3SVLA

Structural basis of the improvement of chrr - a multi-purpose enzyme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
181
structure length
181
Chain Sequence
KLQVVTLLGSLRKGSFNGMVARTLPKIAPASMEVNALPSIADIPLYDADVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVIDQGTLDHLTGQLTAFGEFIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yieF
publication title Crystal Structure of ChrR-A Quinone Reductase with the Capacity to Reduce Chromate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 58
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3svlA00
4PTYA 6NULA 1QRDA 5LJLA 3OVMA 4N82A 4PTZA 1FLDA 1D4AA 2X2OA 2OYSA 5TGZA 4N65A 3NHLA 3R6WA 2ARKA 2KLBA 4Y7CA 1AHNA 4QOJA 5LLDA 2B3DA 3ESXA 3FVWA 1C7EA 2QMYA 3TE7A 4S24A 3KLBA 1RLJA 4GQIA 2MT9A 5F4BA 1NNI1 3F6SA 1BU5A 4QOHA 2FX2A 4YALA 3G5MA 3F6RA 1YDGA 1QBGA 4FX2A 4ZVLA 3F2VA 2W5UA 2QX8A 2Q62A 2D5IA 4ICIA 4BMOB 3O2NA 1D04A 3W79A 3OJXA 3LCMA 4H2DA 3UXHA 3ES9A 5B3LA 1AKUA 5ULLA 3W78A 4HEQA 3GFSA 2QX4A 3OX3A 5LBTA 1E5DA 3S2YA 1RCFA 2MOKA 1ZWKA 4FGLA 4DILA 1SQSA 4ZVKA 1FUEA 1RLIA 2Z98A 4J8PA 4CETA 1CZHA 2XOEA 3NHRA 5FA6A 1T5BA 3OX2A 2XODA 3U7RA 4YQEA 3N3BC 5NULA 2FDXA 1H69A 5B3KA 2R96A 2BZSA 3GAMA 1H66A 3FNIA 2OHJA 2QX6A 2WC1A 1FX1A 2FAXA 1DX9A 3NFRA 1AKQA 1DXOA 1AZLA 3GFQA 1AKTA 4BMPB 1WSWA 5FUQA 1AKRA 4LTDA 3LT5A 4XDGA 5EA2A 4FGKA 3P0RA 5LVAA 1VMEA 1WSBA 1JA0A 4U7HA 2AMJA 1OBOA 2Q9UA 3D7NA 1J8QA 1FLNA 3L9XA 3B6KA 5F12A 2BPOA 1J9GA 1JA1A 3B6IA 2ZKIA 2Z9DA 1TLLA 1FTGA 5LBUA 4ZVNA 3TZBA 4CF6A 1XYVA 2R97A 4D02A 3SVLA 3N39C 4C0XA 3L9WA 4F8YA 1FLAA 3EDOA 2GSWA 1CZUA 1CZRA 4DY4A 4Y9RA 4Y9UA 1OFVA 4C14A 1V4BA 4OXXA 3NHPA 4M0CA 2FZ5A 1J9ZA 5EMNA 4ZVMA 2HNBA 4QOGA 1J9EA 2X2PA 4GI5A 4ESEA 4LTMA 4QOEA 5NLLA 5FX2A 3U7IA 2N1MA 4LAFA 4PU0A 1FVXA 5LJIA 3HLYA 4U7FA 4H6PA 2HPVA 4NULA 1OBVA 4QOFA 1RTTA 1AKWA 2RG1A 1KBOA 4YAUA 1F4PA 1AKVA 3FX2A 3FW1A 4GR9A 3ESZA 2FCRA 1I1OA 3B6MA 1ZX1A 1YCFA 1TIKA 3B6JA 3HR4A 2FOXA 3W77A 3UXEA 1BVYF 2V9CA 3F90A 3N3AC 3NHFA 4XDHA 1AG9A 5EAIA 4C0WA 1B1CA 2MWMA 4N9QA 4YAWA 2OHIA 3GFRA 3NHSA 4C76A 3O73A 3NHWA 3JSXA 1X77A 3OX1A 3QFRA 2Z9CA 2V5VA 3OJWA 2BN4A 3K20A 1C7FA 2FVXA 2F1OA 1GG5A 3ESYA 5BUCA 2QX9A 1DXQA 2A5LA 1T0IA 1CZKA 4YAOA 3ZHOA 1XT6A 2MTBA 4NLLA 2M6SA 2Z9BA 1CZNA 3NHJA 1XYYA 4QODA 3RPEA 2QMZA 3W7AA 5LMCA 3HA2A 2BMVA 1XI2A 1QHEA 5F51A 2V5UA 4LTNA 3FJOA 2M6RA 4QOIA 3QFCA 2BF4A 2QWXA 4YAFA 5A4KA 3EYWA 3QE2A 1YKGA 2OHHA 1CZLA 4FGJA 1D03A 4U7GA 2QR2A 2HNAA 4DIKA 3NHKA 1FLVA 3NHUA 1KBQA 4HS4A 3NHYA 3NLLA 1AMOA 1YCGA 3KEGA 1YOBA 1QR2A 1SG0A 1YRHA 3KAQA 5JROA 2FZVA 3OWXA 2FLVA 3KAPA 4R81A 1CZOA 2KQUA 1YCHA 1ZWLA 3K1YA 3OWHA 3TEMA 4LA4A
chains in the Genus database with same CATH superfamily
2R2AA 1MVNA 5K45A 6NULA 4DT1B 4DDUA 4KPYA 4OJTA 3BHIA 5BPFA 4YAKA 4N0DA 1NASA 4QTYA 4TMVA 4ALLA 3HHPA 1ECGA 4YYEA 1GCUA 3L7CA 4MQEA 2OYSA 1RHRA 1CYEA 2P9CA 2J6CA 4LI3X 5FEUA 5GJWC 1YC2A 5ERYA 1QQ5A 3ZNOA 1XZPA 1JJFA 2NGRA 3R6WA 3UW3A 1B23P 1XRNA 4EKIA 1IXRC 5EINA 4TMTA 2ONCA 4MW4A 3TSZA 3DHYA 4QOJA 2DVMA 5D5HA 1VCHA 5JC8A 5T4BA 3DLPX 2LKCA 5I9LA 5JEEA 3JV7A 2O0JA 1GDTA 1FRFS 3COVA 2ZBQA 3UANA 4DJTA 3A37A 3AHHA 3M6WA 2FTKE 2A3RA 3FVWA 3UWSA 4FM9A 4LUCA 1J0BA 5DCUA 3TE7A 4TV8B 1VSTA 2I6QA 2PKXA 2UYOA 4S24A 4FDLA 3OFVA 4NZOA 5LA6B 4JI5B 2WG1A 2VWPA 3BRWA 2JI6A 4TKVA 4AF8A 3IKMB 3MB8A 3RLFA 1E63A 1OX4B 3GLHB 4P84A 3GU3A 5DRYA 3CF6R 3V6MA 3F6SA 5A4MS 3BC1A 2GO1A 3OP1A 4XRRA 1PT9A 4PRKA 2NTNA 2ZSKA 4LJYA 1TM7E 4D8TA 3VPXA 1TCCA 4FYPA 2P35A 2ZE5A 4MQLA 3RS2A 3IAM1 1PFWA 1YJXA 3P2MA 4BWFB 5MGNA 3OT5A 4HDKB 2IEGA 2GN9A 3GVHA 3IDOA 1S7CA 4P93A 1L6IA 1P18A 3F2VA 4KR9A 1KDRA 2W8BA 3RSFA 4AJ4A 2JI4A 1QR6A 4LJ9A 3HTXA 4RK1A 4K2HA 3E2PA 2QMQA 1FYWA 4RLHA 1CQJB 2RKBA 3R7DA 4DQXA 3P45A 3R0ZA 3CKKA 3T7RA 2CF5A 3TTXA 5KMGA 2AC7A 2D5IA 5FOXA 3I2HA 4BMNA 4TYNA 1AZWA 3EZLA 4OFXA 5GOZA 2ZUDA 1GV1A 3ZXIA 3AESB 3B5IA 4AS3A 3OT4A 2R68A 3ENQA 1Y3IA 1MD9A 4O25A 4B2LA 2A9OA 5CDSA 3S29A 4GOJA 4B17A 1A88A 5JAOA 4E03A 3ZNPA 4D42A 1BXGB 4BO6A 3KJQA 1Z5NA 4UVEA 3MELA 4IO1A 2H4YA 1MC8A 4JOQA 2I03A 4KLRA 5TPWB 2I91A 4CFYA 1BHO1 1A72A 1S3FA 1MQ9A 1OHHA 4DWWA 2YIMA 1XVVA 4WDQA 3C74A 1ZOPA 1DG3A 2A14A 1HEYA 5EOVA 2BCGY 2XGSA 1OWOA 4GZ6A 1GEGA 2BZGA 1MX3A 4Q48A 2XITA 1P73A 1GPNA 4B7AA 3MA0A 4KRGA 2QZJA 5EMMA 4H77A 3NFYA 1ZD2P 4DCJA 1XNRB 2IYOA 1QFJA 2PGOA 2OAP1 3CUEF 4WZBA 4CU2A 2IOFA 5KYNA 1YZKA 1FUEA 1LZKA 1NAIA 1GTG1 3MTEA 2QTLA 4R9NA 3SHTA 1I9CA 2J9RA 2FN9A 2AN4A 2BCEA 3LI2A 1G5IA 3LUBA 3UEOA 2BFDA 1A76A 1AUXA 2QL9A 1H85A 1XZMA 3BQ9A 5IHXA 4KX3A 3ZE6A 2PU5A 2UKDA 5ALTA 1PD0A 2GN4A 3MLBA 3PNQA 3H8WA 1MO4A 2IYAA 1T1RA 2ZI6A 4HMOA 4NHOA 2WAOA 3FD8A 2Q7XA 3VU3A 2WSBA 4XVHA 2H65A 5I6DA 1SOAA 2BWJA 5LNK1 1QOZA 1N25A 5FA6A 3HXOA 3EPJA 2Z95A 5FJJA 1R9MA 2Q3BA 2P91A 2XF2A 4UBMA 5AW6A 1MKYA 1P2TA 5DNCA 5LOVF 1C50A 5DZSA 3GLFB 3I5XA 3GARA 3G5UA 4KWHA 1MHPA 1XQ1A 2QLMA 1RMTA 3OJLA 4K46A 4M9ZA 3KXDA 3R20A 5CPBA 5A6VA 1C3XA 5KVVA 2ZR7A 5TMEA 2BHSA 3GUUA 4OHPA 4MRSA 1AJEA 1G5RA 2JNWA 5DYWA 2JAUA 4C7MA 1PWHA 3FVVA 2WFLB 3LXUX 