2EVWX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with r-caged gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title A newly designed microspectrofluorometer for kinetic studies on protein crystals in combination with x-ray diffraction.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2evwX00
1G17A 2Y8EA 1NIPA 1U0LA 1VPLA 2ZREA 2OFWA 3ECCA 4OHZA 3BK7A 3KFVA 3AP1A 3AP3A 3I72A 3LFUA 3SHWA 2XZPA 2A5JA 2ODWA 1S8FA 4Q7LA 3WRYC 2FPMA 4URWR 5G53C 2PX3A 3DZ8A 5EE3A 3SR0A 4QHTA 4FD2A 2AXNA 3QBTA 4F91B 3P26A 3C5CA 5EP1A 2FFBA 1NJGA 3CX8A 4OHYA 2RGNC 2YC2C 3I5XA 3AM1A 3TE6A 2FSIA 5FOTA 5TV2A 4CEHB 1OFHA 4M1YA 2A5GA 4Q18A 1Z22A 2XNSA 3NBZC 5E95A 2O0HA 4GMDA 1ZCAA 5IF9A 4MRRA 2ZSEA 4BLOA 4CT4B 5CDFA 3NH6A 5JI2E 1MT0A 3LW7A 4D80A 1ELOA 4P31A 3U61B 3PUWA 1X1RA 3C4JA 3FDIA 4BEBA 3IO5A 3QSYA 4TMTA 1IQPA 2FJUA 1RPZA 1TUEA 2ZTSA 1X8LA 1XD2B 2GVDC 1R10A 3E70C 3LH5A 2J7PA 4RY2A 1J7KA 4M9SA 3AQ4A 1N0UA 3N2IA 4KVAA 3CM0A 3NHBA 2XXAB 4HLDA 1IM2A 3AVXA 4ARZA 2B7CA 5GJBA 5FTLA 4CEIB 1GAJA 3R9WA 1SVLA 4LV8B 2G6BA 4MRNA 4BEJA 1H8HD 1R5OA 4FCWA 4ZI2A 1G3IA 4R2IA 1XEXB 2IYZA 3LLUA 2I4IA 2W6JD 2JAQA 3LX5A 1VG9B 2XZOA 1ZNXA 4BLSA 4BQSA 1KI2A 1MKYA 2H5EA 2CJWB 2IYWA 3SU8A 1CR2A 5CM9C 2V55B 4QJ3A 1ZD1A 3W5IA 5K8IA 1JR3E 1XMJA 4BLQA 1Z6AA 5IT5A 6Q21A 4HZUA 1BIFA 1IY0A 1ZNYA 3QF4A 4BFZA 3T5DA 4ZIRA 5HZKA 2REXB 4LJ4A 1F48A 3EZ7A 3DEFA 4NMMA 1Z6GA 4EUNA 3R8CA 3THWA 1G291 2MMGA 3SJZA 3SYLA 4JL8A 2J0SA 1AGPA 1AS0A 2ERYA 4GSYA 1F6BA 2JLZA 2NZ8A 1U9IA 4GBMA 4MYHA 1XZQA 1NLFA 1OXSC 4NP6A 3IEVA 2HV8A 4QGGA 3RS0A 1WBBA 3KTAA 4GOJA 3BAFA 4HB2A 4U00A 2ORWA 3CR8A 2GXSA 2JLRA 1HA3A 2EW1A 2JLSA 1FMJA 3PJRA 1SZPA 4NYIR 1OFTA 2C77A 1W36D 3GP8A 4BRWA 2ZROA 4MA4A 3AVVA 1Q21A 1EWRA 3LLMA 1NL3A 2HJGA 4AD8A 3MWKA 2QEQA 4R9UC 3EZFA 5DI3B 4M2LA 4AURA 3LV8A 3ZJYA 2K5UA 3B82A 1NG1A 3GLHA 3AF3A 2AX4A 3FE2A 3IBYA 5KSOA 3UANA 4ERNA 2IL1A 3AKDA 4NCHA 1KI9A 4L16A 4D2IA 4KITB 4XD7D 1J2JA 1OJLA 4PANA 5DE3A 3K0AB 2W6IA 1GP2A 4CF7A 3HU3A 1KI4A 4V0NA 1TEVA 4X8MA 1U0JA 2FSFA 2QL6A 5FUXA 3TW4A 2QPAA 1MRSA 3MJHA 1A4RA 3LXRA 5FBVB 5D3QA 5B57C 2AD5A 2WWIA 4NDZA 1E2DA 3VX3A 3BJIC 2XSZD 1DAIA 1XXHB 3GFTA 4OI1A 4M8NE 3UPUA 1CULC 2RGBA 2G9NA 4JVSB 4E22A 2GF0A 2HLDD 3TSZA 2QT1A 4LYJA 2BJVA 5FPKA 4PR0A 4D0LB 2O8DB 1LVGA 1GNPA 3VR2A 5FOVA 3LVRE 1G20E 2IEZA 1CXZA 1RYHA 3AF4A 3RWOA 1ZP6A 2ZQ5A 3OEED 4GT1A 3NEYA 1PZNA 3KB1A 4B74A 2OUKA 1I2DA 5HE9A 3VR5A 2GWHA 2ZJZA 1OYWA 2BM1A 1DE0A 5L8VA 1UAAA 1G16A 5TXGA 2LCFA 1MABB 3BH0A 3GFOA 3KFXA 3T1TA 5FPSA 4PSKA 2H1LA 1KI1A 4DT1B 2OG2A 4I1VA 3GJ0A 4MGZR 2QI9C 3EC2A 1RRCA 1NMXA 4B48A 1AKYA 2YINC 1FMLA 3SYKA 3QBVA 3TUZC 2QUZA 3GLIA 3WBJA 4A36A 3QVUA 2ZRJA 4GP7A 3WP0A 4PO1A 1NMYA 3LDAA 1W2GA 1E2QA 4UXIA 2ZANA 3RRYA 3WMFA 4BFWA 4Z8XA 4DSNA 1KKMA 2RMKA 4GZLA 2GJSA 3QKRA 3V4FA 4Q4LA 4DIDA 2LWIA 1ZD8A 4F93B 2RCNA 1G3RA 5EP3A 5EZ5A 4C0SA 4GFDA 2HYDA 2DBYA 3GJ7A 4OQMA 2MSEB 1Y63A 3L0PA 4TN1A 5JWOA 5CJ2A 1R2QA 2FEOA 3BS4A 4D26A 5BQ5A 3SI7A 1XNJA 1Z6TA 1E69A 2WHXA 4A8JA 3QKSA 4FIDA 4C3ZA 4GRAA 4W9MC 1NG9A 3U7GA 3NXSA 3Q72A 2GZDA 2RB4A 2QM7A 2RHDA 5D3MB 5TVKA 3REGA 1E0KA 4HAUA 4L5BA 1QHGA 4RD4A 5C18A 2EYUA 2YHSA 4O2RA 5B2ZA 2WWFA 4A6XA 2IUTA 2IX3A 1RZ3A 2RGCA 1ZU4A 2J3EA 4H1UA 4MKIA 4E07A 2NO9A 4D0GA 4URYR 1AM4D 3SQWA 4DDVA 1KTVA 2ATXA 4EDHA 4KLZA 2WM9B 2NZJA 1XD9A 4F92B 2DR3A 3K9GA 1SGWA 2ZVQX 3QEJA 5JI3E 3B13B 2WBLC 4HI0E 4I1SA 4GDFA 2IF2A 3K0SA 4ZCMA 3H86A 5G3YA 2KJQA 1G6OA 2PT7A 3S1AA 3T06B 5A5GA 3BWDD 4AI6A 1IN7A 3O8CA 2KBEA 4JLAA 4R71A 3EX7C 3L8ZA 4GPTA 2WMNB 2QY9A 3VHLB 1E32A 1W0JD 3NDPA 5FOUA 4HB4A 4Q4AB 5DO9A 5B58C 3LXXA 3N5CA 2OESA 1OIXA 4C0AC 1UFQA 2C9OA 2ODEA 1LTQA 1X3SA 3HPQA 3BB1A 3N2EA 4PPGA 2YV5A 4CEHA 4M1KA 1EK0A 4PHHA 5KDOA 3E2IA 1X1SA 1YE8A 2PMDA 1GKIA 2XAUA 4IVPA 4G0NA 1P62B 3SZRA 3BOSA 3CWQA 1W49A 4EPYA 1KAOA 1O3YA 1RYFA 2B6HA 1FNNA 1FZQA 1HQCA 4B76A 2P6UA 1CR4A 1FP7A 2GESA 2GDJA 1L8QA 1IBRA 1Z0KA 4TLBA 5L3QA 5HKKD 2UZ3A 2IUUA 3OIYA 3EA0A 2W83A 4U7DA 4LBYA 3L2OB 5SZHB 1S0UA 1P7CA 1XD2A 2WPDA 3UMRA 4TLCA 2LKDA 4MDEA 4LJAA 3FHTA 4TZ0A 4E03A 1AZTA 1S9HA 3U3MA 3DZDA 2XXAA 3SBEA 1FNMA 5FL7D 4IHQA 1M6NA 4A2PA 4D81A 2GCNA 4Q7JB 1JQLB 2X8AA 2ZAOA 1E79A 2P5SA 1Z0FA 4Q1FA 2GJKA 3MWJA 3AGQA 1U81A 2ZJ2A 3QENA 4JBYA 1ZUIA 4Q1BA 3IEUA 2BWJA 4M1SA 4WZBE 4Y0VA 4LBWA 3KB2A 4QXAA 3W90A 2CHQA 3CR7A 2CJWA 2V6JA 3FHCB 4DUGD 5EJEA 1IHUA 4KO8A 3NBYC 2QG6A 2QMHA 3GLFB 1LF0A 3IKJA 2F1JA 5E7IA 1W2HA 3SHFA 3UG6A 4OQFA 1P5ZB 1S96A 4A6PA 1W46A 2BHRA 1VG8A 4KYUA 2ZI4A 1E0JA 3UMSA 1TF2A 3KJEA 4QGHA 2EVWX 3F3YA 5DGXA 3VKWA 1VIYA 1U99A 2XB4A 2RGXA 1QVRA 2QSZA 4FINA 2WOOA 1E2JA 2REBA 2F9MA 2V7QA 3WNCA 3H1TA 1KY3A 3L82B 3M4YA 2IXEA 4YQFA 4XWKA 1FW6A 2X19A 1NSTA 3EXAA 3TJZA 2ZRPA 2IWHA 2AWNA 3B1VA 5A4JA 2FSHA 2YOHA 4NKRA 4Q02A 1R7RA 3H2YA 5AUNB 5B64A 3KQLA 1AS2A 3KQHA 2D2FA 1E1QA 2FEMA 2VA8A 4URXR 2P65A 4OHWA 1Z0JA 4O25A 3OIUA 2FFHA 3RAPR 1XXHE 1D6JA 4HDQB 2HXSA 4C4PA 5BW8A 1KSJA 5JBQA 1G8HA 1QHHB 4X8LA 4BZXA 4ZDIA 4KU4A 1XMVA 1VDZA 3VFDA 3ZYCA 1FTSA 5CB6A 