4ND3A

Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (l-lactic acid) and cofactor (b-nicotinamide adenine dinucleotide)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
317
structure length
317
Chain Sequence
MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITASIPGRPKDDRSELLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPATSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLDNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lactate dehydrogenase, adjacent gene encodes predicted malat
publication title Biochemical and structural characterization of Cryptosporidium parvum Lactate dehydrogenase.
pubmed doi rcsb
source organism Cryptosporidium parvum
total genus 113
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nd3A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4nd3A02
2WWRA 3QVTA 2CFCA 3CXRA 3DZKA 3ZWYA 4ALNA 2GZ3A 5KVQA 3GGPA 2Y1GA 1XSEA 3O4RA 3RUEA 1OOEA 1LSJA 2V6GA 3JQFC 3L9WA 1F8FA 3C3XA 4B79A 3QW2A 4JROA 5JYEA 2NLOA 4CMHA 4I9UA 3KTDA 3DZBA 4OKNA 3OF2A 3RFVA 1E7SA 1HF3A 1U3WA 2BFOA 4DTIA 3I83A 2HDHA 1T2FA 4FW8A 3C1OA 3GVCA 1D1TA 2WM3A 1PU2A 3H2ZA 4WASA 4DQVA 4AJ4A 2GN4A 5TIIA 5TJ9A 4M86A 2O3UA 2EWMA 3GLQA 1JWAB 4NBRA 4B3IA 4TVBA 5JLAA 1LUAA 1NWCA 1X15A 1WLYA 1PZEA 2D4AA 5AVOA 4BO7A 3BMQA 2ZB7A 4RLSA 3DO5A 5G0UA 4IJUA 4CPDA 3AK4A 3OHSX 4ND3A 5JDCC 4E21A 4NQZA 4DQXA 3BMQB 3E6AA 3FWNA 5JDIC 4ALJA 4L4RA 1SO8A 3K2BA 1DC3A 4AVYA 1A9ZA 2X0IA 3Q0EA 4W6ZA 2YW9A 4J3FA 2VZ9A 2X4GA 3I6QA 3MJVA 1ZSYA 4MOWA 3GR6A 2EW2A 2Z95A 1D1SA 3KM0A 5CFZA 5KJ1A 1H93A 2B4QA 4JJFA 4PLZA 1OC4A 2CDAA 5CEFA 4E2ZA 2FY8A 2VUTA 1V3VA 4IS3A 4UUMA 1ISMA 3BMCA 4CQMD 3GF4A 4I5FA 1LBEA 3ZGYA 3FTPA 3OM9A 4UULA 1J5PA 3ANLA 4JLWA 3KYDA 4QQRA 4CL3A 4E3ZA 3PVZA 3BMCB 3OMLA 3L6EA 3U0BA 2PTGA 1TVEA 1Z7EA 1DBVO 3DZGA 4E5YA 3JYQA 4NH4A 1A7KA 3VPGA 4ZHSA 3H4VA 1OBFO 4KZPA 2Z1MA 3LSYA 3V2GA 5IG2A 3PYMA 1HE3A 1X7DA 3AI2A 1FMCA 2IODA 3E82A 4PG8A 4E5MA 4QTZA 2QHXA 5HWSA 3GAFA 1QG6A 1QR6A 5L7WA 4RCVA 3H6KA 5TS3A 3O38A 1RPNA 3I9NA 3WGGA 1Y8RA 2O4UX 1CDOA 2X0NA 1SOVA 1KOLA 2FSVA 4MKRA 1DSSG 2IE0A 4UVIA 5F5LA 2UVDA 4E2YA 3FR8A 1TXGA 3HNPA 2RAFA 5K6AA 3F47A 2FN7A 3O9ZA 1Y8RB 4XCVA 4B4OA 3PHLA 2X5JO 5EQFA 5CEEA 1BRMA 3OBBA 2C82A 3ZHZA 1KYQA 1PR3A 2IEBA 4RVHA 3PLNA 3I23A 2DBZA 4BGIA 3V2HA 5JFOA 3K5PA 3ZDFA 4UVDA 1DAOA 5DOZA 3TOZA 3D0OA 3OIDA 3MWEB 1P44A 4NPCA 4GLOA 4EBFA 6ADHA 3OECA 1XIVA 3DFZA 4PZDA 2YUTA 4U7WA 3U49A 4S1VA 3Q11A 4CMEA 4LMRA 5LDHA 1QYXA 1NXQA 4QX6A 3OJLA 3JYNA 5AOVA 3VPHA 4BKOA 2FZEA 2OZPA 3OJ0A 1NR1A 3DMTA 5CDGA 5JW6A 1X7GA 1V35A 4PLVA 4OAQA 4ESOA 5B12A 1U8XX 3ICPA 4CJXA 4C7JA 3LC7O 1KC3A 5L4LA 4XEHA 3GVXA 5A3VA 2FRDA 2EJVA 4YJHA 3WOHA 3RC7A 3JV7A 1YVEI 5L9AA 1X14A 1MG5A 3H3FA 2X5KO 1OZAA 2X0JA 3D3EA 2DPHA 3UCFA 4U5QA 1ISIA 1T4DA 1T4BA 4YJHB 4PRLA 1PIWA 2AEJA 2NACA 4FGSA 2J5KA 1NQOA 3M1AA 4BO2A 3VHRA 3K8ZA 4IGEA 3JQ9A 4NFHA 1VC2A 3W4JA 4A5OA 2QQ5A 4GGPA 1MA0A 1ADFA 4I08A 4TZTA 1Q0QA 1DC4A 9LDTA 1EFLA 2ZTVA 4BO0A 5DN9A 1VKNA 2QZ9A 3VC7A 3EUWA 3MZ0A 1B26A 5KKCA 4R1SA 1MP0A 3DB2A 1ARZA 5HBRA 1N8KA 3NDJA 1BGVA 2JJYA 4E30A 2WTBA 1GYPA 4MVJA 3R1IA 3UOGA 3H9QA 3PWKA 1FJHA 3CSDA 3CMCO 4CODB 4CR6A 3M6IA 4CMKA 1OC2A 1CQIA 1DRUA 2XXJA 4E6PA 3FR7A 4Q3NA 4TZKA 1ML3A 1E6EA 1LDGA 3DTYA 4HUJA 1R0KA 2B37A 1ADBA 1XA0A 4ROSA 3NJ4A 1U1IA 1A9YA 1ZIDA 1I3MA 1LDMA 4I1IA 3WIEA 1NHGA 2WDZA 2GN6A 3PIIA 4TWRA 1YOVA 3MEQA 3NTQA 1RKXA 3PHGA 3QE3A 2Y1OA 2ZQZA 1TLTA 3GMDA 3LT0A 1YOVB 1BXGB 2IYPA 2Y0CA 4BUCA 2DTEA 4JK3A 1B8UA 1E92A 1EE9A 1IE3A 3GHYA 4OSOA 5JCJA 2JD0A 3ROMA 4DRYA 4DVJA 4YAGA 4Y98A 4BKPA 4J43A 1HLDA 1PS9A 1SEVA 1Z74A 3K9QO 4A0SA 3SC4A 4WCFA 2C7VA 1DO8A 4XR4A 1P9LA 4S3MA 3GK3A 1M6WA 2FP4A 4GBJA 3RI3A 1M66A 3RVDA 4WCFB 1T1RA 5AYVA 1E5QA 2DTDA 3FI9A 3TQHA 2EGGA 4NFYA 1H2HA 2A4KA 2B35A 3UGKA 3ZHBA 2FPPA 2AQHA 1O89A 3D4OA 4MIOA 1UP7A 2RHRA 4DMLA 5LDGA 1B14A 1P3DA 4J1QA 5KKAA 2GF2A 5DBFA 4ZJUA 1DDOA 3S2FA 2B36A 3UH1A 5A5FA 3UFXA 2HMSA 4LCEA 1DXYA 1GR0A 5ENDA 1HSZA 4DGSA 3W8EA 3GT0A 4RPHA 1UP6A 3JCZA 4YT5A 1ISGA 4O59O 4NR0A 1E3SA 3BYZA 4J0EA 3H9GA 4WK6A 4XQCA 3OSUA 1A71A 4EJ0A 1LLQA 4J91A 3X2EA 2Q1SA 4Q39A 3F6YA 2D59A 2Q2VA 4J9UE 4P38A 3TZQA 3Q1LA 4L4SA 4UEKA 4AJ2A 4XDYA 4XGKA 4ITUA 3UKOA 1GADO 1E1MA 5IDWA 2HMUA 3F9IA 1P1HA 2ZJ1A 2VNSA 3JQDA 4JGBA 5JMPA 4BGUA 4IDDA 3ETEA 5COAA 3TN7A 2TMDA 4DLAA 2Y99A 2NTNA 3NKLA 2VN8A 4E5PA 1WDLA 1SMKA 4Z0PA 4RPJA 5IJZA 7ADHA 4ALMA 1JA9A 1I30A 2BGLA 1WZIA 4W82A 4XJSA 3AM5A 1PTJA 5JDCA 3QVSA 3STHA 4BGVA 1C0PA 3DZFA 4WLFA 3PLRA 3UW3A 2B5VA 1VSUA 2QRKA 4E5KA 3U4HA 1QSGA 1W8DA 2Y1DA 4FFLA 2HMVA 3IP1A 2EP7A 2ZTMA 4XYBA 4IJVA 1I5RA 4RGBA 3V5NA 4JJGA 2PD6A 3QHAA 1PGQA 4LVCA 1GPJA 4FGWA 4BV8A 3RBXA 3WTCA 3BHMA 4MO2A 3P19A 5U4QA 3AFNA 4YCAA 3JQCA 2H5LA 1LQTA 4XYLA 1TT7A 2JAHA 4AJIA 4FN4A 3GHHA 2YYYA 3N74A 3EZLA 5T5QA 2E82A 1MFZA 2IZ1A 4WLUA 2BH9A 2WYUA 4D45A 2X9NA 4H3VA 3GEMA 4BQPA 4RQUA 5JS6A 4J2HA 1ZEJA 1U3TA 2WD7A 3OEWA 1E1LA 4EUFA 4A7PA 2HUNA 1R4NA 5K0ZA 2EKQA 4WEOA 3VKUA 3DBHB 3I6IA 1YWGO 4J4BA 4OYRA 1A5ZA 3AOGA 1GEEA 4B4WA 1ENYA 1ADGA 5BSEA 3FBGA 