3SVLA

Structural basis of the improvement of chrr - a multi-purpose enzyme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
b'KLQVVTLLGSLRKGSFNGMVARTLPKIAPASMEVNALPSIADIPLYDADVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVIDQGTLDHLTGQLTAFGEFIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yieF
publication title Crystal Structure of ChrR-A Quinone Reductase with the Capacity to Reduce Chromate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3svlA00
3FVWA 3W7AA 1D03A 2FVXA 2FAXA 1QHEA 1H69A 1J9EA 1JA0A 1TLLA 1XYYA 4HS4A 4U7GA 4BMPB 2ZKIA 2M6RA 4FGLA 4QOJA 2FDXA 2MTBA 4PTYA 1AKVA 1DXQA 3N3AC 1CZKA 2GSWA 2XOEA 4QOIA 1OFVA 4YAWA 4C14A 4C76A 3FX2A 3F90A 1FUEA 5LBTA 5EMNA 5LBUA 3N3BC 1DX9A 2OHJA 3OX2A 3F6RA 3GFQA 3R6WA 1I1OA 4N9QA 3TZBA 3HR4A 4C0XA 4PU0A 4HEQA 1B1CA 3B6MA 4Y9RA 3KAPA 1CZNA 2BN4A 3L9WA 3FJOA 1AKQA 4LAFA 1AHNA 2M6SA 4NULA 3ES9A 4QODA 2ARKA 2B3DA 4U7HA 3KLBA 4ZVMA 1CZUA 3QFCA 1E5DA 4N82A 1RTTA 3TE7A 3OJWA 1YDGA 1FX1A 1VMEA 1QRDA 1J9ZA 1YCHA 1QR2A 1NNI1 5NLLA 3JSXA 2QMYA 1KBQA 1C7EA 5JROA 3F6SA 4LTMA 1J9GA 1YCGA 1AKTA 2HNAA 3P0RA 2Z98A 2X2PA 2FZ5A 2QWXA 1YKGA 2X2OA 1OBOA 4DY4A 2QR2A 2R97A 3NFRA 3B6IA 2D5IA 4D02A 1AKRA 4LTDA 1J8QA 2XODA 5A4KA 3SVLA 5F51A 3NHFA 3ESYA 4ICIA 2BPOA 3UXEA 3ESZA 5EA2A 1YOBA 2W5UA 1BVYF 4S24A 5LVAA 3UXHA 4YAOA 1FVXA 5B3LA 4H2DA 3GFRA 1FTGA 2R96A 4XDGA 3HLYA 2WC1A 4YQEA 3U7IA 2HNBA 2V5VA 4FGJA 3S2YA 3K20A 3ESXA 1AG9A 3OJXA 4H6PA 4CETA 2V5UA 2Z9BA 3L9XA 3OVMA 1WSBA 4QOHA 2MT9A 2BMVA 3FW1A 1CZHA 4BMOB 4FGKA 3O2NA 1TIKA 1SQSA 3W78A 5TGZA 3FNIA 5FA6A 2Z9DA 2Q9UA 3B6JA 3NHWA 1AKWA 1WSWA 4QOGA 4GR9A 3NHJA 3ZHOA 3B6KA 4YAFA 4NLLA 4DILA 4ZVKA 3G5MA 1OBVA 4C0WA 3N39C 4FX2A 1H66A 1ZWKA 2RG1A 3NHUA 1SG0A 1FLNA 3OWXA 3NHKA 2N1MA 1KBOA 1BU5A 1XYVA 2KQUA 1X77A 1JA1A 4LTNA 5NULA 3KAQA 1CZRA 1XI2A 5F4BA 2QX4A 4F8YA 3GFSA 4OXXA 3OX1A 1FLDA 1F4PA 4PTZA 1AZLA 4GQIA 3NHLA 4J8PA 4YAUA 3LT5A 5F12A 4M0CA 2QX9A 3TEMA 3NHRA 4ESEA 5LJLA 5EAIA 4DIKA 5LLDA 5LJIA 6NULA 2FZVA 4ZVLA 3LCMA 2QX8A 1AMOA 5BUCA 2Q62A 1YRHA 1GG5A 4R81A 5FUQA 2FLVA 2OHIA 3GAMA 1ZWLA 4U7FA 1QBGA 1AKUA 3EYWA 2BF4A 2AMJA 2BZSA 5LMCA 3U7RA 2HPVA 3KEGA 3NHPA 2OYSA 1XT6A 1FLAA 2F1OA 2KLBA 1T5BA 2FCRA 4QOFA 3OX3A 3W79A 3NHSA 1D4AA 1T0IA 4N65A 4LA4A 1RLIA 3RPEA 5ULLA 3O73A 2QX6A 1YCFA 1RLJA 1FLVA 1CZOA 1CZLA 3W77A 2A5LA 1C7FA 2V9CA 2OHHA 4Y7CA 3K1YA 1D04A 1DXOA 2Z9CA 4XDHA 2FOXA 2FX2A 2QMZA 4ZVNA 4CF6A 4Y9UA 1RCFA 3OWHA 3NLLA 3F2VA 4QOEA 1V4BA 3NHYA 5FX2A 2MOKA 4YALA 3HA2A 3EDOA 2MWMA 3QE2A 1ZX1A 5B3KA 4GI5A 3D7NA 3QFRA
chains in the Genus database with same CATH superfamily
4W5QA 2ZJYA 1GWNA 4OQXA 5IKEA 1D03A 2FZEA 4IIBA 3LPLA 4JL8A 1E3WA 5G0WA 1Y8CA 1B73A 4RMIA 4B7CA 4M0MA 1YOVA 1CHNA 5JHHB 5DJ5A 1J9EA 1ZQ1A 3V48A 2BEUA 3B52X 4YP9A 5GZ3A 5GP1A 3SQMA 1H65A 2QQGA 2DXIA 2Y9PB 2Z2XA 3GLHE 2I1VB 3NBZC 4JFAA 2H9YA 2HBQA 2OFPA 1ST2A 3PIIA 4NATA 5AIBA 1ZSNA 2CZCA 3OE7A 2CD7A 1A9XB 3ZVNA 4RORA 1YZVA 5HCNA 4DZTA 5A0TA 1FDWA 3KELA 3NAQA 2WABA 2I4IA 2PO7A 3DOEA 2CV2A 4R2HA 1DWPA 3DE3X 4MV9A 3ZWPA 5LOVF 4AQ7A 2EX1A 3HHPA 3CW9A 3KAKA 4C1BA 5KQMA 2VN8A 4C14A 1UJBA 3UXMA 1PJRA 1VL8A 2ZZKA 1BG6A 2D4AA 1Q0QA 1OC2A 3L0IB 4TSFA 1W2HA 4P22A 5EMNA 4D9HA 2F4VB 1MVLA 3I34X 3PS9A 2HIAA 1BXRB 5DHQA 3UN1A 1ZJZA 1NF2A 3KE8A 3VNQA 1LRLA 1UJMA 1KSGA 4E5DA 3TW4A 4X1OA 4I99A 1NMEA 1TFUA 5JH7F 1G18A 2PLWA 5A2GA 5JVDF 4YAKA 9LDTA 1CUIA 4J0EA 1DJQA 2VJMA 2IGTA 4JBYA 1G7CA 1E58A 4TKVB 5TEWA 1M83A 1TZCA 1PJ8A 5D00A 2OXIA 4QPNA 1KJ8A 4Y2VA 3X1WA 4F4HA 2DBQA 1PR4A 1VHWA 3TTTA 1GGJA 3UMMA 2C9CA 3S6JA 5C1DA 4CDNA 4L0CA 4F60A 3L1KA 2D5AA 4KIGA 4NCHA 2HMUA 2R5WA 5G1PA 4O2BF 1MIOB 5GV8A 1E2UA 2P6UA 3Q3GE 1G98A 2FQ1A 3TI7A 4K40A 4AZ0B 2HRQA 2QM8A 2WJ4A 1HLPA 3WB9A 3D6JA 3GN1A 4ZT7A 1GRRA 4R1QA 3FJOA 1FJ2A 2YUIA 3BD8A 5FOTA 4X64B 3EGWA 5LZ5A 3FOZA 4YHBA 1AKQA 1SVUA 3HBAA 1ZH8A 2XAAA 3CKMA 3IO5A 1L6IA 1MJHA 3UNXA 2Z2IA 2EQ5A 2CMFA 1E79D 3VSDA 2D1FA 1XD2A 4QDOA 4DYHA 3IQXA 1C9JA 3HU2A 3WLKX 4UTXA 2CFRA 5KNCA 3UK0A 3A9TA 4B6RA 4ASUA 4EUSA 2Y71A 1JNXX 3NOOA 2FW7A 1ZXBA 2FR0A 4L8YA 3OCUA 4BCDA 1CLUA 1QYCA 4XM2A 3ACBA 1GSOA 5JEDA 1O08A 5JYEA 1RQNA 2C61A 4TLMB 1WV1A 1YZUA 5DH9A 4NDNE 1HC7A 1F17A 4UBLA 4HWPA 4WZBE 3OJWA 1DZIA 5ALEA 1TDJA 4N5LA 3UAXA 3ORSA 3OLWA 3QLJA 4KQ6A 4WGGA 1XZEA 2Q5FA 4XQEA 4J0CA 2HM7A 3IERA 1TZMA 1FNCA 1Y1RA 2BM8A 1EAMA 5D2CA 3THRA 2ZR7A 4MVJG 3PZRA 3W0LB 4B4DA 4ALJA 3C8HA 1U7OA 2WM8A 2QR5A 4PYKA 1MTOA 5NLLA 1FVHA 1MXHA 3O4RA 2VJNA 3U7GA 1BX3A 1Z8HA 2QIOA 3HY4A 3KO8A 1RPJA 3OLCX 2PVCA 1K5DA 3H5VA 2MDTA 3IVGA 4HLCA 1RNLA 2C3UA 2QM7A 2WILA 3B82A 1J9GA 3ETNA 3KSRA 4EYKA 4B3MB 1QLJA 4TT3A 2Q8NA 5FL7A 2OZPA 3BEDA 2GWHA 3D4BA 2NNWB 4TWBA 3S40A 3STXA 4I3HA 3SK0A 4DMFA 5KOHB 3B7GA 3SHFA 3OD5A 3BHNA 3THYB 2BH2A 3R9WA 2G5GX 2R68A 3E1GA 3H9JA 1RYHA 3I12A 4G1MB 4LRUA 4OP3A 5KX5B 3M6IA 4DV1B 1LPOA 2VDNB 4Q03A 4NICA 2PEZA 2XV1A 1YKGA 4N5NA 3RTDA 4ARUA 5EP3A 1U3WA 3OM8A 3B2QA 3NT5A 2X4GA 4B7ZA 2X1LA 4NFHA 1T36A 1X1QA 2P69A 3ZE1B 2P6NA 5JXHA 1U8ZA 2IYAA 2Q6VA 2VDWA 3BWMA 