1E6WA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
251
Chain Sequence
b'SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
total genus 87
structure length 251
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e6wA00
3FWZA 1CETA 5KJCA 3BTVA 2WD8A 2FPGA 5KNLA 2JKVA 2I3GA 1HE4A 3E9MA 4J1QA 4DC1A 4CQMD 3IUSA 2IEBA 3GN1A 1YE3A 1ULUA 1EZ4A 3HDJA 3SC4A 2A92A 3C8MA 4J0FA 4KMSA 3IKTA 4MVJP 3PHJA 5C3MA 5L9AA 4DWVA 1V8BA 5I9LA 1HDXA 3WGQA 2C0CA 4JNKA 3E1KA 5F1PA 3E48A 3GEDA 3HN7A 4PZDA 3EZYA 3AU9A 1NHGA 2E6UX 2Q2QA 2BFOA 3EK2A 5GZ6A 3ST7A 2DFDA 5C7OO 2AG8A 4LRSB 4MDHA 4BNIA 1WMAA 1N1EA 5C37A 4LCJA 4J7UA 4ZHSA 2PWZA 1ZK2A 3QSGA 1NVTA 3H9UA 1OOEA 3QWHA 1GCUA 3FPLA 4CM1A 1EUCA 2O7QA 3KTDA 5KJ6A 4M89A 2PKQP 4I08A 1XKQA 1GYPA 1Y9EA 3ZU5A 1Q1NA 3GAFA 3JQGA 4MVJI 3B70A 2ZJ0A 2QYTA 1F06A 2IEDA 1EQ2A 4TRJA 4WLVA 4ZRMA 3TJRA 1NASA 3JCZA 1I3MA 2C5AA 1DO8A 1LLDA 3DOOA 1PWZA 1Y9AA 4XA8A 3QW2A 3TQHA 4J9UE 1K6IA 1F12A 3WYBA 4MO2A 1GCOA 1X0VA 3OQ6A 5TC4A 4FC7A 5I9MA 1V9LA 3A06A 3O9ZA 1DFIA 3VTZA 3VHRA 1NBOA 3LU1A 4WE3A 5DOZA 3TWOA 3G79A 2JCXA 3AJRA 4XGNA 3EY4A 1G0OA 2GZ1A 3D4PA 4BGEA 2DUWA 4TZKA 4D44A 3RVDA 4RF4A 1BRMA 4PRKA 5JMPA 4E30A 4ALIA 4A2CA 3DAFA 1IUKA 2LDXA 3GFBA 4RZHA 3ZWBA 1P0CA 2JFFA 5AXCA 4M49A 1RM0A 1U1IA 1Z74A 1Z75A 2P68A 3IC5A 2XOXA 2Z1MA 2NU9A 4Y67A 1DJNA 1QRRA 4HADA 2PZMA 3S2IA 1VPDA 2ZCUA 3Q2IA 3O38A 4IDCA 3DZBA 5TJ9A 1PX0A 1RM4A 1NWHA 1QR6A 1LDMA 1DHRA 4IZIA 2D59A 2XF8A 1SC6A 3DZFA 1AHHA 4G5HA 1SMKA 2C20A 4O0LA 1C3VA 4EGFA 2P5UA 1M2WA 1OI7A 2P9CA 3DBVO 3H9JA 4LMRA 4NU6A 3I9JA 3DDNA 1D8AA 1AXGA 3JQ8B 4JGBA 1LJ8A 3TZCA 5JY1A 2HMSA 4Z0PA 1EDOA 1WVGA 1U3WA 3E5MA 3BIOA 2Y1OA 3MTJA 2Q2WA 3WNVA 1T2DA 3GNSA 4PG5A 3F1KA 3DAGA 4ONEA 1O0SA 5GZ1A 5F1OA 4LGVA 2X5KO 1P1JA 1UDBA 1HDZA 2DTDA 5T8KC 4UVDA 2AHRA 4IBOA 3OH8A 1C0IA 4XGIA 3U4CA 1PZFA 3S2GA 5BQFA 4ZVVA 1N8KA 1ZIDA 1C14A 2QYSA 2X6TA 2AQ8A 1K0UA 2W90A 3N58A 2O3RA 4IJWA 3LLVA 2NLOA 2FPPA 4IXWA 1DIBA 1V35A 3QLJA 2W2KA 3W6UA 4GSLA 1OC2A 2DTXA 3RKUA 3OQBA 2OUIA 4HFNA 1H6CA 3HB4X 4E5YA 3AK4A 3F46A 3NJ4A 3T4XA 1UAGA 1E3EA 4IQGA 1W4ZA 4O63O 1C1DB 4CV3A 4E2YA 3JQBA 3W8FA 4B7CA 3NUGA 1DIAA 1RPNA 3BYZA 1VKNA 1VL6A 4TRRA 5JDIC 5IDQA 3WBFA 2QHXA 4GQAA 4RVUA 3BTUA 4GX2A 3SLGA 1CF2O 4HFRA 3UW3A 4CM6A 2WWRA 4YACA 1DLJA 3OM9A 5HBRA 3PVZA 4Q3CA 2H5LA 2WYUA 4KTVE 4AL4A 4K26A 4RQUA 1IHXA 3S2FA 1C0KA 1L7EA 2UDPA 3R6DA 2DBRA 5B12A 3WLEA 2OOSA 1K3TA 3DO5A 1NFFA 1YB4A 3CMCO 1PTJA 2P4HX 4E3ZA 1CWUA 3CPSA 4XR4A 1KC1A 1PL6A 3KHUA 3QA9A 4EDFA 2A4KA 3HADA 4FFRA 4OJNA 1IZ0A 4A73A 2F1KA 3LC2O 4I5GA 1V3UA 1IB6A 3F3SA 4W82A 2NACA 1P1HA 3AFNA 1UZNA 4J90A 1QMGA 4GH5A 3F47A 5C7IO 1DB3A 1H9BA 1UXIA 2NTNA 3PIIA 4FJ1A 2P9EA 2I6TA 2P5YA 4YQZA 4AJ1A 1Y5MA 1O5IA 4QECA 5TNXA 2JFGA 1ZNQO 4H16A 4LRTB 1P74A 4BNUA 2O3JA 4BGVA 3WMXA 3A1NA 3PJEA 1NFRA 1HETA 3WSVA 2DC1A 3H65A 4TVOA 4ALLA 3BMOA 1B26A 1LXCA 1SAYA 3NJ8A 3TSCA 3W4KA 1DRVA 4PZCA 2FRDA 3BTSA 4DQVA 1P44A 4GMGA 2AA3A 3NDIA 3CUKA 2D3TA 3KYCB 3MZ0A 4KDFA 1A4IA 1JW9B 4UAGA 3GQVA 5EPOA 3ZNPA 4PLZA 4K6CA 5CPFA 1CERA 1IY8A 4BHTA 1DHTA 4YRDA 1NQAO 4IMPA 4ZD6A 4DC0A 3I9OA 2ZK7A 1GQ2A 1LLUA 1T24A 2W4QA 2PA3A 1ZJYA 4NBWA 2ZYDA 4MIYA 3LF1A 2A94A 4B4UA 3S55A 2JD2A 4RV9A 3TZKA 3KSUA 3MJEA 1RYDA 2G1UA 3JSAA 2C82A 1Q7BA 4XQCA 5A9TA 2YJZA 3RIHA 4RDHA 4PLYA 2ZTUA 2R2GA 3Q0EA 1LC3A 2VUUA 2PZLA 4D0RA 1C0LA 1NNUA 4WLEA 3RBVA 3AOEA 5DCWA 5ITWA 4DGSA 3PHIA 1K5HA 4XQ9A 4OL9A 3ROMA 5THKA 3UHAA 1T1SA 3TZHA 3KYDA 4CJXA 5JXWA 1PGNA 3ZZNA 4GGPA 2QX7A 3B1JA 2X9VA 3OIGA 4WLNA 6LDHA 5TRTA 3DXFA 1TLTA 1KEPA 4ID9A 3ZN2A 1ENYA 4D7AA 5IDXA 3E9QA 1GZ3A 1K6JA 1MLDA 4CR7A 1WDKA 2D1YA 3JD4A 3SLKA 4IXTA 3ZI0A 2NNLD 3WMWA 4FGSA 1FDUA 5JPIA 2AQIA 1BXGB 4RLHA 4E12A 2GN4A 2LDBA 3Q3CA 2IZ0A 3L4BC 1UP4A 1JU9A 4HKTA 4CLOA 1DJQA 1ISHA 4PVDA 3STHA 1VI2A 3H9QA 2IXBA 5BT9A 1IPEA 3U49A 3OFSA 2JHGA 4EUFA 5KVQA 3OEWA 1UAYA 3WX0A 1I2BA 2EKQA 3I9MA 4DPMA 3D4OA 3K31A 1GPJA 3ITKA 3JYPA 4NDNE 3OJ0A 3Q1LA 4YA6A 3UXYA 2VUSA 4GKVA 4Q3AA 3FNGA 1HDRA 4N5NA 4P4GA 2E37A 3DTTA 4DYDA 4MPDA 3KO8A 2DVMA 2HDHA 3AUTA 1OZAA 3GH3A 3LC7O 4E0BA 3DBHA 3BMCA 1F0YA 5JMWA 1LRLA 1TT5B 5BSEA 4CMJA 1PQWA 3OP4A 3QWIA 5B4UA 4II2A 4PN3A 1AE1A 2DTEA 2E48A 4AJ4A 1DFHA 1LSOA 1ZW1A 3GGPA 3QWAA 5A02A 2ZTVA 3OF2A 4N5LA 4ND1A 5CG2A 4U8GA 3LT4A 4DLBA 1Z82A 3EGOA 2HJSA 4YYZA 5DBFA 5IDWA 1R66A 1M6WA 4CLRA 2OP1A 3MOIA 3DZIA 5EQDA 4CMEA 2Q4EA 2ZIZA 4YQYA 1N2SA 1WDLA 4QUKA 3V1YA 3ZV6A 2NSDA 2H1SA 4CM9D 4E21A 1DIGA 3E82A 4L4RA 4BOYA 3OBBA 3L6OO 1JWAB 1BWSA 4MP6A 5IXYA 3HDQA 2HK9A 1QP8A 1H94A 1PJQA 4YVFA 4FOOA 4C7JA 4YDRA 3EUWA 4JLWA 2RBEA 3ZV3A 1QLJA 3CH6A 3E6AA 4OM8A 5JBIA 4BKRA 3I6IA 3DB2A 4CM3A 4CQMB 1R4MA 4OGWA 3QVTA 4WLOA 2RH8A 3IP1A 3WOHA 2IXAA 4K9DA 3DONA 4N18A 4MOWA 3RBZA 3FNHA 4OIMA 4DLLA 1BDBA 4BV9A 2PGLA 3DZGA 2O7SA 1LSUA 4E5PA 2POQX 4XWYA 1XGKA 1DRWA 1RM5A 4CMHA 4UEOA 3BMQA 3WQRA 1PJ4A 7ADHA 5BNFA 1WZIA 3V2HA 5C7LO 4WLUA 3ADPA 3DMYA 1X7HA 5DF1A 1Z45A 1KY4A 4KUEA 3A9WA 3CXRA 4NFYA 3LLSA 2X0NA 5L95A 1DC5A 1GU7A 1M75A 