2VJQA

Formyl-coa transferase mutant variant w48q
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGQLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGDSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FORMYL-COENZYME A TRANSFERASE
publication title Differential Substrate Specificity and Kinetic Behavior of Escherichia Coli Yfdw and Oxalobacter Formigenes Formyl Coenzyme a Transferase.
pubmed doi rcsb
source organism Oxalobacter formigenes
total genus 144
structure length 427
sequence length 427
chains with identical sequence B, C, D
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 2vjqA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 2vjqA01
3UBMA 2VJPA 2VJLA 2VJNA 1PT8A 4ED9A 1XA4A 2VJQA 1Q6YA 2VJMB 2VJOA 2GCIA 1P5HA 1T3ZA 2VJKA 2VJMA 1XK6A 1XVUA 1PQYA 2G04A 1PT5A 1XK7A 2GD0A 1T4CB 1PT7A 2GCEA 2YIMA 1VGQA 1T4CA 1VGRA 1XVTA 2GD6A 1XVVA 2GD2A 4HL6A 1P5RA 1X74A 1XA3A 1Q7EA
chains in the Genus database with same CATH superfamily
2QT1A 4W8HA 3EIWA 3HFJA 1VB3A 3C6XA 3PVCA 4M36A 3FTCA 4Z99A 3T9CA 4UUAA 4QODA 4D57A 5HIMA 3PE6A 1T2DA 3T1TA 4D56A 4CM4B 1SUBA 4GLFA 3QNWA 2FSHA 2WG0A 3N2KA 4AG6A 2EFDB 3E7XA 2BW0A 3HBLA 1N7HA 3A26A 4ISCA 4D6YA 4N47A 2HU5A 3N7UA 2BEUB 4FS8A 4KSBA 4WRRA 5TGZA 1L4GA 1VMDA 3TLYA 4QGSA 1PUIA 3O4HA 3N8IA 2N1MA 4N3AA 2V7PA 2XV1A 4EG3A 2DFPA 2GJ9A 3KVOA 4G8JA 1LPMA 1H2WA 3HDJA 1ZM4A 1YRQA 5HNKA 3W6UA 2AN5A 5FPSA 3WLMA 3N6VA 1T9GS 1XAJA 4GMHA 4JZYA 4LRSB 3HJRA 3ZI0A 9ATCA 2XXAB 2BBWA 2QMZA 4B45A 4DR7B 3AG6A 3QUAA 1PL0A 2PUDA 1KC1A 3N39C 1J6UA 1O6FA 2M6KA 1PFQA 4X90A 1CJVC 2Z56A 2O20A 1P0CA 1P1IA 2CK3A 3EA5A 3HXPA 4P93A 5FUYA 1F8UA 1VG8A 1Y8RB 3R44A 4JQSA 2HQRA 3EQ9A 5EAIA 3RBAA 5FPTA 13PKA 2IYEA 2C2WA 3I4FA 1ELOA 5SYMA 2YHAA 5KNCH 1F3LA 1JQDA 1TCBA 1XRLA 3G79A 1KBQA 2AK3A 2WM8A 3FZGA 5ERYA 5E7IA 4JUFA 5DPMA 4NBUA 2C2MA 5C4GB 1E8MA 3O4JA 3WFIA 1E6UA 3HXTA 2TYSB 4IVNA 1JFLA 1T2EA 4AJKA 2GHRA 2H4YA 3QFTA 4Z0NA 4Y6SA 1L7PA 3IHTA 4FYMA 5JXGA 1PQWA 3JYOA 4CLOA 3EF0A 2AQ8A 3RYIA 4EKYA 4IW3B 3JWGA 4N41A 3ZE0B 3TXAA 1HDXA 3RVJA 1N6RA 3S1AB 4A0RA 4CNBA 2HA6A 4OHBA 2WKQA 3LT4A 1AMNA 2V7QA 1ZDMA 2NZUG 1EFAA 5CH3A 3IR5A 3K9BA 4DTIA 3FKQA 3DDWA 4CJXA 1DJQA 1QXSA 3PGMA 1USIA 1OQAA 3CKMA 1HI9A 4YCDA 1S2GA 3EXFA 2XKJE 2F64A 2J7PA 3NCTA 4FYKA 1OWOA 3QM1A 4QRDA 4IG9A 4RZIA 1UP7A 2YXEA 5EZYA 1Z39A 2UKDA 2FI1A 1NZJA 4G86A 4C7BA 1Y89A 4U5XA 5KI6A 2WIGA 2ECFA 2VBGA 1KZYC 4TMFA 4FMCB 3CZMA 4DA9A 1D5CA 2J30A 4YMHA 1PT9A 2OV8A 3NNSA 5FR2A 3GZ4A 2EL9A 5DM4A 5A5EA 2XEDA 4F2GA 5HTOA 1JLKA 2PGOA 4FN5A 2VJMA 1XUOA 2VQ6A 1FUKA 5I4BA 1J2YA 4I4IA 4OHXA 1TYCA 1IPFA 1IUKA 1FY2A 2ENWA 4KFRA 2BH2A 2G08A 1AE1A 5ES4B 2O2EA 4C7VA 3U37A 1RZ3A 3LF1A 1QJ4A 4PU0A 1ZGBA 3GY0A 4KC0A 1QGUA 5CG2A 1IJBA 3IBSA 4GXQA 2I80A 3OE7A 1JPJA 2CNLA 2WSYB 4UEKA 1ICEA 1GXSB 3AR6A 3AERB 2WY2D 1HETA 3NHYA 4XSGA 1PWZA 2CUNA 3PS9A 3KB8A 2GOYA 3UQZA 2QMEA 2EAUA 2OO7A 4UARA 5ELXA 1QP4A 5ELLA 1SUDA 2FN7A 5BSMA 2QZSA 3JAMA 5JT1A 5B2ZA 2VPQA 4RULA 1CVRA 1PR5A 1PSWA 2NO7A 1S8FA 4DR4B 1XP8A 5E3IA 1YUMA 1QV6A 1QCZA 1S2NA 3OZDA 4RK5A 3MEQA 4PE5B 1H66A 1FFCA 3E5NA 1CJKC 3GWZA 2X40A 4JA2A 2G1KA 2NSHA 3DJFA 4GKBA 1N8NA 1JHMA 4N8SA 1GGEA 2PJDA 4URWR 1SQ5A 4D8UA 4UM5A 1DJOA 4WBNA 4A5SA 5JXWA 3W4IA 3BMXA 2O06A 1B0UA 3QW2A 4Q3BA 4RWEA 2IHVA 4P0TA 2SCUB 3A9RA 2FYTA 4BO6A 3QKRB 3QVWA 3VR6D 2OVBA 3UIEA 5JANA 2AKYA 1IZ7A 1J09A 1JA1A 4ZRNA 1O4VA 4KDRA 3ZV7A 2VJYA 4JX8A 2Q9UA 2WA2A 2Y0DA 3RODA 1C3VA 2ZWVA 2GKSA 2ODBA 4RF5A 3KZNA 3W8FA 2WPDD 3DULA 3HLKA 5B2EA 1C4XA 1WPQA 2FXVA 4R9NA 4YP1A 3SIPA 4B84A 4WCFA 4Q02A 5JMOA 2QV0A 4KQCA 2WKRA 3WK6A 4YRGA 2EX4A 2IHUA 2YIJA 4NL4H 5G41A 3ZTYA 2PR7A 4TYPA 2VHJA 2B4TO 3HVKA 1RD4A 2Z8YM 1MB3A 1U1FA 1PDVA 2O3SA 3RD5A 4EVSA 2HPAA 3BWEA 2B4RO 1VRWA 1IULA 3BB4A 3UWDA 1BMFA 1XTPA 4GI5A 4Y18A 4YP9A 5TQ2A 4UULA 4PONA 3VR3A 5JNUA 3ZWPA 2DP4E 5DTRA 5CEEA 3BEDA 2CV1A 1BQ4A 1T3SA 1DKRA 1OUMA 2I2BA 3GP8A 5LMCA 1E2LA 4MUAA 1QCCA 2ZJ8A 2QD4A 5I8WA 3LWBA 4HRVA 1T1SA 2G5GX 4Z0PA 1JFFB 3G6KA 3I04A 5U4XA 1KOLA 1NP7A 1AUOA 4FYIA 3EMDA 4X7BA 2FA9A 1DX9A 1BQEA 1N4DA 1Q7TA 2D1SA 2VRBA 2DKFA 5E2AA 1Q19A 2A9FA 4WXHA 3DMHA 3QXSA 1E2QA 3AB8A 2WP8J 3GFQA 1H1LB 1D1PA 3SYRA 2O54A 1PFGA 4RPHA 3FJOA 2C2OA 1K6IA 4OHOA 2FE1A 1B8UA 1IN1A 5CFPA 3D0RA 1XZPA 3I2HA 3A04A 1H0RA 4BMPB 3H9UA 5AVKA 4EUNA 2IPAB 2P4SA 3M70A 1ZJJA 1H23A 4O2AF 2V9ZA 3IMCA 4M1EA 1QWSA 1ZG3A 5HCIA 4QTUB 2NV2B 3GJ5A 2WFLB 3IPYA 1XZAA 2AWNA 2CB9A 4YCSA 2VJQA 1KP9A 1YZVA 3HHEA 5KX5B 1CF2O 3BB1A 3SHFA 2X2OA 3ANMA 4LN1A 3ZGZA 1A50B 3ASUA 2GCOA 1C1DA 1TKBA 4UXJA 1J2JA 3ED5A 2GUWA 1KHTA 1V8OA 1R8XA 1I1QB 5DHQA 3DBOB 4IL5A 2GN1A 2ADOA 1P8AA 3EOBI 3IA7A 4Y2PA 5ALEA 4D99A 4EKNB 3D3WB 5AM3A 4L5IA 1JU9A 3AVWA 1JEQB 3Q1LA 5LOVA 1RC8A 4RENA 4WD3A 1W0JA 4JB3A 4CKWB 4LPKA 2P9FA 3SJBA 1KI2A 3WXBA 1UDXA 2QRGA 1VOTA 1RI4A 3MJRA 3VC1A 4MVJA 3MRTA 1M7BA 1TVKA 1J2UA 2NM0A 1P7YA 2H2AA 1CDEA 1NC3A 2VYND 4OXXA 2NUTA 3B13B 2I1LA 4GPIB 3UXYA 1JBEA 2B6HA 1YDHA 1SIWA 5BN3B 2E48A 1FDVA 4Q19A 1I5EA 3D6UA 3Q10A 2X0RA 5DLYA 5EJAA 5AWFC 1R8JA 5LA6B 