3V6LA 3CLKA 4C07A 1QQTA 1FX0A 1KF0A 2WD7B 3SNKA 4B81A 4JKYA 2XDAA 5BSHA 1TZMA 1ISGA 1JQAA 2GF2A 2NXWA 2VYFA 4MUGA 2WJAA 3BBLA 4EVSA 2RGWA 4S2EA 3KLMX 1D6SA 4GMGA 2O7SA 1BDJA 3GFFA 4J2HA 3T5PA 1UM9A 3JAKA 1UPBA 4XD2A 1OFUX 5HIJA 4H1UA 2C4UA 2Q21A 3DL7A 2NV0A 4KXMA 4LGYA 1J2RA 3CB2A 2X9LA 4YI5A 2YJ5A 4NCXA 4B4KA 2C7RA 4OLJA 4C6SA 1TQ6A 4BP1A 5A3JA 2Q1XA 3LOPA 4RKEA 4QWMA 3STHA 5CA1A 3M6FA 5FNVB 4A36A 4HYYA 3I6BA 4PLCA 3B38A 2DH5A 3T9EA 4KIGA 3BE6A 3QQPA 5DCLA 2REOA 1L1EA 3PTAA 4EEZA 5B5SA 3HP1A 2C57A 4XARA 4H7KA 3LZDA 4DQUA 3EPLA 1C0KA 1NDUA 2Z56A 2ATEA 2TYSB 3AI3A 3DZCA 3FRHA 3S68A 3HN7A 3P19A 5AOAA 3LA6A 5JXHA 3D1VA 4JOSA 2XNDD 1IXYA 2FZKA 2R751 2I1LA 2ZSUA 4BS9A 3EUEA 4XUCA 4DN6A 5IF3A 5JY1A 3G0DA 4C7OA 1C0LA 5C8DA 1PWEA 4X71A 1FUYB 2FNAA 4ZP1A 2O3RA 3BCHA 4GSYA 2EQBA 4ZQGA 3CUUA 3I9JA 3JZAA 5THKA 3SF8A 3ZD8A 2HA4A 1FYEA 1FE8A 1WCXA 3L9XA 3LQRA 5UKDA 3WC4A 4JAVC 3L1VA 4OL0A 1AQJA 1CTQA 3OUTA 5EUQB 3GLGB 2O8BB 1QCDA 2C97A 1DLJA 2RAUA 3TUJC 1JMKC 5TEVA 2CCKA 2Z4RA 1T2VA 4PQRA 3MRSA 3PQFA 4JC0A 4GKBA 5EWMB 5FHQA 4MUXA 3WFZA 1QQBA 1XWWA 2QL5A 1FTGA 2ZYIA 3HGTA 5D01A 5HQ3A 2X1HA 1WXIA 5BYAA 4CKCB 1RD4A 1N4DA 1NJFA 1HX7A 3D2BA 2OBFA 1T2AA 3DZ8A 5EMHA 1U99A 2H08A 3X1MA 4B6FA 2VDUE 2HA0A 1KJZA 2Q4TA 4IUCS 4PYNA 2XMCA 4UREA 4Y9TA 3O26A 5F1OA 5IC6A 2GCPA 2PWAA 2IL1A 4R3UC 3FFXA 2HH9A 4LOIA 4LZNA 1DXYA 4RUKA 4PG6A 1X7YB 2JEYA 2P75A 3GGPA 3OJEA 4KXVA 4ZALA 3Q6IA 4BNIA 4DMGA 5KO2A 3SDBA 4XIIA 3R2JA 1XMQB 1QNLA 2AN1A 4QLOA 1O77A 4N7BA 1A8HA 3DLBA 3VVCA 2XSZD 3UKOA 2OFFA 1WW8A 1KDZA 4CW7A 3KSMA 3UY4A 3B1XA 3ETCA 4QPCA 7GPBA 1O08A 1GGFA 3O84A 1X42A 2PX4A 3CR7A 2DR3A 3VDQA 1T6YA 4OMFG 4OXXA 3SE7A 4TTRA 1YB4A 4PNPA 3IUJA 2V7QD 3C15C 4J90A 4DA8A 3FETA 1XZGA 2PXXA 4M76B 2D13A 4MCIA 4HKTA 2WAMA 3TD6A 3NPMA 4O4IF 4AZ3A 4B5LA 4C3VA 3W5BA 2X77A 2DQKA 3I9NA 2MR5A 4K2AA 4XASA 3RJTA 4HNRA 3DPSA 3USCS 4LK3A 1R9JA 1FNSA 1CKEA 1T3SA 3D6HA 4OSOA 5LL6P 1KY4A 3JARA 1ZYUA 3QTLA 4LC0A 1JV2B 4ZGBA 2XCRB 1IJEA 1C7RA 2C84A 2LE0A 1BKSB 3AXSA 1YL6A 1DC5A 5HE8A 2I7TA 4E15A 2GLXA 3TLEA 4JSYA 2Z1MA 4LOJA 1B4DA 3C4VA 1FMLA 2HJSA 4YLYA 2X1VA 5ADHA 4PVDA 4COOA 2P5SA 4Q4CA 1A8QA 4QRHA 3U4DA 1K2VN 4FD2A 4EY4A 4K9LA 2ZDHA 2HX1A 2IGBA 1DTWB 2A0XA 2J6BA 2ENWA 3SBOA 1GJRA 3BFXA 5K8IA 4Q3LA 1SXQA 3ZH2A 1EFVB 3DF9A 3OPQA 1HL3A 4U02A 1L1FA 2G83A 2WE7A 4P0TA 1DO8A 4FOLA 3WWOA 3KQNA 1RRMA 1YJBA 1PJQA 3QLJA 4P4LA 2G0AA 5EE1A 2JLAA 1ICIA 2FPRA 3V97A 1NRJB 4C01A 1AUVA 4HLCA 4LYDA 4N0MA 5LNK6 1G4AE 4FBLA 4MRAA 5F2NA 4FFNA 4B83A 4KU4A 3RHZA 1NVVQ 3KJZA 3GHYA 1ZX1A 4PX5A 4D0RA 1KO1A 1XDDA 5EIAA 2GZ1A 3NM6B 1VHJA 2GWRA 4WLUA 2H1RA 1E3DA 5ESRA 3FPBA 2VWQA 3PVCA 1II0A 3ECCA 1XJCA 3FM9A 4IGEA 4M9QA 3CR3C 5LBIA 3KOMA 4EUNA 3JWEA 2WF6A 2EG5A 1JTFA 2QZ9A 1E3SA 2H2FA 1GTZA 1SZPA 1M76A 3KZ1E 2MJLA 1FFCA 3OWOA 3NAQA 3IYLW 4KE8A 1PE0A 4HXGA 5A62A 4RL4A 5EAIA 4BLVA 3SKXA 4F4JA 1X7GA 1EE1A 3DXZA 4N5MA 4CMAA 1KJWA 4JLPA 4XW2A 5HKKA 3MGCA 1QE3A 4ITRC 2WWRA 5AYVA 1YU9A 2SKEA 4FR0A 4KE6A 3DPIA 4RF4A 1RYHA 4CBVA 1C0PA 1PBTA 2HL6A 3PRJA 5BV2P 3A1NA 5JALA 3S1LA 1X39A 2HKIA 5DOZA 1IJFA 2C2MA 4OREX 1X7WA 2FRDC 5IAGA 1EP3B 4CKBA 7ABPA 2PK3A 1RPZA 4KFUA 4ZO6A 4B48A 1FNCA 5D85A 1M2VA 1CEEA 1CHDA 1XNJA 5LDDC 4UUPA 2VJYA 4NYMQ 4WCVA 2FDCA 3KOZA 4I6EA 2FPSA 3FLEA 3VISA 2H1OA 3TSOA 4INOA 1BRMA 1XTIA 2PX6A 3H4VA 4TGLA 1N2EA 2PFKA 3GT0A 3TCNA 1Y8RB 3HNOA 1PJ4A 5G0TA 4PCLA 1SJ9A 1QLJA 1SQ6A 1Z3CA 1UT5A 4NK4A 5FBLB 4DV0B 2HO4A 1M7HA 1US8A 3DD5A 1DRUA 1Q1BA 4UUBA 5C8YA 1OU0A 1KI9A 1ZUNA 4MWCA 3NIWA 1A4UA 2OZKA 1TW2A 4WBNB 4P38A 4PYKA 1QJ4A 5ALFA 4YXWD 2FOLA 1ML4A 2P3SA 1E7YA 4R3WA 4FOOA 1Y4AE 4MWEA 3DE6X 3IAS6 4F6RB 5B4UA 3OKAA 1W47A 3UMVA 4NYIQ 2R1VB 3KSDO 5ITSA 2CNDA 3SZLA 4C0AC 1X80B 1KHHA 3MCWA 2XD9A 2NZVG 4DIDA 2EBHX 1WA5A 2BBSA 2OA0A 1ODSA 4MV0A 4NS4A 1GM5A 2AJLI 1CX9B 4L6CA 3TW8A 3ZY4A 4NLLA 3DZHA 3FNEA 5IC5A 2OM2A 1YHYA 3EQ8A 2YY5A 5ADWA 1W2WB 2B7LA 2GAJA 4OQPA 1VI2A 4DUYB 3RVQA 5AW0A 1RR6A 3V9AA 1JJBA 4G84A 3GXOA 4QUDA 1RYFA 1RQLA 5F2OA 5C3MA 3DYBA 4B3SB 1LB1B 1P4HA 1KDVA 3VR5A 5AM2A 2AI1A 3HKBB 4MJ7A 5CDUA 4G01B 4MMXB 1C3OB 1YSCA 5AH0A 6ADHA 1QYWA 1N5RA 3IOBA 2YRFA 2C3MA 5DGDA 3O8OA 3L05A 4LWZA 1EUQA 1NRWA 1EB8A 4BTEA 4EA8A 4JBNA 5JBIA 2HF7A 4KXQA 3VAYA 1B93A 2YKGA 2LR0A 2A5YB 2IF0A 3UYLA 3EASA 1LBSA 1XTUA 2I3GA 5EE3A 1DBPA 1K5PA 1LFDB 1R0RE 1SKAA 1Z26A 4JDPA 5CGZA 1GP2A 3WGMA 4YRAA 3OJ0A 5DN6D 5JUWA 2J85A 3B53X 1NBMD 3DAYA 5KU1A 2CWDA 2GZRA 5CA1F 1POXA 3AF1A 5INTA 1Z38A 2J1LA 2JVJA 3TRHA 1U7XA 5KYXA 1SZJG 1CJUC 2QNBA 4FGZA 4B4UA 1EM8B 2XGJA 2MSKA 1KMIY 3EAFA 3NEYA 3DTVD 4QU8A 3W1VA 3W3AA 3OIDA 4L15A 4LXTA 3TM4A 4EMSA 4TS4A 4ZK6A 3WJAA 2CB0A 3RD5A 1PSZA 4B85A 3TSCA 2RI1A 1JG4A 3RU9A 4BFUA 4EG7A 4RF5A 1QFMA 4Y2RA 4BJHB 2XUOA 1SELA 4IRXA 2AQIA 3U1TA 1JECA 3QI2A 4MVJI 2D8AA 1V5FA 3C5EA 5BXYA 2AGVA 1X6VA 1ZOLA 1XRQA 1DV2A 1XMVA 3ESAA 2AUNA 3MTQA 1B6SA 4NXNB 1X1DA 3GZTB 5D6NA 1UZAA 3VVMA 4DCOA 4RACA 3WDKA 5HM8A 2F55A 1II8A 2J3MA 2Z08A 1E1KA 2V7BA 3KSUA 4U0KA 3EXEA 4FDTA 5EN4A 3V8EA 2AL7A 4KRXA 2XYHA 3F46A 2C88A 2IEIA 