3SVLA

Structural basis of the improvement of chrr - a multi-purpose enzyme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
KLQVVTLLGSLRKGSFNGMVARTLPKIAPASMEVNALPSIADIPLYDADVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVIDQGTLDHLTGQLTAFGEFIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of ChrR-A Quinone Reductase with the Capacity to Reduce Chromate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords protein yieF
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3svlA00
4Y9RA 2WC1A 3N3AC 4FGJA 4H6PA 2W5UA 3B6IA 3KAQA 4YAOA 5F51A 1ZX1A 1OBVA 1RLJA 5F4BA 5NLLA 4YAUA 1B1CA 1OBOA 4C76A 1BVYF 1CZUA 1D4AA 3FVWA 1D03A 3P0RA 1T0IA 2BN4A 5EMNA 3FJOA 2F1OA 1QR2A 3F6SA 3HLYA 3NLLA 1J9ZA 1YKGA 3W78A 3L9WA 2M6SA 1I1OA 3W7AA 1SQSA 2QX4A 1CZKA 1T5BA 1KBOA 1J9GA 1JA1A 1YDGA 5EAIA 1QRDA 2R97A 4PTYA 4CF6A 1BU5A 2ARKA 1AKRA 2FOXA 4LTDA 3ES9A 2QX8A 1E5DA 1FLVA 2Z9BA 4YQEA 3QFCA 1OFVA 2Q9UA 2B3DA 1DXOA 4LTNA 4DILA 1FLNA 3NHSA 1WSBA 3GFSA 3NHUA 4HEQA 5TGZA 3K1YA 1J8QA 3NHPA 3OX3A 3K20A 3GAMA 3FNIA 4M0CA 1H69A 4NLLA 4S24A 5LMCA 1FTGA 1KBQA 5JROA 3TEMA 4BMPB 4C0XA 5A4KA 4R81A 1WSWA 2AMJA 4U7GA 3N3BC 2RG1A 1CZRA 2Q62A 3KEGA 2Z9CA 2MT9A 3OX1A 5LBTA 3OX2A 1TLLA 3NFRA 3O73A 3F90A 3W79A 4C0WA 2QR2A 4YALA 5ULLA 1X77A 5LBUA 3OJWA 1AKUA 2QWXA 2HNBA 3N39C 3NHWA 3KAPA 4F8YA 5EA2A 5LJIA 2A5LA 2KLBA 2MTBA 2V9CA 2N1MA 3F2VA 1YCHA 1CZHA 3OJXA 1GG5A 4GR9A 1SG0A 4ZVNA 4CETA 4H2DA 5NULA 1H66A 6NULA 1RCFA 1CZOA 4N65A 1AKTA 3O2NA 1YOBA 1FX1A 2BF4A 4PTZA 2GSWA 2V5UA 1D04A 1TIKA 2OHJA 3KLBA 3OWXA 4N82A 5FA6A 4BMOB 3NHFA 4PU0A 5FX2A 3U7IA 4ESEA 1AMOA 4FX2A 1NNI1 5BUCA 2FDXA 3NHLA 2QMYA 2QMZA 3NHRA 4YAWA 1AKQA 2ZKIA 4QOFA 2FAXA 3ESZA 4DIKA 4DY4A 1DXQA 1YRHA 2BPOA 2FLVA 3B6KA 3G5MA 4LAFA 3OWHA 4ZVMA 5B3LA 5LJLA 1FLDA 1AKWA 1ZWKA 3OVMA 4XDGA 4QOHA 1VMEA 2Z98A 3HR4A 2OYSA 4FGKA 2FX2A 3F6RA 3LCMA 4N9QA 4OXXA 2X2OA 4YAFA 5FUQA 1FVXA 1YCFA 2FZ5A 3EDOA 4GQIA 1JA0A 3GFQA 4XDHA 3D7NA 2HPVA 2QX6A 2BMVA 3EYWA 4NULA 2FZVA 3UXHA 2V5VA 3ZHOA 2BZSA 1J9EA 2R96A 2Z9DA 2D5IA 3R6WA 3UXEA 3B6MA 1CZLA 1RTTA 3NHJA 4ICIA 3GFRA 1RLIA 2QX9A 1XYVA 3JSXA 3NHKA 1XI2A 3QE2A 4QOJA 3FW1A 4U7HA 3QFRA 5F12A 3NHYA 3SVLA 1CZNA 3TE7A 1QHEA 4QOIA 1FLAA 3W77A 2HNAA 3ESYA 1AHNA 4QOGA 2OHIA 3ESXA 4ZVLA 5LVAA 1YCGA 2M6RA 3LT5A 1F4PA 1FUEA 3HA2A 1V4BA 1AZLA 4HS4A 4D02A 3B6JA 2MOKA 4FGLA 4C14A 3L9XA 2XOEA 2KQUA 1QBGA 3S2YA 5LLDA 4LTMA 3TZBA 2MWMA 4U7FA 3FX2A 3U7RA 1XYYA 1C7EA 2OHHA 1AG9A 5B3KA 3RPEA 4Y7CA 1AKVA 4ZVKA 2X2PA 1DX9A 4QOEA 4QODA 4Y9UA 2FVXA 2FCRA 1XT6A 4GI5A 1ZWLA 4J8PA 1C7FA 2XODA 4LA4A
chains in the Genus database with same CATH superfamily
1FS6A 5GM2A 3T9DA 2OGUA 1Z5VA 2XIJA 4RD3A 4A1FA 1FMLA 4NONA 5DRTA 1XPRA 2O8BA 3VNVA 2JIZD 4MRAA 1W36B 3EXHC 4G36A 2HZBA 4M49A 5BR1A 1X80B 3R7DA 1FMFA 1EG2A 2IV2X 1JN0A 2G0TA 2YDYA 3MNFA 2ROQA 5CRIA 3LX8A 3RLIA 1TM7E 5ADHA 3NEJA 1Z5WA 2R6DA 3ZWBA 2R1UA 1G8PA 4HF7A 3L0CA 3VBEA 4EQZA 2AK2A 2R48A 1QRDA 2RBKA 4BNXA 2GHRA 1DWPA 4ZQFA 3FYUB 1GAQA 3OZEA 1Z0JA 1WVGA 3THWB 3NYRA 4JROA 1M5TA 3KZ1E 2Q5HA 4OD0A 4ENPA 4C3UA 4C07A 1PNRA 4EKGA 3DO8A 1N1MA 1WTAA 2YOGA 3FH0A 1ZG3A 5BW6B 1RPTA 1J8QA 1PLLA 2Z3VA 1G2PA 3HABA 1Z25A 5LC1A 4AJ9A 2PIDA 2B1GA 2AKEA 3K0KA 5AKLA 3OEWA 2XNCA 4IWYA 2G3YA 1E58A 3X0DA 1L7AA 1FK8A 4HVAA 2C4HA 2AI2A 1KZYC 3AONB 2YY5A 2WZBA 2HNBA 2H1SA 4EZIA 3DKRA 5MN6A 3DOHA 4M1QA 4BNTA 3QWFA 1SURA 2GRUA 2CMHA 3P4YA 1RBQA 1G8MA 2ERYA 4KWCA 5JARA 2ODWA 3D6FA 4KK4A 4WY5A 1SUSA 2VJDA 4JH0A 1QQTA 3VVCA 3KP1A 5REQB 2ONYA 2W7TA 4EB0A 1QRTA 2B2CA 1XF9A 1BCRA 2ORIA 3K3PA 4FB5A 1V8ZA 2IX9A 2WWHA 2FQXA 1QYRA 5IASA 1CB0A 4FN4A 4Y6GB 4MTLA 3HBJA 5AI8A 2G1PA 1KVQA 3WR5A 4OGGA 2F9LA 2XEXA 3M4YA 5G0WA 3PUIA 1XZIA 1C4XA 3EVDA 5BMVA 2YIMA 4UVEA 4B7CA 1FYVA 4YJ2B 1W6UA 2R4UA 3IIEA 1JHZA 1QH0A 2AJCA 1GZUA 1WCYA 4J7XA 5DMXA 1EQ2A 2HSZA 2WIFA 1AY0A 1L5ZA 3OCZA 1JJVA 3B8HA 2BLNA 3Q9LA 2ZRGA 4Q4CA 4KI0A 2FX2A 3F6RA 3M5CA 1MIOA 4K6GA 4YYZA 1J20A 5HXAA 2RIPA 2WILA 3HKEB 4XWOA 2FZVA 4REOA 4M89A 1JLMA 1E1RD 3TPFA 4EY5A 1KR2A 1VLVA 2A3NA 3PA8A 3JSXA 3LOUA 1FW6A 2ZYVX 3HFSA 4NYIQ 3DVQX 4IGIA 4JLAA 4QXRA 3DFMA 2FF7A 4U5XA 5LLTA 2C82A 2XZDA 1A69A 3FVVA 5JALA 3W9SA 3X1KA 1J24A 4I08A 2J85A 3TGPA 2G82A 5J23A 1YA4A 2IE0A 3IGFA 1ST3A 1NUUA 4NBTA 2ZUTA 2H0QA 4HNRA 4RLFA 1HK7A 1VDZA 4ASUD 1UM8A 3LPAA 1PS9A 3PSAA 3HNOA 3MJ4A 3PHGA 3T7JA 3LHFA 3PXEA 1QIDA 1QHGA 3FUXA 2DMRA 2WAAA 3R23A 1KO7A 2PX8A 4HAOA 1AQYA 4E6PA 2I76A 1KMQA 5KVSA 4QLOA 2ZRBA 1GXSA 4MDHA 3FGOA 4QO7A 1CUYA 1PJ2A 3T3HA 5TQ2B 1JEEA 4BVHA 3EEIA 1P2TA 4NYMQ 2QI9F 1N78A 3AEUA 2EX0A 1RI1A 1SHTX 2FPGA 2RGNC 1N0VC 3FSRA 4Q7JB 2IHZA 1KZ6A 1T8WA 3E3LA 3MJDA 2W4IA 2YWFA 3EQ9A 5AXDA 1GFSA 2CLKB 2Y2UA 4X3CA 3CNOA 3Q7EA 2FSFA 4PLTA 4FVTA 1YQTA 4I2NA 4B31A 5AVVA 2MYNA 3F49S 4M55A 3ZLUA 3ESAA 1AS3A 1R88A 2EFDB 4L8YA 2BY4A 2NUTB 5B58C 2G7MC 3Q7SA 1PUXA 2VJMB 4BJ1A 4MVWA 2BAGA 4AFNA 1Z6ZA 3OEYA 2WUVA 1Y3FE 1RAEA 3SD7A 5JS2A 1IE3A 4YMSA 3FTCA 2RGYA 1LNQA 1ZL0A 1VA4A 2IDKA 5CNJA 4G2TA 3EVNA 2D00A 5DB4A 1WY5A 5BQFA 2H5JA 3CZQA 