3K9HA 1MO4A 4TSFD 1XEWX 4HATA 1T6NA 3PR1A 2PL3A 2IWRA 4DWJA 4KFSA 4NHOA 2IW3A 4KV9A 2GAOA 3ZIAD 4DEXA 2BDTA 3GEIA 3K0AA 4M53A 4Q4HB 4XSGA 2JDIA 3IO3A 2G83A 4XSHA 2ZXUA 5HZHA 1FX0A 3LO5A 2QRNA 2CVFA 4HB3A 2VHJA 3W3ZB 1U94A 4A2WA 3I5YA 3SFVA 1FPMA 3MRSA 2G77B 2WWYA 4MDFA 3CO5A 2QQ0A 3Q9LA 4LPSA 1NVVQ 3TKLA 1KJZA 5KUTA 3QXCA 2GJ9A 1G7TA 2H8KA 1E3MA 1CJTC 2PJRA 3EIHA 2IXFA 5DHAA 2CBZA 2QQEA 4CT5A 2BIFA 2DYKA 1Z63A 2EFEB 2MSDB 4II7A 2NG1A 1X8JA 4IDPA 4NL4H 4IXNA 1COWA 3MWYW 1NJFA 4OJKA 4TYNA 1MABA 3FB4A 4MQBA 3EZ9A 2OILA 1T8UA 1G8FA 2VIIA 2XOKD 1P9RA 3PEUA 3PVSA 4FMCF 4PQRA 4DT1A 2H7VA 3GJ8A 2QT0A 3BORA 1XTIA 3QQ5A 4TT3A 1WBDA 3TAHA 4G5QA 1SVKA 1JECA 4RD3A 1K5DA 2AD1A 2N1BA 2HXYA 1E4YA 2QP4A 3SQXA 4GI7A 3VR4A 2FG5A 2H16A 4B44A 1ZMXA 2BMFA 4CYMA 4FWTA 1Z0DA 2D7DA 1Z3IX 2R6FA 3VNVA 2DWOA 3BRWD 3LBNA 3NBFA 4P33A 1XPRA 4IDHA 2P67A 1CP2A 1H8EA 2ZIAA 1CJUC 3K0CC 3B1ZA 4TTPA 4A2QA 1W47A 2QTVB 1ESMA 3DO6A 4HLUA 4K8OA 3CUEF 2OM2A 5J4LA 1N6IA 1R0ZA 2IUSA 1GRQA 1P2TA 3BFKA 4XWOA 2MMCA 5BN3A 1NSFA 5AJZA 5BYKA 2V6IA 1GUAA 2ANCA 2O8BB 4GMXA 4OQXA 3EAQA 4IKEA 4X8HA 3DMNA 1E2EA 4C0JA 1W5TA 4GNKA 1EFRD 2KE5A 4JKIA 3BGWA 3CX7A 5JCPA 4PC6A 1Z6YA 4TQUS 4WVFA 1M7GA 3I61A 1BOFA 4TYWA 3AF2A 3KL4A 4B3XA 1FOEB 4YMVA 4M1WA 4LOAA 4RD1A 4US1R 2Q9AA 3QPWA 2G88A 4EJSC 1OHHA 1Z8FA 5FBLB 5DN6D 421PA 1G4UR 4TZ6A 2OE2A 3KKNA 3VU9A 3UMFA 1YZGA 4YXWD 2O5VA 2JJ1A 2VP4A 1XEWY 4EIWA 4XJXA 1VIAA 1UKZA 4YLGA 2GCOB 1JXMA 2W2VA 3ASZA 3CH5A 5JWHA 4QM6A 1KKLA 2YZ2A 4RFSA 1L4YA 1IXZA 1W5SA 4WW0A 3K0FB 2RGDA 3X1XA 1E9BA 2B8TA 2ZI5A 3BE4A 3VKGA 4PHTA 2PBRA 4B34A 2ZS8A 2OAP1 4B3BA 3QG1A 3DM9B 1RKBA 1N6PA 1XCGB 3DVLA 1TAGA 5HCNA 2GJAA 1Z6XA 3P4YA 4TMXA 1IXSB 3IHLA 2WWGA 4YMTA 5HTKA 2OCPA 4A1FA 4AKHA 4LHZA 2WSMA 3T1OA 3D6TB 2VF7A 4M1OA 2OEPA 3P1JA 3BB3A 4KBFA 1T9HA 1N25A 5EXXA 3WNDA 1KJWA 2YYZA 1HUQA 4NCIA 1IN8A 2AK2A 1JQJC 2KI5A 5SZJA 1S3SA 1LFDB 2VL7A 1VYTA 5FPYA 2QTHA 4EFNA 4IJMA 4LY6A 1CR1A 2G0NA 4L8GA 3PUVA 3RYTC 5JLJA 2J1LA 4PZLA 2VHCA 4C2UA 3ICEA 2GXUA 1LW7A 4FW9A 5AUQA 3EIEA 2ORIA 1CR0A 4Q9HA 2GBLA 4JL5A 3PUYA 2EYQA 1KAGA 2VTKA 1G4AE 3EWAA 3I32A 3R20A 2YOGA 1VKJA 1W0KD 4FWIB 3PEWA 4I1UA 3DOFA 4OL0A 2EFGA 5AR1A 4B32A 1RRGA 3GLFA 3PITA 3ICQB 4M0LA 4GOKA 4ZV4A 2VSXA 1PVOA 4KSBA 1BS1A 3CPEA 1S1CA 5CITA 3TR5A 1A2BA 2VSFA 3I1FA 2QM8A 4QGFA 1LF5A 2QU8A 2SHKA 2XTNA 4Q19A 2W2XA 4QL3A 4W5WA 1XJ0A 3C5HA 2O8CA 1ZU5A 2XJ4A 4I1OA 1ZC3A 5KHOC 1W4AA 4DB2A 2CHVA 1S1MA 1BO6A 1R8SA 2ZE6A 1BKDR 1P9WA 3CW2A 3CZPA 1OH7A 1QHIA 2XB2A 1RRPA 4Q03A 4TL9A 5AJYA 1A2KC 4Q01A 1U8ZA 1XBTA 2RGGA 4Q00A 4WXRA 4QHYA 1NVXQ 2ORVA 1KYIA 4FCTA 3FHOA 3QEOA 2XX3A 1OF1A 1I2MA 1XJCA 4FMBB 1CJKC 1ZIPA 1QHHA 4WXPA 3WBKA 5CK4A 3MLEA 4YDSA 4AG5A 3MGCA 4CVNA 1Y3AA 5KDDA 1G5TA 3SOPA 1U2RA 1E99A 3LNCA 4JLBA 5H8WA 4G5SA 2QE7A 4Q4HA 4B73A 3EW9A 3AB3A 1IJFA 1KK1A 1ZNZA 4QM7A 3AUXA 2VHQA 1JI0A 2Z43A 3V4RA 2IYQA 4N0DA 1SXJA 3P20A 5SZIA 1Z08A 2HF9A 1WP9A 2JLQA 2ZJOA 2EFDB 3UXMA 2QAGC 2WVJA 3K70D 3THOA 3VKHA 3X1WA 4RCZA 2JLWA 2J0UA 1D8TA 5TMPA 2GXAA 3WXMA 1NN0A 1D2NA 1YQTA 1KZ7B 5KU1A 5H70A 3W5JA 2HCJB 2CLSA 4ACBA 5AK0A 1G7CA 1G41A 4RKFA 1M7HA 1DBSA 2QP9X 4JSTA 1LS1A 3RSOA 3ZDQA 4ESVA 2O8FB 3AVTA 4Q1DA 1SVWA 5A0FA 2BBWA 3O8RA 3ZVRA 1KI3A 1NLYA 4ZI3A 2JIZD 2IYRA 4HUQB 1I4TD 4F4IA 3B7GA 121PA 5IK2D 3WYAA 2ZYVX 4DB4A 1NLZA 2ZE8A 1DAHA 5L3SB 2C04A 5JS7A 3AKEA 1E94E 3ZD7A 1C4OA 3EARA 2DWQA 4YMSA 3O8BA 3TNFA 4IDNA 1EGAA 2BMJA 4HDOB 5EQTA 3DPUA 3QPUA 4MGKR 4R7ZA 3VR3A 4WIAA 4DKXA 1R0YA 1E2NA 2JJ2A 3B85A 3QVVA 1XF9A 3OZXA 1HE1C 2FOLA 4WAUA 221PA 2YWGA 4I99A 4BFUA 3HJNA 1CJMA 1YZLA 4F38A 2UVQA 3A1TA 1ZJ6A 4KXFB 3WMGA 4KYIB 2AXPA 2CE2X 1AQYA 1OPXA 1RVDA 2F7SA 1ZYUA 2XNDA 3I62A 4JYCA 4FCVA 5FTNA 3CF6R 3BIFA 2CVHA 2W58A 4A15A 5FBQB 4ABYA 5JEEA 4N3NA 621PA 3AVQA 1FQKA 3X1YA 3ZH9B 4ASUD 1CJVC 1LS6A 1IY2A 4LWZA 2QP3A 2A5YB 4UNQA 2BBSA 3BXZA 1MO6A 2F9LA 1WE2A 3BB4A 3F5FA 5CLQA 1GG2A 5KO2A 4Q4JA 5J4HA 2D4HA 4HEJA 5C4MA 4JL6A 3TH5A 3NC1C 5KNDA 3OAAA 3QOFA 3DKPA 3ZQ6A 3RC3A 2WIBA 2GZHA 2QN6A 4DLRA 4DLWA 4C0HA 2QPTA 3A8TA 2E9SA 2ZRGA 3GJXC 1W36B 1CTQA 5KTYA 2W2TA 1E98A 3P4XA 2GEUA 1CIPA 2GCOA 4US0R 1YU9A 4UXJA 2GEDA 1JR3A 1AQUA 1DG1G 3K09A 4P4SA 2NGRA 2YVUA 2YKGA 2IS4A 1AN0A 2G1KA 4O3MA 3PIRA 3GLHE 2EU8A 3IILA 3TUIC 3GJ3A 5JHGB 2D62A 2H57A 3OE7A 1OXTA 4O0MA 1SKYE 4JLDA 1JBKA 2WICA 4S35A 1JAHA 1OFIA 4CRWB 1B0UA 1GILA 2IT1A 3MWLA 3QXSA 4EJSB 3IQXA 2W0MA 4KCGA 2CEAA 4JLNA 4QRHA 4U02A 1DG3A 5KSPA 5K8TA 1TTTA 4QG7A 3D7MA 4PC2A 3WNBA 3U7FB 2CNWD 1G8PA 4S2EA 1E0AA 2FWRA 3TIFA 3W9YA 1XPUA 1KNXA 1UEJA 4D4MA 1LNZA 2F1HA 3W6NA 1KZGB 2P3SA 3P27A 4DDTA 5BN4A 5F9FA 4A0RA 1VG0B 2RGAA 2XITA 4M21A 4AC9A 3DDCA 2VBCA 3PUZA 2ZRLA 1II9A 1LY1A 3CPJB 2WJGA 4K46A 1P75A 1JEEA 3DHWC 4NTZA 4Q1AA 2OXRA 1KI6B 1OE0A 1BYIA 2ANBA 1Q57A 1ZM2A 3NC0C 3OFNA 2ODBA 2XGJA 5FI0B 3O8DA 1SVMA 3DMDA 4P4TA 1P61B 3WYFA 4A0GA 1N5IA 2UZIR 3F0TA 5EXTA 1JR6A 4LJ6A 2JLVA 2GNOA 4TQAA 1QHNA 5DSZA 3WY9A 3A1UA 1IJEA 1VYUA 3EZ2A 1Z0IA 1TMKA 4G01B 1UKEA 2WJJA 2BEJA 3A6PC 1HV8A 