3SVLA

Structural basis of the improvement of chrr - a multi-purpose enzyme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
KLQVVTLLGSLRKGSFNGMVARTLPKIAPASMEVNALPSIADIPLYDADVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVIDQGTLDHLTGQLTAFGEFIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords protein yieF
publication title Crystal Structure of ChrR-A Quinone Reductase with the Capacity to Reduce Chromate.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3svlA00
2QX6A 3FW1A 3FVWA 2D5IA 2OHIA 1NNI1 1AKQA 1QRDA 3D7NA 4H6PA 3KEGA 3LCMA 2HNAA 4NULA 4LTMA 2V5UA 2FOXA 4FGJA 5BUCA 2BZSA 4GI5A 4NLLA 1J8QA 4YALA 1CZLA 1AKRA 1KBOA 2A5LA 2OHHA 1XI2A 4N82A 2MT9A 2BF4A 1WSWA 2KLBA 4LTDA 4H2DA 2BN4A 1FLNA 2BMVA 2MOKA 3NHSA 1RLJA 4YAOA 3GFRA 5B3LA 1D4AA 1DXOA 2R96A 3L9WA 2HPVA 2WC1A 1DXQA 4XDHA 2QR2A 2ARKA 3B6IA 1YCGA 4N9QA 1QR2A 2M6SA 2W5UA 1AKVA 1DX9A 2N1MA 1FX1A 2Z9DA 2FVXA 3W79A 2R97A 3NHYA 4XDGA 2BPOA 4C14A 1CZRA 2HNBA 4ESEA 3OJXA 1ZWKA 2MTBA 2X2PA 3EDOA 3TZBA 4CF6A 4FGKA 3FJOA 1OBVA 3R6WA 1D03A 6NULA 3K20A 5NULA 4BMOB 3O2NA 3OWHA 1BU5A 1C7EA 5F4BA 1YDGA 3W77A 4QOGA 4QOJA 3NHUA 5LBUA 1C7FA 1VMEA 1WSBA 2QMZA 2Z98A 4Y7CA 3HLYA 1QHEA 3QFRA 1XYYA 1FUEA 4N65A 3F6RA 1FLVA 1D04A 4OXXA 4HEQA 4QOEA 1H66A 3G5MA 1E5DA 1F4PA 3NHFA 4LA4A 4M0CA 5ULLA 3F6SA 2XODA 3KAQA 3OX3A 3NLLA 4ZVNA 1CZOA 1J9EA 2FLVA 3N39C 1T5BA 2V5VA 3ES9A 5TGZA 1TIKA 3QE2A 1CZKA 3S2YA 5LLDA 2FCRA 3LT5A 5LBTA 4Y9RA 1YKGA 3TEMA 3NHJA 4LAFA 3HA2A 3HR4A 5LMCA 1ZWLA 4GQIA 4DIKA 2QX4A 4ZVKA 1AG9A 3NHWA 4FX2A 1X77A 1SQSA 1AHNA 4DY4A 1YOBA 4GR9A 1KBQA 4U7FA 4D02A 1TLLA 2QWXA 1CZUA 5JROA 3OJWA 3OX2A 2AMJA 2M6RA 5FA6A 5FUQA 4PTZA 2Z9BA 1B1CA 3TE7A 2FAXA 3UXHA 1YCHA 4PTYA 2FX2A 3FNIA 4U7GA 3W78A 1OBOA 1RTTA 4ZVMA 1FVXA 2X2OA 3OWXA 3RPEA 1QBGA 1CZNA 3ESXA 5EA2A 2MWMA 3FX2A 1RLIA 4C0WA 3GAMA 2RG1A 1JA0A 1JA1A 4ZVLA 4ICIA 3NFRA 1FLAA 1SG0A 1RCFA 4J8PA 2FDXA 4Y9UA 2OYSA 3ESYA 3KLBA 4QOFA 3NHPA 5F51A 2Q62A 1ZX1A 1AKTA 2B3DA 1FLDA 4PU0A 5LVAA 4HS4A 4QODA 1AKUA 1J9ZA 2XOEA 3EYWA 2KQUA 4C76A 1AMOA 3JSXA 2OHJA 2QX9A 2Z9CA 3K1YA 2QX8A 1AKWA 2ZKIA 3U7IA 3F90A 3OX1A 4S24A 5EAIA 3NHRA 3NHKA 4LTNA 4C0XA 3B6MA 1XYVA 5LJLA 2GSWA 3N3AC 3U7RA 3ZHOA 3L9XA 4BMPB 3SVLA 1XT6A 4YAUA 4QOHA 3B6JA 3GFSA 1FTGA 3F2VA 1CZHA 2FZ5A 4CETA 4FGLA 3GFQA 1YRHA 5B3KA 3O73A 3OVMA 5EMNA 1GG5A 3W7AA 5LJIA 1H69A 3B6KA 4YAFA 2QMYA 3ESZA 3N3BC 1OFVA 2Q9UA 5NLLA 3QFCA 1AZLA 5A4KA 1YCFA 4F8YA 2FZVA 1V4BA 3P0RA 1I1OA 4QOIA 2V9CA 1BVYF 2F1OA 4YQEA 5FX2A 3KAPA 3NHLA 4YAWA 4DILA 5F12A 1T0IA 1J9GA 4U7HA 4R81A 3UXEA
chains in the Genus database with same CATH superfamily
1R6DA 1B41A 2FPKA 4N18A 2W2LD 3KYJB 3L07A 3A2NA 2QIPA 5KJ1A 1I2DA 1B42A 4O4IB 3WMXA 4GMFA 1NVEA 4DLVA 2AOWA 3TZCA 5FI1B 5T57A 1MD9A 4CHGA 4N8EA 1M1ZA 2JHFA 2HK7A 2BHRA 1SVOA 1ZU4A 3QKRA 4PAMA 5IULC 4RL6A 2FP3A 2ZT6A 1IWPB 2ALJA 3B51X 3H2YA 3IQHX 3ECAA 3L06A 2PE5A 3BHNA 2TMKA 4COOA 2BLNA 1SKAA 3W8EA 1U3DA 4XD7D 4EG7A 4NI5A 3HFSA 1A95A 4DOMA 1NUSA 2ZSJA 5GOZA 3VDRA 1QVVA 1ZRNA 2BFPA 3RJ9A 3HUFA 2C2OA 1FTYA 1SULA 3D6TB 2QU7A 1XTPA 4PZCA 1KS9A 4V24A 1SKUA 5IAGA 3EAFA 3W6NA 5IJWA 2QAGB 4MQLA 1CETA 4H6VA 3HMKA 4M55A 4P92A 1XR3A 2IPXA 2Q0XA 4XLZA 2O2EA 1L8LA 1Z6XA 3B82A 1N77A 3W1VA 5DP2A 2ERXA 4PBRA 2QZ9A 1UPBA 4IFTA 4PQFA 2OP1A 4NU8X 3VJMA 4F3CA 4F3KA 5CR9A 4ND1A 2XGGA 4F2GA 7MHTA 3B38A 2HFKA 4V0RA 3FGZA 3O7MA 4O1HA 3E81A 3LHKA 1DUIA 4DPKA 2JDID 3WYEA 4MIYA 1R6BX 2J48A 4AMVA 1B8PA 4A15A 4MPDA 5F23A 2ZAIA 3MWKA 1FYFA 2EEPA 5A5FA 3LKZA 5A4IS 1CEQA 3P9YA 4ENQA 1IZ7A 4PCLA 1QFYA 9ATCA 5F2OA 4X00A 1CQJB 2O8EA 2GPWA 1I5OA 2AFHE 3VR1A 4WDRA 2A5LA 2GEVA 1W88A 2PL5A 2FE4A 2FMHA 2XDQA 3NAMA 4LDPA 3T7SA 4FBMA 5BW5A 3VJRA 5JS2A 3IQXA 1OJLA 1SVMA 4BAZA 4DCGA 1SVKA 2Q5IA 4I1UA 5THXA 2GAFA 1VPLA 1Z5ZA 3WDMA 1IJFA 3PR2B 3WLSA 3T7TA 4E21A 1SVLA 5CB4A 4RK0A 1FBTA 2R1VB 1IRXA 3PUHA 2C99A 4UAUA 2UYOA 2V9PA 3FHJA 4W7IA 2HYDA 3CXRA 3LVRE 3GPCA 4YAOA 2QYTA 5DHQA 5EFOA 5YASA 2VP3A 4E22A 5I7WA 5JH7B 3LA8A 1PFVA 4NCXA 1KAEA 3MEQA 3CB2A 1HZZC 4CHTA 2CV1A 3AERA 3KHTA 2CDNA 3UO8B 4DCNA 1H65A 2XRYA 2ZIUB 2O07A 2ZTVA 3AKYA 1VJ0A 3F5MA 4GPD1 5EP1A 4B47A 4BBPA 5KKNB 3AJAA 4JJEA 1JH9A 2C04A 4JELA 4LN1A 2XUOA 1A3CA 4N9QA 4FS8A 1FU7A 5A5EA 2BE7A 2REXB 3QU5A 3JWGA 1BJRE 4WDQA 3GGSA 4BUCA 1UC9A 1VMDA 2OQIA 2W5UA 2UUCB 3PTZA 5F1PA 4HRYA 2G1AA 1NJSA 5T4HA 4QLAA 2RIPA 3EXHC 2ZRLA 3BE8A 3WIEA 2H48A 5FADA 2ZAOA 4EITA 2GEKA 4C2BA 1KY5A 2D4AA 5GQSA 3VHXB 1PZMA 4W9NA 2PUDA 2F8TA 1SOAA 3THSA 4H0NA 5JV5A 3W3ZB 3MMNA 3UHFA 1V11B 4IV5A 4Z4EA 3G9QA 1PR9A 3S7TA 2YWCA 3HBLA 3M70A 2R8XA 1YGYA 3PUVA 2BPOA 4G1EB 1EP3B 4I3FA 1RLUA 4RA9A 4PSVA 1J0BA 3LPAA 3QELB 3C87A 4NMLA 5A9SA 3SSOA 1QJCA 3CZPA 3KPWA 3MCUA 4PPYA 4DR3B 1Y3CE 1U1CA 3MCZA 4Z3OA 1I6WA 1KC1A 1XF9A 3QUCA 1KSGA 2Z09A 2A1UB 4Y0AA 4AZ0A 1WXGA 1DAOA 2C83A 4TOIA 3MELA 1KHTA 1WLSA 4YR7A 5M34A 1TADA 1AZWA 3ELUA 1D4OA 4JR2A 1ZXBA 3B9BA 1TUIA 1LQUA 5HDBB 2V3CC 1R8QA 1Y4UA 1UKCA 4BFWA 4FFLA 1ICEA 2WE7A 1DQZA 5ECWA 5DHTA 2I66A 1VI5A 4BO8A 1ZHOA 3TTUA 1W59A 