4LGYA 4QWWA 1O03A 2GZ3A 4ZU6X 3NT2A 3R76A 4LVCA 3BC1A 1SUEA 4CZ2A 2D2FA 3I4LA 3ZLBA 2XYPA 4Z4QA 3MS2A 3QV1A 4MW4A 4A2WA 4CKXA 5MHTA 4OSOA 5HWSA 5IJ9B 5AJYA 1E2HA 3QPUA 4PC7A 5YASA 4OMFG 3L8FA 1HL7A 5EVJA 3RS5A 5K4AA 5IM4F 3UPUA 4UUPA 1PE0A 3O8CA 4LWZA 1QDLB 3NZEA 3NXKA 4DJEC 2WYWA 4RYLA 2P9QA 3DB2A 3VSEA 3WJ1A 5K09A 1OH7A 1R6TA 3PLRA 4S12A 3A32A 1K1EA 4BFSA 3ESZA 5BQ5A 3N6RA 3RSCA 3W8EA 2VK2A 3ZBTA 2PKYX 3OOWA 4HF7A 2EKPA 4HMOA 4ZT6A 4EH1A 3TSCA 1O6FA 1ZGCA 2QNIA 3CNOA 3T4PA 2F8SA 1M72A 1ZEJA 4IGIA 1PEAA 5LP1A 3AYXB 3R9XB 1KNQA 4R8KA 1CB7A 2X9LA 4TZ6A 2V7XA 3TTUA 3H5RA 4IY1A 3JWHA 2ALJA 2H4WA 4F5EA 3IBFA 1QOZA 4IVPA 1OREA 4KLAA 2GYWA 2HDNB 1P6UA 4AUKA 3OF3A 3QX9A 4EQ6A 1F2DA 4MK4A 4KFCA 5BW6B 2ECKA 3O9ZA 2EF1A 3H7AA 1T9CA 3AHCA 4LJYA 1ZPDA 4FCVA 3AF5A 4OLJA 4RJJA 1UZNA 5JWRA 2UYGA 1L7QA 4M22A 5IMBA 3QEKA 4C4YA 4DBZA 4TYWA 3RKUA 1QS0A 1IDOA 1O96A 1AG9A 1PZHA 3KVOA 4R9NA 4BFXA 4PLWA 2QRUA 5J5AA 2WHXA 1CQWA 1JECA 1VIYA 3EXHA 4M7PA 1DARA 1E1NA 1CUDA 2JBWA 1V4VA 5E9JA 4ZHQA 4TLCA 2Q1UA 2OC4A 1N7HA 4EHBA 1HV8A 1QHHB 2IK8A 1E3QA 4UE2A 1CRPA 3G8DA 4DDMA 3KU4A 2KM1A 4FN5A 1JN0A 2E21A 1XNJA 4P98A 3OY2A 3A28A 1CY6A 3TQFA 1I51A 3VU9B 5IPFA 1EGQA 1WCXA 2JLBA 3KUUA 4JJ7A 3A58B 1R88A 3GUCA 4OUDA 4QFMA 1GLGA 4MMXB 4W5JA 3TEJA 4DGQA 4CM4B 3DEAA 4ECAA 1M6VA 2AKEA 1JDVA 1MJNA 3GD5A 1IBLB 2H0AA 3RTGA 2ZB8A 2QD2A 3OURA 5F64A 4A8JB 3NBQA 4CCAA 1F2UB 5ENDA 1RVDA 1DJMA 1GQRA 5K20A 3S7ZA 4OIFA 3KJIA 1P7YA 4CKEB 2YY7A 4X95A 4EYOA 2Q9UA 4AJEA 2QAGB 3L4BA 1VCIA 2QSJA 3F8WA 3E4CA 1P0QA 3SBXA 4BBPA 1RPZA 4XGIA 1DIOB 2GYUA 4FCTA 3NHWA 2VRCA 3IUQA 4TL6A 4KQHA 4EABA 4WKPA 2IY9A 4C07A 1SRRA 1IZYA 2O4CA 2YS7A 4XTCS 4UU1A 3ZKWA 3V34A 3K9FC 4U6NA 5C8YA 4CN8A 4F91B 2UYQA 1YMQA 1J4AA 5JADA 3SD7A 1DOZA 2A7QA 1XQ1A 4HYTA 3WMEA 1N75A 1LKZA 3MK31 1JTVA 1UPXA 3PDJA 4Y1EA 1Z26A 1RZUA 1L3IA 1VJ1A 5K3CA 3N1UA 4JXZA 4YO8A 2RGWA 3EULA 2NQ8A 3IJ5A 4JLJA 4DWOA 2H1SA 4CTNA 3OZTA 4KFTA 1K0FA 3EFOA 4Z0PA 5EHXA 4MAFA 2R65A 3BXEA 3FSJX 5B53A 1QHFA 1V71A 3B85A 4E21A 3BPSA 1JHVA 3VU3A 4A15A 4H0FA 3GUUA 1BH2A 4L4UA 1IPHA 5ECGC 1FYXA 5KQRA 3BE5A 2B8EA 4F2HA 4G26A 4UEOA 4U5QA 4P82A 1EWQA 3BMQA 2P1DA 2V6FA 3DVRX 3VR6H 5A6SA 5DHTA 3OLVA 5T3UA 4CR7A 3FJYA 4LWPA 1VJTA 4ZT3A 4EF6A 3IT0A 3FWKA 2TSYB 1Y98A 2VPWA 2VZLA 3LQQA 4G0XA 4IHAA 1HFKA 1K4YA 1NXVA 4FNGA 5ALYA 3MWKA 3KM0A 2XTZA 3HKBB 5E4YA 3V7UA 1W59A 4ABTA 3M82A 3PF8A 3EZGA 1CUAA 5BQPA 3OTOB 3ASUA 1FPMA 4PV7A 1PJQA 2FR1A 1AKMA 2ZYRA 4RADA 2HU5A 2WWXA 2ZETA 3D4OA 3BXHA 1GSAA 2BKXA 2CY0A 1N2XA 3O82A 4HFNA 4B45A 2PWZA 4DC9A 5KZMB 2HPAA 5AOVA 1BZYA 3OKFA 2GRJA 3QVTA 1YO6A 4RULA 1A2BA 3DMGA 3IDFA 2H1OA 4ILEA 1EP9A 3SDZA 4LMBA 1GT91 3VGJA 4F5DA 3U31A 3E8XA 4DJAA 2H7VA 2HEGA 4RFSB 1XO1A 1YVEI 1NQOA 2XHEA 1KO4A 1TUBA 3G59A 1SKQA 1N0UA 1TU3A 2SKDA 3DNFA 3JQRA 1GY8A 1JIQA 3GRVA 4DUZB 4TMXA 3BF8A 2YV4A 2SBTA 3KJZA 4HQKA 1EJ0A 4JHXA 1P1RA 1GU7A 4YFVA 5KYNA 5CYGA 4D3DA 1CC1S 1HM5A 1M1YB 1FJXA 5IUNC 1Z16A 5I3CA 1RYYA 1BMFA 3ULKA 4H7DA 4PFJA 4YJFA 4D99A 2WFAA 1SA0A 1EFRA 1BYIA 2OILA 2QVXX 2XTAA 4G5OA 5LMNB 2C84A 2X8BA 1E4YA 4IICA 5U1PA 4YT8A 4JBNA 5CU7A 3AHFA 3WP1B 3IODA 3OU6A 1E9BA 1Q77A 4OHKA 5JIBA 1CUGA 2PS9A 2VUHB 4MPTA 6NULA 3OE1A 1BNCA 1V41E 2H5JA 5EP4A 5CPFA 4DLZA 3IEMA 1II0A 2DJ5A 4YJ3B 3PX7A 2WSIA 2F6RA 4B76A 1E5TA 2GXAA 4RZQA 4Q9DA 2QLFA 2BKLA 1R6XA 1JDJA 2MSWA 3GQBB 2P6OA 1C1DB 3AU8A 1D5CA 1N5IA 1PUXA 4EX6A 3C7AA 2WIFA 3GH3A 2IOFK 5T4EA 4EW1A 2YJTD 5TF0A 4IOKA 4I6EA 4X1YB 2BF4A 2BFWA 4Y67A 5AICA 4B3GA 3C6MA 5EUMA 3P45A 1KE2A 5EQFA 1SXGA 4D9EA 2XJ4A 4PGMA 2HF7A 2X5KO 4CV1A 4HDRA 2DHRA 3F5QA 3CF6R 4GXRA 4EHDA 1FXWF 3GBVA 5CLFA 3HJRA 4MWDA 1PJ2A 2G25A 3CH5A 3EXEB 1EKXA 4HT3B 2XZDA 1QH8A 3MNFA 3CV3A 3MSCA 3QY0A 4I50F 8GPBA 4JYZA 3ROEA 4YMHA 1UXJA 1DTWA 2JF0A 4RHTA 3FI9A 2ZJ1A 2F3RA 4NENA 3HYRA 3CTPA 1EE1A 4IWXA 2HRCA 1NYRA 4ND8B 3VR6A 2C4VA 2C3OA 4KYTA 7REQB 1T8UA 4R2XA 5BY2A 2VHVA 1OZAA 4ZCLA 1DQSA 2IEBA 2QRHA 3ODPA 2VHJA 4IRXA 4DPLA 3MMZA 4GYKA 1XRRA 3B51X 1K6IA 3LUKA 5IDWA 4BKPA 4P0PB 1T2DA 1ZW1A 2J7PA 3HBMA 1YS7A 4I1RA 3SFZA 4D7AA 1OT3A 4HDSB 4GOND 3ADKA 1NGSA 2QX6A 3CH4B 1ISMA 4LBVA 1E2QA 4WIAA 3LXRA 3RFUA 5BVHA 4JKYA 4BNDA 5LL6P 3DLHA 4NPHA 1UWVA 3P9IA 3TRKA 4L8VA 3T41A 3WR5A 1XQVA 2IBMA 4WN9B 2AMFA 3GF4A 1W48A 2HCRA 2Q0SA 1UUFA 3F8TA 1SY7A 4FHCA 1BYUA 2IITA 3OOYA 3GFBA 4INJA 2ZCUA 4DG5A 4QPZA 3GROA 1QVWA 4F3NA 4YRKA 4LDPA 4AURA 2QY6A 4GR5A 2BFCA 1I3LA 2H4JA 2C9BA 2QRQA 3HN6A 3LYHA 3P2IA 2E7ZA 5EIHA 2NVUB 5B7NA 2WOOA 3UYLA 2BUCA 2PJDA 2ZR0A 5EP1A 2RHOA 4TGLA 1AKNA 3KEMA 1PUIA 2OHHA 1Z7YA 3TPCA 4Y7CA 4L6IA 3INTA 1FXWA 1JR3E 1X92A 1YL7A 4BB0A 1MO4A 3CB4A 5K4GA 3LC1O 1AKYA 4MUJA 2CNDA 1LLFA 2FVYA 2ZVQX 4O08A 2X5XA 3C7KA 3TVDA 1Y8QA 3FWZA 5AKJA 1Y6JA 4QL3A 2ZITA 5DI3A 3TNYA 2P2LA 2A0KA 3CWCA 4CMEA 3H4VA 4IDOA 1N0HA 3F6BX 2XDQA 4ARZB 5GMOA 2QORA 1G0OA 3BCSA 3IT3A 3BZBA 5TPWA 2BDUA 4P0TA 2YOHA 3OWHA 3DO6A 1D7OA 4MDFA 4B35A 1G42A 3JZDA 2O8NA 3LXUX 2YW9A 5D3MA 2Q9CA 2B61A 3K0CC 2PNJA 3HTXA 3D6UA 2H2HA 1X1TA 1GQOA 5AHOA 2GZAA 1OU0A 2VPIA 