1E6WA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
251
Chain Sequence
SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
total genus 87
structure length 251
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e6wA00
1ZK1A 4OXYA 4BKOA 1YXMA 1T2EA 2NQTA 4QTZA 4XQCA 4E21A 1IL0A 2RH8A 4B3HA 3PJDA 1YGYA 2P2SA 4ZD6A 3QRWA 4DYDA 4O0LA 4BO5A 3JQAA 1ZSYA 4CLOB 4F6LA 5IZCA 1QRRA 5KNLA 2YHIB 3SX2A 5JW6A 1HKUA 3PFWO 3ZH2A 4MO2A 1OBFO 3KV3O 1P1RA 4RPGA 4FS3A 4J9VA 1ISMA 1T4BA 2JCVA 4YAKA 4OYRA 4DYVA 2VT2A 3RI3A 5KIAA 3Q11A 4YT8A 3AM5A 1O89A 4YRBA 4GSKA 1QV7A 4K26A 4DBZA 4DMMA 3QVXA 2Q1SA 1M6HA 1CJCA 1YJQA 3I9JA 1LTHR 3PIDA 3HQ4O 3I9LA 3DO5A 1F0YA 1R12A 2X0NA 4JCOA 4Z6KA 5HWSA 4N18A 5JAZA 1B0AA 1U5AA 5JAQA 5KKCA 3WSWA 3O4RA 4P4NA 1B3RA 1HDOA 5JLAA 1HE5A 4PLGA 3P2OA 4ND1A 2QYTA 3HUDA 4QSMA 5TF4A 1E77A 1NVMB 2ZCVA 1Z7EA 1Z7BA 1K2WA 2PH5A 4FQ8A 4IZHA 4J1SA 8LDHA 4AJ2A 2C29D 1MLDA 3PQDA 1LI4A 2I99A 4PRLA 1GUZA 1U7TA 4R54A 5BNFA 4W7IA 1P1FA 4EUFA 4WEQA 2OMEA 4NG5A 1DAOA 1LRJA 1P74A 3I1JA 3GQVA 4BVAA 3D4NA 3GDGA 4XQGA 3S2FA 1E3IA 1DRUA 2YW9A 3BHMA 4A2CA 3TFOA 1T26A 2B5VA 3EY4A 5MGBA 2D5CA 3BMCB 1RKXA 4F45A 4XGKA 3ONDA 2CNBA 2FP4A 2OUIA 5GMOA 3MCVA 3H2ZA 3I3OA 4KWHA 4E5KA 1BDBA 1IZ9A 4R01A 3U49A 3FBGA 1VL0A 3CINA 1WAMA 1E1KA 3HHPA 1Q0HA 1H2BA 2VUSA 1Y5RA 2Y0EA 3UAGA 2GN6A 3D3WB 4YQYA 1SCUA 2NM0A 3KVOA 4CM9A 3PHHA 4FFRA 2ZYDA 1DJQA 4JP3A 5JE8A 5BSFA 1NM5A 3ITDA 5H81A 3H3JA 4I9HA 4MVJA 5AXCA 1U3VA 4XYGA 4L4SA 4J43A 3W4JA 5C7LO 1A9ZA 3RAJA 3PTZA 5L53A 4BL5A 2PD3A 3GMDA 1IPEA 4GQAA 3O38A 3VHRA 2PR2A 2Q99A 3UH1A 3NDIA 3ZHBA 4CLXA 3QWIA 1ADBA 4YA6A 4RQTA 3Q3CA 3GVXA 4LRTB 4ND2A 5DBFA 5U4QA 3ZWAA 1QR6A 2PTGA 1NHWA 2QZ9A 3KHUA 1C1DB 3I5MA 2GDZA 3HG7A 4FPXA 2YYYA 4GMGA 2FRDA 3K96A 4QX6A 2C5AA 3QQPA 3FF4A 2X22A 4UREA 2DPGA 3MJCA 3W8EA 3JQCA 3E1KA 3SC6A 3GMSA 4GWGA 1YL7A 4BNNA 3RFTA 3LT2A 5DNAA 3HB5X 3VPSA 3ETDA 2GGSA 1QV6A 1K3TA 5CEJA 4CLRB 4L9RA 2BGMA 1GV1A 4I9UA 4YJGA 1T4DA 2C82A 3OEYA 5BNIA 3KEQA 5I7SA 3VAZA 3E5RA 1MA0A 4BIIA 2QHXA 1GYPA 2JD1A 1TB4A 2AQHA 3KTDA 2V65A 3AI2A 5BR7A 4MVJI 1E1NA 4W7HA 4XD2A 4CLHA 4E2ZA 4YBZA 5B12A 4CMIA 1ZJZA 3VH2A 3OF2A 1UUFA 2AG8A 2X86A 1EQ2A 1AUPA 4QUKA 1UZLA 3AU8A 4R68A 4NU5A 4ZU3A 4XJSA 2GRAA 1HE2A 3L07A 2YZ7A 1ONPA 1MC5A 1K5HA 4Y6PA 3DOJA 3TFQA 4BNTA 4I1IA 3AM3A 4MKZA 1BTOA 3QE3A 1T25A 4GSLA 4LK3A 3KEOA 4DQVA 4FJ2A 3UW3A 4CMKA 1KEUA 3VH3A 4CMBA 2FN7A 1NFQA 2Y66A 2HRBA 4N54A 1RYDA 3E9MA 4IJUA 4DIFA 2VN8A 1ZO8A 3QIVA 3KZVA 3KO8A 3BMOB 5I9NA 1U7HA 1YWGO 2DBVO 1GYRA 3WB9A 3U09A 3JQ9C 3UHAA 1XLTA 4WCFB 1DIRA 3IP3A 3LF2A 3ZWWA 1NHGA 2WEKA 2Q1TA 3U4IA 4D41A 4EJ6A 2W8ZA 1LA2A 5GY7A 1I2ZA 2CF5A 3NT5A 4E6PA 1JN0A 3RBVA 4D3DA 1HDGO 3ZW8A 3OQ1A 1DRVA 5AVOA 1WMAA 3C24A 4FFNA 1DHRA 5LC1A 5DP1A 4UUMA 2VHWA 5AQ1A 5BSEA 2C20A 4DC0A 1PEDA 2WD7A 3KLMX 1CQJA 3ZW9A 3QA9A 2JL1A 3GH3A 2IEDA 1LLUA 1U3WA 4XQEA 1UP6A 2E37A 4GGOA 4J6FA 4ND3A 4TRJA 4OOEA 1ONOA 1SZJG 2DUUA 4N5LA 3O26A 4CMEA 2JFGA 1LSUA 1YL5A 5KOIA 2CDAA 1NTOA 2DPHA 3GR6A 2HJRA 2PFGA 1JAYA 4RVUA 3PZBA 3IOYA 1DOHA 2X5OA 1E5LA 1ZXLA 4WEOA 4B8ZA 5A3VA 3U62A 1OC4A 2EGGA 2CVOA 1MXHA 2WYUA 2RHRA 5CFZA 1P44A 2PGLA 4E2YA 1VSVA 5COBA 1UDCA 2ZCUA 3D4PA 4DQUA 4E5NA 3V5NA 4J4HA 2AEJA 4IGEA 2X5KO 1J49A 1NR7A 4P22A 1YQDA 1Q1NA 3ANLA 3VPHA 8ADHA 1D1SA 4CQMD 1BHSA 3SJ7A 4R1TA 1UDAA 1V3VA 2DM6A 3JQ7B 4RZHA 1PZEA 2VNAA 2X9VA 3A28A 4IJKA 4TKMA 3WQRA 4DQXA 3PP8A 1XU9A 4HFMA 3OECA 4NPCA 5JAMA 1N5DA 2I3AA 4J1QA 5TJ9A 2OORA 1HL3A 1TEHA 4E12A 3NRCA 3GC6A 3MZ0A 3QW2A 4P38A 2NVUA 3D64A 2B69A 4JX8A 3AM4A 2XXJA 3HWRA 5F1PA 2HMTA 1HDZA 3C3XA 4CQLB 4W4TA 5CG1A 3FI9A 4GAEA 4A0SA 3KYCB 4YJFA 3WQSB 4ZICA 1DEHA 1J4AA 2HO5A 3IUSA 1GUYA 2VTEA 3OMLA 4II2A 2PLAA 4DIBA 1GCUA 3ZWPA 3B1KA 4G65A 4DMLA 3VDRA 2YUTA 3KSZO 4ILKA 5G0UA 3M2TA 1G1AA 4Q3NA 3DAPA 3ORFA 3GT0A 4C4OA 3ZNPA 3JQ8B 4M55A 1H93A 4JP2A 4BMVA 3H3FA 3GVPA 4ZQFA 3DZBA 2O3TA 3PQEA 3VZPA 3WGYA 3EC7A 1W0CA 4JROA 4GVXA 1A72A 1RJWA 2IZZA 3GLQA 2FPGA 1ZSVA 3DR3A 1VLLA 3W8DA 3ADPA 5LCXA 3DZHA 5ICMA 1NXQA 5T67A 1R0SA 4WLNA 3TNLA 4LSMA 2AMFA 4LISA 2Q49A 1W4ZA 2CVQA 1ZK0A 1R6DA 1QMGA 3LK7A 1LLCA 3FTNA 4AJPA 4BNLA 1UP7A 1UXGA 2O48X 1U1IA 3EMKA 2EXXA 2F1KA 4RLHA 2HLPA 1P77A 3RIHA 3OJLA 1ORRA 3ADOA 4GX0A 4OL9A 2X0IA 1I2BA 2A94A 1H9AA 5G2OA 4JXKA 3DQPA 5K9ZA 1Z6ZA 1PGPA 3RKUA 1ENYA 4DREA 3D1LA 4OIMA 1V8BA 2NTNA 3AUTA 3RQSA 4CLEA 3KOUA 1Z75A 3JQDA 4E5YA 4P4GA 3RKRA 3CMMA 1PGNA 1RYEA 5KVQA 3UICA 2B4RO 2BFPA 2Y0DA 1OMOA 2V6MA 4BKPA 2ZQYA 4YCAA 1P1JA 3GVCA 1VSUA 1W8DA 3ITKA 3WYEA 3QWBA 2GO1A 4YYZA 1PJCA 4XYLA 1K6XA 9LDTA 1PQWA 5AXAA 1JDJA 2PY6A 1HYHA 2DTXA 2ZTVA 1BRMA 2PGDA 2X0JA 2FY8A 3C7AA 4MPDA 4ZVVA 1DPGA 3UXYA 2PD4A 3CZRA 4OMUA 2OHXA 4XDYA 1YBMA 5ENDA 2Y1GA 1IE3A 4WLEA 2FSVA 2GR9A 4G81A 3RC9A 1TLTA 1HDYA 3DFUA 4EDFA 1EVIA 1XYGA 3AY6A 1Q0QA 3JQBC 5TIIA 3ZV5A 1PZGA 1ZW1A 2GSDA 3ZCXA 3G17A 4D45A 5JFOA 1T2DA 1Z73A 2PK3A 4FDAA 3NEPX 5TJHA 3WNVA 4LSWA 2JCXA 1DO8A 3ZWOA 1SEPA 3QVSA 2J3HA 3RUAA 4PRKA 1Y1PA 3R3SA 4M87A 4IIVA 5KTKA 