1E6WA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
251
Chain Sequence
SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dehydrogenase
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
total genus 87
structure length 251
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e6wA00
2VNSA 4BO4A 1JQBA 4U8GA 4KP7A 1CERA 1FDTA 2LDXA 1GY8A 1XU7A 3GN1A 2VOJA 2XF8A 1FDUA 4BNVA 1MFZA 3QVSA 4D46A 5I9NA 2CUKA 1QKIA 1A27A 3JQ7A 3PQFA 3VC7A 1I5RA 2VN8A 2EJWA 2PFGA 4EITA 1RM5A 4BO8A 5KVCA 1OI7A 3G79A 3SX2A 2I66A 5L7TA 4YT8A 1B2LA 3NDRA 1YONA 3CSDA 2EERA 1TXGA 1TEHA 1OC2A 4BMVA 5A9SB 1YKFA 2QHXA 3E5MA 3GGGA 3IJRA 4J0FA 3RC2A 2FSVA 3UCFA 2Z1MA 1WPQA 1X1TA 5GZ3A 4YRAA 1U3UA 1ZVMA 2PLAA 1YL7A 2PV7A 3IUPA 4TROA 3INGA 2WJPA 5A3JA 4J43A 5TX7A 3DBRB 4A73A 4MP8A 2WD8A 3HDHA 3C1TA 1NQ5A 2Q2VA 4ALKA 3KYDB 4II2A 3M2PA 1P33A 3GZNA 2HO5A 2ZTLA 3PWKA 3QVWA 3OA2A 4GX1A 3PQEA 4IDGA 3V1UA 1ORRA 3Q2IA 5BSHA 1E7WA 2Z5LA 5JDCA 4NMHA 1KVUA 2QYSA 3I4CA 2HMUA 5DZSA 4BKOA 2WD7B 4ZQFA 1R0SA 2WMDA 2Y1DA 1U3WA 4Y9DA 1V8BA 1GD1O 4DIOA 1DFIA 1YJ8A 2HMVA 3A06A 3HHPA 4CQMD 1EQ2A 3OP4A 1DRWA 4I1IA 3RBVA 4CMEA 3TZHA 4N5NA 4MPDA 2I65A 2VHYA 3WWYA 4DMMA 1HYHA 1HL3A 3DZGA 3FBGA 4OXNA 4PLFA 3V8BA 5JCJD 1QV7A 1ADCA 4L4XA 5JMPA 1MFPA 4FJ0A 5IDWA 2C82A 3DWFA 5TLSA 1G0OA 2X5OA 3QQPA 5GZ1A 4CLEA 4J1NA 2RHRA 4FD3A 3GNSA 2QW8A 1O8CA 3F9IA 5ES3A 2Q49A 2R00A 8ADHA 1NQTA 4NDNE 4CUKA 2NUAA 1DIAA 3EAGA 4QEDA 2WSBA 3Q1LA 3WLEA 4YJGB 5I7VA 1E5QA 1DC5A 1HT0A 3DHNA 4GGOA 1A9ZA 4CR7A 3DOCA 3UH1A 5ILOA 2EGGA 2YFHA 3NTOA 3VH4A 4CMKA 5CP8A 4U7WA 5A3VA 4WEQA 1W8DA 1HDOA 5DDIP 1B14A 2RCYA 3WGTA 1DOHA 4F6CA 2EJVA 4GGPA 4E5MA 2XXBA 1RYDA 4RF2A 1AHIA 3ZNOA 4IIVA 4E0BA 3LZ6A 4IXWA 2VZ0A 2W8ZA 4B3JA 2B36A 4L0QA 5FI3A 2AMFA 1X7DA 3U62A 5DBGA 3RFTA 1N7HA 2HSDA 3U0BA 3NT5A 4HFNA 3QW2A 3LDHA 1R15A 3DOOA 4FGWA 4CLOB 1VL6A 4NK4A 1BXGB 4E2ZA 5AXAA 1R12A 4BNTA 1HEUA 1DLIA 1YOVB 1LLCA 5CHEA 3QHAA 4I5FA 1VSVA 3V5NA 3KXDA 1NVTA 3RVDA 1B16A 2RBEA 3ZNQA 5JS6A 4RPLA 2Y05A 1PJ2A 3OIDA 2DBQA 4KUEA 3RI3A 4IIUA 2AA3A 2FPPA 2FR0A 3GVCA 1E77A 1LRKA 1F06A 3GDFA 4RORA 3WX0A 1BGVA 3GDGA 5T6BA 4CJXA 3RJ5A 4C7JA 1PQUA 4EJ0A 3H5AA 3E1KA 3ASVA 4BS9A 5TNXA 2DC1A 2P91A 1R37A 2H5LA 1TLTA 2HK7A 2QRKA 1SOVA 4MO2A 2HAEA 3VOSA 3WLFA 4QFCA 3AI2A 4HV4A 3KUXA 4BB6A 2W90A 3I6QA 3KYBA 4XR4A 4XYGA 3ZV5A 4EEXA 3DBLB 1RM3A 3WNQA 3KTDA 3I52A 3AOGA 2JD2A 4J4TA 3OFSA 4UAGA 2Y1GA 3TL2A 3ZU3A 3I23A 3ONDA 3NV9A 3GHYA 3HQ4O 1ZZEA 2ZIZA 3IP1A 4TKLA 2DBZA 3ZWOA 1JVSA 4W4TA 5TRTA 5A5EA 2CDBA 1I10A 5HBRA 4M89A 1U4OA 1ULSA 5IZCC 1JN0A 1I3LA 1HSOA 1Z45A 1L1FA 2IZ0A 4M1QA 1PL7A 3AY6A 4R16A 2Q50A 4R9SA 1QR6A 2PNFA 3G0OA 3PK0A 2NNLD 1ZXLA 4OXYA 2RAFA 4K1LA 3ROMA 1EDOA 4ZQEA 2DU8A 3PI7A 4FW8A 3UCXA 2YV3A 4F45A 1UJMA 1ONOA 1KVRA 4IDCA 3LLSA 4Q3BA 2EWMA 3RUEA 3EW7A 4L8VA 1N1GA 4UVDA 5LDGA 4QXMA 3QP9A 3IDSA 1T2DA 2C59A 3ONEA 4IDBA 2PH5A 3PHJA 2Q45A 3HB5X 4XDZA 3W8DA 3RBZA 5HTOA 3Q6IA 3P2OA 4ZRMA 1DIRA 2QRLA 2DLDA 2VWQA 3GMSA 1P77A 3GVXA 1MG5A 5KOIA 2EW8A 5THKA 4IS3A 4OKIA 3C85A 3JD3A 4WPGA 3KBOA 4YJFA 2Q1UA 4YPOA 2PR2A 4D3DA 4AJOA 3AU8A 3ICCA 5C7IO 3U5TA 3A28A 4OQYA 1I2ZA 2I9PA 4FOOA 5DCYA 3H6KA 1NFQA 3VZPA 1UUFA 3KM0A 4XQGA 4FOSA 3U4IA 1C1DB 4ROSA 4JGBA 3W6UA 3WGYA 4R1UA 3TJRA 1TT5A 4DQVA 3HDJA 1M76A 2WE8A 2VWHA 4O6VA 1KIFA 1M67A 3COSA 2NTVA 4L76A 3WQRA 2P2SA 3AUTA 5TS3A 1F8FA 1HSZA 3C7AA 1DLJA 2V6GA 4CM9A 2EW2A 3G1UA 3CE6A 5COBA 5AOVA 3H4VA 1LX6A 4IDDA 3RKRA 2XXJA 5A02A 3QSGA 4XDYA 8LDHA 3B1KA 1ZH8A 1C0KA 1HDYA 1A71A 1LBEA 4PVDA 4FN4A 1VE9A 5JXWA 5JCXA 4GVLA 3OF2A 4FIZA 2OORA 1ZW1A 5L40A 1U4SA 2VUSA 1VJ1A 4F6LA 5EQDA 5JDCC 2E48A 3IUSA 3ANLA 4WLFA 2FMUA 5THQA 5JC1A 4RZHA 4TZKA 3H3JA 3VH2A 2ZTMA 4XX0A 3TQHA 1NR7A 4PLTA 4RO0A 2DM6A 3BZUA 4OIMA 5CPBA 4PLZA 4TRMA 4CMEC 4YAIA 3L77A 4NJMA 3DQPA 4PVCA 5CFZA 2YV2A 4I5DA 1HDXA 4BGEA 3PZRA 1WWKA 1B8UA 1BHSA 4H16A 4RV9A 1DSSG 4IM7A 3X2EA 4HP8A 4RLHA 4ND3A 4J49A 2GN9A 1LXCA 1PJTA 3EZYA 1P1KA 1PR9A 3TOXA 2GUGA 3PYMA 1U8XX 2VYNA 4CLXA 5ENDA 1PGOA 1AHHA 4WEOA 1JAYA 4E31A 1I36A 4GKBA 3Q9UA 5T57A 1H5QA 2JD0A 4YJHB 3E5RA 3H5NA 3MTGA 3O26A 4ZQHA 5CDGA 1I33A 3ITKA 1H94A 4MP3A 3Q9NA 5B4UA 2D5CA 1P31A 1R4MA 1ZBQA 1EDZA 4J7UA 5CDSA 2RIRA 2NTJA 4QX6A 2J8ZA 4Q3EA 4G65A 4CM4A 1WXDA 4J90A 2P5YA 1A72A 2DUUA 4RVHA 4CMCA 2VOEA 2D3TA 3OJEA 2NVBA 3U49A 1R6DA 3FSRA 2VYVA 5B1YA 3IJPA 3JTMA 1YDEA 3GMDA 4H3VA 1I0ZA 3IP3A 4TVBA 1BDMA 2YHUA 5ENVA 3Q2KA 1GYRA 1K5HA 1E3WB 2FR1A 3D1LA 3DC2A 1F0YA 1Y8RA 4B79A 4DWVA 1UAGA 3W1VA 1Y5MA 1ISMA 2B0JA 4R1SA 3MEQA 4M87A 3F4LA 4MIEA 3LYLA 4ALMA 1Y5RA 2D4AA 5TQVA 3GFBA 1H93A 5KTKA 1Y9AA 3K2EA 2QQ5A 3GVIA 3DOJA 4GH5A 1ZK4A 1R4NA 4PN3A 3OM9A 1D7OA 4YDRA 4CM8A 4F3YA 5JMWA 5CG1A 3ULKA 4XWYA 3WIEA 3MTJA 2ZTVA 1BXKA 5JYEA 3X2FA 1ZMTA 2PD6A 1F12A 1E7SA 3VHRA 1QP8A 5F1OA 2D59A 2PGJA 2ZB4A 1DHTA 1I3MA 1LUAA 4OQZA 3FTNA 3U9LA 4E21A 2GDZA 4D44A 3GK3A 2GF2A 1ZK0A 4U6QA 1C1XA 1EQUA 1NXQA 1NWCA 4IXTA 3NTQA 1KY5A 1IHXA 2OMEA 4E2YA 3GOHA 2DFDA 4R68A 3NT2A 3EVNA 1ENPA 1M2WA 1ZXBA 4I8XA 