1RAAA 1VB5A 4HRXA 3LFTA 3N0WA 2R25B 3ZK7A 3EZ6A 4OFBA 3NNSA 3KT3A 3ZGVA 1P19A 3W5UA 1IBRA 1PKXA 3KU1A 2CB9A 2YRXA 1Y5RA 2ZBVA 3QG1A 4HDSB 1FSGA 2FR8C 4KH1A 4NONA 3TEMA 3ZD6A 1O6CA 4DG9A 1YXMA 4L6IA 4G5QA 4NG4A 4V2UA 3X2SA 2AWNA 3DP7A 1RM5A 2XXBA 3MT8A 4JUBA 3TLGB 4G0WA 4NU6A 3A2MA 3H86A 4UFNA 1YQUA 2A0FA 1WMAA 3J7AC 1Z2DA 4YRKA 1T3LA 1W76A 4ZIRA 2I7XA 3PRYA 3LWNA 3GLUA 2I71A 4MQEB 4MYRA 1SY7A 3GRCA 3Q40A 3MYRA 1RYDA 1P1RA 3E9RA 4G0YA 2NNWB 2RB5A 5T57A 2VP2A 3WX0A 5BOSA 5MDHA 1QTQA 3HV2A 3JZFA 1PT8A 2KLBA 1F6DA 3KKKA 4Y0NA 3WLOA 5IKMA 2XRZA 4IVRA 1BXKA 3UT6A 4C0KA 4JQOA 1J5EB 1EEHA 2IPOA 1KQGA 3FUTA 1I10A 4Z0HO 2QLFA 1I01A 2CL6X 1K7EB 4L16A 5F21A 2WSYB 5CURA 3FB4A 4F46A 2C0QA 3DC7A 2JG3A 2UUCB 4RZ3A 4NOLA 1SVOA 2BMWA 3OPYA 2IXEA 3H5OA 1MG0A 3ESXA 3CIFA 3R7BA 3EGXB 4KQ2A 1NX6A 1R5BA 4TS1A 1MRSA 2XYGA 1QAQA 3BN3A 3NIGB 4RKQA 5T6MA 4O3MA 2HSDA 2Y67A 1PQUA 3QELB 2DKOA 5DXAA 4B47A 3PL5A 3H75A 4H7DA 4UARA 3TSWA 1A1VA 1NSFA 2VQ6A 2H7VA 1XCPA 1GNLA 3L1KA 3TDMA 3B1ZA 5DSZA 3GCWA 3L7IA 1IWPB 2I6UA 3BMXA 4HB3A 3X43A 3BM5A 5FQOA 4EUSA 4EKYA 4PFKA 5KSWB 3EOAI 1AHPA 5HGXA 2WYIA 2XYRA 3ICCA 3OP4A 5CLIA 2ZBEA 2GEJA 3B7PA 2RGAA 3OFND 2Q3JA 4GVXA 3JQQA 5GTDA 2HJHA 4I4CA 3FFAA 4O2BB 2DXIA 1GXSA 1IHUA 1MU0A 1UMKA 1VCOA 1OI4A 1ZMTA 2HA2A 3AKYA 4UEQA 2OV3A 4Z2YA 4B0PA 4EQ6A 4ZGWA 1RWXA 4COKA 2XQGA 4G09A 2D06A 1KJ8A 3F96A 4MGYR 2L69A 3I6MA 3IP5A 4QATA 3WIEA 4ZO7A 2NVOA 1JWAB 4LRSB 4XEUA 2FJ0A 4BO1A 2PMWB 1E2QA 1Y37A 2J3LA 5G0UA 4FI3F 3LRPA 3OIFA 3WLMA 3H5IA 3WLQA 2IT1A 1ZINA 5D00A 4CMIA 2EYQA 2CFOA 1LLCA 1UBLS 3D8RA 4GP9A 3BHMA 4RGYA 1D04A 4POOA 3AEYA 3BD8A 1LK5A 2PWBA 1CUSA 2NTVA 1HDRA 2H2IA 3AOEC 3IP8A 3PEUA 5HFAA 5DYGA 1J0CA 3CW8X 4MVJD 1AN0A 4PX9A 4RK6A 5HWSA 4ARIA 3AF5A 2X41A 3ABSB 4Y7DA 1SCAA 2IU3A 2PFGA 1WEHA 1XZQA 1Z34A 4MV6A 4U7JA 3C6KA 4ECAA 4Z3OA 3BD9A 4KN6A 4MRRA 4M88A 4PGMA 4PLYA 2JGEA 3KJFA 1Z5OA 4MPTA 4EGSA 1S8NA 3STVA 4GWLA 3H5TA 1SK9A 3W7BA 1KRXA 1EVIA 1SUIA 2OGZA 2JI8A 3IQFA 1FBTA 2FWIA 3INYA 2QYHA 2JGMA 1YAJA 4UM9D 2Z2IA 5JSKA 1DIRA 3RJZA 1WZUA 3TINA 2D2IA 1SCQA 3HP7A 1AKYA 4A5OA 2BVNA 3MCTA 3N58A 1VMIA 3BTUA 3G0CA 3IV9A 3NIBA 2NPOA 4J1NA 2XBMA 4JOBA 4OOEA 2PN1A 3H4IA 3LCJA 5J3JA 2ACVA 1JBEA 1UEXC 1JEJA 3TZHA 2F7SA 4KSYA 3UXMA 4U2FA 1H42A 1ZD9A 4ZVTA 4DEVA 2FLWA 1JAHA 1O0SA 1UPFA 2GZAA 2M98A 1IU9A 2R84A 1LDMA 3G82C 4YRJA 1B14A 1WCIB 3UJ7A 3I4FA 4C1BA 4ZZ1A 1QHYA 4REQB 2PVPA 2V55B 1JQEA 4NOKA 5E2IA 3TB6A 1J24A 4YQYA 3X1ZA 5HJ5A 1JHUA 2FG6C 5DDIP 4I08A 3TGPA 3RIHA 3FTFA 3X1WA 4YEDA 2YVUA 5I3CA 5JVDA 4NCAA 2DQZA 4YP7A 2TMGA 4ME6A 4Q4LA 3KVNA 2QJRA 1R5OA 2AHRA 4EL5A 3RVSA 2ORYA 1KWKA 1BWRA 1RBQA 2W8ZA 3DXYA 5DX8A 1GPKA 4DKXA 1GNQA 2FUG1 5DM0A 5DWDA 1SAYA 2QROA 3OQBA 1RLOA 5ITWA 3U4IA 2JFWA 4ILEA 4RMGA 4YRPA 1CUWA 5CIQA 5C8XA 1GPH1 2ICAA 1MT0A 2NYRA 4DJAA 2AV6A 2C9OA 4HNGA 4E4TA 2IBSA 5JJ5A 1E8NA 4HVLA 2XUGA 2AD1A 1TD1A 4P3KA 4A10A 4EVIA 4XWKA 3K9BA 3ZDZB 3SQNA 1QF7A 4IJ5A 4IIDA 1E64A 1OKKD 2AJCA 1QIGA 1ZRSA 2NQ2C 5I4IA 1J20A 1YJ5A 3JAKB 5KOHA 2B83A 3RUAA 1GTMA 1G8JA 2J30A 2X14A 2R6GA 2ZJ8A 4X7MA 2B21A 2WV7A 4WX2B 2OQIA 2V8BA 3IIIA 4JNCA 4GYWA 3HDTA 1F14A 4D43A 5FFFA 1K2WA 3T52A 3S2EA 4CCWA 8LDHA 2VXBA 5I7AA 1FIUA 3JYPA 3IJ5A 2NVUA 2ADFA 4K81B 2GTHA 3UVEA 3ZC3A 1FQOA 2Y0PA 2IP1A 2JIPA 2NSLA 2XKJE 3LGSA 2WRZA 4KR7A 3KUXA 1QYRA 3AUXA 4I8DA 3T3PB 3EBPA 4OK5A 3I83A 1PR0A 4URZR 3WNCA 2RGDA 1F12A 2CDAA 4J76A 1CUVA 5DNVA 5BN3B 1JILA 5TLSA 3P0RA 4XTCS 1XAGA 4Z8XA 4J3JA 4OQNA 4AJ2A 5KC8A 3C3AA 4YB8A 4NBLA 1WSBA 3TECE 3MWEB 2WG0A 3R4CA 3KLOA 1X1BA 1W5SA 3CE9A 3VC3A 3OCJA 4GXNA 3USZA 1CY0A 1S9DA 2O2YA 2ERCA 4QTTB 1OX6A 3A1UA 5LYJB 2CNKA 4QTUB 3AVVA 1UKBA 4QQNA 4TXLA 1HK7A 1LI4A 1Q1GA 2DP4E 4JMPA 3DLIA 2I55A 2REQA 4GWKA 3KJXA 1IC6A 4WRRA 3NCHA 4YWHA 3T1QA 5JW6A 2ZYRA 1YS2X 5A7FA 1BMFD 2NZUG 1D9XA 1CR0A 4F9FA 1KEUA 1G0OA 2L82A 1XZNA 2NZ8A 4J91A 4MTCA 3EZXA 5AI8A 3ITKA 1HNWB 2E4UA 2CJPA 2J08A 3DTTA 3D64A 2Q4BA 2FEWB 5IEBA 3VR4A 4GOND 4JASB 4LDRA 4TKLA 2E1RA 2PV0A 4FCVA 1UDCA 3N39C 4YPVA 5CLLA 2Q6VA 1NPYA 3PQEA 3K3PA 1J21A 2OLKA 2OBXA 1JG6A 2ZANA 5TQ2A 3SX0A 3ZWVA 2YR0A 1ANKA 4MEAA 2ZYSA 1DCTA 5E6UB 5BSGA 2A0UA 1P3JA 1VECA 2JD0A 1JX6A 2N42A 2R6ZA 4OGWA 1L3BA 2ALJA 5HQJA 1CDDA 1U7UA 1ZRNA 3B36A 3E70C 3I8SA 4I36A 4B7XA 3EPHA 2JB9A 2EW2A 1YB2A 4WESB 4QT4A 4JI3B 2BFEA 1RRKA 3CKYA 3QV1A 5E2AA 4B8ZA 3HA3A 2Z6UA 2BGRA 4L7VA 1JZSA 3AKZA 1CD5A 4HFMA 4R2JA 4MA5A 1M6YA 4OU4A 4KR2A 3NT2A 3D4PA 3ESRA 3P0IA 3CJRA 4KUHA 4CUZA 4FU0A 3A7DA 4D8VA 1L5YA 4LSMA 2W71A 4AZ3B 4CTOA 2ZWPA 4AJJA 1TZ2A 3BWBA 1C7QA 3C48A 1NN0A 3L82B 4KLCA 2PGAA 4PS1A 1I7NA 1V71A 3SC6A 3X2EA 1XD8A 3IVXA 5F98A 2QL6A 4NNPA 3AVPA 2LCIA 4UUAA 3V7YA 5IT9A 4UZSA 4MVYA 4DYVA 5HIAA 1THMA 3MGGA 3HE3A 3P9NA 3GVPA 3KV1A 5DB4A 4RK0A 2N1MA 1DBRA 4WZAA 3ZDEA 5I5GA 5FAXA 4UE6A 5BSMA 3BTOA 3Q3VA 4KEAA 1W96A 5EKTA 1N6RA 1FW6A 1UK9A 1W88B 3GFVA 3LUFA 1NBWB 1TKBA 4GXQA 4WPGA 5A0FA 2IV7A 4BUCA 3CWZA 4F3CA 1HQCA 2ZQZA 3URMA 3COJA 2G77B 2GKGA 1P6UA 2RCYA 3AU8A 3CZQA 3GGDA 1QP7A 1EXDA 2OSBA 5C5CA 1E62A 1QP0A 1QRAA 4LGMA 1A27A 