2EVWX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with r-caged gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
molecule tags Signaling protein
source organism Homo sapiens
publication title A newly designed microspectrofluorometer for kinetic studies on protein crystals in combination with x-ray diffraction.
pubmed doi rcsb
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2evwX00
2Q9BA 2J0VA 2O8DA 4LHYA 4US1R 4LJAA 1KSJA 4CGZA 3SHFA 4JBYA 1Q3TA 3MJRA 5C4MA 1E9DA 4IOKA 4DCVA 2GILA 1COWA 2ONKA 2WJGA 1R6BX 2P5TB 3LD9A 4TMXA 4GZMA 1OKKD 4LJ4A 2QN6A 1JJ7A 3LO5A 3WYAA 5L3VA 5M04A 5HPYB 5SZKB 1WE2A 4JBXA 1Y63A 4IXNA 4LBVA 1QHXA 3SI7A 1CIPA 1OXSC 1QHHB 1KO7A 3PENA 4Z8YA 4QJ4A 4G5QA 3KJGA 2ZVQX 3JZMA 5JHHB 3BFXA 1KSHA 1YRAA 4RZ3A 3WP0A 1X1RA 1E2DA 2G6BA 3LAWA 3EARA 2YKGA 1CRPA 1DS6A 4LPKA 3KB2A 1TX4B 3VKWA 1W4RA 3W5IA 2V6IA 3ZIAA 4EJSC 4UXIA 4GI7A 3U60B 2ZS7A 4B33A 3HWSA 2W6JD 3I5XA 4GPTA 4O0MA 4ON9A 2P6RA 5CLQA 4D4KA 1M7GA 4HB2A 2IA5A 2ERXA 5D3MA 2PL3A 1P75A 4GP7A 4RSGA 2GEVA 2ASEA 1HTWA 3NIBA 2WIAA 3T12A 1QVRA 1YZKA 2NO1A 4Q1CA 2R6GA 2F9MA 2YYZA 3LBHA 3GEIA 4DDVA 2JA1A 1FX0A 1UDWA 2QEQA 4LJ8A 2J41A 4ZV4A 5FPTA 5KNDA 4EIWA 1XPRA 3SC3A 1JAHA 2HDNB 4LPSA 1CJUC 4FMCB 1VTKA 4YMSA 1IN5A 3QXHA 5CK5A 5CM9C 1J70A 4DKXA 1KIMA 3BJIC 3DKVA 2AFIE 4TN1A 4A0GA 3RC8A 1OE0A 3MAAC 2GETA 5J40A 1W44A 5FOXA 4IFBA 3J81k 3EG5A 4HB3A 4LCBA 4RY2A 2UVQA 2QAGC 1OSNA 2FH5B 2JGNA 1KMHB 3KKNA 2ONJA 4UJ5A 1HQYE 2D7DA 4B47A 1VYVA 2AK2A 1N6PA 3GJ4A 5K8UA 4PSKA 4TYWA 1D2NA 2FF7A 5JMTA 1GZSA 1U90A 4ITRC 3W9YA 4NCHA 3P4YA 1Z0DA 2ZRCA 4NP6A 4PPNA 4F91B 2QRNA 2BKUA 2NZJA 3AF2A 1E2MA 4XOIA 3TSZA 5JWHA 1ZNYA 2KWIA 3BORA 3AF3A 1A4RA 1QHGA 3E2IA 3SJBA 4BEBA 2XSZD 4LHXA 1UF9A 3S1AA 5TV2A 1KI6A 4A92A 5J4VA 1X8KA 3K09C 1U9IA 4G1UC 3QNUA 1JR3A 5EP3A 4DZZA 4EQ6A 4QC2A 1IAQA 4AY2A 1XCPA 2YHSA 2PLFA 2C5LA 1W7AA 3H86A 2ZI3A 4CF7A 4Z54A 1NVWQ 1TF5A 4JVMA 4B3DA 2IS2A 3B1VA 4MGIR 2CLDX 3HU1A 5F98A 2IS4A 3CZPA 3SEAA 2K5UA 2Q9AA 1SXJB 2AKYA 3IGFA 3SR0A 1GILA 3ZVMA 1S1CA 1OW3B 4F4JA 5IHPA 4DSTA 3KQLA 4LSGA 3KQNA 5CIWA 1XEWX 4U00A 3KFXA 4NCJA 4Q4JA 4QBGB 1CR1A 3GLHB 4X8HA 3RWMB 4D6PA 4OQLA 1NN0A 1Z0AA 1GRNA 3NBXX 1JNYA 3ASZA 5LB2A 1TMKA 3AVVA 3NEJA 3ZZUA 3CRVA 1YQTA 1VCOA 1UPTA 4GDFA 1XJ0A 2XTNA 1KGDA 2XX3A 3NBYC 4LOAA 2CJWB 2BHRA 4OHZA 3QKSB 5CITA 2JLQA 3MJHA 2O8CB 1U9IC 4A6PA 1NKSA 4FMDF 3NKVA 1V5WA 1XP8A 4BFSA 4Q4JB 2YJTD 1UFQA 3KKQA 3KZ1E 1YE8A 4NDZA 5AUQA 1S1MA 4URXR 4C0JA 4QHTA 3DO6A 1P6XA 2O8BB 3TAUA 1VIYA 1WDTA 3WXMA 4PANA 1ZNXA 4C30A 5A5GA 2VF8A 1K5GA 1RFLA 4B44A 2OV2A 1RRCA 4QM7A 4G3XA 1I4DD 4B71A 4BZXA 1GKUB 3OHMA 4TMTA 2ZJ8A 3TR5A 4FMCF 5KSYA 1VPLA 1ZM7A 4ZCMA 4RD0A 2YNMA 3CF6R 3HR7A 5L3QA 3THWA 2KSQA 2QUZA 2PZEA 4PQRA 4V0NA 3TSWA 3QI2A 1G3QA 4CEIA 1BYIA 2ZJ2A 3GLIB 1CR2A 4BLSA 2FN4A 4DLVA 2IEZA 4AG6A 3TQCA 1SVIA 3W8RA 2DFTA 4C2UA 4KITB 1E2HA 3TGPA 4L4UA 4LHVA 4OI1A 2BMDA 3B6EA 1YRBA 5J47A 3K70D 1VYTA 3Q5DA 1K6MA 1EFHA 4PC7A 3UWOA 2IK8A 5FL7D 3SDZA 3SYNA 5CJPA 5DI3B 1XTIA 2GEUA 2ZITA 1E1QD 3NC1C 1ZCBA 1XJQA 1HUQA 1WRBA 4ZDKA 3IKJA 1KO8A 2ZI6A 2RAPA 1VHTA 2AD1A 4C7OA 2FFAA 3W34A 1JAIA 1ZCAA 2F1RA 3THYB 1SHZA 1KK0A 2ZE8A 1LF0A 1M1YE 4IDPA 2EFHB 4J0QA 3HU2A 5C1BA 4NYMQ 3AVWA 1I2DA 2GBLA 4RFSA 2ZE7A 121PA 2E9SA 1F6BA 2QMUA 2BMJA 3TRFA 5JHGB 3UMFA 1KNXA 1T3LA 3CO5A 4ILEA 2WJJA 4C0KA 3R8CA 3WRXC 2ZRLA 3P1JA 4YMWA 3ETLA 2W2TA 2WZQA 3Q7PA 1S0UA 4JKYA 4QM6A 1TU3A 5AJVB 1TF2A 4JL6A 4QNRA 1L8QA 1Z6TA 4WXPA 4DUGD 4PC1A 1OB2A 1COWD 1N0WA 5H70A 4MITA 1SKQA 3L8ZA 1RC8A 3EC1A 1JR3E 4KODA 2AN9A 3I8XA 2ZR7A 3UKDA 4ZI3A 4EPVA 2DB3A 5JZVA 3K8YA 4GFDA 4FCWA 4KYUA 3TE6A 1GUAA 4BLRA 4EPWA 4R2HA 2Z4SA 2V1XA 5FPSA 4AIIA 2DPXA 2DHRA 3R9WA 2ZSAA 5TMPA 1TNDA 3CZQA 1AK2A 1Z0KA 2A9KA 2OT3B 2JASA 4RD3A 5CYPA 1UKVY 3GJ6A 1N6IA 3EWSA 2CLSA 5JCZA 2QGZA 1OFTA 3BD9A 2IXFA 3MWKA 3MLEA 1GNPA 1OB5A 4Q03A 4EFLA 3O8BA 3OFND 4HZUB 5JI3E 2H7VA 4HLUA 2VQSA 3U3OA 3H1TA 4A4DA 4F4CA 4TLBA 4B3GA 2PEYA 3R9IA 2WMNB 4A0HA 1IN8A 4DLXA 1R5BA 1IXZA 2RHMA 2VF7A 2FGJA 2V55B 4EJSA 3I61A 3QKSA 2IUUA 2FEOA 3WBKA 1GFIA 4PSVA 3SS8A 2GESA 3U6BA 4QHYA 3NHAA 3KUDA 1W5SA 4OHXA 2JLVA 1MO5A 4WW0A 1E1RD 4A82A 2OILA 2QT0A 3IBYA 2CVFA 3DKPA 4W5HA 1X1SA 3CPHA 4V0ME 5TXGA 3RS0A 4BLOA 2WSMA 4LDJA 1ZC3A 2V7QA 4NCKA 2H57A 2QSYA 3K0FA 5H68A 1ONBA 3RSOA 2J0UA 1F2UA 1U94A 2RGXA 2ZE5A 3BB3A 2X19A 4TZ6A 2C03A 4DLWA 1N6RA 2MSDB 3U7HB 2G77B 4Q7KA 3SJZA 2JLYA 4XSHA 4TTRA 2ZI9A 2ZR9A 1TQDA 3MWLA 1S8FA 1YU9A 2ODWA 3W3ZB 1HQCA 2GJSA 3KUCA 3ZQ6A 1Z8FA 2HJVA 3EZ2A 2C78A 3I92A 3AVTA 1S96A 3E70C 1P3JA 2ORVA 2QENA 4HSEA 1R8QA 5LD2B 2VYFA 2N1BA 5GJWC 3VNVA 3IPYA 4CT5A 2ZAOA 5D3QA 3DZ8A 4C0SA 2FZ4A 2VH5R 3K0CC 4DB2A 2ATVA 5DI3A 3GP8A 4URUR 2R6FA 1FPMA 1GP2A 3BBPA 2XZOA 2GJ8A 2JLZA 3HPQA 4PHTA 4NCNA 1ZIOA 1E4VA 3ZVLA 1W36B 4BFUA 4TQ9A 2HLDA 2VA8A 5DYGA 1XCMA 1DAHA 4RZXA 3PEWA 5KUTA 4ESVA 5EXXA 2NZ8A 4A2WA 4ERNA 1HH4A 1XXHB 1X6VA 2Z0MA 1G18A 1NSFA 5DE3A 4OL0A 3AVOA 2HUPA 3QVUA 1KJZA 1LFDB 4M53A 1WB9A 1DADA 2OSBA 2UZIR 1A7JA 1OXXK 2ZE6A 