4IZIA 1EBUA 3WFJA 3WWZA 4AJJA 1JKJA 2JAPA 3FN4A 1EFKA 3TZQA 3GN2A 3WJAA 1U2GA 3HN2A 1KY4A 1I3KA 2HU2A 2V6MA 3GEDA 2HLPA 5KJ6A 4EBFA 3GRKA 4RDIA 4XGKA 1ZUD1 3ZHYA 3KLPX 1VLLA 3QLJA 3HE3A 5F21A 2WM3A 2J3HA 4HNGA 1Q7CA 3ENKA 2HQ1A 4CQMA 2NVUB 1HF3A 1NBOA 2DTEA 2YY7A 4GAEA 4DBZA 4BV9A 3OA0A 5BQFA 4D79A 1T4BA 3Q11A 3GF4A 3JQAB 1HDGO 3I83A 4J3FA 4J1SA 4CQLA 2SCUA 1O5IA 1FK8A 4XR9A 3IKTA 4R9RA 3SLGA 2O3JA 4GL4A 2EKPA 3EZLA 3JQGB 3WMXA 5CEJA 1DBVO 3S2GA 5U1PA 4OXKA 3EHEA 3GFGA 3KYCB 3QWFA 1E3SA 4S3MA 4N5LA 3VVBA 3MWEB 5BR7A 4NR0A 5BSEA 1JW9B 1M6WA 1NHWA 1XDWA 4IBOA 3KO8A 4EUEA 3P2YA 4I9HA 5B12A 2Q46A 5F3RA 2W2KA 4GWKA 4NH4A 2IODA 4OO3A 3WSWA 2GO1A 5KIAA 1GQYA 4LW8A 2YUTA 4XGNA 4XYEA 1LNQA 3FWZA 4IJUA 1Q1NA 3UAGA 2D2IA 4GMFA 4W6ZA 4RF4A 1R66A 3L0DA 1IZ9A 2NSDA 1UZMA 3S2IA 4QT0A 1B26A 4YCAA 1GV0A 3C24A 3QWHA 1DJQA 5AXCA 4ITUA 4CM9D 3IQDB 1UXIA 1NAIA 3ITDA 3LQFA 1ENOA 4JP3A 4NFSA 3JQBC 2NV6A 2PK3A 2V6FA 1H6AA 4RVDA 1P1FA 4JNKA 1QMGA 3TZKA 3JYOA 3ZW8A 3TL3A 1W0CA 4B4OA 1ZK1A 2ZJ0A 4LISA 7MDHA 1V6AA 4D42A 3L6OO 3R1IA 3TDKA 1P9LA 3DAPA 3IKVA 4BNLA 4BUCA 5L9AA 2VZ9A 5G2OA 1Y9EA 4NHEA 5TGDA 4BNHA 4C7KA 5DCWA 2C07A 2XAAA 3WJ7A 4EI2A 5JW6A 1SEPA 1QV6A 1NP3A 3DMTA 4WKGA 3WFIA 1TVEA 4E3ZA 3JQFA 4FB5A 1WZIA 3RKUA 1DB3A 1E7QA 3JQ8B 2BGKA 2AE1A 3PHLA 1B0AA 1GYPA 1F14A 4R1TA 2CY0A 5FWNA 1GQQA 1NX6A 3JD1A 3ETGA 3GLQA 2ZJ1A 3W4JA 4E33A 1D3AA 3WSVA 5C37A 1RKXA 4WUVA 3LC2O 4WNCA 1O94A 4B3HA 3FR7A 1L7DA 1UP7A 3WGZA 1C0LA 1DHRA 5AQ1A 4X54A 1R0LA 3KEQA 2XPCA 1NASA 2P4HX 3I9MA 5G0UA 1E1KA 2O3TA 3DO5A 4JROA 4GX5A 4HXYA 1EE2A 4PGFA 4CV3A 1LDBA 4FFLA 5CDYA 4RDHA 1U2DA 5ER9A 3ZGYA 3H3FA 4JBHA 5I7SA 5EPOA 4BO1A 3KETA 1Q0QA 1XIVA 4E5PA 3FNEA 3ANNA 3I9OA 4WCFA 2PH3A 4TRNA 2O23A 5K6AA 2X9NA 3JD4A 3GGOA 4R5HA 1W6UA 1V0JA 2CNBA 3GA0A 4JCOA 4RQTA 4NQZA 4EW6A 3V2UA 1DEHA 1KEPA 3WYBA 4YEDA 3U3XA 1JA9A 2BD0A 3V2HA 4DIFA 5IG2A 3AM5A 1ZEJA 2VYVD 5KVQA 3JYNA 1E6EA 3DBHB 2VRCD 4EUFA 2PD3A 1SEVA 3ZWMA 4D3FA 4WJZA 3P5SA 4CV0A 3PJDA 1ZSVA 2EEZA 3U4DA 1DO8A 2AE2A 3AY7A 4RVSA 1AUPA 5FEUA 5JO0A 1N9GB 1PJLA 3LT2A 2RH8A 3UICA 1WZEA 2X4GA 1EK6A 5DF1A 2C54A 5F5LA 3SLKA 3UFXA 3WBFA 3B1JA 5H82A 5BNTA 1PS9A 2QG4A 5A4DA 2OUIA 4MVJH 4RPJA 1P1JA 2PWZA 4HUJA 4O63O 5JC8A 4YT5A 1W4ZA 5A9TA 3WQSB 3H9QA 1YXMA 2G1UA 2JFGA 4KWHA 3W4IA 3WOHA 1PSDA 3AK4A 3H7AA 2VHWA 4YR9A 2Y68A 4B3IA 3DHYA 4U0KA 1PWXA 2UDPA 3VPFA 1CF2O 3GEMA 4IPTA 1PL6A 2XOXA 1KS9A 3QRWA 3ZCXA 3ZHZA 1EE9A 4BNNA 1U7TA 3CH6A 1LSJA 1V3VA 3O9ZA 4N7RA 4PLHA 1B7GO 5JLAA 5K0ZA 2UUPA 4JJGA 2TMDA 1FMCA 4ND5A 2TMGA 1GU7A 4NBRA 4QECA 4BKUA 1BWSA 4BO5A 1YGYA 1NPTO 1F17A 2DBVO 3OJOA 4DA9A 4J4BA 4GSKA 4RLSA 3AUAA 3EYWA 2HDHA 4LMPA 1SC6A 2B69A 3M6IA 3W6ZA 4BIIA 3RUFA 3BMOA 4YT4A 4I9UA 1NQOA 1JWAB 3BTUA 3BMQB 2NU7A 3PHGA 4E2WA 3I3OA 5L4SA 3T4XA 3T7EA 1Y81A 1MP0A 4BNMA 2PD4A 4D45A 1IZ0A 1XQ6A 2NWQA 3JQEA 1H0KA 1AGNA 4NK5A 3FHLA 5L95A 3PWSA 5CEEA 3ZWAA 5L51A 1VI2A 4CMBA 1G6KA 3KSUA 1OOEA 4ZN6A 2R2GA 3HNPA 1I8TA 3PYLA 4KUHA 2C2YA 3OIFA 2GYYA 3KSDO 3F1LA 3BYZA 4CMHA 1E7YA 4FR5A 3U09A 2X58A 1S6YA 1T1SA 3JQ6A 5JY6A 2V65A 1PR3A 3UXYA 3GQVA 4FQ8A 2GN6A 2WTBA 3LLVA 2DQ4A 4UUOA 4NIMA 1T1RA 1XR3A 1PWZA 3GHHA 5KVSA 1J0XO 3PFFA 4M54A 3TOZA 4TKMA 2YHIB 4PZDA 1B15A 4J1TA 2Y99A 5A9SA 4YT2A 1T2AA 2CVZA 2PKQP 3INTA 3VDQA 4D7AA 2DT5A 1NHGA 4LVCA 4QQRA 3NX4A 1E1LA 1YBMA 2AHRA 2GN8A 1UZNA 2JCYA 3CEAA 3NEPX 4NFHA 3ZWYA 1KYQA 5FYDA 2BHLA 2ZCVA 4WE3A 3LT4A 3DBRA 1YQDA 2ZYAA 3ZNPA 4LSWA 5GY7A 2X6TA 4QTZA 5BNIA 3FNHA 2A92A 3IC5A 4G81A 1EK5A 3RUIA 3AOEC 3E48A 4YTEA 5KKCA 4INAA 2JCVA 4J7CA 3DZIA 4UEJA 4CMIB 3PGXA 3B70A 4L4RA 1SB9A 5IF3A 1DPGA 1JVBA 1N1EA 4YBZA 3GUYA 4IQGA 1CETA 2IYPA 1RM0A 3L6EA 1Z73A 1D8AA 5GMOA 1IL0A 4FJ1A 2EF1A 3GG2A 2OHXA 5JBIA 3H2SA 3FPCA 3CMCO 2P68A 4F46A 5DP2A 4UVHA 2WD7A 1LDGA 5J23A 3RAJA 3K6JA 1ZIDA 4Y98A 3GUCA 3CKYA 1E7MA 4FS3A 3RUDA 2CD9A 2DVMA 5FF9A 2B4QA 2F1KA 4FFOA 5TT1A 1U5CA 2CFCA 2VT3A 4J2OA 2VWPA 3RASA 1BSVA 3DMTC 3FCOA 4YAEA 1MC5A 4YRDA 1H6CA 3JQFC 4FBGA 3KV3O 4YAKA 4BVAA 1GTMA 3JV7A 5IN4A 5A1TA 1ISFA 4LRSB 2X9GA 4DUPA 3DMYA 4E12A 2OBYA 4IZHA 4M55A 3DB2A 5EIOA 5JFOA 1BXZA 5T8KA 1T25A 5T64A 1PJBA 2C7GA 1PJSA 2X0NA 2X8LA 3H2ZA 4PG8A 3AM3A 3BMNB 1U8FO 3O8QA 3JCZA 4DC1A 2NADA 2JAHA 3AM4A 4E13A 4FC7A 2HRBA 3VPGA 2AEFA 4CM6A 4AFNA 4WLVA 1X13A 3RSHA 4WLUA 1JDJA 1H2HA 1EFLA 2CMDA 3JSAA 1PQPA 2LDBA 4A0SA 4YYZA 4BNIA 4MDHA 2UYYA 4J0EA 4I08A 4A03A 3GC6A 1SAYA 3FBTA 3EDMA 5EMHA 5G0TA 1GCOA 3TF5A 4GX0A 2G17A 3PFWO 1PZEA 5A05A 4IQ8A 2VHZA 1BMDA 2RH4A 1GAEO 4UEOA 1NTOA 4NFYA 2IE0A 5IN5A 4WLOA 1V35A 2FRDA 1MLDA 3FF4A 3G1TA 4OM8A 3K5PA 4WCFC 4XJTA 4EGFA 5F1KA 2DTDA 5LDHA 3UOGA 3ROQA 3UW3A 3MJVA 1UAYA 4L9RA 5KNLA 2YYYA 2ZB7A 5B37A 2GGSA 1GCUA 1MXFA 1QRRA 2CVQA 4RL6A 5F1PA 2X7HA 1ENZA 2FPIA 4TMFA 3MOIA 4PCVA 1BXGA 3H9JA 2DBRA 2JFHA 3VKUA 2WDZA 4DYVA 4RGBA 1YOVA 1X0VA 3KZVA 2O3RA 1YO6A 3G49A 1AE1A 1DXYA 1E0DA 3CZMA 3ZW9A 2O3UA 2Q1WA 9LDBA 5CPFA 2NLOA 4A2CA 1GYQA 5EQFA 3CPSA 2IXBA 4H15A 4OGWA 5EN4A 3UHAA 3WG9A 4FFNA 2Y1FA 1HLPA 1UDAA 