2JS7A

Solution nmr structure of human myeloid differentiation primary response (myd88). northeast structural genomics target hr2869a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
160
structure length
160
Chain Sequence
b'MGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myeloid differentiation primary response protein MyD88
publication title Solution NMR Structure of Human Myeloid Differentiation Primary Response (MyD88).
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 41
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 2js7A01
4W8HA 4LQCA 1T3GA 3JRNA 1FYWA 2J67A 5H3CA 4LZPA 4C7MA 4OM7A 3UB3A 5KU7A 4C6RA 4FZ5A 1O77A 2Z5VA 4W8GA 4DOMA 2M1XA 3UB2A 4EO7A 4C6TB 4C6TA 2Y92A 3UB4A 1FYXA 1FYVA 2JS7A 5FORA 4LQDA 3OZIA 4C6SA 3H16A
chains in the Genus database with same CATH superfamily
5EIFA 4UKDA 4XA8A 3F6RA 1O6BA 1ID1A 4NPAA 4WK6A 5IBCA 1BDHA 3CM0A 2BMEA 1YRYE 4BXOA 1B15A 1XZMA 4KX5A 5EHQA 2NM0A 2H1OA 1IZ7A 2BCEA 5IBQA 4KYTA 5K99A 1LY1A 3UMBA 5K9ZA 1OJLA 3COVA 4L95C 4CCYB 3CLRC 3OJOA 4CYMA 3B6IA 4Q21A 1L7PA 3STWA 1HG1A 3SICE 3IQXA 1RXYA 3AIKA 2IYWA 1QV9A 3CLSD 3A6DA 3G7SA 4K86A 4ER7A 3LY5A 3ZKWA 4RDXA 5KTKA 3CLUC 3E2MA 4MYTA 4CG2A 2ZAMA 4RD4A 2WZCA 4EBFA 3NC4A 5L4SA 1DEXA 2ASEA 3FTCA 4BFTA 2YCBA 3W05A 1IIBA 2I6TA 5J63A 1RYYA 2C57A 4ZOAA 3VKUA 1WL8A 3OU2A 4PC6A 3FZEA 4LG1A 4XRGA 3H17A 4OSEA 1LV7A 3SJAA 1Y1KE 1MO4A 1I14A 2MDTA 2NVBA 2F8SA 2PUWA 2YJZA 4NBTA 3EVGA 4F2DA 1WU8A 2ORED 2GETA 5FI3A 1MTOA 2MYUA 4RZXA 4BYGA 4LYJA 4D9BA 2X4LA 4D8TA 3OM9A 1USVA 2Q6KA 1RRVA 2ZAYA 4R2XA 3P20A 1QK4A 2IU6A 1UAYA 3MINB 2AG8A 4DR5B 1DX9A 3FDFA 1C7ZA 1HSOA 4BGDA 4F3TA 3ICCA 3NRBA 1GAWA 2UV8A 1L7MA 1ODLA 3EXEB 2YWCA 3GO4A 4ZVLA 3EIQA 4BX3A 4CEHA 3D4PA 2PV0A 2OFPA 1YC2A 2QPAA 1T4BA 1U6JA 3ITDA 4BATA 2EGGA 4ASUA 4DDVA 1ZNYA 4WNAB 1UKZA 2D4HA 4P4TA 4PO8A 4Q24A 5D87A 1V95A 3F4LA 3R7BA 1KEKA 1LFDB 2NU9A 3ORYA 5KS2A 3AKCA 4HLQB 3LPAA 3A6ZA 3PL1A 4JB3A 2GBIA 4NPHA 4QARA 4S24A 5EJFA 2OFFA 4A6PA 1DWOA 2O52A 3DP9A 1PZXA 4DY6A 1XEWX 3CVVA 2IUSA 2V98A 5IVPA 1EWTA 2NSHA 4DL9A 1PR1A 4ALIA 1YA6A 2Y99A 4QU0A 5JWHA 2F1OA 3FPHA 5EQFA 2UZ3A 2OMEA 3FPCA 2AOUA 3HCRA 4BMNA 3EZXA 2YX1A 2C9MA 1RCFA 3AUSA 3C3BA 3F3YA 1XHFA 4ITVA 4EWLA 1T1SA 3KUCA 4GRDA 4R9SA 3AJ9A 5FP0A 3SJUA 4TYQA 4NAUA 3UMJA 2FW8A 2WTXA 3P9NA 3PGKA 5TS2A 4M4SA 2YV1A 1LX7A 2F4NA 4BQSA 2H07A 1ZVMA 2W71A 3U6KA 5JVDA 1D0VA 1RS0A 1GPJA 4BCDA 4EATA 1ZD5A 3MS7A 2XODA 4FSXA 3ADKA 3ET4A 2HQ1A 1IB0A 5IJ9B 1PO7A 2ARKA 1X8JA 2VYFA 3LK6A 2GSWA 4UNPA 3S4YA 1UKEA 3E70C 3ZXIA 4EKYA 3VNQA 3DV0B 4IAOA 2X77A 3ASYA 3QX9A 3ZY2A 4B8ZA 4MS3B 1LB1B 4Q4LA 2D3TA 2ZRIA 1C41A 1PBNA 3FF1A 4D4IA 4XI9A 3TW8B 2HBRA 1HV8A 4FYHA 4C0SA 2WT8A 1KEEA 2QMZA 2JJ1D 3WLKX 2WAYA 1IHUA 4BJ5A 4EVIA 3W5UA 3T7CA 4KR6A 2ZQYA 3BAZA 4BB5A 4DRYA 3CUSA 4QGFA 1CUSA 1F4LA 2C2KA 4IINA 5HBRA 5LN1A 2QAGA 2XF2A 4FLMA 4RU1A 3DLTA 4PZYA 4Y9DA 1DEKA 3IBFA 5C3MA 2VNJA 2X3UA 3AR6A 3CZPA 1SZDA 3ISTA 3P9YA 4EG4A 2RH9B 4WX2B 5AVTA 2VQEB 4S35A 4M9RA 4PSCA 2EOAA 4HQLA 3GR6A 4GZMA 4XKJA 3L7AA 4R9NA 4BAGA 4LS3A 5CK5A 5CW2A 3ZDZB 2XGOA 2OQIA 3S2ZA 1N34B 3LHIA 3NHLA 2ANCA 3DHEA 2BM0A 4NBWA 3P45A 4UNNA 2JIOA 2J1LA 5KOIA 5G0TA 2C2YA 2DB3A 4H08A 1Z83A 3V1NA 3FMFA 1RPAA 1C4XA 1RFGE 2AB0A 4BXOB 2YRWA 1G8YA 3GVPA 1E2MA 1PLLA 1P6QA 1UR5A 3PD0A 1ZHFA 4WXPA 2WOOA 2HNKA 4JJKA 5HA5A 3EPKA 2WIJA 5L8VA 4IXMA 1SHZA 3RFFA 5LQRA 4OQQA 3V42A 2A57A 2ECQA 2W2QA 4P34A 1BKSB 1T8PA 3SE7A 4JLAA 3DEFA 1R6XA 1TGYA 2GARA 1SKUA 2OHVA 3QBJA 2QBYA 1XZ8A 3RWMB 3RRZA 2VK4A 4HDAA 5LYJF 3A28A 2QU8A 1M66A 1XCMA 5E2BA 4X91A 4PFKA 3UPUA 4C6SA 3AL3A 1M6VA 2GEVA 5KVAA 1M6NA 3MMZA 4KFSA 3RHSA 4CHGA 1FJXA 2PTGA 3KO8A 5JTTA 3GLGE 4JBLA 3EA0A 1XP8A 3T9CA 4JAVC 2FEXA 1WCV1 5E3JA 2KPOA 2DFDA 2V7QD 2G1PA 5F98A 1AZSC 2RAFA 1XBTA 4ZV9A 5E7JA 1X74A 2LNDA 3KQLA 2P5SA 2AKYA 2B4YA 3D4NA 3EY4A 3GL9A 2WF8A 3KC2A 4HDCA 4LI0A 1R0CA 1SUIA 3CBGA 1SJ9A 2QZJA 4BQOA 5AUNB 2QTCA 3NOXA 4QAQA 5K8TA 1TQHA 3TE6A 2R2AA 3FFWA 3W4JA 4YUVA 1M1NA 2IT1A 2VIIA 4NSNA 3ZDXB 4XLLA 3I61A 2C7QA 2OYRA 2OAGA 4PX5A 1OXMA 5DMHA 4CEHB 5SZJA 4OQFA 2QM3A 3GLGA 4IUCS 4L27A 2JJ8A 2PT7A 4ZC8A 2I67A 1MOSA 3DEZA 1E9EA 2JGIA 4FGJA 3EYWA 4PPQA 4U6SA 3NU1A 3K2QA 1NG1A 2O2XA 4X97A 5T4BA 1ZYUA 1EWQA 5AW8A 2NU9B 4EQZA 4WNYA 2XNHA 1PFUA 3ISJA 3R3UA 1V1JA 1RU3A 1DDIA 2VSFA 2ZSBA 3X44A 4QVKA 1QB7A 1FDIA 4E5YA 2AG1A 5TMEA 3KQUA 4AJNA 3RVDA 1LSJA 3L8MA 4LFAB 3FFBA 2VJBA 2H3EA 2G5GX 1WP9A 1TYCA 4N49A 3ZGLA 3AFNA 4XUDA 1XVUA 2AOUB 2QNIA 2HU2A 3CZCA 4R81A 4DA0A 4KPFC 3F5QA 4FZJA 3QPVA 2EC5A 5EUCA 3R0ZA 2H6EA 1RM5A 4GSKA 4Q9HA 3P9SA 4M8IA 3TX6A 2AV6A 2HWXA 3VAZA 4BX2A 1OUMA 2L18A 2WILA 5K8UA 4OJQA 2CLOB 2VUSA 4RTPA 1QG6A 2KI5A 3O84A 4CM8A 2ZATA 3E3AA 1N6IA 2FPOA 3HI6A 2G04A 4KQFA 1H05A 5JVDB 3PQ8A 4ZVOA 1Z2OX 5HF5A 3UAVA 1TCAA 5B7QA 3WHKA 2YFKA 3LTEA 5LOVF 3L04A 1CUHA 1NQWA 1EVKA 1YC5A 3VYSB 1O9BA 1TZMA 1KEEB 3HJCA 2WPNA 4JP2A 2I7VA 4MKXA 3SSMA 4ZYTA 4I19A 1RTTA 1KYTA 5H3HA 4E2XA 5H9VA 2PMCA 4P7FA 2BR4A 1PJTA 5JDIC 4CCAA 9LDTA 1GADO 2R00A 4G24A 5EERA 2GPWA 4XM1A 1U81A 