2EVWX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with r-caged gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title A newly designed microspectrofluorometer for kinetic studies on protein crystals in combination with x-ray diffraction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2evwX00
2R2AA 3DL0A 2QN6A 4EIWA 3EX7C 1EXMA 5FTNA 1GNQA 5JHHB 4YONB 3VKWA 2IYUA 3AUXA 2F9MA 1DG1G 2IYRA 4XJXA 1C1YA 4D4JA 1J70A 2W6ID 3N2IA 3IDQA 2DWOA 3KUCA 2VF7A 3AKDA 4PPQA 2QMUA 4BLOA 2QU8A 2B8TA 3DMDA 1NF3A 1SVMA 2EFCB 3T5DA 2NGRA 2E9SA 3NC0C 2IC5A 2LKCA 2WWHA 3CH5A 1XCGB 2PCLA 4Y0VA 3R9WA 2FZ4A 4E22A 4B44A 3SJZA 2JLZA 4DLWA 1N5IA 4ZPXA 2HV8A 3PENA 3A4NA 2BEKA 4DKXA 2PLFA 4GL2A 3QF7A 1OIVA 4OI1A 2JLVA 2P67A 2R8RA 4IXNA 4OHWA 2ZREA 1OXTA 3TW4A 3ZYCA 1IBRA 4FMCF 4MYTA 2IEYA 4DWJA 3TVTA 2REXB 2WWFA 3IPYA 4PO9A 3NTUA 3NXSA 3B85A 2J87A 4GI7A 4ZKEA 1G3MA 5HZHA 3KXLA 4LCBA 4W5JA 2I1VB 2ZE5A 5E95A 5EE9A 4Z54A 5FUVA 5E3HA 5IK2A 2YC4C 4WOPA 3FOZA 3AV0B 2JJ2D 2L0XA 1E9AA 2ANBA 1E32A 4GNKA 4TYQA 1JJ7A 4HAWA 3CX6A 4HAVA 4V03A 3RRNA 4AURA 4UXHA 1KKMA 3H86A 3DM5A 2J0QA 1R2QA 1EX6A 4KJZA 2RGBA 3VR2A 1U0HC 3AVWA 2BV3A 5FOTA 2V3CC 2ODEA 3MWYW 3K70D 3EC1A 3BE4A 1D2EA 1SHKA 2ZRFA 2IUTA 1TEXA 2GJAA 2OCAA 1ZINA 2WAXA 2ZAOA 5C2JB 1NY6A 2GK6A 2RMKA 2XGJA 3QXHA 3TW8B 4XOIA 2YINC 3HR8A 5F2EA 2XNDA 3ZD6A 3SQWA 3R8CA 5JI2E 3WRXC 1W36C 2A5FA 2C99A 2CL0X 3QVVA 1DO0A 1GIAA 3EWAA 1U98A 1RE0A 3MRSA 4LHZA 2VHTA 1KK0A 1NL3A 5FPYA 4L5BA 4C4PA 3V4FA 5E4FA 4OK6A 3PQCA 2ZRNA 1RZ3A 1L4YA 4IXMA 5FPHA 3FMFA 4D6PA 1XBTA 4NTZA 3QPUA 1Z0AA 3MLEA 4QRHA 2ZYTX 2NPFA 3K0FB 2GKSA 4RD2A 2FEMA 2VH5R 5FTJA 2B6HA 4DUGA 1XX6A 2GJKA 3GLIA 4BUJA 1E6CA 4TMWA 3CB4A 4Q19A 1ZM4A 4A82A 3HYRA 4AYXA 3RS0A 4IHQA 2QPAA 4H1VA 1VECA 4IOJA 1N6NA 4B47A 1YR8A 2ZJ5A 4OI0A 4Z1MD 2R6FA 4LJ8A 1NVVQ 1EFCA 1S0UA 4J0QA 3AVPA 4KLZA 3KQKA 3VR4A 3CRMA 5J47A 1R0YA 2D7CA 2MSDB 3SU8A 3K0FA 1QHSA 2WSMA 4QL3A 1ZJ6A 1A2BA 2GHIA 4F7WA 2P6RA 4EFNA 4HB0A 5KSZA 4XD7D 1S1CA 4PX9A 3OESA 5K8UA 4KXFB 2WWYA 3VR3A 2C95A 1U8YA 3TIFA 4W7SA 3IIKA 4BLQA 4ZCLA 4RFSA 3RNLA 3DZDA 3P27A 3MMPA 3AVTA 2OM2A 3FMOB 4BLTA 3GMTA 2IL1A 4YXWA 2R6CA 4HEJA 1ZW6A 1N5KA 4LWZA 2MMGA 5LB4A 1VIAA 1Z0FA 4D0NA 2C03A 1S9DA 4B74A 4QHTA 4EPRA 5L3VA 2E1RA 4MKHA 4QBFA 3SS8A 4DJTA 1KI9A 1KO4A 4HLUA 4TTQA 4BFTA 1G7CA 4Z51A 1BIFA 2PEYA 2I4IA 3CRQA 2AK3A 5F9FA 1E2MA 2IEZA 4DLUA 1XF9A 1GVNB 5KNBA 4PC7A 4QGHA 2GXSA 4PHHA 1C9KA 2Q3HA 3P26A 2VHJA 4EQ6B 4KHZA 2O8EB 5IT5A 4I99A 1ZNZA 3AUYA 3NDPA 1RRPA 1UBFA 3NH6A 3A58B 4O3MA 1A2KC 4JLJA 3A4LA 1IJEA 3FWYA 5DN6A 2BJVA 3R8FA 2QQEA 2J46A 3K0CA 2F7SA 4LJ6A 2YWFA 2JLWA 2IS4A 4V02A 2HYIC 5EP3A 1OHHA 3VMFA 3QXCA 5H8WA 3CW2A 4RD0A 5AJWA 1YR9A 1Q22A 3BOSA 5F9HA 3P4YA 3K9HA 4FWTA 1IY1A 5FH9A 3DZ8A 4JBYA 1G21E 1P62B 5GJCA 1IHUA 4JSYA 4M22A 5JJIA 2HXSA 4AD8A 5BYKA 3BS4A 1G8PA 2HEIA 1UKEA 1CR4A 2C9OA 4PHTA 3K53A 1P7CA 121PA 4R7ZA 2IYYA 3PFIA 3KX2A 5L8VA 3BH0A 1ZD8A 2CEAA 3I73A 3SOPA 3VTKA 2ZIAA 3AKCA 3ZQJA 2HT6A 1TMKA 1W0JA 1E0SA 4LGMA 2D7DA 5CDFE 1FQJA 3CO5A 3KKOA 5IK2D 2A5DA 2YWEA 4S35A 2G0TA 4JJZA 1OH7A 4LBVA 1N6PA 3NKVA 2VSXA 3PEYA 4QHYA 3OIUA 4C0QC 3FTQA 1G6HA 1Y3AA 2ZU0C 5AJXA 2QAGB 5JS7A 2IUUA 4LHYA 1Z22A 1LW7A 2ZS7A 5CLLA 3KQNA 2IXGA 4JL8A 4B35A 2QMEA 2J41A 3FE2A 3BXZA 4M2LA 1FFHA 4V0MA 4AKIA 1OH8A 4HAYA 2ZSDA 4NONA 3PEWA 1G7SA 3FHCB 5J4LA 2XNDD 1T0HB 4CRWB 4N0EA 1IN4A 5FOSA 5M04A 3DVLA 4TLDA 1AIPA 4GP7A 4A0FA 2WJHA 4MRRA 5L3QA 2ATXA 3T12A 3VKHA 2WIBA 1W48A 2ZRHA 4LC0A 3IUYA 1M34E 3DM9B 2GCPA 3EIEA 1ZM7A 5G41A 1GRRA 1HEIA 2YC2C 4PSKA 3WNBA 1JNYA 2BM0A 3LVRE 2Z0MA 1COWA 2Q9CA 3GJ4A 1N0WA 4MGYR 1OW3B 3IHWA 4A6PA 4GPTA 2X2FA 2B8WA 3MCAA 5KDOA 3C5HA 4HYYA 4M1YA 1PZNA 1G5RA 4LK2A 1PLKA 3VNVA 3GLFA 1T5LA 2FSGA 2R9VA 4LYAA 4OQXA 1GL7A 4D0LB 2IS6A 1XMIA 1Z6GA 2IK8A 4ZDWA 1NN0A 1W49A 1G5TA 2BMDA 5F3WB 4NP6A 4C2TA 4M9QA 3AP2A 2P5TB 4KSCA 4JLAA 1NN3A 2NPIA 1JECA 4ZI3A 3PIRA 1MRSA 2DWPA 3L0SA 3D31A 3I32A 3A1TA 2DFKB 1BOFA 1FMLA 2OBNA 1U9IC 2AFIE 3UG7A 4B2LA 2GXAA 1P61B 1Z63A 4WA7A 3W3AA 1L4UA 3G0HA 4M21A 4JBWA 4MKGA 5HTKA 2PEZA 3O8CA 3N2EA 1FMJA 1KSJA 2VPPA 2RGNA 3HPQA 1ESNA 1D5CA 2QP9X 4YXWD 3W6PA 3HDTA 2GILA 1E2KA 4BPBA 3BH6A 4NYIQ 1LF0A 3HYTA 2OAP1 2OXCA 3LD9A 1T9HA 3U3RA 2WZQA 1W4BA 1CS4C 3LFUA 3QI2A 2GVZC 3SDZA 1DAKA 1KK3A 1N5LA 4LBZA 2WM9B 1Z8FA 4D80A 4DEYA 3WXMA 3KXIA 4LV5B 2J1LA 2R65A 2OT3B 3D6TB 5G40A 3DPUA 3MAAC 5FPSA 3RS7A 2A9KA 2YZ2A 3LQRA 3I4LA 1NSFA 3QKRA 1EFHA 3ZS9A 2YHSA 1OH6A 3TAUA 5HKKA 2CL7X 1XPOA 1T0JB 1DG3A 2EFGA 1FW6A 2BM1A 1P73A 3AVYA 4PQFA 2XTMA 4TTRA 4DCUA 1PVOA 4L15A 3VR6A 3IPXA 1ZNXA 2D74A 1KY3A 2QORA 2YYZA 5TARA 5FPTA 1U0JA 4Q4HA 4RFVA 1OHHD 1Z83A 2VP0A 2NO7A 4LY6A 3A8TA 4IJMA 5BYJA 4Q9HA 1NP6A 4AWXA 2O0KA 4XH9B 2H5EA 4JSTA 2YOFA 3PXGA 1SXJB 3BORA 4JLNA 4QOSA 1IOZA 3T35A 2ZR9A 4I1OA 3PVSA 1P3JA 5CK5A 3RABA 1E3MA 4HAUA 1Z06A 2XB4A 3M6AA 1VG0B 1VKJA 4JLKA 5D3MB 2UZ3A 2V8OA 