2V6MA 2X86A 4GSLA 2JAPA 3GEDA 1R4NB 1P74A 4MIYA 3WBFA 4CV1A 2I3GA 1E5LA 4L76A 5FWNA 5IDYA 2POQX 3F4BA 4PLTA 1H0KA 4OH1A 4CM9A 1U7HA 1FF9A 3BTUA 2UAGA 1KVRA 3JQBC 1IB6A 1VL6A 1U4SA 1WAMA 2RCYA 1W6UA 2YHIA 1K6IA 5EIOA 5BT9A 2P91A 3ONEA 3WJAA 2PKRA 3O03A 4CMBA 3BHIA 2P4HX 5TJHA 5IXYA 1BDMA 1IZ0A 3QWFA 4A73A 2VOEA 1N5DA 5B37A 2YHIB 3ZCXA 3NEPX 2NU6A 3QWBA 3PGXA 4G5HA 4GX0A 1VI2A 1L1FA 4B3JA 4YJGA 4YRDA 2ZYDA 2FR1A 4E13A 5CDUA 5BNTA 1KEPA 1U5CA 4AJOA 5JYDA 5G0VA 3FRJA 3DHEA 3DOOA 2P4QA 3ADPA 1EE2A 1XLTA 1C14A 3IIEA 4BNZA 5B4UA 5HM8A 5I9LA 5FFFA 1IUKA 1MXHA 1PQWA 1J4AA 1KEWA 5L95A 3PFFA 3DTTA 2J5QA 4E4YA 2EJWA 4EJ6A 3WG9A 5HS4A 3U62A 3TDKA 4U0KA 2R2GA 2P5UA 1K6JA 4ALIA 1YS4A 2PFGA 4ZQEA 1DIBA 3DONA 4ZRMA 2RH8A 4D41A 1DFGA 3WYCA 5ITWA 4CMJA 4O63O 3G3EA 1MXFA 4LRSB 3ZHYA 1NAIA 4RDIA 4FJ1A 4KP7A 4BMNA 3ZW8A 4FSHA 4EUHA 3I4CA 4LK3A 4YBZA 1B0AA 4J4TA 2VHWA 4BNHA 1WPQA 4IDEA 5DOVA 1T1SA 3GVPA 2E48A 2YV3A 4GQAA 4GMGA 4MVJH 5HA5A 4C7KA 1C1XA 4MVJM 4F46A 3EC7A 3C1AA 3WFIA 4YTEA 3RROA 3EVNA 1E1NA 3IC5A 3WQRA 5GMOA 3LU1A 3F5QA 1Z7BA 4TSKA 1C1XB 3QRWA 2D8AA 4RQTA 1R37A 1HETA 4I5DA 4D0SA 2ZIZA 2RHCA 3RU9A 4BNVA 1EMDA 2VWQA 4WUVA 5EN4A 5KJFA 3OETA 5AXCA 5JAIA 3N7UA 1GQQA 1GQ2A 4KOAA 4YAIA 2I76A 1ZK0A 3AUAA 4IBOA 4PLGA 1V6AA 2PK3A 1ENZA 3LC2O 4DYVA 4BNTA 1LSOA 2A9FA 2VYND 4XZ3A 4DIBA 4EEZA 3E9MA 3NDIA 4FFRA 3KSUA 4FFOA 3GH3A 4ALLA 4PIVA 1R4MA 1I3KA 1R6DA 1TT5B 4B4UA 4PG7A 4RZHA 3ROPA 4I9NA 1CEQA 3QA9A 3VPFA 5CDSA 3RBZA 2W2KA 5CDYA 3RUIA 1NQAO 4CL8A 3F1KA 1PZHA 3H3JA 4YT4A 1HXHA 1YXMA 5JCXA 3SVTA 3D3WA 2W2KB 1HEUA 1IHYA 1CYDA 2GLXA 1I2CA 4JN6B 1ZMTA 1RM4A 1PSDA 2ZQYA 1A7AA 3DZIA 1XHLA 3L4BC 4PFJA 1C0IA 4E31A 3HB4X 3K31A 3D3WB 4L73A 1MG0A 3OIGA 1D3AA 2HO5A 1JKFA 1NPDA 3JQ7A 4TKMA 4TQGA 3SEFA 3UICA 1XDWA 4TRNA 3DOJA 2JHGA 2XAAA 4R16A 1K5HA 3CEAA 2CVOA 3JQ7B 3GPIA 3GDGA 4RVSA 1KVSA 3SXPA 1ISFA 4RZIA 3HJAA 3WYBA 8LDHA 5DCWA 2OORA 4I5EA 5A1TA 1MC5A 2AQ8A 3GUYA 2H9IA 4ZRNA 1G6KA 4R3WA 4BO5A 4B3HA 1ZO8A 4KUEA 4Z6KA 4ZVVA 3HSKA 4R51A 3ZNQA 3PQEA 2VWGA 4R54A 2GPTA 2YV2A 4CV2A 1O8CA 1P0FA 3LC1O 4MJLA 3AU9A 2BLLA 5TLSA 3WQQA 4B8ZA 4HFMA 2JCXA 3E9NA 2G1UA 2OGUA 3KLMX 1DLIA 3H9EO 5GZ6A 4U6SA 2D3TA 5CPBA 1KY4A 1KETA 2C2YA 1BW9A 3RC2A 3HDYA 5IDXA 3LT4A 4O1MA 1E3IA 2D2IA 3HUDA 3CE6A 2OOSA 6LDHA 3FNHA 1P1IA 4A03A 2DLDA 4UREA 4FD3A 2PA3A 2IZZA 2PGJA 1JVBA 2QZZA 1ZH8A 1BW9B 1EBUA 1BXKA 2AHRA 4JP2A 1ZKMA 3G0OA 3PK0A 3Q9UA 3AUTA 3HDQA 3UCEA 1EVIA 4X54A 4ZQFA 2VCYA 5FEUA 2PGDA 1NHWA 1X0VA 1ID1A 3K92A 5EQDA 3HDHA 1GAEO 3ST7A 3NTRA 3KYCA 5I9MA 5I8WA 1UXGA 4B7UA 3C7AA 1JKIA 1NASA 2X58A 4FJ0A 2G0TA 4WOKA 2PD4A 2GCGA 3PJFA 4R68A 1W4ZA 3PDUA 3GPDG 4AJKA 2DTXA 1KERA 1XWFA 3KYCB 5DT9A 4FBGA 4A27A 2ZB4A 4BNMA 4IJKA 1F17A 1XKQA 2LDBA 4XWYA 3CPSA 3OJOA 2I67A 5A9SA 1DFHA 3MOGA 2ZB8A 2B4TO 3I9MA 2AXQA 4K1LA 4RVGA 4YEDA 3WQSB 3MCVA 5AXBA 4EW6A 4CLXA 4B4VA 4YPOA 3PZRA 2R00C 1IL0A 3JYOA 1DC5A 4DQUA 1P1JA 1N9GA 3M2PA 3D4NA 5U1PA 1H5QA 4ZA2A 5CP8A 2DM6A 1K2WA 2IXBA 2O3QA 4GVXA 4BMSA 2HK8A 1ZK3A 4RO0A 1N9GB 1E77A 5I8ZA 4EITA 4NZ9A 4D3DA 4UEJA 3D5QA 1GEGA 3N58A 3GEGA 2RH4A 3RU7A 4TMFA 4J1SA 3WJ7A 1UXHA 4AJLA 3RBVA 4B7CA 3DAPA 4KUGA 4NI5A 4CR7A 1PJ2A 4MP3A 2O7QA 1Y6JA 3H5RA 1NYTA 2DVMA 2Y66A 1E7QA 4IZIA 4L75A 1UZMA 4PVDA 4TROA 1RM3A 1PJQA 2E37A 3ASVA 3EYWA 2BGKA 3GZ4A 1B15A 3ZI0A 3PYLA 3BAZA 4WEQA 3VTFA 3LT1A 3DDNA 1HKUA 4JBIA 4Q3BA 5EERA 5I9NA 4UVGA 3DFUA 3PQFA 4C4OA 2O7SA 1GUFA 3EY4A 3LQFA 2O3TA 2B69A 3CTMA 4UVEA 1Q7BA 3JQBA 4D79A 4YT2A 3AOEC 3KYDB 1RYDA 2HMTA 3GC6A 3H7AA 4J7CA 2W2LD 4HNHA 4LN1A 4R5MA 4EZBA 4CM6A 4JIGA 1EVYA 4Y6RA 1E7WA 1NVMB 1S7CA 1I0ZA 3IKVA 4KTVE 4BNYA 5KJCA 3S1LA 3PHJA 5B1YA 4K9DA 2QX7A 3BMOA 1O0SA 1PS0A 1AHIA 1UZLA 1X0XA 1LDBA 3BMOB 3JD3A 1GCOA 3DHNA 4OL9A 3E9QA 1ADCA 4OJNA 2X9GA 4UUOA 4WPGA 4DREA 5AQ1A 2ZCVA 2G17A 4DA9A 1V3UA 3L6DA 4W7HA 3QQPA 2OO5A 4YJFA 3OEYA 2JFHA 4W9NC 1G0NA 1UAGA 4ND2A 2UUOA 2C5AA 2E4AA 3DBLA 4RPKA 5TRTA 4WLOA 1JN0A 1GY8A 2YFHA 3RSHA 3VKVA 3AY3A 3WMWA 1UDCA 1ZXBA 3GG2A 4H16A 4H7PA 2FHSA 4N5NA 3D5TA 1HE2A 3DBLB 2EERA 4LW8A 4EYEA 3EW7A 3A9WA 1U3UA 1YBVA 2I65A 5B4VA 1I2BA 2VHVA 1E6WA 3GOHA 4LRTB 4IQ8A 4WECA 2NQTA 1WWKA 3NT2A 3KETA 3K30A 5I7SA 3VVBA 5FYDA 3K73O 4KWIA 2A35A 1KIFA 5JC1A 1YO6A 4W99A 2C0CA 3MJEA 3B1FA 3P5SA 4BS9A 3BTOA 1ZBQA 2DUWA 3IL2A 2Q3EA 1GQYA 3RUFA 2VZ8A 3DXFA 3WDSA 1DHTA 2WD8A 3PIDA 1BSVA 4RV9A 1X1EA 1GZ6A 5ICMA 3W6ZA 4MVJE 1XQ1A 2AG5A 3T7EA 4CMGA 4YB8A 1DEHA 3G79A 4L74A 5KTKA 5COQA 1Z82A 1PL8A 2VHXA 3JQAD 3UXYA 4OKIA 3EVTA 2X6TA 3DMYA 3CMMA 3WWZA 5DDIP 1H94A 2VHYA 4NDNE 4RORA 1CQJA 3C1TA 3JD2A 3V1TC 1H6BA 2XPCA 1AN9A 1VL0A 1ZCJA 4IQ0A 1YH3A 3ZW9A 5EL0A 2BELA 1EFKA 1I32A 1YL5A 4J1TA 5G0WA 1HSOA 1QMGA 1RYEA 3KEOA 2ZJ0A 4LVUA 3WLFA 1PWXA 2VT2A 2C7GA 5F1PA 4UAGA 4YJDA 4DPKA 1QLJA 3GGOA 4CLHA 4DIOA 1GZ4A 2NVUA 5AXAA 3RASA 4FFPA 5MGBA 2EIHA 3ZWAA 5C3MA 3IAHA 1I3LA 1DC6A 1YBAA 3JQ8A 4FCCA 3L4BA 4NJMA 4HFJA 3RC1A 2NWQA 3GGGA 2NVUB 1CWUA 1M6HA 1NTOA 4N7RA 4GKVA 5G4LA 1Z6ZA 4IM7A 1PQUA 3OQ1A 1QLHA 4RF2A 1HE5A 1MV8A 2W8ZA 3FSRA 3WMXA 1ORRA 4Q3DA 1EK6A 3Q6IA 4CV3A 4D43A 