1E6WA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
251
Chain Sequence
SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
total genus 87
structure length 251
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e6wA00
3A06A 1R4MA 3I9NA 1UXHA 2LDBA 3VZRA 4A7PA 4JK3A 1E3LA 4B7UA 4GX0A 4LW8A 3RFTA 3LU1A 4FOSA 5KJ6A 3JQ9C 3RUIA 5ES3A 3WFJA 1VRWA 3I6IA 2IZZA 4BNIA 4CQMA 1HE2A 1BXGB 1PJ3A 4LN1A 3UCEA 2D2IA 1LRKA 5JMWA 3JV7A 1OZAA 4BV9A 3F1LA 3TZQA 5ICSA 2EEZA 2O3UA 3IQDB 4EJ6A 1Y5MA 4N5NA 3ZNPA 1LDEA 4P38A 3D7LA 4DBVO 1I2CA 3VOSA 1RYDA 3PP8A 1V3UA 4XRRA 4FOOA 4EW6A 5DBIA 5AYVA 2BELA 5G0VA 1FXSA 4HY3A 3RFVA 1XWFA 2NVWA 1PJQA 3E5MA 4R3WA 1BTOA 4P4NA 1P74A 2G82A 3WGQA 4XD2A 1EE9A 3F6YA 2O50A 3JQBC 4PRLA 3KYCA 2QRLA 2VHZA 3ADOA 1NBOA 4ZVVA 2ZTMA 1ENPA 3DBRA 5TNXA 2O3QA 3B1JA 2EP5A 4MP8A 4BNFA 4MJLA 2NV6A 4JJIA 4YDRA 1Z73A 3GUYA 3O03A 1F12A 5A3JA 1GZ3A 4XDYA 3SC6A 4B79A 4BIIA 3WYEA 2YV3A 1X0VA 3ZU4A 1E3JA 4AJ2A 1FMCA 2ZJ0A 4GKVA 2YY7A 4E13A 1Z75A 4UREA 1U2GA 3ZV4A 2AE1A 1BGVA 1NTOA 1VI2A 3TPCA 3U4CA 2EW2A 3W1VA 4TKMA 5I9NA 2V7PA 1FDVA 2J5KA 2VT3A 3DHNA 3INTA 4BNLA 2EV9A 3FR8A 2E82A 2B4TO 1NFFA 3SLGA 2AQKA 3AY7A 3GMSA 1YBMA 2GLXA 3VH2A 5HTOA 5HA5A 1N7GA 4CMBA 3ICCA 5CG2A 1VL6A 1ZK1A 3IKVA 3JYPA 1HE4A 3OA0A 2Q4BA 3K5PA 1XHLA 3QVXA 3HADA 3G17A 4HXYA 3C7DB 5F3RA 3RCBA 3VH3A 1E3WA 3KEQA 4ZQHA 2CZCA 3W8EA 4JP3A 1JVSA 1LDNA 2EKLA 2JD0A 1YJQA 4JBHA 1R37A 4PLCA 5T8KC 1JW9B 1PGQA 3G49A 4FBGA 1Q7GA 5AOVA 4BQRA 4BKQA 2VTDA 1MXHA 3RUHA 3RC9A 5EERA 3VVBA 5AXDA 3NDRA 1VJ1A 3Q0EA 1HRDA 2EHDA 4GX5A 4PFJA 1VL8A 3KLMX 4B4VA 2IEDA 4F45A 2I99A 2E48A 4RV9A 2GR9A 4IJVA 3VPGA 1W0CA 1KVTA 1KY4A 3TN7A 2LDXA 1LLCA 3E48A 4C7JA 1MV8A 1VPDA 3I52A 5IZCA 4BNWA 3WNQA 5AVOA 1PZGA 2JCYA 3COSA 4GWGA 2UAGA 3G3EA 1X1EA 5L7WA 3BHMA 3HB5X 1YDEA 4E5KA 3WR5A 2D5AA 1WDLA 5TT0A 5B12A 1NFQA 1UDCA 3S1LA 4WLUA 2VWQA 1YXMA 1AXEA 3QWFA 1DC5A 1QV6A 2OOSA 2GGSA 2ZTVA 3DMTC 1GQQA 1HDRA 1M66A 2YZ7A 3KYBA 4QQRA 3CMCO 4NU5A 3WGTA 4IS3A 4ZQEA 2WD7B 4YCAA 2NUAA 4IPTA 1O8CA 4RQTA 5C7LO 3A4VA 2X23A 3R3JA 3RROA 1HLDA 1PSDA 3TFQA 3QE3A 4PVCA 4MVJM 1M2WA 3DEYX 3PFWO 4J43A 1IYZA 3AFNA 4GX2A 4RF5A 3VZPA 4TQGA 3ZZNA 1N1GA 2O2SA 4J1QA 4NH4A 1DDOA 1E5QA 4OKIA 3PJFA 2B4QA 4RVSA 3RU7A 1RM5A 4AJ1A 4QO8A 1RWBA 3ZW8A 1V9LA 4R1UA 1MUUA 5IN5A 2NU9A 1F8FA 4MKRA 4BV8A 2BF7A 2DM6A 1X1TA 2WYVA 3G0OA 4MKXA 2A4KA 2A92A 2UUOA 2DQ4A 1YKFA 3AWDA 4ILKA 4I9HA 4UAGA 1HDXA 3BMNA 1EFLA 2YJZA 4UVHA 4S1VA 4ZQFA 3WX0A 3LT4A 2ZATA 3WJAA 2PKQP 1C3VA 2VRCA 3FHLA 3B20A 2X1HA 4HWKA 3C24A 2HAEA 4UULA 1A9ZA 3HHPA 2WDZA 3PWSA 4CM6A 3PLRA 3UW3A 4ALNA 3RUEA 4I9NA 4DREA 3IS3A 4ESOA 3DHEA 1HTBA 5JY6A 5JE8A 1YQGA 4OHUA 4CLRB 1XSEA 3I4FA 2ZK7A 3OJ0A 4E33A 1BW9A 1I32A 1BWSA 2PGLA 1Y1PA 4Z0TA 4JBGA 4IDFA 4JGBA 1YBVA 1E6EA 3PJEA 3QWHA 1NPTO 5L45A 3BMCA 1HYEA 1YBAA 3FPCA 1ZBQA 3EC7A 1SB9A 3W6UA 3DDNA 4QTZA 4RPKA 1DLIA 3KTDA 4J0FA 2WYWA 5EINA 4OXYA 2JKVA 3WNVA 4YXFA 5I9LA 4KMSA 3ZN2A 1YL7A 4GBJA 2O7SA 4QSMA 3FN4A 3QVWA 1O89A 4XEHA 3KETA 3KYDA 3UICA 2UVDA 3IOYA 1E6UA 1Y9EA 3G1TA 2OMEA 4D43A 1CIVA 3RQSA 1DJQA 4CMKA 4BNVA 1JQBA 1K3TA 1QYVA 2EG9A 1I10A 3OQ1A 5G0WA 1HETA 2YQ5A 1SPXA 5DBGA 4W4TA 1BXKA 4ZN6A 3GNQA 2A9FA 3P2YA 5HRUA 1I2ZA 4PLGA 2HMSA 3PHJA 4M49A 4RF3A 2EGHA 2VUTA 2ZCVA 1ZXBA 2V6MA 5CEFA 1ZZEA 2Q49A 1SCUA 1S7CA 4Y6PA 1P9LA 2GZ2A 4CUKA 1PGPA 3Q3CA 5A5FA 5BNTA 4BO8A 3PHLA 4CLXA 5TJ9A 1XU7A 4M1QA 1Q1NA 1SNYA 2WE8A 4BKOA 1AHIA 1TLTA 3H7AA 4E12A 2NU8A 4CLOA 5JBIA 4LVCA 1NFRA 4WNIA 2VHYA 1QRRA 3D5TA 4J1SA 2WWRA 1Y5RA 1KVSA 1EBFA 4YJDA 2IRWA 2YUTA 3FRJA 3VKUA 5CDYA 1CETA 3VZQA 3A28A 2IODA 1B3RA 3W8DA 4CQMB 4EITA 1B15A 1ADFA 2YV2A 4Z0HO 3OQ6A 4FJ2A 4JIGA 4DQVA 1B8VA 4E5NA 4CM1A 4NFHA 3JQGA 1LI4A 3LT0A 4BO0A 4AVYA 5IN4A 4WOKA 4YAGA 2ZQYA 3QIVA 1PZHA 3GRKA 3GGPA 3KSUA 1RM0A 3I9KA 2Q1SA 1SC6A 1P0FA 4LSMA 1DIRA 1Z7EA 1HXHA 3PZRA 4GI2A 4CM8A 5CP8A 1DIBA 3IJRA 3AW9A 4IXTA 4OSPA 5G0UA 5L95A 4NPCA 2YV1A 2P5UA 5I8ZA 5A9SA 1Q7CA 1W4ZA 2DBVO 2NTJA 3SEFA 3WBFA 1HT0A 1RM3A 4WGGA 3ZW9A 1TT5A 3ORFA 1Q7BA 4GVXA 4BNGA 2NU6A 3ETGA 3KYCB 3HN7A 5IAAA 3TJRA 3GDFA 1U1IA 2TMDA 4LMPA 4AJKA 2Q2WA 2Q1UA 2C0CA 4E2XA 1V8BA 3D5QA 1ZJYA 4Q3DA 1E1MA 3HG7A 3WIDA 4MINA 4MVJD 4PLYA 1OC4A 4PG4A 3W4JA 3AY6A 3RFXA 2VQ3A 3AI3A 1U9JA 3ANLA 4E32A 1WMBA 1PL6A 3DBVO 1T2FA 4XQ9A 2I3GA 4KQWA 1YGYA 1EUDA 5CEEA 2QYSA 3NX4A 4UEJA 4IGFA 4XQGA 4YWJA 2PKQO 2RHRA 3KUXA 4UUPA 2VHXA 4CMGA 2DPHA 3DZFA 4AJHA 4NR0A 3PFFA 5FI5A 1XKQA 1Z7BA 2O4UX 4J2OA 5IDXA 2D0IA 3JQAD 2DTDA 3E9NA 2CUKA 3NDJA 1D4FA 2PWZA 2DAPA 1FK8A 1ORRA 3I5MA 3E9MA 1E3WB 1V6AA 2FPGA 2X8LA 3RUFA 1J6UA 1DFGA 2CVQA 2VNAA 3MJEA 4RDIA 4AJOA 3NEPX 4Z6KA 4DC1A 4A73A 3UFXA 4B7CA 4DC0A 4BGIA 1SEPA 3ANMA 4DRYA 3GK3A 4D0RA 4E0BA 1UXKA 1GYQA 3N74A 3QA9A 2YDXA 3QWIA 3ZWBA 4BNXA 4HADA 1B0AA 1Y81A 4ID9A 2C7VA 1QR6A 2XXJA 3WFIA 1L7DA 1ZK2A 1H5QA 3GEMA 3QWBA 3M1LA 4RDHA 3DFUA 3L6EA 4WLVA 1LDBA 5I9MA 1X7HA 4PGFA 2AEMA 2JJYA 4WPGA 3E5RA 1H6DA 2CMDA 1SO8A 2YHIA 5F21A 4R5HA 5TRTA 1KS9A 3E82A 2Y1DA 1EVYA 