1M1ZA 4F11A 1WXQA 5FBKA 3Q7EA 4EX6A 4JJ7A 4TV9A 5DM2A 3U13A 1N0UA 3QU2A 2H7YA 2P6UA 4EQZA 2CNOA 4LA4A 1HDZA 4PC7A 3VKHA 4RELA 2D5BA 1ORWA 1T6BY 4RKWA 3VZRA 2WZCA 3PDIA 3T7KA 3DV2A 1C1YA 4A27A 2D5IA 2X9QA 5FPHA 4DRZA 4E7OA 1VKOA 3PP8A 2WWWA 2JGKA 5IAEA 1OI7A 2UUPA 4KWEA 1E1CB 2FMHA 4G1BA 3ZKWB 5HOEA 2BR5A 4V03A 1RPNA 4QTXA 2EBUA 3QEOA 1Q0SA 1NULA 2HD4A 2O1WA 1S02A 3B78A 3KD3A 2Z4SA 1RBZA 2A0WA 3UT5B 4EFMA 3C5HA 1I8TA 1UBSB 3T1HB 2HJHA 2X5KO 2RE8A 2RAFA 4XD2A 1I3LA 4L5CA 3UHAA 1G291 2I54A 1Y1LA 1XEAA 2AMJA 3G8DA 4ZT6A 3G13A 3BH6A 3IIJA 1CIJA 5B1EA 1RCFA 4EJSC 2VWHA 1NQXA 1V7QA 3R7WA 1M1NA 5BV0A 4EFLA 2C2BA 3IAUA 2C96A 5JDIA 4E5KA 1RQ2A 4AJ4A 3UH0A 1Y42X 1J00A 4FP9A 1S6YA 1R1DA 5K0JA 2P4HX 3MBKA 4XQ9A 3TW6A 1RS0A 3R4CA 4NMLA 5ICEA 2E7ZA 4NBVA 4IRXA 2XYRA 4TVKA 5E4FA 3GD7A 3TGLA 3CGWA 3WKDA 2AEJA 1BWSA 3HFSA 3OWHA 2O1XA 2QR3A 3QLEA 1AKUA 2FCAA 1X7GA 1X80B 2BP7B 4PLPA 5JBQA 2MU1A 1GGFA 1DKPA 1EWYA 3EZ9A 2JVIA 4RCZA 2HHJA 1Y4UA 4MYDA 5E1OA 2Q5QA 4MUNA 1GNPA 3LY5A 3NP9A 2I7CA 3UJHA 1JBQA 2HDOA 3OX4A 1K98A 3JTMA 4DGSA 2HA7A 5JCXA 4KMSA 2O2HA 4LBVA 2BGTA 2GN4A 3RS3A 2JFHA 3OBBA 2OHJA 3KEOA 2GAOA 3ZE7A 4P3PA 1R18A 4KPFC 4G4SO 5JE8A 3WI7A 4DA4A 1JB1A 2QRKA 1SGWA 5DK4A 4LE2A 1DC8A 3ZLBA 1SWVA 4JODA 2C1ZA 5JVDB 1L4HA 2JGMA 2CDRA 2WD7A 1YRYE 2F00A 2JAQA 3PKZA 2I78A 2QSJA 2JFUA 3SOPA 2R60A 2HA2A 3G2NA 1EB8A 2IYZA 5JCOA 4BNDA 2PKCA 5ALHA 3PUJA 5ALLA 3EPKA 2GRUA 3MVEA 2IY7A 5F2KA 2AC4A 2OXTA 1ISGA 2W2VA 2EZ9A 2XKAA 1SC1A 4RH1A 5C46F 1GA4A 4RPLA 3FB4A 3TINA 3V42A 2V59A 1PX0A 1ZRNA 2PBRA 3P8ZA 4Q47A 5CYFA 4B87A 4Q4CA 1CE8B 2O2CA 1U0LA 5K3SA 4YCNA 1FNCA 2FPPA 4MGIR 4OJKA 3L8HA 3BWYA 4YMWA 4IY1A 1P0QA 2PLWA 3QZUA 4OB7A 5ALKA 3ZHUA 2PZMA 4OQPA 1VBMA 5FFMA 3TZHA 2AKEA 1FYWA 1D2GA 1MGPA 3O92A 4HHEA 5JXHA 4IHJA 1WHSA 4LYEA 3GGSA 1HV8A 3KVYA 3SEFA 3MLBA 1FYEA 1DAGA 2J9YB 2G7MC 3IO5A 1PZMA 2JAPA 4MH0R 1MC4A 3U4QB 1YZUA 3EVTA 5JALA 2C5EA 5KDDA 3I5UA 2H5LA 4QDZA 4Q4DA 5E6UA 3O8RA 1SBHA 4UMVA 1LQUA 3GLIA 1A96A 1G20B 5BSEA 2LD4A 1ZOIA 4ZI5A 5L3QA 1DBIA 2QJOA 5JNSA 2AJBA 4TMXA 1D6NA 1LCIA 4RTQA 4K6GA 1QG4A 1WAMA 2IZ6A 2NUPB 4OQ4A 4IDEA 5GGYA 2IWHA 2P0AA 1XFDA 2II6A 4L6CA 4U7TB 4I3HA 3S2EA 1ABFA 2NU9B 3D2BA 3ASZA 1TM2A 2X42A 1YE8A 3QU4A 2C9BA 3NJ8A 4GVXA 4QELA 4F7DA 3ITDA 3ANYB 5E3JA 4Q3OA 1Z5OA 2MWMA 1R0SA 4Q1BA 1Z35A 3F8WA 4IQGA 2PIDA 2PUBA 1CY7A 1Z28A 4GZMA 1PL6A 1JSZA 3AOEA 4RABA 2H1SA 1RQ7A 3G02A 2FDCA 2FAXA 3IPLA 4GC5A 1KVRA 3C1OA 1I51A 2DUJA 2A92A 3EAFA 4GRAA 4QX6A 1QS0A 4HS4A 3CVXA 3BQ9A 3DHEA 2A0YA 2W2KB 4L0CA 4TRMA 2Q2OA 2IK8A 1G3MA 2VHWA 1KA9H 4QO7A 4TRRA 4YMGA 5DGTA 2G36A 1J8MF 2BMJA 3WDSA 1D1SA 4C1NA 2ZIUB 3B1ZA 4L4YA 4DAOA 1PR2A 1JIVA 1NRJB 3GHHA 4HRXA 3EH2A 2DBRA 3RYFA 4HVAA 3HA7A 2FK7A 3QHPA 4KE7A 5FB3A 3EJ6A 4E5MA 1ZIXA 3K16A 3R7LA 4W4TA 1Z56C 3LK6A 2XDAA 2CF6A 4O29A 2D7DA 2NMVA 2I2AA 4RHUA 1ODFA 2BE9A 1JXMA 1IBCA 5JMTA 1ZM9A 3W3AA 4WW0A 3LC2O 3R7SA 3WL8A 2A30A 1NUQA 2W2OA 3L1IA 4KFSA 4R8RA 1W2GA 4I9NA 4ZQHA 1PS9A 5IARA 1DAEA 2VK2A 4MAAA 4ZMBA 4CKCA 1ZI9A 3TR6A 1WETA 2AL7A 4IP0A 4WZZA 4E0BA 3QEAZ 5ALWA 3UWSA 4R1QA 4AZ0A 4B35A 4CFYA 5E8JA 3WB1A 5FEUA 1G20E 1KI9A 1Y9AA 2J7KA 2PWBA 4MYUA 5HILA 5FH9A 1XZIA 4YJKA 1ZZGA 2OOSA 1GNSA 1IZ9A 2AGVA 2R6GA 3BBLA 1T36B 4ATNA 4UHDA 5JI3E 1Y9DA 2PXHA 5HF5A 3RUFA 3OKPA 4KMMA 3VDNB 2XSZA 4AIRA 4EPXA 5HRUA 1GTRA 1G21B 3CPJB 1EZZA 3BJMA 1LDEA 1V5FA 1AN0A 2XTJA 1XA4A 1G6OA 3IUYA 3PFBA 3J80A 1O1YA 4UBKA 3MWYW 3ZVLA 1N6NA 3ADKA 4IWNA 3U61B 4TQAA 1JG2A 4M0FA 2FSVC 1BE6A 2UV8A 2BGKA 1OYWA 4GM1A 2E6KA 1TVMA 4EWLA 1OTXA 3PHCA 3LJKA 3MUOA 5CDYA 1M6VB 2I3DA 1WU8A 2F59A 3IKMB 4MYCA 4JI1B 4DSNA 2Z5GA 1D07A 1PS8A 6GPBA 2XA2A 5KNBH 1SHLA 3EGCA 3UC5A 4BAGA 4XX0B 4E6PA 2RD2A 4N82A 5LQSA 2C8JA 3DM5A 1P7ZA 2CBXA 5DIZA 4F8EA 1SCUA 2RGNC 2VZEA 3O38A 3SYTA 1UKAA 1SXJC 2CUZA 2OQIA 1I3CA 1VKJA 2QAGB 3JVEA 4IOMA 1RT9A 1Z8NA 3C85A 5B4UA 2Y2UA 4IMPA 1CNEA 1CP2A 2YJ6A 4FJ2A 5EZQA 3FZYA 1OILA 2G82A 4R1MA 3UCEA 4FB4A 3BM5A 1QFYA 3AUUA 4NU0A 3PQ4A 1IN4A 4OK3A 4WE3A 3JYPA 1HL7A 5KDLA 3ZZ1A 2FFQA 3ABQB 3UHJA 4ARVA 1ZUNA 5D5HA 1C0IA 1HWYA 1ECGA 1TE2A 3DZHA 1G5FA 3EB9A 2VZ9A 1A0OA 4JP2A 5D3KA 3FMIA 2WOJA 5ES3A 4JITA 2YCLA 5FLEX 1ID1A 3IQZA 4I5IA 2C7PA 4DAEA 1XRJA 1UMBB 2NIPA 5ENZA 4EA9A 3DL0A 3KLNA 4E5UA 2EOAA 2G6BA 2QTCA 1Y5LA 4WSOA 1E9AA 4B3BA 4X7RA 4J16A 5DSZA 3WYFA 4Q37A 1BIFA 1P6XA 2ZUUA 1YR3A 3N2GA 4NF2A 2Y0BA 1QNFA 2GCIA 4HNAA 1G21E 3AU8A 3GGJA 4GBMA 4L6AA 5I51A 3Q9UA 2Z57A 4HDMA 2WQ6A 1TZKA 3OZCA 4ZXPA 3TAHA 1PHRA 4BFZA 1TUEA 2VK1A 3O47A 4DLSA 1S8AA 5FV7A 1WQ4A 1WSBA 1SC3A 1Y63A 4N8EA 5FBHA 1FYVA 4B79A 1C0LA 2REQB 1TM4E 1TYBE 2N42A 4AKEA 1KP3A 2F9MA 1KWKA 5F7OA 5B4VA 3ZE6A 4D9MA 3VKFA 1PR4A 5EESA 4EUFA 3V3KA 1V8FA 2EBFX 2PYZA 3EVEA 4HLDA 1VSVA 1GO2A 3D59A 3VH4A 3AR9A 5GIOE 3WA7A 3GRFA 5JS1A 1YBMA 3HCRA 3QMMA 4FI3C 4EHDA 3R3XA 5KYNA 2P6RA 3ZE1B 4J1QA 4FHCA 3REGA 1UK9A 1RFGE 1E1RD 2OSVA 2WF9A 4XSHA 5EQTA 3TQOA 4GWKA 4RUKA 3ZHCA 2D5CA 3ZV6A 4II7A 1C7FA 3HCDA 4ER3A 1R74A 3G8BA 2IF0A 1XVUA 4HDAA 1WL8A 2D1FA 4X94A 1RAAA 4R8VA 4FBMA 1N2CE 4BN0A 2V45A 4CZ2A 