4Y6PA 2HJRA 4RF3A 4BKRA 2Q4EA 5I8WA 3DAFA 4HX5A 2Y0DA 1L7EA 1TT7A 5HS6A 4BNKA 1LDYA 5DBFA 1KOLA 3OH8A 2AQ8A 4NJMB 2HJSA 1YE3A 4U0JA 1BVRA 4GQAA 4XRGA 1FDVA 1FDWA 1JWBB 3DFZA 2JL1A 1PJ4A 4RCVA 4XB1A 4ZGWA 3GAFA 2PTGA 1KEUA 1YBAA 2POQX 3DBLA 4JXKA 1VKNA 3VTFA 2HRZA 2AXQA 2NU6A 3F46A 4IMPA 3V1YA 2OGUA 4I9NA 4RVFA 2PZKA 3GPIA 4LGVA 3ETEA 1XEAA 2Y1CA 2Y67A 4EUHA 1X7HA 5LCXA 1GUFA 4XEHA 5T67A 3HZZA 3NAQA 5JAIA 1R4MB 3ST7A 3VZRA 1P0FA 1UZLA 2VHXA 3C3XA 3PDJA 1MG0A 4CM4B 5JO9A 1JKIA 3D3EA 1X14A 4YACA 4AVYA 4BO6A 3IL2A 1OAAA 5HWSA 2VTDA 4RPGA 5C3MA 3D4OA 4H7PA 4Z3DA 1PU2A 2Q1TA 2Q99A 4YAJA 4AJ2A 2DPHA 5CDTA 3JD2A 4P4LA 3WBBA 1NFRA 2CF5A 2D8AA 1DC6A 4GVXA 3TZCA 3H9EO 1YJQA 2O3SA 4Z9YA 4JQCA 4HFMA 1NPDA 5HRUA 4QO7A 4GBJA 1BG6A 3OHSX 4NG5A 4DIBA 1B3BA 1WP4A 2E49A 1H9BA 1GUYA 4R69A 4LCEA 3MWDB 2W4QA 5H83A 3ORFA 2IZ1A 4DL9A 3GVPA 1XHLA 2DPGA 3BXXA 1BW9B 2J5KA 1F8GA 2R00C 3PLNA 4PLVA 1RJWA 3B20A 5I7EA 1DDOA 3D7LA 5B4VA 5IZ4A 1UH5A 3DR3A 5AYVA 4CM8B 3EUWA 3MCVA 1E1NA 3SC6A 1MB4A 2QIOA 3DTTA 1KEWA 2DKNA 1C1DA 3S55A 1ZSNA 2HMSA 5CG2A 3K30A 5JPIA 3OQBA 5ILGA 3GDOA 3VVCA 1UXGA 2CSUA 4GMGA 1KEVA 3L4BA 4CM5A 2VNAA 2R6JA 1ISHA 1DIGA 3CTMA 3MZ0A 2DTXA 1P74A 3L07A 1LLQA 2QZ9A 1ZK2A 2FHSA 4G5HA 3PPIA 4EJ6A 3E9NA 2C0CA 2ZATA 4J91A 4PZCA 2PA3A 1QYCA 1SO8A 2X5KO 4DREA 2VRCA 5EERA 1VRWA 1IYZA 2D1YA 5U9CA 3FNFA 1LI4A 2B83A 2J3IA 5F5NA 1LSUA 2ZQYA 1YDWA 3WMWA 3C7CB 5G4KB 2Q1SA 3M1AA 4XRRA 4OKNA 4BO7A 2GERA 3RIHA 1NVMB 1HZZA 3F3SA 2P9EA 1VSUA 1K6JA 2D5AA 3RCBA 6LDHA 1Y6JA 1Z75A 2AQHA 4CLRB 3AY3A 4QFDA 1GADO 5TJ9A 2X9VA 3AWDA 4CQMB 4RZIA 2AEMA 1I2CA 2NTNA 2X5JO 4CR6A 3JD0A 3BHJA 4PFJA 4HY3A 1K2WA 4NI5A 4CQLB 2VCYA 1PGJA 3DFUA 3ADOA 3GNQA 5L45A 3DZJA 3F6YA 1ISJA 1O89A 3RQSA 4E32A 1HDZA 2EGHA 4AL4A 5COAA 1DAOA 1DC4A 1LLDA 2PZJA 3LF1A 4OJNA 3C1AA 4TZTA 3NKLA 5T8KC 4PRKA 2CVOA 3QJ5A 1GPJA 3OBBA 4N54A 4ZA2A 4OMUA 2AQKA 1OMOA 4YJHA 4JP2A 1CRWG 1ZNQO 1NPYA 2A9FA 2WE7A 2BF7A 4DGSA 3SVTA 3BMCB 2YZ7A 2W2KB 2BI8A 2O48X 1YB1A 4P4NA 3WICA 9LDTA 3INRA 1KERA 2BFPA 4CV2A 4Z6KA 3OQ1A 3ZWXA 3DZKA 3WGQA 4BL5A 4AJKA 1TB4A 3S8MA 4FFMA 1HE3A 3PGJA 3PQDA 1E3LA 1BRMA 4ZICA 1PZGA 1RYEA 1E5LA 1Y7TA 3S2EA 1EUZA 1IULA 1SNYA 5MGBA 4HADA 3C7DB 1M66A 1IB6A 1X7GA 1K6IA 2B5WA 5BNFA 3K31A 4Z0TA 1JKFA 4DPKA 5EL0A 5A9RA 1E3WA 4IDAA 3RFXA 5ER6A 4MVJD 4CM3A 2IEBA 1I3NA 1XQ1A 3PYXA 3WXBA 4R5MA 1Y8QB 1J4AA 2NVWA 4E5YA 2GRAA 4NU6A 1RM4A 1Q2XA 4FJ2A 5DCUA 1MA0A 2VZ8A 4MOWA 3S2FA 3V1TC 3TRIA 3BIOA 5FFFA 2GPTA 2UUOA 1A7KA 1PS8A 4W9NA 3D3WA 3WQQA 5JDIA 1HKUA 2I3GA 4OYRA 2GLXA 2EXXA 3IS3A 1OC4A 3G17A 4JLWA 4CODB 3FPLA 4YA6A 2DFVA 3HG7A 2P9GA 5DP1A 2UVDA 2ZYGA 1E3IA 2AEJA 4DXHA 1PTJA 1H6BA 1A4IA 3F1KA 5CEFA 3PEFA 4WK6A 2NU8A 1K6XA 1A9YA 4NNJA 4KUGA 2FWMX 2Y0EA 2F00A 2Y93A 3ZHBA 1DRVA 3HDYA 2P9CA 4Q9NA 1WNTA 1WDLA 2O7QA 4I5GA 2X1HA 4K6FA 3WS7A 3QVOA 1SB8A 3W8FA 3V2GA 2CDCA 4ILKA 4WLNA 4CPDA 4DRYA 1XGKA 1GZ3A 4ZQGA 2BH9A 1SCUA 3K96A 1NYTA 3GAZA 4WCFB 2X0RA 3DONA 1XU9A 2YFQA 2PKQO 3HFSA 1QYWA 2GNAA 3QVTA 3RUCA 4D41A 2AW5A 3JYPA 3IOYA 4BNGA 5CDUA 3ZNNA 4CM1A 3VTZA 4CMGA 5HA5A 4RPKA 3I1JA 1O0SA 4AJHA 2NVUA 4W82A 2VTEA 2H63A 2OXIA 2J6IA 3PDUA 3IMFA 3JQAA 5L7WA 3VZSA 3NJ4A 5IDYA 5IDXA 2BLLA 1Z7EA 1PGNA 3OICA 1YL5A 3H9GA 3FRJA 2B35A 3R3SA 3BHMA 3NGXA 2BFMA 4TVOA 4GKVA 4ALNA 3JQ7B 3ON5A 3JQGA 2VUTA 1V9LA 1H6DA 5JAQA 5JY1A 2BMAA 3OEYA 3T7CA 3A14A 4NBUA 4B7XA 2FZWA 5H81A 4A7PA 1CQJA 1DIBA 1ZKMA 5T5QA 4CLDA 1U3VA 3UCEA 2V6BA 3N7UA 4Z0HO 4JN6B 3VZQA 4CUZA 3F5SA 4XJSA 5JAZA 3O03A 4PLGA 3KVOA 5K9ZA 5MDHA 1EVJA 4KDEA 4MVJG 3SXPA 4A10A 4BNUA 2Q3EA 3N58A 3PP8A 4AJLA 1WAMA 4W99A 1I32A 5COQA 3A9WA 5G4LA 1YB4A 1U7HA 4ZU3A 2OFPA 2VT2A 4KMSA 4BV8A 3AW9A 2GSDA 4JX8A 2EP5A 1D1SA 3GZNB 3O4RA 4A27A 1MUUA 2CZCA 2YDYA 3IAHA 3K2BA 3L4BC 3UKOA 1XSEA 1PGPA 4TWRA 1ZJYA 4KTVE 5I7FA 3RUHA 3MJ4A 4JJFA 1ADBA 3BMOB 2QX7A 4CR8A 1YBVA 3PWZA 4BKPA 1V3UA 3HFGA 3L9XA 1A5ZA 3FD8A 3LU1A 3KB6A 2OOSA 3Q0EA 4BNYA 4DBVO 1JAXA 1WDMA 3ZV3A 1O9BA 4OH1A 5IDQA 1AXEA 2EKQA 3DZFA 1LRLA 4HFJA 1ZEMA 3AJRA 1IY8A 3JQ8A 1Q0LA 4ZQBA 5HM8A 5DULA 3WR5A 4UREA 4KDFA 2IXAA 4N18A 2QYTA 3ZU4A 3OSUA 3QIVA 1PX0A 2H1SA 2IDZA 1P1IA 4B7CA 1NQAO 4GPD1 4PZEA 2YJZA 3RD5A 4NBTA 2VQ3A 2NACA 1ONNA 5A04A 1LEHA 4MVJF 1GEEA 3TZ6A 4PLCA 3RROA 3D0OA 1U1IA 4QSMA 1XWFA 1LC0A 1YH3A 3LC7O 4MKZA 3TSCA 3MJEA 1UDBA 5GZ6A 4OHUA 1CJCA 2FN7A 3LC1O 5IXSA 4HFRA 5EINA 4P22A 3QE3A 2I6TA 2FPGA 4MVJP 1B8PA 2QZZA 5C7LO 3EVTA 1NR1A 4LVUA 3KOUA 2JHGA 1YQGA 4J6FA 4L73A 1P3DA 3PJFA 3L6DA 1GUZA 4B4VA 4BO2A 3I5MA 3NJ8A 1Q0HA 3OMLA 3H5RA 3GY0A 3RUAA 5I9LA 3ZWCA 2PGLA 4BQPA 1E6WA 1GL3A 4PLWA 4BNJA 5IXYA 4OSPA 2J3JA 1UP6A 1JLLA 3EY4A 3DBHA 1R0KA 2BFAA 1M6HA 1IHYA 3BTVA 3CIFA 3RC9A 4BGIA 4LN1A 1I2BA 1LDMA 1DJNA 2ZK7A 3ROPA 2I76A 2ZKLA 4XYBA 4Z0PA 1D1TA 5TT0A 1N9GA 3ZWBA 4ID9A 2QRJA 3NTRA 4BHTA 2ZYDA 4E5KA 1FXSA 1ZK3A 3GZ4A 3IIEA 4TRRA 1WLYA 4GLOA 4D0SA 3GH3A 3VH3A 3MJTA 4JK3A 3S1LA 4J4HA 4J9UE 3E9QA 1EBFA 1HZJA 3NRCA 1DFGA 1WMBA 1KC1A 3WYEA 4K9DA 1E1MA 1P44A 2O50A 4NJOA 4CV1A 3PLRA 