3FVQA 1GM5A 4TQAA 4TMZA 1NMXA 1P2UA 1WQ1R 3N2EA 4HAUA 3ZH9B 4B3FX 2C9OA 4RZ2A 5JRJA 3U7GA 4JLDA 1KK3A 4BFXA 4V0MA 3REGA 3B78A 2REXB 4UNPA 1FW6A 4QNMA 1G3RA 5FUYA 3U3RA 1R2QA 5FR1A 4TZ0A 4IHQA 2FNAA 5EJEA 4JJZA 1X8LA 1Z22A 4MH0R 4LZZA 1ZM9A 2BEKA 3F5FA 3THXA 5SZHB 4L16A 4QGGA 3TVTA 3H4MA 1KAGA 2ZROA 4C2TA 4MUBA 4Q1EA 1J8MF 2ZI7A 1S9DA 3A36A 3K9HA 4XSGA 3U7EB 4DHEA 5B64A 5F9FA 1H8HD 1W0JD 2IHYA 2F1HA 4ZDJA 821PA 2XZLA 3AF1A 4B43A 2O8FA 3C5CA 3BH7A 1F60A 5TY0A 5FPYA 2YV5A 4A2PA 1GIAA 4KJZA 3U2QA 1QZXA 2BBOA 5JI2E 3CRRA 5HE8A 5KHOC 2Y8EA 1OXTA 3NH6A 5HKKA 5JSZA 2JJ2D 4DLYA 4A8JA 2OLKA 2CHVA 1SKYE 3TUIC 1R0WA 4PPGA 1E0AA 2XNDA 3QJYA 4MRRA 1SXJE 1HE1C 1II8B 1WBBA 2AD5A 3I72A 3PUXA 1Z63A 4AD8A 4TLCA 1N6OA 2CL6X 4GOKA 2VHTA 3UPUA 4CYMA 1XD2B 4ZPXA 1J2JA 3AEZA 3FB4A 4HAZA 3QKRB 5J4HA 4BLTA 5JFGA 4N1AA 2BBSA 2B7BA 1S3GA 2GVDC 3NXSA 2ZYVX 1DAKA 4PAOA 4ASUD 2XJ9A 4C0HA 4RCYA 2BOVA 1ZNZA 3SBEA 2XSZA 3CX7A 4LI0A 4ZI2A 4YMTA 1P9NA 2J0QA 3IQXA 4TTPA 2C96A 3MFYA 3HPRA 2QAGA 2GXAA 2IYYA 2CE7A 4GP6A 2RHDA 1IJFA 2G88A 3NWJA 3K0SA 1RVDA 2AK3A 2JLRA 1RRFA 2I4IA 3OIYA 3WNBA 2EFDB 4LJ7A 3ZJYA 5FOSA 5HZHA 4AG5A 4DB4A 4NU0A 2WWIA 1DAFA 3FMOB 3OEHA 4D4JA 1MKYA 3M1IA 5DISB 1EESA 2QROA 1U0LA 4N0EA 1V43A 1XTRA 4FMDB 2F55A 1G64A 4KI0A 3TW4A 4EUNA 1Z28A 3RRZA 1OXVA 4KLNA 1GOTA 2OBNA 2HJGA 4TT3D 1P9RA 2QPTA 2BJVA 1KKLA 1L4UA 2KI5A 1Z0IA 3RAPR 4URZR 4N0DA 4QOSA 1W48A 4Q9KA 4AYTA 3RABA 1SVOA 5C4GB 2IYXA 1A5TA 1NY5A 1OHHA 3LDAA 4G0NA 2QQ0A 1EFUA 3GLHE 3MCAA 3X1WA 1XZQA 1XXHE 5A4JA 3QPWA 3OEHD 1DBSA 1JECA 4DIDA 1Z0JA 1DG3A 5C18A 4M9SA 4HAWA 3VU9A 2ZRIA 4TSFA 1DPFA 2RGEA 1KYIA 2EFEB 2QL6A 4XVUA 1F48A 1BO6A 4Q1FA 3V4FA 1SVSA 2WMOB 2GJAA 2AR7A 3OIVA 1U8AA 5EE1A 3EPJA 3QOFA 4YONB 4LUCA 3QBVA 1NVVQ 2GJ9A 3C4JA 4YQFA 4DWJA 3OAAA 1NNEA 1QF9A 5L3SA 3B85A 4OJKA 3QEJA 2TMKA 2O8EA 1IXSB 3GEHA 1TPZA 2AWOA 2VP6A 2FPMA 1PLKA 4D0NA 4KFRA 4R71A 1AZSC 2EYQA 2WPDA 4E5UA 2EU8A 2CHGA 4D82A 2ZTSA 2ZQ5A 3B1YA 3U5ZB 2YOFA 3LLUA 2FJUA 3D7MA 4D81A 4JT4A 2IYRA 5G41A 2VTKA 1ELOA 1VMAA 1E9BA 3NBFA 3TJZA 4EKDA 2R6DA 2GXQA 2FSGA 1Q21A 2IL1A 2XB4A 2ZETA 3GQBA 2WWXA 5DSZA 3WBJA 1YJ5A 1IM2A 3U44A 1TL7C 3BH6A 1W1WA 4LJYA 3BIFA 1OIXA 3WYGA 1YZLA 1WA5A 3WMFA 4TYNA 2ZRPA 1QBKC 3SYKA 2W6JA 3KB1A 2BC9A 3SNHA 4JSYA 3RRMA 1OFHA 2C2HA 4A36A 1UKZA 1KOFA 4PQFA 1T6NA 3SU8A 1NL3A 3ZIAD 4EQ6B 5FTLA 3SQXA 1EFRD 1VG1A 3EAQA 1OFIA 4AI6A 3QQ5A 3HYRA 3X1DA 1NJFA 4HZUA 5H8WA 1G4AE 1NLZA 3OIUA 4LK2A 1NG9A 4BZQA 3QF4B 3NTUA 2RGDA 1QHSA 1XMJA 4P4TA 1ODFA 2HCJB 3BRWD 2O52A 4QGAA 4NPHA 1TUEA 4GOJA 1WXQA 4M1KA 1CEEA 5F9HA 4Q4LA 2ATXA 5HE9A 4TLEA 4RCZA 1UDXA 3GPLA 4DIEA 2H17A 4W7SA 2BCGY 1AGRA 2WWGA 4B75A 4US2R 1FNNA 4M22A 4LGMA 1E4YA 1XEXB 3MWYW 3UWKA 2IS1A 3QE0A 5FBQB 4DXAA 3U4QA 1CJMA 4MYCA 1XD9A 2UKDA 4D4MA 2ZSBA 5KSZA 2QQEA 2OO7A 4UXJA 1OYYA 2BMFA 4Z8XA 3GJ8A 3T5GA 421PA 4KFSA 4DLRA 3AV0B 3AKCA 621PA 4S2EA 1F2UB 1N5IA 4MYHA 1W46A 4TYPA 4PO9A 5DN6D 3LX5A 2O8CA 1KI2A 2CNWD 2VIIA 1E9EA 3U7FB 3QPVA 1WBDA 3R7WA 4NZYA 4B6FA 1GSIA 2F9LA 4JS0A 4EFNA 1SVKA 3SZRA 2QNRA 3A1TA 3IDQA 3NHBA 4RFVA 1X8JA 4LYAA 4MGZR 1YZNA 1ZYUA 2QY9A 1E2QA 4V0KA 3SJAA 4DSNA 4XWOA 5JS8A 1E96A 3GLFB 2REBA 2NG1A 4DCUA 4QGHA 2PJRA 1LB1B 2F43B 4URWR 4X8OA 2IWRA 4YC7A 2GXSA 5CJ2A 1JI0A 2J3EA 3U6KA 1N5JA 2JATA 2WWHA 3N70A 1UJ2A 2ZUCA 5F2EA 3FFBA 1KSFX 1EGAA 3NDPA 4LJ6A 1RW4A 4MRVA 3W5JA 1E9SA 1HV8A 1ZU5A 2ANBA 3LBIA 4NONA 4XVQA 4URVR 2F1JA 2IUSA 1Q3HA 3X1XA 5JJIA 3GLIE 2Q3FA 2QPAA 4BECA 3HYTA 2MSEB 1DO0A 1L7VC 3FMPB 3ICQB 4QHSA 3KTAA 4ABYA 3AGPA 1PUIA 4PZYA 1SULA 2X2FA 4P4UA 5IDVA 2WM9B 3M6AA 2VHQA 2O0KA 4MGKR 1II9A 1XCGB 2C9CA 2XNSA 3LWNA 1R4AA 3GFOA 4WZ6A 5EUMA 2X2EA 3Q7QA 4PSAA 3LX8A 3IO5A 1PLJA 3ZVNA 1MR3F 221PA 2D7CA 3VFDA 3QG1A 2QU8A 4MYTA 2CLCX 3W90A 2ODBA 2VSXA 2QI9C 1F5NA 3SBDA 3EW9A 3VTKA 1XTSA 4NTZA 4JLPA 4JLKA 3QY0A 4TL6A 3FTQA 5KDDA 5HZKA 2F3TA 3FHTA 2Q21A 4RD1A 4IVQA 2O5VA 3A4MA 5E3HA 1VYUA 4LBZA 2XXAB 4DRZA 3TNFA 2DR3A 3OF5A 1RYHA 2VRWA 2PBRA 2ZRGA 3B5JA 4R2IA 3LQRA 1FOEB 2IEYA 4V0OA 3ZS9A 1R5OA 1JXMA 2J7PA 1PLLA 1FMLA 1GTVA 2ZYTX 3GJ0A 5KNBA 1X86B 1OIVA 2D4HA 4DLTA 1NG1A 1M7BA 2H18A 2VL7A 4OHWA 1SKYB 1T4GA 2QE7D 2BM1A 5FBVB 2EWVA 5DNYB 2VSFA 1DARA 1LS6A 1VECA 2W2VA 4HI0E 1R0YA 4AURA 3L0OA 2ZREA 4TMVA 3UG7A 4B3XA 2DY1A 3OE7D 4KFUA 3A8TA 5FR2A 2ZJ5A 5EP4A 2OXCA 3KQHA 2IYZA 2XZPA 4M2LA 1H8ED 4KVGA 2OBLA 1E2GA 2JLUA 3SFZA 1NN3A 2HT6A 4NBSA 1UKYA 1VCNA 4X8LA 2NPFA 1LTQA 2QBYB 1IY2A 2PT5A 3K0AA 4PQYA 2YINC 1Z6GA 4UKDA 3CW2A 3B7GA 1FUKA 5CDFA 4PFSA 5EZ5A 1G41A 2OFXA 1ANKA 2WJIA 3HJNA 3PQCA 2CCKA 3C5HA 1XPOA 1KMQA 1MV5A 2RMKA 1VCMA 3GEEA 3LQQA 4M1YA 5DGXA 4BFZA 2QP3A 1Z29A 1FP7A 2GF9A 3GMTA 2WVJA 3R8FA 3CKLA 2WSSD 3K9LA 4LBYA 4DSUA 5FH9A 4M9XA 1K5DA 1QHNA 1CJTC 2IYTA 5UKDA 5JRZA 1BIFA 1JB1A 3AVQA 1CU1A 3CLVA 5IK2D 1OFUX 4HAVA 3BB1A 3GJ5A 4HB0A 4IXMA 4HUQA 3CRW1 1U8YA 2H5EA 3PEYA 2PEZA 3VKHA 1DAEA 1GL7A 1E0JA 1G21E 1KMHA 1XBTA 2ZJAA 3CBQA 4K46A 4TT3A 2YWEA 2WAXA 3VR5A 4A15A 2SHKA 1G17A 1FFHA 1E1RA 1SGWA 3IUYA 4ARZA 1L2TA 1S4QA 3MUFA 2QA5A 