1TT7A 2YHUA 4QEDA 2JHFA 1ULSA 4MIOA 3HNPA 3ZNNA 2OBNA 4HY3A 3TQHA 1FXSA 2BGLA 4TWRA 3WS7A 3DEYX 2WE8A 2R00A 4U8GA 2HU2A 4A7PA 3PRJA 1Q7BA 4HADA 3OA0A 1DFIA 4HP8A 4M86A 2PA3A 4R9RA 3PQFA 1PQUA 4FJ1A 4M8SA 3AUUA 4YJHB 5DF1A 1Y8RA 4A27A 1HYEA 3QVWA 1A9YA 1BWSA 4QQRA 3V2HA 3WBFA 2V6BA 4WGGA 1IPFA 3MTJA 5IDXA 3VOSA 3TL2A 1GU7A 2NADA 1AE1A 1JKFA 3PLRA 4GLLA 3WGQA 4BKUA 3GUYA 3F1KA 3BTUA 4NIMA 5LDGA 2YFHA 4ND4A 5JDCA 2BF7A 3IJPA 3FWZA 4PLYA 1YE3A 3RBZA 4MVJH 3S8MA 2VUUA 5ITVA 3RUCA 3JD4A 3GHYA 2NWQA 1GADO 2NNLD 4ZA2A 3AFNA 5TC4A 1FK8A 3F6YA 3OJFA 3B1JA 3PIIA 4XZ3A 2BHLA 4XKJA 5ENVA 4QFDA 3I83A 3T4XA 2CUKA 4MVJF 4UVIA 3WJAA 4PG7A 4P4LA 5G4KA 4RORA 2I5PO 4XGIA 4XR4A 4N5MA 1IHYA 4Y8VA 1KVQA 2VWGA 2IXAA 3PEFA 4W9NC 1DC4A 3WDSA 1IZ0A 3RJ9A 3WGOA 4FOOA 3ASVA 2CDCA 4FIZA 1Y8QA 1YB5A 2OL4A 2VCYA 3BMQA 4ESOA 3RSHA 3ZZNA 2UDPA 1GTMA 4ZGWA 3O03A 3AOEA 3MWEB 4BO0A 2G17A 5A5FA 4A10A 4Y67A 4D43A 4IY1A 3RCBA 4BQRA 4RQUA 1CIVA 1LSSA 2XOXA 4L4RA 3DXFA 4ZQHA 4CR6A 3C7CB 3HE3A 4MIEA 4PVCA 5L7TA 1P0FA 1IY8A 4GI2A 1GQQA 3GG9A 1ZEJA 2P9GA 2AEFA 2VZ9A 3DHEA 5BT9A 4Z3KA 4MKRA 3FWNA 1ZKMA 1DBVO 4H7PA 3ROPA 3K30A 1I3NA 3HDYA 3N7UA 4PLCA 3WG9A 3L6DA 2LDBA 3VDQA 1ZSNA 3IKVA 4WE3A 1RM0A 3WFJA 1DFHA 1NNUA 3GAFA 1PGJA 2BKAA 3IJRA 3JQ6A 3DZIA 3UN1A 4S3MA 1PU2A 2YV3A 5DCYA 1GFSA 5A02A 1XWFA 3H7AA 4D42A 4XEHA 5EPOA 4PVDA 4E2WA 1UXJA 5JMPA 2IE0A 5A3JA 3FD8A 5A9SA 2Y1OA 1WDMA 3HDHA 4BNHA 4M1QA 1F8GA 2HK8A 2VT3A 1TT5A 3GEDA 4PLHA 2DFVA 1LDNA 3GN1A 7ADHA 4CQMB 3AK4A 3DDNA 3L6OO 3I4FA 3M1AA 1RPNA 4GX2A 4IXTA 4B8WA 3LT4A 1NQAO 4J16A 1DSSG 3P19A 1XG5A 4L75A 4AJNA 2O4CA 4I5EA 1N7HA 4YAJA 4NJMA 1GZ4A 4XWYA 3KUXA 4Q9NA 1LDEA 3GFGA 2HSDA 4JJGA 3DBHA 3GVIA 2TMDA 2YV1A 1EUZA 2DAPA 1WLYA 2QX7A 3WFIA 1R37A 5JPIA 4ZHSA 3HB4X 2Y67A 3PGJA 3DB2A 5TT1A 4ZQEA 2O7QA 3T4EA 2OBYA 1NPDA 3I52A 4BO2A 2QZZA 4S1VA 4D3FA 1DRWA 1OC2A 3T7EA 1U5CA 3ZWNA 4X54A 5JDCC 3V8BA 3H5NA 4D7AA 1C0IA 1U9JA 3OQBA 3V2UA 2ZTLA 1A7AA 1FJHA 2EERA 4IMRA 3JQGA 5TSDA 3H4VA 4OOFA 1ENPA 2O2SA 1BG6A 3PHIA 5CEEA 2D8AA 3V1UA 3FPLA 3E03A 3OP4A 5HS6A 4NJOA 3U4CA 3NTRA 3IIEA 5H83A 4XIJA 2B4QA 1GV0A 1Y5MA 2O3UA 4RZIA 2CF6A 3K6JA 4CR8A 2J3KA 4NMHA 1LEHA 3L4SO 3WMXA 1PSDA 1D1TA 3SJUA 4WUVA 1I01A 2E4AA 3JCZA 3WYBA 2QYSA 4XRRA 1LDBA 1YOVB 3QWFA 5EERA 1PX0A 2HCTA 3HFGA 1A4IA 1M67A 3UF0A 1UZNA 3KRTA 1C1XA 2YJZA 4IDCA 1NWHA 5L7YA 3KYDB 2GN4A 3FNFA 5A1TA 3H8VA 1R15A 2O3SA 4UVGA 2AHRA 2Y93A 4YRAA 4Q3BA 1H6AA 1QP8A 1EVZA 2EKPA 4RLSA 1ZMTA 1N9GA 1PS9A 2ZKLA 4LRSB 4JBHA 4BB5A 5B4TA 3GNTA 4XR9A 4URFA 2AXQA 3SXPA 4M54A 3I4CA 4OSPA 2J5RA 3GOHA 2CSUA 4H15A 2DC1A 2J3JA 5CDUA 3UKOA 3HJAA 1D3AA 3QHAA 5T8KA 3JQEA 4J1NA 2EG9A 4NK5A 3WMWA 4YJGB 3LT1A 1NBOA 1G0OA 1NQOA 5DULA 3F46A 1V9LA 2VRCD 4YAGA 3JD1A 2B83A 1HLPA 1T24A 1DIAA 1JU9A 4JBIA 2VYVD 4JIGA 2EWMA 1TI7A 2X9NA 3S2EA 4AICA 1ZEMA 2Z1MA 4CMIB 4HKTA 2OOSA 3D5TA 3DBLB 3TZCA 3L4BA 3S1LA 4I5DA 1ADCA 5A04A 1KVSA 1U3TA 2VWHA 3QVTA 3OIDA 1N92A 2P91A 4ALJA 4YXFA 1XHLA 2GERA 3KBOA 4E5PA 1I3MA 2Q4EA 2NU8A 3JYLA 4CMGA 4DWVA 2EIHA 4JK3A 2YQ4A 2G0TA 4PG4A 4BO9A 4D3SA 1K0UA 1DC3A 1E1LA 2D5AA 3BXXA 1UJMA 3K9QO 4OHUA 3ZU2A 3GZNA 2CDBA 5B1YA 2VHVA 1MC4A 4NU6A 3S2IA 1JVSA 4FC7A 1EUCA 5DN9A 4UVHA 2OO5A 3OH8A 4WK6A 4N7RA 3ZNOA 2TMGA 1PS8A 3BMNA 3ANMA 2C2YA 1AXEA 1U8FO 4IQGA 5CG2A 2E48A 2WE7A 4A5OA 1XCBA 3AWDA 4HUJA 4ID9A 3JQFA 4OQZA 1XIVA 1BXZA 3L0DA 1KBZA 1EK6A 2YV2A 3DL2A 3IKTA 5I7VA 3QWAA 3O8QA 2R2GA 3QWHA 4BGEA 3DFZA 3EZYA 3GA0A 4EUEA 3VPXA 1BW9A 2XPCA 4H16A 4IS2A 3VTZA 4TRRA 4J49A 2JD2A 1LBEA 1PGQA 5DT9A 1W73A 4CMJA 4NHEA 2AQIA 1E7QA 3P2YA 5BSHA 4O63O 1AXGA 5F5NA 1EK5A 2GZ2A 2EP7A 2DVMA 4PLVA 4DL9A 4OSOA 1V35A 5I8WA 4WECA 4YQZA 3BTSA 2Y1EA 4GKBA 1VM6A 2IYPA 1ZZEA 2OP1A 4NBWA 1LLDA 3RVDA 2EP5A 3WIEA 3UOGA 4W99A 1ONNA 3FTPA 2FSSA 2YHIA 3V1YA 3QSGA 4GGPA 4CM1A 3F5SA 2BFMA 4N5NA 1BVUA 3AY7A 3A9WA 2ET6A 3ASUA 3RD5A 3PWKA 1HF3A 1DLJA 3WGGA 2DT5A 1LLQA 1IHXA 3FCOA 5IZCC 3O9ZA 1HETA 1HEUA 5F1OA 2O3QA 4PLWA 1DXYA 3IAHA 4FGWA 4Z9XA 3LQFA 3RASA 4B4VA 2Z5LA 3P7MA 2WYVA 3JYPA 2I67A 2QRLA 3D5QA 1FF9A 5B37A 3RC1A 5KJ1A 1KS9A 3CTMA 3VZSA 2DTDA 5L3ZA 4D46A 1R4MA 3DWFA 3U9LA 1SMKA 1O6ZA 2DQ4A 3RU9A 1ISHA 1U28A 1XEAA 1M76A 1QYDA 3NJ8A 3OIGA 1EFKA 1HZJA 1LC3A 1WP4A 1E3SA 2EF1A 3E18A 1OFGA 4J4TA 4CLDA 4CODB 4RV9A 1WPQA 5IN4A 2PKQP 2FZEA 5EESA 2FHSA 5AXDA 3FN4A 3DTYA 1EE9A 4RVSA 5AXBA 1EEHA 4EEZA 2IRWA 2VNSA 2V6GA 5T57A 2ZTMA 1E5QA 3ZHXA 3ZU3A 2GZ3A 5JMWA 1HDRA 3GVHA 3CZMA 1MFZA 1WVGA 4FFMA 2EHDA 3BMCA 5CDSA 1NQ5A 4B7UA 1XSEA 1P0CA 2D1YA 5B4UA 2F00A 4WNCA 4E0BA 5TLSA 4NDNE 3MOGA 5TX7A 3GGGA 4KTVE 3H65A 1UAGA 3DONA 2YDXA 3KYBA 4CV0A 3D3WA 3E5MA 3I6IA 3EHEA 1YKFA 3LC2O 3EZLA 4PLPA 2HK7A 4ZRNA 5HRUA 2VOJA 2GF2A 5EJ2A 1HLDA 3WSVA 4BV9A 5TGDA 4WKGA 3SBOA 2OP0A 4UAGA 5IXYA 1E7MA 1MUUA 3LC1O 4A73A 3D3EA 3H9QA 1NYTA 1PJSA 1CWUA 1P9LA 5F5LA 4U5QA 1S7CA 1PZHA 3JSAA 3CIFA 4RL6A 4BGUA 3KSUA 3UCEA 4MDHA 4CM8B 5IDQA 4FSHA 4K1LA 4II3A 3TSCA 3Q2IA 4TRNA 4XA8A 3JQAD 3QLJA 4DIOA 3PZRA 1C1DA 4R51A 4B4WA 3HFSA 