 1ZJZA 3W79A 3TQRA 4UUQA 4HAIA 3DBVO 3GT7A 5C5DA 5IVHA 1O9BA 1XTPA 2PZ8A 3UAVA 5DYIA 1YKFA 3TJZA 4DQKA 4CM3A 2L0XA 4MB6A 1NGSA 3ZE0B 4N41A 5AK6A 3B8EA 1W93A 1YZUA 3R5SA 3DAHA 2FHPA 4EECA 1SC6A 4DCGA 4QT0A 4S12A 3WK6A 3QE0A 3UKOA 1FMCA 1ATZA 4O4JA 3V8EA 3HDVA 2XE4A 3DXZA 5I7HA 4DG8A 3G5UA 2HWKA 4C6RA 2X1MA 1A76A 1PR5A 1CRQA 1ZHFA 3C2QA 5KMGB 1KNXA 4QOEA 1AMNA 4C08A 2O0MA 3AU9A 2PM8A 9LDBA 1O95A 4PN7A 2BOVA 3SM3A 3EPRA 3WK9A 3RFXA 1HNNA 16PKA 2GRUA 3C3MA 1CUVA 4RQTA 5JJBA 2JASA 1LDGA 3QY0A 4D97A 5G3YA 1HE8B 3PRJA 2ZYGA 4ZP1A 5AKYA 4JJKA 2PUBA 3SP1A 1A5ZA 4JBWA 1M54A 5H0IA 4OHVA 1P81A 5JRJA 3GFGA 1P61B 3PXAA 1A5BB 1ZHOA 1D2CA 3GLFB 4ZTUB 5C1DA 3K9HA 4FOOA 2PUTA 1R6TA 4DMKA 1DCTA 4M2LA 4WXEA 4MYUA 1DC4A 2YBEA 2C9OA 2VHZA 4AY5A 2WWYA 1TPYA 4BJ1A 1OF1A 4PONA 4BO2A 2A1UB 1MB0A 3PTZA 4JQOA 4U2BA 1R6AA 4J3NA 1DXQA 2NZJA 4WVFA 3TTXA 4RNCA 3W1EA 4CFZA 2ZJ5A 2WKSA 4YMSA 3Q6NA 1WB4A 2B4AA 2H2DA 1M72A 2AEFA 3WWOA 1SKYB 1ODKA 2VSYA 2EFDB 4JJ4A 1V26A 1SB8A 3TZHA 2AN3A 3AXSA 3E3NA 3RAPR 1LLFA 3UFXA 4ZQEA 2VT7A 5TQ2A 4Z7NB 2J8ZA 3VQTA 2H3EA 3D1JA 4TOIA 4GR5A 3LCRA 4BVBA 1Z2EA 4PHHA 3W5IA 3ZLTA 1E1RD 2WTEA 3BZUA 2P6UA 3BQNB 2QX7A 1TJ5A 4GNKA 4A91A 4EA8A 4R71A 2Q5HA 1DAEA 1KO8A 4Y9UA 3S70A 2OBMA 4H15A 3EE6A 4EJFA 1NW6A 4NOJA 5JQGA 2YFHA 1NSTA 3FNBA 4ZCQA 3PFHA 4CIBA 1DCMA 1XAIA 2FLKA 4L3OA 4ZVPA 1TM3E 1Q84A 1PYDA 1YJ5A 1QQ6A 1YBHA 1JHDA 1U8UA 3B9QA 2OAP1 3TUJC 1FDWA 4ZANA 4G0QA 4Z0HO 4HDSB 1G41A 1PWXA 5DNEA 1QAOA 2DBQA 4EKDA 1GAEO 1PNOA 2R48A 2WP0A 4I4TA 3N7TA 2FSIA 1E4OA 5F4BA 1GCOA 1E3WB 1BHO1 3G2MA 3QFRA 1WBDA 4K9KA 1YJXA 3SJBA 2CFOA 1UM9A 5F3WB 1OLOA 1Y8RA 3STUA 2D2FA 3DEFA 2HCBA 3GGDA 2PUEA 2O07A 4N8DA 3S2YA 2HXSA 2ODWA 4IGEA 4QTTB 1UQUA 5EWJA 3KM0A 4BVGA 4NCJA 5CLJA 1E2EA 2PSEA 4XKJA 2O20A 