4M1SA 4Z51A 2ZUDA 3BAFA 3KKMA 1G8GA 1GAJA 2QE7A 3AH8A 4P32A 4RKFA 4FINA 4EJSB 2BIFA 3Q8XB 5TVKA 3P32A 4W9MC 1XRJA 4NL4H 1Q20A 3SOPA 4DJTA 1XMVA 2BEJA 1OH5A 1R0ZA 2VO1A 3EPHA 4U02A 2IUTA 2FV8A 1D6JA 2GBLC 4TWZA 1G8YA 2P6NA 3VR2A 4DUGA 3O8RA 3KKOA 2A3RA 1E94E 4DDWA 1XX6A 1K8RA 5EP1A 4AKGA 1GWNA 3BOSA 3FDIA 3QXSA 2GZHA 3WMGA 2DBYA 2ORWA 2DFKB 3EZ7A 2PMKA 5CIQA 3KTAB 4MYUA 1D2EA 3QEOA 3X1YA 1RJ9A 2OZEA 1T0JB 5KSOA 3T35A 2IYUA 3IQWA 2IF0A 1T0HB 4HDQB 3VMFA 2Z43A 3ADBA 1MRSA 2XAUA 3TVDA 4GSYA 2B92A 1E2FA 1QDEA 4NE2A 3A1UA 4OKSA 4OQNA 4G5RA 2GWHA 3DMDA 4WBSA 4M8NE 1KKMA 3K53A 3CR7A 1G5RA 1FL9A 2WBLC 5FI1B 5BYKA 4JLJA 4CEHB 3LV8A 4U7DA 4PPQA 1E1QA 2AFHE 1OIWA 1DVRA 2CL7X 1F2TB 1R8SA 3NDBB 1XB2A 4QFMA 2JJ2A 1OPXA 2HXSA 2WSSA 4NH0A 5FBWB 5LBIA 1P2VA 2J0UB 3G82C 5C46F 2XTZA 5TDHA 4B73A 2PX3A 2QP4A 4YMUA 2OCYC 1CBUA 1G3MA 4PC6A 3DPUA 3T61A 4WAUA 4IDHA 4F93B 1QHIA 1GG2A 4IFEA 5EP2A 1NP6A 3VR4A 2VSOA 3RRNA 4Q02A 2ZJOA 3VQTA 1P2TA 1XJCA 4M1MA 4ZCIA 4KYIB 4NHOA 1H8EA 3U4QB 4M1OA 4XWKA 2RGCA 1XNJA 3RSLA 5AJYA 1S3SA 3AVPA 2WICA 1WP9A 3GJ7A 1Q1BA 4GMXA 4JLAA 5FUVA 4FWTA 3W6OA 1MABA 4FIDA 4EDHA 3FPAA 5AUOB 4MDFA 1UM8A 4Q00A 2G3YA 2R9VA 3GCGA 1IY1A 2QMHA 4TL9A 2J7KA 5DI9A 4B2PA 1EG7A 4NYIR 3CRMA 5CM8B 4CEJB 5BW8A 2A5DA 4YXWA 4X8MA 1KO1A 1ZVQA 1XWIA 1IXRC 2ZANA 2BV3A 2JAQA 1TEVA 1NIJA 3M0EA 1NRJB 2AXNA 4DCSA 2IW3A 3B82A 2OEPA 4W5WA 2IYLD 5G53C 3ZGXA 4U5XA 4QKQA 5H1YA 4O3MA 3AP3A 5CB6A 1C9KA 2HF9A 4ZO4A 4WZAE 3NEYA 2PT7A 3CIOA 4OI0A 1Z6XA 1L4YA 4LHWA 521PA 4B3BA 2WTUA 3AKDA 5EZ6B 2WAYA 3O47A 4CEJA 3SFVA 2PCJA 4LBWA 1U98A 5E4FA 1VHLA 3VR1A 2OHFA 3NVAA 1M6NA 1Q12A 4Q7MB 4F38A 1E2KA 1E98A 2IX3A 4OBEA 1G8FA 2IYQA 3WMEA 1HE8B 1NIPA 6Q21A 1W47A 1G5TA 5FUXA 1UADA 2N46A 2QTFA 3A1VA 1O3YA 3TBKA 1XZPA 2GZAA 3VHLB 2G1KA 2XEXA 2LKDA 3PG5A 1T8UA 4OJQA 1EWQA 2ZJBA 2QAJA 1ZD9A 2RCNA 4KV9A 3IHWA 1XD8A 3MD0A 2A7QA 3VX3A 2GDJA 2RGNA 1IQPA 1T91A 3V00A 3DOEA 1G3UA 3ND8A 4DVGA 8OHMA 5LDDC 2KB0A 3ASYA 1ZW6A 4K81B 5JEDA 4V0LA 4JL8A 4OI4A 1XTQA 3IEVA 2EFCB 5HKKD 1ZU4A 2GXUA 5DH9A 1KSGA 1YVDA 3HR8A 1EFTA 1CULC 5KDOA 1HT2E 1QHHA 2BBTA 4UJ3A 5JWOA 1ZUHA 3KXIA 3UIEA 4Q9IA 3THWB 2NOAA 3B9QA 4MGYR 3K0CA 4N3NA 5E95A 1CF4A 2DFLA 4EPRA 2ZU6A 2F43A 1U0JA 4QGFA 2VP2A 1T5IA 4LWZA 1B23P 4AKEA 1NMYA 4A1FA 4R9UC 1RYFA 4XTCS 5CK4A 1OYWA 3BFKA 2A5JA 5L3RA 4G5GA 2WWFA 2C8VA 5FL3A 3TKLA 4XD7A 3FYHA 2G9NA 3SYLA 4MKGA 1LVGA 3EIHA 2GCPA 2FPLA 3TLXA 2LCFA 2EVWX 4LC1A 3PVSA 2ZRBA 4YMVA 3L82B 3B13B 1Q22A 4RFSB 3IPXA 4B74A 3OAAD 2ZYWX 4PHFA 3O8DA 1T8TA 4XVRA 2R6AA 2B8TA 2FZLA 4XH9B 5DYIA 3RS3A 1W2GA 1KI1A 4CEIB 1CS4C 4UQOA 1KY2A 3AF0A 4O2LA 4FW9A 1WMSA 4WOPA 1Z0FA 2NO6A 4M9QA 3ZYCA 3GLGB 2ZYUX 5KOYA 2CCGA 2ZRMA 3BWDD 3IIKA 4BFYA 1W36C 4PR0A 4R7ZA 1JALA 3T34A 4JIMA 1VCIA 4MQBA 4HLDA 4AWXA 4HLQB 2AXPA 1Z47A 4URYR 3RDPA 3BS4A 4FXPA 3CNOA 5EE9A 2I3BA 5D3MB 2OAP1 1E2EA 3P26A 2RKOA 4ZKEA 4Q01A 4ZDWA 1U2RA 2GZDA 4TL8A 4Q4HB 2L0XA 5B57C 3B9PA 4D0GA 4XWAA 4QBHA 3VU9B 1NI3A 2DWOA 3N5CA 1U81A 2ODNA 4IEIA 3GLGE 3U3KA 4A8JB 2BKEA 2O0HA 4MKHA 1P5ZB 4BUJA 3L8YA 3W8NA 1GKIA 1XEXA 2V7QD 3CM0A 3FHOA 3TK1A 4P4SA 3TUJC 3VX4A 1P72A 4Q48A 3LBNA 2JLWA 1XD2A 2FFBA 4RJLA 4E07A 3S1AB 2OE2A 1DAIA 3GFPA 2KBFA 4BRWA 2P65A 4BEJA 2ZRNA 4H1UA 5J4KA 4KO8A 3WNCA 4F4IA 1I4LD 1NVVR 2IBMA 2H16A 2FSFA 1FNMA 4L5BA 3EWAA 2ZPTX 4MUAA 4DEYA 4DSOA 1B0UA 2WOOA 4TYYA 2W00A 3T5DA 1OKKA 5FOVA 2ZM5A 2XJ4A 4HB4A 1UKEA 2VP5A 4K8OA 3Q5EA 1GDDA 2FFQA 2PLRA 1T9HA 3FKSD 1GRQA 4JLVA 3AVUA 4Q47A 4AC9A 3AP2A 2WKRA 4Q7LA 4AYWA 2VBCA 1PVOA 4MRPA 1YZUA 4M4SA 3BK7A 5FPKA 3AB3A 4DT1A 2G0TA 2QG6A 2WIBA 4MA4A 5EXPA 1O87A 2AWNA 3ADKA 3ONWA 4HUQB 5DHFA 1AS2A 1W4CA 2QMEA 3PUWA 2QM8A 2OESA 2CVHA 1US8B 5FL7A 3BFVA 1FX0B 4KFTA 1JPNA 1E2JA 2R65A 3KJHA 4C0LA 2JDID 3I4LA 4PC2A 3WYFA 3H2YA 2P67A 1QVAA 1VG8A 4BFWA 2CEAA 2KE5A 1YZGA 1KY3A 3L0PA 5LD2C 4KXFB 4L9WA 3QENA 4FN5A 4TQUS 1LF5A 2FU5C 1DO2A 1E2NA 1KDTA 4CW7A 4MKIA 5AJZA 2BVNA 5LPNA 2RGGA 1BH2A 3PUYA 4Q19A 1II8A 1FP6A 1M2OB 5TARA 5EQTA 1D9ZA 3PXGA 5DN6A 3L0IB 4FCTA 4CRWB 2NO0A 1OF1A 3VKGA 3GLFE 1W0KA 5FUWA 1YR9A 4TLDA 1H65A 1H8HA 4IEEA 3T1TA 2WWYA 1AIPA 2Q9CA 3OESA 3K70B 2IF2A 5AUNB 1MOZA 1I4TD 3DEFA 4FD2A 1AM4D 1KJWA 2N42A 4JL5A 4Q1BA 4I1SA 1TQ4A 1C4OA 1KJYA 3QKTA 2OCPA 2QT1A 4MKFA 3I62A 4E22A 2XTMA 2ZVPX 4AK9A 4XD7D 1LV7A 3QXCA 4G5SA 2O0JA 4A6XA 1E69A 4D4LA 5JCPA 4M9ZA 1WF3A 4UNRA 3GLGA 1VG0B 2GCNA 1E9RA 2PZFA 1Z2CA 5CDFE 2V9PA 3SQWA 3RS2A 2Z6VA 4JYCA 1CXZA 1W2HA 4EAQA 5C2JB 2HT1A 1ZUIA 4BGDA 2CJWA 3BH0A 4H1VA 1CR4A 4IOMA 1KZ7B 3T06B 1HEIA 1NF3A 1TF7A 2B21A 3I8SA 1SXJA 3X2SA 2WJYA 3QG5A 1N5KA 2QTVB 2A5FA 1TAGA 2OBMA 1NN1A 4NKRA 4HZIA 2J0SA 4KHZA 4C9BA 3QKUA 2NQ2C 1JEEA 3QUSA 4FI3C 4KBFA 3C16C 2D62A 2GNOA 2OM2A 1KI7A 1ZC4A 2XOKA 2AKAB 3A4NA 3OE7A 4JT2A 3E1SA 1E32A 3LVRE 2JLSA 1KK1A 4DDUA 4OHYA 4WZBE 4BZPA 4TTQA 4B34A 1NBMD 5FTMA 2XOKD 3B8HA 1OV4A 2GCOA 4GT1A 5G40A 2H92A 5AUPB 4Q9LA 1GNQA 1CKEA 2D2FA 4PO8A 4US0R 2J7PD 5JEEA 1N6LA 1N6NA 3P27A 3RYTC 1IY0A 4AKHA 1M7HA 1U8ZA 2F7SA 2VPPA 4LC0A 5GVRA 1NY6A 