2JS7A

Solution nmr structure of human myeloid differentiation primary response (myd88). northeast structural genomics target hr2869a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
160
structure length
160
Chain Sequence
MGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of Human Myeloid Differentiation Primary Response (MyD88).
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Myeloid differentiation primary response protein MyD88
total genus 41
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 2js7A01
3UB3A 4FZ5A 5KU7A 5H3CA 3JRNA 4W8HA 4C7MA 3H16A 3UB4A 3UB2A 2Z5VA 4LQDA 1FYVA 1T3GA 4EO7A 4C6SA 1FYWA 4C6TB 2Y92A 4C6RA 2J67A 5FORA 4LQCA 4C6TA 4LZPA 2JS7A 4DOMA 4OM7A 3OZIA 1FYXA 2M1XA 4W8GA 1O77A
chains in the Genus database with same CATH superfamily
3TW0A 2O07A 1C1XB 1C4WA 2E9SA 2DBZA 2HLHA 4MQ4A 2PANA 4AP6A 2HK6A 2ZJBA 2E89A 3R6LA 1EQ2A 4PR3A 4XQEA 2UYHA 2WTEA 4MROA 4IVRA 4V0NA 3UO8B 4Z1MD 4TYYA 4PLFA 4RZ2A 1REQB 1WS6A 2OKGA 2LCQA 2HHAA 3AQ4A 4C7VA 5KX5F 5IM4F 4KTTE 2M6RA 2MSDB 1YXMA 4Q9AA 2GXAA 3EIOA 3LAWA 1Y1SA 4KKVA 4WLOA 3SAJA 3KWJA 4U7TB 1U0OC 3CSSA 3FRJA 4CMAA 1N0IA 4ZC8A 2YZ7A 3A8TA 4MI3A 1G18A 4BVBA 4HP8A 2NGRA 2XQGA 3OQMA 1QPGA 1YHNA 2XNHA 4TZKA 2VQ3A 3L0CA 3N2GB 5B1YA 1R0WA 1ZICA 5EPOA 1Z0KA 1IHDA 1YZLA 3N3AC 3U4AA 2R1ZA 2BN4A 2PUAA 4DHWA 2O20A 1P5HA 2I2FA 5FPYA 5BSHA 3IHWA 3GI1A 1QRSA 1H3EA 1HPLA 2AMJA 1JLLA 4B3BA 3TZHA 1WOYA 2HDWA 2F7SA 1T0HB 4BJHB 4QDXA 1K06A 3NEAA 3TE6A 2DCMA 4N3GA 3W5BA 1JH8A 1UBNA 2FW1A 3JQBA 4JL6A 3DE3X 2GK4A 2GZDA 5FV7A 2W6PA 1EX9A 3BXEA 4JEIA 1A7KA 3TLCA 2B5VA 2JI8A 5L53A 2VF2A 4U9UA 3GJ7A 3C7TA 3V4LA 2E4VA 3EISA 4E14A 2XW6A 1S8OA 1BXGA 3BFXA 4XJTA 3RK1A 5IJZA 1X7WB 4F3CA 2BM0A 5DASA 2A14A 2O5VA 4GICA 5EZQA 5DBOA 4BFXA 4ZI7A 1RI5A 2CXRA 4KC0A 2XHZA 1JAXA 5KX5A 1XVLA 1F4VA 4J4BA 2B94A 2IIPA 1P5RA 2C99A 3BKXA 5CT5A 1PDWA 1XCPA 2QYSA 3JWJA 3KC2A 4X6YA 5E6RA 3RHTA 4CKYA 1I4OA 2QTVB 3CNLA 2DFNA 3A2MA 3OURA 4LCBA 3TLGB 4DR7B 4X20B 4UHHA 3I9MA 3E53A 2ALJA 2GFHA 3C24A 4XRGA 1LFDB 1VB3A 1W2GA 1ZIOA 5T8KA 4WN9A 3WLTA 2CNNA 3IULA 4UUAA 1EP2B 4Z9XA 1CETA 3UV7A 2ZBRA 4I8XA 4BQIA 1Y6GA 4U7FA 3OLYA 3SFTA 4RA9B 2XUGA 3UHAA 4LDPA 2GXUA 3VJRA 1M7HA 3IB6A 1ULBA 4FK8A 1G42A 3OETA 1L7PA 2H07A 2G5CA 4L8GA 1JV2B 3BZBA 4PQEA 4MVJI 1YZUA 3AKEA 5JDCA 1KAQA 4KMMA 2OV3A 1S9DA 1CUUA 3GT4A 2IZ6A 1Q7RA 4ZVSA 3WLHA 1YSCA 2I1VB 3TGPA 3LA8A 3C8DA 3PUYA 3I92A 4DNXA 3T7DA 2FDRA 2IQIA 5C4GB 3F46A 4DDKA 1Q2UA 4IWXA 1AS2A 2VF8A 5IHXA 1P5FA 2ZRHA 3C4QA 3EXFA 1U0LA 1Y9JA 4WRRA 1L1FA 3UAWA 3GEIA 3WMWA 5AKXA 3TZQA 5L45A 1FSPA 4JYMA 2Z3ZA 3CX6A 2O0LA 4I4TF 1L5LA 1AHHA 1IUNA 5DCWA 1HF3A 5C1BA 4N3NA 3W9UA 1INLA 1VYVA 5BSGA 3V2IA 1NR7A 1QP8A 1BQEA 4XCQA 4YDHB 3NNDA 4Q9LA 3GOHA 2AEEA 1VCIA 1XZJA 4ARZB 5KKNB 1X8XA 1DQYA 1T9AA 2PIAA 4CEHA 3MWFA 4HRVA 1R5JA 5IVKA 1QM5A 4FFMA 3BTSA 4BVHA 5HG0A 3PUXA 4KIUA 1ZI9A 3ABZA 2H1CA 3TL6A 1AS0A 1S7CA 4C3ZA 5KWJA 4YFYA 2IGTA 2P3SA 1DKLA 3E6AA 3DDCA 1DRVA 1HQCA 4FGKA 4ZT4A 1GG5A 1P3JA 3UZUA 5AUPB 5C53B 2DPMA 1NNSA 4IZ6A 1YB2A 2ZULA 5DX0A 4AJPA 2GFQA 1IBKB 1TJYA 5KMGB 4UBNA 4J0HA 1MDFA 3LUCA 1FBTA 4O2BF 3J81k 3AYXB 3KOWA 5ALWA 1GTMA 3I01A 3RV3A 1D7AA 2H7VA 4ZOAA 5KB3A 1SBCA 1N9KA 3Q3CA 1VJDA 3IUEA 3PP8A 5FPQA 3AXTA 4LYYA 3OM9A 5DI3B 5ENZA 2C7VA 1GITA 2PMWB 1IJKA 2JH9A 2G08A 3EOZA 2X0JA 3V97A 1JDJA 1UXGA 1EQAA 3FETA 1ZGJA 3DT6A 2VG8A 4WIAA 5IAKA 1IQUA 4F4IA 4NHOA 1L7VC 4ZAFA 1RXUA 1PZMA 3OWHA 3PUKA 4RTPA 1F48A 3GLFE 2XUZA 4GHWA 2Q0XA 2AZ4A 4UTVA 1D1SA 1AKMA 1R18A 4JJ7A 4D8VA 4Z8YA 3QEMA 2PMKA 5KINB 5LOVF 3PSHA 2WVJA 4YROA 3WIBA 3WAGA 1JQAA 1Z0IA 3WB0A 2Q7XA 1NPDA 1U7PA 2ZB4A 4DCJA 4DCUA 1FFGA 3RVDA 5IAAA 3KQKA 1G20E 4DZRA 2VXCA 3WNQA 4LK2A 4AO7A 1XJQA 2BEVA 1U7DA 3FFBA 2ECQA 3ZJUA 1NF3A 2V59A 4EZIA 1YDHA 4BPRA 1JALA 1Y8RA 2CUKA 4YN3A 5I9LA 1NQTA 1NMSA 2UUPA 4DEYA 5LL6P 1LH0A 4P83A 4XR9A 4B8WA 1TVKB 3B1ZA 4PZUA 1JG1A 2HNAA 1KBQA 1ZD2P 2AJ8A 5IW8A 5TMBA 1XDGA 2JI9A 2V4UA 3T3MB 1CUDA 3G2OA 3PEEA 3E9YA 4N3AA 2I3GA 2NSHA 4LY3A 3SP1A 3T1HB 4U2DA 1Y48E 1QKIA 2CL0X 2GK3A 2GJSA 3WTBA 3J7TA 1CY8A 1J7KA 1WHSA 2RI0A 2P6PA 3NXKA 5KYVA 1E2FA 4FDAA 5KVCA 5FOXA 1DMRA 2VHXA 3LLSA 3RSOA 4C7OB 3AP1A 4I9HA 1SD5A 4DCMA 1N92A 1QH9A 3KQYA 3CR7A 1U0TA 2FSVA 5COAA 1K7FB 3KZKA 3QG5A 3WQRA 4PRYA 2ANCA 1DHTA 3MLBA 4KFTA 2XNDD 4U02A 1QQAA 1COZA 1SG9A 1QIIA 2DWPA 2ZIWB 3OPXA 4L73A 4XX1A 5F7ZA 2NVUB 4QTUB 4GI7A 2DP4E 3LBNA 4EJ6A 5IJ9A 3EX7C 1TAQA 3E22B 4DSUA 1CRQA 2OENG 3WDMA 2DZDA 2ZJOA 4N6OA 1PVOA 3IAHA 4HF7A 3D5EA 3T5BA 1ZCFA 2F8SA 1A4IA 1E99A 4X00A 1P9NA 1V1JA 5LSAA 3FPEA 3LCMA 4J9VA 4FOOA 1NJ8A 1FU8A 4Y2YA 1XN4A 4CL3A 4KTVE 3IHKA 3OUZA 3IDAA 3AUAA 3CWCA 3EODA 4FKMA 4MYUA 5C0OE 1QP0A 3SR3A 3KJXA 3A9UA 1FSFA 1Y5RA 5EPEA 3X1YA 1AK2A 3WHLA 4UMFA 1O03A 3D31A 2OBBA 1RJFA 3LA6A 1XDDA 1XVUA 2OV2A 4FNOA 1YHZA 4KXVA 4ADSG 4EFMA 3KTOA 4WSOA 3MOSA 3AV0B 1C9NA 4BNZA 1ZYUA 4AP5A 2WSLA 4J49A 1YQ9A 2VPQA 4DLLA 4EWLA 1TLTA 3LNCA 2P7IA 1ULUA 4CM9D 3R2JA 3B6JA 1ODKA 3BG5A 3ZHVA 3NP9A 3OMLA 1X7ZA 3VC7A 4UPEA 4YT8A 3GGJA 3EWIA 2X5OA 