2AW5A 2J30A 5HS6A 1RD4A 4JR1A 1WOMA 1XJCA 3BOSA 3U19A 5AJWA 3W2HA 1E58A 3FWNA 5AUPB 3EPLA 3KKNA 4YCAA 5EJIA 2XMGA 3L4KA 2ZYSA 5A4KA 4Z9XA 4HWPA 1SEPA 4FFSA 2H52A 1X9HA 4QYIA 1LPPA 3UW3A 2D2IA 2NZWA 1KTIA 2H5IA 4LMRA 1X86B 1WVGA 4GMKA 5JZSA 1I1NA 1XAGA 1VGQA 3ZHQA 1YS2X 3OG9A 5HF5A 1PL0A 2BJHA 3K7EA 4DA6A 3K72B 2QUZA 3NUQA 1FDVA 1RRPA 5I3CA 3DEAA 4BQIA 3A6KA 3CPJB 3TYXA 5FO1A 3V8VA 5F64A 3OZUA 1UPFA 1US8A 3DLCA 3KUCA 1B3RA 1ZCJA 5KHAA 2OMEA 3KSZO 2J6CA 2JCBA 1I7NA 4KPYA 1USUA 4ACAA 4OH1A 1I3OA 3QOWA 1K4KA 5KI6A 5IJXA 1EGMB 4C76A 4BN4A 4IG4A 1LBEA 2XTZA 1RI1A 2BGRA 4B47A 5IKPA 2NSLA 3D4PA 3I1FA 4G0MA 5AWFC 4GT1A 4CKEA 4DKXA 2J5KA 1SG0A 4WFQA 2PH3A 4ZI7F 3VKVA 3N76A 5J40A 4BFUA 3MBIA 4MO9A 3C3CA 1I24A 1JDBB 2J0UB 4FGKA 2GLXA 4C14A 1LFAA 2H4YA 4MGYR 2VNSA 2QOEA 4FDTA 1DZIA 4DPMA 2QZJA 1CQPA 2PT6A 2XCOA 4GI2A 4LEIA 1LDMA 1EUCA 2D8AA 4H3KB 2R6ZA 1T29A 2Z5VA 1BX1A 2VI5A 2ZR9A 4JJ6A 4LBYA 4ZPXA 1ZMXA 1XN4A 4Q3DA 2ZETA 3OSZA 1G8MA 4XYEA 4UHDA 4X7PA 2JBAB 1LW7A 5ABPA 3GMTA 2FW8A 4NHOA 1KEVA 4TS4A 4AZ3B 3P4YA 1ZR4A 4J1NA 3MMXA 5EQDA 2H51A 1XTRA 1M75A 2IPOA 5TT1A 3TLGA 3AFHA 4L7QA 4QQNA 3FKQA 3VH2A 3PQ7A 5LLTA 1A71A 1H1DA 2AZDA 2HGZA 4UHBA 4FTWA 3OVMA 1I01A 4H7HA 2GT1A 3GP3A 1WJGA 4WFIA 1OT3A 4N5HX 1M7HA 4UHJA 2R84A 3W8FA 4HTFA 4B45A 3FOZA 3FR8A 3DFIA 3F9RA 1QC5A 1YI8A 3I42A 2V3VA 4E1VA 4NBRA 5SZIA 4M55A 2CEAA 1BCRB 3CEMA 3EGCA 1ZL2A 3UUEA 3DBOB 3HJTA 3B7PA 4YQZA 5H8WA 5HR5A 2H7XA 2IYEA 1GZHB 1YHNA 1W0JD 1JFRA 3I58A 2O06A 3O95A 1E1DA 3L6DA 3OWXA 4N65A 4MDEA 4P3OA 5BV2P 1SCBA 3TNFA 4CMCA 1OX5A 4RUKA 5KKCA 1H05A 1NUSA 1UEIA 3I23A 3UM9A 3ZH2A 5CEJA 5KQRA 3CVVA 3O4IA 5K3FA 2AEMA 1N4AA 4EHHA 5I7OA 1E3TA 1PS8A 4WESA 3HDTA 2V7TA 5ALPA 3RSOA 1U8XX 1D2GA 1E8MA 1PUJA 2P5YA 2VLBA 3U7QB 3IMEA 3W8NA 