3CW8X 4C89A 2RK6A 2ZSIA 1XZNA 2B2CA 4KVFA 1RAHA 4JAVC 1PKXA 1KYYA 4CN9A 1P45A 1QK3A 1KYZA 2Y77A 3AV0B 2F3TA 4KK4A 4WEQA 3W7AA 4G5QA 1VE9A 3AUTA 4E2YA 1UXIA 3DWEX 5HTOA 1W29A 4TYMA 2EJVA 3WY9A 2JCGA 2MSCB 4PLVA 1X2BA 2WIJA 5DSTA 1UJ6A 4BO2A 2YHIB 4QAJA 2D1YA 3FFXA 4KQMA 1EQUA 3S99A 4BO8A 1S2OA 1T9GR 3NATA 4CT0A 4WBXC 2WVHA 1AGRA 3AZQA 5E2IA 4WRRA 4DBVO 2G0NA 1CQXA 2ZULA 4LE2A 5JSYA 2OYCA 4B4WA 1KMQA 1V3UA 5DNCA 3SHTA 1EK5A 1W0JA 3E9YA 4JU8A 5K0LA 4UUOA 1U7UA 3Q3JB 1LF0A 4WLOA 3ND6A 521PA 1ZO8A 5E0OA 1ZH0A 3BN3A 2PWPA 5KJ6A 1MGOA 2NT4A 4B6FA 2F8TA 1T9DA 4IIVA 2C97A 1O87A 1TOAA 4J0HA 1WLSA 2IL1A 2XUDA 5EJ2A 4B73A 4W7IA 3Q5GA 1Z0SA 2SICE 3OE4A 3ZHBA 1DFGA 1DS6A 2FUCA 4LJ5A 5LBTA 1C1XB 4IHKA 4CMJA 1RPNA 3NX4A 4D57A 3BKXA 4ALMA 4G4SP 4CDRA 2I9KA 1W25A 2CXTA 5K8IA 4QU8A 4EDHA 1QZXA 5HF9A 3PNSA 3CVUA 3P9XA 2IEAA 4ZGBA 3GP3A 4JQCA 4EHHA 3TX6A 5IDXA 2JFPA 3GGGA 5JNWA 3VPXA 2QLJA 3N8GA 3P19A 3EZNA 4LBWA 1DMSA 2COUA 4LISA 4F93B 1GTL1 4KYUA 4LHVA 5B57C 1KYQA 3HR4A 2WNSA 2CLFB 3VPFA 2ZDGA 1VG0B 1PZFA 2QYOA 4UJ3A 2XGGA 4X8MA 1AQLA 3K1ZA 5EYPA 1IUOA 3GPCA 1OXUA 3D2BA 1JMVA 4Y9RA 4IR7A 4KR9A 4OI4A 3GJ8A 3DBRA 2VR1A 4I9NA 2Q28A 4P86A 1OW3B 3HP1A 4GKBA 1NYLA 1XNHA 5B1DA 2F64A 1N8NA 2EP7A 3SJBA 4DMHA 3E81A 4G01B 4NR0A 3B36A 4AJLA 1Z7EA 4EGSA 2XQVA 2IYEA 1JWAB 3QVSA 4IIJB 1OI3A 1C0EA 2NYAA 4O1HA 3WNQA 4MWTA 2IS6A 4EO9A 1NP3A 1TA0A 2L2QA 4L9SA 1C4WA 3ES9A 2JGFA 4E5PA 5TDHA 2IWRA 1GPH1 3N8DA 5IC5A 2CUKA 3I1JA 3ESDA 3P9YA 5A7HA 2ZRQA 4HX9A 4BQRA 4XCXA 3RF6A 2X42A 4ZJPA 2WJ3A 1J0AA 3DT6A 4TQGA 1UOQA 1NE7A 3FUVA 3OJOA 2C58A 2JLWA 1OVGA 3RS9A 4C87A 1H2YA 1NJ8A 2XE8A 2ZUTA 3TXAA 3QFCA 2Q4OA 3U3RA 4FNAA 4R2JA 1X39A 3RVJA 5H0IA 2AJLI 2C03A 4Z1MA 1JSRA 1C14A 2FHPA 4P32A 3S55A 3K4PA 3LVFO 1ZNZA 2QPOA 3KOMA 4HQOA 4MYHA 5FBWB 1GZ4A 4BAGA 4WA8A 1Z68A 3ZE9A 3KTOA 1ISRA 2VYND 1G16A 2ZJ8A 1P3JA 1K4KA 3ESRA 2ZDQA 2K7FA 5KVAA 3LWDA 1EI9A 3M3HA 2ECOA 2G9QA 2FP4A 4OBXA 4LRWA 4RZ2A 4BE4A 3K0EA 4YRCA 3DO8A 3EZ6A 3FDFA 2O19A 3LT4A 4RY8A 2Q3FA 3NUQA 2HH9A 2GAIA 3MINA 3C3KA 3R09A 1JIUA 5IZCA 2HO4A 2OHFA 4IIGA 3Q11A 2PGXA 4O6VA 5FLKA 3SQOA 4MS1B 2Y67A 2RGNC 3H5IA 4RENA 1ZR4A 2W71A 4HQNA 2CXRA 1TCBA 3TF5A 2B34A 4ZC1A 2WFLB 3HUDA 4MKZA 2ZSHA 1ZMBA 2GFIA 4HJXA 4CLRB 4FSDA 1CULC 2MR5A 3QUCA 1GPAA 1G5HA 2GJKA 4Q3AA 2IW1A 3ER9A 2ODPA 1Z9BA 2I7DA 2X7JA 4ON9A 3ECAA 5JY1A 1U7XA 2G8LA 3W34A 1US8B 4Q6BA 2OXFA 3LHDA 5AM2A 4XKJA 5ES4B 4G8JA 5EQDA 4XGQA 1IC6A 1NZFA 5FULA 4ZYYA 1RKUA 1AKRA 4C7VA 4ZVPA 3NM5A 4D80A 3A2MA 1GFSA 3CR8A 1SC1A 1Q6YA 2P2CA 2QGZA 3DUWA 1UT8A 1NI5A 3MIZA 3MTBA 3EZ9A 3NG1A 4M8LA 2P2NA 1O9BA 2ANCA 3FOEC 3AI7A 4K1XA 3GJSA 2ONZA 3IJEB 2PT9A 4RTMA 4URHA 5FWXA 1A2QA 1S0UA 3I0MA 2QHXA 2WAYA 1JSZA 3N86A 2PKEA 2AWOA 2EFJA 2P6MA 2ZXFA 3L18A 4R2KA 4UAVA 4PZUA 5FKJA 4AO8A 4CV2A 3LBHA 3DFUA 3K9LA 4IINA 3FWNA 4NFYA 2QSYA 1NVGA 3EDYA 4QJIA 1Y8RB 2DX7A 5BPHA 5I45A 5JBIA 2PUWA 3DFMA 4YLYA 3LXXA 3T3GA 4WT7A 4CIAA 2LNDA 1XAGA 5B3LA 1K7EB 1E89A 2FW0A 2VCHA 4EUEA 4YIHA 2I66A 5LC1A 5EVCA 3ZI0A 3SS8A 2HU8A 4B3CA 5C4MA 3IR7A 5JEEA 3ZCUA 2X41A 5K3AA 4BFZA 1NBMD 3FHTA 3U5ZB 2VZ0A 2HNBA 3CZRA 3RTEA 4DQUA 1WUKS 3AP2A 1GNLA 4PHCA 3VQTA 1E2LA 4BV3A 3ZKAA 2XVZA 3HMKA 4R51A 2PKCA 2ZPUA 3L9XA 1J1IA 4CEJA 5CDGA 1TI7A 2X8WA 3LP6A 3D8HA 1YZKA 3LQ1A 1I7LA 3SC6A 2VYVA 1ADYA 1P5ZB 1RYZA 5IYZB 1QO9A 1Z0JA 1NPYA 3M5DA 4C4OA 3NR2A 4AO7A 1E3EA 1HQKA 4LK3A 2JDID 5MF6A 2MT9A 1KY5A 1T2EA 2GESA 2OVBA 2FEAA 2XBLA 1USUA 3NC4A 4ND3A 3WBFA 4EVIA 3NHMA 1GRQA 5CG1A 2PMWB 1THMA 2H54A 5CK4A 4BQEA 3LCRA 4RTSA 1AVTA 4DXAA 1WIWA 3JVVA 2LKCA 2QYSA 1M74A 2WYUA 4RDIA 4GAEA 4EG1A 1Y1LA 2XXJA 3BS4A 4PYIA 2J9ZB 2C5FA 3P2EA 4IKEA 4ZA2A 4ZVSA 5BWMA 2J32A 2IP1A 4DMGA 3CUKA 2AN4A 2C9OA 1S8FA 1MH1A 1QX4A 4FYPA 1DIGA 2HJVA 3PFNA 2GBIA 4Z7JA 2Q45A 3FPKA 4MW2A 1SU6A 2W37A 5LQSA 4FGUA 4A10A 2VFAA 4KAXA 3CLSD 1DXHA 4ZOEA 3PC8A 2EZ8A 3WNZA 5EE1A 1USVA 1JKXA 2DCUA 1G9TA 2G1KA 3ITEA 1KAHA 1L4UA 3A25A 4CQMA 1SHKA 2FU5C 4OFBA 4EKGA 2P4SA 5JFTA 1Q7CA 3ZHOA 3UJ3X 3VUEA 1QOPB 2WP0A 3SF0A 3B3JA 1ORRA 3C6YA 1QCYA 4NMXB 2Q2OA 2WJ6A 4QFCA 1DQRA 5G0UA 3I2YX 1Z47A 3P20A 5C5DA 1W5AA 4JJFA 1YL6A 3COJA 1KEEB 3UAYA 3BXZA 1QG6A 4ETMA 2JZCA 3EA0A 4GNKA 4YRFA 3S7TA 5LWHA 3DMTC 1FBTA 2RGDA 2EKDA 4DHEA 3E70C 5BRJA 3OESA 5JAIA 2K87A 1U98A 3N0TA 4H16A 5ALUA 4ZVRA 4Q4CA 3HU5A 2IY7A 3WK5A 1D9ZA 4JXJA 1CVIA 1DJLA 1X8JA 2HMAA 5KTOA 4Z7NB 1A76A 1OYYA 2C8VA 3FKJA 4TYYA 4LY9A 4Y2UA 2JGRA 4N0MA 3QKTA 3FIUA 1X77A 3V55A 1KORA 3ECSA 5B3JC 4HDOB 3MILA 3P9ZA 1P7CA 3NTOA 1FYDA 1DZ3A 1NUHA 1QAOA 4MW6A 5AVKA 1D8TA 1I6MA 3ONVA 1N92A 2WIAA 5HK8A 1LFAA 1AF7A 4LSGA 3PIDA 2AZMA 2J08A 1GADO 2Z8ZA 1WJGA 4QXRA 5LZ2A 4KR2A 4R1UA 1WB9A 3KQVA 4DJFC 2DT5A 1RQPA 2TS1A 3BCUA 1LW7A 2A5GA 3DLTA 4HEA1 3ZY4A 1Q74A 3ZW7A 3ABSB 1FE8A 1D1SA 1YAJA 3GRFA 2B1QA 1JLLA 1ZKDA 3D7LA 4WOJA 4NBNA 1LSOA 3OTQA 4X3OA 1X42A 2WU8A 1JU4A 2GT1A 3I2GA 4P3YA 2FUG1 4EGAA 5BWBA 3K5IA 4EG5A 1EE2A 5C8VA 5TQ0A 1RZRA 1YDWA 2W6IA 3B9PA 5FOWA 5U4XA 2KLHA 1JKJA 4JQOA 4Q3KA 3TQIA 5HS6A 3LQRA 2HCJB 1C8VB 1KSHA 4AXBA 