5AVOA 4J3FA 3W4IA 2FZEA 4GI2A 3C7CB 2BFMA 2FY8A 1CQIA 1E7QA 3ITDA 3KSZO 4YT8A 3NV9A 1O6ZA 4YPOA 1KVTA 4CV2A 3R3JA 2VYNA 2B35A 2E4AA 2FSVA 3WQQA 3JD0A 2QQ5A 3Q6IA 1KEVA 1TXGA 1ZVMA 5CDUA 3BZUA 1TEHA 2OHXA 1HRDA 1IHYA 3OETA 2XXBA 3ENNA 4XIJA 1BXKA 1ZK4A 3AU8A 1O9BA 4YCAA 5K0ZA 4GX5A 5KKAA 4GX1A 3I1JA 4CUKA 2C2XA 2E82A 2HK7A 4WJZA 2WEKA 3C1TA 2Y1CA 4YJGA 4BNTA 4CM4A 4WNCA 4NZ9A 2D4AA 1B2LA 4P22A 1LDNA 1UZMA 3ETEA 2AG5A 3UCEA 2ET6A 2C2YA 1HSOA 1LBEA 2VNAA 1WWKA 4XX0A 5GY7A 1GD1O 1CRWG 4BO1A 1C1XB 3RC9A 1UH5A 4J1TA 2CDAA 4W99A 1YQGA 4RF5A 4FGWA 1PJLA 4OXKA 3RAJA 3MTGA 5IG2A 1HYGA 1W6UA 4NJMA 2BKAA 5IZ4A 5FWNA 1FDSA 3HNPA 3P5SA 4NIMA 1ONPA 4Y6SA 1ADFA 4J4BA 1QYWA 4F6CA 2Q46A 4D0SA 3JQEA 1PJ3A 5B4TA 4ESOA 5CHEA 2EGHA 3CZRA 4IIUA 1ARZA 4ALKA 2E49A 3L77A 5CP8A 4XEHA 4CMKA 2GR9A 4AJHA 1LC0A 3RU7A 1PWXA 3RUEA 1ZSYA 4XCVA 2O4UX 2UUPA 4W6ZA 3D3EA 3U4HA 4M1QA 2PD3A 5L4SA 2WD7A 3PYMA 5EJ2A 2VWHA 4EITA 3RSHA 4BKQA 3R1IA 3M6IA 1X7GA 2D8AA 5LCXA 3EYWA 3WR5A 2WDZA 4DMLA 4D42A 1LI4A 1ZK1A 4IS2A 5MGBA 3NRCA 1EFKA 4MKXA 1XCBA 4MKRA 4TWRA 1CDOA 3GNQA 1E5QA 1U3VA 2BI8A 4CQLB 4GVXA 2C7VA 5EERA 1IZ9A 1Y6JA 5BSFA 4O59O 1DBVO 4FR5A 5L51A 2PZJA 1CQJA 3IUPA 1GV0A 1YDEA 6ADHA 1NPDA 1PL7A 3DBRB 4TSKA 5ER9A 4UUOA 3PYXA 4NR0A 2RCYA 3WGYA 4PZEA 3VH1A 1K89A 4ND3A 3ZGYA 1N9GB 1KYQA 3FD8A 5KWEA 4E5NA 4YAIA 4R5MA 3Q2KA 3OECA 1T2EA 3GAZA 4CUZA 1E3SA 1GEEA 2UUOA 4K6FA 4BGIA 4CMCA 4BO4A 4HWKA 1M6HA 3GLQA 1GYQA 1FXSA 1HLDA 2HAEA 5L4NA 1Y5RA 4URFA 4IDFA 5A03A 4KOAA 4PCVA 4WOJA 3SC6A 4X54A 1VC2A 4YRAA 5CPBA 4YT2A 1OMOA 4J2HA 1P33A 3ZV4A 2VHYA 4EYEA 3MJ4A 5TGDA 2PNFA 3PRJA 4CL8A 3GFGA 2D5CA 3ZWOA 1LDGA 3HDYA 1H93A 4EJMA 1E6EA 4OKIA 3AY7A 4G2NA 1VE9A 3H5RA 1IYZA 3ULKA 4BGUA 4Z6KA 2BELA 1R0KA 1T2AA 3DOJA 4FJ0A 1J6UA 2Z5LA 3JD1A 3TOXA 4BL5A 4MVJD 3IOYA 1ISMA 2B4RO 1T2FA 2V65A 4DIBA 5DNAA 1GADO 4JXKA 4WEOA 3MJCA 3DAPA 2VYVD 3WJ7A 3GDOA 5B4VA 2FR0A 1DC4A 4YJHB 4C4OA 5JAZA 1JLLA 2EWMA 4P4LA 3RJ9A 5JAMA 1JTVA 1B8PA 3I4FA 3D0OA 4E5KA 4OAQA 1FJHA 5HM8A 1I3NA 2EP7A 3RUDA 3K30A 4J91A 1F8GA 4UREA 3JQ7B 4RGBA 1J0XO 1EEHA 2EHDA 9LDTA 1WNTA 4RVSA 1UR5A 1EFLA 3ZHBA 3M2PA 2H6EA 5CFZA 2O3TA 4HBGA 3EVTA 4WNIA 3FTNA 1F14A 1DAPA 1P77A 3QQPA 2IZ1A 3GHHA 2HO5A 1G6KA 1GEGA 3L9WA 3JQAD 4YRBA 2XAAA 2C29D 5L4LA 4AJ2A 3TL2A 4IJUA 1HEUA 1ONNA 5L53A 3LYLA 1PR9A 3Q11A 2QRKA 1ZSVA 1XHLA 3G49A 5L7WA 1SZJG 1Q7CA 3GGOA 3JQ8A 3ZWXA 1PS8A 4TVBA 3AM4A 5K9ZA 1U7HA 1MC5A 2VRCA 3HHPA 1QYVA 4NBUA 2PGJA 3IS3A 4DREA 3U09A 1J49A 2AXQA 4OOFA 3WYEA 4EI2A 3RUCA 3ZWCA 2Q1TA 1ZK3A 5JNLA 1PGJA 3VPSA 4Y6RA 4RVFA 2EV9A 4FS3A 1U5AA 1YOVB 4RF2A 2EJVA 5CEEA 4PLCA 1S7CA 2FWMX 4WEQA 4MVJF 3HJAA 3JD2A 4IDGA 3RASA 1EBUA 1F8FA 1V0JA 1KVQA 4H15A 5KVSA 1A27A 4L74A 3OHSX 5THQA 4EZBA 3ANNA 4HUJA 4RQTA 2YFQA 3WGIA 1SCUA 1XA0A 3QWBA 4ITUA 3V2UA 5DBGA 2X9NA 1ZXLA 3H3JA 5T8KA 4TMFA 4GMFA 3PLNA 1G0NA 2RIRA 3WGOA 2NU7A 2V6BA 2CY0A 4LMPA 5FI3A 3VPFA 1BMDA 2B4TO 1YJ8A 3ABIA 3E18A 5JY6A 4ZA2A 1PGQA 4KUHA 4OQZA 4HP8A 3Q9UA 5AXAA 3QP9A 3ZW9A 1I30A 1KEUA 1AXEA 1E0DA 2ZB3A 4J43A 5TQVA 3B20A 2IYOA 4LK3A 5IXSA 3AY3A 5DP2A 4I5FA 2P4QA 1YGYA 4L76A 4W7IA 2CNBA 1UXKA 1DOHA 1ORRA 1ZEJA 1A9ZA 2R6JA 1F17A 1EUZA 1E7WA 1IE3A 1ZMOA 5I8WA 4BQPA 4B3HA 4D46A 5JCJD 5JDIA 4OHUA 1CJCA 1N92A 2X22A 1B14A 4FQ8A 4QT0A 1E3WB 1E1KA 2ZYGA 4OXYA 4UVEA 1YQXA 4M54A 4WPGA 3L6DA 3PJDA 1U4SA 1UXHA 3I9LA 2Q1WA 3WBBA 3P19A 4R68A 4E33A 1EVIA 2DUUA 2FOIA 3RWBA 5ITVA 5JO0A 3PPIA 4MVJG 4CMBA 1B15A 4ZQHA 4GPD1 3WTCA 2Y99A 1U8FO 4IDDA 3V5NA 2W2LD 3VPGA 4D79A 2C5EA 1NQOA 3ANMA 4I5DA 2HUNA 4BQRA 4JQCA 1DSSG 2FPIA 3IL2A 3NEPX 2BGLA 3ON5A 3DZKA 2G76A 4DXHA 3OA2A 2NQ8A 3N7UA 4IDAA 1HSZA 2DKNA 3DBLB 3S1LA 2HKIA 7MDHA 2P2SA 3GC6A 3WIEA 4FDAA 5IZCC 4DPLA 4ALJA 1FDVA 4PRLA 3HSKA 1HDCA 1IULA 3KYCA 1EE9A 2J3JA 4Q39A 9LDBA 1O89A 3M1AA 3O26A 5JCXA 1JN0A 3NGXA 4DA9A 4M8SA 4LN1A 4A10A 1B8UA 5JYDA 4BB5A 2PLAA 2GERA 4N5MA 5BNTA 5G4LA 1MP0A 2VOEA 4FD3A 2JD0A 1BHSA 2G17A 2ZTMA 2O3UA 4CLDA 1RYEA 4ZQFA 3D3WB 5HTOA 4BB6A 1PJSA 2C7GA 5IFLA 1NR7A 3KV3O 3P2YA 1KVUA 3PQDA 3SJ7A 4HNGA 4W9NC 4FW8A 3UGKA 3FR8A 5CDTA 3ZH2A 4HNHA 3KZVA 1YBAA 3FNEA 4Z9FA 1E1MA 2QZ9A 3L4SO 1NPTO 3ETDA 1GDHA 2GSDA 1PS9A 4RDIA 2QRLA 1SEVA 3BHJA 5G2OA 4E13A 1M67A 2WE7A 1GL3A 1GQQA 4BNMA 4BO7A 4LVCA 1WMBA 4FFOA 1EVZA 1VM6A 1BXGA 2GZ3A 4NBRA 1OC4A 2ILTA 2NQTA 1MUUA 4UVIA 2AE1A 2JAPA 1A72A 4R01A 4YT4A 3LVFO 2H9IA 1E6UA 3ONEA 1VJ0A 2ZB4A 3ZDFA 4WOKA 2BH9A 4IGEA 1KEWA 1X15A 4OSPA 1JAXA 1P9LA 2AMFA 1EBFA 3DMTC 2VTDA 1LDYA 5GZ3A 1GTMA 4BNKA 3W1VA 4P38A 4BNWA 4EEXA 4B8WA 2ZQZA 3L4BA 3SEFA 3NT4A 2B4QA 4HV4A 4EJ6A 1EK6A 4L0QA 4BNYA 1R0SA 2FZWA 1D4FA 2J3IA 4A03A 3H9EO 2EKPA 1P1KA 2WYWA 5H81A 2HRBA 3A14A 2AEJA 3PHHA 1TT5A 2IE0A 2Y1DA 2C54A 4LCEA 3GVHA 4FC6A 3U9LA 2I9PA 4BIIA 4FIZA 4N54A 5DBIA 3QE3A 4ZQGA 1PU2A 3QY9A 3HB5X 4JJIA 2JAHA 4QEDA 5I7EA 4K28A 3ZWVA 2EG9A 3KVOA 4GWKA 2QZZA 2Y1GA 4R41A 3ANLA 1I3KA 4ZQBA 2OZPA 2PH3A 3L6EA 4CR6A 3HFSA 1NXQA 2B0JA 1NR1A 1SB9A 3LT1A 3WGTA 4CQMA 2VN8A 2YQ4A 3GEGA 3NTRA 4LVUA 