3EGIA 1XXHA 2AXNA 3T9DA 4ZN6A 3M49A 1ADGA 2VT2A 4KGZA 3BMNA 3Q9SA 3LZDA 4L15A 4WK4B 2AF3C 3L4BA 4MGKR 5DYYA 3L8GA 3G0HA 4L4UA 3AP3A 4RO0A 3RAGA 3M7IA 1ZKDA 4QAQA 1VXOA 1RIIA 1E6WA 2R7AA 1GGMA 5KTKA 3IQFA 3EDRA 1AS0A 1RR6A 3EUAA 3J81A 3WYGA 5KDDA 3F74A 2IXAA 4XCXA 3TIIA 4WQMA 3VR2D 1VPEA 4FHCA 4WKBA 3Q8WA 4MTLA 1AF7A 1GDHA 2F7SA 1DZ3A 2P9BA 4E5VA 1YRBA 3PF8A 3P9KA 4E2FA 1QZZA 2ZQ5A 1GKIA 1A95A 1WG8A 5B1EA 2BBTA 3BQMB 5EVCA 1RM5A 4X8OA 2RHBA 3COWA 4AG6A 1OFUX 3CRVA 1X1RA 1TKBA 2ZJ8A 1P8AA 2VHJA 2PT5A 3IVGA 4TSFD 4D81A 5B36A 5K3OA 3RIHA 1OYWA 1QFSA 4CM7A 4IR7A 2H5EA 2KX7A 1T9KA 4RZUA 1KJYA 2RGEA 1Q21A 4ZMSA 3FGZA 4HDCA 4WERA 1UXHA 3P4XA 4PSVA 2HW8A 5ERYA 1KMHB 1TF7A 4MVJE 2TMDA 1QOPB 2EKZA 3OH8A 1H4VB 2LDXA 3BM5A 3PHCA 3QBTA 4Q47A 2I1VB 4TZ6A 1W59A 1IN7A 3EPHA 4JJ8A 3EFHA 1VQ1A 1CUUA 1XKXA 2CKMA 3GY0A 4CF4A 4I6EA 1GL7A 2ET6A 5IM4A 4I36A 3TM5A 2OBNA 7GPBA 1DARA 3S1AB 3MUFA 4ARBA 1QR2A 3RV4A 3AY3A 4LISA 3TD9A 4G0VA 4IIVA 1RC1A 3B89A 4YREA 3LQ2A 2P5UA 2XF2A 4RTMA 1NOIA 1TIKA 2XBLA 3VJKA 3S81A 3F97A 3HI4A 4DC0A 3U17A 5BR8B 1TMOA 3BHNA 1FFDA 1LLDA 1TX4B 2AD5A 3PV0A 3ZGYA 5AFSA 5DBGA 4HP8A 1RRGA 2HMUA 4RTLA 2RAPA 3R0IA 2Q2NA 1XEAA 1I4WA 2FPIA 3JWHA 4CFYA 5GMOA 4UHEA 3W2IA 4K8RB 4ZHSA 2DBYA 2O1WA 4P80A 2ARKA 3AB3A 2O48X 4KQCA 4URWR 4G8JA 2OXEA 3S1SA 1N77A 3K5PA 1J2RA 5AQ1A 1J9ZA 1K27A 2Q2QA 5BRJA 4QUAA 4PPFA 2O7VA 1E0SA 3VXKA 3N70A 3BSSA 1UBLS 1T3SA 3CWCA 1V3VA 3SD7A 3WISA 4CEIA 3H5VA 5K0JA 3G0DA 4MVJF 1VG8A 2HNAA 2JAQA 3RTCA 4BMVA 4BNDA 1QLJA 4IDCA 1FQWA 5CM2Z 5LNK6 3AL3A 4BKRA 1M0SA 1EHIA 4YRLA 1YQUA 4KL8S 5G0WA 2KLBA 1DEOA 3DE2X 1LPSA 1J22A 1YZGA 1M5UA 3N87A 1MF7A 2IXEA 2BFPA 2XYPA 1EFPB 1RW4A 1WCWA 3CEAA 3G7SA 4INPA 4RIFA 5DTEA 3O94A 2GM9A 2ZR8A 3D7NA 1MX5A 3F5DA 4LDZA 3ZWPA 4CEHB 2VK1A 