5JWOA 3ZZTA 2OLKA 2ZE6A 3GD7A 3Q3JB 4IOMA 5FFMA 3ND9A 4A9AA 3RAPR 1UPTA 1XTRA 4JLOA 1MKYA 2FSFA 3KTAA 2ERYA 2P6UA 4IDPA 3AF3A 4WVFA 1W0JD 5CIWA 1SXJA 4JLPA 4K46A 2C96A 3EPKA 1QDEA 4CZ2A 3EA5A 2ORIA 2JLRA 2LKDA 1EWRA 1W46A 2GVDC 2G83A 3W9YA 3RS5A 1TADA 3DOEA 1ZD9A 4LHXA 1A5TA 5LPNA 3B8HA 1KJYA 5EXTA 1HE1C 1YZGA 3QE0A 4CT5A 4CEIA 1XTKA 1SVLA 5DYIA 3CM0A 4V0NA 3PUYA 2ZI7A 3R9IA 1NBME 2RGAA 3TBKA 4L9SA 4NYMR 5K8IA 4FN5A 1YE8A 1VCMA 3SYKA 2OFOA 1XTQA 2BIFA 2QAJA 1OFIA 4JL5A 2A5JA 5SZKB 4ZIRB 5DSZA 1JEEA 5FOWA 1JPNA 2C9YA 4XVUA 1CR2A 4JKIA 5B30A 3CR8A 2VTKA 1NMXA 1W47A 5B57C 1VHTA 3EZ7A 4I1SA 5JI3E 2GESA 2FMXA 3TSOA 1N5JA 3A1VA 3LY5A 5AR1A 821PA 4A0HA 2VLIA 2G1KA 1E9CA 3MWJA 3VR5A 2VHCA 3LH5A 3CX7A 3DO6A 4D81A 4DLTA 3MSXA 1YJ5A 5GADl 1KZGB 3BD9A 1ZNWA 4RZ3A 3THWB 4RVCA 5KNCA 1QHXA 4PHGA 1G4UR 2XX3A 3LNCA 1LTQA 4K81B 3REGA 2X2EA 2IYZA 1YZNA 1ZUHA 2CK3A 2IXEA 2ZQ5A 3L0IB 2JLUA 4MDEA 4D82A 1JAHA 1LVGA 2QG6A 4II7A 3QUSA 3JZMA 5ANRB 4E5UA 4EPWA 2FFBA 5KTYA 3U7EB 1R5OA 1UAAA 4Q7LA 2FJUA 4P33A 3K70B 3THWA 2R62A 5IF9A 5P21A 3GLHE 3U3KA 2H17A 2O0JA 2E87A 4JVLA 1UFQA 4RCYA 1YR7A 2C77A 3GLGB 1PJRA 1YU9A 4Q5IA 4TLCA 1KI8A 1HUQA 1QHHB 3K9NA 3QG5A 1FX0A 1LS1A 1PUIA 1SGWA 1IXZA 1UKZA 1CJTC 2ZVPX 2XOKA 3WYFA 5LD2B 1C4OA 2AFHE 3FDIA 2J9RA 4NYJQ 2GCOB 2YVUA 1Z6AA 3L0PA 1JXMA 1SZPA 4LJYA 3KJEA 4L16A 1XTIA 5HE8A 3RS3A 4MGIR 4TMVA 1BO6A 2ZSAA 1IONA 1GSIA 3U3JA 1Z08A 1W2HA 4EPXA 5KNDA 1SHZA 4HUTA 4S2EA 2GAAA 3U44A 1HE8B 1XD2B 1QHHA 3GJ5A 3MUFA 2EWWA 4GRAA 5EE3A 1MABA 2O0HA 1G20E 3FYHA 1X8KA 2O8CA 5C4MA 1TUIA 3TH5A 4DCNA 3S1AA 1MV5A 1GKIA 2BC9A 5HKKD 2AN9A 4JT4A 2F1HA 2GCOA 3NC1C 2CL6X 3ONWA 5TDHA 1G64A 1VCIA 3OZXA 3NBXX 1VYUA 3C16C 2ZXUA 2GEDA 5EP1A 2W0MA 621PA 1DAGA 4WZ6A 4OHVA 2G9NA 1XD2A 2FFHA 2ZPTX 3AP3A 4UQOA 3ZJYA 2KB0A 5E7IA 2NIPA 1N6RA 3Q7QA 3SJBA 3T5GA 4U7DA 1CTQA 4DBLC 2C04A 1MRNA 2IUSA 1P2UA 3VNUA 3SBDA 1CRPA 5DYGA 5G3ZA 2RHMA 5J4HA 1E9DA 2F43B 2QPTA 4LSGA 1E1RA 3ZIAA 1OF1A 1O87A 3A4MA 1UBEA 2ZTSA 4PANA 4ASUA 2VA8A 1KJZA 3ICEA 4CIDA 1G4AE 5FOUA 4TYWA 3UANA 1IN8A 2F3RA 1KNQA 4M1OA 3WHKA 1GWNA 1FPMA 1Q0UA 4PXAA 2QAGC 4M1TA 3B78A 2CJWA 3DHWC 4XD7A 3TAHA 1WB9A 5EE0A 1KDTA 2N46A 2RGXA 3SFVA 1KI2A 2F1JA 3NHBA 1SXJD 4TMXA 2DWQA 2VIIA 3QENA 2F43A 2OCBA 3KJIA 1N6OA 3RC3A 3CRVA 1KDOA 2Q3FA 5CB6A 1CKEA 2BVNA 4G3XA 1W36D 4IDNA 1Z0DA 2H57A 2VF8A 1XCMA 4P4UA 4BFUA 2HLDA 4WW0A 5BN5A 3LBNA 3HP1A 5AUPB 4Q4LA 4B3FX 2N1BA 1Z29A 1YRAA 1NVUQ 2Q21A 3AEZA 3RLFA 4C9BA 3AVXA 3TR5A 1JBKA 4MUAA 1CULC 4TN1A 3KQUA 1NVVR 1FTSA 5EP2A 5D3QA 3NBFA 5L3RA 3QJYA 3OIWA 2IX3A 1SQ5A 2BBSA 1EFTA 5JRJA 1UKYA 1KGDA 2ANCA 4BFVA 4BECA 4RZUA 2LWIA 3LV8A 5JCPA 2CHQA 4LOAA 5BQ5A 3QIAA 4KODA 1QF9A 1E2QA 3QSYA 4A6XA 3JVVA 2WKPA 3ZZ0A 1XD8A 2F6RA 1DPFA 1GUAA 1RRFA 1XXHB 3NIBA 2JLXA 2IXFA 2IBMA 4URVR 1YHNA 4B2IA 3P1JA 3K0SA 1K8RA 2WPDA 4QXAA 2VP5A 3AB3A 3DEFA 4NH0A 4OHZA 2P0EA 3RWMB 4LPSA 1I2DA 3AVVA 1DARA 2PJRA 2NQ2C 3UMSA 1BMFA 1G19A 3RVBA 4PAMA 1Z6YA 1HT2E 2NG1A 3W8NA 4BE7B 4LRWA 5H70A 2P3SA 2A7QA 2V7QA 4C7OB 1CJVC 5K8TA 2FU5C 1GRQA 1XTJA 3C5CA 4UNQA 4AKHA 3U61B 4P32A 1XXHA 4B73A 4R71A 2CK3D 2RAPA 3SBEA 1LY1A 1HA3A 3LO5A 5L3SB 2FH5B 2P65A 3ZZUA 4DLXA 4JKYA 2W0SA 3OE7A 2IHBA 1F3OA 4WXRA 2OBLA 1F48A 1J7KA 1RKBA 1TNDA 2IF2A 5J4YA 1E98A 4M9SA 2FSIA 1YZQA 4ARZA 5FPKA 1X86B 1QHIA 2ZRKA 4EJSB 4C7OA 4V0OA 4B3GA 2CDNA 2OUKA 5L3SA 5DO9A 5EUMA 4NL4H 2MSEB 2XOKD 1P6XA 4LI0A 4W5HA 2QI9C 2P2LA 4ZCMA 3AF0A 1YZKA 4HDCA 1CP2A 3M4YA 2AD1A 4IRUB 1R5BA 2ZS9A 4LJ5A 3SNHA 2DR3A 1U8AA 2ZUCA 4DHEA 3SI7A 1JI0A 4AK9A 4EJSA 1N6KA 4DIEA 3THYA 3UK6A 5FTLA 1BS1A 1II9A 1CJMA 3UATA 2D2EA 2J0SA 2HJGA 1IM2A 1RRGA 4TYYA 1SKYB 1EK0A 4B33A 2ZSBA 4IFBA 3NEYA 4URUR 1D8TA 1KMQA 1UJ2A 4KFUA 4OQNA 3T06B 4JZKA 4LJ4A 3UG6A 4BLPA 3GLIB 1MO3A 2V54A 1WMSA 1D9ZA 4MRVA 1TTTA 4HB3A 4O2RA 4TSFA 2HT1A 1D6JA 1XPRA 5AJZA 5JRZA 2EFEB 3V00A 2ERXA 2IYLD 4TLAA 3KXKA 1W5TA 1MH1A 3GJ6A 1JQJC 2Y8EA 4FCWA 4CEHB 1Z2CA 3VQTA 1G9XA 1XD9A 2ZRAA 3A1UA 1Q20A 5GJVC 1AK2A 4DDWA 1OB2A 3VX3A 3K0EA 5EQTA 2AWOA 1R0XA 1U2RA 4RSGA 2OV2A 4RFSB 2WV9A 3BGWA 1NLZA 1E1RD 3ZIAD 2HUPA 3AKEA 3CBQA 4ASUD 2DB3A 1F5NA 1P9RA 3PG5A 4X8LA 2JLYA 1KAGA 4ZCIA 2WMNB 3UXMA 2DBYA 3WP0A 3W90A 5FBVB 4CEHA 3UPUA 3ADKA 3LLMA 1J2JA 2QMOA 1XRJA 2FGJA 3EG5A 2QSZA 1ZAKA 1V43A 4BLSA 4DDVA 4C0JA 221PA 2EU8A 3U7GA 3BRWD 4B71A 2Z4RA 3H4MA 3OEEA 3BERA 1KNXA 1DTSA 1WDTA 2NO1A 3FMPB 4V0LA 2HLDD 4Q18A 2GEVA 4PZLA 3EAQA 1E2HA 4LHWA 2ORWA 3KQLA 3LLUA 1RVDA 3SJAA 2IYQA 2GBLA 4FMCB 4UNNA 4EAQA 2FOLA 3VU9B 1KZ7B 3SE0A 4URXR 1NN1A 1XMJA 1G291 3C41J 2OILA 3K09A 1D2MA 2JLQA 2VL7A 4RZXA 3WRYC 1OIWA 1BYUA 2ZRJA 3QKUA 1GNPA 1Q21A 2GXUA 4YQFA 5JMTA 2VSOA 5KSOA 4G01B 4IDHA 1KI4A 1S96A 1U81A 1XEXA 1X3SA 3BFKA 1G8HA 1CXZA 3KFXA 4ZO4A 1Z0JA 1U0LA 2YV5A 4Q47A 3VU9A 3KZ1E 1E9BA 1QHYA 2WJIA 2WPDD 4F4IA 2FDCA 1E0JA 1X1SA 3MJRA 5G53C 2WJVA 4A2QA 2OESA 2NZ8A 5EZ6B 2ZITA 1E9EA 4AI6A 1BMFD 2ZRGA 