3K6SA 3QEBZ 2CVPA 3DTVB 1RXEA 3HJUA 1W4RA 4R2IA 3KQWA 4GBED 1VKNA 3A4NA 2PLNA 1EJBA 5K45A 3L46A 1EUCA 3RQIA 1COZA 4N03A 3ZVRA 1SBNE 4JGBA 9LDTA 1QLHA 3IXQA 3DFKA 1TZJA 4XGKA 4JT4A 4Y67A 3GGDA 3RO7A 4RVSA 2NPIA 1P4SA 2VHYA 2WU3A 4KXXA 2W6OA 2W93A 2XTZA 1I3NA 2FLKA 3PNBA 1G8AA 4MRAA 3LBYA 4YMUA 5ICMA 3CZ4A 2XWPA 5AOCA 1A8IA 4AS1A 3E1SA 3RANA 1FFGA 1BVUA 2D4AA 5JD3A 1BDIA 4Z4GA 4AKHA 1CLEA 3B9BA 1UL1X 5AKLA 1IOVA 3CLHA 4I50F 4UU1A 2LGJA 5IAAA 2ZVQX 3O9VA 3M4JA 3SU8A 4Z4EA 1EESA 4YACA 5AKKA 3S2SA 3PYMA 4YP0A 3U1BA 2VG8A 4KXFB 2CJWB 4QXOA 3GPLA 4PC2A 2BKUA 1HFWA 2WHXA 2LBPA 3FYUA 2VT2A 1LK0A 1WIWA 4JEMA 4KVZA 4LYYA 1W88A 1DADA 1U7ZA 4EYGA 5IT4A 1YB4A 2ZRBA 3F6PA 4K8OA 1Y1TA 3BF8A 1MQSA 4Q66C 3F71A 5AI0A 1U3VA 4C2AA 4DRXB 2DLDA 3JXEA 4K9NA 1DZ3A 1VSTA 2QXTA 1TPYA 1QHFA 2GEVA 3EVBA 3FPFA 3FD8A 3U3ZA 2JEZA 3H7AA 1L1FA 2ZVPX 1SKQA 3JPYA 4ABTA 5AW7A 3EDMA 1SUAA 1TOAA 5KVSA 4ERNA 1PEAA 1KPIA 1OX4A 3KFVA 5KREA 2R1VB 3OZTA 4U0JA 2E5WA 3BREA 3W6PA 1DPGA 2HIMA 1TZ2A 3TYXA 3MJDA 1G2OA 4UJ5A 1TGYA 2Z8XA 4BE9A 3SXPA 4J90A 2WYWA 4ZEOA 4F4CA 2D2EA 2DOKA 5DYGA 1GPMA 1P7WA 4ROSA 9ABPA 3GXOA 1LBQA 3FW1A 1MXFA 5EPOA 4CETA 4MW6A 4CQMB 1R0BA 1UBMS 4G1MB 5TJHA 4JSRA 3EZ7A 3IKVA 5C32A 3ONWA 4UBLA 2H11A 1KL7A 1I2AA 5T5QA 5JADA 1T13A 1JHPA 1XQXA 2O2ZA 3BTUA 3L1VA 4U2EA 3C8MA 1FMFA 1QC5B 1NUPA 2AE1A 3CPHA 2JLAA 4H60A 1XDBA 5CVCA 2VH5R 3T7DA 1M2VB 3WBJA 5AK5A 3LXUX 3VZPA 6ADHA 1V7CA 5KVVA 3AF4A 1EWVA 4AD8A 5JZSA 5E6RA 4LXQA 3KLMX 4MV5A 1TW3A 1YCGA 5KYYA 1W73A 5A3RA 3DF7A 4PSUA 4MQLA 2GZDA 1JAYA 5LWQA 4Y0VA 3KTOA 1TFUA 2QT9A 4BGUA 4DJ5X 1UM9A 5FNVA 4MNTA 1OI3A 1JG4A 4F84A 1P9RA 1X87A 4CLDA 2PL9A 3T7RA 3FAKA 2Y8EA 3LP6A 4MLCA 2OP0A 3L4BC 1LW6E 4NBSA 1JDSA 3I58A 4EBBA 2PIAA 4G0YA 2V54A 4ZYXA 1PL7A 4INPA 2EQ5A 3HC7A 1K8RA 4ZOCA 1B7GO 1X8KA 2FSGA 2PO7A 3MD9A 2YVAA 3D9QX 4BXOB 1SXGA 3Q5DA 2H4JA 3ZCUA 2GDJA 4JVSB 2IF2A 3B9PA 4XASA 4POOA 5LP6A 1QR2A 1BCRA 1NMEA 4FVTA 3WGNA 5A4DA 1ZJWA 5C53B 1SVSA 3V4OA 3EK2A 5M04A 1M5RA 4RFLA 3T9EA 4NYJR 3DWEX 2E55A 4E5YA 1EVIA 1HT3A 4PBRA 2X1VA 3DLPX 5DLDA 2A0KA 2PWYA 3ISVA 3P9KA 1X7ZA 4QYTA 5ALDA 4E07A 2HCRA 1MAVA 5LCXA 3QMVA 1KZGB 3RYCB 3CN9A 2UU9B 4JEUA 1LTKA 2JB9A 4Z9YA 1TUGA 2XB9A 4UM9B 5B7QA 3EA0A 2CDBA 2FFJA 1KKLA 1SD5A 3ZN2A 4LPSA 4C4PA 4CEIA 5TMPA 3WGVA 2B0JA 2QX4A 4II3A 5EMHA 1DVRA 1Z82A 4OP2A 5C81A 1OREA 3RLFA 3RTCA 4ZCMA 3ENVA 5ICSA 1O87A 2LIVA 3VO8A 1J8FA 4WESA 1UFQA 4BAUA 5JSHA 5LDDC 4QLAA 1Y9EA 4PW0A 1OD6A 2WMOB 4BJHB 3CCCA 3ORYA 4XJTA 4IUBS 5BUSA 2HOQA 1NC1A 1SB9A 2V97A 3KJZA 2ZR8A 2HRBA 4CNQA 2H31A 2FEKA 1I0LA 2QSUA 2VDOB 4UASA 4XXHA 3R7DA 4HWGA 5F78A 2IBSA 5CIWA 3WWOA 3IAFA 4OHPA 4R2HA 4F5WA 2BR3A 4WXRA 1I80A 4KR2A 2AD5A 2RGEA 1NBIA 1NMYA 3NWOA 4ZICA 3DHVA 1HSOA 3OX2A 4HQRA 2HHCA 3DSRA 4BN4A 1OBOA 4K0KB 4W5NA 1IQ0A 1YHYA 4MP6A 1O2DA 1UXOA 1XVAA 2XQJA 4MW1A 4O4LF 2B61A 3H5LA 1ZCJA 4HPWA 4CMIB 1PFYA 2I4RA 4MS4B 1LZKA 2FWBA 1V6AA 4LHXA 1RU3A 2ZIXA 1HE2A 1AKRA 3S55A 4A8HA 1XZJA 2ZIZA 3NIBA 4JC0A 3BDVA 5FQNA 4ANFA 3TNLA 5B4TA 3GP3A 1O6CA 3IUEA 1YRLA 5MN6A 5FL3A 1AQ6A 3UPDA 3KQMA 1U7DA 2B2XA 3BAFA 3DZKA 1LU9A 5FAKA 1Y8AA 4L5YA 2X86A 4C89A 3KXLA 4HWPA 1Y33E 5IWAB 1I7DA 3N70A 1O94D 1EEHA 3RFVA 1BDBA 2PHZA 4WFKA 3ZY6A 4XM2A 4MI9A 3DMDA 2XZDA 2XCOA 3PE4A 1Z07A 3R77A 4IOLA 4BNLA 2CLOB 5BWNA 1T4CA 2KBFA 4B85A 2D06A 3AJRA 3IO3A 2EWWA 4XWGA 4RGBA 4ZVPA 1TJ5A 4XVHA 1RTKA 3AFMA 4BO3A 2ZUWA 4XCVA 4AAYA 4D3DA 4C22A 4YREA 1WCIB 4P81A 1E1YA 2NYRA 2EZ4A 1LS1A 3PITA 3HGTA 5KC9A 3O4IA 1VE9A 3VR4D 2IIVA 4ARZB 2QVGA 5A62A 4I99A 3AEYA 1FFAA 4DSOA 3H75A 4LYFA 4NBRA 4GX1A 1BW9A 4EHJA 3VKGA 1R6XA 5BRJA 2I2WA 1NUAA 2OORC 4KZKA 2DFDA 4OKIA 2C7VA 4XJXA 1JDJA 1CZNA 3VSCA 3QE9Y 5FLXA 1EGAA 3W2EA 1ODKA 4EJFA 1FFDA 3FZEA 3B2QA 4P8RA 1NASA 3KWLA 4E1VA 5AKHA 1X7HA 3GF4A 1E0DA 3ORHA 5AICA 1H22A 1PF7E 3AY7A 1CR6A 4GL2A 3UC9A 5IZCC 1MQAA 2RJOA 5G4LA 1YUNA 2BCGY 3EDCA 5JARA 3OT4A 4G89A 1I4WA 1X0VA 3HCBA 4QOGA 1IC6A 3FI0A 4IMJB 1GR0A 1E3DA 2IRWA 3O3MB 4BC0A 1FJHA 3MK31 4NPHA 2JL1A 2ONYA 4PFKA 5EXSA 3C5CA 3RTBA 1IQRA 1CQIB 4WKGA 1K8YB 3LKVA 5T64A 1GPDG 3NDJA 4JXKA 4WFJA 2OCYC 2DX7A 2XVAA 2DH5A 4MLDA 1KP2A 3LS2A 5KWIA 3WBBA 1CUSA 4JI2B 4X93A 2Q3CA 2PX4A 2ZWOA 1N3LA 2FWIA 3MUNA 3PCRB 4BB0A 5G3YA 3J7AC 4GYKA 4KYIB 3PQEA 5DHRA 5GQSA 4Z0TA 2WKWA 3IDOA 1MTOA 2RK3A 3M5DA 4C29A 5G1NA 1POXA 2ZI5A 4HNGA 4M9CA 3CF6R 1KJIA 2ILVA 4YUWA 4G1EB 1KI6B 1Z29A 4DDUA 5KU7A 1VLZA 1L8OA 1YVEI 2I66A 2BFDA 5BMVB 1M2KA 1R88A 3U3MA 2J31A 3PL5A 1ORVA 1W7AA 2XNSA 1YC2A 4BNKA 4Y3UA 2P9TA 4S2UA 1FDWA 2HQBA 1SZPA 2ZSEA 4L16A 1TT7A 3ZHXA 3ABOB 4DA6A 4E11A 3E9NA 4HH1A 1P72A 3V4FA 3GG2A 4WMLA 4EJ2A 1G5TA 3EVZA 4M55A 2C29D 1SD2A 4Q7LA 1D2NA 2Y1GA 3ESZA 3RBZA 4FR5A 3TRKA 1AO3A 1OBVA 2XVMA 4D3XA 3STHA 5MN4A 3CNBA 4WUTA 1OR8A 3OD5A 2CXSA 2VH1A 4NX2A 4RVNA 1RMQA 3OI7A 3U19A 3W8NA 4TMYA 4NKRA 1G66A 3JAWA 2X4DA 4FGJA 3TTYA 2Z2JA 3LVBA 1PRYA 2XADA 1VCOA 1JWBB 1H5QA 3HKBB 2C7QA 1UINA 5LB4A 2G9RA 1A4UA 3WSWA 4Z3KA 2A33A 5FADA 2H9AA 1KYXA 2DHDA 1FFWA 1RYHA 1U1DA 4H4EA 1I33A 2HSZA 3O7WA 1BGWA 1J5PA 4QPZA 5BQ5A 3ZJVA 