2PS0A 3F4LA 3VPFA 2P78A 1E0JA 2JHGA 1GRCA 1KI1A 2F62A 2W6QA 3GRAA 5B1IA 3WB0A 2ON6A 2EG9A 5A2GA 2H6EA 1H65A 2GEJA 3AVPA 3VI4B 3I83A 3FSRA 1EEHA 4TLAA 2C4KA 1SIWA 2ZU6A 4YX9A 4ROTA 3U44A 8AT1A 2W42A 3EXG1 1GEEA 2G63A 1YZVA 2RB4A 2YNMC 3RS4A 1PVOA 1RQNA 2O0LA 3MMNA 3U0VA 2JK1A 4PZUA 3PG5A 2CJXA 1MEJA 3F3SA 1N6NA 1A77A 2WOOA 2PUDA 1ZD4A 2C4VA 2BONA 2UUOA 2JATA 3T7JA 4KQ1A 3DKVA 3NS7A 2A9PA 3TR6A 1R00A 1N2JA 1KJNA 3H2KA 2W58A 1RTTA 3ADKA 5HBGA 5ELMA 4S2UA 1QYCA 1QYXA 2B5VA 5DEIA 3WB1A 1SAYA 2ZQYA 2C1ZA 5BW5A 4JC8A 2IZ1A 1RVV1 3LBYA 1CPYA 3K0BA 5I4CA 2YV4A 1PF7E 4JI4B 3GWZA 4D41A 5L3RA 3OPMA 3V2UA 3TCKA 1GZ4A 1G8AA 1GTG1 2Q3CA 4J7XA 4NFSA 3VMFA 1NR5A 5E95A 2GBLC 4DJDC 3G0GA 2BHNA 4U2CA 3V55A 2JLRA 5ADWA 3ZJVA 5H3HA 4IQ0A 3RBAA 4ND7A 2CXXA 5J1TB 3IXLA 4YUYA 3C85A 2PKQO 2YWEA 2FP3A 1E6CA 4KQIA 5F73A 1FX0B 1T8YA 3KYDA 2CYBA 1G8YA 3SJ7A 4MX8A 1BAPA 2YH2A 4DR6B 1Q1QA 1L5QA 3O6VA 4Q21A 1W0CA 3GJ5A 4RHYA 4HXGA 1T8RA 1A9RA 2BKLA 2RH9B 4GOKA 1GTVA 4DMFA 1CZLA 3C24A 3NBKA 5FCDA 4YMLA 5BOSB 3F8WA 2QX6A 2XECA 1AC5A 3B6MA 3NTUA 1VJGA 4F2GA 3GZ4A 1WF6A 2B8WA 4J1TC 3VNBA 4E4YA 1MTZA 4P3PA 4WZBB 1U65A 1V16B 3GDFA 4AECA 2NGRA 2OYSA 1NJSA 4K7JA 4OYYA 4LX8A 1MAUA 1S1MA 4O4HF 1U2TA 1Z28A 1ZSYA 3DCYA 1HLFA 4NX2A 4FYYA 5IG2A 3I5MA 3U5ZB 1NKVA 1YBMA 3P2MA 5KB3A 1J5EB 3GLUA 5A9SA 2ODQA 4HK4A 4UFOA 5IVPA 2GDZA 1I2CA 3AYXB 3HJBA 3KX2A 3MA0A 4W7HA 3VSBA 5B4VA 1UDBA 1E8DA 4JBXA 3FJYA 2R7KA 4WINA 3S2UA 2IS4A 4CGYA 4R8LA 4WK6A 4EITA 2C9YA 1I5OA 1PR2A 3E3OA 4RL4A 4Z0NA 3RUFA 1VA5A 3KV3O 4CQMD 1VRCA 2CYCA 2PUGA 1YONA 1SBCA 2DUWA 1OU0A 3L82B 3AFNA 4MW6A 4NIMA 4RDHA 3GFRA 2MMCA 3WSTA 4E5PA 2CJWB 2WKPA 2XB4A 4JLNA 4N12A 1JA9A 1G4HA 1GZUA 2DR0A 1MIHA 2P3LA 2QMQA 3C98A 3F6YA 1H0RA 2NVOA 4NDAA 3TZ6A 5IJ9B 1RHJA 3E0XA 