1LGYA 3JQGB 1KU0A 1IXRC 1W581 1TYDE 3PL5A 1T9AA 4IQ4A 5BNZA 1S1MA 1OIXA 4HGYA 5JSUA 2CXNA 4HTFB 2H9IA 3B6ZA 3UAYA 3AW9A 5HJEA 1OA0A 3DPSA 1INLA 1B76A 4EW1A 1LSSA 4LXXA 3PDUA 1JSRA 4XASA 4ER3A 4ZTUB 1E2DA 1XWIA 2QVGA 2VNSA 3GT0A 4NMWA 2FY8A 4PFSA 1TKRA 2IX9A 1KNQA 1JLSA 2EP7A 2OV2A 1XZPA 2XA1A 4UEKA 3WS7A 2YZNA 3BCUA 2PBFA 3FDIA 4WGGA 2X40A 1SZCA 2V0NA 4GWGA 4WXEA 1L5VA 4ZZ1A 5KAPA 1VL2A 5KWIA 5FBLB 3IRVA 1Z0ZA 4EUEA 4UNIA 2GO1A 4LRXA 3NKFA 4MV9A 3KVRA 3T0IA 1VBKA 3GYGA 3LYHA 2XVYA 2FZKA 3U1TA 2P4SA 3ESAA 3IBTA 4NZYA 1Y7IA 1L1QA 4Q9JA 2Z98A 5EIXA 3L7IA 1E2HA 2A14A 4N0DA 3LLSA 1B26A 4M7PA 1K4KA 2HDNB 1CR2A 1XYYA 3C3CA 2W70A 3WA6A 2Q3LA 1UPUA 4XPIB 1NPTO 2ZBRA 4XA8A 1WZNA 2OLKA 3TAUA 2YX1A 5JVDB 2NXEA 3V8BA 3T1TA 1TZMA 3E05A 3A6JA 1NI3A 4JLBA 4LJAA 4A6DA 5JWRA 4MWDA 2QTTA 1KJZA 2ZUSA 1DWQA 2F4VB 1D2MA 1ZEJA 3R3XA 4NVRA 1K27A 1JB9A 3ZDEA 4J7AA 3KD2A 4HL6A 3EIEA 2YJ5A 2ZRPA 3TJMA 3ELYA 4XGQA 1EWTA 4IR7A 4EF6A 2UKDA 3NT5A 2GBFA 1PDVA 2C58A 1NVWQ 1FSGA 2C4HA 4ND3A 3DXXA 3MUOA 1UPAA 2KBFA 2A7XA 1EHCA 2IXFA 3GVIA 4ZVNA 1XMOB 4BEBA 1H93A 4V3CA 2P7IA 5IS2A 4CM4A 3BKWA 2L82A 3CIOA 3R9XB 4J1QA 3UMYA 3IA7A 2QG4A 1YZ3A 4P08A 1N2JA 3I9FA 2A92A 1CW2B 3WI7A 2VYVA 4OQEA 4YDHB 2VWQA 2GK4A 1FY2A 1OILA 3A9UA 2J6IA 2PVSA 2R4UA 1E69A 3S2YA 5KQSA 4QDTA 1EI9A 2R5WA 4OA5A 4EMBA 1YL5A 2OVBA 3B6EA 1E1DA 3HADA 3VISA 5F73A 4DQUA 4ENTA 3GPBA 4EKNB 2AG8A 4Q66C 2PQ2A 3ZJTA 1QGED 4UXJA 3V1KA 2ZS7A 4YRGA 4FKMA 2FGJA 1ZWLA 2Q3BA 3NKVA 4OJNA 5LQUA 4BY9E 4Z1OA 2WQ6A 4Y98A 1QGYA 1OPXA 5IK2A 1E2BA 3PHHA 4URYR 3W9SA 5BWNA 1PNQA 1ZOPA 2RFLA 2Y67A 2YJ4A 4EG4A 1GGJA 4EA9A 3AG6A 3ANMA 3AT1A 3FZYA 4GNRA 5E8JA 3RNLA 3DZGA 3UUWA 1NV9A 2IP1A 2ISCA 2ZCUA 3INGA 1A82A 4WUTA 5U1PA 1EP1B 3LLVA 3AO0B 1P62B 4UUAA 2Z2ZA 1HXHA 1WLYA 2XZPA 2W2OA 1BN6A 3A05A 3DMNA 3WNVA 1L1EA 3BIJA 3OMXA 4Q1VA 4QVKA 3KFLA 2GOYA 4MA0A 4ZYTA 1X6VA 2WKWA 3IPYA 4EI9A 1ISRA 1GL3A 1WHSA 3DHVA 4Z9XA 7REQA 5IPFA 4Z5XA 3DO6A 2HX1A 1WW3A 4HZGA 2PGXA 2VDWB 3L6DA 4NK4A 1DKLA 3BFJA 4UQPA 2DHCA 4OQDA 4RK4A 1T1RA 3WDSA 1DQRA 2DTXA 3HWWA 1Z75A 2AKYA 5A2GA 1PV4A 5FOTA 3TIXB 3CF0A 4AYTA 1RCTE 1DX6A 3MFQA 4ZJPA 5KYYB 3BRQA 1S2MA 3DE6X 3IAS6 1XVUA 4GC5A 3E9NA 1J8DA 4KPUA 5ALXA 1SUSA 2Z57A 5D6OA 5BVGB 2NVUB 5CA1B 4KNYA 1RU3A 2VCEA 4A91A 1T2DA 1AZSC 3L4BA 3ZN2A 1N5LA 2OK7A 5I47A 3T95A 3RJMA 2B8EA 4N6OA 1PT9A 3BULA 2A9QA 4Y2SA 3T41A 1NYRA 1SXGA 3DMFA 2HHLA 1ID8A 2VA9A 2F43A 5SZIA 3EYAA 2EFYA 3FPKA 3PUWA 4GG1A 4A0FA 1KY3A 3SIWA 2JFZA 4RDCA 4ALMA 1AMUA 5DO9A 5H4GA 1Q0PA 1YB4A 4Q03A 3DJFA 3GDFA 4U0JA 4UTXA 2DR0A 3RIHA 4IDBA 3T6KA 3VHRA 4DQVA 5ALYA 1CRQA 3OM9A 1YQTA 3GAMA 3AP2A 5FL3A 4Y2TA 2EOAA 1A7UA 3IP3A 4RVUA 4MHSA 1A7JA 1VJRA 3ICCA 4UUMA 2GEJA 2CXOA 1S2LA 4LHSA 4EDFA 5L3QB 4FR2A 4B1FA 4RC9A 1B3RA 2C57A 4WAUA 1QB7A 2C5HA 2FPLA 2JLCA 2A86A 2WIBA 3PJFA 4M1SA 5GPBA 3B2EA 3HP4A 2MHCA 3KNZA 3V6LA 1Z88A 2RBKA 2WWXA 3LXXA 3Q7EA 1V7ZA 3A1VA 1ZK0A 5FV4A 3QBVA 5JI2E 4AJKA 1GU1A 2A1TR 4DXAA 3B13B 3BVPA 1H1DA 3U7HB 1BEUB 2Y71A 1DFHA 3DE5X 4LJLA 3G2MA 1XTKA 1XDGA 3T61A 2EYUA 3LL7A 5DK6A 5JPIA 3ZKAA 4QDOA 3NQ41 3E22A 5K03A 4M1TA 2NLOA 1X8KA 4WLOA 4Y1RA 5JJBA 3ZGXA 4C7VA 5L7WA 1QFSA 1S3SA 4MVJP 3HY4A 4Y0NA 2IKQA 4MQMA 121PA 1C1YA 1C50A 4G8CA 4YB8A 3WGYA 2O8CB 3PQ8A 3RDPA 3DXZA 4TZ0A 1N2XA 3AM5A 1R5BA 5KYXB 1KSJA 3TBHA 1JFTA 3ZVNA 3RF6A 1FLDA 1VPDA 2F3QA 2VP2A 2Z95A 3EEFA 3K96A 1KJJA 1AOXA 1Y7HA 1SC6A 3EDQA 4NV3A 4CKEA 1D6SA 1PT8A 1PLJA 1ZIYA 2APJA 2JGKA 4D57A 3U44A 5DE3A 4TQGA 3IHKA 3NWBA 3WGUA 5BR8B 1Z07A 2F00A 4TX1A 2I29A 1K86A 2P90A 1JEAA 1AMOA 1EJ0A 1PT6A 1OWNA 2WWWA 2QRMA 4UDXX 5FTMA 3NJRA 2Y3IA 4DM4A 5H68A 3WVNA 4X3OA 4G9GA 1OU4A 1KQOA 2CNKA 2NN3C 2XR1A 1PJLA 2Q5CA 4ND5A 4TV8F 1AKWA 1DEOA 1K3FA 2LXNA 4RXMA 3C3DA 2FR1A 3HWSA 3WMFA 1RDFA 1PV1A 3QVGB 4A27A 3OX1A 5IC5A 3F0TA 4Q39A 1NVFA 4L0QA 1VFNA 3AHGA 5SZKB 4BV8A 5AW2A 3LDAA 2VAVA 5SYAA 3RD5A 1EB9A 4YAEA 1QYIA 4AJNA 4BFTA 2D06A 2DTEA 4KTVE 3HABA 1K2WA 2YS6A 2XCOA 4MWSA 3DMYA 4MIOA 3N3AC 2BGGA 3UGTA 3BAZA 2QJRA 3F49S 3JQ8A 4RKQA 4N76A 1H2FA 5B6PA 3DLPX 3VPCA 1V4NA 3MERA 5JYBA 3OT5A 2KLHA 2YW2A 2XMSA 2WJ6A 4NONA 1MXHA 1E98A 4WJKB 3V7NA 2WYWA 2YQ5A 5AW6A 2ZUFA 5IX8A 4X93A 3LOUA 4YJGB 1ZSVA 1X7DA 3QWFA 1M6VB 1EFKA 3OEED 2C2WA 2BRUC 4DCCA 4EJMA 4UVIA 3WADA 5B3KA 3CKYA 4Z9BA 5EJ8A 2XZOA 1YFZA 4JBXA 1ZY2A 1QNLA 3LQYA 2FR8A 2ZT7A 3OLZA 1V16A 2H52A 2WABA 4IDEA 2QXTA 2HWYA 1V48A 2E2WA 5JSQA 1Q7EA 2PSFA 3P4XA 2NZXA 4CNBA 3ZWBA 2BGTA 3GLHA 4HGQA 4P6VF 1YHNA 4J2OA 5ILOA 3RKSA 4PC6A 1GTVA 3RVDA 2OESA 5L40A 1MV5A 2ZOSA 4J0CA 1JXAA 2YFHA 3AB7A 3DMTC 3VR5H 4PZZA 4N7JA 5G3YA 1HR0B 1PR2A 2PUHA 4O2BA 4L9SA 5DT9A 1SXJE 3F5SA 3OA2A 3EVTA 5JPCA 3CUYA 1X2EA 4M8NE 4AVYA 1KEEB 3DP9A 4RKYA 5JADA 3L8DA 2JLXA 4R2JA 4OD0A 4NCJA 2W37A 1JLLB 3IEUA 4MWBA 1ODJA 2CKDA 2BHSA 3PNYA 5TQ0A 3UFXB 5ALRA 1DBSA 1A9XB 3ZWDA 1XTTA 3GHHA 3ZCUA 3WGQA 2NSLA 1JIUA 5BMVA 5CH3A 2BKLA 5KJEA 1WMDA 3K70D 1QYVA 1A76A 1UBSB 2QRPA 5L7TA 2GCIA 4D3YA 1J4AA 1E5LA 1T1EA 1F8GA 1XFDA 4AMZA 4DL9A 3HB0A 4E31A 1ORDA 3ZS9A 4Q3EA 4ME6A 4DC0A 1T8RA 