1FRVA 4WDQA 5DNCA 2AI2A 1QHIA 2I33A 4YJ3B 4CL8A 3AHFA 4MVJI 3GA5A 3E2IA 1HKUA 1AS3A 4GR4A 4XKJA 2P3SA 3IL2A 4QXQA 1CY8A 3L7NA 3OWXA 3L04A 1FFBA 1ZA2A 4IWXA 3VPFA 2I6SA 3BMOA 1LLUA 2I6FA 2AFHB 4LY6A 5KTSA 1TD9A 3B52X 1RWWA 3EFBA 1XF9A 2JFWA 3I52A 2R9VA 5AVOA 1SCNE 3MOIA 2QGZA 3UOWA 2IIBA 3VR1A 3VR5H 3HSSA 4ALJA 1FQJA 2C2YA 3VHXA 1U31A 3FI9A 3OA2A 5HGXA 4HWSA 5G0TA 1MF7A 4RW0A 1M83A 1YU9A 5AOBA 3AIKA 2IPMA 1DELA 3GN2A 1NURA 1V95A 1QMGA 1Q16A 2E4WA 2NTVA 2YHIA 2DFLA 3D02A 4PLWA 4W7SA 4KFCA 2FMUA 2X7JA 1KYIA 4MCIA 1VE5A 3D3JA 4IZHA 2NVUA 1PJAA 1B41A 4OBEA 1YR7A 1ECCA 2M2IA 2HCJB 1OT5A 2QDKA 2YQ5A 3DTVD 3PL1A 2LV8A 2FEAA 4ND2A 3EQ8A 4XFJA 5T6MA 1IEQA 1NKVA 2OEPA 4WCDA 3NORA 4DCPA 1RXUA 4QPCA 3ZUPA 1UFRA 2GN6A 3RGWS 5JCPA 2GUGA 2QRVA 4IOKA 3NM5A 1Q21A 2C95A 2GB4A 4KQHA 2GRAA 2AJCA 4BC1A 1BS1A 4O2BF 5H9WA 1Z18A 2O52A 4B46A 1SR8A 1Q7EA 1YH3A 2X4LA 2ZJ1A 1YRBA 1U28C 4RS4A 1UXJA 1PEKE 2JD1A 3LCVB 5FUWA 3E7WA 3RVDA 3KWMA 1HO3A 4YO7A 1N3IA 4YMLA 4Z9AA 4TVSA 1EVZA 3GAAA 2IXTA 5BR4A 4J76A 3GJTA 4DW8A 3E3NA 1JR4A 1USWA 3FWPA 4DC1A 5EJ8A 1D2RA 5IT0A 1L5SA 1RM0A 5JOQA 5BSUA 1KQPA 2BGIA 2GPJA 3EULA 1WUKS 1SA0A 3G3EA 1KY4A 4H59A 4JWTA 4KU4A 3LM8A 4O0MA 1K63A 2CHUA 4YASA 5ALIA 4ZRMA 1UDCA 2VT3A 4DMLA 3NMUF 3MCVA 2HQSA 3T4UA 3WDKA 1YZQA 2X6QA 3Q87B 2KX7A 2Q07A 3GFOA 1Z4QA 2Q6KA 2AFHE 3EZ6A 4A7PA 1A95A 2WMDA 1XZGA 4PHTA 3ZU2A 5EHZA 3QGMA 4WHMA 4YO8A 1OV4A 1K5HA 2UZ0A 3FH0A 3FIJA 2C97A 3IVMA 4B4KA 4B74A 4Q1EA 1OLUA 4RFSB 4E5PA 4C2TA 3RK1A 3PICA 4IVPA 4H4CA 2XWBF 3FFAA 3D3QA 4GR5A 1OPXA 3Q6NA 4R0VA 4QG3A 2AMFA 5DYIA 5MFZA 3OCXA 4Z51A 3TSAA 1G6HA 1L4KA 4LVUA 2VRNA 3IAM6 1OH8A 4BWFB 3FNHA 3OPNA 3DLIA 5CVUA 3RE1A 2FN8A 4EB6A 4AQ7A 4GM4A 4C6SA 3K9FC 3MJFA 4RMNA 5H1YA 3V8EA 4WOKA 4AJJA 1TYZA 5BYAA 3PFGA 1A69A 2PQMA 1LK7A 1OBHA 2R25B 4TUYB 2GPYA 5AIAA 2Q4RA 4CIWA 3PGLA 1WCYA 5I9SA 3QNMA 2O2XA 4PFSA 2B5OA 1DTWA 3BAZA 2V4MA 1P1KA 3EHDA 3F9IA 4LJ9A 3CIFA 4DADA 5BOSB 2H16A 2Z8YA 4R1NA 5KVQA 3D2LA 3IP8A 3L7LA 3I6IA 4PXSA 3TQFA 3S8YA 2DR3A 2EGHA 4TTQA 1LJUA 1VKHA 2ZGVA 3OMXA 2GK7A 2BHLA 4BNZA 2J5KA 4CXMA 1OVMA 3FSGD 4TSRA 3VVCA 2V96A 3GOHA 2HJGA 4HDKA 4IS3A 2UAGA 3R0XA 1UOOA 5BNZA 1T8WA 3EH1A 3F1KA 4RS3A 5FYDA 4TKUB 2ZRJA 3G9ZA 3NHKA 4U6QA 1R66A 4LQDA 3DNMA 4ZVLA 5G53C 4AWAA 1YHZA 5D6NA 1B26A 5LXTA 1JQKA 2W6IA 3BTOA 3HMKA 2HRQA 1XN4A 3BC1A 1F0NA 4PG8A 5IJ9A 3KPVA 1OAOC 1Z26A 1HE5A 2WYIA 3SGLA 3DQPA 1DXQA 1AIPA 4Q5IA 3DBVO 1QIGA 1OIXA 1S89A 3HB5X 4ZK6A 1YQUA 3DE5X 3JW8A 4FGSA 4X1YA 5AI9A 5ADVA 3KYDA 1FJGB 1GLGA 4JT9A 1U8TA 4G8BA 4WFQA 2C77A 3N1UA 4XZ3A 2PKRA 3NBFA 5SY4A 3PFCA 2ZVJA 1R5OA 3SR0A 3H2YA 1G0NA 1XOIA 4ND8A 3F4BA 5DW0A 9GPBA 2GD0A 4CM1A 1X1AA 3KHSA 4KR3A 1EFPB 2UUAB 4QC2A 3RYTC 1RRVA 4U7JA 3MMPA 1I5OA 1K3UB 1MKYA 2VF8A 4UM9D 4ALLA 1CFZA 1NZDA 3GJZA 1HE4A 1EHIA 3BA1A 3CRRA 5KAMA 3K2EA 4DC9A 2DETA 1ZD3A 1UWKA 2I2CA 2IXEA 5ED0A 5CXUA 1WSAA 4U2DA 5H4HA 3KYJB 4X6YA 1YU6A 5G0SA 3LHFA 1UC5B 3BWCA 3O74A 5EIBD 5EINA 3LDFA 4ZU3A 1XKTA 3AR4A 4FC6A 4PX9A 4RGVA 2AMLA 3TSYA 4CG0A 4X85A 4A0HA 5I9LA 2H9YA 4FFBA 2Q46A 2IYFA 2PWZA 2EF0A 3A1NA 3OCWA 4KIGA 2EFJA 4ND6A 4NEQA 5TRTA 4LKRA 4AP9A 4CTJA 4M1YA 2EF1A 4Q03A 4QAJA 3QITA 2FJPA 3M3HA 3A2MA 4CU5A 4RHYA 2G06A 3D54D 3OPYA 4QPJC 5T3UA 4KQJA 3LKDA 3WKEA 1N5RA 2DFNA 2LW7A 2ZRQA 1LLCA 3PENA 4LDNA 4Z4IA 2ZBEA 3ZGYA 2K87A 3C8DA 2O3QA 4H3VA 4H9GA 5HEKA 1OT3A 1GSOA 1NSFA 1Z74A 1U5BB 5C7YA 3RABA 5CIQA 2J6HA 3DAPA 5L4NA 3V5NA 1OA1A 1R15A 2HBQA 4MQEA 5DCLA 5DGCA 1KRHA 1GCGA 1ZWKA 3LU1A 2WWFA 1DAMA 1GR1A 3EUEA 4ZANA 1ZR4A 4TMTA 4AWBA 1GTMA 1IL0A 3N2YA 3FPHA 4I55B 3KQKA 1J8DA 3ZK8A 1FPQA 1W46A 3K8YA 1ONOA 1X39A 3AFNA 4XRGA 2H0RA 1ADJA 5LZ8A 2EJCA 4AUNA 4CL0A 4N0EA 4TROA 2QN3A 3RAFC 4RD6A 4UBJA 3U60B 1NPTO 1Q0UA 4TTRA 4ZVVA 1LBTA 2ZR9A 3DEYX 1JTEA 1HRDA 3JALA 3HU5A 5AVJA 4BE4A 3BGDA 1X0XA 4D26A 2A7XA 1NFQA 4WJKB 3QYPA 1VM6A 3W78A 1WCXA 2PGXA 3GLKA 3GCZA 4OQFA 3D2CA 1ZGGA 3OKAA 3OLVA 4PEVA 1P5HA 5AVUA 3OHPA 4J2HA 1A9PA 2Y27A 1TM1E 3IAEA 4C4ZA 1JG3A 4U39A 4MHOA 3KTDA 4KV9A 4MRPA 3VAAA 4YAUA 3EGOA 1AF4A 1SC4A 3SHWA 3RIXA 2CHGA 2BFBA 1AGXA 4CM7A 2F3TA 4WY8A 1KWGA 4EZBA 1G1AA 5HIIA 2CDNA 1SK9A 2XUZA 4ZDIA 4Q9DA 4D45A 2V9CA 1NPYA 1QHHA 2AQHA 3IDSA 2I29A 1ZRMA 4B6EA 4G56A 3QKIA 1VJ0A 4IFBA 3QPWA 4C7OA 4U63A 1SCAA 4NHOA 3IEVA 2R00C 3OFNA 5BV2P 5CFRA 1SIOA 2RK4A 5KQPA 3AUTA 1BGVA 2AJ8A 2DBVO 4HQOA 1WDKA 1HDOA 1TQ2A 4CIXA 1XXHB 1EFVB 5HFAA 3IUJA 1PQYA 2Q3EA 3L18A 2YKGA 3L7YA 1KKMA 3NANA 4IZIA 2QTFA 3E5RA 2ORYA 1YQ9A 2P1DA 2W6CX 4MK4A 5CTJA 4K9SA 3WYDA 5JQWA 4DR3B 3GUCA 4U9UA 3HXQA 3HH8A 5ALFA 4RPKA 3T0IA 2NZVG 1ML3A 3U80A 1D03A 2IW1A 4XVRA 2W2TA 4PR0A 5DLQC 1KHHA 2WQZA 4PXAA 4KXUA 5BNWA 4DA0A 2Y0PA 1DKQA 3I53A 4KFTA 4EARA 1KEEB 4L8VA 2AJTA 4HWOA 2CL7X 1NF2A 2F8MA 2YZGA 2YQ4A 1P5ZB 1B8PA 2CZGA 1FRZA 3G23A 5BV1A 2IODA 3SLKA 3B53X 4XUEA 1AY0A 4AX4A 3QRWA 3KJQA 5DNAA 1QGDA 4R05A 3LQQA 2VYFA 1XZNA 2JIMA 3QVGA 3O4GA 4IZ6A 5IK2A 4TYNA 3H8VA 1PWYE 3L6DA 4PTZA 4POAA 4HUTA 2AC2A 3CUVA 4QYWA 4BU0A 3OIWA 4ZVNA 4OL9A 1GG8A 1R4NA 4HGOA 2ZUBA 1HYQA 4NABA 1GGMA 2QX7A 2ICAA 