3VR4H 4CTOA 4XR4A 1OJ7A 2L19A 3KYCB 3RWOA 5EXXA 1EFAA 3T7DA 3SEQA 5CW2A 4O5AA 4UHHA 5DGCA 5K3CA 1NBIA 4Q1BA 2AC7A 4O4LF 1RLTA 2HLPA 2IVZA 1IWOA 1MGOA 2PMCA 3BSFA 3NOQA 4QU0A 4WJZA 3DGFC 3AFIA 2V55B 4MVJP 1E6EA 3H04A 10MHA 1YQXA 1FTYA 1W1UA 2GVZC 1PEYA 3Q7QA 2O3TA 1EP1B 1XMPA 2JZCA 2JIOA 3PUKA 4JNKA 1TD9A 2OWDA 3ILXA 4BGVA 1DTWB 2ZSDA 3VSCA 1WDLA 4N01A 1M2GA 4YV2A 2PMBA 1OSNA 5K8TA 3AF0A 2GZ1A 1MJNA 1OVGA 1OLUB 1N7JA 2JFHA 2KBFA 2PANA 1G63A 4MW7A 1M8KA 1LWNA 1NQ5A 4NYIR 2NV0A 1R6XA 3I01A 3H7IA 1U0SY 4FYMA 4US0R 5FYDA 3JYHA 5SYAA 4COKA 5K0GA 2QN1A 1XKTA 2EFHB 5HNKA 4BNKA 5C34B 4LNHA 1PWHA 1RXYA 4FKBA 4JGIA 4D96A 3IE1A 3P5BA 3COJA 2FUG1 3PXBA 4GUDA 4ZEWA 2KBEA 1FRNA 4BNNA 5BT9A 1DWPA 1X7YA 4D1YA 2BGGA 4FFVA 4KIJA 3VGJA 1K75A 2EKBA 3CUKA 5GOZA 4G8CA 3RIYA 1KYWA 3D6FA 1KYVA 3ZWBA 2NW6A 3FYTA 5DGIA 2HFJA 3BYZA 3C6YA 1OW3B 1IZ8A 1J0BA 3C5CA 1T2NA 2ZIWB 3D7SA 2BW0A 5ITWA 2CXUA 2ODNA 5KSZA 3DYBA 3QM1A 5KOYA 1E4EB 3QEBZ 1BXRA 5EXPA 5ICGA 3HB1A 4AZ0A 5DLYA 1OILA 5EIOA 2GK6A 3ZOZA 2ERYA 5JI2E 5LXTA 5ED0A 1TT7A 2PKEA 1PQUA 4REMA 1G21B 3BJIC 4RIHA 4EDFA 2H1CA 4F5YA 1EVLA 4UFNA 2AQIA 5A3RA 2QTGA 4R2XA 1MC1A 1S9DA 3PPXA 2HQRA 2P0EA 3O3CA 3QU9A 3G49A 1MJGA 4UTNA 5BWNA 3H2GA 1CF2O 1Z6GA 3KT3A 4ENVA 2GEKA 4IMIB 3E7FA 3CNQS 4MQLA 4X6LA 3T8YA 2XB8A 3CCFA 4IOLA 5DLDA 1GZ7A 1G3UA 3KOOA 4K05A 3ADPA 3E5RA 4O0MA 4WOCA 3RLIA 4X64B 4W5QA 1O77A 2IS6A 1YQDA 4O2AA 3H5AA 4C4YA 1BZYA 4MQ5A 2HTFA 1IHUA 2WSSD 3UHJA 4OUKX 1H8HA 3TECE 3FFXA 3UA3A 5MDHA 5A3VA 2Z2YA 4J0IA 1DAIA 2NU7A 3LGAA 2C96A 3X43A 4OXXA 2QUBA 1PGNA 2ST1A 2HJWA 1UC5B 3F49S 3OQJA 3Q9LA 1IJBA 1HQYE 3OECA 3M6LA 4M8LA 2D2VA 1EYZA 1DBPA 1EBBA 4HX5A 4AUEA 4NSNA 4ML3A 1YQ9A 2XV1A 3BH7A 1CUAA 1D2AA 2YIDA 2IEGA 2NZ2A 3C3WA 1WMEA 4U2GA 2Y1KA 4HLDA 5LBTA 