2QRJA 4YAEA 4DLBA 3GPIA 3U0BA 3R6DA 1DRUA 3L6DA 1ML3A 2RAFA 1ADBA 3WJ7A 4D79A 1TB4A 1PZFA 4AJIA 4F6LA 3SBOA 1NQOA 3R3SA 4PVDA 4CR7A 1GR0A 1K89A 1NYTA 3GR6A 3I1JA 4IM7A 5ENDA 1NVMB 1UXIA 3DWFA 3I4CA 4RVDA 3CUKA 5JYDA 2GZ3A 1OAAA 1JN0A 1O94A 4GGPA 4RPJA 4A10A 1HDOA 3WB9A 1U8XX 4PZCA 1VLLA 5FF9A 3RUDA 2OGUA 2PFGA 4IDBA 2A35A 4PLHA 3GPDG 4FS3A 5DP1A 3WS7A 4BO3A 5JW6A 2DFDA 3K2BA 4Y6SA 3H5RA 1XYGA 1GFSA 3P2OA 3B1FA 5U1PA 3C1TA 2C2XA 3NRCA 3OJEA 2Q1WA 1QMGA 2PV7A 1HEUA 5GZ1A 4YAIA 3UGKA 1W8DA 2VOJA 4M87A 2CFCA 4CUJA 2W2LD 5ENVA 3UKOA 3Q1LA 1LRLA 3LYLA 1VL0A 4D0SA 2C82A 3H9GA 1T4BA 2H1SA 2FPPA 4RORA 2C7GA 2X0NA 4E31A 1YL6A 1LDMA 3JQDA 1JKJA 3NTRA 3TFOA 4GKBA 3AM4A 4OKNA 4Q3EA 3TZHA 1NPDA 2W4QA 3BMNB 4HNGA 4ZQGA 3GN2A 5IZ4A 1JAXA 1MP0A 4XGIA 3INRA 2X0IA 3V1YA 1VKNA 3ON5A 4HKTA 4YTEA 3M1AA 4AJLA 2PD3A 4ZRMA 2Y68A 5B4TA 2CF6A 3MWEB 1X13A 7ADHA 3ZWOA 1HE5A 4MKZA 4R69A 3GVCA 3LF1A 4LRTB 5CHEA 1UUFA 1E77A 2VWHA 2DUWA 3OEYA 1ZJZA 2AA3A 4WJZA 5JYEA 3O4RA 3P7MA 1BW9B 4NIMA 4URFA 1PR9A 1H93A 5HM8A 2J3HA 4IJUA 4BVAA 4AJEA 4XX0A 2VWGA 1ZK3A 4WCFB 1UP6A 3BMCB 4XIYA 4DLLA 4U6SA 5T64A 1H94A 2DPGA 2OORA 5JAQA 5IFLA 3JQ7A 3IP1A 4CL3A 2HK9A 5TX7A 3E03A 1F17A 4GMGA 3RWBA 7MDHA 1I0ZA 3TSCA 1O0SA 4FGWA 1U3VA 3MJVA 3TQHA 1P77A 3KSDO 4FC7A 3RVDA 4NI5A 1JAYA 1PS9A 4L4RA 3HSKA 3JQ6A 4YJGA 4MVJG 3ZWMA 4YT5A 5BR7A 4R68A 1A9YA 4MP6A 3KYDB 3DO5A 4IGEA 3CEAA 1EDZA 2Z1MA 2Q2VA 4GSKA 3VH4A 1E7QA 4ZGWA 1PQPA 2UYYA 3IKTA 1SMKA 1V35A 1E3SA 4CJXA 3GZNB 4Q3CA 2HUNA 4OOFA 5JDCC 4E6PA 4YJFA 4YT2A 2EWMA 1BG6A 5IDQA 4MVJA 4C7KA 4CV3A 4EUEA 2Q50A 3O8QA 1E7YA 4E2YA 1R6DA 2O3SA 2IXBA 1PS8A 3OSUA 3NT5A 4FD3A 4R9SA 4DLAA 2JFGA 2AQ8A 1IULA 4MVJP 4WEQA 1F8GA 4WKGA 4RLSA 4W9NA 1J5PA 1GCUA 3H6KA 3RUCA 1I33A 2H6EA 2XPCA 4UUMA 1KEUA 5G0TA 3PGJA 2D59A 3PHHA 5EQDA 4O59O 4IDGA 5KIAA 2NVUB 1B8PA 4FFPA 3UCXA 2GCGA 1VJ0A 4Y8VA 1JVBA 3H9EO 3E9QA 5COBA 4RJTA 3ZU3A 5BSGA 1Q0QA 3FTNA 3JQAA 1E7RA 1ENYA 1X0XA 5BNFA 3PVZA 4UEKA 4XKJA 3JQ9A 4J4BA 2Y0DA 4WLEA 4AG3A 2Y1FA 1GUYA 4N5MA 3NAQA 3GDOA 3MJCA 3F3SA 1Z74A 1ZIDA 3BTSA 4J49A 4CMJA 1L1FA 1BDBA 2BI8A 4RVFA 1M6WA 5L3ZA 5I7EA 2X5JO 1FDSA 1PU2A 2Z1NA 2AMFA 2O4CA 4ALMA 2EJVA 1DXYA 2OFPA 4E5MA 3PYLA 1N92A 1YB1A 1E1LA 1YB4A 4F3YA 1DHRA 1NXQA 2G76A 1P45A 2WD8A 1U4SA 4MVJH 4CM8B 3VAZA 1TEHA 3GUCA 3SJ7A 3RBVA 4HP8A 1LDGA 2C5EA 4L9RA 4NBRA 1SEVA 5A9SB 3V1UA 5IF3A 4U8GA 1SOWA 1JDJA 2J5QA 2X9NA 3GY0A 5BT9A 2VN8A 3BMQA 1TT5B 2V6GA 1IHYA 3QJ5A 3RC1A 4HBGA 1ONPA 1T2EA 2GN6A 3ZGYA 4CV1A 3IMFA 3JQBA 3GF4A 3QSGA 1Y6JA 3CH6A 3JYOA 2Q99A 2RH8A 1AHHA 3C1OA 4Q3BA 3D3EA 4B3JA 2D3TA 5TIIA 4RGBA 3NJ8A 2BD0A 2GPTA 2QRKA 4Z9YA 1MA0A 3EVTA 1L7EA 2VCYA 2HMVA 3F4LA 2I76A 3RKUA 4DYDA 2O3JA 1MLDA 1GYRA 1M75A 1ZSYA 4KP7A 1XELA 4PZEA 2JL1A 4B3HA 3GC6A 1SZJG 2VUUA 2ZB8A 5JXWA 2P5YA 4GLLA 1C14A 4IDAA 4WNCA 3MEQA 3D3WA 3L9XA 4L75A 1DAPA 5KTKA 4CM9D 3UOGA 2C20A 5K6AC 4YACA 1B3BA 3LSYA 1CDOA 4OJNA 1LX6A 1KIFA 3B1KA 3WGHA 3WSVA 1MC5A 4MVJF 5THQA 2VTEA 3R1IA 1HDYA 1KVRA 4R1SA 3ROKA 3RKRA 3T4EA 2C5AA 2DT5A 5F1PA 3JQCA 1P1FA 2W2LA 1LRJA 4AFNA 4BNNA 4J9UE 1ZMTA 2OUIA 2CY0A 5T8KA 2OP1A 1F14A 3DONA 1XDWA 1I36A 2JAPA 2O2YA 3T7CA 3LF2A 1UDBA 1Z6ZA 3IL2A 1JWAB 4CLEA 3VPFA 1MG5A 1ISIA 1VC2A 2X7HA 3WYCA 3FF4A 1FJHA 5ER9A 3HWRA 1G0OA 1LA2A 4CL8A 1C0KA 3MJSA 2Y1GA 2VHVA 3GHHA 3GHYA 3AUUA 1PS0A 1DIGA 1YO6A 3JYNA 1RM4A 2Q4EA 4KDEA 2NQ8A 4PG8A 2NTVA 2X0JA 4CM3A 1DIAA 4CR6A 4LCEA 4A0SA 5CG1A 1V3TA 3GDGA 1C0IA 4YJHA 3NJ4A 3OP4A 2NQTA 3JD1A 2Y05A 4YB8A 5AXAA 3L6OO 2PK3A 2YHIB 4M8SA 1PL7A 2HMTA 3NDIA 4CM7A 4XYEA 1R66A 5CFZA 3GNTA 3OECA 4MIEA 5JFOA 4FB5A 3BA1A 3WQQA 4IINA 2Z5LA 4XQEA 4BO6A 4IIVA 4K6CA 2PR2A 4DWVA 1T26A 1D8AA 3FBGA 3LC2O 5JMPA 3DMTA 3DBHB 4BS9A 1DB3A 3EGOA 9LDBA 3FTPA 4B4OA 1LSUA 4XJTA 5MDHA 3H4VA 3VHRA 3TZKA 3DZGA 1HE3A 2JHGA 3FSRA 3SXPA 5KVQA 3I9LA 3TL3A 5C7IO 4WECA 1YS4A 3QY9A 4Y98A 1P1IA 1Y8RA 4R41A 4XR4A 5JSFA 3DQPA 5C3MA 2P91A 2HRZA 3N7UA 4CMHA 1LEHA 1GCOA 1CF2O 2FZWA 1WZEA 2OHXA 2BGKA 1A71A 3D4PA 2W98A 3Q2IA 3WWYA 3GGGA 1AE1A 1E7SA 1EK6A 4JXKA 1H9BA 3U5TA 1JKFA 4A5OA 5EPOA 3GGOA 4KTTE 3QHAA 3IUSA 5IXYA 4XB1A 1DRWA 3T7EA 3G79A 3OBBA 1U2DA 3ONEA 5IG2A 4EJMA 3WBBA 1X15A 4FC6A 3F9IA 3GQVA 3OICA 2HO5A 2BLLA 2Y1EA 2V6BA 2VZ8A 3UN1A 3ITKA 1G0NA 5AXCA 2OBNA 3ONDA 5ADHA 5H81A 1BDMA 1SBYA 4JNKA 3ASVA 2Y0CA 5I8WA 4PG7A 1YQDA 5BSFA 2R00C 3HZZA 4XIJA 5I7FA 1PJBA 5FYDA 4YEDA 4JROA 4DA9A 2GASA 4HFMA 1ZKMA 2HQ1A 3EYWA 1IY8A 4L0QA 3B6ZA 3F47A 3KOUA 4XRGA 2V6FA 3F5SA 4ZJUA 3L07A 3ZHBA 2YFQA 3JQ7B 3WGIA 3FNGA 3FI9A 5GMOA 3DOOA 3JYQA 4YPOA 3PLNA 5B4UA 1YB5A 3K8ZA 3LZ6A 4BGEA 1ADCA 1YONA 1E1KA 5CDSA 4YVFA 2C07A 2HDHA 3RBZA 3UUWA 4BNYA 4YJGB 2P9EA 1R16A 4GWKA 3UVEA 3BMOA 4LSWA 1BXZA 3ZHZA 1DC3A 5ITWA 5A02A 4LISA 4A26A 4L4XA 2ZB4A 6ADHA 1ZEMA 2CSUA 1H2HA 3HB4X 3G1UA 3L0DA 5B1YA 2WEKA 2BRUA 4NG5A 4YJFB 2A94A 1LSSA 2ZKLA 4UUNA 2AE2A 3GVHA 3K30A 4M54A 3V2UA 1DC6A 4YRDA 3O8QB 1CJCA 3PWZA 3HFSA 1I2BA 4OYRA 2NM0A 3MZ0A 1C1XA 9LDTA 4N5LA 2Y0EA 3RU9A 1YRLA 1G6KA 1IPEA 3OEWA 