3G5UA 4J0JA 4I1SA 4OHYA 1IIRA 3D8TA 2OKCA 3HZZA 5CB6A 2VZ8A 4XEUA 5TDHA 3Q3HA 1EUZA 3K09C 3WL3A 2WFAA 4F2DA 5DMHA 4ODIA 1HOTA 3PLAE 1TA4A 2ID7A 2GR9A 4YJFB 1GNVA 5LQUA 1U9ZA 3PQ3A 4WOJA 4TMKA 2I91A 2PX3A 4D92A 1YTLA 1W8IA 1UM8A 3SC2B 4BMNA 5C2JB 5EJGA 3U40A 2QWXA 3FWHA 6NULA 2IGBA 4B6OA 2OB1A 4MR9A 1MG0A 3DZ8A 2QMHA 1NE2A 3DMFA 1L4LA 1T5TA 3E27A 2K7ZA 3MT8A 4M53A 4QBGB 3L7JA 3WLHA 1VJGA 3SC4A 3INGA 1DAHA 4PPGA 4UHBA 5CUQA 5F1YA 1TCUA 3U7QA 1M34A 2HYIC 3AHCA 4RQUA 2O2GA 1V16B 2Y0EA 3ZEIA 3FTFA 4R41A 2QTHA 4RK1A 2EWVA 4WV3A 1PJ8A 1IY9A 2FJ0A 3RFXA 3N2EA 4BKOA 1ETHA 2ZK7A 2C5SA 2HV8A 1XWFA 1QZ3A 1MIOA 1X7DA 3UJBA 1J97A 2FMIA 2XQFA 3FX2A 4QULA 4ZO8A 1KZ9A 3G0HA 2YVLA 4BV2A 4IJMA 1Z6GA 5CT9A 3GEGA 4U0KA 2HJSA 3UA3A 1GRQA 1H85A 4TQ9A 3CN7A 2QGNA 3NHWA 1U8XX 3RH0A 4B3DA 5HVNA 4ML3A 3IR6A 3KV3O 3R6DA 2QVBA 3H65A 4O2AA 1YI8A 1SRQA 1YR6A 1J49A 2Q3MA 4CKZA 2W6JA 4P7GA 1UBHS 1DEAA 2O2JA 3PDWA 3EXIA 3L6OO 5TQ2B 1MO5A 3T3IA 5K3EA 1F12A 3GVHA 5F7JA 5B5SA 3HNOA 1N2EA 2FWJA 2XVYA 1VLLA 4K3UA 521PA 3K1AA 2XZLA 3EYAA 2FF5A 2CJYA 3IH5A 4GZ6A 1JHQA 4L02A 4MS1A 2A1TS 1G2IA 2VJLA 1FNBA 2MOKA 2PS1A 4G85A 1UDAA 4I1UA 3IAHA 5C1OA 3L1HA 5HRCA 5JRDS 1V1MA 4NBLA 4UUQA 2QL5A 3G8YA 3U1VA 4QECA 2J5QA 1Z37A 1Z33A 2VUTA 4AS3A 3QY9A 3GJSA 3RARA 4NENA 1U9IC 2I6TA 3LCCA 1CG6A 1NBHA 4FOSA 3RTEA 3ON5A 5KHLB 1X9IA 1R9MA 1L5WA 5SZJA 3WK7A 4F2WA 1K3FA 1MX9A 3AKDA 1VSBA 1E3LA 3OEEA 3M6UA 4BGIA 1HG0A 1XJWA 3IGFA 3VJKA 4MLZA 1U2DA 2OPBA 2HSEA 2XNDD 2CCJA 3ZK7A 4EUEA 2TSYB 1O0BA 3L0YA 5CDHA 3V4PB 2GJKA 3V34A 1CRZA 3X1WA 2CFIA 1VE3A 3P9IA 3DE6X 5K0NA 5T4HA 2JZOA 2QTAA 3TR0A 3FE2A 1W75A 1RM4A 4JIMA 3V1UA 4CL2A 3ZBPA 2Q8PA 1C1DB 4ZT3A 1NP3A 2J6BA 3L5OA 4X1KB 4NNPA 2JA2A 1UBNA 2G72A 4Q9HA 5IKMA 3NTXA 4GKVA 4QWWA 3UAXA 3OIDA 1RNLA 3KOYA 3DFFA 1Q1QA 3K4QA 5DTJA 5IKXA 2VJCA 1D2EA 1DUSA 1R6TA 5LOVB 3H1BA 4KIJA 5JH7B 5HIKA 4J3NA 2HFJA 3LSYA 3WWZA 4F1JA 3W5UA 1XZLA 3DT6A 2ZBGA 2B1QA 3MQ4A 4JUAA 2B25A 1FLAA 5BV8A 5ICGA 1OKKA 2JLUA 3IBGA 3NQ41 2FQYA 4NHEA 2YWBA 1F2UA 1Z7GA 3E05A 4B3GA 1YJBA 4JVNA 4N01A 3HYTA 1K8XB 2YZ2A 3IHKA 1OI2A 4TPKA 2OAQ1 2OO3A 5K03A 3UV6A 2OP1A 4LFAB 3G9XA 3SICE 4PPQA 2A1UB 2BD0A 5FO1A 6REQB 1QK3A 3U49A 4B33A 2J3HA 4DR1B 4AECA 5E6SB 1XDDA 2A94A 3QEMA 1EUQA 2ZJ3A 3DNPA 4CTMA 5CNMA 2JLZA 1HZZC 2PGAA 4RPJA 3LCJA 4OUDB 4EFNA 3EASA 1ZS9A 1R37A 2XWJI 5I8ZA 4QQRA 1BJRE 3DC7A 4XIFA 3H7IA 1KAQA 3LQ4A 3U3XA 3RUAA 1PFWA 3UM9A 4KP7A 1N2SA 4URFA 2X0FA 1M3SA 1S2IA 5SYAA 5C7IO 3OJWA 2ZJOA 3AILA 2FLWA 1Z6TA 3LPCA 4HGPA 3UNXA 2XLCA 4EHBA 2GF9A 1AT1A 3VU3A 4N9QA 4LC1A 3RAEC 2PVSA 3V1YA 4E46A 2YVQA 4PS1A 1GFZA 2BMAA 2IUSA 3GPDG 5HUHA 1YR1A 4N0PA 1LBEA 2C9YA 2Q9AA 2O57A 4WKBA 3OZSA 1ZMOA 1W4CA 5KTOA 2VKQA 2J5BA 4OM8A 2VQ3A 4YAIA 4V02A 4JK3A 4AY3A 4AJOA 1LH0A 4CMKA 4Q3KA 4R1SA 4DSAA 1ZGAA 2P2DA 1CSEE 4YIKA 1EFLA 1NTOA 5BVHB 4XJVA 4FM9A 1M2FA 4INOA 3L49A 4MVJE 2GBLC 3N7AA 4PNZA 4WKOA 4Y6OA 4ZN6A 5C1BA 1Z4IA 2X6RA 1QRRA 1XNHA 3DFZA 4Y6QA 4M22A 4QSHA 5D1NA 1N9KA 4KODA 2ADFA 2FQXA 2J3EA 3I23A 2VDPB 3GCGA 3O3CA 3Q98A 4KKXB 5ALJA 3PDJA 4LFBB 5JJIA 4RVFA 1L9XA 1ORDA 3IHLA 1XTVA 5LQAA 4UNIA 1W5SA 4LV8B 4OTZA 5F33A 2R3SA 3CIOA 3R9XB 2HH9A 1SFRA 4Z4CA 1QIHA 3TR5A 4EX7A 4MYHA 3IFSA 4F3RA 4PYJA 1N5IA 1SG0A 1E1QA 1ENYA 1WPGA 5AO9A 1VJTA 3AOGA 2ZSFA 1PYDA 1AZSC 1L5QA 1EWKA 4OD0A 4GBGA 3HRHA 2VO1A 1ZL2A 4NCIA 1XI2A 3HBAA 3OTOB 2A8YA 2WD7B 1ZAKA 3OO1A 1G8JA 3Q8XB 3UJ8A 1PGPA 4RESA 1IZZA 3DWIA 3ZS9A 4TXJA 4AW9A 4G4IA 4LIPD 1VTKA 3LECA 4F5YA 2V98A 1K7FB 1L7NA 2FK8A 1XQYA 2H5EA 2ZJFA 4G24A 4CEHA 3S1SA 1PT5A 2JRLA 1XPJA 3MNFA 3ZWWA 1NA5A 4AUEA 1AM4D 1VP9A 1IZ8A 4AZVA 2HZBA 4C6HA 4WWHA 3KS9A 1BKDR 5KTYA 4YQEA 3ZCPA 1Y9JA 4AJIA 5EWMB 1HT2E 2REOA 1Z63A 1XTRA 3TRDA 4UCWA 4L8GA 3SBDA 2MYNA 3VU9A 2HU7A 4EJ6A 3ZBQA 5BT8A 2A2ZA 1TRKA 3KVRA 3ZNOA 3ETHA 4H7PA 3D7SA 3H19A 2DWPA 4IHJB 2GKGA 1CD5A 1R3DA 3RFUA 1VGVA 5NULA 1G63A 2XDYA 5EIOA 2ZRKA 8ABPA 5C52B 2IYWA 4LX0A 1VIVA 2GESA 5CGZA 3DTYA 1T91A 1L7QA 4L3WA 2O07A 1EDOA 4G0OA 8MHTA 4DY4A 3SIXA 2Q4BA 4B71A 4HZUA 1HURA 5EWLA 3SIRA 1XYYA 3AEKB 1D5WA 4G41A 4Q7EA 3M9LA 3OFKA 1HDCA 1NVVR 3DBHA 3NT5A 1G8KA 2XVXA 3WIEA 5KCMA 1YR8A 1I6LA 4CR7A 4JT2A 4LISA 2HGZA 4TSKA 5TVKA 3KHKA 3OWOA 5JS2A 2JLBA 1OASA 3OCYA 2F1JA 4IX1A 1B8NA 2FY8A 2I65A 2XWQA 4C7MA 4LQLA 1QIKA 2WJJA 4IUDS 2QM3A 1VYVA 5TV2A 1I2CA 3R5KA 5GP1A 2V65A 3CLTC 4BNIA 1WB4A 2WU4A 2Q6IA 1DDGA 3GZNB 4XTCS 3DJYA 3BZBA 2GJAA 2RHTA 3RREA 3S28A 4EG0A 4HDQB 4Q4JA 1ZXBA 3MPUA 3HYRA 1RWKA 1W44A 2XB6A 4O4IF 3WWDA 3IV6A 3R9IA 1XZ8A 3D5EA 3KKOA 2QROA 5KKNB 2Q41A 4BATA 3E1GA 3J7TA 4YMVA 2QN2A 4JAVC 1CDOA 4E2ZA 5JYBA 1ZCZA 4MS3A 2NLOA 1ACLA 5I6DA 5CU7A 5I7FA 2V7QD 1L7RA 4P3NA 3VVLA 5IG2A 3LQ1A 1XTUA 1MA0A 1E60A 3KLPX 4REMA 3I83A 1Z7WA 3H2KA 3OCZA 4ZAWA 5T41A 3V8BA 4CRWB 5FTWA 3ESQA 4P80A 4EY5A 2VJKA 4FTWA 1HE3A 4HNHA 2J7PD 3C98A 4FR2A 5DSXA 4ZEMA 3LNCA 4AU1A 2AMYA 5CA1F 3G2PA 1VGRA 2QE6A 3CTMA 5FUXA 1G1MA 4L78A 5B1IA 2C2ZA 4BMCA 3QLVA 3ICOA 3GLIE 3O8QB 1I3MA 5LZ2A 2HN9A 4AZ3A 3E0XA 2R8EA 3SZMA 2ZIWB 3A0RB 1GUBA 2IITA 1VPLA 4YR9A 1YZYA 