1DQYA 1N75A 2A9KA 1XQYA 3AZOA 3NHZA 1C1YA 1FU4A 2QWXA 2RHGB 2ILTA 1Q3KA 3AOEA 4MV9A 1M34B 2ZZKA 1OCEA 4I4NA 4HAYA 4EHJA 3BWEA 4GOND 4GPEA 2VJMA 4ZZ1A 4A6EA 5IFKA 1TK9A 4UVGA 5AYVA 5DHQA 3G8BA 3WKBA 2X76A 3IQZA 1JJIA 1GLNA 1WV0A 4IYRA 2LP4Y 2HRZA 3I62A 4CDRA 5JE8A 3NHWA 4ZJUA 1ZJJA 2PUWA 5C1OA 1THGA 1RM3A 2ZUCA 1U3GA 1GZ6A 2Y1LA 3E22B 1AKVA 1S96A 4XEHA 4GZ5A 5IZCC 2X9QA 3OZ7A 4R1QA 2B34A 1SK9A 2HMVA 4D3YA 3JS5A 4YCDA 5BV7A 1Q3TA 4GZ6A 1DWOA 3LGSA 4QQRA 1U2GA 5DNYB 1L7RA 3N2GB 4OYLA 5EEGA 3F5QA 1LTHR 1R4NB 1I2ZA 3F1LA 4RGYA 4TMZA 4MCJA 1CF4A 4P32A 1CXZA 4PZDA 4AI6A 4PZ0A 2AXPA 1QRTA 2WTNA 2H2IA 2C0QA 4QEKA 3ANTA 2H4JA 3DG9A 3TDKA 2OM6A 3B1JA 3HWX1 3KKOA 4ZOLA 3OZAA 3R5TA 4K2HA 4UBOA 1NURA 2WFAA 2VXCA 3O4RA 2G83A 4GQBA 5LB4A 4KE8A 1LVUA 4U7DA 5AW0A 4ZZ3A 3CNHA 3E4DA 3UAOA 1K5DA 1JKJA 5BN1A 4BFZA 4PC3A 1JPVA 4OQDA 5IYZF 4RYDA 1L7OA 4CM1A 5E7IA 2RHDA 1GJRA 1Y9DA 2WTMA 2IYUA 3EGOA 3PTLA 2YWDA 4K3UA 3UJDA 5KNBH 3RIEA 1DMSA 4AN4A 2V58A 1JSZA 2GEFA 3NBUA 1P3DA 1YQTA 3HVJA 4HNQA 4RFSB 3NI2A 5BV0A 1MO2A 2HRRA 4XM2A 1BD4A 3EOAI 3KEFA 4JL8A 4BE9A 5HKBA 3RUPA 5KCZA 4BFXA 1RPZA 4I4CA 5U1PA 3OPYB 5JARA 1XD9A 5CVEA 3RGWS 1RLMA 3EC1A 4XD7A 3DE4X 4CU5A 4GPIB 3JQQA 4DABA 2C4UA 5HFAA 3EZGA 1Q1GA 1Z8NA 3IDAA 3TRKA 4H27A 5DEOA 2Z30A 4ZDIA 5JYDA 5DDIP 2OHJA 1L1RA 1QFMA 1FNCA 1K5PA 5DX8A 3JQGB 3VX4A 4OHWA 2B4RO 4AG5A 4BNZA 5CT6A 4JLUA 3JQ8B 3OY2A 4DLWA 4GMXA 3QVSA 3ASZA 3TR5A 3NWBA 1QPGA 3ORSA 4BQPA 3WGIA 1CR4A 3N0VA 1YZ3A 3PEEA 3S6JA 4B6EA 5FHRA 5C5IA 3U2QA 3W78A 5HZGA 1QH9A 4K9LA 3AKEA 3HUEA 3GAFA 1KEWA 1YJ8A 2A5JA 2D2XA 2IHKA 2ZSFA 3FSGD 2A4MA 2WQ7A 3WGKA 3ZXXA 5BV8A 1PWEA 3HL4A 4F11A 4DW8A 1SD5A 1J4AA 4F4IA 5J3JA 3HXQA 2PKXA 5K0CA 4CVNA 4HH4A 1DAPA 3LU1A 1TE2A 1Q91A 3D4LA 1QVAA 3D7MA 5KTRA 1Q0PA 