1D3AA 2PZKA 3DZKA 4JQCA 4W82A 4RL6A 5DN9A 4Z3DA 3OM9A 4U0JA 1NQTA 3NYWA 4BNZA 2P9CA 4EEXA 1I5RA 3ENNA 3GVPA 5JCXA 2P4QA 1DLJA 1HF3A 3PI7A 4RVHA 5THKA 3F4BA 4DMMA 4CM9A 1PEDA 5A04A 3B70A 5F1KA 4WCFC 3QV1A 2VYVD 4GQAA 4CQLB 1DOHA 4EZBA 4WK6A 3LT1A 4IZIA 1GU7A 4U0KA 1UXJA 1Z82A 1QV7A 1VM6A 4NFSA 4BL5A 4TRJA 1LSJA 4NDNE 3FNHA 2IZ1A 4DL9A 1M76A 2Y1OA 1KEVA 5TLSA 1WMAA 1X7GA 1I3MA 3JTMA 1YVEI 3RI3A 2FR1A 1RPNA 5CPBA 4DPKA 1DEHA 1IL0A 1LJ8A 1HSOA 1R4MB 2J5RA 2RIRA 5TS3A 3FBTA 3TOZA 3LLVA 3DZBA 1Y8QA 1JWBB 5JC1A 3PTZA 3GAZA 3LLSA 3AOEC 3EW7A 4XR9A 5DZSA 5FWNA 1MB4A 5FFFA 3PYMA 1C1DA 4YAJA 1A72A 1IHXA 2G1UA 3ITDA 3WSWA 4D3DA 1EVJA 5L9AA 1I3NA 4Y6RA 2O3RA 5EIOA 4IDEA 1HL3A 3K31A 2ET6A 1QLHA 1C0LA 3N58A 4Y67A 3WICA 3BMQB 1UAYA 2HCTA 1LC3A 4CM5A 2Q1TA 5A05A 3WIEA 3HJAA 1GQ2A 4XWYA 1QLJA 3RC2A 4BNJA 1GPDG 3GG2A 2EXXA 4TZKA 1I24A 3PHIA 2PTGA 3V8BA 1U8FO 2GZ1A 3OF2A 2BFOA 3HE3A 4Z9FA 1UZLA 1Q0HA 2VZ9A 4P8RA 2PA3A 1ULUA 4S3MA 5DULA 3RC7A 4XGKA 1TI7A 4ZQBA 1VKOA 3MJ4A 1KVUA 1XA0A 1ZFNA 4J2HA 3W4KA 3SVTA 4NBTA 2I3AA 4I5GA 4J4TA 3SLKA 3BHIA 2AEFA 3DBRB 2J3KA 4RPGA 2ZCUA 1ZW1A 4R5MA 5EN4A 5F5NA 1P1HA 1PJ4A 1YQXA 1QXSA 2H63A 1YOVA 3NGLA 4U7WA 5KCZA 1BXGA 1ZUD1 4Z0PA 1BVUA 4DUPA 3E8XA 4K28A 5F1OA 2DUUA 3D0OA 2X9VA 4BNHA 4CMEC 1RYEA 2UUPA 2ZJ1A 1QORA 1W73A 2FPIA 4N18A 1MG0A 2CVZA 5IDYA 4OXNA 2OO5A 4DIFA 2HMWA 4ND1A 3WTCA 3UHAA 1P31A 3MOGA 1ISJA 4W7IA 2IEBA 4W7HA 1I3KA 4FCCA 3UCFA 1ZXLA 2XF8A 1IZ0A 2PKRA 2VYNA 4BQPA 4HFRA 2ZIZA 3ZWPA 4MIOA 3EAGA 3SC4A 1YDWA 3GNSA 1FDUA 2DKNA 2E4AA 4TMFA 4ZICA 1V0JA 4ITUA 1T24A 4TVOA 1ONOA 2Q3EA 5ILGA 4EBFA 1MXFA 1EVIA 1P1KA 3AOGA 3VKVA 1FDWA 1GEEA 2VNSA 1UJMA 2WE7A 1HDCA 3WXBA 1OC2A 3U4HA 4RVGA 3AFMA 4NHEA 2BKAA 4BHTA 4A03A 3U4IA 1QG6A 1E7WA 4P22A 2H9IA 4K9DA 3CZMA 1LLQA 1PQWA 1U3UA 2ZB7A 2YHUA 2PGDA 1ZSNA 1J0XO 3U62A 1EQUA 3ZWAA 5JAZA 4R3NA 4QECA 2P2SA 3DBLA 3CE6A 1B14A 4QT0A 3PHGA 4I1IA 4XYMA 1JLLA 5C5IA 1UZMA 4YR9A 1R0SA 1N8KA 4IDDA 1WNTA 3RASA 2VWPA 1HZJA 2DLDA 2WTBA 2JCVA 4JJGA 4C4OA 2RCYA 2FN7A 2Y66A 4I5EA 4IJKA 1K2WA 1M67A 1Q0LA 2WYUA 3CPSA 3DC2A 3ONFA 4OQZA 3WOHA 4NMHA 1I3LA 2OP0A 2DTEA 2I6TA 4ZD6A 3S55A 3NT2A 3OMLA 3BIOA 5BNIA 2GO1A 1AN9A 4M55A 3BXXA 5BSHA 1KY5A 2O3TA 4H16A 3VTFA 3QP9A 2VT2A 3MJTA 1U3WA 4PG5A 3ZNNA 3ASUA 1H6AA 2JD2A 5DDIP 2D1YA 4FIZA 4RCVA 4G65A 3RIHA 4U5QA 1XCBA 4KWHA 3W4IA 1DPGA 1LXCA 3ZWWA 3INGA 3ZCXA 5A3VA 4O6VA 3W6ZA 2D8AA 4D44A 3W8FA 3ZWNA 2G5CA 2D4AA 4LCJA 4D42A 3WMWA 1P1JA 1AXGA 8LDHA 2VZ0A 3R0IA 3CMMA 4BKRA 3JD0A 1MX3A 4RVUA 4ALLA 1ZEJA 4NK4A 4CLDA 2D5CA 4W6ZA 5TC4A 1K6XA 5DNAA 3IC5A 4HX5A 2GNAA 3PXXA 2HKIA 4BGUA 3ZHYA 5A9RA 3NTOA 3HUDA 1T1RA 3SJUA 3FWNA 1M6HA 2VYVA 3PDJA 3L4BA 4PLPA 2PZJA 5DT9A 1A27A 1NPYA 3JQFC 1BMDA 4ONEA 3RUAA 4U6QA 1I8TA 4XQCA 3C7CB 2GYYA 3S2EA 3H65A 3QWAA 4AICA 3ABIA 1ZH8A 3CKYA 2UV8A 1QSGA 1J4AA 1FF9A 2VUSA 4BKUA 2QZ9A 5JDIC 3EK2A 4X54A 4EGFA 1EDOA 2WD7A 4OM8A 1R0LA 1D7OA 3GVXA 4FFRA 2BFMA 3V2GA 5ER6A 3K2EA 5BSEA 3ZHXA 1X14A 3GH3A 3DFZA 3NT4A 4BKPA 3S8MA 4B7XA 3EHEA 5EMHA 1O5IA 5JCJD 4MVJI 1PL8A 3GT0A 4PLFA 4BNMA 5L4LA 4DYVA 3FPLA 3PWKA 3OIDA 1B2LA 1LBEA 2DFVA 1U7HA 2VHWA 4XDZA 5J23A 2NLOA 5BQFA 2QG4A 3BMOB 1N2SA 3EUWA 1PJTA 3ZV6A 1LU9A 4FW8A 1IZ9A 1D1SA 1K6IA 3ZV3A 4B8ZA 3DZJA 1RKXA 3OJFA 4FFOA 4QEDA 3U4DA 1P33A 2AEJA 3Q2KA 4IMRA 4BOYA 3H8VA 3DTTA 3KO8A 2IYPA 2X86A 1GQYA 4BMVA 4DGSA 3PK0A 4DMLA 4J7XA 5JDCA 4AJ4A 3O38A 4WE3A 1U5CA 3KZVA 1HZZA 3I23A 2OL4A 4RZIA 3OJOA 4PLWA 3WTBA 3ZDFA 4DTIA 1WP4A 2YYYA 1C1XB 3K6JA 4KQXA 4YRBA 1BRMA 3LC7O 4Q3NA 4HUJA 4E2WA 1VSUA 5TF4A 2RH4A 1HYHA 1HWYA 1KOLA 4J0EA 3RAJA 4NU6A 3ROPA 3AM5A 3FNFA 4IZHA 3X2EA 4L76A 2YW9A 3H5AA 3TNLA 4JLWA 5DCUA 4I9UA 1IUKA 3UXYA 4BGVA 1EQ2A 3HNPA 1KEPA 4H3VA 4Z9XA 3ADPA 4XYLA 1GEGA 2HJRA 1WW8A 2B0JA 4IJWA 3NTQA 3JSAA 4KTVE 2QQ5A 4UVDA 3AUTA 5HBRA 4BMSA 2EJWA 4D46A 3I83A 3Q9NA 2JD1A 3ICPA 4W99A 1ZCJA 3F5QA 4YRAA 1DRVA 1LLUA 2J8ZA 3D4OA 1ID1A 1PJ2A 5KKAA 1TA4A 4TRMA 1I30A 5HS6A 5C37A 4R01A 1D1TA 1U7TA 3HN2A 5DOZA 4IUYA 3IAHA 3KRTA 4D41A 4FPXA 4CLOB 4BO5A 1KEWA 1UDAA 4KZPA 1A4IA 1DC4A 3ZWCA 3AUSA 1YE3A 1IE3A 1Y8QB 4LVUA 3Q6IA 4ALJA 2EKPA 1DAOA 4B4WA 5JPIA 5HWSA 2GN4A 1EEHA 3VPSA 2DC1A 2HLPA 1E6WA 1EZ4A 3H3JA 3HQ4O 3KLPX 1H6CA 2NVBA 1IOLA 1B26A 3D64A 3ULKA 4FGSA 3JQGB 3PZBA 1B8UA 2CDCA 2P9GA 1OI7A 2O7QA 1CQJA 3AI2A 4E2ZA 4OSOA 3OJLA 4CMCA 4F46A 3FNEA 4CODB 4L74A 3TL2A 3DB2A 3H9JA 4QX6A 3DAFA 2JHFA 4TWRA 1WXDA 3AJRA 4XGNA 2BH9A 1KETA 3ZWVA 2CVOA 1U3TA 1QYWA 2C29D 2GSDA 3WGZA 2BMAA 3GAFA 5C7OO 5JNLA 3WGGA 3X2FA 1VSVA 2PGJA 4JCOA 4JP2A 1VJTA 3RJ5A 5JLAA 2B5VA 1E92A 1YWGO 1O95A 3NKLA 4BO2A 2OXIA 3WGYA 3PQEA 2XAAA 1P0CA 2XXBA 1YOVB 3ROMA 1NASA 4FJ0A 3OETA 1LLDA 5IDWA 1ENOA 5TSDA 3E1KA 1QKIA 5TGDA 1GV1A 3NV9A 4EI2A 1H0KA 1UZNA 1WDMA 5K6AA 1A4UA 2PY6A 4PG6A 1IB6A 3FR7A 2POQX 4MDHA 2Y99A 2QIOA 3GA0A 4DBZA 4UVGA 2EGGA 3P5SA 5JC8A 5CPFA 3PIDA 1QYDA 2BI7A 1WAMA 3BHJA 4IXWA 4H15A 3BAZA 4G5HA 1GADO 4NQZA 4NBUA 4K1LA 3HDYA 1GUZA 3HDJA 3IUPA 2CD9A 1JA9A 1I01A 4J7CA 4ALKA 3KVOA 