2GKOA 2QAGB 3ZWCA 5HJ2A 1RMYA 1WG8A 3QWFA 5FA6A 5BW8A 2G09A 4DV7B 1D07A 4FLEA 1YUMA 4BJ3A 1UBSB 1YR2A 4JGBA 5C4GB 4D74A 4OLAA 1QZUA 4BIMA 4QJBA 2YVAA 5FPPA 2G1KA 2KBFA 3A7EA 2YOFA 1MVOA 5DT2A 2MSCB 3VDQA 3I6MA 1WY7A 1G8HA 1YFJA 3HA2A 3JPWA 4H6WA 1DRKA 2VAVA 2RDMA 3KS9A 4IOJA 4YCSA 2UYQA 1EA7A 1U5BA 3OEEA 4NR0A 2YXPX 3TG8A 4R5HA 5JG7A 2FCRA 2ZFUA 3HWSA 4DA6A 1KERA 1A88A 1FY2A 1I2DA 3K9HA 1Y3HA 2IHJA 3LK7A 4X1OA 2I7XA 1OFGA 4CF5A 4F12A 1NVXQ 2LIVA 4JLJA 3EEOA 4CLOA 5A7HA 1I1OA 1VJ0A 2ZE6A 3O4HA 5FTNA 1NRJB 1Z39A 1K63A 4UDNA 3IIMA 1NXPA 4WH0A 5T5QA 4D5EA 1LV8A 3ANNA 3DLAA 4MGZR 1JS1X 5IHPA 4IIHA 2HGSA 3I37X 1XQYA 2J7PD 2JATA 4WASA 2QBYB 2QRVA 4BX8A 4CQLA 4ZPXA 2HX1A 2JI4A 3ADBA 1E2GA 2RIPA 2HWYA 3N2NA 3STXA 2QVGA 5IAAA 1ID8A 5DWVA 2OECA 4MRSA 4URXR 3L1HA 5IAEA 3RW9A 1H5NA 2F9LA 2LZ0A 3VZCA 5ALXA 3SCZA 4FYKA 1W48A 1H9BA 2FUG6 1BD4A 1VE7A 4MVXA 1KEPA 2NSDA 3OOWA 5C31A 1FNMA 1MFPA 1OHHA 2B0CA 3TTYA 4BUJA 1PJ8A 1T9KA 1QAMA 3NHKA 4J1TC 1PGQA 5BN1A 5K01A 1C0LA 2QTLA 4K40A 1ZH2A 2MSDB 2O3QA 1OLOA 2WUFA 5KREA 1F2TA 3WLSA 3ZZUA 1CYEA 1GR0A 3K5WA 4EHKA 2FLKA 3OOSA 4EA7A 2FWMX 5JNSA 2BPOA 1YKFA 2JHGA 4U5XA 1KI2A 3INGA 4AY3A 4FD3A 2EFHB 2PQ2A 4CT0A 2PL5A 1UP6A 2Y1WA 3GLQA 7ADHA 1RAIA 2RGNC 1M1NB 2CVHA 1A2BA 1U1FA 3K70B 4N3CA 1CEYA 4TLAA 3LNTA 1M7GA 1Q1QA 1BG6A 3HB5X 2FFQA 4MCJA 5AJWA 3GLGB 1XNRB 4QJIA 2D00A 5EP3A 4RTJA 1TZKA 3JSXA 4KLZA 1F0YA 1OZHA 5HX7A 3LJKA 2R96A 3ZE1B 2V1XA 3TJZA 5JXWA 3EZNA 3C7TA 4RGQA 4WACA 4BQIA 1PZEA 2JLQA 1YDEA 2HYDA 1A9PA 4YRDA 3A2NA 5CM8B 1G66A 2CLKB 2QK4A 3V2IA 4B4WA 3OPVA 5CH5A 4D3YA 4JXZA 4KFUA 3L9XA 4G85A 2I6GA 1HLPA 5JJBA 1N3YA 1F8FA 4TKLA 1E79A 2X42A 3PFBA 1KRHA 2OXIA 4MW1A 4A0FA 4E4YA 4YUYA 2H1IA 4C2AA 3KOZA 1W9MA 4Y9TA 4N0DA 4RH0A 4C0WA 3G0IA 1E2DA 1EWYA 1UWLA 5HIMA 4IOLA 4XVRA 4A6XA 1UFKA 3R1IA 4PVCA 1R8SA 2XWJI 5I4IA 1R8YA 1SWWA 3O8BA 2QR3A 4WI1A 5D86A 4GM1A 3SU8A 4G0XA 4Y9SA 1B74A 2KB0A 5LP6C 3WBFA 1WMDA 4J4BA 4EDFA 3O4RA 1Z29A 3UHPA 3GLTA 3LMKA 5CLJA 1HURA 3MWJA 4OXKA 5DNEA 4EA6A 4LCJA 2C3PA 4EW3A 4L72A 4Y2PA 1X92A 2V54A 1R6UA 1QGOA 3QKRA 3F74A 1IEVA 3DTVA 4GVPA 4OJKA 4OM7A 5F4ZA 4BX9A 2ENUA 2JASA 3AHGA 3D0QA 4GYYA 4Q4JA 5B2FA 2ERXA 2Z8XA 1B76A 3NM5A 4N82A 3ETJA 3IP8A 3M5WA 1ECLA 2IP1A 2NUAA 1SBNE 2JFZA 4BYMA 1VMEA 4DA4A 1AIPA 1JH8A 3G9QA 1R1DA 1KTVA 2I33A 4TVSA 2VYND 4YMUA 1QX3A 3MD0A 2N1BA 2BDUA 3N2KA 4OBWA 4UUMA 1PKEA 4JI5B 4G63A 1MB3A 1L5KA 2V59A 5CRIA 3K31A 5DM70 3RROA 1C0IA 3INNA 4OI1A 4MVJH 4M37A 3ZTTA 4DCNA 1N0IA 2VUTA 3IKJA 3TLBA 4NS4A 3MS2A 2OLKA 2ZAOA 2WUVA 4IJWA 4ZU1X 1FP6A 3W6PA 3NAMA 4ZIRA 1KYVA 4XGRA 5JROA 1CUIA 3K96A 3OIFA 3QFCA 2XPCA 2FH5B 1RPJA 2P40A 4PZ9A 5JMPA 3RUAA 3EVNA 1PJQA 3VBEA 4M0EA 2FPIB 3BIFA 3HNPA 4PLYA 1G16A 4COKA 4PQEA 2C9CA 4CEJA 1J0EA 5B57C 1EBUA 3HH8A 1VLLA 4JUDX 4QQNA 4X6XA 4EFNA 1YR3A 2ZBEA 3WIDA 5EIHA 1JV2B 1UK6A 4ZEVA 1EU1A 3L7YA 2BTQB 2O4UX 3L6EA 3R77A 3U0BA 1C8LA 4BO2A 4HK4A 3KD2A 2CGEA 3CS3A 3ZIAD 4QUJA 3NH6A 3W78A 1KAEA 3H5WA 1OWLA 1QFJA 2JIRA 4Q37A 4CLOB 2I03A 1ZGJA 3H2GA 4JQZA 3VPHA 2EBHX 1JHVA 2X1LA 4FCVA 1ZK0A 4KQHA 5G1OA 3ZU3A 5E8RA 5T4HA 2ECOA 4QOIA 1ZK3A 2AL7A 2B8WA 5IDVA 2AG6A 1YCDA 1Q0RA 5IDYA 1PT8A 4ND4A 3WRYC 1JHXA 1NLMA 4A1OA 2GF0A 3C5HA 3C1TA 4UJ3A 4B43A 3CH6A 3D7RA 3N7UA 1MC5A 4Z1OA 1YBMA 1JEOA 4MWCA 3H9UA 1JJFA 5EKTA 3EPJA 2O3JA 2WUWE 4O5AA 4G01B 3NW9A 2PX0A 1K6MA 1W59A 2HXGA 2ATCA 1EVQA 3RJ5A 2R7MA 4BP3A 3NDIA 5LYJA 1O03A 2Q1TA 1XTTA 2C77A 2G4LA 1F2TB 1KDTA 2JIBA 4YCAA 1TXGA 5BSGA 1LQUA 1L5HA 2JLBA 4FPXA 2FUEA 4A03A 1ONSA 1QHGA 4KQWA 4RVFA 1RYFA 5JEDA 2Q29A 3OZRA 4POOA 2JKYA 2H85A 3OCWA 2N47A 3VNBA 4UCXA 2OBBA 3CBQA 4PQYA 5LVAA 4OYLA 2Q2NA 4DADA 3QU9A 1P1BA 1ZVJA 3IKTA 1B6GA 1OLUA 1PTJC 3K8QA 4O2LA 1T0PA 3CE9A 4HC4A 3RV4A 5HKKD 3IBSA 2FPPA 2QTBA 2RH4A 1H8ED 3FCYA 4DRXA 5A3RA 3WQSB 3FYSA 4M0FA 4W9NA 2F59A 2I34A 1NKVA 3QIAA 1Z34A 2B7CA 2DUNA 3D7LA 3KQPA 4TS4A 7MHTA 1G5QA 4E0BA 1WXIA 1QIGA 3IIIA 2E82A 3VYUB 1C0EA 3HI4A 2V6IA 4JC0A 1JWLA 4KFCA 2QUKA 3EODA 2I7TA 4UE6A 3FHJA 3U3RA 4M1KA 5BNTA 4B6SA 5FWYA 1DINA 3LECA 6Q21A 3QF4A 3UWOA 3KYCB 5DX8A 4CLRA 5EKUA 3BK2A 1SBHA 3HXKA 3SC3A 3VR2D 3QV2A 4JI2B 3F7NA 2J3HA 4MI3A 1QPGA 3PFKA 2X6RA 4BL5A 8ABPA 3RH0A 3VDNB 1T8RA 4BFZA 2OZLA 4CJXA 2XI4A 2H1WA 3DONA 5I7WA 3VSEA 1RXVA 4GZLA 2DTXA 3BGDA 4PZAA 4YDQA 5LMZA 1QWSA 3EGEA 4H6XA 3BIJA 1E0SA 2X8AA 4Q1CA 1AKNA 2GF9A 3JCZA 3NAZA 3WFJA 4QNMA 3ZW8A 5FHRA 5CT4A 1IN7A 2WPDD 3ACDA 2YJ3A 1ADJA 2FSGA 4KC0A 5H3CA 2E55A 5ULLA 4XXHA 3NUQA 5JSYA 4C14A 4NDAA 1OH8A 3QKRB 2HRBA 1WHTA 3DTVB 4IFEA 1XROA 4TWBA 4CN9A 1E0JA 1XRJA 1G3IA 5JH7F 1I5RA 4G5XA 2CXHA 2X86A 2EKBA 3NM4A 4FC6A 4Q4JB 5AVSA 1TF2A 3SOZA 5JALA 2ATVA 1GJRA 2OO5A 3GBSA 2I7CA 3CRW1 4JU9A 2NUAB 3HYNA 3U7QA 1RHJA 2HQBA 5FDFA 1TFRA 1G63A 2FDXA 4J4TA 5EKXA 2Q9CA 3R74A 1CT9A 1GG5A 2ZRGA 1DIGA 3VC3A 1QHNA 2AG5A 3LLMA 3L0ZA 5ISMA 1PT7A 3N2KB 4K5QA 4EL0A 5LOVA 3EGXA 2HAEA 3PLNA 1F48A 1UC5B 1SBCA 4HNQA 4DMFA 4BJ6A 4E5PA 2V7PA 3AWDA 2JGFA 4EF5A 3DDUA 3KUKA 4DLKA 5JS6A 5KYTA 1W5AA 4NE7A 4GAEA 4QPPA 4I5EA 4PWYA 2JJ2D 2W6PA 2WWRA 