3DPSA 3LUBA 2C3MA 2QRVA 3DKIA 2V8BA 2YOHA 1QFYA 4ZALA 1TQ6A 3D5QA 4M1MA 3QOFA 2XCQA 1OT5A 5DM4A 1G9TA 1EXVA 3EJ6A 2DPMA 2D5LA 2GEKA 2J87A 3F90A 4PR0A 1PBNA 4BTVA 4MQEB 4L4SA 4XJSA 3ORHA 2BM9A 5CTAA 4QYIA 2YYZA 1E6EA 3QJ5A 1X7ZA 1QRUA 3RYFA 3HWSA 5HVNA 1T26A 2JIMA 1A2OA 4O4IB 5L3VA 3UWPA 4GYJA 2FUEA 1ZJYA 1B8UA 4YO8A 1OV4A 2WJGA 2X1VA 3IUEA 1AKTA 1TMKA 2ZEJA 4IMIB 2CFOA 1R1DA 1W73A 3BD9A 5HJ2A 3OZUA 1R50A 1KI6B 3A1SA 1O6GA 1PLKA 3H87A 2J0VA 2O7QA 2XUDA 3PCXA 5DTMA 3V1LA 3U60B 1MTOA 3VPCA 4KPEC 1D1PA 5FL7A 4RPHA 3HXLA 3UV6A 1CE8B 3FOWA 3A9VA 3TSYA 5IJAA 5GJCA 4QXOA 1VJCA 3A7DA 4BQRA 4EG7A 1I7DA 2RI0A 5FOQA 2W0MA 3LT2A 4QUAA 2WTEA 3RYCB 3L7CA 4AVYA 1X7YA 1B16A 2DECA 2IBSA 4QFBA 4WLVA 4ZVQA 1U8YA 1DG3A 1T0UA 3OQNA 3AOEC 3HJNA 4MLZA 5TARA 5DSXA 4I55A 2NXEA 1U5BB 1E89A 1I5EA 4ZCLA 5DOVA 4OQXA 2YCBA 4C88A 3ER8A 3LXUX 1SUPA 1E96A 3II6X 4DCNA 5CDHA 3E1KA 4OSOA 3TL2A 4W1QA 5GVSA 1Y7LA 3C7CB 5F1YA 5I9MA 1T9KA 4EUFA 1HE5A 4XYGA 2V6BA 2HWKA 3C6BA 2AMVA 3VU9A 1P7YA 1RM0A 4LJRA 1O95C 2R00C 2XB9A 4QBIA 2WFLB 1QTRA 4BQEA 5KYYB 2I91A 3U3MA 2WU3A 3I6IA 4HFJA 5ALWA 4DGSA 4YT2A 1E4OA 5IUJC 5JANA 1ZVVA 4BLVA 1CF9A 2AFIE 3HEBA 1JPNA 1NSFA 3ESCA 4BO3A 3UB4A 2ANBA 2ZIZA 2XCSB 3IQEA 2GHIA 1KY3A 4R2WA 4X60A 3LC7O 4HGNA 1ECPA 1XDSA 5FI1B 4YRPA 1G18A 2DOKA 4N6OA 4GKBA 2E9SA 4OBWA 4WKNA 3P9YA 2SKEA 3ZHBA 1YRYE 2P7IA 5JAUA 3M0EA 3PEYA 1XDZA 1P5JA 1REQB 4TXNA 3WTCA 1E5VA 4EJMA 4PC1A 6YASA 2LVBA 5HR5A 3OPYI 3RI3A 1I3CA 3H4IA 5THQA 1DP4A 1KVTA 1BVYF 1HTTA 1A82A 2ZJFA 2R25B 3S8YA 1L4FA 3EZFA 2YNMA 2RAFA 4YO7A 4E33A 2GKSA 3GV0A 3M2PA 1AXEA 2FGKA 4DLNA 5DZSA 3B5IA 2DXIA 3D6HA 3F1KA 1KAMA 5TMBA 2UXBB 1FSSA 1GZHB 3I2JA 3WDKA 2IIVA 4WFQA 4EY6A 1GDHA 1U0SY 1WCIA 2Q9UA 4YJKA 4PLVA 2JAOA 3FJ1A 1N2GA 4UBKA 3REOA 5HJ7A 2WQ7A 4GLOA 5EVCA 4RMHA 4MWBA 1JE1A 3RUCA 3AVXA 2XUFA 2HXYA 4ZOLA 2JGDB 3RW9A 2ZIGA 2Q50A 5EJ2A 1OFIA 3ELWA 5KSOA 4UUNA 1EFHA 1E79A 2FZ4A 3N05A 4FE3A 1LSSA 3MQFA 3PC6A 4HAUA 2KBEA 3E8MA 3GWGA 4RX1A 3BT7A 2ZIVB 3IAXA 3EB9A 3ETEA 3QVLA 2EKDA 3R3WA 1AHIA 4R9VA 3RBAA 5BWOA 3I9OA 3ZV5A 1J7KA 3M1YA 1ETUA 3QU7A 4W5JA 4DPMA 4AF7A 3KYCA 2GKOA 1Y3CE 3DR3A 4NZOA 3RS8A 5K05A 5KINB 2RIRA 4ID9A 2YHIB 4BLPA 1LV8A 1HKUA 3BM5A 4BKMA 3NASA 4A91A 3BTOA 3LYLA 3C4VA 3GQBA 1O7JA 3ETGA 3NYQA 4GL2A 2QYHA 1JMYA 1W94A 1E2JA 2Q6TA 1CC1S 3CWCA 4YH1A 1XO1A 4YV2A 1NUSA 2XIQA 2YMPA 3U62A 4X62B 4DYVA 1LH0A 2VUTA 3OUZA 1C3VA 2J9YB 3K5PA 3PR1A 4M2LA 1NKSA 4TMFA 1LLQA 3FZYA 4TS9A 3QPCA 1JQKA 1G66A 2PSFA 2RH5A 3RIHA 3VRHA 4X85A 4ZT6A 1UZUA 3IAUA 4NBVA 2C9YA 4N1AA 1ORIA 2BCJQ 3G7UA 4B6OA 5CA0B 3HJUA 3OZXA 4GZMA 3TDNA 3PNPA 4G4GA 4MQFA 5BQ5A 3H65A 3LY7A 1FL9A 3NI2A 1Z8HA 5AXAA 1O6BA 2ZE6A 3GZNA 3OJOA 2R96A 4ENSA 4GKKB 2X6RA 2YOFA 1WXEA 4KYIB 1VHQA 3FPBA 4JLVA 4BAGA 1V9CA 1G8GA 4REQA 4TN5A 4UDXX 4RYDA 3A6GA 2E55A 4FZVA 3G9ZA 4J76A 3SHVA 2V6FA 2CDRA 5FUWA 5LZ2A 3SBXA 4KXVA 5CFNA 1T0JB 1TEVA 3AJRA 3B6JA 4BLUA 4G25A 5AM5A 3H8VA 2IP1A 5H59A 4MUBA 1XLTA 2VKTA 3AJEA 3N2GB 3SYKA 2HK8A 3LX6A 1PSWA 1HDGO 2OHHA 3EF1A 4J9UE 1GM5A 4RLQA 1N7HA 3FFXA 1C3OB 3H1AA 3WL8A 2PD3A 1Z8DA 4LFAB 3IEMA 3KE9A 4JT9A 1R6UA 1X2BA 2GPJA 5EPEA 3OG9A 3I9NA 1CUUA 1WMDA 2R84A 1ETHA 2RHLA 3PFHA 1DIHA 3LXMA 2XOKA 3VKFA 4C0QC 2ZQYA 4TXJA 4N8DA 2AW5A 2J9RA 3AEKB 4BNDA 3FDXA 1RRGA 3STHA 1RI5A 3LC2O 3R41A 4QBFA 2PUWA 3IP6A 4HLDA 2ZJ3A 3PDHA 3ADPA 5B6PA 3IS3A 3E6AA 1GCGA 3JARA 3QUQA 3DTVA 2QTWB 3ZDBA 1K8RA 2ETVA 1F3OA 2C5BA 3GBPA 1ORTA 1VCIA 3QM1A 1I24A 4MWZA 1G5PA 1MX5A 2DQZA 3RKUA 2DPXA 1K3UB 3ZS8A 4BVGA 5BNTA 4D44A 5JO0A 2PGNA 3FPEA 3L4SO 4V0SA 1OAOC 2O2EA 2FOXA 3FAZA 1GAWA 3PRYA 2VT2A 4MIOA 1U2EA 1GKIA 1UIMA 1A72A 1TUIA 1Z07A 2HIGA 2VIIA 3BHNA 3BJRA 4L0DA 1MC4A 2HA0A 3QZUA 4IO0A 5D7NA 3U3OA 3FNGA 4I6EA 4RZSA 4YP5A 1ARZA 4KQ2A 3ANMA 4XCXA 1O6CA 1NOJA 3AB7A 3CF2A 4ZRMA 3GAMA 1ZH4A 1SIWA 4Q1VA 3QV1A 1J09A 2C8LA 2ATXA 1YVRA 3IAFA 2DTEA 1VHTA 4QVIA 1UXGA 3C85A 4UAVA 5DE3A 4KSYA 3E0QA 4JI2B 3TQSA 3F6YA 1GZ4A 5FWAA 4US1R 2CCKA 1R10A 3AEXA 2BFOA 2HD4A 1DQYA 1NT2A 1RAHA 1CT9A 2P9JA 2CLOB 3FNRA 4RZQA 1P80A 3NDJA 2DR3A 4DXAA 2M2IA 5C5CA 1UBLS 1H5QA 3UGQA 2VH1A 1E1CA 4IVRA 1NUHA 4O1MA 4P33A 4MR9A 4TMTA 3WISA 2WIBA 5JHHB 4K6CA 3RRMA 1ZISA 3ANTA 3RT7A 3S4YA 2CBXA 3L8ZA 3N6RA 4EGQA 2Z6AA 4MCJA 2L0XA 2NV2B 3QBEA 4ZDIA 1KI8A 3K4PA 2J0SA 1PQUA 1O5OA 2PUHA 4FCCA 1I7LA 5BYKA 1KEEA 2Q6KA 2BGTA 4WOCA 1QVAA 4PO8A 1BW9A 3J7TA 4Q00A 3SZOA 3CVJA 2O0HA 3AYXB 3DOOA 3PEEA 1M2OB 4MWTA 1HT1E 2LTAA 5LCXA 3R8XA 2KPOA 3AUFA 3RRZA 5A4JA 3HCFA 1FFGA 4TMZA 4M4SA 1B2RA 2J8ZA 2A4MA 4ABTA 1E1YA 1AQLA 5KMGB 3HVUA 2DSTA 4P5EA 3U7EB 1TTPB 3MHTA 4OAOA 2BMWA 4G5GA 3ETDA 1YCDA 3O8QA 3STUA 1C7IA 3PGJA 4NMWA 4B5LA 2NSYA 3ET4A 2C1EA 1Y6QA 1JLHA 3PHLA 4BQPA 1Z7BA 3VPSA 3CV3A 3LLCA 4TWIA 5FTMA 3CMMA 2BTQA 4IF4A 1L4NA 3BL5A 1WCIB 3FKSA 2HMTA 1C41A 1CJVC 3PG5A 4L76A 1YJ5A 2MMGA 5BSHA 3HJBA 1JFRA 5KDLA 5JEDA 4DC1A 3EIUA 3LYUA 1VLJA 3IO5A 3S44A 3HZHA 1FNCA 3R9WA 1NWCA 1NJSA 5KDDA 2DWQA 5AI5A 4PGMA 4G9GA 3NM6B 3FRIA 4D96A 3RJZA 1YHZA 1O9GA 3NT4A 4HI0E 4UU0A 5CD1A 2B6NA 2VJMA 1W5EA 