2AE2A 3FTPA 4BO5A 2ZYAA 1LLQA 4XJSA 5ILOA 2GD1O 4YTEA 3AI1A 1E7YA 2X7HA 3I23A 3I83A 3QJ5A 2D5AA 3O4RA 1XSEA 3W6ZA 1BSVA 3ZWYA 4R3WA 1PL8A 2CDCA 4G81A 3UF0A 5BSGA 1I3LA 3JV7A 3F9IA 1R12A 3GUYA 5KJEA 3VZQA 2X0RA 4N7RA 2V6MA 3K2BA 5B37A 3VDQA 3JQFC 1DXYA 1MG5A 1ZXBA 1GZ4A 4CM8B 2HMWA 3F5QA 3BA1A 1HE2A 1LNQA 2HK8A 2VNSA 2GNAA 3PFFA 1XYGA 1GFSA 4R16A 3P7MA 3TFOA 3PI7A 2BLLA 5LDGA 2HRZA 1DC3A 1PIWA 3TNLA 4YBZA 3UN1A 1WPQA 1QORA 4PLVA 4ZICA 4Y98A 1YO6A 1YBVA 3BTOA 2VRBA 4FFLA 3KLMX 1SPXA 3PZRA 4PLGA 3WFJA 3PK0A 1EQUA 1HDOA 3T4EA 3UCXA 3EZLA 4J1NA 2YHIA 1LQUA 2DLDA 2NVUB 1ZEMA 4CUJA 1XLTA 3GZNB 3QIVA 2NM0A 4ND2A 3WICA 1I36A 1YH3A 4RORA 5J23A 2X23A 4XZ3A 5A3VA 2EP5A 3ROKA 2EIHA 2CVQA 1ADBA 2Y0DA 3GRPA 1C1XA 1G1AA 1NQ5A 2EXXA 4FCCA 5F3RA 3QVOA 2I76A 1QLHA 3AUSA 1WP4A 3MJTA 2WM3A 4BKOA 5A04A 1NAIA 2WTBA 3D5TA 4PG6A 4ND4A 1MX3A 4OO3A 2X86A 3LT2A 3W4JA 3HWRA 4HFJA 3WQSB 3C85A 2Y66A 4D3DA 5HWSA 5TLSA 4LSWA 3DFUA 2BRUA 3ZNQA 1GZ6A 1PQUA 4BVAA 1K2WA 2ZQYA 5CG1A 2NUAA 4LSMA 4MVJM 3NTOA 3PWSA 3S8MA 3VH2A 1GAEO 5G0SA 4JP3A 1N7GA 1Q2XA 1Z73A 3QVXA 2DT5A 1DFGA 4NK5A 3K92A 3WXBA 3HDHA 3JQAB 3IKVA 5T6BA 3RC1A 4XYLA 3HQ4O 3E8XA 3IP3A 4IGFA 4XIYA 3I9KA 4Q3BA 1ZKMA 2CD9A 4BKUA 1CIVA 1O94A 4WLFA 4XDZA 3ZU3A 3KM0A 5GMOA 4C7KA 3KETA 3ZWNA 4CV1A 1U2DA 3H3FA 4GKBA 4M87A 1GUYA 3GDGA 4L8VA 1ISJA 4NJOA 4AJIA 2OL4A 3GG2A 5KKCA 5A1TA 2UVDA 4U5QA 4R1TA 3FF4A 4KP7A 2VHXA 3TZ6A 1TB4A 2X0IA 4J49A 1U4OA 2HQ1A 5KIAA 3E5RA 1GUFA 1TVEA 2Q3EA 4OYRA 4Q3EA 3H2SA 4CQLA 2X8LA 3VPXA 3RUHA 3ZHZA 3ETGA 1EMDA 1ADGA 3ROPA 1JVSA 1Z7BA 2J5QA 2Z95A 3DBRA 3PGJA 4YJFB 4AJJA 4L4XA 1CEQA 3G17A 1M76A 2GRAA 1O8CA 4DTIA 1N7HA 1N9GA 1B8VA 1WZEA 3GVCA 4CMIB 4QFDA 5L7YA 1EVJA 4RPHA 4YR9A 3BMOB 4Z0HO 4A7PA 2P91A 1ENOA 1LQTA 1MGOA 1YXMA 5DP1A 3WWZA 1P1RA 1V3VA 2DBZA 3DHEA 4IDEA 4TKMA 5TS3A 3PTZA 4XQGA 4IUYA 3WB9A 5FF9A 4JJGA 3VZRA 3QVWA 1RJWA 5JSFA 5COBA 2FR1A 2Q49A 3CMMA 1N1GA 1H6BA 5H82A 2X1HA 3AFMA 2X9GA 4BNVA 3ZW8A 3AM3A 2Y1EA 4O5OA 1YVEI 4E6PA 4XKJA 1TI7A 5KCZA 4DPKA 4PLPA 3I9NA 4JP2A 5TT1A 1N5DA 2BMAA 4UUNA 2EJWA 4DYVA 3KB6A 4RVHA 3RBXA 1E3IA 2CVZA 2Y93A 5ENVA 4CLXA 4JBGA 5C5IA 2NWQA 4QO8A 2I66A 4R69A 2TMGA 3G3EA 4HFMA 5FI5A 2BFAA 4WGGA 4ZRNA 1Y8RA 5G0WA 4DUPA 3SBOA 2G82A 4GVLA 2PY6A 3BMNB 3PQFA 4QX6A 3GOHA 3F6YA 4FJ2A 3RC2A 3JQCA 5HRUA 4EUHA 1BVUA 1NVMB 4OKNA 3VH3A 1XEAA 1A9YA 3MEQA 1Y8QB 4RPGA 4ZGWA 3K6JA 4MP3A 5JLAA 1WDMA 1YS4A 2V6GA 3JQ7A 5F5NA 4FFPA 4BNZA 2BFPA 3BAZA 3HUDA 1B3BA 2B5WA 5JO9A 4AVYA 4XB2A 3PHGA 4GBJA 1HZJA 1PQPA 1FK8A 5JAQA 3TRIA 2G0TA 4BNJA 3K96A 2AQHA 2IDZA 2PZKA 3IIEA 1DPGA 2D0IA 1EE2A 3AI2A 4XRRA 1KERA 3H7AA 3UCFA 3MJSA 4Y8VA 2D2IA 1LLCA 4Y9DA 5ENDA 1P31A 3V1UA 3ZCXA 1HDYA 1IPFA 4BMNA 1SO8A 1X1TA 4NNJA 5G4KB 1E7MA 2G5CA 3B6ZA 3EMKA 1E5LA 3GN2A 1E1LA 4ILKA 4YAEA 5K6AC 5KTKA 2DBQA 1HDGO 5DOVA 3ASUA 2YQ5A 1UZLA 2DAPA 3ORFA 1PZGA 4YAJA 4B7XA 2BGKA 4RPJA 3AW9A 4NFHA 4RO0A 4GLOA 4PGFA 3AOGA 3ADOA 4PLFA 2NU6A 2OP0A 1LDEA 4NH4A 3LSYA 3R0IA 4U0KA 4IJVA 5CDSA 1YOVA 3RU9A 1W0CA 4I8XA 3NAQA 4CLRB 3C24A 2I65A 3GZ4A 5TX7A 2PV7A 1JKJA 5AXDA 3OEYA 2X4GA 2BHLA 2R00C 5EN4A 4ZU3A 1SBYA 2C59A 4XD2A 4B3JA 1TA4A 3DTYA 3I52A 3GMSA 3FRJA 3IJPA 3BXXA 1PJTA 4NU5A 3FWNA 5JE8A 3I4CA 4B8ZA 4BMVA 3HG7A 3OA0A 4JROA 4BNFA 3ENKA 1IOLA 2CFCA 1EK5A 4FPXA 4XJTA 1YQDA 5AXBA 1XU9A 4W4TA 5BNIA 4XYBA 3WFIA 1LRJA 2VHZA 1GV1A 1JDJA 1HTBA 5AOVA 3PIDA 4OQYA 1YB5A 4UEJA 3MJVA 4BO9A 3TF5A 3KOUA 4E2XA 2NV6A 4IINA 3WYCA 3C3XA 3W8DA 4QTZA 1H6AA 3V1TC 5F21A 4NFSA 2Q1SA 4R1NA 2RH4A 1YONA 5FEUA 2IZZA 5L40A 1AGNA 4L75A 3ZNNA 4D3SA 3PDUA 4WK6A 5FYDA 1D1SA 2X0JA 3OJLA 4OXNA 1C0PA 1E3WA 3ONFA 2J5RA 2VT3A 4MVJE 1XQ6A 1LX6A 4BO8A 1ML3A 4J1SA 1FF9A 1JAYA 4E2ZA 5A9SB 1ISFA 3CTMA 1VL0A 4R3NA 1MV8A 1KVRA 3KLPX 1YL5A 4TQGA 5KJFA 4Z3KA 3VDRA 4CM9A 4XRGA 4RPLA 1SEPA 2DFVA 4AG3A 4AJLA 4XQEA 2GASA 5COQA 4YJGB 1ISIA 4CM4B 2Y05A 3DBLA 2QW8A 5BR7A 1SB8A 2BD0A 3U62A 2GPTA 3DWFA 4E32A 4ND5A 3TPCA 2SCUA 2HMUA 3IAHA 3PGXA 3PEFA 5ILGA 3M2TA 1LA2A 2O2SA 3ASVA 2Q2VA 2F00A 1HYEA 1YL6A 4FOSA 2HMVA 1ENZA 4IIVA 4KWIA 4WKGA 1HE5A 5HS6A 1T4BA 1DEHA 4NJMB 5IZCA 1VSVA 4E2WA 5ER6A 1RWBA 2B36A 5DULA 3R3SA 1Z6ZA 4ZQEA 3P2OA 1XR3A 3RUFA 1VLLA 3FSRA 1X14A 4WCFC 1EDZA 1BW9B 1LUAA 3D3WA 1R16A 5EESA 3RFXA 4U6SA 1SOWA 1B7GO 1U3UA 3VKUA 3F4BA 3FI9A 4M86A 5EMHA 3CZMA 4KUGA 2NVBA 5JC1A 2GYYA 1E7RA 1YRLA 2GCGA 3K2EA 5T57A 3DEYX 4MINA 4ZN6A 2IODA 2O23A 2OO5A 3VC7A 1I8TA 3LF2A 4WCFB 3CE6A 4DL9A 3C7DB 4IY1A 2GO1A 2O48X 4PVCA 4MJLA 3D64A 4R4JA 4R9SA 2VWGA 4W9NA 3UICA 2YUTA 3ZU2A 1E6WA 4Z9YA 3PXXA 4J7CA 2EEZA 5MDHA 1P1IA 5CAEA 4BNLA 4ALMA 1NWCA 4B3IA 1NHWA 4FN4A 1R4NB 1C1DA 2VTEA 3G1UA 4IDBA 3WGZA 3B1FA 3VAZA 3VVCA 4GGOA 3LDHA 2ZB7A 2HMTA 2O2YA 4R1SA 1B16A 3ZHXA 3L07A 3RQSA 4EJ0A 3KUXA 2YDYA 3UKOA 3GK3A 3QV1A 1BDMA 3EVNA 2Q1UA 4DIOA 5G0TA 2Q50A 1I0ZA 1QYXA 1Z7EA 1BG6A 1NP3A 3GVIA 3VVBA 1NAHA 2GZ2A 2EKLA 1ZH8A 2CF5A 5LDHA 1V3TA 4HX5A 1YB1A 5JS6A 1LSSA 1QSGA 1NX6A 5FFFA 3DMTA 4BNHA 3D1LA 1RM3A 2GN8A 3OSUA 5ES3A 3HFGA 5ADHA 5AQ1A 