4TMVA 5DI9A 1DPFA 4BZPA 4LK2A 1A82A 1N6LA 4YMUA 1SHZA 5FL3A 4CEJB 3CRRA 4DJTA 2FH5B 2NPFA 1E1RA 1YR6A 3TMKA 1MRNA 1JJVA 1MO3A 1N6RA 1OKKA 2FZLA 2PT5A 4G5OA 4QBFA 3V00A 8OHMA 5J4KA 4J0QA 1XZPA 4DLZA 5JSZB 4OHXA 2NO0A 4C0QC 2PZEA 1OYYA 4NPHA 2B7BA 3SDZA 1NKTA 4B6EA 2KB0A 5GADl 2QBYB 4LGMA 4PX9A 4RZUA 1MV5A 3A4NA 2DFKB 3ZD6A 2OBMA 4JLOA 2J45A 2OT3B 2O52A 1WF3A 4N0EA 3THXB 2Q0HA 3KXKA 3LBIA 1UBCA 2PH1A 3NIBA 4MRPA 4Q9IA 4DLVA 4QC2A 1NVWQ 4PSVA 2CMKA 2ZRDA 4JBXA 4Z1MA 4LX0A 3TAUA 4UNRA 2IF0A 1PLKA 3RS4A 2QROA 2ZR7A 2F43B 2QAJA 2J0QA 1U9IC 4M9ZA 3AKYA 4URZR 1EX6A 2BVNA 2D2EA 3H4MA 2CLDX 3NWJA 1PV4A 3EIQA 3BFXA 5KSZA 1KHTA 4B2PA 4LC0A 1CKEA 1OH5A 2HDNB 2C99A 1KO4A 3TSWA 1QF9A 4LJ9A 3LVQE 1NN3A 1TUIA 3X1ZA 4AIIA 5LD2C 2VSOA 1G3QA 4D25A 2XTMA 3OF5A 1US8B 1OSNA 3IDQA 1F3OA 3L0IB 2ZE5A 1ZD9A 3FKSD 4JLKA 3BH7A 3I73A 4PTLA 1GL6A 4NZYA 4ZKEA 4ZDWA 1DTSA 1HEIA 5JRJA 1NNEA 3F8TA 2RKOA 2OFOA 5L3SA 4LYHA 4BPBA 2GTPA 4L9SA 3U6BA 4B2LA 4LHXA 4WOPA 1P73A 4ILEA 1B23P 1II8B 3VQTA 1KGDA 1Q3HA 2ZJAA 2FFAA 5G40A 2AL7A 1KNQA 2WZQA 4N1AA 4A0FA 1ETUA 1NBMD 4Q9JA 1TNDA 2BOVA 4DCSA 4ZDJA 2D06A 2V4ZA 1TADA 4DCUA 4CEIA 5FPHA 1CLUA 1YR7A 2W6JA 3TLXA 1W7AA 1DVRA 2BBTA 1F2UB 1KSFX 3AVOA 3QE0A 1XTQA 5K8LA 2NOAA 2WAXA 3TRFA 1OH8A 4XWAA 1R6BX 1FP6A 2IXGA 1XEXA 4X8OA 1LB1B 2ZSFA 5P21A 4Q21A 3SFZA 2GEVA 2WAYA 2GA8A 2YOFA 3OIWA 4FMDB 3KX2A 1JPJA 5C4GB 1KO5A 1KOFA 3BFVA 2OFXA 3PEYA 3SBDA 1HY3A 4PFSA 5KOYA 2JLUA 3U60B 1CBUA 1G8GA 4YDHB 1P6XA 4AKGA 1UBGA 4EKDA 1G19A 2WKRA 5E7MA 4FMCB 2IYUA 4MITA 2RGEA 1HH4A 1UJ2A 2IA5A 2A5FA 5KYKA 3SJCA 1P2VA 2PJZA 4PPQA 1BYUA 4F7WA 1II0A 4LHYA 1XB2A 2JJ8A 1AK2A 1V43A 3GQBA 3RDPA 5LPNA 2FNAA 1M34E 4PO9A 2AN9A 2ZEJA 2C8VA 3K70C 4A8JC 2F3TA 4DCVA 5L3VA 1E2KA 5BN5A 3CRMA 3KQUA 5JWRA 1ONBA 4OQLA 1TL7C 3WRXC 5J47A 3U3RA 2ZRNA 3EPHA 2NQ2C 4HZIA 3PEVA 5H1YA 1KDOA 1F60A 1UKYA 2VQSA 3CRW1 4C30A 2J0VA 1XP8A 4M1TA 5DI3A 3UKDA 4XD7A 4EPVA 1MO5A 5CJPA 4TL6A 4KBGA 4DC9A 2F55A 3IGFA 1WB9A 1UM8A 3ND9A 5J4VA 2ZU6A 3U44B 3IIMA 3QF7A 3BD9A 3GEHA 2O0KA 1TU3A 5HCIA 1FTNA 1P9NA 1XFAA 2J41A 3ASYA 1SQ5A 1N0WA 2PZGA 2ERXA 4JLJA 1W1WA 4NYMQ 2P6NA 2XSZA 4V0LA 4V0ME 2Q9BA 1YR9A 2HLDA 2IC5A 3NBXX 4OJQA 5JECA 1GM5A 3THYB 4UJ3A 3B8HA 1XXHA 3I8SA 1R0WA 1VHLA 2ZRBA 1ZUNB 4CGZA 3OEEA 1A5TA 3RVBA 5J40A 4GL2A 1WQ1R 2OCAA 2ZJYA 2V54A 4QBIA 2FGKA 5EE5B 2O8DA 2CDNA 4KSCA 1VTKA 5FI1B 3AUYA 2J9RA 4FMDF 5BWMA 2GK7A 3FTQA 3Q5DA 3SYNA 2QE7D 2BV3A 1QG4A 4IW3B 2PEYA 4DZZA 2D3WA 3AVUA 4B2IA 4ITRC 1GWNA 1M74A 1OIVA 4Q1EA 1SXJD 5F98A 4W5HA 4ZDKA 2Z5FA 1KI8A 2AR7A 4XTCS 1TF5A 4IVQA 5FOSA 1A7JA 3GJ4A 3WYGA 5JJIA 3VNUA 4RD6A 2CK3A 5JJLA 4LJ5A 4AKEA 1BH2A 4IOKA 4KFTA 3U7HB 1NN1A 4CZ2A 2VP0A 3FWYA 2C96A 4TYPA 4CEJA 1P72A 2DHRA 2NMVA 1HYQA 2WOJA 1UKVY 3TVTA 4BLRA 3I8XA 2AHOA 2GETA 2BM0A 4Q5IA 3KXLA 2Q3FA 1QHYA 5JJKA 1ZM7A 1G7SA 2QNRA 2FPLA 4BFYA 4QOSA 4NYJQ 3VR6A 5JSZA 2BKEA 3W6PA 2J46A 2ZU0C 3VX4A 2NO1A 1K8RA 2QBYA 4RKEA 2ZUBA 5TB5A 4JIMA 2ODNA 2OLKA 1QHXA 2CXXA 1TQ4A 2HF8A 1VCOA 3AP2A 1T91A 4IDOA 2QGZA 1VCNA 5D3MA 4R98A 4DSUA 3THXA 4Q7MB 2B8WA 3OHMA 1XDBA 2YNMA 3FFAA 1XJQA 1OB2A 4PZZA 2CCJA 2CE7A 3SC3A 4JBWA 4ARZB 1OXVA 2KSQA 3A1VA 4P4UA 1UPTA 1YZKA 2QORA 2J7PD 1G8YA 1W44A 2F43A 1JAIA 2IHBA 4RJLA 4AKIA 2CL6X 5GVSA 2MSCB 4NU0A 3E1SA 4ZCIA 1XPOA 1E9DA 4M9XA 5GJVC 1EX7A 3IIKA 2J59A 3CRQA 3QXXA 2IS2A 3T1VA 2WSSA 2B92A 2FA9A 4GP6A 2P6RA 4LV6A 4A9AA 2ZJBA 4DIEA 2HYIC 1CEEA 1OFUX 4BECA 1W0JA 2J7KA 3T15A 1Q1ZA 3MJRA 4D4KA 5EE9A 1YRAA 3QF4B 1ODFA 2BCGY 2C03A 4LYAA 1NBME 5CIQA 2VRWA 5L3RA 3RRMA 1IN5A 1HT1E 1US8A 1AGRA 4Q4AA 2GJ8A 3HYTA 2F6RA 3WMEA 4HUTA 1R8QA 4MH0R 1BMFA 1XD8A 2IYXA 5AWFC 4V03A 2FFQA 4XH9B 1OW3B 3OAAD 3AV0B 4AYXA 4LPKA 1S2MA 4NCNA 3B1WA 4B6FA 3HR8A 1KO8A 2C78A 5JFGA 2XEXA 2RH5A 5DNYB 2EWWA 2X2EA 3R7WB 3ZLJA 2IEYA 2FE4A 4RD2A 2HJVA 1KO7A 1VMAA 5JZVA 4WBSA 3CX6A 3QI2A 1YZUA 3D3QA 3FMOB 3Q85A 4ZO4A 1U8YA 2ZM5A 3GLHB 3FPAA 3NKVA 4P3YA 3OEHA 3EG5A 1SKYB 4YC7A 5CYPA 1HURA 1T5IA 2RGNA 4QBHA 3KUCA 1WA5A 1JXOA 4BFVA 3U5ZB 4WZAE 2DPXA 3Q8XB 4BFXA 2CL0X 1IAQA 2R8RA 3KKMA 4L4UA 4AK9A 1YVDA 2W6ID 4Q48A 2WTUA 4HAYA 1IONA 3FKQA 4EPWA 1D2EA 1Q20A 4OK3A 2BMEA 4DEYA 2Z4RA 3NDBB 4GZMA 2YJTD 3A1WA 4IOLA 2WWXA 1J8YF 2HUPA 3T5GA 1G9XA 2JATA 2ZRFA 4Q9KA 3JZAA 3RS7A 4HYYA 2R2AA 3W6OA 1JEDA 2QZ4A 5LB2A 5KDLA 4Z51A 2R9VA 3CIOA 2O0JA 4DLUA 1ANKA 3REFA 1G1MA 1XTSA 3EPKA 4HLUC 1GRNA 2REOA 3KQKA 4POAA 1OB5A 3RC8A 4ZCLA 3AKCA 2A5DA 4XOIA 1KMQA 5FTJA 2ZI7A 4TMKA 2R44A 1W4CA 4JJZA 4OK6A 2DY1A 1H65A 2ZSAA 3CLVA 4PAMA 2H18A 2ZUDA 5TARA 4G3XA 1GOTA 2ZRKA 1NMZA 2D74A 4NYMR 3GLGE 1G5RA 1I4LD 3QIAA 3LQQA 4RSGA 1T4GA 3AGPA 5LBIA 1E9SA 3MCAA 3OESA 3ZIAA 2A3RA 3QKRB 2L0XA 3A36A 4BLTA 1P2UA 1RRFA 1G21E 2C98A 3QY0A 4H1VA 4LJ7A 4MRSA 5DISB 1NVVR 2ZS9A 1E1RD 5G41A 4TYYA 4LZZA 1ZM4A 1HTWA 2OCBA 4C7OB 1E2FA 5EXPA 3K70B 1SXJE 4RCYA 3ZGXA 3MAAC 5FOXA 3LAWA 3CH4B 3RLFA 2GCPA 4LBVA 4EFMA 5HR5A 1PJRA 3CB4A 3N70A 1WMSA 1YZNA 3ND8A 4KLNA 3THYA 1EG7A 1G18A 2V1UA 1KDTA 5AUOB 1N3BA 1DO0A 1TEXA 2AK3A 5KSYA 5GJCA 1GL9B 