4B4UA 4MIYA 4ND1A 4XQ9A 5U4QA 1ADGA 4ESOA 4Z3KA 5AXDA 4C4OA 2YDXA 1PQWA 1MV8A 1SBYA 2WWRA 4Q39A 3H8VA 1PEDA 1WMAA 1LSOA 3DDNA 5JNLA 2P4QA 4KZPA 1W73A 1HDRA 4W9NC 5JDIC 2HMWA 2IEDA 4MP6A 3TNLA 3RFVA 1QLHA 3GGPA 5TJHA 3GVHA 2X23A 1N5DA 1T2FA 3O8QB 3F47A 3KYDA 3E9MA 1SOWA 3HB4X 4K6CA 4NBVA 2GZ1A 4YXFA 1N92A 3CZRA 4PLYA 1C14A 1HYGA 3FWNA 1DRUA 4Q3DA 4B4WA 2Y1OA 5KJFA 2GR9A 1XYGA 3BMQA 3ZN2A 1LU9A 1BTOA 1E92A 1QXSA 4GX2A 4YAGA 4BKQA 2BELA 2B4RO 3BAZA 2EG9A 5L4LA 3SEFA 1LSSA 4Y6RA 1ZO8A 2HUNA 3CINA 4P4GA 3RWBA 3TFOA 4MVJE 4WCDA 3WGIA 4BO0A 1VJTA 3VAZA 3OJFA 4QUKA 1QG6A 3DBVO 2C20A 4PG6A 3JQAD 3AI3A 3AU9A 3QWIA 2O2YA 1LRJA 2I5PO 3ZHXA 1C3VA 4TQGA 5AXBA 3ZWPA 4J2HA 2ET6A 2HK9A 1P1HA 3WB9A 2FP4A 5KJ1A 3PJGA 3E6AA 2H6EA 3PZBA 5ITWA 4ND4A 3QWBA 4BQRA 3L4SO 1C0PA 1HLDA 4R01A 1NFFA 4B7UA 1ARZA 2W98A 1ZMOA 2YHIA 3AFNA 4K26A 4YJGA 3E03A 4ZVVA 4O1MA 5DNAA 3MOGA 4JJIA 3NGLA 3RJ9A 4YJFB 4PG7A 4XZ3A 4M86A 2DAPA 1E3JA 5ITVA 1J49A 3A4VA 5FI5A 3ZWNA 1PGQA 4WLEA 3BA1A 5JSFA 3ICPA 1X1EA 3D64A 4MVJM 1PIWA 3L9WA 4PG4A 1N7GA 3KRTA 1E6UA 3HUDA 1TT5B 1PS0A 2FR8A 3SC4A 3P19A 3ANMA 4IJVA 4UEKA 4L4SA 4NPCA 4CMIA 5G0VA 3PRJA 4AJNA 5K6AC 4WGGA 1VC2A 4XKJA 3ZH2A 4TSKA 1LQTA 5DN9A 4XGIA 1Q7GA 2DUWA 4XD2A 3OEWA 1HXHA 3K8ZA 3OETA 5EESA 1P45A 1LDEA 3HDQA 4D3SA 2W2LA 1XELA 4CLOA 1K89A 4DLLA 1KVTA 3HJAA 4KTTE 4PG5A 3QWAA 3DXFA 2OL4A 1Z74A 1GDHA 1U9JA 5DT9A 4MVJA 4YVFA 4R3WA 5IJZA 1FDSA 2GASA 2GZ3A 1D4FA 2VRBA 3ZV4A 3KEOA 3NYWA 5KVVA 4BO3A 5A06A 1UDCA 4IY1A 4FFRA 2J5RA 1LLUA 2ZTUA 3UN1A 2C2XA 2YQ4A 4FDAA 3QVXA 3FNGA 4Z9FA 4UUNA 1HE2A 4FFPA 3I9NA 1LQUA 1UP4A 1IOLA 4R51A 2B5VA 1HWYA 3SJ7A 4R4JA 3WDSA 3AUSA 4DQXA 1BVUA 5C5IA 3WTBA 3WTCA 2NM0A 1Z82A 1LDNA 1OBFO 3H9UA 4E30A 3BMNA 3PHHA 4A5OA 1IPEA 4KQWA 3PIDA 4XYLA 3VH1A 2FZEA 4AG3A 5L4NA 4UUPA 3BTOA 3PVZA 1DIHA 2JKVA 2HKIA 3CMMA 1ID1A 1MXHA 2BGMA 4LSMA 1ADFA 1IPFA 4JIGA 3VPHA 5AVOA 4P8RA 3QY9A 3FTPA 4HNHA 1VM6A 2UV8A 1XA0A 3PJEA 2JD1A 1XLTA 3PXXA 4RQUA 4UULA 1YQXA 3JQBA 3HN7A 1YVEI 4WOJA 2OO5A 2EKLA 4Y6SA 1NM5A 3VPSA 1YRLA 2X0JA 4DTIA 4ZJUA 1VL8A 3ENNA 1UXJA 4XYMA 1LA2A 1WW8A 5IAAA 2I67A 1ONPA 4FSHA 4RVUA 5IFLA 4EZBA 3GEGA 2G82A 3OQ6A 6ADHA 4J1QA 2ZCUA 4O0LA 2OP1A 1LC3A 3LVFO 1N2SA 2EIHA 4PLPA 4U6SA 1NNUA 3VPXA 1FF9A 1JTVA 1G1AA 1ZFNA 1T4DA 2GD1O 1RWBA 3CUKA 3R6DA 3BTSA 4L74A 1Y8RB 4CMAA 5A03A 4NBWA 4WECA 4IDFA 2X22A 2GCGA 3W4KA 4BNZA 3JQ9A 1HDCA 1ZSYA 3W8EA 1YB5A 1EUDA 4KQXA 4IGFA 4E4YA 3GPDG 3LT1A 2AG8A 4DLAA 4IUYA 3NDJA 2FSSA 5G0WA 4FC6A 5EJ2A 2VUUA 1ISIA 1R4NB 3SBOA 4PIVA 5CAEA 2X86A 1N8KA 1VKOA 2V7PA 3GT0A 1O95A 2EV9A 2Y66A 2OZPA 4WNIA 1KBZA 3JQCA 4CL8A 2WYVA 3M1LA 3RU9A 3AUUA 3MJCA 3DAGA 2BI7A 4XIYA 2NQTA 3QA9A 1BDBA 4OL9A 3ZWVA 3GRPA 2G0TA 4L75A 3ZU5A 1T26A 1EMDA 4DPLA 1U28A 1QYDA 2AG5A 4LCJA 1ISGA 4OOEA 1KETA 1E3EA 1C1XB 1K3TA 2BRUA 2Q2WA 1P0CA 2J3KA 3PHIA 4FGSA 4OOFA 4MKRA 1I01A 3DHEA 4CM7A 2GZ2A 5B4TA 2H9IA 1OFGA 4UVEA 4XCVA 3VKVA 1EVIA 4N5MA 4ALIA 4EDFA 3M2TA 1EVZA 3C8MA 2PY6A 3UVEA 2EHDA 4JBGA 3ZU2A 4EEZA 1H2BA 3LK7A 1QSGA 4AJEA 4R1NA 1CDOA 1CQIA 5ICMA 4IJKA 2VHVA 2GN4A 3JYLA 3ETDA 4RVGA 3Q3CA 4DC0A 4E5NA 2J5QA 2BGLA 5HS4A 4FPXA 4MVJI 3ZV6A 4QO8A 4XA8A 1G0NA 4AJ1A 1U3TA 1QYXA 2E4AA 4YQZA 5KWEA 1A7AA 3H65A 2G76A 1WDKA 3GR6A 4CUJA 2B37A 4U5QA 3EGOA 3LSYA 2UAGA 1PJCA 3E82A 3LT0A 5L53A 3PIIA 5A5FA 1BW9A 3NT4A 2IZZA 3ASUA 3OECA 3RBXA 3ZZNA 3D5QA 4OAQA 4Y67A 3D3WB 1M75A 5TC4A 1KVQA 3ONFA 4AJIA 1KC3A 3TFQA 4BGVA 5BSFA 3ABIA 5KKAA 3HWRA 4AJPA 3NDIA 5JYDA 1J5PA 1GQ2A 1EUCA 3D5TA 2C5AA 3MJSA 2A94A 4I5EA 2ZQZA 1GV1A 4BO9A 2WYWA 2HK8A 2Y0CA 3PTZA 2CDAA 1XCBA 3TWOA 3D4PA 5KJEA 1DAPA 3N74A 1TI7A 3TN7A 4DYDA 3R0IA 2D0IA 2AQIA 4YJDA 4YQYA 4Z9XA 4AJ4A 4LK3A 3E18A 2A4KA 3D4NA 1UXKA 1QLJA 2W2LD 3EC7A 2OP0A 4TRJA 2JCXA 2JJYA 1YWGO 5DOZA 3AI1A 1VPDA 3UUWA 1A4UA 1GEGA 3SJUA 2FOIA 1K0UA 4NZ9A 4JBIA 4XQEA 1B8VA 2NU9A 5TF4A 3DL2A 3HADA 3I9JA 3HSKA 5L3ZA 2PKRA 1YS4A 5G4KA 4MKXA 3FI9A 4O5OA 4YWJA 3JQDA 4ZHSA 1X0XA 1EZ4A 2IRWA 7ADHA 4J9VA 1S7CA 4IMRA 4W7HA 1QYVA 1JU9A 5DBIA 1J6UA 4CLRA 3OJ0A 4R54A 4YRBA 4NU5A 3OIGA 3UF0A 1U5AA 4IGEA 1PZFA 1AN9A 4DLBA 4DVJA 1TA4A 4IQ0A 4BGUA 4CLHA 1PJ3A 4S1VA 2Q2QA 1KVSA 2Z95A 1EVYA 1GFSA 4AICA 4HBGA 5JAMA 2G5CA 5JCJA 1HRDA 2C7VA 2I99A 4B8WA 4FCCA 1Z6ZA 1NWHA 3I4FA 1HE4A 4LMRA 2PZLA 3RC7A 1PL8A 3P7MA 1X15A 4UVGA 1ML3A 3ZI0A 1UXHA 4BB5A 3O38A 4M49A 3WNVA 4WASA 1GPDG 1SPXA 1Q7BA 1E7RA 4BMNA 1UR5A 4MJLA 4XIJA 3WGGA 4CMJA 3C1OA 4BOYA 1Y1PA 4OSOA 3K9QO 5LC1A 2P5UA 2YV1A 4UUMA 1ENYA 3EK2A 3DZBA 3BMCA 4LRTB 1HE5A 1CYDA 3G3EA 1CEQA 2C29D 3KSZO 3UGKA 3R3JA 3AOEA 4BMSA 4Y8VA 3WGOA 2YW9A 2PGDA 3FR8A 2BKAA 2E37A 3K92A 2A35A 3KHUA 3NUGA 4YB8A 5G0SA 3DZHA 3A1NA 4DQUA 4J16A 4P38A 1HETA 2O2SA 2ZB8A 1VJ0A 4IINA 4M8SA 3ZWWA 1B3RA 4GI2A 4UVIA 3T4EA 4ZRNA 3GNTA 4CL3A 2OBNA 1IUKA 3I6IA 1CWUA 1ZCJA 4ZD6A 4DMLA 4A26A 1MGOA 1Y8QA 2BFOA 4ND2A 4BNXA 1GR0A 5ADHA 4HKTA 4RPHA 4RJTA 1T2EA 1CIVA 1XKQA 4J7XA 2ILTA 3WGHA 2CF6A 5ICSA 1HYEA 4RF5A 3ZDFA 2WEKA 2NQ8A 3KYCA 1T2CA 2O4UX 1HTBA 4WOKA 1SMKA 2B4TO 