1TF7A 5TVKA 4QHSA 1AQUA 4LHVA 3TQCA 4A8JC 2V7QD 2ECKA 3K70C 3QY0A 1XWIA 5DISB 3RRYA 2ZANA 3W5IA 4A4DA 3U5ZB 1VTKA 4KYIB 3FKSD 2QGNA 3B5JA 4IVRA 5CLQA 4ZI2A 3M0EA 4CVNA 2DFNA 3OE7D 2OE2A 4C0KA 3REFA 3WMGA 4PAOA 3KB2A 5LD2C 1H8HA 3QBVA 1YZUA 3B2EA 2BMJA 1B0UA 1I4LD 1KY2A 1P60A 2AD5A 2AWNA 4NMMA 1CLUA 3Q7PA 3WMEA 1RPZA 2O8FA 2AK2A 5CDFA 4Q4AA 3T1VA 5JECA 2JEOA 3CNLA 5H68A 4TLBA 4QJ3A 5LBIA 1NN5A 2OLJA 1NMZA 2OZEA 2HXYA 4LUCA 3AQ4A 1AZSC 4GBMA 2FPKA 4CF7A 3EZ6A 1S3SA 3PR1A 1T8UA 3TE6A 2QP3A 4DCVA 1R6BX 5L3QB 4H9GA 4QM6A 2WJYA 2KBFA 4FMDF 2PX0A 1YKSA 1LF5A 3PUWA 1RJ9A 4Q9IA 1IJFA 2Z43A 1GRNA 3B60A 1TEVA 2IWHA 1R8SA 3U2QA 4RKEA 4EDHA 5CJPA 3W8RA 2NMVA 4M8NE 3OEHA 4IOKA 2ASEA 2D3WA 1OSNA 3D3QA 1W5SA 2A30A 5EP4A 2CBZA 3D8BA 4B43A 2A5GA 2EYQA 4TSFD 3GLFB 3GJXC 1KYIA 5BN3A 2KE5A 5C1BA 1TUEA 2FFAA 1T3LA 4Q4JA 4PPFA 3ZVLA 5JHGB 2ZETA 3C14C 4KBFA 4C30A 2JIZA 4GZMA 1KK2A 1E2IA 4RD6A 2FFQA 5BXQC 3FPAA 4EPYA 1N6LA 4XWOA 2ZRPA 3HU3A 4X8MA 3W6OA 4NCKA 4P31A 1DEKA 2JCSA 2IYWA 4YMWA 3ZDQA 2AL7A 4FIDA 1TQ2A 3QNUA 5FOVA 2D2FA 5AK0A 5FBWB 1U8ZA 2G6BA 4BFSA 4DB4A 2ZRMA 4KVGA 1VHLA 2ZYUX 2J3EA 1M1YE 5FUYA 4A0GA 3KJGA 1ONBA 2W2TA 1VDZA 3NBYC 2G88A 4OQFA 4E07A 3OAAA 1RFLA 5FOXA 1AQYA 2Q0HA 3OHMA 1MO5A 3Q72A 2IF0A 4OBEA 2PX3A 1KO7A 3T1TA 5CB8A 2W6JA 1VCOA 4BLRA 1WBBA 1ZCBA 4A1FA 3KB1A 3CONA 2QENA 3OEED 3QKRB 2W00A 5DGXA 5TXGA 4EPTA 1Y63A 1KIMA 2IWRA 4PSVA 4CEJB 1F2TA 1IXSB 1IQPA 3BB3A 3U6KA 1VCNA 5GVRA 2ODWA 3HPRA 4FCTA 1HQCA 4US0R 2BCGY 5TY0A 3ZGXA 3AVUA 3TNFA 4GOJA 2G3YA 3DMNA 4KU4A 4Z8XA 3KUDA 4JLVA 2KWIA 1MOZA 2PZGA 4Q4HB 4XWKA 3TK1A 2NO0A 4GT1A 4AYWA 3A1WA 4CYMA 2ZEJA 2CVHA 4CEJA 1CRQA 2HDNB 4ZDJA 2AHOA 3SHWA 1HY3A 3C4JA 1K5DA 4BEBA 4WAUA 4BFZA 2ZSFA 3BAFA 4QBGB 5AWFC 3L2OB 3KL4A 3A37A 3LVQE 4TWZA 4R98A 3B1ZA 3ZLJA 5JJLA 2RB4A 3KKNA 2PZEA 1L8QA 2EW1A 3KKPA 1F2UA 4D2IA 4LV6A 4YMSA 3CLVA 5JFGA 1YZTA 3WYAA 2G77B 3DKPA 1JXOA 2JJ8A 3HWSA 2O5VA 1H65A 1E2PA 1ETUA 5JBQA 4LJAA 2NO6A 3KTAB 1NVXQ 4FMDB 4N3NA 5FI1B 1J8MF 3FGNA 3IHLA 5SZJA 2BMEA 1XEFA 3LDAA 3UWOA 1NIPA 3IEUA 4G5GA 1PUJA 1IN6A 1A7JA 2QRZA 3FVQA 3PEUA 4GFDA 2OO7A 3LW7A 3UKDA 1W36B 1KDRA 1GOTA 3NDBB 2D06A 3KKMA 2B92A 1Z07A 1GL6A 2RGDA 2ZJ2A 5EE1A 3FHOA 3BBPA 5KPDA 4X8OA 5EXXA 2GDJA 4X8HA 4CEIB 2K5UA 1H8HD 1P2TA 2ZE8A 1JR3E 3SYLA 4UNSA 1TAGA 1CJUC 1KO8A 3OIYA 3CZQA 1GL9B 5DHFA 1LNZA 2KI5A 2B7CA 4HZIA 1GNRA 2GF9A 3IQWA 4OJKA 5FBQB 2QZ4A 3R7WA 1N3BA 4ESHA 1QVRA 2QY9A 4GMDA 1AS3A 3GEIA 2ZUDA 4JT2A 4MGKR 4ACBA 5GJBA 1KDPA 4US2R 4KCGA 5HCNA 1EFRA 2GNOA 5CK4A 4B3BA 5A4JA 5DI3A 2D62A 4DRZA 1OB5A 1E9RA 2ZJBA 4LJ9A 4LX0A 4WBSA 3W34A 3IBYA 3WHLA 1XJQA 4HSEA 2XITA 5FI0B 5AUNB 5DI9A 1GKYA 2H92A 3G82C 5DIFA 1TL7C 2MMCA 1M6NA 3ASZA 3EZ2A 1G3IA 3SC3A 2YWGA 3EXAA 1NBMA 2F9LA 3UWKA 1VG9B 1P72A 4CT4B 2GWHA 4IVQA 1UDWA 1AKEA 1NJGA 3TSZA 1NKTA 1P5ZB 3OEHD 3UMRA 2WBLC 3QG1A 3C8UA 3VHLB 1LFDB 1G1MA 3MJHA 5IDVA 3CRW1 1GG2A 5CM8B 1E0KA 1GFIA 4A92A 4D4MA 1T3SA 1R7RA 4JL6A 4BZXA 2W58A 5A0FA 4R2HA 4HZUA 3WBKA 1ZM3A 2A2ZA 4NDZA 5FL3A 4Z8YA 3IO3A 3LRPA 4ZKDA 2JIZD 4ABYA 4Q7KA 1IN5A 3FFAA 4XVQA 3I61A 1Z2AA 3TGPA 4QFMA 3CR7A 3O8DA 2QGZA 1FUUA 5IHPA 2H8KA 2JLSA 2VO1A 2A5YB 3GLHB 4HDQB 2F55A 1GTVA 2HCBA 4I81A 2QTVB 3X2SA 1ZD1A 4HLUC 1FX0B 3CF0A 4Q9JA 5ELXA 4DCSA 3MG9A 4KI0A 4LDJA 1SVWA 4Q7MB 1T4GA 4OKSA 4M1MA 5JWRA 2R6GA 3ZD7A 2BJWA 2QNRA 3SQXA 3GJ7A 2C98A 2GZAA 2TMKA 3OAAD 2DFLA 2XSZA 5E7MA 2GETA 3SJCA 3EW9A 3GLHA 1ZM2A 3NBZC 4C0HA 4LV8B 2W6JD 3KFVA 1KSGA 4FMBB 3U44B 1A4RA 1QG4A 1GDDA 2YOHA 1N6IA 1E69A 1MABB 4JVMA 4XIGS 1BH2A 1KOFA 3K0CC 3QXSA 2ZI6A 5FL7A 5AUOB 4B2PA 2O8CB 3U7HB 1YR6A 3S1AB 2IHYA 3TUIC 2CCGA 1DAMA 2FX3A 3IILA 1OFHA 4BWYA 2QMHA 2BBTA 1ZYUA 5J4VA 4HAXA 4B6EA 1TF5A 2VRWA 1HURA 1S3GA 2JDIA 4BRUA 5EXPA 1X8LA 1OYWA 4XSHA 2J5XA 2OXRA 4NHOA 1II8A 2XNSA 4MGZR 4I4LA 2DCUA 4XTRA 5DLQC 1UADA 2ZROA 5FBLB 1NLFA 3O8RA 4TT3A 1EG7A 2GK7A 1TF2A 2PZFA 2QM7A 3HR7A 1D2NA 2YJTD 5LB2A 2V6IA 1I2MA 3IKJA 4G5QA 5KUTA 1DO2A 1DAIA 4A36A 4XSGA 1W7AA 5G3YA 4U02A 1ZC4A 2B7BA 1HTWA 2QE7D 2QT0A 2QEQA 4XTCS 1OJLA 1Q1EA 4HLDA 1MO4A 4E03A 1NJFA 3GLGE 2VSFA 1EWQA 1HYQA 1E2GA 3AH8A 3Q85A 3CKLA 4HB2A 2PT7A 3AM1A 1S2MA 4DEXA 4LYJA 3GJ0A 3PUZA 2JASA 5SZHB 1NLYA 4R9UC 1E9SA 4TMZA 2CJWB 3Q8XB 2A3RA 2AKYA 4Q01A 3ADCA 1CEEA 1AS2A 1E2LA 5EZ5A 3TLXA 2ZE7A 1Z3IX 1W2GA 2GTPA 1GP2A 5EJEA 2ZSEA 1ZMXA 4I1VA 2WJJA 4Y0AA 3WP1B 1EESA 2FEOA 4PR0A 3SHFA 4PC6A 2PCJA 3RRZA 1ZM9A 2FE4A 3D7MA 1DBSA 1Z0KA 3I8SA 4EKDA 3SEAA 4EFMA 3LXRA 1R0ZA 4WZBE 4NCIA 4RD4A 5CYOA 2RKOA 3RC8A 4ACAA 1F60A 4DLVA 4EPVA 2R44A 4PC3A 2AR7A 4BRWA 3L8ZA 2BMFA 4IVPA 2J45A 2J7KA 3W3ZB 4Q1FA 3U7FB 1Z5ZA 3PEVA 4PZZA 2JGNA 3TRFA 1VG8A 2GZDA 1EFRD 1R10A 4Q1AA 4MKFA 2Q9BA 2FN4A 3ASYA 1RW4A 1AKYA 4KVAA 4Q1EA 5KYKA 4IEIA 3GP8A 2KSQA 4MA4A 1M74A 1S9HA 1J99A 2JJ1A 3BB1A 3I3SR 3X1XA 2RGCA 4BFWA 1M2OB 3Q9LA 4CW7A 2X8AA 1SKQA 1GZSA 1Q1BA 2CE2X 4B3DA 1NBMD 1G7RA 1XJ0A 1KI6A 1R0WA 4D0GA 