3VOSA 1WXDA 3QWFA 4R1UA 3KYBA 4R9RA 4Z9XA 3CEAA 2Y68A 4Q3DA 4YEDA 1T2CA 2AEFA 4IZHA 1U3TA 3MOGA 2YY7A 5JDCC 1QG6A 1VJ1A 1H5QA 5DT9A 2FMUA 4RZIA 4GWGA 3GDFA 3JQDA 5T64A 1EVYA 4U0JA 1X13A 4JBIA 4KTTE 3KXDA 1PJCA 4JCOA 1A7KA 1Y7TA 3OIDA 1P45A 3FR7A 4FB5A 3TFQA 3O03A 1ZUD1 2YV3A 1DLIA 4EW6A 1AN9A 3FCOA 2PH5A 3D5QA 4L9RA 4DVJA 2VHWA 1W73A 2WYVA 2JHFA 3O8QB 5CEJA 2B37A 5ICSA 1KS9A 2PD4A 3MWEB 2GUGA 2VZ0A 4AJNA 2CSUA 4FFNA 3PP8A 4CL3A 3I5MA 4CLHA 1NM5A 2OFPA 3GRKA 4I1IA 4EEZA 3JQ9C 4II3A 4O6VA 1D1TA 2GGSA 3CKYA 2VT2A 1E77A 2V7PA 2PR2A 4UUPA 2B83A 3I6QA 1ADCA 1L1FA 4AICA 2AW5A 3H9GA 1IL0A 8ADHA 1UP7A 3HZZA 1JKFA 1U5CA 5EIOA 4CM8A 1KBZA 4J0EA 4DBZA 4IJKA 3VPHA 3GEMA 4U7WA 3NT5A 1GY8A 5TF4A 3KEQA 4AJKA 3ZWPA 3ICPA 1MA0A 1R37A 4YB8A 3INGA 1GYRA 3JQFA 3PYLA 3WLFA 4AJEA 3FBGA 5IJZA 1A71A 4IQ8A 3V8BA 2JCVA 2NTJA 3E9NA 4BMSA 5HS4A 2WJPA 1VSUA 3H6KA 1WAMA 2A9FA 4D43A 4OMUA 3ZHYA 4MVJA 2JD1A 4XR9A 5CDGA 4GX0A 4UVHA 2NVUA 4NBTA 2VYVA 3PZBA 4NG5A 2EERA 3MCVA 3GZNA 4KQWA 3RCBA 3GPDG 1FDWA 2RHRA 4XYMA 2VUTA 3OIFA 2BGMA 3OJEA 3PWZA 4BO3A 3PQEA 3JTMA 4PLHA 1R6DA 2HLPA 1XDWA 4IQ0A 3U4DA 2QIOA 3OJOA 1PJ2A 3RFVA 5U1PA 2EGGA 1JVBA 2PKRA 1HKUA 3D4NA 4LW8A 3WWYA 3F5SA 4KQXA 1ZZEA 1QYDA 2YDXA 4MVJH 2XPCA 4CMGA 4R5HA 2GLXA 3DQPA 3G0OA 2CMDA 5T5QA 2OBYA 1VRWA 2GDZA 1D3AA 2OORA 1D7OA 4K1LA 4I9HA 3JQAA 4A26A 1ZMTA 1U7TA 2ZATA 2B5VA 3JQGB 4GLLA 1UXJA 2IRWA 2VYND 4GL4A 1ZSNA 1W8DA 3QHAA 5I8ZA 1BVRA 4NMHA 3JYNA 3PDJA 2OMEA 4YAGA 4KZPA 4NHEA 2CUKA 2ZTLA 2O4CA 4CLEA 4TZTA 3RD5A 2Q99A 3JYQA 1UDAA 2AEMA 3A4VA 3PHLA 4EUEA 5JFOA 4S3MA 3LT0A 4G65A 1Q0QA 1Q7GA 2Y67A 3Q9NA 4QQRA 3BHIA 3L9XA 3GVXA 5B1YA 4RF3A 2OGUA 3FNFA 1NFQA 5H83A 1DRUA 4BO2A 2HCTA 3IDSA 3GNTA 3VZPA 2NVWA 2PTGA 4F6LA 5L45A 3PWKA 1X7DA 4XGKA 4YJFA 2W98A 3PJGA 1GR0A 3NDRA 1H0KA 1E3JA 4RJTA 1Y81A 2DQ4A 3VKVA 3AY6A 1QKIA 4CMIA 4DMMA 1MFZA 5T67A 2FR8A 3OMLA 2PD6A 1FMCA 2GN6A 2X5JO 3AM5A 4DLAA 2Q4BA 3EC7A 3RKRA 3DZHA 1GUZA 1O95A 4JN6B 3ONDA 2JFHA 3C7AA 3RJ5A 2HJRA 2X5OA 3GGGA 1U2GA 2YV2A 2WE8A 4J9VA 3W8EA 1E3LA 4R51A 1HWYA 2C07A 1T4DA 1VKOA 2YHUA 1XWFA 1UUFA 4F45A 1I10A 5EL0A 1NYTA 2WSBA 3UFXA 3LQFA 5G0UA 3COSA 3V2GA 1ZCJA 1UJMA 3H2ZA 1HLPA 5JCJA 3CINA 5HA5A 4IPTA 1KY5A 2CF6A 1A5ZA 1KIFA 1LDBA 4S1VA 4A0SA 2Q45A 1KVSA 4A27A 1NVGA 3C1OA 1I2CA 4B4OA 1I24A 4F46A 2JL1A 5A4DA 4JBHA 2VCYA 3RI3A 3TZQA 3BMNA 3OQ1A 4Q3NA 2DM6A 4MIEA 4BS9A 1ZBQA 4BNNA 3JQBC 4TKLA 3WSWA 3WNQA 5KJ1A 4RVDA 5IN5A 4MIOA 1Y8QA 2W2LA 1ULSA 1ENPA 2W2KB 4UVGA 2PK3A 5KVVA 5F5LA 3DC2A 3G1TA 4CM7A 3K5PA 5IF3A 3FN4A 1SNYA 5BSHA 4M55A 1PZHA 1JKIA 4PIVA 2J8ZA 5I7VA 1KETA 3AUAA 2H63A 1OBFO 2DPGA 1QV7A 2BI7A 3WGGA 4OH1A 1AHIA 1I33A 3FHLA 4YJDA 4QSMA 5A5FA 4D3FA 5G4KA 4CV0A 4E4YA 4GSKA 2WMDA 4XB1A 5CEFA 3DFZA 1Q0LA 1HZZA 3NTQA 4DQUA 1TT7A 3X2FA 1HL3A 4H3VA 4ROSA 4KWHA 2EW2A 1OAAA 4IS3A 4P8RA 4WUVA 4RLSA 5K6AA 4A5OA 3GMDA 1Y1PA 4H7PA 3DHNA 4J4HA 4W7HA 3CSDA 3U3XA 1HF3A 1ZJZA 2YZ7A 5A3JA 1EUDA 3H5AA 2I67A 4NQZA 1Q0HA 1PGOA 3GG9A 4NK4A 3U0BA 4J4TA 3JYOA 3FBTA 1QV6A 4PG4A 3B1KA 1BTOA 1S6YA 2VQ3A 3NDJA 3NKLA 3OICA 4JK3A 1PR3A 2EW8A 4RL6A 3ROQA 2R00A 3GUCA 3RFTA 5IN4A 3F1LA 5G0VA 5CDYA 1H2BA 3WGHA 3GR6A 1DIHA 3UVEA 4INAA 4WASA 1PSDA 5COAA 4IMRA 3M1LA 2I5PO 2BF7A 4CM5A 1A7AA 2JJYA 1YKFA 4BO6A 2Y0EA 3AOEC 4I9NA 2Z1NA 5L7TA 2CDBA 4IM7A 5A06A 3AI3A 2VRCD 1LRKA 3L0DA 1ZO8A 1R0LA 3X2EA 1YDWA 1LEHA 4WECA 1SOVA 1V6AA 1AUPA 2A35A 3WDSA 4E5MA 4Z0TA 3RUAA 3HE3A 3N74A 1LU9A 5DDIP 4B4WA 3T7EA 3K73O 2I3AA 4DQXA 3ZU4A 4PLWA 1P0FA 3GVPA 1WW8A 1CYDA 1H6DA 2NTVA 1P3DA 1JA9A 2O3SA 3KYDB 4PFJA 5F1KA 3GF4A 2GF2A 3KBOA 4MKZA 1R15A 2OBNA 4BO0A 4J6FA 3VTFA 4YJHA 3ZWWA 5A9SA 3JQ6A 2J6IA 2O3QA 1BXZA 5KOIA 1E7SA 4CMAA 3WJAA 4UEKA 2VZ8A 5LC1A 3SX2A 1U28A 4RVGA 1E92A 4B79A 4CR8A 2CZCA 5EQFA 4YXFA 4ZJUA 1HT0A 1MC4A 3U4IA 4UUMA 3KSDO 4EBFA 5TIIA 2YHIB 2FHSA 1A4UA 3T7CA 1H9AA 4CLOB 3BHMA 4LISA 1FDTA 1JQBA 3DR3A 3LZ6A 3ZV5A 1LSJA 3SVTA 2TMDA 2VWQA 4NI5A 1YWGO 3DOCA 3EAGA 4O1MA 4XYEA 1ISGA 5I7SA 5TJHA 1MG0A 4FBGA 4AFNA 1I5RA 2Y0CA 4DIFA 4DRYA 3NX4A 1J5PA 1GQYA 4TRNA 1XELA 1ONOA 2I99A 1LTHR 3RC7A 2J3KA 3JYLA 3WIDA 4RPKA 2DU8A 1VJTA 3NGLA 1DIRA 3DBHB 3BMCB 1YJQA 5TSDA 3VH4A 4BUCA 1ZFNA 3AUUA 4KDEA 4OSOA 3I3OA 4F3YA 4CMEC 3A28A 2GN9A 3UUWA 4Q9NA 1QYCA 2O50A 2QG4A 5DCUA 4QFCA 2X58A 1BW9A 2RHCA 4CODB 1DAOA 1P1FA 1M66A 3UH1A 1E1NA 5I9NA 4L4SA 2YFHA 3D7LA 2J5KA 4QO7A 4CPDA 2DPHA 2NU8A 3FPCA 4UULA 1GPDG 2ZKLA 5A05A 1T1RA 1DDOA 2VOJA 3GY0A 1VL8A 1X0XA 4WCFA 1HXHA 3E03A 4HXYA 5DCYA 2UAGA 1I01A 2CVOA 4RCVA 4PG8A 5U4QA 4FSHA 1WLYA 1B0AA 1I2ZA 3LK7A 1KOLA 3IMFA 2EF1A 3K8ZA 5A5EA 1NPYA 2RAFA 4J2OA 3PFWO 4E31A 2PFGA 1K6XA 3AWDA 1R4MB 1PS0A 3TL3A 3DHYA 1U8XX 2NADA 4AJOA 3WG9A 1R4NA 4J16A 3INRA 1RKXA 5JYEA 1PEDA 2P9GA 1NQTA 3MWDB 3ZWAA 3NT2A 1JWBB 5ICMA 3GA0A 4I9UA 4XYGA 1T25A 1HYHA 3QRWA 3LC1O 1UP6A 5TT0A 2V6FA 1ZK0A 1UXGA 4PG7A 3F4LA 2DBVO 2HSDA 3VZSA 2ZCVA 5DZSA 5L3ZA 3ZNOA 1J4AA 3BMQB 3INTA 2J3HA 4NBVA 2Y1FA 4QXMA 3TN7A 5JC8A 1XG5A 1YL7A 8LDHA 2ZJ1A 3CIFA 1XQ1A 2HU2A 