2PZMA 1SZJG 1P1RA 3STHA 1FJHA 4BNFA 1PZHA 3B1FA 4IS2A 3WIDA 1I30A 3F4BA 1O6ZA 4E2XA 1OZAA 3JQ9C 2E6UX 5I8ZA 4Q3AA 3QV1A 2JFFA 3GG9A 4BNWA 5C7OO 5KJCA 2FY8A 4GLLA 1ZJZA 3K73O 3EMKA 1T24A 2HMTA 3AFMA 2I3AA 4B8ZA 1RPNA 1XG5A 2E82A 1C0IA 1LTHR 1NAHA 4E6PA 4KWIA 2IYOA 3ADPA 4XB2A 2Z1NA 3U4HA 4EYEA 2EP7A 4II3A 4R41A 1DC3A 2VYND 3B6ZA 3BHIA 4IJWA 4ALJA 1PJQA 1DFHA 4XQCA 1R16A 4HWKA 4EJMA 1YL6A 3KLMX 1H9AA 1AXGA 3LF2A 4D0RA 5I9MA 2Y1EA 2Q4BA 1ULUA 5DOVA 5JE8A 2C5EA 2O7SA 4DPMA 3RU7A 4MIOA 5BSGA 1Z7BA 2WYUA 3U4CA 1WVGA 4PRLA 5IZCA 3ROKA 1GZ4A 2RHCA 3WYCA 2JHFA 1EEHA 1QORA 4GSLA 3TPCA 4D43A 5TIIA 1I24A 4R3NA 1MX3A 2O4CA 2ZB3A 3DEYX 1NVGA 2X0IA 1VL0A 2VWGA 5BT9A 4K28A 3VDRA 3CXRA 1IE3A 3E8XA 4O59O 3F5QA 4Q3CA 4KOAA 3I9LA 4URFA 2O3QA 2YQ5A 1GZ6A 5KCZA 4ONEA 3DTYA 5L7YA 2HCTA 3RC1A 1LJ8A 4Q3NA 3JYQA 4IDEA 1MC4A 4G2NA 1V3TA 4GWGA 3I9KA 5TSDA 4ALLA 4MINA 4W7IA 3OJLA
chains in the Genus database with same CATH superfamily
2IHNA 2PUBA 1JQBA 1XD2B 2I2BA 5ALYA 1SKYB 4BFYA 2RHJA 1CERA 4QQKA 2Q5IA 4I99A 1ZA1A 5I47A 2R65A 2VOJA 1VL5A 4ZWNA 1MFZA 1EVLA 4LBWA 2ZRHA 2H31A 4OQMA 4D46A 4HQLA 2CUKA 5I9NA 1I1OA 1QKIA 5DLPA 1G20E 3CCBA 4NBSA 1MORA 2JCSA 1YZTA 4LBYA 4BFZA 2EJWA 1SR8A 1ZMXA 1SH7A 1OI7A 4XWWA 3NIWA 3G79A 4UU7A 4B6QA 4PC6A 1NJ2A 4WBXC 3VOBA 1GCIA 3RT9A 1FDIA 4Q48A 1YONA 3D43A 3THXA 5KHLB 4NNPA 2EERA 2J6CA 1TXGA 4JLAA 1GITA 1YZVA 3H8WA 4KK3A 4TL9A 3U7FB 13PKA 3O4HA 2QHXA 3FSJX 4ZCPA 1SN7A 1UFOA 2PZFA 2YN4A 5K0SA 2GCOA 4G9GA 2UZAA 1T5HX 2ZPTX 4Q6WA 2GPNA 2C5BA 1N5OX 1XAIA 3ECCA 3PE3A 5GAJA 4DLTA 1JSCA 3AR2A 4YRAA 1LS6A 1U3UA 1W0JD 5GZ3A 3L4JA 1SU6A 4A2PA 4DZTA 1XTUA 1WB6A 2QENA 4REQA 1ESDA 1VYUA 2ARKA 1SBTA 2WJPA 1SBHA 5C8DA 5F2NA 5A3JA 4KN6A 1FFCA 2J4CA 5TX7A 4EGJA 4KOEC 5YASA 5LQAA 2D5IA 4GQIA 3F7NA 4X95A 1NQ5A 2Q2VA 3RT7A 2XMQA 3V3TA 1KIMA 3KYDB 3QG1A 2CNLA 4II2A 5CLHA 4A8PA 1T8WA 4N7JA 3S70A 1UMDA 3DEAA 2ZTLA 3KR9A 1KSJA 3Q7QA 4QDOA 4GX1A 4WJLA 1L0BA 1L8LA 2JKYA 2V0NA 3LWBA 3PQEA 4L50A 3OEEA 2RJ3A 4TS9A 3V1UA 1ACJA 3IHLA 4RTOA 4NY1A 3Q2IA 3U0VA 5BSHA 3MBKA 5D6NA 3B1ZA 2Z5LA 5JDCA 3H1PA 1KVUA 3MLEA 1QHSA 3GT4A 3HTXA 4MS4A 4IDNA 3I4CA 4F04A 4YMIA 3COPA 2REXB 2ZT6A 1CP2A 1YZKA 2A0UA 4M36A 5DZSA 1R0SA 3HXLA 2CLSA 4FDVA 3F73A 1A7JA 1O96B 2A3NA 3ELBA 4RLQA 4NYJQ 4A5SA 2VJMB 3G82C 3C5HA 3RYFA 3A1FA 1C9YA 1N3YA 4DV2B 2XD9A 3A06A 2HMVA 3HHPA 2ZS9A 3R3XA 3LRTA 5EOVA 1NXVA 2DULA 3RBVA 1PT7A 4CMEA 3TZHA 3PT9A 1G64A 3A4YA 3QKIA 3I4LA 2ZDHA 4OL0A 3S68A 2AYXA 1ODFA 4RGYA 5FNVA 3AVXA 2CJYA 3T54A 4OXNA 1IXYA 1OXTA 1VDZA 2HPAA 4D8UA 4DY6A 3T1HB 4XWGA 3ANTA 3HKDB 5IC5A 2DYKA 2WAAA 5BW5A 3TE6A 5JCJD 3DVQX 2CT8A 4L4XA 4BWFB 2PCLA 3NBMA 5IDWA 2PSHA 3N2KB 2UXCB 1FSSA 2ZU0C 1HG0A 5JSUA 4CLEA 4L8LA 2LUOA 1O8CA 3WY9A 2BC9A 3FAZA 5ES3A 1G16A 1C3OB 3AH8A 4MRSA 3DQQA 4BEJA 5H68A 1LZLA 4KAFA 4NDNE 3W5UA 5IJXA 5JANA 4DIKA 1E6LA 3Q1LA 2HF2A 3F6SA 4D4KA 1PUXA 4ECAA 1GGVA 4YJGB 1DQPA 5ALQA 3UNXA 4C2AA 2DFLA 5KX5A 3JU3A 4NE7A 3VMMA 1A9ZA 1V4BA 4Y1RA 4XD7D 1NKSA 4WXMA 2QMUA 2HDWA 4KV9A 3TLJA 1XZ8A 2WFZA 4LVOA 3CLVA 2GD2A 4U7WA 5A3VA 2ZUSA 1KYYA 1HDOA 4B40A 4JLKA 2OOKA 2G07A 3SC3A 2VH1A 3WGKA 4M7RA 4F6CA 1QR2A 1LPOA 5H70A 2EATA 2PXHA 1S2OA 5DYTA 3R6TA 3B6IA 4RF2A 4CEJA 2IE8A 3D7RA 5AVVA 2EX0A 2JFQA 3ZNOA 1I2DA 4GLBA 5KWIA 2IHYA 3ZS9A 4DLKA 2PX6A 3OCVA 4Q9IA 4F85A 4F5ZA 2AMFA 1X7DA 1I9CA 3ILHA 4GC5A 4QATA 1D5WA 1EU1A 1T1JA 1QYRA 3NVMB 1JLKA 4LI0A 1DWQA 1I5EA 2OYSA 1AZLA 2I33A 2I8CA 4TMZA 3U0BA 1L7PA 2V9PA 2D0OB 2W42A 3BQNB 3NT5A 1P7CA 4ARIA 1R15A 3CKMA 4M37A 3AF4A 3DDHA 4FGWA 4U63A 4P0QB 1ZQ1A 1RXSA 1X2EA 1BXGB 3TI9A 4WXPA 2ILVA 2PMKA 2DWQA 2HHJA 4BWVA 5C4IA 3H1TA 4OQ4A 1EK0A 2ZT8A 4BGDA 4M1YA 1UQTA 1IUOA 1LLCA 2PQ6A 4HDSA 4WERA 4I5FA 3BE5A 3B7WA 3BB1A 1B16A 3KXDA 1PRYA 1JHPA 2VF2A 3QVKA 1W5AA 3VUFA 3WLIA 1PJ2A 4UM5A 3SZOA 1NYQA 3I0ZA 3PJRA 3C6XA 3N53A 4M1SA 2FR0A 4P2GA 1E77A 5BW8A 3GDFA 2C4MA 4RORA 3EC1A 3GDGA 3PPVA 5EQTA 4LJ4A 1PQUA 4P3KA 3R77A 2VDNB 3KE8A 3SYRA 3CX6A 5TNXA 2V8BA 4MVXA 4UUQA 3KKOA 2P91A 5IASA 4Z1OA 1E9SA 3MJHA 2ONZA 2NSJA 3Q7IA 3U9TA 1E1DA 2VSQA 2QRKA 4BJ1A 2A0YA 5IM5A 5J58A 2FPKA 3G89A 3DVSX 2I4MA 3AI2A 2PS3A 3HKBA 4OP3A 5JYBA 5E8RA 3V1KA 3I6QA 5EJ6A 5KOHA 2IBTA 4ZVMA 1G41A 1JT9A 2SNIE 1DARA 3OWHA 4AX4A 1RWOA 3OFJA 1KTIA 4KVZA 2FX3A 2FFQA 2VJPA 4J4TA 2O5EA 1VRVA 3T3EA 2XXAB 3ZU3A 1UJ4A 3ONDA 3P2JA 5F4ZA 4UC0A 1RT9A 4ARCA 3ONNA 1MO3A 1TO1E 3QPCA 3HQ4O 1ZZEA 4H77A 4BWYA 1DQZA 4P5DA 2ZIZA 3WKDA 1NXWA 2DBZA 2PLFA 4W4TA 2LVBA 2GDJA 4FNOA 4Q34A 4RTRA 1QNLA 1I10A 1QG0A 2GAAA 2PIDA 4M89A 1ULSA 4ZT2A 1Z45A 2BTQA 5HIJA 1U0LA 1MB2A 4R9SA 1IXSB 1QR6A 2PNFA 1JIQA 4YK7A 3KWLA 2GMWA 2RAFA 4K1LA 3T1QA 4DHEA 2DHDA 2ZBEA 5EZQA 4KIJA 4N41A 1GNQA 4Y6LA 4BV3A 2C5LA 1WPXA 1HV8A 1ZVVA 2V4UA 1UJMA 4F45A 1V6SA 4UE6A 4OAOA 5BVGA 3FCEA 4IDCA 3LLSA 3RUEA 2EWMA 1JRLA 3EW7A 1EM8B 2X7JA 3ZQJA 4C4AA 1EGAA 1O5OA 1BJKA 1DI0A 1RFGE 2JGFA 3GRYA 3I5UA 3O90A 1DX4A 3QP9A 2JEYA 1T9DA 3ESYA 3CM0A 5CTJA 4YV0A 4ND6A 4N82A 2DPLA 2Q45A 3TE7A 3V32A 4XDZA 3THYB 1Z4MA 2ZYUX 2CDNA 