2GAAA 2Q6TA 2G0NA 3N2IA 4XJXA 3PCRB 2RGNC 5CB8A 3LFUA 2ZXUA 1GNRA 2GTPA 4PX9A 1DAGA 3UXMA 3B2EA 2HXYA 3PIRA 3EPLA 1G7SA 2CDNA 1KAOA 4GZLA 1ZRHA 1NLYA 1XXHA 1ZM2A 2P2LA 3AKEA 4P3YA 3JZAA 2O8DB 2OFOA 5GJCA 3ZD6A 4OQFA 1TUIA 1YZTA 1ZD1A 4PZLA 3EX7C 4JVNA 1RIFA 3KDSE 4CVNA 1RRGA 1CRQA 1P62B 4FMBB 1W49A 3ZZTA 5HR5A 1T3SA 3UATA 1YR7A 2D3WA 1FZQA 1NMZA 5AJXA 3I5YA 4F92B 2V3CC 3GJ3A 5E7JA 3MRSA 3TAHA 3RWOA 1N3BA 4IDQA 1W4AA 1G19A 3PR1A 3C41J 4AKIA 1G4UR 1OLOA 1PZNA 4GBMA 3TR0A 2LWIA 2GKSA 2WHXA 3EA5A 4JJKA 1W0KD 2ZI4A 4BQSA 4KSBA 1FTNA 4KAXA 2OXRA 4QG7A 3LW8A 1FQKA 2VP4A 4OK3A 1E9CA 2QAGB 2V6JA 4OK6A 4UNQA 2A5GA 3IO3A 3FWYA 3IEUA 2Z4RA 3FMIA 3P4XA 3PEVA 3BB4A 3TSOA 5JWRA 2J45A 1D8TA 1SVMA 2FG5A 1W5TA 3F8TA 2ZRDA 2O8FB 4FWIB 1I2MA 2ZJZA 3MWJA 2BBWA 4TL7A 3TUZC 2YOGA 4IVPA 1HA3A 2F3RA 3K0FB 4BPBA 2MMGA 3QKRA 2GEDA 1E9AA 5FOUA 4PTLA 4B3CA 4MRNA 5KDLA 4FCVA 1AS3A 2NO9A 4YDSA 1N25A 3IHLA 1TQ6A 2YWFA 3NBZC 1SHKA 2DFNA 1IN6A 2JJ8A 4PXAA 3ZVRA 2RH5A 3L43A 2G1JA 1S2MA 4Q9HA 1E6CA 3DOFA 4IJMA 3VAAA 2JDIA 2O8BA 3GLHA 3OIWA 4G01B 1KO4A 3A58B 3UK6A 4DDTA 4NCIA 5G3YA 4D25A 2J9RA 2ZI5A 4QRHA 5DO9A 3OZXA 1J8YF 2ZRAA 5E7IA 3W6PA 2OG2A 3CPEA 1AKYA 5K8LA 5B2ZA 1ZNWA 2C04A 2I1VB 3EASA 5J4LA 4A8JC 2VHJA 1FTSA 5TB5A 4BWYA 1IN4A 1G8PA 2C77A 2IHBA 2W58A 3LVQE 4OYHA 5IF9A 1OHHD 4UXHA 3VNUA 1Q1QA 2AL7A 5JSZB 1E99A 2PJZA 3CRQA 4P0TA 1PV4A 4Z1MD 4L15A 3ZDQA 2BJWA 4R98A 2LKCA 3G5UA 1G6HA 4Q1DA 1Z3IX 1R5NA 3IIJA 4A0RA 1XTKA 2P0EA 3RRYA 2XB2A 3LNCA 3EZFA 2WWWA 4L9SA 3UMSA 4CDGA 2FX3A 1NSTA 4JBWA 4JLBA 1TU4A 1EWRA 3A1SA 3A37A 1BYUA 4D26A 3KQKA 1C1YA 2IYVA 3EA0A 3BGWA 5FTNA 3VR6A 3LXXA 2JJ1D 4D0LB 4ZDIA 5J4YA 4A0FA 2GK6A 1QRAA 1SQ5A 4IKEA 3CWQA 4BE7B 5FPHA 2Q3HA 1G16A 1CLUA 1P7CA 4I1UA 1TTTA 1KI9A 2IWHA 1Z5ZA 3THYA 4HYYA 2QMOA 2QRZA 1R10A 1YKSA 2OAQ1 1NVUQ 1SZPA 2PX0A 3I3SR 1BMFA 4S35A 3GLIA 3ECCA 4IVRA 1QG2A 1GKYA 2P5SA 4ACBA 4D80A 2HEIA 3IIMA 1ZUNB 5BN4A 3EZ9A 5JLJA 1Q1EA 2UZ3A 3B60A 3WRYC 4O2RA 1FQJA 2ZRKA 2JJ1A 1N6KA 5IK2A 3VHXA 4P33A 2F1IA 1WCV1 2RGBA 1JQJC 5AJWA 3THXB 1GITA 4JMPA 3HP1A 1DEKA 1J99A 3FMFA 3Q85A 4KBGA 4LY6A 2R62A 4JLNA 1II0A 4II7A 1T3HA 2ZS9A 4B2IA 3ADCA 1TEXA 2ZS8A 1KI3A 3Q72A 2Z5FA 4GOXA 4RKEA 4BLQA 3FOZA 2FWRA 3QBTA 5KSPA 2KJQA 2KBEA 2W6IA 3HDTA 1D9XA 3AP1A 2IS6A 2VP0A 1XDBA 3NG1A 4OQMA 5JJLA 1QG4A 4JVLA 2A30A 3R20A 4AYXA 1CTQA 1ZIPA 2P6UA 3B1XA 5K8TA 1CJKC 2NIPA 5L8VA 2J5XA 3T1VA 4C0AC 2Q0HA 1TQ2A 2X8AA 3ND9A 5FFMA 1OH7A 1AGPA 1BS1A 1PJRA 3OEED 1P2SA 1P61B 3CONA 4ZKDA 3CF2A 1UBCA 3AQ4A 3FKQA 1XMIA 4G5OA 1M34E 2EWWA 3K70C 3K1JA 2JIZA 1ZMXA 1OH8A 1N0VC 1RZ3A 4I1OA 1P4SA 1G7RA 2REOA 1ZINA 4IDNA 3U3MA 1NJGA 4MRSA 2NTYC 2WOJA 3I1FA 4DLZA 1NLFA 2W0SA 1XU4A 4EFMA 3T1QA 4HLCA 2FSIA 4Y0VA 4IOJA 2BMEA 3K9GA 5GADl 1DTSA 3WY9A 2WV9A 1ETUA 2AX4A 2FSHA 4Q18A 3R7WB 5B58C 3RS7A 2X77A 4ASUA 1ZAKA 2HYIC 1M74A 4H9GA 5L3SB 1KO5A 3DDCA 1CR0A 2ZSFA 4NMMA 5FI0B 1ZM3A 3CR8A 1DG1G 4KSCA 4RD6A 2DWPA 2GVZC 5EXSA 721PA 1E0SA 3GFTA 2FGKA 3EIQA 3HU3A 4LX0A 3KQUA 2A78A 1CP2A 1W4BA 4Q4AA 2WJVA 1EX7A 2GRJA 3F3YA 1KI6B 1OH6A 2XITA 3H84A 1G1MA 3THOA 2BCJQ 3L2OB 4HDOB 2ZSDA 1N0UA 2CCJA 2ZEJA 2QZ4A 4E09A 2FOLA 3REFA 1E3MA 2GCOB 2FPKA 4C4PA 2W83A 4Q7JB 3RNLA 1ZD8A 1P60A 2V4ZA 3WHLA 5BQ5A 2XGJA 1IONA 1LNZA 1A82A 1MRNA 4GL2A 4ACAA 2EQBA 2QPOA 3PEUA 2OUKA 2B7CA 2I1QA 5K8IA 3WHKA 2HLDD 1YHNA 2EFGA 2EYUA 2MSCB 3FE2A 4NYJQ 2MMCA 3PFIA 1G6OA 4DLUA 1KDRA 4A9AA 4DC9A 4BASA 2F6RA 1G291 1GL9B 3UANA 3LY5A 3I73A 4HAYA 2NPIA 4D2IA 3AGQA 5GJVC 1ZP6A 4UNNA 4QXAA 5L3QB 2JCSA 2R2AA 4ESHA 3R9XA 1Q44A 1UBGA 3D6TB 4CT4B 2DWQA 1J90A 2J87A 1M8PA 5BN3A 3E5HA 2ODEA 5BXQC 1D2MA 3AKYA 1J7KA 1G5PA 3TW8B 2RGAA 4RD4A 1KDOA 3U61B 4JLOA 1AZTA 4BFTA 2QP9X 2C95A 1OXUA 4M21A 2QSZA 5KPJA 2YZ2A 2ZAMA 4RZUA 2BWJA 3DVLA 2YWGA 3SJCA 5KPDA 1NVXQ 2A5YB 5E7MA 1KK2A 4JSTA 4KVAA 3V4RA 1LW7A 1U0HC 1EX6A 3FGNA 4M0LA 3RLFA 3EC2A 2ZU0C 3FHCB 2D74A 1MH1A 3MSXA 1MO4A 3WNDA 3AM1A 3QXJA 5JJKA 1UEJA 1Q57A 3JVVA 2ECKA 4WA7A 3QSYA 1F2TA 2E87A 2NO7A 1G20E 1SXJD 3WP1B 3LA6A 2GF0A 4E03A 5EUQB 2W6ID 1TADA 1JPJA 4QBIA 1AJEA 1A2BA 4POAA 4IRUB 4QJ3A 1CJVC 4I81A 5FOTA 2B8WA 3MGCA 4ZCLA 5LB4A 5EXTA 5BWMA 4YDHB 4XTRA 1YZQA 1PUJA 2ZSEA 3CH5A 1Z06A 4OI2A 1EFRA 2E1RA 1JQLB 2A2ZA 2VHUA 1NN5A 2HYDA 2AHOA 4WVFA 2XXAA 3IILA 4UNSA 5P21A 1NKTA 4DBLC 3Q3JB 1GL6A 4JLMA 3T15A 1Z6YA 4C0BA 1GVNB 1GRRA 4TMWA 1Z07A 4I99A 1BMFD 4L8GA 4C7OB 3ZD7A 5JS7A 1EFCA 4TMKA 3D3QA 2R6CA 4F7WA 3AUXA 4LV5B 2CE2X 2HCBA 5KYKA 2J59A 4Z1MA 1RE0A 1JEDA 2NMVA 2OLJA 3AUYA 3RVBA 2Z83A 4DT1B 4KLZA 4IOLA 3ZLJA 1SVLA 1VDZA 4KU4A 3AVYA 1XF9A 5GJBA 2ZJYA 3LH5A 5AR1A 3C14C 4PZZA 2W0MA 2QTHA 3M4YA 4Q4AB 3W6NA 3RS5A 3QF4A 1MO3A 2OCBA 2C9YA 4LRWA 1E2LA 4V02A 3A4LA 4WIAA 3BERA 3KJEA 2QBYA 1RJ9B 3K09A 1AKEA 1IOZA 2QGNA 1MABB 2WJHA 4M1TA 3CX8A 4TLAA 5HCIA 4QL3A 3CX6A 3QXXA 2R8RA 1VG9B 2FE4A 4LJ5A 4TSFD 4WXRA 4EPYA 2P3SA 3W3AA 3AVXA 3GD7A 2ZUBA 3EIEA 3EZ6A 4IDOA 4LYJA 5FBLB 1N5LA 2GHIA 4ARZB 2WKPA 2VHCA 5FOWA 4Y0AA 3KXLA 1SVWA 3KJIA 4LYFA 1T5LA 2ANCA 3QF7A 2C99A 5DHAA 4B35A 3CNNA 3MMPA 