4XM2A 2IBTA 4QQRA 4AXXA 3PXXA 2DULA 4B0OA 3DVQX 5C8VA 3UTCA 2AF3C 4GLOA 5K0LA 1Q95A 1QKIA 4GDFA 2OHOA 3ZS9A 2HFJA 2CLMB 4Z6KA 4KQWA 3CH6A 3N2GB 2YVQA 3AW8A 4YXFA 3QU9A 3VYUB 2QE6A 3QF7A 5H4GA 4KREA 1XA4A 3EG5A 3KZKA 1G7SA 2FUG6 2ODPA 3PK0A 4HGZA 3RRYA 3LLMA 3VNSA 3N6RA 4GD3Q 1UBTS 3HXQA 3CT6A 1XQVA 4EB6A 2YVLA 3FYTA 4MUKA 4ZO4A 4B3XA 2CLDX 1PGOA 5JASA 1PFVA 4E33A 3JQRA 2ZAIA 3O8BA 4BLQA 2EV9A 2G0NA 1R0LA 2V9CA 3TVYA 1X1EA 1ADBA 2QT0A 4KR0A 2QRVA 4TLAA 3T5AA 3R3WA 4NK5A 4DHEA 2HWWA 2HPAA 2HRRA 2P5YA 3QBVA 1DAFA 1KP3A 2P62A 4C0WA 1S5PA 1SKMA 2F48A 4XGQA 4EVRA 2CLKB 2ROQA 1WBDA 1H2YA 2WU3A 2YQ5A 3OIYA 1OZ0A 1IUKA 4LI0A 4KVAA 5EC8A 2DUUA 1YU6A 2AC4A 2ACKA 2DFVA 5KVQA 4XDYA 2XD4A 5JZMA 2WIGA 5BSVA 3A4TA 1T3ZA 2V7UA 3H8SA 5KWIA 1G17A 3KYIB 2HHHB 3U37A 3B9RA 1LJLA 1K6XA 2CXHA 4X66B 2V6GA 4DE5A 4C76A 3REQA 3LVRE 1GFWA 2G4CA 1R4MA 4XIGS 3O4JA 4B75A 4BFVA 3AZQA 1ABEA 3ZIAD 4GH5A 4G0OA 4N49A 4JGGA 2D2VA 2A9PA 2VAXA 4TN1A 1A04A 5B7GA 1GRQA 2O8DA 2OC4A 3RU2A 3VNRA 3ZDRA 1ZUHA 2YWJA 3NRCA 2NYVA 1R6XA 4NDAA 2WY2D 4IFIA 4ENQA 5IC4A 5J4HA 4A0FA 3WFJA 4LQDA 2WPNA 5CEJA 3LUDA 1GNPA 4CDGA 2AFVA 4UOEA 3U40A 2PKYX 2HOQA 2QF7A 2VSOA 3WYEA 1PR1A 3PNMA 4JA0A 4F3RA 3ZJVA 4IXDA 5H16A 2IYZA 3X44A 3MWKA 3I5AA 3O82A 4OKNA 4F5WA 4US2R 2VH2A 3LHSA 2VQ3A 1UP7A 2R8BA 5FL7D 4R8LA 5T67A 4R5HA 3SXJA 3ITEA 3KL4A 5FBKA 3ZTWA 4B6EA 4NMMA 1N6OA 4HV4A 3LCRA 2P9HA 2ZBPA 3PKIA 5DH9A 3NPAA 3KOXA 1UJ4A 1SHZA 2MTBA 3LDFA 3CH7A 5CUQA 4LHXA 3SR4A 4BE9A 2VF5X 4IDDA 4URYR 3MGKA 2WHRA 5ETJA 5H3LA 5HS4A 2JGFA 2PRIA 4GQBA 3EIQA 3KXLA 4UATA 1F7UA 1I1HA 1SU8A 3Q5GA 3U60B 4OHKA 1VLHA 3WGUA 3KE9A 1N57A 3I64A 3PIRA 1V3UA 3KKPA 3NEPX 1OYVA 4OYHA 5D5PA 1VJ0A 1GAWA 2PKRA 5ELMA 3NASA 3GELA 3IOMA 1HT2E 4RH1A 4BE7B 4DLVA 4ER7A 3GP8A 3MOIA 1KEPA 1YVRA 2MDTA 1Q0RA 3O8OB 1WTCA 1LF0A 4DIMA 4RGVA 5DV9A 2YUTA 2HLNA 3K2IA 2X0IA 3OSUA 3PUXA 5F51A 4DUGA 3ICPA 4E6EA 1B0AA 3VDXA 3GNLA 4EJSB 4F5YA 4RYLA 1BOFA 4OSPA 4QYIA 2YCLA 2RGUA 1OLSA 3B8HA 4AS2A 3FHLA 1KMCA 4M22A 3UHAA 1QTRA 3VR6D 2A9QA 1B42A 2ZSFA 4BMDA 5KYXB 1ODJA 3AJEA 4IDFA 3RYFA 1KEKA 2EL9A 3RYCA 5CLJA 5B2EA 3F8SA 5E7MA 4JV5B 2OGSA 2PZJA 5CYOA 3MS4A 4Q4JA 1PJZA 1EDBA 1Y1PA 3ORSA 2JHFA 3PXCX 1UMCA 4K6MA 2QR2A 4RY8A 1VL5A 5IAJA 3FI9A 1A5TA 1RTKA 1J25A 2B69A 4UNRA 5IM4A 1UT6A 4OUDB 3VR2A 2H31A 3PPVA 5AUQA 4G4SP 3MHPA 1FCJA 3LQ4A 1XHEA 3MRTA 1A7KA 2X86A 4YP1A 1S2GA 5G3YA 4BKUA 3QUAA 5M2QA 3D3WB 1DUIA 1DKUA 2BGLA 1KARA 1YOVA 1RYYA 3N76A 1P72A 5C0OE 2ZRAA 4UBNA 1Y3BE 4YPFA 3AHCA 1Q6YA 3IAFA 2GBLA 3EXEB 3KJEA 4YYZA 4PLTA 4DB2A 1SG0A 5J40A 2IPNA 3NAZA 5B55A 4GM1A 4QG3A 3C2QA 3TZKA 5FWYB 2O7NA 3T1OA 2QR3A 1CIPA 3DOOA 4MW9A 2HHJA 3ITDA 4DQ0A 1TLFA 4Y2JA 1X0VA 3ETEA 5FPHA 1B74A 4OHMA 5JZSA 2Y9MB 4LA4A 4TTVA 2NO4A 3PC3A 4ZV7A 1RM3A 3SI7A 4EHJA 2Y1DA 2FX5A 1U0JA 1Q16A 3V2UA 1BCSA 4UU0A 3ZG6A 2WILA 3HCRA 4PC2A 3KPYA 2Y3IA 2ZRKA 4PBTA 4JODA 1UAGA 1K66A 1KVSA 3ZCPA 4C4PA 1MA3A 3MBKA 1OXXK 2ZETA 1WCYA 2SNIE 5AJYA 3WDSA 1L5FA 1TOAA 2HDWA 1V3TA 3MBOA 3O1IC 2IXDA 2O5RA 3HMKA 2ESRA 4HN4B 4R7ZA 1OSNA 5AVOA 2OG2A 3OQIA 2DBVO 4OUKX 3HR7A 1XLWA 3K0AB 1V5EA 5DO9A 3F73A 4AKHA 1K5GA 3FRJA 3HB0A 2N0SA 2PQ0A 3U7HB 1M2OA 1NVKA 1TYAE 5TY0A 4B44A 2ZCJA 1NT2A 3BDIA 3LHDA 4AU1A 1J1IA 1PTJA 2GN6A 4R2IA 4ZAGA 4B74A 1H5QA 2GFHA 3EPRA 1K4MA 2DBYA 3E9EA 2W2LD 5EHGA 4AN0A 3G49A 2MSWA 1ZQ1A 4RFVA 3HY6A 4BIMA 3IUMA 2X4DA 3UWDA 2BAGA 3K9LA 3OTGA 1E5LA 4BO5A 3RIGA 3OHMA 1ORWA 2H9IA 1OROA 3RU7A 1JI3A 1FVFA 3STTA 3IB3A 1W59A 5ECDA 1HF3A 4LC1A 3JWHA 3VO1A 1W52X 1HE4A 1L4EA 4RVGA 2B1RA 4RH3A 5DEIA 1PG5A 1NMZA 5P8WA 5KDLA 4QELA 5G02A 1DZ3A 1BEEA 2R6JA 1GGEA 1Z18A 3MIIA 4JEUA 1DWPA 4P31A 5LN1A 3G5MA 1J6UA 2XNSA 2IOFK 1M2WA 1KFJB 3NC0C 2LW7A 4KDCA 4MS3B 3E9YA 4IFEA 4MAMA 4AX8A 2JPDA 1ZUD1 3PUVA 3KK0A 3QNUA 4ZVLA 2O52A 1CDOA 3VPBA 2P79A 4QICA 2Z4TA 3VR3A 4EJ2A 2LP4Y 4CIDA 1E6LA 1NVWQ 2XDQA 2PKWA 1B00A 3G6KA 4G1FA 1QX3A 2WD8A 2BEUB 2R7LA 2XUHA 4QIHA 5EMLA 2G25A 3QXSA 3GJXC 2E1PA 1L7NA 3L43A 1M1ZA 2C2XA 2O1SA 4G65A 2RGCA 3ZGXA 4AJNA 4V1CI 1E2MA 2XJ4A 1SVSA 2XBUA 2HJGA 3G02A 4ICIA 5TQJA 4CMIB 4D0SA 3O9VA 4DR7B 2Y0BA 1KYIA 2BEWB 4Z9AA 3PVSA 4ZCMA 4HJXA 4WD3A 2OG1A 1QZTA 2Y4OA 3RUFA 3A28A 2O8EB 1NJ5A 1K92A 3HY4A 5L51A 3TZ6A 2OPHA 4GYYA 3LM8A 1QKJA 9LDTA 2FY8A 1ZO8A 3QOYA 1X19A 1WIWA 1YACA 4H17A 3U3MA 4S12A 4M98A 3VR0A 1FFXA 1FC0A 3R6LA 1FP2A 2GI4A 1DB3A 4QNRA 2OHGA 3QITA 4OFWA 5JNLA 2IHTA 1FVOA 3CG0A 4ES6A 5L3ZA 4BMSA 3E3NA 3SPXA 3DG9A 1HZJA 5JATA 1ZSVA 3BERA 3RREA 3ID6C 5E3JA 4DSAA 5BWBA 2IPMA 3GLIE 3X1YA 4AD8A 3IXMA 4MVJP 1JDVA 3D3QA 3FUWA 4FGLA 4EFKA 4TV8F 4WJZA 4FJ0A 4ZDWA 1E6EA 2I8AA 1H3EA 3CZRA 1VSUA 3D7RA 2XYVA 4GMHA 5LZ8A 5JMPA 1O87A 1SFRA 4OHCA 3EXHC 1YQXA 1PJSA 2XGOA 1GZ5A 3WRVA 4N39A 1HY3A 1I2MA 3FPSA 3BRWD 4CM9D 1Z2CA 1X7XB 1HM5A 3RGGA 5CXXA 4ER5A 5CX1B 1FXSA 3ZK8A 1JMVA 4BV8A 2CVOA 3E8XA 3ZZ0A 1TUEA 4EKGA 3WQSB 2PPVA 5JVDB 1PJLA 1F5NA 3Q7SA 3T7JA 2R48A 3TW6A 2RHCA 3IQEA 3LYAA 4CF3A 5I4BA 5F3DA 4M7WA 4Z7QB 4LXQA 1T5IA 3OF3A 3ORQA 4ZOLF 3CBGA 5DLDA 3R9KA 2JATA 3FN4A 3LECA 1TECE 3OLXA 3SZOA 