4Z4HA 1XNRB 1G2OA 2C1EA 4BQFA 1D2EA 1ZL0A 1PJ8A 4H60A 1DIRA 3WKCA 2DLDA 1Y4AE 4G23A 4HNTA 2G5TA 4KAAA 2P9TA 2C2ZA 5KOIA 2EW8A 1ODTC 3D7KA 4LWZA 3OM1A 4QUIA 4WPGA 2WILA 3KBOA 3OE7A 2YVQA 4YJFA 5LZ8A 4IF6A 3T7KA 2PR2A 1IWPB 1I1NA 1IUPA 1JFTA 5AJWA 1BD4A 3F2VA 3AU8A 2OGZA 4UM8B 5AKGA 3AEQB 5C7IO 2REQA 1NSFA 1ZIPA 1VZ3A 1H4VB 4MW1A 2FFRA 4U3JB 1AKRA 5EI5A 1I2ZA 1MV5A 3C41J 4HHEA 4QL3A 4UAUA 3MPOA 3H6KA 2QVCA 1NFQA 4K9LA 1UUFA 1QZXA 2KBEA 2XRFA 4QODA 1QP4A 4Q0MA 4FOSA 4RZUA 5AUPB 1OXKB 1B0UA 4ROSA 3QOYA 3ISJA 5CRIA 3UJ8A 3WGYA 3CVUA 5ESDA 2QK4A 3IA7A 3NYIA 1DKUA 3GP3A 5DO9A 4BLRA 1OGIA 1C9KA 1T13A 2WE8A 2BEUA 1Q7TA 2PZEA 2WTXA 3K94A 1L5LA 4E5SA 1GKLA 3GMIA 1OPRA 3OOWA 2NTVA 3AUTA 5D3MB 2PQMA 3GLKA 2PSJA 4DMFA 1JT2A 1KIAA 1OJ7A 1PEYA 3A9SA 3LKVA 4IDDA 4I55B 4NENA 1G60A 3KPVA 1FFHA 4OHVA 1MVLA 3WLJA 1A71A 3CLHA 5A1JA 5J4KA 2V7UA 3V4PB 5BN5A 3GPCA 1SCAA 3I3SR 4QIHA 1BU8A 3EGDA 2CJXA 1ZD4A 4FIZA 3WLKX 3EVZA 2PG3A 1GOTA 2VUSA 4D26A 1VIYA 1YQQA 2GWHA 3TR5A 1VJ1A 2VSFA 4INZA 5EQDA 3RRFA 2FPWA 4WFKA 3RRZA 1Y4SA 1XZBA 2QR5A 5CFQA 3R0JA 1E1CA 1Q21A 4AJ9A 2I29A 1U5BA 3H3JA 3IAS1 4MB0A 4BPRA 1Y98A 1EINA 5DLEA 4R71A 3I62A 1OLSB 2I1VB 3SS7X 5EKXA 3U26A 3ZD8A 4YJ3F 1P4JA 3A6ZA 3ISTA 3O1HB 4OIMA 5B58T 3UMCA 2Q7XA 3WK6A 5BQXA 3L77A 4Z2AA 1D6SA 1G21E 5DNDA 2YV2A 3I61A 4BGEA 1ZN2A 2FEMA 5ALZA 1NURA 3GLVA 4ZARA 1BHSA 4CKCB 1H9CA 1LBHA 1TA0A 4G36A 4AZTA 4FE3A 1DSSG 1KGSA 5D6OA 5FPKA 2ZBQA 3E9DA 3SF8B 1W6RA 2H0RA 3IVCA 2YNMD 4BECA 3TQFA 3K4HA 1P6UA 2YHBA 4DR7B 3P32A 3VR6D 1PR9A 4JKYA 3TOXA 2GUGA 4EG5A 1JIXA 4F1JA 1QO9A 4NULA 1OREA 3A0RB 4WEOA 1RC8A 1O5TA 4BYMA 2O8DA 2IDKA 1Z5VA 1Y5IA 5TE9A 2N1BA 1Y7PA 2QXTA 3H5NA 4MB6A 4WADA 3FYDA 4ZQHA 2YXDA 2XNSA 3SFVA 2YNMC 4ZOEA 2A14A 2G9UA 2REBA 2V54A 2V5VA 3WKEA 1DQRA 3EBOA 2DCUA 2YV5A 4F38A 1Q12A 1V7ZA 2HRCA 5DM0A 1P31A 1R4MA 4CVNA 4J7UA 2NTJA 3K20A 3TUIC 3UPUA 4MQBA 2J8ZA 2OHOA 2C00A 3U3OA 1WXDA 2LIPA 4J90A 2X6RA 5FOVA 3WIBA 1B6RA 2O7VA 5FTMA 1A72A 5CD9A 2DUUA 2WLTA 2FMXA 1MJNA 1YQEA 1EAMA 1E59A 1O9HA 3ESRA 3Q4GA 4IKPA 1WZ2A 1I4WA 2IZOA 5J5AA 1ICEA 3U49A 1JHAA 3WQBA 3VO1A 1MQAA 2C2GA 2QPOA 4LNUA 1OGJA 5JOQA 4DA4A 3KR0A 2BSXA 2QD4A 4EPVA 3DYIA 4PSCA 2NOAA 1P5FA 1QHEA 4F3TA 2BHNA 4H3VA 1L5NA 1I0ZA 1QFZA 3RU2A 3IP3A 2J48A 1BDMA 1C81A 1KJ8A 1SCKA 1VMDA 1W0KA 1X2BA 3HXPA 4JEIA 4OQQA 1BVHA 3EEBA 1K5HA 1E3WB 1B93A 1YK0A 2FR1A 2GCIA 3D1LA 1W4CA 3G7NA 3G2JA 3L8CA 3Q3GE 3QXSA 4EEKA 3D8TA 1UAGA 4OVKA 1L8XA 2B25A 3W1VA 5TEVA 2QAGC 4R1SA 1GZ7A 3GJTA 4GR4A 1DTSA 3V4SA 3WYNA 4QGSA 5EKUA 1HY3A 2QS9A 3JPWA 4DNQA 5FQNA 3GFBA 1CQWA 5E6RB 3SQXA 4G67A 3KJXA 4ANFA 5KTKA 4OLBA 1P0QA 5IVKA 3ZZMA 1IY1A 4O2BF 3K2EA 2QQ5A 5E4FA 3DOJA 4OH7A 1R3UA 3QKRB 3CRZA 2R4UA 1KYIA 3KXIA 2PLRA 4PN3A 1KFEB 1UDXA 2GJKA 3GIDA 3M4ZA 4MW7A 4TLBA 4YDRA 3VGPA 5IH7A 5JMWA 3PHCA 4GPAA 5DPMA 4D8VA 4YMTA 3D6HA 2UZ0A 2D06A 3MC1A 1NTRA 2XQJA 3WIEA 1P5RA 1CHNA 1BXKA 2AHOA 2C4VA 3RS7A 1FP1D 3LM8A 5JYEA 2ODEA 1ZMTA 3G23A 3ZE0B 5JXGA 5KTOA 2WHRA 5F1OA 3L04A 2QA5A 4CDNA 4PFQA 1NSTA 2D59A 2YJGA 2Q8PA 5CT4A 2NU8B 4DA9A 4KH1A 2XNDA 1JWLA 2JLYA 1GRRA 4I8DA 4RQAA 5KHOC 5ECDA 4M0LA 3KQSA 3FTNA 4E21A 4RBNA 5HFNA 2ODTX 2YJNA 4DE5A 3WV5A 1F6DA 3W78A 3DKRA 1V1MA 5EMMA 4TSFA 2ZRMA 3AHDA 3NTQA 1IHXA 1TZKA 4LE2A 2QM3A 1OT3A 3VDMA 1JQDA 1Y4UA 4X00A 4RE5A 1TF5A 2RGAA 3PFNA 4RJLA 3EVNA 3TECE 1QZZA 5FBHA 1ZXBA 4I8XA 4IZIA 1QB7A 3L7BA 3T5AA 4AJJA 1BXRB 1J0DA 1JKJA 1CJTC 2JAPA 4FTWA 1DCTA 1KSGA 5CLLA 5B58C 2YICA 3HCAA 1IN4A 1U2GA 2FXIA 3HN2A 4U8HA 3S2SA 1I3KA 1T8PA 3GEDA 3TGWA 2BUCA 1IZYA 4GHWA 4B45A 3JWEA 4JASB 2XSZA 2B1GA 2I3BA 3ILXA 1XDDA 1YHYA 4Z86A 3RJMA 2XWBF 1UODA 2OKGA 3DTVB 5F21A 1B41A 3LBFA 2FQ1A 4L9AA 2J3HA 1Q7CA 1N8TA 5CCBA 3TI7A 1HF3A 2V3VA 2AEEA 1PG0A 4ZOLB 4MW4A 1Z6AA 3OCUA 3PUYA 4J3FA 2H17A 4JVSB 4LOKA 1Z25A 5DGTA 1O5IA 4ZAVA 5LWHA 1BMQA 4KGXA 5CB4A 3KQMA 4R9RA 4HQRA 4LOAA 1VSTA 4RK1A 3AHCA 5EIBD 4R0MA 3K6KA 4BP8A 3RSCA 5C8ZA 4K9OA 4MAFA 5FNVF 1BS2A 1ABBA 1DJLA 2VSXA 1E0KA 3B85A 4OXKA 3T06B 1I0IA 2O8BA 4M9QA 1R0YA 4S3MA 4Y1FA 1Y3DE 1OIWA 5DTMA 3M4XA 5KEIA 2YIVX 5BR7A 5BSUA 1E5TA 5DIFA 1JW9B 1UBOS 2FMHA 3KO8A 4E1VA 4I9HA 4EHBA 4A6PA 4JA0A 1H3NA 3VBCA 1T8TA 2IODA 2GO1A 3G0GA 1GQYA 5F7OA 3FFTA 4PQEA 4XYEA 1O6FA 1Q1NA 3RCBA 5FOSA 1N9KA 3BBPA 4XSGA 3BSWA 1RAGA 4GMFA 1IM2A 4ZAZA 3W7BA 2WC1A 3UC9A 5KX5F 2QN7A 3ZDEA 1SVOA 4C29A 4YCAA 2ZIUB 4CM9D 1DJQA 1EFCA 4RANA 1YZFA 4ZP1A 3IQDB 3ORSA 4CKWB 1F8UA 3ITDA 4DMHA 2F4NA 4JP3A 4NFSA 4RA9B 4UW9A 3ZCTA 2YKGA 1XDUA 4GBED 1MO6A 2PK3A 2IYEA 1WMFA 2V6FA 1NN0A 2JEZA 3E61A 4G1EB 1QMGA 1HX7A 1Z7YA 5CVJA 1W0CA 2AXEA 1ZK1A 3EIUA 4IFIA 3WHKA 2Q3HA 3OY7A 4D42A 3R1IA 1QO0A 1P9LA 4BNLA 2G3YA 2O2GA 2CK3D 4DJDC 3VJKA 4UZSA 2CXNA 5TGDA 4C7KA 5DCWA 1EXDA 1M1NB 3QFHA 5LYJA 2XZTA 2JKZA 3R8XA 3VNVA 1OBHA 1QV6A 3IELA 3NAZA 1P3Y1 2C97A 4QGFA 4AURA 1T0JB 1JJ7A 4I81A 1V5FA 3U44B 4I1PA 1SKUA 3V2IA 1OGYA 4K1XA 3BUSA 1JHZA 1B42A 2OECA 2QE7A 4W5TA 3JQ8B 1UKEA 1XTSA 3HVJA 2AE1A 4G1CA 1B0AA 4KFRA 4L5BA 3RVBA 5KYWB 1F14A 1OLUA 3NWEA 