3A6LA 4H7DA 4IL5A 4RACA 4ZIRB 3DUWA 2ZI7A 2P4UA 4UFOA 2WE8A 3KBBA 1EK2A 3ZE6A 5TPZD 4LX8A 2AMJA 2P5YA 3HBNA 3N2ZB 3S55A 1XSEA 4DIFA 3HVRA 1QOQB 4CEJB 3KUDA 2AW3A 1V5FA 1IBCA 2FWAA 2RI1A 2WRZA 4Y2GA 2UU9B 1JQBA 2B9VA 2DHRA 3RK4A 4AO7A 3ITEA 3E3NA 4HVLA 1CLUA 3T06B 1GA1A 2XVMA 1FFWA 1UZUA 5AO9A 4J16C 1D0SA 4B8YA 2O8BA 4QJ5A 1IZYA 2GZHA 4JI7B 3TDNA 5LQDA 4TL6A 3HDVA 2Q4EA 5CT5A 5F2KA 4R8KA 4NU0A 2YBEA 4X1KA 5EYPA 1F8GA 1KO1A 4ZQIA 4ZI5A 1M6EX 3EXHC 1XMIA 3QVWA 4HB4A 5SYMA 4EUKA 4WBXC 4CF3A 3DLIA 3OT4A 3ZWDA 4DC1A 2OCBA 3LQKA 1WOMA 2Z5LA 4OIFA 2VDOB 2R68A 1AJEA 2H2WA 1GCGA 1Y6RA 1P7PA 2GEFA 2WHYA 3JALA 3L1IA 4FZVA 3VH4A 3M1YA 3VPDA 2Y0PA 5AM5A 3BUSA 5DM60 2O54A 2PKCA 4X3CA 3OZTA 1JXQA 1OVGA 4YJ3B 4DCPA 4EMUA 2QZSA 4FYWA 5HIJA 1P9OA 2A7QA 2EF1A 1TIBA 1NVUQ 4AZWA 5LYJB 1INLA 1BYUA 1DCFA 1XU9A 1R0LA 3I12A 4CETA 4PAWA 3LGSA 2GCOA 1MXFA 3UO8B 2P8SA 1WS6A 1ODSA 3LQ2A 4PS1A 5DGHA 2C2OA 2C31A 1TAUA 2YNMC 5HPYB 1F0KA 1KYYA 3AZQA 3IRVA 4CMAA 3BE4A 2Z9CA 1L7AA 4KV7A 4LN1A 4Z1MD 4CNQA 4RV4A 3M6MD 4LWQA 4MVJP 4NZZA 2X19A 1UBFA 4RY2A 1EUZA 3B82A 5CXSA 5EXPA 4BRUA 4Z0HO 1OX6A 2WIFA 1OLUB 1B6SA 2X13A 5D1NA 4GOXA 4PTZA 4AJ9A 3H9QA 2P9JA 4ZQCB 1IN1A 2FPPB 2HYIC 4HWKA 4DRXB 1VLZA 3M6WA 1YS2X 1H0KA 1WULS 3A9SA 2ZPTX 3LQRA 3D3WA 5CLGA 1GCUA 1A97A 4B3CA 2GCGA 3BIWA 2FB9A 2UAGA 4B7XA 2AF4C 1UJBA 1QFZA 4B4UA 3ETLA 3I62A 1Z82A 2I9KA 1AO0A 4YRZA 5FWYB 1U1GA 5K3FA 5JFGA 4NCIA 3UBTA 3MN1A 3O4JA 3QF4B 1MGOA 1W96A 2HM7A 5FBKA 5FL3A 4TWRA 3V34A 4CLRB 4YQYA 4RL4A 4RJJA 2WSBA 1ILWA 2YY6A 3GD5A 3G88A 3H3FA 1PL8A 3QKUA 1WVMA 3IKMB 2OD2A 2B2XA 2ZBDA 2EZTA 3SJ7A 4XJSA 2WA2A 2CL7X 1EZ4A 2OZLB 3HKEA 1Q3KA 2ZUBA 3B2EA 2AFHE 2VXOA 3A10A 3CX4A 1NWCA 1M8JA 1GPLA 3F1LA 3PC3A 3T3GA 1DG1G 1GILA 3WNCA 1RWXA 4ZGWA 2GGSA 1T2AA 2R9VA 5I5EA 1M75A 1DFGA 2QJOA 3E81A 1VKHA 1SCUA 1QBGA 4D1YA 4KQ6A 1RAGA 1JIQA 3V4OA 1QR2A 3LFUA 1N1DA 3NQ41 4GKBA 3RTEA 4XOUA 1GUZA 1EK5A 2VXBA 2ERYA 2HDWA 3D43A 2IA5A 2J6HA 3DFFA 2W58A 3FVQA 3L18A 1YU9A 1WPGA 5KHAA 1YULA 4FEGA 2PY6A 2CYAA 1WHTB 3C3DA 5DKFA 5AWFC 2JZNA 1CWUA 2I4MA 3ZY5A 3R41A 5JCPA 2ZB4A 2ZBVA 1YZQA 1CERA 4IGAA 1EA5A 5DSTA 4NDNE 1B3BA 2J09A 3DDNA 4V0OA 4L8FA 2AFHA 3U7QB 3AHJA 2HPZA 2P91A 3RVRA 1NQVA 4LF8B 1TJPB 2W6ID 1O2DA 3HCFA 2QSYA 4L74A 5EFOA 4D4MA 1OI3A 3ZD9A 1XRRA 3H0CA 1F51E 3EQ2A 5LOVB 3EGXB 2R6R1 4KTVE 3GWGA 3L6CA 3EVBA 2GHIA 3WGNA 4CKEA 2VAXA 1P29A 5DN6D 5B1EA 1H6BA 1WR8A 2OBNA 1G4AE 1UZNA 3BE5A 4RC9A 1RYNA 4NXNB 3OCXA 1WQ1R 1GQRA 2F00A 3PUYA 5AVWA 2H1VA 3LUJA 3WS7A 2J87A 5KI6A 5CCXA 3NDRA 4OHCA 1II8A 1BKYA 2O6LA 4I7EA 4ER6A 4QXPA 2OQVA 2PZAA 1D2MA 4K6OA 1NQXA 2GTHA 2TMDA 3BZWA 2ZIWB 1G0OA 1W30A 3QMWA 4C7JA 1O3YA 2X4DA 2I6QA 3CISA 1L5GB 4DJ5X 1IQ0A 4BNWA 4TTTS 3SHQA 2QN8A 1UCFA 3F67A 4AJJA 4M0DA 3OEHD 3SBXA 5JMOA 1BWQA 4LQDA 4GOOD 3ZZ0A 2LTAA 3AGQA 1AH2A 1DBRA 3A58B 2B4TO 1W4LA 1RCUA 1Z13A 4UEQA 2YWBA 3HUDA 3ADCA 4BEBA 4D2IA 1CTQA 4J4HA 1DUVG 1DXOA 2I4TA 1Q95A 4D3DA 5EYPB 4X1KB 3QEOA 4HDKA 4BLTA 3A11A 1BGXT 1N1EA 3FDZA 1BE6A 4LJ4A 4OQYA 4MARA 4OHXA 1KH3A 3DVSX 1ULBA 3E03A 4OG2A 4NI5A 3WB9A 2WG2A 4IPTA 1BMTA 1ZU4A 3BK1A 3CO0S 4LAFA 4AO6A 1CR1A 4GNKA 4DDUA 3OTOB 3JALB 5F1KA 3V4FA 1UMCA 2GJAA 2RBKA 3G6KA 4MCAA 3TK1A 4HEA1 5DU2A 3ZH9B 5I45A 1EUQA 2C97A 4CR6A 1ABFA 1B0UA 3AVWA 1GLNA 1I3LA 1HYEA 2PKQP 1BJKA 3H16A 1FVOA 3OKCA 3PQ6A 1OIVA 1RXSA 2WTAA 3KFLA 3K4HA 4BV3A 1YB5A 2GCOB 3FGPA 2JI9A 4ZCQA 1E5LA 1E92A 1LH0A 2PIDA 2ZUTA 2F1KA 2G9RA 1I6WA 4JYCA 1IN8A 3FETA 3G89A 2OXCA 1WQ3A 1JWAB 3CPJB 1O4WA 4RV9A 3I5MA 3S2GA 1KAOA 4PE5B 1B8NA 2XWSA 1K98A 3FNBA 4TRJA 3WB0A 4N7JA 1Q17A 4YJ2F 4U7PB 4URZR 1T2VA 5EIXA 4Z2AA 5BV2P 1VBNA 5L7TA 3VR0A 3R8CA 5J47A 3VXKA 2IHKA 4C08A 2VNKA 2VHVA 3F9CA 3WDMA 4CUJA 1XZKA 4G8BA 4DQKA 1C8BA 1FNDA 1M1ZA 1TPZA 1U0HC 2A1TS 3QOXA 3B89A 3KXDA 3D3WB 4LK2A 2FVXA 2C3YA 2PAAA 6NULA 1T15A 4NBNA 1NF9A 1YR8A 1NURA 4KREA 1K7XB 2QVYX 3C3XA 4FE3A 4PNPA 5FD8A 2IYTA 4N01A 4Q9AA 3BCSA 5K3FB 1MT0A 4C78A 1EUCA 5EE9A 2CJFA 1XYGA 4E5SA 2ASVA 2REBA 3IXMA 3F6PA 1QH0A 5JY1A 3EX7C 5IASA 2HDHA 3LGAA 4FMDF 3QENA 2BFWA 4B6GA 1OW3B 5LP6F 1JHDA 3B9BA 1P62B 2I3DA 2P9ZA 3AKYA 3B1ZA 2B3TA 2WFZA 2FSVC 1B14A 5BNFA 3ZCQA 2NIPA 1IM5A 4MHSA 1KRXA 1SCUB 2ST1A 1CW2B 1GTMA 3PSHA 5KC8A 2IQIA 2ZCUA 2VPZA 1PBTA 5F7JA 2XOKA 4Y6LA 2PTHA 5F35A 2JFNA 2CNLA 3E9EA 2N0SA 3OTGA 1DPGA 4BGEA 4YQEA 3CO5A 4XCVA 4YRCA 3C15C 5I3ZA 2OGTA 3W3AA 1O94C 2ZS8A 4B8WA 5AM0A 5FULA 3GEBA 4J0JA 2BV3A 2XR1A 3GNQA 2AFHB 3KQHA 1G6KA 1ZA2A 3HR8A 3IV9A 2R87A 3OD1A 3HA3A 3BJIC 4GI7A 3C6KA 3ZY3A 1P2TA 4CMEC 5HZHA 1GRNA 2C7RA 2BVNA 5DBIA 2P2NA 5JH7A 1PWZA 4FJ2A 1AVTA 2CLLB 2HA6A 4AIIA 1UFOA 3ED1A 1KIFA 2O3UA 2Z09A 4HR7A 4TUYF 3R8FA 2PBRA 4U02A 1U5CA 4CKEB 5AM4A 2CBXA 2ZJ8A 3QV1A 1BJRE 3NXKA 1QHIA 5KBYA 3ZD7A 1BD3A 4I8DA 3H3JA 4GECA 4P38A 4ND2A 4P6VF 3RT7A 2AEFA 2XYGA 5E1BA 2QR2A 4BFWA 3UXMA 3O8RA 3OOJA 1JBEA 3R7SA 1II8B 2V3WA 1XPUA 4WEOA 5JAZA 3S7TA 2OCIA 4JT8A 3T7TA 5B7GA 1YSCA 2IEYA 4A0SA 3IEXA 3C7AA 1ZC4A 1ZNXA 2QVBA 3RTGA 2I2FA 3IVCA 1M8FA 2Y76A 3G7NA 5AI9A 1FFAA 1XA0A 2HXSA 4M1OA 5HS6A 3TKAA 