5KWEA 4R1TA 3GDFA 2CSUA 4CV0A 2H1SA 3QWAA 4TVOA 1EQ2A 3ROQA 2IRWA 4HKTA 2BD0A 3TZ6A 4FC7A 4P22A 1ZZEA 3F1LA 4G2NA 1Y7TA 1YONA 2HU2A 2W98A 4CM4A 1V3TA 3H65A 4M89A 4QT0A 4RDHA 1NVGA 2O23A 2VT3A 2DAPA 4ZD6A 4Z3KA 1F06A 3NDRA 2X0RA 4NU6A 5KOIA 4H15A 3JD0A 1SOWA 5TT1A 4CM4B 4A26A 2UYYA 2Z1NA 4OQYA 1ULUA 3TZHA 2LDXA 4MPDA 1HYGA 1PGPA 2OXIA 1MLDA 1UXIA 3SBOA 4QXMA 1DPGA 1Y8QA 3RUAA 1B3RA 3RFTA 3B6ZA 4MVJI 4IGFA 2GN9A 4GLLA 1HDYA 1P1FA 1RWBA 4BNFA 1OI7A 2V6FA 2PWZA 2Y0EA 1UAYA 2CVQA 1Y8QB 4JBGA 1Y5RA 1RM0A 1FDSA 4GWKA 4YAKA 1ENPA 1W73A 4RPGA 2ZYAA 1GYRA 3AI3A 3TFOA 4MP6A 3PQDA 3LYLA 3I9LA 2FPGA 1EVJA 2Q2WA 3JQFA 4DWVA 1TEHA 2HSDA 1A4IA 1JU9A 2EKLA 1V0JA 2G5CA 2HRBA 3KV3O 3DBRA 3T4XA 4DUPA 3WS7A 3ZWMA 4CUKA 4A10A 1KBZA 3QLJA 2EHDA 4PLFA 1UH5A 4HBGA 4ZU3A 4IDFA 2I66A 3DBRB 1AXGA 4FDAA 1H6AA 1AE1A 4CLDA 4Y9DA 4HWKA 4F6LA 1T2DA 3OP4A 3TZKA 2HMWA 3ZWOA 3QVOA 4K6FA 3QVWA 4P4NA 2Y1FA 5CDTA 4L8VA 1FDTA 2ZTLA 2EEZA 2GGSA 2R00A 2JD1A 1PGJA 2Y05A 4PRKA 1W0CA 1QYDA 3PDJA 1AHHA 2VRCD 2AEMA 1QRRA 1R15A 1LNQA 3RAJA 1MX3A 1PR9A 3WGYA 3ZWCA 1E7RA 4PLPA 1NQTA 1TB4A 2BKAA 4KQWA 4NBWA 2V65A 5FI5A 3I9KA 3VZPA 1PS8A 3AU8A 2J3HA 3NTOA 4BNKA 1CIVA 3E5RA 1LEHA 3GAZA 1XR3A 1LRLA 2Q1UA 1VKOA 4BB5A 4IQGA 2J3KA 5BSHA 2JD2A 3VDQA 5JDIA 4GGOA 5JBIA 4DPMA 4XA8A 4IMRA 3QIVA 4PG6A 1DIAA 1LSUA 4WE3A 2NUAA 4MINA 1DIRA 1UR5A 4YQYA 5TSDA 4J9VA 2YJZA 3ULKA 9LDBA 1S6YA 4KQXA 1N1EA 3WNQA 1I24A 1ZUD1 2RIRA 2QYTA 3RCBA 3C7DB 3OICA 4LSWA 1J49A 3W4IA 2I99A 2H63A 4DC1A 1ZK4A 1VRWA 1JAYA 1WXDA 4OHUA 4ALKA 4DC0A 3DC2A 1ISHA 2Q45A 3HG7A 4G65A 1UJMA 3JD1A 1NQ5A 3IJPA 5B4TA 2QG4A 4XYEA 1I33A 4Z0HO 4NBVA 1R0SA 4NMHA 3CZRA 2DKNA 4OGWA 3WNVA 2GR9A 4GVLA 3BHJA 5DF1A 3QSGA 1LX6A 2OP0A 1LDNA 3CINA 5ES3A 2JFFA 1SCUA 1H6DA 2BFAA 2Q1WA 3EDMA 4XYMA 3WBBA 1M2WA 4J2OA 3F3SA 3RQSA 5CEJA 5JMWA 4EGFA 1LRKA 4AJEA 3NT4A 3RUCA 4KWHA 4CQMA 3H5AA 1BDBA 5KVCA 2NTVA 1T2CA 3FCOA 3GNTA 5IXSA 2VTDA 2WD7B 2IYOA 3AY7A 1A27A 1I3NA 4ID9A 4W7IA 3VZQA 4MIEA 5L4NA 5T8KC 2PR2A 2PH5A 4UVHA 4CQMB 2J3JA 4II3A 2GN8A 1DOHA 1WDMA 4YQZA 4YA6A 2XXBA 5G0SA 5TQVA 2B83A 2Y1EA 3INTA 4FFMA 2NSDA 3K2EA 4LCJA 1U7TA 2W2LA 2ZKLA 2C54A 4FC6A 4PLYA 4AJPA 1R0LA 4XKJA 3VVCA 5TT0A 1X1TA 4FB5A 4GMFA 4WGGA 3ON5A 2DU8A 2FR8A 5COBA 2HQ1A 1SC6A 3DBVO 4OMUA 5K9ZA 2XOXA 3H5NA 2PNFA 2HK9A 1YJQA 4J16A 3KUXA 5C7LO 2G82A 4PLWA 4CM7A 4CM8A 3WWYA 3BXXA 3A4VA 4AJ1A 2EG9A 5F3RA 4ND4A 2J6IA 1JTVA 2VUUA 1ZXLA 2VTEA 1VJ1A 4CM8B 1ISJA 3L77A 2CD9A 2J8ZA 1OFGA 3KSDO 5JAZA 1HZJA 3KHUA 1Y9EA 1I10A 4YJGB 1U4OA 1HDGO 3AUSA 3NX4A 2DT5A 1NP3A 1KEUA 3HHPA 4RL6A 2Q46A 1ZVMA 1XG5A 1DRVA 1E3EA 1P77A 5BSFA 1B16A 1SB9A 2YFQA 2EKPA 2FR0A 5JE8A 3VH2A 1HDOA 1LI4A 3GVHA 2F1KA 3MOIA 4ZGWA 3PXXA 5IN4A 1WMBA 3HN2A 2CUKA 2DPGA 3PYXA 2W4QA 5U9CA 3UVEA 4I5GA 3G49A 3IMFA 2DUUA 4YACA 4OM8A 4Z9XA 2GO1A 5K6AC 4JXKA 2O4CA 2YV1A 3ZWVA 4NK4A 5A3JA 1AGNA 4WLNA 3VAZA 3ROKA 4BV9A 5A06A 1HDZA 2JL1A 3FN4A 3I9OA 5F1OA 2GNAA 3AY6A 3A06A 3VPSA 3HDJA 4R9RA 4N5MA 3A14A 4D3FA 5G0TA 1B8VA 1EBFA 1FDVA 3KSZO 3I4FA 4QFCA 5T57A 2GERA 5F5NA 5DP1A 1YJ8A 4Z9YA 4WOJA 1N7GA 1QORA 2P68A 2P9EA 2Z5LA 1QKIA 4EJMA 1BMDA 4GX5A 4J4HA 3JQAA 4J49A 4YAEA 4R1UA 1P0CA 3DMTC 1JW9B 4PZEA 1LC0A 4M49A 1P1KA 2CDBA 3TPCA 3U5TA 1CJCA 4BO8A 3JQAB 1DFIA 3OA0A 3S2EA 4U8GA 4ILKA 4PG4A 2HJRA 3IQDB 2X7HA 1E3JA 4E32A 1SBYA 1PGOA 2Q4BA 3OJEA 3PWZA 2ZYGA 4AG3A 1CERA 2DBVO 2OFPA 2Q4EA 3EHEA 5EINA 2F00A 3WR5A 3P7MA 2RBEA 4OXKA 4M55A 2O50A 1HYEA 1GUZA 2PKQP 1SNYA 4R5HA 5IZCC 4PGFA 4IY1A 3X2FA 3VOSA 1R4MB 2GASA 1L7EA 1TA4A 1YL6A 5FI3A 1F12A 2VQ3A 4N18A 4M54A 3S2IA 4B7XA 3GFBA 4JNKA 4BNXA 3PI7A 5DBIA 4DIFA 1FDWA 4Y67A 4Q3CA 2YHUA 4NK5A 1DIGA 3NAQA 4MDHA 1VE9A 1YB1A 4BHTA 4RVDA 1ZFNA 3JQEA 5L3ZA 2PH3A 3GNQA 4XB1A 3U4DA 4AJNA 4OO3A 2HAEA 5JY6A 3VDRA 1ONNA 3BZUA 3W8DA 1N1GA 1DAPA 1Y9AA 4BNLA 3WGIA 3CH6A 4XIYA 4FQ8A 2A94A 1XGKA 3H9JA 4D7AA 3G1UA 3ONFA 3KRTA 1U5AA 4XD2A 4Y8VA 1C3VA 1LLCA 2FWMX 3E48A 2GRAA 2VNAA 3INGA 1KC1A 4RPLA 4CLOA 4ND1A 5T67A 1VLLA 1G1AA 1NFFA 5DCUA 4MKZA 1NFRA 4KDFA 2BRUA 4CLOB 1ZJYA 2DBQA 1ZK2A 1UDAA 4FR5A 3IJRA 4BKRA 1XQ6A 3TF5A 3WFJA 5TF4A 3GRPA 2Y1CA 4OSPA 3KVOA 4QUKA 5A9TA 1PJCA 3PPIA 3QV1A 1XCBA 4U6QA 4Z9FA 3U4IA 4PZCA 1YDEA 4J6FA 4FOOA 3D7LA 3W6UA 5FF9A 1IPEA 3E5MA 2NV6A 1JKJA 2GYYA 4WCFC 2WEKA 3CKYA 3EK2A 3T7CA 3DWFA 5I7EA 4Z0TA 1H2BA 4P4GA 4FOSA 3MJTA 1E3WA 4MKXA 1PZGA 3DOCA 5KCZA 3S8MA 1E7MA 4IJWA 1SEPA 1P33A 2WYWA 5JSFA 3R6DA 2E49A 2GZ1A 1E3WB 3ENKA 1HWYA 3JYPA 4OXNA 5L7TA 2CNBA 3U3XA 1I01A 1KS9A 5GZ3A 3L4SO 3SX2A 3ICCA 4IXWA 4DL9A 5JNLA 2HJSA 3LLVA 2VRCA 3HQ4O 2C20A 4BO3A 4DYDA 4M1QA 3NGXA 2P9GA 3CUKA 5A9SB 4IXTA 3AUUA 1LA2A 4D0RA 5DULA 1K0UA 1IHXA 1ZSVA 4BQRA 4CMIA 5CG2A 1MUUA 3L07A 1BVUA 1J0XO 1O94A 1RJWA 1HL3A 2FMUA 1BHSA 4K28A 1OAAA 3PEFA 3TL3A 3UCXA 1WNTA 2DQ4A 3OIFA 4AJJA 3VTZA 4CLEA 1ONOA 1Q0HA 3QWHA 4LGVA 4CMIB 5L51A 4IZHA 1JQBA 1EZ4A 1HDXA 2OBNA 1G0OA 1PJSA 3BTVA 4E0BA 4HNGA 4FJ2A 2AMFA 3QP9A 2JCVA 2ZCUA 5THKA 4FIZA 4Y6SA 3ADOA 3WYEA 1NBOA 1M75A 4IDAA 4TKLA 3UAGA 1WVGA 2BGMA 3OFSA 1T2AA 1MC4A 3C85A 1BVRA 5JAMA 2WMDA 4NBTA 1Z75A 