1TXGA 4WUVA 3OH8A 4WLNA 1KC3A 2HRBA 4OL9A 4DQUA 5IJZA 5L4NA 1AGNA 1ENZA 4INAA 2PH5A 1LTHR 2NTNA 1NHGA 2X5KO 1SOVA 4AJJA 2R6JA 5TQVA 5G0SA 3VH1A 3JD4A 2NADA 1MFZA 3ZI0A 1ONNA 4RQUA 3I9OA 5KNLA 3STHA 5CDGA 1K5HA 2BFPA 1Q2XA 2W2KA 4G2NA 1GZ6A 4QFDA 3BTOA 3EVNA 2B69A 5KVVA 1Z45A 3JD2A 4II2A 4WOJA 4UUOA 4JX8A 4FFLA 4GH5A 5JS6A 2CNBA 5TJHA 3DBLB 1EE2A 5DCWA 2BGLA 3OA2A 1N1EA 1NQAO 1LNQA 4Z3KA 3S2GA 1PGOA 2Q45A 1UXGA 1CYDA 2R2GA 4CM4A 2O23A 1R4NA 1YJ8A 5KOIA 1W6UA 1LQUA 2YQ4A 2QZZA 4LMRA 4NBVA 4OMUA 2ILTA 5JCJA 2YFHA 3A9WA 5DBFA 3ETEA 1ULSA 2WMDA 1XR3A 3RJ9A 2EW8A 2PD6A 3H3FA 4R1TA 5ICMA 5LDHA 3DAGA 4OQYA 1NVTA 4FSHA 5FI3A 5F5LA 5CAEA 3VPXA 5CDUA 1EBUA 4J1NA 4R1NA 4IDCA 1CQIA 2I9PA 4RO0A 4CLHA 3C7AA 3PJDA 4YA6A 1ZK0A 4KWIA 1BSVA 2FMUA 4GL4A 4TKLA 2Y67A 4MPDA 5ITVA 1NHWA 1DIHA 1C0PA 1Y7TA 2RHCA 1EUCA 1ADGA 1N5DA 1T4DA 3DOCA 1PJCA 1XEAA 4KOAA 2B35A 1ZMOA 1ZSVA 3DMYA 2PZLA 4Q9NA 1QYCA 4MIYA 3WMXA 2FR8A 3FCOA 3I9JA 3JD3A 1XG5A 4R54A 3OIGA 4P4LA 1ZK4A 2Q46A 2GERA 5I7SA 4O5OA 3V1TC 1DO8A 1P1RA 4EUFA 4GVLA 3AY3A 4B3IA 2EKQA 2FR0A 1UAGA 4ZU3A 3AU8A 1E5LA 5DP2A 1H6BA 1JU9A 2H5LA 2V65A 3M2TA 2CF5A 4AJPA 1A7AA 2VYND 4P4GA 3AU9A 1IPFA 3PJGA 3DHYA 1WLYA 3K92A 5IZCC 4NJMA 4L4SA 3RD5A 2ZB3A 5DF1A 4BNUA 2FOIA 1E3IA 1NNUA 4R9RA 3PRJA 4GSLA 4PN3A 1CERA 1TVEA 4GMFA 2R00A 4RPLA 1NM5A 2VRBA 1DJNA 5GZ3A 1PJSA 3S2FA 2HSDA 4AJNA 1AUPA 1QYXA 1NX6A 4FFNA 3L4SO 3WLEA 1ISMA 4KUHA 2JAHA 5GZ6A 2IE0A 3RSHA 4HV4A 1OMOA 1EVZA 3KEOA 1Y9AA 3HDHA 4Q3AA 3VC7A 4OO3A 2ZQZA 5A9TA 4IY1A 4HFNA 2JCXA 4J16A 4QO7A 5G4LA 2NNLD 5ILOA 2B5WA 3WYBA 4YQYA 2OBYA 4R16A 2NWQA 2PH3A 3GN1A 4FJ1A 1A5ZA 3JQ8A 4IQGA 3DOJA 4PCVA 4XJSA 5B4VA 4O63O 1DHTA 4MVJE 3ANNA 4ZHSA 3LQFA 3TZCA 1PWZA 3DL2A 1VE9A 4NNJA 3HFGA 2EERA 1R12A 4GGOA 5KWEA 2IDZA 1OBFO 1UP7A 2JFFA 4II3A 4PLZA 5K0ZA 1F0YA 2B37A 3CXRA 1U4OA 2WJPA 1E7MA 5G4KA 1NAHA 4BUCA 2X6TA 3EZLA 2TMGA 3H5NA 1T2CA 4TVBA 2O48X 4O0LA 1O6ZA 4YQZA 3GFBA 1DBVO 2J3IA 5T6BA 2ZYDA 2OZPA 1GYPA 2JFHA 1QP8A 1UP4A 4WCFA 2X58A 4R4JA 3ETDA 3ZNOA 2DTXA 2HJSA 2P68A 2CDBA 2SCUA 4NJOA 4K6FA 3PEFA 4E3ZA 3IDSA 4DQXA 1LQTA 4EUHA 3LT2A 1RJWA 5EL0A 2FP4A 4WCDA 5G2OA 1PZEA 3KXDA 4TROA 2E49A 3D4NA 1UH5A 2YDYA 1HSZA 2GN8A 4E30A 4E5YA 5KJCA 1ISGA 1GAEO 1R15A 3IJPA 2IYOA 1ARZA 2ZYGA 3JQAB 4UVEA 1HLPA 2FSSA 4IQ8A 4ALIA 2Q2QA 3ZWYA 3HDQA 3AOEA 3JYLA 4MP3A 3BZUA 2CDAA 3KV3O 4HNHA 3GZNA 3MWDB 2C54A 3GLQA 4BMNA 3WG9A 1PIWA 4Q39A 5KKCA 3GZ4A 4Y9DA 4FN4A 2W8ZA 4NFYA 1ISFA 3LVFO 3VDRA 5EQFA 4JJFA 3EMKA 3VZSA 2AXQA 2NACA 3FD8A 2UDPA 4D3SA 1A7KA 3QVTA 1N9GA 5A4DA 4FR5A 3PYXA 4ND2A 5TT1A 4PLTA 3FWZA 4TRRA 2X4GA 4R51A 3K9QO 3CZRA 4BO4A 1LDYA 1U28A 4ND3A 4CMIA 4OOEA 4J4HA 4O1MA 2FZEA 4EJ0A 2NVUA 1PX0A 4L73A 5I7VA 3I9MA 2W90A 4YBZA 4GPD1 5AQ1A 4AL4A 3GEGA 4I8XA 3AUAA 3QVSA 2AHRA 2ZYAA 1YH3A 1XQ6A 1EFKA 3O9ZA 4GLOA 4NBWA 3OHSX 5A06A 3VTZA 3H2ZA 4CMAA 1B7GO 1KBZA 3F1KA 4MOWA 1NQ5A 2WSBA 1KYQA 4CMEA 4UEOA 1O9BA 1X7DA 1KVQA 3OFSA 4TZTA 4E4YA 1EUZA 1SB8A 2HK8A 1NWHA 2X5OA 4WASA 1PJLA 3DXFA 2GDZA 4ZA2A 3D3WB 5A03A 3VDQA 4UVIA 2F00A 4WLFA 3DZHA 4TSKA 4DPLA 4HFJA 1PTJA 4BB5A 1TT7A 5KJEA 4OH1A 2RBEA 1G1AA 4DIBA 3I3OA 4LK3A 2HU2A 4FQ8A 3BYZA 1EMDA 5DCYA 1GL3A 2HK7A 4M89A 3GOHA 3PPIA 4BNKA 1ZNQO 1WWKA 4M86A 3GVIA 1ZO8A 4J91A 3PDUA 3WGOA 4BO1A 5HS4A 4WEOA 4RF2A 5H83A 4XZ3A 3U49A 2GN9A 3CSDA 5JY1A 4CPDA 5KJFA 2W2KB 3TRIA 1KERA 1XGKA 3PIIA 3PQDA 2FSVA 4NK5A 2QW8A 1BVRA 2J3JA 3EDMA 3TF5A 3WQRA 3LK7A 2DBZA 4D45A 1PQUA 1T2DA 3GRPA 5L40A 3KHUA 5L4SA 4PIVA 2Z95A 3OQBA 5LCXA 4TRNA 3AK4A 4DIOA 4LGVA 5KVSA 5B37A 2GD1O 2ZTLA 3E6AA 1MGOA 3VVCA 1FDTA 4OGWA 3ZH2A 4CV0A 5COQA 1NAIA 4RPHA 4CM4B 1R4NB 2QYTA 1GUFA 2I65A 3Q9UA 4YT8A 5A1TA 4YJHB 1XIVA 5T5QA 3ZU5A 4OIMA 1XLTA 1GPJA 4I5FA 4PZDA 1NVGA 4XB2A 4JBIA 1E3EA 2P4HX 4NZ9A 2EP7A 3LDHA 4MO2A 5COAA 3UF0A 4I08A 4ZRNA 3H9QA 3AM3A 5T57A 3O26A 4FFMA 1NR1A 1WPQA 2BGMA 2J6IA 1GV0A 1K0UA 3ST7A 2IXAA 2PLAA 4J6FA 1PGJA 4CR8A 4EEZA 3CTMA 1MFPA 3DZIA 1H2BA 4CQMD 1T25A 4XCVA 4ND5A 1GY8A 2IZ0A 2EIHA 1S6YA 1LC0A 3KBOA 1GZ4A 3PQFA 2FRDA 3U09A 2PZMA 4RF4A 1PWXA 4XYBA 3GMDA 5IXSA 1Y8RB 3ZWXA 2X22A 4XYGA 3OIFA 3ZU2A 1GTMA 4DPMA 3K73O 1E0DA 8ADHA 3C85A 3M2PA 4I5DA 2Y1CA 3SX2A 3KB6A 5LDGA 1HDZA 2GF2A 3BTUA 5U9CA 5EJ2A 2G0TA 1OFGA 4NJMB 2BHLA 1HYGA 4JN6B 5LC1A 3EZYA 1E1NA 3JQFA 1ISHA 3U9LA 4J90A 3KM0A 3L9WA 3DBHA 4B8WA 2I5PO 3S2IA 5JDIA 2NSDA 1JKIA 3RBXA 3UH1A 3E18A 4YAKA 4ROSA 5L7TA 5A5EA 1B16A 4YYZA 2B4RO 4DXHA 2I67A 3MOIA 1K6JA 4YT4A 5DOVA 1MC4A 4QUKA 2FHSA 3C1AA 3C3XA 2AQIA 4B4UA 2VOEA 4EDFA 1NP3A 1EK5A 4H7PA 4BO9A 3V2HA 1CEQA 3EY4A 3GEDA 1HKUA 3I6QA 2NU7A 1SAYA 4IMPA 3M6IA 4BO7A 2F1KA 2B36A 5H82A 3DAPA 3IP3A 2AW5A 1NWCA 3A1NA 3K96A 3JQEA 3DR3A 3WWZA 3AI1A 5L51A 4EYEA 4N7RA 3D1LA 3JQ8B 3V5NA 5GY7A 2EF1A 3TZ6A 4PRKA 3L77A 1XQ1A 2AQHA 3WDSA 1R0KA 2PNFA 3H2SA 3QQPA 4RLHA 1H9AA 4DVJA 2ZTUA 1V3VA 4J1TA 1U5AA 2PD4A 4FDAA 3L4BC 1KC1A 4KUEA 2B83A 2XOXA 4N54A 5AXBA 2QX7A 2X9GA 5CDTA 4IBOA 3TDKA 4J9VA 2Y93A 1WZIA 1F06A 5KVCA 3TOXA 4OXKA 3ZV5A 1YL5A 4LRSB 