3A36A 5JLJA 4NCNA 3IIJA 1RIFA 2NOAA 2X19A 2FWRA 1CJKC 1Z6TA 1E0AA 3ADBA 3EC2A 3MD0A 2EQBA 5F98A 3OF5A 1AGRA 1SVOA 4Q1DA 5JEDA 3BK7A 4TL9A 2YNMA 4UJ5A 1M7BA 2MSCB 2FF7A 4QNRA 4HLQB 5CJ2A 4C0AC 3U4QB 3GPLA 4XWAA 3EIQA 1JB1A 1DS6A 2GF0A 1SVIA 2RGNC 2QSYA 5E7JA 4C0LA 4DZZA 2QL6A 2Z4SA 4ARZB 1U9IA 3T1OA 2VEDA 3JVUA 4GZLA 3F0TA 4P4SA 1HQYE 1S8FA 3B1WA 4DSTA 4Q00A 1KI7A 5DHAA 1NI3A 1N6HA 3K8YA 3FKSA 4LYHA 3B6EA 1VG1A 1E79A 2IYTA 4QM7A 2WAYA 3U4QA 1BYIA 2V9PA 1U99A 4ZV4A 3G5UA 3EARA 5KHOC 5EE5B 1ESMA 3B13B 4G1UC 2WMOB 2SHKA 3ADDA 3T15A 1AJEA 1OFTA 3CZPA 2XSZD 1ODFA 2DFTA 3B9PA 1Z47A 5HPYB 5IRCD 3THYB 1XXHE 3SZRA 1RC8A 2Z6VA 1OV4A 4IDQA 4TMTA 4DLYA 1NG9A 3WY9A 5DH9A 5FL7D 1AN0A 1CIPA 4I1UA 4KSBA 4M9ZA 2WKQA 2QA5A 5TMPA 3FFBA 3AF1A 2EVWX 2CLDX 4W5WA 5JJKA 1XMSA 4PHFA 2G0NA 2JDID 2NTYC 2CLSA 3CIOA 4HUQB 4D26A 3DDCA 4OK5A 1CF4A 4OHYA 4AG6A 1US8B 4KBGA 2OG2A 3M1IA 2F1RA 4UXJA 2WKRA 1CR1A 4BFYA 5JEEA 4TT3D 1Z28A 2GZHA 4JVSB 4WZAE 2P6NA 4BQSA 4A15A 1HH4A 2CHVA 4FW9A 3TR0A 1OPXA 1ZC3A 5BW8A 3DOFA 6Q21A 1DADA 2PT5A 3ECCA 2QQ0A 2VYFA 4MH0R 1II0A 4O0MA 1XEWX 4Q48A 4AIIA 3IGFA 3J81k 4JLBA 1E9FA 4TYPA 1E1QA 1SXJC 3LA6A 2B21A 4QGFA 3I8XA 2J59A 3BH7A 4HUQA 5EUQB 3F3YA 4IDOA 4MDFA 3AGPA 3CUEF 2IA5A 1US8A 2ZAMA 2FGKA 1FZQA 1JEDA 4KFRA 4Q1CA 2H7VA 4LC1A 3AVQA 1AGPA 3E2IA 5KSPA 2DY1A 1ZU4A 3IQXA 1AZTA 3RRMA 2YWHA 1G8FA 1NKSA 2IT1A 1WRBA 5CYPA 1NNEA 1G3RA 3U3OA 2ATVA 2ZI9A 2GRJA 4F38A 4JBXA 3TVDA 3PJRA 2XTNA 1ZIPA 1H8EA 2IYVA 3CX8A 2ZVQX 2A78A 3E70C 1SKYE 3C15C 1T3HA 4Q03A 1P9NA 4YMUA 2IW3A 2ZYWX 1ZUNB 2Q3MA 2I3BA 3ND8A 3TUJC 2BCJQ 2EYUA 3MFYA 3GLIE 3R9XA 4FINA 3RSOA 3JZAA 3PV0A 1F6BA 3EPLA 1DAHA 2X77A 3I62A 3QBTA 2BWJA 5TB5A 5GVSA 2OHFA 1SVKA 1IAQA 2F1IA 2GJ9A 3FKQA 1N0VC 4Q9KA 1N0UA 2PBRA 5C4GB 1FNNA 2WICA 4RY2A 4C2UA 1L2TA 1QRAA 1LB1B 4C0SA 2ONJA 3V9PA 4A0RA 3U3MA 2C5LA 4Q7JB 1G6OA 1OLOA 2QTHA 3B1YA 2IS1A 1XEXB 2AX4A 2JJ1D 4M1KA 1LV7A 3F8TA 4A2PA 2V1XA 4F4JA 1G3UA 1VMAA 4MYHA 4W9MC 2ZJ8A 3PUVA 2OEPA 2ZRDA 4LZZA 1XP8A 1R8QA 4QG7A 1ZIOA 5C46F 3N70A 1NY5A 4G0NA 3Q5DA 4YC7A 1K5GA 1M7GA 2QTFA 2CVFA 4OJQA 3ZVNA 4B32A 1XEWY 3BFVA 4NZYA 5CITA 1XJCA 4HATA 5C18A 4H1UA 1KKLA 3ZVMA 3IEVA 3RWOA 1TX4B 4R2IA 4NYIR 4UKDA 3TSWA 1PLLA 2WSSA 1XZPA 2CCKA 1CU1A 4HLCA 3I5YA 2CNWA 4DLRA 1E94E 3EPJA 4ITRC 1KAOA 3BFXA 3E1SA 1W0KA 3EWSA 4Q9LA 3TQFA 4KITB 4L9WA 3CF2A 4MRSA 2O8FB 4OQMA 3WMFA 2H1LA 2CE7A 2ZUBA 4Q4AB 2BHRA 2YOGA 4Q1BA 3QPWA 1P4SA 3MGCA 3QXJA 1E79D 2JA1A 1IN7A 4TQAA 3AF4A 1NMYA 1Q1ZA 2W2XA 4L4UA 3ZH9B 4O25A 4LPKA 2H16A 4NPHA 4TQ9A 1EX7A 3K1JA 4EQ6A 2O8EA 2WOOA 4ILEA 1GM5A 1Q12A 4B3CA 1M7HA 4G5SA 4BASA 1DOAA 1RJ9B 4EUNA 1E96A 3R20A 4AC9A 2YKGA 4TMKA 2ZYVX 4PPNA 3T1QA 3LX8A 4POAA 2XXAB 3THOA 2GJ8A 4LBWA 4TQUS 2PL3A 3HJNA 3KQHA 1JPJA 4K8OA 3L8YA 4TTPA 1FL9A 1ZVQA 1Q3HA 3WNCA 3L0OA 1P2SA 3GFPA 4WIAA 2OBMA 2GA8A 2V6JA 8OHMA 2KBEA 4V0KA 4AY2A 3CPHA 4HB4A 1P9WA 2OCYC 2FPMA 4GMXA 1XDBA 5TV2A 1KMHB 3CPJB 1DELA 2IYSA 3QF4B 3SR0A 4C3ZA 5LDDC 4RCZA 4HDOB 1IXRC 2WJGA 4L8GA 4Q4JB 4DVGA 2XXAA 1OKKA 4YDHB 3THXB 5JS8A 5DE3A 4UXIA 2QROA 1I4DD 4OI2A 5B2ZA 3GQBA 2V55B 2FNAA 2O8BB 5KOYA 4OK3A 1GKUB 1ZUIA 3QVUA 4V0ME 2ZM5A 3AF2A 1KMHA 4D25A 2C78A 3QXXA 1HT1E 1KI1A 1G41A 2ZJOA 3QF4A 1E2NA 4FD2A 1E1QD 1G5PA 3O8BA 2ZJYA 2BDTA 3EZFA 4BZQA 5KU1A 4DXAA 4PO1A 3QKSB 3THXA 4PQRA 2G1JA 3RDPA 2QBYB 3K9LA 1ZCAA 1QZXA 5H1YA 2QAGA 1R5NA 5BN4A 2H18A 4RD1A 4IEEA 4QGAA 1W4CA 3CH4B 2O8BA 4Q02A 3RS4A 5CM9C 1GITA 2N42A 4PPGA 3CPEA 4JLMA 1YVDA 2VP9A 1AA9A 1H8ED 1QBKC 3WBJA 3GCGA 3H1TA 3VAAA 4Q66C 1XFAA 4F4CA 1F2TB 1KSHA 1UBGA 4MYUA 3QKSA 5KDDA 5A5GA 2O8DB 4MITA 1XU4A 3AP1A 3SFZA 2QBYA 4QJ4A 1P75A 4B48A 4DUGD 1SULA 4A2WA 2ZRLA 2ZR7A 3PITA 1WP9A 3TKLA 2ZRCA 4IFEA 3GLFE 3CRRA 3GJ8A 1KHTA 2C2HA 4LBYA 4RD3A 3CF6R 3V4RA 4RJLA 2UKDA 3K0AB 2J0UB 1OYYA 5AJVB 1QHNA 3QKTA 3H0KA 2QP4A 3KDSE 2W83A 1SVSA 1OXVA 4US1R 4ZDKA 4TLEA 4URWR 2OFWA 1OXUA 3BWDD 3X1WA 2O8DA 3NVAA 3HU2A 5BWMA 1QHGA 3LW8A 3FHTA 2BKEA 2Q9AA 5HCIA 3RANA 1W4RA 4YDSA 5HE9A 2X1VA 4CDGA 4NU0A 1J90A 2FSHA 1JQLB 3LQQA 2EFDB 1OIXA 2XEXA 2VP6A 1AS0A 1F2UB 3K0AA 2J0UA 3WNDA 2NZJA 4BFXA 2GCNA 2R6DA 4PFSA 3O47A 2XZPA 4MRPA 3LAWA 1WBDA 3UMFA 1UEJA 2QM8A 1E4YA 3B1XA 2AXNA 4TL7A 4B3XA 1OXSC 3AVOA 4QNMA 3OFNA 3RHFA 1XCPA 2Z83A 5J4KA 4MKIA 2F3TA 2ZRIA 3QEJA 4AKEA 1TU4A 4D4KA 3TMKA 4TZ6A 2QE7A 3OIVA 2BBWA 4NKRA 1NG1A 1RYFA 2V4ZA 4KAXA 1G8YA 4QBIA 4GDFA 3VX4A 1ANKA 2GJSA 1Q44A 1VYTA 2BBOA 3NH9A 2LCFA 4NYJR 5FTKA 2AKAB 2WSSD 3LXXA 2CNWD 1X6VA 3B9QA 4B75A 3QOFA 1FNMA 4MYCA 4NBSA 4B76A 3CWZA 2W2VA 3MWKA 1W0KD 1G8GA 3I1FA 5JZVA 3BJIC 3X1YA 2VHUA 3R7WB 5J40A 4IOLA 3SN6A 3VFDA 4OHXA 1CBUA 5DN6D 4EJSC 4QC2A 4PC1A 1TQ6A 1T91A 4URZR 1WXQA 5GJWC 2QPOA 1QVAA 5HR5A 1KO1A 2PMDA 5DI3B 3B82A 4KYUA 2EWVA 5FR1A 1QG2A 2RGGA 3LBIA 1YQTA 1XTSA 2J7PA 2HF9A 4IW3B 2CHGA 5AUQA 1L7VC 2WWWA 4JIMA 1FOEB 1TQDA 3DKVA 4RZ2A 5DNYB 1PV4A 1E2DA 1JR3A 5CIQA 3GEEA 5AJYA 