1O0SA 4I5GA 3PGA1 4U63A 4KNVA 1FPQA 3LOUA 4OFXA 3V7NA 3M6VA 4IEFB 2QF7A 1UBCA 1CDOA 1N6NA 1J4AA 1LTKA 4P98A 1IN5A 3MHPA 1UPXA 4FJ1A 4MW7A 1E62A 5A0FA 3SE0A 5J5AA 1Q6ZA 4HDKB 4BAZA 1ZI6A 1WUKS 4FZ5A 3ZH2A 3E8SA 3RJMA 1FLVA 2J9RA 2P1DA 4MICA 2XWPA 3HBFA 1OBHA 1A50B 3UA3A 3AIIA 1UK9A 1RMQA 4ID9A 2NT4A 3RANA 4WDRA 2C1XA 3NTLA 2ODWA 2VTBA 1UMCB 4PEVA 4MK4A 1RJFA 2Q3LA 4Q3AA 1CB7A 121PA 2IHYA 2V6JA 3M89A 4BVJA 4Y9UA 1R9GA 1ONNA 1P3JA 1WXGA 3QTTA 1F8UA 3HB9A 1X9HA 3PNLA 1ONOA 2A2ZA 2NZVG 2YW9A 2NUPB 3DPSA 2IBMA 3FNRA 4M0PA 2RGYA 2WWGA 1KDYA 1EE2A 1HSZA 4I66A 1T3TA 4IS3A 4EKGA 2C7BA 3OOYA 3I6ZA 2O7QA 3N6XA 1D9XA 2PGNA 3D1JA 4UMDA 1U7TA 4UDXX 3F6CA 2HJSA 2AZXA 3IHLA 3FMPB 4TMYA 1ACLA 2DC1A 3FB4A 3OCJA 4DNOA 5TF0A 4KUHA 3EIOA 3TIIA 3CF6R 5DCLA 3NTUA 4PIMA 3ZVKA 2AMYA 4CV2A 3I83A 1ZRSA 4HN2A 1UADA 3NWJA 3KPJA 4ZO9A 4BVAA 2JGMA 1L4EA 2I8CA 2OHXA 2Y27A 5A5DA 1CQWA 3U37A 3E9ZA 3AVOA 1V5IA 4GQAA 4QT0A 3LDFA 4N5LA 3ZW7A 1E98A 3ROGA 2AC7A 3GLIA 4DZZA 3DR3A 4CMKA 3NEAA 3U09A 4DTCA 1GKYA 3PKZA 4RMGA 4GS5A 4CIDA 2YOHA 4I36A 2JGNA 2PLWA 1CLEA 3STTA 2X9VA 1COWA 4YS6A 2BHLA 3AC0A 2ETXA 4FR0A 4P4NA 4Q02A 5IARA 4DYVA 2VHQA 5JTUA 1MQAA 1Y6FA 2D6FA 1QYIA 1E2BA 4EOGA 3MWEA 4GZ5A 5HW0A 5DYWA 4YMLA 4Q39A 4QPZA 2FQXA 1GZUA 2HFKA 3K30A 4F4UA 5LP6B 1TK9A 1VIYA 4RD6A 4DR7B 2EJWA 2ACVA 1BWSA 1E69A 4K6FA 1RSZA 3UC5A 1ECBA 2ZBUA 4JYAB 1SNYA 3MJDA 3LF2A 4I8XA 1T0IA 2XYVA 5FKJA 2WSIA 3DQQA 4CKCA 1FDOA 3E1SA 4XH9B 3TRKA 1MC8A 5DPMA 1QGED 5DSXA 3DV2A 3CR3C 2ZJ5A 2Q4BA 1T8UA 1ENPA 2P3OA 5BQ5A 1CE8A 5KNDA 4EYGA 3UV3A 3PQ3A 3K05A 4QGAA 3UJBA 1YZ3A 2HKIA 2UXCB 1N9GA 1F8YA 4IRUB 4D41A 2H9AA 3IP9A 3T5PA 2GJ8A 4KJZA 4NFSA 3ZZNA 1A5AB 1JQJC 3P96A 2RHMA 2VYVD 4LY0A 5JH7B 5BSVA 2W0MA 6PFKA 5E3IA 2JLXA 3WFIA 1KZ9A 2UVQA 2Y0EA 1VBMA 1OH6A 1U94A 1EBBA 2FY8A 3CLHA 4MRRA 4QOEA 2PYDA 3JVEA 2OVBA 2CYCA 2W98A 3C45A 1DTEA 2VYCA 3NB0A 3WWYA 4D0GA 1AT1A 1W1WA 3K0CC 4L9WA 1OYVA 3LCVB 5AKYA 2ORWA 2ZPAA 3AUXA 3RIMA 4C89A 4UHHA 1GU0A 3EWIA 4Z9FA 1HE3A 3C74A 4YMIA 4OO3A 1YRWA 3VOAA 3BDVA 2NXCA 2VDLB 3E53A 3RQIA 3TRIA 3WYAA 3JR7A 3RC3A 3WYDA 5HKOA 1Z63A 3CB4A 4YBZA 4Z9AA 1SA0A 3ZCTA 1G5TA 1L1QA 4ZREA 1V0JA 2JLAA 3CUWA 3OO1A 2HMYB 1Z26A 4DY4A 1YFLA 2BL4A 2MCFA 4DV5B 3RVPA 4LSMA 1QPZA 2CLIB 1YO6A 3KPWA 3TEFA 3IEKA 5DM4A 4E51A 1N77A 1Q3TA 4MYSA 2YL2A 5CCBA 2PXAA 4W4TA 2Z56A 3K94A 1WB9A 3HZRA 3GRRA 2FMFA 2R8YA 5EUQB 5IBRA 4M9XA 1VMIA 1XWWA 1A9ZA 4NX2A 3HV0A 2RHHA 3DW1X 3ZDQA 2G5CA 2EJTA 2KYRA 1FUUA 2O7VA 4UDOA 1VJDA 3ZU5A 5EWMA 5TC4A 2JEZA 4IO0A 1QTNA 4RSMA 2MWMA 4U2KA 4E09A 1VL8A 1YRHA 2TS1A 4O08A 3AM5A 1B8PA 5KUTA 2COEA 1L3IA 1MV5A 3Q3EA 4IDBA 2H00A 4Z9YA 3CV3A 2GI4A 2EFGA 2XA9A 2AS0A 4F04A 2IPXA 4YUWA 4JNKA 5F76A 3VOBA 5G0WA 2JBWA 2BSQA 1YACA 2PWAA 3OP4A 2CVZA 5DLPA 1BO6A 1YQ9A 4JEHA 1IMOA 4J1TA 5AESA 2P3LA 2FFJA 1YT5A 4RZSA 1W5BA 1ZN2A 3PPVA 1HEIA 4ZMSA 4PR3A 1GD1O 1VI5A 1S6YA 1AHIA 3ANLA 1C50A 2JEOA 4KO8A 4B7CA 1JYSA 2GLXA 4CQJA 4AKHA 1XK7A 4IDDA 2RK6A 3V1UA 3AKZA 2CDCA 2QL6A 3GVXA 5DCYA 1GSAA 2JI8A 2WFLA 3LKBA 4FDAA 1E77A 3QA9A 1E1MA 1P60A 4QOGA 1N25A 2IX9A 1ESEA 4IIBA 2RIRA 1K0UA 3AVPA 4Z8XA 4P80A 4YJ2A 3GLIB 3G7UA 3TKYA 3WGTA 1SD1A 3OA0A 2OBXA 2BBTA 5E4JA 4A0GA 5HKAA 5GPBA 3QSYA 4AY2A 1OD6A 1DAHA 4QYMA 3LVBA 1IWBB 3AU9A 3I52A 2YZ7A 4XGNA 4XARA 3TZLA 2I87A 4C6RA 1DVRA 1JEAA 3HFSA 3MWEB 4I8IA 3UJCA 3MUEA 4KOEC 3QYAA 4OREX 1XZJA 1O89A 5CLLA 2CD9A 5E2IA 3WRWA 2OB2A 2QLBA 3IEVA 1OX5A 3L6DA 2A9FA 4BLVA 1Y8QA 4F4JA 4UBJA 2BR5A 1AUVA 2PLRA 3DVAA 4X85A 2FSFA 1K2WA 3V9AA 1NUUA 5JC8A 3NBAA 1ND6A 4KVAA 1QE5A 4CKCB 3N70A 4OJYA 5ALNA 4CM9A 3OX2A 4C07A 5LP6A 4TYWA 3ELWA 1U98A 1YK0A 4CU5A 1EQAA 4B40A 4E4TA 4PRKA 5JCOA 3EZ9A 1CE8B 4B81A 1CY2A 3NKFA 1SK8A 4UU1A 3GEMA 2YVQA 1VLQA 3R9XA 4J1SA 2REOA 2TMKA 4OB7A 1N9GB 4Q9DA 3KJHA 2DCMA 4Z99A 3WMEA 3L8ZA 1TE2A 2K7ZA 2WU8A 2OHHA 2IEBA 1B3RA 1SHKA 2XBUA 1OI7A 3AI1A 4FFRA 1IPHA 3F7OA 1W1IA 1KEVA 4YLGA 3I8OA 4LXGA 3W2FA 1C0KA 1L8LA 1OPXA 4BQEA 3FPFA 1J9ZA 1H23A 5DXAA 3A6PC 1JIJA 4OLJA 3OPYA 4TLEA 2PKRA 2EEZA 4N7MA 1SXPA 1UOEA 3CLVA 4EG0A 3NATA 2C7OA 3V48A 5JARA 4LF7B 3BWBA 5FUMA 1A9SA 3VZSA 1J2JA 2G1JA 3CRVA 1H2XA 2K6GA 4C6HA 4XQEA 4GICA 1QKKA 1KHHA 1NXQA 1N7GA 3BIXA 5L3QA 3O4VA 3OE4A 5L9AA 3R7DA 4KN6A 4WZAE 4TUYA 4IKPA 1NVBA 3MC1A 5BSRA 5IKMA 1U1IA 4X8OA 1GGVA 1IU9A 4IIYA 4CV0A 4X7MA 1QP7A 3OFNA 1G41A 1LS6A 1QMPA 3ZQ4A 4R8MA 2QP4A 3E8MA 1SA0B 1YQUA 5DYNA 3U39A 3WHLA 5IZCC 2HO4A 1NPDA 1A9OA 4M22A 1R6VA 3VNUA 2FZLA 3MTJA 5JAHA 2B25A 4N3AA 1DWUA 1JPNA 1MN6A 2Q28A 3KJZA 4K9PA 4F1JA 5JAUA 5ELXA 1N5IA 1FDVA 4J91A 1UL1X 4PZLA 2YV3A 2XJ4A 4KQXA 3TZKA 1TCCA 2OHIA 3O9VA 3LUAA 4HNSA 4WZAA 5T6MA 3PTZA 5AJHA 3SHFA 4KH1A 1W36C 1VZ3A 3OWHA 4PGHA 4RCZA 2C5FA 5DNCA 1DADA 3H2KA 4Y2TA 3EAQA 3O92A 3EIUA 5EWMB 1PT6A 1J8MF 3AI7A 3GFSA 2CLEB 3HB0A 2HLDD 2O7NA 3KWJA 3M6XA 4X44A 1KWGA 2OXRA 2WB2A 1UQTA 4AJOA 3QM1A 3PHHA 2VWHA 1FS5A 1G2QA 3ETDA 3T7RA 1CZUA 3RKUA 4AU1A 1LBIA 2H2HA 1KAMA 1QO0D 4BOYA 4B84A 2IH2A 3MRXA 4PSDA 1Q92A 4QA9A 4MR9A 4QGGA 5FNVF 3AONB 1FYXA 3B3AA 1SQSA 3R3SA 5FEUA 2DLCX 2H52A 