4CEHA 1IN7A 1Z08A 3KFVA 3EPKA 3C8UA 4GNKA 4BLPA 1HYQA 3JVUA 2X1VA 3O8CA 3H0KA 5JECA 1UEIA 1HY3A 1AN0A 4QBFA 1E9FA 4MDEA 1NBMA 2IYSA 4PAMA 1F3OA 4GRAA 5BYJA 4Q21A 5CLLA 3TMKA 1G7CA 4PC3A 2H8KA 3UMRA 2ZRJA 3RHFA 4B2LA 1ZBDA 1YR6A 1Z83A 2CK3A 2VLIA 2V1UA 1JXOA 1Z2AA 4O25A 5EE5B 5FTKA 4IW3B 1US8A 1E2PA 3MG9A 4PHHA 4W5JA 3U44B 3ZS8A 3SE0A 1DELA 1IHUA 1ZJ6A 5BN5A 3NH9A 4DCTA 4LYHA 5JBQA 2DCUA 4EPXA 1DOAA 4P4SB 4NYIQ 2QORA 3V9PA 2CMKA 2J1LA 4Q1AA 4DEXA 5F3WB 3SN6A 1E2IA 1KHTA 3PJRA 2ORIA 4QJ5A 5KO2A 2YVUA 3VR3A 3PV0A 2EW1A 4TYQA 1AA9A 2IXGA 2OFWA 1JBKA 1E79A 2ERYA 1N6HA 1XTJA 2OCAA 2R44A 1VIAA 2JEOA 2FEMA 3CF0A 4GMDA 5IRCD 1MT0A 3SHWA 5SZIA 3TIFA 2PZGA 3LXRA 2YOHA 3DM9B 5ANRB 1UAAA 5DLQC 2ZRHA 2YC4C 4HATA 2ZR0A 1HT1E 3A1WA 5CYOA 3FFAA 2B6HA 1A2KC 1X3SA 2IYWA 5DIFA 1AQYA 3ZQJA 1MO6A 4V03A 2BDTA 1OJLA 4RD2A 1EXMA 2O8EB 1ESMA 1LY1A 1A1VA 1XEFA 1FMJA 3BC1A 3DL0A 4B48A 1DE0A 1W36D 2FFHA 1Y3AA 3CH4B 4NYMR 1XPUA 2FMXA 5KTYA 3D8BA 3P20A 3QPUA 2PH1A 3Q9LA 1D5CA 2G83A 4XIGS 5EE0A 3LLMA 1RPZA 3G0HA 1SXJC 2XNDD 1BKDR 1KDPA 3C15C 4JYBA 2W2XA 2HF8A 3ADDA 2IT1A 1KNQA 4DCNA 4HAXA 3LW7A 3CB4A 3KX2A 1LS1A 3ZZ0A 3RC3A 2CNWA 1FUUA 1P73A 4DLSA 2V54A 1EK0A 2PCLA 3TH5A 1AQUA 1P9WA 4RVCA 3RANA 4JVSB 1VKJA 5ELXA 1JR3D 1W0JA 2V8OA 3AF4A 4LV6A 3I32A 4CIDA 2CK3D 3B1WA 4NYJR 1RRPA 5KNCA 3B1ZA 3X1ZA 4EPTA 3TQFA 1E0KA 1Q1ZA 1E79D 4JKIA 1UBEA 2FA9A 3BE4A 3L0SA 3PUVA 4PAQA 1N2CE 2VEDA 4LHZA 3RS4A 5J5CA 1KI8A 1KTVA 3DHWC 3U3JA 4I1VA 4B6EA 1R7RA 3CPJB 3A6PC 3BXZA 2CHQA 3FKSA 3K9NA 4Q66C 3ICEA 2ZIAA 5G3ZA 1DAMA 5EE3A 4HUTA 1ESNA 3DZDA 1XEWY 4HDCA 2JLXA 2PMDA 3DM5A 1XFAA 1U99A 1ZM4A 2J46A 4YLGA 5HTKA 4PO1A 2DYKA 4B76A 1XMSA 2JIZD 2D2EA 1AS0A 5GVSA 4HEJA 1Q0UA 1YR8A 1Z6AA 2BM0A 1HURA 1UBFA 4LV8B 5IT5A 2RB4A 1G3IA 1G9XA 3OEEA 2H1LA 3F0TA 1JJVA 3CWZA 3UG6A 1RKBA 5AWFC 3T1OA 2C98A 2QM7A 3LRPA 4B32A 1JR6A 2GJKA 3K0EA 4ZIRB 3CUEF 2WPDD 4JZKA 3C7KA 4Q5IA 3PUZA 4I4LA 5A0FA 5FBRB 2GA8A 3IBGA 4M1WA 4LJ9A 4OQXA 4PPFA 2D06A 4HLUC 1NBME 2VP9A 1BOFA 2WKQA 1S9HA 2GK7A 4C3ZA 5FTJA 4BRUA 2YWHA 1KZGB 2YC2C 3CNLA 4KCGA 4OK5A 1IJEA 3GJXC 2ZRFA 2IXEA 1G7TA 3PITA 4Q9JA 4CZ2A 3QVVA 5KU1A 3D31A 4P31A 4ZIRA 2NGRA 2CL0X 3EXAA 1OT3A 1IBRA 2HV8A 4A2QA 3NC0C 1R0XA 3OFNA 3KXKA 4OHVA 3K0AB 4YXWD 1QHYA 2GAOA 4PHGA 4Q4HA 1KI4A 3KKPA 4C0QC 3DMNA 2CBZA 5SZJA 2IC5A 5AK0A 4BFVA 3GLFA 2FDCA 3KL4A 2CXXA 2Q3MA 5HCNA 1G8HA 3QIAA 5B30A
chains in the Genus database with same CATH superfamily
2BUBA 3DONA 1H2AS 2Q9BA 3AHGA 3D8TA 2OD7A 4HRXA 5BW5A 5CB4F 4HFRA 4LJAA 1I32A 4ATNA 4FBLA 1HYHA 5EXEA 3SHFA 1Q3TA 1T25A 2VBGA 4GPIB 4C7XA 4BMXA 1QFSA 4DCVA 4CL3A 2JC3A 2ONKA 2BFDB 2WJGA 1THZA 3BMOA 3SSMA 1FDSA 3WO1A 4NEHB 2C2OA 3U7QB 4DA7A 1OKKD 4ARSA 4BWGA 3URMA 2Q5IA 3BSYA 3LO5A 3WYAA 3P94A 1M0TA 5DLYA 4CJXA 5DNEA 5SZKB 1WE2A 2HPZA 5EA2A 4EF6A 1E0DA 4IXNA 5DX8A 1QHXA 2PIAA 3SI7A 1WW3A 3AM4A 3NFYA 3GT4A 1QHHB 5HZGA 2FVYA 3QU7A 4V2UA 3T9CA 2GA9A 1XQWA 3CLRD 3CRZA 3BUSA 4QJ4A 4CQMB 3KJGA 1U8XX 2ZVQX 3KKEA 4IF6A 3L7BA 1PL0A 1YRAA 2OZVA 2NV2B 5AW5A 1HBJA 3T9BA 1X1RA 1E2DA 3JYHA 4M0KA 1Y5NA 3WQHA 3EARA 4WZBB 3Q0IA 2QSJA 5ESXA 3VKWA 3BCUA 3ZIAA 2OBBA 1G21B 3C7DB 3GZJA 3TNYA 1IZYA 3U60B 1H4QA 4QJBA 4PVCA 3PHIA 2AOUA 4MGHA 4O0MA 2V7EA 2O9JA 4ON9A 1S2GA 3DXYA 4F6CA 2F48A 2D5IA 4HS4A 3CBGA 4ANFA 2ZWVA 4H1TA 2GD0A 4YDRA 4B4VA 2ASEA 2X5NA 2PD3A 1C1XB 1WZCA 1ZDMA 2JAHA 1SCUA 1EXDA 3A6LA 1CUXA 4D6XA 3OTGA 1YR3A 3DTVA 1FX0A 3PFHA 3NYWA 4NFYA 4AJ4A 3UBTA 1SHJA 4ZV4A 2YS6A 4F97A 1JW9B 5KNDA 1PSDA 4EHJA 3QXGA 1U7OA 4I9FA 1A1SA 1KOJA 3HA5A 2ZJ0A 1YAJA 3DBLA 1TTHA 2DXIA 3TTWA 1A88A 5CK5A 2WU0A 3VHXB 2B78A 2BHNA 2KX7A 3CF4G 4LYGA 5AW1A 2AFIE 4TN1A 3PPWA 1VP9A 1EDEA 2E4VA 2PLNA 3S28A 5LQSA 3ZHBA 5FOXA 2NVOA 2XVMA 5L4SA 1UXKA 3EG5A 4HB3A 2WTXA 4RY2A 5IPFA 2JGNA 1FP4B 1KMHB 3KKNA 5AJHA 4PGGA 4Q3EA 3WDLA 3ZWDA 3FVVA 3WTCA 4JD5A 2AK2A 3TN7A 2IYFA 1FNSA 1L9KA 1BXGA 3BRCA 1GZSA 3C6BA 4GXTA 4ITRC 4L3OA 4RMGA 5F1KA 3GPCA 3BL8A 4GQIA 1C14A 3USCS 2LIVA 3VSDA 4EMTA 5KTPA 1QZTA 2REQA 5SICE 2EOAA 2V3WA 4NOKA 2OHHA 3V8EA 4F91B 1EVZA 5AVJA 2ZW9A 4LXYA 3MRXA 4YGXB 1N5OX 1HLPA 4J8PA 5KVAA 1VXRA 2AGVA 3FZNA 4AJ9A 4CKEB 4MTLA 1UBUS 3E2IA 4N7RA 1KZYC 5DBFA 4BEBA 4CM7A 3F6RA 1KI6A 1DO8A 3EODA 3KALA 3K09C 4LDQA 5DGHA 3JQFA 5ALNA 4BUZA 2I7XA 1U9IA 4DZZA 1HGXA 4QC2A 4MV7A 1EVQA 3MLBA 5DW0A 5H80A 3RVQA 2C5LA 2Y99A 3AXTA 3BAZA 3CNHA 4FQ7A 1W7AA 1U2DA 2I67A 4EB8A 3A7DA 3QI7A 1YOVA 4Z54A 3SQLA 4PZCA 5DTJA 3S70A 5A03A 4G36A 2CLDX 3P9XA 3QLVC 4YMGA 2A0WA 1GGVA 2QS9A 4CCSA 2PQ0A 3AV3A 4RKWA 1SBHA 1K8ZB 2DJIA 2XQJA 3KB8A 3CZPA 4E7PA 4OGWA 3SIWA 1UMDB 2IPNA 1SXJB 2Q9AA 3FYCA 1XE3A 1PR2A 2FQ1A 3IGFA 3OMWA 4HGZA 5BV7A 5CBPA 2ODTX 1DRKA 1L5RA 4CM3A 4F4JA 1Y3HA 3QTBA 5DASA 4F3YA 3KQLA 3KQNA 1XEWX 3O4RA 4Q4JA 4QBGB 3Q0EA 4QODA 5GMOA 3MGBA 4JUIA 4WNAB 3A9UA 3RWMB 4D6PA 4DAOA 4YRGA 5LP6B 5P8WA 2OBXA 3G6KA 5E6UA 3UN1A 1JNYA 3QIVA 5LB2A 4AAYA 3IV7A 1RZUA 5FADA 2X8JA 5EJGA 4BO9A 3UFBA 4EJMA 5B4TA 4CEHB 3HU5A 1PK9A 1YQTA 1FYDA 1EYZA 3VTZA 3NASA 2XX3A 2FK7A 3O92A 3H5LA 3DFUA 