3AL0C 1EK5A 1T1EA 3CWQA 4PSVA 1FYDA 3G13A 4ZEMA 4NFYA 2X4IA 4BJ3A 4F6LA 3IEPA 2G1AA 4XIFA 3LHKA 1I7LA 2QTBA 2GETA 1Z28A 1QGUA 4N0PA 1I2ZA 2YIJA 4IH1A 3C6QA 3N75A 4HVAA 2P9ZA 1PV1A 1JZQA 3DWGA 3NC4A 2F64A 1NUPA 5DVZA 2NU6B 3R7WB 1JHVA 2YHBA 3AHDA 721PA 2VXCA 4YP9A 1JHRA 4II2A 3WQRA 5KOHB 2W2MA 5C32A 1OILA 2GM3A 2VBFA 3GJZA 4Z4FA 4IQGA 1P9LA 3JASA 5DRTA 2B4TO 3KWLA 2GAAA 4WUTA 3VNUA 1GITA 1GPWB 4XSGA 4YJKA 3KR1A 3ICWA 1M54A 3O8CA 4C30A 1W46A 4HQNA 2F1KA 1FJHA 2JA2A 2WTAA 1M9NA 1AZLA 1M10A 1UKZA 2FYTA 2YFYA 2PXCA 3AERA 3GFQA 3NTUA 3MTAA 2CL7X 2VPYA 4JXJA 1YGPA 1T6NA 4I1OA 3V1YA 5TXGA 1I4OA 1J22A 3QA3E 4NENA 1X1RA 1N2ZA 3GCZA 2FMFA 1QAMA 2H1IA 2Z5GA 4BUJA 3WSTA 1ISMA 1QHSA 4INAA 2DBRA 4RJIA 4XYMA 1BYUA 3KOUA 4FGKA 2O20A 3EOZA 5TSDA 3UAWA 1RXCA 3WLKX 1GU1A 2QUHA 2OCAA 3KT6A 4FHGA 3A9CA 2D59A 4DTCA 1U0RA 2IUTA 2VP3A 3D5TA 1HNZB 4L0MA 3L7LA 2VTBA 4H35A 3CX7A 5BNZA 1FS4A 1O8CA 5C4MA 1MW9X 1T0UA 1VGQA 1W0CA 3D7NA 5AXCA 4Z7NB 5JBQA 2AR9A 1J1UA 2BFAA 4O02B 4AZVA 1SQFA 5MF6A 4A2PA 4OHUA 3I9LA 3LAWA 1OXVA 2ZKIA 2B30A 2PAAA 3M8KA 4GOMD 5H70A 1T8UA 5IM4F 4QASA 2DPMA 4CLRB 4ZAZA 3L07A 1XTPA 2R8PA 4HAOA 1SBQA 1CQZA 1RFLA 3DLCA 2O0LA 3EA5A 2VDPB 3TEFA 3GH3A 2VIIA 4IVNA 1F2TA 1GVHA 2V7WA 2ATVA 4LJ7A 2Q0SA 4HL6A 3X1KA 3PL1A 4MLCA 4MW1A 2QGNA 4B4OA 3AY3A 1BEZA 2AFIE 3OAAD 3G0GA 3I53A 1F1JA 3KP1A 3ZE8A 3CVUA 3LPNA 3WK6A 1FLAA 2FU5C 4HDNA 4IHKA 3W5CA 1T1GA 3A26A 5CM8B 3O83A 5CR9A 5HRUA 2NO6A 3OJOA 3OM0A 3IE0A 4OQEA 4V0SA 5FBZA 4Q9IA 4RA9A 2G06A 1MABB 2X9VA 3SOPA 4P2BA 4RHYA 2WHYA 2H4FA 4H4DA 1RJGA 4ZI5A 5LLSA 5JPCA 3L0SA 3CPHA 2BFEB 1RWMA 2XDWA 3QPAA 4QU0A 3ZU2A 4EI7A 2CDRA 1EZ1A 4O59O 4F1KA 1K4KA 1P5JA 2HLPA 3PRHA 4I9NA 4DCMA 3U7GA 3PA6A 2IHZA 1N0UA 3ESQA 4NF2A 4QYMA 4BVJA 2YC2C 2MSEB 4LC9A 2AJ8A 4N7RA 5BSKA 1NQ5A 4AWBA 1YMQA 3WJ7A 1TPYA 4ER0A 2BGMA 2P8JA 1ADCA 1F8FA 3DSRA 4Q9NA 5KIAA 3KQHA 4KNWA 4Q16A 3L7MA 4ZVVA 1FFSA 2PXHA 3NJ4A 2D00A 3R1IA 1EXVA 3OOEA 5DNYB 4QYWA 4RTQA 5I7HA 4QOEA 5NLLA 4WJLA 5C46F 2XXJA 1QDUA 4TVKA 2ZRLA 3WNVA 1I3KA 4ZMSA 2ZCVA 3CUTA 3I4CA 3K53A 2VKTA 2F4NA 3MAJA 4RS4A 1NXSA 4K0KB 3MJCA 3G2MA 5LP6A 1NT4A 2Q9CA 1Z16A 4D9GA 3IDSA 3Q3GE 4H6PA 3DL2A 3OY7A 3UOGA 1FNMA 4BUZA 1KIFA 5DX0A 3TQCA 1N77A 1U2TA 1TIPA 2PVSA 4R98A 4OKSA 1BMTA 3C5WP 3R5SA 4QOFA 5JG7A 1SZCA 4D3XA 2QW0X 4IH9A 4JGIA 3I9OA 2VP6A 3TTSA 3GH1A 3W04A 3A4VA 5A7HA 1BA3A 3IBFA 3RASA 3HDVA 4FFBB 3RKSA 3FX2A 4EWLA 3NMUF 1F9AA 1FF9A 1RAHA 2C8LA 4C43A 3Q2IA 1F6WA 4XZ3A 3C3PA 4TZ0A 1SHTX 3SS8A 4BPBA 2WUVA 1P17A 2JBWA 2RKWA 1H0KA 3FE2A 5IK2A 2O7RA 4MWOA 2OXEA 4MI3A 1MRNA 4A6XA 5U4XA 4NKRA 3B1YA 1E8MA 3FPLA 4D74A 1DO0A 2A9KA 1AXEA 2FW8A 1F0YA 4JL6A 4EB6B 3A6KA 1KDTA 3LXMA 1A98A 2RIRA 2AH5A 1WXXA 1HG1A 2TMDA 1DKRA 1NZFA 1E2DA 4FWBA 4NPAA 2WU1A 1Y6JA 1V6SA 1ZCZA 4OI4A 2FOXA 5CVEA 2I67A 2O1EA 5K6RA 5IG2A 3SP1A 1MQSA 3O3MB 1NOIA 5E38A 3DS8A 3EOBI 5AIAA 3VJLA 2P6MA 1E1MA 1KEZA 1EQAA 4PGFA 3VHXB 2ZGVA 3TYXA 3OMLA 4QTZA 1XN4A 5AHWA 5EL0A 2E21A 1M0TA 1RP1A 2F17A 1NULA 5HKLA 4ARVA 1L7OA 2R5WA 3NNNA 3QUCA 5IUNC 1NZJA 2ZTVA 1VRWA 3WL8A 1TK9A 3NCTA 4Q9AA 5H02A 2BR3A 3TW8B 4IDGA 3HR8A 1RZ3A 1OLUB 1Y8ZA 5FWDA 2XA1A 2J7PD 4PX2A 4LE2A 4JP5A 1DNPA 5FBHA 5A5EA 4OGFA 2WSSD 5FQNA 1GKKA 2VHZA 1UANA 4YCLA 1Q74A 1R4MB 1NA5A 4LJRA 4FFSA 3E18A 5AK0A 5EWJB 2AZXA 3KKNA 1N5OX 3G7SA 4E88A 1U4NA 3RK1A 2Q5FA 3N0RA 4GT1A 4KAAA 3SGLA 4ZZ3A 4B3RB 4CWAA 3KR2A 1UC4B 2O8DB 1X15A 3CF2A 2X4LA 5IMSA 1OTYA 3HH8A 7MDHA 1FU8A 2Z9CA 4Z3KA 4EMTA 4I1SA 1XRSB 5GAJA 3S55A 4WDRA 4Z8YA 3FZYA 3UCEA 4RABA 1UXIA 3B6EA 2OCYC 2DFTA 2HMAA 4L6AA 1PR9A 1SQGA 3U4GA 1D6JA 4YGXB 3EJ6A 3K96A 4QECA 3IPCA 1TFUA 2ZULA 3BS4A 4CLOB 3KHSA 2ORVA 4UZFA 1HL7A 1XMXA 1VPEA 3FPFA 1V8OA 5IABA 2P1ZA 5H83A 1HLFA 4YMWA 4KQIA 1RRVA 1VM6A 3DYIA 1IXSB 1LX7A 2LVBA 2XR1A 1A8IA 1XT6A 4AI6A 3CLUD 5JBNA 4HAIA 1IM5A 2RDMA 2UVDA 3NJRA 1JIJA 1Z0IA 3BH7A 2I54A 2PBLA 3PUYA 4WINA 5CVVA 2M6SA 4ZPJA 4XVCA 4YR9A 5CFLA 4O63O 1J99A 1A9TA 2J3DA 1M74A 3MEQA 3LUAA 3NHJA 3HG7A 3DDZX 4QUBA 4AG3A 1FSZA 4M0EA 2DPXA 4QODA 5GP1A 3R3XA 4JB2A 4XLTA 1A7AA 3W7AA 1AZSC 3ZHVA 2IHNA 4MX8A 1YVDA 2A9VA 4C2AA 5LQRA 3GRVA 3HA2A 4ALKA 4D3SA 4ETWA 2ATXA 4ZAWA 3OQJA 5AIBA 2H0QA 2QZZA 5DNEA 3ZU6A 4O2AF 1ZUIA 3QEBZ 4LZJA 4RMJA 2QTMA 3QK7A 3EAQA 4PPYA 5GV8A 1ZQ9A 4B09A 4UBIA 1OLSB 2EZ4A 2OGWA 4QOIA 3A9UA 3G8BA 3I6ZA 5AVJA 1NF9A 1SCUA 1F06A 2H57A 2R44A 3A7EA 3EEIA 3RHFA 3S2UA 5A4KA 4F4FA 4PLWA 3HWRA 5KNCD 4OHZA 1IULA 2H07A 4BJ5A 1RI2A 3OQMA 3QZUA 1JTVA 2Y1LA 1IFXA 2AKYA 5JZ9A 3RC1A 1NSYA 4A2QA 5AK4A 5CD9A 1PX0A 3D8TA 1SBNE 3QPVA 1D0SA 3BSSA 4JT2A 3QE9Y 1IY8A 1QRUA 3TZCA 1UMCB 3LY9A 4BLTA 5DEOA 1XTQA 3HDGA 1E9BA 3OUUA 2XLBA 1ORIA 4PXYA 3PX3A 3KVOA 2EATA 2CD9A 1ONPA 1JEYA 1LU9A 1KBQA 1UOEA 4CMGA 1TVKA 1ST2A 4GP7A 1JI0A 1N7IA 4CQMA 4JI6B 4JT4A 4EG0A 9MHTA 3OM8A 1OE0A 3VO8A 4IINA 2D5LA 1OIXA 1TUBA 1ADFA 3E5MA 1X0XA 3C16C 3QI7A 3TVDA 5KC9A 2W2VA 5J23A 1D07A 3S81A 3I5MA 1CDEA 3MW8A 3GLGE 5CLFA 4KFCA 3TTYA 2PS0A 1LJUA 3T5GA 1YOVB 2JHAA 1AH2A 4JITA 3DPUA 4G2NA 3ZWMA 4Y2PA 3DZBA 4BO0A 2I7DA 1HEUA 3L02A 4X7BA 