3KO8A 4OOFA 3MJ4A 1HTBA 3RUHA 4R3NA 5T8KA 3IUSA 3GG9A 3QY9A 5KVSA 1K89A 2TMGA 3LK7A 1DRWA 2G76A 4I8XA 4PLHA 2ZB3A 1M67A 2NQ8A 3GFGA 3BIOA 3H9UA 4LSMA 4R1NA 5G4KA 4BKUA 3TZCA 1GTMA 4J7XA 2CF6A 1HDRA 4HADA 1X13A 3HN7A 3ZWNA 2I3AA 2VZ0A 4Z3DA 3ANNA 5A02A 2CVZA 4XGNA 5G4KB 4R69A 2UUPA 3KYBA 1EK5A 3O26A 2O3RA 2V7PA 1MFPA 5KNLA 1VM6A 3ZU2A 5DZSA 1NFQA 5H83A 4BO4A 3LF2A 1X7HA 1LTHR 1NM5A 4O6VA 4IPTA 3AJRA 3GY0A 2CZCA 4B8WA 4Y6PA 1GV1A 4Q3AA 5EMHA 1EUDA 4EDFA 1HLPA 2O3SA 1SB8A 3D4PA 3AFMA 1JLLA 1YQGA 3JQGA 1R12A 2EW8A 4IINA 5LCXA 3RD5A 4GWGA 4CM9D 5A4DA 2O2SA 4K26A 1HZZA 3JQ6A 3PJGA 3K6JA 4XJTA 4RJTA 3FTNA 3P2OA 2I5PO 2C29D 1GPDG 3JQGB 3Q9NA 3SC6A 2NADA 1NWHA 3F4LA 5HS6A 4CR8A 3GZNA 3O8QA 4WJZA 2JCYA 4WKGA 4Q3EA 1LRJA 4YJFB 4F3YA 3C8MA 1LXCA 1T24A 5ENVA 5JAQA 3VH4A 4DPLA 1JVSA 3MJCA 5LC1A 2A92A 3GZNB 3O8QB 2QW8A 3AM4A 4WCDA 5L7YA 1H9BA 4CUZA 4M87A 3DAGA 1SPXA 5DCYA 3ZU5A 2AE2A 1TI7A 4MVJG 5KJEA 2NVWA 1P1RA 4II2A 2XF8A 3SJ7A 2YY7A 4DBZA 4KDEA 4Q9NA 1UZNA 1AXEA 3ZV5A 1B3BA 2FSSA 3D64A 4L4XA 4NJOA 1KEVA 2YQ5A 1CRWG 3A28A 3UN1A 4PG5A 1A72A 5EPOA 2WSBA 4PLCA 4CM1A 3I5MA 3KLPX 3DEYX 1E0DA 1N92A 3BTSA 4AICA 4R9SA 2O2YA 1DJQA 3W4KA 1EQUA 3C24A 1I2ZA 3VH3A 3W1VA 2C2XA 2H6EA 2YQ4A 4JQCA 1FK8A 3IOYA 3GNSA 3VH1A 3UF0A 3GVIA 1MB4A 1QYVA 3ZWWA 3TNLA 1EEHA 2EGHA 3I52A 3KB6A 3KEQA 3PRJA 2AG8A 4NIMA 1GFSA 3DR3A 4YRBA 2Q99A 4RF4A 5EESA 4EI2A 3SLKA 5C7OO 4BNNA 3RKRA 3H8VA 4OQZA 2V6BA 3UHAA 4CLRA 3EZYA 5JY1A 2OL4A 3SLGA 2D1YA 4GKBA 1DB3A 3WGTA 3FNEA 1KVTA 3D1LA 4D42A 4DLBA 2AA3A 2NTJA 1PWZA 3FF4A 2BMAA 1BXZA 1GU7A 2P2SA 7MDHA 5IZCA 5F1KA 4O5OA 5A9RA 4CLRB 3OA2A 2J5RA 2Q50A 2GDZA 4TRJA 3EMKA 1GZ3A 4YXFA 2P9CA 3IS3A 3DHYA 4R01A 3I9JA 3V1UA 1ZJZA 4XIJA 3ITKA 5KIAA 4NBUA 1YKFA 1YE3A 4KMSA 1CF2O 3C7CB 3F46A 2PZJA 1IY8A 4XQEA 3MTJA 3EGOA 2VYNA 1ONPA 2ZATA 4TRMA 1QP8A 1QYCA 2EV9A 3JQ8B 4NJMB 1E1KA 1NPTO 2WE7A 5G2OA 4E5NA 4UEOA 3S55A 3U4CA 3AM3A 1GDHA 3A1NA 2BI8A 4KUHA 5BR7A 3FPCA 4YYZA 3CZMA 4E2XA 1K6XA 4P8RA 2FZWA 2CF5A 2X8LA 3INRA 2W90A 3FD8A 2Y67A 4NG5A 1QV7A 4YR9A 2AE1A 3DZJA 2C59A 1QV6A 4YVFA 4WLEA 1BG6A 1GV0A 3K96A 3LVFO 3PZBA 4HX5A 4FFNA 3TRIA 3W8FA 2DFDA 5JO0A 4ND5A 1HYHA 3I3OA 2VYVD 5L4SA 2PY6A 1B8PA 1D8AA 1LDYA 2PKQO 3IUPA 4J90A 4L9RA 3VPXA 3Q3CA 1BXGA 4P4LA 1YGYA 2CDCA 1Q2XA 4IDBA 4BNUA 3SJUA 3ANMA 3ZWXA 4R41A 2Y93A 5ER6A 8ADHA 3AW9A 1CETA 1I8TA 1ZSNA 3RJ9A 4MVJP 3HB5X 4WLVA 2AW5A 2PZMA 1BWSA 1Y1PA 2UDPA 2EP5A 1NPYA 4IMPA 1C1DA 5IN5A 1VPDA 3V2UA 4GPD1 3OH8A 4DLLA 1SZJG 3IP3A 4RF3A 3PJDA 5ICSA 2NM0A 3ABIA 1C1DB 3DAFA 4BNIA 4JBHA 1GCUA 1LDEA 2O3JA 4ZQBA 4KTTE 2PZLA 5ADHA 2PGLA 2HLPA 2ZK7A 3TL2A 2Q49A 1FDUA 1N2SA 3TOXA 4G81A 1YQXA 4IDGA 4IUYA 5CHEA 1O9BA 3KOUA 5IZ4A 2WJPA 2YDXA 3ZV3A 1ZK1A 5A05A 2FOIA 1E7YA 1LC3A 1LLDA 1VSVA 1F14A 2BF7A 5H82A 5I7FA 1PQPA 2ET6A 4QEDA 3ZWPA 1JAXA 2IEDA 3WB9A 1ULSA 2BHLA 5T6BA 2Q2QA 2O48X 5A04A 5JO9A 4LMPA 5F21A 2I6TA 2B5WA 2NU7A 4XGIA 1NVTA 4BO6A 1WMAA 1P45A 1WDKA 2OMEA 1YL7A 3JD4A 1BTOA 3H2SA 3IDSA 5DNAA 3ZV4A 4M8SA 2DC1A 3TSCA 4XDZA 2VHZA 3HFSA 2X9VA 5MDHA 1DHRA 2X23A 2VWPA 1HT0A 3ZV6A 3L6OO 3ZWBA 1EDZA 3E03A 4J7UA 4AFNA 3ZHXA 2AQIA 5J23A 1PX0A 2Y68A 1F0YA 3NV9A 3OQ6A 4W4TA 4BO1A 5CG1A 3ZNOA 5L45A 2PV7A 1N7HA 1Z45A 1UDBA 1UUFA 1YBMA 2D5CA 2NVBA 4QECA 4YAJA 3R0IA 2HK7A 3F5SA 1R16A 3AI1A 2JHFA 2EF1A 1U3VA 1GD1O 3P2YA 2OHXA 4J0FA 4RVFA 2VRBA 1UXJA 4WNCA 3KXDA 1XELA 4FS3A 1JWBB 3RWBA 2VOJA 4WNIA 2B0JA 5DP2A 3HWRA 4HFNA 3UUWA 3ZNNA 3LDHA 1GUYA 1LLUA 1V8BA 1B7GO 3ORFA 1IZ9A 2D0IA 5TNXA 3WGOA 1K3TA 4CM5A 1Q1NA 2HRZA 3RJ5A 4JP3A 4D44A 5THQA 4J1NA 2ILTA 3AOEA 3WTBA 5GY7A 3LLSA 3PHHA 3ZH2A 4F45A 4BOYA 1PJ3A 4N54A 4E33A 2P5YA 2QIOA 4XQ9A 3CIFA 4A2CA 1KVUA 1YB4A 4F6CA 3S2GA 2R6JA 3WSVA 4NNJA 4GSKA 3LT2A 2NNLD 4JJIA 4BKQA 3GMSA 5CAEA 5KVVA 4JCOA 2QRLA 2ZTUA 4IIVA 4D3SA 2GSDA 2YZ7A 3ZNPA 2JKVA 3BMNA 1IYZA 4BMVA 1C0LA 5T64A 3R3JA 4L0QA 4BL5A 5IDQA 3DBHA 1Q0LA 3FWZA 4MP8A 1I36A 3BMNB 1PGNA 1KY5A 2AEFA 1ZEMA 3L0DA 3LF1A 2GZ2A 3GN1A 4W9NA 3B1KA 2PD3A 5ILOA 3JTMA 2BFMA 1D4FA 1XU7A 3TJRA 5JXWA 1L7DA 2QYSA 3HZZA 5EJ2A 4BB6A 5TC4A 3U9LA 3AWDA 3ETDA 3ZZNA 5I7VA 4OXYA 2CMDA 3PWSA 4XRGA 4HV4A 3ASUA 3B70A 5BSGA 4ONEA 3KZVA 4CMCA 2C07A 4GL4A 3LZ6A 1HDCA 4BNGA 3ENNA 1FXSA 3JSAA 3L9XA 1JDJA 1Q7CA 2OBYA 1D7OA 1IPFA 3WX0A 5BNIA 4EEXA 5C7IO 5A03A 3QWIA 4CM3A 4URFA 5H81A 5L40A 1Z73A 4IIUA 1H6CA 1LU9A 1DJNA 1P31A 1UXKA 4UUNA 3WIDA 1M76A 1U28A 2HCTA 1E3LA 4QSMA 1PJ4A 1NAHA 2DBRA 5HTOA 4AJHA 1RM5A 5IAAA 1YRLA 4HFRA 3PP8A 3HE3A 2VUSA 4GX1A 3RIHA 4XX0A 3E1KA 1Y5MA 3ETGA 3ZU4A 1F8GA 3GQVA 4MVJF 4DXHA 1V9LA 1E6UA 2UV8A 3RC9A 1GL3A 4PN3A 2X22A 3WGZA 4LISA 3NGLA 4NFSA 4E2WA 4GAEA 4PVCA 3FPLA 4YWJA 4INAA 4BVAA 1MGOA 2OP1A 5IFLA 4ZICA 3VZRA 3ZN2A 5TX7A 4D46A 1GYQA 1WW8A 1VJ0A 3B1JA 1PJTA 1UP4A 1Y81A 3GN2A 2OUIA 3MWDB 1H9AA 4ZN6A 4XYGA 4CMEC 4RLHA 3FHLA 1T26A 4GH5A 2PZKA 4N5LA 1NNUA 1NR7A 2E6UX 2B4RO 1DLJA 4HP8A 4HY3A 1A4UA 1PJLA 3ZU3A 1SAYA 4NHEA 3V1YA 2X5OA 2BFPA 1EUZA 3RUDA 5C37A 2EXXA 3E8XA 1NX6A 1YDWA 1KVQA 3GA0A 3WXBA 2CY0A 3NRCA 3V8BA 3M1LA 3HFGA 5BQFA 3PTZA 1PL7A 1PEDA 2AQKA 3E18A 