4WZAB 4D9CA 1QH0A 2EZ4A 2JLSA 1QF6A 1QZ3A 3JU3A 3P7MA 4YK7A 1C30B 4R81A 2GT1A 1MC5A 2VJDA 5A4DA 1LDEA 4EABA 1QZUA 2ZEJA 2J5KA 2WT8A 1SBTA 3EVDA 1G6KA 5LUAA 1NVXQ 1AXGA 3O82A 4JJFA 1XQ9A 3HXPA 2R85A 1PTJA 1Z18A 2VZ0A 2XX3A 4I08A 1H3FA 4L16A 4XCVA 2QVZX 3DJYA 3KVYA 4Z8XA 4IWNA 2I54A 5EWMA 3PDCA 3SLKA 2E5FA 1FQWA 3JD4A 4V3BA 1KI2A 3RYHA 2IYQA 3BD7A 1UWCA 2OD7A 3D59A 2HSEA 2EJUA 3DD1A 3H97A 3KHSA 3ZHCA 5IN4A 1E6EA 1ZNYA 5F2NA 5JW6A 4HO1X 3RFUA 1GVNB 4G0UA 4B46A 1T24A 2IYRA 5B7GA 2VAWA 4CCYB 3SQWA 4LOLA 5SV2A 3SHWA 5CIYA 5DN6A 2CY0A 3ETGA 4QA9A 4BTVA 4RTRA 3SLGA 1EDOA 3HO1A 3BQMB 2K6GA 2EG9A 1M34E 1ZN2A 5DHSA 3F1KA 4DCJA 1MB9A 1Z8FA 3FE2A 4KVGA 5C7OO 1TU4A 3G1UA 4LE0A 4AYWA 4D8WA 1UFQA 1FYXA 1O95A 2QTVB 4EGFA 1MAWA 1L7AA 1IY9A 2J5QA 3DPIA 3GFOA 4O2AA 2LRHA 1ZNWA 2HNAA 4N1AA 3SDZA 4L5IA 3C39A 3E58A 3MUNA 2XQFA 3PE4A 1A1VA 2HBYA 3QPVA 2FWRA 2E55A 1GL6A 2IHTA 4UMVA 3B89A 2FOXA 3OPQA 4FGJA 4KVFA 5JAIA 1V3UA 3BMXA 1P29A 4MQ4A 1MBZA 4BO4A 1DTSA 1R37A 4LOJA 1Y1RA 1JBKA 2VF7A 3MJ4A 4NFLA 1QANA 4YALA 1UBUS 2B35A 4UOQA 4Y1EA 5P21A 1YZQA 1GCOA 1N5IA 2P5UA 3CJRA 1MOQA 2QSUA 5EJ5A 5CJJA 1X1RA 4JAVC 4Y6GB 3W06A 1AN9A 1KR2A 1NVVR 5KYUA 2BM8A 5HCIA 2XXAA 2OG2A 2V59A 4HUQA 3VVCA 3LVFO 4LSZA 1JFFB 1C2YA 3COPA 2R65A 5DI3A 3TSOA 4HDSA 1R9JA 3JALB 2JA2A 2PUBA 3H3JA 3D7KA 4EGJA 4D43A 1DCTA 4UUQA 1A9YA 1BD4A 3M6AA 3OIFA 3WYCA 4POOA 5A4JA 3AB8A 3ILHA 3MG9A 4C7OA 2O8FB 2DBQA 1JFVA 1W36B 2XAUA 4YJ3A 1X7XB 1CF4A 3U3KA 3W5UA 3U26A 3GRUA 1J20A 2ZZKA 4G41A 3MINA 4LJ4A 3B1VA 1HDIA 4HNRA 4EW2A 3WLAA 2FDRA 3B3QA 3EY4A 1N7JA 1ZOOA 1BMQA 3U4MA 1MRSA 2O5CA 1OXSC 3JVDA 4FWBA 2WJIA 2P69A 1QH9A 4KFSA 2HPVA 4E3WA 3WYAA 1OX4B 2PGAA 2QNRA 2SHKA 4A6XA 1FFWA 1RHUA 1YCGA 2AL7A 4FHCA 3BWBA 3RAJA 221PA 2PNFA 2SECE 5AXAA 3OZTA 2ZXEA 1N6HA 3DTTA 1AGRA 3K3PA 1JMYA 1A96A 2AS0A 3Q4GA 3OOYA 2OVFA 1E8DA 3BXGA 2OCLA 4MDHA 2NWQA 4ZRDA 5IEBA 3ZI4A 4KQKA 1C8KA 4TZTA 5IT5A 3OIDA 2C54A 4REQB 2R97A 4KQ6A 2ZQZA 2B61A 3WL6A 4CU5A 4HNTA 1W73A 4NBWA 5KMGA 3I92A 4DR4B 1JGTA 1IB0A 2RI0A 3BIWA 3L43A 4TMKA 3EVZA 2DLDA 5LA6B 3RFTA 4ESEA 3TRIA 2P41A 4M1WA 5FEMA 1QK5A 2HLNA 2IE0A 4PVDA 2GEFA 3VSBA 3THYA 4LDJA 3COYA 4Q9NA 4DN6A 1UAAA 4WY5A 1KYZA 1UC5B 4S12A 3QOFA 2UZ3A 1U04A 5JJLA 1QFMA 1GTMA 2O7SA 3I28A 3DA8A 3PBKA 4JBNA 2IYVA 1G2OA 2FKAA 3OQBA 4TSKA 5DK4A 5T8KC 4EAQA 2BT4A 4RCYA 4FN5A 1V8BA 2V7PA 2X0NA 3PNBA 4KZPA 4BB6A 1M2OA 1XN4A 1SKYB 2FHPA 4UMEA 2QPTA 4DQLA 2VK4A 3NRJA 2Y27A 1X1AA 2HXSA 3GLFB 4HAVA 3H9UA 4LOKA 4F45A 3BZWA 1F38A 3E9QA 3JQBC 4WESB 3MJRA 3WRYA 4TTRA 2A9RA 1P4GA 3DTVA 5A06A 5DNYB 2ASVA 1S8OA 4Q6WA 4AP5A 1L4EA 4NJMA 4QNRA 5ICSA 5FTLA 1YAJA 5HGXA 2GESA 4AFNA 5AVJA 4NENA 4D4JA 4QYMA 3PXAA 4FX5A 5FJIA 1G8MA 1ES9A 1H6AA 4P7BA 2ZSFA 4FTWA 4BNVA 3BAFA 3HCPA 3ADDA 2H3HA 2P3SA 4O5OA 1E89A 4CM9D 4PLTA 4BWFB 3JZMA 1NBMD 3RU2A 2HMWA 1JR3A 4PQEA 3EXAA 5E6SB 4F86A 4KWCA 2P2YA 4K0KB 2NTVA 3ZDRA 2QSJA 3RFCA 4JT4A 3KFXA 1RRFA 1BX0A 3PCXA 2AW5A 2VOEA 4P3YA 3RROA 1MRZA 4JSRA 3SNKA 1KWKA 4KQCA 1ZISA 3HB4X 2HJGA 2M32A 3B1ZA 1NJ6A 3SFVA 2XE6A 1NW9B 2VHJA 5B1YA 2XQJA 2PLAA 3AFIA 1FUEA 3K4PA 4CGZA 1AF4A 4JI2B 1FLVA 2XITA 2WHPB 2EP8A 4Q4JB 2WAMA 2W6PA 4X1YB 2FU5C 4PHHA 2W6MA 3Q8KA 5IHXA 3DCJA 5EXPA 4HNHA 2O0JA 4DLPA 1DAPA 3NTQA 4WQMA 4B40A 2DX7A 3H9EO 1DIHA 2RGAA 3FG9A 3GJSA 4FDMA 2A9OA 4D42A 3AJEA 1OSNA 4Y67A 5DGIA 2J41A 1KGSA 4YAIA 3SNHA 1Z16A 3F6SA 2WV9A 5BMVF 2IE8A 2XMPA 3NLLA 4QJIA 2B8JA 3K2QA 5TEVA 2GETA 4DCPA 4W6QA 3WISA 4DSOA 3BSSA 2OB2A 3CRMA 4LK3A 2G1JA 3P71T 4WLEA 1QHSA 3DWFA 3SYLA 2P75A 4L72A 4UQLA 3STHA 1VKOA 2DWQA 5BN1A 2J4DA 1PNVA 3HFGA 3W1WA 3VYVA 3ZVKA 3LMKA 1G20E 1XNJA 1HQYE 1NZFA 3Q3HA 1OZHA 2RCYA 3K0CA 4RSGA 4NV0A 2FA9A 4AJHA 4M9UA 3TI7A 2NG1A 2ORYA 1K6IA 3FXAA 4Q9AA 3X1XA 3INTA 4WPGA 2NMVA 3HEAA 1M0WA 1POXA 2GAIA 3BDVA 3DUFA 4M1KA 5TB5A 3R8FA 3IILA 1GITA 3PS9A 1F3LA 5BXQC 1F1BA 4KQXA 1V3VA 4RPCA 4HRVA 3EQ2A 4ZT2A 3DVLA 3PQ6A 3EULA 2B1IA 3M6IA 1BS1A 1J7JA 1EUDA 3LT1A 4J94A 5AMXA 3KQYA 4U2GA 3ZWPA 2GD0A 1TCUA 3G8DA 2O19A 2QF7A 1X1CA 2IEIA 4LGYA 2C07A 1SQSA 2WHYA 4QBTA 4QOSA 1XU4A 2BEUB 3RK0A 3R8CA 4UBKA 3FWHA 4PHCA 5ER9A 1L6IA 4PIMA 1MC4A 1R0RE 1EX6A 4U7FA 2IHKA 4HNAB 1AV6A 3LXMA 2ZZMA 5K8VA 1PFWA 1OWLA 3QA3E 4MPTA 5KVQA 1EJ2A 4BYMA 1CUWA 2YUTA 3I3OA 4L78A 2I4NA 4DJDC 3ZNQA 4CLHA 2PUTA 4HXYA 4JJIA 2DERA 3FWKA 1G17A 3FKSD 4PC1A 5EZ6B 3ZY3A 4B3TB 3DDHA 4XQ0A 2OWDA 4E6EA 2Z6VA 3EIHA 3H5LA 3NNDA 4JLUA 3UUEA 3SKVA 1E1CB 4LY9A 1DWUA 1R4MA 1UWLA 2MYNA 2W2VA 5E8RA 3ZCPA 2RHJA 3OZBA 2IYAA 2CVFA 1UANA 1K08A 1ZIDA 2BFBB 4TT3D 3QMWA 3DH0A 3EQ9A 1NFQA 4FLFA 4CI0B 2ZJAA 5DNCA 3CSUA 4QZVA 4FW8A 4L0MA 4ZQGA 3UA3A 1MFPA 3RI3A 3SDSA 3PPWA 1KBZA 1UODA 1WRBA 3A7EA 3BGIA 1NBOA 3CRRA 3CW2A 3HWRA 3O8OA 4JIGA 4K87A 4ARBA 4DLZA 3WY9A 4DYVA 3BGOS 1TJNA 4NG4A 4CMIA 4G89A 3WBFA 10MHA 1KDRA 2PGIA 3L0BA 4C0SA 1XSEA 3BWVA 2WJPA 4HI0E 4KXNA 4ES6A 1NN0A 2ZRAA 1Z56C 1W19A 3DQQA 3O92A 1H9AA 1ZIPA 4JGGA 3ZZ1A 2XZDA 3UHOA 2CHVA 2H5JA 2FGKA 3EVNA 1VLMA 4JI8B 4U39A 4IVNA 1VSTA 3GH3A 4MAMA 2H16A 3M6FA 1GGVA 4CMHA 1Q1QA 