2W2TA 4RA6B 3ZTYA 4EZBA 5J4LA 4E3WA 4AQDA 5JIBA 3GNLA 5FLYA 3NHJA 5U9CA 1N1GA 1SIUA 3W5VA 4PPGA 1P6UA 2KMLA 2V6BA 3GQVA 1EP3B 5BUZA 1G64A 3KT3A 4FCTA 1LLUA 2NZUG 2JFFA 1TW3A 4NPCA 2IOFK 5IUJC 3ZUGA 5FAXA 1Z0ZA 4HQFA 2BFFA 3V9PA 2PZ8A 3N75A 3HK2A 1E96A 4ZN6A 4AG3A 5CCEA 2C0CA 5LQCA 4H27A 3L93A 3DB2A 4RVSA 2WFLB 2R6JA 3IUJA 1L4GA 3IJEB 4C4YA 3DXXA 4OXXA 3U5ZB 3OIYA 3N3AC 4DLSA 2RBGA 1NW7A 4YJ2B 4TRMA 3MGBA 3FIUA 3H7IA 2WICA 4D3SA 3O82A 1U80A 2PK3A 3SHVA 3UFBA 2RK3A 4PO3X 5ALEA 2AN5A 4JOBA 1C3VA 2IYEA 2AH5A 1C2YA 4MUBA 5C81A 3KTAA 2NO5A 2XNCA 1AGRA 2EWVA 5THXA 4MHOA 3OZCA 4PZCA 5H02A 4BKMA 1S3GA 1ZRNA 1PJZA 1Q50A 3JYNA 1VE6A 3KXIA 2HDOA 1MZVA 1B23P 2GNPA 5CIWA 2VF7A 3OKFA 1UT5A 5JI2E 4MVJD 1Y34E 4AN1A 1Y8QB 3ODPA 1OAOC 2RONA 4Z86A 4YWHA 2P30A 3DVAB 3GJ6A 4L5IA 1JG4A 2FV8A 3ZCPA 3KQSA 1V8FA 2FPRA 2MYNA 2JFXA 3OM8A 3I6IA 3I5AA 1CEXA 3NBQA 4TQGA 3UKDA 2CN1A 2ZM5A 2BKAA 1NXOA 1QMGA 1V3VA 2I8LA 2A9PA 2KSQA 3FR8A 3M9LA 3G82C 1ISRA 3GUCA 2IUTA 3N8KA 4ODIA 2G5PA 4UPDA 5EIOA 3RUIA 3ZDRA 3PHJA 4BNDB 3L4SO 4AZSA 5K0GA 2FRDC 1E5TA 4GEGA 4IVQA 1U3DA 2H2AA 2Q0QA 3OSZA 4L6AA 5ITWA 3OIWA 3P5BA 4HFMA 1P7ZA 1RMTA 1XVVA 2IYAA 2JARA 1NGSA 2X8JB 3O1LA 4HQ6A 4RZ3A 4U00A 4W8GA 1YQGA 4MJ3A 4ZAGA 1G7SA 1GEGA 1V43A 2C1ZA 3PE3A 4NHEA 3DC2A 5IEBA 2WHEA 1PP4A 5KDLA 1E6LA 1O95C 1CQIA 1TIPA 3AB3A 2OHGA 3OZAA 5GZ3A 3UQYS 5IXSA 4CMCA 1PNQA 1ZHHA 3K73O 4FFPA 1IPFA 3OPYB 1F17A 1I3MA 2CJWA 5DRYA 2YJGA 1LK7A 1W2GA 2JF0A 3OP1A 4HGQA 4LVCA 5CJPA 3RC1A 4BU0A 5IC6A 3RADC 2EKLA 5L3QB 4TMKA 3GAFA 2GD2A 1P3Y1 1C3LA 4RW0A 4CL0A 4TUYB 2Q3HA 5GV8A 5A3VA 2HV9A 4IIVA 2EERA 3HPQA 4MAMA 4YMVA 2BZ0A 3QYJA 3WDKA 2HHJA 2WF9A 1W4ZA 4R9RA 4UJ5A 4O63O 3HHPA 1VCNA 1EB9A 2I8AA 1TYEB 4Y2UA 1C8KA 2WYHA 3PDIA 1N0WA 4MUMA 3AR7A 4K8OA 2NZJA 3L01A 1AXRA 1YNSA 1TAGA 4P9NA 5CVEA 3FSEA 4Z0TA 4P86A 1Z75A 3U48A 4CTNA 2J3KA 3TFWA 2OG2A 2H11A 4K05A 1DJOA 4OTZA 1WEHA 1CNMA 2XNKA 3JWGA 4J16A 3SZGA 4AJPA 4KQEA 2KW5A 4RLQA 5FH9A 5KYGA 4LXYA 3U4MA 3DYBA 5C7IO 5IABA 4E11A 4RMIA 1HYGA 3PCTA 1PE0A 2O2YA 1L4FA 3WAKA 3V7FA 5K4AA 3RS0A 2IIPA 3PR3A 4YMHA 4KG7A 2O50A 4URHA 4DNXA 2P4HX 1FRZA 1KSFX 4QULA 5EZYA 3B1VA 2AYYA 2Y2VA 4LDPA 2ZRHA 3SP1A 2FP3A 2JIZA 2NP6A 5SZKB 3W9UA 1AMNA 4LHSA 4MR9B 2ATEA 2PJRA 1CY8A 4RWZA 4E21A 3IDSA 5C1OA 2IH4A 1N5MA 3LZ6A 4MQ6A 2B7LA 2ORVA 3K2IA 1JFVA 4A2PA 4G9GA 1Y7LA 2XJ9A 3BXXA 3I1FA 2P41A 2IS2A 1POWA 4DVGA 2H5EA 3IT2A 3AV0B 3NNSA 3ZU2A 3S1AA 2YN0A 3EGOA 5J4YA 4PYMA 4BBJA 1P5JA 2EBWA 3BGIA 3U9LA 2D5CA 2YHUA 4B3XA 3MXOA 2Q4RA 4MOWA 4D99A 5I6DA 1HTWA 1RRMA 1L5MA 2BEUA 1NF3A 3LSYA 2QSJA 2BFAA 2FU5C 3HSYA 4TGLA 3UZUA 3DCJA 3JWHA 1Z37A 3CF0A 1YZYA 1I1HA 2Q2VA 2RHWA 1YU6A 4YCMA 3V2HA 3I09A 5JBQA 3DDHA 2PGAA 2LCQA 1R9JA 4GC5A 3OFSA 3QVTA 2WSYB 4R3UC 1QV6A 1UUFA 5IMSA 3KXLA 2F9MA 1UOOA 1XZDA 1GHTA 2J3JA 1XPRA 1RP7A 1TM7E 1J8DA 3JQRA 1SOVA 3AVQA 4II2A 4C7BA 1UDXA 3KTAB 3ZHQA 3HWRA 4GMHA 1E1RA 2ZJZA 5K3SA 2QLNA 2PSFA 3T4UA 3ROMA 1GUFA 4AJEA 1QOZA 2Z4RA 2DVMA 2HREA 2NO7A 2WF5A 5DYTA 3EOZA 4XASA 3JS5A 2ACEA 3MB5A 4L75A 1CR4A 1VKNA 1H5QA 4YBRA 2VDJA 1C4OA 2MMCA 5H70A 3SHTA 3NIBA 3UKJA 3RPEA 4CFZA 1P1KA 1X1CA 3RRMA 1ZU5A 1Y7IA 2VBCA 2F48A 4EG7A 2GRJA 4IFTA 2Y1DA 1CRWG 1O54A 4C0BA 2QN9A 4B79A 2GOYA 1IULA 4M9QA 1CU1A 1BA2A 3CHYA 4FYYA 3W6NA 4LTDA 3O1HB 3E4CA 3PWSA 4IV0A 5TR9A 1GFZA 4CRWB 1WJGA 2JVIA 1YL7A 4JQSA 3LRTA 3TGPA 4BTEA 3B51X 4JHXA 4F72A 2ZETA 5C5DA 2AR7A 2JRLA 4JQOA 4RFVA 4R54A 3CKMA 5IJAA 3O31A 2GWHA 5JLAA 4NTZA 4RTRA 1OBVA 3GF4A 4RNDB 3RS4A 3M2PA 4AKEA 5TVGA 5JS1A 1R0XA 3JY6A 3UK1A 1HLGA 2SCUB 3VOTA 3OETA 1CQIB 3WIEA 4FMCF 4KL8S 1MIHA 2WU3A 3X1KA 1AHNA 1KSHA 3I0MA 3R6TA 3T8YA 4TQUS 3X1YA 3LVFO 1MQ8B 1XKLA 4MUJA 2XEXA 1MDBA 1V1RA 5LQAA 5TGZA 1Z2NX 2CJWB 5C46F 1MPTA 1RRPA 3KK0A 2WLSA 4HGNA 3U1BA 5GIOE 1WCWA 3DHNA 1JTVA 3GGGA 3JYPA 3PX7A 4JR2A 5BP7A 1HFKA 3HDYA 4NBLA 1PZHA 2DF8A 3HGMA 4RZIA 3VDXA 1C1HA 3HXOA 4IQFA 2YXEA 2XNDD 1M34E 3P19A 3PVCA 3GXBA 5F3RA 4ZYWA 5HUQA 2I4OA 1ZK1A 2E4YA 2J85A 4CN8A 3HL0A 2FETA 4LHZA 3NHAA 4TKVA 4GX1A 5LQNA 3AY7A 2I7DA 1XLUA 1ZQ9A 2HMWA 5ECYA 1N92A 1PG2A 4QATA 4RO0A 2UUBB 2ZULA 3C5CA 4O4LB 2Z9BA 2HQSA 3C4QA 4GL4A 1LC3A 2HA5A 3D0KA 4TMWA 4O3MA 4G1UC 9ATCA 4TMZA 3WYGA 2QSUA 1I9GA 3QE4A 4S1VA 4B76A 2XCLA 2WLTA 5EA2A 4LRUA 3FJYA 3GT4A 1F20A 3TIGA 2XMQA 3Q12A 4M38A 1I94B 1ZQ1A 3KQOA 5FNZA 1X6VA 3IOCA 3LOQA 3EH1A 3FGOA 1Z6YA 4FGUA 2XXJA 1M34A 4X6LA 3LY7A 5EE0A 5GGXA 3RTBA 2O3SA 3C1UA 4XD7D 1SKMA 1WMEA 3PBKA 4X60A 3W1WA 1X42A 2LCFA 2XE4A 2J9YB 4FOPA 2HBYA 4M1SA 1YK1A 3U60B 2FMHA 3O3CA 4P22A 1JVBA 1IHOA 4DG9A 4EGQA 5KQSA 5KOJA 2CNDA 4U7HA 5EZYB 4CGZA 4XZ3A 3R5HA 2GZSA 1W0JD 5AKZA 4EY6A 5JEEA 2ODPA 3A4MA 4KXNA 4U2BA 3RVNA 3RVQA 3S27A 1YI1A 1NYRA 4JASB 5J2TF 3EA4A 3GRAA 4PRZA 3FMOB 4F21A 1SXHA 2F3RA 4YFVA 4CKBB 3AI3A 3BWVA 1QO9A 1XFDA 4M76B 1ZICA 4UHCA 3SBEA 1XD9A 1ZS9A 1TO6A 2HNBA 1JVSA 2C2XA 5B1HA 1F5SA 1U3CA 1C4WA 5AW7A 3NT2A 5FNVA 3S1AB 3AERA 4MKIA 1GV0A 3JZMA 3GN2A 1W2HA 4QBIA 4UHFA 4F46A 5LDDC 3QMPA 3WA7A 2JLZA 1OZ0A 2CZQA 4ARSA 1SWVA 2WM3A 2VSYA 4M0UA 3T5CA 1L4UA 1RQ7A 