2E6UX 5G4KB 4E5PA 4D7AA 3PGXA 3DTYA 4IS2A 3VPHA 5JAMA 2HMUA 3IIEA 4GX1A 5U4QA 1N7HA 3GFGA 4G81A 4KDFA 5FEUA 3KSZO 3Q11A 4K26A 4A27A 4QXMA 6LDHA 1WDKA 4BNTA 3BTVA 1DFIA 3JCZA 3MTJA 4RZHA 5L53A 1CWUA 1GD1O 2E37A 5JO9A 4CLRA 2AG8A 5JAIA 2X0RA 3F46A 1NR7A 5CEJA 3UAGA 4PLVA 1HDGO 2DBQA 2QHXA 1ZVMA 5K9ZA 2DBRA 5JO0A 1OOEA 4GAEA 2AG5A 3NUGA 4CV2A 3ROQA 1BHSA 4J7UA 2FY8A 3NGXA 3QRWA 2I66A 2DVMA 3P19A 1XU9A 1CRWG 1LSOA 3T4XA 3WQSB 5KJ1A 3A14A 3GG9A 3CINA 2GUGA 3QW2A 1GDHA 1WVGA 4L8VA 4ND4A 2C2YA 1T2AA 2G17A 1C1DB 1LUAA 4XA8A 5EESA 1N9GB 1JTVA 3MTGA 2BFAA 4QFCA 3ZNQA 3WLFA 1P3DA 1UR5A 1J49A 1DSSG 1T1SA 2WM3A 3H9UA 4CMIB 2C59A 5L7YA 4WLOA 4IIUA 4IQ0A 1PGNA 3QVOA 4CQLA 4CUZA 1P44A 4W9NC 5T67A 2DU8A 4A2CA 2GRAA 2FWMX 3LC1O 3QLJA 3U3XA 4D3FA 3ENKA 3TWOA 4OAQA 4BB6A 5MGBA 4J3FA 3CIFA 1PR3A 4F6CA 1DFHA 3C8MA 3MCVA 2VRCD 4E21A 4KUGA
chains in the Genus database with same CATH superfamily
1YR2A 3PXGA 1R4MA 2HZ7A 4FCVA 3B7GA 2LDBA 2R5FA 2H4FA 3FPAA 4IRXA 4ZV9A 5TQ0A 2P3QA 3VZRA 5CITA 1G41A 5KJ6A 3O92A 1QM5A 1AF4A 4HMQA 4LA4A 4X7BA 3RUIA 1VRWA 3I6IA 3C8DA 2ZYUX 3D6VA 4L8FA 4CQMA 1IBMB 4TN5A 1J1UA 1WCIB 5T3YA 4BQFA 3HDVA 3UCEA 2B34A 1CDEA 1LRKA 4Q1DA 3UJ6A 4KGXA 1FU7A 4C6TA 4EQZA 5JADA 3MAAC 4QOIA 3F1LA 1T9HA 5B7PA 3IQDB 2QLMA 2UKDA 2ZJ4A 4D6YA 4EJ6A 4LFAB 2J46A 3FYCA 2EFDB 2BCEA 4P92A 3ZG6A 3BRWD 2DPMA 2REQB 2FZCA 3VOSA 1RYDA 5K0JA 1GRQA 1VJ5A 4ARIA 4U3JB 2WWVD 4PGMA 2BELA 2HIHA 2ONCA 3C3DA 5AYVA 5LKRA 3NHZA 1BHJA 3EZ6A 1ZUIA 2XI4A 4JLNA 1QKKA 1W34A 3RFVA 1H9CA 1KU0A 1PJQA 4HDNA 4MUFA 4R3WA 1VLJA 2A30A 1BFDA 1WKVA 4I1OA 1P74A 5EIBD 4XD2A 1GAWA 2O50A 1AKTA 1SC3A 2CUZA 4PRLA 5LZ4A 1QE0A 1AUOA 2YY5A 3IKJA 3WL4A 1O95C 4KMOA 3H5IA 4AY5A 1SBNE 3B1JA 1AN0A 3C6BA 3IIIA 4HPWA 2QQ0A 3EMDA 1DE0A 2NX2A 5E6RB 4MJLA 2J3EA 4YDRA 4G1EB 3CT4A 1NVVR 5FPPA 3W5SA 1H0HA 5M2QA 1AH2A 3T52A 1XALA 2DQKA 4JU8A 4O8CA 3PGVA 2FVYA 1O2DA 1FSSA 3AT1A 2FW7A 3BRQA 4XDYA 1YZKA 3P2KA 1GRNA 4DV6B 2QOEA 3MXTA 4QNMA 1BKDR 5ED0A 2XTNA 1H8HD 1SVNA 2WILA 4AJ2A 1CZNA 2V7XA 2JH9A 1LKZA 3B2NA 3HMKA 2YY7A 2YJ5A 3LWBA 4X8MA 1Z75A 3LO8A 1EJ6A 1U2GA 3AY0A 1A8IA 4C0JA 5TPWB 1U3FA 1VI2A 1AKYA 2AJTA 4Q4JB 3TPCA 3MT9A 4NESA 5BPFA 4L78A 4TS4A 1A9SA 2NUPA 1IJKA 1R0RE 4CCWA 2FN3A 2ZRGA 3FR8A 3X1XA 2B4TO 1NFFA 2C9BA 2HPZA 3L7CA 4GD3Q 3ZVRA 3BFPA 3LLUA 5AVKA 2VF4X 2VC2B 3JSXA 4ZYWA 2PU7A 1QFSA 1Q3HA 1N7GA 3OX3A 4FZ3A 3ICCA 4YR7A 3JYPA 3DDUA 1HE4A 1ZMBA 3OZCA 1XHLA 4RZ3A 4GWLA 3C7DB 4B9EA 2C1XA 1U90A 2JFNA 1E3WA 2ZRCA 2XCSB 4JP3A 1LTQA 2MMGA 3RFUA 3ZJUA 2UZAA 4NAVA 1T9BA 3DDSA 3OO0A 4PLCA 1JEEA 3BWVA 4N9QA 4FBGA 4P3XA 2BEWA 2H9YA 4BKQA 5B6PA 1SELA 3J81A 5D51S 2Z5GA 4FMCF 2CHGA 5EERA 4YV0A 1SKQA 3VVBA 4AG6A 3Q0EA 1HRDA 3CZPA 2QN2A 3MD0A 2IU4A 2EHDA 3R5FA 1RFGE 1KI1A 1T1GA 2GHRA 2YN0A 3CF4A 4JI7B 2OLEA 1OZFA 4US0R 3KLMX 4F45A 5LMUB 4QAQA 5C18A 1T8WA 2AFIE 2E48A 2G04A 4IJVA 1LPBB 3LQ4A 2ATEA 4MVWA 4Y6LA 3N59A 3TN7A 3VPGA 5CCBA 2HHLA 3UT5B 1XL1A 1E2FA 4NQRA 1JBKA 3GFRA 3AEZA 2AC4A 7GPBA 2Z6UA 1XMVA 2EIXA 3AETA 1WQ1R 5DHSA 5AVOA 3R44A 1PZGA 1E2DA 3WNQA 4C0BA 5DHFA 1U6KA 1VZ3A 2VDVE 3QM1A 4FE7A 4Q19A 4WQMA 1XF1A 5HRAA 3W5UA 2FK8A 4DZTA 3ZLJA 3TMKA 5CMLA 1K92A 5IVPA 3OTQA 2HIMA 4PS0A 1E96A 5KYTA 3OWOA 1S02A 1EM8B 4JT9A 1MOPA 1TZCA 2WKRA 1G9TA 3EVAA 2FF7A 2RGEA 3B3QA 1WDLA 3ESDA 5FNVF 1Z0IA 5D3QA 2PH1A 2OCIA 3ACCA 1WLSA 3ANSA 3KU1A 3O91A 3WLTA 1UDCA 3VR0A 2BKLA 2QNRA 2VWQA 4MS1B 3W5AA 2A9QA 2FJPA 2XBLA 3NVKI 1DC5A 2OOSA 3VMFA 3NBFA 4ITRC 2CFTA 2GGSA 2GPNA 3VV2A 1FXWA 2O20A 2Q6OA 1M6NA 1ZN8A 3CMCO 3DMDA 1QH8A 4GE3A 4OF4A 3NWEA 4IS3A 5BN4A 2WYOA 2HRCA 4YK7A 2WD7B 2NU7B 2NUAA 2VDUE 3EXFB 3E4CA 5CB0A 1YU6A 2H4HA 2WUDA 2X23A 3AHJA 3R3JA 4PCAA 1HLDA 4MPJA 3TFQA 1I2DA 2V3VA 1V9CA 3QE3A 4X44A 4E70A 2V0CA 4MVJM 4AMVA 1G8YA 2YIJA 1P39A 1OI4A 3FTEA 3R5JA 5JS7A 2XBUA 4TQGA 4ZAWA 3J7AC 1I5OA 1N2CE 1DDOA 2F3PA 1DAEA 1TLLA 2NYUA 3PJFA 4M0CA 4OKIA 5IKEA 4B3GA 4CKBA 3H83A 1IWPB 4X91A 4QO8A 4D92A 4DQKA 4DKJA 2CXSA 3TGPA 2GJAA 4CG2A 3PEWA 1V9LA 4R1UA 1EXNA 4DZRA 1G21A 2NU9A 2VDPB 2ZBQA 1SM4A 3O2QB 4MKRA 4BV8A 5JCPA 5FJJA 2P6PA 2A9VA 3D8NA 2UUOA 4MLCA 2RAUA 1YKFA 3N2KA 4FXPA 5EKXA 3A4YA 4N41A 4UAGA 1HDXA 1EFLA 5AW9A 1QKJA 1ZD8A 2FHPA 3WBKA 3C6YA 5GM2A 4AYWA 4INJA 2ZWOA 4IZ6A 4RY2A 4LMBA 5HP4A 3FHLA 1OAKA 2AKAB 1CUIA 1JEJA 3BD8A 3C24A 2J9ZB 2VO1A 3I2GA 3A7EA 2ZJYA 2IIVA 2Q6IA 3PWSA 4LNUA 1UT5A 4AMBA 4K86A 3Q4GA 4K6HA 4DREA 3BJEA 3IS3A 4M1WA 3G59A 2BMVA 1YQGA 4YRIA 4OHUA 3RVOA 4EMSA 1YT5A 1D8TA 3ES9A 1A98A 1CY8A 1FNMA 4JV5B 4JLDA 2ZK7A 3I9V1 1G8HA 1QZUA 4YMVA 3OFKA 3BD9A 4BCCA 1I32A 3LBNA 1LPMA 4KR7A 2P2ZA 4LQCA 2E5FA 4MPRA 1KKUA 1Y1PA 2R79A 3OKFA 1SBIA 4JGBA 4DWWA 1APBA 1E6EA 3QWHA 1E5TA 4KACA 1BXRB 1XNQB 5L45A 3BMCA 4YJ3B 4A0QA 2D2EA 5L3SA 1ZBQA 4LY9A 1YIDA 4ERXA 3DMGA 2W22A 2R8EA 5JJLA 1FTNA 3PXCX 3DDNA 3NONA 4O02B 4U6NA 4RPKA 2ZZKA 3DLPX 1TVKA 4UD6A 3WLNA 3T4UA 4JVMA 2GAJA 5AFSA 1P9OA 3W7VA 3AF0A 3P4XA 1EK2A 5CHYA 2JKVA 5JSKA 1NLYA 1O94D 3HU5A 1ZAYA 1SCQA 2ARKA 4BN4A 1NN0A 2O7SA 2RB4A 3C3MA 