4I50F 3URKA 4B71A 4U9HS 3K1AA 1NIJA 2HMUA 3RRBA 2A9JA 3JQ7B 1RI5A 4Q24A 5TMBA 3WV4A 2NSYA 2I1WA 3F4BA 4LWZA 1KQGA 2J9ZB 1ZJ6A 4GI1A 2GA9A 4NEGA 3IE2A 4ENSA 1BVRA 2WZDA 4CEJB 4KH0A 1BQEA 3GT4A 5DNEA 3OHMA 2C96A 4Y9UA 3DMPA 3T9AA 4D1YA 4YX9A 2V98A 1OFIA 3BFXA 5U4QA 5KX5A 2RHLA 4UZSA 1E2NA 2XF8A 2C2GA 1RMYA 2QAGA 2B1JA 3VHQA 4JP5A 1KI3A 5I9TA 1ULZA 2VNJA 1Y3BE 2V54A 4HEJA 3FTNA 5BSVA 2HIMA 2PRKA 2EBFX 3SX2A 1EWVA 1U9IC 5AWFC 3RS7A 1HG1A 2YN0A 3PRHA 3QOXA 4IVRA 3O0DA 2XQIA 2RARA 4DFDA 1XEWY 5IEJA 2OCDA 3OOSA 1CUCA 1I32A 3PEFA 4NBTA 4NE2A 3RAPR 4WBNB 2XH8A 3EODA 3NEJA 5EZYF 2XNDD 3OI7A 3T3EA 2ZSKA 3SIRA 3CRZA 1US8B 1XL1A 1EBFA 2QGFA 2ZAMA 3JZAA 2A84A 4C0AC 4LJRA 1H0RA 4Q4HA 3MAGA 1JQDA 4H35A 1I1HA 1ZCJA 2NTYC 4MVJA 3F97A 1VL5A 1AZTA 2I76A 1HETA 3ZE1B 4BLSA 1GZ5A 3R7DA 2FETA 4FGZA 1IJBA 4GVLA 4BAGA 3WLFA 4HH3C 3BF8A 5DI9A 3OZSA 5AJUA 3ZWYA 4IHAA 2CYAA 2ZETA 4RVNA 4MHTA 4LSMA 3SYMA 2F9FA 3D4LA 1VIDA 4R51A 1R4ZA 2QGNA 1LY1A 1D9XA 3JVUA 1QIJA 1Z7WA 4JIMA 3RADC 1W96A 2PCLA 4Q3NA 4NTZA 4BMPB 1O9HA 1U8AA 3V4FA 2J3DA 3EGVA 2WYHA 1IU9A 3VOTA 5DWVA 4ZI2A 3S1AA 5L45A 1VJDA 3L1JA 4L9RA 2D2IA 1I8TA 2XB9A 4CLRB 4D9HA 5J1SB 4JEIA 1EUYA 1MEOA 4QOHA 1EE2A 3FTEA 3GIWA 4FKZA 2C7OA 5E6UA 3KTDA 5HE8A 4XRGA 3WKEA 3BKXA 1KERA 2J7PA 4MW1A 1T9BA 2VRNA 3OZDA 4ASUD 3BSFA 2ATXA 2MSDB 4KNVA 1B0PA 4F4DA 3BGVA 1UC4B 2ROQA 3WLHA 4DM7A 4X1IA 4IJKA 1D6MA 1CUDA 3AY0A 4K3VA 4PRZA 3QVSA 1K7FB 2IHVA 2YHBA 4IUDS 4MRRA 3DVQX 1E79D 4A4DA 4OX9B 1Y89A 3WGHA 4FZ5A 5DW3A 4WBNF 1K4YA 3WK4A 1W6RA 1ULBA 2CLCX 3ANXA 1QUEA 3FNQA 2AFHB 2IQ5A 5DTJA 3T7JA 3V4SA 3R0XA 2V6JA 3DAFA 3O4FA 4EI7A 2W8BB 7ABPA 1DBRA 2YYSA 2IU3A 3KJZA 4GF5A 4MI6A 4ZC1A 2Q5QA 2NUAB 3I0ZA 5A3RA 5JBNA 1MNAA 1U28C 4OFBA 1EMDA 1P2TA 1IY8A 3S40A 5IVKA 3PEYA 3KR9A 1LH0A 2AH5A 4MA4A 4CV2A 4PFJA 3RVMA 4HYEA 1V11A 1U5AA 4P38A 5LOVB 1NP7A 2Z2XA 3VR3A 3CR7A 1CRZA 2ODNA 1NQUA 2VKQA 1CY2A 4GAEA 1WZUA 3IDAA 4Q0MA 2G4CA 4XOUA 1CF2O 1YUBA 4ZOBA 5T41A 1IBLB 3EF1A 4G23A 1RI3A 4I5DA 4JWTA 5DTIA 1PD0A 5IH7A 4YN3A 1KYVA 1NHGA 5ES4B 3BH0A 1DJNA 2ZIWB 3E23A 3PXCX 4I4NA 3RYIA 3N70A 2XEXA 3ICPA 4JB8A 4E2FA 3L46A 3O8CA 5J43A 3K5WA 5EKTA 5DOZA 1AT1A 2Q6TA 3LCVB 3FDXA 4R2IA 3GC6A 2D3WA 3SHQA 1NNLA 2X86A 5IAAA 4PZ0A 3ICWA 2HA4A 3H19A 4G9EA 2GEUA 3LUBA 4CM8A 2Y92A 4ZCQA 2CUNA 1Z0FA 3C48A 4FMDF 5CH5A 3WLPA 3QYFA 2ZVJA 3IDSA 4QXRA 1RAHA 5IYZF 1TTTA 1MB4A 1Z34A 4GZLA 2CNDA 4NSNA 1GPAA 3R0ZA 3JPYA 2VBGA 2LW7A 4DLUA 4AMUA 4ALNA 4WCFB 1WEHA 5EHZA 3TG8A 4RIEA 1XP5A 3N8DA 3KEMA 4ID3A 5F3RA 4OI1A 2AXPA 1LTKA 4MVCA 2WD7B 4ZP1A 1P4RA 4KGDA 4PZUA 1XTIA 3IOMA 2NSHA 2OD2A 1HGXA 1THGA 4EUKA 1CNFA 2WI8A 3G13A 3TZKA 3ZE7A 3HJCA 3SXJA 4ZGBA 1RBQA 2QR5A 2A0UA 3PUIA 3QXHA 1MB3A 3C6YA 2DY0A 2IJGX 3UFBA 2X5JO 4E5PA 3BT7A 4BZQA 1LQ2A 2ID9A 2IPOA 2EBHX 2X4LA 2B34A 3NG1A 2G9NA 2H7XA 4HNVA 4N7MA 5EESA 4L28A 3SC6A 1ZN9A 1KOGA 1CERA 4M9RA 2Q6LA 2OFPA 2JCSA 1M2JA 4IJQA 1N8SA 5HK9A 1BFDA 4WH0A 4LBVA 5K3AA 3RS8A 5DBGA 4ZZ0A 1YO6A 4DMHA 1ZD9A 5FBQB 3P0IA 2I7TA 5K09A 1U9CA 4NULA 2ZSHA 2C1XA 1NURA 1Q3HA 2VDMB 4XB2A 4JI0B 3CVJA 2ZVQX 3O4JA 2H1RA 1W5TA 5H02A 3IERA 3AWIA 5HFNA 3RUDA 4W1QA 3A31A 1QV7A 3BHMA 3E4CA 4XPIA 3UMRA 2DULA 4NLLA 1X1SA 3GUYA 2J3IA 3HGTA 2V4ZA 4KC0A 4NFHA 3GNSA 4LXGA 4EFKA 1SKMA 4BKRA 3WC4A 3F73A 1QHGA 1YZKA 2HD4A 2P11A 2XGSA 5BQPA 4TRMA 1G7CA 4AJOA 4EFDA 1U2DC 3QE9Y 4ENUA 1CDEA 2B21A 3B3FA 1CD5A 3I1IA 1DTEA 2V7UA 4IIGA 4DV7B 3TIFA 3OAAD 3C16C 4C2AA 3L7AA 2PV0A 5JCPA 2VHWA 3PGJA 1FTWA 3HG7A 4FC6A 4IGIA 1FUKA 2Y93A 1EG7A 2ID7A 2YY5A 4YYEA 5B3AA 4LISA 2PRSA 4D9EA 4IRUB 3W1EA 2E89A 2QZSA 4QPJC 3NR2A 1QGZA 4KO8A 1E7RA 1FLNA 3DQPA 3OTHA 2HM7A 3PTLA 1BOOA 3L77A 5T3YA 4DV5B 4FPXA 3OEWA 1C9EA 1FDSA 1RQPA 1E4YA 1SCDA 2HJHA 3SXPA 5DCWA 1N2CA 4D9JA 2Q8PA 3DDCA 1J09A 3Q3JB 2P9ZA 2HEIA 2ORIA 3EA4A 4I8IA 4CXMA 3QKSA 5H7XA 4HFMA 4YRLA 3H8SA 4ZU1X 1BHSA 1CG6A 1UQUA 1A8SA 2RI1A 4JYBA 4UFPA 4ND6A 1R16A 4US2R 5LFAA 1WO8A 3DLAA 4EZIA 1QVAA 4QE3A 1XRQA 1Z7YA 4RYDA 5HIJA 3VPDA 2FQXA 3NC0C 5C4IA 4ZIRB 2ARKA 2W4MA 3UMMA 3IOBA 1BCRB 2FW9A 2J6HA 4XGKA 3R7NA 4HZUB 1RNLA 2R66A 4HX2A 1NVBA 4KQEA 1WTAA 3H2KA 1XMQB 4Y1FA 2DBZA 2YWGA 1H9CA 2O7RA 1IYZA 1GUYA 2EFGA 2GBIA 5FJJA 3WRWA 5A1TA 4H1VA 1G6Q1 4M9SA 5G0WA 2Q41A 4JH0A 4NPCA 2HSDA 3KSAC 2CDCA 1BH6A 4NBNA 1AS3A 1YV9A 4PPNA 3C1AA 3P9XA 2KSQA 4KWHA 4UE2A 3ZC3A 1Q7CA 5JECA 1TM5E 2A88A 5CNKA 2WKQA 1ZFNA 4LGMA 2DFDA 1O3YA 2PD6A 3NHYA 1E4VA 4NATA 2P9YA 2WTUA 5KPDA 2P1RA 3F5DA 3VR0A 2I6TA 3JQ9C 4H6XA 4NBSA 5JRZA 4DDTA 2VDWA 1CZRA 4C6RA 1C1XB 1Y1QA 2ZULA 4XAQA 2QD3A 5DMXA 1YRAA 4FZ3A 5TJHA 3W6ZA 4C4TA 3B60A 4TVBA 3WAGA 2DR2A 4NZPA 2DKNA 3PNQA 1IHOA 2E4WA 1NUHA 5B58T 1NUAA 3DOIA 1II0A 5E4FA 4C89A 4X7RA 3EMKA 4AY4A 4EA7A 4KHPB 4EA8A 2YIJA 3LQRA 1N1DA 3SIPA 3UW3A 5A2QA 4Z1MA 2GCEA 3HDHA 5HRCA 5CA1A 1J22A 3TX2A 3I73A 1GPWB 4R1TA 3D2AA 4J9VA 2K87A 2C2KA 4NE7A 4MHOA 1RYDA 5TMPA 4QHSA 4BIMA 4ZPXA 4RNCA 2ZE5A 3I05A 1IEVA 4GM4A 4LDAA 4MGIR 4Z51A 4HNUA 5AJYA 3VMFA 5JJ5A 1A8IA 3MK31 1L5KA 5FYQA 5LKRA 2BBOA 3G1TA 3C8HA 1REQB 1TYCA 4MLCA 2XUPA 1DMRA 