1LRKA 2BMAA 2FMUA 4U6QA 1I5RA 1WW8A 3OFSA 2YY7A 3HADA 3PI7A 2I76A 1WNTA 4NFHA 5EMHA 4AJJA 3H9JA 1ZVMA 3HDQA 1GEEA 3GK3A 3PXXA 3RC7A 4QFCA 4WJZA 1EMDA 5DDIP 2VYNA 4EW6A 1RM3A 2ZQZA 3KXDA 1RWBA 3GN2A 4EI2A 1UAYA 1H6BA 5A05A 3SVTA 4TVOA 2PZJA 3GEGA 4CR7A 2FOIA 2NU6A 3R0IA 1Z82A 3UCXA 4HX5A 1I10A 1ML3A 1JAXA 5IN5A 1SB9A 5JYDA 1LDMA 3LT0A 4NK4A 3VTFA 3OSUA 5GZ1A 3H6KA 2P9CA 1G0NA 1P31A 3PYXA 2NUAA 4ZQGA 1YDEA 3F4BA 4L74A 1EBUA 3ON5A 4UVEA 2Y1DA 3DAFA 4BNUA 4F46A 4P8RA 1GQYA 1ZCJA 4PZEA 1CETA 3M6IA 1ZIDA 4ZN6A 5A5EA 3TZHA 3WQQA 2D3TA 1LXCA 4MINA 1K89A 1R4NB 1OI7A 1HZZA 3GDOA 1R16A 2PZMA 1TXGA 1ADFA 4IQ8A 5A03A 1D7OA 7MDHA 4GX5A 2W2LA 1B15A 4JJIA 3ZGYA 4YR9A 2C54A 5IDWA 3MTGA 5C37A 3S2GA 1B3BA 3CMCO 1KEPA 4DPKA 2D0IA 5KVVA 1GPJA 4M49A 1YB4A 2V7PA 3IC5A 5THKA 2W4QA 4KQXA 1P1IA 1GR0A 3INGA 4L8VA 2VUTA 3BA1A 1DJNA 3GHHA 4J2HA 4NQZA 5EIOA 4WCFA 4IDAA 4RDHA 3ZV3A 3DBRA 4CM9D 4LCJA 1CQIA 2FR1A 2WJPA 1NFRA 3PDJA 1DIBA 4GMFA 4RF2A 2RAFA 4MVJD 3IL2A 2J6IA 3QJ5A 3NT2A 3FRJA 1I8TA 4TSKA 4FN4A 4C7JA 4ZQBA 3JD3A 2EEZA 4LVUA 1LSOA 5IXSA 5KJFA 3VH1A 3R3JA 1QKIA 1IUKA 1PTJA 1V3UA 3RWBA 1NVTA 4Y6RA 2EW2A 5L45A 1NR1A 2FPPA 2Q2WA 3RROA 2ZB8A 1I32A 2HMUA 3CH6A 5KJEA 1PGOA 1Y7TA 3DZGA 3G0OA 1A71A 3VPFA 4AJIA 1YL6A 4IINA 4C7KA 2IXBA 3AI1A 3C1AA 3Q2KA 1B8PA 4E32A 1ZXBA 1E3EA 2YFQA 1O95A 4XYMA 1J0XO 2D59A 5FI3A 1JKIA 3WGTA 5JY6A 3ZU4A 3GRKA 3LU1A 3VKUA 3WXBA 3ZWCA 4KQWA 4CM6A 5BNTA 2AA3A 3AW9A 3Q0EA 4CMEC 1U4SA 2ZIZA 3ZN2A 3LDHA 5FWNA 4GKVA 2B4TO 2ZJ1A 1XA0A 1F14A 4Q3CA 4KUHA 1LU9A 2DBQA 2A9FA 3QVOA 2AW5A 5G0SA 3TF5A 1Q2XA 3JQ7A 4WLUA 3HZZA 4RVDA 2DTEA 1ZNQO 1WMBA 1F8FA 5A9TA 3E6AA 4YT5A 4D79A 3U4HA 1ISGA 1I0ZA 2Q45A 1QLHA 3E8XA 4BO6A 1U2GA 4XYEA 1AN9A 2QQ5A 3GRPA 3MWDB 4MVJE 5AYVA 2EKLA 2GASA 4BO3A 5KJ6A 1KC1A 1WXDA 3G1TA 1T2AA 4F3YA 4CQLA 4DPLA 1YBVA 5DCWA 3DAGA 2FR8A 3KYCA 4RF4A 4FJ0A 4XYBA 1TA4A 1Y81A 4KWIA 3JYNA 4FFOA 3KETA 3JYOA 5I8ZA 4D0RA 1HWYA 4MP3A 5L40A 2G5CA 1YJ8A 3EDMA 3HN7A 1N7GA 1KYQA 4IGFA 3QP9A 4FGSA 1H9BA 1HDXA 5IDYA 4KTTE 5DOZA 1PQPA 2BELA 3TZQA 3V2GA 1R66A 2G82A 1EVYA 4GVLA 3RUHA 4LMPA 2UUOA 3BIOA 2CD9A 4HFNA 4YT2A 1RM4A 3GG2A 1M6WA 3OJ0A 1X14A 2NTVA 5K6AA 2SCUA 3W6UA 4BNKA 4BNZA 4I5FA 5CPFA 5L9AA 1BGVA 3MJTA 4EYEA 1FDVA 1NPYA 2BD0A 4R16A 3X2EA 3TOZA 3JTMA 4J90A 4DLAA 5CDYA 2GNAA 3WOHA 1QG6A 2W2KB 4RF5A 2C5EA 5COAA 5ILGA 1A27A 2R6JA 4PLZA 3NJ4A 2BH9A 3ZWBA 4QECA 4DBVO 1XELA 1LQUA 4KUGA 2Q2VA 5JAIA 3IP1A 3PJEA 3CPSA 4O59O 3ZNQA 5JDIA 3FNGA 2W90A 1GZ6A 1PZFA 4OXKA 3FBTA 3EGOA 3LLSA 1QXSA 4ALNA 6ADHA 4MP6A 4U7WA 1I2CA 4BMNA 4UEJA 3MJVA 2EGHA 4PZCA 3BHIA 3GPIA 2DU8A 1E3JA 5KVSA 4PN3A 2NLOA 4CV1A 1DIGA 5ILOA 3GGPA 5EINA 3BTVA 1E7YA 4DA9A 1N1EA 1DC5A 3NDRA 6LDHA 1BXGA 4AJLA 2PH3A 3ONEA 1YO6A 2E82A 1PS0A 2ZK7A 3RC2A 5JSFA 4YB8A 4IM7A 4U0JA 3WX0A 3NTQA 4IIUA 2GN8A 3ENNA 2DBRA 1CERA 1GUFA 4R5HA 3TRIA 3BHJA 4XB1A 3RUFA 3VVCA 4LVCA 1SC6A 3MOIA 3EVNA 2VTDA 1R0KA 3CUKA 3F9IA 4F6CA 2X9GA 1EUDA 1GEGA 1LNQA 4FOSA 4BS9A 4IJWA 2UV8A 2JKVA 4R1UA 5CDTA 4HV4A 4A26A 4YJDA 4NBUA 4FR5A 3ROKA 4K6FA 4GPD1 2J3IA 1NX6A 2WSBA 4B3IA 3AFMA 3JQAB 5KJCA 1MP0A 3ST7A 2P9EA 5JCXA 1CYDA 1C1XB 1SOVA 1HSOA 1L7EA 5G4LA 4OJNA 5BQFA 4BGIA 2BI7A 3MJSA 3L9WA 1G6KA 4BO8A 3H9GA 3BYZA 2W2LD 3DOOA 4BOYA 4NZ9A 3I9KA 4IS3A 2VZ8A 3VZRA 5JYEA 4FFPA 3HDJA 5T5QA 1UXHA 1B16A 4YRDA 3QY9A 2A92A 1ZFNA 4LMRA 4Y9DA 3Q9UA 2XXBA 2GD1O 4JGBA 3VKVA 4AJ4A 2HAEA 3WYCA 1ID1A 4MP8A 1DIHA 3TL3A 4CM7A 3TOXA 1FDSA 3B20A 1D4FA 1I24A 4CMAA 1U4OA 2QIOA 4CPDA 4XIYA 3PJFA 3UVEA 3NDJA 4JBGA 4YJHA 2X5JO 4OGWA 1KETA 4NNJA 2QRKA 3ZV4A 3W1VA 2Y1FA 2DFDA 2R00C 4GLOA 3DMYA 3K92A 3TDKA 3GNSA 3L6EA 3NGXA 2P5UA 4CMHA 3W8FA 3K5PA 2JHGA 4AVYA 4IDEA 4IZIA 1P33A 1VKOA 1T1RA 3G79A 4I5GA 3IQDB 4FB5A 1C14A 2H1SA 3H5AA 1PL8A 2ZATA 1YVEI 1VPDA 4DLBA 4BO4A 1FMCA 4MJLA 1KVRA 1P45A 4R3NA 3PHJA 1TVEA 3GZNB 4KZPA 4MVJG 1LRLA 1YDWA 4CMCA 1IB6A 2HMVA 1ENOA 3C85A 3ONFA 4Z9FA 3OBBA 1EBFA 4Q3AA 2JAPA 2VWPA 1L7DA 3BMNB 3ZWYA 5F3RA 2WD8A 3OJEA 3OQ6A 4B3JA 1MB4A 1VJTA 1PJ3A 4PGFA 4PG5A 1NASA 2C0CA 1PR9A 4DRYA 3NUGA 5LDHA 5HA5A 1ENZA 2B35A 3PWSA 3R1IA 4J7XA 3ZU5A 2H9IA 2HDHA 2NACA 1IULA 4B4UA 3AOEC 1WDLA 2Q1UA 1I33A 2RIRA 5L51A 2RHCA 1Q7CA 2GZ1A 3T7CA 2JFFA 1SO8A 2C7GA 4J7UA 3ZWXA 2J5KA 3E48A 5U9CA 1ZK4A 4CV3A 1WWKA 3V1TC 4J3FA 4TVBA 2B37A 1SEVA 4CM4A 3ICCA 3WJ7A 3BZUA 1CEQA 4L4XA 2P4QA 3DZKA 1Z74A 3U5TA 2C7VA 4PLTA 1O0SA 1MFPA 5I7FA 3ENKA 3CSDA 3WLFA 3A1NA 2BLLA 2WWRA 2G1UA 3NT4A 1HYGA 2H6EA 2IEBA 4WLFA 2YDYA 3JD0A 3OA2A 3ICPA 4DUPA 4ZJUA 5KVCA 3GGOA 1PJLA 1HSZA 4CQMA 3EAGA 1VKNA 1JTVA 1H94A 4EGFA 2E49A 4XQ9A 1C0KA 1E6UA 4XRGA 3LF1A 4JJFA 3B6ZA 4UEKA 2OXIA 1R0LA 3ZV6A 1T2FA 1P1HA 4RVFA 4U6SA 1F12A 3PFFA 3JV7A 3DTTA 2PNFA 1RM5A 2X23A 9LDBA 1R4MB 3DHNA 2AQKA 3ANNA 4W82A 2VHZA 1Y6JA 3GEMA 4BKQA 2GN9A 2I9PA 1KIFA 4CJXA 3OETA 4RVHA 1DLIA 4K6CA 3ZI0A 3JQ9A 1YONA 4OAQA 2CMDA 4RO0A 1ZH8A 1C0LA 2I66A 3WR5A 4MKXA 1GYQA 3MJ4A 2O3RA 3WLEA 4J9UE 2PV7A 4U0KA 1P1KA 2JCYA 4TKLA 3PLNA 4R1SA 3RFXA 4FFLA 5ITWA 4UUPA 2O3JA 