1RP1A 3F98A 5ED4A 2IS1A 3VTKA 3OHSX 2ARKA 1P74A 2IEAA 1Y3IA 4XRRA 1NWCA 4OF4A 2ADMA 2I1QA 4AM8A 5JC1A 2WIDA 1QRTA 3RC8A 2O48X 3R5SA 5BXYA 3ZXXA 2E82A 1SPBS 3CX4A 1VP3A 3D0QA 3HK2A 5L3SA 4YCJA 3O8CA 2P77A 3JVIA 1BX1A 3OE7D 2REBA 3HL4A 1JPUA 3MBIA 1OIWA 1QH0A 4MGYR 1FP1D 3AEUB 3ANNA 4HAXA 1VCMA 4KE9A 2AF3C 5KTPA 3BMCA 3HYNA 3KPYA 2W5UA 2IV3A 1T43A 3K1ZA 1E7SA 4LHVA 1ZOLA 4YXWA 4BMZA 2PX2A 3AONB 4DLLA 2JKYA 1LVHA 3CKLA 1IXYA 3P32A 4F2HA 5LDHA 2OGSA 3CW8X 3GRAA 3LUPA 2XUAA 3AI2A 4B6QA 1C9MA 1H65A 4KRFA 3OEHA 2Q7DA 5I4IA 1QH8A 2Z9CA 1OLXB 3RVLA 5DO9A 2XRZA 1ZVMA 1RRMA 2G4VA 1ZJYA 1RYNA 2RK6A 3K8QA 3V55A 3V32A 4FGUA 5F52A 4DVGA 1V1RA 3M6XA 4N18A 3PPVA 1J70A 5AUOB 1CDZA 4KWIA 1TZCA 4X84A 2OGZA 3GJ3A 2O8EA 2IQIA 2WJIA 1KJWA 1XQ9A 2IOFK 2G0TA 2WOOA 2NQ2C 3O26A 5FTNA 2FEMA 5TF4A 1M8JA 2VATA 3ZHTA 4DVJA 1ADGA 1UBCA 4GP9A 4HRYA 4KPUB 2QMUA 2Y77A 3M6MD 1F0PA 3MT0A 2VEDA 4R2JA 4LZPA 4QYIB 3RHSA 4TXNA 4OAOA 2HBYA 1DAIA 3G2IA 4M1ZA 4OA5A 1SKYB 2G07A 1XVLA 1VJ1A 5CT5A 5KB3A 3CVWA 3WX0A 5CA0B 1K06A 2ISCA 2VDWA 5KNCD 5I7SA 3BQMB 1G5PA 5ANRB 1NXVA 1N33B 4EB3A 2I7TA 1V4VA 3GLHB 1FDSA 1QBGA 1RIIA 1S7CA 1TVCA 3CNEA 3N2GB 4P2BA 4WIAA 2ZAIA 5EXPA 4OOFA 3UCFA 1E5TA 3ZH2A 3RG8A 5J4YA 1GCUA 2Z3VA 4HDMB 3QBJA 4DREA 3EBLA 3V8NA 1SBTA 1C7EA 1BMFD 4ZCTA 4R16A 3WYGA 1Y3AA 3FJYA 1YIDA 1NU8A 2QAGC 2QVLA 3NHMA 2WVJA 3W7VA 4AZTA 2AVNA 2AHOA 3DDOA 1SHTX 1PYOA 1U2PA 2BLLA 1UODA 3CEJA 4JSYA 3FBWA 2PT5A 3ZYCA 1DDIA 1JVSA 1Q22A 1Z4JA 5ARBA 4MINA 3S2ZA 2J9XB 1O8CA 3P5BA 3STTA 2ZS8A 5FOXA 3Q1KA 5IAGA 4ZVUA 4RVGA 1EXMA 3F7TA 2PT6A 4Q0MA 2J0UA 1N34B 3A6DA 2IS4A 2SBTA 4N5MA 1IDOA 2HIHA 4MPRA 4QJ4A 1PT8A 3UH1A 1Z5NA 2VUSA 4Q3EA 5JR3A 4I50A 4M89A 1RZUA 3ACDA 3U4HA 4KAFA 1K6XA 4A9AA 1XJCA 2ZYWX 4LMAA 1MG5A 2ACVA 1KH1A 4R9SA 2D1RA 1V2HE 5DHUA 4ARCA 2XMCA 3DL2A 1UP6A 4GOLD 4R0MA 1ENZA 3E3LA 4BKPA 1EGHA 1I7LA 2V0GA 3K6SB 2ABWA 2F7SA 2P65A 4DSZA 2XH8A 4MA5A 1W19A 4H16A 4KQIA 2OR3A 2B1RA 1I01A 2FVXA 3HP7A 2FCRA 3PHGA 4L1KA 3T7IA 3U1TA 5HZHA 3NTVA 1IBSA 3CRZA 3DTTA 1YKGA 4LRYA 3SM3A 3D7RA 1G7TA 3PF9A 1D0VA 4O2RA 1SKYE 1CP3A 2XRMA 2EW2A 4H17A 3IDAA 1XTIA 3ONFA 4YRRA 2GM4A 3AUKA 4G1CA 1FJXA 1MDFA 3IKLA 3ILVA 3U4MA 2PGDA 2HMWA 2ZDGA 2XE4A 5HZMA 1GAXA 3P0IA 2HPZA 5BUQA 1P60A 1GRVA 3CO0S 4GWLA 5BRNA 1C50A 4RANA 3S99A 4OAPA 4IXMA 4XX1A 3AQ4A 1FBNA 2CD7A 2RHJA 1MB9A 1MQ8B 1S01A 3KTFA 1QH1A 1NXSA 4MVJD 1D1QA 1HK7A 1SC9A 4WOCA 5AKZA 2NZXA 3UZUA 3WLEA 4EA8A 2PJRA 4HNUA 2W48A 3GFVA 3GGPA 2QRLA 3FDZB 3PUKA 4JKYA 4DLNA 5TSDA 2FW6A 3H6KA 4G07A 1DARA 1O4WA 1B15A 4ND3A 1ILEA 4FFNA 3V48A 5F12A 4NQRA 4LXHA 2NV6A 1Y6JA 4B7CA 3LBIA 3ORRA 3AY0A 3IDFA 4QREA 1OFUX 1ZFNA 3AM3A 2ZYAA 3DV9A 2R96A 4YT8A 4QWMA 1IY2A 1J56A 2H3HA 2VNSA 2Z1MA 3N8NA 2HEGA 4HLNA 4RMGA 1KO1A 1QAQA 2ZWPA 4KE8A 3KXPA 1MDBA 3TOXA 4X8LA 2F3QA 2WHPB 4H7HA 1NR5A 1DO8A 2P8SA 2XRFA 3DKPA 1Q95A 5KOHA 3ANLA 1B93A 1NUTA 3FNGA 1Z4OA 3IVXA 4B4DA 4JS0A 4KGZA 3UEOA 2QMOA 4KJZA 4PQRA 1NI4B 2WJ3A 3WL4A 3CR8A 4ZKDA 4GMDA 5SY9A 4B8WA 1IHXA 1KVSA 5IUKC 1X9GA 3VOTA 1Z9BA 2QVXX 2Y1FA 2ZR0A 3OPYI 4GQAA 4NJMA 4OSOA 3CONA 1LA2A 3ADOA 3RSLA 1YB1A 4ZI3A 1VYUA 5AM0A 1YGYA 4MB2A 1SVKA 2P1RA 1HE8B 1PZEA 4B3JA 4BTVA 1YZNA 3DPUA 1NZFA 3USZA 2PZGA 2IYRA 4EKIA 1FSZA 1H2HA 4JBGA 3WLTA 1DJLA 3THXB 4P36A 3BTSA 2JK1A 4QVIA 1VIMA 1QLWA 4DWOA 1SBCA 2AN3A 1ZN9A 2XAAA 2YFHA 3HWWA 3LFTA 1T9ZA 4RTOA 4C9BA 1WDWB 1S4QA 1T2VA 2VH2A 5H4GA 2RC6A 3Q7TA 1EFTA 2J5RA 3HCNA 4D9KA 1H3EA 4RZHA 1J25A 1TO6A 1UFVA 2OESA 2KI5A 3RIHA 3TTUA 4RVDA 1NBEA 3EPRA 2H06A 4OXQA 4OYLA 2OXRA 4CN8A 3QA3E 4EHHA 1AX9A 4ZAXA 4CCYA 1MN6A 4UNQA 4KOAA 1HLPA 4GMFA 4O4HF 1IN7A 4YGXB 1KMCA 3CZRA 5FEMA 1F8FA 3CM0A 3IQWA 5LP6B 1E62A 4TXHA 4OSPA 3IS3A 2NU8B 3ZW8A 3ROTA 2X22A 4AP5A 5JQGF 2R8RA 1W4LA 4K6CA 2W6PA 3CH4B 2AX3A 4FYYA 3MELA 2AFVA 4DBZA 4X6LA 2R8XA 5T4BA 1PP4A 4KNYA 3EISA 2RGWA 1NUSA 1TUBB 1Y5MA 4LXIA 3AI1A 1I4OA 4NLLA 3A05A 4J7UA 1KQFA 1D6MA 2XVZA 3EIFA 4QQ8A 1H2XA 1GZ4A 5CLGA 3M6LA 2HMAA 5AHRA 1SCIA 1TTPB 2CL5A 5FA6A 3RVSA 1TU0A 2B7LA 4O4LA 4CEIB 3P26A 3C1TA 4FE3A 5BN4A 2VBCA 1Q1EA 2H1CA 5BORA 4E2WA 1KRXA 5FF9A 3ZWBA 3ABIA 1TT5A 4ZU1X 4XYLA 4IHAA 4OYYA 1AKYA 3QW4B 3HKDB 4GICA 1OH5A 4GKJB 4KQXA 1EVYA 3AIMA 2R48A 3FZNA 2EQBA 2I8LA 1VJ5A 1WUYA 4ETWA 1NOJA 3HKEB 3OLCX 2QRUA 4BNGA 1K0UA 1XCJA 1WZCA 1C8BA 1Z2OX 4GSKA 3JD2A 4H7IA 4PAMA 4W63A 4D4GA 4MV3A 5JAZA 3IEMA 4V0RA 3I0MA 2Y6VA 4HLUC 1AKNA 4MV8A 4YPFA 4NPCA 1DP4A 2PQ0A 1PDWA 1OXBB 1IN6A 2ONCA 4R40A 4ZAYA 3WWCA 5IULC 4EGJA 2FPGA 2AQIA 1BN6A 3BOSA 5LR6A 4IIYA 2PT7A 3W2GA 1O0SA 2BF7A 3VR6H 5KWEA 3OECA 2BJVA 2G0NA 4IIJB 4AJHA 2WVHA 1M7GA 3U17A 3P0JA 2F1HA 5DGXA 1B42A 3VYSB 5EIBC 2P6OA 2XUHA 2ZTMA 4K9QA 4GLOA 1GUYA 3ILXA 4KQKA 3LHKA 1WU7A 1C1HA 5D3ZA 1YS2X 4YAWA 1JLMA 1L8XA 3I2KA 2EATA 3AP3A 4HXEB 4JGGA 1JYFA 3JASA 1CIPA 1EUDA 1EM8A 1V47A 3OSUA 1T5IA 4BLTA 3BE6A 4H3HB 4IQ8A 2W2XA 3RYFB 3EA4A 3V1KA 4K26A 2J3MA 2YZNA 1T4CB 3OUZA 3CSDA 4HLQB 1RYDA 2QQGA 5HJEA 2YV4A 2IFTA 1LK5A 4ABYA 1UJ2A 4A82A 3CW9A 1UT6A 4M8LA 3TKAA 2HIAA 1E99A 2D1QA 4NESA 1ZQ1A 4M21A 5F5NA 2X9GA 3MGBA 3PWSA 