2MR6A 2RHHA 5G0TA 2ZBFA 5HEKA 3FTCA 1UDBA 2CUZA 4NZMA 2H9YA 1P5HA 1TFUA 3GFVA 1A9QA 1MG0A 3QVKA 1H2BA 1Z33A 1DAIA 1IEWA 1P77A 4ANFA 3RIGA 5F4BA 3TN7A 1PFYA 4RH3A 1QO0D 3IV9A 1S89A 4LIPD 2QXUA 3P94A 4HNGA 1IZ8A 1ISPA 3RQIA 4XEUA 1GL7A 1EBBA 3NFYA 4CIAA 1WMBA 1QP4A 3WO0A 3O8RA 1E0SA 4IICA 3FD8A 3O9VA 4L1KA 5AOBA 1EESA 4BJ3A 4CM6A 3VKHA 2HWUA 1IOLA 4HFNA 3V1YA 2WHQA 2PKCA 5KVCA 1ZR4A 5B58C 4H4DA 4O4IF 3GA0A 5FLEX 3TRHA 2GBLC 3OF3A 4F38A 1DQPA 1DEKA 1SGWA 3C97A 3QEMA 4RORA 4J1TC 4X97A 4KITB 2DTDA 4JU8A 3OUZA 1DAEA 1FSSA 4RV4A 1ZD2P 1N5MA 2BRUA 4QPDA 5DM2A 3EOAI 3IUSA 2JAQA 1EUCB 5HJ5A 2I7CA 2F8LA 4B31A 3Q7RA 2FSPA 2VRCD 2X3UA 3ET4A 3O84A 2O8CA 2VSNA 3GJRA 5EZ5A 4A8TA 3RFFA 1ULAA 3R44A 4H15A 2ZYIA 3I9JA 3QWHA 4P81A 5T4BA 1PVVA 4U7PB 3SQOA 4XLLA 3CKMA 3AMVA 1U7UA 1ZGZA 4OXRA 1J5XA 4L85A 4NCNA 1O4WA 1WXIA 1FYWA 4M54A 3SSAA 1U1FA 4AN4A 4K8OA 2C92A 1SOWA 1PZEA 3QX8A 1GT6A 1M76A 2G8LA 3H1AA 2NZUG 4B81A 4C3ZA 2G07A 1Y3HA 4ZHQB 2DETA 3KUDA 2AHRA 4F3RA 4QTYA 4TKVA 4GNKA 1SQGA 1RACA 1GUZA 1RYHA 1Y7PA 4JLJA 4DRXA 3KOWA 3GJZA 3ES9A 4Z4FA 2PZAA 2VZ9A 3M49A 3QKWA 4L7QA 3SJAA 3CMMA 2BVNA 4TM7A 2GJ9A 3B7PA 5CDFE 4M9CA 4J3NA 5FUMA 4MSUA 4DJ5X 2WFAA 4NWIA 1UQRA 1WY5A 4JS0A 4C2UA 4O0MA 3JASB 1Q12A 2HJRA 3QIVA 3HR4A 4P4SB 1YHZA 1N7HA 1ULSA 4N49A 4E46A 4DIEA 4CKWB 4OH7A 1X86B 4HAUA 5IABA 2JCXA 4PG4A 1PBNA 4LC9A 5K0LA 4MUHA 5K3SA 4LSGA 3FOZA 4CBVA 4W1PA 4G4GA 4TV9B 4QIHA 3G1WA 1V5WA 5HQTA 4RTMA 2ASEA 2XCIA 4U6QA 3LY9A 2XUZA 4R2MA 5EYPB 1J1IA 3N6VA 4FI3F 4L95C 4TLLB 4B2PA 1HDRA 4TRRA 2VH2A 4RHCA 4YQFA 1XEXA 5EZQA 4YJGA 1N9GB 2F2TA 5T64A 3LGSA 1JIXA 4LEIA 1RZVA 4JL5A 1D1PA 5EXEA 2QWXA 5TS2A 5KTNA 4BNDA 3NP9A 2VNAA 1MJFA 2JH3A 3V6MA 5I6DA 4IIJB 5JROA 2JK1A 1KDZA 1GQQA 1RRGA 2LDBA 3R3VA 1RKVA 1HV8A 1TVKB 1Z06A 4IDPA 1RAIA 2YFQA 3TLEA 3LFHA 5FQOA 4LFBB 5CFZA 3SJUA 4BFYA 3V1TC 5EHIA 5EJFA 3DBLA 1Y4ZA 3D4OA 1B6GA 4ZKDA 4M22A 4F12A 1FJ2A 3O93A 1NOIA 3K8OE 4S1OA 4Q3DA 3RE1A 1RXIA 1N2GA 1KF0A 2X22A 4NAUA 4RVHA 4MRMB 1F8XA 5DTEA 1ZVQA 2HWXA 4I46A 4ZO6A 1GL9B 4HAZA 1JLLA 3RQSA 5EGSA 4AJ4A 3L7JA 4EPXA 4IXTA 1ECPA 3UFXA 1NXQA 1SVNA 1F0KA 3B9RA 5IJZA 2X19A 1Z2EA 1O6BA 4Q5IA 4DABA 1Z4NA 1OLXB 1OGIA 3NDRA 4ZAFA 4ZVMA 1T15A 2QVXX 3HXQA 4M76B 2HK6A 1O94C 2CNWD 1THZA 4KYVA 1QH8A 1UBOS 4MAAA 3CNOA 2EKQA 1CUIA 3HHPA 2PUWA 2FWJA 4KRGA 4WZAA 1KORA 1KO4A 1PGOA 2RGUA 5TSDA 2YVKA 4L3OA 4RTKA 3DW1X 1FXSA 3W6OA 4E2WA 1LQTA 3FYTA 4ZVVA 3BFVA 3CN9A 2PT9A 1IK4A 1M1YE 1T6ZA 3VSEA 2V1UA 4B4UA 4I1OA 2VPZA 4PPFA 5CTJA 2O2GA 3C41J 4ZDJA 2WQZA 5DX0A 4RDXA 1TGYA 4KMOA 4DUGD 3UMSA 1MAUA 3RIYA 3R76A 2WF6A 1B8VA 4IEEA 2WKSA 3ROZA 2M98A 5I7RA 1ZJZA 1ZI9A 3C6MA 3OZWA 4QL3A 4RD1A 1CYDA 5C35A 3A1UA 2B98A 4FU0A 5DHPA 3ST7A 4IFEA 2Z4TA 2JBAB 2HRDA 1G5HA 1SXJB 4LGCA 4ZYYA 3L40A 2CHGA 3ICOA 1ZMXA 2ZM6B 2VAMA 3GLRA 4CCYA 1MHTA 3HCCA 1CHDA 2ZAGA 3K31A 4ZD6A 3KEOA 5F9FA 1UK6A 3KLBA 5F64A 4G2TA 2L17A 3PFWO 1BO6A 2PD4A 4S1TA 1ECBA 1RKXA 3G85A 5JAPA 4IGAA 1RYMA 2O3QA 1DC8A 4OHXA 4D26A 3QE4A 3QPUA 2CMDA 1Z45A 2QBYB 2QL5A 2EGHA 4Q1BA 4YMGA 3HN2A 4OHVA 2QTVA 5KQGA 1HE1C 1F3OA 3ADKA 2C59A 2BM1A 1ZK3A 2WUDA 4A92A 4C7MA 1XU9A 3QZUA 4I8XA 4OAOA 5H70A 2YCBA 2QPOA 1CBUA 1VL0A 2FXVA 3WNZA 4FYYA 4HAYA 1Z6AA 3NXSA 5ITSA 2AJDA 1AKUA 2BKXA 3ICQB 1HYBA 4EKDA 3M6UA 3QM1A 3ENWA 4H9GA 2JJYA 1SK8A 1EGAA 1VRCA 3OJ0A 4WJLA 1WB9A 3V33A 5B53A 4X62B 2NADA 4P36A 1OT5A 4UUBA 1TIBA 5ADHA 2BFWA 3E7PA 5HQJA 1GO2A 1DJMA 5LC1A 2ZBDA 1O5IA 2PJDA 3C85A 4UNNA 4NXMB 4ETIA 2ZYRA 4D56A 4O4LB 4UTPA 3I83A 5JVDF 5JXIA 1VG8A 1RJGA 2VLIA 1EHIA 4CEHA 2F6RA 4Z9YA 1Q14A 4XUEA 1JFFA 4NDAA 4MIEA 2FMXA 5FUBA 2ZIGA 2X0DA 4TTVA 3REFA 3G2HA 3I1JA 1E2GA 4CFSA 2IWRA 1RTKA 4G1VA 4MRPA 2Z0MA 2NT3A 3ESBA 4OJTA 2V7XA 1R0SA 4UEJA 3I9OA 2NZYA 5IFLA 2WYOA 2O8FA 1W5EA 2RCNA 3MPUA 4LW8A 3A3NA 3LVQE 4O1MA 1X7XA 4MWTA 3A9WA 1M34B 3HYCA 1LZKA 2QD1A 4YAUA 1IXZA 4PYKA 3WHIA 3QBDA 1NW5A 3WGNA 5BYKA 2FX5A 5IAEA 4WY2A 1TEHA 3VI3B 4GICA 3ZGOA 3HBNA 4L7VA 3EIOA 3OMWA 2LKDA 3LDHA 4A0GA 3KKQA 4ZYVA 3NJ4A 3WL4A 1P45A 1K7CA 3NBQA 2PV7A 1T9HA 1TJPB 1GSAA 3IOYA 1HWYA 1DIGA 4ZEXA 3UG6A 1PGPA 3V4OA 2GVZC 1CSEE 1F5NA 4RQUA 2WWIA 4MB0A 4F5ZA 2VP5A 4LCEA 3TYXA 4NXNB 5IYZA 4O2RA 2I6GA 2VDVE 3DFIA 4YAFA 1BQ3A 3TK1A 4BFCA 4KPYA 5DTQA 1L5YA 2JS7A 1DO8A 1T3HA 4K9OA 5AM1A 1H2YA 4CF3A 2AIRA 4GR4A 5G3ZA 4Q48A 5C18A 1I4OA 3QVXA 3T1VA 2R44A 1V4BA 4WGFA 3NAZA 4B35A 2WU1A 3QU7A 2Q3JA 4QPCA 3TDMA 1OIVA 2PMKA 2Q4RA 2X76A 1BNCA 3OTQA 4B44A 1I1OA 2IVFA 4FI3C 4QOIA 5EG5A 3OQOA 1H22A 1B14A 4DCVA 3N2EA 4Z6KA 2YN2A 1VE6A 2JATA 5FX2A 1UMBB 1DTWA 3NEPX 4L8YA 3TB4A 1XLVA 4OHPA 1OLUA 2OCPA 3A9VA 4DILA 3PKJA 1MX5A 4AG5A 4KOAA 1F7VA 3GJ3A 3H4TA 3KLNA 3S70A 2OK8A 1UDWA 2NYVA 3ZE8A 4R8SA 4G86A 4QLBA 3EZGA 3UV7A 3FZNA 3U9TA 2SBTA 4YP1A 1ZK1A 4MI3A 3H2ZA 3O4HA 3DOFA 3D6MA 4GRIA 1YS9A 4BNNA 1XCJA 2IUTA 3MTIA 2IIVA 5MN4A 1XLTA 4JVLA 4Q4CA 4WESA 1QGUB 2VTKA 4WEOA 2C00A 3OQHA 1JG7A 1YC5A 5EIAA 2JAOA 2IQIA 4IO0A 2O2JA 2XCQA 4HDAA 2O8BB 2TS1A 1E1QD 2VP9A 1RYEA 4NMMA 4UFNA 2M6LA 4DA7A 2X0KA 2R6R1 1UOQA 2V03A 3B1KA 