2Q9CA 2V1XA 3MG9A 1VCIA 5CYOA 5HPYB 4A4DA 1RFLA 2QMEA 4XTRA 1E2LA 3JZMA 4URUR 2V9PA 1EESA 1FUKA 1HE8B 3K53A 3CKLA 3L43A 2C5LA 1KK2A 2TMKA 4TLDA 1UDXA 2XOKA 4DLSA 2WJHA 4EFLA 4BFTA 1NN5A 4OBEA 4BGDA 1P3JA 3QKUA 2BKUA 5CDFE 4TL8A 2R6GA 2FN4A 2F1RA 3PG5A 3QJYA 3H0KA 2DFNA 2EFCB 5FUWA 4NYJR 2GK6A 1FL9A 2VO1A 3S1AB 1AKEA 1WDTA 3ZZTA 4DCNA 4ESHA 1R0XA 1E9EA 5CIWA 2NPIA 1HQYE 2Z6VA 1P2SA 3QXHA 1D2MA 2ZRAA 1YZQA 1MOZA 3GEEA 5KNCA 2QRZA 1UEIA 1TPZA 3CONA 4I4LA 2OAQ1 1Q22A 1X8KA 1D9XA 2C2HA 3TSOA 3VR1A 4A82A 4AY2A 4XVRA 1GNQA 4CIDA 1GNRA 3K0EA 4I81A 3K9LA 5FR2A 2EQBA 5FBRB 4IEIA 3AF1A 3H84A 4QJ5A 2XJ9A 3U2QA 4L9WA 1F5NA 3B6EA 4DXAA 2GBLC 1N5KA 4MUAA 1OV4A 1T3SA 1T8TA 3NVAA 4LJ8A 2O8BA 1V5WA 2QTFA 4OI0A 1EFRA 4JT4A 5L3QB 2H17A 1OXUA 1G3MA 1E0SA 1XMSA 3HU2A 4IFEA 4TQ9A 2IYLD 4W5JA 2V3CC 2P0EA 3K8YA 4OK5A 1L4UA 1VECA 3CNLA 4UNPA 5DYIA 3QNUA 3W34A 3A37A 1DAFA 2PZFA 2ASEA 4F4CA 2WPDD 3MSXA 5E7JA 5K8UA 3ZVNA 3EA5A 4MGIR 5DLQC 5DN6A 1KO1A 4LBZA 2I1QA 3DOEA 3ZVMA 4CW7A 4DRZA 5GVRA 4YXWA 1Z06A 2XZLA 4IEEA 1G3UA 3KKPA 4PAQA 4D6PA 1E79D 1Z47A 5UKDA 1UBEA 4HLCA 5BXQC 4FXPA 5CB8A 2FMXA 1VYVA 1ZINA 3HYRA 3JVVA 3LY5A 3ZS8A 2ZRMA 4C0LA 5JS8A 3FYHA 1KSHA 4OI2A 4G5GA 3U4QB 3T35A 3EC1A 3IUYA 3K0FA 3C41J 2UKDA 5EXSA 2PLFA 3IPYA 4HB0A 4F4JA 4PPNA 1ZBDA 1M2OB 3U3OA 2FGJA 4BASA 1S3GA 2VP5A 2A9KA 3GFPA 3HP1A 4KVGA 3T12A 2KWIA 3TBKA 1N2CE 4JLPA 2YWEA 4AYTA 1S9DA 1UBFA 2IYYA 4PO8A 4JT2A 1IY1A 3D31A 2Q3MA 1SXJC 1YRBA 4NE2A 3M1IA 5H68A 3U7EB 1Z2AA 2DFTA 2G0TA 2RHMA 2V7QD 2YWFA 3R7WA 4M1MA 1FUUA 2X1VA 1U98A 4ACAA 4LSGA 2JEOA 4BZQA 4EPXA 1RJ9B 3W3AA 2BBOA 1E9AA 3QKTA 4OQNA 2A30A 3VAAA 1AZSC 1E1QD 1DOAA 1NVUQ 4HAXA 1ZW6A 1D5CA 1Z2CA 2JASA 2HT6A 1GITA 1W4RA 4P32A 2A78A 3FMFA 3HU1A 1ESNA 5JCZA 3FOZA 1CF4A 2OHFA 5ANRB 3CNNA 4K81B 4QFMA 1FX0B 4MUBA 1W0KA 4EQ6B 2F1IA 3D8BA 3UWOA 2B21A 4ZPXA 4AG6A 4LDJA 3IBGA 3SJBA 2JDID 3CPHA 5ELXA 1NP6A 2WJIA 3UWKA 2WKPA 3CBQA 1VCMA 2A7QA 3RABA 5IHPA 3AVWA 2EWVA 1ZIOA 2R6DA 4B71A 2OBLA 1IOZA 3KJIA 3DKVA 2PCJA 1GL7A 4D82A 3KZ1E 3ZQJA 3GLIE 2ZR0A 5GJWC 4OI4A 1RC8A 3U6KA 2OLJA 4MKGA 3RS2A 4PPFA 3AF0A 5AJVB 2J5XA 3QXJA 1Q3TA 3DL0A 3LRPA 4YONB 4B3FX 4R2HA 1OLOA 3A1SA 3A4LA 1N5LA 4JYBA 3RS3A 3P32A 1QZXA 1AS3A 1CS4C 1PLLA 4UNSA 1COWD 4PSAA 2AKAB 1JB1A 2NTYC 2X2FA 4HAZA 4NCKA 3B9PA 1DEKA 3CF2A 4TLEA 2KBFA 4LHWA 1ZUHA 2GILA 2G1JA 4PHFA 4U5XA 1AA9A 2IBMA 1E2IA 4TT3D 2AFHE 5DH9A 4DSOA 3KDSE 2CK3D 4LI0A 4UKDA 3BH6A 2E87A 4TMWA 5F2EA 4JS0A 2VH5R 1T0HB 2HT1A 4DBLC 2FZ4A 3A58B 2QA5A 4BLPA 2ZITA 2HEIA 2BC9A 4OYHA 1N0VC 1H8ED 4Q66C 2I1VB 2VHTA 4C7OA 4M4SA 3BBPA 2ZSBA 5KNBA 1IXRC 2W0SA 1CRQA 1E9FA 2GVZC 2ZI6A 3CWZA 5FUVA 2PLRA 3CF0A 2Z4SA 4RZXA 3X1DA 1EFHA 3A4MA 3FMIA 4JVMA 3U3JA 3LA6A 4KODA 3R9IA 2ZAMA 2ZUCA 2O8EB 3K09C 3KUDA 1E2GA 1OXXK 1RW4A 4PXAA 4QNRA 1J8MF 2WWWA 3LWNA 3BC1A 1DS6A 1G6HA 2ZI3A 1KDRA 5C46F 1G7RA 2GF9A 4M22A 4H9GA 4Q7KA 4MRVA 2E1RA 2JIZA 2GAAA 1RIFA 1GTVA 1L7VC 2Q6TA 3GCGA 4E5UA 2ZYWX 4UQOA 2O8FA 1DADA 5HE8A 1EFCA 5IDVA 5IK2A 2OZEA 3O47A 4RD0A 2PX0A 3EZ6A 3VU9B 4A0HA 3KJHA 4HUQA 1SVIA 2ZVPX 1XU4A 2HCBA 5E4FA 5AJWA 1OHHD 4BRUA 5FH9A 1UDWA 2QAGB 5FTKA 4NBSA 3JVUA 5J5CA 1X6VA 2JJ1D 2WSSD 4RFSB 2OCYC 3RNLA 1QBKC 4FN5A 5TY0A 1TF7A 4EPRA 1F2TB 5EE1A 3RSLA 1U8AA 5EZ6B 4RZ2A 2GRJA 2CLCX 2OXCA 3UIEA 3IHWA 4PHGA 4QJ4A 2BMDA 2PEZA 1SHKA 1OT3A 1T3HA 1T5LA 1WCV1 1H8HA 3TQCA 1XX6A 1KY2A 1VG1A 1BMFD 2ZJ5A 1ZC4A 4G5RA 1R5NA 4JJKA 4PC7A 4PZYA 1N6HA 1GIAA 1LV7A 3B1YA 4JMPA 4MGYR 4C0BA 2Z0MA 2VP9A 4LUCA 1W4BA 3IPXA 2ONJA 4LJYA 4ASUA 4BUJA 4DLTA 5IRCD 4URVR 1UF9A 3QUSA 4LCBA 4XIGS 4DDWA 4AYWA 3G5UA 3C7KA 4WZ6A 4KI0A 4PQFA 3RS5A 1Q1BA 721PA 1DAMA 1GVNB 4LV5B 5E3HA 4DHEA 1YHNA 2QPOA 3K0CA 3OEHD 3C15C 4US2R 3W8RA 4BE7B 1N5JA 4PC1A 4DLYA 2IS1A 1W48A 1CRPA 1XMIA 1ZCBA 3HWSA 3RRZA 1JJ7A 1R5BA 1NY6A 4B33A 4NCJA 1KMHB 4LHVA 3VTKA 1NF3A 3UK6A 1XWIA 1PLJA 3L0SA 1DELA 4CDGA 2FDCA 3KXIA 3GD7A 1NY5A 1GDDA 2ZRCA 4TWZA 3U4QA 2VPPA 3AEZA 1TQ2A 1EFTA 3TVDA 1Z83A 2AFIE 3KJGA 5SZKB 1I4DD 2I3BA 2NIPA 1NIJA 3NG1A 1N6NA 4DDUA 1EWQA 1ZM3A 2VP2A 5EP4A 1M1YE 4V0OA 5M04A 2O8CB 4UJ5A 4IRUB 3ADDA 3PCRB 4EJSA 2C95A 2JLXA 2CNWA 3IQWA 2DB3A 1DAEA 1R4AA 2ZRHA 3ZS9A 3AH8A 4IVRA 4IOMA 2LKCA 3KQNA 1YR8A 5B30A 2IYVA 2C9YA 2V8OA 2GZAA 2WIAA 2GXQA 4DLXA 2YWHA 3SEAA 3UG7A 2WWHA 1RJ9A 3HR7A 4D4JA 3GLGB 2Q3HA 2VEDA 1Q1EA 2N46A 2OBNA 1YZTA 1N6OA 4IOJA 3TGPA 5FPTA 1MH1A 3OIVA 4UNNA 3PXGA 1KI6A 3CRVA 1WRBA 1P4SA 2DCUA 3SJAA 2BEKA 1KI7A 5FFMA 3LW8A 3GPLA 3EPLA 2XTZA 5G3ZA 4DSTA 4QNMA 3LQRA 4IDQA 4EQ6A 4TL7A 1E9CA 1QDEA 4NONA 1ZM9A 1SXJB 3Q3JB 2WJVA 4V0MA 1U90A 5EUMA 1XRJA 4B3GA 2FSGA 4WA7A 3TQFA 4HAWA 2J87A 3M6AA 1SULA 4MKFA 3W8NA 1WXQA 2OV2A 2QMOA 5JRZA 2J0UB 4HSEA 4TMZA 2CCGA 1J90A 1K5GA 4ON9A 1KJYA 5C1BA 1AJEA 3KKOA 4MYCA 1GFIA 3I3SR 4P0TA 4HDCA 4RVCA 4TLAA 3SE0A 2ZE7A 4JSYA 3FGNA 3AVPA 1L2TA 3GJ5A 1KSGA 2R6AA 1Z28A 2BJWA 4B43A 2IK8A 3C8UA 4B75A 2WKQA 4C2TA 4BWYA 3RRNA 5TDHA 2DFLA 2YC4C 1Z0AA 2EFHB 1E6CA 3LBHA 1EFUA 5FR1A 3WHLA 1NI3A 3CNOA 1TQDA 1NKSA 2VLIA 3V9PA 1X86B 