1EGVB 2C4NA 2TYSB 2ZAIA 3GG2A 4HH3C 3ZUGA 2P9EA 2XUQA 3OQIA 3G17A 3H5WA 4RMNA 5ENZA 4IJVA 3IKTA 2Q46A 1UBOS 3G0BA 5DXJA 4FR5A 1K63A 1KKLA 2P3QA 2VJAA 2JKVA 3U7QA 5FV4A 2NQ2C 1W96A 4UUNA 1R18A 1JJBA 4XEUA 5BWNA 1SGWA 1SWVA 4WOCA 1E2BA 4U9UA 1R50A 1T9ZA 1K7CA 4QXQA 4GD3Q 3CF4A 3V6LA 1TMKA 1IQUA 3BIXA 3FTNA 4DJJA 1PTJA 4PSUA 1LDYA 1NRJB 1T2UA 1SVIA 3LZ6A 2JFWA 4HVAA 5J43A 5ARBA 4LYGA 2OO3A 3D2CA 2R1VB 1V8BA 3B60A 1L4KA 2H4ZA 2R60A 4HPWA 3L1IA 4EEXA 1HG0A 2B1IA 2BF7A 2XYRA 3T1HB 3ZDCA 1JYEA 1QWSA 2R00C 4LJ8A 4TWRA 1K3FA 2NGRA 1DRKA 1AKUA 3KKKA 3LIIA 2QAIA 1RLMA 1XD2B 2H1FA 1LSSA 2W6PA 3SSNA 1X38A 4DRZA 1Q0UA 1IWBB 1UMCB 1JIKA 2QD5A 2J0VA 2WSMA 5LOVB 2EEZA 1AHHA 3PGXA 2BMWA 1UBJS 2XCQA 1E1CA 1L4HA 4IVNA 1BN6A 4NG4A 4GYYA 3TR6A 1UEXC 2HU7A 2GN6A 3CBGA 2GEDA 5KMGA 2R8YA 3IGFA 4M7OA 5LYYA 3QW4B 1X7ZA 2IZOA 3RAGA 1ADCA 1H5UA 1XC7A 2NPOA 1QFZA 1H4VB 4RLQA 1KH1A 2NIPA 1TU0A 5JJLA 2NACA 3BK2A 3MSXA 4MP3A 1HE5A 1EGMB 1ONPA 1LRJA 4FZRA 5EINA 3U4GA 1XEAA 3W5CA 2IEIA 3DC7A 3DBHA 4LECA 4BQQA 4RTLA 5CAEA 5P21A 1IN8A 3N9IA 5JVDB 1NW3A 5GOZA 5BYBA 3T1YB 2FCRA 3V46A 5JO0A 3MUNA 2VTEA 1JGTA 4L8LA 3WLAA 4JA0A 3IUPA 3E5NA 3I8SA 1LS1A 1ONSA 3PD1A 2ZATA 1SAYA 1M2OB 2XQGA 2GZDA 1FFCA 3E5HA 4REOA 2BKUA 2PAFA 2W6OA 5I6DA 5EIXA 3EUEA 4AULA 2YICA 3NIDB 5F2NA 3T1TA 1UKAA 3UB4A 2B5WA 3OZAA 3W1VA 2NAPA 2QG9A 2XA1A 1CUWA 2ZSEA 4O2BB 1ZJ6A 4OQNA 2WHEA 2OHXA 4HN2A 5ABPA 4MR8B 2GN2A 3PUZA 2ISCA 3VSAA 1CZOA 3A4MA 4NMWA 1CJTC 4DZZA 5L40A 2QN6A 3K0AA 3U3JA 5IJZA 2BJVA 4WESB 5K0FA 2H1VA 4JLOA 3S29A 5C52B 2OQRA 1IBMB 3VR1A 3QA9A 3ILXA 4BBZA 4NNJA 5FPQA 4UDOA 4AZ3A 4LNAA 4HNUA 1K68A 2W42A 1R0WA 2RB5A 4HNVA 1TA9A 3GJZA 1II9A 2GI4A 1R9GA 1RMTA 1T36B 1XCOA 3I92A 4Z51A 1JEJA 2WWVD 2G6TA 1LBEA 4KWTA 5HRAA 1NC1A 4KACA 1F9EA 1XEXB 4O4JF 4U9IS 4N0QA 4DSAA 4JI2B 3IEKA 1VPVA 5EKXA 1O89A 2MYTA 3VTFA 4BECA 2J0SA 2YMQA 4EPXA 2VZ9A 3TCXB 2AWNA 1VJ0A 4M8NE 2YWCA 4DDKA 2VHZA 3WNCA 3V8NA 1XDSA 2BKVA 4D4GA 3SLKA 1F2TB 1Y8AA 3K0HA 4EATA 4HK4A 2FMFA 4RJTA 5U4QA 1U8CB 3O26A 4YUWA 2ADOA 1XCJA 2XZLA 1CEYA 3DQPA 4NQRA 2GZHA 1MA0A 4FN4A 5AP9A 3UF0A 1I0IA 1T34A 1U1FA 3AEXA 3E4DA 3ZJTA 1V26A 1V4BA 4BKOA 4DUYB 2C4HA 4GZMA 4EENA 1OLXA 3EK2A 2MOKA 1PQWA 1UXGA 2JZOA 2CE2X 1U0JA 2IVFA 3QU9A 5CLLA 3UJ9A 1GFZA 1T3GA 2XMSA 3OKAA 2WMDA 3DULA 3GPLA 3BRCA 1TNDA 3B3AA 3T3PB 2ZBPA 1H3FA 2HJGA 4PRYA 2IGBA 4E70A 2XEDA 2Q2VA 2GD1O 4OGWA 3AB7A 3D64A 2RD2A 3KFLA 4JI8B 4YRBA 2PANA 3DP7A 1GTJ1 1NI4B 4MA4A 4HSGA 1SXJB 1WNTA 1OLOA 1T2FA 3B1JA 2YNMD 2X0DA 1AURA 1PAUA 1POWA 4KGZA 4QELA 1P0CA 3HMQA 3ZQ4A 5JAPA 4RY0A 1BSVA 5E2AA 1X1DA 1AN0A 3GXOA 3IBYA 2DERA 5P8WA 4R69A 1I4LD 3VH3A 3FFTA 1WULS 3ZCTA 2FW1A 2C4WA 5C2JB 4J7CA 3QITA 4H7JA 2B8JA 4PS1A 1I4OA 2MTBA 2ZUWA 3IOEA 4TL9A 2F7SA 3N3AC 1DXQA 4B7XA 4LN1A 2XXAA 1CR2A 4O4JA 1N33B 2PL1A 1FYVA 3EARA 2VPQA 1GAQA 1ODTC 4Y2GA 4Q7LA 4EFNA 1OFVA 3ST7A 4NFSA 3VTZA 5K3OA 1L8LA 4QGHA 4DLKA 1YMVA 3V4OA 1XHFA 2O9JA 3SQDA 4DMKA 3ANYB 3ESBA 3M9XA 3JYQA 4RE6A 2XUPA 3VO8A 4TZKA 4BO7A 2X13A 4IH9A 5IEBA 1L8XA 4BWGA 2CEAA 5BYAA 5CDFA 1AUVA 2HV9A 3MUOA 1OBHA 4RA6A 1H6AA 5IAGA 1XAHA 3NIBA 2FZGA 2PA3A 2R87A 5G4KA 2FX3A 3WKDA 1ST3A 4KR7A 2IP2A 2GM9A 1Z29A 2QGFA 4H0NA 2CBXA 4UULA 2B21A 4E1VA 2DFKB 2AT1A 1GKIA 1O1YA 1UJNA 2GUWA 2HIMA 4IOJA 3WBBA 3VYVA 2FRVA 4BLSA 4HADA 3X1ZA 2ASEA 5DX1A 3HVKA 4U2BA 1NXPA 4M99A 5DGIA 4ZXFA 2PKQP 1U2ZA 1S4QA 5ALDA 4E4RA 1RIFA 3F47A 2RHDA 1WD7A 1CZNA 2DEUA 3PQ2A 1EFAA 2OB2A 1IN7A 1X0XA 5DYNA 2GO7A 3CXRA 4IS2A 4XSGA 3WYFA 4D56A 4IAOA 4XEHA 1RWNA 1Z6XA 1LZKA 4JLWA 5CDTA 1U6JA 5AW7A 1P9OA 3DB1A 4GYJA 3A04A 3WIOA 3N58A 2M6SA 2DFTA 1JDTA 4OMCA 4OQMA 1W88B 3HUFA 1QWOA 3AFIA 3GJYA 3TLCA 3W2FA 2VBFA 3B38A 1HLFA 2L19A 3GA0A 4L27A 1G55A 3CVOA 4HGNA 5CT8A 3SXUA 4ZIRB 1EUQA 1G2OA 2C0PA 5ELXA 1O57A 2DUJA 3KJFA 4KXFB 2B25A 4M88A 5KAPA 2ZBUA 6YASA 3PV0A 1Q57A 5KS2A 1OXKB 2R66A 2VJPA 2IHKA 2XNHA 4Z0HO 5K03A 1SQ0A 2PYDA 2PVSA 2C7RA 4WLUA 3SXJA 3BMQB 2VNKA 4LDZA 4Y2YA 4CDMA 1IM2A 1GRCA 3S2UA 1I1NA 1QGUB 4BGEA 3RSSA 2QRVA 3PDCA 5K3DA 1WTCA 2FPSA 2KJQA 2LCFA 4W82A 4PNHA 3UB2A 1DEXA 2QW0X 1U2RA 4Z8YA 2GJAA 3KB2A 1M34B 2OAQ1 1H2RS 2XH8A 5IDVA 1S2MA 2AYYA 3KBOA 3GL9A 4S1PA 2GPAA 4E4TA 2W2LD 6REQB 1YRLA 2GXSA 5FUMA 4A03A 2HLNA 3PYLA 5JROA 1KYTA 1WZIA 3F6SA 4DWVA 4ND5A 4NHOA 4BAUA 4KUEA 1VG1A 4URVR 1PNOA 3E23A 2NZXA 3W5BA 3AINA 3H4MA 3O93A 5KYUA 3OPYA 4HD8A 3RTBA 1SHTX 4RBNA 4AY6A 1KERA 5T3YA 3TLMA 2OZEA 2QTNA 1T6BY 3R0ZA 4LNUA 3E2PA 1TYZA 5IXYA 5JMPA 1ZG3A 3SC2A 4D2IA 2OXRA 3R20A 1IY2A 2CZGA 2P2YA 4MMYB 3OKPA 1MZVA 2AJTA 2HI0A 4BVJA 3KJQA 1XE3A 4CCSA 3X1YA 1SUWA 3E53A 1Y7HA 3TQCA 5EWJA 1FSSA 3G2KA 4LOJA 4YCSA 3ETCA 1F48A 3ILHA 1AA6A 1S3FA 1FRQA 2H4FA 3W90A 3A1SA 3WIDA 5I4CA 1OE0A 4OQ4A 2NU8A 4CV3A 2J4DA 4BNKA 4WASA 1E9EA 3VOTA 3ZI4A 1UAYA 3PX2A 1Q2XA 2ETXA 4FI3F 4WXYB 3VDMA 3KQKA 5KNBH 1FYWA 1T9BA 1TUGA 1WB6A 4Z49A 2BM1A 2RIRA 3QK7A 5JALA 1AQNA 3ERCA 3NJRA 1JE0A 3K1TA 1RWXA 3WO0A 1QGYA 3SYTA 4HRYA 2DH6A 1ZCBA 3M1YA 4LIPD 4E4YA 1JDBC 1MC4A 3OG9A 3RVOA 3T12A 3FPSA 4YR9A 1VMDA 5DP1A 2I03A 