3M70A 4LOAA 4OHZA 1C9JA 5CITA 3OOEA 1Z2DA 3LT0A 4KKVA 4X6YA 5K3AA 2VAMA 4P7JA 3INTA 4YRDA 4AVYA 4DWOA 3R6DA 3G49A 4MO2A 4ZOLB 4CNBA 1Q7TA 2AOXA 2B4QA 4YLEA 1GUDA 3BJEA 2IV2X 4A6PA 3NKVA 2DJ5A 2G08A 1XP8A 4LMPA 3PEFA 3B2NA 2YJTD 1X1QA 5KNDH 3KKQA 3KZ1E 3ZGYA 4XIJA 2XADA 3EH1A 4GMKA 4L02A 3E81A 3HBNA 3N0XA 4L3VA 5AUQA 3DBRB 3ECSA 4QHTA 1LRKA 4MV3A 4WMLA 3GDGA 2HA7A 1HE4A 5F1YA 2WY2D 4N5LA 4QXOA 4H15A 2DULA 1WDTA 1ZLXA 2JFYA 3LUBA 1F17A 3BRSA 4WZBA 1HTBA 4IWXA 5TF0A 4C30A 3RUDA 1RFLA 4B44A 4NBWA 5HIAA 3F4BA 1QH1B 1O5IA 1E92A 1GKUB 3OHMA 4RIHA 2QXUA 2ZDGA 2WABA 4TMTA 5J5AA 3ORRA 1I2ZA 1I5RA 3A3YA 1JR2A 2OORA 2DQKA 2OZPA 1P91A 3TLGB 3OJLA 3SHOA 3PR3A 4R5HA 3T52A 4JQYA 1AHIA 3HFJA 5AK6A 1WAMA 1XVLA 1UOQA 1VLQA 5EHQA 5BRAA 3UCEA 5L3QA 2C20A 3PI7A 1TC1A 3TSWA 5LQJA 5ADUS 2HGSA 4Y9TA 3EVFA 4GI1A 4RVOA 3OX3A 1N78A 3CNEA 4LXQA 1NQVA 1V1RB 4O4HA 5EZYF 1C7JA 2I2CA 2IEZA 4LOJA 1SVIA 4DA0A 4C4TA 3W8RA 1E1CB 2DFTA 4C2UA 1F0YA 5AVQA 1E2HA 4L4UA 1NHWA 5KTRA 4OI1A 4BX3A 5J47A 1VYTA 4EB6B 1FSFA 1F5SA 3MLAA 5FL7D 4D8WA 4WH0A 3RUIA 3G68A 5JCJA 3RR2A 4BGEA 5F52A 4BMOB 3IR6A 2I6QA 3I28A 4TKZA 1JRLA 1E1QD 2X3UA 5AM0A 4ZZ2A 1ZCBA 1VGVA 2PTGA 3LI2A 3PQ2A 4JGBA 3ABOB 5CVEA 3G8CA 2RAPA 2AD1A 2QX7A 4E1VA 4C7OA 2FFAA 1MCZA 3IPAA 1T2DA 3STHA 1WVGA 1JAIA 4G41A 2QRVA 1QO0A 4YX9A 1GTL1 3ND6A 4CKWB 4K87A 3BJMA 4MCAA 4ZT4A 4ALIA 1O97C 1KK0A 4KACA 2OO3A 3ZNQA 2WW8A 3EDQA 3U5TA 4IDPA 4KB5A 2Q6OA 1YFJA 3UJCA 4Q24A 3JYPA 3MS4A 1Q7EA 1XAHA 4BNLA 5BXYA 5C1BA 4D9MA 2HWYA 3AVWA 2BD0A 4G5YA 2GBLA 3C8DA 4LHSA 121PA 3S6JA 1NMQA 1V48A 1KNXA 3R7AA 1M2VA 3H0CA 5EQDA 2EL9A 1BA2A 1TFRA 4ILEA 2LZ0A 1K5PA 3Q2OA 3BSWA 3F7OA 4IM7A 3VJMA 4AF7A 4BQQA 5BR8B 3EGIA 4BV9A 3UK7A 4YMWA 3ETLA 4W5QA 4AO7A 1TU3A 4Y0NA 1I0IA 5CA0A 4RM3A 1MN6A 1RP7A 1TF2A 2RH4A 1Z6TA 4JL6A 5JALA 4L2IB 5EFZA 4PC1A 1OB2A 3ZDEA 1UOPA 4NBTA 4R84A 1B0AA 1A9SA 5BP7A 2QZZA 1VLHA 9ATCA 1IK4A 2WF8A 1RC8A 2UXCB 3VVMA 4KODA 4F3CA 5K0EA 5LMZA 1VRVA 2ZR7A 3A31A 5A4MS 3FWKA 4KPGA 1EFPB 4LWQA 4EPVA 3W7BA 5I4IA 1GUAA 4L72A 1H5UA 4RNDB 3N5KA 4EPWA 1T1IA 3C48A 1KBQA 3MHTA 1BS9A 5DNVA 2DHRA 3GJYA 4KQ9A 2ZSAA 3CZQA 4FFBA 5CYPA 1AQNA 5JE8A 2JASA 1KYQA 1OZAA 2O4CA 2E7ZA 4NZMA 2YV2A 2CLSA 3QELB 4PYIA 3B2QA 3R74A 3BD9A 3MWKA 4WXMA 1GGJA 4P84A 5BSEA 3N86A 1A95A 3PWKA 4Q03A 3PGA1 3O8BA 4EFLA 3EHEA 4CKBA 1O96A 3C4QA 2DBVO 3IUMA 2VQSA 3GJRA 3NNNA 1QE0A 3KAJA 5E6UB 4A03A 4D79A 4F4CA 3H04A 2QVGA 1IIBA 1DFIA 1V3TA 1J8VA 1YRWA 2ZAYA 3PHBE 2XRFA 1KRHA 1KTIA 2GZ3A 1ZCZA 3DLIA 1ZSYA 2W6MA 1IXZA 2EP7A 3QE4A 3M33A 3OZFA 2LTAA 3CZMA 3FI9A 4R8SA 2PH3A 2MWMA 2V55B 3F47A 2IUUA 4EJSA 4RZHA 2A0UA 3WBKA 3ZD9A 2R11A 4PSVA 1XTTA 3UH0A 4Q3NA 2IU6A 3BIXA 2BGIA 2F62A 1W34A 3Q15C 1MO5A 1TK9A 4OHXA 4TMYA 2JLVA 3I4CA 3W06A 1G20A 2B9VA 2FN7A 3JR3A 4FE4A 4GX2A 3N2KB 3ZU2A 4A82A 1Z8HA 3ZCUA 1UK7A 1C3OB 2QT0A 1P2DA 3IBYA 4HH0A 1RRCA 1TM7E 4W5HA 3CPSA 2B25A 5CXXA 1PNOA 1XMOB 5TXGA 4DXDA 1MUUA 1QGAA 2QLBA 1QC5B 4BLOA 2F3SA 1SG9A 3N7AA 3HRIA 1QH1A 2H57A 1T0UA 1L1RA 2QSYA 4FDUA 3K0FA 4QUDA 1U5AA 1YZ3A 1ONBA 1ZLYA 2RGXA 3BB3A 2RAUA 2ZIFA 2X19A 3IX7A 3ILXA 3T5MA 4DE5A 2EBUA 2C03A 5EIEA 1MEEA 5K0CA 1W30A 3T4EA 4UEQA 1AE1A 1CUBA 4MV8A 3SJZA 2HSWA 4XM2A 3CG0A 3EZLA 3OE1A 4I4CA 3NRBA 4YCBA 2JLYA 1FJXA 1AKTA 3AO0B 4ZHQF 2CSXA 2ZI9A 4JEIA 1VE3A 1PFQA 2ETVA 1TQDA 1O6CA 2DTEA 4Y2VA 5FFNA 2CMDA 3AOGA 2XGSA 1S3FA 1NXQA 4BO2A 4ZRMA 1LK7A 4KWHA 1MOSA 2K7ZA 1SD2A 4M60A 3ZQ6A 1B74A 5EJ9A 4KO2S 1PS9A 1Z8FA 2VHEA 1SIBE 3HXMA 2WF6A 2NACA 3I92A 2X9QA 4YGYA 4ZXPA 2Y1KA 4HSEA 2QENA 3ZNNA 1E18A 3NKLA 4BGUA 2OL4A 1VJTA 3VNVA 1UBJS 3PUHA 4IP0A 4X20A 1N2CB 3RS8A 4C07A 3UUWA 1SK9A 1Z75A 5LYYA 3N74A 4DB2A 4L74A 4URUR 4J1SA 4C6TB 3F5QA 1N2GA 1BDIA 2GJ8A 2BT4A 3HPQA 3DA8A 2C7BA 2EX0A 4NLLA 5IM4A 1S2IA 2GAIA 4GF5A 3VPXA 1P2BA 2RCYA 4XFJA 3ZHZA 3HHPA 2IBTA 1DAHA 4RZXA 3FI0A 3MGKA 2ASVA 3ZD8A 1V71A 4JEHA 2JJMA 2NZ8A 3IB6A 5C51B 1ECCA 3VTKA 1KYZA 1HDZA 5DP2A 1H9AA 5E6RB 1GU1A 3IELA 4QECA 3BMXA 2HMYB 3KUKA 5JNTA 2AN4A 2G9VA 2G1UA 1X2EA 2ZXFA 3EXFB 4D97A 2HUPA 4M53A 4CV2A 3C3KA 3K30A 1RYDA 2R5NA 5AQ1A 1WB9A 3DLCA 1TKCA 1OXXK 2PWYA 5IVIA 1NW6A 2D7JA 4TQAA 2SICE 1T35A 4IS3A 4G07A 1P2UA 1WQ1R 4HAUA 2B83A 1V11A 1Z6PA 2FN9A 3PCTA 1WUHS 1E8DA 5EMMA 3SVZA 4E2YA 1IXYA 4OXXA 1RNLA 2E5LB 3LDUA 3EPRA 1KK3A 4ZCQA 3TZHA 1ZN2A 4BFXA 3M6UA 3REGA 3W5BA 2QAIA 3E7FA 2JH9A 2ZKLA 2EKPA 5L40A 2O5EA 3P8ZA 3F5MA 1CS0B 2C1XA 1Q5PA 3GCXA 1R0SA 3VNRA 4BNFA 1SA0B 1RBQA 1Y48E 4Q3CA 1Y9DA 6NULA 1JG6A 1YCDA 3AFGA 2VUTA 1INLA 1X8LA 4JJZA 4RJ2A 4JXXA 1OFUA 4LZZA 4ZCIA 1Y33E 4KN6A 5HZMA 3M3HA 4MYRA 2J6CA 5ULLA 2R4TA 5HXAA 4TKLA 5SZHB 3THXA 5DEIA 5MF6A 1EVJA 1QGED 1P1JA 1T24A 4UU8A 3SKXA 1RWMA 1YQWA 3JRNA 4GKBA 3A36A 3T4PA 3U7EB 5KTTA 5F9FA 1K8QA 3T7IA 5IANA 2QN8A 3V4VB 3SEZA 2XZLA 3AF1A 4B43A 3C5CA 2IQ5A 3BH7A 1F60A 3R5HA 4UMEA 1MAAA 3WLKX 3OHSX 4CM8B 5EHZA 4DNOA 3ECAA 3ISTA 2VYND 3ONEA 2VOJA 2IP4A 3LQ1A 4MIOA 1OXMA 2BN4A 3AY7A 1P8JA 2F3UA 4RE5A 5GIPE 1OXTA 3FLBA 4LE2A 3W1VA 2XUOA 4ECAA 4RVNA 4B6RA 1USVA 2JJ2D 2XNHA 4DA8A 