1VHTA 1Z5ZA 4Z8YA 1M8PA 1KIMA 2AKYA 1ZVQA 3PUXA 4KHZA 4Q47A 4RFVA 2W00A 4RZ3A 1OIWA 1T0JB 3DM5A 3MFYA 4EPTA 4JLVA 3SS8A 3PFIA 3ZZUA 1M7BA 2ZJ8A 5DHFA 1YKSA 2GKSA 5DYGA 2CL7X 2FX3A 3T61A 2JJ2D 3TUJC 4XVUA 4GOXA 4V02A 2D7CA 5DIFA 1GKYA 2ZRIA 4YMWA 3HPRA 4QHSA 2PCLA 4Y0AA 3PENA 3KKQA 4JVLA 5EP2A 4PQYA 1W36C 3PQCA 4TTRA 1XTRA 2ATVA 4W7SA 1JALA 3ZVLA 3ADCA 1GSIA 1QVAA 1KK0A 3B2EA 1XTJA 3SNHA 2ZYTX 1E2MA 2O8EA 2XNDD 1XCMA 3RWMB 3NH9A 3NTUA 1FQJA 2ZETA 3X2SA 3T1QA 1NRJB 4HZUB 4B3CA 3FMPB 4JVNA 4ZIRB 3B1XA 1SVOA 4OKSA 4QBGB 4XVQA 3TR0A 2ZI9A 4PAOA 3FKSA 4Q4JB 2CHGA 3Q7PA 1U0HC 4UXHA 5EE0A 2JGNA 5JEDA 3THWB 4A92A 4B3DA 2FF7A 1PUJA 5CK5A 4BFSA 4E09A 1E9RA 3EASA 3QPVA 4G1UC 2ONKA 3TW8B 2VYFA 3VHXA 1ZAKA 3ONWA 4JZKA 1Z29A 1TX4B 4EAQA 1E4VA 2VF8A 3KTAB 821PA 4DVGA 2FU5C 4KJZA 2GHIA 2QAGA 2ZPTX 2ECKA 5J4YA 3FVQA 5HKKA 4C0KA 1Q12A 1OH6A 2FV8A 2A2ZA 4P4SB 3AVYA 4IXMA 2FPKA 1IN4A 2H92A 5LD2B 1NBMA 4MYUA 3UATA 1F2TA 1II8A 3B78A 2ZYUX 2C9CA 1JR3D 5FL7A 2WJYA 4KFUA 1FFHA 1CU1A 5LB4A 1Z07A 5CLLA 1RE0A 4LYFA 2R6CA 3OE7D 4V0KA 2Z83A 1XEFA 3M0EA 5AUPB 1AIPA 3GJ6A 4NYIQ 2G3YA 1F2UA 2JCSA 3G82C 1HT2E 5JHHB 1Q44A 4D0NA 4DUGA 4TYQA 2QMUA 5FBWB 3C14C 5FUYA 1SVSA 2N42A 1E96A 5FTMA 3J81k 3NHAA 2JLYA 5F9HA 4QKQA 1YJ5A 3SN6A 1D9ZA 4C9BA 3GLFE 1SKQA 2BCJQ 2DWPA 2P5TB 3I92A 3T34A 2P2LA 1GRRA 521PA 3RHFA 4KAXA 1A1VA 5F3WB 2WMOB 4AWXA 2CCKA 4NH0A 4HLQB 2WV9A 4Q9LA 2PMKA 3I4LA 2IYSA 3TK1A 4ZKDA 1QRAA 4TTQA 5KPJA 5LDDC 1T3LA 5KPDA 3MMPA 1XTKA 3C16C 1GKUB 1DARA 1O87A 3GMTA 4B35A 1IN6A 3OFND 3FFBA 1KMHA 2VHUA 2F3RA 4IFBA 1TU4A 1G64A 1EXMA 1Q1QA 4O2LA 4JLMA 3BERA 1J70A 2X77A 3G0HA 2OSBA 1PUIA 3GLIB 1TQ6A 2VP6A 2RAPA 5CM8B 5FOWA 1GZSA 2ZR9A 5AJXA 4TSFA 3B60A 3E5HA 5C2JB 3L8YA 4OHVA 3VMFA 3NEJA 1C1YA 4LRWA 2OO7A 1DAKA 3ADKA 3HDTA 3L0OA 2IYTA 4HAVA 4L15A 4PC3A 5BYJA 3ZZ0A 2QENA 3U3KA 3ETLA 2QSYA 3U44A 3LD9A 4QGAA 2Q21A 2R65A 1E2HA 1DAGA 1KDPA 1OKKD 1J99A 1K6MA 2QGNA 3EWSA 1MR3F 1ZRHA 4D4LA 4A8JB 3QKSB 2IHYA 1UADA 1N6KA 4Z54A 2NO6A 3WHKA 3Q5EA 2R62A 3K1JA 4LC1A 3EPJA 3CZQA 2ZSDA 1JPNA 1QHSA 4FI3C 4JKYA 3GLGA 3LX8A 3Q7QA 4M9QA 3QG5A 5EUQB 3R8FA 1Q0UA 3B5JA 2ZS7A 1JNYA 1QG2A 4MKHA 5JMTA 1E2PA 1KK3A 2JA1A 4KFRA 4DCTA 1S4QA 2IS6A 4B47A 1P60A 2AWOA 2NO7A 3B9QA 3K9NA 3MUFA 4Z1MD 1ZNWA 4Q1CA 3ADBA 4MYTA 3R9XA 3MD0A 3IIJA 1G5PA 1XCPA 1C9KA 3PV0A 1DO2A 3RANA 3WP1B
chains in the Genus database with same CATH superfamily
4MCJA 1M8JA 4PF1A 3BWCA 3U0BA 4UU8A 3E3NA 4KNWA 1U0LA 4G09A 2DX7A 4L3WA 1H93A 1OX4B 3WLNA 5BVHA 2CY0A 2F4NA 1VPLA 2ZREA 4OHZA 5LZ5A 4FR2A 4KMMA 3BK7A 1OGIA 3VSCA 1M1XB 3AP1A 3AP3A 5F5LA 4N18A 4MMZB 3I72A 4EJMA 3SHWA 2O3SA 4I14A 3IJEB 4F5EA 1F7UA 1L3IA 2YY5A 3DZ8A 2PKWA 4D43A 4YQYA 3VZRA 3W2IA 4DMUB 4R16A 2XGOA 3BSSA 5EP1A 1IPFA 4BIMA 3JAKB 1Z15A 1Z5OA 4P93A 3CT4A 2YC2C 3EW7A 4N01A 1PS8A 2YVAA 1ZKDA 2FSIA 1JIXA 5INTA 4MHTA 1JDUA 4Q18A 4MV5A 2XNSA 5JBQA 2O0HA 4ZODA 2G9VA 4GMDA 5C37A 2PBLA 4CT4B 3F5DA 3BTSA 4ILKA 1YQUA 2IBTA 4P31A 2RHOA 2FPUA 4C1BA 1YV9A 4CF4A 2OR3A 3FZQA 1XTTA 1LEHA 4TMTA 1U5BB 3N05A 2POCA 2C3OA 3IT0A 2OGWA 3VDXA 4EW1A 2Q45A 3U19A 1X8LA 1HYEA 4WVLA 1I01A 3OEWA 3SMVA 1YR2A 3ZBQA 1R10A 2GVNA 1T4CA 2ORYA 3E70C 2J7PA 3EXHA 4RY2A 1J7KA 4LZPA 2QNBA 4M9SA 4W63A 3DUWA 4H3KB 3V7NA 1N0UA 4KVAA 1F8GA 1IM2A 1HO3A 2Y05A 3FDZA 3S1SA 2B7CA 5FTLA 5DLYA 4KBYA 1GARA 1F7VA 5TT1A 3DEHA 1DNPA 2F90A 3GGPA 4MRNA 4E5MA 1IQ0A 4CM1A 1H8HD 1POWA 1P5HA 3PBKA 4J2OA 4IMPA 2DTEA 1G3IA 4R2IA 1XEXB 2EF0A 3C6XA 1CR6A 3IUMA 2EKDA 4YYZA 1SXPA 1VG9B 3Q9NA 5HFNA 3HXTA 2G70A 4ZT7A 3MCWA 1LDMA 3CLTD 1IMJA 1MKYA 2IYWA 2UZ0A 2X7HA 3QTBA 1BD4A 1CR2A 4KJXA 1JBEA 4OGKA 1WUIS 3GJYA 2V55B 3IJ5A 1K3TA 1I2BA 4HQ0A 1BMTA 5AKHA 5K8IA 1XMJA 4IDAA 1NMSA 4RESA 1Z6AA 2TMDA 4HDNA 1ZDMA 1BIFA 1DI0A 1GUZA 2Q2QA 1N2BA 1NQUA 2FFJA 3PXCX 2REXB 3PT9A 4UDNA 1TOAA 3T3IA 1F48A 3JQFA 3DEFA 5FEMA 3MELA 4NCXA 5E1BA 4KE6A 1MVNA 3QV2A 2FW0A 4JUFA 3O9MA 4YRJA 3SJZA 3ZHVA 4JL8A 3OP1A 1Z2NX 3ST7A 1CY8A 3RHZA 3RTCA 4BNDB 4TTTS 1WTAA 1FSGA 3GQBB 4UHCA 3EF1A 1OXSC 2Y99A 3WA6A 4IFTA 4IHAA 4BNIA 4QEDA 1LDBA 3OF3A 2Z9CA 4X1IB 5EKXA 2QNIA 3KOYA 3VDNB 1QDUA 1EUDA 4GOJA 1TO1E 3WIUA 3ZCSA 3CF4G 4HB2A 2ORWA 2Q1TA 2GXSA 1VLHA 3D6NB 1XQXA 4G1BA 4CIBA 1FMJA 3NUQA 2HNAA 4S1TA 1OFTA 4KXXA 2RG1A 2OORA 4E31A 5CBPB 2H06A 4FM9A 1XTZA 2A4KA 4AD8A 3BRCA 3O2SB 4G5XA 1CJSA 2NU6A 4MQFB 4R01A 3DBRB 1C2YA 5THXA 3PWKA 4BNFA 3ETGA 3ME5A 1G9TA 4CF3A 3G8DA 3B82A 2J5BA 1DAPA 2BEUA 2QD1A 1E20A 1YDFA 2IPLA 4G9EA 2C88A 4JCCA 2WF6A 4D2IA 4L16A 3GA0A 1M1YB 4MLZA 3WGOA 1P5RA 1J2JA 2BH9A 4XD7D 1OJLA 4B3HA 4BN5A 5IKPA 3QHAA 1E9VA 2W6IA 3JX9A 2RFLA 1JQKA 4CF7A 3L8EA 4V0NA 3RS9A 1Y1PA 1I7DA 4UUOA 3ZY2A 2V6MA 3CLRC 3EGWA 1URPA 1MRSA 3GRUA 4HEA1 1A4RA 3LXRA 3MJ4A 4LK3A 1N1EA 1CY1A 3RJMA 2XYRA 5JH7B 2F00A 1KYTA 3RWBA 2MHCA 2ACWA 1E2DA 3KSMA 3PF8A 1L0BA 3C6ZA 2VT2A 3BJIC 1K9VF 2Q1UA 1DAIA 1B73A 1Y7LA 2BZ1A 4ND3A 4OI1A 3T6KA 2Q5QA 1C8LA 1CULC 2N75A 2RGBA 2VCYA 3N59A 4JVSB 4W8HA 4DA0A 1ADBA 1NBIA 2GF0A 3IX7A 3GRPA 3UV7A 3HJCA 2RSLA 3H1PA 4FGSA 