3JD3A 4L73A 2ZB8A 3DL2A 2YV1A 2UV8A 2VWPA 5A9RA 1PZEA 1XU7A 2YYYA 2B69A 3C1AA 3EHEA 4Z3DA 3OJFA 5I7FA 1NTOA 1H2HA 2XXJA 3TDKA 2UYYA 2VZ9A 5EINA 3HN2A 3SJUA 3WS7A 4YAKA 2YW9A 1T26A 3KRTA 4YT5A 4I5EA 4P4NA 4U6QA 3KEOA 4TRMA 3ZWMA 2QRJA 5JW6A 3IQDB 4XDYA 5AYVA 5IDYA 3TOZA 1MB4A 4TROA 1OFGA 4YWJA 1MXHA 1X1EA 3S2EA 2OXIA 5KVCA 3H4VA 2PGDA 2W8ZA 4B7UA 3U5TA 1Y8RB 4R54A 3UOGA 5JAIA 2FN7A 3H8VA 5JDCA 1UDCA 1HE3A 3EW7A 1U9JA 2AQKA 4D41A 4JJFA 1XIVA 3K9QO 2FP4A 5IAAA 4J7XA 2PKQO 1DC6A 3SXPA 4FFMA 3O8QA 1PJBA 3ICCA 4ALNA 3PLRA 4GAEA 4OOEA 4NPCA 3EDMA 4BNXA 4PLTA 4BV8A 3QVSA 3GHYA 4MP8A 5DN9A 1B3RA 3WTBA 3DZJA 2IYPA 1KC3A 1ID1A 1MFPA 4Y6PA 1I32A 1MXFA 1YBMA 5U9CA 4BKPA 3RUIA 2JCYA 4JX8A 2VHVA 3UAGA 4B4VA 3GPIA 3IJRA 3GT0A 2FSSA 4JIGA 1PGPA 3NYWA 4WCDA 3H5NA 2WD7B 3RROA 1BGVA 3JQ9A 4D45A 4BNGA 4HY3A 4DBVO 3PJFA 1L7DA 4AJPA 1QXSA
chains in the Genus database with same CATH superfamily
5IXJA 3NVKI 1CETA 1JH8A 4N0PA 3BTVA 4P92A 4HX2A 2WD8A 5KYYB 3EPKA 4YJKA 4WZAA 2JK0A 2R7LA 4ZZIA 4IFEA 1XEWY 2HXYA 5J1SB 3MSXA 3DOEA 3NCHA 1T3GA 1Z39A 4J1QA 4LHSA 1XD2B 2VQFB 5EC8A 3S4YA 4EATA 5HJ5A 1T36B 2XYRA 1Z4QA 2IEBA 3P9CA 2FPXA 2WP8J 3GN1A 3EGDB 1XDDA 3KQVA 3NASA 3ZDQA 1EZ4A 3FMOB 1N6RA 1BU8A 2QOEA 1JIQA 1B6GA 2X42A 3LQ4A 4KMSA 4M1TA 5DTQA 1I2MA 3E5NA 2BYTA 3MVEA 1XPJA 1XCOA 3A6EA 1GNPA 4UNSA 4YRMA 5I9LA 3N5KA 3C39A 4MJXA 4EABA 2AXNA 2C0CA 4JNKA 2YWCA 4K9QA 3VTAA 1D5WA 4F8YA 5J58A 2QD3A 4C7VA 2F9FA 3EZYA 3B8EA 3IVMA 3KKNA 1SUCA 2ZSIA 4ZJZA 5HMLA 2J6CA 2HH9A 4YRIA 3EFEA 1ICEA 2NIPA 5E1DA 4AW9A 2PUGA 4IDOA 4PSUA 2I3ZA 1K8RA 3HLKA 3TI7A 1O95D 2XQKA 2ZIFA 1NN0A 3CJRA 2I03A 3VZBA 4NABA 2O1EA 2X14A 3HVIA 1GNSA 5AM5A 2ZJ7A 1ECLA 2C3MA 1NVTA 1PX2A 3HACA 1U2RA 1GCUA 4CM1A 1GR1A 3E58A 5AM2A 3ELDA 1GPNA 1I13A 4TQUS 2CXTA 3CNQS 5EMHA 1NVDA 1N5MA 4BCCA 5KJ6A 7ABPA 5JIBA 3WP1B 4B6EA 1NW9B 1GYPA 1W5BA 1Y9EA 3GBPA 4KG7A 2R65A 1I94B 2X5XA 2ODQA 4HEHA 3B78A 1HQCA 3IBCA 1UBHS 4G1FA 2X3YA 2C88A 2X1MA 1GA1A 1WUKS 3T06B 1YR1A 2ZPTX 3KQPA 5LLTA 1RZRD 3DVQX 1THTA 4I66A 2G9QA 5GPBA 1XDBA 3SR4A 1E96A 1REQA 2C5BA 2GBIA 1ISSA 4J9UE 4L3OA 3OQHA 1CR2A 2Q3JA 3WYNA 3ZDYB 1F12A 1PV2A 3WYBA 2VFAA 4GKJB 3LRTA 2C3PA 5I9MA 2RHTA 2PSHA 5BW5A 2WU8A 3O9ZA 4C01A 4NDAA 2B2NA 2CJYA 2NZJA 3GQBB 5FWYA 4C2TA 1NBOA 2CE2X 5DOZA 3G79A 3TW6A 1JLLB 1K63A 2WWFA 4FUTA 3ZYZA 4IO1A 4BU1A 2DYKA 1QYRA 5E8RA 4ZEMA 1NONA 3JATB 1UT8A 4YFYA 1ST2A 1SC1A 5LYJA 2DUWA 2N47A 5IMBA 4D44A 5JROA 1N5JA 3E7FA 4G9EA 2QBYA 2OV3A 1IAVA 5JMPA 4E30A 3K6SA 3RVLA 4A2CA 1IUKA 1PK7A 1TZJA 2LDXA 3WLLA 1OFTA 1OAOC 2XJ9A 3ZWBA 4D99A 1P0CA 4DR1B 2WFMA 4LZOA 1RM0A 1Z74A 2FX5A 3IC5A 2EVWX 1SOMA 1QRRA 4LIPD 4RJIA 1K1EA 2D5BA 4X8OA 2GHQA 1SFRA 1IFXA 1EB8A 3GLFA 1YF3A 5J4LA 2WMYA 3Q2IA 1PX0A 1SN7A 5IM5A 4LE1A 3RTDA 3ZDEA 3T34A 5LOVB 1LDMA 1DHRA 3I53A 5EJFA 1JLHA 1Y37A 2R5FA 5KHAA 5JJ5A 4OMDA 1WD7A 2XF8A 5DPMA 4OUDA 3DZFA 5JNRA 4FGJA 2ZSFA 4PYIA 2WIAA 2P9CA 3DBVO 1DWUA 2NYVA 3Q3VA 4LMRA 4NU6A 3SDSA 3TLXA 3I9JA 2VRNA 4EB6A 3Q8WA 4PSCA 3TGPA 1QQBA 1G3IA 1H0RA 4TKUB 1P0PA 1LJ8A 1IMOA 1K2VN 1J0CA 4AY4A 3L7JA 3JU3A 2H2GA 4K40A 3S8YA 2WC1A 1UBCA 1L8QA 4BE7B 2VTBB 2QE6A 3KSMA 1WVGA 3HVHA 3WJ2A 1W1WA 4HLQB 4F04A 1CY0A 3BIOA 3KJXA 1ZWKA 2RGXA 4LBZA 3KC2A 5M3BA 3HK2A 3WNVA 4LAFA 2JIOA 3WZ2A 4C6RA 4PG5A 1XTZA 2KSQA 2QLNA 4ONEA 3TKAA 4BCBA 2F55A 1H8HA 5KQMA 4NCNA 1Q1QA 5F1OA 3A7DA 3QQ5A 3ESAA 3I05A 4LGVA 1VG8A 4M38A 4NG4A 1P7ZA 3KUUA 4KOEC 5B58T 4M1WA 1J7JA 2AHRA 4DLKA 4QFBA 3AEUB 3I28A 3KAJA 2NXCA 3EDCA 2QUAA 2GPSA 1G19A 4O4LB 1EX1A 4XGIA 3U4CA 3KTAB 3F5DA 2QJWA 4BVBA 2X6TA 2FQ1A 2AQ8A 3P9YA 4IJWA 3JVIA 3BG5A 4ZI2A 3T99A 3MYRA 5HR5A 2QN3A 3U3OA 1R9GA 1V35A 3WKBA 5HZKA 2NG1A 1WSAA 2AK2A 3OQBA 3RKUA 3JAMA 3TW4A 2LW7A 4M1YA 1IZ7A 4JL6A 3HJFA 1JXAA 1RXCA 4O0MA 4YRQA 3GXBA 4IQGA 4O63O 1PV1A 1LI5A 1W4ZA 1WEHA 5L3RA 1QTNA 2HA6A 4QM6A 4JDUA 1TA0A 3BYZA 2PAFA 3DWGA 1VL6A 3KQOA 4I19A 4IX1A 4L4ZA 5HE9A 3PQ2A 3PXDA 1O6BA 2GEDA 4ZOQI 3SLGA 4CM6A 1MEOA 3UW3A 2DGDA 1FSFA 3D2BA 4UQPA 2NV0A 4I50F 1V11B 1PO7A 1DLJA 2PRJA 2ZZKA 3BCRA 4Q3CA 4YJ2A 3I6MA 3ZGOA 3IT3A 2JHPA 5LM3A 1SUAA 3I39X 2ZM6B 1MJFA 4AL4A 3DKRA 3GFFA 4RQUA 2P69A 2PX8A 4X90A 3S2FA 2C7OA 3MHTA 2ODBA 1FJGB 3R6DA 4KGZA 4KWCA 1EGAA 1WXGA 3WLEA 5IKMA 2HF9A 3LHSA 5FX2A 1NFFA 1YB4A 2PSJA 3ZE6A 2B4AA 4R2KA 2HU8A 1WKVA 1KC1A 1PL6A 2REQA 2X0FA 4EDFA 2OO3A 1XZQA 4ED9A 2DEUA 1K7SN 2ZUBA 1E6CA 1GNQA 5BWNA 3DEIA 1UANA 2IA5A 1SH7A 1BKSB 1CP2A 3UK1A 4CHTA 3K1AA 2YV4A 5EY5B 2NACA 1UZNA 3EEQA 1RWKA 3SM3A 4B7AA 4JLMA 4B9EA 5C7IO 4NDZA 1XE3A 1DB3A 4DA4A 2VH5R 3IB6A 1Y5MA 1VLVA 3IE2A 1T2NA 1IM2A 2JFGA 4ZOEA 1DI0A 4LRTB 4I36A 4QDUA 2FPIB 3EDYA 4QU0A 5DBEX 1J8FA 2C3YA 5CA0B 1EESA 1Z25A 5IK2A 3I01A 3R5KA 4J3JA 2GXQA 4BGVA 5I4BA 4JSRA 1NG9A 3PJEA 3PC4A 3QBDA 3E22B 1HETA 3ZLTA 1RXSA 1ZIOA 1OV4A 2DC1A 5CFLA 3ISVA 5GONF 4EO7A 1CQXA 1LXCA 2IF2A 2GXAA 4UHFA 3GT7A 3TQSA 4KDCA 4DQVA 4OX9B 1BCRB 2JNWA 2WU3A 4GMGA 4RY8A 3AIOA 5FTJA 4DADA 3NDIA 3CUKA 4FEYA 3KYCB 4G4IA 2XIJA 1SRQA 3PC2A 3G2HA 4BC0A 2M98A 