3JCZA 3JVEA 3HM9A 2D2XA 4K9DA 6PFKA 1PI3A 3LVRE 3M4JA 4NDAA 4QULA 1SC3A 4Y1EA 1KORA 1ZD3A 2P0YA 1KP9A 1TIKA 2CHGA 2J6HA 2X2OA 1IB6A 1L5YA 2WHEA 3GLHE 4LI0A 4GGMX 1Z74A 5D85A 3ZV7A 4Z51A 4YRGA 1X7HA 1XMOB 4TLBA 1WKCA 5FWYB 1YB6A 2B8NA 3GFTA 1B4DA 2ZWMA 4M2LA 2DPXA 5FO1A 5B1EA 1SELA 5FOSA 2E87A 4FM9A 1DJQA 2PMFA 3PRYA 4DUYB 3F6SA 4NHEA 4FYIA 4U5QA 1K5HA 4PPYA 2I65A 1O6GA 3OQJA 2RAVA 4NNPA 5IYZF 4RHCA 3N8IA 4LOLA 3K15A 2IYRA 2WINI 2Z5VA 2Q9UA 3IB3A 5I7RA 3HXQA 2A8YA 4DSNA 2L19A 4WJZA 3THYB 1MDBA 3EGCA 3SKYA 4O4JB 5J4KA 4JVOA 4YT5A 4K9PA 3NVKI 5F4ZA 1XZCA 2Y4OA 1LLUA 3MWDB 3IQGX 3X1WA 5MDHA 1P2SA 3IEPA 1X9HA 3R4VA 1Z3IX 4OH7A 1O4WA 3P7MA 2J3EA 4P08A 1H1TA 5CIQA 4IOMA 2HHHB 3ZBQA 2GKOA 2HBZA 1CJVC 3OX2A 3QG1A 4DA4A 1CF2O 2X8LA 1ILWA 3OLWA 3UIEA 5IS2A 3ESYA 3G8CA 3TFWA 4TL6A 3FOZA 1MORA 3KT0A 4Q3CA 1U28A 3MELA 3VSCA 3G2IA 1E3QA 1EP1B 4NJOA 2QZJA 4MV3A 3S5JA 2UXDB 1E94E 2PCJA 4JOBA 3AVQA 4MVJP 5GOTA 1EUCA 5HEKA 1KAGA 2IE8A 3BTOA 3CC8A 1OWLA 3HADA 2PL9A 1DQPA 3AG6A 3LUPA 4Y2QA 4MULA 2DBVO 2VJQA 3GFGA 2H1SA 4DV0B 1FP4A 2QKYA 1ZA1A 4H77A 2AEFA 2QN6A 2CNDA 4D8XA 3CLRC 4JBNA 3U4GA 3AI3A 4U6SA 4HUTA 1KEWA 1MB2A 4LXHA 3DKPA 4N03A 4B9EA 1FXUA 5FLXA 3JAKB 5IZCA 2ZRDA 4EHBA 3ADDA 1C7JA 2JJ1A 2OORA 3EYAA 1ML4A 2RJOA 3B70A 1KNXA 1D6MA 2FSHA 5A7GA 1M8FA 4B3MB 3GAAA 1D9XA 2DFVA 3DEIA 3WL3A 4F4UA 3CXUA 4I5GA 4FB5A 1L7OA 3H2HA 3A4NA 3HDJA 3MWGA 5A02A 2EAUA 3RADC 4KMOA 4H6WA 4DMCA 1MAHA 4GL4A 3IDQA 1DINA 3QH4A 3R09A 2MSKA 2WPDA 1SIBE 3DE0X 3F3SA 2G5PA 3FSGD 3S1AA 3E7WA 3HY6A 1OSNA 1IJBA 4CFYA 2CXPA 4X1YB 2VHCA 3GLGA 1RR6A 5I4IA 4QM7A 1JPJA 3G2LA 4U0JA 5HM8A 2UUOA 1JAYA 2KI5A 4Q6WA 4UZFA 1LDGA 3UA3A 4CW7A 5J47A 1M34B 4Q4CA 2IX9A 1R6XA 4UDNA 3NC0C 4WASA 3FUWA 3IERA 2ARKA 3PXDA 1ENYA 3NBQA 1EX6A 4R9RA 3EC2A 5H70A 3WK7A 4AY2A 1TAGA 3HDTA 5EZ5A 1M2VA 4KAFA 2B8TA 3FWPA 2BKUA 4FKBA 3I42A 3T7EA 3TLBA 2ILVA 1YQEA 1SBNE 1SKMA 1ECLA 3OZAA 4JR0A 1PDVA 4GVXA 1OV6A 2NV2B 4X6UA 3VJLA 1K97A 3COYA 4WK6A 4LY9A 2PG3A 3AF4A 2CYCA 3KLPX 4Y2TA 1QOQB 3U81A 3UJ9A 3VAZA 4DB4A 3CVOA 3X1JA 2B5OA 5FWAA 2PGNA 3WHIA 1DIGA 1QZ3A 3KE9A 4F9TA 3P9CA 2VCYA 3G9UA 5JPCA 2R6JA 3V8NA 3WGKA 3X1ZA 4KQXA 2P9CA 1VJCA 1XSEA 4KGDA 4QGAA 5REQB 3ZKWA 4B9AA 1YJ8A 4GPBA 1XNRB 2HJVA 3VI4B 3M1YA 4IIYA 2PX0A 2FPUA 2Q4OA 3KKZA 4YI3A 3QF4B 4MHOA 1NDUA 3IQFA 5BRNA 3EC7A 1XK7A 3PQ7A 1FW8A 4YRFA 4JVLA 4K88A 3PSAA 4ZMSA 1HTWA 1JLHA 1UR5A 2CKDA 4E6PA 1UQUA 4AYTA 4JN6B 3SDSA 4QGSA 2R6DA 1FMJA 2WT4A 1X9GA 3BD7A 1WCXA 1GUYA 1DIHA 2XWQA 3E9RA 3GEGA 4GMXA 5AOVA 4YPFA 4DABA 4R81A 4G84A 1IMJA 4KV9A 3QW2A 1T0JB 2VBGA 4EENA 5EYPB 4EP1A 5TS2A 4BMOB 4DHEA 5AKIA 4C76A 1CDDA 1M5TA 3HO6A 3VZSA 5BNTA 1WPGA 4TQUS 5H7XA 4GLLA 3CJTA 4QUGA 2H4YA 4AJOA 1O97D 3LV8A 3MWLA 4NE2A 4YB8A 4DLZA 4G9GA 1J5XA 4IDFA 3SZMA 1GOTA 3M5WA 2GASA 5I7VA 1XIVA 7ADHA 3EZ2A 2AOUA 4GBGA 4L4XA 1R6BX 4RLFA 3H1BA 5H16A 2FEOA 1L5HB 3D8HA 3U4IA 4PZ9A 2CJPA 2H1WA 4UXIA 4M37A 3G2KA 3BICA 4ZZ3A 1QR2A 3K4HA 4TLLB 2ZPAA 2VTEA 1YAJA 2Q5IA 5BQPA 1LTHR 3CW2A 2CMFA 3WSVA 4CPDA 4G5OA 1N2CE 4S1NA 1Z3CA 2F62A 1NW5A 4AN1A 2R5WA 1SOVA 3DC2A 1C0PA 4P4NA 4N01A 1PK9A 3HYRA 4UXHA 3WIVA 1EJ2A 2PZ8A 1ZIPA 1UBCA 4XB1A 1DXQA 3IXQA 3ZV3A 1WXXA 2HA5A 1ZN9A 5A06A 1DDIA 4JROA 2ZIAA 3P2EA 2ZJ4A 2ID8A 3QVKA 3UB4A 4BRWA 5HM6A 4RV5A 1E3LA 5G0WA 1MMFB 4YRZA 2FWJA 3BGDA 3I6QA 5HUQA 2AZMA 2QV0A 2HW8A 2SCUA 5FTWA 4GPIB 2QOEA 3DLHA 4B6SA 4JP1A 1J0EA 1J2RA 2XECA 1AE1A 2VK4A 2F2TA 3UH0A 4YR9A 3OM0A 2WQ7A 1E8MA 3AM5A 4FOLA 2NTEA 2CLOB 3TRFA 2WJ3A 3KEMA 2ZXUA 3QFFA 1GUDA 2C2ZA 2ZIEA 1IY2A 2PNFA 3FJOA 3I2FA 3IESA 3G23A 4BU1A 4EHJA 3CTMA 4RFVA 4PLHA 2MSEB 4RZHA 4I1IA 4AJEA 3GVXA 4PQYA 3LK6A 5LVAA 3N07A 1RYHA 1XTUA 2GCEA 4P3PA 4CKCA 3BSFA 4URVR 1FUEA 2ODQA 1C2YA 1ZMXA 2IT1A 2J07A 4LY6A 1Y1LA 3WDLA 1M8GA 4F96A 3DE6X 5A9SB 2GN0A 2Q3DA 4N48A 3T6KA 4Q7KA 2B5WA 4BJ6A 1G8JA 3DUFA 5KSOA 5EMKA 2HZBA 4L8VA 4LHXA 2HPAA 1V39A 4YWHA 3B3QA 3PRKE 3UCEA 2BIFA 3ZTTA 2C00A 3BCRA 1UDRA 1XEFA 1HE3A 1Y5LA 3AJ9A 1DRJA 1SXHA 1NSFA 3KOMA 4DLXA 4TTVA 2OBYA 3JZFA 2JLYA 5L8VA 2R0QC 1BGVA 2P6OA 2QHXA 3W5CA 5IT4A 1CQZA 1ODCA 3VZCA 1L5KA 4PLCA 4ARCA 5ELMA 3TRKA 1M2OA 1ZVJA 2ZUUA 4UEJA 4CHTA 2NU6B 3H1GA 2VQEB 2JLCA 2PN1A 3N7UA 2LW7A 3QUAA 4L0CA 4B87A 2AZXA 4JHXA 2D4HA 1JN0A 2YHUA 4OYYA 3AHDA 5LZ7A 2NQ8A 4ZVKA 2BI7A 3RSSA 4NYJR 3DZFA 5EWMB 5IF9A 5JNUA 3SQWA 2AE1A 1M74A 5GAJA 3ZZ1A 1M1NA 4OEHA 3UATA 4HBGA 4DXHA 3AUTA 4EPYA 5EIXA 2GNAA 1AQJA 3SJAA 4U5XA 4YMIA 5JLAA 4H6PA 3OA2A 1GA6A 3PU6A 3QPUA 1WXGA 3IJPA 4H0CA 4BO8A 5HJ5A 2JAHA 3EC1A 4ZCQA 3UWOA 4YCCA 2D74A 3U09A 1P4AA 1UPAA 1SHLA 2YVUA 4Y1RA 2P5UA 4IKEA 3UCFA 2Q5OA 4M9SA 3W8DA 1VPWA 4U2EA 4KQ2A 3TBFA 3WISA 2X77A 1CRZA 4ETNA 1JQDA 3HLKA 3OWXA 3LDUA 1QRTA 1TM3E 2X4LA 5KVQA 4WCVA 4UBLA 2A1UA 2VN8A 3LFTA 1UC9A 3UAXA 4M83A 1NM5A 3UPUA 3I2KA 3TYXA 4EATA 1PQPA 1EGVB 1J9EA 1P9RA 2YXDA 3ZDEA 1M6HA 2C5FA 3F90A 1W46A 1DBQA 1I7PA 1T3TA 5C18A 3GRRA 1QK3A 2BHTA 3VPCA 1MO3A 4H2DA 3FDXA 1MX9A 5J2UF 2P2GA 1GU7A 2N1MA 1ORIA 1ZOOA 3GRKA 2QY9A 4HCJA 2YICA 4QWWA 4A6XA 4UNSA 4E7PA 4EYGA 1KVUA 5CHYA 1V1RA 