4AB1A 1M34B 1UANA 2VJLA 4OJQA 1DQZA 4OLJA 1OU4A 3FN4A 3QVWA 3RM3A 2GETA 4XEHA 3R40A 2J3MA 3KEFA 3SDBA 3TKAA 3WO1A 1OX4A 5JD6A 5K4HA 1F7VA 4I4LA 2I3BA 3IOYA 1E6UA 1RDFA 2ODNA 2PX8A 2BEUA 3G1TA 4OA5A 4PYLA 5KYGA 1Y9JA 2BRUC 3EXHC 3G2HA 3FYUA 3OU2A 3Q8XB 2NXCA 4F2WA 2NO9A 1LPPA 2E3JA 1I10A 4KXQA 5CDHA 1HETA 2IDKA 5IFKA 3UWPA 1SPXA 5DBGA 3VI4B 4ZT3A 1WZNA 3EWAA 2ZEJA 4GI1A 1XDSA 4JHLA 2A9FA 3P2YA 3VV3A 3D7MA 3F5MA 4NTZA 4M49A 1T3LA 4Q0MA 3B1XA 2ZCVA 5B1DA 4FYIA 1ZZEA 4LZOA 4AS1A 1TD9A 1IB0A 2WG1A 3R7FA 2GZ2A 2P2LA 3RS7A 3VDXA 4LWZA 1ZA2A 4LJSA 5JQGF 3CVUA 3LZCA 3REQB 3LUBA 4XI9A 1K86A 1THGA 5AK3A 5JS1A 1T2UA 1Q1NA 1T8SA 4BKOA 1PYGA 1AHIA 1PHRA 3H7AA 1CNEA 5DPMA 4F2DA 1V5EA 4JXXA 3R7SA 4HDQB 3U1VA 2R85A 1GGVA 1Y5RA 1EBFA 1GPYA 2C2ZA 2CLFB 1MIHA 2M6SA 2YUTA 3D54D 3Q0TA 1LW7A 3FPBA 3Q8KA 5CDYA 3H0CA 4BXOA 3R0QA 4TYWA 3PNKA 1JEOA 4NBLA 3W3AD 4BP8A 3QE2A 3A28A 2IODA 1G5FA 5DX0A 5KU1A 1B15A 5FFMA 1ADFA 2J6HA 2LXNA 3U7QA 4W5RA 3RRZA 4FJ2A 2IP4A 1G9SA 5CT9A 4DQVA 1ZYUA 3AR7A 3PXBA 4YHBA 1HT1E 1K9VF 1PNOA 1ZGBA 3ID6C 1P0QA 1PV2A 2XGOA 1DJOA 1TZMA 4BO0A 4AVYA 4JYAB 1N5JA 1X80B 4C4ZA 5DNVA 2YJTD 3IP6A 3QIVA 4YAGA 1PZHA 3GRKA 4JB0A 5TVGA 3O21A 5JZOA 2Q1SA 4OEHA 4V03A 1D4OA 3O94A 3ZY2A 2BKEA 3H8SA 3VHXA 4CM8A 1M0EA 2AIRA 4ZI5A 2HYIC 5GINE 1AUQA 3KQKA 2FFBA 5CP8A 2IXTA 2C9OA 2LRHA 4UU0A 5G0UA 3O8OB 5FWXA 5LD2B 3CLUC 3SEFA 3W7AA 1E2KA 2P79A 3HYCA 1U1GA 2PNJA 1PLLA 4Q48A 4WGGA 2O8VA 3ZW9A 5JNWA 1QQ7A 5JRZA 2PUAA 2FV8A 1Q7BA 4BNGA 4PQFA 2V9CA 6REQB 2EBFX 2NU6A 3K0KA 4IEIA 3U3RA 4EF5A 2YQZA 3KIPA 4XFKA 2PUFA 1THTA 3TJRA 4PSUA 5D1HA 3EIEA 4W63A 2TMDA 4RETA 2P11A 4C2AA 2JW5A 4BB0A 2Q2WA 4W5TA 4LJ5A 2Q1UA 4E2XA 1A88A 1V8BA 2IKSA 4Q3DA 1QHSA 5B58T 2Y76A 3HG7A 1SUEA 2EZUA 4V0SA 2YZMA 4II7A 2KB0A 5KB3A 4BEJA 3NC1C 2Q3JA 2R6FA 1GPAA 1DPFA 4X94A 3RSOA 1Q19A 1IUOA 1UBHS 4RD4A 1CJVC 3GXOA 3PDCA 3RFXA 5HUHA 1Y8ZA 3ANLA 3GJ3A 1ZH0A 5UKDA 4H4CA 2D06A 2BTOA 3UA3A 4EMTA 5TQ2A 3WKCA 1NTRA 1W47A 4LDNA 2FWRA 2ZIUB 9GPBA 4IFTA 2XNDD 3HRIA 3A9CA 4BYMA 2H2HA 5BQ3A 1EUDA 1FYXA 3MGGA 1T35A 1NG9A 3NX4A 3OCJA 3HCNA 1ISRA 4XB6B 4XQGA 1E89A 3KUXA 4YI3A 2JLAA 3QUCA 3F3YA 1BH6A 1HNZB 4G0NA 4CIDA 2YJ3A 3DZFA 3B38A 2GZDA 1CKEA 1T36A 5BSMA 4AJHA 2IH4A 4JU9A 2GQ0A 5H02A 2GCNA 2YTZA 3NRBA 4REQA 1K5GA 4LC1A 3T5GA 4EA7A 2HA2A 1RLTA 4KX5A 3EVCA 3LKBA 2VDQB 3EAQA 2ZIXA 2XA1A 3G0DA 4FWBA 3WSTA 1FRQA 4JJ7A 1P9NA 3N75A 4IIFA 2PWZA 1RLMA 4IKPA 5DK4A 2BFFB 2CLEB 3I5MA 5BW4A 2QJFA 3PSAA 3AUJB 3FJYA 2FPGA 4ZVRA 2PUGA 5CVCA 1J6UA 1JQDA 2HWUA 2AGVA 1J5XA 3PT9A 2VNAA 1T8UA 3QUTA 4X20A 3FX2A 4BDSA 1Z0JA 4RDIA 5J5CA 1RWQA 2R1TB 5LM3A 1DBQA 3BC1A 3NVAA 4DC1A 4PYJA 1Q91A 1UBOS 4DC0A 4BGIA 1I5EA 3Q85A 3ELWA 4EUSA 1YDMA 1GTJ1 1RKBA 1WU8A 4OP3A 3VC2A 5DNDA 2H2DA 3WBJA 2FSPA 5C8YA 1UXKA 2B1QA 4MR8B 3N74A 1DMSA 4FKMA 1CZHA 2DHEA 3N9IA 1NMXA 4BNXA 5BUZA 4OLAA 4ID9A 3FGPA 1G5RA 2C7VA 3TZLA 1TKBA 1QR6A 2PGOA 4U8HA 4ZYTA 1Y63A 1D2GA 1IBCA 1RLOA 2GEFA 3QWBA 4LDPA 2XNJA 3MINA 4B7ZA 4RDHA 1OH6A 4OTZA 2E21A 2B4AA 4OLBA 1IH8A 4WLVA 1LDBA 2HWKA 4E3WA 1L4YA 2UXDB 3LVRE 3AX6A 3K9NA 1XZCA 2AEMA 3LDAA 4QOJA 3L8YA 4PAGA 1AZTA 2HX1A 2XMDA 3EG9B 1PR1A 3L8FA 1L5VA 5TRTA 4U2EA 2QYHA 3DDOA 5FUXA 2NV2B 3E82A 2Y1DA 2EKDA 4RS3A 4YQFA 1DRUA 1CUDA 2XYHA 1VMIA 2IHTA 2GLUA 2RAFA 4N3GA 1ADBA 4I1RA 4YCDA 1TB4A 2NSLA 1X77A 3E70C 4B3DA 3SYLA 3R3SA 4PVDA 4X61A 3AIMA 2P9HA 1GR0A 1FFEA 1K89A 2VH5R 3I1JA 3WWEA 1XPRA 4DMUB 1N2XA 2VK2A 5LB2A 3IUYA 1PTKA 1MOQA 1M10A 3CUKA 4RVDA 4RTQA 2BGJA 4GGPA 5KHLB 1VE7A 3OF3A 4TKZA 3WB9A 4G09A 3K9HA 4K2HA 4KCGA 4I66A 3KYIB 4V2UA 1XD8A 1RI5A 3FG9A 3OI7A 5AW7A 3WS7A 1KP3A 5DP1A 1IDOA 2WA1A 2QVZX 2DFDA 1JMKC 3CVXA 4RD3A 2UYGA 2REOA 4FDVA 4HT3B 3B1FA 2QUIA 5E1OA 4L16A 2Z2ZA 5HKBA 1YHNA 2PV7A 2Q1WA 3R6TA 1GFIA 2VK1A 4ANFA 1SVSA 3UGKA 1TE2A 3RIMA 2AZXA 1OVMA 4YIHA 1UCFA 1F2DA 1LRLA 3Q1LA 5HQTA 1EUYA 1YTUA 2X4LA 1A8SA 2W2OA 1T4BA 2J32A 1IRIA 4GZ3A 2CXNA 2H1SA 2FPPA 2TSYB 4LEIA 5GJWC 2B8WA 3P9NA 3WGNA 1YL6A 5K0BA 3PNPA 3PGMA 2FVXA 4FILA 4BP3A 4MLPA 3EULA 4RQAA 2P4UA 5LP6B 3DW3X 4ZVQA 2X8JA 5KNBH 2O8FA 1NPDA 5K2MA 1MAHA 3FETA 3X1DA 5LP1A 2BM0A 1R10A 3BMNB 1L3IA 4ZEWA 2W71A 3RYIB 4KB5A 2WT9A 1GZSA 2HO4A 3CJRA 2QN6A 1MP0A 4ZIRA 1KQFA 1BS9A 2X0IA 4KPEC 3OQIA 3UY4A 4LRWA 3AHGA 3ON5A 4TMXA 1Z34A 2NXNA 4HKTA 5ERGB 3M1AA 2OENG 4B75A 4A5SA 4DN6A 3JVEA 1OIXA 1TAUA 4EPWA 3WRXA 7ADHA 4A6PA 1WUKS 2GM9A 4R69A 4TPKA 4Y6QA 4EKYA 2Z6QA 4KBFA 3IEMA 1I1NA 1LBIA 1XYYA 3WI7A 1G20E 4X6XA 1J9ZA 2WD9A 3P7MA 5K0FA 4NIMA 4MHTA 4URFA 1L5QA 5TS2A 3IUJA 2OCAA 5IMBA 2ZRJA 5CVVA 1W4AA 1MTOA 4I46A 2J3HA 4JR1A 4BVAA 3ETCA 4L7QA 2J3QA 3AL2A 2VWGA 4HQOA 4JVSB 3T3HA 2Z98A 5LYJF 3J80A 3GFVA 1FMLA 1H94A 2OORA 2QZJA 2H11A 5GJCA 3JQ7A 3S1AB 4CL3A 3GQBA 2IHBA 2QD1A 3MA0A 4D3ZA 1Q1ZA 4LGMA 7MDHA 2JLWA 4KO4S 4DR7B 4UEWA 4WBNF 1AKNA 3MJVA 1UWKA 3KSDO 3R9KA 2ZR7A 5GGYA 1S01A 4NI5A 2JLXA 4YP6A 1RP7A 2XSZA 4PGGA 1ZMRA 2R11A 1T9KA 4EHNA 3JQ6A 1F3LA 5DNWA 3ZWMA 5BR7A 1A9YA 1L7VC 4MP6A 1OAOA 3DO5A 3EA0A 4S0XA 3CEAA 1EDZA 