5B3LA 2DG2A 2XMDA 3W2TA 2CY0A 1TMKA 1GQQA 1EP3B 3DFMA 2XJ9A 4LGYA 3PX3A 5EWLB 1EXVA 2MCFA 2ZJ1A 4A1FA 4F2HA 3SYLA 3UA4A 2HRRA 3VA7A 4HQFA 4QXAA 3ZIAD 1OU0A 1KFBB 1TM2A 3NHRA 4PFKA 3VTKA 2DMRA 1NNI1 4WUVA 3BIXA 3R3VA 4MS3B 3LC2O 5DJ5A 3CVWA 3EODA 1NLYA 2C8JA 1G2PA 2J4DA 4GBGA 4B3HA 2GO7A 2B1JA 4FKBA 3VYUB 1UP7A 3WGZA 1JDVA 3SCZA 4GYWA 3WL5A 1SULA 1NBMD 3HABA 2TECE 4N8SA 2G7ZA 2B8NA 3ZLVA 1QH8B 1G3MA 4FFWA 3SY8A 3I9MA 2OXEA 4FZJA 5G0UA 3X1MA 5DVZA 2O3TA 3ZDQA 3LY9A 3T5CA 1YRHA 2OBFA 3G8AA 4JROA 5FI0B 2CEKA 1Z0KA 3L4KA 5ER9A 4X20A 4DLUA 3H3FA 3BE6A 5I3CA 3AJAA 5FPTA 5EPOA 4PCUA 1XZIA 4A0RA 4RIFA 4BO1A 3MTEA 2PL5A 4JYZA 1H8HD 2B4AA 1XIVA 4E5PA 3FNEA 3I9OA 4XVRA 3IAS6 1LK7A 3N1UA 2PH3A 4TRNA 2O23A 4ER5A 2X9NA 2YH2A 4ZMBA 4IVQA 2OV3A 1V26A 5K6AA 1NI5A 3GA0A 1AZWA 4JCOA 4NQZA 2K4MA 3MGKA 1JAZA 2BBOA 3V34A 1OYVA 4YEDA 3U3XA 2BD0A 2M32A 3TRHA 3V2HA 3N07A 1ZEJA 1A5SB 1ZXXA 5EFOA 3IALA 1Q0PA 1OYWA 1Z68A 2YOHA 1Y7IA 3LUHA 3IXLA 3G0CA 4MGKR 4DANA 3VKHA 3ESDA 2AUNA 1SEVA 3KEFA 2YHAA 4C07A 1G6Q1 4KE6A 2GESA 3ZWMA 4WJZA 3P5SA 1ZSVA 4JX9A 4IIFA 4JYCA 3COJA 4K3UA 1T5LA 4AKTA 1N2HA 1DC7A 2J3MA 4DAEA 1F2DA 1BFDA 1V25A 1QKKA 5DH9A 3UICA 1TUIA 2AYZA 2X4GA 5DF1A 3SLKA 4AY4A 3UFXA 3B1JA 2LPMA 1VLHA 1CLUA 5A4DA 1XRMA 1WJGA 1A5AB 1P1JA 1TQ8A 1OFUX 2JI7A 4HUJA 4O63O 4DQ0A 1SXJE 4YROA 1WSDA 3GDWA 1KY2A 3MLBA 521PA 1SCQA 1CEYA 4JUDX 1THMA 3W4IA 4M6WB 5C46F 3EC2A 3H7AA 4YR9A 2HUPA 3MWYW 5HIAA 3O3OB 4TV9A 3FCCA 1NF9A 4QPJC 4E5DA 4PFSA 3RAFC 3F78A 1OBCA 1Y1QA 3VPFA 4LDJA 4E94A 3EE6A 1KS9A 3QRWA 3ZCXA 4BNNA 1EE9A 1SUPA 3B5JA 1P3JA 4KYVA 1V41E 2BJVA 2QJOA 1LSJA 1TTHA 4KODA 3B9PA 1P8AA 1VGQA 4FKZA 4AMZA 3D2BA 3VPDA 1S9DA 3ETJA 3IILA 4JJGA 2X0FA 3EGEA 1FMCA 3MYRA 1K3UB 4B74A 5A3RA 9ATCA 4LJRA 5EZYB 1SBQA 2X3YA 3SC2B 3IPLA 3LVRE 4QG7A 4BKUA 5JBQA 2RGYA 1R6TA 2DBVO 2MSCB 3OJOA 5SYAA 4ESVA 4RLSA 1NJSA 3U1TA 3E81A 5FUMA 4DCSA 2IEYA 1K66A 3AUKA 4X1KB 1RBYA 3W6ZA 4BIIA 5E1BA 1HORA 1D8TA 4I19A 3RUFA 3CGGA 3U3MA 5ILQA 4KSCA 3UPDA 3BMQB 3K05A 2YVKA 3WLTA 4E2WA 4Y9RA 2D5LA 1YU9A 2O07A 1WP9A 4PNHA 1Y81A 1MP0A 1J90A 3IOEA 3Q1KA 4BQSA 3ZDBA 1IEWA 1SURA 4CCYA 1YIDA 2AJ8A 3MK31 3NWOA 2P7HA 5EEHA 3A2NA 1PSWA 3ANSA 3JWJA 3KCQA 5HJ2A 1QONA 3FIJA 1GQOA 3RS2A 5B6JA 5CEEA 4FBMA 4BXOB 3E9EA 3OSZA 5DU2A 3VYTB 5C81A 1YBHA 5L51A 2IXEA 1U0RA 2ZAOA 3ZC3A 4CMBA 3T0IA 1G6KA 4MQLA 3KSUA 2YY6A 4Y6OA 1OOEA 1T43A 1DQSA 3ME5A 4RJKA 1O6GA 2OHVA 3UH0A 2C2YA 2ROQA 1I9GA 3COWA 4OSEA 3F1LA 3BYZA 1M6VB 1JLRA 3O2NA 4FR5A 3GJXC 3U09A 1E9BA 1T1SA 2EDCA 2V65A 1KKLA 3UXYA 4WVFA 3GQVA 4FQ8A 4KBGA 4MMXB 1HK7A 1E79D 1CUZA 1JIUA 2YJTD 1BDHA 4HDQB 1TEVA 4HN2A 1QCZA 1QH1B 3PFHA 4UMVA 2I78A 5KVSA 3GHHA 1J0XO 1PL0A 3PFFA 4TKMA 4J1TA 4DV6B 4HUQA 5BUCA 4HPWA 4YT2A 4Z7QB 3NBZC 2CMHA 1WR8A 3IBYA 4XUGB 4L3WA 4LVCA 4HWTA 3NX4A 3SDZA 3LBNA 1J33A 1VIDA 2AHRA 2GN8A 2JGKA 3VSEA 5REQB 4O29A 2AMVA 2EFHB 4OQFA 2WIKA 1PW7A 5K3FA 5KBYA 3IB6A 3IE0A 3LBIA 3QA3E 3TW6A 1FX0B 3NAMA 4LSWA 4LYYA 1OH6A 3ZXYA 5FOUA 1RW4A 3W2FA 2IXTA 2EL7A 3FNHA 2IT1A 5ECWA 5FJJA 4NX2A 3ZHOA 1L5YA 1EK5A 1WSBA 3RUIA 6Q21A 4YHHB 1UBKS 4OFZA 2PV0A 4C4SA 2B7LA 1QIFA 2O2CA 3O9VA 4RM2A 2JCVA 2JLCA 4CMIB 5IKEA 3T3OA 4L4RA 3EFOA 4B9AA 4NS4A 4D9BA 4O4LB 7ABPA 1W49A 4WOBA 3BJRA 3BB4A 1RM0A 1DG3A 1Z73A 3JTEA 4UATA 4DZZA 5JV5A 5GMOA 3H97A 1M8GA 4FJ1A 4HVTA 2NUPB 2OHXA 3H2SA 4OY3A 4PC1A 4Q5IA 3OZVA 4KHPB 1LQ2A 2R1TB 4UVHA 1BJRE 2WD7A 2ZRLA 1FLNA 3B6KA 5J2UB 3G0IA 4B47A 4F9TA 3G88A 1K8RA 3N2ZB 4LBVA 1AKMA 3RAJA 1XYVA 1R3DA 1ZIDA 2COEA 1UC4B 2NUTB 3HMKA 3I9V1 2CJWA 1JSRA 2Y4NA 4NZPA 3KU4A 1PJRA 2F1KA 3SHVA 3ZGZA 3NBKA 5FDFA 1WM1A 1KK0A 4LDAA 4QOSA 1GAQA 1WCWA 4EL5A 2OK8A 1MOPA 3QEJA 4PX3A 4FWIB 1BSVA 2GA8A 3DMTC 3FCOA 3K0KA 1STOA 3EA4A 3JR7A 1SWWA 1R0XA 3UJBA 4KDRA 4YRDA 5CCEA 2CNKA 3HBAA 3KV3O 1KSFX 1L5RA 3FTCA 2Q0QA 4BZWA 1W1WA 5IN4A 3SM3A 5FPQA 3MXTA 2R6GA 2GN1A 1QQTA 2R7AA 3DB2A 4D4GA 1M2JA 3MAAC 1BXZA 1O94D 4ADSG 1T25A 2OVFA 3OPYA 3A6HA 2WKRA 4IP0A 2B6HA 4B4DA 1HT3A 4ZZ1A 5EMJA 2AR7A 2BR4A 1PJSA 2X0NA 1K5PA 2ST1A 2X8LA 1F9EA 1U8FO 2IYAA 2QLJA 4ZK2A 2NADA 2W71A 1N0WA 2ZSAA 3AM4A 4TXHA 4FC7A 3WKBA 2JGDB 2HRBA 3HBFA 3HJGA 3VHXA 1CIPA 1ORVA 1TU3A 1EP1B 1NP7A 3DL4A 2AR0A 1X13A 4S0ZA 821PA 4JBXA 4RSHA 3EASA 3JALB 1AQUA 2CMDA 1PQPA 4R05A 2ZITA 5FLEX 4BNIA 1SUAA 2R1VA 4RXMA 5BWOA 4J0EA 4I08A 1D2NA 1ZM7A 4N0PA 1RWQA 4DQDA 3U4MA 5G0TA 3ZOZA 3TF5A 3NHKA 1XZJA 5A05A 4MAMA 1NBIA 2IXDA 3OX4A 4UFPA 4UEOA 1NTOA 4IIJF 1NRXA 4RE6A 4YRZA 5I4BA 3L7MA 1KQFA 4WCFC 4FONA 1SUEA 4XJTA 4EA6A 5F1KA 2DTDA 1PD1A 3T95A 4F06A 2CL7X 5BUSA 2CGEA 5FAKA 4ZEVA 4DA6A 1W25A 3FTQA 4Z0NA 3RGWS 1TJ3A 4HCJA 5M04A 1R10A 3I2HA 1QG4A 4GKJB 3NJRA 3UK7A 3G9ZA 2WHPB 2WPNA 5LPNA 1ENZA 2GM9A 3LE8A 2I2CA 4HRAA 3KTFA 3KXPA 4N3AA 1IN7A 1D07A 3QMVA 4ZO6A 3E3AA 5IDVA 2JJQA 2FW8A 3OOJA 4GOMD 5DGDA 3EUAA 3K9WA 2XOKA 3I92A 1GSAA 1YO6A 5DHFA 3WZLA 2O3UA 2AZDA 3D3KA 1OILA 1ZUHA 1A8PA 4MROA 3ZIDA 2M6KA 5AWFC 4X7BA 2R7MA 5EN4A 3I1FA 1YV9A 1X3SA 2PWAA 1V5IA 4OQNA 4RF3A 3CLSC 3L5KA 3TSWA 1Q1EA 