1XC7A 2IF0A 4YNBA 4KQ9A 5HYVA 4MPTA 3HVHA 1CK4A 4R4JA 5TC4A 1OGYA 6Q21A 2Q62A 1NBEA 1KO5A 3OCYA 2ZRGA 1YRQA 4BRUA 5LZ2A 4G0MA 1U3UA 4KSCA 1ONNA 4EKNB 3D2BA 3ZWCA 5JROA 1FUYB 2OFOA 2H2FA 4QOEA 2FE1A 4YJ2A 1JJFA 2B7BA 3KQOA 3L8HA 3ODPA 4GKVA 1R16A 4W1RA 3SC3A 4BV3A 4HT3B 3BMCB 4WXHA 3LVFO 3EUEA 2UVQA 3KR0A 1YD7A 4IY1A 1IBSA 2N9UA 5KNLA 4B3GA 1T5BA 2H16A 2YWCA 4TGLA 4U3JA 2EJWA 3LPAA 4LXUA 1SA0A 5CYFA 1XMJA 4EAAA 4PN3A 4CKCB 3OZSA 4F1KA 2HF2A 3KXPA 4JNKA 3GFSA 5CT4A 3UHFA 4G24A 4DQXA 5H3CA 3QTBA 4F3RA 2UZAA 3FHTA 4BRSA 4HNSA 4YS6A 1DCFA 4OBEA 2Q0QA 4QAQA 2I2AA 2BH9A 3ANNA 3WWPA 5JQGA 2BEWB 1Y98A 5LZ5A 1CW2B 4M36A 1COWD 1GPUA 3P9XA 4TWBA 3K20A 1ZUNB 2P2NA 4KK3A 2C9OA 4X8LA 3PNOA 4NCHA 4C7JA 1MXFA 3DTVA 3EYWA 1NSTA 2IKSA 4C6RA 3RTDA 4L4RA 3GNTA 4ZREA 4TV8F 4EJSA 5EQDA 2QTGA 3D59A 3I2IA 4MRVA 4YAUA 4OXXA 3RC2A 2OV8A 3QOWA 2D0IA 3W6OA 5EFOA 3NP7A 2MYTA 4AYXA 4G0VA 4XCVA 1F5SA 2GN9A 1YR1A 3PUJA 3AC0A 1QMPA 1NJ5A 4AQYB 5D87A 4K9SA 2Q3BA 3ZWOA 4M8KA 1USUA 5LXTA 1M1ZA 3PWZA 4X62B 1LSJA 3IURA 3CKYA 4LV5B 2YINC 2ORVA 2PSDA 1NQVA 1TA9A 2IYAA 5IM5A 2ON6A 4WN3A 1FDIA 1HZZA 5D6NA 3S2YA 1VI5A 1S3SA 3NUGA 5E6UB 3QE0A 1VE7A 4X60A 4MMZB 1QIDA 3VUEA 2B7LA 4I9UA 3M4NA 1CRPA 3GAZA 2QRHA 2P5YA 1IONA 1ORVA 5IXSA 1ZJWA 3G49A 2D0PB 4IQ0A 1SVUA 3V46A 3FM9A 4C0KA 1PV2A 2CBZA 3Q9UA 2IZ0A 2WDZA 1VB5A 1DJNA 2O8CA 4GPZA 4JMPA 3R3YA 5BW4A 1XL1A 3STHA 2W6CX 3EZ6A 3FNIA 4JC8A 4BATA 1YZHA 5AHXA 5TS3A 3QJYA 1Z7YA 1DPGA 2KBFA 1FYEA 2GM9A 4IMPA 2JC3A 3LQFA 5KQGA 3V1TC 3KD2A 2IZOA 4MEBA 4TKVA 4BQEA 1NY6A 3FXAA 5DHUA 3GEEA 1ODJA 4OQLA 2JGMA 3ADOA 2PUJA 4JFAA 1HXHA 2W22A 3AKYA 1ZVVA 4HV4A 4MDYA 1JSZA 1QB7A 1DARA 1ZBQA 4KBGA 3A4TA 1UKBA 1JLKA 4RS4A 5TPZA 1B23P 2JBHA 1DP4A 3TLZA 4ZANA 3EZNA 5F1YA 3VKWA 3WHPA 1TC2A 2Q3JA 4NS4A 2I6XA 3MMXA 3N2NA 4YXWD 1ZWKA 1NT2A 4I1YA 3P45A 1AKWA 4HNVA 4G5FA 2HWXA 2AK3A 1Z06A 3NCHA 5HJEA 5JZOA 3CLUC 2Q3CA 3FHLA 4MS1A 4PTLA 1YE5A 3SXPA 4CFSA 5BR7A 1RMYA 1H65A 2PQ6A 5JYDA 1LWOA 2NO5A 1BKDR 4RKQA 4NMMA 1IXZA 3BBLA 1KPIA 2B8EA 4MJ3A 5A03A 3ITDA 1ZU4A 1NMZA 2XD4A 1PZGA 1M6EX 1M1YE 3F5MA 4KDFA 5AICA 2JD1A 5FEUA 2R6FA 2OTCA 1KVQA 2IUYA 3EW9A 4G5HA 4WOJA 3QEAZ 4DJEC 1U7TA 1JX6A 1YRYE 2QRVA 1T26A 2I29A 4AUMA 1YJXA 1R0LA 3F5QA 3H75A 1TKAA 4RQUA 4XWYA 1M6WA 4CCAA 3TG8A 1K3TA 1DV1A 4ENUA 4FS3A 3WGHA 3IDFA 3L7YA 3IRVA 3OEED 5I7AA 5K0JA 4NZPA 3GAMA 5JEDA 3FTEA 1KAOA 1T6ZA 1C0KA 1TQ4A 2ZR0A 3HBFA 3MFQA 2ZE6A 3A58B 4WZBA 4YMHA 2JIBA 3V3TA 1XPJA 2AVNA 3FIJA 2P9BA 4TXLA 2H7CA 1QCZA 3GDHA 4D97A 3KQLA 1W88B 2D54A 2B99A 5IFLA 4EHNA 1MN6A 3QJGA 3JD2A 1GXSA 1YR6A 3O4VA 4YAEA 1CY1A 5FP0A 1U1EA 4M0KA 4HO1X 5AKEA 1R8YA 4JH0A 3HJAA 3WV4A 1QE0A 4JLVA 5BYAA 3W5DA 1JU4A 2G28A 3UPDA 1D2GA 1T9DA 2C9BA 4JNCA 3R7BA 4MCAA 4M3NA 3HNOA 4JKIA 4BWVA 2GEDA 2HUNA 4ER7A 4L72A 2FSIA 1BFKA 2JG3A 1JDNA 2JEYA 2ISCA 4ZVLA 3ZVRA 4DNPA 1COWA 2I6GA 2Z08A 5DHRA 3FSEA 3WIUA 5JZBA 4GSKA 4NL4H 2JLXA 3E5RA 3ABSB 3CPJB 2HQRA 4PNHA 1CB7A 1FTWA 2G1UA 2ZJAA 4FBGA 4OQNA 4ZPXA 3L8ZA 5D7NA 1Q1ZA 2J9XB 4PO1A 4JP2A 4TROA 2JEOA 2WLSA 4WBNA 2XOKA 3LZDA 5CFPA 4QYTA 2O59A 5E3IA 2W5UA 4BFZA 1JHZA 1BH6A 1ES9A 1B1AA 3RABA 1R8SA 4URWR 2GO7A 2O4CA 3OKPA 2J9RA 3NIGB 1YMUA 3RCBA 3O5AA 3OPNA 4L6IA 13PKA 3GPLA 2NACA 4R54A 1Y3BE 2ETVA 2RHCA 5F4BA 5AJTA 3L0ZA 1I0IA 2PXCA 2OQVA 1GT91 4ZHSA 3ABIA 3G5AA 4JX8A 1T6XA 3MCVA 3R0JA 2C9ZA 3AY0A 3O9MA 5JFOA 1Z45A 4FDVA 3TEMA 2I1LA 2RK4A 2MU1A 4ZYYA 3RRYA 3AGQA 4PSUA 3UK7A 3BQ9A 1S5PA 5H3LA 4Z4HA 3IOMA 2YBEA 3OQBA 4GT1A 4ZAWA 1E62A 1BVHA 4OKSA 2FWBA 4JD5A 4Q93A 5BV7A 2YBDA 4ZJPA 5ICEA 4BVLA 2GLXA 1T36A 1KE1A 1IM5A 3GWGA 3M49A 5HOEA 1ADBA 4CMCA 5IJ9B 4ZHQF 1UT6A 3VYRB 2FW7A 3ADPA 1PQWA 3DYIA 3SEQA 1TUBA 1Y7IA 4ABYA 2EIHA 2V3VA 5HKAA 2R8BA 4JJIA 5AKKA 1QZZA 3TMYA 1YCGA 5DHAA 2Q8PA 4BBZA 4YP7A 3TS1A 4DEXA 4NZZA 4PPFA 2FMHA 2X13A 5BYBA 3IP1A 2OT3B 3GCGA 4UM5A 3ZTYA 1JR2A 2QN9A 2P91A 2ZSHA 3P94A 1N7HA 4EITA 2WE8A 3CISA 1IU9A 2HF8A 1JLRA 4YCLA 1E2JA 5LQMA 3AF3A 2AHOA 4UBOA 5DYNA 3SR0A 1P3DA 1Q7BA 1OF1A 4ZCTA 2PE5A 4AZTA 1ONOA 4EYEA 3EQZA 4L5CA 4KR0A 1Y1PA 3S99A 2TYSB 3JR3A 4PAOA 2W2XA 3RG2A 1TCCA 3C1AA 4AWAA 2AXPA 5A0VA 5KWSA 2INGX 3OE7D 3KSBC 1II8A 4KLCA 1TMKA 3QX3A 4UDXX 3ZIDA 4BE4A 4RVDA 2JCVA 2F8MA 4NDZA 2X4GA 2FEAA 2HKIA 3WBJA 2Z2ZA 4PIVA 1OXSC 5F9MA 2FHSA 1D2NA 2Q5CA 2R68A 3GRVA 1OWPA 2QP3A 4IUBS 5ITWA 4KXWA 5CX1A 5K03A 3DDNA 5IM4A 1VOTA 3K4QA 3IKTA 1ZWLA 3UXHA 3KJGA 3VYVA 2FWMX 4GR4A 1TFRA 3AXSA 2QK4A 2QORA 4PRLA 4Q24A 3O8OA 3EXEB 3W06A 2W2KA 2D8MA 1T5IA 4ZOBA 2J7KA 4CJXA 2GLUA 3MS7A 4TV9B 4EX6A 4LA4A 2BGWA 2XTAA 4QFCA 1O0SA 4R1MA 4ZJUA 1QGUB 3SBOA 4DQLA 1LQTA 5EJIA 4ER0A 5HQ3B 1XAIA 1VL8A 4R0NA 2PKRA 1YV9A 3O3OB 3FDJA 1Q16A 1XMIA 2IFTA 5DMHA 3W5VA 4ARIA 1GTVA 3VR4H 1F6DA 2G9QA 1HK7A 3TRDA 4YTEA 2HPHA 2ZG6A 3TEFA 4WBNB 1FVFA 2YNMA 4TUYA 2FZ4A 4KB5A 2CLHB 4YRJA 3HQ4O 1A3CA 1VGVA 3EXHA 3JPYA 4KK4A 1U2RA 4YMTA 4PZLA 1DOZA 2CCJA 5ELXA 1E1KA 1R3DA 2CXXA 2YOGA 3JQFC 1ZDMA 3OIGA 3PRJA 1CJSA 4EMTA 1EEXB 3C4JA 4MYTA 3SM3A 1CR0A 4PG4A 1PT9A 3A1UA 4J0QA 4YCJA 3MSXA 5DBFA 3MJSA 1Y5NA 1XUOA 