4GBJA 2PKRA 3LC7O 3D4OA 5AOVA 1CRWG 2B5WA 4CM3A 1QYVA 3ETGA 4B4OA 4E4YA 3Q6IA 3I9OA 4TZTA 1H6DA 1KVUA 4XGNA 2BFAA 1DDOA 5FYDA 4RPLA 4BNIA 4NFSA 2WYWA 2WD7B 1VI2A 4A03A 4AG3A 4DGSA 5JC8A 2X0RA 2JJYA 1E3WA 2HKIA 1WDKA 1GDHA 4KOAA 4FD3A 1UH5A 4DLLA 1IYZA 3UUWA 4HWKA 4XB2A 3WBBA 4GWKA 4WLVA 2Q2QA 4BNJA 3H9UA 4RPKA 1YOVA 2X4GA 1HE3A 4KDFA 1X0VA 1EFLA 4UUNA 4CLOA 3FNEA 1GY8A 1UXKA 4ALKA 1PWZA 5EL0A 3KYDA 2PD6A 3A14A 4BUCA 5TS3A 5A9RA 2VHYA 3D0OA 3F3SA 1YH3A 2XAAA 3G3EA 1F06A 1NAIA 2Q50A 3AUAA 3IS3A 4LGVA 4ROSA 4Z3DA 2Z95A 2ZTUA 1WZIA 4NR0A 4CUJA 3FR7A 2GLXA 5GZ6A 2HUNA 5HTOA 3RUEA 1X7HA 5C7IO 2GYYA 4BNFA 2NQ8A 1A7KA 1O9BA 4OO3A 5TRTA 5GZ3A 5TT0A 1FDUA 3SLKA 3ROQA 4AJ1A 5J23A 4I08A 4NBRA 1FDTA 3D7LA 4JQCA 4DPMA 1UP4A 2NVBA 1JKJA 4YPOA 4CL8A 4D0SA 2J8ZA 4G2NA 1E6WA 5CDGA 5CP8A 1ADGA 1H2HA 3ZHZA 4IDFA 3NAQA 1JW9B 1HE4A 2NVUB 2HJSA 4R69A 1LX6A 4TZKA 2ZB4A 1J6UA 3PGXA 5CHEA 5T8KC 4ND5A 3DBLA 4J91A 4WLOA 1QLJA 1LSJA 3DC2A 4YJFB 1LUAA 3COSA 1QYWA 3TZKA 5DOVA 1H0KA 1Y9EA 3NYWA 2ILTA 3TJRA 3Q9NA 4Z9YA 1YB1A 4YT4A 1LQTA 1XKQA 3C8MA 1B14A 3L4BC 2BGKA 1M66A 1KY5A 2O2YA 4I9NA 4INAA 1ZK2A 2ZB7A 4Z0HO 1YRLA 5G0VA 4Q3DA 4R3WA 3L9XA 1B8VA 2VOEA 2XF8A 2Q3EA 4R1NA 2RBEA 1Q7GA 4R4JA 2O23A 2O4UX 4XJTA 1E92A 3DMTA 5JCJA 2QG4A 4XDZA 1EQUA 3BTOA 3VZQA 1LC0A 1BXKA 2I3GA 4M89A 3I9NA 4J1TA 2GPTA 3GY0A 1KEWA 4NBTA 3HSKA 1I3KA 2PGJA 5G0TA 1XU7A 4H3VA 3K31A 4UVDA 3DBRB 4AFNA 4YTEA 4DXHA 5JBIA 1PJ4A 2W98A 4BNVA 2X8LA 3MJEA 5KWEA 2UYYA 4PZDA 5DBIA 1OOEA 2OGUA 1N8KA 4K9DA 2POQX 2A4KA 3FPCA 4AJKA 4JN6B 4FCCA 4BNYA 2NU9A 3MEQA 5FFFA 1PL7A 3JQFC 1ZMOA 4HNGA 4L76A 5ADHA 4RF3A 3OM9A 3PJGA 3CEAA 3GFBA 3FR8A 3LVFO 3RU7A 4KP7A 3U3XA 5A4DA 3LZ6A 1HXHA 3LSYA 2VZ0A 2X7HA 1E0DA 3PYMA 1C0PA 1SPXA 1SNYA 2WM3A 4XCVA 1PJQA 4MVJP 1XR3A 2QRJA 4ALMA 1YS4A 5DP2A 3KLPX 1EZ4A 2VWQA 4CLRA 4Q3EA 4EBFA 1DFGA 1UZMA 1X15A 4YAEA 4R9SA 5THQA 2AEMA 4PCVA 5TQVA 1U2DA 1FDWA 2HK9A 2QW8A 1K6JA 5I7EA 5JXWA 1HT0A 3NGLA 4NBVA 4YWJA 1PJBA 4AJOA 4IPTA 4J7CA 4WOJA 3F47A 3AY3A 4BO7A 1E3LA 2CZCA 1SAYA 4LCEA 1YQGA 3JQBA 4BNGA 1E6EA 3C7DB 2HRZA 2I6TA 4PIVA 1GZ3A 1E1MA 1DB3A 4Z0TA 5JY1A 3W4KA 3ULKA 3WTBA 1PWXA 2CVZA 5JO9A 3RUDA 1GD1O 4O5OA 4GX1A 2ZJ0A 3VC7A 1M2WA 2WTBA 4KUEA 5BSGA 3LYLA 5EQDA 4G5HA 2GCGA 4WNIA 3OEWA 4JLWA 3LLVA 3AUSA 1PR3A 1UDBA 4IQ0A 1VC2A 3WTCA 3BMOA 3Q1LA 2VHXA 1ZJYA 4PG8A 3ETEA 3KSDO 1B7GO 1OAAA 4I8XA 1SB8A 1X7GA 4IMPA 3EUWA 4R41A 4RCVA 3KB6A 1HTBA 3E9NA 4IUYA 4BNMA 1K6IA 5C5IA 2B0JA 4PLFA 2IDZA 3L77A 5IG2A 4BKRA 1JQBA 3N58A 5IF3A 4GH5A 1Y8RB 3TPCA 5L4NA 4DTIA 2DLDA 3P5SA 2EJVA 2Z1NA 3FNHA 3G1UA 1Q0LA 2P4HX 3AU9A 1Y9AA 1O8CA 1VJ1A 3GDFA 4RPJA 2UUPA 1DC6A 4QXMA 4BNWA 1PL6A 1E7WA 5K0ZA 4J0EA 3DMTC 2C07A 4L0QA 3EYWA 3H5RA 4DVJA 5KCZA 3IMFA 3M2PA 4RDIA 5I9MA 3UCFA 4EJMA 4W9NA 1SBYA 2EJWA 2I65A 1NQTA 4J2OA 4UUOA 4WOKA 3GZ4A 2H63A 4CM8A 5EN4A 5F21A 2Y05A 5L7WA 2DBZA 5T64A 1NAHA 4FBGA 4LW8A 4QO7A 1ARZA 1GL3A 4AJEA 5G4KB 1D8AA 4CL3A 3STHA 4XX0A 3NX4A 4YEDA 3I9MA 4TRMA 1L1FA 5B4VA 1ULUA 4YVFA 2FR0A 1AHIA 3WGHA 3OIFA 1Y8QB 2AG5A 3BMQB 4RGBA 4BV8A 4OQYA 1P3DA 3TZ6A 1KERA 3AOGA 3B1FA 2DUWA 4AJHA 4LN1A 2ZYAA 2X58A 1BXGB 1DHTA 4IBOA 2Q1WA 1LDYA 5COQA 1ZK3A 1JWAB 5C7OO 4EITA 3DHYA 3SC4A 2EV9A 1XGKA 1VL8A 3GUCA 2NSDA 4Z0PA 4J0FA 3W4IA 1A5ZA 1NP3A 1Z45A 3RJ5A 1B8UA 1NFFA 1X7DA 2UAGA 1EDOA 3E82A 4OH1A 4NFYA 3A06A 2OZPA 3B70A 5I9LA 5IFLA 1ISJA 1R4NA 2Y0CA 3K2BA 2A35A 3PPIA 3WICA 3AI3A 4EJ0A 1C3VA 4B7XA 4E30A 5IJZA 5L95A 3C1TA 3GNQA 4ITUA 1JA9A 2RCYA 5A9SB 5TNXA 1X1EA 4JNKA 5A06A 3JQ8A 2B36A 3N74A 1KOLA 3K2EA 4GL4A 3INTA 5ER6A 4BQPA 1V0JA 1TT5B 3VVBA 1PJ2A 4AL4A 5HBRA 5L4SA 4HFRA 5JCJD 1AHHA 5ES3A 4RPHA 1VRWA 3OICA 4PG6A 3WGIA 2GUGA 5CPBA 1X0XA 4BMSA 1O5IA 2C59A 2EW8A 3DZJA 1PIWA 3WGZA 3BAZA 3IDSA 2VRCA 5HS4A 1NVGA 3U0BA 3PK0A 3DZFA 4BO1A 4Q39A 2J5QA 2NU7A 2VYVA 1KVTA 4DC1A 4NJMB 1JWBB 2BFOA 4YDRA 3WNQA 4WCFC 3DBHB 3GAZA 2VRBA 5IZ4A 4B7CA 4NH4A 4Y6SA 3A4VA 5JC1A 1ZUD1 3FHLA 5FF9A 4OXNA 1GPDG 3PVZA 5G0WA 5F1KA 1E7SA 3NKLA 2X1HA 3HN2A 3UFXA 2Q46A 3RUIA 4EEXA 1O94A 2FWMX 1X13A 1GCOA 3QV1A 3K8ZA 3JYQA 2FZWA 3H9EO 5CAEA 4ZRMA 2E6UX 2V6FA 2ZB3A 3OHSX 2PKQO 1GQ2A 2VYND 4YAIA 4IJVA 4CUKA 1I30A 3S55A 1HDCA 3JQGB 2OFPA 5HM8A 2PZKA 2WDZA 4IDGA 4OKNA 1UR5A 3IUPA 4ALIA 5ICSA 1W6UA 3VH4A 1NWCA 4IXWA 4CUZA 3GPDG 2AE1A 3DOCA 1HRDA 1MX3A 3JD2A 2IODA 4QO8A 4HNHA 2ZYGA 4IDDA 4IDBA 1KC3A 1XDWA 1YBAA 3SLGA 3H2SA 3M1LA 4B79A 3PHLA 1MV8A 4CM5A 4MIYA 3FSRA 3VPGA 2HMSA 4ONEA 3EVTA 4YACA 3PDUA 5L4LA 5KKAA 3DBVO 1T2CA 2BI8A 4RVGA 3NV9A 1XQ1A 1MGOA 4OM8A 1U3UA 1NPTO 1X1TA 3C1OA 1UXIA 1I3LA 2C2XA 1CF2O 1B2LA 3ZHYA 3TN7A 2O7SA 2X6TA 4WPGA 2NVWA 5EQFA 5FEUA 4TMFA 1JLLA 2AE2A 1N9GB 4KDEA 4CM4B 3RFVA 3K73O 4FW8A 1U8XX 1YQXA 3TWOA 4PFJA 2UVDA 2D2IA 1CDOA 4L73A 5H82A 2IYOA 5JNLA 1KY4A 3PHGA 1AGNA 1E7RA 4CV2A 4E5MA 1LDGA 3E9QA 1MXFA 5IAAA 2HMWA 1B26A 1LJ8A 4O6VA 2CY0A 2PWZA 4R5MA 2P68A 5DZSA 4BB6A 3ZWMA 1F17A 1N1GA 5CEFA 2LDXA 4HFJA 4BHTA 2WMDA 1OZAA 1QSGA 3UGKA 3AJRA 5DCUA 3RBXA 1T1SA 4E3ZA 3U4DA 1BVRA 