4M83A 2Q2VA 1CEYA 5DM60 1FYFA 4F4UA 2QSYA 1PQPA 1SWWA 1T0HB 1OH5A 3IKTA 2AX4A 1Y4SA 3DMRA 3WV5A 2A5JA 1NDHA 1YZQA 3GZNB 1KAOA 3IT0A 1AA9A 4Y18A 4FLFA 3MQFA 4EF6A 1UBEA 4MQ5A 1N7IA 5C8XA 3THWA 4YQEA 4GLJA 4EA6A 4V3BA 3QH4A 3V97A 4JC4A 4EG6A 5AUOB 1G38A 1W29A 4OXQA 3SZMA 2NV0A 1CJSA 2YWRA 3KELA 3D3JA 4CT5A 3O8QA 2BT4A 2ODAA 4JT2A 1R6DA 4FUTA 3E3MA 4E2YA 4EG7A 1VI5A 2IXBA 2HCRA 3NT5A 4BAZA 2IY9A 1E2JA 1N9ZA 1VBFA 3OJWA 3D6JA 2A84A 5F7JA 5H9VA 5I01A 1TD1A 4MVJP 5BNWA 3I1FA 4RFVA 3V4VB 3IHLA 2EX1A 1GCUA 1IEWA 1B41A 1VB3A 1QX3A 1T5OA 5DBOA 2D2FA 4FHFA 1SFRA 5G0TA 3PGJA 5LXTB 3NETA 2D59A 5B53A 2I6FA 2QW1A 1UKBA 4B2LA 3RS9A 1RQRA 2RHBA 4DLVA 4P32A 2NU8B 2NVUB 2RG7A 4FFPA 3DZDA 3VMMA 1K7SN 2DECA 2W2PA 2XB8A 3MWYW 3NUQA 5LBIA 4Y8VA 1JVBA 4E5UA 3HMQA 5IBQA 3AL3A 3ZU3A 4WKCA 2ZE7A 3GDWA 5BSGA 1FXUA 1E7RA 1XRQA 4UEKA 1RRPA 3JQ9A 1A04A 3BSYA 2OPHA 4WLEA 3ZIDA 2G9VA 3R5KA 2QU7A 3EQ7A 2JGJA 4N5MA 5K1ZA 3TTTA 4LYJA 1UMCA 4M6WA 1D2HA 3PTAA 5NULA 2E4ZA 3MTEA 1JEQA 1O3YA 2GJ9A 3ENVA 4CMJA 2PUTA 4JUCA 4AY2A 2X5JO 1PU2A 2RBGA 3NW9A 1JH8A 4ALMA 1BH2A 2OFPA 5E1BA 4QLBA 5HF9A 3PYLA 4F3YA 2WIGA 2VDJA 2G76A 2R68A 1U4SA 1NUUA 3ZK7A 2WJGA 1VJGA 2FMFA 2XCUA 1TEHA 3H2BA 4JBYA 3OKPA 5SY6A 4FT2A 5CB4A 3SJ7A 3X0DA 4LF7B 2PWAA 4GC9A 4AECA 5A9SB 4I4TF 3U7HB 1X70A 3EOZA 1J8FA 3BMQA 3WMRA 1SC4A 3SYRA 4UMDA 3QJ5A 1IHYA 2GARA 1WVIA 3RC1A 1ONPA 3FHOA 2H08A 5HCUA 3ZGYA 3IMFA 1CY2A 3GF4A 3SQOA 4CIBA 1SHKA 3CH6A 4DR3B 2ADOA 1KR2A 4K05A 5FOQA 1WF3A 1ZY2A 4GP9A 1DAKA 2ZPAA 1C9NA 4B3JA 1KZ1A 2WSSD 1T9DA 3FF1A 5K3EA 1R27A 3NWJA 3PTLA 4LJ4A 4RGBA 1MJNA 2GPTA 2O0KA 3JYHA 3PUKA 4ZWNA 1KTIA 3EVTA 4OL0A 4Y6GB 1Z0SA 1PG5A 2VCYA 4X63A 2OM2A 3GLIE 2J85A 3DEJA 4RNCA 4XVUA 2OGTA 2XRYA 2JKZA 2ZE5A 4OBXA 5C4IA 3RYCA 1MB0A 1MLDA 2EZTA 1RNLA 1CUJA 1GYRA 3O0TA 4M0PA 3HUEA 3X1ZA 5M3BA 5F3DA 5HIMA 4KP7A 4C5AA 4EY7A 2ZT8A 4EVQA 4J3NA 5CYPA 3N2YA 4TUYF 3NANA 2AOVA 3BIXA 1V7CA 3GLTA 4JMPA 1C14A 4AWXA 2HA5A 5C4GB 2J0QA 4OMDA 1ZVQA 4FKBA 1JJVA 1E62A 3GJ5A 3N8IA 2PUEA 1DAPA 1WA5A 1A69A 3IA2A 4JT4A 4OHCA 5KNDA 3ICEA 2WIKA 1B3BA 1DEXA 4BP9A 2UZ3A 1ZU4A 2ZBDA 1KR5A 4UCQA 1KIFA 2HCBA 2VUIB 1PWYE 4ZU6X 3AH8A 2BW0A 4L15A 4YP5A 5FL3A 3R1IA 5THQA 3K8YA 3QFTA 1U98A 3T4EA 5I7OA 2PS1A 3DMNA 1AO0A 2WWHA 3JQCA 4X64B 2JASA 4WD3A 1SRRA 1VA4A 2ECOA 3D6NB 3LA8A 5C1PA 4RKRA 2VQDA 1TJYA 2CL0X 1F51E 4P81A 2A9JA 1QBKC 4J9UE 4PYNA 5A0FA 1Y3DE 4IHAA 3RK4A 3WRYA 2I55A 1C3XA 2OP1A 1F14A 3DOHA 4MB0A 1XDWA 3BGWA 3W5IA 3TVTA 3P0EA 1IEXA 4ZO8A 1WX1A 2ISQA 3KJFA 3MXOA 3AW8A 1WUIS 3LF2A 1T91A 2JGKA 4HG2A 3IUEA 4NCHA 1ISIA 2PIDA 2X7HA 3ZDEA 1EI9A 4ARBA 1G16A 4BWFB 4DG5A 3Q8WA 1G0OA 1LA2A 4CL8A 1OWPA 2WYIA 3GHHA 3GHYA 1RTKA 1Z6PA 2QX4A 4OHRA 1DIGA 1AX9A 1I9CA 3UO8B 2P69A 1I7LA 4F1JA 5JEEA 1RR6A 3CLUD 4DLSA 5ALPA 3RNLA 1E5VA 4BFWA 4L85A 4PG8A 3R7NA 4HH0A 3UMCA 5K0GA 3CC8A 5TPZD 3X1WA 2VNKA 1U7OA 2YNMA 1J25A 3AR2A 2ZJZA 3N8KA 2BHTA 4AURA 3JD1A 3LVQE 4HEQA 4YB8A 4Y1GA 2PK3A 3NHYA 1C9KA 2YHIB 1SVUA 2DETA 2R65A 4GEKA 4QYXA 4D8TA 2KLBA 1OXUA 1PL7A 3NDIA 2LV8A 2HDNB 3G13A 2I2CA 3IPRA 4TT3D 4EFNA 2V9ZA 3CX7A 4MIEA 4O5AA 5JFOA 2AH5A 3T15A 3NGMA 4TMYA 2XDQA 2DOKA 4H7IA 3SSOA 5HKKD 5AUQA 4BO6A 5HJ5A 4IIVA 1NE2A 4DG9A 4FSXA 1Z5PA 4IJMA 3QY0A 4DWVA 1FQKA 4W5QA 1T26A 5JU6A 1D8AA 1EP1B 2ZSEA 2N9UA 1L4EA 4LGYA 5JMPA 5DHPA 3DBHB 2WJ3A 5LR6A 1DB3A 9LDBA 3UHPA 1O96A 4B4OA 3H0EA 2JFZA 4BQEA 4JI6B 4E94A 2CXQA 3VHRA 3TSYA 1JZTA 3OLWA 3OOEA 3GZJA 1HE3A 1P91A 4OI1A 3FSRA 3SXPA 3TL3A 5FOWA 4RTKA 1TU3A 2X4IA 3NS7A 1AKMA 4TWIA 1YS4A 3T5TA 4YMGA 1KSJA 1G55A 4R41A 5JSFA 5KZMB 3KOOA 3DQPA 4QU9A 5E8JA 4LFBB 3R3YA 3N7UA 3PBKA 1ZHOA 1LEHA 4LHYA 1TF2A 5ARDA 3ZDXB 3N0XA 2W98A 1FUUA 4N7JA 4GMXA 4JKYA 1XNGA 3RYHA 1E7SA 3DE7X 2C7PA 2BF4A 4MMXB 3RLFA 3E9CA 3V1MA 3AFOA 4JXKA 2YL2A 4UMEA 3UM9A 1KI9A 2XKBA 4NULA 4BLWA 4DF3A 3GGOA 4KTTE 5IEBA 4EKGA 1BDJA 1M1XB 4DVGA 5DO9A 4I14A 4GUAA 4DUYB 1DRWA 1GR1A 1XXHA 4I36A 5DTJA 3T7EA 4JI8B 4QQ8A 4R8KA 5KYXA 4HLCA 1CLEA 3WBBA 4DCVA 4GOOD 3F9IA 3GQVA 1PNTA 5JRDS 4ZXFA 5TV2A 1OZ0A 1QIJA 4C0WA 4P84A 3CNLA 4JZYA 1FTYA 4FMPA 4O25A 5E4JA 2XGMA 1V7QA 3NYQA 4HAWA 2OHOA 3ONDA 5AXCA 1RPJA 1W5FA 2A1TR 3QZUA 5IJAA 4KWCA 5CCEA 3ONNA 3WLPA 3T95A 1CCWA 2X2PA 3KXPA 3ZBTA 3HZZA 2V5AA 2XMQA 4IOMA 3DPIA 1X2BA 3WLHA 3ZLTA 1NNSA 1TYBE 1XZPA 2H59A 5C81A 1F2UB 2NO0A 1Z5ZA 1ZKMA 2WKQA 4NAHA 3SHVA 3EUFA 5TARA 2DWQA 3CT6A 1KI6B 3HL0A 3FUTA 2W6NA 4BVJA 3GI1A 5JTTA 2V6FA 3F5SA 2CLCX 2DHQA 5DHUA 3ZLVA 4FQ5A 2YFQA 3WGIA 4DA4A 2GPWA 3FNGA 4MZDA 5GMOA 3U19A 4C29A 1LPNA 2V55B 1DUSA 3BBLA 3CR3C 3AHDA 1R9JA 4YPOA 4HNVA 5BMVA 1TX4B 3SC2A 4B3RB 2QN3A 2H1CA 2O1EA 1A8QA 3K8ZA 3TQRA 1IC6A 1GCGA 2FQXA 2X13A 3OCUA 5EZYF 1QFYA 4U2GA 3UVEA 2P9EA 1R16A 1Z7GA 2FEMA 2G0AA 4XWGA 4J16C 4M22A 2QJRA 2GPYA 3H99A 1C3OA 3ZHZA 1DC3A 3NOOA 1T3ZA 1WRBA 2QRMA 2WAAA 3C8ZA 4L4XA 4A26A 4C5BA 1JSLA 8GPBA 3OT5A 3QOXA 5KYUB 1GGKA 2WU1A 2OLKA 3G1UA 4BTVA 2XA9A 1WQ4A 2PH7A 5B1YA 2FZKA 1LSSA 2ZKLA 3PKIA 4UUNA 1ATIA 1Z22A 2FUKA 3OCCA 3VU9B 3C0KA 1UAAA 1GIAA 