3S29A 1I7SB 3SIWA 1FTWA 2EYQA 2VT7A 3UMSA 1GPNA 3DMTC 1JJAA 1RS0A 1Z5ZA 2Y9PB 3AG6A 1HZZC 1FDOA 4LOKA 2PGOA 3R1IA 4L3OA 5EI5A 1SBTA 4FGJA 1Y8ZA 3ZNOA 2XBUA 3M6XA 3MC1A 4WZBB 5JH7A 1SKYE 4QVGA 2EX4A 2ATIA 3QPVA 1O6FA 2C58A 1FTQA 3BZBA 4A27A 3RQSA 3H6KA 3TKYA 3CJQA 1E62A 1HXHA 4AKIA 1V9SA 3SOPA 4P7FA 1NTOA 1V6CA 1IEWA 1MMFB 3LP5A 1WU7A 1JG2A 1Y1SA 2EF1A 2NSDA 4U6NA 3LCVB 4YCLA 1F1JA 4LXXA 5FEUA 3IURA 4EX6A 3KB6A 1DWOA 3COYA 5EWLA 3WADA 3CF6R 4KXNA 1AK9A 4OJNA 1PBTA 2EF0A 2XNHA 3FGZA 3WGVA 2IHNA 3RVSA 1US8B 1FFCA 4FW9A 4MI9A 4OHOA 4OHMA 2JLVA 4H0NA 4F4UA 1NSTA 3O91A 4FONA 4JVLA 3AHDA 1E99A 1SXJC 3RQIA 5KTNA 1E7RA 2P65A 1EP9A 4LN1A 1Q1GA 1TZKA 1WG8A 2J07A 3CRQA 3K1JA 4RCYA 1XRPA 3PIIA 3EUFA 1E0KA 4X92A 1QLJA 2CJXA 3C3CA 1PW7A 2C04A 3ISVA 2Y1EA 4LISA 2DPGA 4MV0A 4C0WA 2A0KA 1RQPA 2CXSA 1GGNA 5JQGF 1QE3A 2E1RA 1PT5A 2PS3A 5BXQC 4EJFA 4JENA 3OBIA 4XLZA 3GUYA 4OGFA 4E14A 1QG4A 5DGCA 4HB0A 1UL1X 2R1TA 4MW1A 2WAYA 3DWGA 2WUGA 2ZRMA 4LI3X 2YRFA 1QIMA 3PDJA 2WZQA 4ZN6A 4JKIA 3JVEA 5M2QA 3KAJA 1GT6A 3H99A 1DAHA 1FX1A 4CKCB 3FRJA 2ONJA 2GSWA 3G2OA 4UMVA 2GDJA 3FB1A 1ZU5A 2R6FA 4UJ5A 3V2UA 2XUGA 1HDIA 4CEJB 6LDHA 2AEJA 2O0LA 2NZWA 2FMKA 1G6KA 1G42A 3G0BA 3D1JA 2VO1A 3B2NA 3L4EA 5E1BA 5F2OA 3KK0A 3KQKA 2YJZA 3PQ2A 4ER0A 1P9NA 3TZLA 2BONA 3M81A 4YBRA 1W36C 1KVUA 1O96B 2IDJA 3B6EA 2I3DA 4DV5B 4Q3DA 1RBZA 2CNKA 3OZFA 3P2EA 3KL4A 4AJPA 3FF1A 1SIOA 1MJGA 1GLNA 1T15A 4L22A 4W6ZA 3RO7A 4P0QB 2QRVB 4RKQA 4RKRA 4XA8A 2ZR8A 3AUXA 4MUIA 1RC8A 4NMLA 1V1MA 1YWGO 2XWSA 1C4WA 5I9BA 5GMOA 1ADJA 3CX7A 3ZCRA 2PIAA 3H16A 4EEZA 5LB2A 4IXMA 3DNPA 4GX2A 1GYQA 1XN4A 3NHYA 1QHEA 4WA7A 1VG8A 1HBJA 3A9RA 1RPZA 4EA6A 3BFVA 1XHFA 1ZO8A 1F4PA 4LZJA 3ANSA 2IP4A 2FOIA 1P2SA 3Q12A 4CZ2A 5DGTA 1NG9A 1IY8A 3VR3D 1EKXA 1T2NA 4L8VA 4RFLA 2CL5A 1H3NA 3A6HA 4XQ0A 3NU1A 5DTRA 4KQWA 4O3FA 3VR0A 4A3SA 1W85A 4JP2A 2R60A 4DMFA 2AEFA 3ETNA 3SC2A 1M67A 2V7GA 1UJNA 2AE2A 3TOVA 4QG3A 1QNFA 4EHDA 3RYHB 3AEUB 1RM5A 4N5HX 5DWDA 4RHTA 4WL0A 4NMMA 1Z4PX 2IU4A 4E70A 2Y1FA 5FUXA 2DH6A 5DM0A 5KC8A 2X15A 3VDMA 3WLIA 3WNDA 2DQ4A 1U9IA 3MSXA 2EFJA 3FE2A 1JTEA 2OAEA 4P82A 1BXRB 4G37A 2K2WA 4PG5A 3UENA 1YZNA 4CV1A 4E07A 3EODA 1WMAA 4UPDA 2AJ8A 3IR5A 3QELA 1R3DA 4CLHA 5KOJA 2VYCA 1M1UA 1Z6AA 2AFHB 3TLBA 5ICMA 4AKSA 2OOSA 2PYIA 4LGCA 2A30A 1X3SA 1U90A 2VHXA 3AJDA 1V9LA 4BUZA 2YWJA 1L5WA 3T4UA 3R9XB 3F0TA 2C0CA 3B3GA 3GH1A 4CM7A 5BV0A 4BEVA 3TEMA 2IEIA 2V59A 2RG1A 2HQOA 2L18A 2Z08A 4YJ2F 5DBGA 4EZBA 2PL3A 4KQXA 1VZ2A 5AKGA 1NHGA 2WFAA 4WBNB 1GY8A 1UBJS 3SYNA 2I9KA 3MM4A 3PUVA 1JDUA 1LY1A 2A5LA 4BN0A 3JQFA 1JH8A 2VJLA 3IAEA 2O3UA 1ZJWA 4B6GA 1WA5A 1MB9A 3DM5A 2NN3C 2PL5A 4W6QA 4F93B 1M34A 4YCSA 3CVUA 1USGA 4XUEA 3F8SA 2V9ZA 5FL3A 2CXHA 3JWEA 2XD4A 3IRVA 1ZUIA 2D0OB 1UBRS 4RF4A 5KU1A 3CTMA 1O0SA 1OFUX 1LBIA 4KZPA 4MVJD 2ZUDA 1YL5A 8ABPA 1QIEA 3AY6A 5SZKB 3KKMA 3EY9A 4D4MA 1UFQA 2NW6A 3N0RA 4DR5B 4PYRA 3KVYA 3L0BA 3U1VA 2FUCA 2O52A 1PGPA 4OQ4A 5BRNA 4PZAA 1EX9A 2O2DA 2ZSEA 2JJ2A 2Z83A 3EGDA 3R75A 3WGMA 3WYEA 4P3NA 4B2IA 3G88A 3RVKA 4A16A 1CEXA 3GFQA 3WNVA 4ZI7A 1I51A 4U2BA 3I8XA 5D2CA 4LGYA 3SG0A 3TJMA 2ZIFA 3I04M 3V8MA 3VA7A 2F1IA 5DIFA 4AROA 7AT1A 2JIOA 1RLIA 3GFRA 1OH7A 2IPLA 3BPSA 3WBFA 4CMKA 3BIOA 2ZAGA 1F60A 3TN7A 2X0EA 2HNAA 2YW9A 1NI4A 4GI2A 3ZKWA 3O84A 5AM3A 4M8SA 4CM3A 4KNVA 1UDXA 1Y6ZA 4PLWA 3PICA 4EAQA 5KNBA 3NQ41 2FFJA 4KW7A 2ZITA 2IU6A 3AETA 3COVA 4UTZA 1KJ9A 2AFIB 2MHCA 2OQIA 5CJPA 2YNMD 2RBGA 4NU0A 4DARA 5I8PA 1B73A 4BO0A 5CVEA 4OBXA 1D09A 3RHTA 3O1JC 3AFNA 3WRXC 1L8AA 5TQ0B 4X1OA 5AW5A 1NAIA 2NM0A 2HV8A 4KO4S 1LFDB 2ORWA 3EIEA 3GCGA 1P9WA 3WBKA 2JCXA 1BE0A 4RVCA 4EFDA 4H7IA 1EX6A 1IOVA 4A2QA 4IXWA 4XVHA 4CE6A 1NJ2A 2PS9A 1DCMA 4TQGA 4X64B 2M98A 1CUIA 1E6CA 1OBOA 2AFVA 2R5WA 1DOAA 2N47A 3MAJA 1C1DB 1UBUS 2ISQA 1OZ0A 1NC3A 2UVDA 4DN6A 1WE2A 2JBHA 2QW8A 2HF7A 4CLEA 4Z4QA 5DXAA 1SQSA 1NPTO 2C57A 1OXTA 1AO3A 1XTQA 4KE6A 4NIMA 1RMYA 4KO3S 2BI7A 4D25A 1AK1A 5EYPA 4KBGA 2ARKA 4RADA 1H2RS 1EJ6A 1YB5A 2Z09A 1IG3A 1GN8A 3CLRD 2XRFA 3KJIA 4XJVA 1DFIA 2O0JA 4OMFG 4S2EA 1YR7A 1ZK0A 4ZIRB 2XHEA 1MR3F 1R2QA 2ZSUA 3H3XA 3UATA 5KTSA 1EUCB 1Y1QA 2ABWA 3RS9A 1P2GA 4YRDA 4KMOA 2OOKA 3VSDA 1B6SA 1Z0UA 4J3FA 4S3MA 5C8YF 4J1TC 5FNVF 5CA0A 4UVDA 1GP2A 2IZ5A 1WNFA 2PKRA 3MWKA 3VR2A 2WJJA 4CMGA 2ZJOA 4R16A 3VOSA 1GPBA 2O54A 4JOCA 3UMGA 3O4VA 3FRHA 4DV0B 2OXTA 1RPJA 3L92A 4A0QA 2QP4A 4XQ9A 3D4NA 5B3JC 3ICVA 5K8LA 4Z0TA 1AUPA 3AI1A 4LS3A 3NHWA 4JP5A 5C32A 2DGDA 2H63A 4MW7A 3L1IA 1IM2A 4JLNA 3E4DA 4XB2A 2IV7A 4LG1A 1UBMS 1NN3A 1IATA 5CP8A 4HQ0A 4KE9A 1GR1A 5IX8A 3JQGB 3GRPA 2BF4A 2O20A 2OE2A 4WCVA 1EUCA 5ALQA 1ZKDA 2QLTA 4ILEA 5PNTA 3TDKA 1GQ2A 1NW5A 3USES 1JTFA 3RRBA 5DV9A 3DQZA 2ES4A 1CX9B 3PKIA 3H17A 3KOUA 4ZWNA 1U81A 1CP3A 1IZZA 1HZZA 1QH8A 3KNZA 4KQKA 1G17A 4PGAA 2QRNA 4QULA 4GM1A 1JHMA 4MYTA 2NUPB 5E4TA 4ESVA 1GCOA 4KJXA 1E6LA 1Q0HA 4HV4A 4CKCA 2B8TA 3KQUA 4CHTA 3TSZA 1GGVA 3ZGLA 1Z56C 4TKUB 4Z49A 4UDOA 2D54A 3FCXA 4DBZA 2HR1A 1EAMA 4JB3A 2X2OA 4C4ZA 2W00A 2CJWB 1N5OX 3FCCA 3VPFA 4B4UA 1VJ1A 2ZI6A 3PXDA 4JEUA 