4OKIA 4BGVA 5JS6A 4FC6A 1IOLA 1MG5A 3F5QA 4TROA 2FPIA 4EZBA 2YQ5A 3ZWVA 1PJTA 1KEVA 1V6AA 1S6YA 4BNXA 3F1LA 3I6QA 4Y98A 2D4AA 4WASA 1VL6A 3EW7A 4D44A 2AQ8A 1H5QA 2RH4A 4UEOA 2DKNA 1MG0A 2G76A 3KM0A 4MOWA 1SOWA 1EE2A 3PWZA 5K6AC 2NV6A 1WZEA 1VJ0A 2JFHA 2W2KA 2VQ3A 1M75A 3ABIA 2P5YA 3ROMA 1BMDA 3GF4A 2IZ1A 2H5LA 5U1PA 4RJTA 1DAPA 1ISIA 4MVJM 4J4BA 3WWZA 3ZDFA 3SEFA 4TQGA 3F4LA 4K28A 4QT0A 1QORA 1I36A 3NTOA 4ALLA 4E13A 1JVBA 4W6ZA 1J5PA 1EDZA 5DBGA 1VE9A 1ZBQA 1ISFA 2Q4BA 4E31A 3EK2A 1EVJA 1QYXA 1XQ6A 2PZLA 5FI5A 5C3MA 4O1MA 1BDMA 2JAHA 1GAEO 2Y1CA 4E2XA 5JDIC 2NTJA 5ER9A 1A4UA 3W6ZA 5MDHA 3PYLA 4NI5A 5JO0A 2HQ1A 3WIDA 3I23A 3INRA 3O8QB 1QYCA 2JD0A 2EKQA 1BW9B 5T6BA 4E33A 3OJOA 3X2FA 4HBGA 2IZ0A 3G49A 1H6CA 4WCDA 1N2SA 4EUHA 3CE6A 1BSVA 4KMSA 4HXYA 3R6DA 2BRUA 2Y68A 3CKYA 1E3WB 2CFCA 3WWYA 3CXRA 2Y99A 2O50A 4UULA 1V3TA
chains in the Genus database with same CATH superfamily
3HVIA 1YXMA 2NQTA 2WWWA 3QFFA 2Y4OA 4QTZA 4E21A 2RH8A 4XOIA 1YGYA 3M6MD 4MRVA 4ZD6A 4C4YA 1U0SY 4P3YA 4N6OA 1PWHA 1RXUA 1JHMA 4LHXA 1A0OA 3KU4A 4E94A 1KMQA 4C2BA 3HWWA 4FT4A 4BO5A 1RC8A 2O14A 5IFKA 5JATA 2IKQA 4P7GA 1THTA 3DOFA 4CKBB 5IZCA 2JIBA 5AKGA 3UA3A 4MS3B 3LCCA 4HVLA 5G1OA 1DWOA 3KV3O 1R10A 1HNZB 4FS3A 1A9OA 1E2LA 4FUQA 3TRJA 1WB4A 4FM9A 4X62B 2WWHA 2YMQA 1ZLXA 3DE7X 3N2ZB 3RFCA 4C4TA 3FOEC 3DH0A 2FFRA 2VT2A 3O0TA 1M6VA 1Q21A 1XK6A 2VDUE 3Q11A 1V9SA 4QICA 4DLYA 3QVUA 1O89A 2WUGA 2P8SA 2OZKA 4NBNA 3W5UA 3LYAA 1PT5A 2LBPA 1PR2A 2F67A 3LBAA 1Q0ZA 3OHMA 2WPDA 3QVXA 3AQIA 1SXJB 4G0XA 5CHYA 1W49A 4B45A 1YA8A 3HQ4O 3U31A 1NLYA 2RG7A 3HSSA 4IHJB 1K7YA 4QDTA 5AUNB 5KINB 3U16A 1MO3A 1QHIA 1CS0A 4D8VA 3LUFA 5JAQA 5KKCA 3FLEA 4ARIA 5JQGF 2VBGA 3MAGA 4ZTBA 5FLEX 4PLGA 2G88A 4NG4A 5JLAA 2C8JA 4PSKA 2XCQA 4B6PA 3VU1A 2ZI3A 2V7WA 2WWTA 5EWLB 1NIJA 1A5BB 3DMNA 1JQLB 2ZCVA 1P17A 1Z7BA 2PH5A 4FQ8A 4UJ5A 5ALHA 5ALXA 3S7ZA 4AJ2A 2C29D 1MLDA 3A2LA 3ZDZB 1T3LA 1U7TA 3CLUD 1M8GA 3LOUA 1N3LA 3CNBA 1Z0SA 3IT1A 3MW8A 4MDYA 1FDRA 5BNFA 4JD5A 2GO7A 4W7IA 4C4PA 1P1FA 3PNOA 4BJ1A 1CE8A 3LDUA 1IXYA 2NO6A 4RS4A 5HQTA 3TEJA 3QFCA 5KX5A 2OB1A 2OMEA 3OF3A 1V6CA 3A4YA 3DLPX 3MMXA 1Z4NA 5CIWA 1O94D 1T6XA 3G0DA 3NRBA 1DRUA 2YW9A 3BHMA 4M9ZA 4A2CA 4EFNA 1BMQA 3TFOA 2JFOA 1RKXA 2YWRA 3ONDA 2PMDA 2PX5A 2OUIA 5AJZA 4YR7A 3H2ZA 4DLPA 3HI6A 4R01A 4B7ZA 3U49A 1KWGA 3FBGA 4LOJA 1PQYA 3CINA 1WAMA 3C2QA 2QBYA 4DG8A 1NVAA 1H2BA 3PVSA 4J0GA 2WRZA 1Y5RA 3KOYA 4D4MA 3DD5A 4XM1A 3TTWA 5IYZB 1CR4A 2GN6A 3LL7A 3VPBA 1DEAA 3PHHA 3ZE8A 2Q5QA 1Y6QA 3WBJA 3GLGE 3DNFA 3HLYA 5JE8A 2VP6A 2J5BA 4B35A 4TZ0A 3PICA 1C29B 1U3VA 4RHUA 4N3CA 3GPCA 4BVKA 1NKSA 4EHLA 4G25A 4EPTA 2B7CA 2YL2A 1PUXA 3F97A 3RAJA 1V7PC 3OJXA 4DJEC 1GWNA 4X3OA 1G21E 1U7XA 2YFYA 4H7EA 1ZOPA 1R5OA 2YYAA 3CR3C 3HNRA 3C8HA 3VO9A 3LBHA 3O38A 2PR2A 4YWHA 3HABA 3UH1A 3FHCB 3QWIA 5D84A 4D81A 3CY6A 1Y3BE 3OU7A 4FKMA 4QUBA 1I4DD 3U3RA 3GVXA 5KYYB 3QBJA 4ND2A 1VIVA 4YRCA 1T4CB 3ZWAA 1QIEA 3WI7A 3KHUA 1ZX1A 1CUUA 3PRYA 2X15A 2XUGA 3PFIA 2FRDA 3K96A 2NUTB 2C5AA 3LUAA 4F72A 2HF7A 1S8FA 1YIOA 3BB3A 3AY0A 3JAWB 2DPGA 1HURA 4HRXA 4K9LA 4KX3A 3JQCA 3LX5A 4BQOA 2WQZA 3RFTA 3BBPA 1FJGB 1OLUB 4H1UA 2GGSA 1QV6A 5CEJA 3SR3A 1SKYB 5GIOE 4L9RA 3TRFA 2C82A 1AGRA 2PA0A 4ZT2A 5IC4A 1QBKC 5BNIA 3KEQA 4B3DA 4EB6A 2KB0A 1NONA 4AXXA 9MHTA 1HEIA 1HT2E 3E3OA 1G38A 4BIIA 4ARCA 2QHXA 3NIBA 3WHPA 3P9PA 3R0VA 3CG0A 4UCQA 3NHKA 3DBIA 4W7HA 4XD2A 4BLTA 2YXBA 3OF2A 1UUFA 2GXUA 2AG0A 2QU8A 1TEXA 2G09A 3GLHA 3MQ2A 1HR0B 4OA8A 4IVQA 2H08A 3AU8A 2PZ8A 3IPCA 3QX9A 4ZU3A 3I39X 2VF2A 3TUIC 2RDMA 2VH1A 1HE2A 3D6VA 5IS2A 2GZHA 2XNKA 3EQ6A 4JI2B 1MC5A 1K5HA 4NOKA 1JT2A 1KBOA 3SK0A 4Y6PA 3DOJA 1H22A 2W83A 1KR5A 4P3PA 4W5WA 4AQYB 4EGSA 1GDDA 2OECA 4I1IA 1Z0IA 1H2EA 4MKZA 4PGGA 2FFAA 2ASVA 1FUKA 4I1RA 4N03A 4OGGA 2Q6OA 3VC1A 2CYBA 3UJHA 4FMDB 2YZ2A 4PC7A 1YRWA 5A0TA 1TW3A 3HJRA 4FJ2A 1OLXB 1EGMB 4MV4A 3UW3A 4FMPA 3K0FA 4ESHA 2JLYA 1FUYB 2FN7A 4RAOA 3ID6C 5FL3A 1PEAA 2HRBA 3UUFA 4GR4A 3G85A 1GGEA 1ZO8A 3QIVA 1DI0A 5KWJA 3BM5A 3N05A 5L3VA 1U7HA 3SZMA 1YWGO 3WB9A 4QQFA 2HQRA 2LKCA 4US1R 3U09A 3CEPB 4WCFB 1X70A 2PUBA 1NHGA 2OO3A 5EJ5A 3QX3A 4HH3C 1GITA 4Y2RA 4E6PA 3R3UA 3HPQA 1ORTA 2E5LB 3ZW8A 1WMAA 3C24A 4FFNA 4GPBA 4O2LA 2BR4A 5LC1A 1IY1A 4L16A 1AU9A 5DP1A 3M82A 1KXJA 2XVZA 4B6EA 3HNOA 1Z28A 1CDDA 5BSEA 4L0CA 1SA0B 4RD4A 3KUDA 4BZQA 3T4UA 5CGZA 1XP8A 1T5SA 3QA9A 2JL1A 3GH3A 3P2KA 3QH4A 1LLUA 3HGQA 5AFSA 2AYYA 1FQKA 2DSNA 4NE7A 1UP6A 2E37A 1ULAA 4HLCA 4TRJA 3PKIA 1T2NA 2QNIA 3PNSA 2DUUA 5SICE 3OOWA 1TX4B 2WYIA 5EZYA 1FNMA 2JFGA 2WQ7A 1O9HA 1Z5GA 3TW8A 1NTOA 2WF6A 3OFND 2RGNA 1TTPB 4R31A 3PQ6A 2HJRA 3QI7A 2PUDA 4HSGA 3PXCX 1JAYA 2XE8A 4CGYA 1TYZA 3GLIA 1CJUC 2Z5VA 3IOYA 3KJQA 2QD1A 1DOHA 3QLVC 1YR9A 3ZY5A 1E5LA 5FQOA 4JA2A 1D09A 1G5RA 5A3VA 2NN3C 4QJ5A 3WK5A 1MXHA 3EGDB 1UKAA 4NS4A 4N3GA 4HMQA 1OBOA 5JALA 3D4PA 4GOMD 4E5NA 1CUGA 3EXG2 4J4HA 4G8CA 3DYVA 2AEJA 4R84A 2RJ3A 2X5KO 4CQNA 1J49A 2BGGA 3VR1A 1Q1NA 4IAOA 3UW1A 4X97A 2MR5A 3PT9A 4R1TA 5GOTA 1V3VA 4RZHA 2DM6A 