4M54A 1DG3A 3S27A 3V2UA 3VXKA 3ZLBA 1XTBA 2QXYA 3IOBA 3P4YA 5LLSA 1X8JA 1YULA 3KB8A 4FQ7A 1FP4A 1FQWA 3MZ0A 1OBOA 4JMLA 5D3MA 9LDTA 4PTLA 1W2WB 2V7EA 2Y0EA 2Q27A 2ZUCA 3TVYA 2FSFA 3K4PA 4LVOA 4FDTA 3ZXIA 5K8LA 4L8GA 2Z2XA 4X93A 2ZI3A 5BN3A 4GPBA 1NQTA 2TYSB 4JYBA 5KPDA 4DV4B 1Y6GA 1XK7A 4EEXA 3CVWA 4XSHA 3VSCA 2IBMA 1WQ3A 3PFGA 5THKA 1DLJA 1HF3A 3OQHA 3OX2A 1V4BA 1B0PA 3F4BA 3CGGA 4U39A 1PEDA 2G88A 1U0NA 2WP0A 4TVSA 4L5CA 4BMYA 4GQAA 4RFSA 1E20A 3HJCA 3SM9A 1N36B 1U80A 3AQIA 4WK6A 1NLMA 2VCHA 4X8LA 1UXJA 1Z82A 1WSDA 1VM6A 1XZFA 2DH5A 4OLHA 1LSJA 2PTHA 4RSHA 4TRJA 1K4YA 2IW3A 1WBDA 5F12A 3F97A 3RUPA 1KEVA 5B1SA 2YYZA 3Q3VA 1YVEI 4IHJA 3SQLA 3ZVMA 1GQFA 3TGWA 5B1IA 4RYDA 1J8DA 3MVEA 3LIPA 1LJ8A 3X3HA 3K0AA 4MW9A 2R44A 1AKRA 1DTWB 3LLVA 1QIFA 5CYFA 1IJFA 3F8TA 4MB2A 5DW0A 4B48A 3GLSA 2AZMA 3LKDA 3PTZA 3GAZA 4HMOA 4A3SA 1LBSA 1QOQB 1HBJA 3DGEC 4YAJA 1IHXA 1XJCA 1CE8B 3CZ5A 3ITDA 4BVHA 2CHQA 5JD4A 1R0WA 4EG3A 2PMEA 2OD2A 4LHSA 3OMXA 3U4AA 5BP7A 2Y1KA 3HNOA 3JPYA 4IDEA 5JNRA 5CJPA 2ET6A 1QLHA 1C0LA 1QFZA 2RGYA 1Z4LA 2HCTA 1JTFA 1D4AA 1KYXA 2Q1TA 1XEWX 1COZA 4UTZA 4YRTA 2AD1A 4ZCLA 3B3FA 2HGZA 4TL8A 3NOXA 3W0LB 4BNJA 5CA0B 4CHTA 3ENWA 3DTVA 3QTBA 5K8CA 1G4AE 4TZKA 3PV0A 3UGTA 3V8BA 3EZ9A 3IR6A 2C4TA 1GCIA 2Q5JA 5EWMA 1KJQA 4ZVKA 1H5NA 1VRVA 4ZVLA 3P9XA 3I5XA 2QAGA 1U0EA 1UF9A 2CJXA 2EEPA 4BMZA 4D8VA 3U4QA 3L5OA 4GXNA 4ESHA 2ZWMA 1NBWB 4NU0A 5B55A 3W06A 1Q1AA 4ZQBA 1VKOA 1KVUA 1EYZA 5K8UA 5KYWA 3VGJA 3SVTA 5LZ5A 3HU1A 2GOYA 3WZ2A 2Q8PA 4MQLA 1L2TA 3BHIA 4C03A 5MN6A 3MHTA 4HAUA 4RPGA 1K7EB 1ZW1A 3IVRA 1YQXA 2X77A 4IVNA 3SFVA 4ZDWA 2FPSA 1XDZA 3FYHA 1STOA 3D2AA 3DV0B 3NGLA 4FBLA 4ZT6A 1AQUA 1WCIA 3D2LA 3LAWA 2A4MA 3GLFE 3L8CA 4Z0PA 1PK8A 1KQOA 2FW8A 4PIPA 2V4UA 5F1OA 4YRLA 1KEKA 1MOZA 4HC4A 2X9VA 1JJAA 1XPOA 3B52X 2XH8A 4N18A 5M5BA 1MG0A 2DCUA 4LQLA 4FOTA 4OXNA 4O2AB 2H5JA 1IATA 5FADA 2J33A 3R3UA 5JSZA 1CJTC 2REQA 3KTAA 2WYHA 3D0KA 3DKKA 5F2EA 1EDBA 1WPGA 3NP9A 1EDDA 4PBTA 4OY3A 1Q21A 3GNLA 4XASA 4Y6OA 2V4MA 5JHHB 3C3BA 1UL1X 4ND8B 1CS0A 3COPA 1GKUB 4IKOA 1OE0A 1UBKS 2PKRA 2PX4A 1WM1A 4E88A 5DXFA 4BZPA 5FHRA 1BMTA 1ND5A 4EO7A 4HH1A 4DOMA 2WFLA 5CW2A 3ZHTA 1Q0RA 4MV7A 2GFQA 4KQ2A 2DWOA 5H3LA 2E4AA 4G9GA 5K8JB 4TMFA 2BH2A 2JCBA 3B3AA 3ROEA 1T24A 5K51A 3HEBA 4MCJA 1QG2A 2H17A 1KZYC 2Q3EA 1MXFA 5ILGA 3AOGA 1FDWA 1GEEA 4BNDA 2WE7A 1OC2A 5E6RA 3HBAA 4N47A 4RVGA 5DGCA 1W87A 2B92A 2CFOA 3AFMA 4L8YA 5MFZA 3GLHB 4A03A 6YASA 2ES4A 2H7VA 3ESRA 1QG6A 1YJ5A 4GR5A 3FVWA 1QIGA 2PQ0A 5DJ5A 1FNBA 4H0NA 5LA6B 4E5DA 1OGYA 1PQWA 5BWNA 5H4GA 3T7DA 3AFGA 1ZSNA 2ONKA 4KO3S 1M1YB 2EDAA 3BXFA 1OGIA 3CWCA 2BZ0A 4QECA 1KH3A 4CQJA 3RTBA 3L4KA 2P2SA 3DBLA 4M9UA 4QT0A 2BSAA 3HVHA 4I1IA 2BGUA 5C5IA 3OC6A 4Z1MD 4NEGA 1UJNA 2IGBA 5AVXA 5EHXA 2ERXA 1N8KA 1Q11A 3BD6A 4LG1A 2V59A 1HZJA 1PAUA 2WTBA 4JJGA 4Q4HB 4TTIA 2B78A 2VZLA 4XM0A 5FFNA 3LFHA 2I9KA 4ABTA 1Q0LA 3OPYI 2VDLB 4RD1A 1PFKA 2GPSA 2BONA 4V1CI 3QITA 4GQIA 2X7XA 3S55A 1ECFA 1LVHA 2JGLA 4AY4A 4M55A 2BCJQ 4BWGA 2JJMA 2VPWA 2VT2A 3OU6A 2XOKD 3YASA 1CF9A 3K09C 1XCMA 4GZLA 1AZLA 1H69A 1DBPA 1MJHA 4QAJA 5CBPB 3EZ2A 4RD6A 3PICA 2A5GA 5DDIP 2FWIA 3GCGA 3H6HA 1ZIOA 4RCVA 3P5BA 4QYIA 5F9MA 4DUZB 4UU8A 1ZCFA 1LXCA 2PMFA 3TX2A 3WGVA 3H4TA 4RTJA 1AMOA 2QRUA 4PF1A 2GX6A 3RARA 2FMIA 2D54A 3AXSA 3OOWA 4D44A 4JOQA 5LU9A 4P3OA 2EFYA 3FFWA 4HRVA 4IH9A 1QZ3A 1Z2CA 2X3YA 3R0IA 2QR3A 4OUKX 3HLTA 3CMMA 4BKRA 2H2AA 2Y1LA 2R4TA 3VNQA 1WCXA 3HXPA 4UPEA 1K6EA 2FG6C 1XRMA 3BQ9A 1J7KA 3L8DA 4KN8A 1Y5NA 2EWVA 4MWGA 3ND6A 4W6ZA 1JQKA 3PQ2A 4LXUA 1XTPA 2PJZA 3KCNA 4HX5A 3OTWA 2HKIA 2FJUA 1L4GA 3GCZA 4MV4A 3HUDA 1V11B 1EM8A 1G6OA 2FW9A 4YHHB 1WSBA 1TGVA 4D5EA 4AP6A 1K3UB 1X7ZA 1M6HA 2PANA 2VYVA 3PDJA 1SKMA 1ZRSA 2IYYA 5FR2A 4B85A 3UXHA 1NPYA 3IXQA 4BRZA 5JC1A 4XQCA 3MPUA 4MS1A 1L7AA 3N0VA 4ZKEA 1QHGA 1SXJB 1ZH8A 4BMPB 1WPXA 4CTOA 3F3KA 4HQNA 2PFSA 2IPAB 3SIXA 2W2QA 2VUSA 2XNKA 5KX5F 4UHBA 1I7NA 2G70A 4PYQA 1MO6A 2WD7A 4HH4A 3KK0A 4U00A 2ASVA 3AQ4A 3EXFA 4QEKA 3RT7A 2RGDA 1YCGA 3QXXA 4D2IA 4QVKA 3L1KA 4G25A 2BFMA 5ALOA 1GPUA 3V2GA 1ZM9A 2WUFA 2X5NA 1RHRA 2HTEA 3VR5A 4BC1A 5BSEA 3CVYA 1RPTA 3M6FA 2IYAA 4YP9A 3VYVA 5JCJD 4BNMA 4EYKA 5FR1A 4IDQA 2CFIA 4ASUD 3KZXA 1WL8A 3DM5A 3FPLA 4I9FA 2C5FA 1FSFA 2DUNA 2WM8A 1LBEA 3FYDA 2ID7A 1RHQA 4XDZA 4K1XA 5AMXA 2NLOA 1VDMA 4RGQA 5G02A 4WUTA 5KDOA 5JTUA 2R25B 3V55A 1N2SA 2VP2A 4XWOA 3UIEA 1RZ3A 4PC3A 4JUDX 4YX9A 1D1SA 3SKYA 2H1VA 3U4DA 1RKXA 2G08A 3OJFA 3QBDA 4QEDA 5C8YF 3Q2KA 1IXYA 4MZXA 2W42A 2YXNA 4BOYA 3H8VA 4DGSA 1ZX1A 3BL5A 4XTCS 1TGYA 3P94A 3UTDA 4LY3A 3AVPA 4B71A 1NGSA 3IOEA 3O90A 4Z4FA 3SDZA 4IJ6A 2FZVA 4J1TC 3GUHA 1T43A 1UOEA 3E7XA 3OJOA 3A11A 2XVZA 2XUIA 4QREA 3HJUA 4XUGB 3WTBA 5GIPE 2O8NA 3U3OA 4QUBA 1QGUB 2AHOA 3MD9A 3AVQA 3WL8A 4HUJA 3WLIA 4E2WA 1BIFA 4PC7A 1RLIA 4YUZA 5AJTA 1CYEA 4J0EA 3BGSA 4NU6A 3Q5DA 1AO3A 5F23A 2F1IA 1OXBB 3ZHQA 5CFOA 3Q7EA 4QOHA 5LZ9A 2I8LA 3VR5H 5DCUA 3UXYA 4W5NA 4AI6A 2IUFA 3M3PA 1GEGA 1GA6A 3H75A 4K0RA 2HC9A 2W2NA 3HY4A 4IJWA 4DS3A