1RPJA 3O2QB 3KWLA 5ERXA 5I45A 1I1NA 4BHTA 3ESDA 3STYA 1II0A 4YRDA 1OREA 1WZUA 2GCOA 4IMPA 3I9OA 4C6TA 2ZK7A 3Q72A 1T24A 1HOTA 3B9BA 1LK7A 2L0XA 1TYCA 1ZJYA 2R8RA 4D4JA 2HF8A 3LF1A 2A94A 3MJEA 4B3TB 3Q6MA 1T1EA 1GVHA 2G1UA 3IFSA 3DZ8A 1I5OA 5A9TA 1Q7BA 2PRKA 4LF6B 3T1OA 5I9IA 1PT8A 3IAM6 3RG2A 2HY7A 2WFLB 4Y2PA 3A37A 3OLZA 3ZCRA 2P3OA 4MS4A 2ZANA 1M0TA 2PGXA 3K2QA 3PF8A 1U0NA 3T7JA 1OLOA 2F59A 3ROMA 3PCXA 1ZGAA 4B43A 4IIXA 2RC5A 3N3BC 4R8KA 2G07A 4IDPA 2Q5HA 2QX7A 3H0CA 3EF0A 1ZGCA 2XUIA 1KEPA 1RC0A 2A7XA 3DXFA 5TRTA 4YGYA 4OBXA 3KOZA 4TTSA 4WN3A 1CS4C 2IU3A 3NIWA 1MLDA 3ZW7A 4CR7A 1J8VA 2Z56A 1OB5A 1HT1E 3DLAA 1WDKA 1H2RS 2XVXA 4PQRA 4M9RA 4G0PA 4PHFA 5FI1B 3UJ3X 2AUMA 2XDYA 3WMWA 1XMOB 2J1LA 1L5NA 1BXGB 4RLHA 1W36D 4LF5B 2Z1DA 3CO5A 3UMSA 2AI1A 1KMQA 2LDBA 3DNPA 3AZQA 3LPNA 2IZ0A 3WGMA 4DANA 3O95A 1JU9A 5A1JA 4GOLD 2QE7D 1YJXA 4KXLA 3DLBA 3E35A 2JZNA 4OHRA 3KP1A 5ECDA 3U1TA 4F84A 5IASA 1XD8A 4B2YA 2YWHA 4TLEA 1RABA 4PHHA 3DE4X 3OFSA 3U49A 4EUFA 2TSYB 4ZTZB 2R1TB 3FX2A 3URKA 1K5PA 1RADA 4ER5A 3PEVA 3PICA 1JPUA 1KSHA 2C4KA 2W2OA 3KKEA 1XVVA 3Q1LA 3PQ3A 4NDNE 5EZYB 4B3FX 2R4QA 1M2VA 3L8EA 4GKVA 3V8EA 2FWIA 1HDRA 4S0ZA 1QIGA 4HPJB 5L3SA 3TCNA 4BZZA 2PXCA 2XUZA 1I3OA 3FHCB 5EP1A 1DOZA 2O0LA 4MPDA 2DVMA 2HDHA 3AUTA 2QAIA 3DE5X 3LBYA 4IYRA 5C4GB 4E0BA 1ZR4A 2EKDA 1F0YA 4R7TA 2GBCA 2GCEA 2ZI9A 3B85A 3LWNA 5BSEA 4JVLA 4KVAA 3HRHA 3E3LA 3FLAA 3ASZA 3OP4A 5CYGA 1NF9A 1YKGA 3AUJB 3CN9A 3Q7IA 2CFSA 4M1ZA 4LDAA 1ODJA 1VI5A 4II2A 1AE1A 4E15A 3MMNA 3SAJA 5BVGB 5KTPA 1LSOA 4MDEA 3QWAA 4DIKA 4RIEA 1D6SA 1KI2A 2OZLB 2HBYA 5CG2A 3LT4A 2OK8A 2VDNB 3S6JA 1V1MA 1Z82A 2XDWA 2ZRMA 4EPWA 4YYZA 5HPYB 3DPIA 1R66A 3L6UA 2GMWA 5BN4A 1WCWA 4YRPA 2OP1A 3VXKA 4D81A 4JYAB 1JA0A 3DZIA 5EQDA 4CMEA 4KAXA 4E5VA 1N2BA 2WJGA 2XE8A 2ZIZA 3SQNA 4BP1A 3V8QA 1IOZA 5IYZF 2H1SA 5LWQA 3H42B 2HQSA 1DIGA 2WTUA 4JXJA 3VGJA 3F6CA 1JWAB 5EKTA 4YRFA 3HZRA 5JS2A 2Z58A 3FUXA 4DHWA 1QP8A 5I4CA 2VJAA 4MW9A 3WL3A 1AO0A 1JJ7A 1RKVA 5CX1B 4C7JA 1EDEA 4F71A 4UARA 3S2SA 3L79A 4JLWA 2RBEA 1TYEB 2ORIA 4R8VA 1DKMA 1VLJA 5ALKA 5JBIA 1W0JA 2FTKE 2IPNA 2PBZA 2Z3VA 3GRAA 3I6IA 2YJNA 3IOMA 3QJYA 3QUSA 4G5FA 1VKZA 1Q6ZA 1A9XA 3QVTA 3IOCA 2R9VA 3H1GA 3SBDA 2OM2A 2K2QB 5KMGB 1IBMB 2O8BB 1X94A 2PR7A 3S2UA 1DE0A 1M5RA 1T4CB 2XVAA 4L27A 4LXQA 2PS0A 3PE3A 2FXVA 5TARA 2D5LA 3NQ41 4GKKB 3RRFA 1EP2B 2EZTA 4U4AA 4AP5A 4RK7A 4LE0A 5CGZA 4OIMA 4DLLA 3NEYA 4QAQA 7REQB 4LOKA 3RT1A 3DZGA 2O7SA 1LSUA 3RW9A 4LBWA 4K6GA 4RJ2A 3K53A 2JLUA 1MIOB 1JILA 2EDAA 2Y1LA 4YMLA 4IO0A 4P7BA 4UEOA 3AF1A 3TIIA 3FI0A 1FFHA 3R5JA 3FMGA 4LJYA 1Y3DE 4RZ3A 5AKEA 4NV3A 2F4NA 5BNFA 5C7LO 7ADHA 3GP5A 1Y3CE 5JMOA 1AKVA 1Q19A 4OVKA 2FZCA 1V1JA 1UK7A 1ZBDA 2IIVA 1KJ9A 2OCXA 4NFYA 5BP7A 4EECA 2Y71A 1YMVA 1GU7A 1E8DA 1M75A 2XMSA 4RVOA 3DJFA 4R3UC 1CQIA 1E7QA 2IGBA 2NV2B 2WIFA 1CY7A 4YT8A 5JNUA 1P5JA 4CNQA 2VKTA 1KVTA 1W2GA 3ND9A 2NW6A 2ZRFA 2XUJA 2I4NA 4RMJA 3WB1A 2XSZA 2B35A 1KMHB 2XCUA 3JD0A 1H4TA 3NNDA 4JENA 3Q6IA 1S1CA 2OSBA 2IS2A 5F7ZA 5CDUA 2C31A 3BZUA 2OHXA 1RAHA 5GOZA 4P84A 1IHYA 4INPA 1NVVR 1R10A 1JQEA 3OETA 4G63A 4MQFB 1BXRB 4XIJA 3AU8A 4V03A 4YCAA 5E6RB 4OUKX 5KKAA 4GX1A 4UOQA 5CB4A 1SHZA 1YZNA 4X65B 1ZWLA 2C57A 2Y1CA 4BNTA 1YD7A 4ETWA 1U6KA 4WNCA 3P9RA 5D5PA 2D4AA 3L8YA 1XDZA 4Z5XA 3GJ7A 3UCEA 2NZVG 3AR6A 4DW8A 3HN6A 1HSOA 2J0UA 1UPBA 1WWKA 3U31A 3WV4A 3UMBA 1D2CA 2GAFA 4RSMA 2ZCJA 1U0BB 4DM4A 3LA6A 3CWCA 1UH5A 1G8SA 3HCPA 3RC9A 2CDAA 2LZ0A 2ZAGA 2B8JA 4O2AB 4RF5A 5KOYA 1RLTA 1F0KA 1ZQ9A 1JG7A 1G8KA 3MTGA 5IG2A 4BLPA 1HYGA 4V0MA 2ZW9A 5AO9A 3PI6A 5FPPA 3TPFA 4GT1A 2OVBA 3M3HA 1QAMA 2AGVA 1E63A 2BKAA 4HGRA 5FWNA 2RGYA 3HNPA 3RAEC 4B0PA 1XLUA 1L7RA 1KAOA 4J4BA 3P2MA 1QYWA 3SIRA 5EIFA 3AC0A 4QREA 2CKMA 1PJ3A 1YMUA 1L7MA 3HGMA 1FSZA 1GFWA 3HJGA 4G23A 5AWFC 2WVJA 5HILA 5JG7A 2HWKA 1B6TA 4EGCB 1THMA 2PV0A 1KKUA 3MOSA 3QVLA 4J0CA 3D4BA 4N3AA 1LC0A 3RU7A 3ZZTA 1ZSYA 1KNQA 2UUPA 2LVBA 3D6AA 4L4UA 1JIVA 2BGWA 2J9RA 1E2QA 4AS3A 5L4SA 1U2SA 1WXIA 3PYMA 2BFEA 4HDKB 1PSWA 2DY1A 2G9RA 1E9FA 3HXKA 4EITA 3N2ZB 1CDDA 4BKQA 3PEYA 4Z1MA 3M6IA 3OQIA 1JDBB 4X41A 4RNDB 3CKLA 4M6WA 4BQIA 3WR5A 4F9TA 3UNXA 3A4IA 3IPRA 2I91A 5K0TA 4B3BA 1LI4A 4XX1A 1ZK1A 4IS2A 2O52A 1FUIA 3LYUA 3NR2A 5JOQA 2B7LA 2Q5FA 3DL0A 3ZDDA 2F9LA 3CONA 2R5WA 3OAAA 3TB6A 1HR0B 1QPZA 1KRWA 3I1IA 3QF4B 3GNQA 1RWXA 1E5QA 5HF9A 3WKAA 1TK3A 5GJVC 1U3VA 5B6IA 2WHPA 2C8VA 1IQRA 4I0WB 1IZ9A 4M76B 1ZPDA 1B2RA 3ROEA 5L51A 1WA5A 4PZUA 1WUIS 3H0EA 3MT8A 4I3FA 5AKHA 4AI6A 1CQJA 5BQOA 4G0OA 3IAS1 4D9KA 1PL7A 4J0IA 3FM9A 4TSKA 3PYXA 2H1IA 4HMQA 3VH1A 1W29A 1VHWA 1OI4A 3A2MA 1UPAA 1Z5NA 2NTEA 3IA7A 1FFCA 4DLSA 4HVCA 1KYQA 2J3EA 4LJRA 5TMEA 2XODA 1Y9JA 1SURA 3HO8A 4U9UA 4YAIA 2REOA 2JAOA 3UJDA 4ZFNA 2QORA 4IFIA 4YC7A 3TCKA 5FHRA 3EH1A 4ZGBA 1E3SA 2DCUA 1M2HA 2EFHB 4BVHA 1UBOS 1M6HA 1QE0A 3FB4A 4QPJC 2SHKA 3CRQA 1OHHD 4IDFA 5JTTA 3V1MA 2BLNA 2CEKA 1EYZA 1RQ2A 2HZBA 3D2AA 5FOXA 3H1TA 5KAPA 5CB0A 2GQ0A 2W0MA 1AIPA 2BMFA 4AZ3B 3L2OB 4Z1OA 4TXLA 3MJ4A 2PNFA 4UFNA 