3JD1A 3K31A 3MAGA 4DJ5X 5K7SA 1XRSB 5HYVA 4ZMBA 4PSDA 4WL0A 3H18A 2XT9A 2CLHB 2FNAA 2GPWA 1EJBA 2XIQA 4NU6A 3A9VA 4MROA 4YAEA 3WYNA 3GLFB 1XWIA 2B9VA 1SVSA 1MG0A 4IKPA 4R3NA 4DPKA 4FYMA 2ZB4A 2OFXA 2AD1A 3D9QX 3RYIA 3E03A 1L3BA 4K6CA 5C8DA 3G0IA 1AQUA 3NASA 4LDQA 3VDQA 4Y6SA 2F1RA 3BVPA 4NZMA 4OO3A 4Z9FA 3UG7A 3WSVA 4AZWA 1JS1X 2YZ2A 4AMZA 1P73A 2BGUA 1HT3A 2ZKLA 5KIAA 3U4HA 2FDRA 3H1GA 1HNWB 1OC4A 3PDIB 4HDKB 2PQ2A 4QNNA 3QEAZ 1DTWB 1L5FA 5EE0A 4GMFA 4NENB 5AI9A 3U44A 1BW9A 2C5LA 2CE7A 3GCGA 3I3SR 3U7IA 2UVQA 3RJZA 4A0RA 5KTKA 2Z4RA 3AUFA 4GYWA 4G1BA 2D0DA 4FKBA 1XD8A 3PYMA 4RU1A 2CMKA 4FDTA 2G36A 4M9SA 1ZK3A 2Z9BA 2X9VA 4XJTA 5B55A 4B46A 5KYGA 2ZI4A 5SY6A 4ARSA 4DLYA 2R7KA 3NHZA 1Z25A 4F92B 5IG2A 4TV8F 3ZH2A 5ITWA 3QSYA 1WKCA 5E1OA 2QJRA 2C7OA 3IVMA 1LJUA 1ZGHA 4YIKA 2YIVX 1RAFA 2WVJA 2YWJA 3BZWA 5JLAA 4A8JC 4OHRA 1IHUA 1KO7A 3WTBA 1PF7E 3PXCX 4D9NA 3AVYA 1SVOA 1ZU4A 3U1VA 3PDUA 3ZDDA 3PUIA 3V1LA 3BD9A 2WKRA 1JXQA 3EUAA 1UH5A 3C3PA 3M49A 1R1DA 2LIPA 1XK6A 4GLLA 3L6BA 5JARA 3DMDA 3F5SA 2QGNA 2P67A 5J58A 4NKRA 3F74A 3Q98A 3UV3A 5G0TA 5K6AA 3QJYA 5HOQA 1WEKA 4JNCA 4RAQA 3SJ7A 3ZEIA 2GCOB 4EB8A 1HE4A 1J49A 3FE2A 1RM5A 3H5TA 3QOYA 3ZHTA 3WICA 2HF8A 2YHSA 4ATNA 4D8TA 2WM2A 121PA 2DUMA 2IODA 3N2GA 5FF9A 3WZMA 4UFNA 1S89A 1JAHA 1VL6A 2JLRA 1ODCA 2CEKA 2PSDA 4M8SA 3RS0A 4NF2A 2G77B 4I50B 2VPZA 3QYPA 4FUQA 2COKA 1W4AA 2ERCA 2H1IA 1JFVA 5DOVA 3BFJA 1QRUA 4KXLA 3LDAA 2JKYA 2Z4SA 4K1LA 4B47A 1IDN1 2G4LA 4W9MC 2CNWA 4A4DA 2VF8A 1E77A 1Q83A 3DF7A 5KNBA 5LLSA 4K03A 5F7ZA 2BW0A 1JMKC 4DLWA 3QPDA 1B0AA 2HLHA 4L76A 3DD1A 2WE7A 5LZ9A 1HE3A 5D3MB 4XE5A 4M1EA 4TQUS 2ZT6A 2DKOA 5REQA 4UDXX 4ND7A 4DRXA 3W6NA 1YFKA 2G70A 1I7PA 1F2VA 4X6XA 4KLRA 3B9BA 4Q4DA 5BOVA 4EHKA 1CY1A 3WHIA 2PXHA 4UVHA 4AQDA 3MCUA 4FUTA 3L79A 5T8KA 3EGDB 1X6VA 1FLNA 3WIUA 5H4GA 3ZIUA 2RH9B 3F5DA 1AXRA 3GT7A 3H4TA 3SIXA 5B1YA 1F5NA 4G65A 5ALIA 5LMUB 3DFKA 2LIVA 1A2KC 3FNQA 1BO6A 2O50A 3BGIA 3FZYA 4IXTA 4UOZA 1QYIA 4NMHA 4Q16A 1EPUA 1YDFA 3DAYA 1V1RB 4LSZA 4UMEA 5CMLA 1RW4A 2FSVA 5AKHA 4U2CA 4XH9B 5G1OA 3RU9A 3V2UA 2O07A 1ZM3A 1RHRA 4IYJA 1ULSA 4FSHA 5DM0A 3WOVA 3QWHA 2SKCA 4IGKA 3GNQA 2Q3EA 4IW3B 3HBNA 1AJEA 4F9TA 2IXDA 1HOXA 5KO2A 3FZQA 4NV1A 2PA0A 4R4JA 4BN5A 2VTBB 4JI7B 3RCBA 4IDPA 3UJPA 4YRMA 2I91A 2VZEA 3KOWA 5DM2A 1G6KA 1U9IA 2HSWA 2HWXA 3R9XA 1PR6A 1JFSA 2P62A 1O77A 1DMRA 2ZP1A 3JYNA 1W85A 1KR5A 4HCJA 2MMGA 3A70A 2I65A 3WKBA 3ZWYA 1Q14A 1JDUA 3K9GA 1Z4IA 4BE9A 1ZUNA 3MF4A 4BO3A 2E4YA 3EUWA 3I9LA 5H3LA 3MWJA 3WMWA 2HDHA 3TW6A 2P78A 2E1RA 3AUYA 3FUCA 5EJFA 4YRAA 4N5DA 1M1YE 2IXGA 2OV2A 3MUEA 3TNLA 1JPJA 3GFFA 3C5CA 3BMXA 2JBAA 5DBIA 1FMFA 4GI1A 2AMLA 2QLBA 3FYDA 1SG9A 1CLEA 3MCTA 3MT7A 4KWCA 3V8VA 4DIKA 4YRQA 4NZNA 2HRBA 4GP9A 1CS4C 3HEAA 3EXG2 5EYPB 5D3QA 2FZVA 2WZQA 5J63A 4I4CA 2VCEA 2C4MA 3KU1A 4S3MA 1FFXA 2ABWA 3ZWOA 1KJWA 4QBIA 4CI9A 5JPCA 1ZIOA 3AM1A 1S8AA 4QDUA 5AKKA 3VKVA 4LRSB 3WWCA 4PC1A 1GG5A 3AZOA 4YGXB 3UT5B 3ISJA 1T4CB 1P61B 5DULA 2HLDD 4ZTBA 1D4ZA 3UMVA 4Q82A 1RJWA 1U2SA 4PQYA 1O5OA 1JDNA 3HB5X 5HIIA 5B64A 3WYGA 3BL8A 3DZJA 1RM3A 3S2GA 1LFDB 5FJJA 4CJXA 4DV7B 1WX1A 1FQKA 4F4JA 1QKIA 2PGIA 2XTJA 3DOHA 2B37A 5AKIA 1Z83A 3B5EA 1UKBA 1JQEA 3O8RA 3L0CA 5CIWA 1UZMA 4N01A 3IPCA 1ESMA 2GCIA 2RC6A 4MW1A 2JPDA 4WDRA 4C3VA 1Z88A 1QFYA 3GGSA 5JBNA 2J0UA 1VYTA 3Q3CA 4LY0A 2MCFA 4LI0A 5MDHA 1ZEMA 2JD0A 1VL5A 1ICEA 1HNZB 1KJNA 2OYSA 1OBCA 1QF6A 4K2HA 4F21A 4CF4A 1AQ6A 2Z56A 4J07A 5BYKA 1XJCA 3FDZA 5K1ZA 2XX3A 4XJVA 4BP9A 1X0VA 4DARA 1E4EA 4HQFA 2V98A 1FLAA 1P18A 2Q0HA 3EG9B 3KOOA 3ILVA 1WE2A 3LMKA 2BHNA 1H42A 3CH7A 3K6SA 2FEOA 2EATA 4OSEA 5EFOA 2BEVA 3OUUA 3OZWA 2IV7A 2RHBA 2PTGA 1QAQA 1NU8A 1RS0A 3M6VA 5AM0A 3GRAA 3UBMA 2QTWB 3IQFA 5BN5A 2NG1A 3VR0A 4NL4H 4Z4IA 3UV7A 1IAVA 4OJNA 2XMQA 5E6UA 4BXOB 3I4CA 3KKPA 1OLUA 4AKHA 4O2AF 3AUUA 1QNLA 1FXSA 1RD4A 4G36A 1Q1QA 2ZEJA 4DA4A 2HTFA 4C2AA 3GP8A 3TO5A 5HJ5A 3OY7A 3T9DA 2QL5A 1E1QA 3MINB 3LLCA 1FMCA 3KQTA 2J5BA 4XGRA 1RQXA 2HQOA 3SQLA 3IMGA 4DYVA 3TSZA 2MR6A 1VSQA 4PF1A 2OT3B 1NW8A 4MO2A 3I83A 2PYZA 1AMUA 1HT1E 1JDZA 1T6YA 3CFYA 2J3HA 3SQXA 2A1UB 1TLFA 2GLTA 5A5GA 1ZUWA 3PU6A 2GS9A 1V8DA 3GPIA 1X1AA 3C43A 3HKEA 4FQ7A 4HNGA 2FLWA 2R6CA 2OECA 2PU5A 1GNSA 5F4ZA 2O6HA 1GUAA 2A9JA 5F35A 4LFCB 3TZKA 2V9CA 3VH2A 3WLHA 3VZCA 1C4OA 2Q1WA 1INLA 4G56A 4P4SA 1IN1A 1KVUA 1OX6A 4RV9A 5F76A 2G1JA 3PWKA 4UHFA 4XGNA 3AEUA 3KKMA 4I08A 4UHDA 4MYCA 1E32A 4B3RB 1AC5A 1RCTE 3PEEA 1GR1A 1N9ZA 3GDGA 4AIIA 1TIBA 3BXGA 1YJAA 5DGXA 1ZCZA 2WQZA 5ER6A 1KETA 5GONA 5CB4F 4TUYA 3R7NA 1E59A 4WKOA 1J07A 3LD9A 5JSUA 3H75A 3LPNA 3O91A 3FHLA 4L16A 4P31A 4Y9UA 3RO7A 4HN4B 3U4CA 3W2IA 1JEAA 3TECE 3A6PC 3OCXA 4YJDA 1T6ZA 3VPSA 2FWMX 4GLFA 1UADA 4RKYA 3TR0A 1Q21A 3UOAB 5FWXB 2R0QC 1USGA 1JIXA 1UPTA 4V02A 1S3IA 3HA2A 1Z33A 2RGYA 3QLUC 4BB9A 7AT1A 2JK0A 3OQNA 5IXSA 5KJFA 5F21A 4ZFNA 1E3JA 3FVWA 4I1PA 1OZ0A 3KEOA 2BFFB 1B3RA 1R0SA 1TYDE 1K3UB 4WCDA 1YRWA 2FAXA 5ES3A 1CFJA 1CETA 1QH9A 1Y81A 2PRYA 4PIPA 1EINA 3EMKA 2XXBA 3AVVA 5IT9A 4X90A 1NTRA 4OXRA 4X20A 3SI7A 