1Y5IA 2WNSA 5HKKD 4ZI3A 1ZO8A 3BFJA 4E2ZA 1SHTX 4MSUA 2OO5A 2GTHA 2LIVA 1CUSA 5JS8A 2CHVA 3AF1A 4J16C 1QWSA 2AX4A 4ATNA 2XWJI 3K5IA 3KCNA 3W6ZA 1K92A 5KHOC 3VYTB 1FL9A 3SZLA 1I5RA 3MSCA 2EZ4A 1H69A 2H1FA 1ONSA 1QVAA 4FYPA 3O8QB 3ZU6A 1MR3F 2H4JA 1UZMA 2ZWAA 1JH9A 3BIFA 2G88A 2JFOA 2YN0A 5BXQC 5E9WA 4DC0A 1VJTA 1ML3A 2FG7C 4EH1A 1E1YA 3V1KA 3OAAD 1Y37A 2XUQA 1UANA 1W5FA 4GRDA 1TUBB 2R00C 3ZYCA 4MW9A 3AOEA 5CEJA 1YDMA 2DKOA 4F8EA 3U37A 3F7MA 5FUXA 3GF4A 3H2KA 4LJ4A 3U9TA 2VRBA 5EKUA 5G4LA 3IAXA 4N12A 2QUKA 3VFDA 1BJKA 1HY3A 2GNOA 4UJ5A 3TQRA 1E1MA 1SQGA 4MUNA 3NH6A 4R2XA 2NU8B 3D7MA 5FR1A 4YLYA 1CDEA 1PS9A 3EDMA 2ZBVA 3QBDA 2IXFA 3EDQA 4HSEA 5B5SA 1I5OA 2WIGA 1FQKA 4GP6A 3KAPA 3PF8A 4MWDA 1DAGA 2B7CA 1DIRA 1FDVA 5A5VA 1SKAA 2FY8A 1RRMA 2ZCUA 3HUTA 1D03A 1Z37A 1CUVA 1UBRS 2NXCA 3H9QA 4MYDA 4QUAA 4BNIA 1SVIA 3FCAA 4OM7A 2VUHB 1H2EA 2J08A 3RRFA 2JIOA 2XE8A 1TAUA 3H5VA 2GBPA 4L2IB 4WESA 4WNCA 2TS1A 3OHMA 4S0XA 4N65A 2ZRLA 1D3AA 3G3EA 3RBAA 4V2UA 2XWSA 1F9AA 2EBFX 2ZXFA 1Z0AA 4R40A 2TSYB 1Z5PA 3WO0A 1HLPA 1W4RA 4MW0A 3WYNA 2TMKA 3ANLA 4UM9D 2RGBA 4E5MA 2XZTA 4IO1A 3E7DA 3KKKA 3KSAC 2VPXA 3DDWA 3K96A 2Y2VA 4KL8S 3T7KA 5JH7F 2R4UA 4C2AA 2G9ZA 5JW6A 2MINB 3AJRA 1VIDA 2D1RA 4KP7A 1Q7EA 1MOQA 2V0CA 4OLJA 3TPZA 1WXFA 4YRNA 3HYLA 3ESQA 2XRMA 3Q3HA 4MR9A 5BPFA 1AA6A 1W36D 1SWVA 1Z2OX 3K92A 2OLJA 3V2GA 2NZJA 4L5IA 1BNCA 4QT0A 3T9BA 3CLTD 4LYJA 1SD1A 4IJ6A 4W7SA 2J9YB 2IU0A 1N0VC 4JR2A 2JHFA 2QXUA 3VOBA 4WE3A 1OOEA 4L9SA 2WFLA 1QV6A 3V8MA 4A36A 1VKZA 4RH1A 2Q99A 3UWPA 1WAMA 1W5AA 4KGVA 1U8FO 2GOYA 1Q5PA 2YV2A 2ZLBA 4XVRA 3U7RA 5L4LA 1ZESA 4K40A 1BRMA 3RHFA 4R8KA 3H4VA 4Y1FA 3VNSA 1JR6A 3O75A 1ZD5A 4JCOA 4EYQA 4RDCA 1S2NA 1SXJE 3W2HA 5ULLA 1WUTA 2X0NA 4YUXA 4DCCA 1OV4A 1ENPA 3RS4A 4DUZB 3SHWA 2BDUA 4EUFA 1E2PA 1OIWA 1VG9B 4DUGA 1FJGB 4J1NA 5K1ZA 3RRZA 5ESRA 4ZEOA 3TVDA 2BGTA 3LOUA 3TGLA 2QN2A 3MTGA 1Z63A 3OU7A 3EPJA 3SXUB 1AUPA 1GPH1 4HPJB 3DS8A 3GPDG 5JD5A 3SE7A 2R8RA 5EZYF 2Q5JA 1NLMA 5DHPA 5FAXA 4LZZA 1IL0A 1CUXA 4UQOA 4F0JA 1DDOA 2HM7A 2QWXA 4FZVA 2BL4A 2OC4A 4IINA 4E07A 1CEYA 3O8CA 4ZEXA 2R7KA 3OIVA 1RJGA 4ZVUA 5IX8A 5K20A 3TL3A 1A2BA 4GEKA 5EI5A 4OL0A 2IOQA 4IR7A 3STWA 5BVGB 3C3JA 2NO1A 1ZM7A 2GA8A 3A28A 4NAUA 4Q34A 2YJ3A 3S2ZA 4YDSA 4P4GA 4UBIA 3SLKA 4L3VA 3ZI7A 2WSSA 3I3SR 3O31A 3R3ZA 3AHEA 1UM9A 5AHRA 2LVBA 3O7MA 3R3VA 4KBYA 4X84A 4E5UA 2BDTA 4F11A 1H22A 4HDSB 3ZGNA 1DVRA 3R7WA 4PAGA 1THTA 1Q0UA 5BWNA 1UJCA 3QVGB 2ZBUA 4HB0A 3I52A 4FNGA 2PL1A 1HR0B 1H2BA 2BR3A 1C7ZA 4XSHA 5EL0A 5JY1A 1F6BA 4UU8A 3QA3E 4RVNA 1ETUA 5AXBA 2Z1DA 3FLAA 3L04A 1C7EA 1P45A 1P4HA 1WXDA 2PO7A 4MV5A 1I3KA 4P7JA 4EVIA 3IAUA 1T3HA 3GEBA 4IHAA 1VL0A 3OI7A 2XMPA 2EC5A 2FW6A 4XM1A 3OQ6A 3H1PA 3CNOA 2X0IA 2O3SA 2YJNA 3LI2A 4JB0A 1Y8RB 2B83A 4EMUA 4ETIA 1JEOA 1QHEA 2D2EA 4IZOA 5IH7A 5KYGA 4TXMA 2VJLA 5I7UA 1DKMA 2UYGA 2QDKA 3P4XA 3CVXA 3T0IA 1Y4UA 1P74A 2WNHA 2OYRA 4K0RA 1E6MA 4EHAA 1XXHB 1UJBA 2GPAA 4R7ZA 1Z12A 3VU9B 1KZYC 4RK0A 3DHYA 5KX5B 3TN7A 4KPUB 3W78A 4LXXA 4C03A 4A9AA 4KXUA 1PR4A 4IIFA 1SVMA 5AI8A 3E48A 1U3TA 5CD1A 1L9KA 4FOPA 3LRXA 4CEJA 2JDIA 1T2UA 1J1UA 3WG9A 1GTSA 1KFCB 3P9IA 3PIDA 4KWEA 1T9HA 3V00A 3NDRA 3V3KA 4YV0A 2VLBA 3R6TA 1IHUA 5GPBA 4H7IA 1UM8A 1QFYA 1TL7C 1DO0A 3IT0A 1TGYA 2B61A 1F5NA 1CJCA 4S1WA 2GZRA 4CCWA 3RHZA 1R8XA 1Q1AA 2CDBA 4C4XA 2FR8C 2G7ZA 5EIWA 5EJMA 3T3IA 4XD7D 3AVYA 1U2TA 3TIIA 1IQPA 1E5TA 2BM8A 3PCRB 4J07A 3OJOA 2COUA 4U63A 4ACAA 2I7CA 5B1DA 4CQLB 3L7BA 1I6KA 1RC8A 3HB4X 2JVKA 3AR7A 1A9ZA 3UJPA 1QH8A 2Q1XA 3RF7A 1RWWA 4HH4A 4WA7A 3X2SA 5GV8A 2BEUA 4EJ2A 4GM4A 4UVDA 2AK2A 5KQLA 3CZPA 5BYKA 2YX1A 1PL7A 1I7DA 2W98A 1AV7A 4BCCA 4OG2A 1KI9A 1Y1TA 2WG2A 4TKUA 5FBZA 1R10A 1A27A 1BWPA 3DTVD 1FNNA 5IF3A 4XQCA 1G60A 3H9EO 5EUMA 3RU3A 2JFNA 2C7BA 4G23A 4QUHA 1CQWA 3F1LA 4RD2A 3V4PB 2YWBA 3B78A 1IN4A 1KJZA 5KU7A 1J8FA 2R8PA 5J2UB 4MUFA 2O7NA 3IOYA 2GF9A 1A69A 1B0UA 2PYZA 4EABA 3UJBA 3OE5A 2Y66A 4WKCA 1YULA 2OGZA 4BNFA 1G1MA 2WAOA 2ES4A 4L78A 4CNQA 5SZJA 3GJ4A 2X7JA 3KQNA 3BN3A 4Z4GA 4YRIA 2KBEA 2QL6A 3DAYA 3JSXA 4ZVRA 5T4EA 1GZUA 1PYOA 2OD7A 1G4HA 3BCSA 3F8SA 3KVRA 1J70A 1LUAA 1JDBB 2WWXA 3L8MA 5EP4A 2YHIB 4RY0A 1NBMD 1R2QA 1Z6PA 4TYQA 5CVVA 2JIZA 4IDOA 4J7AA 3BRCA 3NBXX 3GMIA 1MAVA 1SB9A 1PR1A 1V2GA 2X9NA 2FRDA 4XGQA 4DYHA 1IHYA 3RJMA 2VYQA 4G0WA 1JZQA 1T0IA 1KJYA 3JRWA 1EFRA 3NO4A 4H08A 1S3FA 3AR8A 3ZWWA 1PUIA 2V7BA 2IRWA 1J9GA 1PS0A 3CLKA 3RRNA 2BISA 4HAOA 4IIJF 4FD2A 3HCNA 3HSKA 2OZKA 1PE0A 2YOHA 3E2IA 4ANFA 3URMA 3K05A 2YYYA 2WFLB 2PEYA 4LKOA 4WK0B 4B44A 4N0PA 1QQBA 4JDPA 4DAOA 1ANKA 4ZZ1A 3S0JA 3BRWA 1G16A 5GONA 3ZLUA 1ESMA 2EJCA 1GZ5A 2ZKLA 4NI5A 4ZAVA 5LYJF 2W4IA 4FYJA 4E31A 5AUNB 1A7JA 1QR6A 2AJCA 3AHHA 2JFVA 3HCEA 4DG8A 3RAEC 1IN1A 2Q21A 5HHTA 1XKQA 2WVGA 2V7TA 2G5GX 4BCBA 1Y82A 1L4NA 1RZVA 3RKUA 4EJMA 4E51A 5L4SA 4MI6A 4ZT2A 2QMQA 3QZUA 1GDHA 4UASA 5DI3A 2RJNA 1LSOA 3OLQA 4WCFA 2BKAA 4DV1B 2G0NA 3FHOA 1I1NA 2PRJA 1O96B 1AKRA 1UINA 2AFRA 1L7EA 3ZY2A 2UYCA 1XOIA 1QVZA 3DC7A 1J2EA 5FFMA 2JJMA 2GZAA 3MA0A 5CDHA 1AO3A 1NMYA 3VYUB 1XZFA 3L8YA 