3QLTA 3GJZA 1U1FA 3CB4A 4IJKA 4YI5A 4DQXA 4DV0B 2ZRPA 3OZRA 3PP8A 2LE0A 1H05A 4DILA 2CMFA 5DFAA 2I3AA 3QOFA 1SWVA 1A8UA 3OTHA 4RA9B 1YZVA 5DNEA 3UZUA 3MZ0A 1BU8A 3F9CA 5K4HA 1IG0A 4P38A 1KMNA 1ESCA 2NVUA 2H4FA 4B9AA 3JQPA 3DEIA 4DRXB 2IHYA 4OEHA 1AKVA 2QLMA 5K0NA 5F1PA 3ZGZA 1YVUA 4X1KB 3FUWA 1G42A 2XD9A 4LGYA 4ACAA 5EAIA 2NV0A 4CQLB 2NNWB 4E4TA 4RTKA 1RZRD 4B33A 1C4KA 4OI1A 2WOOA 3MOSA 2IQIA 4KQFA 1FRNA 1KOJA 1LWOA 2J46A 3CLKA 3K9BA 2J6CA 3OQIA 4QWMA 1GCIA 1DEHA 3WGVA 1J4AA 2J48A 3HB7A 4EK9A 1JEJA 3IUSA 1SVOA 3GRVA 3EXHA 3TLZA 2EX4A 4HGPA 3QNMA 3L7DA 4J0JA 2DHCA 3JATA 3ZWPA 1EE1A 1GG5A 4JGGA 2XNHA 4G65A 5FWDA 4TV9F 2Z3ZA 2YUTA 3KSZO 4B8YA 3FGZA 3W2EA 5KS2A 2UZ4A 3KJIA 5KQPA 4DV3B 2FFBA 3C8ZA 3BRWD 1CUBA 4BXOB 4FU0A 1DX4A 3ORFA 1QHSA 2QI9F 2XTNA 4B76A 4DCOA 4U9IS 4JI0B 5LA6A 1Q84A 1YMQA 2P0EA 3JARA 1OH6A 1NLUA 1C9KA 3ETJA 4M55A 2Z2ZA 5E1DA 2YASA 1VA4A 2R6CA 4NAVA 5CB4F 3H3FA 2FXIA 4UHHA 2J4CA 2Q6TA 3LS2A 3OQVA 4ZQFA 3PQEA 3OO0A 3VZPA 2SCUB 1XQWA 4MR8B 1W0CA 3NXSA 5DK4A 1SIUA 3IESA 2CNLA 1RJWA 3GLQA 5IM4A 3OZFA 4KLNA 2B2CA 1NF3A 2EDCA 1RZUA 2PXAA 4L5YA 5ICMA 4NOLA 4W9RA 3O3NB 2X8JA 1R0SA 2CXUA 4NH0A 1RWQA 2QD5A 4LSMA 4V0KA 3UXEA 5I7RA 1CUFA 5EGSA 2PBZA 2VK1A 3UB3A 1JAZA 4CL2A 1ZK0A 1R6DA 2QT0A 1TCCA 3FTNA 9GPBA 3UANA 2Y6UA 5K3DA 2BKEA 2OUKA 2P5SA 4KR6A 4PC2A 5DNVA 5FUMA 3GXOA 2F1KA 1NC3A 2AMVA 1KAEA 3RIHA 1L7MA 5FBLB 2C92A 5HKKA 3BIXA 2UUAB 1QZ3A 3O93A 1I2BA 4WNYA 2G04A 4QSHA 1H8HA 1HA3A 5EUQB 3B3QA 3T99A 1D6JA 3K1JA 5K9ZA 3RKUA 1FA9A 5D51S 1HNXB 1WSAA 1UJ2A 5KYTA 2O8EA 5AH0A 1UPFA 3UWOA 1YQQA 3TNDA 4C0XA 2PJZA 4WL0A 5LD2B 2HFJA 3KOUA 2PM8A 1DKNA 1V1RA 1EG7A 2P9FA 3QOYA 3OTQA 5E1MA 3DE0X 3CMMA 4E5YA 3UBTA 3DVQX 4YRTA 3TSWA 1FRFS 2Y0DA 4XARA 4PHGA 3C8DA 1TMKA 4DNFA 5KHOC 4BKPA 1J0EA 2FH5B 2ZQYA 1KPIA 1P1JA 3NHAA 2CLFB 4ED9A 4M88A 3GVCA 3PU6A 1KI8A 3KSBC 3V4RA 4E6EA 1XRSB 1CNMA 2GO1A 3PX7A 1PJCA 2XZTA 1U7ZA 2RD2A 4Q7QA 5AXAA 2ZTVA 3Q6MA 2PGDA 4UU7A 1KGDA 2D1SA 2FY8A 3C7AA 5ESRA 3UXYA 4ZHQA 5AVXA 1EUDB 1C1HA 2OHXA 4OMUA 4QU9A 3ZOZA 3KJEA 5EA2A 3RVNA 2ZJFA 3FTDA 2G7MC 3IOMA 5ALGA 1V9CA 1JHQA 4G81A 3RC9A 4KQ9A 2BR3A 1TLTA 1W9MA 2DERA 3OTGA 4EDFA 3ZZ0A 2XJ9A 2GSWA 3AY6A 2YY5A 3TK1A 4A8PA 2GILA 4X44A 4QULA 1PZGA 2WIAA 5GJCA 3GT4A 4DF3A 4N65A 3KLBA 2FUKA 1XZCA 1UPUA 2QMHA 2WFAA 1IUPA 4I1VA 3GFSA 1QQBA 4I36A 8GPBA 4DA6A 4TMYA 4C0BA 4DCMA 3CO5A 4PRKA 1Y1PA 2G9QA 2XCUA 4INPA 3W7BA 3SHQA 5FPKA 4PSCA 3MRVA 5KTKA 2JHFA 1FYEA 2I6QA 2C2HA 1FUIA 4ZOEA 1NURA 2WB2A 3CUYA 2O2EA 5JPCA 1C9NA 1JB1A 1L7OA 2XMQA 1FXSA 1T9ZA 3HFRA 3I9V6 3MRTA 4NZZA 4QELA 2F8LA 1PHPA 1GR1A 3IR7A 2B8WA 4QOEA 4TWRA 2O8NA 3DEYX 3T1VA 1LKZA 3ZDYB 3DM9B 1X7XB 2OKCA 3FFBA 1WXEA 1Z5UA 5LR6A 4HADA 4PYOA 1ZPDA 3OA0A 1DFIA 3E4DA 4LV8B 4TTJA 4R9RA 1JHUA 1XMSA 2EFHB 1J0DA 2JRCA 2Z3WA 4V0MA 4XIFA 3S99A 1PT6A 1SM4A 2R7AA 4EG8A 5CA0B 1GGJA 4RNCA 4DXDA 1Y8RA 2XWPA 3P9SA 4JHLA 1BWSA 1Y6RA 3TW0A 4B0OA 4WGGA 2GFQA 3MTJA 2QZPA 1D03A 3G0CA 4K9SA 1GU7A 2FPIB 5DNWA 4BKUA 4MWTA 3C3YA 4BQSA 4C88A 2YFHA 1NL3A 1NJGA 2OLEA 4Y0VA 1IMOA 3B1YA 1ZESA 1XWWA 3GFRA 1W36D 1ZR2A 2PYZA 3AIOA 5ITVA 2KHZA 4HQNA 1LZKA 4LBVA 1W2HA 1OV6A 3W3AA 3E3NA 3D81A 2ONJA 3AHCA 1CJBA 3UIEA 5KBYA 1X1AA 4U9HS 3GLHE 3AFNA 5D8DA 2XZOA 2XE4A 5DVZA 3F6YA 2H07A 3GQBB 3M89A 1L1RA 2RHMA 4XZ3A 4XKJA 5ENVA 4QFDA 3ITEA 1OH7A 1W6RA 4EJSA 1CHDA 3DEKA 4OLJA 3K8QA 3NAGA 4UVIA 3WJAA 4NYIR 4P4LA 4FHEA 4XR4A 2PFSA 4FGZA 4PZ0A 1V95A 2FZ4A 1P9NA 4W9NC 2C03A 1K88A 3LKBA 4C3ZA 3EEFA 2R8BA 4FYYA 4FOOA 4PGAA 3NAZA 5EZ5A 3ZWDA 2CDCA 1RWWA 2ZW9A 1YB5A 3BMQA 1UQRA 4FIZA 1QANA 4D0GA 3A6EA 1GCGA 5EG5A 3MUNA 3N2KA 2ZREA 3C8UA 2HIMA 4XLTA 3X1XA 3TB4A 1FS5A 1YZ3A 3MRXA 5IHXA 1TM5E 7YASA 3ZZUA 3I0ZA 3LX8A 4IJ5A 4Y67A 3UK6A 4D9IA 1DDIA 3DKIA 4KREA 3RCBA 4AXBA 1CUZA 3DXFA 2EW1A 2AK3A 2ZIAA 4FBMA 4MIEA 4M9RA 1XJ0A 1TVCA 4GI2A 5EKTA 4I4IA 4D4JA 2O8BA 3MWDA 2ZR0A 3A6DA 1JECA 4IIXA 5BT9A 3D8RA 5T7BA 3FWNA 3RYHB 3ROPA 3K30A 1I3NA 2O2HA 2WJ3A 4TLDA 3N7UA 4PLCA 3L6DA 2JLBA 4WFKA 3VDQA 1ESNA 2BLNA 4HTAA 3TVDA 4MX8A 1DFHA 4INOA 5JFTA 2OZLA 4LTMA 3OJCA 2ZJ8A 3O94A 4LOHA 1MW8X 4HN2A 1WEHA 3DZIA 4ZK2A 3GD7A 4S3MA 2R751 1DKUA 5DCYA 2CBGA 4QPZA 1XWFA 5HX7A 5IDVA 3ICOA 5G02A 3I1IA 3NOXA 5EP3A 1ZD9A 3BWVA 4D42A 3LRTA 3BSYA 5FEMA 4A0RA 4HDQB 4HYQA 5A9SA 2VUHB 3B2QA 3LQYA 2C3YA 4HDSB 4IQFA 2P6NA 1TVMA 4TN1A 1CZUA 4MCIA 3I64A 4D9GA 1KAQA 2HK8A 4ZI7B 3DMHA 3H5OA 4WZBA 3GLIE 1KJYA 4A8TA 5CW1A 1CW2B 3GN1A 4HUQA 4GL2A 4JB8A 3IQWA 3D6UA 2PO7A 4JYCA 2ENUA 3STYA 3DL4A 3AQ4A 2P4SA 4IXTA 4YRLA 5HIIA 4J16A 3MK31 1QJ4A 1NXOA 1YKGA 1WTCA 4LBWA 1DSSG 2WJ4A 2C2WA 1PVOA 2WWIA 4HG2A 1XG5A 2R5WA 1TZKA 2QENA 2VJMA 4RXUA 1KEEB 5EJAA 1L5MA 1XZLA 2FKNA 4OHVA 3H0KA 4JT2A 4AJNA 2C7PA 1WSWA 3SSAA 5IVKA 5ECDA 1WLSA 4YAJA 3EMVA 3G2IA 5BN4B 3TUZC 2G3YA 1X39A 3GFGA 2HSDA 4BYGA 3VU9A 4FKZA 3CUEF 4YQEA 1B41A 2H52A 4H4EA 3LUCA 1EUZA 4RK7A 5FTMA 1WLYA 2QX7A 1I3OA 1R37A 1WSDA 1ZI8A 2X5XA 1V3QE 3G9QA 4JJ4A 4R05A 2HSJA 1SRQA 2Y67A 3HB4X 4WKNA 3WV5A 3I5XA 3DZCA 5TT1A 3STVA 