5JSZB 4OYHA 4FCVA 2KJQA 2FG5A 3ETLA 1XPUA 3ZQ6A 1NRJB 4DSUA 4GP6A 5K8LA 4O2LA 1JR6A 1Q3TA 3T61A 4N1AA 2ORVA 4BEJA 4GOKA 5HZKA 4M1SA 4P4TA 3ZS8A 4YMTA 1WQ1R 1SXJE 1VYVA 3CNOA 1P2VA 4GSYA 3NWJA 3X1ZA 4DCTA 1E2FA 1KK1A 1BKDR 1FQKA 2FZLA 5B58C 2R6AA 2REOA 3RSLA 4JYBA 5B64A 2IS2A 1W44A 1K6MA 4HZUB 2WWXA 3K9GA 3UIEA 4OQLA 5JSZA 1KSFX 1OKKD 3U60B 3QPVA 3IO5A 4ZDIA 4D4LA 4Q21A 4UJ3A 1W1WA 4FWIB 5D3MA 4MQBA 2XAUA 4WXPA 3A6PC 2RGEA 1EGAA 2GAOA 4UNPA 3P20A 4PTLA 2QT1A 2EFHB 1IY2A 5FBRB 1JALA 2Q6TA 2VP2A 4KFTA 3GFOA 3NEJA 1S1MA 1UDXA 3W5JA 2V1UA 721PA 2D4HA 5UKDA 1ZBDA 2XJ9A 1CR0A 1DE0A 1O3YA 3AKYA 4QGGA 4B6FA 1G16A 3BIFA 4M53A 4P3YA 4MUBA 1TQ4A 2PMKA 3KKQA 3EPHA 1WCV1 2QUZA 4BGDA 2OAQ1 2ZJAA 3VKGA 4DC9A 4AYTA 2ONKA 2JATA 4FXPA 4ON9A 2FPLA 4RKFA 2AXPA 4TZ0A 4QKQA 2W6IA 1FP7A 4LJ7A 4JMPA 2J0VA 1KJWA 4BZPA 4JS0A 1G18A 1KO5A 2FA9A 1IY0A 2DPXA 2GBLC 3I92A 1XMVA 1RYHA 2ODNA 4TYNA 2BOVA 4JJKA 1COWD 1T5IA 1A1VA 2CXXA 5KPJA 3E5HA 3IIMA 3K09C 4JVNA 2DYKA 2CLCX 2WIAA 4AG5A 4ZIRA 5JCZA 1NSTA 1B23P 1Z6XA 2WWIA 2ZI5A 5KO2A 2WWGA 1S4QA 2XJ4A 3LBHA 3MWLA 1II8B 1JAIA 3CWQA 3LX5A 1U90A 4PC2A 4U00A 1FTNA 1GILA 3EA0A 3RYTC 5FUWA 1V5WA 2ZR0A 4M0LA 1E4VA 4P0TA 4NCHA 2C8VA 2CMKA 1A82A 1Z0IA 4A8JB 2WVJA 4KLNA 5J5CA 4GOXA 3EASA 4DIDA 1NVWQ 4DB2A 1YRBA 3N5CA 5FTMA 3H2YA 2WHXA 3HU1A 1OH5A 1MO6A 2HJVA 2JJ2A 3A1SA 4G5OA 3C7KA 2ZU6A 1RRCA 1AM4D 1OFUX 4PO8A 2RHDA 4HI0E 2HCJB 421PA 4M4SA 1J8YF 3GFTA 2Z5FA 2I1QA 2OSBA 1G17A 1ZU5A 3P32A 4YLGA 1G3QA 1XZQA 3OFND 3SYNA 1KTVA 1TPZA 4QJ5A 1VIYA 2VQSA 2DHRA 4A8JA 1WE2A 1EFUA 3EZ9A 1UBCA 2ZJZA 2ZRBA 4M9XA 3NG1A 2PH1A 2XZOA 4LYFA 4KO8A 2HYDA 5FUXA 3GLGA 3PUXA 2NO9A 1X1RA 1X8JA 4PSAA 2UVQA 3VR1A 1UF9A 1FP6A 4U5XA 3TJZA 1NIJA 1T8TA 1UEIA 4PAQA 1FUKA 2CCJA 1XB2A 4KFSA 2VP4A 3GEHA 1W4AA 4B34A 1HV8A 3QEOA 2VBCA 4URYR 3B1VA 3Q5EA 2O52A 4M1WA 1JJVA 1GAJA 3PCRB 2BEJA 3LWNA 3KJHA 1E2EA 5JWHA 3L43A 1WF3A 2P5SA 4PZYA 4JLDA 1YZLA 5EXSA 1MR3F 3I5XA 2GEUA 4UNRA 1XNJA 1OT3A 4NE2A 4DLZA 2XZLA 1UKVY 3P4XA 2IYXA 1E2JA 1WA5A 4F91B 4AKGA 1ZNYA 2OCPA 1U94A 2UZIR 3U6BA 2J7PD 3GJ3A 3L82B 4DDUA 3W6NA 2REBA 1OXXK 3B7GA 1JR3D 5FR2A 1N2CE 4TL8A 4Z1MA 5KSYA 1UM8A 2C9CA 2XTZA 2GXQA 2FV8A 4IKEA 1KI6B 1E99A 4G5RA 4FI3C 5KDLA 1R4AA 4QBHA 2WOJA 3X1DA 4CGZA 3NHAA 3EIHA 1N25A 1Q1QA 4YMVA 4NYMQ 3RS2A 4OI4A 1M8PA 1D9XA 4DLSA 1T6NA 2OFXA 3T34A 2ODBA 1VPLA 2PJZA 3VHXA 4DSOA 1G7TA 2PLRA 3FMIA 4DT1B 2HF8A 2ZS8A 3TUZC 2XB2A 3ICQB 2JAQA 2RCNA 4E09A 1LS6A 1KI3A 2QRNA 3CNNA 4OL0A 4N0DA 4TL6A 2BKUA 4MRNA 1ZP6A 1Q57A 3BB4A 1OE0A 1TU3A 3QQ5A 1MT0A 4DDTA 4EFLA 4DSNA 1PLJA 4P4SB 2RH5A 3IBGA 3AGQA 2ZI3A 3H84A 4XVRA 4NCJA 521PA 4DT1A 2WTUA 1DAEA 2VHQA 1ZRHA 4ESVA 4C0BA 4HAZA 5SZIA 1DVRA 4KV9A 4ERNA 3F5FA 2ZI4A 4JYCA 3FB4A 4PQYA 4F92B 1I4TD 3WYGA 3BC1A 1ELOA 3ZVRA 4F93B 3I72A 1DAFA
chains in the Genus database with same CATH superfamily
4QDJA 4MZDA 3VSBA 4EIWA 3WHIA 1UAYA 5LNK6 1CVIA 2V7UA 1GNQA 1QK5A 2H9YA 2Y6UA 3FRIA 1D1TA 1Y9DA 3ZE0B 1KZYC 2R48A 1BDBA 2Z3VA 1SUDA 1SELA 3F5SA 3IUPA 3PNSA 4G5HA 4YI3A 1WCYA 4ENSA 4RY0A 4D43A 3A7DA 3IDQA 4BLOA 1Y3HA 4MYDA 2QMUA 4KB5A 4WK6A 1IEXA 1MVOA 1NF3A 4CM9D 3ELBA 4U0JA 1I7NA 2E9SA 4PWZA 5B7PA 4FBMA 5FORA 4BEVA 1ENZA 1RYZA 3CH5A 2G40A 2PCLA 3EGXB 4QYIA 5E3IA 5DLPA 3G59A 3MMNA 3REOA 4E22A 4B44A 1IYZA 3RE1A 5HOQA 4KO1S 3ZHOA 3LVFO 3OOSA 3I45A 2HPVA 2PLFA 3CVUA 2GPNA 4X1OA 3T3OA 2P77A 4Q24A 1D7OA 3OURA 2P67A 3BMQB 3CZCA 4BO7A 3QVMA 3TZCA 1IPHA 2P91A 3SF0A 4JSRA 1XRRA 3W7AA 1QGUB 1OXTA 4AT1A 1IBRA 2K2WA 3T41A 4MYTA 2Y0DA 1Y5MA 2WWFA 2ZAGA 1QPGA 3E48A 3UUEA 1AQIA 1KU6A 4Z1OA 5K0CA 1I1OA 3AHHA 3NXSA 1QWSA 2P41A 1QB7A 2WLSA 3GIDA 5CYFA 1D3AA 1ZOIA 3PLAE 1W5AA 5B1DA 5IT9A 4O1IA 4GI7A 4ZKEA 1G3MA 1P1FA 4MCJA 2V6BA 5HZHA 1O97D 1PHPA 4W5JA 2I1VB 4KVFA 5EE9A 3CJTA 3FOZA 1MX3A 2JJ2D 3AV0B 4DIOA 5BQ3A 2BHNA 2ANBA 1FFXA 4I9GA 4TYQA 1OWLA 2J85A 4IKOA 3L0YA 4R7GA 4HWSA 4RGBA 4FOTA 2FN3A 1TTQB 2VDRB 4UXHA 4ZVNA 1R2QA 4KYTA 2RGBA 4CTNA 2WABA 3NM4A 5F7JA 2QY6A 3LUPA 1C1XA 4RS3A 5IX8A 5LP6C 3W2GA 2JEYA 2WM3A 5EMLA 3DZJA 3TD9A 1EP2B 1OBOA 4RUKA 3VVCA 5JNTA 3ILSA 3JQGA 1QH1B 3ZWKA 5AI0A 4UHCA 2ZIZA 4L73A 4YP1A 3SZGA 1EFPA 2BF7A 2WI8A 1PCXA 2GJAA 2ZAOA 1ZINA 2B99A 2Z8YA 3K2IA 1NY6A 3WGZA 2RMKA 4EK9A 3L1HA 2RHWA 2XGJA 4CL3A 4KX3A 1FFYA 2YINC 4D8TA 1W5EA 4GG1A 3N87A 4MUGA 5K0LA 1NBAA 2J3DA 3R8CA 4ZPJA 2NUAA 2IU3A 3O2QB 2OHJA 3QVVA 4PV7A 1B8OA 4V3BA 4A5OA 2TRSB 3ZHYA 1GIAA 2BSAA 2H1WA 3GLSA 4QT4A 3MM4A 3MB8A 4HFJA 4AUEA 3GRKA 1NL3A 1XVIA 3PTLA 3AJRA 1TO1E 3ROEA 3QFFA 3PQCA 4H3VA 2ZRNA 4L75A 3PBKA 1L4YA 5FPHA 3PT5A 2R86A 1XBTA 3ILXA 2VPQA 3QLVC 1Z0AA 3QPUA 4OA5A 4FTWA 1XLTA 3K0FB 2GKSA 3NW9A 3GEMA 4RD2A 4HNTA 4WXMA 4UHFA 4LKRA 5FOQA 2B6HA 4DUGA 1V1MB 1WZIA 3ZHQA 2B30A 2GJKA 1UKAA 3MRTA 5ECWA 4BUJA 1BHQ1 3CB4A 1U2DA 2D8AA 2XBUA 3M49A 1ZIXA 5J63A 4DCGA 5CDGA 3OQJA 4ZYYA 5IT4A 2QPAA 4Y2PA 1VECA 3MLAA 1FRQA 2NACA 3K0HA 1YR8A 2QD5A 3L1UA 1USVA 1MZPA 