3O9ZA 2QM0A 2EVWX 4CKBA 3O1IC 3ROXA 3G89A 2DWUA 3GLGA 4KBGA 5CW1A 1V8PA 3BE6A 2QVBA 1XA0A 2EX4A 1QIHA 3PQ4A 3WNZA 5LVAA 2P35A 2I6XA 4WOJA 1PR1A 3L49A 5JBIA 4YBZA 2BGJA 4MQEB 2HRDA 5DN6D 3NGXA 3G8YA 2I87A 4KITB 1EDOA 4YFVA 4HZUB 1XCPA 4MVWA 1ULUA 4ZT7A 5B58T 2FCRA 3K31A 4Q6WA 3N8DA 4GICA 1NFRA 1NUPA 1WDTA 1DRJA 3RFFA 3ZCVA 4DY4A 1PNRA 1V11A 3RUCA 3ZXSA 1GUAA 1UM8A 2QYOA 3E9MA 3UICA 4D9MA 4DQXA 2N75A 4GX0A 4MEAA 4U7TB 2QTHA 2J5XA 4KLZA 4XM0A 3ZUPA 4A82A 5CA1A 1CB0A 2XEDA 5F52A 1MXHA 2AI3A 4E5MA 3JASB 4ZHQF 2W8ZA 2CVHA 1Z07A 5JVDF 2FKAA 2I80A 2GR9A 4TT3A 2PJDA 3FCXA 1ZZEA 2VF7A 1RWOA 4KE7A 1TLLA 2D59A 4JLKA 1T9BA 4KVZA 1W36B 3EEYA 5E6UB 4QGAA 3RADC 3ZGZA 4K0RA 2V7UA 5C37A 5FA5A 1E2LA 1T6ZA 2BMFA 2X23A 3TMAA 5B3JC 4KYIB 2J3LA 4AJ4A 3CT6A 4MWBA 1QHYA 4B31A 3W9BA 2I62A 3PHBE 3W3ZB 1PZFA 2QUHA 1IVSA 1LRLA 2CB0A 4HLCA 4JNCA 3OY7A 1QV7A 1UDXA 4ISBA 1F5SA 1X42A 3USES 1Q1BA 4F5EA 4H7EA 3P0HA 5LM3A 4KNVA 3RARA 1OXXK 4IXTA 4G8BA 1XRQA 2VJQA 3LQ1A 5EE1A 4CKWA 3UJPA 3EFOA 3ICEA 1VLQA 2IC5A 1QCZA 3BMQA 3UJ9A 3M0EA 4WH0A 3A4YA 1W5AA 1EWVA 1BWRA 3CZRA 1Z4PX 1MHTA 2QLNA 2YXBA 4EHDA 1RCUA 1GRVA 3T4EA 1T3TA 2NVBA 3PS9A 1ZWKA 1J09A 4K9DA 4FX5A 3U39A 1RM0A 1XTZA 3FYCA 5IDVA 1AIPA 1COZA 2JFNA 5SY9A 5BQ3A 1ZJ5A 3WX0A 2AG6A 1EWTA 3VSDA 3CGGA 2XI4A 1I10A 4R40A 4YRAA 1CQZA 3BXZA 2V7QD 4WNCA 3UG6A 1P77A 3A7EA 4W99A 3ZD8A 2HH9A 2VJPA 1R16A 1R37A 1T4DA 3ZKWB 4JI5B 2GPTA 4Y6OA 4FXPA 4TM7A 2MSEB 2OAQ1 3LY9A 3VR1A 5KOJA 1HT2E 2YWHA 2P6NA 3NEPX 4WXYB 3VZRA 5CFPA 3GB9A 3E9ZA 3EWSA 4TRRA 4BLWA 5CFQA 3LHIA 1UFOA 2A14A 1SQ0A 1OZAA 2JNWA 4MVJM 1M3SA 4FC6A 5TMEA 3PPYA 4AWAA 3QNMA 2FPUA 3SC3A 2ZRJA 4ETNA 5FPSA 4CKYA 1OTYA 3CNNA 3FOBA 3E7XA 2QRNA 4B2PA 1ZWLA 1C7IA 4B3JA 1U6IA 3SBEA 2IZOA 5EPOA 2JLYA 3G8AA 3K9LA 5AXCA 3C6MA 