1R8XA 1TYDE 2O7VA 2W6ID 3EXFB 2YXLA 4KVGA 4ZQEA 2EG5A 1C4OA 2D8MA 2O7QA 5JCOC 4BO2A 2F6RA 2PS0A 2QZZA 4ZK6A 4X8OA 4OXRA 2LWIA 3CZ4A 1T5IA 3SDSA 1L4MA 1SRRA 1GNRA 3EOBI 3VJRA 4ZYLA 2D0OB 3QKTA 2IKSA 1U5CA 3EBOA 1G19A 2C5BA 3V8BA 3VBCA 1WB6A 3ZTYA 1CUWA 4Y6QA 4EYOA 1SBCA 2B34A 3V2UA 4KH0A 2YY6A 4RA6A 1U9ZA 3PUXA 1SUWA 4PINA 3S2UA 3JQGA 1J99A 1PWEA 2Q3BA 3H4VA 1VA5A 2Q1YA 2Z8XA 3L1VA 1ATZA 2D8AA 2BTQB 3K5HA 4OMFG 5EXEA 3VO2A 1RVV1 1T5DX 3S81A 4KYUA 3RO7A 4NJOA 3IIEA 3D8SA 3DKVA 2AMJA 1DMSA 5EJFA 2FZKA 1Q0SA 2I6XA 1GV0A 2O3UA 3HEMA 1X1DA 3H19A 2CF6A 2I29A 3EGXB 4JJAA 4F5WA 3S44A 1ZIPA 4WDRA 3L7MA 3CLHA 3I76A 4AU1A 4F2WA 5LIPA 1M34A 1I01A 3AMVA 2UYGA 4N48A 3JCZA 4MEJA 3L0PA 1C30A 3L49A 4C7OA 3R3VA 1QDLB 4LOAA 4A36A 4MYHA 1VDZA 3QWFA 3ND5A 1KJWA 2VP4A 3CGWA 1G7SA 4GBMA 3CZ5A 3KSAC 2XBMA 1A4IA 3QPAA 4AI6A 1NUSA 4MKHA 3PUYA 3OCXA 3D6HA 4BP9A 3W06A 1NT4A 3KYDB 4JBYA 4YMIA 3X1JA 3BKXA 4KAAA 2A7QA 4IIDA 3VYVA 1NU8A 4Q3BA 3R5FA 1ECFA 2QY9A 4UDYX 1AQJA 3LA6A 2EKPA 3L7AA 5IJ9A 1PS9A 2V74B 3IUMA 4MRSA 5F1YA 4AF7A 4BB5A 2C9OA 3DYBA 1E2BA 4G9GA 1TF2A 1XRRA 3GNTA 3GU3A 3JVVA 4UW9A 4PSVA 2GBFA 4X92A 3BMXA 5DI3A 1A9XA 1EWVA 2OG1A 1P7WA 2WDPA 4HJRA 1X80A 3RBAA 2J5RA 4PHCA 3ROEA 1UFKA 2A1UB 5CDUA 4ID3A 2OAGA 3CTPA 3Q9SA 3I9V1 3REOA 3BIWA 2Z4TA 2Z2XA 3JQEA 3ELYA 4J1NA 5DWVA 1BZYA 5AO9A 5BN3A 5CFNA 3EPKA 1NQOA 2VUIB 5H80A 5CCXA 1NRJB 3NTXA 2GPNA 4NSNA 2X13A 2CKDA 2GZRA 3RYFA 2B83A 1HLPA 3F8SA 1DIAA 1JU9A 3B7GA 3IBYA 1WMFA 1M1YA 4JBIA 4JKOA 4BP8A 2H5JA 1MB0A 4JIGA 4WZAB 4XB6B 3S2EA 5T4HA 1ZEMA 2EL7A 5F64A 1Z7YA 1XNGA 2A7XA 2CDRA 1P3JA 1TPZA 2P3QA 2ZBVA 3DBLB 3I2GA 1J8DA 3L4BA 3OEHA 1M1NB 4I55A 4M21A 3F98A 4R1MA 2FPWA 3CJQA 1U0LA 1TZ2A 5AKLA 2RMKA 4HEHA 2Q6KA 3OIDA 2FF7A 2HU8A 4TL8A 3RS2A 1M3SA 1Q92A 3QUBA 4YFYA 4KXMA 1XHLA 4I2NA 5HRCA 3UGTA 4DWVA 3MT0A 3DGFC 3YASA 3L4KA 4PG4A 3EPPA 4LTNA 5KDLA 3A7DA 5M3BA 5BSKA 5J58A 4R7ZA 5KEIA 3U7RA 3WGLA 1Q77A 3I01M 2NXJA 1PEYA 1YCGA 2GYUA 3DV2A 3DVRX 1GRRA 1PX2A 4HMOA 4OHUA 4HVCA 2CDBA 3WMEA 5B1YA 4ER0A 3WAJA 3VPAA 1OGYA 2P27A 3S2IA 3N8DA 3WLTA 4TXHA 4AWAA 4UPEA 4KN9S 1EUCA 4RV5A 4V39A 4XSHA 1GQFA 2Q9AA 5DN9A 3T5CA 5E0KB 3KD3A 1Z06A 2TMGA 1PS8A 1SCKA 3BMNA 2H8KA 5EMMA 4B84A 5C31A 2CFOA 1JG3A 3TX2A 2I1LA 1Q15A 4GIBA 3KKEA 3L82B 1U8FO 4EVSA 1JHXA 1AB5A 1NVUQ 2IUYA 2WE7A 4NV3A 4G89A 2FSIA 2PZFA 4DMCA 3L0DA 2JJMA 5DYNA 4HAIA 5AM1A 5C18A 5DM70 2F9MA 3IEVA 1PV1A 3SWWA 1QGOA 1CZNA 2Z43A 3EZYA 2W9XA 3NDPA 5HK8A 1BW9A 2KM1A 4BEJA 4F93B 2OGWA 4TRRA 2XH8A 1ZUNB 4HDKB 1PGQA 1GZ5A 4J49A 3G02A 3LLMA 4OBBA 3W8RA 4O63O 5K09A 1XZIA 3KQSA 1AXGA 4A2PA 3PGVA 5CITA 1EK5A 5MF6A 4CDNA 2Y1LA 2QUKA 3MCWA 2JAOA 1QHFA 2N47A 1W36B 4V0ME 1SOMA 2RC6A 1IN1A 2P9TA 4PLVA 1P5RA 3AEUA 4G1MB 4WZ6A 3TIVA 4OSOA 4WECA 3MWGA 4MZXA 1M8FA 1FBTA 2EATA 2P6OA 1OSNA 5KPDA 1UK8A 2RBGA 1ZZEA 2YKGA 3OM0A 4KYTA 2IEIA 4JLMA 3DDUA 4MV9A 1JFLA 2R6DA 2AI2A 3O8OB 3WIEA 4MGKR 3U7EB 1P4GA 4FYHA 4C06A 1IIBA 1Z2PX 4FYXA 1ONNA 3ANXA 4KN5A 2C95A 4LVOA 1C9JA 3LTNC 4CM1A 1I6KA 1ODLA 2QSJA 1A9TA 2P0YA 3N7AA 4G5RA 2PRKA 1ECBA 2ZJ3A 1DG1G 3FRHA 4MQFA 3TCNA 5JAHA 4G4IA 3AY7A 5C2JB 3DDHA 2GAJA 2PX3A 4RD3A 5A2GA 2BEVA 2VAPA 1WZUA 3RD5A 4C1NA 3PWKA 3QX8A 3G0GA 4EPRA 1IHXA 2FN9A 2J1LA 3AIKA 3FCOA 3TGPA 2O3QA 4PLWA 5LKRA 3IAHA 4FGWA 3LQFA 3O75A 3RASA 4B4VA 3NFYA 1EAYA 4YALA 2HMAA 1U8TA 3Q41A 4YJ3A 4CKYA 1FNDA 2XCIA 1EXVA 1WXHA 3D5QA 2V4ZA 1FF9A 4MWEA 1KS9A 1SU7A 2HDNB 5KOHB 2GVNA 3FCYA 3F7NA 3TIFA 2GM5A 5BOVA 5L3ZA 5J4VA 1R4MA 3DWFA 5CK4A 3E3MA 3H11B 4XJXA 3VC3A 1JIUA 1N2BA 1SMKA 4AY2A 1TO6A 2M1ZA 3HCWA 3RU9A 3OQMA 3N6RA 4PBTA 1XEAA 1WDTA 2BP7A 3NJ8A 4IY1A 4O2AB 4O0MA 4DYVA 2EF1A 3E18A 5TMDA 1ZC4A 1DBRA 3I58A 4N7BA 2JVJA 4LZOA 3KELA 1C1YA 2OCPA 4MMYB 5JUWA 3OCJA 2QAGB 2R0QC 3I37X 1CQWA 2O8FB 1S2DA 3IAM6 3DTYA 5AOAA 3RTGA 3ZKAA 4UD6A 1QGED 2C88A 1BYIA 5D3KA 5LZ9A 2QGZA 1JHZA 2V6GA 5T57A 3W3AH 4OHPA 4UOZA 4I99A 4CIYA 3WNDA 2WTEA 4Q9HA 4OQNA 1Y6ZA 1EUQA 3CZMA 1MFZA 1EIZA 1ONBA 3KDAA 3BJRA 5CDSA 1P0CA 1E8NA 2D1YA 5I9IA 1DX6A 3N86A 4FZ3A 4M83A 4TMKA 3GUVA 3PEVA 4ML3A 1N75A 5T3YA 4E0BA 2BUCA 2GHRA 3VOBA 1PR4A 1R18A 2JZCA 1DZ3A 1NJFA 4X7PA 1IWBB 1D0IA 1P19A 1T91A 1UADA 4G0OA 2YDXA 3KYBA 5KU1A 4YJ2A 1E59A 3R9WA 2ECOA 3Q7IA 3I72A 3E5MA 3VNUA 5B1IA 3LC2O 5DMHA 4ZOLF 4FOTA 4ZRNA 5HRUA 2VOJA 2ZT5A 2GF2A 4OGFA 4RMIA 3SX0A 4WZBE 3KOZA 3PNVA 5EJ2A 3I01A 4BV9A 5TGDA 5KNCA 2GPAA 4WJKB 5EGNA 5BW6B 3RTAA 5EXDA 1V5FA 4ZI3A 4OH7A 1E7MA 1EFRA 3LC1O 1JR4A 4RPCA 4QTYA 1E9AA 1BD3A 2F3QA 3JSAA 3B8EA 4XX1A 3CIFA 1NBIA 4ARZA 4RL6A 3WWOA 4EENA 4EW3A 2AI1A 1FU4A 1NM5C 3UCEA 3LGSA 5ALMA 4FSHA 3DTNA 2OE2A 4K1LA 4II3A 4L8FA 2XB8A 3O2QB 4TRNA 1WZ2A 4JYPA 4FUTA 2JFQA 3LQ2A 3PDHA 3PZRA 5HTKA 3WJ2A 3LHSA 3VOTA 4UEWA 4B81A 4Y2YA 3DDZX 2IELA 5LYJF 1Z2OX 1DAIA 1WW8A 4DCTA 3OFSA 3ENVA 2B1GA 2R9VA 3BE5A 4LJ5A 3HADA 4LK2A 4OKSA 3Q1KA 3CBQA 4OQEA 3WLQA 1SVSA 4BCCA 2HU5A 5EMHA 4AJJA 4MV0A 3OQOA 4B3BA 4LQLA 2G0NA 3COWA 4PZZA 1OA1A 4I5IA 2IIVA 3PXXA 5JRDS 4C6RA 1QG4A 4WJZA 4QHTA 1CJKC 1Y5NA 