3Q41A 1R8QA 1N2EA 3EGIA 2J5BA 4KE6A 1T1RA 5G3ZA 4DCSA 4NX2A 1TYDE 1QAQA 5LU8A 1OXXK 2Y0DA 3KQQA 4ZDKA 2OL4A 5TX7A 3LD9A 1NXWA 4ZAGA 4ZICA 1LF0A 1O6BA 2DQZA 3ND8A 1JILA 2N1BA 2W2KB 2Z09A 3C7CB 1FEZA 4M7RA 4UD2A 4WXYB 5KTKA 1NE7A 1S3IA 1QU2A 2REBA 1MF7A 4F2HA 2FWPA 1J0BA 1GZ4A 2E85A 2ZJZA 2GHRA 3I6MA 4KXFB 4FQ8A 1MIOB 3O1IC 1HNNA 3LF2A 2LCIA 4IGEA 4BO7A 1RI4A 1NLFA 4F9GA 5CU7A 2VHYA 5JAUA 3FMFA 2GZ1A 4MTLA 5KDLA 2D7DA 2Y1OA 1QOPB 1E3WB 3R0XA 4PZDA 1HTTA 2PMCA 3I1IA 4O0MA 5JTTA 1YKGA 4DJJA 1ZM9A 4B4VA 4QUIA 2VTKA 1W85A 1DX9A 3LYUA 1YJCA 1NFQA 4I6EA 4ILEA 4CM4B 1S2LA 4UATA 1XZEA 5ADHA 2CMGA 2E1RA 1ZISA 4DBZA 1HYQA 3X1XA 1Y3AA 1B0AA 3NW9A 2JKZA 2VZLA 4ROTA 4D4HA 4E5KA 1GP2A 3AEKA 3MNFA 3QVXA 4BWYA 1LGYA 2VO1A 1OC4A 4MLCA 1RKXA 2O2CA 4QG7A 2XT9A 4YAKA 4DJAA 5C7OO 5BN3B 5CK4A 5DLEA 4X66B 4J6FA 2AZTA 4BLOA 3FYUB 5AW5A 2HAEA 3B82A 4PHFA 2UKDA 1THGA 4GX5A 3SNHA 2ECFA 4LKRA 3RLIA 5CB0A 4X1KA 2QL7A 3KT6A 1N9GB 1SBTA 2NN3C 1ZMTA 1TVEA 3TLMA 1Q21A 5KS2A 3EFOA 5CITA 4WNIA 2B2XA 4PZ0A 3GBSA 4PPQA 2AEJA 2YQ5A 4B81A 4ZVPA 1TT5B 2V7XA 4LMRA 4B34A 3QLVA 4Z0PA 3BVPA 1M2VB 5E6RB 5IRCD 1PT7A 5HK9A 1YOVA 1OI4A 4AIRA 2HPVA 2QT1A 3IXLA 4HEQA 4JLOA 2CD7A 4Q1CA 2QJTA 2IUFA 2BFCB 1PN3A 1E96A 1GA1A 4FGWA 4NPCA 4PC7A 4RORA 2CXOA 4R05A 5CJJA 3SY8A 4JJZA 4F38A 4J3NA 5IABA 5G1PA 1GPKA 2IHYA 3E70C 1ICEA 4URZR 4YMUA 1GQRA 2Z6VA 4MYSA 3OQIB 1H2XA 4MPJA 2RONA 3M1IA 5J5CA 4URYR 2QP4A 4V03A 3N2KB 1XF9A 2RHLA 3UTDA 4A82A 4N49A 3ZDQA 3R7DA 3SD7A 3PXXA 4BB5A 5HUJA 1QBKC 3JQEA 2XNDA 4BNMA 5B36A 1ECGA 4JUFA 2GESA 2BM1A 3JWPA 1XD8A 4MXDA 3WK9A 5K99A 5LUBA 1S6YA 1C4XA 1HDZA 2PVCA 5EP3A 1MVOA 2ZE5A 3GZJA 2F3QA 1DOAA 3DP7A 3JAKA 1OFTA 2NW6A 3MMPA 4FE4A 5FA5A 4BYGA 4EK9A 4R71A 3JYNA 1WKBA 1DRWA 5DYGA 1T4DA 1V8DA 3SIWA 4QU5A 1O5IA 1CIPA 3E2PA 4KLNA 3TKAA 1JQLB 4F6CA 1TZKA 1VJ5A 5HF6A 3B85A 4BFCA 4ESOA 4YMVA 2XIJA 2Q1UA 2Y77A 1EZ4A 4RLQA 4F5ZA 2YZKA 1XD2A 4L6AA 4WY8A 2OFXA 3R41A 2BFBA 1TO2E 3KALA 1Y9ZA 1IZYA 9ABPA 1KMNA 4QTZA 1MVLA 2DF8A 1GY8A 1SBIA 3PFCA 4J2OA 4JJ6A 2IW1A 4LV8B 5ALZA 4EVSA 2X6TA 2EKZA 1CVIA 2L17A 2OZEA 2VHWA 2GTPA 1NBOA 1M6NA 4V1CB 2JZCA 3VNRA 3W79A 1BU5A 3G0GA 4Y6PA 2GA9A 5BR4A 4YP9A 4TYWA 3EZXA 3MLEA 1JWAB 4G0PA 4QVKA 5TB5A 1YI8A 3H05A 4E03A 4UQPA 3LDGA 3RU7A 2WJHA 4AS1A 3K4PA 3PWTA 4GYWA 3NV9A 5B6IA 1QGED 3JS5A 2OBXA 4OB6A 3WGNA 2I66A 4QYWA 4Q12A 3FMOB 3QFSA 1DAMA 3R8CA 3T5TA 4YXFA 1FLDA 2E4XA 2EQAA 4XWOA 3HJBA 1EE9A 2HMSA 3E8SA 2O05A 3OZGA 2IHUA 1M8PA 2AOTA 3I34X 4G5SA 1LBEA 3GQVA 4QBTA 2G8NA 2GD6A 3CEAA 4LFAB 3WLQA 4ZJZA 6ADHA 5HMLA 5AXDA 4FFSA 3WYCA 4LZPA 1KDRA 1HV8A 1L7RA 3VR2D 3VR3D 3G68A 4DCTA 4EY3A 2FLWA 5LDHA 1T4CB 1ZA2A 4TKLA 2IZZA 2VHTA 4PCLA 3H1TA 5REQA 4TKVB 1XTJA 3OOWA 3GP8A 3K7EA 4N7JA 1M3SA 4KVZA 1DTSA 2ST1A 4ZMBA 3PCTA 4RPHA 5EG5A 1YS6A 4I50B 5JARA 1VG0B 5EIBD 1PT5A 3FKSD 3M82A 3D6HA 2CV1A 3B1XA 2GXQA 4UBKA 4EEXA 1P7ZA 1A72A 2BGRA 4C7XA 4RMHA 1CS4C 1QLHA 3HL4A 3PDWA 5KI6A 3PC4A 4L02A 3HCAA 3DZKA 4O4JF 1MD9A 1RAAA 3JSAA 4OV6B 3G8YA 4JI8B 2CF6A 2R6AA 1OAAA 4BL5A 1MTOA 4JY7A 4U00A 1IJFA 2Q6LA 2BW0A 4WD3A 3EXHB 1ZC3A 4AYWA 1RBZA 3CRRA 4DUPA 5KPDA 4OY3A 3DD5A 5K3AA 4AFNA 1GVNB 3NBFA 1D2EA 1SUBA 3ZWNA 2A35A 3KZNA 5CXXA 1QQ7A 3CHYA 5HTOA 3DGFC 3RS7A 3VR6A 4F85A 3VR4D 4YJ3F 1T5HX 2CUTA 4TKMA 2D7CA 2J5QA 3W8FA 1A88A 3CG4A 1LA2A 1QXSA 3L82B 3UOGA 2ZWVA 4BQSA 2Q46A 5CVJA 1EFLA 2BAGA 4HNHA 1XKLA 3VA7A 3ST7A 2BKVA 4NG4A 2ZOSA 4P9NA 2H52A 1ACJA 1L7BA 1TF2A 2LE0A 1M2KA 2HJRA 2Q28A 2XMBA 3B3JA 2OAQ1 2CLSA 3QPCA 3QXCA 4OK5A 3CX8A 2F3TA 2OXEA 3EZGA 4QDKA 2AG6A 4CHGA 1J0CA 2J67A 2RC5A 3AEQA 3BD9A 5FQOA 2F43B 1KTIA 3D54D 3RUHA 3FLEA 1NQXA 3O90A 3D8SA 1I1OA 3KCQA 3HYNA 4MH0R 2VAMA 3NT5A 5KSWB 3EASA 3NC4A 5AK4A 3DHWC 3DG9A 3F7OA 2V74B 3IEKA 3JQQA 4Q4HB 3NU1A 5CP8A 4DMGA 3WHKA 5FBHA 4EGJA 4KLRA 2FYTA 4ZK6A 2YHAA 3NDIA 4IMJB 1CUFA 4J2TA 1N8NA 2OHVA 4LQLA 1AO0A 4O4JA 3NNSA 3KEOA 2CW5A 3AVTA 1GPMA 2JCYA 1U65A 1NNEA 1DI0A 3LUKA 5DM4A 3FMVA 5BO5A 2UUCB 4YJGB 2QR5A 4YRTA 1I2MA 1R0XA 4ND5A 1BVRA 2FPGA 4PONA 1U63A 1AUVA 1UJ4A 1BROA 3N74A 4RADA 3M5CA 4E4YA 1ZI8A 3STTA 3WKEA 2QVYX 2CV2A 2FNAA 6AT1A 5JVDA 5DM60 3ISTA 1J2YA 3ZZTA 5C7LO 5EHIA 1H1LA 5EERA 1ESNA 5SY6A 4NPHA 1SEVA 4QXMA 4CKWA 3VNBA 2GPSA 2VOJA 2CL7X 4B2YA 5AVTA 3L5OA 1EFVB 6ABPA 3OLXA 3UK6A 5DJ5A 1T1IA 3TINA 3VDXA 4KZKA 3AF2A 2Z04A 4BMPB 3V2HA 2DSTA 3CN7A 5JWRA 3ZE0B 1Y8ZA 1XMVA 2C9MA 2WPNA 2XUDA 1HT0A 2H18A 1NVDA 3ZJ4A 4K7JA 4XTCS 4P81A 3ZIAD 2V45A 2GJ4A 5COBA 3C6BA 2OAP1 3Q87B 2YFQA 3E7XA 5LOVB 5FPHA 5D8DA 2O8BA 2W6ZA 3T95A 1O96A 1UWCA 2V7QA 2VDNB 4UE6A 4YJ2B 2NUTA 3AHGA 4EYSA 1H0KA 5E8JA 3MJTA 2EP8A 5NLLA 3FFAA 1FLNA 5HF5A 1DBPA 3BGVA 4GXQA 2XNCA 4G63A 4LRXA 4OBWA 3RVNA 1TIPA 2I03A 2Y9MB 1FRNA 3THSA 4DLUA 2V7WA 1BSVA 2Q4RA 5G0TA 5BN5A 4F21A 2EHDA 6LDHA 3NPMA 1KJNA 1UWKA 3HVUA 2Y1CA 4JLJA 4S0ZA 1M0WA 1Z6ZA 3BWVA 3HV0A 4H7FA 2G0TA 5JJCA 3C8HA 3NKFA 2GCOB 2I3ZA 4JJEA 3KU4A 2HADA 4LZJA 4BNVA 4ENSA 4RETA 5FHRA 4IDAA 3TRHA 3WGVA 3BHNA 3CT6A 1FFCA 1B43A 2J59A 1XJWA 2XTZA 3FX2A 3TSZA 2ZJ7A 3ZV4A 1W25A 1GA4A 4FTWA 3CLRD 1X7DA 