3ONDA 1WP4A 2VWHA 4UUPA 5C5IA 2SCUA 3JYLA 5ILGA 5KJ6A 2C5EA 1J6UA 4TRRA 3COSA 2J3IA 3ITDA 1DIHA 1VJTA 4K6CA 2WYVA 3OQBA 3VZSA 5L53A 3RFXA 3Q2IA 3NJ8A 4MVJD 3WGQA 1QXSA 1PJBA 1ZNQO 3IKTA 3KBOA 4BO9A 4HXYA 3WGHA 2QRJA 2HKIA 1R66A 3JQ9C 4EUEA 3M2TA 1Q7GA 1IULA 1TT5A 3RKUA 2JFGA 3QVXA 2DFVA 1U9JA 3TWOA 3FBTA 4QO8A 4BNWA 3DQPA 3GRKA 3WLEA 3FNGA 1C0KA 4BIIA 4I9HA 4CMAA 3MTGA 2I9PA 4RF5A 3MJSA 4DBVO 3EAGA 3Q2KA 3I1JA 4GX2A 3GDOA 3R3SA 1XYGA 5JPIA 1EDOA 4JX8A 5ITVA 3DL2A 4QFDA 1O95A 4PCVA 5A5EA 4XR9A 5BNFA 1AUPA 1ZMOA 3PFWO 3FNFA 1U2GA 4BGEA 3NYWA 3DZHA 5JCJD 5IF3A 1EVZA 3T4EA 2VYVA 4IS2A 4DMMA 5TGDA 5CPFA 5DBGA 1PL6A 3WSWA 4GI2A 4O0LA 3OJFA 4ZQHA 4U0JA 3TFQA 4OOEA 1YB5A 4YRAA 1O5IA 1ZW1A 1T25A 3PGJA 3QJ5A 2IXAA 5ER9A 3WICA 4IDCA 2WE8A 4XB2A 1B2LA 1EUCA 1LQUA 3PJEA 1HE4A 2FPIA 4XQGA 5AXDA 1LJ8A 1XEAA 1LSSA 5JC8A 4FPXA 1VL8A 3G1TA 4NU5A 2NU9A 2Y0DA 4QO7A 2D5AA 4YDRA 3GUCA 2NU8A 2YDYA 1WZEA 1PZFA 3BA1A 4CUJA 1OMOA 1O6ZA 4R4JA 2BI7A 4BNJA 3PHIA 5HRUA 1T2EA 4YT8A 4OIMA 3G17A 3NUGA 4CQLA 2IDZA 1QYWA 1HRDA 3U09A 4AL4A 2Q1TA 2PLAA 1YQDA 2GUGA 1U8FO 4RVUA 4CQLB 3B20A 2X1HA 2GD1O 4XRRA 1IOLA 3NT5A 1XU9A 4E12A 5GZ1A 2IZ0A 3HADA 1U2DA 4ZQGA 1ENOA
chains in the Genus database with same CATH superfamily
5DYWA 2WWFA 3LVRE 1J56A 3ZWYA 2GZ3A 2MSLA 5LXTB 3GGPA 3L7AA 3N5KA 1XZQA 3VPAA 4UTNA 1T2VA 1AS2A 1XSEA 2SICE 4OIFA 2AKYA 2IZ6A 2IU3A 3GP5A 3AVTA 5D5PA 2YL2A 5FWXA 3NHUA 5SZIA 3UWPA 2IW1A 3A0UA 3E5HA 4UDOA 3L7CA 5BYJA 4F4CA 5H02A 3MGCA 3LCMA 4JROA 1A9TA 3B89A 3H1BA 5K0NA 1E9RA 3OZDA 1P0PA 1NRWA 1QGYA 1XALA 2WHQA 1ADYA 4BVJA 1XZDA 4HYTA 3RK1A 2NO7A 3WLQA 2G1JA 4E1BA 2O19A 1RYMA 3F9RA 4FYKA 4NSNA 2WWIA 2LUOA 1J0CA 3IMGA 3M6LA 3RVLA 3LWZA 1K4KA 4D9KA 2JLZA 2V3CC 1VB5A 2QSJA 2POCA 3K5HA 2RB5A 3LBAA 5DTQA 4V0OA 1PD1A 3U19A 2YJNA 4RL4A 5DM1A 5CA0F 3NZEA 3ZHTA 1J1ZA 2GN4A 1M34A 3EZ6A 1VGVA 4QTUB 5ES4B 1E2MA 2H29A 4FYPA 2HGSA 2RGWA 4NBRA 4HAWA 4B3IA 4TVBA 4P4SB 5JLAA 1UMBB 1E3QA 2QL5A 1LUAA 1U99A 3NXKA 2BFBA 4M9XA 3G8AA 1WLYA 1PZEA 2W93A 3BKWA 3CRRA 1U8CB 3DV0B 5AVOA 3CEJA 1T15A 3CS3A 2H2IA 1JPUA 2C5SA 2XWSA 4CPDA 4MPJA 4ZMBA 5GM1A 3U81A 2WMNB 1ZU5A 2NO9A 4URWR 3CWZA 4DQXA 1LX7A 1Z62A 3BMQB 3E6AA 1ZIYA 2XJ4A 1I5OA 2ZT7A 3FGPA 1W0KD 3FWNA 3GLHA 1TUBB 4ALJA 4ZI7B 2J6CA 5EGSA 2ZR7A 2YW9A 3RHZA 1KAEA 1GTRA 1N0UA 4UFOA 3WGNA 1SA0B 2YJTD 4I46A 4N7JA 2HA2A 1HQYE 4CNQA 4WD3A 1R6AA 1C1HA 1JQ5A 1PEAA 2Z95A 2ZAGA 3GR6A 3LUDA 3O4HA 3RVOA 2JF0A 4AZSA 1MJ5A 1SBIA 3KM0A 4OKSA 2Z2JA 4BE9A 2A58A 4JJFA 5CEFA 2P77A 1Z2NX 5KTRA 2FY8A 4DWWA 1V3VA 3D7KA 1Y4AE 4B3MB 1GN9A 2V98A 2QE7A 4IWYA 5KSPA 4H9GA 3BMCA 4G8BA 4Q48A 1W44A 3CRNA 3ZGYA 3BEOA 4ADSG 1M7BA 4UULA 4KFTA 1KI1A 3QX9A 1EP9A 3TTUA 3WB1A 3MMZA 4FP9A 3HCRA 1VCNA 3BXEA 1H3FA 5EP3A 1BD3A 1GAXA 1PKEA 3OMLA 4CWAA 4E5YA 3PFKA 2WU3A 2YMPA 4XH9B 3MG9A 4S1NA 2ECFA 2NX2A 4U7GA 4ZHSA 2PKYX 3ZVKA 1SD5A 1QDLB 4QEZA 4P7FA 5IKOA 2GCOB 3CB2A 3AESA 3LSYA 1U8YA 4G4IA 3Q8WA 3IQIX 3PYMA 1PHRA 3AI2A 3AKDA 1RWWA 3GJ0A 5B1IA 4YRRA 2GAAA 1FMCA 1OH7A 4LRWA 4K87A 5FBWB 4E5MA 1OLXA 3NPMA 3ZBPA 4AP5A 1SWVA 2G9RA 3TM5A 1JLLB 2BCJQ 2DKFA 2JIBA 2QHXA 3ESYA 3RABA 2BFDA 2C2GA 2ZJBA 3TSAA 1P72A 4RCVA 3ANSA 4LDPA 2QN7A 3ORRA 4EX6A 1PFYA 2AFHB 3WGGA 1Y8RA 2HU7A 1CDOA 3F67A 2BKLA 1M1NB 1NVFA 1SOVA 2HQRA 2Q4DA 3PTAA 4WNYA 2QIPA 1K1EA 1DSSG 1AKYA 5F5LA 2J4FA 5HUJA 1WY5A 1WX1A 1C30A 1L2TA 2FWRA 2PIDA 3UK1A 2FN7A 3CLKA 3EBOA 4EMTA 1V1MA 3RC1A 3EODA 2ISSD 4MAMA 1RRKA 5CEEA 3T7TA 5AP9A 1BRMA 3OBBA 1QNLA 3A36A 3RT1A 3IP5A 4HNQA 2C82A 4L22A 3ZHZA 4P84A 2MMCA 2IEBA 4RVHA 3I23A 2DBZA 3HDVA 4BGIA 4KQGA 2YOHA 5LQCA 5I7UA 5JFOA 1SGWA 3ZDFA 4UVDA 1TFUA 4XVCA 1S2DA 3TOZA 4PF1A 1I6KA 3D0OA 4YI5A 1I80A 1ZNZA 4KHZA 4NHOA 3L8EA 4NPCA 9MHTA 5C52B 3U4MA 5IH3A 4MWDA 1XIVA 3U49A 1ECBA 2RC6A 2YUTA 2XNHA 1NY5A 3KXLA 3Q11A 4U7WA 2J1LA 5LDHA 2P75A 3D3NA 2ANCA 4EARA 5FTJA 1QYXA 5BWMA 1NKSA 2PUJA 1M2OA 3OJLA 1SU6A 3ZDBA 2PAAA 3FMGA 2ISQA 2QD1A 1TM5E 2ZOSA 3KKKA 3TE6A 3ZK8A 3ZZUA 5JEDA 3L0CA 1K8XB 4QU9A 1Z5NA 2AR9A 5E9WA 4BKOA 5DMXA 5HK9A 1RQ7A 1X7YA 3PICA 4EQ6A 2O2CA 5CDGA 2C92A 1GPUA 2QX4A 3P9PA 4S1WA 2IDMA 3FM9A 4PQGA 2WF5A 3IQHX 1U8XX 2XSZA 4ESOA 5B12A 2IX3A 4CJXA 3V55A 1NJ2A 1YJBA 4P2BA 3TLEA 821PA 2E6KA 2Y1KA 4CKBB 4D3YA 1CD5A 1KC3A 1AURA 1DBWA 4IOMA 3GEBA 5LUAA 3SWWA 3GVXA 4BMXA 2FOLA 1Z5UA 2ZT8A 3W9BA 1KZHA 3JV7A 1YVEI 5L9AA 1YZFA 1QBGA 1Z5WA 3BDIA 4OI4A 3SBXA 1AZTA 2X0JA 3U40A 1ISIA 2C9MA 5IKXA 1KIAA 4GI1A 3DP9A 2NACA 4PRLA 2H16A 4RTLA 5HQTA 1MQ9A 4MJ7A 2YXPX 2J5KA 1XMJA 1CUGA 2B4KA 3W8DA 3A27A 4BO2A 1JLKA 3UC5A 2R5NA 3KQVA 5JOQA 3H5VA 4IGEA 1Z08A 1VC2A 3OFND 4WDQA 4A5OA 5ALNA 2X8JA 1YJAA 1GRQA 1R50A 2JIDA 2MYNA 4I08A 1NDUA 4JB2A 4LG1A 1X1SA 3PEVA 2F1RA 4UDNA 5JZOA 4G0XA 3PEWA 2CFRA 1RJ9B 2DFKB 3OKAA 1HMYA 3O82A 4FE3A 1ZJWA 1DT3A 2ZTVA 4B6OA 5FLYA 4BO0A 1VKNA 3WVNA 1NBME 3SYLA 1ISSA 1GGKA 5ALZA 1K97A 3EUWA 5FAXA 2C4KA 4R1SA 5KKCA 1Z4LA 2DHQA 3DB2A 2ZIVB 1N8KA 1VPEA 1J0EA 3IDFA 2P2NA 3E1GA 1IG0A 2R48A 4O1HA 4R2XA 1DCKA 3M7IA 1YRAA 3N3BC 3PWKA 1V7ZA 1BWPA 3CSDA 4CTOA 5C5DA 4LC1A 3HU3A 4KQFA 2ZI4A 3A6JA 3M6IA 4CMKA 