4QXPA 4F84A 2Y1XA 3ZXXA 4N48A 1UEJA 1GILA 2VPTA 3AB7A 1JW9B 2Q07A 3VM6A 4TWBA 1Y98A 4S1PA 4CKEA 2QE7A 5L40A 4J1SA 1A3CA 4EPRA 3L0CA 1OXTA 4YRQA 5ABPA 2ZJ1A 4R2WA 4EHBA 1CW2B 2CEKA 3U0BA 5HUQA 3EB9A 1F2VA 1BCSB 1YRLA 2FZLA 1E4EA 1WM1A 3PQ5A 4HAYA 5LXTA 1JNYA 4RORA 3QXCA 3B5EA 2EJCA 1MEJA 1XFDA 2GTPA 2ID8A 5EP1A 2FP4A 3VYRB 3ZWXA 4AMYA 4BGDA 3A2LA 4OSEA 1U02A 1UKAA 2Y1FA 4M0DA 4ZT6A 3VYSB 3FAKA 3QUBA 2GZMA 3R6TA 5A1TA 4URXR 1KHTA 3K2BA 3OQIB 4CCYA 3ZCTA 2GBIA 2RBGA 4M0FA 1Y8AA 1J39A 2ZJ6A 3RGWS 4F71A 1M2OB 1JDBC 1UDBA 4CV1A 4E13A 1NDQA 3IDQA 3UJPA 3SJ7A 1HG0A 2VPPA 3P0EA 5LLDA 4DLWA 3D2LA 5ESXA 4ZQEA 1K8QA 1U8FO 2I4NA 5LD2C 2EJTA 3BWVA 4EW1A 3A9SA 5IYZB 2PUHA 3CSUA 4PW0A 4WCFA 1U0TA 1L7XA 3FFWA 1A2KC 1P4JA 1YZQA 1U1GA 2Y71A 3KX2A 1U0LA 4AN4A 4NJMB 1XDWA 4KO4S 4YMIA 1YS7A 5FJIA 3U3RA 2P7HA 3WK7A 2QLNA 2ZDGA 3C43A 5LP6F 2GRUA 2O5VA 4GF5A 4BZXA 4DJEC 5CD1A 1TA9A 4OMDA 1APBA 3DKIA 5AVYA 1MV5A 3LQ2A 4EG3A 2PH5A 4OGKA 3I05A 4E1AA 2W00A 5GONA 3PPYA 4OB8A 1GYQA 1I4WA 5F78A 2JGJA 3S5JA 4RXMA 3H1AA 5F1KA 1AKNA 3WHKA 4AIIA 4DABA 1ORRA 1VIMA 1VLZA 4ZODA 4EECA 3PD7A 1RZRD 2RJOA 3C1TA 4FC6A 5ILOA 3HZOA 4Z0PA 5IZCA 3LUJA 5L8VA 1EFUA 3KB6A 1KMMA 2AXNA 4GUDA 3SBEA 3UH0A 1K8YB 5FUWA 2GBLC 1Y7IA 2QTAA 1ZI8A 2ZSBA 3ZLVA 2JGDA 3GJ6A 5ADUS 2J5KA 3Q1LA 2FMUA 3BILA 2GN8A 1VHDA 2C2WA 2RHWA 5D6OA 1CNFA 5FR2A 5D8DA 4EF5A 3LCMA 5KOIA 1EJ2A 3NDIA 4WFIA 2I2DA 4DAOA 2ZE6A 4IJQA 3Q2OA 1T6ZA 2QM3A 3BZUA 4II3A 3FBWA 1XK6A 3EQZA 3IUPA 3N59A 1NW5A 2YRWA 4ZVQA 2C5SA 3IODA 5FF9A 3E3OA 2E18A 2UZ3A 3MOSA 4TSFA 4KBYA 4U6QA 1NGSA 1VIYA 3W5SA 3E81A 3FTNA 3BOSA 4L07A 4NFHA 4RY0A 4BQOA 4W5QA 1FTYA 4KLAA 3HFRA 4WNIA 5JAPA 4IV0A 3MUEA 2I87A 3OF2A 4U9HS 1G6HA 1R1DA 2BC9A 1BQ4A 2Z83A 3VOBA 1JFVA 4IGKA 5CBKA 4W5OA 1CUIA 1SKBA 2W6NA 3DW1X 3KV3O 5D3MA 4DXHA 3FPJA 3K16A 3SS7X 1E2LA 1PTJC 3IELA 4LMBA 3U49A 3ZGLA 2AYXA 2WM8A 5ALMA 1R16A 1G60A 1SKYE 4PZDA 1ATZA 1L5VA 4YT5A 3V7WA 4YACA 1GZVA 3N9IA 3WADA 3O8RA 3EE6A 2FSSA 5DHAA 2EP8A 2GD2A 3KSRA 3QLTA 4Y6SA 3BXFA 5D3ZA 3W3ZB 5BQXA 1ZVVA 1QU2A 4IMJB 2GM9A 3U7JA 4XD7A 4QBKA 5FI5A 1DU4A 1D2NA 1T2DA 3TAHA 3PC7A 4J43A 3GQVA 4ZRNA 1PZFA 4QE3A 2I7VA 3MM4A 5TMDA 1FSSA 1K88A 2IUSA 4D82A 1XJWA 4Q1BA 4IJKA 1QYVA 4D3YA 2Y2VA 2IXGA 2JFUA 4P8RA 1LTKA 2WJ3A 4EUHA 4CI9A 1FTWA 3C39A 1PGQA 2VUHB 2AG6A 4FWIB 1Z4LA 3QVOA 5LQAA 1N33B 4MKRA 1G20B 2CVZA 4QFBA 4EO7A 2BKUA 2RGBA 3GJ0A 4GECA 5KNDD 4EJMA 4F04A 2P9GA 3ZBUA 4UM8B 4ZT3A 3TR0A 3S5UA 5DSXA 5AOVA 3HO6A 3L1JA 3IS3A 1E0DA 3NWBA 2OC9A 2Q1WA 1DBQA 4GXTA 2AC2A 3PFFA 2UXBB 3R8XA 3SX4A 4FB5A 2PUCA 4JP8A 3RBZA 5KYTA 3TFOA 4CGYA 3DE0X 3QKRB 1EP1B 5JU6A 4LF5B 4U7DA 4RLQA 3NBUA 4DLTA 2HLDA 4BO7A 4E94A 3DA8A 4LY0A 1M1YA 1L5NA 2EJUA 2VJOA 3TS1A 2QUIA 5ALRA 5HTOA 3F47A 4HR7A 4TLBA 3UJ8A 1EVQA 4GXRA 4PSAA 4UXHA 1JJIA 5DYTA 3MJDA 4RMIA 5JAMA 1SR8A 3GGSA 4H60A 2C95A 2OE2A 2PAFA 2JGKA 4L9SA 2QN2A 3RS9A 4QDZA 1Z7BA 1AKTA 1D1PA 5DP2A 3RSQA 1Q83A 3MPOA 3TKYA 3WYAA 1WVMA 4UMEA 1UMDB 1DC8A 1UJMA 4F1JA 4B3GA 2WUEA 3TBKA 3K0KA 3AI1A 3KKOA 2JIZA 3WGYA 3ZY5A 2G1PA 1JG7A 4I5FA 2R6R1 4X00A 1D5CA 1GQFA 5E3IA 2D3WA 4MNTA 4RIGA 1MGOA 2P41A 2BUBA 2H7CA 5AJWA 1CR4A 2C5LA 3UN1A 2VTBB 4KCGA 4FDAA 1Q2XA 3DKKA 3F67A 4NNOA 4ALNA 4CKWB 2GXAA 1GGVA 3HXMA 5DTMA 3H2ZA 3JAWA 2W2KB 3SSAA 4KAXA 2GVNA 4CIYA 4DR3B 5KWSA 1MZPA 3BMOB 4JJFA 3WV4A 5BQPA 5KTTA 5LU8A 2ZR0A 1YFZA 4IQ0A 4L4SA 5JD3A 3I42A 3R6DA 4UBJA 4IHJA 3MT0A 3K9GA 1MFZA 3GEHA 4Y2HA 1EE2A 2VDWB 3QH4A 1QK5A 5JJKA 1G66A 3OZBA 3BSWA 4UQOA 5FR1A 3WMRA 1ZW6A 1P7YA 4HDMA 3V7NA 1T13A 4PHFA 5JJBA 2EKQA 1EXMA 3DR3A 1AIPA 1WZEA 2G71A 4MO9A 3GEDA 1Y3CE 4I0WB 8ATCA 3W8RA 5ICMA 3ZHSA 3ZPXA 3OLWA 4K6OA 3VTZA 1COWA 1NF3A 2VQDA 4BQEA 1GR1A 1RC1A 3U7FB 1CZRA 3DCJA 4MPPA 3T3OA 4G8DA 1Y1KE 3IERA 1OFVA 4FMDB 4CYMA 2QAJA 1W4AA 3UG6A 4F96A 1LEHA 1KKMA 3M83A 4GHWA 4RZIA 2EDCA 3IP3A 4IZ6A 5AOCA 2ZUUA 1NQAO 4FFMA 4LRTB 1SC1A 1J7JA 1JU4A 1JBKA 3TZQA 3CRNA 1OLXB 5HJ2A 2XZOA 4FMCB 4M8NE 5LXTF 3NHPA 2YVAA 4RTRA 1FFHA 5T4FA 3S1AA 2BF7A 4DCGA 2JLUA 3N6VA 3EGOA 4W5JA 4CGZA 5KOJA 4CL0A 4NU8X 3NVDA 5BN1A 1UIRA 4G0PA 3TN7A 5L95A 4RL6A 3LK7A 2X2PA 3JRNA 1OTHA 4UW9A 1L8LA 1S3GA 2BTQB 3CEPB 4N9WA 3LDUA 4NWIA 4TWRA 5AK5A 3L0YA 4MDEA 3W9UA 1G3MA 1ZA2A 3NQ41 3TZEA 3PJGA 5JI3E 2QRNA 1FQKA 1Z0KA 3PYMA 4J2OA 3WLFA 1PZMA 1EFPA 1JLHA 2V6IA 2Q8QA 2ZB7A 1PT5A 3AZOA 5T4HA 1GLNA 3Q8WA 1G6Q1 1P75A 2AIRA 221PA 1IN5A 3KKZA 3UMGA 5LYJF 3THRA 4Q3BA 1QZUA 4I50A 3JU3A 4LEIA 5JISA 2V4MA 1MQAA 1XP5A 1Y6GA 1JHYA 4PBRA 1J2EA 1T9BA 2O0KA 4EPXA 3U1BA 1KP2A 3IO5A 3O9ZA 4FKMA 4D8XA 4OAPA 3DHEA 1TTTA 3LUGA 3O95A 3D4LA 3U61B 3AYZB 2BP7B 2PKQP 3IMGA 3W4JA 1QPZA 4IP0A 1EBBA 1KEEB 1OCEA 3MMXA 1ZJYA 4Y2XA 1SZDA 2X5JO 2DUNA 2XMSA 3VTFA 2A4KA 3IHWA 1E7SA 3PR1A 4B34A 2CXTA 3AILA 1IY9A 1GG8A 4Y30A 2GJAA 4P98A 1GNVA 3UA4A 5AJUA 4IXWA 5GONF 1ZMBA 2DWPA 2VDKB 4MMZB 4DNOA 1VL8A 4PYRA 4P58A 3B6MA 5I9SA 4OIFA 5KWVA 4HB2A 3A9TA 4QJIA 4QHSA 2IQIA 5C4GB 4KBFA 2ZAOA 3D6TB 3ZEIA 1GTJ1 1ZAKA 3V3TA 2TS1A 5DMHA 1U1EA 3BREA 4OJQA 4C2TA 2X8WA 1UJ5A 3JATB 4YAEA 3I62A 5IUJC 3IMEA 