5FO1A 4BZXA 2YY6A 1MNAA 3PNBA 1QAMA 2A3RA 5D51S 5DBFA 1A9YA 1UPAA 2O2HA 4BQFA 1T5OA 3DHVA 4RK4A 2IW1A 1XMIA 4Z5XA 3EFBA 1G6OA 1E59A 1CERA 4YI5A 1KOJA 2NTNA 4MLPA 4ZYXA 5AKKA 2HSDA 5GGXA 4L4UA 1ML3A 2JBWA 3L7KA 4NHOA 1R9JA 3QX8A 2EC5A 4QDTA 2NPOA 3V4LA 4MGZR 5K7SA 1JHAA 2BDUA 3V2IA 3T35A 3EZLA 1DRVA 2ZDQA 4A6DA 1QCYA 2NPIA 1Z63A 2W2TA 4TZ6A 1N2CE 2BGIA 3H13A 1IMOA 2A0UA 5BN4B 4BB6A 3OPVA 4UHHA 1IHUA 4HGZA 3FETA 1LK5A 3NJ4A 2ZU0C 3LUPA 1KP3A 3ZNNA 2FSHA 4URFA 3R3XA 2QDXA 5K2MA 4HO1X 4D9FA 2WD7B 4NJEA 4CKWA 4AG5A 2XNJA 4HDRB 5CLLA 1JQ5A 1L8QA 3OJ0A 5SYAA 6ADHA 1JR6A 5BSVA 2I3AA 4P80A 4HYQA 3C70A 3DHNA 1KJNA 3CEJA 3KPJA 5TEVA 1DTSA 3LQYA 3K72B 4V2UA 4IINA 1A7UA 4MULA 3T34A 4D3YA 2WFLA 1Z34A 3RUDA 3NDRA 5KYYA 2FPKA 2KI5A 4R8KA 5AJXA 1PR0A 3NKLA 2JB9A 1RXEA 1ZHFA 3GRFA 3EISA 3BJMA 3HL0A 2QUHA 3L0SA 4JBYA 4YCBA 5F77A 3SLGA 2V96A 2QJTA 3TW4A 1OB5A 3K2IA 2UZ1A 4XD2A 3DDHA 4N18A 3UGJA 5BWBA 1AQ6A 2WG1A 4JWTA 1K8YB 4UBJA 5EZSA 3RC1A 3WICA 3FUVA 1DT3A 1XJCA 1XLUA 3NTOA 1XYGA 4K03A 4WK0B 4ZOCA 4G4SO 4BVKA 1Y81A 1EA5A 1UQRA 1ZMTA 3V1UA 3E9ZA 1BD4A 2Q0HA 4DZRA 5K6AC 4Q9NA 3EZXA 3CHYA 2TS1A 3MB8A 5EJ9A 3HM9A 4FM9A 3UWKA 1WBDA 3RHFA 3WP0A 5KI6A 4YUVA 1R4NA 2MR5A 4U7GA 3P52A 4PTLA 2F9MA 3HFJA 2Z2XA 2QVGA 1PS0A 1Y3BE 4BMSA 3AUJB 1N6RA 3DFUA 5EUQB 4FYKA 5DEIA 3ZHUA 1E8MA 1M83A 2FZLA 3IPCA 4ZVRA 1SWVA 3ZD6A 2I4NA 2JASA 3O8BA 2WB4A 3AXTA 1JDSA 3PJRA 4TVSA 5DNDA 5F3WB 4OKSA 1LPOA 2H1WA 4DQUA 5KYGA 4OPMA 3QENA 5LKRA 3HU5A 4YRCA 3EXG2 2G5CA 4Y0NA 5JD3A 1Z0DA 5EJEA 2G7ZA 2RHTA 2PXAA 1FDSA 4TLCA 3HXTA 4TT8A 2ZANA 4HLCA 2A57A 1G8JA 4RE6A 1X7ZB 4C4PA 4BMOB 2VP2A 4FQ8A 3UW1A 1E20A 5GGYA 5JPCA 2OEPA 3ICQB 3EIOA 2IJGX 3OIUA 5FUBA 3C8UA 4RD2A 4JI0B 1EXDA 1IOLA 1JPJA 2X0FA 3RAGA 1SBYA 2WSLA 3IIMA 4HUQA 5B3LA 2QYOA 9LDBA 4ZQEA 1DU4A 2FG5A 4X20A 1X8KA 4JBNA 3NG1A 3ZY4A 1E8DA 4N9QA 2I6XA 1VCHA 1F8XA 3PT5A 2GF0A 4X8OA 4F5DA 1JBEA 3LWNA 1F4LA 2XXJA 4RNCA 2D5AA 2X19A 3EYAA 5I7EA 2JGEA 1GTMA 1W4ZA 3Q9NA 3ZH9B 1D2EA 4INZA 4JQCA 1XYVA 1JIKA 5AM0A 4D6PA 3MT8A 1JAXA 2GF2A 4EARA 3MJFA 5IH3A 2JKZA 5HG0A 3H9CA 3V55A 4ABYA 3OZVA 2RC6A 5SY4A 1O4VA 4DWOA 5FI0B 4ROTA 1KO5A 1H2AS 3WV4A 4RPJA 1IY0A 1FEZA 2KBFA 2MOKA 1X13A 1X14A 2QR5A 2XOEA 4NMHA 4C7OB 4TWZA 1WD7A 2FZWA 4B3SB 1DEOA 2QYSA 2M1ZA 1FZTA 3SX0A 2ZUVA 1YBHA 3IKVA 1Y63A 3RU7A 2ASVA 2OLKA 1TB4A 4JSTA 4WXRA 4GLJA 3TINA 2QBYB 3PGMA 1U7PA 4XPIA 4PSAA 1O89A 1DOZA 1HDCA 3KDAA 1LSOA 3OFKA 2ZDGA 2QV7A 3ITNA 1IBKB 2QIOA 1UDRA 1NWHA 3ZQUA 4DAEA 1WS6A 5ITWA 3K09A 1CZUA 1ICEA 2RKBA 2VP4A 3CKYA 3GRCA 2D2IA 2VDUE 1EB8A 2JK1A 3TLYA 1R0KA 2HK9A 2JCBA 2PO7A 3UWDA 4DFDA 1EX7A 3CLUD 5EIXA 1IEXA 1K27A 4WBSA 4RGVA 4RY9A 3GLGE 3EPLA 2O0MA 5CXQA 4FBLA 4XLLA 3KSDO 4DE5A 3D59A 2YVUA 5D5QA 2ALJA 5J43A 1P1HA 1N6IA 3KJQA 1HGXA 2H08A 2QQFA 3KALA 2EWMA 3ZUGA 3I5MA 4FEGA 4RJ2A 3EZ7A 4COKA 4TYYA 4CIAA 1JWLA 3IV7A 2IS6A 1V2HE 3DLCA 2H4WA 5C3UA 3FTNA 3PENA 2QY6A 2WA2A 4TKUA 5LL6P 2UVPB 2XMZA 4CU2A 2VHZA 2Q28A 2XB4A 4BFUA 4DJAA 5LMCA 5FPSA 3GR6A 4L95C 2DR0A 4HOYA 4MP8A 3OD1A 4EELA 5AVTA 1F0YA 1N0HA 3DXFA 1ESEA 3HACA 3IA2A 1LC0A 2FEOA 2XB6A 3BAZA 4HWKA 1PEKE 4QTTB 4KFRA 2A1UA 4DR4B 1MVLA 2KS6A 2JA2A 4R3UC 1G1MA 3R40A 4TSFD 3EG9A 4B2PA 2PUDA 4ZVNA 1K06A 1DUVG 3ADOA 4GR9A 5EESA 4AY3A 5CFMA 3GWZA 4CIDA 1ZIDA 2BP7B 4FYMA 4LPKA 1R0ZA 3QVGA 5TF0A 3W1VA 3KSBC 1Q0QA 1Z6YA 1UJ2A 4TT3D 1PZFA 4Z1OA 3V8BA 1WTCA 3Q1KA 1Z2EA 2CEKA 3PWKA 4EJSB 1QHXA 3QRWA 4QUBA 5DF1A 1SQGA 3R7FA 3RS3A 2BEKA 1K92A 3TMAA 3EW9A 4R54A 3PVCA 3VZPA 4OX9B 1YRHA 1FQJA 1P0CA 2I6QA 3W6NA 3JATB 2RGGA 4B7UA 3FIJA 1GYPA 2YNMC 2QLFA 1JFFB 4MCIA 1H3FA 1C9EA 1OD6A 3CF0A 4GL4A 2BFCB 3DR5A 4QASA 2H3EA 4U9HS 5G0TA 3VHQA 1TFRA 4IIFA 2C7GA 2CF6A 1O95A 2R00A 3D7SA 3OCYA 3CMCO 2B82A 2IY8A 4WGGA 3THWA 4QRHA 2ZGVA 3IX7A 4DLUA 5IXYA 3IJRA 3OM1A 3WLLA 5C8VA 4D9GA 3WXMA 3NPAA 4XEUA 4BFVA 4YPVA 3GC6A 2CMGA 2ZRHA 4D4KA 2E85A 3WQBA 2E7ZA 1DIAA 4TXLA 3U3ZA 1L9XA 5HQJA 1SCKA 1T3HA 4HS4A 3TQTA 1WPXA 4CXMA 2B8JA 2WIKA 1P72A 1L1FA 4F3RA 4C04A 5G3ZA 2JGKA 3AOGA 2ZJ8A 1JXAA 2BI4A 2BBOA 2XPCA 3MWEA 1Z5GA 4MPRA 4QAJA 4R3NA 4FDLA 4MWSA 3QOXA 4G8BA 1DC7A 4FYHA 5DOZA 1L5KA 1UMDA 3AIOA 4QHYA 3ZXIA 4A8HA 4KPUA 7REQA 5JCJA 1QMGA 4M1OA 5D85A 1YZGA 2REQA 4LDQA 4GR4A 2IHUA 3IBSA 1KTVA 4KKVA 5IT5A 3WK7A 4MQ5A 4RSRA 1G20A 1S4MA 1Z5OA 4OF4A 2X8JA 1MORA 3RKSA 2YJ5A 3IDFA 2NAFA 3KCNA 1OC2A 3PQ6A 4GDMA 4QTXA 5FWXB 1XEAA 1FFXB 1S02A 1Y8RB 2GAIA 3IERA 3M49A 3B52X 5LZ7A 4ENQA 4H27A 1RAAA 4QU5A 5H9VA 4AZ0B 2AOWA 2CCGA 5I7AA 2MU1A 2PKQO 2Y0EA 5GV7A 2GERA 3SC6A 4HPWA 2OZEA 3CLKA 1X9IA 4LDPA 1EU1A 4BV2A 1BU5A 2F6RA 3IXQA 4MUAA 4TL6A 4O4JF 5DK6A 2RHRA 5D86A 1A2BA 2B5OA 4DJFC 5HF5A 1TRKA 1A4XA 3PNLA 4KKXB 4PFSA 4RDHA 4WJZA 3GIWA 4P7GA 2J3JA 5K3AA 1XR3A 3VTKA 1FLNA 3IHTA 1PKEA 2KW5A 5B4VA 4TZ0A 5K0SA 3OT5A 3EDYA 2P5YA 1XQXA 2J30A 1BGXT 1ZW1A 3AUTA 3SVZA 5CFLA 1FTGA 2YFHA 3ITDA 4TT3A 1I0LA 3A1CA 5EZYB 5LYJB 1MNQA 4NS4A 1JU3A 2SKDA 5JCOA 4L5AA 1R6VA 4OYLA 4RIFA 4BB0A 3GB9A 4L4YA 1RYDA 4MS1B 4Y2XA 1H85A 1KK0A 3GX1A 2R4QA 3GA0A 1DAKA 3GEBA 5JI2E 4RTSA 