4K6GA 4ZEVA 5JFGA 5K8TA 4GL2A 1D3AA 1JDNA 1ZOLA 3AC0A 4OHKA 4AAYA 4K9RA 4JI4B 2R1TB 3TD6A 1R2QA 2TYSB 1H0KA 1P1IA 4RVCA 5E6SA 3CTPA 3P32A 3LX4A 4FE4A 4ZAVA 1O5OA 3N59A 3R6LA 1KO5A 2FW8A 4QYIB 1WPGA 4MVWA 1QIIA 4MKHA 3ZW7A 2BTEA 4LDQA 4D81A 5AR1A 2X5KO 5EVCA 3PUXA 3VX4A 2FPWA 5K01A 1SA0A 2QLLA 1EDZA 2EL7A 3I2KA 3N7UA 3S4YA 4CKZA 1N0UA 5EKUA 1BKYA 2YL2A 3EZNA 4WE3A 4YRNA 2ENWA 3N6XA 3UK0A 5CK5A 3QITA 1XRRA 4X1KA 4N3CA 2WHPA 4Y9TA 1E2JA 3HNRA 4Q4JA 3UJ8A 3MQ2A 3GVCA 3TMAA 2DFKB 4LDNA 2JZOA 1XTJA 3CUWA 2AX4A 1TDJA 2Y4NA 3MWFA 5HYVA 2WR8A 3RM3A 4HWPA 1J2TA 3M81A 1F2UA 3F3SA 5EL0A 1G19A 1GR0A 1X7HA 3GEMA 4FOTA 1HLPA 1KI9A 4ZPJA 4XEHA 1CYEA 1MTZA 1XRJA 1U7DA 3UUFA 4A5OA 3FTPA 4QXMA 4CQMD 5K05A 2F8SA 1XJQA 2JFPA 4XD2A 2QRLA 1IHPA 1L5HA 3ZIAD 5SZJA 1WSAA 3RG2A 2LDXA 2GH1A 2MINB 3KZCA 4LTDA 3I9LA 1WF6A 3PNSA 3ZLVA 2OKCA 3HJHA 1U11A 2BMVA 1YZNA 2VJMB 4RYLA 4KXVA 5J5VA 1QRRA 2MOKA 4L8FA 3V32A 1NN5A 4WFQA 4O4JB 3M3HA 2FEOA 4X61A 1E3JA 1RLJA 1EQ2A 4EUFA 2FR0A 3MCWA 4YLEA 5B55A 3EEOA 1VLVA 3E18A 3RVRA 3TVDA 4FQ8A 2JFHA 2IOFA 1DXOA 1JXMA 3BHIA 4URZR 3AU8A 1R9GA 5AI8A 1PJBA 1UZLA 2XADA 3R5HA 1TF7A 2Q6VA 3S1LA 2DQ4A 3DSRA 3ROTA 1VGVA 2DJIA 2GM5A 1JKJA 4MUBA 3GUHA 2HQOA 1QR2A 2AN4A 4EHAA 4BCDA 2JD1A 4MNTA 4PXSA 4J07A 1YC2A 2OXTA 2CXXA 1UFOA 1QHFA 2DH6A 3TLGB 4B87A 2EKPA 2Q1SA 1L4YA 1QSGA 2BEUA 2Q49A 4A8PA 1YR3A 2Z9DA 1T9KA 3PE6A 4MAFA 4UHBA 5AW7A 5I3CA 2O0KA 3JYQA 1KJ9A 1F14A 4DZTA 2AOVA 1SXHA 2TMYA 3LSYA 3UWDA 5JIBA 4HNAA 1C0IA 2F67A 5FHRA 5HSGA 1ZBQA 1SBHA 3DEIA 4OAPA 1FS5A 3K9QO 1FYDA 3PC2A 4Y2UA 4O3MA 1WUIS 1W94A 1YZHA 2O7QA 5JMWA 4G0PA 2PYIA 3TLBA 1CY8A 1KAGA 2E4AA 2G80A 2QTWB 5G4KA 2ZYAA 2WP0A 1MU0A 2E9SA 3HN7A 3HU1A 3FIUA 2FMUA 3KWFA 3PGKA 4FSHA 3TDNA 3X2SA 7MDHA 2JAPA 1G20B 1RBMA 4KFUA 3PWSA 2AC2A 2PXHA 4DE5A 4Z2AA 4DHEA 2V0GA 1G7TA 3S2FA 3SOZA 2PKEA 4V1CA 3FFXA 4KR6A 3JTEA 5EIOA 3IPLA 2UVDA 3PX2A 2RGGA 4KDRA 1W85A 2OBYA 2P5SA 4ZYWA 4JBGA 2XMQA 4F6LA 3R6WA 1NMSA 2H00A 1YDMA 4TLDA 3K20A 4DMUB 2QK4A 2UZAA 3G7NA 1T5IA 5GINE 1T0JB 2VUIB 3AP1A 1TAUA 1HBJA 4K46A 4U2EA 3OLVA 2QR3A 4Q1EA 4NYJR 4Q82A 4H59A 1L5QA 2QE7D 5MF6A 4KYIB 3PT9A 2G1KA 2KS6A 4JDPA 4LWQA 2PNJA 1XAIA 2G71A 3GZNA 3SF0A 3U3DA 2HCRA 2PVPA 4IFIA 4NRDA 5KYGA 2Z1DA 2I2WA 1ZO8A 2YNMA 2XQVA 3G7SA 4MMYB 1T4BA 2VDQB 3GNLA 5B12A 3WWCA 3VPFA 1D1SA 1OVMA 5FIUA 5KVVA 4JJAA 3VC7A 1A8UA 1I36A 1KI7A 1TW2A 3RTGA 1DPGA 4G65A 1KL7A 2AN3A 1YU9A 2J3JA 4MX8A 5IMBA 2C7PA 1RW4A 2O5RA 3EZLA 5DSTA 4XTRA 1G16A 1ICIA 3FFAA 1B2LA 1JNYA 1RQRA 3JQ7A 3EXFA 1K68A 2BGJA 1XB2A 1U8CB 3UK2A 3CUKA 4CEIB 1ADGA 4DR2B 4KN5A 1AIPA 3GXOA 1JW9B 2PTGA 3H1BA 3OFJA 4JA2A 4D41A 1TM4E 2YWJA 2J31A 5BMOA 4MGHA 4M88A 5PGMA 3RFXA 1Q11A 3W9YA 1RHQA 2VA8A 3BWYA 1NW6A 1HSOA 2PWBA 1WP4A 1FX0B 5JE8A 3IS3A 1ZQ9A 4G8BA 5HRAA 4NEQA 4RPJA 4N65A 2ZUEA 3JQFA 2O52A 3LOPA 4RGBA 4XGIA 3EXEB 4OMCA 4OXXA 1E64A 2P30A 3O7WA 2INGX 3IQWA 4N5DA 5C8YA 4DDHA 4JOBA 5JZMA 2PL3A 3EARA 4LZPA 5GZ6A 2GM3A 4J76A 1U7PA 1JUDA 2QMUA 5CXUA 3EB9A 1O1YA 4PS1A 3ER8A 4HYYA 2V5AA 5EN4A 2XKBA 5BNWA 4BX8A 1Z6TA 1OYWA 1GUDA 2VTBA 2CJPA 2IS6A 1KU6A 3IMFA 1PAUA 1G59A 4FCWA 3UCFA 2KPOA 5I9MA 1E3IA 3PQDA 1Z12A 4WOKA 3PRYA 2ADFA 1U1DA 2EFJA 3AVXA 3JAKA 1DRVA 1XQ6A 3S2GA 3I4LA 3PYMA 4ARUA 4D9IA 2XOKD 4OLHA 1BXKA 5E0KB 1JIQA 1FMCA 2P2ZA 5AW9A 2Y1XA 4GDMA 4BNWA 5KTMA 1MQ9A 2XE7A 4ZN6A 1V3TA 2E49A 2EP5A 1CWUA 1CZKA 2GARA 2OCKA 3ETJA 4BQPA 4M0DA 4LC0A 3PYLA 1M1NB 3KRTA 4HP8A 4BLQA 1Q0LA 3ILXA 3QUSA 1EGMB 2HIHA 2I9KA 2D2FA 4OU4A 4QPPA 3A2KA 4U6SA 3TEMA 1IQUA 2A3NA 2JJ8A 4ZT7A 3A10A 4JQOA 2WSLA 4J4TA 1E6CA 1BCSB 1MO2A 3FMOB 2ONKA 5AVQA 4RX1A 3NP7A 4YLYA 4EHDA 5LMNB 5BQOA 1TMOA 4GOJA 2IY9A 4QU5A 1M83A 1XWFA 1FB5A 1HQCA 2W6IA 4KE6A 4BJ1A 3R9IA 4CJXA 5DM0A 3RSZA 4V39A 1IONA 1SOMA 5GY7A 1CQIA 2NM0A 4O02B 4L8LA 3CU5A 1RZRD 3ORQA 3CMCO 1FW6A 2H8KA 4URXR 3D8SA 4FJ2A 4RZUA 5FBHA 1YOBA 4ZK2A 4HN4B 4NNOA 2WM3A 5AHWA 1MB0A 3D4IA 1TQ6A 4MW4A 3WZLA 2DCMA 1T4MA 2FZEA 2BGKA 3IEXA 2JIDA 1X1EA 3QVJA 3AF3A 4FZRA 4OBBA 5K0NA 1ONOA 3HQ4O 1VKHA 2OBBA 1D1TA 1RJDA 4QHTA 5JXHA 2B36A 4K88A 1BKSB 1Z6QA 1PZNA 2OTCA 4XWTA 3PEUA 4KDFA 4LF5B 2E7ZA 4HLUC 4RDIA 1W2GA 4YMIA 5K4AA 1LBHA 4TT8A 4OBEA 1FP4A 2Z5VA 2NTJA 2W8BA 5L3SA 2NUAA 1MA0A 3GLKA 3H9CA 5ARDA 2NXWA 4JUAA 2NAPA 2ZK7A 5C34B 4G6ZA 1X39A 2G1UA 1HNWB 5IJ0B 3EY9A 1YI1A 3PR3A 4TN1A 3ZU3A 3DAPA 5LOVA 2BEVB 4LBYA 1EFVB 1L4MA 2FX2A 3A4IA 3IQFA 1E7MA 1GLVA 2D2XA 2POCA 2YY7A 3NRCA 3TZQA 3ZH9B 4C3VA 1PUJA 1D7OA 1T3ZA 3JD2A 3PWKA 1OGJA 2EEZA 3FSEA 3RANA 4AQ7A 3SBOA 4MS4A 5BSEA 4R7TA 1NMQA 2C82A 5AI5A 2FB9A 1JTFA 3VZBA 5CG2A 3AH8A 2TMGA 2H06A 4WN9B 1AMNA 1U2DA 4MV7A 5LA6F 2X2OA 4KR9A 3QJYA 1FPQA 1SEPA 1KDPA 1GXSB 1TLFA 4LZJA 2NIPA 4ALIA 4LV6A 3SHOA 2Y9MB 3HKBA 1JWBB 1TCCA 3U3XA 3QA9A 3EGIA 4UXIA 3EFHA 5BT9A 4MW6A 4R0VA 4OUDA 4JQCA 3EGOA 1A71A 3L8ZA 1C3OB 5JJKA 4PHTA 3BIFA 2VDKB 4JC4A 1B73A 3BICA 4PYLA 1MLDA 5CNMA 1H94A 1JDUA 1ZR2A 4NCBA 5DN9A 4LRSB 4G36A 4N5NA 1WSDA 4XM2A 4BRZA 2GHQA 2NXJA 2X1LA 2W7TA 2QN6A 1JIKA 4PM4A 2GYWA 2ZBPA 1QKKA 1T36B 2VKTA 5AJVB 2QRHA 