1F1BA 2I9PA 1VL2A 2I76A 1XLTA 5TQ0B 5A4FS 2ZAMA 1QS0A 3TLJA 5EHQA 2HCJB 2CUNA 2NOAA 2W0MA 2NVUA 4J3JA 4HLUA 3LUHA 4US2R 3ULKA 1H4SA 3D3WB 1DFIA 3PNPA 4GKBA 5D3QA 2AKAB 2YZGA 1DC3A 3GN2A 2AG1A 1JSLA 2EFGA 1ZR4A 4TRJA 4LIPD 5H80A 2WB2A 4CEJB 4W5HA 1X8JA 1AOXA 5F98A 2ZSFA 5GONB 5CH3A 1X6VA 2V5VA 1VHJA 4XOUA 3RSHA 1ZRNA 5JI2E 1FFWA 1QDLB 4G4GA 4KE8A 4OP2A 5CVEA 3SYNA 3VPDA 3VJMA 2KHZA 1TMGE 1D8AA 1PZHA 3C3PA 3A9CA 4YT4A 5EXSA 4XD7A 4FYWA 3WYDA 4TZ6A 1H4QA 4FLMA 3SZOA 2OESA 3ZW9A 5MF6A 3QITA 3TNLA 2OXRA 4D99A 1KPGA 3T3OA 4W8GA 2V6MA 1V8PA 1NJSA 3LY5A 4WZBB 4JYZA 1TO6A 4M89A 1RU3A 4JT2A 3SF8A 4BQRA 3MOIA 3G1UA 1V7QA 4LRYA 4XQ0A 1AC5A 2X8BA 1GAJA 4L15A 4HPXB 1QH8B 4PO9A 4EYOA 2I6QA 5DXFA 4L75A 3WL5A 5ED0A 2O5CA 1NW6A 3AK4A 4QDJA 5DNEA 2JLQA 4PBTA 3W6PA 3T7TA 3RRBA 2L0XA 1DAEA 4Q18A 4UUMA 4KGXA 5LMZA 5HFAA 2FR1A 1NDHA 3FDIA 3M7IA 3BJZA 1TKCA 2JIMA 3I32A 4JR1A 1K9SA 4AKEA 3Q3IA 1J1IA 1R9NA 1B8PA 2XRYA 1MX3A 1JSCA 3CF4G 3GO4A 3INGA 4MRNA 3MERA 4P4UA 3EOBI 1E66A 1ZGCA 4OQPA 4PC1A 4DG5A 4WZZA 4DF3A 1B93A 4R1SA 1I14A 2IL1A 2JLSA 2MDTA 1G8PA 2DQSA 4OXRA 3SPXA 1KWGA 2WVAA 3AI2A 3H7IA 1GV0A 3KJQA 2BP7B 3TIFA 5LQDA 1SUAA 3QP9A 1JNXX 4P2BA 3N9IA 3TX2A 4TV8B 1Q95A 4JDUA 1LJLA 2PBRA 2WIBA 3FOEC 3C7DB 1Z29A 3M6LA 1K3UB 5JRZA 1WO8A 4XVQA 2WU1A 1C7IA 1HDYA 1JR3D 3AW8A 4N5NA 4EDFA 1CJUC 3AH8A 2RH9B 3FPSA 2NP6A 3NIDB 2LGJA 2GUGA 3NOXA 5BUCA 1GTG1 1OBCA 1RLTA 1SHZA 3I83A 3DV2A 3ZE7A 3QEMB 4O1IA 1VP9A 1JU9A 3SYTA 1G5PA 1DQNA 4KYIB 2BFFB 3ZUPA 2QTMA 4HGOA 4CL0A 1Z5GA 2N0SA 3U62A 4KEAA 5L3QA 5HVNA 1X77A 2ZTLA 4LOAA 3KAQA 1YQDA 4RCYA 1E1DA 3KUUA 4MR7A 1X1EA 3LGSA 3T1QA 4A8HA 4ECAA 2MWMA 4D26A 3ETGA 1SMKA 3ELYA 4U39A 5SZKB 3V7UA 3HXLA 1PJTA 2VNKA 2ASEA 2IYNA 3EXG1 1N6NA 1Z28A 3CSUA 1FPMA 2H1IA 2RAPA 3LBIA 4PXYA 3UK2A 3H11B 3DO6A 3CKMA 1N2SA 2VLIA 1M1XB 1VMAA 1DL5A 1YS9A 1XWIA 2Y1WA 2PO5A 3FYTA 1KS2A 4PO8A 4R8RA 5HBRA 3QX9A 1JEEA 3RFVA 4W9RA 3PNYA 4BLVA 3QTTA 3DMFA 2IOHA 4I3GA 4BGEA 2EF1A 1Z47A 4MS3A 3KQUA 1G5HA 5T64A 3WRXA 2EJTA 2PIDA 1GGJA 3EVBA 2JIPA 4ZALA 4I9GA 1OXTA 2ZRJA 3E03A 1TYCA 3KTDA 3U17A 4ESHA 4CQMD 4IAOA 2QMUA 1E3EA 5ENDA 4B4KA 4ESVA 1FX1A 4NENA 4QL3A 4KUEA 4DWOA 3EUWA 4ZCMA 3S81A 3D5QA 1RPNA 2VRNA 1IDOA 4HX5A 3ZHXA 3ZHQA 4RVFA 1KO4A 1ODIA 4B3XA 1PJZA 3HU1A 2YASA 4BJ1A 3HWX1 3CMMA 2QS9A 1TJNA 3FZGA 2JI6A 5A6VA 4GMKA 3B2NA 2ZWIA 5F7JA 1G0OA 3E9MA 4RNCA 4A2CA 3HBLA 1ZBDA 4PTZA 2C0PA 2HRCA 4K1LA 3NM4A 1RNLA 1TAHA 4OBBA 3CQ9A 4IHJF 2W90A 5JPIA 1VRVA 1LRJA 2OHGA 4ZCIA 1PK7A 3BM5A 1KERA 2C98A 3AIMA 1EDZA 4FYHA 2WE7A 4RZQA 1WZEA 3GW8A 2NO6A 3HGMA 4CV0A 1E63A 4KNVA 4PQFA 2WBLC 5HQTA 1HRDA 1FDOA 2C3MA 3UB2A 4O3MA 2CB9A 3AL3A 5D3MB 3AFNA 3SYMA 5K3OA 3CLHA 2ZAGA 4E5PA 3WI7A 4RZIA 1PGOA 1GSAA 1R37A 2VDMB 4ZGGA 5BSEA 2JFFA 2JHCA 5LLSA 3RUAA 1GZHB 1O5OA 2OLEA 1ATZA 2P41A 4LMBA 1AKNA 2PX3A 2Z8XA 3C6MA 1T2AA 1DT5A 3JATA 2K2WA 3L0SA 2H6EA 3HJGA 4DIEA 1Z7BA 2VA8A 4QOSA 5AK0A 4FX5A 4A5OA 4FXOA 5LA6B 4DJFC 2NNLD 3ESZA 2NQ2C 2R85A 4QNMA 4TN1A 4KQ1A 5JDCC 1BCRB 2CE7A 2H3EA 3K9QO 1JL3A 4UOQA 3JYLA 3KT8A 4XQGA 3MEQA 1JUDA 3NRBA 1CZLA 2QL9A 5EN4A 3NTUA 1BXRB 4UTOA 3CLVA 3VNAA 2I0FA 4ZI5A 4C29A 2Z4TA 3NANA 4F1WA 3WDSA 2MINA 2VYND 3EMKA 5K0GA 3ZDBA 4MW5A 5BSKA 3MAAC 1M66A 1MCZA 2FJ0A 1GSHA 1MENA 2WTBA 3NOQA 1EJ6A 1WB5A 2IYPA 5TT0A 4NJMA 2B3TA 3CZAA 5T3YA 1JKJA 1R9MA 4M60A 1QFJA 2I4NA 1OAOA 4NXMB 3O21A 5CLHA 5TEVA 2ZB3A 4FUQA 4MVYA 2QX6A 1H94A 1JHXA 3LT1A 3C97A 5EGNA 4Z0NA 1NXPA 4CLDA 1D07A 2VUTA 5M2QA 2QBYB 3G9XA 2YWEA 5GGXA 3RBXA 2WVHA 6NULA 4XWAA 1QNLA 4QJBA 4DPLA 1KFEB 2BMAA 2ZQ5A 5IUKC 1BW9A 1Z4IA 4ZRNA 1NBMA 3QF7A 3SQOA 4I50A 4O8CA 2FWAA 1F8GA 1X0VA 1BCSB 3U31A 4LTMA 3D6VA 4EF4A 1XNGA 5LNK1 2CZQA 1BMQA 2LTAA 3ZGZA 4I5FA 4IS2A 4ARAA 3PXAA 4RKRA 2AYZA 1QV9A 2FSGA 2QRNA 3OJ0A 1O2DA 3Q10A 2PZBA 3ROPA 4EO7A 1P7CA 3G0CA 3SOPA 2QQ5A 1YB7A 2BHRA 1C7RA 4Q3OA 3FAKA 4WFKA 4B76A 3WYBA 3UMRA 4I6GA 2H0RA 3DV9A 4FDUA 3DL4A 4EGFA 1II8B 3SVZA 4E33A 3PBKA 3HJFA 1TA4A 3ZDDA 1HFWA 2XI4A 3OCXA 4PQGA 2Z8YM 2C5BA 3C2QA 2TMYA 4TL9A 5AH0A 3UAVA 2HJWA 5ER6A 2DT5A 2WWIA 2E21A 3C74A 2Q6IA 4WX2B 1ZC4A 3CWZA 1X1BA 4NWIA 4EB6B 2EJBA 4A16A 4RZUA 4DVJA 1GNRA 3P26A 3SIPA 3RBZA 4LTDA 2CMDA 1S01A 3MUEA 3U56A 4EMSA 4JBGA 2AQKA 4ZQCB 2VNAA 3TSOA 1N6HA 1W1UA 3X44A 2AD1A 3EJWA 2P5TB 1OFUA 4DV5B 3NDPA 1Y3DE 1FTGA 3T1TA 2VDQB 4C01A 5JV5A 2Z1NA 3HK2A 4R3UC 1N6PA 1N0UA 2WJ4A 3C3KA 1OU4A 2GB4A 1W9MA 3TOZA 3NKVA 2RCYA 4MGYR 4DDUA 5C9ZA 5KC9A 1D2RA 2ODEA 2AI3A 4G6ZA 1IXYA 3VYWA 3M6FA 4BFVA 2A5DA 3KXKA 5DZSA 1HG1A 5ERXA 2GCPA 1SUIA 5IDQA 3W8NA 1Z6TA 3PD0A 2MTBA 2ZBEA 4R1NA 3A11A 4OXIA 7YASA 2DUWA 3PGVA 3W5AA 3H8SA 3NNNA 2FWIA 5BN4B 4NFSA 1PNTA 2Y27A 3IEVA 2DJ5A 1LLDA 1H8HA 4WFJA 3MFYA 1RQLA 2XCIA 1Z16A 4FCWA 4TSRA 4EG3A 4FB4A 3CURA 2R25B 1IIRA 3QKRA 2LPMA 3N2IA 1NVVQ 4LHEA 1XQVA 1B6GA 3DEAA 5KWEA 3BWMA 2A5LA 3QMWA 4C7BA 2QLJA 1DLJA 4OFXA 3BHIA 4C0JA 3Q3GE 4NBNA 4FPXA 4R0MA 3Q7QA 1NXQA 4Q6BA 2C57A 2EDAA 1B6RA 4QTXA 3U3JA 3ZGYA 3JD1A 2QSUA 3OCJA 1UK6A 3CR3C 3E27A 4JSRA 4WKBA 3FTCA 4AVYA 4YCSA 3Q2IA 2EEZA 4LDQA 4RGVA 