2AN5A 1QDLB 2FN4A 5I8WA 2ONCA 4OXRA 5CB4F 4A36A 1QGAA 2J7PD 4UU0A 1J07A 4A8JC 3VR2D 5I51A 1RXUA 1NBME 1LDYA 1YE5A 5A4KA 1ZUIA 1KOLA 3QE4A 4EYGA 2AQ8A 2PKXA 2HB6A 3E35A 1Y1RA 4U0JA 1NJ6A 4FNMA 4DADA 1H2FA 4GQAA 3OF5A 1JWBB 1CB0A 1K7SN 3DFZA 4MK4A 2WJIA 2Z5GA 4RCVA 1FJGB 3BGIA 3DVAB 4JI1B 1SC4A 2JJ2D 1KEUA 4R1OA 1YBAA 4F2WA 3BRWA 2F3PA 3ZKWA 2ASVA 4KR3A 3GFOA 4L22A 4RTQA 5LQKA 1VKNA 2XUDA 1VE5A 2HNKA 3Q6NA 4HGZA 3F46A 1Z39A 1PV1A 5CA0B 3CEJA 1KQNA 2OGUA 2BISA 4ZT5A 4D8YA 1CJMA 4HWOA 3G6KA 3ET4A 3V46A 4AKGA 2JFVA 4NU0A 5KTTA 4EUHA 3UWKA 1K0FA 1WHSA 1WKCA 5LCXA 2R66A 4C6RA 1B23P 3U7IA 3PC8A 3TTWA 5T67A 5T7BA 2ZJ5A 3HZZA 4P08A 1VPLA 4GOLD 5C8XA 1V8PA 2F8LA 2FG6C 1F1JA 3INNA 4WBSA 3C3XA 3OQNA 3PDJA 4ZOBA 4YACA 3UUGA 3IL2A 1SBIA 5FL7D 3FFXA 4Q93A 3NTUA 1XTPA 3V6LA 1BNCA 3NVAA 3DKVA 4TL7A 2ATIA 2OAEA 2PE5A 4AJ2A 3UUEA 5IX8A 2DPHA 5C35A 4H7EA 1R4ZA 2Q4TA 3WBBA 1PDOA 4QBHA 2W48A 1AA9A 1DC6A 5JHGB 4GVXA 4YAOA 3TZCA 5LYJF 3ZW7A 1KA9H 3S29A 1N3IA 3ZKAA 2QUBA 3UJHA 4HSEA 1AK2A 2XUGA 3ZLTA 3C4QA 1NPDA 1JG6A 2K7ZA 2WU1A 4RK5A 4PV7A 5BOSA 4R2LA 1FTSA 4DIBA 3KKQA 1R64A 2E49A 2WZBA 5J1TB 4Z4EA 1RJFA 3E15A 1AKVA 1L1EA 1PR2A 2O7NA 1T3ZA 1E6MA 2DETA 5T4EA 1Z4JA 1WCXA 2XB6A 3QKWA 1OLXB 1JXMA 1S96A 1XZKA 2NZ2A 2XQIA 2LTAA 4G5OA 2AB0A 2J5KA 4D80A 5HTOA 2QMHA 2EFJA 3I5XA 3P9ZA 1SG0A 4PLVA 1ODIA 2WUDA 2CNWD 4B5LA 4GU5A 2AL7A 4QEKA 5IZ4A 1XBTA 1YR2A 2HIGA 3SMQA 3DR3A 4TSRA 1TAUA 5CXXA 3EUWA 1KAEA 3HWX1 3MJRA 2BGIA 3ZI7A 1GG8A 2QIOA 3OQIA 1C1DA 3S55A 4B43A 4N39A 2P0AA 4GBMA 5CG2A 4WNAA 4TMWA 3PB3A 2R5FA 3QW4B 4DVGA 4GOND 4JLPA 3QMPA 5JPIA 1JEAA 1E61A 4TKVA 3MRSA 3SXJA 4NXNB 3FGZA 1UXGA 4ICIA 2BHTA 3PXGA 1PSZA 2JI8A 2WHYA 3L4BA 5EIEA 1APBA 3FMPB 2HWXA 4F6RA 3OIWA 5AJYA 1G19A 5G1NA 3R74A 2UXDB 1ZK2A 2FHSA 4RD2A 4K3VA 3OOEA 4X85A 3WLHA 2ZJOA 3ZHTA 1XF1A 3EHDA 4P3XA 4J91A 3TTTA 5DN6D 5KYGA 1QYCA 1SO8A 2X5KO 2WOOA 4DREA 4JI5B 4YXWD 4H6WA 1PI3A 1T8YA 1XJ0A 2B82A 3C87A 4F3KA 5F5NA 1MIOB 2ZQYA 1SXIA 3IQZA 1QF6A 4AZSA 3WMWA 2VBGA 3SZMA 3AR3A 1CDEA 3LPAA 2HO4A 3M1AA 4I5IA 1J5XA 3TD9A 1CG6A 1HDIA 1VJRA 2PRYA 2ZWIA 3NP7A 1NVMB 2O20A 4G97A 5EWJA 1HBJA 3RIHA 4ESHA 4EGAA 3RJZA 1C3XA 1QRTA 1XVVA 4TT3D 3V1NA 1R0ZA 1Y6JA 2HLNA 4B17A 2HJ9A 4GL2A 2YCBA 2CKDA 3ZDRA 3AWDA 3UJ6A 4RZIA 1ZNYA 3IKLA 3JARB 2ENUA 2X1LA 4PTLA 1G8AA 1GFIA 1GXSA 4DLVA 2EC5A 4PFJA 4HY3A 1C4OA 3NOOA 3ZE6A 4CQLB 2XCUA 2SCUB 1PGJA 3MBIA 3EH2A 1FYWA 3DM9B 3GEHA 4HLNA 3R7WA 1QM5A 1YC2A 5DISB 5T4FA 4E32A 3BJIC 5EHNA 5TQ0B 5COAA 3CFYA 3HCNA 2PX5A 4N3CA 5FUYA 1WCYA 2RI6A 1EQAA 3C1AA 4OJNA 1MTZA 2G09A 3CR7A 3SICE 4KE8A 2CVHA 4TV9F 4XUCA 3KB1A 1V45E 3GD5A 4PS1A 3SAJA 5DCLA 3JAKA 3MJFA 4N54A 5HQ3B 1G7TA 3QJYA 4DV7B 4OMUA 3KNZA 2EJUA 2FFBA 2OSVA 3IQHX 3O0TA 5BN3A 5BWNA 1C7RA 4R0NA 3AJDA 3EUEA 5DI3B 2JC3A 2XJ4A 4DWJA 3B2EA 3HVKA 2A9FA 3H05A 4EVSA 3I9V6 2QRQA 5AUQA 5AOAA 4P7FA 5K01A 3WC4A 1IWBB 3A6PC 4HB4A 5KNCH 3NH6A 1KERA 1LB1B 5JD6A 1U1DA 4OJMX 1GUDA 1RIFA 1TB4A 1ZOLA 1HE3A 4UXJA 5EA2A 4BZPA 3WGUA 3WVNA 3B38A 3LTEA 3SXUB 3WL6A 4EIWA 2GPSA 2WU4A 1BRMA 5EHGA 4NCHA 4OHYA 1UPTA 4NMWA 5JNSA 3K1JA 4Z99A 3S2EA 1PNRA 4HDRA 1J2EA 2Q3LA 1VBFA 2PS0A 4C6TB 3C7DB 3GCGA 1IBKB 1I6WA 1K6IA 1TF7A 2RK4A 5BNFA 1XEWX 4C76A 3OOSA 2BFCB 2CMFA 2H1WA 2WV9A 4B84A 5I5GA 4NLLA 1ZRMA 1RYFA 4B3MB 2N47A 1DUVG 3C6KA 4WWHA 2CNNA 4HTAA 5AJXA 2LCFA 2VJKA 3PQ2A 2IEBA 1I3NA 5LP6A 3OQOA 3PYXA 5DBHX 1SJ9A 3WXBA 4CKEB 1PUIA 1TFRA 2ONJA 4YJ3B 3SSOA 3L1VA 1QDEA 1Q2XA 3MCTA 2FG7C 5DCUA 4BRWA 2R7NA 2XMGA 3S2FA 2OV4A 4BAGA 1GARA 2F1IA 5HX7A 1E2KA 4ZZ3A 1F4VA 1FNMA 2CLHB 3KYIB 3NVDA 3T5DA 3LUKA 4ZOCA 3WQQA 2Z9BA 2I3GA 2XA9A 3QIAA 2EXXA 5CFMA 5CVTA 1R6BX 4QXOA 1R5JA 3LYUA 1RRFA 1SU4A 3AXSA 4M7WA 3AL3A 1US8A 4OGFA 3FPLA 1BRTA 4ZC1A 5GONF 4BQOA 2ERCA 3HG7A 4MUMA 3VNSA 5E3HA 4UM9B 4OQDA 3A4MA 4UTRA 2C04A 5BN1A 2DR0A 1P1CA 3ZGLA 2C7BA 3QF4A 4X91A 1QVVA 2G83A 3AESA 3F1KA 5CEFA 5FT9A 2JJ1A 4EI8A 2DWUA 2X41A 1PFUA 3VPBA 3I2JA 1A9YA 4ND7A 2RD2A 2ZFUA 4KUGA 5HM6A 4YMWA 1G8HA 2F00A 2JANA 4Y2VA 2Y93A 5EYPB 4BQQA 2H65A 2DWOA 3FSGD 3HDYA 4WK4B 2P9CA 5K4AA 4JUIA 5TPZD 1EFAA 1Z4KA 2ZB2A 5H4GA 1UT8A 3JZMA 3K0EA 4F4IA 4Q02A 1GL6A 5B57C 4RJJA 3TX6A 1FC0A 3OT4A 3RADC 2C7QA 2X1HA 3DH0A 4K6FA 4UCWA 3W8FA 3LX8A 4C89A 2GM3A 3L8GA 2CDCA 1BMFA 1RZ3A 5FTNA 4MWSA 4CPDA 3WAJA 1TU4A 2GOYA 1RLJA 4RV4A 3L7KA 5I7RA 1ICIA 5TY0A 1IVNA 1LZKA 3GAZA 1HOTA 2WJGA 3H42B 3BL5A 3GAMA 3FLAA 4N12A 2IU3A 4HQKA 4DCGA 1JH8A 4K9MA 1N2JA 1CQXA 1JLHA 1RPTA 4Y6GB 2R8PA 1JF8A 3QVTA 2E7ZA 5K3EA 1S01A 4IHKA 4D6YA 2VEDA 1V11A 1UBMS 1Q0ZA 3RDPA 2IHUA 4BNGA 5KYUA 2JFOA 4JVNA 4CM1A 3D7SA 4CMGA 4L8YA 1T9HA 2WJVA 3I1JA 4QAQA 1O0SA 2BEWB 4MR9B 4A8HA 5F9HA 1MJ5A 1XRPA 5IK2D 1Z16A 1DCKA 3NONA 2H63A 2A1IA 3O7MA 1KJQA 2VXYA 3JQAA 2P65A 3LPMA 3VR0A 3ZCUA 5IDYA 5K3DA 5A5VA 4UASA 2YMMA 3LP6A 2Z04A 5IDXA 1MZVA 1PGNA 3NB0A 5KOYA 3U6KA 3FRJA 4O2BB 2B35A 2HV9A 3HJHA 3NGXA 4HWPA 1GKIA 3G9TA 4ALNA 3P0IA 4UTPA 2VK1A 2JA2A 1RWPA 2VFAA 2AJBA 3FNQA 1L4EA 2QLBA 2ZUVA 4ABYA 5JY1A 5TDHA 4C4RA 2EQBA 2ZRBA 2NZJA