1UAGA 2D8MA 3NI2A 1NVVQ 1T3GA 3OMLA 4J0QA 2Y4OA 2F00A 3KQKA 5L7TA 5E4TA 4AZ0B 1XXLA 1E4OA 2NQTA 2BEVA 3CRMA 4FMPA 5J47A 1BCSA 2MSDB 1YDWA 4R83A 2B69A 1GSOA 3NTXA 3SZLA 4BATA 5JS6A 1TVEA 5IEBA 1CHNA 1TYAE 3MTQA 4EFNA 1RI4A 4NJOA 4HB0A 5JVDF 2AHRA 4PX9A 4P82A 1A9OA 1QRTA 3H17A 4KQ6A 2ZB4A 3C0KA 2V45A 3E5NA 4HN2A 4RH3A 4BLWA 3P27A 3C74A 1WW2A 1GEEA 2DFDA 3MMPA 4XD2A 1XHFA 3D5TA 3FMOB 3V1UA 5HM6A 4ENVA 3GMTA 3G9UA 1IEWA 2R6CA 4QPZA 2Y76A 4NCAA 1SUSA 3GXBA 4HEHA 1Z0UA 1Z0FA 1Z7WA 2C03A 5ED0A 4B74A 5F77A 3WNVA 2ET6A 2GPAA 2JBWA 3E84A 4EPRA 2JKYA 2UVDA 3AFOA 3MT8A 4BCCA 2BGUA 1L7DA 1ZN8A 2GLXA 1TAQA 3ANXA 2PRKA 4GI1A 2CY0A 3IX7A 1B42A 4HLUA 4QBFA 3TRJA 4BFTA 1T9AA 4Z51A 1BIFA 2PEYA 1RKXA 2I4IA 3OLVA 1E2MA 1E18A 4AO7A 1GVNB 5IJWA 3LKDA 1QOZA 1UL1X 2FYTA 5FD8A 2CVZA 3R5HA 2GXSA 4ZQIA 1NASA 1ACMA 2Q3HA 3P26A 4YRQA 4HFNA 3IIEA 4BO2A 3P52A 2IDKA 4HN9A 4BJ5A 4I99A 5IT5A 4JC0A 1ZNZA 1I1QB 1T36B 2HV9A 1NOKA 1UBFA 3CCCA 3KOZA 3OP1A 3RGWS 1HMYA 3PE4A 3A58B 4QXRA 3T5PA 4O3MA 3JYNA 3FTNA 4HOYA 1RJDA 3E3LA 1IL0A 1IDOA 1UBJS 2DHQA 4YRAA 1IJEA 4PSUA 5P8WA 3A05A 4RHCA 1T15A 3R8FA 3K0CA 2Q8QA 4V02A 3CURA 3BWVA 3RBXA 2YHIB 3HJGA 1T4DA 1O0BA 1O08A 3CLUC 3RRBA 2AOTA 1EGHA 5ALOA 4N7JA 1WIWA 2P8JA 4IDDA 4FWTA 1HDZA 1BZYA 1BJTA 3KR0A 1IY1A 2OTCA 1N9KA 1DEOA 1Y9EA 3AO0B 5ALGA 4HBZA 1KY4A 2DSNA 2XUHA 2ZYGA 1KWKA 1ODSA 4Z7NB 3IBSA 4RJTA 4UHJA 4AD8A 4JYMA 2H1FA 1EE9A 3BS4A 4KV7A 3W5UA 1CZNA 4I4NA 1FS5A 2C9OA 2GNPA 2PSDA 1N5RA 3T3EA 4TVKA 3R7DA 4EMBA 1PE0A 4P4NA 4ASUA 3WLQA 3AK4A 3JAWA 3KX2A 2EX4A 3DV9A 4O2AF 5AK3A 1UWKA 3PE6A 3I73A 4NXNB 2V9CA 1U04A 4MLDA 5ALSA 2RGRA 3I58A 3OZGA 3C3MA 3UXYA 1JHPA 4ROTA 4ZAXA 1UEXC 2BUBA 1GGVA 2FWNA 4UBIA 4DA0A 1JW9B 1TMKA 3OOJA 1JKMA 1PNVA 3CO5A 3WKAA 3JAKB 1KIFA 4EDFA 3FWZA 2G0TA 4DAOA 4CM8B 4L50A 1XU7A 3NKVA 3TI7A 4QHYA 3FTQA 3H5LA 1QXSA 1APBA 3EGCA 5FBHA 1Y3AA 1QQBA 4CV0A 3KEGA 2Z95A 4H08A 5DHQA 4KO2S 5H9WA 1GCUA 2H4XA 1LKZA 4LHYA 4E2XA 5AVJA 4ER7A 1NVTA 3CKYA 1CY4A 3QU2A 5C8VA 4OB6A 4WACA 1YMVA 4RSRA 3R2JA 4MUEA 5IUNC 4FZRA 1Z4QA 4HGQA 1J1UA 1SCAA 2B98A 5KOHA 1FFHA 2VLBA 5KYYB 1ZJYA 2QVBA 1JQEA 3A0UA 3WL6A 1LPNA 4CBVA 4HAYA 3K1YA 4ZCRA 3PEWA 3OVMA 4LHEA 4DANA 3RFXA 3FHCB 2LXNA 4DBLE 2FPPB 5J4LA 1XL1A 1NI4B 3A32A 1EQAA 1YRWA 4N0EA 1DC7A 2DUNA 1GNSA 3DVAB 1P4HA 4Z9BA 4BTVA 4A0FA 3NIFB 3CW8X 5D6OA 4HQ0A 4IPTA 1A50B 5LMZA 3F6EX 2X6RA 5CP8A 4HQRA 1UMDA 4C7KA 1JDUA 1U1GA 3IUYA 3RVRA 1FUIA 1CY1A 2GSDA 3FNHA 4FHCA 1HEIA 2YC2C 2AOWA 2PZBA 2Z3ZA 2Z0MA 2OV6A 1C7FA 1N0WA 1VM6A 4CKEB 3QEAZ 3KHUA 3SCZA 5MF6A 4MGYR 1MG0A 5TQ2A 1SY7A 3VO9A 3AI7A 3WBFA 3RI3A 2W2OA 2B8WA 5I7RA 1L7XA 4WOCA 1T8SA 3ND6A 4X93A 5JVDA 3LFTA 3NDIA 4HGYA 4KVZA 3P97A 2WVGA 4X24A 4Y2VA 5BO5A 4IMJB 2MSLA 4KXVA 2GM9A 3KVNA 4UBLA 2R9VA 3H99A 2P69A 3QEMA 2IS6A 1LBEA 1Z6GA 4XM1A 4UE6A 1ZZEA 5I7OA 1XTZA 2BMDA 4NP6A 4FEEA 4C2TA 1DJMA 2EG5A 1BSVA 3AP2A 1GKKA 4LTNA 2X8JA 4KSCA 4REQA 3H2SA 4OXQA 4BN5A 3D3KA 5GPBA 4MPJA 1EJ0A 3KWMA 4KQJA 4G1BA 4D9KA 2XOXA 2RH4A 3HFJA 1SIBE 4KR3A 3RTDA 1PYOA 2OK8A 2PGAA 1YBVA 1FJGB 2ARKA 1O58A 4MQEA 1W5BA 3MC1A 2AFIE 3A6ZA 5ALUA 3REQA 4B2LA 5LU9A 1Y5RA 2JFFA 1PT9A 4EVQA 3W7BA 1A9XA 1LZLA 4JBWA 1ST3A 4MKGA 1FK8A 2PEZA 1QH8B 3FJYA 5H16A 5HTKA 2I9KA 3WDLA 1X19A 2NAPA 2GM5A 1E1CB 1JH9A 3EXFB 2QL7A 2IOQA 3HDTA 1VE7A 2XA2A 5D5QA 3RARA 1LF0A 2OAP1 3UKJA 2IITA 5KNCH 1LSUA 2WZQA 3CNBA 3U3RA 3LFUA 4LSZA 4ATNA 4CLRA 5JNWA 2Z09A 1B14A 1DAKA 3S5UA 5ITWA 2VOEA 2A0XA 3Q6MA 1W9HA 4NBWA 3WXMA 3QNMA 2FR0A 1PQYA 5E0KB 4D80A 1RRCA 1EK6A 4FSXA 2PU5A 3OUZA 5FPSA 5AK6A 2NU9A 2H6EA 1J97A 4LEIA 3I9MA 4BX0A 3I4LA 3NVKI 1NSFA 1X38A 3QKRA 1EFHA 3LTEA 2FDXA 2JARA 4GXTA 2O5RA 5B1SA 5JJ5A 1OH6A 2F3UA 4INJA 1N2HA 5DULA 1Q6ZA 1T0JB 1XN1A 4RVGA 4B3MB 2GAJA 2GHQA 3I52A 4XCQA 3ZJ4A 4BNTA 2JCVA 4DCUA 2XTMA 5E1OA 3N7UA 2BH2A 2WB4A 3DE0X 3IPXA 3KAPA 1B8VA 1VIDA 4CQLB 4QD3A 2JGAA 1KY3A 5I3CA 5F73A 1M1NA 5TARA 1UOEA 4OBBA 4D8VA 1U4NA 1AGYA 3IPCA 5FPTA 2OV4A 4Y2RA 3OPQA 3ZBQA 4O2AA 2GR9A 3F7MA 1AMNA 3DOCA 4LY6A 2NO7A 3KYCA 3HDHA 3NATA 4WCFC 3OC6A 3FCSB 1KMIY 2Q6OA 5BYJA 3SKYA 3RYCB 2M6SA 4R0VA 4YJDA 3TLGA 5U4XA 4JSTA 1B0ZA 1NKVA 2CXHA 2YOFA 3WK6A 1SXJB 1V96A 4QOSA 4DLAA 4GW3A 2PYDA 1GPH1 4ND7A 4I1OA 4F8EA 4BRZA 5B53A 3EOZA 1I0LA 1E3MA 4HAUA 2A9VA 2XB4A 1QQTA 3M6AA 2QLJA 1HQKA 1SBIA 1XVAA 2A88A 4K6MA 1S2LA 1CNFA 2QW8A 1QIHA 3GPCA 2V8OA 5EKUA 4R6XA 1UDRA 1QSGA 1G60A 2ZE6A 1RXEA 3Q3JB 1ZD3A 4DLLA 3RAPR 1UPTA 1E3JA 1MKYA 3E9QA 5C5DA 2FSFA 5FO0A 1VSQA 4JLPA 4K46A 3TG8A 1R4NB 4X7MA 1ZI8A 3KQQA 3F2IA 1RDFA 4CM4A 2IX9A 1MBZA 2LKDA 4ES6A 2J9GA 2J0EA 4MUKA 4M8LA 2HH9A 3W9YA 2GJ4A 2G83A 2XKAA 3NIGB 4LHXA 1T2UA 4QTUB 2ATCA 3OKCA 4R3NA 4EYOA 4FFWA 1YZGA 4J1SA 3L0CA 1TM1E 2GKGA 4PN7A 2IV7A 2YN2A 3KG2A 4V0NA 2OXTA 3ZY2A 2X6TA 4IBOA 1IUNA 1AUXA 2CHEA 4DPLA 4L9SA 2HFKA 4X1KA 4KK3A 4BO6A 2CXPA 2QG9A 4FN5A 2QJTA 2UV8A 1L5MA 1U0EA 4H4CA 4XYGA 1RMYA 3GT7A 3SKVA 3WTBA 2WAAA 4ZTUB 