4FGLA 1O77A 4QE3A 3W3AD 3PDCA 3DMTC 2RHBA 3KJIA 4KUHA 1UFOA 4GVLA 4MWDA 5FAXA 2D0OB 2IE8A 3EIOA 4REOA 1OHHA 1DWUA 3OOSA 3VZCA 5TR9A 1BH6A 4CMGA 3ZHQA 4CMBA 5CCEA 5M34A 4LZNA 2VTBA 3QKUA 1UPAA 2PUEA 1WXWA 4PV7A 4A8JC 1XXLA 3HJHA 4HTAA 1IHYA 4L8YA 5LN1A 1E2GA 2PFSA 1LDMA 4NDZA 1DI0A 1PR6A 4G5XA 4AVYA 1N6PA 5CM9C 1J42A 1U2GA 2OG2A 4YAEA 1ZGZA 2QQFA 4PN7A 3R3WA 1BOOA 4LZWA 4A0GA 3WKBA 4OLJA 4IWYA 4X44A 4PHGA 4WBSA 1AUPA 2W9XA 3GNSA 4GRIA 4MCJA 1NAIA 1DB3A 1H2AS 3I0ZA 5ITSA 3GLGB 4DV5B 4EYKA 3H8SA 1M6NA 4L95C 1ZUD1 1UF9A 1P0PA 3QE3A 3V1MA 2OXCA 4ZHSA 3FRIA 1HBJA 1TL7C 3M83A 3N8HA 3AY3A 5CXQA 3UOGA 1YMUA 3DMRA 1LDGA 2D2FA 1TXGA 2XIJA 3BWVA 1N7IA 4RV4A 4YAFA 4B4OA 3BMNA 1O03A 1E7QA 1XAGA 2ZQ5A 2IX3A 2FZLA 1I4EB 2XOKA 3DT9A 3LOQA 4P35A 2H1IA 1J0XO 2XPCA 3BXGA 3H1TA 4LC0A 2PQ6A 4XDHA 3UJCA 1K6EA 2SHKA 4DMUB 3IMKA 4E51A 4UVDA 1ISHA 2A67A 3H16A 4UEJA 4ZOBA 4LNUB 1W93A 1HQYE 3Q9SA 4FMDF 3NYIA 1KAMA 3A1CA 4Z9XA 4PYMA 1VE7A 4L08A 3TPFA 2VXCA 1XU4A 4A23A 4RTMA 1MENA 4PZ0A 1UC4B 2YWCA 5HIJA 3T9DA 1FC0A 1T9AA 2V74B 3FMVA 3ICWA 5HM8A 4D25A 1ORIA 2M9MA 3AJ8A 2ZYIA 3QG1A 1Y7TA 3QLJA 5U4QA 5HQ3B 2OHHA 3V6MA 1UOQA 3ZH9B 4NYIR 3OPQA 2CZCA 2Z2KA 5CX4A 2B8TA 2X3UA 4CV3A 4OI4A 3DBLA 2JFGA 3IULA 2UZIR 4F7WA 3W90A 1A8SA 1C3OA 2IU0A 4CM9A 4KO1S 1C4OA 3JVVA 4KN6A 4CM6A 5CX1A 1FLNA 2GXQA 4V0MA 4D8XA 2YVUA 2XE8A 4Q24A 3LCRA 5TT1A 4U7HA 4IJ5A 5DGIA 1E5QA 5HSGA 1ISMA 5K8TA 4C6TB 4EPVA 5J5VA 2PY6A 2PN1A 3QQ5A 4DBVO 2W6MA 4Y2QA 1PTJC 2X7XA 4HNRA 4JHXA 1GWNA 4CT4B 5B3JC 5J2TB 4MULA 2QI9C 1HUQA 2AKAB 2IHBA 2O8FA 2Z4RA 4W8GA 4B7AA 3THWA 1G5IA 2R7NA 3L1JA 4N0QA 3ZGXA 3OC0A 3GVPA 4TLMB 3IOBA 4AMYA 1OB2A 5LKAA 1LB1B 2FZVA 4X62B 2P2NA 2JHPA 3MZ0A 4ND7A 3ZV5A 5CVJA 4O2BA 1RABA 1HR0B 1TMOA 5FP0A 4ZOLB 1CUGA 1UPBA 3QX3A 3ST7A 4NZNA 5JIBA 5DBOA 4PG5A 5K3FA 4F38A 4ZV7A 2ZSHA 3W4JA 4RO0A 1QZXA 2NTNA 2EFEB 4FYHA 1P9WA 4RBNA 2SKEA 2IP2A 3KKMA 3GNLA 4C4OA 4HQFA 4RLSA 2X8LA 3OKCA 1JAIA 5G0WA 1ZH4A 2NVUB 5BWOA 3TLEA 1WNFA 2IA5A 1OYOA 1D1TA 2VSNA 1A82A 1HLGA 3HJCA 1MZVA 3NGLA 3PFKA 5LBTA 3ZE2B 3WWPA 1N1EA 1CZUA 1NMZA 5LBUA 1RLIA 1NNLA 1I2DA 2XNJA 4OGWA 2VJBA 4ZYVA 4LMRA 5GPBA 3TIFA 1QVWA 2PDAA 4C4TA 2QRVB 3KRTA 2OHXA 3NHZA 3VH2A 3LWDA 4GPEA 5B7GA 4PSVA 5KNDH 5ESRA 4AX8A 1TO2E 3CA8A 2VDLB 3LXMA 2AXEA 4G26A 3SE0A 4BWYA 4V0LA 3H5TA 4MYRA 3SAJA 2MSNA 3CWZA 4I6EA 4YTEA 3JWJA 4QUAA 4Z1MA 1IJEA 4OA8A 1NNUA 1O9BA 1RVV1 2PS3A 4UHCA 2VUIB 1Z5ZA 2YFYA 5JXIA 3PRKE 3OE4A 4ZAGA 5KNBD 3I34X 2ACKA 5HWSA 2FUKA 1B6RA 3CH5A 2FFRA 3FCOA 5EMLA 1DCFA 4YMSA 4OEHA 4OGFA 4R5HA 3RB8A 1Z83A 1T5OA 3ZU6A 1FTSA 3NRJA 5ADUS 1DEXA 3CB2A 1GADO 2PX5A 3T94A 1C2TA 3GL9A 2GEUA 3WLNA 2QNIA 1QX3A 4IFTA 5AW2A 4C4AA 5IM5A 4BL5A 4ZIRB 1UBJS 2DPXA 1PKXA 4X71A 4EUKA 3ETDA 5D01A 3ZE8A 1DEOA 4YRPA 2PMCA 1OLUB 5K8UA 3ZQKA 1XEWY 1J8YF 3QTBA 3KSUA 2QIPA 3N3AC 4IUYA 4D4IA 3N07A 3QOYA 5AI6A 5A2QA 1H0SA 3C2QA 2NU7B 2YIDA 3A14A 2QU8A 3W2IA 1XTKA 4MV9A 3VH3A 5CEFA 5DLPA 1U5CA 3JVUA 3WQQA 2G04A 1KEZA 1LI4A 1KMNA 1CHDA 3C97A 3DKRA 2Q4EA 2BFCB 4IGIA 1II8A 1VL8A 1MC1A 4E2FA 4OATA 2WU0A 3COVA 3O5AA 3OIYA 2L17A 5F98A 2IP1A 4KG7A 5A06A 2O8DA 4P98A 5DI3A 1H2YA 1MIHA 2C82A 2IVFA 2UUCB 3K0AB 4ENWA 1Q92A 3H9EO 4FFMA 4XPIA 1D9XA 2YN2A 1KFKB 4W1QA 4L75A 5AQEA 5F51A 2CLEB 2Q99A 5FOWA 1F5SA 2A59A 3MTEA 3ZE9A 1TLFA 1PJ3A 1D3AA 4NYMR 3UT0A 3EBOA 4M0DA 1R5NA 2MR6A 1ND5A 1KMHA 4FU0A 1TAHA 1VBKA 3GELA 3N0VA 3KOXA 3VDRA 4YRIA 2HW8A 2XGGA 5GY7A 5TB5A 5JAHA 4HR7A 4Q16A 4WNYA 3I5MA 2N1BA 3IHWA 2XZPA 2A84A 2YNMA 3FLAA 1QDLB 4DG5A 1XPUA 3FHLA 5K6TA 4DZRA 1Y3BE 2GPBA 3JU3A 4R83A 4IKOA 5ALVA 1ZLYA 3SSAA 2GK3A 2YRXA 4DQXA 1YFLA 3LY7A 3OD1A 2NG1A 5A4MS 3C6MA 3TX6A 4EABA 4HVCA 2J6IA 3BRSA 3TIVA 4WNAA 1JT9A 3KYDB 2AI3A 1KZ4A 4LZJA 4URYR 4HPXB 121PA 1FZTA 5ELMA 2VWPA 4ZARA 3FCCA 4EYSA 4AZWA 4ND8B 3N28A 1PYGA 2QYSA 4URUR 3VTZA 3I76A 4IICA 1AC5A 3DMYA 4XD7A 1DBVO 4X0EA 2HWWA 2VP2A 3WJ2A 4RY8A 1J23A 1N9GB 2ACEA 2HXGA 4HX2A 4Y6PA 1J06A 8LDHA 2OFXA 4XDZA 4R3WA 1E3WA 5A9RA 5IJZA 5CT4A 1Y4SA 1C7ZA 4ARUA 2X1LA 1G5RA 1NYTA 2J45A 1YNSA 2RHGB 4KLCA 4Q12A 3VNVA 1S1CA 3CEAA 4M2LA 1RXVA 4LJAA 1O95C 3HB1A 4BNXA 3KZVA 1CUYA 3EOZA 4OFWA 4HTFA 1ZI8A 1WXEA 1ACJA 4FFBB 2C31A 4TL7A 4F4DA 2YOFA 3R3SA 1WDLA 4MR8A 2JLCA 1FTYA 1VCIA 4HAYA 1TK9A 5KBYA 4ZJPA 2VDUE 3O91A 4ZVMA 4YV0A 1S3IA 1SUWA 4EB8A 4YX9A 1IXZA 4P7BA 3U31A 4OHFA 2B5WA 1GYPA 3MPOA 1TVEA 4F0JA 1I4LD 2DECA 3II6X 3WIBA 5JAUA 2G63A 2PV7A 4UOZA 5IJ0B 4KXYA 2FSUA 3OQHA 4CM5A 1J0DA 1BWQA 2R1TB 4B2IA 1GUFA 3OQOA 4S1PA 1KDVA 1A5BB 4MUEA 3M6VA 1NQUA 1TQ6A 2PH3A 5JO9A 4CVNA 4NFHA 1Z12A 5FTLA 2D13A 3ODPA 2CMHA 1YNOA 2VXYA 3EY4A 1DT3A 3KUUA 4U2KA 3RC3A 1JEOA 1R2QA 2A9RA 2OZEA 2B1JA 4LF9B 2FPIB 1YDMA 1VMAA 4MAFA 2YZ7A 1SHUX 1OBFO 2VPIA 3O31A 4TLCA 2C83A 1JQLB 1OFHA 4GNRA 2HB6A 1MABA 2JH3A 3IEPA 3L84A 1EXWA 4E1AA 2O4CA 1RQGA 2OBBA 2VOEA 2VNHA 3G0OA 1BN7A 4FEGA 3TRFA 2O59A 3G0IA 2W8BA 3RRMA 1B6SA 2QENA 5B36A 1UBTS 2F43A 3E0QA 4D9CA 3E9MA 4ZYWA 3S81A 4P58A 2WF8A 4UNNA 3WFZA 2QB5A 2IHTA 1D7AA 1XMVA 5E9JA 1DC3A 3NDBB 3JALB 4TZ6A 5FIUA 1N5MA 1YJ8A 3HFRA 3PYXA 