1WZCA 2ZATA 2BJVA 1JILA 2BI4A 2O8DB 1GNPA 1U0FA 5IT9A 4N12A 3LVRE 4TS4A 3ZJ4A 3CWCA 1ZWLA 3M4ZA 5H83A 3RWOA 2CKMA 4GXTA 1CNMA 4KUEA 4R0VA 1JQ3A 4J75A 1SKMA 3I9NA 1TA4A 2OUKA 3S2SA 1I2DA 5HE9A 3KB8A 5BY2A 3NHFA 2GWHA 4PVDA 1ZAYA 2VWHA 3V7WA 2H1WA 3S2YA 2LCFA 3BH0A 3BAZA 3VPDA 4H18A 1FW8A 1L9KA 1QS0B 3Q2IA 4DLNA 5LIRA 1KXJA 3Q9UA 3RRBA 2BFWA 5K8JB 4PSKA 2ENWA 1E3LA 5ALUA 4DT1B 2DECA 4X3PA 2EHJA 1LGYA 2HBYA 3OPNA 4MGZR 2QI9C 2JFUA 3ETDA 1NMXA 4O4JA 4YQZA 1AKYA 1FMLA 3ZWOA 5H4GA 4F2WA 3GAZA 4PZUA 4X65B 3GLIA 1ZK2A 2GD1O 2I1WA 2HSWA 3EHDA 3WP0A 1I3MA 1NMYA 1W2GA 3DR5A 4A0QA 2ZANA 4LOLA 5DHUA 3V97A 3B52X 1OASA 3M33A 4UHHA 1XYVA 5K99A 4GZLA 3VVMA 2GJSA 3PC4A 4I3HA 1ZD8A 3HABA 4F93B 1DC5A 1F4LA 1G3RA 1HXHA 1UQRA 2RCNA 4G84A 3CUTA 5EZ5A 5JV5A 1LX7A 1RXWA 4RLHA 2PG3A 2DBYA 4XIJA 2VSYA 1Y63A 1ZZGA 5FEUA 1RI2A 2JNWA 3IULA 3ZWKA 5IBCA 3PS9A 1Z6TA 1E69A 1GZVA 5JDCC 4FEYA 4GRAA 5GIOE 4WFKA 1CUZA 2VOJA 4BO6A 5JFOA 2RB4A 1NI5A 2KHZA 2QRLA 4G37A 4O2BA 4WEOA 3JATA 2GLTA 4W5NA 2OGSA 2EYUA 3E61A 4IIDA 1Y9JA 4O2RA 4YUYA 3OIFA 5B2ZA 4HNQA 1EP1B 2IUTA 1AY0A 1RZ3A 2B8NA 3TOZA 4MKIA 1MIOA 4MCAA 3GRKA 4OMCA 1ODLA 4D4GA 1JDJA 2J48A 1CUGA 2WIJA 5JH7F 2XE7A 5TIIA 2HJ9A 4F71A 4YIKA 1VGVA 1BGVA 2Q6IA 2ATXA 1N1MA 3AFOA 1HZJA 1NQ5A 3AR6A 1QTRA 3I5AA 4DVJA 1CB7A 1WOYA 2ACVA 3KQTA 4GDMA 1XD9A 3KHUA 3MJDA 1Q7CA 3OQIA 1Y8RA 1PU2A 16PKA 5JI3E 3B13B 4MLCA 3PLAE 1P0FA 4S0ZA 2I6FA 2WBLC 4MW1A 3A6HA 3K0SA 5L40A 2HFJA 2PKQO 3H86A 2ATCA 2FMUA 3KVOA 3PE4A 4J03A 2OQRA 1S89A 5A5GA 3SZLA 1IN7A 3DONA 3EX7C 5G1PA 1VZ3A 3IBSA 4BCBA 3GFFA 1OVGA 5DO9A 3LUFA 2OESA 3AUTA 3VPAA 4DLKA 1U04A 1LTQA 1GGEA 4IDCA 3N2EA 4PPGA 2UZ1A 4UU0A 5J43A 2DHQA 3OICA 1ZMBA 4CNQA 4ITVA 3KPUA 5KDOA 3DFKA 2PMDA 2XAUA 4GGOA 1WPXA 4W6QA 4IVPA 5EG5A 3TBHA 5CFPA 3AR2A 3IP6A 3ELBA 3C6QA 3OJFA 4X93A 3SZRA 3BOSA 1Z4LA 1VE1A 2J5KA 4EPYA 1FXWF 1KAOA 2E18A 1HI9A 1FZQA 2GBCA 4I8IA 2P6UA 1CR4A 1FP7A 2R1VB 4IO0A 4J7XA 4C0WA 4B3JA 3VC3A 2XKBA 1DDIA 3ZNNA 2UZ3A 5L3QA 4M46A 4LMPA 3ESCA 2XOXA 2OCLA 3ZHQA 1HDZA 1S0UA 4BC0A 5K8VA 4TLCA 2AOUA 2LKDA 3FHTA 4LJAA 4TZ0A 2DFVA 4NBRA 1LPMA 4E03A 1VJ5A 1M0TA 1J9ZA 1S9HA 1SHUX 4Z0TA 3CGWA 2ZXFA 3PE6A 4NJMA 4WN3A 4GOOD 5AQEA 4IG9A 2PAFA 4Q7JB 3F6EX 3HA5A 4WCFB 3V6MA 1S02A 3BIJA 1JSCA 4TN5A 3WGYA 1KFEB 1Y81A 4J0FA 3QENA 4E33A 2XVXA 1ZUIA 3HJRA 3W5SA 2I66A 2PXHA 1EVJA 2WJPA 3ZOKA 4DANA 4CV0A 1RIIA 2YTZA 2CHQA 3KZMA 4OFZA 2CJWA 3D4BA 5ALVA 3UYKA 3GCZA 2BGRA 1YASA 3OWXA 4EO7A 3LK6A 1YS7A 1JU4A 3V32A 4GQIA 3CA8A 2Y3IA 1YL6A 4X41A 4LN1A 5E7IA 3H2SA 1P5ZB 3O8QA 1TM5E 4JCOA 5DK4A 4YACA 1CQJA 5TGZA 1CWUA 3UMSA 5KYGA 4GM0A 2EVWX 1Q6YA 4BV9A 5DNDA 2C92A 4HQNA 3HR4A 4A26A 2RGXA 3OKCA 4LGVA 3KWMA 5DYTA 1QVRA 5KS2A 2QSZA 3DBLA 1ATZA 2WOOA 4B2YA 4D79A 3IL2A 2ZIXB 3AHHA 4JROA 1T5TA 4XWKA 2ZBPA 1U4SA 4YQFA 4NFYA 1SOUA 3KZXA 1CRZA 3EUWA 1KERA 4DCPA 1ZK0A 4ZALA 2IWHA 2O48X 3ETHA 2H11A 3JD1A 5A4JA 1UWLA 4NKRA 1IPHA 4Q02A 3V1YA 1FEZA 1PV1A 1JF8A 3DO8A 2D2FA 4Y6GB 2YHUA 2VXOA 4CG2A 1TPYA 2P65A 1Z0JA 1BJKA 2MYNA 4RHFA 5JAPA 2FFHA 4I66A 1XXHE 2DUUA 4FJ1A 2HXSA 3IVMA 4C4PA 3P5SA 3TTVA 4IL5A 1G8HA 3ZJVA 1NQTA 3NHSA 5CB6A 1FTSA 4ZU1X 4UMFA 2V65A 1MO4A 3U4GA 4C7KA 3PRJA 1XEWX 1T6NA 2C4WA 4K9KA 4WLFA 2IWRA 1VPVA 4DRXB 5KYTA 4QODA 5DASA 2IW3A 2RKWA 2GAOA 3JSAA 4KV9A 4M53A 4AKSA 3K0AA 2O14A 1HDGO 4ZRMA 3IO3A 3OD1A 5HZHA 4RPKA 2W8BB 4MK4A 3UFXB 4YRAA 4HB3A 1OU4A 2VHJA 4R31A 2HO5A 5D5PA 3VZPA 3BMCA 1VLQA 3SGLA 4A2WA 4BNMA 4YV7A 3JU3A 5JBIA 3MRVA 4FGZA 1NFFA 3U1VA 2G77B 3ZCUA 4P7GA 3KV3O 4MDFA 3CO5A 4OKIA 1UC8A 2H3EA 3CMCO 1FLAA 3RBVA 3T7SA 1KJZA 3IAUA 4REQB 1UP7A 2I5PO 4F5DA 2H8KA 2HTFA 3KEGA 1A5ZA 4OF4A 3WGUA 4CUKA 2EJTA 1EK6A 1FDTA 1MB3A 4H7DA 1Z63A 2EKZA 2BIFA 2DYKA 4YUZA 3CZRA 3KBBA 2D0IA 1G8MA 1ZY2A 3HBMA 5AD1A 2IH2A 4IDPA 1CJCA 1ZH4A 4IJKA 2FPIA 2OO5A 4XDHA 1EDOA 5C3UA 2VJQA 4DS3A 4D8TA 5JSQA 3O0DA 5CB0A 1L7RA 4WY8A 2OILA 1SQFA 1JU9A 4FMCF 2J85A 2XOKD 2EX0A 3WLOA 5A4KA 1Y33E 3GJ8A 2QT0A 4ZQIA 3V8BA 4EHBA 1M6WA 1WBDA 2QRJA 1SVKA 1JECA 1OCEA 2BHSA 1AMNA 2AD1A 1E4YA 3GMDA 3ROFA 2FG5A 2PRSA 3TZLA 3PQ2A 4C01A 2BMFA 4FWTA 2G67A 3PK0A 5B3JA 2D7DA 1SB8A 4RC9A 3LBNA 1G66A 1TUBA 2JRCA 3CN9A 4BMCA 5I5EA 3L6CA 5KNCD 1H8EA 3OPYA 4FC7A 5AM5A 1PK9A 2PYZA 2QTVB 1RJWA 3GBPA 4HLUA 4OYYA 4K8OA 4KWEA 4ECEA 2D00A 1N6IA 3Q7RA 1GRQA 4XWOA 1X70A 3BFKA 3RAJA 1E3WB 1DJMA 4ESEA 3I83A 1XRSB 1AB5A 1I5EA 3H9EO 2HA5A 4MW9A 4QPCA 1RD4A 4PZ9A 5E6RA 4NDAA 3PD7A 4KPYA 1XKLA 2YJZA 1H2RS 2VHXA 3JWJA 3EAQA 4DMLA 4DSAA 2PV0A 4KHPB 4FGLA 2I7CA 4XXHA 3FLBA 1E2EA 4K6CA 1W5TA 1XDUA 3OFSA 1A9TA 3HLYA 3NHYA 5F52A 1Z6YA 1KEWA 2XDQB 1PS0A 4WVFA 1X7XB 1G60A 5FV7A 4G2TA 4GEGA 2VJYA 4RZQA 3UW3A 1UWKA 2PUEA 1Z2DA 3JZFA 2F62A 3IKTA 1VL1A 3G2OA 4CI9A 4H6VA 3TPZA 2I4RA 4JIGA 4C87A 4X0EA 1ZBQA 3GJQA 2W48A 4LOAA 2Q9AA 1W9MA 3QPWA 1L5OA 1VMIA 4TZ6A 1RYNA 1AUPA 2CSXA 1L4EA 3VU9A 2CSUA 3UMFA 3KUXA 4XM1A 2WHEA 2O5VA 4UBMA 1MJGA 4H3VA 4QT4A 3KYCA 3OCUA 4DQXA 3DBHB 1A72A 3TI7A 2UAGA 3MTGA 2BMVA 4IV8A 1VIAA 1O4VA 1QGUA 4LGCA 3VC2A 4E2WA 4K3UA 5DM60 