4ZIRB 1QRDA 3R75A 3GA0A 3E22A 4PLYA 4XRRA 2ADMA 3SLKA 2BONA 1IY8A 1NR5A 2C9YA 1PWXA 3QVKA 5KYUA 5C1OA 1CR2A 2GD6A 4CR8A 4PBSA 2PAFA 1FS4A 5DNUA 5DLDA 3YASA 4HGZA 2PZMA 3SX0A 5KIAA 1L5NA 1UT5A 3EZ7A 2IH4A 5JI3E 5CAEB 2GESA 2FMXA 2G5GX 3LF2A 2XUOA 4GHWA 4MDYA 3LY5A 2ZKLA 4UUMA 3L8FA 1OWOA 1TRKA 4CIWA 1TUBA 4X64B 3R5SA 2G1KA 3C3KA 1E9CA 4QARA 4ZZ2A 3VR5A 1F2VA 2VHCA 2ZM6B 1FQOA 2Q5EA 4EL0A 2V98A 4DLTA 3MSXA 2IHVA 4DG8A 4MA5A 1YVEI 3LX6A 4IIVA 4AJ2A 3U7QA 3VPDA 3MWDA 4MQ6A 1Z73A 4RVCA 5B1EA 1VMIA 3KWJA 5BMOA 4D79A 4F4UA 3UJCA 5IAEA 2PTHA 3K30A 2F3SA 4WY5A 3ORHA 2WU1A 2FE1A 3ZY5A 2IXEA 2GWRA 3N7AA 3DOIA 3NHRA 4BKMA 2FLKA 3PNMA 3FB1A 3DXYA 2POCA 5EZYF 5LM3A 1VJDA 2EZ9A 1JAHA 1LVGA 2HU2A 4K0RA 4EPWA 1K5PA 1XHLA 1JKJA 2F8SA 2DERA 2YMPA 5DEIA 1Q0RA 4JB0A 5DMHA 1SBZA 2PE5A 2Q41A 4Q7LA 3V1LA 1ODKA 2QTBA 3R4VA 1RXCA 2R62A 3BD6A 4CFYA 1GQOA 2R96A 4OGWA 1E9VA 4R8KA 3O8QB 3KPYA 3JU3A 4GL4A 2C4UA 2HBQA 4YJFA 1GQFA 2M2IA 3HTXA 1BHJA 2FWJA 2HWUA 2ID4A 1KI8A 2UVPB 4Q5IA 3K9NA 1PUIA 4QELA 5BNTA 3DAYA 1L4MA 4WXHA 2J5QA 5JAHA 4D3YA 4DQLA 2ZVPX 4BQNA 5LD2B 3DWIA 1C4OA 2VUIB 2QPLA 2ZW9A 3LZDA 1BD3A 2D6FA 4HXFB 2GCOB 4IO0A 4DG5A 1A97A 3L0PA 3EIWA 3GN1A 1JFFB 1JXMA 1K6IA 1PFQA 3QBJA 3RS3A 2HRBA 4L16A 1NW4A 4MGIR 1E6UA 3U3JA 1Z08A 4JA0A 3LKVA 5FWXB 5KQRA 5KNDA 3TW6A 5KQSA 1SHZA 1E63A 2X0KA 4PCVA 4RULA 4GGOA 2Y9MB 3B89A 1HE8B 4YRFA 1AX9A 1Z45A 2VHYA 3PL5A 4HEQA 5LQSA 5EE3A 1LWNA 4XB1A 1G20E 1QKJA 3EQ6A 3VH2A 1YCGA 4EF5A 5C4MA 2BR4A 3NHLA 1GEGA 4DCNA 3S1AA 1MV5A 3L7JA 1GKIA 4GOMD 2AFRA 2F1HA 5HBGA 1ZS9A 4WZBB 2CL6X 1T29A 1TFUA 1ILWA 2ZJ4A 3AILA 4JQYA 1KJIA 2IE0A 4JGBA 3GLQA 2QN3A 3WGIA 1T9CA 3WAGA 2G67A 5EJAA 1L7BA 2W0MA 621PA 4GYJA 3TINA 3GD5A 1VCHA 5IMSA 3WLKX 3ZJYA 3RT1A 2HMSA 2ZUUA 3W4IA 3Q7QA 2P6OA 5A9SB 1OI7A 1NATA 3VHXB 1Y7TA 2C04A 3RSZA 1MRNA 1CRPA 1AH2A 3KTOA 1EVEA 5DYGA 3EBLA 5BPHA 4QEKA 3K1ZA 3W2HA 3MMXA 1E9DA 3BILA 2QPTA 1E1RA 1FXWF 4G36A 5KTTA 3WGJA 3FSJX 4UU0A 3A4MA 3OX4A 1JVSA 1UBEA 3PNBA 5CRIA 3NHZA 2H0QA 3QKIA 1BFKA 3G0OA 3JY6A 3H2ZA 4JJAA 2C59A 4FKZA 2Z08A 3GZTB 5LUAA 2XQKA 4BKUA 4H0CA 1IN8A 2F3RA 3GDWA 4U6QA 3KEQA 4QASA 4UEOA 3MCTA 2OBFA 3WHKA 3FWHA 4ZTZB 2XRMA 4PXAA 2QAGC 1P1KA 3B78A 5EJIA 3LOQA 5DRYA 5TJHA 3RSGA 1LNSA 3JQEA 1NM5C 4L2IB 5EE0A 4ALKA 4UBNA 1EIWA 2HPAA 3IV9A 2PO5A 4EM6A 4TMXA 4LSMA 4W8HA 2AZ4A 2M6KA 2F43A 3KJIA 4UBJA 1N6OA 3RC3A 3QE2A 4V2IA 2PL5A 2VTEA 3CRVA 1JTVA 2PKRA 4PRZA 2Q3FA 4MS3A 5FWNA 7YASA 2BVNA 1P80A 5E0OA 4FS3A 4KN9S 4ND2A 1Z0DA 2VF8A 2YV4A 1FVHA 2WYIA 1LX6A 4BFUA 5K0FA 2VQEB 1Z62A 1N5DA 1ZI9A 2TMYA 3LBNA 3HP1A 1ZK3A 3E4CA 4QQRA 3TJRA 1EUDA 1ULTA 4HQFA 3DFFA 4B3FX 3RLFA 5KREA 3MTEA 2HA0A 3TR5A 1JBKA 4H60A 1JDTA 4PYKA 1NUHA 3V4LA 1BX0A 2DH6A 2NWQA 1VLLA 1POXA 5EP2A 3BG5A 4NENA 5D3QA 2M32A 4LOLA 2QW1A 4LXUA 5K3SA 5L3RA 5JS2A 3OIWA 1GCIA 4RIHA 1QIKA 2BBSA 2GEBA 1EFTA 2GRUA 5D51S 1QH0A 3SR4A 1XWFA 2Q27A 4QYIB 3UV6A 2J6IA 4RZUA 2LWIA 3OUTA 5B37A 2ERCA 1QQAA 3I3OA 3QSYA 5EUCA 3GPDG 3NDJA 2QB5A 5AKLA 2GHRA 4BQEA 3ZZ0A 1KEZA 2FWIA 3CLSD 2FPXA 2F6RA 2W6MA 3NP7A 4WKBA 3TEMA 5DX8A 3NIBA 4QU0A 2PL9A 3E9CA 2AJ8A 2RKWA 2IXFA 3DD1A 3HVJA 1H2RS 4URVR 3A04A 1HO3A 5EZYA 4ZT6A 2FMIA 1HTTA 1LVHA 1MIOB 1JDJA 5AHXA 3K0SA 4IH1A 1A7UA 1NE2A 4PE5B 4AQDA 4D8WA 4R3WA 1D07A 2FQQA 3RFUA 3NGLA 3RBZA 3Q9UA 2ZJ7A 3GEGA 4LPSA 5CVJA 3AVVA 2O2IA 3IRVA 3VHQA 2PJRA 3A6EA 5B6PA 4X60A 4N5IX 4NU6A 4PAMA 1VA4A 4A1OA 1PX0A 2DAPA 3DLHA 4LRWA 5H70A 1JMKC 3IVMA 3RUCA 1RYBA 2FU5C 4HYQA 4XQ0A 4EHDA 4RX1A 1FFXB 4UNQA 4V1CA 4R71A 1V7PC 2FUKA 2GBIA 1BNCA 1YRQA 4FIZA 4MWDA 3LO5A 5L3SB 1RAHA 1AOXA 2Q7XA 3M6WA 2IHBA 3I9OA 4O29A 4XFKA 5ENZA 5IABA 1C1XB 2OBLA 2R8OA 5BVHA 1FRZA 3W5SA 2VT3A 1RKBA 4DUYB 1T9DA 2FSIA 3LI2A 4C7VA 2VXCA 4JENA 5JSKA 3JQGB 3EEOA 4I14A 1X86B 1QHIA 5ALVA 4C7OA 4DSZA 4V0OA 2ZIGA 4P83A 2V7TA 5SYAA 4I5EA 1CT9A 1NJ1A 1WWKA 4ZEWA 1PNQA 3I8OA 3KAKA 1AB6A 5K3AA 2X41A 1AO3A 2R5FA 2RK6A 3TB6A 1AQNA 2QI9C 2XVAA 1QFSA 4WHMA 4WZAA 5LUBA 1YZKA 1WZEA 2AZMA 4HDCA 4CETA 2V7BA 1USIA 2GB4A 2ZS9A 1F20A 2H1IA 4AB1A 3EUWA 3S4YA 2Q0QA 5F1PA 3EW7A 5BV0A 2DLCX 4AK9A 1EUCA 1Y9AA 4FC6A 4DIEA 3UK6A 5KYXA 1GUBA 1HDCA 2MIIA 1R0SA 4TYYA 3K8ZA 1P18A 5DTRA 2ZSBA 4EY3A 1FY2A 1UXKA 1U3FA 2XTJA 3CLUD 4IQFA 1KMQA 3UJ8A 4R0NA 4BBZA 1GR0A 2Z5GA 5ERGB 4AP6A 4N0QA 1D9ZA 1PFYA 4MRVA 3GJSA 3B8EA 2HRDA 2WG2A 3ETCA 4O2RA 4UHHA 4QUAA 3BHMA 3ZCRA 1QU2A 2P68A 1K9SA 1IEQA 1PJCA 1FXWA 4OGLA 3RIEA 3V7NA 1JLMA 1S8AA 3U4IA 1GTMA 3UK2A 1SN7A 3PGXA 2EFEB 3OBIA 3V00A 2ERXA 2IYLD 4TLAA 4ZA2A 3RD5A 1DKNA 3VDMA 2BEVB 5EJ7A 2E6KA 4U9UA 1OXMA 1HE3A 5IZCC 1HGXA 4DMCA 4N5NA 1WCIA 3ZX5A 5AI6A 1ABFA 3CU5A 4X6LA 1DUVG 4JV5B 1XD9A 3A1UA 5GJVC 1Q20A 4YRCA 4ID9A 2D59A 4OIMA 3UJ9A 3K0EA 1M66A 3LUFA 3P9CA 2AWOA 5H59A 5TMBA 2FWBA 1U2RA 2JK0A 3D7NA 4OMFG 2OV2A 4WWHA 4GYYA 1E1RD 1RYMA 2GZ1A 2HUPA 3CBQA 3IVRA 4LWQA 4NS1A 1F5NA 1CZHA 4F7DA 4E5VA 2DPGA 4Z6KA 4XXHA 3E15A 3TGLA 2Z5VA 4OJMX 