2BEUB 1Y81A 4NJEA 1HLDA 2D8MA 2BHTA 2GN4A 1P2BA 2MSKA 2QTAA 2HIMA 4D96A 5CDYA 4YRGA 2NWQA 4EG1A 2CLMB 2PWPA 4YV0A 1W34A 1SUAA 4UFPA 5J4KA 1UPCA 3ELDA 4C06A 3LWNA 2DPGA 1YMQA 1R18A 1UM9B 2XUJA 3EB9A 4UXIA 5CVJA 2RHTA 4KSYA 1FXUA 1KI9A 3RVLA 5A4FS 4JVOA 3TM4A 1D4OA 4RHXA 2JLYA 2A5DA 3WJAA 1NT4A 4I9HA 2PVSA 3ZHVA 5EIEA 3JXEA 3BA6A 1QIFA 1MIOA 3BXFA 2VHTA 4LBVA 4PSUA 4PRYA 4RMNA 3TJMA 3FNEA 4ISBA 4D25A 3DFMA 4M99A 4K03A 1DKLA 1XD2A 4C0XA 2ILTA 4LGCA 1XMVA 4MAAA 4WECA 1Q0LA 2JAUA 5I4BA 4EA9A 5BWBA 2YHAA 3S2YA 1LRLA 1YZTA 2GBFA 4KDRA 3C8HA 3SYRA 3MTDA 4PG7A 1GO2A 2V7GA 3ZE9A 4KOAA 1H0RA 1JG1A 1COZA 1JR3D 2WEKA 3A1WA 3F6SA 4MYHA 1TO2E 3IEIA 4O0MA 1RI3A 1H66A 1GWNA 1RHMA 1PYOA 4LJSA 2ACWA 5EGNA 3BB3A 3Q4GA 3OCCA 5AW5A 3T9EA 1Q0PA 2O2EA 1LI4A 1USIA 1W4BA 3AEQB 4WCVA 1UZAA 1QH8A 4UOEA 1VB5A 1BDBA 3L5OA 1ZC3A 3PVZA 3ZXXA 4DSAA 2FEAA 3PQ7A 4FONA 4H3KB 4RIIA 2PZMA 4DB2A 4N9WA 4XUGB 4UMEA 2J0UA 3V8VA 1O94A 2CJXA 3S40A 2O5CA 4G5HA 1RYMA 3DOJA 3F71A 3L07A 1T4GA 2NXNA 4UVEA 3QG1A 4ONEA 2Q49A 2ZOSA 3RM3A 5TJHA 2LDBA 3HUUA 1V7ZA 3WZ2A 4JI1B 4MGKR 4BNUA 4CMEA 5EKDA 1U2RA 1H4VB 4XRRA 2O2HA 1V1RB 2C5SA 3JD4A 1TZBA 4V0RA 4HYQA 2QZZA 1K92A 2VOJA 1ISHA 1FTNA 4QPDA 4FT2A 1DMSA 1YUNA 3ZQ6A 3AHEA 1JNXX 2QNRA 3DZBA 1XRQA 3I2FA 4F93B 4IV5A 1SKYE 4E33A 4Q1FA 2NGRA 2AZTA 2VF4X 2DR2A 3H2BA 2ZU6A 1E99A 3B85A 4RPCA 5EHIA 3MA0A 3WNZA 3WV5A 4W5OA 2GCEA 1RQPA 1DC3A 3AINA 3HCOA 3KXKA 5T3YA 3HYTA 2C2WA 3OMLA 1QTQA 3I2JA 4Q7JB 3KT0A 3A1UA 4CUZA 4YAIA 3MF4A 4UOZA 3P32A 3CEJA 3QNMA 1G6Q1 4EF6A 4OU5A 2HBZA 2Y9PB 2PR2A 3DBHA 2EP8A 1UPBA 3FCUB 2HMTA 4MVYA 3BKXA 5GQSA 9GPBA 5A9RA 3UHOA 2KX7A 1SCIA 4BBAA 2ZSUA 4C7VA 1P1FA 3ZXSA 1QRTA 1M34B 2DKFA 3P71T 4WJZA 1AG9A 1WLYA 1A8PA 5JWOA 2QPTA 3BH7A 2DR0A 3C2QA 5FF9A 4J9UE 1RWWA 1H94A 1C80A 2HXYA 1E5VA 3IT3A 5KOJB 1U99A 2XUIA 3TDKA 5KNDD 1P9RA 1SHLA 3RV3A 4RE5A 1JQAA 5TEWA 3IHWA 3RC2A 3S99A 3CU5A 3DCNA 3O03A 3T54A 3FTQA 1KVQA 3KE9A 4FYMA 1I0LA 1I2MA 1SVUA 4L50A 3V7UA 2ET6A 3TDMA 1DS6A 3EF1A 4HYEA 4EW6A 1NG9A 4B73A 1TFUA 3K6KA 1VIVA 4G1FA 1RLMA 2Q2OA 1V6SA 5E8JA 3RBXA 2E5WA 3H6GA 5CIQA 2HIAA 3LPMA 3TOVA 2Y3IA 1N1MA 5FNVB 3AERB 1ECJA 2HWKA 1SVKA 3RSCA 3TXXA 2J08A 5IK2D 1Q16A 2F8MA 1AUQA 3UCXA 5JECA 1Q12A 4R2IA 3IUQA 4CI9A 1NIPA 2E4WA 2KBEA 2WJIA 4HS9A 5E7IA 4N47A 5EVCA 4NJEB 5REQA 1EGHA 1W44A 5HZGA 2C82A 4G5YA 4O1MA 4J0CA 1AHPA 3ILHA 2HK7A 3HKCA 1RVDA 2PUFA 1WBJB 2C4TA 4M9UA 1ORIA 5BW5A 3VC7A 1KI7A 1XAJA 3LCMA 4LECA 3A0UA 4MW2A 4BEVA 3L06A 3SIXA 2H2FA 1JYEA 4EJFA 3OQMA 1JR2A 3TI7A 2FZCA 5MGBA 4JQCA 5DNYB 1JJAA 3LUFA 5EP4A 1UFQA 1OF1A 2A92A 4O3FA 2G7ZA 4LDZA 4ER0A 1JXMA 2YMMA 2XZPA 1ACMA 3FF4A 1UF9A 4XLZA 3M1IA 4KE7A 5L4NA 1MIOB 2M98A 2XWQA 3LQ4A 4F96A 1C81A 5IWAB 1G7RA 3NEPX 4JLDA 1ESDA 5FUVA 1XD2B 1D6MA 1GXSA 2PKXA 2Q6VA 3QXXA 3I9FA 4R2JA 4U6NA 4YVFA 1OPRA 3PX3A 5FBLB 1TF7A 1QHHB 2BY4A 1LZKA 2BM1A 4IJ5A 4F8EA 1YB7A 2JLRA 5CP8A 5TQ2A 2GESA 4A5SA 4C3OB 4AKIA 4LJ5A 4CG0A 2RHJA 3RSSA 3EH2A 1II0A 5FTJA 4E46A 1ZI9A 1Y4AE 1K5PA 2Z5FA 3TI9A 2O59A 5K6AC 3DEKA 1ULHA 3MYRA 2J0VA 4MINA 4YAGA 2BTOA 2MJLA 3FXAA 2BM9A 4UMFA 3LC0A 1KGSA 3K0SA 3IAXA 5COAA 5D2CA 3IPCA 5CDHA 4YP1A 4B3BA 2Q6TA 1QH8B 2Z57A 3FTDA 4OYYA 5FTLA 1CZOA 3K1TA 1S7CA 4DC0A 2R6FA 4RVOA 5U4XA 4DQUA 1M7BA 3G5MA 2JJMA 4I14A 2REXB 2J0UB 5IU6A 3T9AA 1Q14A 3Q7QA 1ZGZA 1FUEA 9MHTA 3ABOB 3TH5A 4Q0MA 2ZVPX 3KJFA 2BMAA 5FCDA 3E8XA 2E89A 2BLNA 2RAVA 1KK3A 2YV4A 3KIPA 4PLVA 2J5BA 5BQFA 4Q34A 1I1NA 3WC4A 5HTKA 2DWOA 1BU8A 1JFRA 5G41A 1GL9B 3KR1A 4YIHA 1N4AA 3QY9A 2H8GA 4RK4A 1DV1A 2CNKA 3HKDA 1VQ1A 3H7AA 1M2FA 4WZAB 3U6BA 1QJCA 3PRHA 4PNZA 4N76A 3K5PA 1QHEA 5JD5A 4X6UA 5IF9A 4Q12A 4RF2A 4PG4A 1MAHA 2XSZA 3K0CA 3PYMA 4ID3A 1T8WA 1YRAA 2QVLA 3QVGA 4JB8A 2D4AA 2DEUA 3UUEA 3TX2A 5BYJA 4DSUA 2J6BA 2J32A 3AUKA 4HNRA 2W5UA 4OHVA 4HQ0A 4N39A 2J8ZA 3LBIA 1Z3CA 1GSIA 1WZIA 1ZSNA 1MJ5A 2X2OA 4LVOA 4G3XA 3S68A 3VV2A 1TKAA 3ZHXA 4GBJA 3R4VA 1DRJA 1USGA 5A4AA 2QMOA 3EHDA 3CX6A 4Q05A 2GZAA 3WLQA 3U7HB 5A3QA 4AICA 3MCWA 3DBHB 4KMSA 3BORA 4YYZA 2XAUA 4DV3B 2EKPA 1RM4A 4N0QA 1P7WA 1SKYB 3AFMA 3R3HA 1B7GO 4LRWA 4AP9A 5CVTA 1V6AA 1Y6ZA 4I2VA 5IEJA 4QQKA 3G13A 4RVNA 1TT7A 2RB4A 2I0FA 4BFVA 2GT1A 4C7MA 3ESRA 3MVEA 3ZDDA 1VRWA 4G0WA 4NOMA 4M0LA 4IZOA 3UNXA 3UXHA 5EXSA 3DG9A 2CW5A 4P35A 1EXMA 3OY2A 1DB3A 1FVHA 1E61A 1XKTA 1HKUA 2HPHA 2IGTA 2I29A 2P6MA 3L8CA 2IXFA 3KZMA 2SKEA 3ZIDA 3FVVA 4DA8A 3FLAA 4PY2A 5E6UA 4G0NA 2ETVA 3V33A 4GD3Q 3VGJA 2HRZA 4YCJA 4C29A 1K3FA 4F8YA 1DFHA 4OP1A 3RS9A 1JGTA 2GN6A 1W35A 1X70A 3CYFA 2D3WA 3CLSC 1HOXA 4FK8A 4DR3B 5HFNA 5J2TA 3VJMA 2PUGA 2VL7A 1BNCA 1XEFA 2AJTA 1ZD8A 2FN4A 1V7CA 2G28A 3AHHA 4G9BA 4NG5A 3LPDA 1MJGM 2CFOA 2XYQA 5EZ5A 3U3JA 3DSRA 3NTOA 1JBKA 2QRHA 2C9BA 2WD8A 4FU0A 2GM5A 5REQB 4EYOA 5GJBA 2QUHA 1YQTA 2HEGA 1SBQA 2XUGA 1GTSA 1MKYA 2XV1A 2EAUA 3B12A 3E3MA 4X93A 4PGGA 4U2EA 5CCDA 3IEMA 5IJWA 2GASA 2DGDA 1II9A 3Q9NA 3VAYA 5K4GA 2NTYC 5KCZA 1KFKB 5F5NA 4DR4B 1V11A 2LW7A 3C39A 4CDMA 4YT2A 1KY4A 3NJRA 3D8SA 1QO7A 2C0PA 3K3PA 2VK1A 1UEXC 3B7WA 1PV2A 5BRNA 3PD1A 1W2WB 3D81A 5AOAA 2W2VA 