2VHUA 2H92A 2PN1A 3RH0A 3KDPA 3DM9B 1M2KA 2PL5A 4Q7EA 1XYYA 2PV7A 3TL6A 2BH9A 4U8HA 4D92A 5JSQA 5CFNA 4RSMA 2HY7A 2JANA 3E3AA 3GVXA 4KZKA 3BTVA 4AS2A 1OAKA 2J3KA 4QOJA 3EBLA 3HB4X 3HSKA 3OCYA 1ELOA 3QMMA 4RF4A 4AFNA 2WPNA 2ODAA 2X4IA 1VLZA 2HRRA 2Q4RA 1T0BA 3LCVB 3RFTA 1SG6A 2O8BA 1Z6QA 3K96A 2GMWA 1AS3A 2OSBA 2VCYA 4L9WA 1PQ4A 4ER5A 1G0NA 4KC0A 2AYZA 3T8YA 2AGVA 4JP3A 2BIFA 3P8ZA 3BH7A 3EIOA 4LJ7A 1KKUA 3L04A 1L7DA 1BEEA 4HEA6 4FNOA 4HLDA 2XT6A 3JZIA 2ZR8A 1CRLA 2XUJA 4L75A 5AJVB 3U81A 3UAGA 1A8QA 1KZ6A 2H59A 3IAS1 5DXFA 5C3UA 2XAUA 2OHJA 4KE7A 1UBCA 4BEWA 3EX7C 2JI4A 3FSGA 3SICE 5M5BA 5BT8A 1UM9B 2FUG6 1HWYA 4NYMR 3Q9SA 2PCLA 3GFQA 2EKZA 5B6JA 4Z86A 1Y4DE 1JG3A 3R3YA 4IJQA 5JRDS 3CRQA 1RJGA 1MJGA 1Q95A 2IVZA 3NP9A 5CGQB 1XIVA 4V0ME 1KK0A 1QP7A 5TARA 4L7QA 3DC2A 2XB8A 3WL7A 3NWBA 1YR8A 1XK7A 4PBSA 5B4UA 3HFJA 4LQDA 3VU0A 4RTJA 4P3PA 3TZLA 1I36A 2V6IA 4KO2S 4C7MA 5LR6A 3VZPA 2DECA 3HBFA 2C99A 3HCWA 5CNJA 5CJJA 3AW9A 2CBZA 1OLSA 2RE8A 3PGMA 4XPIB 4EPRA 1LLDA 2VRWA 1T91A 5GPBA 2VK4A 1DKNA 3H1FA 3F7TA 4HQRA 2WTXA 1B41A 2A9FA 5JCJA 3EQ2A 5EMJA 1NT4A 3QBDA 5A7FA 4IP0A 3ROXA 1Z0KA 4LMAA 1XRQA 3UVEA 5K0GA 1K08A 1W9HA 5AVQA 4RWEA 1R2QA 5IKOA 1CB0A 1YVDA 2OCXA 3T1VA 1VKHA 3LPCA 1SUIA 4RH3A 5FUYA 4ER3A 1E1MA 1Z5OA 2V3CC 4EVQA 4M55A 3BMNA 3RC3A 2Y92A 2ATXA 1E9FA 2VSYA 2IHZA 1DLJA 1WMDA 3WG9A 5EJEA 3JASB 5TX7A 5GVSA 1HGXA 5IM4A 2GZMA 2WQ7A 2XKKA 1O7JA 3ISTA 2PUFA 4IUBS 3K7EA 5J5VA 3TBHA 3EA5A 1K66A 1TUEA 5ADHA 5EXEA 2X9NA 3IUSA 2IHNA 2AFHB 1PFWA 3P0JA 5H9VA 1II8A 3RC1A 1K2WA 3HYLA 4F3TA 4LHXA 2QQ0A 4FYHA 3AFHA 2PO5A 3G7NA 4LE0A 1Z4NA 3KJNA 3QU5A 4Q5IA 5ALZA 5FBLB 1TYEB 3JQ7B 2OZLA 5JFOA 1YCHA 4YXWD 3Q72A 1GPNA 3FOCA 5IKMA 5EXXA 2W6NA 3WS7A 2LE0A 3VA7A 1UP6A 3DLBA 4MIYA 4IIFA 1L8OA 2OAP1 1XPJA 1QG4A 1PU2A 2A9QA 1KARA 4DLUA 3JSXA 2QMYA 1KBQA 5KYYB 4EKNB 3IUMA 4RIEA 3WFIA 4EB6A 1UJ4A 1VBNA 4GH5A 1YBHA 3CEJA 4CIBA 2O7SA 2H7CA 1GZSA 2P79A 5BMVF 2XGJA 2PCJA 1X8XA 3DD5A 6ABPA 2AXPA 1FSFA 1IN6A 1YS2X 3HRIA 2VSFA 4HB0A 1KZ9A 2GCGA 4G97A 4WNYA 2PSJA 3G3EA 4U7PB 3ZZTA 3U40A 4UE6A 1F12A 2VT2A 5A5FA 4EY6A 1F14A 2JHGA 2QROA 2NU6B 4MJ3A 4UU7A 3T9EA 3ZN2A 1GAXA 3EVBA 2YJ5A 4RESA 2O8EA 4RF3A 2J3DA 1BWQA 4R84A 3UFBA 4EHLA 10MHA 3VNUA 1OBOA 3EE6A 4YMLA 2ZWAA 4GPIB 3D6MA 4QXMA 4C6HA 3BGDA 3QXSA 3CN7A 4PCLA 1R4AA 2BLLA 2O2HA 3TR5A 4N0EA 4B87A 4HHEA 2GZSA 4C5BA 4EB0A 3V4FA 5B4VA 4C29A 4KRXA 2E37A 4HY3A 2WPDD 3Q8XB 4QRHA 4BIIA 4O3MA 5TC4A 1FNNA 4K6KA 2RAFA 4R01A 1E79A 4WCFC 3TLJA 1C81A 1HKHA 2FG7C 3PICA 1W36C 4XVQA 1DFIA 3GGPA 1EXWA 3GGJA 2NSHA 3U2QA 5HVNA 4XIGS 2C5BA 3KZ1E 3D3WA 4OQYA 1J0XO 1VJ5A 2PGDA 3TE6A 3L5KA 2DWQA 3UHAA 5JRZA 2YJ6A 4RL6A 4AQYB 1VB5A 2X8AA 2X0JA 3FTCA 3AVXA 1EVYA 1C8LA 4QFBA 1V96A 3ZIAD 3IUYA 4YYZA 2AC2A 1GZ7A 1IM5A 2IZ5A 3X2EA 5LVAA 3HA7A 2VBGA 3GP5A 5F2EA 6LDHA 3A1DA 2FRDC 5EIBC 1E1CB 3B3QA 2FETA 3U3XA 2OGZA 2P35A 1YDEA 3PQEA 4ZJZA 3HB1A 4F5ZA 1RBZA 2JIOA 4XDZA 1C9KA 3GUZA 4I6JA 4XDGA 4L5IA 3SSOA 1VSBA 3WB2A 4UU8A 4RM3A 5I7FA 3UGJA 2AR9A 3FLEA 3V4ZA 4FOPA 2WC1A 1PLJA 2E18A 2YC4C 3B7WA 3O8BA 2Z5GA 1YDHA 4O33A 1D2NA 3JQFC 3QPVA 4KR0A 4Q0MA 5BWLA 5DPMA 4R1MA 3UMGA 4QPDA 5AW4A 3OFVA 5ECDA 1Z37A 1L4LA 2CKDA 1NBHA 2QI9F 4H6PA 1MQAA 3EVZA 2EWWA 5ESXA 4FB5A 2QTHA 3ZDEA 3RK1A 5KKNB 5BR1A 3TBKA 4A36A 3QG1A 1USIA 2NT3A 2QIPA 2UVDA 3DDWA 2NZ2A 1HE2A 1J24A 3DOJA 4P4TA 4BO6A 3O2JA 1FEZA 1VL1A 5G41A 3HA5A 4IDBA 1IULA 2C07A 1CZHA 1U0EA 2ZDHA 2PH3A 4YLEA 5CT5A 3HL4A 2FWAA 3JATA 1ZRNA 3P7MA 4LVOA 1Y3FE 1LPNA 1VSTA 1GUBA 1Z39A 2CKMA 2DUUA 3M3PA 4FKZA 4X1KA 1A96A 2W22A 2G80A 1VFNA 2VDQB 1W581 2JGAA 1VL0A 3L0ZA 4TKZA 2QRGA 4ZQEA 3RREA 5BMOA 3RHFA 3QY9A 1E96A 3CVWA 2QQEA 2PL3A 3RVKA 3EAGA 4J16C 4ZOAA 3IRVA 4D6PA 2NUTB 4EO7A 1ZC4A 4JCCA 5C4IA 1PHPA 4IO1A 2P9YA 1IIBA 1Y42X 4WWHA 3TAHA 4GLBA 1KC1A 3EW7A 4EM6A 2I6FA 4RGBA 1RYBA 1RKBA 1DHRA 1JBQA 1M5UA 4KN8A 1H2AS 3CNQS 3DUFA 3DH0A 4Q9AA 2PR7A 2ZI5A 3GMDA 1DO8A 3NAMA 1HBJA 1XEWX 2HO5A 1KC3A 3ZGOA 2POQX 1VECA 1DUVG 3AR9A 5G4LA 1ZFNA 3F8SA 4TYQA 4DLSA 1U3CA 3P2JA 2WAAA 1ISJA 4AP9A 2XSZA 3HXLA 2HNKA 4OXKA 2IUYA 5TJHA 5AQ1A 5HQ3B 3L6CA 1VMAA 2I2FA 3JQPA 3OECA 4ILKA 4YEDA 5AK0A 4ZARA 1VRWA 2HLPA 1G1MA 1BS2A 1G8KA 1U7DA 2NADA 3A4IA 3PK0A 4L08A 1OBVA 4NEQA 3UUWA 4PYMA 3I0ZA 1CYEA 1A5BB 1LUAA 3AEZA 1FRZA 1SBQA 1RM0A 5TQVA 5EZQA 4AX8A 1N32B 2W2KA 1EUZA 4K7JA 1ADFA 1JT2A 1ZVMA 3FPHA 1EZ1A 1B7GO 4FJ2A 2G71A 5H68A 2REXB 2RG1A 4TVKA 4D0GA 2DYKA 4ZJUA 3NHUA 5JDIA 2F1HA 3NYWA 1YZLA 1DQYA 5DKFA 1N77A 4OK5A 3WVNA 3QTTA 2PUCA 1NKSA 2EP8A 3P0EA 4P3KA 4FBLA 3FNGA 2HRDA 4TS4A 2ZJOA 1BFUA 4YYEA 1BWSA 3VJLA 2OB1A 2VYFA 5LDGA 5HUHA 5ALGA 4KQKA 1WMEA 1GM5A 4Q93A 3PSHA 2WB2A 3CQ9A 3SDBA 4AW9A 2BMAA 1KMHA 4HI0E 2RMKA 1Y37A 3JR7A 1K8ZB 1IEWA 2WJWA 3LLVA 1X87A 2Z1DA 5AI8A 4OXQA 2FDCA 4M0EA 1X1CA 2V6JA 2XCUA 5B5SA 1NJ2A 4YK7A 4AU1A 4AMYA 3FMGA 4YN3A 4BB6A 4F86A 3V1UA 3WLQA 5BN3B 3R5FA 2W8ZA 3JAWB 4MNTA 1HEIA 5E3JA 1W5EA 1E9AA 4YHHB 4O4JB 1W87A 4RTOA 2QUHA 4YMSA 1U2QA 3QVOA 4CW7A 5J4HA 1OXVA 4XQCA 2AQHA 3DEHA 5DTEA 3PXGA 1YRYE 4XXHA 