3MCAA 4QFDA 4TPKA 4BC0A 1OB5A 4U2KA 2ZT5A 3AP3A 2FPXA 2DWQA 2OCPA 2EBUA 2PQMA 1EGVB 3OOWA 3PNLA 2P11A 4NJOA 4WN9B 2DJIA 4Z54A 5JHGB 3JR3A 5IANA 1EUZA 2MWMA 2FMIA 4ZPXA 2Q5OA 1Z37A 4NOJA 2C2ZA 4NG5A 4YFYA 2VUUA 1UPUA 1QZXA 4IIUA 4C4SA 1LA2A 4LPSA 3MOGA 2H1HA 2VRNA 1WB6A 1VYVA 4MR8A 5CM2Z 3NDBB 1EE9A 3KXPA 3Q72A 1NJ1A 1Q17A 4D80A 4EOGA 3B3JA 2X22A 2P2CA 2ZWAA 4YAWA 2HBZA 2R60A 3SJAA 2MHCA 3Q5EA 3EVDA 1ILWA 4ZI3A 2PUFA 1OIWA 1ZN7A 3N2YA 4JUDX 1GG9A 1M73E 1AX9A 1O6ZA 4RZHA 3VTKA 1LCIA 2UYYA 1X8XA 2WK1A 2PTGA 3LRXA 1AMNA 3FSJX 2N1BA 1Z5ZA 2VUSA 4YJHA 1AV6A 1ID8A 1K1EA 3TEJA 2ZI4A 4MVJM 2ECKA 5EWLB 3TLZA 1CB7A 5AUNB 1V5WA 1NKVA 2JEOA 4IPTA 1DX4A 5LP6C 2CZCA 5KTOA 1IHDA 2UAGA 2XB9A 3BT7A 4L5IA 2VBCA 4PGGA 3FI0A 2A7QA 2A2ZA 5JXJA 3D59A 4JI0B 1EXNA 5F3RA 3ROQA 2CK3A 2F3QA 3EEQA 2AMYA 3UH1A 3L46A 3A4NA 1QCCA 4JKIA 1YB1A 4N12A 1XD2B 4JI1B 5FB3A 4OX9B 3H9GA 3TKAA 2I76A 2QEQA 3HCOA 3PIDA 1Z3IX 3HACA 2DSNA 2W11A 1W8DA 4OYYA 4ZJUA 1BWPA 2P3LA 4B40A 5EJ5A 1M6NA 1EB9A 1FVHA 3G2NA 4B82A 1IBMB 1XVTA 4UE3S 2RGRA 4X95A 1MCZA 1YVEI 4URVR 4RGQA 3GLVA 1YR8A 3C87A 2ZTLA 1BYIA 3CXUA 4C0HA 5JSZB 3ZBQA 2IH2A 4FEEA 3E0QA 4CMHA 2DG2A 5ALUA 2RGEA 3AFMA 3AMVA 4IGFA 2QXYA 3QOFA 2AOTA 1AC5A 1I4EB 3JSAA 1GPUA 4ARAA 3QW2A 4YWJA 3RRMA 2IP2A 4GSKA 2BD0A 2ZYVX 3OE7D 4U3JA 3TO5A 5F3WB 5LMNB 1XHFA 3IA7A 2V5UA 3C3EA 3HUUA 5HSGA 4FZ5A 4PZEA 4ENRA 2C8JA 3P2OA 3QFCA 5HYVA 3CVYA 2E4WA 1QTIA 3ETHA 2AZMA 3GUYA 3LK6A 1TKCA 4KYTA 2Y77A 1TM3E 3TOCA 3TZLA 1E4OA 1YKGA 2OT3B 1J90A 3NTVA 5K3AA 3UGKA 3V2GA 4BE4A 5JO0A 5JJLA 2Y6UA 3EARA 1LVGA 1Z6PA 4LV5B 2FFJA 3QVSA 4DQKA 1PFGA 3IVMA 1BEUB 4IJ6A 4BEWA 3CCBA 3IBTA 3I6QA 1FUKA 1RVV1 2IDJA 2VLIA 4FEYA 5CH5A 1AA6A 2YZKA 3QENA 3LY7A 4AL4A 3ZW7A 4MW7A 1JEYB 5JAQA 1ATIA 3ZDBA 2E82A 1SCDA 2Q5CA 2Z0MA 5CFOA 4YASA 3BTVA 4I4NA 3C45A 2X0DA 4AZ0B 3A3OA 4AULA 1YNSA 3IR7A 4JQSA 4Z4EA 4FR2A 1FW8A 5K7SA 1V9SA 3UPTA 5DOVA 1UFRA 1DRKA 2PZEA 3I0MA 5J63A 1NVGA 3CNQS 3S0JA 4GRDA 2JIOA 4MIOA 4F6CA 1JG2A 5IDXA 3L92A 2CNWA 2HN9A 3VUEA 4LS3A 4YJFA 5F5NA 4IHJF 2BI8A 1QR2A 2EP5A 4ZEVA 4PS0A 5EUMA 1VBFA 3HBAA 3ZNQA 2IBMA 5AK3A 3SIWA 1U3WA 3D6NB 3RUIA 5JROA 2VJDA 5EIEA 2FZVA 3INNA 2FLVA 1LPOA 2NZXA 5LIPA 4CKEB 2M32A 1KO8A 3QU7A 2Z8YA 3C6YA 4R9RA 3BHJA 4K8OA 3L7JA 3UWMA 4C03A 4R81A 4DA9A 2W6IA 3R0XA 4M6WB 1SXPA 2X9NA 2ZT6A 1IB6A 2GYUA 3LTEA 4NEGA 1E2FA 1G3UA 3L93A 4AO8A 2DFNA 3BVPA 3F3MA 4CMKA 3EA0A 4UTZA 3SKVA 1E4EB 2W93A 1T8YA 1XEWX 2H1FA 3VPAA 4E3WA 4WLFA 2E7ZA 3QLUA 4J1TA 4EY8A 4B2IA 2E37A 1JMYA 4D9EA 2FP4B 1Q44A 2HTEA 4JK3A 3WLHA 2OORA 2X1LA 3I2YX 4XYEA 4NJEA 3BBPA 4EEXA 1GNRA 3E6AA 3BIXA 4RFSA 4BLPA 2KLHA 1B3RA 3H0CA 4X20A 4KN5A 1IQPA 2OXFA 4YLGA 4YRSA 1VG8A 3UMRA 4ONEA 4FT2A 3H9QA 3QVWA 3KFXA 3ND5A 1FRZA 3M4NA 5AT1A 3BJZA 3F6EX 3QF4A 5K8UA 2JFBA 2NUPB 2PMFA 1ORVA 2B3DA 2FHSA 2XJ9A 3DD1A 4JR2A 4DIUA 4HUTA 1BJKA 3GZ4A 3K8ZA 1YUMA 3HM2A 4EMUA 1YRYE 4ZHSA 3H9JA 3LXXA 2J9FA 2DUJA 1C7EA 1K3FA 2X3UA 5IN5A 5I9NA 2Z2JA 4IVPA 1ENYA 3HQ4O 3VGPA 3ILHA 4FK8A 3K0FA 3KLBA 5IVIA 5LB2A 3UKJA 1JWBB 3H5NA 3W9BA 2QORA 2ZJZA 1YB6A 2X58A 4XQGA 4V0RA 2HRDA 1S7GA 4H08A 2OV4A 4D81A 4GICA 3T1YB 1STOA 2EW8A 2IU0A 2DERA 4NCIA 4GQIA 1J2JA 4I50F 3JD1A 4HYEA 1NNI1 5JSYA 4PFSA 2GILA 3PV0A 5BORA 3GWGA 3VA7A 1W0JA 3GRUA 2HRCA 2Y1WA 4FLMA 3VR2D 2J0SA 3MUFA 4WK4B 3KQPA 3RK0A 4TVSA 3EDMA 5CVDA 5BQOA 4X0EA 4AW9A 1V6AA 5BUQA 3ETDA 3M3HA 4OU5A 4ZVSA 3FJYA 4O4LB 3T5TA 4BJ1A 1VBKA 3G0IA 2FPPA 3CSSA 1VP3A 1YS6A 2WP0A 1TDJA 1Y5NA 5G0WA 2BFFB 4BNHA 4L85A 4BATA 3O2SB 1MA0A 2QY9A 2ZU6A 4OXKA 2MINB 1GSHA 3C5HA 1Q22A 2D74A 4GGMX 4ZCQA 2UXDB 3J81k 4XYBA 1KI6A 1YJAA 2XYPA 1Z25A 1LNQA 1JFFA 4R1UA 2GCEA 3N7TA 5IARA 1SGWA 2NUAB 2V74B 1MC1A 4KKXB 4P86A 2QRGA 5FTJA 4PAGA 3A6EA 4D44A 4DNFA 3MWDB 5KBYA 4DYHA 2WNIA 2WB4A 1UWLA 5A2QA 1B15A 4BFWA 3RAEC 1NXPA 5FT9A 4X45A 2J87A 4G4SO 1G4UR 1UBFA 1ZY2A 2GHQA 3QVVA 4WKGA 5ALDA 3RUDA 4Z86A 1L7BA 1YS4A 3K9WA 4P4SB 2OFWA 3Q3HA 3L06A 4M9CA 1U0SY 1EI9A 1XGKA 3OSZA 5CFRA 3EVBA 1I1NA 3HB9A 3O7WA 1D6MA 3HN2A 3IUEA 4G25A 4B35A 3STYA 4HGNA 5FAKA 1E5DA 1RCFA 2VNKA 3KTAA 1HDEA 2ZT7A 4RVCA 4PYIA 3EDYA 2NX2A 4K87A 2WUDA 3KCNA 2H2WA 4XOIA 4JLDA 4UVIA 3ZJTA 2WUWE 5D3MB 2KYRA 4TKMA 1S02A 4DDKA 3EXIB 3GBSA 3TLYA 2Q3CA 1T5OA 2BI7A 1P2FA 3AUFA 3MSCA 4XCQA 3DL0A 2UXCB 4X1IB 4YUZA 4KPEC 3Q3CA 1OC4A 4DBLC 4EHHA 3QKUA 3WKBA 1K7XB 2IS2A 1I2CA 5CBPA 3DQZA 1ZVJA 4WCFC 4YP6A 4LSGA 2WJ6A 1DAMA 2XQJA 2YJNA 3DWEX 5FD8A 4AAYA 4TN5A 5TR9A 1GIAA 3IIMA 3PF8A 1RRPA 4U2EA 1Z8HA 2CL0X 3V7UA 3QP9A 1K5DA 3VZBA 1MB3A 2G9RA 3OEHA 8AT1A 3ADOA 3AL3A 2FPKA 3A6HA 4RY2A 2OV8A 4H3HB 1G2IA 4K6KA 4MW0A 1QIFA 4YUAA 1E69A 3LUCA 3DBOB 1SVMA 4N0EA 4BEJA 4AG6A 2QMEA 2QOEA 4BY9E 2XZLA 4JU9A 3P4XA 2WJZB 5CITA 1VMDA 5L45A 1GN8A 1XQ6A 1C30B 3BQMB 3M5WA 2CC2A 1QCZA 3UJBA 1V95A 3NV9A 5CDHA 1GZUA 5AUPB 4X7RA 3WGVA 3OCCA 5DW0A 1UFOA 2IYLD 1GSIA 2ZI9A 5GM1A 2NPFA 4BAGA 2W42A 5G53C 4N5NA 4F12A 4AY2A 3ZWYA 1SD1A 3BL5A 1H9AA 4M1KA 5DMXA 1LWNA 5BWLA 2FPIA 1G1MA 1QF9A 2O2SA 2R1TA 1WKCA 2NXJA 2Q27A 1IXKA 3UUWA 5JT1A 5F9FA 4OX9Y 3FNRA 2O8CB 1U7PA 