3MCVA 3QMPA 3RBXA 4E14A 3TI9A 3VU1A 2R97A 4J0EA 4P3KA 2FFAA 5E8RA 3GT3A 4HDMA 5DYTA 2GAOA 5AM0A 4KCGA 2QL7A 4MUYA 3QNUA 1KDRA 2PV0A 4YAUA 3CX3A 4OGWA 3ZNOA 1PNVA 3CRQA 2C5EA 3FIUA 1JHMA 1KMNA 1ZMRA 1Z4IA 2V5UA 4AQDA 1NWHA 5AUQA 1BDBA 1O8CA 2LDBA 1ZM9A 3KOMA 4GAEA 4LDPA 4V3CA 3ME5A 5FRDA 1GAQA 5C46F 3JZAA 3B7GA 3FFBA 4R1PA 2Y0DA 3AM1A 2W6OA 4IEEA 1KYQA 1WXXA 2DSNA 4LY9A 4URZR 1SNYA 2IOFK 5I5GA 2EEPA 2I6TA 3B2EA 3P96A 5JJCA 3NBMA 3WG9A 3AVVA 1TW2A 3JZIA 3A8TA 4AKHA 1VJTA 2GN2A 2RMKA 1EAMA 3AP1A 5EKUA 1X8LA 5DNUA 4MK4A 5KVQA 3PDIB 4PC7A 1RDFA 2W6MA 3HBMA 5ALIA 3VPBA 1PIWA 3ZE6A 5BPFA 3KUUA 1BJKA 2PYIA 1B00A 4A5SA 3QEOA 4ZOCA 4OB6A 4NCAA 2R6HA 4J4HA 1KI3A 2G9UA 2J5QA 2C1XA 2XWBF 1WCXA 1YDHA 3L7YA 2Q7DA 5JC8A 1AMOA 1OD6A 4DMHA 4DR7B 1NI3A 1ZH4A 1Q1EA 3TF5A 1GQFA 1QB8A 2O8FB 2ECKA 1WXGA 3HVKA 1I4OA 4GOJA 4UCQA 5HJEA 3MGCA 1QKIA 2DQ4A 3RTAA 1NU8A 3VHXA 4OMCA 1FVXA 2HLDA 1B0PA 3LY8A 2AL7A 4CHTA 5M04A 1ZD5A 3KR0A 3Q41A 4IIJA 1XXLA 2DCMA 3FUTA 3P45A 1NVGA 1ISFA 2VC2B 1JH8A 3DO6A 3T9EA 3C74A 3LBHA 3TIGA 4L4SA 1ZXBA 1Z6YA 1MIOA 2VAXA 2Z9DA 3Q6MA 4KW7A 2N42A 3FHOA 2QXTA 2VHCA 1TYAE 3OF2A 5GV7A 3WE7A 1QAMA 4O4IA 1L5OA 2HMSA 2CMKA 2FDRA 3GVIA 3TE6A 3TEFA 5IDQA 2BH2A 2FF5A 5JBNA 3TLEA 2B37A 3OZVA 4GWLA 4X61A 5IPFA 4MUGA 1J23A 1EP2B 4OLJA 4CRWB 4P4SA 5MF6A 2B8NA 3U49A 1JHZA 5HIKA 3CG0A 1FNNA 4H3VA 4RE5A 3OEHD 2UYQA 3HC7A 1ULTA 4TUYA 4IV8A 3HV0A 2UU9B 1Y98A 2FPLA 3A4VA 3SQLA 2F43A 2YVAA 1JGTA 1UBNA 3GA7A 2JAOA 1Z2NX 4LF5B 4N5LA 3CG4A 1NR7A 1H42A 2VPTA 2IOHA 2GO1A 4XB6B 3H5OA 1S3FA 2VSNA 4GLFA 4OQFA 4Q03A 3GRVA 5HWSA 1VFNA 2YUIA 4TPKA 2QJOA 2GVNA 3N07A 5FFFA 4ESOA 1XZJA 2CUNA 1QVVA 1U8CB 1NVTA 1ONPA 2RKOA 4XQEA 4QICA 1RJFA 3K9FC 3EVAA 3IUPA 1HT3A 4JOCA 4AKEA 2JH3A 2C7VA 4IFTA 1ADFA 2NU6B 4D3SA