3CNNA 3CLTD 3FYUA 3PICA 4WZBE 1QRRA 1OGIA 3CCCA 4K0RA 2WV7A 4Q3NA 4Q4CA 2ZDHA 1VYUA 1YB4A 1Y6GA 2OXFA 1GXSB 4XVHA 4D6XA 5JFTA 3W5DA 3D1LA 1WKCA 5EY5B 2V74B 1C3OA 3LQ1A 1XV5A 3PXEA 4EJ6A 2F55A 1BZYA 1Y3IA 2GX6A 2R1UA 2ID7A 5LZ5A 5TQ2B 4UTOA 2A86A 3DS8A 1UBJS 4KNWA 2AA3A 4DR1B 4M1QA 1C1YA 3CA8A 3CX8A 4FUTA 4NATA 1YZHA 1J22A 1RQRA 3GDFA 1K7CA 4Y1RA 3UHAA 4ESOA 3UPTA 3I9OA 1OZFA 2JDIA 3H4IA 3C41J 3PEFA 1QGUA 4FX2A 4QPNA 4Z8YA 3ZWYA 4S1WA 2A94A 3GVHA 3OHPA 3ROPA 3IFSA 3GEGA 3PC8C 1EK6A 4N54A 1T25A 3UXYA 2ZRJA 4KXLA 2EKZA 3PCRB 5DGCA 4WGFA 5HMMA 2EXXA 2WINI 1FJHA 2W2NA 3IMEA 3R7AA 3W3AH 5EJ7A 4XB1A 4TRNA 1FIUA 4K46A 3DKPA 1DBQA 2ECFA 3HC7A 5AVYA 4AXBA 4M1TA 2ID8A 1RE0A 1IUKA 3J80A 1KFJB 3RVOA 1REQB 2GA8A 2HN9A 1W73A 1YHYA 3EMVA 1DBIA 2XNJA 4MW0A 2OOSA 4OSPA 3VBCA 1G9TA 2R48A 4WOCA 5KU1A 3W79A 3EUFA 4IBOA 3DAYA 5CFRA 3NIWA 4FMCB 5DO9A 1XU4A 4DPLA 2GPJA 3LDGA 1BN6A 2A0FA 4UXJA 1YIDA 2IDJA 1G19A 2GK3A 1CYDA 3IRUA 3AVUA 3CE6A 1HGXA 1IHYA 1JEJA 2CXOA 1E4VA 3FWNA 3MJHA 5NLLA 3QVGB 4RIEA 3ZV7A 2X9GA 1YBFA 1L6IA 3E9RA 2KJQA 4F86A 3IX7A 4AMGA 1U0RA 3D3KA 4S1TA 4C30A 2WZQA 1MB4A 2BKXA 5BYBA 4G65A 1GPNA 1THZA 3L1JA 4HXYA 5IZCA 1KJWA 4B80A 2P7IA 1PDOA 1ND5A 2WVGA 3PHLA 3IAHA 4EX7A 2WZBA 2WJGA 4FKZA 4LZOA 3MIZA 3GLFE 4U8GA 5LQSA 1NFRA 4YJFA 5DIZA 3WZLA 5LP1A 2PN1A 5I8ZA 3T5BA 1RZ3A 2FMIA 2GJKA 2O48X 3BVPA 3E9QA 3D8BA 3PUVA 3DT8A 3OHMA 2XUAA 5JI3E 2R7KA 1DJQA 4QOHA 4MQMA 4BNTA 5C7OO 2GFIA 4ZDJA 1L7RA 3JTEA 3SPXA 4HAWA 2QD2A 4M2LA 3U7RA 4U0JA 4GSYA 2XX3A 2OM2A 3O4GA 3QUTA 4RHYA 4YRLA 3Q3JB 3RWBA 4F45A 1EK0A 4EJSA 5E6UB 1ZJYA 1F3LA 1EQUA 5EVJA 1Z5GA 2AQHA 2GFQA 3AIMA 5BNIA 1V3UA 5KQLA 4FFSA 2WDZA 4MITA 4OGGA 1T2DA 5HE9A 1BRTA 4D8WA 1FS6A 4MQLA 4F5ZA 1G18A 4OQLA 3NPAA 3VI3B 2RHBA 3OZVA 1DRUA 1FFCA 1HDZA 1I8TA 2NTEA 5CAEA 1S2DA 1ENZA 4NJOA 1N33B 4XYGA 5ICEA 4TZKA 2Z4SA 1NR5A 4ZVQA 4PZPA 1WTCA 4JMLA 3ORSA 4N65A 4Q3LA 3K70D 1XTVA 2O8FB 4QRHA 2GTIA 4YNBA 1N3LA 4OJTA 3C6XA 3UB2A 4RV5A 4HBGA 1SURA 5K03A 1GYPA 1Q7GA 1SR8A 3A31A 5DYIA 4NE2A 2QRKA 5I4KA 2FCAA 1XZHA 4AUEA 1D1TA 3UB4A 3O47A 4QFDA 4WK2B 4ZVSA 1SG6A 2IYRA 4UREA 3RHZA 3O2JA 2JCGA 1UM8A 3EDMA 1V11B 4BNVA 2EBFX 4EYSA 3TZHA 1KFCB 3IPLA 3M6AA 4HYTA 5LA6B 1OU0A 1RXUA 3PXXA 5G4KA 5DH9A 3W8RA 1U4NA 2P4QA 3FYUB 4DT1A 2OUKA 1S9HA 1KI6A 4KQKA 4MV7A 1Z7GA 3ZHCA 2NTVA 5IMBA 2KS6A 3OI7A 3MTIA 4RK7A 4BBZA 1F9EA 4HGZA 4QBGB 3JQ9A 3FUVA 5LL6P 3BTSA 4RK1A 5H59A 1C3OB 3TLYA 4AVYA 2D1SA 4D82A 4DEVA 8MHTA 1W52X 4CNBA 3VKGA 1JSRA 2BDTA 3WL6A 2VWQA 3H0EA 2GN2A 3ZN2A 5KHOC 3AF1A 1ECPA 5IUNC 1Y5MA 3SHOA 5ALUA 1OAOA 1IFXA 3LWDA 3JQQA 2ZRQA 1W76A 3AEKA 3NOQA 4W1RA 3USZA 4Y1RB 2QKYA 1ZR4A 3QTLA 2PU7A 4HGRA 1PVOA 5IP5A 2LKDA 3CVUA 1QGUB 4FHZA 4OKSA 4BQQA 3SBDA 2VDWA 1L1RA 4BE4A 3Q40A 4WCDA 1BKDR 2H1RA 4GBGA 4W5WA 4D0SA 4Q9IA 3ON5A 2PS3A 2FRDA 4E31A 3V4VB 2JJQA 2AWNA 4N3BA 2WU4A 3OF3A 4XIGS 4DJTA 3MCTA 4EVSA 4Z7QB 4YJGA 4H6VA 3U7IA 1XYVA 3OPQA 4GL2A 4J3NA 4AG6A 3SQOA 2VI5A 4O4JF 2EFEB 1UMDA 1JHUA 1TUGA 3GYBA 3IA7A 2PRKA 4E07A 1P18A 2IWHA 1NW6A 2WJHA 3CGGA 4MUHA 1WCXA 2VHWA 4V3CA 5EWLA 2B35A 1TF5A 3AJAA 4LF5B 1EGMB 1ZLYA 1KDVA 1K27A 4AY6A 3K4QA 2C94A 4G41A 4JIGA 4B48A 2AC4A 1CP3A 2Q5LA 1RRCA 3LX6A 4BO1A 5F7ZA 5ALGA 3IOEA 3KWLA 5I3CA 4AT1A 2ES4A 1Q1ZA 2H9YA 4UU7A 4QDZA 5AJYA 5DM2A 3BDIA 1GGKA 1Y63A 3BRCA 16PKA 1MAWA 3WQBA 4RM3A 1BOFA 4P4LA 2FYTA 3ESDA 4MV6A 5JAQA 4DCGA 2QJWA 3CWZA 2VNSA 2I1WA 4LNHA 4AY5A 3RIYA 4J29A 5CFPA 3RARA 4AYTA 1VTKA 1S9DA 3BGVA 4WE3A 4YJFB 3WDLA 5F7OA 2ZR7A 1NBHA 5LBIA 4JC5A 4MUIA 3IGFA 1QE3A 3I8XA 1GPAA 1WZUA 4ZVNA 1X1TA 1HOTA 2EKDA 2ZS9A 3K9QO 2QTVA 5HNKA 4DLXA 1I13A 2YICA 4PPFA 1QUEA 1XDDA 1B0AA 2C9OA 3LX8A 3O3OB 4TN5A 2V97A 4UTXA 4XWGA 4I5FA 3TAXA 1A8SA 4EJSB 1M2JA 3GLFB 1QQ5A 3GAAA 4JELA 2CNWD 3RUDA 2VPXA 1SPXA 1VI2A 2CMGA 3R3JA 4P7BA 5FBRB 2XBLA 1WNTA 1YWGO 2XZOA 3CB2A 3VYWA 5B58T 4G36A 4HDRA 1F12A 1SU7A 3IAFA 2VVTA 1NVFA 1U2EA 4YCLA 5GJVC 1NJ5A 3OQHA 5DRTA 1V8DA 3H1PA 4GE0A 4KN8A 1D2CA 1EE1A 3ZS9A 3TBHA 4KMMA 4YJDA 1HH4A 4DVJA 4QQ8A 4R8SA 2I3GA 1WW8A 3BL6A 2X0JA 1CUXA 3A3YA 4R31A 5FYQA 4C4AA 5A2GA 3HMQA 1I4EB 1NQUA 5CD9A 4BMOB 3TQHA 5IT0A 1DJNA 1JZSA 1W94A 3RJ9A 4L5JA 3P2MA 3PDWA 4OH7A 3UK2A 2AOTB 3G2PA 4DG5A 4XTRA 1S3FA 1LLQA 2B82A 2XTZA 2ZRMA 3KKOA 2DFKB 3CT4A 3NTQA 4QUHA 5G4KB 2QJFA 3BH0A 4DT1B 1U3TA 4K9QA 3L0YA 1Z0AA 1IUOA 1KPHA 1XQ1A 2Z3VA 1EVLA 1KI6B 3FA2A 3H42B 4WKPA 1Z45A 3OLYA 2X1MA 1H2YA 3IP7A 4ZEXA 3UATA 3UMSA 3VVMA 4LYEA 5I7HA 4RKRA 4FILA 1GTJ1 4FKBA 5I47A 1V5WA 1OLSB 1TO1E 3LL7A 2G1UA 2PO7A 2Z1NA 3H1AA 3CPHA 5BWNA 2J4FA 4UDYX 4E6PA 4MROA 4ZTBA 4H3HB 2VDQB 4B75A 3UH1A 3EZLA 1J0CA 1TADA 2IL1A 1YF3A 3AEKB 3PWKA 1SELA 4V2UA 2VSXA 4L4RA 3BSYA 5J40A 1XAIA 4CODB 3PUKA 4E5KA 5D1HA 1PFWA 3ZC3A 4C01A 2D06A 3WJ1A 4YRRA 1GRRA 1LLDA 3LZCA 4JLNA 2FEWB 4LXXA 2DUJA 2VDWB 5DX0A 5BNWA 3QA3E 4Q6WA 3UJAA 4CV3A 3DFKA 1CC1S 2FA9A 4JJ8A 2Q3DA 3NOVA 4R7TA 1UBKS 4TS9A 3RKSA 3ER8A 4G97A 4TTAA 4NKRA 1GAQA 3MD9A 4AP6A 1OT5A 3BWDD 1XQ9A 3H2SA 3WLIA 3ESCA 1LK0A 5IX8A 1BMQA 2YC2C 1EFHA 3ECAA 3N07A 2PBZA 3O0DA 2WG1A 3OEED 