1FFBA 4DLYA 5JAUA 1K66A 3VC3A 3AUKA 1XI2A 3LUGA 2Q8NA 4E5PA 2YWDA 4MW4A 3W5UA 3WGYA 4MRRA 5JAOA 1RQGA 1WBBA 1W96A 2CFIA 3I72A 5A7FA 4P80A 3TDNA 3WL5A 1N6OA 1Y1PA 5LP6A 1C0PA 1XD2B 3NJ4A 3FD8A 4HAZA 4OOEA 5JFGA 2BBSA 1YQGA 3L0DA 2ZYVX 2ET6A 2XJ9A 3Q10A 4P0QB 2QLTA 1ZNZA 2XSZA 4FYJA 4J49A 3PJGA 2FRDA 3IUJA 1ICIA 4ZI2A 3PF8A 1X1TA 1NX9A 3E6AA 4G0YA 4TTPA 3FTPA 4XR4A 4N8EA 1ZESA 3K71B 2H8GA 3G3EA 1M0EA 3UK0A 5TGZA 3K5WA 3MWEB 1QIMA 2D13A 3IDSA 4B40A 4U2FA 4E94A 3CVYA 2G88A 3IAHA 1BDHA 3II6X 1MQ8B 2B4KA 4C7VA 2IBSA 2GZRA 2GMWA 2WUWE 3ZDDA 3FYTA 2VDVE 3OIYA 3WNBA 4LJ7A 3QA3E 4HDMB 5BT8A 1SUPA 4R31A 4YRPA 5HZHA 4LDZA 1UAYA 3QVGB 4AG5A 1NV9A 4UPEA 5K0TA 4DB4A 4C76A 4E88A 3T3HA 1C9MA 3OEHA 2HIAA 3IMKA 1XNRB 5TT0A 3A9SA 4DABA 4I5IA 4JVOA 4IJQA 5CT9A 1KVSA 3KOOA 1XTRA 1V35A 3UJ8A 3ZBUA 4X65B 2F55A 3GBVA 1X7ZB 4KI0A 4EUNA 4KMMA 2RHJA 3DLPX 3LQFA 2VFAA 3S5UA 3VBCA 2R5WA 16PKA 2OV4A 4QYMA 2IEAA 2OBNA 4RU1A 4E4TA 2HJGA 5A3VA 1ZMBA 1P9RA 3H17A 4JQZA 4R8KA 4TT3D 3HWRA 4ER0A 3EEOA 4YJHB 1Z4NA 2BJVA 2KI5A 4P98A 4YAUA 3GRAA 3RC2A 4U2BA 1V6CA 5B58T 5TQJA 3I64A 3MYRA 4WBNA 1W48A 4HNQA 3TZLA 3E8MA 5E8JA 1ZWLA 4UTNA 4J75A 3GVPA 3AK4A 5C4GB 2IYXA 1NDQA 3ESZA 1A5TA 1V3VA 4UOEA 1H2RS 3GLHE 3H2HA 4M7PA 3X1WA 3CINA 3W5DA 3NU1A 5A4JA 3T7KA 4J7CA 2D1FA 1NA5A 1JDBB 4I55B 3U48A 3VI3B 2ST1A 3L7DA 1QNFA 3WKBA 1DBSA 3CEHA 4FDVA 4HEHA 4RCVA 3WK7A 1Z0JA 4F12A 5C18A 4AQYB 1W85B 5IT9A 3VU9A 3GP5A 4BN5A 1R8XA 1GG5A 4MUIA 1KYIA 3LKBA 5EHXA 1IBKB 1DEOA 2CV0A 2YZKA 2XUFA 3L3BA 4Q1FA 1IRIA 5T6BA 2H08A 1I7PA 1FRZA 3ANSA 2H59A 3OIVA 4D9FA 1ODSA 5EE1A 5DBEX 5C8DA 2W6QA 1VKZA 4LUCA 1M2WA 3QBVA 1NVVQ 4K9LA 1XCOA 3M6LA 4N8SA 1TZCA 3ROFA 3U4DA 1UZLA 4ZAZA 1QF9A 5L3SA 4I6GA 3A7EA 3OEYA 1IXSB 1TPZA 4D0NA 2FPMA 2E18A 3L1VA 5ICGA 1UT6A 1AZSC 1O57A 2CDCA 2R8EA 2X3FA 3P0EA 2Z6UA 1QIFA 2CHGA 3QVKA 1HL7A 5SYAA 1A50B 3W2IA 1Y9AA 4ETMA 3V2UA 4CM6A 1BDJA 2I99A 3O91A 4JBGA 5GQSA 3BCSA 1D1SA 3KPYA 1UZAA 4RK6A 1EE9A 2HQOA 5G41A 1DMSA 1ELOA 3HYSA 3JQ9A 3Q3IA 4GPEA 4PZUA 4LTNA 1MW8X 3NBFA 2GXQA 1NW3A 2IL1A 3HZOA 2XB4A 1H0RA 1PDVA 4P2BA 1ZQ9A 3WBJA 4EEKA 1S8AA 2QK4A 4LJRA 4EJ0A 2J3DA 3FSRA 1J5XA 1NUHA 4AJ2A 2XMCA 4E6PA 4TYNA 2ZRPA 3VNQA 5AIAA 5KI6A 4RY0A 1VZ2A 3L7MA 3D6MA 3DLBA 3RRMA 5KOHA 1OFHA 2C2HA 3IBSA 5T5QA 1E3LA 4DV7B 2Z6AA 4A36A 1C3LA 1MVNA 3S2ZA 3DDZX 3ZIAD 1XRLA 2BFDA 3GU3A 1GQYA 4PZDA 3EAQA 2NU7B 1OFIA 1A5ZA 4GGPA 5BMVA 1NLZA 2ONYA 3O03A 3OIUA 3O2NA 3JVDA 2NZVG 1NUAA 1P1CA 4GYJA 1JNXX 2VTBB 4BVEA 2FEXA 2IUYA 3BRWD 4LNHA 4R0VA 2I33A 4UD6A 3VR5H 3ZDAA 1YRHA 3V4SA 3MFQA 3C3AA 1C81A 3U37A 1BCSA 2Q5EA 3VDMA 4KRFA 3UGKA 1VMIA 5F33A 1NVTA 4KP7A 2BCGY 3A14A 3OZRA 2WWGA 4QYXA 3SBOA 4P9NA 4US2R 2IX9A 2R8ZA 2P9QA 5JTTA 1E4YA 3MWYW 2IEGA 2XQVA 3KQVA 4XARA 3UWKA 5K51A 1NYTA 3EEBA 4Z2AA 1OAAA 2OGUA 1SOVA 2UKDA 3C3YA 1FFAA 4GGOA 4HMPA 5KSZA 2NZUG 2OO7A 1YK0A 3GF4A 3DFFA 2BI7A 1KARA 2BMFA 2XE8A 3G0GA 4GL4A 3RD5A 4Y9DA 1RM3A 5FA6A 1QQAA 4S2EA 5K6TA 4ZO9A 2PUTA 1B8NA 5DN6D 3LX5A 2CNWD 2DG2A 5K0BA 2MYNA 3U7FB 2CVPA 3AT1A 3QPVA 3D81A 3DW1X 4PLVA 4U4AA 3R7WA 4BYMA 4CV1A 1EUCA 3GUUA 5DXFA 2FW9A 4JR1A 1BRMA 4PO3X 1L1FA 3KD3A 2BZGA 4UTVA 1X8JA 1R1DA 4V0KA 1C7ZA 1YZNA 4AZ3B 1E2QA 2WDZA 4XWOA 1UEXC 1WJGA 3PZBA 2BFAA 1Y6GA 2C88A 3GFGA 2I9KA 2GHRA 1UDBA 2QKYA 1BGXT 4CLOA 4ALLA 4E2FA 4X8OA 1XALA 4YC7A 3TQIA 4QM7A 1HDOA 2EZ4A 5TIIA 4G8JA 1UDAA 1UJ2A 4QDXA 2P2SA 1MV8A 3W4IA 4MRVA 3GBSA 3W5JA 5FRDA 3IPCA 1HV8A 3ICVA 4XVQA 4URVR 3DDWA 1Q3HA 1RWXA 3BK1A 5A3QA 1HR0B 2Q3FA 4DUZB 2JI8A 5EJ6A 3ISVA 1FTYA 4C21A 4G0PA 1BX3A 3WRYA 1DO0A 3I2YX 3R7DA 1RACA 3BFJA 4HVTA 3LHKA 3AR3A 4DV3B 2Q1YA 4FR0A 2NYVA 4IKOA 2X2FA 3W9UA 3ZWMA 1QP0A 3A6FA 3LCJA 4GI2A 1XCGB 3LKVA 4H0NA 1R4AA 4U8HA 1OWMA 3EEYA 4N7BA 1J39A 3WL3A 2HIGA 2PMBA 1JBEA 3O4JA 4EJ6A 9ABPA 3OT5A 2MYPA 5BWOA 5JDIC 2HUNA 3E48A 3KVNA 3QG1A 3R0VA 5FULA 2XE6A 5A9RA 1YKGA 1QIGA 1RAGA 2ADMA 3I83A 1Z18A 3MTGA 1RYEA 3WLJA 1ZH0A 4E5MA 1QP4A 3TLBA 1U2SA 3RFXA 1D1QA 1XTSA 3CLKA 3FDFA 2YJ3A 3FW1A 4RXMA 4JLKA 4TL6A 1G21A 3FTQA 4UHDA 1UFKA 5TQ0A 3T6KA 5HZKA 5DXJA 2GM5A 3LFHA 4RD1A 4DRZA 3DBIA 3IQEA 1NBOA 1NGSA 1L5SA 2VPQA 3OF5A 3P9NA 1F12A 3CT6A 5IBPA 3DTVD 2O2XA 1PD0A 4R2IA 4TKUA 5AJUA 2FI1A 3JQEA 1VRCA 3NTLA 5AKLA 2HIMA 3OJ0A 1RWPA 4ZVRA 2V74B 2B2CA 4YO8A 2IEYA 3ZS9A 4ZGGA 4W1PA 1GTVA 5ER6A 2ISQA 4COKA 1NG1A 1M7BA 5TQ2A 2VL7A 2CJFA 2QOEA 2DWUA 1SKYB 4W82A 4EX6A 1GYRA 2Y27A 4R9NA 4JNCA 3MTJA 3BJRA 5FBVB 4PLFA 3N2LA 2JD2A 1R0KA 3UJPA 1YVEI 1RWQA 4HI0E 4AURA 2W2KB 3L0OA 1UP7A 1SXGA 1Q0LA 1Y9EA 4CDRA 4D6YA 3PNQA 2ZJ5A 4FIZA 5EP4A 2OXCA 4WVLA 1PVVA 2IYZA 3KQHA 4M2LA 2XD9A 3DJFA 1XKTA 1FP2A 3HL4A 4GZ6A 2RHGB 1Z45A 4NBSA 1RBZA 2PO7A 2NPFA 1JVBA 1LTQA 2QBYB 4RLFA 2PT5A 2YFQA 2OGWA 3CW2A 4MVJD 3VVLA 5A4AA 5C7OO 1H4TA 5EZ5A 3T7EA 3V8QA 3W4JA 1ANKA 1DHTA 3KYBA 1E8MA 2V5AA 4QBTA 4TXNA 2CCKA 5CNIA 1XPOA 2OHOA 1KMQA 2RMKA 3GRZA 4HQNA 4I66A 3GEEA 4QQRA 4Z5XA 1RIIA 4WZAA 1Z29A 2OWEA 1FP7A 2GF9A 2QX9A 1MTOA 3VUEA 1AZLA 2PSHA 3CZAA 3B1FA 3LVFO 4UCFA 2C4UA 1UC8A 2DQSA 2WSSD 3RE1A 3NBMA 