4CR6A 1OC2A 4DUYB 1FTQA 3I30X 4Z7OB 1S96A 2CL0X 1IXZA 1ZISA 2OO7A 3FR7A 5LNK6 4ZO7A 2GN2A 4Q3NA 4TZKA 5TARA 2J9YB 1XQVA 3AGQA 1YZTA 2RDMA 1E6EA 3F3MA 2V7TA 3GDHA 4MSUA 5LBUA 4IHJF 1EAMA 2CE7A 2AG0A 2H31A 2PKEA 3GFFA 3HWWA 1ADBA 1XA0A 1NN0A 1QHGA 1WMFA 3G0IA 2J9FB 1A9YA 4ZVTA 1L5LA 4C21A 5HKBA 2EJBA 3WYGA 1LDMA 4G0ZA 3THOA 4F5ZA 4S05A 1NHGA 2WDZA 1G7RA 3GRZA 3PIIA 4IQFA 4M98A 4TWRA 2H4YA 3MEQA 4X97A 4YP7A 5EE1A 2BPOA 2RGXA 3PHGA 5FKJA 1VBNA 2Y1OA 1TYBE 2YS7A 1VI6A 3GMDA 3LVBA 2QJOA 4MV3A 4PEVA 1YOVB 3VZCA 2IYPA 2Y0CA 4BZZA 4RKRA 1IE3A 3GHYA 3C3PA 3LX6A 2JD0A 2W2MA 1YVPA 3HI4A 4BQNA 2VIIA 2P78A 4DVJA 3VNSA 4BKPA 3SR0A 3AJDA 1L9XA 2QUJA 3P9QA 1O8BA 2XNCA 2LCFA 4ZEMA 2R2AA 3IMEA 5E1MA 3RRJA 4HX2A 1LK7A 3SC4A 1N34B 3I42A 3HJBA 1CUEA 1DO8A 1QWSA 2IF2A 4Q4HA 2G25A 2PLWA 4IEFB 4ZO9A 3SQDA 2B2NA 3TAHA 5KTOA 2IDJA 5JU6A 1RI5A 3H1TA 4GBJA 2FN3A 2G8LA 2IOQA 4GZ3A 4HNVA 2XT9A 1UM8A 3IHTA 4L0MA 1JGTA 1D04A 5AYVA 5INTA 3AEKB 3RF6A 1GNLA 1H8ED 4CW7A 3M70A 1URPA 4IGKA 4R2MA 4DC9A 5LQMA 4NZOA 1OHHD 3FUVA 2Q9AA 1Y4ZA 1RAAA 3AIMA 3FFTA 2AQHA 3LBFA 1I9CA 2WUGA 2FTKE 3QHPA 5KNBH 4J1QA 1DI0A 5KKAA 2GF2A 1ZGHA 2AFVA 5LL6P 3S2FA 2B36A 3UH1A 7REQB 1PBTA 3UFXA 1KO5A 1QGDA 2OLEA 4S2UA 1MH1A 4KFCA 4DGSA 3DP7A 3W8EA 1KRXA 3GT0A 4YRSA 4N41A 1M2NA 2J0VA 3L1UA 3LIIA 3VQTA 1ZXXA 4ECAA 1KJNA 3GARA 1KQFA 1KAHA 3SOPA 1CFJA 4KRFA 4GQIA 4CF4A 1K4MA 1V6SA 2VDMB 1CKEA 3OSUA 3N2KA 4KE7A 2VHEA 2X7XA 3UB2A 5ALLA 2VJYA 4OHKA 4F92B 1JR4A 4LYDA 1TMGE 1CY1A 2JVKA 4L4SA 1BIFA 1GDDA 5TMEA 3I9V1 3MFQA 1MB3A 4AJ2A 4XDYA 3JWIA 3UKOA 1CE8B 2JIZD 5LQSA 2O8VA 1JFVA 2ZU0C 4I3FA 3RU2A 4B44A 3CISA 1AIPA 4DB4A 1UT5A 1J9EA 4TXHA 1IQ0A 4IHQA 4U9UA 3H11A 4QJ4A 5COAA 1FC0A 4Z9BA 2J4DA 4WDRA 1YHNA 2I2AA 3M3DA 2DR0A 4IOJA 2VLIA 1JP7A 3C8ZA 4D9EA 1AKWA 1YQWA 4J07A 2VN8A 4E5PA 3DEHA 1WDLA 1SMKA 3ZK7A 1VSTA 4RPJA 4W5QA 1UDRA 1XV5A 4YASA 1ONBA 4ZC1A 4ALMA 1GILA 2QZPA 1P5FA 2VCHA 3VDXA 5IC5A 2PUVA 1QGUA 2C0PA 3D6NB 4C0AC 4XJSA 4CF7A 3RVKA 1E3TA 3PPYA 4ZZ1A 1SUSA 2OHFA 3KUCA 2AI3A 3NH6A 3OQIA 4HRVA 3REQA 3DZFA 1E98A 2CJFA 3GMIA 3UW3A 3EGCA 1VSUA 2GQ0A 3GU3A 1LV8A 2HFKA 4HN9A 4H31A 5E3JA 4X7RA 1XAIA 3FI0A 4DCGA 2VP9A 2Y1DA 4FFLA 1KRHA 3IR6A 1QYIA 3HVUA 3IP1A 4KQ2A 4RKEA 2F1HA 2Q1YA 3VJKA 2JLWA 2CNDA 2ODBA 3OPYB 4JJGA 1P2FA 4JCCA 2XQVA 3Q15C 4UBIA 5HEKA 3WQBA 3EIXA 2HJGA 3WTCA 5LP1A 1KOFA 4JEMA 4Y7DA 1QHIA 2X1LA 5TXGA 1TM2A 4IL5A 3ER6A 4QPDA 2G9ZA 4HVCA 4TTRA 1HNNA 3PHCA 1FPMA 3P19A 3A6DA 4Q37A 4X8LA 5U4QA 1QVVA 3K6RA 3H16A 3L6CA 4I4TB 3ZGVA 3QIAA 2WNIA 1LQTA 1UC5B 3LXMA 3P2JA 4EI7A 1MTOA 1GPWB 1E8NA 2A1TS 5C4MA 1HDEA 3GHHA 5K3EA 5GINE 2OMKA 4G8JA 4PW0A 5LD2C 1ZR4A 3EZLA 5AHOA 2IZ1A 5AKEA 1P29A 2FPXA 3H2KA 1T1JA 3HVHA 3NEYA 1WUYA 4H7HA 1X7ZA 1WW3A 2YWCA 1T4GA 4JI6B 3GEMA 1YRHA 1FCJA 3OLYA 4J2HA 1ZCBA 4TTQA 2YTZA 4MPTA 3LFUA 3EARA 3LPNA 1CQWA 3T5PA 3QUTA 2EKQA 4WEOA 1DO0A 4OYRA 1Y8ZA 5EFOA 3RT7A 3D02A 1R0WA 4ES6A 1ENYA 1ADGA 2YR0A 1LPAB 1FLDA 3BDAA 4JJ8A 5A7GA 5BSEA 3K9FC 2V6MA 2X86A 3H5WA 4O2LA 1VXOA 1JEEA 2B1RA 1ZI8A 3EEQA 4NCBA 3OT4A 1KI6B 4Q7KA 2GA8A 3O21A 4CV1A 3PI6A 1NN1A 3JR7A 4KNVA 4ZT4A 4L76A 1P62B 4OH1A 5CA0A 2O0MA 1KI2A 2E18A 4BLSA 5B3JC 3O7MA 3OPYI 4I55B 4OLBA 4D1YA 1VL6A 3ESXA 3TFWA 3L5KA 2XTNA 1WAMA 2N9UA 1W6UA 4PONA 2FCRA 5HDQA 5BT9A 3ONEA 1DJMA 2RI0A 4CCYA 2PKRA 5ARCA 5GIPE 2BVNA 5TJHA 3IEMA 5KQSA 1RXWA 1BDMA 3QWFA 3LCUA 4KSBA 2VOEA 4BNDB 2PWPA 2V8BA 2ZBRA 2LP4Y 1VHJA 5B36A 4PX9A 3QWBA 2AZXA 3UBMA 5DSTA 3ZGZA 4GX0A 1VI2A 3QLEA 1L1FA 3INYA 3O47A 3OPXA 4GNRA 5GJWC 3ZCPA 4TX1A 4MUAA 5BNTA 1KEPA 1U5CA 5CTJA 1ODJA 4YJKA 2ZM5A 4X64B 5JYDA 3AC0A 1C5KA 3FRJA 1QPZA 3ADPA 2R8OA 3LHIA 3IIEA 2RKOA 1R8JA 4FQ5A 1PQWA 3FDFA 3PFFA 5AKJA 4N47A 1TADA 3LOPA 3NBKA 3VTKA 1UBUS 3WLSA 3K4PA 4E4YA 2HLDD 3LP8A 4X5OA 5BOSA 5CVTA 1OWMA 4KQHA 3CSSA 1CZOA 2BY4A 4PSKA 3GW8A 2XRFA 5AVTA 2XT6A 2XB4A 2ZIGA 1YS4A 4MS4B 4DS3A 1DIBA 1FRNA 4OGLA 1EFHA 2B8NA 1DFGA 1EDDA 3CT4A 4W8GA 4BBJA 1GAWA 4Y2RA 5CCEA 4W1QA 1MXFA 4LRSB 2J48A 4HNAB 4OXXA 4RDIA 5GVRA 2QYHA 3ZHYA 1C2YA 2BM1A 2R85A 2UUAB 3K8QA 1HLFA 3ROEA 4GKJB 4TT8A 5IVIA 1U7XA 3ZW8A 1B0AA 4J4TA 2I9KA 1O0BA 4BNHA 3NETA 2XA1A 3EUFA 1ESNA 3O93A 2YV3A 2WHRA 3VNUA 3RYHA 3T95A 4GMGA 1T13A 1D2HA 2YFKA 4MVJM 4UM8B 2JATA 4Y6QA 1Z5GA 4M8KA 3UXMA 2QAGC 3A4LA 3C45A 5FL7D 1WUKS 2XADA 3RROA 1RLOA 4YAUA 2IZ5A 2C88A 3IC5A 1WF3A 5GMOA 3MQFA 3LU1A 5CLGA 2GVZC 3MMXA 1XB2A 4O5AA 4OUDA 4X20B 4HZIA 2J32A 4PS1A 3D7SA 3OZWA 3V4ZA 4Y1GA 2D8AA 2WHPA 3R6GA 4D0SA 4HAXA 2KMLA 3WL7A 1WF6A 1U0TA 1ZD3A 2LKDA 3S5UA 2RC5A 4A6DA 3BCSA 3RU9A 2KJQA 4BNVA 5C3UA 3MS7A 1W6RA 3QI7A 5EN4A 2AD5A 5HGJA 1TYDE 5TY0A 3ISTA 1YC5A 1FUUA 1G17A 1VE7A 3P4YA 3N7UA 1XD8A 1YBHA 3DVAA 4QXOA 4NCAA 1WETA 4KOAA 1UWKA 2X1VA 2QX6A 5JASA 5LKAA 1ZK0A 1Q2UA 2A7QA 2BGUA 3AUAA 2Z04A 3DV9A 1TQ6A 4IKOA 4Q9HA 4M36A 4OXIA 3GWGA 5K5EA 1SHUX 4W1SA 1M0EA 1AD2A 2YY6A 3ZJ5A 1Y33E 3AF1A 4J3JA 1UBMS 3O7WA 4BX8A 5TQ0A 3I4LA 2PJRA 3E9MA 2QW1A 4D82A 4FFRA 4MICA 4F5YA 3D6MA 4ZIRB 3GH3A 4ALLA 5IULC 4P34A 1Z4QA 3DLPX 3Q7IA 5HUQA 4OHZA 1KJZA 3FNIA 1EPUA 1MO2A 3QMPA 2OC4A 4I9NA 