5DVZA 5F76A 1U3GA 2GXSA 2ZB2A 4Q00A 3CU5A 3HUFA 4B0OA 2C7RA 2ZB3A 4MYSA 2FG7C 1MV5A 1SVOA 4NATA 2NU6B 5KJ1A 3AK4A 1SQFA 1VL5A 1NMXA 5A7HA 1NN5A 3L93A 2OZLB 5LNK6 5EP4A 3QVJA 2ZJ2A 4FHGA 3FM9A 2P90A 1QIJA 4EUSA 1E92A 2ZAMA 4ZI2A 1E2MA 3JAKA 3JVDA 4N3CA 4S1NA 5FCDA 2FP4A 3BXZA 4M8NE 4PQFA 3MTDA 3GK3A 4YP5A 3HN2A 5B7PA 2OV2A 2XQIA 3LL4A 4MUHA 5J5CA 4N0MA 5CBKA 4MEBA 3HB7A 1PFVA 1CETA 1QHHB 2XBLA 4IS2A 2Q2QA 4RE5A 3UANA 3WMXA 3WLKX 4AKIA 3PXUA 3NAMA 5F4ZA 1F51E 1EBUA 1MRNA 1RWVA 5AW3A 3A1DA 5CW1A 4DBLE 3BSYA 1P61B 2PZLA 4P4NA 4R01A 1VL0A 5T4FA 3SSMA 1O97D 4F72A 3X1JA 3BA6A 1DJNA 1TQHA 2DG2A 1G60A 2PFKA 4HYTA 4IDQA 1TIPA 3G5AA 4RHXA 2Q5OA 3VXKA 3RS8A 4ZCRA 2ZSUA 2I1VB 3D31A 3OOWA 2V7WA 2JD0A 1V4BA 1SCKA 3VZQA 3PUVA 3Q7SA 1JQEA 3DO8A 3HG7A 4J4TA 3E58A 3JD0A 1XCLA 3Q3CA 4UXIA 4RTSA 3HV2A 1JA9A 1ZNXA 5H3LA 4Z54A 2JK0A 1BMQA 3UXMA 1EKXA 1XR3A 3D3NA 1AHPA 2JEOA 2I03A 2QAIA 1V5EA 1B23P 4D1YA 3MJCA 1T3HA 1WHTB 3CW2A 1AKEA 1JLLA 3IMFA 2ROQA 2DWUA 5EZYF 1KIAA 4I4TF 4LBWA 4MGKR 2QHXA 3LBAA 5BVGA 1SEPA 2JBAA 4JP3A 5KYUA 3GVIA 3Q5EA 4C5BA 2D4HA 4GSYA 3D6HA 3U62A 5KQLA 4QT0A 3MOGA 3SHOA 1H3NA 1YFJA 2PPVA 1K7EB 1T1RA 2YFKA 3O84A 1VPEA 3F7MA 2APJA 2G5CA 4JEHA 3QBEA 4YCMA 4CL3A 1UKYA 4KQGA 2BWJA 2ZXUA 5J4VA 1PV1A 3UO8B 2K7FA 4J2TA 5LZ4A 3T5PA 2BBOA 2PYIA 1A8PA 3JRXA 1JKJB 4PG7A 2IY8A 1I7QB 1WV0A 2ZS9A 3KYCA 4PLYA 4BFSA 2QLLA 3B36A 3IPXA 2JG3A 2KHZA 3IQEA 4QHTA 1U7WA 4UDOA 5BT9A 1ZGCA 2A86A 2HCFA 3CRMA 4JI5B 1BHQ1 2VSXA 4B3IA 1HT1E 4URZR 2X8JA 3W5SA 1JWLA 5IAOA 3EAQA 2H65A 1C3LA 2RBEA 5DTQA 1W96A 1DRUA 1IFXA 1QO0A 2C2HA 1CZOA 2ECKA 2J9ZB 5EIAA 3ZJUA 5CAEA 3PWTA 3D43A 3AESA 3RASA 4Z53A 4RDIA 3VVBA 3KSBC 3COWA 3FHCB 5K99A 1M34B 2NXCA 3DEHA 2I2FA 3H5WA 2FWPA 1M5TA 5B1SA 3V4SA 4BEJA 3ZPXA 5IHXA 1E2HA 4GOND 3FBTA 1CF9A 1C9JA 1M2GA 3DH0A 4PG6A 3I2IA 4AO7A 4U2FA 2FPOA 1NJSA 2DEUA 4ZCPA 2P2SA 4JOBA 1ST3A 1EJ2A 4CLRB 3AEXA 5JFGA 2ZZMA 3HUDA 3RAGA 3ZJ5A 2Q5IA 2NVWA 2WSMA 4ILEA 4KWCA 4BS9A 1A3CA 2JAWA 3EAGA 3OLXA 1IVSA 3BD6A 3ZDBA 2VP0A 5AVRA 1WQ1R 3GD5A 3JD1A 5MFPA 2JFVA 2CMGA 2Y76A 3L6BA 1PD0A 5K09A 1WG8A 5JV5A 2I1WA 4BLSA 1U0GA 3I3OA 3D7LA 5A5VA 5HM6A 1AGYA 1ZRSA 1T3LA 1QMPA 2OG1A 3AF5A 3IUPA 1E64A 1U9YA 1Y3CE 3IRUA 2O5VA 5ALPA 4KREA 1YIOA 3GMIA 1N7GA 2QUIA 3TLGB 2IEGA 3TD9A 2HV9A 2ZUTA 5FWNA 3G7UA 1H9AA 2B2CA 2RI0A 3KCQA 3M7IA 1JLHA 1C30A 3CNLA 2IZ7A 3PIRA 3PGA1 4QUIA 4U9IS 3NYWA 4NENB 4TV8F 3PC7A 3R20A 3H99A 8GPBA 1S2LA 1AHNA 3BD7A 1UMKA 4A8JA 1OGYA 2YDYA 1GTZA 4Q9IA 4MUFA 3SVLA 4DLVA 2PKQP 4A3SA 1W9HA 3CRVA 4TQUS 5DHTA 3TOCA 4K28A 3BCHA 1B73A 4KQEA 2B98A 1SHJA 3K70D 3UUGA 5JROA 4ZQGA 1M34E 5LZ7A 5JZ9A 5HTKA 3P94A 4WADA 1HGXA 5KHAA 3QV1A 3H0EA 3DKKA 3G5LA 2F4NA 1IQPA 1H6AA 4KLZA 1PO7A 1NAHA 1T5HX 2ZE7A 3VNAA 5K9ZA 4RZ2A 2FVYA 2JGFA 4K9PA 3CURA 2V3VA 1P29A 3WNDA 3FTEA 1FU7A 2QF7A 1SKBA 1PIWA 2ZYUX 3GRVA 4KVGA 3FCSB 1N8SA 2Q5EA 4J0FA 4X5OA 1J8QA 3OAAA 2IXFA 2UDPA 2OBYA 3PEYA 3S5JA 1F2UB 1QGAA 2PA3A 5KINB 2RGCA 4MITA 1ADBA 5EIWA 1CTQA 4KBYA 4BEVA 5K0GA 1U0EA 3FNQA 4HQKA 2ZRLA 1UH5A 3LHIA 2JAUA 4DEXA 2PCLA 4RH0A 3TW4A 1QG2A 1E4VA 4BFLA 4LOJA 2D3WA 4ZHQF 1NM5C 4HDRA 2WJAA 3QEMB 4LCEA 4QUKA 5FPKA 4H15A 3GYBA 1J2RA 1JDBB 3Q7IA 1RAHA 5TJ9A 5BN5A 4YRZA 1P2SA 2DQSA 3PHLA 1Y4AE 2QQ0A 2XCIA 3FVWA 4F4HA 3V2UA 1SU8A 1FB5A 4UEOA 1O08A 2P30A 3R9KA 1ZNQO 1ODCA 1FEZA 4D3FA 2NT4A 3OE5A 4YBRA 5K0BA 4M88A 4GR9A 3VC3A 4N5IX 1VI6A 5F5XA 2I4NA 3I73A 2XYVA 2XOEA 1W1IA 4E09A 4QVKA 1DAKA 4WK4B 2G9VA 1O9GA 3S29A 4WZAB 4M8KA 2DWOA 2CLCX 3ED1A 3ZLVA 1DO2A 1FUEA 3H83A 2V3CC 5ALSA 1KQ3A 2H5JA 3SYMA 5KDOA 4BO9A 5HK9A 1MJFA 1U1IA 1RKUA 1W87A 2IYPA 1DFIA 1I3OA 4CIDA 5AKYA 5JC8A 3WDMA 1N75A 1IBRA 2EP5A 3VR4H 2EKZA 3CBQA 1LEHA 1QOPB 4G5QA 1GTG1 2V03A 3CF2A 3I9JA 4PLFA 4BCBA 3NHLA 4P4TA 1SB8A 3ZJTA 2J0QA 4BJ5A 2ZIVB 3ETGA 5BWCA 4D98A 1ZEMA 1M75A 1QCDA 1L2TA 3O75A 4HG2A 4F9FA 3PPYA 1VXRA 1JXQA 1JEAA 2A5FA 4IV5A 2SECE 4ZOAA 2E85A 2HXSA 4ZCLA 3IESA 3D3KA 5DBGA 2PWPA 4XIYA 5G3ZA 5KWSA 5DXFA 2VAWA 4NOMA 1W4ZA 4Q3CA 4ZVKA 2FUEA 2QDXA 5DM1A 4RZUA 1D2MA 2LKCA 4YQYA 1L5HA 3U7GA 3JS5A 3O73A 5JSUA 1GQSA 2DRIA 3KCNA 4PF1A 2YC4C 2ZUCA 1QIFA 3GUVA 1MRZA 5C7LO 4RCYA 2BEWB 3MWFA 4KR6A 3BSWA 3LGAA 3W5HA 1SG6A 3IOEA 1JEYB 1LBHA 3R0VA 2Q8NA 5BYJA 2B4AA 4CEJB 3WQHA 4J0IA 2PMDA 2RAVA 2GAAA 2ZTLA 3JWPA 4D9GA 2QVCA 1I9CA 4ENTA 1CUDA 4PC6A 5A3QA 2OYRA 1KORA 4COKA 4A1FA 2WD9A 3CT4A 4EFDA 1AS0A 3A2KA 1WP4A 4F6RA 5CDUA 3DYBA 4Q4HA 4IXTA 4WZAE 2PSDA 5DHPA 1GKUB 4KRYA 4PZAA 1XKQA 1NNI1 4FSXA 5H3CA 4GXRA 5ALOA 1EDDA 1GARA 3BIWA 3VU9B 4OXIA 1U0NA 1EWRA 4RPGA 5ILQA 2UYYA 1DMSA 1F2TA 1QQ6A 3PQ2A 4K86A 5F2NA 5FV4A 3OY7A 1GY8A 2OCIA 3OJ0A 5FHQA 5EN4A 4C21A 3T1YB 4W9RA 4ALIA 4QDXA 4YEDA 4DDVA 3HU3A 4Y9RA 4BMXA 1T10A 4DHWA 1TLLA 1MW8X 1RBQA 5DBFA 1AXRA 1QYRA 4RJ2A 5TT0A 4AJ2A 3PBKA 3HBMA 1JGTA 1GZVA 1XEXA 3AB7A 4O4IA 4M0KA 3LX8A 1E61A 3T15A 1KO4A 1NOIA 2X13A 1M7HA 3QKSB 4YRBA 1PKEA 1JR2A 3ROZA 4BOYA 2WB2A 3Q40A 1GL9B 2ZVDA 3DBHB 3L6EA 3TH5A 1VHJA 4TLEA 2BFFA 2WU1A 1JMVA 5DNWA 2VUUA 2RKBA 4UD6A 5FKJA 1HF3A 4L74A 1DC5A 5C34B 1SO8A 3ICVA 4YS6A