4UULA 1ID1A 2BUBA 4XUGB 2VHJA 1CEQA 3LA8A 4CG2A 2ZDHA 2EFYA 2DHRA 5U4XA 1WSDA 4ND5A 1GAEO 4W9RA 4AK9A 3SSOA 1TKCA 1AUXA 2WR8A 2AFRA 3T12A 5HGXA 2XVMA 4KB5A 3PR3A 2Y8EA 3EFOA 4YJGA 4OLHA 5LXTF 3UA3A 1AKEA 4RTPA 1O95D 3VH4A 2FA9A 4DRXB 3N8GA 1AA6A 2CXTA 2P68A 5CEJA 1TC2A 3QHAA 3V8RA 2YZNA 2YZGA 1ZCZA 4C6SA 1Z8FA 1P2FA 3EQ2A 1XBTA 1EBBA 1Z75A 1E3QA 2VHUA 3KT6A 5C1IA 3TOZA 4YRFA 4AZ0A 1N5KA 2VPTA 4CLXA 4H15A 2CB0A 1T2CA 4RY0A 3HB9A 4AT1A 3AHFA 2F7SA 2WTUA 4O4IA 1BHO1 2FZ5A 2X8JB 4L0MA 5TX7A 5JMWA 1QAQA 3C6MA 1B1AA 5L4NA 4HL6A 1P7VA 3IKJA 2Q5QA 2Z9DA 3R6WA 4DABA 4KLZA 1IJKA 5HJ5A 3JW8A 1VJDA 2VP9A 2KE5A 3E2PA 1II8A 1DOHA 3A3PA 3WYFA 1NV8A 4BP3A 3NORA 3EOZA 5I4IA 5CCDA 3STTA 3NNDA 3BMNB 1EHIA 4M8IA 4M0MA 4EGJA 5B53A 2B8EA 3ND6A 4BKRA 4DDHA 1FUEA 5HBRA 1T91A 4N54A 1AZLA 1K4KA 2P4EA 3G0IA 1Y1RA 3U49A 1NBIA 3PFWO 4GX0A 4US0R 2CVPA 1ZOPA 2VATA 3F96A 3CA8A 3HBFA 3RFFA 1P0PA 4KHPB 3QV2A 1K8XB 3KUKA 1U9JA 4PS1A 4HWTA 4YCDA 3ZVNA 3PNVA 1X1DA 1G2OA 3BORA 4HD8A 4MYDA 4QXQA 1GGFA 1OT3A 5GONA 1YZUA 4MOWA 5I9TA 5IJ0B 5DW0A 1WZEA 1WUKS 4Q19A 4UC0A 3PVSA 5LQDA 4KODA 4A2WA 4BUCA 2ZIWB 4IDBA 4S12A 1IUNA 1ONOA 2XWJI 2VPPA 3LPLA 3A1TA 2I6TA 5DPMA 3MERA 4JD5A 4DUPA 3P5BA 1EK1A 1MV5A 3PE4A 5FBLB 4A0RA 5GINE 2C4MA 2BN4A 5TSDA 4BC1A 3NC1C 1OA1A 1UBFA 2JGJA 1ORVA 3E3AA 3Q8LA 1UKAA 1LRKA 2OKCA 1E3IA 3I6YA 1AH2A 2OFPA 1IOZA 3PJGA 3RUAA 3VJLA 4PLPA 1LBQA 1V71A 1AQIA 2H4JA 3OT4A 1TMYA 6PFKA 2H51A 2YJ6A 4IFEA 4W8GA 2BMFA 1XRNA 1JEQA 2NG1A 5FBWB 1NM5C 1NQWA 1SVNA 3UNXA 1AKMA 2A7QA 2PRZA 3ENKA 3FDZB 3HP4A 4J0QA 4LXGA 1ELOA 2Y1KA 2YZMA 1Y3DE 4P7BA 3RBZA 2I2WA 3RWBA 3SF8B 4BZZA 3E2IA 1EJBA 4WRRA 2NU7A 1Y7PA 1EWYA 1Q7EA 4IH1A 4QAQA 2CLHB 3V4FA 4CCYB 1VL0A 1V8PA 3N59A 3NC4A 4KTVE 4YRQA 2GEVA 1CQWA 3A9SA 2RD2A 4WDRA 1CR4A 3E70C 4MWGA 4EPTA 2GTPA 2P79A 3DVSX 5IT9A 5G40A 3I2GA 3KQNA 2DX7A 4PZEA 2BMEA 4ZO6A 1BFKA 2A0WA 2C42A 2HF2A 1H22A 3NAMA 2PH3A 4RPKA 4DMGA 5LKAA 2OK7A 2BZGA 4E0BA 2XTAA 3KVVA 3X1DA 4ZICA 4ARIA 5LMZA 1RC0A 2O8FB 1BDMA 1QKIA 2XAUA 4HYYA 4H2DA 1SVIA 4ZI3A 2FUG1 3IPLA 2PX5A 3SSMA 4UTVA 1WKCA 4R6XA 4V38A 4D41A 4NQRA 4LY6A 3RBXA 4AZSA 3EAGA 3Q15C 2VBFA 4RAOA 1RJ9A 1SELA 2WQZA 2R1TB 2GCPA 1J0CA 3F6PA 3D3WB 4KQJA 3TBKA 2ZTUA 4DDWA 5FF9A 3IPRA 4IJUA 4L7QA 4FFNA 3M6IA 1XX6A 2ZYHA 4R2LA 5CJ2A 5FFFA 3ZWKA 5ALVA 3FI0A 1ODJA 3VC1A 4FYPA 2QRUA 3DYBA 4B45A 4KWIA 1ZONA 3SNHA 3VDXA 1OUMA 3M6AA 2ZM5A 3I62A 3GCXA 3BXFA 1ZGGA 2Q6OA 3P9IA 2WHEA 3OVMA 2RAPA 1Z4IA 1CU1A 1LPSA 4N7MA 1LVGA 5IJWA 4XASA 2X41A 3CS3A 1EFDN 2GARA 4V03A 1T1EA 1R00A 5BOVA 4LECA 2FSVC 1US8A 4F9TA 3GVXA 4HMQA 2C9DA 2JD0A 3MYRA 3OX4A 621PA 3B6MA 4U63A 1H93A 1JEQB 2ZK7A 4L9AA 1NF3A 2NUAB 1OROA 4AUEA 2RE8A 1XKQA 1U63A 3T3OA 5CLQA 1QRAA 1VKOA 4RNDB 1F6BA 5LYJA 1TAGA 4OGLA 3BTSA 1BDIA 3UJ9A 4G5YA 1BA3A 4I4TF 1FSZA 5DCLA 4F5YA 1EHCA 3FFAA 3HY6A 3HXQA 5F23A 2R2AA 4ND8B 3NVAA 4IRMA 3DTVD 1KSHA 5I4CA 2IK8A 4J4BA 4EITA 2EP5A 4IIHA 1T0BA 4BP8A 3O3OB 4MS3B 1ZN7A 2ID9A 5EERA 3A8TA 5EIEA 4JBGA 3AR7A 4XGKA 1WW2A 1EBFA 1JAHA 1MCZA 2R9VA 3DVAB 4MQMA 1QF9A 1WQ3A 2W5UA 1UEIA 1O0BA 3SAJA 1GSHA 1DINA 1SUWA 4WNCA 2OGSA 2I2XB 2OD7A 2IZ0A 3KR2A 1V1JA 1KS9A 3THSA 4FUTA 4Q3BA 3V4ZA 3WKBA 1TQ2A 3F78A 3K6KA 1C30A 3LY9A 1IN1A 1K5DA 4L50A 3QI7A 1Y42X 1I1OA 2ZRNA 5HWSA 3H7AA 1CY6A 4PX9A 3K8ZA 2EHJA 2ECPA 3JQBA 2GVZC 1DQRA 4FMBB 4KXLA 4X71A 1GU7A 5DYGA 4DTIA 2H4ZA 4XGQA 4KGZA 4OI1A 3WG9A 1Y7TA 3K1TA 2RH8A 2VAPA 4O5AA 4M0PA 1I3KA 4FWIB 4E1BA 3L07A 1PVDA 1WU8A 3GRRA 3AIMA 3HUEA 3BMQA 4ANFA 1RIFA 4JX8A 4B35A 1TOAA 5FTLA 5I9NA 1LTQA 2PU5A 5F2EA 3NHPA 3OX3A 4J0DA 4M0CA 1N2ZA 3ZUPA 2I3BA 1U0FA 3AILA 2VHWA 4JSRA 2CLDX 5GIOE 3LZ6A 4EW2A 3OPYA 1IIBA 1TVMA 2TECE 3LY5A 4HB3A 3LWDA 1VL2A 2WYUA 1J0BA 1RXYA 2W6CX 2X86A 3PPXA 4MMXB 4PO1A 3K0FB 4D0LB 2WU4A 4DA8A 4Z3OA 4J7UA 1CNMA 2CKDA 3AQIA 4NDZA 3TIVA 2I3GA 1E1QD 2IODA 3GK3A 3C5EA 5AHRA 4GLBA 1GKUB 3OZSA 4IIEA 5AR1A 1C2TA 2X4IA 1I30A 4HWPA 4ZQBA 3TUIC 1M5UA 3HKCB 3ZU4A 3E23A 4TQ9A 2C59A 4UU8A 4V1CA 1O8CA 2XT9A 2XDQB 4MR9B 5KOYA 1OH5A 4PTZA 4HB4A 4IDNA 4JP3A 1SC4A 3D8TA 1P17A 5IFKA 5A04A 3C43A 4FX2A 2QORA 1SQ5A 1EK0A 2FG7C 2Y9MB 2FDXA 2HBYA 4IQGA 4L02A 5E6RB 4EG5A 2YJTD 3L6OO 3LC0A 1SBNE 1E69A 1T8YA 3BHIA 1OYYA 1C3LA 3DKPA 4HDOB 4LZOA 4R71A 2ZXUA 1YB6A 1UK9A 5LU8A 1TM1E 4MAMA 1HV8A 2D8AA 1XJ0A 2WIJA 4Q3NA 5GIPE 3RWOA 4JX9A 4B47A 3PFKA 4ZCTA 4LE0A 4HNHA 1KQGA 5CB0A 1BRMA 1KK1A 3H9BA 4B3GA 2H5EA 2D59A 3DCJA 1SUBA 2ACEA 4JV5B 3E22A 4XGNA 5KEIA 2NVWA 1HYGA 1N6NA 2JI6A 1DTWB 1NKVA 1XRMA 5A6VA 4HTFB 3R8FA 2QB5A 4EJ6A 3NKFA 3HTXA 1JEDA 2HV9A 2RHJA 1HE4A 5DBOA 2EXXA 2GGSA 5BN4A 1GEGA 1A77A 5KBYA 1JDZA 2PGAA 4QHTA 3HA2A 1UINA 4Z53A 3TGWA 1B4DA 2FPXA 2PJUA 5IDWA 1F48A 2PEYA 3E1GA 2SBTA 3HHEA 5FWXA 4Z7QB 1YFLA 1E6WA 1Z15A 1WY7A 2X5NA 4R68A 4HT3B 1WCV1 4TRMA 3I0MA 1P1RA 2G71A 3U26A 3ZGNA 2NTYC 3D8NA 3K2EA 2BFBA 2OV4A 3TG8A 2Y71A 3NTUA 5J5AA 1KDOA 4NU6A 2C29D 1F8YA 2ZS7A 3GNSA 2AD5A 1KJQA 3W5DA 3GUCA 4FR0A 3C5HA 3N28A 1SR8A 4OV6B 4JR1A 4LC0A 4I5EA 1SZDA 1T4GA 1TRHA 2KYRA 2B2XA 4J29A 1A2QA 1QDUA 2YTZA 1DVRA 