4L6AA 2EAUA 4U2EA 3MQ4A 3U3JA 3VU3A 4EHFA 1JDTA 2H1OA 4Y9SA 1PYGA 2WUWE 4YT4A 4EELA 2XMZA 4GOKA 2XB9A 3EQ6A 1THMA 3USZA 2W2KB 1HEUA 3TTSA 3M89A 3LUHA 4X1YB 4KAAA 5HOQA 1MZVA 1TLLA 1EWQA 1ZGGA 4LE2A 2ZQYA 1A7AA 3DZIA 1NJFA 4AIRA 2W6CX 4A0FA 1C0IA 6NULA 2WAYA 5IBRA 2ECPA 3MB5A 3HB4X 4L73A 3BRWA 5KCMA 4EI9A 3HJRA 3EEFA 1FQKA 4RXTA 3MAAC 5ECGC 2ZR9A 3F6PA 2ODWA 3O8BA 3S81A 1ZN7A 1KYZA 3SEFA 2AEEA 2J7PD 4H60A 4TRNA 2R8XA 2CHGA 5I47A 1JALA 2VJPA 5F2KA 2JHGA 4MQBA 4R16A 1AUOA 2C4UA 3RV3A 2FPWA 1LY1A 3MLBA 2JGFA 2E4YA 3L8CA 2EWWA 1WB4A 3IAS1 4HB0A 2MDTA 2X76A 3G2IA 4YJ3F 4RQBA 2BFFB 3JY6A 3SEZA 1SG9A 2GZMA 3H1GA 3KAKA 4I5EA 1WXFA 4ZANA 3VR4D 4W1PA 3PIRA 2AQ8A 3GUYA 5DWVA 5JWOA 4M1KA 2KX7A 4BO5A 3D7MA 4B3HA 3M9WA 4JJ4A 2XQFA 3RF7A 3ZNQA 3D6FA 3K6KA 3PQEA 4QSHA 3SIRA 4ZHQF 2X19A 1W36B 1OY1A 3AU9A 4LJSA 2XB8A 3ANYB 3T5CA 3DPSA 3RK0A 2ZSKA 4TTIA 3RAEC 4Q1BA 4RESA 3C5WP 1ZP6A 1DLIA 3A6HA 3L06A 3PQ5A 2D3TA 5DN6D 3YASA 2UVPA 3TBHA 3T6KA 4H4DA 1QUFA 4RANA 5DNDA 2CD7A 2D2IA 2C3OA 3CHYA 1Q1BA 3HUDA 2OOSA 1KZ9A 3FNHA 6LDHA 2JBAB 1N6KA 2Z83A 4G1FA 4A03A 4UREA 1LBQA 1BH2A 1ESDA 1ZWLA 1JVBA 5A0FA 1C9EA 1EBUA 1BXKA 2AHRA 4ZVLA 1QRDA 2AC7A 4FX2A 3PK0A 3QPUA 5JWHA 3H2YA 1XXLA 2WD9A 3AUTA 3Q9UA 1CF9A 3DDOA 4DDKA 4HTFA 4Q9AA 1ID1A 4WBNF 2GBCA 4ZV7A 3CC8A 3NTRA 3ZGNA 2A4MA 5I8WA 1OTYA 3GEIA 4WKBA 4B7UA 1JKIA 4WOKA 2G0TA 2IYEA 2PD4A 3DJYA 2Q3DA 4R68A 1W4ZA 4ZT6A 3GPDG 4AJKA 1UAAA 2DTXA 3H0KA 5DGIA 1NOJA 4RZ3A 1KERA 4RSGA 4QIHA 3JWGA 1T8TA 3EASA 1RCUA 3L6UA 1G55A 2W58A 4KXFB 5CDHA 1UPFA 1CJKC 3CNQS 4I1VA 5E8RA 1XKQA 4KXXA 4AY4A 5FWXB 2O6HA 4XWYA 1WPRA 4NJEA 1JG3A 3D3JA 4CQNA 2I67A 5JVDF 3BFVA 1JEAA 2GM5A 4XWOA 2B4TO 3I9MA 4HYQA 3NYIA 4RVGA 3PUYA 3IX7A 3QU2A 3N39C 2H4FA 3FCEA 1E79A 1M2FA 3F74A 2C04A 1L6IA 2CXQA 4Q4DA 1H85A 2RONA 1QPBA 2WK1A 4DQUA 3AZQA 1P1JA 2GK6A 3F7MA 2GJKA 2WVAA 3Q7QA 1I1OA 4QOEA 3M2PA 5EXSA 5BW6B 4HGOA 4ED9A 3G0DA 5J4LA 3AYZB 1H5QA 4ZA2A 4C07A 5CP8A 3AYXB 3W1WA 4BMSA 1M34B 2PS1A 5ETJA 1MH9A 4PHCA 2ID8A 1JBEA 1KJJA 5DIFA 5HFJA 3FUTA 2JH9A 1UBCA 3NBXX 3AHFA 1HOTA 2QLJA 4O25A 4UEJA 3AKZA 3N58A 1H8HA 3ZVLA 2OGSA 1JJFA 1LNZA 3QXCA 4G0MA 3OM0A 1RLUA 4RD0A 4TMFA 5SYAA 2FPRA 4A6XA 5AVVA 5KOJB 1JEDA 4B7CA 3DAPA 3JRXA 4RJLA 5AM4A 3WLJA 3PNQA 2BZ0A 2GEBA 2PKCA 3ABQB 5L3RA 2A9OA 2Y66A 1TTPB 3CFYA 4KIUA 2DHEA 1J1IA 1WCWA 4YUWA 4D0LB 2H9YA 1UZMA 4PVDA 4G0WA 1JXOA 4C6RA 1ZJ4A 1M1ZA 3U3ZA 2HPVA 3ASVA 2XHZA 3EYWA 4FCWA 4LV5B 4RACA 3ZI0A 5JSYA 2XV1A 1G21B 2FVYA 3BAZA 3G59A 3PYLA 4YDSA 3RRFA 5HDBB 3UMRA 5LFAA 2ONCA 5F7JA 3IBFA 1Q6YA 3ESQA 1VTKA 4JBIA 5I9NA 3QSYA 2JAXA 2P2GA 4N82A 4NYMQ 4ZT5A 3IBYA 3A4YA 2CNNA 1J2YA 3AP2A 4I8DA 4D4MA 4HRYA 2BMWA 4DDMA 3QU4A 1JEQB 3W5UA 1V7CA 3CTMA 5BOVA 2ZGVA 2I29A 3RHSA 1OWLA 3LJKA 4NH0A 3BWVA 4YT2A 3DLHA 3ZYZA 4P3OA 3ZQJA 2EFCB 2QLMA 5E6RA 4GOMD 3H7AA 2GH1A 3J81A 4JEHA 4NBKA 4R6WA 4R5MA 1VKZA 4DR6B 1TZJA 4Q9KA 2EYUA 2MSEB 5JT1A 4UNRA 5ALFA 4Y6RA 3O75A 3FVTA 3PG5A 2V6IA 1XDDA 2BMDA 4JLSA 5EJ7A 4NZMA 3T9FA 4PCUA 5C31A 4LJ7A 4AU1A 4UPDA 3SHWA 2DFPA 4DCVA 4R7TA 3CLRC 4OFZA 4Q3KA 3DUWA 1VJCA 1XP8A 4JR1A 5SZKB 1ZI9A 1M5RA 4A8JA 4D8WA 1UOOA 3P71T 4OL9A 3C6MA 4OJNA 2V5AA 4RHTA 2G17A 2R1VB 4MTLA 2BP7A 2GAJA 1LGYA 1V3UA 2H5JA 3L6DA 4Z7JA 1D2NA 1GCAA 3BA6A 1XTPA 4AZ0B 3GA7A 3V48A 2V59A 4B8YA 1HDIA 4W5NA 4K9OA 1G0NA 3K4QA 4JUCA 1UAGA 5C35A 3IPLA 2ZJ3A 4XPIB 1V8PA 1XZFA 4JWKA 2IV2X 2R6FA 1IWBB 1IM8A 2E4AA 2IIPA 3GAMA 4M88A 1FYWA 2OHOA 5BPFA 2H08A 3VKVA 1JA0A 4PM4A 2QJTA 2HJ9A 3P9XA 1IB0A 1MB9A 2NZYA 3GG2A 4WZAA 3T5MA 3VFDA 3RS7A 3D5TA 3OF3A 4E51A 4F4JA 5KTTA 2EERA 2NUPA 1Z4KA 4YQFA 3JRWA 4EYEA 3EW7A 2IIVA 1QWOA 2SHKA 1YBVA 2WW8A 2ZYUX 3Q8KA 2W22A 4AY2A 5JNSA 4LI0A 4IR7A 5EUQB 1SXPA 5EIXA 4BU1A 4RTNA 3NT2A 1AO3A 4FYYA 1M2OB 2B8JA 1SZDA 2HZ7A 4X3OA 3IRUA 3UKJA 3GLIE 3VVBA 3BF8A 3DCNA 2F8SA 5FYDA 3UATA 3BCHA 3R74A 1H2XA 1PNQA 1QE0A 3T41A 3WLRA 1KIFA 3FSEA 1YO6A 3E22A 4DLSA 3MJEA 3K1YA 4ZZIA 3B1FA 4EQ6B 3QENA 4IH4A 1IBLB 5JMOA 3DL7A 2COUA 1A2KC 4P9NA 3WDSA 3QPBA 1T6BY 3PIDA 3NC0C 3HXPA 4L8YA 4RV9A 3KZMA 2GJSA 5BW5A 4MQFB 1T5SA 1KYXA 3N28A 4ZODA 3FLEA 4JEIA 1G9SA 1XQ1A 5CFQA 2B99A 2AG5A 4G8CA 3T1YB 4D2IA 2DX7A 1P9OA 1ZOSA 2WTXA 4XUCA 5CT4A 3OWHA 4G8DA 1P7ZA 3R9WA 3QM1A 1G8YA 2G0NA 4RGVA 5P21A 5KWSA 1X38A 4H35A 1PL8A 4RBNA 3UXYA 2ZSDA 5C1OA 4OKIA 3I3SR 3EVTA 2ZQ5A 4R2LA 3CUSA 3DMYA 3P9IA 2C9YA 1BC5A 2MIIA 1GL9B 4XWGA 3LLCA 2VHYA 3N2IA 3C1TA 1QK4A 3TTXA 4UAUA 3VKGA 4YBRA 1P6QA 1XCGB 2C8LA 5DTRA 4LDZA 1VMAA 4IQ0A 5EL0A 4Q4JB 3KQSA 4EPYA 2BELA 4J1TA 1I32A 1MQSA 5G0WA 2ZI7A 5BXQC 3WMEA 1RYEA 1NN5A 1J2UA 2J3EA 3OX1A 3QFFA 3WLFA 1PJAA 2V4UA 3AVWA 1GLVA 1O77A 1U3DA 1BCRB 2C7GA 1GFZA 2WG1A 3NIGB 4MR7A 1IEXA 4UAGA 5F1PA 4M8LA 1X80A 3UUFA 1VE6A 3D54D 1QP7A 5DEIA 2EFHB 3VU9A 1OV4A 1X3SA 1TK2A 4FFPA 5BO5A 1V1RB 2EIHA 4EVQA 1VRCA 1MAUA 4HDMB 2VJNA 3IAHA 1DC6A 1ICEA 3JQ8A 3V7UA 3L4BA 3RVMA 2VSXA 2P0YA 3CR7A 4MO9A 4H1WA 5AI8A 5J4KA 1GG9A 1NTOA 4G1CA 3C5VA 5JAOA 1NTRA 2GK7A 4N7RA 5G4LA 1IWOA 1NUPA 2RIPA 3A6LA 3WBJA 2R3SA 3D3KA 4BN0A 1NU8A 3MUEA 1S2OA 1Z8NA 5IKMA 2C58A 2D62A 2VG8A 