3Q0TA 4YRIA 2OBBA 4QEDA 1JHMA 3E7XA 4OHZA 4G23A 1G8JA 2CF5A 3S1AB 5D5PA 4B3HA 1P2GA 2PKXA 3VYRB 4BPRA 1K27A 3FHCB 1WUTA 3BH0A 2QLTA 2H3EA 4CV0A 3TQQA 1XBTA 3F2IA 3QHQA 4IMPA 4RA6B 3F96A 4NC9A 2J9RA 3N8KA 3AXSA 2AI3A 1PCXA 2IUFA 1IUPA 2JVJA 2ZJ0A 3R6TA 2FF7A 3MJRA 4LV5B 3FMFA 1WMSA 1E61A 3EIQA 5I3ZA 1B42A 5G0VA 3HDHA 3NFYA 3W2HA 1P8AA 4HAUA 3PTZA 3GGOA 4K9OA 2NSJA 2DHQA 5AUOB 2WWFA 3KKZA 4IMRA 3SFTA 2AOTA 3L8MA 3T7AA 3PHBE 3H9EO 3PRHA 4IFIA 4KFRA 1X13A 4J2HA 1NQXA 1E9DA 1BE8A 3QUSA 3RTAA 4INZA 1RACA 2XRZA 4WECA 4QQRA 1MFZA 2OCIA 4IXNA 4OU5A 2WD7B 4HQ6A 3V3TA 4A0FA 1ZM2A 2R6AA 3TQOA 3DPSA 1AXEA 1J8VA 4I55F 1UBLS 2N75A 2NUPA 4HWTA 3R0JA 5L3VA 2RARA 1BA3A 1P0MA 1CRQA 2OHIA 4X91A 3NO4A 3MTAA 1G63A 1W0CA 1Y7LA 1KFBB 2IP4A 1NY5A 2V9ZA 3GK3A 4OK6A 5DO9A 5EJGA 4DQDA 1NG1A 2FTKE 4CIWA 3HV2A 3KQUA 1E94E 2HXSA 1PFVA 1U0GA 1VJRA 2CVFA 4YNBA 4Q1EA 5KTNA 4PO1A 1QHNA 4G5YA 4M37A 4MKIA 4XOUA 3SXUB 1Z5PA 1Q1AA 2QN8A 1XDBA 5BUQA 3N0RA 3R0XA 2NX2A 3FYUA 2YRWA 2ODTX 3K15A 2I67A 4L2IB 3FGNA 1NOKA 3UJ8A 2I9PA 2UZ1B 4Q3OA 4XFDA 2CXXA 1OX4A 1OI2A 1Z28A 3D0OA 1S7GA 2JFBA 2J4CA 2RONA 3I32A 3LE8A 4OHBA 3WL3A 5AVSA 4Y2QA 1BMQA 3I45A 3R2JA 3O94A 2WWWA 3ZD7A 1KP9A 1G21B 1G4AE 2J9YB 2NV2B 4G9BA 3A3YA 5ICMA 3NAZA 1GFIA 3MC1A 1VIDA 4XIFA 3WGVA 4EF5A 3IAM1 3WL5A 3RGWS 2JFZA 1NZJA 2RI1A 1HDEA 3IP5A 1EHYA 2OFWA 4PLYA 2ZAGA 2JIMA 3LWNA 4MVCA 1TEHA 3HO8A 2QXUA 1Z4LA 4EA7A 5CLIA 2AQ8A 4NU0A 5B30A 5KQLA 4BQPA 1RLIA 2GBLA 1Z6AA 2GXUA 2P0AA 2Q1XA 1JQKA 2UZ0A 3RRYA 1A72A 1YKFA 4P93A 1CUEA 1SUAA 4AKEA 4E13A 5HRUA 3H0KA 4P6VF 1OXBB 2PNFA 1XZCA 3V4PB 2YY6A 2QUZA 4DRYA 4ZOLF 3P32A 1A4RA 1MJGM 5TPZA 2D0IA 3Q7PA 2B1JA 3QPWA 3MM4A 1FLVA 1EXNA 4HUTA 1Q0TA 4X5OA 4X3CA 4DXHA 2G7ZA 1Y63A 3LDUA 4PG4A 4YCDA 3K0KA 1M2HA 1NL3A 1ODLA 5C37A 1F51E 3TRFA 1I0LA 5KYXB 3SC2B 5EKSA 3VXKA 1RPAA 3H1AA 4QYSA 3UAVA 1N34B 2C00A 1XYGA 1EWTA 4R5MA 4HV4A 1XTRA 4Q7QA 1IEVA 2WP8J 4BUZA 3QE9Y 2VF5X 5DX8A 2DBZA 2B9EA 1NONA 1UC5B 3HU1A 4ZRMA 1OKKD 4WLEA 2RSLA 5B36A 2WHRA 2YIDA 4FYWA 3HO6A 4HB2A 2CCJA 1E0JA 4MR7B 4DCJA 1IXYA 2HUPA 3ORQA 4FP9A 5CP8A 1J1ZA 2ZE6A 1O4VA 2BEWB 2IE8A 3G5LA 5FWAA 4MDHA 3JQDA 2CXUA 2E85A 1K8YB 4YREA 5G3YA 4LZZA 4AN1A 5ALJA 5CVTA 4XAQA 3C3WA 1E5LA 3DL0A 3LF2A 4F8YA 4UATA 3UK2A 1CVLA 3TFQA 3P27A 1B76A 1YONA 1Y3BE 4U6SA 4E32A 5DSZA 3RJTA 5AESA 4KIWA 3ZNNA 1SVNA 2ORIA 1DEHA 1EFDN 4JODA 1IBCA 1EG7A 3Q7SA 4YJ2F 3R9KA 3IA7A 4LE1A 3AEKB 3BD6A 3WHKA 3QE2A 1YR7A 1E1DA 3H6GA 3F67A 1Z4JA 3VZBA 1ZD3A 2VHXA 3QXXA 1QONA 1Y4SA 1JR6A 4H59A 3IP8A 1P1FA 3LWZA 4F0JA 1BQ4A 3AF4A 3H04A 3LQYA 3P0FA 3T38A 3O9VA 5AI6A 1JR3A 4NBSA 4YB8A 1H93A 1SCNE 3H2IA 3VC3A 2O7NA 4KNYA 4XM1A 2CL7X 5TLSA 2R751 4J0QA 4G1EB 4KFSA 1Z17A 5DFAA 4DMLA 5EPUA 3KYIB 3EXHC 2F59A 5BSUA 4BNHA 3QX3A 1QQ5A 1W8IA 4UBKA 2IW3A 2PU7A 3C1UA 4U7GA 5L7WA 2PVPA 1F3OA 2QMQA 3U44B 1T3SA 4CKBB 3B9QA 1NASA 3ZWBA 3UHJA 1HYGA 2JIQA 2QDKA 2ORWA 1KL7A 1OXMA 2HREA 1CZKA 3QLVA 3CJRA 4L6CA 3QU4A 4WADA 2QENA 3PDWA 1U6IA 4OXYA 3ZXXA 3OEYA 1E9SA 2J3EA 4ZV9A 3SF8B 5BWCA 5CBPB 1WY7A 3SZ3A 1JBEA 4O5AA 1DQNA 2IU0A 2NXNA 1ONOA 3RGGA 2XRMA 2BDTA 1PKEA 1HKUA 3L07A 3UCEA 1ZSVA 4C76A 5DP2A 3UATA 5CA1B 1YU6A 1FUEA 2YXEA 4PCVA 3VOSA 1GQFA 2DG2A 3TQHA 2IYWA 5FL3A 2WTNA 2I6TA 4OBEA 1I1HA 1VHTA 4GXTA 3L4BC 3FNEA 3CSDA 3DVSX 2Q2NA 4PIVA 4EJ0A 4H35A 2G4VA 4MQMA 3A2LA 1C3JA 4HXGA 1ZIDA 3UC9A 3BCRA 3TLGA 1X80A 4FFSA 1GV0A 3OIYA 5GIOE 1AV6A 4P3NA 4H6VA 1YZTA 3EHDA 1HQDA 4C0XA 4ZCIA 2P41A 4H1TA 2F1KA 3STVA 3M1IA 2IS1A 2M1ZA 1N6HA 3DCJA 3TSYA 2ZJFA 3GV0A 1TCCA 4DV6B 3KAPA 4GUDA 4TTRA 1GN8A 3O5AA 1QCDA 4AF6A 2OBLA 2ZWOA 4FE4A 2ZAOA 2FGKA 3L9WA 1QYXA 1HDIA 2PMCA 5JDCC 1DO2A 2FEWB 3PNYA 2AH5A 4INPA 1W4LA 1RQ7A 2QVYX 4PANA 4Y0VA 3G79A 3UJAA 1AHNA 3TOZA 1V95A 3M6UA 3ZJ5A 4KXNA 2RHRA 3LJKA 4XQ0A 5ED0A 2HSGA 2EIHA 1WS6A 2R1TA 1OFIA 3PL1A 5FNVA 3MPOA 4FZ3A 5A9SB 3ZDYB 3RVLA 1LI5A 4TV8B 2Y1OA 4LMPA 2C2ZA 1XKQA 2RHHA 3VU1A 4EGFA 3FBGA 4QD3A 3H0EA 4BO5A 1CUSA 4Z9XA 4WK4B 3ZJ4A 1YJQA 3VVMA 1EFKA 4BFLA 4KITB 2YCLA 5MGBA 1QPZA 1TVKA 1MMFB 1PBNA 4FFDA 1MEEA 4IEEA 2VHWA 3VHQA 4CKWA 3HU3A 2CK3D 3L7MA 2YUTA 4URWR 3TZHA 4QTTB 3MWLA 2AZ4A 2IIVA 4DKJA 1Y9ZA 1QRDA 2ZJ2A 4MARA 5GJWC 4ESHA 3EVEA 1W9MA 8AT1A 1R5JA 3MXTA 4MCAA 3T3MB 4POOA 4WE3A 3WBKA 1P2UA 2CFTA 1V5IA 3O4IA 3JD4A 3ZIDA 3KQPA 1ESZA 1AUQA 1HDGO 1WPQA 3O84A 3QUBA 2X40A 1MC1A 4I1UA 2BTOA 4LTMA 2J9FB 1ZUHA 3H9UA 3N8IA 4GWKA 4KYIB 4QUKA 4MW0A 1PWXA 2X4DA 1QFXA 3GARA 2P90A 1Z62A 4DGSA 3H19A 4HDAA 4FGZA 3O4VA 1BIFA 1QM5A 4LYHA 5IBRA 3WWDA 5K51A 3ME5A 1P77A 1SBIA 2GF9A 5AI5A 4YS6A 1QE3A 4V1CB 5CVVA 2Y68A 2ZIUB 3W8FA 3AL0C 5EE5B 3BULA 5F2KA 1Q5PA 1GUYA 2ZPAA 2LR0A 2Y1LA 1IB6A 1J8MF 1GG9A 5EG5A 5K0NA 3W9SA 3WLEA 1M1NA 3LOQA 4PNEA 1NW7A 4DC0A 3JQGB 5HUQA 1QRRA 2JBAB 3ADOA 5BO5A 4GI7A 2QR2A 1NBWB 3N0XA 3EIXA 3L4SO 3LKVA 3KSZO 2ZBDA 3Q8WA 5HZMA 1LBIA 5AJZA 1SUBA 4YP1A 3ZDXB 2W9XA 1BD3A 2QRZA 2Q1SA 4OYYA 3FPJA 4YJHA 3EXFB 1VJGA 4B32A 4DIBA 3UHPA 1XNGA 3CG4A 1J8DA 3PTLA 2V59A 2ZSUA 4ZQBA 4KVZA 2EZTA 3I9FA 3RVNA 4E30A 1I3MA 4CNBA 4ZDKA 3K16A 1W52X 