3DL7A 4W9NC 3EFEA 4DF3A 4RIEA 2J7PD 3PC8C 3N8NA 3NBKA 1RC1A 2X9GA 2FPWA 1GNPA 1Z28A 3Q72A 2CXOA 4MCHA 3KLMX 3ZJVA 3KLPX 1EGQA 1AXGA 2UZAA 3OC0A 3A9TA 4MAFA 4PPQA 4UNRA 4HQFA 3CG0A 8GPBA 4AN1A 2W42A 2ZB4A 1L4BA 2JLYA 5EMMA 3VZSA 3CINA 2FR0A 2L42A 2MR6A 2E1PA 3LHDA 2R4TA 1LKZA 4I0WB 1FJ2A 4ND7A 4CCWA 4JYZA 2P2YA 4CWAA 3KWJA 4J9VA 2O0KA 3UUFA 2FX3A 4BV3A 3MWDB 1LQUA 4MQFB 4JC5A 5DTIA 3QX9A 5FEMA 3UG6A 1GKKA 2GFIA 3GA7A 3KE8A 5B1HA 3UOAB 1T5HX 3RUIA 1NW8A 2C84A 1SK8A 4HDNB 4LDJA 4CLOB 4RORA 1WABA 3WJ2A 1KU6A 2OO3A 1VLHA 5JAQA 3I1IA 1CS0A 5AW7A 1B00A 1TLLA 3D0RA 3U7FB 2MINA 1ZLXA 3H4TA 3PLRA 3OQOA 4WZZA 1T5LA 3N39C 4G0MA 1C8KA 3GZTB 2G17A 4D3XA 3FTFA 1KZHA 4QELA 4CFSA 4CETA 2AF3C 1GEEA 5FQNA 3RU2A 3R7AA 1ZHHA 4AY4A 1Q74A 3LBNA 4QXMA 1ZXBA 1TGVA 1QZZA 4TUYF 1ORHA 1Q1NA 5DYNA 1KFEB 3VISA 2YHSA 5CYFA 3TNYA 4KN9S 4MW6A 5A7FA 4FT2A 2HKIA 1BVUA 3FHTA 3NJ8A 1XEFA 4E51A 1ZD3A 4MR8B 4ZJYA 2PAAA 1W6RA 1Z7WA 4UEQA 4IFTA 4B3BA 1K75A 4H1WA 1AMOA 1DPGA 1P44A 3CXUA 3M4XA 4BNLA 1RZUA 4DDMA 4MUKA 5A71A 4GG1A 1E9BA 1A7JA 1W4LA 3IBGA 3FNFA 5JSZB 1PR2A 1CRPA 4K28A 2HMUA 4Y30A 2I2AA 2FLWA 1FQKA 1TXGA 2I80A 2HGSA 1UEXC 2XUZA 1FPMA 3A6ZA 3PDWA 3WNBA 4FOPA 3KB8A 3M2TA 4HHEA 4KFTA 4BNUA 1QS0B 4YAKA 3CKLA 1YI8A 2Q27A 3RVQA 1WHTA 1TAUA 1TKRA 1GZ3A 1QQ5A 2BRUA 1Y6FA 2W37A 3E9CA 1C7ZA 4PRZA 4OH1A 5I4BA 3PGVA 1NR1A 4DXHA 2YRXA 4JB0A 4YJFB 3LQFA 1JG6A 4HNSA 1PWXA 2GCEA 1XZHA 4RA9A 3HYTA 3C14C 2EKQA 4NPCA 3I1FA 4JJFA 3TE6A 2BWJA 4OA8A 4BASA 1XP5A 2QUKA 2FOLA 4WKCA 4Z6KA 3BA1A 3M1AA 3JQ8B 3O6VA 1H4TA 4Z1MA 1F7VA 3VKHA 1UC5B 3S2YA 2A0YA 1W9MA 4K9SA 1M2HA 1E6UA 4OHPA 4E2ZA 4RQAA 4ES6A 1PI3A 3EXFA 3P9QA 4IFIA 4M7WA 4O2LA 5BSKA 2ZBPA 3QA3E 3HBNA 1N1DA 1UKCA 3CPJB 3CZMA 1JECA 3LUFA 5KJEA 3DMRA 2FMIA 2FVXA 2R8RA 2ZIXB 2D74A 3LW7A 4N47A 4ADSG 3TK1A 1UM9B 1XTKA 3GJZA 5ULLA 1DTWA 5JRZA 5DX1A 4I1UA 1Q7RA 3JD4A 4KMSA 2FR1A 3H5WA 3B6IA 4Q3KA 2FEKA 4W82A 3MT7A 1RRPA 1ABBA 1QX3A 4EATA 5D5HA 5WRFA 1U5AA 3AY7A 1ECCA 2VSYA 4KQGA 5AK4A 3DQPA 3SF0A 1K4MA 4HDQB 4DMRA 2IIQA 2ZBVA 4ARZB 1CUZA 3CUWA 4JLPA 4NOMA 4J6FA 4E94A 1BMDA 2YUIA 7GPBA 3FPCA 1A5SB 3YASA 3E8XA 3WB1A 2WUWE 3A7EA 3V7NA 1GTG1 2IZ1A 3PBKA 4Y2GA 4IXDA 1M6WA 4QBGB 4OJTA 1ZN8A 2Z2JA 4TROA 5AK3A 3C3PA 4E7OA 4HN2A 2CW5A 4TL7A 5K3DA 2RC5A 1E1NA 1H1TA 3UUGA 1Z39A 1C9NA 2H1RA 4NARA 2VQ6A 2FSIA 1H94A 2G76A 1IBSA 3FMGA 3P2OA 4M36A 1HOTA 4MIYA 4CQNA 1OBHA 4PCAA 2JFVA 2PZMA 2BW0A 1P3Y1 1JHPA 2QL9A 5A0FA 4C0KA 3ORQA 1XL0A 3MGKA 4BVAA 13PKA 1ZYUA 2VK4A 4Y2SA 2VRBA 3GJYA 5LQMA 1CIPA 4M0LA 1MRNA 4ACBA 1R7RA 1MA0A 1VECA 1YKFA 1G38A 3L5OA 3MOIA 1BQEA 1I6WA 1WDKA 1RE1A 1JT2A 3BMXA 1ZP6A 1KYTA 1CJBA 2FEAA 4KIJA 4CDMA 5HM6A 3RJMA 3B5EA 3LXXA 4K26A 3RR2A 3WA7A 5EIBC 1IZ8A 3AL0C 2VJKA 1E9AA 1VTKA 4XVQA 2BF7A 3KXPA 4PSUA 1JA9A 1W46A 2VHQA 1LB1B 5A5GA 2O2JA 1FMCA 1NOKA 1H05A 1UKEA 5TGTA 4D0GA 1GU1A 3BXOA 2I8LA 4KZKA 3G0DA 3AUAA 2Q1WA 2YJGA 1I2AA 3WLTA 1GA4A 2W43A 3REGA 4B3XA 5A62A 5ALNA 2VOEA 1TKBA 1S7CA 1IBRA 3S8MA 4E1AA 4EA7A 3HCNA 4EPXA 1GILA 2X1MA 5LZ8A 3ACCA 1JEAA 3QIAA 2WAMA 3K9GA 4Q47A 2ZW9A 4Q1DA 3QUSA 4F8JA 2OXFA 4A8JA 4A36A 3WMGA 4EB3A 2VZEA 2XY4A 1TQ8A 3QFHA 1X8XA 3D64A 4FFBA 3OO1A 1E9DA 3CH4B 3KD3A 4IV0A 2RHOA 4YP0A 3KQSA 3D6VA 4J43A 4MS3A 4MV7A 4WUTA 1QNLA 3USZA 2HBZA 3OIGA 1W0KA 3RSLA 1T1IA 2H85A 2ZBDA 1RZVA 2H2GA 4DA4A 1Y82A 1N2CB 4C4RA 3FSGA 5GY7A 4N7BA 3MCZA 5CUQA 4DM3A 2C88A 2A9KA 2RBEA 4OSPA 4PFQA 1GZVA 1L5RA 4XIGS 4U7FA 4PBSA 3MVEA 5EJMA 1QHNA 2OCXA 1XYYA 2YFKA 3T3PB 3W5CA 1X15A 4TWBA 1EA7A 3DEHA 1F2UB 5I47A 2WDPA 1M7GA 4FGUA 3TVYA 2UUAB 2C4KA 3L8GA 4JJKA 2V7VA 4NJMB 1W8DA 1QPZA 4J0JA 2WVHA 2IXBA 3W3AA 4R98A 3TR0A 3ZV7A 2NXNA 4L0CA 1ISSA 2QAIA 4NOKA 2JF0A 3KOOA 2V7XA 2J5RA 3HJTA 4NEGA 1E98A 3AB3A 4B33A 5BQOA 4L8GA 5KYVA 2ASEA 2BGMA 5SYNA 3AJ9A 3BB3A 3N2LA 5A4IS 2GLUA 3BBLA 1MH9A 1YQUA 5L3ZA 2GZ2A 4W8HA 4MRMA 1YDGA 3AVQA 4QGAA 2NU8A 4IRXA 2FK8A 2WVGA 2ZWAA 3GAZA 2D1RA 4N0PA 5K6TA 5B55A 1KH1A 3Q4GA 1SUAA 4MYRA 4GYWA 3AEQB 4BVFA 5ALJA 5F9MA 4DIOA 2FWJA 5CITA 3D8UA 2FEWB 4KXMA 5EHNA 5FAXA 4II2A 4NEQA 4OYHA 5EHXA 1PL7A 3NBAA 1NJ1A 2OWEA 1I2MA 2OLEA 5L3QA 5JROA 5BSUA 4GMHA 1FX0B 3PVZA 2BFMA 3LTEA 1PX0A 1MO2A 3L02A 3PUKA 1I01A 2FSUA 4NK5A 2NIPA 2HJGA 1BS2A 4C0BA 3TMYA 1MX9A 2RJ3A 4YHHB 4EPVA 2ZKLA 5JIBA 2AT1A 3ECAA 3MT9A 2EP8A 4LMRA 4I36A 4YASA 3OE4A 1UJ6A 2YWEA 3U5TA 3UTDA 2WKRA 4IJ5A 2IV3A 3I83A 5BSFA 3KB2A 1BN7A 3OMXA 1P6UA 1AKNA 2ET6A 4FNOA 2IWHA 3CN9A 3K35A 2OM2A 3H75A 4QATA 2AVDA 3W2IA 4D79A 4XEHA 2GN0A 1YXMA 2PSDA 1Z16A 2PANA 2YZKA 1HRDA 3JZIA 4RQUA 3I6ZA 5CVUA 4ZGWA 3N8DA 2HRRA 3N6XA 4RJJA 1PDVA 5CCEA 1P7CA 3G2KA 2PBZA 3REQA 5B7NA 4EP1A 1XVTA 1LJ8A 1T5TA 3AG5A 2VC2B 1NMSA 2BKUA 3GF4A 3VMMA 3B1YA 1U2GA 3G5MA 2ZSDA 4R8SA 3U0BA 3WGKA 2DJIA 4J0EA 5GZ6A 4AMUA 1IRXA 5KKCA 3HM2A 3BULA 1K7XB 4GOND 5HK9A 4V3CA 4Q48A 2GEFA 1KFBB 1M8FA 1T36B 3FMVA 4NCKA 3ANXA 4KFCA 1KI2A 2IYOA 3LGAA 3MUNA 4PQGA 1D9XA 1KIMA 3S8EA 1CQPA 1I5RA 2WD9A 2IGTA 2BHLA 1X8LA 2H2HA 3OZCA 2G1KA 3HJRA 3MPOA 1ML4A 2XOKD 1FXSA 3F74A 1EWVA 4P0TA 3V7WA 4MKZA 4EY7A 