1A5SB 1H6CA 4RHTA 4YJGB 4D0RA 4ZCPA 3MWGA 4ZJZA 2NU6B 1S7GA 2PVPA 3THXA 3ICEA 2RGEA 2IZZA 4ZOEA 2EL9A 4P81A 1UMDB 2XCTB 4GQIA 1ZCFA 1FLNA 1N3IA 421PA 4NZNA 1MUUA 4PLHA 4NRDA 4LJYA 3TTUA 2RGCA 5EWLB 5B3KA 1L7QA 2OV4A 3VRHA 1Y3CE 2HHLA 3P94A 1CUFA 4PBTA 4ZU3A 4HAYA 1FP2A 1K66A 1LDGA 2V65A 1UPTA 3P8ZA 3T7SA 1K8RA 2DRIA 2VUIB 1NW9B 4AKTA 5T64A 1B00A 1LRKA 3EUAA 3RUPA 1XJ0A 4ECAA 2YHSA 3FLBA 4GG1A 3FW1A 5EUBA 2WMYA 3IH5A 1M33A 2EYUA 2Z2YA 3PXAA 5AKHA 2XIQA 2QUBA 2R4QA 1GUYA 1UBGA 4LVUA 3SC2A 1KEWA 3NWBA 1VHQA 2XCUA 4JZYA 1L4NA 1OJ7A 1X8XA 3KYBA 2VZ9A 1Q0QA 1F5NA 3NASA 3QUCA 521PA 1CIVA 5ILGA 4CW7A 2Y0CA 4GUAA 1UXOA 5B7PA 5LMUB 3IMFA 3UUWA 3FBWA 1N57A 3GARA 1D04A 1UWVA 2EFYA 4WXHA 5KVVA 1VYHA 3TR0A 2IP4A 2IUEA 3LBAA 1SOAA 5EHNA 5JXHA 3SQNA 1DEHA 4PYOA 4FNGA 1YKGA 1P0CA 1TCUA 1SFRA 4RPKA 1QSGA 4DV6B 3FJOA 1EAYA 1U3UA 5CUQA 3UWDA 3ZKAA 2DJIA 1I1QB 1NQ5A 5H3LA 4CL3A 2QTVB 1DDOA 3FKSA 2RC5A 1GNSA 3UKOA 3T99A 2R2GA 4K9LA 5BSWA 4JODA 1L6RA 3DDCA 4PR0A 5EFZA 3ANYB 2J30A 3D02A 3MRVA 2F4VB 2QLFA 4PTLA 5ETJA 1D2AA 2BFCA 3WMWA 4DUGA 4HRXA 4R83A 3TVDA 5JDCA 4OMDA 3L4JA 1MJNA 3NEYA 3RUHA 1FPMA 2ADOA 3AHFA 3M6LA 1T6YA 1ZRHA 1NOJA 1E79D 1V8BA 1YJCA 3KV3O 3FZGA 3QI7A 4YH1A 1F38A 2H1FA 4HN9A 4HDRB 4ZALA 1FQOA 4OGFA 4RF3A 1EHCA 2FFHA 3NWOA 4WY8A 4C5CA 2YYZA 2EVWX 1W46A 3L7IA 5AHXA 4TMVA 2OCXA 2UZIR 5ICFA 2XECA 1ZY2A 3AF5A 4D3FA 2NQ8A 3SEZA 5DK6A 1MJHA 1HNWB 1JNYA 2UUAB 5DASA 3OTIA 5C53B 3QXGA 2G7MC 2WM9B 3F9RA 1SUCA 3KZXA 2CE7A 4KWHA 2BELA 3O93A 3DYVA 1H69A 1PS9A 4EG6A 1GVHA 4V3BA 3DTVD 2C4UA 2RKBA 2WIGA 1S2IA 4JUCA 2XE8A 3W5SA 2QOEA 1CS0A 1OA0A 3U26A 1H85A 1UODA 1BJTA 3MJCA 4R1LA 4YP9A 4CPDA 3IUBA 4NMMA 1LW6E 1R0YA 4IWXA 1N8NA 4HQRA 1W7AA 3PQDA 2GXUA 5AVJA 3KOOA 4UEJA 4NMWA 1NVEA 4F38A 1QLJA 4NH0A 3E82A 4RZ2A 3AZPA 2QA5A 1JU9A 1NLYA 1BN7A 2R25B 2VS1A 3V55A 5JU6A 3FOFC 3BT7A 4HLUC 1SVIA 4YAJA 1IUPA 3WWEA 1WPQA 4I4TF 2QQEA 1VSUA 3FTPA 1LDBA 5AVUA 1KJQA 1KZ7B 2P2GA 3GGJA 1XEXA 1SOMA 2ZI5A 3L84A 1P77A 4W1PA 3ZDYB 3BCRA 2CT8A 3HN7A 4PYNA 2EEPA 1TI7A 1YJ8A 1W93A 3IQHX 1IONA 1Z5UA 1Z8DA 2QLJA 1T0UA 1H2WA 4MPRA 4RLFA 4YONB 5HDQA 4RTMA 1LQTA 1I36A 1GKKA 5K3DA 2B99A 1DWPA 5CFOA 2IU3A 1HR0B 1NUQA 5CD1A 4OL9A 5ELMA 2R66A 3THXB 2XADA 1J20A 4C05A 3S0JA 3TLCA 1GTVA 4R2MA 2YXLA 2PKEA 3UGJA 5BQOA 2P27A 3IQWA 3OWOA 4MEJA 1BE0A 3DYIA 3LLVA 3NV7A 2DQYA 1OY1A 1YBAA 1U0SY 3TRJA 3ETEA 3WLJA 1YZUA 4QUKA 2EP5A 4O4JA 4MQBA 4RKFA 4G2TA 4ILEA 4U7TB 4F8JA 3HVUA 4A8JC 5JXIA 1B1AA 4AS3A 1ECFA 3L4EA 1TMOA 5DBOA 1HYQA 5CT6A 5F4BA 1EMDA 2HADA 2PJDA 4FFWA 4WERA 5G2OA 3TUZC 3F5MA 1ABBA 3HYSA 3M6UA 2WHPA 1A69A 1W0CA 2C8KA 3FI9A 1BH6A 2XKBA 3QKSA 4QPJC 3FRHA 3VDMA 4A9AA 2WIKA 3NVMB 1GKUB 2FMUA 2OORC 2Y1XA 2ONCA 1MMFB 4MA4A 4NMXB 3RODA 3P0JA 4INZA 5A2QA 5KNCA 1GNPA 4TZ6A 2J5XA 5CTJA 2NNWB 2GZ3A 5CB4F 4TMTA 1Q7EA 2QY9A 4IHKA 3I28A 3PQEA 4GEKA 4KKVA 3S44A 3KNZA 3UJDA 3CUKA 5LKAA 5KOYA 2X9LA 3C3EA 3LI2A 4NG4A 4RAQA 3T95A 4TSRA 1F2UA 5EEHA 3HQ4O 1IQPA 1SBTA 3DOUA 3A27A 1W87A 3H99A 4IZHA 1R6BX 1KE2A 4HXFB 4UCQA 4YI3A 1EESA 1YFKA 1F2DA 4IVRA 1KI3A 1G2IA 1YCGA 3HHEA 2M1XA 4YCBA 4CT5A 3AY3A 3O1IC 2NXJA 3BD7A 1JJ7A 1LJUA 4JUIA 4YLYA 2DPLA 1P8JA 1U2ZA 1L2TA 1T4DA 1WVIA 2CZCA 5GZ1A 4XDYA 2DULA 3FVRA 3NBZC 2BFCB 1AM4D 1A2KC 5FFNA 3SS9X 1GNLA 2ZXFA 8ADHA 1HPLA 1J1IA 1R4NA 2NYAA 1S3SA 5JATA 5TB5A 4B44A 4HMOA 3P0EA 3HXTA 4UXHA 2YZNA 1D8TA 2YY5A 4KITB 1P44A 1M0SA 7GPBA 1ETHA 4DABA 1FQKA 1QG2A 3FPSA 5L51A 2G17A 2OZVA 3IIEA 3WK9A 4LE2A 4JGIA 2Z2XA 3II6X 4QDOA 2C03A 2XCSB 1E3JA 3ZLBA 2BBOA 4JBGA 2IU0A 5JISA 4B3MB 2QN2A 2B9EA 3FOCA 4GBMA 4E5DA 4DS3A 5BSKA 2BDEA 2Y4OA 4J7UA 3UK0A 5E7QA 4EI8A 3N2YA 5DISB 1N3BA 4LEIA 2C83A 4AWXA 4REOA 1JDTA 3FVTA 2PL3A 5DNAA 5IULC 3X1JA 2ZJ6A 4L2IB 5CGZA 4PGAA 1GNTA 4MYRA 5EHGA 5EJIA 1YBVA 1T29A 1I32A 2QGZA 2CEKA 1UANA 3IAM6 1CS0B 1VKZA 1QP4A 4AJLA 1YB2A 4DBLC 3A0RB 4O5OA 4DDHA 3N8HA 1XVTA 2HY7A 4GMFA 1D5CA 1QX4A 2IITA 1IY1A 3L6UA 4EX6A 1R3UA 1VMAA 3U1TA 3KOXA 2PS0A 1F6DA 1Q1GA 3F7TA 3BG5A 2ZYUX 5FB3A 5K0SA 1W5SA 3WGJA 2NXEA 2WAOA 4N7BA 1Z4QA 3DP7A 1UK7A 1YS6A 4XWWA 4I1UA 4ARIA 3W5IA 1Y7HA 4FWBA 1CV2A 2PV7A 1XA4A 3NVAA 4IZIA 2HSZA 5K6AA 4IXWA 3Q41A 1TQ6A 1HRDA 1DJPA 2X4GA 3KL4A 3LWBA 4FQ5A 4LYFA 1C7JA 2I76A 5AOBA 3WISA 1TEXA 3QVSA 4EP1A 4IV8A 1M2OA 2GDJA 1Q1BA 1TYAE 2L19A 2IEGA 3DKKA 3JWIA 4ZANA 4YRPA 1O8CA 3ONFA 4DCCA 4QG3A 3EZFA 3O8LA 2FN8A 2CV1A 2D7JA 2JL1A 5FHQA 1NXVA 3SM3A 5F77A 5AVXA 2PD6A 3N2LA 4M36A 4ZOBA 3B6EA 4CKZA 1J25A 2DETA 2SHKA 2CSXA 1BH2A 4BKOA 1QP0A 1GU1A 2NW6A 1LBTA 4GOJA 1ODTC 1V47A 1XELA 4ABTA 4ARAA 5K0FA 1UBEA 2PSDA 4A6DA 5T8KC 4BLQA 3E9YA 1D1PA 2O1WA 3N7AA 1PI3A 2CFCA 5A1TA 5TMPA 3QX7A 1MC1A 3BK7A 4BGIA 1VCHA 1FW8A 1RDFA 4N40A 4ARVA 2XWBF 1FXSA 1MX5A 1OXKB 1V3TA 2X0NA 4O4JB 4BC1A 3B48A 4MSUA 1D4AA 2IXBA 2XB4A 3N0RA 1WD5A 4L7QA 2FSUA 3HCBA 4LQ4A 4BU1A 4J76A 1IJFA 1YUBA 5MF6A 2FZ4A 2Q5EA 2C2BA 4DA7A 5K7SA 2O2DA 2NYVA 3A3OA 4H35A 2AGVA 3W2GA 2WHPB 3QKSB 3A1DA 5LZ9A 4ZYZA 5DFAA 2NO1A 3S29A 4PX2A 1K7SN 4HVTA 3JASB 1GITA 4KE6A 3D2AA 2XYHA 3EA5A 5GWXA 1VHDA 4RTSA 1TRKA