1T5OA 3QKWA 4LKRA 1GTMA 1WDTA 4K6HA 3S8YA 1FFXB 1WR8A 3QELB 1O2DA 3QKRA 3U0BA 2WK1A 3ND8A 4HDCA 3HI6A 5I8ZA 4LWOA 3W5SA 4A27A 1NKTA 4UNPA 1E1KA 4LF7B 4HRVA 2NTEA 4MV5A 3RIGA 2O8DA 3BDVA 3F97A 3Q10A 3GLFE 4LXQA 4C0BA 2IKQA 1C41A 4IDQA 3NM6B 1BVYF 4MQUA 4PR3A 8OHMA 1ECJA 1QAMA 2GN9A 2B6HA 2A35A 4S24A 1KGDA 2JJ1D 3GYBA 5HP4A 1RXEA 2DETA 2OD2A 4RMJA 3UKJA 4ETNA 5JMTA 1FP4B 2WKQA 4OHOA 2BSQA 2R84A 4H2DA 4YUXA 2G4CA 4JMPA 5JYCA 1I8TA 3HKDA 1QVZA 2I33A 4BV8A 1SQGA 1TXGA 4GE3A 3THXB 4BJ3A 1WW8A 3FBTA 3MOSA 4XYMA 2AE2A 2AOWA 5JZBA 2RJOA 3T94A 3AJRA 4G63A 3HCPA 4FOSA 4KLNA 4XW2A 1N9KA 4R2WA 1E4EB 2ON6A 3TZ6A 4MJXA 4EYSA 4ZOBA 1FFAA 1XXHB 1MOZA 2VXCA 1GD1O 5LZ8A 1M8PA 4JBGA 3T0FA 2FMHA 2B7LA 1VE1A 4GLOA 1AUPA 1KVTA 3IOCA 2CYCA 4G07A 3RI3A 3ZBPA 4DDUA 4GFDA 1P5HA 5IBCA 1XR3A 3AETB 4C0LA 5CD1A 1I24A 4HNRA 3SE7A 1Y34E 3C4VA 4NCIA 4PGHA 4Y6OA 3MVEA 1O9GA 1OLUB 2EQAA 2D8MA 2AI1A 3WDKA 5KWJA 3D5QA 2HBZA 3IRUA 4F96A 4BRWA 2WKPA 4TRNA 1L7OA 1LJLA 2D1QA 2GNAA 2YWXA 3Q4GA 4G2TA 4IH1A 1DCMA 1FFDA 4L78A 3U80A 2GQ0A 3G2LA 4JKOA 2JJ2D 1U65A 4Q3DA 2VQ6A 4MKFA 5C5IA 4DE5A 1UP7A 1UZLA 1GIAA 3PC3A 4JOCA 4RO0A 5EP2A 4E6PA 1YIOA 2ET6A 3FPLA 1SQSA 3IAS6 2VKQA 3ZZ1A 3PEUA 4WJLA 1XTBA 3PR1A 1M1XB 1EFHA 2OHOA 3FPEA 4W4TA 4A2PA 1CF4A 3OIGA 4V38A 1WDLA 2V0GA 4B80A 3HKEB 1P4JA 2GH1A 1RP7A 3FF1A 2BVNA 1LRKA 2GAAA 3ZLJA 4HGRA 4HTFA 4RKRA 4KPYA 4JROA 3NVMB 3RVPA 2Y0DA 1DAKA 2YWFA 1TPYA 2Q6IA 4EHFA 3KQYA 1B74A 3AEUB 2KBEA 1Q0SA 3L05A 1KJIA 5EFZA 1UZAA 3OPXA 1E3SA 2WDZA 3THWA 1Q1NA 4RIHA 3KYDB 1L1EA 5KB3A 2WTEA 3JYLA 1L5NA 1ZMOA 1P0IA 2WOJA 4MLPA 4QVGA 3W1EA 5K9ZA 1HLGA 1CEQA 3O2SB 1X1BA 5I9BA 4X24A 4XOIA 2AC7A 4DMRA 1J1UA 4HNSA 2GNPA 2SECE 4JQZA 4V39A 5L6MB 3PHHA 1TMGE 2ZTUA 2MSEB 3FCAA 2X23A 2YTZA 5ERGB 4B3DA 1MD9A 4ZAFA 1CEXA 1PG2A 1L1RA 1YWGO 4QHTA 1ZWKA 1QG0A 3V7FA 4N76A 5DXAA 1J00A 1BA2A 2ATVA 1GL9B 2QZSA 4IF6A 1E98A 1NOJA 4O2AB 5CHYA 2OP0A 1FDSA 1G2IA 2QTVA 4QUAA 2BUBA 4RGYA 3ONNA 4D3ZA 4X9XA 4GW3A 1J33A 1H2EA 2JLUA 3J7TA 4DCNA 4DWWA 1HDRA 1IBRA 2ZJBA 3MWYW 1OH5A 2EVWX 3JQAD 4B3SB 2Y0CA 3EVTA 5ECWA 5ESDA 1QVVA 5DLDA 3D0QA 1REQA 4BMVA 4NU8X 5AM5A 3F78A 4LZWA 1Z3CA 3GT3A 3PX3A 4RVGA 1GUZA 5SZIA 3IT2A 4L50A 4C04A 3GUVA 4XVUA 1LBTA 2CMHA 2IPNA 2OGTA 2VUTA 2WWIA 2JDIA 3KOUA 4FFWA 3PUKA 3AY6A 2DBYA 4IV5A 3OHSX 3TVTA 4C21A 4EB3A 4MGEA 2OK8A 4ES6A 5KWVA 4DR4B 1E3TA 1GNVA 1A9PA 1Q3HA 3DYIA 1IPEA 3PQFA 4BVGA 1ISIA 3AB3A 3ETEA 4QBFA 4R9VA 3REOA 2X3UA 2X2FA 3EEFA 4IFEA 4D9BA 5L9AA 2QG6A 2RGEA 1FLDA 4D3FA 5CB4B 1F4PA 4G9GA 1DL5A 2FJPA 3OAAD 3PEFA 3U4IA 1XDGA 3F46A 2Y9MB 1FK8A 2ENUA 3LH5A 3SZGA 4MUAA 4E07A 5JAZA 3G2HA 1JG2A 2O1WA 4M76B 3U13A 2H4XA 5JV5A 3EIWA 1BC5A 4BVBA 4HRXA 4B83A 1XDWA 1TCVA 3H3FA 3K53A 3OFSA 3WGIA 1PZEA 2M9MA 1YCDA 2VRNA 3SHOA 1W8DA 3AIMA 1PR1A 1EWKA 2JFNA 1T0PA 3V4LA 5BSMA 1PIWA 4DR1B 3H8WA 1M33A 4GOKA 4RKWA 4E46A 4FOLA 1U3VA 3LAWA 5AJHA 1PJTA 3ZXYA 2FPUA 3T4XA 3WLRA 4DUGD 4F6CA 3AK4A 2QN2A 4MZXA 2W6JD 4WUVA 5DHSA 1U2EA 5BYJA 1KEKA 1G3UA 2QDXA 3OZRA 3ID6C 1AGYA 3T61A 4J1TA 4Y3UA 1U8XX 2VYCA 1DELA 1P9RA 2WYOA 5CR9A 3SKXA 2CDAA 1E63A 1U8YA 3EAFA 2MSKA 5E9QA 4D9MA 1M2EA 3KYCA 3H11A 4YFYA 2YQ5A 3TIXB 1CDEA 2NZYA 3R6LA 3QWIA 4EHJA 3H1PA 3OHMA 2BHRA 1ZSYA 4AKIA 4U7FA 4RF2A 4EL0A 1JSCA 1BE1A 3ZX4A 2CHEA 3PFIA 4HUQB 1UAAA 1D0VA 1N7IA 2ZRJA 3H8SA 1N1MA 1ARZA 2VHTA 2VUIB 3MQ2A 2ZCVA 3LTNC 3OT1A 4Z7OB 4EYQA 3DHNA 3UWDA 1D4FA 3D3EA 3JRXA 3BMNB 5JJCA 2ZUEA 3AY0A 3L0BA 3RVMA 4M53A 3MTGA 5LA6F 4YMVA 4NH0A 4S0ZA 2ZTVA 1J2EA 5C1IA 2FPKA 5A7GA 4PICA 1R37A 1D1QA 1N7GA 4EK9A 4XGKA 5AOCA 1HT2E 1Y6FA 5ED4A 1RC8A 2B8TA 5DX0A 5JPIA 1ODJA 3B1WA 4N1AA 4RTKA 2NZWA 1EIZA 4AD8A 1MO5A 1LB1B 5A05A 2VS1A 4DT1A 4E33A 2ONCA 4ER7A 1QX3A 4O29A 4HAYA 3BXFA 2VQDA 5A9TA 2C2GA 4AVYA 3MGKA 3TMAA 2O06A 2CDRA 1SCBA 3LHKA 4DWJA 3ITNA 2WI8A 5JZSA 2JHAA 2QJWA 3KPUA 2DBVO 3LT0A 3M5PA 1MB2A 2R8OA 3RVSA 5LQMA 3NWJA 1QYVA 1EFUA 3BJZA 2I7XA 2V0CA 3IFSA 3L02A 3I28A 5IZCC 3RUHA 3UWPA 2WR8A 4B85A 4CQNA 4HPXB 3BM5A 2OXTA 4DANA 1KO1A 4AWXA 1N2BA 3OF2A 3R5XA 5KEIA 2QN1A 5ALWA 4TQ9A 4DAOA 3EQ8A 4ZCRA 1CE8B 2EKLA 1PJSA 1T4MA 2QRJA 3ICOA 4HEJA 4URZR 5H70A 1L5KA 3A0RB 3S1LA 1CUYA 2HYDA 3CE6A 2G9UA 3KIPA 4EY4A 4A6PA 5DWDA 4MI9A 1NQUA 3I53A 2GGSA 1EUDB 3PNOA 2OCLA 2KE5A 5DM4A 2E5WA 1ZNQO 4O5OA 5EXTA 4K8OA 2F62A 3KTDA 4E5SA 2A8YA 1AZSC 5TQJA 4K6GA 2J87A 1Z08A 3L7CA 1GGNA 2FPIA 2IH5A 1IIRA 3NTLA 4DB2A 4EJSA 1XHEA 3GDHA 1V1JA 4RKFA 3O8OB 4D98A 3HADA 2EARA 2Q5IA 5HE8A 3TVYA 4HS9A 1RYMA 3KDSE 5EOVA 3WYBA 2H65A 2OCYC 5IBQA 2DY1A 4QNRA 3IT1A 4LSWA 1XWWA 4RJ2A 5FTJA 3WE7A 3U4QA 4FT2A 4JI3B 4EPWA 4MIOA 4RHUA 3M1LA 4M1SA 2IH2A 4FKMA 2QMZA 5EUCA 3AHHA 1TZBA 1MB3A 1KVQA 4CKYA 2II6A 1XJQA 3KVRA 4UTZA 5IJ0A 3T3NA 2YV2A 4IXDA 3TDNA 4OAOA 1WPRA 5DYTA 3H2YA 3P52A 4R8MA 1K5HA 1NMZA 3GRCA 1QV9A 2BMEA 3BMOA 1UOPA 2ASVA 4JI5B 5B3KA 1YNSA 1WY5A 4GI5A 3HE3A 5E9WA 2QUKA 4CKZA 3SGLA 3CCCA 3T3DA 4MPJA 3ROKA 3RAEC 4F1JA 3R75A 3H2HA 2P40A 5AVZA 3DHWC 3E7FA 1W19A 5KTYA 1T24A 3MJ4A 5BMVB 1V16B 4PWZA 1A9RA 1QE5A 2R86A 3D0RA 2CNLA 3A06A