1A4XA 3DLIA 1FP1D 5BSWA 4QM6A 3OQJA 2A1UA 4FGWA 4RFSA 1L4YA 1IXZA 4K6FA 2VH2A 1Y3CE 3K0FB 2RGDA 4RA6A 3X1XA 4PZCA 2ZI5A 4CODB 1ZCJA 3BE4A 5EWJA 4PHTA 4B34A 1KZYC 4IS3A 2W6MA 1Q17A 1XAHA 5ALSA 1K88A 1XCGB 1VE9A 3VNAA 3QRWA 4BQNA 5KHAA 2Z8XA 1Z6XA 1M8FA 4HWSA 4BNLA 1IXSB 1VKNA 3K6SA 4YMTA 1HKHA 4CTOA 2I7VA 4HY3A 1DXQA 4LHZA 4ZJPA 1FYEA 2GM9A 5KJ6A 3T1OA 2JAUA 4LXXA 4X71A 4KBFA 2OB2A 1UFOA 3E15A 1A77A 1SNYA 1T9HA 4DMGA 1ZISA 1C1XA 1PTKA 4RAQA 4MVJD 2X15A 2AK2A 3F4LA 3IEPA 2KI5A 3Q7TA 5SZJA 3HCPA 2J6BA 1VYTA 3C3PA 2V7VA 3D6UA 3SHOA 3O4GA 5FQNA 2Z9DA 5I9BA 3AZOA 3RYTC 4PZLA 2VHCA 5EYPA 5L9AA 1IH8A 3JQ8B 2IIVA 2LPMA 3IESA 4C2UA 2P4HX 2I2BA 1BJRE 1KPHA 1ADFA 2XMCA 3K5WA 4DADA 1GZ3A 1KRHA 2ORIA 2XDAA 3U56A 4C78A 2QF7A 3QQPA 2P41A 5FWXB 1FXSA 1K97A 4K1LA 4P35A 3R20A 3I32A 4E14A 1UXGA 4FWIB 2YOGA 1W0KD 4GSLA 4MB6A 3O84A 4S0XA 3CCBA 1Y7IA 2BUBA 2EFGA 1PZMA 2ZIWB 4F12A 2V7UA 3CURA 4D9EA 1YO6A 4QAJA 1XR3A 2CUZA 5EESA 1O6BA 2WA1A 3M6XA 4MPRA 5KINB 4GOKA 4PX2A 4O2AA 4HGQA 3GXBA 4TTVA 1Y42X 1C4WA 3H83A 4V3BA 1T8PA 3R3YA 3IT1A 1PVOA 4JELA 3CPEA 4CCYB 3OC0A 2QXUA 1G20B 2JZNA 3NANA 4H4CA 4JJ7A 2VSFA 4X95A 5AI0A 5IH3A 3TR5A 2QM8A 2NYAA 5BYBA 1LF5A 5B6JA 3OZSA 1EINA 4IIJB 4QL3A 3C5HA 5CA0A 3WYCA 4AQDA 1ZU5A 4FLMA 4I1OA 1ZC3A 2FETA 1W4AA 3FYUA 3OEYA 5JNRA 2CHVA 3Q3GE 5B1YA 1N36B 1PT6A 2C0PA 4X6XA 3IBTA 3EEIA 3RU3A 2QD5A 5B58T 2BR4A 1IUKA 4E30A 5ABPA 3IQIX 1OH7A 1RRPA 2KQUA 2YXBA 4Q03A 3SX0A 4DQ0A 5KVAA 3VTAA 2QVXX 1R88A 4CM8B 4Q0MA 3HO1A 4WXRA 3EE6A 1ISHA 3GUUA 5ECGC 3MMZA 1MAAA 2HXGA 3VNRA 3R23A 4FMBB 1I7QB 1PQPA 1CJKC 1ZIPA 4Q4DA 4AN4A 2HK6A 4UE3S 3W5HA 3V4VB 1QHHA 5CK4A 4QUDA 3I3OA 4CVNA 3P9CA 4BFLA 4MR9A 4DV1B 5F5NA 5L45A 3LNCA 1D7OA 3K16A 1I7SB 1PI3A 1Y82A 4F21A 1PGQA 2JCBA 2ZQZA 4G5SA 4PV7A 2QKYA 2HDHA 1LH0A 2GPJA 3WLMA 4ZP1A 3OECA 4B73A 1T6YA 1KC1A 3AJ8A 4C29A 1IJFA 1ZNZA 1YTUA 3AUXA 3EBOA 1JI0A 1JIJA 1A04A 2I2CA 1U1CA 2JHAA 2IYQA 4CR8A 1SXJA 3H16A 1ZICA 1Z08A 2JLQA 3KEOA 3W4JA 4H1WA 1JKFA 2QAGC 2WVJA 2HH9A 3KQQA 2OC4A 3K70D 5JAQA 3PXXA 4N5NA 5ED0A 4DYHA 4DQKA 3L6DA 2EFYA 5HUQA 2GXAA 2O3JA 1X7ZA 2Q4TA 3NDJA 3W2HA 1XZEA 4JEHA 4KPGA 5H70A 1RLUA 2MU1A 4ACBA 3I5UA 4OFWA 5FWYB 3B53X 2J30A 3C3CA 3LZ6A 1JMKC 5D01A 3ZVRA 3GLVA 2PZLA 1K6EA 3QLUA 5JALA 4H2DA 4HUQB 2PUJA 3RVLA 3WDKA 2I3ZA 3NGMA 4M98A 2H0AA 4PG7A 4HQ6A 4R1TA 3SXPA 4R81A 3I04A 1XZ8A 3GT4A 3BWBA 3PUJA 4PCUA 1YJBA 5JVDB 2C04A 1DO8A 3H4TA 3AKEA 2VRCA 1YBVA 2EWMA 3MWFA 4U9UA 2H63A 4QOIA 4F0JA 2F17A 2QX9A 5K0BA 2ZSIA 5CB4B 1Z4MA 3AXTA 3KEMA 1EUCB 4GRIA 3ROZA 3VR3A 5BMVB 3KYDA 1PL7A 4WIAA 5F3DA 4HQRA 4ZA2A 4BO3A 1M2GA 3B85A 4KB5A 3DB1A 3TZQA 3A26A 3VM6A 1IEWA 2RHJA 3MGAA 1XF9A 4QU8A 2UUBB 5K3FB 1SFRA 2NX2A 1R6DA 4J4BA 1C9JA 2ADFA 3TIVA 4I99A 1J5EB 1WCWA 4QJ3A 5KNCH 1XK7A 3CUWA 1N2XA 3K9WA 3R9KA 2WW8A 3T9BA 2X6RA 1TA0A 4TWBA 1R4MA 2ZAGA 5AYVA 3VUEA 2ZBUA 3G13A 2ZM6B 1E3EA 7MHTA 4FOTA 4IDGA 3PXBA 2AXPA 2YY7A 2F7SA 1OPXA 2DUJA 3X2FA 3MT0A 4FCVA 1EK1A 3CF6R 4G4SO 2CVHA 4G36A 1SEPA 5TQVA 1E4OA 5HM6A 2XGGA 4S04A 1XQWA 1TVKA 3RSZA 1KMMA 1U0SY 3IE2A 1T4BA 4KXMA 4L8LA 1KEKA 1CJVC 1WEHA 1IY2A 1U8UA 1NM5A 3N6RA 3P94A 3WNVA 2PRKA 3F5FA 5EHNA 1GG2A 3FG9A 2D4HA 4MRMA 2W4IA 3WI7A 1X38A 2AYXA 4YJ2B 1Z6PA 4B6PA 4YPVA 1GPMA 1GUDA 3QOFA 5EPEA 5JO9A 1FS4A 3TBFA 1AA6A 1TMOA 5EJMA 4JU8A 5F1YA 3VSDA 2ZWAA 2HF7A 2QPTA 4LF5B 3BTVA 3NDRA 2NV0A 3LK7A 1PEKE 3GJXC 2E49A 2V7EA 3C74A 1E98A 4CUZA 1O5TA 4I4IA 2D6FA 4US0R 1B0AA 5ES4B 2C3YA 5IKMA 1K7XB 1QKIA 1XWFA 3T7RA 1WZIA 3AMVA 3M3DA 2H1CA 2AE1A 1M2JA 4F3CA 1P6QA 4OIMA 3ROGA 5AVZA 3D9QX 1FLVA 3OURA 1NPYA 3Q98A 1A0OA 3WKBA 2WVAA 3TUIC 3ETCA 1VE3A 3LVFO 2VT6A 1IJKA 4O0MA 2GOYA 4B8WA 3ZD8A 4MS1A 5ECDA 1BWRA 1JAHA 1OFIA 2GRAA 3N0WA 4CRWB 4OPMA 3JQ9C 4Y2XA 1ZX1A 3IQXA 4KCGA 1BKSB 1D4FA 2EIXA 2Z2IA 2P8JA 4U02A 2YFKA 1Z7GA 4MPTA 4GGMX 4K03A 1N2CA 3H6GA 2AF3C 3PYLA 2PGDA 5CB4F 2O2HA 3R75A 5BMVF 5KTKA 1Z0ZA 3U7FB 4UMVA 3U4HA 4BNVA 1NYTA 3BD6A 5CCDA 3CW9A 4CKYA 2XUPA 2H3HA 4RPGA 5E0OA 1XLWA 3TIFA 3W9YA 3WIVA 3FPEA 1UEJA 5LMUB 4D4MA 1O1YA 1W34A 1C81A 5EKSA 3ZPXA 1L7EA 4M21A 1RI3A 2XITA 1N2ZA 2XT6A 3IUPA 3UUEA 4NU6A 4AG3A 5EJ6A 1PQ4A 1II9A 4MVJH 4CG3A 1L3CA 3QBJA 3ESYA 3OBIA 1MO2A 5G4LA 3X1MA 3ZK9A 9MHTA 4QUEA 4RVGA 1VBNA 2YV4A 2YV2A 4Y2JA 4G1FA 1RQGA 4PYLA 5IG2A 4G5FA 4UHBA 4KIUA 2YJ6A 1P77A 4J1QA 2YMLA 1NVEA 3ZWNA 2MINB 3OPYI 3ID6C 3NYQA 3FVVA 3DMDA 3C3JA 3KYJB 1P61B 4ZYLA 2FX5A 2K6GA 4G6ZA 1QH8B 3GROA 1N5IA 2UZIR 3HB7A 4G8CA 4WX2B 4ZZ2A 5BSUA 3ZLBA 1G55A 1U1GA 2HPZA 5EXTA 2DGDA 5DOZA 4UTVA 2Y1XA 1KF0A 3IP7A 4I50B 2JLVA 2FQ1A 4E88A 5DSZA 3Q10A 2Q2WA 3I9LA 2C4UA 1X1EA 1JN0A 1U1DA 4UCXA 4EL5A 1GUYA 4FJ0A 3RTBA 1TMKA 4N0MA 1M0EA 4DY4A 2QJRA 4O4IF 5CYFA 4BZPA 4DNXA 4L02A 4YP0A 1N6LA 3AR9A 5FL3A 2Y71A 3CRRA 1R15A 2H4YA 3EFOB 2HB6A 3PHCA 5I7HA 2FH5B 1GPDG 1W29A 4QBFA 5FD8A 1TIBA 4G5OA 4MP3A 4R68A 3V00A 4EB8A 1QTNA 2O8NA 1SCBA 1EFDN 1FJ2A 2A0KA 3DKKA 3GPCA 1IY8A 3HCBA 1T8YA 3V7UA 4DLZA 3ADOA 1CQIA 1IWPB 2PZEA 2WWTA 3FJ1A 1UQUA 3SC2B 3SDZA 2KB0A 2C59A 1SD2A 3SIPA 