2A5YB 1K63A 4HGYA 4BLPA 5LLTA 3LXMA 3HU3A 1YR9A 2POCA 1JJ7A 3GC6A 3QKRB 5EFZA 2QLMA 5I01A 3Q8LA 3PQ8A 2ROQA 5CLJA 5LMUB 1IHOA 2YVQA 3MINB 5G40A 1BXRA 1ZM3A 3CZ9A 4R8LA 2O4UX 4JI7B 4I36A 1RI1A 2ZREA 3GJZA 3N8DA 1U2GA 3LC2O 1C80A 5FBWB 1HETA 5EIOA 5A7HA 5FX2A 3OZDA 1Q7CA 4YDQA 3K70D 5DWQA 5LIRA 3CEJA 4ZN6A 1ZVKA 4U2FA 4HTFB 2DECA 3OX3A 2UVPA 2I2CA 5TJHA 1KL7A 3TNDA 5KKAA 3VQTA 1KETA 1XQWA 4S1OA 1G8SA 3LPNA 4CYMA 3H42B 1TOAA 2G1JA 1JFSA 1VECA 1KGDA 2B9VA 2W6OA 5GONF 3KB2A 1MJGM 2R6R1 2JFXA 1DBSA 4Y18A 1Y8QB 3P9ZA 3SJCA 5CNJA 4B5KA 1Q1NA 3WBFA 4WBSA 5E2AA 5EHZA 1GPDG 3QIVA 1KJIA 1UBLS 1G8HA 4BTEA 1T91A 2B0JA 5EYPA 3ZWBA 3PS9A 3EH1A 2V97A 1IOWA 2V55B 4NJEB 5CLLA 1VGRA 5HCUA 2O2GA 1JMVA 5H4GA 1W0JD 3MT0A 3NAQA 5C81A 1OHHD 1WM1A 4PLPA 4RXUA 4U4AA 5B7GA 3L1VA 1FA9A 5LB2A 4LWQA 5EZYA 2VP2A 3JATB 3P52A 4WDRA 2P9QA 5H02A 1M2GA 3U4CA 4E94A 2JH3A 3AVUA 3FN4A 1SKQA 4OMCA 4DW8A 3ES9A 1N2ZA 2GILA 2V7EA 1SU8A 4XIYA 1U1IA 2PVPA 3O4GA 1MPTA 1DEKA 2ECOA 4I2VA 3C5EA 3WJ1A 5L7YA 4BKOA 3TUZC 2QN1A 2PZGA 3V4FA 2J9FB 2YWRA 3K71B 1LLCA 1FDSA 4RZ3A 3WYAA 4B2IA 5E3HA 3KKQA 2JHAA 1VTKA 2WD7B 4Y6SA 2QNRA 4HLCA 1KEUA 5DM2A 5BWCA 1VI2A 5ALKA 3BXPA 3KJHA 4K5QA 2GM4A 5FR2A 2ZZNA 3FFXA 1EAMA 4AL4A 3KHTA 3KYCA 4TT8A 1NIPA 2DBRA 1BDMA 3S2IA 3A26A 2EFHB 2F6RA 2X0KA 3WY9A 4ZQFA 4DY6A 5K3DA 4ZHQB 4IYRA 2Z6QA 4WUTA 1V7ZA 3N2EA 1OH8A 1XEXB 4EW6A 2YV1A 4LV6A 1NULA 1WWKA 1LC0A 4Y2RA 2BFAA 2YXBA 3ETJA 3FPBA 1KU0A 1OUMA 1PT6A 3MTBA 3AEZA 3O2JA 4H3HB 1JHYA 3UW3A 4HVCA 3W5SA 1GGVA 3ICVA 5BSTA 2RHBA 4W4TA 4IO0A 1MB0A 3TZ6A 4QGGA 2VP3A 2VWPA 3T5PA 1JSXA 3AHCA 3JQDA 1H0HA 4LNHA 3WB9A 4DLVA 5KKCA 5DPMA 2XMDA 4UCQA 4D3DA 2OC9A 2M6SA 3FUXA 2HMYB 3D4OA 3L6BA 4IW3B 4DBVO 1DC6A 5A9RA 3QEBZ 1E0JA 4N3BA 1QORA 4C5CA 1PGQA 1LBQA 5JAPA 1TEHA 1DDGA 3EQ6A 3KK0A 4Y9DA 3WK4A 2IP1A 4R2IA 4FYVA 2RGXA 4KN5A 3NHZA 3F47A 1BHSA 4MMYB 4F2GA 3VNVA 1L1RA 2I6SA 3D81A 3MCZA 4G0OA 4UHKA 1E0DA 3T3NA 2JIQA 1WCV1 2HSDA 1Z2DA 3C3EA 1DFGA 3VKVA 2XYGA 5ITZA 3GP5A 4FEEA 1QQ6A 3VBEA 2DERA 5D3MA 1RRPA 2J6BA 3WSWA 3QOYA 5FBVB 1SY7A 2PA0A 2PT5A 3WWDA 2HIMA 1E0SA 1WMEA 2QY6A 2YN2A 4HAYA 5L3QB 1BWQA 1G4UR 3MOGA 5FORA 5FYQA 4MWBA 3LUGA 4RM2A 1N2HA 4CIDA 2YHIA 1GDDA 2GRJA 1BRTA 4ARBA 1J39A 1XNQB 5IT5A 3CMCO 1RCTE 4EO4A 2GFIA 3A6GA 3I6IA 3L79A 4FZ5A 2VT2A 3TNJA 3C3XA 4MUYA 4D9CA 1SZJG 3EIWA 1ZD9A 2YDYA 3LP5A 4Y2UA 3X3HA 2WM3A 3N53A 2F64A 5DTMA 1SXQA 5AK5A 4TT3A 3TFQA 1KDPA 1M5UA 3G0IA 3H04A 2RGRA 2QAJA 4MITA 2PTGA 2C88A 2HO5A 4MKRA 5DP1A 3VGPA 4MINA 3BHJA 1M10A 4Z49A 4M99A 2HYIC 1NI4B 3FSJX 5M34A 3BL8A 2NMVA 2QGZA 3WIDA 4I66A 2NTNA 4MQ6A 4AF8A 4YRSA 4DDMA 4KPEC 2IY8A 2CF5A 3NGMA 4PGFA 2YDXA 2CLMB 2MSCB 2DJIA 5CW2A 4XDGA 4EJ0A 4N18A 5LP1A 3RYHA 1KYYA 1SO8A 5DSXA 3EGXA 2J0VA 3ANSA 3NC1C 3OPYI 1CUIA 1BXKA 1IZ9A 3Q1LA 4FEYA 1R6AA 4JIMA 3IVGA 3DHEA 2GARA 2GYVA 4TXNA 4XFJA 5EE1A 1RHJA 5FNVF 4RW0A 3JRXA 3VX4A 2NYVA 3B3GA 3O74A 2QA5A 5DULA 3L7KA 2YJTD 1CE8A 1U7XA 1HKHA 5KYWA 2P1ZA 3KUKA 4IIGA 3NAZA 4X91A 4B3HA 1DX4A 3V4RA 2ONYA 5K05A 4JGGA 3SWWA 4TRNA 1XLTC 4Q47A 3K2QA 4QBKA 1L3BA 1EM8B 3A6FA 1GCUA 4BO4A 2H9YA 5IBCA 5DNYB 2MJLA 4DPKA 1YA8A 8GPBA 4EVRA 3T0FA 5IDVA 2G1PA 4D45A 2D0DA 4F3TA 2V7VA 4HDRB 1YVEI 4ZVOA 3CLUD 1XROA 2HRBA 2XHEA 3DDUA 5DX1A 5J1SB 5TT1A 1WCYA 2PS9A 3UAOA 5JS6A 2GAJA 3OOYA 3S68A 4QFDA 4QPDA 1UDAA 1XTBA 3I0NA 3EDRA 1E6CA 3GJSA 3KDSE 3E8XA 2IXAA 4RQBA 4HDCA 3ILSA 3OLVA 2IHZA 3IUMA 3R20A 5KAPA 4KXLA 1XCOA 2DWCA 2F55A 1WDLA 2V8BA 2VJMB 4EY4A 3COZA 3U0BA 4FD3A 1I33A 4RJ2A 2L18A 2AL7A 5WRFA 4C0XA 4JBLA 3JQ6A 4U7DA 5ALQA 4ZMRA 1JZSA 3SVLA 4C06A 4RKWA 1O3YA 3RC7A 2GBLC 1XK6A 1VYUA 5L3ZA 3NIWA 2QE7A 5A5DA 1JWBB 2C5LA 2VDUE 3GDGA 5B2ZA 5JSYA 5FXMA 2CC2A 3MGBA 3VZPA 5JISA 4JKOA 4W99A 5FJIA 1VA4A 2VWGA 1OH5A 1ZH8A 2FUEA 5T4FA 2JJYA 2XITA 4XWTA 4G01B 2JLBA 3PFIA 4A15A 1CDZA 3DO8A 4JVMA 1GRQA 1EJ0A 2WSSD 4OB8A 1B76A 1QMGA 4W5OA 5E1MA 2G06A 1RHUA 1YS1X 3K0AA 4JHLA 2IV2X 4F45A 5K3SA 3GBPA 3QLUA 3N6RA 1P7PA 4PLVA 5ALHA 4PGAA 1K4MA 1N6RA 1TQ8A 1W76A 2YJGA 4JQZA 4TWIA 1G8YA 3AHFA 1E20A 5FD8A 4GX1A 2P0EA 1WDKA 1OT5A 1NUUA 2BBWA 4M4SA 4O25A 1E2NA 2XGSA 4ZT7A 1KMMA 3UT5B 2Z43A 3SJZA 3AY7A 1XMXA 4I3HA 4QM6A 1W1IA 4X65B 4X92A 4G9BA 3ECSA 2HJ9A 1G55A 1PEDA 2YC4C 3PQDA 2DM6A 3Q1KA 2EJVA 3SR4A 1B42A 4O8ZA 3T9CA 1XCLA 1FQOA 4GOXA 3H1AA 1LNSA 4UAUA 5A9SA 1L5NA 1Z68A 1CR4A 1ZM2A 3IVAA 3HACA 1QO0A 3EIUA 4UAJA 2C2YA 1WXHA 3KE8A 1YS2X 4Q4HA 5AJXA 3HWRA 1UDBA 1W49A 1XAGA 1VLJA 4DA9A 1SQSA 1E4EB 3KXLA 4J9UE 2NIPA 3ON5A 4R6WA 3PG5A 3ASYA 3RTBA 5CTAA 5ICFA 4DA0A 3E3MA 4E2YA 3GVIA 1GQSA 2VH1A 3VPXA 4DDWA 1WMBA 3GGCA 3SLRA 1WNTA 1C7FA 1KC3A 2FPGB 1B6TA 1X94A 1VRWA 2Q5LA 1WRBA 2Y1GA 3PUWA 1QYXA 4GZLA 5AW0A 4M6WB 1CZRA 2EGHA 2E55A 4LQDA 1R8JA 2ZDHA 3L0IB 4GP7A 3Q88A 3I61A 2QD1A 3GLHA 4CRWB 2Y0EA 4MW7A 4OHFA 3D0KA 4RLSA 1SCNE 3U80A 3DBRB 3A1NA 4UE2A 1XVTA 2JGFA 4MR9B 2JNWA 1DTWB 1RABA 1GZ7A 1XL0A 2HBRA 2X0EA 3LBAA 3PEYA 2XDWA 4NCNA 3K1TA 3DMTC 3HJNA 3U7QB 1JHOA 4BECA 1V3VA 5JVDF 1Z0SA 3TCKA 1DXHA 3H17A 4XEUA 4IXWA 4P0TA 2FEKA 1GZVA 2O52A 2VFAA 2D06A 