5FBVB 4OKNA 1Z62A 4H6WA 4D4JA 1BWPA 3AUYA 3K96A 5LLDA 2VF2A 3V9PA 1SXJE 1RWVA 2PMKA 4P4SA 4WNYA 2V65A 1GGHA 1GL6A 4PQEA 4RJKA 4KWHA 1YB1A 3VR5H 1UPXA 2ZB7A 2JGIA 2O3QA 1L4LA 2Q5OA 2CGEA 4PG7A 2JJ1A 1SHZA 3FWZA 4DQVA 2XEDA 5F1KA 4LQ4A 4KPFC 3AEYA 2DQYA 1E64A 3TRKA 2AZ4A 4LF5B 1B26A 1KJJA 4MITA 3QMPA 2AQ8A 3KT0A 1KQFA 1CQIB 2BDEA 1G60A 1W1IA 3HBLA 4XZ3A 4OKIA 3TSCA 4BQSA 4YUZA 4DSUA 5DNYB 3F46A 4P36A 5DT2A 5B1EA 3O2QB 4YNBA 3TFOA 3TWOA 1WEKA 4YAUA 4MRPA 2OY0A 1JZQA 5FR1A 4IXTA 2YN2A 3ZK7A 5JBNA 5AFSA 3AKEA 1WW3A 1AV7A 3G9TA 3R3VA 3ZE1B 4YXFA 2A1IA 1E9RA 5JBQA 4J7AA 2C07A 4IZIA 4JL6A 3A2KA 1BQ3A 3JQFC 1XJWA 1TVKA 2H9YA 5DM60 4FNMA 1V5IA 2J5BA 3I2HA 3E7DA 1JJIA 3C3DA 1EFRD 4LJ7A 1YC2A 3I4CA 1KORA 3SE7A 4E13A 5BP7A 3GLGB 2G25A 3J7AC 4YQEA 3FZNA 1DC3A 1TCBA 2XKAA 1FY2A 5AVWA 3EVBA 2W2OA 4Q02A 4W9MC 2JC3A 3OY7A 3IESA 4BLSA 2HK7A 4DMLA 3TKAA 4RZ3A 4ID3A 5BMVF 1DJMA 2VP0A 1Y1TA 1EM6A 1Q19A 3COWA 4AYTA 1CUJA 5BVHB 5KB3A 4DDKA 4D9MA 3EX7C 3R0XA 1QC5A 1AN9A 1NBHA 2EW8A 5KWJA 2P6NA 2X23A 1WLSA 1YZFA 3P9XA 2VHEA 1EFTA 2Q1XA 5EL0A 5IT4A 3L84A 4OQYA 3IV6A 3ADCA 1F5NA 4RD1A 5ARDA 5HDBB 1ZSVA 2O05A 5ALYA 4CQMB 1DWUA 4L5BA 1L7DA 1TVCA 3GRKA 4BZQA 3HCPA 2JANA 4PCLA 2WEKA 4Q6WA 1ULTA 3E3OA 1UC8A 3IAS6 5G0VA 1NC1A 4C6HA 4QNMA 4UBIA 4LK3A 1UH5A 2GLTA 3JALB 4TV9B 4Q16A 3KKKA 1F6WA 2H07A 1QSGA 2DHEA 2IOFA 4D8YA 4LVOA 3FFTA 5BUCA 3GLGA 2QG6A 1JYEA 1OFGA 1ZKMA 2QD2A 3DT6A 4QSHA 1IDOA 3BUSA 5BWCA 5BRJA 5D3ZA 1E9FA 3MXTA 2RGUA 3JTEA 3O9ZA 3E7PA 3CU5A 4BMNA 2VDOB 5CYGA 1ZRHA 4CM6A 1RT9A 2D2FA 3QF7A 1QOZA 4EK9A 4IZOA 4D9BA 3ZJUA 1XWIA 5JFGA 1L8LA 2KJQA 2QUAA 3JQ8A 3JVDA 1X7XB 4MNTA 1LPNA 1YZHA 3KXDA 3BWBA 5IKEA 1AB6A 4ISCA 1I0IA 2BZSA 5C4GB 1EFPB 2OD2A 4GX1A 1MABB 3TRHA 1HT0A 2HLDA 2VEDA 2C1XA 2GM5A 3H11A 3RLFA 1I2DA 2VPXA 2P9ZA 4CYMA 1R0YA 2H92A 4U39A 3SVTA 1CDEA 2MMCA 2Z5FA 3DGEC 4LJKA 2YINC 5AQEA 2Y1GA 1J8YF 3DB1A 3ELBA 3KYDB 1IN7A 1P4JA 3A3NA 3Q2IA 4Q5IA 1L1EA 2BGGA 4HLUA 5KTMA 5FLYA 4XM1A 4E4YA 1OH8A 2BHTA 3PQ4A 2OXRA 4JIGA 4XIFA 5FFMA 4B3JA 1T6YA 1YFZA 2H1LA 3T5AA 1OXXK 3T41A 4IJQA 5EJ8A 2OBFA 3LC1O 2JDIA 4YRIA 3WL3A 3ZWOA 3ZVKA 3LNCA 2YXBA 2WWXA 1N2EA 3OICA 4NBLA 5IT0A 4GBGA 5JV5A 2CZQA 4F0JA 2ZYGA 2H8GA 5F51A 4GLFA 1GZSA 3L8DA 1JHUA 4IIBA 5JBIA 2X8WA 3DZIA 4BZPA 4YAEA 1RPNA 5H16A 1U2DA 3T5PA 3I8SA 1RM4A 4LGVA 4ZK2A 1VPTA 4X3PA 1J9ZA 4IG9A 1QGED 3N0VA 2JFGA 4XI9A 3VKVA 1C9YA 1PG2A 3OOWA 1JG1A 3ONNA 1JSXA 1QB8A 2W2LD 3IP8A 3JYOA 2EERA 3OLVA 3W2HA 2J3KA 3INRA 4EYOA 2XGJA 1DJOA 1KK3A 4JQSA 4NYJQ 4OXQA 1EI9A 2ZVDA 3V7YA 4M1EA 3W6UA 2E5FA 5DBIA 5CLHA 5B1DA 2GETA 1E94E 3FNBA 3H97A 3QQ5A 4ND2A 1E2MA 4OK3A 5BORA 2QRGA 3NAZA 3KUUA 3T9AA 5K20A 1LRLA 2OBLA 3FYCA 5ITZA 1ND5A 1V26A 4HB2A 2R1ZA 3PJDA 4HDAA 3OBBA 2W6ID 3KYCB 2X5XA 4H31A 4Q03A 1GFZA 4AQYB 1YGYA 2ZJ2A 2YXNA 1ESDA 1RRCA 3RVPA 3V1YA 1BVHA 3BGSA 3KEGA 4DT1B 4TV8B 3Q3GE 3NB0A 3QBTA 2W2PA 4TZKA 4FKBA 1OFHA 1YNOA 2UYYA 4Y6OA 1SRRA 3IDZA 2CHQA 3HN7A 2IY9A 2IBTA 1E3TA 5DO9A 3Q10A 5F5LA 3V46A 5EA2A 3V1NA 5ELXA 2BHNA 2MTBA 2WTBA 2FZCA 3H83A 1A8PA 4YLGA 1GG5A 2REBA 4X6UA 1GGKA 1A5ZA 1T1SA 2NZVG 1S9HA 2Y2VA 2GZDA 3FCEA 1X7WB 1HKHA 4V0RA 4DQDA 2V3VA 3COJA 4WXEA 1JFSA 5CNMA 1BA2A 1OYWA 4WDQA 5K09A 2WUDA 3GL9A 4C20A 1C8BA 5T5QA 5K0CA 5J2UF 3RSCA 4LF4B 3GDOA 1NATA 3IE1A 3BXPA 4JGGA 2XBLA 5I3CA 4EUHA 3PQ7A 2Z56A 3UAYA 3DE7X 3PFNA 4MV4A 4WA8A 4BFWA 2VQFB 2W8ZA 4XRRA 1CFJA 1NUQA 3GGPA 1YR1A 3PP8A 4FUQA 2OESA 1HEIA 1RD4A 1DXQA 4GM0A 4JJEA 1VJGA 1GA1A 2QSUA 5AJYA 4M21A 3C5WP 5EJ4A 4WHMA 1U0EA 4AF6A 4LJSA 1QFJA 4Y1RB 3VO8A 5IH7A 2P62A 1JALA 1DAMA 1OQAA 2PX6A 3O8LA 4KAAA 4DLSA 3TPCA 5K8JB 1FDVA 2OPHA 5J1TB 2V98A 2ZOSA 4H59A 3F7MA 4KQ1A 5FV7A 4U0JA 1MG0A 3VSBA 1N9KA 5JWRA 4GP7A 1JQJC 3W5AA 3D6MA 3CZ9A 3IQFA 1NQUA 3SBOA 1PJAA 1KE1A 4KN8A 2EYUA 1PEAA 4Q34A 1NSYA 1E2NA 2FPSA 3CJRA 3EWSA 4L27A 4LHYA 3W77A 3G8DA 3ESYA 4UUPA 3V4RA 3SU8A 2HT1A 2QRZA 2VDRB 1NPYA 1UZNA 2J32A 4HEA6 2C7QA 3EAFA 3IQHX 2QMUA 4XFDA 1M8JA 2WSSA 3DBHB 1TO2E 5B6JA 1CUCA 3H1EA 2KQUA 1HE3A 1UF9A 4I3FA 1UC4B 3EQ6A 3V4SA 1U4SA 3NYWA 1WWKA 1SUFA 1SCAA 1Q16A 2Q7XA 3RD5A 3ZJ5A 3IQWA 4YRZA 5EIFA 1CWUA 2ADMA 2FLKA 2NO5A 2QRHA 3DOFA 4XOUA 1PWZA 1AGRA 1TEHA 4FC6A 4LFCB 2Q5EA 3A58B 3R7WA 2JARA 5T3YA 1N5IA 3ICCA 5ALHA 1YOVA 5CR9A 3ZWPA 1HSOA 3X1ZA 3U4CA 1ZVQA 1T5DX 3REFA 3QVXA 1MB4A 4MEBA 4ZMBA 2XYGA 2XF8A 4I1OA 1PFYA 2GPSA 3BEOA 4UZEA 4DR7B 4AMZA 3VKGA 4R01A 2IUUA 2YXPX 5BUSA 1U04A 3MRSA 4Z9YA 3D8RA 1TO1E 1Z5PA 3TNLA 3WLQA 4EW3A 3I76A 2FETA 3L7NA 4YT5A 5E3IA 4F04A 2G1UA 1EUQA 5JZSA 2JHAA 4E03A 1XTIA 1JYSA 5D00A 1ZRMA 4NXNB 2HWXA 4PCVA 1C9MA 3LQQA 2VKQA 3MXOA 2PJRA 3C1AA 1YUBA 5CT6A 4EMTA 2V6GA 4Q7KA 1XPUA 1XNRB 3DAOA 3OOEA 2DWPA 4GIBA 3FPGA 1HSZA 2ODAA 3LD9A 2HA5A 2C83A 1KRWA 1IN6A 5EXTA 2DHCA 3DMPA 1TM2A 1FVFA 3T6KA 3ME5A 4EAAA 1X7HA 1UOOA 1NDHA 1T3SA 2ACWA 2CXRA 2GAAA 2PPLA 3PCRB 1OXSC 3HCWA 3TMKA 4BCCA 4ER7A 4B46A 2ATCA 2DYKA 3UW3A 1GNSA 2XMBA 2VK1A 2Z04A 3LY8A 1L2TA 4JOQA 4RC9A 4XYEA 1PT6A 2HH9A 2X6TA 3HH8A 1RBMA 5BSRA 4B82A 5DGDA 3SJ7A 1SVOA 4Y6RA 4FK8A 1LX6A 