3PRJA 1FTWA 1N2CE 1RCUA 2UZ4A 2B7BA 3R77A 1M8GA 1OIVA 2D5CA 1VP9A 4R0VA 1JHUA 3HDYA 821PA 3O8CA 3W5UA 1H93A 4N5IX 1T3LA 1R5JA 1RLOA 5JSYA 1NJ2A 4G2NA 2C2ZA 1IYZA 3ULKA 3O82A 1NUHA 3A70A 3OUUA 1CEXA 3L4EA 4MVJD 4F4UA 3R24A 2I3DA 3MAAC 3MJCA 4WN9A 1YV9A 4R1PA 1GAQA 4PXYA 1PR6A 3MGCA 5B4VA 1VMKA 3NBAA 2XKJE 5JAZA 4EF6A 4A15A 2QXYA 3KSAC 2W6ZA 2YXBA 1T5LA 1OBVA 2QSJA 5A5DA 1JTVA 4KPUB 4EYOA 2NO7A 4PTZA 3D0OA 4CTOA 1QFZA 4ZYXA 5LYJF 4PHCA 3EVEA 4K81B 4DA6A 4GRAA 4TYYA 5IP5A 4MVYA 3VPAA 1EINA 5H1YA 3JPWA 2DFNA 2QN2A 2G1AA 1J0XO 2EHDA 3SNHA 1K8XB 4JBNA 1Z0FA 1YU9A 3WHIA 4F2DA 4HBGA 2GJSA 3EVTA 1N7JA 4WNIA 5IC6A 2PT5A 3FTNA 1F14A 3VYVA 1JG1A 1ADJA 1DAPA 1G98A 3ND6A 2P0EA 3ZZUA 5DWVA 3OTIA 5BOSB 3C5VA 4UEQA 4N8EA 5LMZA 2HO5A 3KVRA 3TQOA 1EXNA 4ENQA 4FFBA 1W85B 4YRBA 1M54A 1WB5A 2V6IA 4L3WA 2JIMA 5L4LA 3O47A 1HEUA 5BPFA 5KTMA 1UOQA 5EMKA 2DLNA 1ONNA 5EZQA 2IZ6A 3K09A 1QG4A 3EA5A 5SZJA 2V9ZA 3L0YA 3Q11A 2VDRB 4PGMA 4TLDA 2ZVJA 3G49A 2BM1A 3O73A 1SZJG 1EAMA 1Q7CA 3GGOA 2HT6A 3PD0A 4GR4A 3TEJA 3LBIA 3MSCA 2O8NA 3G7SA 3MWJA 2P1DA 3I2IA 2JGKA 4DCNA 5K1ZA 4BLVA 4EFDA 2XEXA 2VRCA 3V3TA 3GLVA 2NPIA 3IQHX 4DREA 2PGJA 4UTRA 3WL8A 1PHPA 3TGLA 3DDHA 5EXPA 4Y2HA 1KS2A 1KXZA 3RUCA 3ZWCA 2Q1TA 4BASA 4Y6RA 3R9XB 4WVLA 2AN5A 4FS3A 2JLQA 1ZIPA 4RF2A 1QC5B 2EJVA 4DMKA 1OB2A 2GAJA 3K9HA 1S7CA 4PLCA 4EKGA 2F1HA 2Q6TA 3HDVA 3HM2A 4V0KA 1D9XA 2A1TR 2WF5A 3FTQA 3HJAA 1E60A 4G5OA 3VNSA 3N5CA 3DVLA 4EIWA 3OCUA 1EBUA 1G21A 4L3VA 2QP4A 5IJ9A 4GOJA 1CYEA 4FINA 3WK6A 3K15A 2VH1A 4L74A 2HI0A 4LHVA 5THQA 2ZI7A 2VQ6A 3VVLA 2AZXA 3D2CA 3AEZA 4HUJA 2HRDA 2YFQA 7AT1A 2GN1A 5JNSA 3GJSA 5ICCA 4EKNB 3WMGA 2BF4A 4ITUA 2EOAA 4HDCA 1BRTA 1UMCB 2X9NA 3LBFA 4TMFA 3SZOA 3UKJA 4MAFA 3B9QA 4OFBA 4V0OA 1C81A 1XAIA 4QOFA 2QNBA 2V6BA 1KJYA 2CY0A 3OU7A 2X8WA 3TK1A 3UIEA 3TRHA 3ZKAA 4LMPA 3EEFA 3M70A 2FP3A 2JCGA 5JJCA 4DRZA 1BMDA 2ZM5A 2O1WA 3DOHA 5JATA 2B4TO 1DBPA 4ZA2A 3FH0A 3KDPA 3LPMA 4ZXPA 4XTCS 3H1EA 1QHYA 2BWJA 3Q9UA 1L4BA 1G17A 1A50B 3O4GA 4J43A 3FZYA 3HYTA 4LK3A 3AY3A 1I0IA 4NAVA 4KYTA 4KSYA 3MWFA 2CNBA 1ORRA 1L3IA 2FHPA 3R5FA 4AIRA 4NMLA 1YDFA 4PXSA 1A9ZA 2ZSHA 1F17A 1SCDA 4CIVA 5JD4A 3I5AA 1IE3A 1YVPA 4YCJA 3BILA 4B3HA 2RHLA 2GEJA 1XEWX 5EWMA 5JDIA 4LDRA 2HHCA 2V0CA 1FU8A 2FJUA 1FYEA 4MQBA 2X4IA 1E1KA 2ZYGA 4J03A 4ENPA 4OQXA 1SWWA 5DYYA 3UJNA 4JQOA 2X40A 4Q1EA 1P62B 4JSTA 4WPGA 5JNWA 2V7EA 3WBBA 2VYCA 3K0SA 3GPCA 4QC2A 2DUUA 4XDHA 4EA7A 4R8MA 3RRNA 3PPIA 5A02A 2BGIA 4Q19A 1XZMA 2CVFA 3ESBA 1N34B 1B15A 4Y0AA 4G4SP 4PIPA 3REGA 3WNBA 2NMVA 1XLWA 2LKCA 3ZGXA 3LXXA 4MMXB 3HB7A 2WMOB 4MR8A 4YI5A 4BQRA 4JQCA 2PCJA 1OY1A 3IL2A 5AQEA 2BGLA 1QV9A 2WAMA 4YLGA 1S2GA 2QQ0A 2G76A 3H84A 3AWIA 1CF4A 1CUDA 1NR5A 3N7UA 1HSZA 3OOEA 1BQ4A 1G6HA 3T5GA 1ZNZA 1KPGA 1P80A 1J42A 4HH0A 1M1YA 1SCKA 5AHXA 3S7ZA 2JGFA 3VR4A 4CNBA 3D0RA 5J2TB 1OU0A 1Z6AA 4MYUA 4WVFA 3VO9A 2JPDA 1EE9A 2J3JA 3OEEA 5DB4A 1JDPA 1Y1KE 3I1FA 3HYLA 3FVVA 4KQJA 4PANA 3CUTA 3LZCA 1AQLA 2C77A 4MLPA 4X6XA 3QTLA 2XTAA 3C5CA 2A86A 2WWHA 5FPSA 4A8JB 3NTXA 1B8UA 1XFDA 2XB4A 4YUXA 5CYPA 5AJHA 2PLAA 2GERA 3HNRA 3D0KA 5EKXA 4ACAA 1NNEA 1U6JA 3OOJA 1BHSA 2G17A 3IURA 3TLCA 1RYMA 1ODKA 3L0PA 4L2IA 1FSGA 1QP4A 3HMKA 3K4QA 3MS7A 1VYUA 5CA1F 1DAMA 2QY9A 3ZIUA 3Q8MA 3VR4H 2GD0A 1NR7A 2WUVA 3QXGA 4NAUA 1AUQA 4K05A 1JRLA 3SJ7A 2CHUA 3PKIA 3N8IA 2HM7A 4FW8A 5HUJA 4D56A 3FR8A 1PBNA 1H2AS 1QKJA 3FZGA 5FORA 1NW6A 5C46F 3JRNA 4HVLA 4LGYA 2XGJA 4Z9FA 4UJ3A 4J76A 2JIPA 4H1VA 1NPTO 2GSDA 4IEIA 4RDIA 1OH8A 2G3YA 2GVNA 4G1UC 1A1SA 13PKA 4K6MA 5FKJA 4BNMA 3BK1A 4H6WA 2GZRA 2VNKA 4LYAA 1VB5A 3RF6A 2GSWA 5DK4A 3K6RA 4NBRA 1XO1A 3FPGA 2ILTA 2AF4C 2IBMA 4J8PA 3SICE 3GJTA 3ENVA 3H86A 4CN8A 1YNSA 4I5IA 4PQFA 2VSXA 1JA1A 1ZINA 1P60A 1E6UA 2WSYB 3AR3A 1XPUA 5IPFA 3IKMB 1NDUA 2W2NA 4AG6A 4BPRA 4ARZA 1AGPA 1RKQA 3FCYA 3U13A 1SGWA 4FNMA 3Q1KA 1PLJA 3DMTC 3O9MA 2R8ZA 4OA5A 1RWQA 3W1VA 4GOMD 4B8WA 3L4BA 3SEFA 5ALYA 4OIFA 1NXTA 4IW3B 2P8JA 4FGUA 4DLRA 4OL0A 2A5YB 1TRHA 4FMDF 2FW1A 1R0SA 2HQBA 3UMYA 2QGNA 3H9EO 3L02A 5FPYA 3DEKA 4G1BA 4BVJA 4DR6B 4D8VA 2HRBA 2AEJA 4MYSA 4P6VF 1TT5A 2FLKA 1RRKA 1SBIA 2DF8A 3RNLA 3R40A 4LDJA 1K4MA 1CD5A 2ZJYA 4QULA 2ID7A 2I9PA 5BQ5A 4C5AA 3K32A 4JEHA 5C8YF 3SE7A 3QE3A 5DGDA 1P5RA 1FJ2A 2B1QA 2V45A 2JKZA 4CG0A 2ZS7A 2LV8A 1H2XA 5CVCA 2VAWA 3HB5X 4QEDA 1M8KA 1R27A 5I7EA 2J3DA 4K28A 1VP3A 5C1IA 4NZMA 2D54A 2QZZA 3EFHA 3PDIA 2VAXA 2VDPB 2OG2A 4TWAA 4Z51A 5IKPA 2O5EA 1MQ9A 1YMQA 3ANLA 4K8RB 4KK4A 5CB8A 1N8TA 2GM9A 4UDOA 2BJHA 4GPTA 4XTRA 3PA6A 4ZQBA 2OZPA 2WIBA 2ZJBA 5E2AA 4N41A 2YVKA 1QLWA 3FSGA 5TB5A 1KR2A 1ZVJA 4M1MA 1TF7A 2HRRA 2DECA 5D3QA 5FUVA 2CB9A 1S8AA 2DHEA 3HFSA 2B0JA 3L84A 4LY9A 1NR1A 1M8FA 4Q1BA 4H08A 5CXQA 2XNKA 2HIGA 4DQDA 2VXCA 2DJIA 1COWA 1RYZA 1QM5A 4KN8A 5AJUA 3TTUA 1DRKA 1JL3A 3MMPA 1JDUA 3FPEA 3KTOA 3B53X 4MW2A 2I54A 2A1IA 4FNOA 3FETA 1ZOOA 2ZYAA 1LLQA 1YI8A 1CRQA 3EIWA 3QFRA 1UJ4A 4ZDWA 1AKMA 3WWDA 2DWPA 4DM7A 3ZZ1A 3T1YB 1CPYA 4L8GA 2Z2YA 3KIPA 1GTZA 4RTOA 2D5AA 3FPFA 1XSEA 3K9BA 1X74A 