4IGAA 1HRKA 3HCFA 3KXDA 1FQWA 4RM2A 4ZCSA 4DR6B 1B74A 1RWBA 2WSIA 4EI2A 4Y1RA 1H6BA 2B4AA 2DY0A 1KNXA 2QP4A 3L8FA 2GK3A 1NUHA 1E8MA 2JI8A 4M7OA 3MJDA 2WPDD 5GJBA 1WQ4A 2FOIA 1P5HA 1OIXA 3CT6A 2Q1XA 3H1TA 4KXXA 5IN5A 3DW1X 3UPUA 4OX9B 2YN4A 3R8FA 3GXBA 2GAIA 5AKYA 3QEBZ 3RVMA 4J94A 3RRXA 1G66A 1PJ8A 2OXRA 3F4BA 4JIMA 4L74A 1L5HB 2ES4A 3FKQA 4JA0A 3QITA 4JOBA 5IABA 3VMMA 4UM7A 4A8JB 4X71A 4F46A 5CD9A 3NWPA 1A1VA 4A91A 2F64A 4PZEA 4HNTA 1S7GA 1ZIDA 1GLGA 2BMJA 1P72A 2WVHA 2CWDA 1B42A 4M0UA 3TZHA 3WQQA 2PGXA 4WBSA 1YV9A 1OI7A 6REQB 3GDOA 3P0JA 4GVPA 5ENZA 3AVOA 4KNVA 4LPKA 5KU7A 3PXBA 1M34E 1R27A 1MO4A 3HVKA 4GX5A 4Z0NA 4Q9IA 4QU0A 1A8HA 1CFZA 3DDSA 3G0BA 4U3JA 3KQNA 3PI6A 1G63A 1ZONA 2VJPA 3IEPA 3MTGA 4A4DA 5IDWA 3COJA 1CPYA 1JE0A 1K5GA 4DPKA 4RIGA 5KVVA 1PLLA 2V7PA 5E2BA 3IC5A 5AQEA 3ZQKA 1TAUA 2XB9A 3FSJX 2WABA 3MF4A 4Y9UA 5LWQA 4L8VA 3INGA 5JJCA 4V0QA 4NQZA 5EIOA 4IDAA 4RDHA 2A1IA 4WADA 3G7NA 3L0BA 3R7NA 1TKAA 2LV8A 4RJLA 4POOA 1CQIA 3THYA 2ZRFA 4FHGA 3L0ZA 4NP6A 4ZMRA 2D2FA 1HLGA 3QKUA 4RF2A 3OPXA 3QJ5A 5AW7A 2JAUA 1OXUA 4Z54A 1RQ2A 2DULA 3PPXA 3SS9X 1N6OA 3K0HA 4C7JA 4ZQBA 4WOBA 5FOWA 4BWFB 3JD3A 4NLLA 2EEZA 4ZP1A 1LSOA 2B6NA 1ATIA 1QKIA 3IQXA 1IUKA 3K16A 2D2XA 1Z6XA 1V3UA 2EYUA 3EWAA 3GARA 3LECA 3QNWA 1MHTA 1WMEA 1XXHA 3SXUB 2BHRA 3BD7A 3P9YA 4RX1A 5L45A 4N76A 2FPPA 2H2WA 1NW8A 2IYQA 2PU5A 1YZQA 3JAKA 2ZB8A 1I32A 4PYLA 5KJEA 5CA1A 1PGOA 5IANA 2GBIA 1XFDA 1A71A 5FJIA 5DGCA 3VPFA 1OPRA 4QDUA 1YL6A 4AJIA 1LJUA 4AZTA 1SBNE 1Q44A 2IXBA 1K86A 3Q2KA 1B8PA 4NCJA 3SJBA 1V16B 1E3EA 5FI3A 3R9KA 4EVRA 5BUZA 3HBJA 1IRIA 4AZWA 3WXBA 1WQ3A 3MIZA 4XVRA 3WSTA 1VLZA 4LAFA 2SECE 2J0VA 3MWLA 3AW9A 5BNTA 1W88A 5KNBH 5FNZA 1Q3KA 3G1WA 1UMBA 4GT1A 4GKVA 1X1SA 1WXIA 4LNHA 4BCBA 4X6UA 2EKDA 3BB4A 4KUHA 3W6PA 1B43A 1L9XA 3V1MA 1N25A 1Y1QA 1ZITA 2DBQA 1LVGA 2AW5A 4EB8A 3PWTA 3BJMA 1URPA 3CC8A 2XTMA 2PQ6A 2OAQ1 2C4WA 3D0QA 4YUWA 3JPWA 4K6KA 3DMGA 4DNOA 2DTEA 1JFSA 4FVTA 3D7KA 1WCIA 4GBGA 1ZNQO 3EC2A 4LRUA 1WMBA 1VE7A 1UBLS 1ZU4A 1ZM2A 3R4CA 4JLJA 2Q45A 1Y3AA 2A9PA 3RUEA 4HAOA 1IZZA 16PKA 1ABBA 3HP4A 5AYVA 1FSGA 3PDCA 4Q03A 1IY2A 1I7PA 1XZFA 2GASA 2HPZA 4EG5A 3GRYA 4Z7NB 1BE1A 1MB9A 3DYIA 4FZ5A 4D8UA 5I51A 4BWVA 1U0GA 2X3YA 4G4SP 5IAKA 1NNI1 3AH8A 5DCWA 4BZZA 4YUYA 1THMA 1VZ3A 4AMBA 1DRKA 2FR8A 2L0XA 1C3LA 2OORC 2P3OA 3KYCA 4FJ0A 4GEGA 4MCJA 4XYBA 2DOKA 1EH5A 3KUKA 1TA4A 1Y81A 1EVEA 1JLLB 1B0ZA 1V41E 1E79A 3GP3A 2VP2A 3JYOA 3LG2A 4FFOA 4NYIQ 3OVMA 1HWYA 4D0RA 3UGJA 5FD8A 4D92A 9ATCA 2J08A 1L4BA 3IAM1 2PMEA 5CVEA 2EAUA 3QP9A 1GRNA 3DMFA 1VIYA 2IWHA 3ZJYA 1H9BA 1R74A 3PUIA 2M9MA 1USUA 2Q5IA 1HDXA 1U0JA 3TSZA 3GUZA 1U8YA 3U9SA 4KTTE 4QVGA 1W35A 4Y2SA 5F9MA 3KQPA 5LPNA 3D8TA 2C8KA 3H4TA 1IM5A 3HC7A 4NZNA 1Q7RA 3IB3A 3V2GA 1R66A 5J4HA 1YTUA 1KP3A 2VO1A 5GM2A 4E1VA 4LMPA 2WSMA 4KNYA 2BBWA 5FWAA 4YPFA 3BFJA 1YB7A 1X14A 3OJ0A 3Q15C 3RV3A 2NTVA 3WKAA 5K6AA 2QRZA 3W6UA 3ZJVA 2FDRA 3NRJA 1KI3A 3SIPA 1P9OA 4WBNB 4RY9A 3WA7A 3I3SR 1D2CA 4IJMA 3MJTA 2PZGA 2OHJA 3R3YA 3ZUPA 2ESRA 3X2EA 2YIJA 1J23A 2FKAA 4DLZA 3HO6A 2PFKA 4D4HA 3FHTA 1ZGBA 4I50F 4R6WA 2GNAA 3T15A 5AT1A 1BHJA 4GM0A 1KA9H 2BL4A 1C9MA 1A27A 1G16A 1YJXA 2RI0A 3NJ4A 4PLZA 2JF0A 2A67A 3OE1A 4HATA 4WSOA 4YXWA 5K6RA 5DSZA 4X60A 2EFCB 2Q2VA 3IP1A 3B53X 3DPUA 2VDMB 3PJEA 4MA5A 4V02A 3UT5A 2DG2A 3LYHA 3WHKA 4MJ7A 3EQ7A 4CG1A 3HYRA 4G41A 4NV0A 3RFFA 3EGOA 3R0XA 1QXSA 4L8GA 4JEMA 5E4YA 2E4VA 1LBQA 2EGHA 3E27A 3AGPA 2NZ8A 4RJJA 1TQ4A 1F4VA 4MQ4A 1UCFA 2DU8A 4RH0A 3MVEA 5GM1A 1WS6A 2B5OA 3MYRA 2C2GA 4PN3A 2A9RA 4PXAA 5FHRA 3OG9A 5BWBA 4RIEA 4ZO4A 3U39A 3QLEA 1BX3A 2AJBA 4FHFA 1ZW6A 3QZUA 2FI1A 1X7YA 1XK7A 2FWPA 1DC5A 4WA7A 3L05A 2X8BA 3WADA 1CTQA 1TKBA 2E82A 3R0ZA 4C03A 1KI1A 1S2LA 5ADWA 3ANSA 3HR8A 3NTQA 4Y1EA 3CEJA 4IIUA 1N2XA 1U0OC 3T3NA 1TZMA 4DB2A 4RHXA 4L2IA 1DJMA 1GUFA 1NU6A 2EKZA 2CW5A 1K6EA 2N9UA 3RHSA 2VIIA 3I0NA 1SC6A 2ATIA 5F2OA 1MMFB 1CF9A 1VPTA 1R0KA 2VTDA 3B5EA 1MC8A 3EVNA 3OE4A 4S04A 2J9XB 1N2CB 3FOBA 1V4BA 2R1VA 2ZJ4A 3HKEB 1GEGA 1LNQA 4BS9A 5A62A 4NAHA 3S4YA 4BUZA 4OFXA 4PANA 5CDTA 3DVSX 1P5FA 2QORA 3QOXA 2QJTA 4BFXA 1RWPA 4FR5A 3ROKA 1NRWA 2PX0A 3RE1A 1QZZA 4GPD1 3T7AA 2I78A 3NHMA 5ESWA 2WSBA 2ZUSA 4AX4A 3AERA 3ST7A 2P9EA 2AZXA 1C1XB 1SHJA 2GK4A 3UWPA 2J45A 5AESA 5IU6A 2H4WA 2Y2UA 3LCVB 3HRKA 1T5OA 4M0KA 2BI7A 4IICA 2VQDA 1ABEA 4XSVA 3JRWA 2ZETA 1RAGA 3H9GA 1JHRA 4IHJF 1ZHFA 2D1RA 4I3HA 1E58A 2HLHA 1AZSC 2FMTA 1M6VB 3WIOA 1HYQA 3G2PA 3HDJA 1B16A 1JRLA 3R5XA 1FVHA 1YQ9A 4LXTA 4MW7A 4NECA 5K05A 3U37A 1I94B 2W48A 4LMRA 4RVOA 4O4IB 4LDNA 4Y9DA 1SKAA 3UC9A 2GD1O 3FLMA 5HUHA 2HAEA 2WW8A 1ID1A 3EA4A 1DIHA 4N8SA 2XQKA 3SZGA 3WYCA 3VR5A 1RABA 3D2BA 4N0QA 1FDSA 3B20A 3NANA 1D4FA 2AC7A 2AZMA 1NE2A 4YCLA 3N87A 1CS0B 2PNJA 1GZVA 2UVPB 3UVEA 4G37A 1B6RA 4ZYTA 1B4DA 4YGYA 4N8EA 1CIJA 1GLVA 1KJIA 4B9EA 3CNHA 2P67A 3F3YA 1C2YA 2IGTA 4HEA6 2R96A 2QRKA 4UTVA 3ZH9B 4IOLA 1Y8AA 3U7JA 3GIWA 2Y1FA 5HKBA 2VTBA 4BRUA 3TDKA 1RLIA 1ECPA 1HFJA 5CBKA 2P5UA 3BF8A 2QD3A 2EJCA 4H08A 2JHGA