1JLLB 1TUEA 1Y7TA 1PG5A 1LK7A 2VP5A 4GNRA 1FUIA 5K0LA 3TW8B 2BSQA 1Z0ZA 1PL0A 2XTNA 4A0SA 1NF9A 4CM6A 4AKGA 4AKSA 3E5NA 2P79A 9LDTA 3O8BA 1XQXA 3CBGA 3NR2A 3MILA 3MXOA 1Z38A 4IG9A 4PYIA 3V4ZA 2I7TA 3AF6A 2ZYTX 4BLWA 1WSAA 1B00A 4X63A 2CV0A 4G4JA 1MG5A 1PHRA 3D1VA 3VGJA 2EKPA 4BN0A 3UQZA 2A0KA 4C6TA 1EFCA 1ZXLA 2Q5HA 1L6RA 3DUWA 3NBMA 5F76A 4LNUA 4JI0B 4N6NA 1NURA 1T2DA 5B4TA 1D0SA 3N87A 4BVAA 1BGWA 2CCKA 3RSLA 4DLNA 2FAXA 2ILTA 3L6OO 1QIMA 3WA6A 1G8KA 2P8SA 4D74A 3TBKA 4M54A 4IV0A 2G17A 3UKDA 3S8YA 2I2WA 4GNKA 4EHHA 2YY7A 2W6NA 5BURA 2PSJA 4OFZA 4MLDA 1KK3A 2Q6TA 2P6NA 4LXTA 4M9RA 3TH5A 3VPSA 5FTMA 4RU1A 2EXXA 3M1AA 1IZZA 5FL3A 5K3CA 3VSAA 2VJBA 5C35A 3R24A 2WD8A 2PGJA 4KUHA 4KRGA 4EDHA 4WKGA 3JQGA 1RP7A 5ALPA 4FONA 4Z5XA 5FOVA 4Q9JA 1UBFA 1JTVA 2XGMA 1UDCA 3MB5A 1VE1A 3WB1A 4GMGA 4FQ5A 3ENWA 3WWZA 2XEDA 3TR5A 3ZD8A 5ETJA 4KQIA 3PE6A 3OZVA 1TLFA 3O3CA 4L07A 4W5JA 2WHYA 4WHMA 2DFPA 3EEQA 4FGJA 2WA1A 2CNBA 2OG1A 2PU7A 3KFVA 1V8BA 3E9NA 3NIFB 1Q74A 3QU4A 2C82A 1TKBA 5J9FA 3DBVO 4I1UA 4ER3A 3IMCA 4I1OA 2RGNC 4WJKB 5KQMA 1UDWA 2RH8A 3ESCA 5L7TA 2ZSEA 3U16A 2YH2A 3UENA 3QVWA 3CVUA 1YK0A 4EIWA 3BYZA 2A84A 4QDOA 3USCS 2PRYA 4I99A 1I7LA 1LKZA 4J1TC 4N40A 2PKYX 1Q0PA 4ND6A 4Q7LA 3V9AA 1J9ZA 4E21A 5JS1A 5KOIA 2VNHA 4IGKA 1UOPA 5JAIA 3KR2A 2ZBFA 3RWOA 4TMFA 1SBHA 2AV6A 4K3VA 1JE0A 5DLQC 4V1CA 5KJ1A 5FUQA 5IYZA 5DGDA 3C70A 4Q4AA 1M9NA 2E6KA 1E61A 3TB4A 3VVBA 1H8ED 5E1BA 1E9VA 2HRDA 1KO7A 4QQKA 2WMOB 3A05A 2XE7A 4H1VA 3RIYA 1P0IA 1K8XB 3L41A 2P9GA 4W6QA 4RD6A 1QGAA 4DJ5X 3TPFA 4EVQA 4DV7B 4L1KA 3CF0A 1ZMRA 4CM1A 3OFJA 1UBHS 2NO4A 1EKXA 3QVOA 1N34B 1NVFA 1WMAA 2HCRA 2XVYA 1HOXA 4RVUA 2QSZA 3D4IA 3EH2A 4NMLA 4O0LA 1SKYE 3IL2A 3SFZA 3PX7A 5DT2A 3H65A 1USVA 3PKZA 1KOGA 1T8TA 3FFTA 1E3SA 1BEUB 1JF8A 4YEDA 3ZD7A 1R4NA 4POOA 5I9MA 2G4LA 3BWXA 3GJ6A 4FFBA 4A2WA 1YOVB 4NOMA 5B4UA 3EBLA 4RTLA 1MFZA 1KDZA 1VLQA 3PZBA 1DB3A 1DKOA 1E2EA 3D4NA 5T41A 1SGWA 3B1JA 4FFVA 3O8LA 5CA0A 1OROA 3FZQA 2ZE8A 1IEWA 1Z8DA 1K5GA 1OASA 3AX6A 4QPNA 1O6FA 3LCUA 1Q0HA 2E4UA 1U3VA 2X58A 2WUVA 1LX7A 1Z7GA 3OQIA 4IH4A 4QYIA 4DCPA 1Z8HA 1OREA 2H2IA 3LHFA 2ZP1A 3LUFA 4NKRA 2A1TR 2DG2A 3V8EA 3THXA 1A4UA 1Z7WA 4RDIA 3L1UA 3S2SA 1SBZA 2V6FA 4ZAXA 3BL6A 3AESA 3GIDA 1PR2A 2GERA 4B71A 2B0CA 4GC9A 4FGUA 4N0QA 5JADA 1T2FA 2VJAA 2Z57A 1APBA 4GOJA 4Z1MA 2QR3A 2HA3A 4FZ3A 3OWOA 1ZHOA 4BGUA 2HYDA 5GVSA 3ESAA 4MQBA 1KTVA 3PPXA 1QVRA 1T9GS 2IW3A 4PG8A 3OOEA 2FPXA 3SNKA 3G7UA 3MIZA 4K0KB 2V9CA 4X97A 3E8MA 4IJMA 1J4AA 2PL3A 3VKFA 2YWFA 3ZGVA 1LJUA 1WQ1R 1ZUIA 4JEMA 2QRPA 3PUVA 5EZYB 4PXAA 2QM0A 3LT2A 4AXXA 4EECA 2BFMA 2IZ7A 3DMYA 2O9JA 4RXTA 3RSGA 3W5IA 3GLIA 2RBEA 1BEEA 3HB0A 2ZEJA 2PV7A 3CNHA 2O5EA 4P93A 1JHRA 1QG0A 1C3XA 4XVHA 3UT6A 1VYHA 3RS9A 4EL5A 3HR7A 5JYCA 2NVOA 2QXYA 1DEHA 4Y0VA 3VH4A 4AJLA 3OG9A 1BVUA 1WB6A 4KO8A 3UGJA 1SC1A 3BH0A 3FTQA 3O7WA 4WBXC 4BFTA 1CCWA 5HNKA 4ERNA 3ADCA 2I4RA 3VO2A 5AESA 4JS0A 1OH6A 2R4QA 3KU1A 5TRTA 2V7PA 4EI2A 3JZMA 4KR7A 1CNEA 2BJHA 3GZNB 4MKHA 1WX1A 4HMPA 5B7NA 2ERYA 3CUWA 2XWBF 3ZDFA 3ZHCA 4B4UA 4HL6A 1XLWA 1SG6A 1PR5A 3QWBA 3GH3A 4JC5A 1Z0DA 5ECGC 1VQ1A 1U0RA 1E4OA 4BKMA 2ZKIA 5C8YB 2QP9X 3L0PA 1C1DB 1AHNA 3H6KA 1WR8A 1LPNA 5HCNA 1N2GA 1VCNA 3GXBA 1CNMA 2ODBA 1PG2A 1VZ3A 2Z2YA 3OIWA 2VNSA 1UFRA 4HJXA 2BDEA 4PX9A 1CG6A 4OPMA 4BZXA 1I3NA 5DHTA 2OYSA 4EHLA 3A6LA 4KDCA 4BB0A 2ZROA 4G8JA 4KYTA 5JY6A 3KVNA 1B26A 4R84A 3CZMA 1SC9A 4XI9A 1M33A 4PRKA 4WXEA 4N4AA 5CK5A 3RUIA 5AVKA 1MABA 3IT2A 1DBWA 3P2KA 3WLMA 2O8CB 1JKFA 3DEJA 2BHSA 4J3FA 4MKXA 2NAFA 4I6JA 4QZVA 5JZ9A 2IPOA 2BT4A 1I10A 1KZGB 1SXIA 2FUKA 1N5MA 4D8WA 2IY9A 4UARA 4A92A 4YV1A 2FSUA 4AJ2A 2J45A 1TE2A 3UAYA 3SG0A 2QTRA 4BX9A 3ICCA 1E59A 3BTVA 1Z6AA 3FJYA 2HH9A 4NYIR 4DDVA 4AM8A 3QPDA 5JBIA 2R66A 3FRIA 5KQPA 1AZSC 1EDDA 2EFDB 1MU0A 4C9BA 4Z4IA 1DJMA 4Y2VA 2BZSA 1MEOA 3PT9A 4HOYA 3CIFA 4NBUA 3R7SA 2Y76A 2HWKA 1EG7A 2IUSA 4D3ZA 1P0CA 4KHZA 4D82A 3CE6A 4X0EA 1EBFA 2GSWA 2XUJA 4J2HA 2FLVA 4G37A 4Q66C 1EUZA 4UTXA 5FAKA 3B2EA 3FJ1A 3IUSA 4XGKA 5BV0A 5DSZA 2CZGA 2P6MA 4K9QA 1OCEA 5EJ4A 5A05A 3UAZA 4LRUA 3F74A 4O3FA 1NX9A 4ZEMA 4Y67A 1KIAA 3M4YA 1EE2A 1C1YA 2PGAA 2R5NA 4JP8A 3MMSA 1IZ8A 2KS6A 2WB4A 4L51A 4Q3BA 3B89A 4B80A 2PBZA 4FGZA 5ALDA 4JLUA 4RV9A 1L6IA 3BE6A 1M2WA 2E18A 2V98A 1DKNA 4NSNA 5IKEA 3E3AA 1PKEA 1R9GA 1P6UA 4NP6A 4A6EA 3AO0B 1XD9A 1QHHB 2ZI7A 4MK4A 3WLNA 3ZQ6A 1SNYA 1OLOA 3TI7A 4EA9A 4GRAA 1IWOA 1QYVA 3JZIA 5JH7B 3SSMA 2R87A 2RGCA 4BKPA 3B8HA 4FFWA 3OAAA 3OESA 3EXIB 2W8ZA 5M7EA 1VLLA 2C4MA 1JIVA 1Y33E 3I9KA 5TIIA 1ULTA 3JQPA 1WZUA 1XDUA 2CSUA 4IGAA 3TTYA 1QJ4A 3ZI0A 2AX3A 2IEDA 1Y7PA 2O2EA 2OCPA 3AVWA 5JO0A 2A9RA 2H8GA 3UJ7A 1KY3A 5TEWA 1P31A 1XZPA 4IILA 1NM5C 2RHMA 2RHJA 3LCJA 2AC2A 2HQ1A 2PKEA 2EFCB 2NSJA 3GUZA 3OMXA 2ZQZA 4KQGA 1G21B 3T7SA 1B8VA 5BP7A 3F9RA 5K6RA 1KDVA 4X93A 5IKXA 1OD6A 5BRJA 1WPRA 2Q3LA 4K46A 4CDNA 4B1FA 2CXTA 1P2VA 2ZRBA 4RF3A 3O2NA 1PR6A 1IOVA 2XKBA 3N7TA 1FP6A 3TEJA 4C7KA 2WQ6A 1XZHA 3L1IA 4KVAA 4WT7A 4D98A 4AKIA 1ARZA 4LF7B 2HF7A 4OQ4A 1QZUA 4I4CA 1J2JA 4M0MA 1MPXA 4RVSA 1OI3A