3AJAA 3E2MA 4QTTB 5FH9A 1GG9A 4CMIB 4KRXA 5IF3A 3CLVA 1SOUA 1NOJA 4L7QA 1R6AA 1PKEA 1U7XA 2OAGA 3PDCA 4HUQA 2H5EA 4Y30A 3RNOA 4EYOA 5B3KA 3PEYA 4TV8B 1GFZA 5BV2P 5C5DA 5KMGB 1GL7A 4K46A 4HNVA 2HQSA 4BVBA 5FJJA 3L8HA 1CUIA 1G17A 3CJQA 4YP7A 1K2WA 3V7WA 2AJBA 3IUYA 1N7IA 4ARZA 1CUGA 2YWJA 3E35A 4OFBA 3BAFA 3HDQA 4ZODA 4Z51A 1VPTA 2QE7A 4YK7A 5L53A 4KE9A 2BIFA 3H11A 3K5PA 3SS9X 3OD5A 3RFVA 3C8HA 2HH9A 2XLBA 2NWQA 2A1TR 3N3BC 3SOPA 2DTDA 4FDAA 3RM3A 4LNAA 1OH5A 1QZ3A 4X3CA 4ZYXA 1GRCA 5K6RA 1NFRA 2C4VA 1B3RA 1D6JA 2GBLC 2OO5A 2P30A 1G8YA 4KLRA 4MS1A 3LSYA 2Q0QA 3UAZA 3LHIA 3VU3A 3X2FA 3O8RA 3JATB 3E2PA 1PQ4A 1DDGA 1XHFA 2A3RA 1JZTA 1H5QA 1PYOA 4I4TF 1E94E 4LVNA 2GGSA 1D6SA 1Y5LA 3EVAA 1RI4A 3JYLA 4MMXB 4OP3A 4E5KA 1K8RA 4AKGA 2VDMB 2G17A 1P33A 1X7ZA 4DA6A 3QXSA 2OY0A 1UJNA 3WMGA 4RVFA 3H5RA 1KERA 1MAUA 2BFWA 2PWAA 3HB5X 2DFKB 3Q11A 3EZ7A 4LXXA 4DJEC 5CIQA 3B70A 1TLTA 1RJ9A 1VSQA 2XMQA 5AKGA 3HVRA 3RVDA 3HFGA 3D64A 3SAJA 4OIMA 4MWSA 3JRWA 2IF0A 3NAGA 4TTVA 4OGGA 3K94A 4CQNA 1D2HA 2Z1DA 1JFSA 1RJFA 2XAUA 3TVDA 1Q6ZA 2NXJA 3NHYA 3PPYA 2VPIA 4L4RA 4LF6B 3DBRA 4JUDX 1WHSA 1JAYA 5TEVA 4NE2A 3A1UA 4H0CA 1WCYA 5CEEA 5KOIA 1RYZA 2N75A 4ZU1X 2WKWA 8LDHA 1FYXA 2J4FA 3A10A 3P5BA 3K53A 3K9BA 1KMIY 3NNDA 4EYEA 5MN4A 2EZTA 3ELBA 1K86A 2AMJA 5CNMA 2Q2VA 4BFLA 5HW0A 1OIWA 1U5BB 2F67A 1JA9A 4XM1A 2YHBA 3NI2A 4EMUA 2UV8A 4CIAA 3WSWA 3ZDZB 2JJ2A 2DUMA 4YUAA 1VIMA 5LBIA 1N4AA 1P2VA 2ON6A 2AI3A 4TUYA 4MLPA 1U7HA 4YALA 1JFLA 3HB0A 1M1NB 1BDBA 2D4AA 4RY8A 4L9RA 3VNBA 3B20A 1CBUA 1G3MA 2H7XA 3FB1A 4PC6A 1J09A 1R4NA 3QGMA 3A4TA 4DCMA 2P8JA 1D2AA 4IDHA 4D99A 2XVYA 1DKMA 1DX4A 2QRGA 5F7ZA 3LTEA 3TB6A 3TFWA 3V8VA 2HU7A 1GG2A 4JXKA 4R1OA 2I6FA 1JHYA 5THQA 4MHSA 1ENZA 3M5WA 1ZONA 4N7JA 4Q02A 2PMCA 3VQTA 2X8BA 1K0UA 2MINA 3TCXB 3JASA 4MR9B 4OH7A 4GDMA 1Z15A 3OE5A 3N53A 2VTVA 1C30B 1FYFA 1U3GA 3K7EA 4GMFA 4MW0A 5ALQA 4BEVA 4NULA 1ADJA 1YNSA 3RSLA 1LTHR 4PLCA 1WP9A 4JLAA 1W5AA 1YV9A 4YMUA 4EW6A 4GWKA 2BY4A 2WMYA 4M9RA 4UAGA 4FWTA 2GB4A 4FDTA 2X5OA 2CLFB 2XMSA 4TXLA 2QL9A 1EWYA 1DAPA 2HIHA 2EX1A 5LBTA 1YVPA 4B2PA 3JTMA 5INTA 1IY1A 3NHSA 3KM0A 1EG7A 3ODPA 4NYIR 2CVZA 1DTEA 4HDSB 1ORRA 2G4VA 4OQEA 3ROPA 2I55A 2C9MA 1IXRC 5B6IA 3CUSA 3M5DA 2ZANA 1UJBA 4UUQA 2JAQA 4YJ2B 2XT6A 1QQTA 2WT9A 1E7YA 1USUA 2DH5A 4WFIA 1NQTA 4X97A 1HETA 1NRJB 3QH4A 5CCDA 4Q1VA 1L7BA 2IW3A 3M6WA 3V3TA 3HDJA 1G0NA 3G9UA 4BGVA 3RYIB 2RIRA 5D5QA 4QKQA 1PKXA 2Q3CA 3U4HA 3I01A 5ECGC 1RQXA 5IC6A 3TI7A 1ZQ1A 1G4HA 2PT7A 3D5TA 3PXBA 4DF3A 1M9NA 4EG1A 1UC4B 3SZMA 1DDOA 3OLYA 3I5UA 3OU6A 2Q41A 1TPYA 2QJTA 1JHVA 3ICOA 1IHDA 1HM5A 1I51A 3TTYA 3AKDA 4DCPA 5EZ6B 2PCJA 4LBWA 5E4FA 1EPUA 2OHFA 2OYRA 2XNKA 1HYBA 2BGKA 3NVAA 3Q1KA 1ZOSA 2KM1A 1E2KA 2O20A 4Q7MB 1ZVKA 3EMVA 5CPBA 4B3JA 4OBEA 1A4UA 2WLTA 4QE3A 4H60A 1J25A 1WVMA 3EBPA 1N2SA 1PGOA 2HSDA 3A1FA 3A0RB 3HKCB 3D6HA 2WKSA 3UV3A 5JAZA 1VPVA 4FLMA 4YEDA 2EJCA 1GPWB 2LKDA 5G1NA 1T8UA 4KIFA 5D7NA 3ZQJA 1ZD9A 3WC4A 3DZCA 3SQOA 1D4FA 4PSDA 3WKAA 4PU0A 2HDHA 2A7QA 3VHRA 3ZCPA 4EFKA 4YV1A 5JSFA 1IQPA 4KGVA 5ALKA 1I3KA 1X7WA 1ULTA 4A6EA 4JH0A 2B1GA 1XDGA 3ZWBA 3TVYA 1G3UA 3ND8A 4DVGA 1RQNA 5LDDC 2QR3A 4UM7A 4ZOLF 1ISSA 4I7EA 4YREA 4E5DA 3ASYA 1ZN8A 2W4IA 1CFZA 2V9ZA 1SOWA 2FUG6 4GNRA 3BMNB 4PFKA 1MZVA 1XTQA 4RADA 4UHFA 1M2FA 3GH1A 1BD3A 3NXKA 4PHCA 3IEVA 3OU7A 3AR9A 1GPLA 2AV6A 1YVDA 3O82A 1CULC 2P90A 5ALLA 1HT2E 2XCLA 3A1CA 5IUNC 2G9ZA 4L0CA 2B3TA 3PLNA 4MGYR 4LHEA 2PGJA 2VT7A 2EJWA 2R86A 4D3YA 2F43A 3RVJA 1T5IA 1QONA 1B23P 4AKEA 1NMYA 1ZRSA 1NR1A 2O7SA 4RELA 1T4CB 1ZXLA 5IH7A 1J1UA 4G5GA 2GYWA 2A0XA 1FW8A 3ZV3A 1KP3A 2C8VA 2F00A 3PSAA 1VKHA 2JZCA 3Q4GA 3FYHA 5AW2A 1R0BA 2B35A 1W29A 5ALPA 1FP1D 2UVPB 3VVCA 1MX5A 4YROA 1U1CA 1UH5A 2A92A 2OGTA 2JIDA 2X1LA 3OQIB 4OQPA 4XYMA 3IQZA 3IAXA 4KKXB 5TQVA 4BKPA 4DLNA 2ZYWX 4AQDA 4C5AA 5D6OA 5DCYA 2B8TA 5DYIA 3K0HA 4CEIB 1A7KA 4XPIB 4EDFA 1JU3A 1KY2A 4IVNA 2E1PA 4F5DA 2H4HA 3IFSA 3EXEA 4NVRA 3GWGA 2DPMA 3ZHCA 4DQDA 1MX3A 4EYQA 5BSHA 2CCGA 3BWDD 5DDIP 5M5BA 4R7ZA 1PX0A 3MTQA 4ND3A 5EJ8A 1Z5GA 4CV3A 3T34A 3O4GA 4QYIB 4MR9A 4D9BA 1MPXA 1YDFA 1KH1A 1YBAA 4NV1A 2PD4A 5FWDA 4AWXA 2R00C 4WT7A 4LXUA 4TWBA 3H9GA 2GFQA 2Y92A 3CNOA 5EE9A 3TLGA 2FQQA 3E7XA 1E2EA 4Q01A 1U2RA 3KOWA 1ECLA 4YRIA 3KAKA 3DLHA 4NWIA 4WCFC 4QBHA 1PN3A 1UPCA 2DWOA 1CDDA 3GLGE 4N40A 3U3KA 1K7CA 1QIJA 2RHRA 4WLFA 1JKIA 4A8JB 1NT4A 2P4UA 3ND7A 2BKEA 4MK4A 2JEZA 5A5FA 1JKJB 2WLSA 4OSPA 3LLSA 4MICA 3DAFA 1VOTA 3C97A 1DG9A 3IAM6 1C8KA 4OXIA 4C7KA 2ZDHA 1GKIA 2V7QD 3P9QA 3CVXA 1ZD5A 3GUHA 2NTNA 3WIUA 5LN1A 4Q48A 2P2DA 2H31A 2Y0EA 4JXJA 4M3NA 4LKOA 4JUAA 2OE2A 5CVJA 2WSIA 3GFPA 3VR1A 4UAJA 1M1ZA 2EBWA 4BEJA 3W05A 2XR1A 4X90A 4Y67A 4PNEA 4CMAA 5AI9A 1IG0A 5JMPA 5LLTA 2XQIA 2IPOA 1GPH1 4XDHA 2VK1A 1IDOA 3F9IA 4F4IA 2CFOA 2IBMA 2JD0A 4PRYA 2JRLA 1FNMA 1VFPA 2A1UA 2I8LA 2ZPTX 3TTVA 1PJLA 4K1LA 5LSAA 1B0UA 1OI3A 1VRWA 3T5DA 2ZM5A 2XJ4A 3B9RA 4I1YA 5FBKA 1E3QA 3L0BA 3MJFA 4CCAA 4K8OA 3IXQA 4X44A 4QLOA 1Y3IA 2WG0A 4L8VA 1M2VB 2PLRA 2GRUA 3NRCA 1A9RA 2ZIVB 3NHMA 1YI8A