2HIAA 1N2HA 1Q15A 2X8JA 1FVOA 4LGMA 2YMPA 1MV5A 2COUA 2X4DA 4C2AA 1FRFS 3L4BC 3ZD6A 3GAMA 3FAZA 4EARA 5J58A 1NVMB 3F98A 4FE7A 1CUYA 1H42A 2A7XA 2XUHA 3LBIA 4JJ4A 2J3KA 1U6JA 2V5AA 3NHWA 1S6YA 1UBCA 3TIXB 3B1FA 3DE2X 5C8DA 1QIIA 5IAEA 2Z1DA 4C7VA 1DFIA 1BHSA 3ZV7A 5HUJA 1RT9A 4YALA 2JGKA 3ESXA 2CMKA 2VJKA 1UMBA 2QD3A 2ZRDA 3SZMA 5DNCA 1C8BA 1M83A 3RS4A 3GPDG 3QPAA 1OFVA 3TSAA 2QAJA 3K1YA 3NOXA 3OQ1A 1D2CA 3AKYA 3KV1A 2B82A 2D2EA 1RC1A 3HJHA 2CLLB 4CTNA 1LU9A 4Y1GA 3RV3A 3Q8MA 4TVKA 1SC3A 4YI5A 5LCXA 2EZTA 4AZ0A 4W1QA 2R8BA 3DMTA 3IOCA 4LC0A 2QM0A 1Q0ZA 3JAWB 1OH5A 1YMUA 4J7AA 3PDJA 2XRZA 3B6KA 4LQ4A 3ZBPA 2C99A 4QPDA 3UKOA 1KO4A 1OX4A 2QZJA 1NP3A 4RGVA 1B8PA 3W7VA 4I2VA 2Q4DA 3OD5A 4LJ9A 2J4FA 3INTA 3KR2A 3G0OA 4ND8A 4UUNA 5LD2C 1HEYA 4GHWA 3EXFA 2DHDA 5DVZA 1OD6A 2WFZA 1DMRA 2OZKA 3JWEA 5MHTA 1US8B 3EHEA 4IO1A 2A3NA 1RXCA 1QGED 1OSNA 2E6UX 2IHVA 3L0IB 4I50F 1KDZA 2ZE5A 1EPUA 1MEJA 1MJHA 1QC5A 1R66A 4F2DA 5HSGA 3FKSD 2VPIA 4OREX 3BH7A 3JAKA 4WDRA 3A25A 1TVMA 3IAEA 1U65A 4KGZA 4ZKEA 2O07A 4DQDA 1DTSA 2QZPA 1XKXA 3O95A 3PX2A 4DZRA 1ND6A 3WL4A 4TLMB 1I6KA 3AUFA 1EJ2A 2OFOA 2RK3A 3FCYA 1DRUA 3P9KA 3ILVA 5FHQA 4BPBA 2VAPA 3U6BA 4L9SA 4ALJA 4B2LA 3QU2A 2PFKA 1XV5A 3IUEA 1B8VA 3R4CA 4WN9B 5BWBA 3ZHOA 5AW7A 1UWVA 3BL8A 1P73A 4UM8B 2FHSA 3L1JA 4EG0A 2QXTA 5HHTA 2DEUA 1I33A 3FF1A 2HMTA 3GGOA 5G40A 2WZQA 2W2PA 1H0SA 1RWVA 4W5RA 3HDJA 1CY4A 4Q9JA 3FNGA 5BW5A 2QIPA 5LR6A 3FSGD 4K8RB 5FJJA 1OZHA 4DDMA 1CDEA 3QY9A 2W6JA 3WV5A 1W7AA 3AM3A 2QWXA 5A0VA 1F2UB 3QE0A 3CUSA 1X94A 3QHPA 2C8JA 5K8LA 2NOAA 1IBLB 1E2BA 1OH8A 1EWYA 1TYAE 1XEXA 2D54A 4X8OA 3CX3A 3GH1A 1MJFA 3MJSA 3NCTA 2ZIEA 3VZDA 4Y2UA 1QCZA 3MM4A 3SFZA 5K6TA 4P2BA 2WAYA 2Q5HA 2QOEA 1T5OA 3MBOA 1BZYA 3CFYA 4BO1A 2OKGA 4UTOA 4PY2A 1KOFA 2OFXA 3PEYA 2B3TA 4PFSA 3M6FA 3ZGNA 4BQSA 2JGJA 2BRUA 2UVPB 5KOYA 3MB8A 2QYOA 1V9SA 3AEXA 3QBDA 1CS0A 3EXEA 1X9HA 5M29A 4BZWA 1FBNA 1CZOA 3DGFC 2RGEA 2WUFA 5HIJA 2IA5A 4IIUA 4AECA 5KYKA 3SJCA 1PJCA 1B1CA 4ZCSA 2JJ8A 1EZZA 1AK2A 1V43A 1V26A 2Y1WA 3BWXA 1E89A 5DPMA 2OMKA 1C9YA 3GQBA 4BNDA 4ZK6A 3RDPA 4HNHA 1VSTA 1Z5NA 5JAHA 2VUUA 2ZEJA 3PUKA 1X1QA 4HFNA 1MA3A 3CRMA 4K6MA 4JBHA 4EHJA 3WRXC 5J47A 1FK8A 2CLEB 3MBIA 4Y30A 3EPHA 4MR7B 3AUUA 1LPBB 4Q3CA 4WECA 5T67A 1T2CA 2XMSA 2QGFA 3TVYA 5CD9A 1QR2A 2J0VA 2O2ZA 5HZMA 4YCNA 1NONA 3V4RA 4FILA 2NNLD 4MQFA 3FVTA 4HWGA 4EPVA 3DNPA 2ZW9A 4TL6A 4RBNA 4Y6PA 3NWOA 3MJFA 1GAQA 3A31A 3I1YA 1UM8A 3QKIA 4YXFA 5J4VA 2ZU6A 3QKWA 2P9JA 5ED4A 4WKCA 1KZ6A 4FHDA 3ZHYA 2O0KA 5B7GA 1NQAO 4Q9DA 1VHJA 4IWYA 2P69A 4NBUA 4Q16A 2XXJA 1P9NA 1TRHA 4FFDA 1T9GS 1F1JA 1SQ5A 3ASYA 4HYEA 1M0WA 4KMOA 3RG2A 1KZ4A 3OMLA 4C4RA 2XSZA 1B7GO 1U3TA 2RH9B 3N86A 5DHQA 4TVOA 1WUTA 3TNJA 3NBXX 4K3VA 4OU5A 2L17A 4NNJA 3SSNA 4RPHA 1N3YA 3DPSA 3B8HA 4E5KA 5KMGB 4B1FA 1VHLA 1JHZA 4CGZA 1M5UA 2WD9A 3OEEA 3NNSA 3ZJ5A 4N5MA 2WD7B 2YYYA 4QBIA 2O8DA 2FGKA 1QCYA 5AIAA 1OAOA 2CDNA 5ITWA 5CFMA 3GRRA 3I9V1 5FI1B 3O3NB 5E1DA 3DQZA 3W77A 3L04A 3PXDA 4PS0A 3IVRA 1OGJA 2HM7A 2J6IA 3HZOA 1NT2A 4IW3B 4KR7A 3ZK8A 4JC4A 4I9FA 3PPWA 3REQA 2C97A 1F0PA 3GB9A 3KOXA 4G4JA 4B2IA 4JI8B 2B34A 3AHJA 5HOQA 3E7XA 3CXUA 3PX3A 4ZDKA 1F4PA 4IUCS 1KI8A 2AR7A 1TW2A 2J6CA 1DJOA 3FHJA 3WYGA 3KS9A 2AFRA 4RD6A 3CINA 2CK3A 1GT91 2IHZA 1FBTA 3WADA 5AOBA 3GCXA 3U7HB 4CZ2A 1QOPB 4TYPA 3LZCA 4KXNA 1OXMA 1ZJYA 3TD2A 4CEJA 1UJCA 5JSKA 2DHRA 2VXBA 2IBSA 3OJ0A 1J07A 1EGHA 1SRRA 1E5LA 4XCVA 1A9OA 2I0FA 4TMFA 3I6BA 2AHOA 2JKYA 2LD4A 2QHXA 1GZ5A 1XKTA 2A9VA 2O4UX 2PVCA 2E55A 3KXLA 1QHYA 4PTYA 3GP5A 1O57A 4B0OA 1D2GA 3D8RA 1AMUA 5JSZA 3FUCA 4C3VA 1O95D 1R1DA 1MX1A 2BKEA 3UNXA 2B69A 2ZU0C 4JWKA 2VHYA 5D85A 1KS9A 3VX4A 5JZSA 4RKEA 3LIPA 3DZJA 1MX9A 1QF7A 5TB5A 4WOBA 3UMBA 2ODNA 2ZBFA 3RJ5A 3TLBA 3P19A 3ZDXB 4KQHA 4M60A 4C4OA 5DK6A 2QGZA 2AJLI 5FIUA 5G02A 1C7FA 8ATCA 2HYIC 3NVKI 2HHHB 4DSUA 1JKIA 3PT5A 3TD9A 2TMGA 1XDBA 2HKIA 2YNMA 1XJQA 3FFAA 5HK8A 3RH0A 5T4HA 4BX3A 1WETA 4D9NA 1YVRA 1A4IA 4PCAA 2B7LA 3LY9A 4QATA 5B55A 4N49A 2BFEB 1M2VA 2KSQA 1UPTA 3OU2A 5IPFA 5GIPE 1GPBA 4MPDA 4IPTA 4YAEA 4RJLA 5KOHB 2IHBA 5FBZA 2VJMB 4CM3A 1MQ9A 4NU0A 3E1SA 2A14A 2R11A 5E2IA 4GOND 3ROKA 3GCWA 4TXLA 4D3SA 1D03A 4EOGA 3ORRA 3L79A 2W6NA 3C4QA 3F97A 3RF6A 4CKBB 1GUBA 2WSSA 2FUG1 2FWMX 4LV6A 4P3PA 4MVJI 2AFVA 2ZJBA 3DGEC 4ROTA 4HH1A 4BECA 4DIEA 1W0JA 2LBPA 4FGJA 5K2OA 4F4HA 4A10A 4D4KA 2GUGA 4L0DA 1P7YA 4FUTA 4L7VA 1QB7A 1QOQB 2NUTA 1YI8A 5AKEA 2O23A 2VRWA 1LK5A 5L3RA 5TQ2B 4A0SA 1UC9A 3ZWCA 2FQQA 4DA9A 3LUCA 1U11A 1QMGA 1C0LA 1ZGBA 2XECA 1AGRA 4FYMA 4OUKX 3HYTA 2AC4A 1BVUA 4WGFA 3OHPA 3B51X 4G5HA 1WR8A 4BNYA 4DA4A 4L57A 1YFLA 2BKVA 2BGIA 4NPAA 5BSRA 4QLBA 2R5FA 5F78A 3QVSA 3AV0B 4EY7A 4DGSA 2J4DA 2WYVA 2A9JA 4AYXA 4G0WA 4WBXC 2N3ZA 5JFGA 1U8CB 4UM9D 1HE3A 4K6HA 3EEQA 2RH5A 4Z9FA 2EWWA 3MMXA 1Y8ZA 3R7WB 1K68A 2EEZA 2REQB 4MR8B 5DNWA 3D8TA 1K3FA 2R1VA 3OTGA 1OOEA 2HO4A 2X22A 4J0CA 3TL3A 1Q1NA 3DDSA 1T0BA 4D44A 5FNVB 4ZO4A 4OGGA 3WRYA 4X85A 1U8YA 1RYEA 2HIMA 2I7TA 3BWEA 3FPAA 1P1FA 3IPRA 3NKVA 4JQSA 2AYZA 2ZQYA