1R18A 1SUBA 2UVPB 2R8EA 5ICFA 1JDVA 1LQ2A 4MI1A 1BMTA 2CL6X 4R3WA 3ZWYA 5HSGA 2GBPA 3ZY4A 4L02A 4AF6A 4C0AC 3PITA 1I3LA 3D7SA 1NXWA 1QZZA 2A0XA 3GUYA 5KJEA 3VR5D 4PX2A 2FUNB 4MB6A 3NP9A 2H1WA 3B2EA 4BVGA 2TYSB 5LJLA 4KR3A 1GAXA 3IUEA 2D0OB 3CX4A 1DXYA 1E1QA 1U8CB 2VT6A 2I4IA 4P3NA 3P9PA 2J45A 2F1OA 4CM8B 5IJ0A 2CDNA 3C7TA 5C8XA 4RXTA 4NNOA 4HRVA 1TYDE 2I4TA 4H7FA 1NQVA 3BZWA 1M7HA 1GFSA 5JS8A 2XTMA 5TPZD 1VG1A 3SFVA 3U6KA 3BAFA 2RJ3A 3VU0A 3PI7A 3DDZX 3LW7A 4WXMA 5EEGA 1TM4E 1B0PA 1KJ8A 2HRZA 1DC3A 4JYBA 4FOLA 3RK4A 3WRWA 4PLVA 1ZKDA 1YRQA 1UBNA 1YBVA 3BTOA 2PMWB 3EEYA 5K3FB 3PZRA 1YK1A 3BWEA 3RPEA 3T9AA 4DZTA 1ZH0A 1P81A 1UJBA 5J2UF 4I1PA 1EQUA 5K5EA 2MYTA 2PZ8A 4ZYUA 4U3JB 3AHIA 3OZEA 3HTXA 2IYUA 4RZUA 4J1NA 2YHIA 3AESA 3HU5A 3IHLA 2I6SA 5FCDA 3KQKA 2DLDA 1CRPA 5CB4F 1SHLA 1ZEMA 2ZUCA 4OHFA 1ZR2A 4EB0A 4ND2A 1BH6A 3B1YA 4YRGA 2PUBA 5A6VA 4B46A 2AYXA 1ONSA 2X23A 4KXMA 3QA3E 2TS1A 2AC2A 2EP5A 3NHAA 2EIHA 2NO5A 3DLTA 3P4YA 5DYWA 3ROKA 4URXR 1QAQA 2C1EA 3C87A 4LSGA 1L5HA 1SVUA 2FE1A 1WP4A 3MJTA 2WM3A 5A04A 4G8DA 1NAIA 4XD7D 4RE5A 3OT1B 1CIJA 1LK5A 3BFXA 4ND4A 1M3SA 5DNVA 3LT2A 3HWRA 2OXFA 3KOMA 3C85A 2Y66A 1TO6A 4LSWA 4GXNA 5B3JA 3DFUA 2BRUA 3UWKA 1BKDR 2RGGA 5TGZA 4EHJA 4DG9A 5IT0A 2NUAA 1K7XB 3PQ8A 3Q3GE 1KAEA 5FLXA 3VH2A 2QVCA 2NYRA 3GH1A 4FX2A 2EFDB 2VF8A 2FX2A 1GUDA 4U2BA 4NK5A 3AIKA 1BAPA 4WKOA 3IKVA 3KQYA 3MIZA 1D5CA 3E8XA 3IP3A 4XIYA 1SK9A 4JOCA 4OD0A 3IRVA 4Q4AA 3VOTA 2I8AA 2CD9A 3A6JA 4RHFA 3DA8A 4PNHA 4GGMX 4BKUA 3A6HA 5KWSA 3ZUGA 4LMAA 1X7WA 5PGMA 2RKWA 3M6VA 3QG1A 5CVJA 5FA5A 1UBFA 4GNRA 1RXVA 3O7WA 4M87A 3KJEA 2Y77A 3OWOA 4DM3A 5ALUA 4F1WA 1QZXA 4LF9B 3CLTD 1ISJA 3MTIA 4AJIA 3MJDA 3GG2A 5KKCA 5A1TA 2HC9A 2BH2A 2UVDA 2RGEA 4RV5A 2PT7A 1YHNA 1S8NA 4IXNA 3RRXA 3BL6A 4PC6A 3SEQA 1KZ6A 1EHIA 1QGAA 3TOVA 3JALA 5DKFA 2GI4A 2HQ1A 1PNTA 1T6ZA 4X00A 3TTSA 4QNRA 4D98A 3SWWA 2JLVA 3G8YA 4QWMA 5KTRA 3HSYA 3VPXA 1BN7A 1QGYA 2RAVA 4A2PA 2EG5A 1VIMA 3MNFA 3PPYA 3ZHZA 1AMNA 2CSXA 3MUNA 3ROPA 3W3AH 1JVSA 4MKGA 3ZE8A 4YJFB 4AJJA 5C1BA 1O95C 2H31A 3U16A 1CEQA 4Q1DA 4IQ4A 2GRAA 2QY6A 3P2IA 1N9GA 3BD7A 3FB1A 3W6PA 5I5EA 1U2GC 5DFAA 5ULLA 4NENA 1F2TB 2JA1A 1HEIA 1EVJA 3HEAA 3KT6A 4RPHA 1PJAA 5BYBA 3TSAA 2CLMB 1C7QA 1BMFD 1YXMA 1MGOA 5DTEA 4Y2SA 2XB9A 3PE6A 3J7TA 1KGSA 1TQ2A 1V3VA 3HBJA 4A3SA 1TJNA 3EVCA 4R7GA 4L7VA 2BFCB 3DHEA 4ZI7A 3THYB 1LJUA 3HKDB 4EY6A 1Z2AA 3MUEA 3NHWA 3C3BA 5ITZB 1RJWA 4H9GA 3BE5A 3SF8A 3UA3A 3V4VB 2WQZA 1GVNB 2YX1A 3AHEA 3QKRA 4F6RA 5H82A 1JEOA 3L7LA 5I7OA 2WKRA 4MR7A 1OCEA 3OZWA 2Y1EA 3F9RA 5H16A 1O4WA 1XTJA 3NO4A 4V0LA 1G18A 2ZI4A 1FP1D 1GUBA 5FOUA 2E85A 1V6SA 1ZI9A 4PLPA 4TL6A 1SUEA 1NBIA 4HYTA 2P27A 3P5BA 3KB6A 4RVHA 4Y2JA 2W22A 2AX3A 5K51A 3DJYA 4E70A 1T9HA 2VJPA 4H2DA 3GLGE 2WWYA 1H3NA 2PJZA 4BFCA 1A96A 2G83A 4R69A 2FMXA 5BYKA 5ALSA 4CKWB 1SIWA 2BFAA 3KK0A 4JNCA 2QT0A 1QOQB 4UUBA 2DR0A 3SBOA 4DUPA 1YVRA 3U7FB 1ZH2A 1PFYA 3BMNB 4NOJA 3KZNA 4OI4A 2HWYA 4P82A 1CJUC 4RD3A 4QDKA 3H8JA 4GPZA 2FV8A 4L4YA 3OE4A 1AKTA 3KAKA 3GT4A 1F1JA 1JVNA 1CR4A 4RKRA 1JEQB 4NEGA 5EIBC 3VH3A 2OBMA 3FTDA 3KOWA 3Q7EA 5AK6A 5DXFA 2HA2A 3A26A 2XTNA 1WDMA 3EGXB 3QVVA 3JAKB 4FFPA 3HUDA 3CUWA 2B5WA 2EFCB 4Q05A 3D6FA 4FK8A 2HTEA 3BF7A 1ABEA 3FPAA 3QTBA 3PHGA 4GBJA 4XIFA 1PQPA 3G9QA 5FOQA 2G88A 2ZE8A 4DJAA 2YCLA 4MPRA 4K9KA 1DAIA 3MWGA 2IDZA 2O07A 2PZKA 5IH7A 2ZBVA 3Q8XB 4ZALA 1DPGA 1M5UA 5GV8A 1IXYA 3UMMA 4Q1FA 2AFHB 2L69A 3NG1A 5ERGB 2PX5A 1LLCA 1T8SA 4UUQA 4KODA 1TUEA 1Y4AE 1SOUA 3I8OA 1SQ5A 3EDOA 1R5NA 4K86A 1SO8A 1CK4A 1X1TA 4H6VA 3QKIA 5E3IA 5HW0A 4QKQA 2CNWA 3B6ZA 1G64A 3MRTA 1E1LA 4YAEA 5K6AC 3FYHA 2DBQA 5DOVA 1U7UA 2DH6A 2YQ5A 5EVJA 1KYZA 1PZGA 5LZ7A 3ERCA 2BGKA 3IRUA 2ZXEA 3ZWQA 3RK1A 5B3KA 4RO0A 4XARA 1F0PA 1Z5PA 1CFJA 2YOHA 1KFBB 1W5FA 2XX3A 3ADOA 3GRFA 4GE3A 1AUXA 3WAJA 4DCMA 3C48A 2VHQA 3KLNA 2PA0A 4AY2A 3BREA 5KCMA 1YOVA 3LY5A 4P7JA 3KYJB 2XBMA 3KUKA 2N9UA 1U1EA 4O2RA 3C24A 2X5NA 3EGDA 3R7BA 4N7JA 2I6UA 4JUCA 4LV8B 4Q48A 5EN4A 4ZIRA 1NRJB 4V0QA 1SBYA 3AEXA 2Y6UA 3I5UA 4XD2A 4B3JA 3AQ4A 3FKJA 1WMEA 5AJTA 1TADA 3DTYA 3OVMA 3L1HA 4JELA 4YASA 1F38A 4YRLA 3ETLA 1NI3A 4I4TA 3IX7A 1Q91A 2E1PA 2FEKA 4NU5A 4OQ4A 4PYNA 5JE8A 3DB1A 1YCGA 1Z0AA 3I4CA 3TLGB 1CJMA 5IULC 1TUIA 1BS9A 1O6FA 1GGKA 3IXMA 2QAGA 3LM8A 3M4XA 3NKVA 3OA0A 3D3NA 3QPBA 4BNFA 5BURA 4V1CI 2FMTA 2D7DA 4QOSA 3ENKA 2XWQA 3M4NA 3WLAA 4ZYZA 1E94E 2GT1A 3P2EA 4EYQA 4AYWA 4O2BF 1QP7A 2EX0A 2ORYA 3BWMA 4KWEA 2CMKA 1D2AA 3E1SA 4XYBA 3N0RA 5AUQA 4XVRA 3OE5A 1Q83A 1CE8A 3WFIA 3FSJX 5CTAA 4I6GA 5AVKA 5BWOA 1JDJA 5LNK6 1ZIYA 1O58A 1PQ4A 4O4JB 1GL9B 3CPHA 3PIDA 1MB0A 1YB5A 3O5AA 3ITEA 4MPTA 4XSHA 2QD4A 2MR6A 3MJVA 3VDNB 2A84A 4IV0A 4E2XA 1QIFA 3NDPA 4QYXA 4KHZA 3W8DA 3DH0A 1UOEA 1V1RA 2WTNA 3PR2B 4UW9A 5F21A 4G5GA 4IQFA 1KO4A 3T94A 3HU1A 1LZKA 1HM5A 5FEUA 1ZN7A 2IZZA 3TRKA 2AF3C 2OB1A 4FXOA 1K92A 4B76A 4PEVA 3L7OA 3L7AA 4D3SA 3ILVA 1EFPA 5FYDA 5A0VA 1D1SA 2X0JA 3X44A 4D9JA 1BNCA 1H8HD 1QO9A 2QENA 5KU1A 1E3DA 1E3WA 1GAWA 4ZT7A 1G2OA 5B2ZA 2J5RA