3LQ2A 3RSOA 4JKIA 1QLHA 3KPWA 2XDQA 1IIRA 4REQA 5EJMA 3T4PA 1GAQA 4H7DA 5BN4B 3FSRA 3G9UA 3V33A 3SQXA 3CF0A 4Q3DA 5BR8B 1OJ7A 4OA5A 2H7XA 3STYA 4CV0A 5A3RA 3PT5A 2H1SA 2XLCA 3EJ6A 4K6HA 1GL7A 4TVOA 1EQAA 3RUPA 3OCYA 4HKTA 1DQZA 2I2CA 3EB9A 3KQYA 3TZ6A 4FC7A 5ELXA 3F1LA 3K5IA 4TUYA 1J0AA 4P0QB 4G2NA 1OXXK 1MJHA 3OU2A 2HMYB 1QIHA 4HHEA 4NPAA 4DLKA 5KSZA 2AN1A 3E9RA 4N03A 1NNEA 1TUEA 2FEWB 3NEJA 4QXQA 4URHA 1N33B 2ERYA 1V8OA 1HLGA 3HMKA 3HLKA 4RKWA 3EWAA 1AGYA 2PPVA 4BN5A 5J40A 2IKQA 1N8SA 3JD0A 1TO2E 3PDCA 2LV8A 1YE5A 2CMFA 2Z4SA 5HM6A 5J43A 1HYGA 3CVYA 2OXIA 5AW7A 1DKRA 5BR4A 3SBOA 4EG8A 1EFTA 3UK0A 4LBZA 3W1EA 3OTHA 4ZYYA 1TZMA 3A3YA 4JMLA 3RVNA 2CLFB 4F3TA 3RFTA 1T3LA 2O0JA 3BWBA 5E6SA 4IMJB 1E9AA 4GLLA 2BL4A 4LV8B 5DHSA 3M1YA 2V6FA 2PWZA 1PL0A 3P9RA 5ALMA 2NGRA 5F73A 5KTYA 1YZNA 2CVQA 3B13B 1ZAYA 1QGED 4JBGA 1FFXA 3AH8A 3KQOA 2A5LA 1RM0A 2GK4A 5GVSA 1FDSA 4CL0A 4LBVA 4NC9A 3V8MA 1KY3A 1PX2A 1ZGZA 1DBSA 3AI3A 4MP6A 3BFPA 3PQDA 3IP8A 4TMKA 3C3EA 3T9AA 4NY1A 3I9LA 4HX9A 5AKIA 2R6CA 1TEHA 2AXNA 4RZSA 3UFXB 3LGAA 2HSDA 1JU9A 1PYOA 2WZQA 4KLAA 3KV3O 3PCRB 4B2LA 4DUPA 1VECA 1Q19A 2QX8A 2WT9A 1Z38A 4KL8S 5CYGA 3L93A 1KBZA 2WUEA 2IXDA 4PLFA 4AZ3A 4HBGA 2QMEA 2BGGA 2BSAA 3HCDA 1C9NA 4ZU3A 4UCFA 4JNCA 3W7VA 3OKFA 4DABA 2GOYA 5BSWA 3FLBA 5DASA 3KWFA 4M99A 3DBRB 3ZE2B 1AXGA 4KI0A 5HIKA 3ZJUA 4FDAA 1H6AA 3UT5B 4CLDA 4JLMA 3G9ZA 3NC1C 4HWKA 1DCMA 3CUEF 5H1YA 3QVOA 4K6FA 4P80A 3QVWA 2GXQA 3HO8A 3FUUA 3OCXA 4Q18A 1AMUA 1L7VC 4AN1A 3NHSA 5CDTA 2VO1A 4WK0B 5L3VA 4U00A 1KAOA 1FQWA 1CCWA 1HKHA 1W0CA 3PDJA 4PRKA 3VR6A 1KQPA 5A1JA 1KQGA 3RYCA 3AF6A 4E46A 2ARKA 1QRRA 2ZUCA 1LNQA 4AS3A 3ZWCA 4M0UA 3FCSB 4PLPA 3K9HA 3H11B 5ERXA 2WFLA 3M3PA 2R7LA 4YJ3A 4WKNA 5CT8A 1OVMA 1PS8A 2PX5A 3W5VA 1XAGA 2J3HA 3NTOA 2HCFA 3QBEA 3PXCX 1LEHA 2DP4E 2JGMA 3DXZA 2R65A 2YN2A 3K2QA 1VKOA 1TAGA 2OVFA 1T1EA 1O94D 2J3KA 5LKRA 4HLQB 4ZHQA 1BEZA 3EEBA 1XYYA 2DFLA 5DTEA 4MLZA 5JBIA 5H8WA 2QYOA 4G2TA 4CGZA 1ZOIA 4PG6A 1NW7A 1UOQA 3OQIB 4MINA 1DIRA 5TSDA 3REQB 3ULKA 2YJZA 1L8QA 4ZYXA 2R97A 2YIVX 4WBXC 1DBPA 1JQKA 2ERXA 2RIRA 1OQAA 1CS0A 1J49A 3AG6A 4JVSB 3CVUA 4IEEA 1U6JA 1ZK4A 1VRWA 1SD2A 4PC6A 2BUAA 4QT4A 3WLIA 2H0RA 1IY1A 9ATCA 2ETXA 5FNZA 1VHQA 3AT1A 3K9BA 3Q7SA 4RAOA 3WHIA 4DC0A 4RK5A 5BUQA 4KVZA 4PFKA 4FI3F 1GPBA 3H1PA 3HMQA 1JEYA 4EI8A 3PDHA 4FR0A 4BUZA 2ZWIA 1JDPA 4DLWA 4FWTA 4WBNA 2GR9A 3SZOA 4U2DA 2GI4A 3FMPB 5C5EA 3TEMA 1KZGB 1LX6A 4YX9A 5JD5A 1MO3A 1W29A 1XRJA 1LDNA 2Q1WA 4R1QA 3ZY5A 4BV2A 4Z99A 2AGVA 1R4ZA 3WIBA 5A5DA 4J2OA 3F3SA 2GD0A 2K4MA 4AULA 5JMWA 3NRBA 4EGFA 1BJTA 1LRKA 4H1TA 5LB2A 1JQAA 1MD9A 2Q21A 1Z7WA 2YWXA 3QBVA 2MR5A 1K06A 5HUHA 3HCBA 5IXSA 2VAMA 4ID9A 3V7WA 4MIEA 4OJKA 5T8KC 5JVDA 1RYYA 2PH5A 2R5FA 4K3VA 5DYNA 3WLLA 4LIPD 5JROA 5KZMB 4MUBA 4YQZA 5C46F 2A0FA 2QL9A 4JY7A 5KKNB 2VXOA 4FFMA 4NABA 1SKUA 2GBLC 2CDNA 3IUEA 1JNYA 3LDFA 1GGMA 3MN1A 1XTRA 2ZBEA 4DR5B 2UZIR 5TT0A 4KH1A 1X1TA 4DIEA 1OLSA 1QS0A 4WXYB 1BHJA 3M4NA 2DU8A 2GWRA 1Y1KE 3A4NA 5BURA 3GJQA 2J85A 2YBDA 2WZBA 1C7IA 3JZFA 1WKVA 3DBVO 1B1CA 4S35A 2XOXA 5CA0B 4OXQA 5K9ZA 2PNFA 3HJFA 2O8NA 3KUXA 4GC5A 3VO9A 5IM4F 3WWYA 1QFMA 4MAAA 4EPWA 2Z3ZA 3NASA 1UBTS 3A4VA 2AN5A 4B80A 4F72A 2HSGA 2J6IA 2CHQA 1UEXC 2ZAIA 1FFDA 1L5OA 5HFAA 4MW9A 1LVGA 2IGTA 2HFJA 2WVHA 2Z5VA 4HXFB 5AKZA 1L5VA 2CD9A 2IYVA 2JFYA 5CFRA 3A9RA 3KSDO 2GK3A 3PC7A 1Y9EA 3RS5A 5FPTA 5E4YA 2QRMA 1N3IA 1OBCA 4LXYA 5FA8A 1HDGO 3NX4A 2VP3A 1YRWA 3LW8A 1HZZC 1XTJA 3E53A 4TWAA 1CZUA 1XG5A 4NZZA 2WSIA 1SB9A 2YFQA 1U2ZA 2VF2A 1UBHS 4IO0A 3VH2A 3UT0A 2GKOA 2JCSA 1E4VA 3GVHA 3F90A 3MOIA 4KHPB 1Z3CA 1UKEA 2ZRBA 5FRDA 4LYAA 2BTQA 2YRFA 3H99A 1JI0A 2RAPA 2NO6A 5I7OA 4O8CA 1T3SA 3F9CA 4NQRA 4JXXA 4BVKA 1P1CA 3G49A 3OCUA 1OU4A 2G9UA 5CK5A 2RK6A 2P5TB 4Z9XA 1NVKA 1NQVA 3TINA 4JXKA 1V8DA 2O4CA 3EXHC 1FBNA 4ID3A 3PLAE 5DTMA 3V1NA 4QATA 5A3JA 4ASUA 1AGNA 3PENA 3ROKA 3T38A 1VKHA 4OF4A 4BFZA 2FMTA 3P4UA 1GNSA 2WSLA 1D09A 3CKMA 4UCQA 2PUDA 1XHEA 3KJIA 1N5RA 4A1FA 1EK0A 1M1YB 3VPSA 3DL0A 2QV7A 4NWIA 1TGVA 4YNBA 4F04A 1Y37A 2R6HA 1QV9A 3VSDA 1SK8A 1D5WA 3RVJA 4YMTA 2IS1A 1B8VA 1FDVA 3BEDA 1S3FA 3WRYC 4R1OA 3KSZO 4FHZA 4QFCA 5K51A 5T57A 4N3AA 2V7QA 4Z9YA 1N7GA 2VQFB 3THYA 3N6RA 4K8OA 3DXYA 4OMFG 4MV5A 2PHZA 1FUKA 1DEKA 2RJ3A 4FNGA 4GX5A 4TS9A 2I80A 3TMYA 4PWYA 1E0AA 1SU7A 1WCV1 1HORA 2MCFA 1LC0A 1VE5A 1Z47A 3TPCA 2A88A 2INGX 3QFSA 4XFKA 4BO8A 3OA0A 4IGAA 2IUEA 3TM4A 2I6FA 3H3XA 5AJUA 4XUEA 4ER7A 3U3DA 5L3QA 1S9DA 2REOA 4UZEA 2X7HA 3STVA 1PGOA 2FRDC 2IY7A 2OENG 2AZ4A 5EUMA 2Q4BA 3MYYA 3DVAB 4UHFA 3P27A 1WE2A 1XMXA 4QAQA 1GVNB 5E9JA 1CUVA 3F7NA 3VO1A 1L4GA 3QXHA 1CERA 2DBVO 3FTQA 3AI7A 4AG3A 4KNYA 5EINA 3EHEA 2R0QC 3B3AA 4F06A 5BV1A 1D03A 3IO3A 2O50A 4QL3A 1HYEA 1GUZA 3BGIA 1KJQA 4F7WA 5CFNA 4Z4FA 4HCJA 4QUIA 4Y3UA 1V16A 2LE0A 4IY1A 4G07A 4PGFA 5TQ0B 4DM4A 1YQTA 1ZMRA 2XMSA 5KQRA 3H1EA 1I14A 2GASA 2KW5A 4JUFA 5FHQA 3OHMA 4WACA 2R1UA 4QM7A 2FSHA 4N18A 4Q1VA 3S2IA 4ZALA 3RTAA 2QN2A 4PAQA 3ILXA 4CZ2A 4CKZA 1NZFA 4Q3CA 3THXB 1YI0A 1OFVA 2DE0X 1V5WA 1ZM7A 4MWBA 3KWLA 2J33A 1RLMA 1B74A 3NHRA 4Y1EA