2X9GA 1KAOA 4K28A 4AZWA 5LQSA 2OHJA 3HU1A 1M1YB 1HFJA 2R86A 1V9CA 4I2VA 4Q3KA 1QKKA 2AT1A 2Q29A 1GTL1 4KXFB 4B3DA 1PVOA 1EYZA 1M2GA 3A06A 1E5TA 4R1OA 4MKGA 1N8SA 2JLSA 1DX9A 4DMMA 3GQBA 1IE3A 1AQ6A 4LRYA 1DXOA 1QHIA 1GQ2A 3IB6A 4CG0A 1JSLA 1M1NB 1T9GS 4RKWA 1XRRA 3N2KB 2XE6A 1JIVA 2Q3LA 5FUQA 2VA8A 5F52A 1FP6A 1E8DA 3K5WA 3A1FA 3STWA 1JHQA 3LIIA 4LMPA 4Q34A 1YMVA 4ZCSA 4UTNA 7MHTA 5BV8A 2AKAB 5JXGA 2ES4A 2G67A 2DH6A 2WVJA 1LDBA 3NTXA 3WO1A 2IU6A 4YFVA 2JLXA 1RIIA 4TTQA 4DNXA 2ISCA 5LVAA 4ESVA 1MO6A 3RWOA 2NZWA 1ESMA 4WH0A 3BD7A 3RLIA 1Y81A 3OJCA 2BYTA 1VGVA 4Q7KA 1Z36A 3JAWB 5LUBA 3IBGA 4KQEA 4DSZA 4LZAA 4P82A 1GPBA 1U7ZA 2O06A 1TTHA 3LT0A 4HUJA 3ZOZA 4DMHA 3I12A 4DPLA 5J2UB 1R8XA 3KQOA 3OF5A 3P7MA 2C1XA 3AG6A 2K7ZA 1EXWA 3AU9A 2HJRA 3H7IA 4Y6RA 2B8WA 3O7MA 4JLBA 1L5KA 3NHMA 4WGFA 8GPBA 2IY8A 1H1LB 1SVNA 1DMRA 1V39A 1N8TA 4IIXA 3AG5A 4S3MA 5LBUA 2QR5A 3LNCA 2P9FA 3DMYA 3FCUB 5JHHB 3QTBA 3X2FA 3TR5A 2O5EA 2PSEA 5ILQA 1NXVA 5FPQA 3V4VB 3E9QA 3DGEC 3IQHX 5ALVA 3A3PA 1GL7A 3T5CA 1IYZA 2WNHA 3NDPA 5CB8A 2F8SA 4MV7A 2VDLB 3IC5A 3O9MA 3PF9A 1QQ7A 2BGUA 4LV8B 5J5AA 2ODAA 2Q1UA 1Z74A 1CQIA 4CMCA 5DTEA 2E48A 5JFGA 1DEHA 1NVTA 1XEFA 1QAOA 3ZQ4A 4E0BA 2ZBUA 1N5JA 1VJRA 1VL2A 2XGGA 2XCIA 2X5KO 1WF3A 2JCBA 2O6LA 3DEIA 5DHFA 1SUAA 6CHYA 4DG8A 2C98A 3BCRA 3PGA1 3IVAA 3U80A 3O93A 4JWTA 1W5BA 2G40A 5G1OA 3S1AB 5CDGA 1IVSA 4CODB 1S4QA 1SD5A 1DBVO 1MTZA 2WLTA 4ER6A 2OHXA 1DIBA 3BPSA 4ND4A 1BWQA 3BFJA 2VUTA 4BNMA 4QUIA 3OQVA 2FUKA 3EVGA 4MCAA 4OD0A 4ZVOA 4ARCA 4LTMA 4BCCA 4RM3A 3DUWA 1RXWA 1QIKA 4JXXA 3D0OA 1KE1A 2PUBA 4TYMA 3C3BA 3P9IA 1KYXA 1OF1A 1H2ZA 2O59A 5U4QA 3GL9A 2O54A 2H0RA 1O97C 4X41A 5LQDA 1NJSA 2HQOA 1A8PA 1Y7TA 1SH7A 3GGJA 4HPJB 5GMOA 1O7JA 3H87A 2R1UA 4O4HF 2B2CA 3W5VA 4TQAA 2B1QA 2YHUA 3AWIA 4KZKA 3H9BA 4MS4B 2HF9A 1QFYA 1NW3A 1V8DA 2P7IA 3DBHA 3WZ2A 5LLTA 3M9LA 4A8JC 1W5TA 3SLKA 3EIFA 4BV3A 1F4PA 4FKBA 4MGIR 5B1IA 1KMHA 4E32A 2FMHA 3L41A 1YR6A 3V80A 3F5SA 5ER6A 4P4NA 2RI6A 1JR4A 1OR8A 1RKBA 2ZIFA 1SD2A 3IDAA 4NE9A 5BVHB 1USKA 1XZIA 2PIDA 2VNSA 4J6FA 5AKXA 3OA2A 3T3EA 1VFNA 2OO5A 2ZIVB 3MCZA 4KW7A 5FTKA 1A95A 4FFRA 3FYUA 2ETVA 4OHWA 3VR5H 2F90A 5HXAA 2C31A 1ZI6A 2JS7A 1XZFA 3DZJA 2EFGA 3G0BA 5KQLA 4PCAA 1KR2A 1OPXA 2CHVA 3KEQA 3UMYA 3ZW9A 5L7YA 1RP7A 1YZFA 3PQ4A 4I46A 4D4MA 4NCJA 1VKNA 3CRW1 5M29A 1QHNA 2SCUA 4U00A 2QPLA 3HWX1 4LZPA 2FH5B 2XBLA 4P36A 5JH7F 2ZUFA 3DEZA 1YFKA 5FUBA 2WD9A 1CY1A 3AEKA 4LDZA 1MB0A 1PL6A 4BEBA 1QMGA 2PYZA 4EPYA 1DAHA 3N3AC 2WINI 2YZNA 1IHXA 2GCOA 3DFUA 1L7MA 3ENWA 3ROPA 1IPHA 4KXNA 2ODWA 3CH5A 4PO1A 1DJQA 2GKOA 2EBFX 3IQGX 4PZYA 3FNHA 4ZK2A 4JVNA 4JMLA 4BQRA 3M33A 5E8RA 4RETA 4W5RA 2VBIA 2F59A 1XEXB 2FX3A 3P52A 4YPOA 2IHUA 2QVYX 3QWIA 3K9HA 3L4EA 4KQMA 2C58A 1GGNA 2H63A 3GBPA 4LXUA 4MR8B 3WB2A 4B1FA 4DDTA 3RHTA 4GKKB 3UAYA 5B1DA 2HA6A 2P2SA 2IYYA 2Q9BA 1E3EA 1H23A 3ED5A 3PBKA 3NOXA 1UAYA 3OCZA 1ZOIA 2YXEA 4QDXA 4RF3A 4OBEA 1CT9A 2WHXA 5EJ8A 4FCWA 1NN3A 4RHFA 2DPHA 3PR2B 1OXKB 4I3FA 2W6PA 3RYTC 1MOZA 2I2WA 5ERGB 3OMXA 1U8TA 1FQWA 1JPVA 4AROA 2GD0A 4XLLA 1KRHA 3FZEA 4DEYA 4NBVA 1E32A 3LY8A 5BWCA 3NGLA 1D2CA 3IHKA 3VNAA 5ICGA 3A1SA 3PDCA 1X1QA 2EARA 2IEBA 1L5HA 1RXVA 1TK3A 4NQRA 5EXDA 4GRIA 3W8DA 1ZD1A 2FZGA 2HHAA 1Y3AA 5TVGA 4N40A 3EFHA 4F2PA 3SZ3A 2PLFA 4WFQA 5EJ2A 2A67A 2BGNA 2AN5A 2JIDA 3UJ3X 2FSPA 2QXTA 1IPEA 5E0KB 2AQHA 4FXPA 3DMNA 1ZH2A 5JC1A 1Z7WA 3P27A 3VZDA 1SPBS 2GOYA 3CO5A 2YMPA 3R9XA 3ROMA 1U2RA 2J8ZA 1N6KA 2YOGA 5HGJA 3AV3A 1P5RA 3JCZA 4QGAA 4FBGA 1CF9A 3WGKA 3ZK9A 4QOSA 1I1QB 4WECA 3TRKA 3WRYA 3QQ5A 3LVBA 2JIBA 4MHTA 5EXPA 4P5DA 4QA9A 5J5VA 4YJGA 3KYBA 4V0MA 3EFBA 3ZXYA 1JAIA 1ZD4A 1N8NA 3WK5A 4ZHQF 2XOXA 4H6VA 2M9MA 3U44A 5IBQA 5HZKA 2AOTB 2WT4A 4M1EA 4WXHA 3RFFA 2BFNA 4MKFA 3RSLA 2IWRA 1JLRA 2C1EA 3T3IA 5EUBA 3AFNA 1DRWA 1Y0BA 3I39X 2X6QA 4FHEA 1I51A 4DDMA 3DR5A 1NI4A 5C7LO 1RPTA 4M1ZA 6REQB 4F85A 4OL9A 3ZWDA 3AOGA 2YXDA 1ZK4A 3H99A 4S0XA 5K6TA 1MIOA 3CEJA 3L7AA 1V4VA 2B4RO 2F8MA 1IZ7A 1H2WA 3NS7A 5E4JA 4YN3A 3JRXA 2QWXA 2ID7A 2PJRA 3ENKA 3UICA 2PS9A 4IYRA 2JGNA 4TTAA 3ZKWB 4BFZA 1YTLA 3G8DA 2KWIA 3BD6A 3GRAA 4LXIA 2Z5FA 4OI2A 3T0FA 1LGYA 3K8OE 2NTYC 3KM0A 4B76A 4JH0A 4GOOD 4KIWA 4M36A 1LBIA 4WWHA 2XXAA 3ACDA 4HGPA 1FDVA 4NEQA 2XNDA 3VMMA 2VYCA 2OAEA 1M34B 2J3HA 1Z2PX 2MR6A 3NEAA 3O3NB 1AGXA 4G41A 5EKDA 1T9HA 4EJ0A 5KNDH 4TRRA 1MN6A 1RQNA 4J2TA 2GR9A 2QVCA 4YJ3A 3NBQA 3ZCUA 2V58A 4Q4HB 4HS4A 4RD4A 5HILA 4EB3A 8ADHA 1UXKA 4C20A 3OQHA 2FMTA 3OI7A 4M8LA 2D0PB 3EXG2 2VDMB 1I30A 3H8VA 2XYQA 3E1KA 1AVTA 4FIDA 3THWA 4M7OA 4WTOA 4JQCA 4RAQA 3H5RA 4QARA 2GEFA 3N0TA 1VG9B 1EM6A 4BGIA 4INJA 2ZIXA 4QHYA 3RNLA 3SX2A 3PLAE 3GUZA 4NDZA 3GI1A 3BMQA 3LVQE 4HQ6A 3CX8A 1ULTA 4R1LA 4EPVA 3H97A 1CVLA 3RQIA 3D81A 3NHBA 1H5UA 4G5RA 2WHPA 3LWDA 4M9UA 3WL7A 4ID9A 2XB6A 1HTTA 1CSEE 1XO1A 4EMBA 5A5VA 3F9RA 1P2VA 4KYIB 1Y34E 2O4CA 2A0YA 2HWUA 4AT1A 1K8RA 2V4UA 2EWVA 1E1DA 4GOKA 1MNAA 4ZYZA 4PBSA 3W8FA 1JL3A 1U8AA 2KQUA 5DIZA 1HYQA 2I22A 4AXBA 1ZWLA 5EFOA 3K09A 4HH0A 4X6UA 1IDN1 2P9QA 4HDAA 4ZZ2A 1UP4A 2R65A 1ORDA 2ZVJA