5B64A 4UHCA 2V3CC 1Z5UA 4KDRA 3JQ7A 1LLCA 4MQEA 1JHXA 4CMJA 1ENZA 2VXBA 3CZ4A 4HKTA 4F7WA 4COOA 4YAJA 2VWGA 1Q1AA 3G3EA 3RK0A 1KWGA 2Q3BA 2VJQA 3UOWA 1EWTA 1BNCA 2E4XA 2YHBA 4MICA 3T5CA 4B17A 5C1DA 5IXJA 2GO7A 3KX2A 3D0QA 5GJWC 1BXRA 1E92A 1G41A 2GMWA 3AL2A 2JGMA 3FWKA 2IIBA 4TMVA 5AJTA 4F4IA 2VRWA 3GPCA 1XAGA 2LIVA 2YWXA 1QKKA 1OPRA 3FTDA 3X43A 3DBRA 1U7OA 2Y68A 4WOKA 4C7MA 4LRSB 3CT4A 4KV7A 5ABPA 5JASA 2C2MA 3ERCA 1V1RB 1E18A 1Z38A 1P62B 1Z6PA 2VHTA 3V8VA 2WP0A 5CG1A 5JAHA 7MHTA 1CULC 3W8RA 3F3SA 3TLKA 4JQYA 2F62A 3OJEA 2XXAA 4Z8XA 2GNOA 1WHSB 5A3SA 1EFVB 1RLMA 2VG8A 1YJQA 4NFLA 4K9PA 3UFXB 1I36A 5BN3A 2ZVJA 2MYTA 4P31A 4DZZA 1A4RA 1BH6A 1H2BA 1U7WA 4TLBA 3KIPA 1U5CA 3L7BA 2VLBA 3B3JA 4RGQA 5AW1A 2QTBA 1GKYA 4GQIA 5IEJA 4G5QA 2EEPA 5IM4A 3PEFA 4X61A 2F8TA 4AU1A 2GD0A 4EZEA 1OREA 3I72A 5C80A 2XTZA 3D43A 3LX5A 2AMFA 4NJEB 1SIBE 1DZIA 3L4JA 1DEAA 1EM8A 2XUAA 3THYA 1NZJA 2HHHB 1YU9A 1WNTA 3IKMB 2NUAA 4HJRA 2CJPA 4HGRA 3H2HA 3N0XA 3RHSA 2Q5LA 3S2IA 5H70A 3T3GA 4IPTA 4KPYA 3STWA 5KAPA 3W8EA 4Q0MA 1ZNWA 2QN9A 3DPIA 1HNNA 1RVV1 5BN5B 3F5FA 4REMA 1QM5A 1TAQA 2ENUA 3HMKA 4S2UA 1IY9A 1M2VA 3WIOA 5LSAA 2CCJA 1ZCJA 1JEJA 2AR7A 4Q3CA 2P3LA 5F76A 3GOQA 5JDCC 2J6IA 3HDYA 4LNHA 5HF6A 3ZLVA 1KKMA 4DCTA 1KY5A 1B0AA 3OQIA 1VQ1A 2EDCA 3R5SA 1RACA 5TNXA 5H3HA 1ZVMA 4F9EA 5KJCA 2NWQA 4CNBA 2GBCA 1FOEB 1MDFA 3BIWA 3G0CA 5KYTA 3Q3JB 3QBVA 2GD6A 2V7QD 3WIEA 5JEEA 1E1QA 1XNHA 2GO1A 2BT4A 2C92A 3BCSA 5CX4A 3GFOA 1K7YA 1USKA 4Z9XA 3R3UA 1JSCA 4PC2A 4PTYA 3U3KA 4MV3A 1FRZA 1KI7A 3WIBA 2C9CA 3OPXA 1V43A 4CMEC 1IXSB 2HF8A 2UUPA 1NLUA 2X3UA 3D7MA 5ELLA 1LNZA 4NBKA 4HATA 3U56A 3QKRB 1A97A 1U3FA 1GL3A 2NU7B 2ZI3A 4G97A 4CKBA 4RA6A 2JEOA 2F4NA 3G0GA 2ZRFA 1TU0A 1AGYA 4NNJA 5IMSA 2OGWA 2VI5A 1WIWA 2GDZA 3FPSA 3N3BC 4FYYA 4IGFA 4URXR 2VRNA 2UXDB 1F12A 1RQGA 3IEPA 3JQQA 3HC7A 2H29A 2COEA 5JW6A 5A02A 2LBPA 2YL2A 1M8PA 4OHFA 1LSJA 1O4WA 1ZXXA 3ZWDA 2VPZA 2BFFB 1J2EA 2PWAA 2ZIAA 4YQYA 5KPDA 1RXCA 3COSA 4B6SA 2FE4A 3DEAA 5F35A 3KVOA 5CA1F 2VDNB 3MWDA 4ZC8A 4W5WA 2D3WA 4Q3EA 3WZLA 1W47A 4YMVA 4H3VA 4II7A 2BCGY 2EKLA 1QTQA 3NVDA 3R7LA 4F6CA 3LLMA 2O19A 1E66A 4QNRA 3ROQA 5B7QA 2QMZA 1AQNA 2QMOA 2WHQA 5FQOA 2GXUA 3QU5A 2BI8A 1LQ2A 4KIFA 4I4TA 4X91A 5CFZA 1SVSA 1YFKA 3RFXA 3F71A 3R6LA 1ONSA 4GRDA 5C8YA 4AWBA 1IH8A 5IZCC 1YU6A 4HX2A 1C0PA 2CFCA 2FKNA 3AHCA 3VC3A 2WQ6A 1PTJC 3QMVA 1JR3D 4WNIA 1V37A 4YDSA 5DCYA 2WPDA 3EVGA 5AM2A 3UCXA 1CF4A 2V7BA 4P6VF 4G8JA 1M72A 3L8EA 1WXWA 2X1HA 4WCFC 3UKOA 2PAFA 2HPAA 3MTEA 4AUMA 1J0XO 1SQFA 2HL6A 2DFDA 3AB8A 4JASB 3E18A 4HAYA 3IALA 1XE3A 1I2ZA 1QF7A 4RHCA 4XWWA 2VH2A 4ML3A 3C74A 2C2ZA 2VK2A 4W63A 1CDZA 1A9XA 1ZA1A 3DLHA 2ZP1A 3OC6A 1P0QA 2NX2A 4ALNA 3FX2A 3AOEA 4AECA 3I9V1 4OY3A 5HQTA 2I2CA 3WYNA 3PC4A 2FNAA 5LUBA 3W2EA 1WX1A 5AKEA 4C6RA 2P3SA 2I9PA 3VNAA 3TFQA 1RXIA 2A94A 2Q5JA 1XD2A 3W0LB 1KXJA 4DKJA 4C2TA 3EXIA 3PYMA 3FKSD 2QN7A 2W83A 4QUGA 5IN5A 1Z45A 2AJTA 1EDDA 1RCTE 3D3KA 4UBLA 2DC1A 4AJHA 1IB0A 4YCMA 5HZMA 5F9FA 1HWYA 3IP5A 1QR2A 2W6QA 2V3WA 4KLRA 3NHBA 3E58A 3DG9A 3CEPB 5C35A 4BVJA 1KBOA 4G0XA 1IVYA 2YRWA 5F7ZA 3CPSA 4RPGA 4ZCQA 3O8CA 2Q8QA 4WUVA 5EFOA 3V1MA 3GEIA 3AHJA 1ZZGA 5FH9A 3TOSA 2VTBB 2P1DA 3SIPA 5JCXA 1S3IA 4TXHA 4XSVA 1E32A 4Z54A 4DA9A 2VCHA 5K4GA 4QREA 1N3YA 2CY0A 1L0BA 3U19A 1MXFA 3DOEA 5FOUA 2FGJA 5KCMA 5TC4A 3W5JA 4HFNA 3ER6A 2P11A 1N5MA 1Y8AA 3DE2X 2GEBA 1U0BB 2D4HA 3PJFA 3Q7TA 1ODIA 4MW9A 4X63A 4DWWA 2SCUB 4FSXA 4QBHA 4D82A 2QU7A 1WBBA 1YDEA 2HJWA 2P4QA 1XK7A 1AS0A 4MMZB 4YMUA 1L5OA 2E3JA 3GUUA 5J4YA 2QP9X 4RJTA 3GP3A 3WJ7A 2BGWA 1T1JA 2K5UA 4EYSA 5JMTA 4C4YA 4TLMB 1CCWA 1UKBA 2EJCA 4RSMA 3P0EA 2WM3A 1Z4MA 4GP6A 4PSVA 4X1KB 1HPLA 4AIIA 1K6XA 2DB3A 3G2MA 1L6RA 3I53A 1PF7E 1RADA 3E05A 2BEJA 3ITEA 1FF9A 3LECA 1GRCA 2YS6A 3Q3VA 3TD6A 4BO8A 5F5NA 4DJ5X 4EI9A 3EG5A 3HYCA 3RADC 1LW7A 1GJRA 5JZMA 5CCBA 3S2UA 3ZHSA 3N7UA 1UAAA 2I6GA 2QZPA 2BELA 1G9XA 2C5AA 5T4BA 2DCUA 3CW2A 3DMFA 3LQ2A 3MRTA 1Q7TA 1YVDA 4G5FA 3CY6A 4G84A 4NCNA 3PQEA 4LFBB 2IDMA 2NSLA 4WD3A 3T38A 2CLCX 1E4EB 3DF7A 2HHLA 4V2IA 4MRRA 2B4TO 2OO5A 4PIVA 5AT1A 1LWNA 1U11A 2PQ6A 4HRVA 4QUKA 3A70A 1VZ3A 3GLUA 4RQBA 3ZWXA 4AKEA 4O2BF 4QNNA 4EHAA 2AQIA 4ERXA 3J80A 1JFLA 3TOXA 1H1LB 2H2WA 1G3MA 4GZ5A 1QKJA 3GJ0A 4K8RB 4B73A 2UZ3A 2IYLD 1R74A 2GJ8A 1FNNA 2W98A 1NVFA 2A5GA 4HC4A 3WA6A 3SPXA 2IXEA 3WGZA 3R0QA 4Y0AA 2ZJ0A 3SZLA 4H7EA 5K3OA 5KZMB 4OLAA 3GVPA 1KETA 4P92A 4JI6B 3TSWA 4AL4A 1W25A 4DEXA 4ND8A 2OCBA 1Z0SA 1LK7A 4V02A 4AZVA 3AXSA 3P32A 5CFRA 1P74A 1MW9X 1Z6XA 4UM5A 4KO2S 3QXXA 3B13B 3QYAA 1IZYA 1JUDA 3DWIA 1QHHB 4QTZA 4W5HA 3GPBA 5E4YA 4CG1A 4E32A 3D6UA 3AESB 3EOAI 4PXAA 5K3FB 4RTKA 5KO2A 1H4SA 2EEZA 4Z99A 2G72A 3WV5A 1XLVA 3S1AA 1T4MA 3TL6A 1YL6A 1JQEA 2YWBA 4MVCA 3V8EA 1RWOA 1SC3A 1K63A 1WBJB 2PVPA 2YFQA 3PIDA 4JLMA 3K0SA 3OIVA 4GAEA 3TE7A 4XVUA 3ZGOA 3CGWA 1HA3A 3K9WA 3MGCA 4CUKA 3IH5A 2P91A 2QJWA 1LDMA 4U2DA 4O2RA 4RXMA 1NY6A 1ZCAA 4DJDC 1QO7A 3C6XA 4F84A 2ZYIA 2B1RA 1YC5A 2IOQA 1EGMB 2ODNA 1JDNA 3DULA 3OI7A 1DEXA 2G0NA 1ZM9A 1CY1A 3I4FA 1GZ6A 2OKGA