5JI3E 2IOHA 4BPBA 3WLMA 1COWA 2VYCA 2L18A 1KVTA 5THQA 1XEFA 1KY4A 2Y1WA 5FBZA 4DUYB 4TWRA 4RV5A 1IWOA 2EFDB 3DM5A 3LGAA 2GNOA 4WV3A 5DGXA 3TAHA 3B8EA 4PCUA 1CR1A 3ELBA 4MI1A 1OI3A 1KEWA 1CDDA 2EDCA 3GJYA 1HT2E 3OCZA 4YBRA 5EWLA 3RUEA 5KB3A 4LYYA 2WILA 4H1UA 1AXEA 4LHYA 5C1IA 3LP6A 3MJVA 2C1ZA 1GYQA 4UCFA 5HIIA 1KI8A 2Q62A 3EDCA 3GAFA 1R4NA 3OZRA 2QV0A 2G7MC 3PNMA 2FUNB 2FSGA 4NYMR 2IV3A 1B8NA 2IDZA 1FRFS 4YP5A 3UMJA 2N47A 4OU5A 3TNDA 1OAKA 4W1SA 4GEGA 3NBMA 4HS4A 1Z4LA 2AF4C 3DZBA 1UJBA 3W5BA 2WUFA 2H85A 4CG1A 4ID9A 1NWHA 4Q7EA 3BDAA 4BX2A 1HDXA 3ENNA 4RSRA 5COBA 1SKQA 4C2TA 4TSRA 3HNPA 5HBGA 3REQB 1WU7A 4CMCA 2JI8A 1FW8A 1ORVA 1N2EA 1FMLA 2D0PB 2X8AA 2Z2JA 1DHTA 3CEHA 3Q98A 4FIDA 2FWMX 4NJOA 3GP3A 4ZOEA 5GM2A 4DARA 1C4WA 1A69A 2B4RO 3OM8A 3FMPB 2L19A 4MW2A 3FF1A 3K9BA 4GMKA 1O08A 4WD3A 2X23A 3ZWQA 3LBFA 2ZKIA 4ISCA 3Q5GA 1IIRA 3MBIA 1XPOA 1UEXC 1P17A 2JHAA 3QKIA 1UJMA 1OV6A 4BZPA 4NYMQ 4DA6A 4MEJA 5C0OE 1FDRA 1FEZA 1G5PA 5EAIA 3M2PA 5C3MA 2BZGA 3MW8A 4BQFA 4PHFA 3D3JA 3QU2A 3WQHA 1XYVA 4WKBA 2DU8A 5FAXA 3WRXC 2WMNB 3PIRA 5JXJA 5L51A 1J97A 4NR0A 3K92A 4PR0A 2A5FA 2G70A 1PCXA 5C1BA 1GLNA 2DPHA 4BKPA 5GAJA 2G06A 3EGEA 4LYEA 3WL3A 3IOEA 3AVQA 5JO0A 1FFHA 5JLAA 5TE9A 3H87A 2WB2A 2M1ZA 1GA6A 3GD5A 2FZ5A 4L4UA 1AE1A 3PJDA 3P9QA 2Q5EA 3O6VA 2OEPA 3RAGA 1UK8A 2IPNA 1OROA 4KO3S 4ZAXA 1QORA 4R1OA 1XAGA 2J9RA 3FIJA 1THTA 4HZUA 1GNLA 1KSFX 2MSCB 3CRQA 2ZFUA 4YRDA 5TF4A 3ZYZA 1PEYA 2AQ8A 4IH1A 4IKEA 4TVOA 1KNXA 2XBLA 1W0JA 3O95A 4MUJA 3CX4A 1KQFA 1ESCA 1LPSA 4IIYA 4QD3A 4UPVA 1IH8A 1LBQA 2FZCA 2C4MA 2GBLA 2HBZA 4K05A 1UMCB 5DIZA 4DMLA 2YJZA 3HXKA 1SU8A 4KQWA 4LV8B 3FNHA 4PPGA 1DL5A 2FZVA 4YBZA 1KJNA 2B92A 5D87A 5DT2A 3UJ3X 2B7BA 5A04A 2OBFA 3WK8A 3K6SB 1WHTB 2GLXA 3OFND 3RVKA 2C8JA 5EP2A 5C1OA 5JBQA 4WOPA 2VBIA 3H9JA 5J2UA 3KPYA 3TIIA 3TZHA 2XDWA 2MMGA 2HK9A 2FWIA 4PCVA 1NYQA 4WZZA 3SOPA 4BX0A 2GVDC 2H65A 5DYIA 2PGNA 7ADHA 4AJIA 4Q9DA 2PSJA 3X3HA 2PT5A 2Z6AA 3NC1C 1GAQA 1UJ2A 4HCJA 4HVTA 4U63A 4BZZA 3KXPA 1W93A 5E3JA 3CX7A 3FCUB 1YULA 9LDBA 4PRKA 2I7XA 2IEBA 3I64A 1B6TA 3QEOA 3FPSA 1JR4A 3DCYA 2XIQA 3ASYA 1JAYA 4ZJYA 3DHWC 5AQ1A 4BBZA 3RHTA 1HL7A 3JZIA 1PR4A 6REQB 1QR6A 4B3XA 2VHTA 1JSXA 1SO8A 5FBVB 2WOOA 1QX3A 1KJ8A 5BSUA 1OXMA 1K8ZB 1OA1A 4GW3A 3JD0A 1ACLA 4HR7A 4LDZA 5ALPA 4D9BA 4EDHA 5IT4A 3QVMA 2RG7A 3WKDA 2W4QA 3GDGA 4B79A 1D07A 5CFMA 4KPEC 3ZE0B 1JXQA 2GCOB 4QRHA 3OIVA 1UPTA 2GDJA 2WLSA 1OAOC 3IUEA 3UIEA 5LWHA 3R0VA 3WIUA 4B7AA 4NBRA 2P2DA 2V6MA 1EXDA 2Z04A 2ZANA 2BGNA 1NR7A 1TL7C 1V7PC 2R6CA 3DC7A 3GN2A 2PU7A 4HB0A 3H6KA 4ZQHA 5ENDA 4M0MA 4W82A 5LR6A 5AI4A 1EHYA 3NTVA 5CT8A 1W8DA 2C9CA 4MKIA 3QU9A 3TQIA 1BEEA 3USES 4O59O 3S8EA 4D0GA 1LI4A 2G6TA 4KW7A 3UOGA 1UWKA 1DSSG 3N9IA 1CULC 2F59A 2R87A 1IMJA 3E9DA 3UJPA 1KK3A 2F7SA 3LHFA 4ZYXA 3GLGA 2Q1UA 1JHXA 2Z1MA 5DRYA 3T1QA 2IBTA 4IWXA 1DAGA 4PAGA 4S0XA 2QEQA 1QONA 3R24A 1N78A 4V0LA 4MVJI 3DE1X 2VXOA 3K15A 3HZZA 4MCAA 2H4WA 1AY0A 3GLHE 3LDGA 3WWZA 1YQXA 4FOSA 3WLKX 2YJNA 4EG3A 2PLRA 2GZSA 3GB9A 4ZICA 1EFRA 1C7JA 2XF2A 4EHJA 4BMXA 4CKCB 1Q50A 1GKUB 3I4CA 5ALZA 3URMA 3IEVA 4L2IA 4ZO4A 2A0FA 2DH5A 4B74A 3IUYA 1L6RA 3QHAA 4C0LA 3F8WA 3HJFA 4HN2A 1FBNA 2GTPA 1ONSA 1UT5A 4RLHA 3RC1A 4EX7A 1R88A 2UZ1B 2VF4X 3PRJA 1T8TA 4H2DA 4HWKA 3RS9A 5HDQA 1AA6A 3HRHA 1JHZA 1GYRA 2SICE 4IG4A 4TGLA 5D1HA 4A6PA 3U3OA 4QYXA 4RLQA 4IHJB 1HDZA 2ANCA 4ZQEA 3TNYA 2C9BA 4JBHA 1DAFA 3ZUGA 4ZOLB 1I10A 1PIWA 1V8ZA 3FI0A 4GZ6A 5H81A 1PJTA 3CV3A 4KVZA 1DB3A 1SHZA 1BGVA 1BW9B 2QG6A 4EB8A 1WETA 3IMKA 1WS6A 2CD7A 3IIKA 1X3LA 3K9NA 3JASA 4M8KA 4QU0A 5CTAA 1SVWA 2HA2A 1ST2A 3A6HA 2BGUA 5CDUA 3F3YA 4EY7A 4ENVA 2RJ3A 4FNGA 3U6KA 1K8YB 1L4BA 3INYA 4C7KA 1T2FA 3B70A 5KAMA 1WKVA 3KDPA 2HDOA 1UT8A 4B80A 4CKWA 2IRWA 4ILEA 1DP4A 3GCWA 1Z0UA 1WD7A 4MMXB 1RVDA 3AHHA 4R2XA 4W6ZA 4AX4A 1PNRA 1LJLA 4FBLA 2IYSA 4TV9A 4HZIA 3B5JA 1MX9A 4UBOA 3KQMA 5EYPA 3W6UA 3QW2A 3GT7A 1DX9A 3H11B 3I6QA 4LK2A 4YJKA 3FPLA 4ZQFA 1FX1A 1Q7BA 3DZKA 1GHTA 4JJ4A 4GSLA 1HYQA 3T0GA 2YXDA 4IYJA 5EIBC 2WINI 3ZBQA 2P6UA 2ID8A 1IPEA 3MC1A 3EGXB 3TSCA 2IT1A 1Y6ZA 2AOTA 3MB5A 3QBJA 4KFTA 4RIHA 4OG2A 3L79A 2LGJA 1SN7A 2YYYA 4G0ZA 2AD5A 1NI4A 1LLQA 4H0CA 1GRVA 3WK7A 1QRTA 3IR7A 4OGKA 4AUMA 1W1UA 3AJDA 3IUQA 3O03A 1S2IA 1G60A 3IP8A 5KQPA 2B94A 2IPLA 3GGCA 4ZJZA 1ZWKA 1IVNA 1FYEA 4RKRA 2ZWMA 3LE8A 4GQBA 1M6NA 2GN2A 3WIOA 1M72A 2Q07A 4G01B 3NCTA 1X7GA 2PUVA 2REBA 3AEKB 3LWDA 3P4YA 5G4LA 2G5PA 5AESA 3M82A 1ZGGA 1UOEA 1ZL0A 2X2PA 2PS0A 3DGEC 1CF9A 2QUHA 4I36A 4E88A 1B2RA 2R7LA 1FNCA 5EMKA 3WMWA 2QRJA 2PS1A 1GA1A 2P3QA 1L8XA 2GERA 1T8WA 5TQ2B 3EA0A 3MTQA 5B1SA 1MIOB 3R4VA 4DRYA 1W8IA 1NUTA 2JW5A 2D1SA 2RK4A 3D8BA 4LI0A 3TW0A 2CYCA 1MC8A 4Y6LA 1T5HX 4IDOA 4XXHA 3C3MA 3O0TA 1OLXA 2Y1CA 1DOHA 1E0JA 2CKMA 3VR5A 3VNQA 4EJSC 4F6RA 5J23A 4HJRA 4TMFA 4EY4A 4DANA 3L0DA 5BXYA 2IDKA 1BU5A 1P1RA 1XA0A 2JFNA 1IAQA 3KLOA 4FMBB 4PZAA 4DLLA 3DEJA 3GEBA 3L7OA 2H1FA 4FYWA 1WTCA 2ECQA 4K1LA 1LPPA 4Y6QA 1FFAA 4C21A 4RJTA 3F6PA 3OEYA 2EL9A 4J49A 3EUWA 4PO8A 1TD9A 2UVPA 1T1JA 4UREA 3U7FB 2XBMA 1O6GA 2OXCA 1KKMA 1A50B 1C7RA 4FUTA 4TMVA 2IZ7A 4PLHA 1P31A 2C42A 2Q4EA 1CJCA 1E4EB 4RF5A 5FOUA 1CQWA 3GNQA 4ZCMA 5CB6A 1GPH1 5JAHA 3RYTC 4WXPA 4DA4A 1PVOA 2ECOA 2QL6A 1OC4A 5ARBA 5JD5A 4LHVA 2Q46A 2WJ3A 4FMCB 4JOCA 2JBAA 2PJUA 2BGRA 2JASA 2X1VA 1H6CA 5IN5A 2DQKA 2P8JA 1E92A 4GI2A 2CL5A 3NIBA 4QQKA 2AOXA 1U0FA 3RBXA 3PHGA 3QNMA 1ENZA 3F6BX 1SBYA 3PCTA 1U4NA 3UMGA 2AZMA 2CXQA 1PS0A 4IVPA 4D2IA 1TXGA 1UJ4A 4Z7JA 1BXRB 1D2HA 4YHBA 5BVHA 1Z4JA 1PYGA 4EGCB 1V7QA 1P9NA 2DLNA 1LTQA 4UVHA 4UEQA 3QX7A 2ZIXB 4P4LA 5DLPA 4XIIA 1ZITA 3U5ZB 1E7WA 1U1EA 1KH3A 4JU9A 3NHBA 4HK4A 3O3NB 4KRFA 3UGQA 4W99A 1E5DA 1KP2A 4BNIA 4IJWA 4KE7A 1VKZA 1P1HA 3E9ZA 2P9FA 3NM4A 5KOIA 1HQDA 3BHJA 3KYBA 3D0OA 3LUAA 3HRIA 5DNWA 5KWSA 4J0FA 5CX4A 1M1YB 3RS3A 5BOSB 3RJZA 1P1JA 1L7QA 1X1TA 3VR6D 1N0HA 1G8YA 2FUG1 2GPYA 2J0EA 3I12A 3KKNA 4OSEA 4P86A 2I80A 2BP7A 5JG7A 2XUGA 5BSMA 4UNSA 2H5LA 1NN1A 1RQNA 3A1EA 1RHRA 3R1IA 4GH5A 4LNUA 3VAZA 1B1AA 3WRVA 4GQAA 4NBKA 4RD0A 1FP7A 4CCSA 1NKSA 3AR6A 3QUBA 3EGDA 4P35A 5LYJA 3G0DA 5BWOA 1YKGA 1ZS9A 2QJWA 3DBRA 2WSSD 3K70C 2VJCA 1A7KA 4DA8A 3WQQA 3ZW8A 3C6ZA 4DBLC 4I1PA 3DYIA 3QVUA 1VJ1A 3IQGX 4CTMA 4FT4A 2NXNA 3AYZB 2JVJA 3TS1A 3VPAA 1ZNZA 4LF6B 3TH5A 2Z30A 1K3UB 3MJCA 2O4CA 1G5QA 3BG5A 3FETA 5AM0A 3T0FA 4EWLA 4TYWA 4QGHA 2R8ZA 3KR0A 1Z7BA 3OTWA 5HFJA 2C5EA 1BQ4A 1YFJA 3LT4A 3MBOA 1U9YA 1L4NA 3TW8A 2YXBA 3F5QA 5KSWB 1RVV1 3UYLA 1PNTA 5KREA 2WE8A 1FMTA 1TE2A 4M8IA 2K7FA 5HBRA 1ZCZA 1H6BA 2DWOA 3PQ5A 3HKDB 1H3EA 2A1IA 2ZI7A 2PDAA 3R09A 4B6EA 4EB6B 2E4ZA 3DV0A 4JLVA 1SC1A 5DNAA 5LWQA 4OK5A 4YJ2B 2GILA 2MSLA 5BSKA 5P8WA 1ZJWA 1XCBA 1I33A 2VBCA 3JQRA 3PF9A 2HRCA 2BI8A 4LMAA 2HRRA 3VTZA 4DSUA 3KQHA 1Q7GA 2C61A 1T0HB 2YDYA 3WFZA 2Q7OE 4BNZA 1I0LA 1IK6A 2G0AA 4WT7A 2ZT5A 1GQSA 2GZMA 1JR3E 2FW7A 2IS4A 1RM3A 3LLMA 4LECA 5FUQA 5CBPB 4WFKA 3DVAB 1JT2A 5CEEA 3PVZA 2G40A 4BQRA 4I9GA 4KE9A 4Z3KA 3TWOA 4OXYA 3R40A 3VKGA 3K0BA 3A4YA 4K9SA 2ZRFA 4Q93A 2CLIB 2FLKA 4Y2GA 3GRAA 1DS6A 3ZHRA 4HQNA 5KJFA 3T1HB 1X1QA 1MOPA 1SMKA 1UKZA 4NICA 5JCOA 3D64A 3PQEA 3AESB 1P7PA 1Y4AE 2GRUA 3LCRA 4I5EA 1KEUA 1PQYA 3BXOA 3EXIB 4MEAA 4QGGA 3N0VA 4R2WA 5FRDA 4G5OA 2CLSA 2YXPX 1BX1A 1UPCA 1U31A 1UMBA 1P74A 4EFLA 5TF0A 2RH8A 2A5DA 3MXOA 5ETJA 5FNVF 3MRTA 1M74A 2M1XA 3FCAA 3O90A 3NH6A 2J59A 5FUYA 1N33B 2B9EA 1K6MA 1I3OA 3Q3VA 2XAAA 4MKGA 2BR4A 2B37A 1ZAKA 2QYOA 3SQDA 1OXTA 3U40A 3D0QA 4JJ8A 1YGPA 4OI4A 3W0LB 1WZEA 4Q15A 4CDMA 1TVCA 5IC6A 2JIZD 4OP1A 4YRQA 1AX9A 1CRLA 4CLEA 5DMHA 3EG5A 3MD9A 3WLLA 4XVUA 4E1BA 5CX1B 4G81A 3M4ZA 1WMFA 1QGUA 1Q57A 3GRCA 4Q7QA 1S7CA 3QPCA 1OI7A 1VIVA 1Z4OA 2WDZA 1GV1A 4DSAA 1LPNA 3GOHA 4R71A 1UBMS 4DXHA 3G79A 3TNJA 1XRLA 2HSJA 3OEHA 1GIAA 2IP2A 2H31A 2AB0A 4B09A 2HA5A 3K30A 4FS3A 4H18A 1X7YA 5F1YA 1KEPA 4AF6A 5JUWA 3AVUA 1LD3A 4HPJB 4I55B 2R1TA 3MCVA 4BMNA 1EK0A 2FP4B 3QX3A 5LZ5A 4C30A 4B75A 4U6NA 4N6NA 1UDXA 1A04A 1EWRA 3P2IA 5HF6A 1EFPB 1M8KA 4JC0A 1HG0A 4Q3BA 3O1JC 3D9QX 5IBQA 4IXMA 3UK6A 5LMZA 3WBBA 5C8DA 2ECPA 1OT3A 5BSGA 5SYMA 4PICA 5IK2D 1KZ4A 2Y6UA 4A2QA 2I2BA 1GTL1 1LV7A 4R68A 4EELA 3L6EA 5CNJA 1QGDA 1BC5A 1TK3A 2YZMA 4DEVA 1UP7A 1JU4A 3K32A 4DV1B 1ZGHA 2YIMA 3D6JA 4YPFA 2Q7DA 2IUFA 3ZOKA 2FQQA 2NO5A 5DM60 3G0OA 4N5IX 5KNCA 3M0EA 1P8JA 1L4GA 4PWZA 3K0KA 1PUIA 3P2EA 3NYIA 4WCFC 4RULA 2J9YB 2ZKLA 1JHPA 4IDDA 5CLQA 3ZY4A 4BV2A 4WNCA 3JTMA 4F4JA 1Y9ZA 3FGPA 2UDPA 1SCJA 4J16A 4DNXA 5IW8A 1XMXA 2QRUA 3V80A 4D8UA 3W34A 3LGXA 4IFBA 1KAQA 5AI9A 4Z7OB 3ORFA 4PFQA 3NIGB 4HEHA 2MINA 2RK6A 3KHKA 4OREX 1RHMA 3KYCB 1LUAA 3D5QA 4A10A 5CDYA 3SVLA 2AR9A 1RWNA 2C3UA 2XLCA 3PHIA 4KN8A 2VJMA 3K94A 4QXPA 1KDVA 1FZTA 2QLMA 2Z4RA 4LJ7A 3ABOB 3VR4D 4CMJA 1RCUA 3F6CA 3VDXA 2Q2OA 4F1KA 2ODEA 1UZAA 3GPDG 2JL1A 1NL3A 1WCIA 3G68A 1XV5A 4JMLA 3M4YA 1DJPA 3RASA 1XZJA 3KD3A 1CFZA 1ZUHA 4CI9A 4NJEB 4QBIA 4OB7A 3K8QA 2FQYA 2CCKA 2BEWA 1ZJYA 4YRSA 1UMDB 3A14A 1STOA 4G5YA 1ST3A 5BUZA 3UAWA 2PMFA 2EF1A 3KXDA 1C0KA 5I5GA 2KMLA 1P2FA 4BMZA 1H85A 1OLSB 2V0CA 4RD4A 4WN3A 5AVTA 1EK1A 2O2IA 1YTUA 4Z0HO 3EFBA 3OLWA 3E8XA 3IPAA 1CY1A 1YJ8A 1Q1BA 2G17A 3VPBA 4BV3A 4C4AA 5BR1A 3ML1A 3NETA 1LJUA 1V2GA 2CVHA 2PGLA 1SC9A 2YV3A 3VFDA 1D4ZA 1JTVA 3PVCA 4WKGA 1N6OA 3AJ8A 4GPZA 5ALSA 2C8KA 3TB6A 1NU8A 3EBOA 4I5FA 1NMEA 1I9GA 1DRKA 4M0KA 5IH3A 2D5CA 2OY0A 5HJ7A 4MINA 2FPIB 1P7VA 4QBGB 2PT7A 4Y1GA 3S5JA 3G0HA 2WM2A 2WTEA 3WGVA 2PK3A 2DG2A 3KSDO 2PS3A 1G5RA 1UK9A 1ZOSA 3FKJA 3M4JA 4A2WA 2JBHA 3O26A 3A2MA 3TLMA 1AS2A 4IIJF 3ZHYA 3HP1A 4WASA 4E5NA 1PWXA 2PHZA 1JEOA 2VHVA 3NWPA 1I51A 8AT1A 2GYVA 3WX0A 3CF4G 3W3AD 5IJ9B 2F55A 2J0QA 1FOEB 2GZAA 3ICEA 1JXOA 1KJIA 3CBGA 1CDZA 2JVIA 5HVNA 4DR5B 4FSXA 2GN1A 3AX6A 1ZI6A 4BJ6A 4Z0NA 2JD2A 4F92B 1T9GS 1I5EA 1JG1A 2ODWA 3B9QA 1G42A 3O3CA 4G85A 1I01A 4OGLA 2PO7A 2PWYA 4HNSA 8ATCA 5GIPE 4ZC8A 1X15A 3GIDA 5JXGA 1YAHA 2WA1A 5KHAA 4MVJE 4OXQA 4BBAA 3K0SA 4MUGA 1WBDA 2PMEA 4A8HA 2GF0A 2QMOA 3MQ4A 3OF2A 2JJ2A 1T2NA 1VI6A 2DY1A 1V8FA 2P1ZA 3KJXA 3OQ6A 4JZYA 4QUHA 3BA1A 5I9SA 3QKRB 1YACA 4Y8VA 4NBLA 4OHZA 5EPUA 1H1TA 1E1YA 3GELA 4N3NA 4DJTA 5BPHA