5TEVA 3UXMA 4UULA 2DBYA 4B8ZA 4HEA1 3W90A 2EBFX 4CEHA 4RXTA 3ADKA 3LLMA 1QU3A 1FP1D 2IU6A 5EEGA 1XKLA 3UK0A 4EKNB 1XRJA 3PFBA 4XZ3A 4QPPA 1ZAKA 2INGX 3LQ2A 1FU8A 1Y42X 1V6AA 221PA 3VC7A 4B4DA 2XUDA 3EOBI 1YA4A 5ITZA 4G4SP 1U2ZA 4ZREA 3PYMA 4UW9A 4OKNA 3WIUA 2WU4A 3JD2A 4OLJA 4EO4A 3EEFA 3IE2A 3RF6A 1XF1A 2I6QA 3WIDA 4AF8A 4B1FA 2VJDA 4IUCS 5AW8A 1U0FA 4QLBA 3PC2A 4Q18A 3BTUA 1RM3A 1IM5A 2GEVA 3OT1A 1X2BA 4DNXA 2VC2B 1E2HA 4LHWA 3TLAA 4NZNA 3LCVB 3KQLA 1IRIA 3OT5A 2SICE 1U2QA 2EJBA 2H0RA 3G8AA 3ABQB 5KKAA 4LZNA 5E4JA 2GBLA 4X85A 4MV0A 3DNPA 4YCCA 3RT9A 2OV8A 1LGYA 3SLGA 3VU9B 3ZW9A 1NBOA 2POQX 2QLFA 3SICE 2WAMA 5EEHA 4EYEA 3JQFA 1XMJA 3DFKA 1G291 3RC7A 3C41J 4EZEA 2HM7A 4DV5B 4C4AA 3WMWA 3WRYC 1JQ3A 1BYUA 1Y82A 3RH0A 5LWQA 5EJ2A 1Q21A 3KEFA 4GRIA 4M6WA 3FYUC 3MJDA 3MJSA 5T5QA 5EHXA 3PZRA 4G01B 3LBFA 1NNSA 1S96A 3U3XA 3NHWA 3TG2A 1CXZA 4QBTA 4DR4B 4F5EA 1U0LA 2ATEA 2YV5A 2NSJA 4Q47A 5ILQA 1TLTA 3V4PB 3JAWB 1XZMA 3R24A 3DVRX 5B7GA 1D2RA 5DX0A 5FFNA 4R8RA 4UQPA 2VPWA 2WJVA 4ZT7A 5IBCA 1JVBA 2AA3A 3EIOA 2AR0A 1E9EA 1JEYA 3OKAA 3T9DA 3CVYA 1TF7A 2XR1A 4LZWA 5KJ6A 3EMVA 3O93A 4URFA 4D0RA 4A8JC 3EDYA 4DV6B 2RIPA 3IQEA 4KNVA 4F21A 3K70C 3N39C 4A4DA 2HMAA 1K06A 5T8KC 5JO9A 2Q5FA 2GM4A 1TK9A 1UMKA 2QGNA 3B5JA 3MQ2A 4IVRA 3DLIA 4JC8A 2CFRA 1KOGA 5CLQA 1CUFA 2DFNA 1PR1A 3EGVA 4CI9A 4B6PA 3KQOA 4Y30A 4F5ZA 4NE7A 2YN4A 4GKBA 1C3EA 1KAEA 3HVIA 3KB2A 3KSMA 3NQ41 3QLEA 3QYJA 2VDVE 2QF7A 4C1BA 5CIYA 1P91A 1PBTA 5KOHB 2BMJA 1P60A 2Y1DA 3K31A 2AD5A 2JJMA 3VPGA 4NMMA 1RPZA 2O8FA 1A88A 4NE9A 3H11A 3BN3A 3PT9A 4OGKA 5T64A 4DVJA 5JECA 2OQRA 2VYVA 2XQIA 2PKEA 1NN5A 1FVOA 2B1QA 2IOHA 4XIYA 1YCDA 2OLJA 5CLGA 1TB4A 4RYLA 3IFSA 3NHUA 5AVKA 4V1CI 1YS4A 1X9IA 1EFAA 3C1AA 3S1LA 4WFIA 3AHFA 4PYQA 4CLOA 1N7HA 1ADGA 2I29A 1XZJA 1DHRA 1N8KA 2C1ZA 4K9MA 4NJEB 4H59A 3AY6A 3VJMA 1RKUA 4QM6A 2GCGA 3HL4A 1UMDB 2WZCA 1L7NA 2KBFA 4FMDF 1CUYA 3VTZA 2FPGB 4HX2A 5TSDA 5LBTA 3OD5A 2WM8A 4IDFA 2VQ3A 4J1NA 2H5LA 4Q9IA 3ZXYA 3PPVA 2CWWA 4C7MA 1N5OX 4C76A 2Z43A 2V5UA 5MN4A 4ARIA 2J3HA 3JATA 3AHDA 1C5KA 2GAFA 1PZFA 3MOSA 1ZHFA 2WY2D 4BX8A 2Y0CA 1VJ5A 4YMIA 2GS9A 1KVSA 3HXTA 4M8NE 5AM2A 3OEHA 4IOKA 2D3WA 1OSNA 4IDGA 1NWHA 4ZQFA 5JU6A 3ZWMA 3EB9A 4I9HA 4GVLA 3RADC 3RIYA 4B43A 4EVSA 2OV1A 4CTMA 1N77A 3QEMB 4G1VA 1W9MA 1KYIA 4OQYA 1D4AA 4YJGA 1L5YA 5BSEA 2GTIA 2X8JB 3FUTA 1M34A 1CQWA 1S2NA 2LE0A 4REQB 4WA8A 5CB4F 2ZYAA 3AI1A 2C7VA 3GLTA 4PGGA 1RZRA 3V34A 3QLTA 2JFPA 3EFOA 1MNAA 2WFAA 4ZYXA 4RD6A 1ORVA 4XGKA 3AJAA 1DBIA 2QQ5A 4MQEB 1DCMA 5DTQA 3F6CA 2Y05A 1ECLA 3FPAA 4QEZA 4DCJA 1P2BA 2EARA 4Y18A 4GR4A 4NCKA 1OVGA 1TQHA 4EUHA 2VTDA 5KQMA 4QREA 3N0VA 3KVYA 4F56A 2Q28A 1SVUA 1TQ2A 2GBGA 5LMUB 1NW9B 1AB5A 5FBWB 3RAFC 3OM0A 4KH1A 4ZODA 3RF7A 3HP7A 2ZYUX 4HH0A 4LYDA 1M1YE 4OQEA 3UO8B 1T13A 3NBYC 5MGBA 2G88A 2Q8PA 1QTNA 2DHEA 2X7XA 3OZAA 1VHDA 4G63A 4CLRB 1JIUA 3PICA 2GO1A 1LXCA 3SVLA 3UGTA 4TV9B 2IF0A 1Q83A 5T4BA 1OAAA 1KO7A 2MYNA 5FLXA 2ONYA 5JBNA 2IXBA 4BO9A 2B82A 1GGHA 1Y8RB 3A6KA 2NU9B 2W6JA 1OGYA 3UUFA 1TGVA 1VCOA 3GDHA 3LPAA 4FQ5A 4GWLA 1K4KA 3S8EA 2QENA 3I6ZA 3QKRB 1YVUA 1TQ8A 2W00A 2X0EA 3UJPA 3QA9A 5CU7A 2IWRA 4GXRA 5AVVA 5TMDA 2C2OA 1Q0PA 1WX1A 2FZWA 3OOWA 2GPBA 1VCNA 5GVRA 1A71A 3HPRA 2AMVA 2PRIA 3DCNA 4FCTA 2XCSB 1WV1A 5TT0A 1K27A 1HQCA 2I3AA 2W4IA 3ILYA 5F9MA 1BVHA 4MR9B 4Z0NA 4Y2HA 3CNEA 3AVUA 4GOJA 5CJJA 4UMEA 4H7EA 4PGHA 3A7EA 4Q3DA 1DWUA 2PWPA 4UM8B 2B9EA 1VL6A 1P2FA 2FCAA 4J03A 4MR8A 4GPIB 4RWEA 4AYWA 2AYXA 2JLCA 4MB0A 5JNVA 3HV0A 2JNWA 1SHTX 1XYYA 2HDNB 2P4UA 3S2GA 3WL4A 4AG3A 4DS3A 4K28A 4G0YA 4YLYA 5C8ZA 5BR8B 3G1WA 3HKCA 3TX2A 3TLGB 1K5DA 2PNFA 4U0KA 4BEBA 1N9GA 2HRRA 4BFZA 1LD3A 3BAFA 4KQ9A 5AESA 1JUDA 1GUZA 5AWFC 4TXMA 1L6IA 4JYAB 3OLZA 2EATA 4TWZA 3JV7A 2VUUA 4R98A 4YQZA 1F8XA 3VPFA 3ZLJA 3KKNA 3HWX1 1QV6A 2XE8A 2EW1A 3IUJA 4HRXA 2G1PA 1DX4A 3ZW7A 2G77B 2JJ8A 4HTFA 3GUUA 3AZQA 1F0PA 4GOND 1BDHA 1G5IA 2NO6A 4XYMA 3GFSA 1ZOPA 4JMLA 4IH9A 3VPXA 5FBKA 3E7WA 5K8CA 1J8MF 1YGPA 1HYGA 3IHLA 4QDZA 3VYVA 2H2AA 3D8TA 1XEFA 2G9RA 4CM4B 4MUFA 4G5GA 3FVQA 1IN6A 2AXQA 4R2XA 4JBNA 8MHTA 1FYXA 4P7JA 4A2QA 2F8TA 1Z07A 1VPVA 3F5DA 1L5KA 4U39A 3A10A 4L07A 3FHOA 3BBPA 5KPDA 3MPUA 4ZI7B 5EXXA 2GDJA 4KDEA 4LF5B 2P78A 2ZZKA 3WZ2A 2AZDA 4Z49A 2PUAA 4D8XA 3OFSA 5FRDA 1TAGA 1CJUC 1KEVA 2ONZA 3JR7A 1PGQA 3CZQA 1GL9B 2CFOA 4L8YA 2QXUA 3P2IA 1U7DA 2B7CA 3RPEA 4PY2A 3UB2A 4MUXA 3BPSA 3JTEA 3LHFA 3P9KA 3R7WA 4RTSA 3N0RA 3PPXA 1Z4OA 1FBNA 2VYVD 2WNSA 1AS3A 2NSYA 4GMDA 4JT2A 4MGKR 4ACBA 3L4KA 2WG1A 4E5NA 5GJBA 8ABPA 3LS2A 2HTFA 1KDPA 2PKXA 2DHDA 3E22B 5E4YA 2ZWVA 4AY3A 4E4RA 4NZMA 1OB5A 1J8QA 4GGMX 3W34A 2QRMA 3ECSA 1BN7A 3RUDA 2ACKA 4C7BA 3E9ZA 3AJ8A 5LDHA 1C41A 5JNSA 2VRBA 1JE0A 3BICA 1KH1A 4Z7JA 5DIFA 3MTIA 3VKVA 1TUBB 3B7PA 3AF6A 3IT2A 3TTXA 2PN1A 5C53B 2F9LA 2CWDA 3DCJA 2QDKA 3M6MD 3PUJA 3Q7RA 4MQFA 2G9VA 1P0IA 1N7JA 2A9QA 1V25A 2RSLA 1P5ZB 3OEHD 1TYCA 3MWDB 3Q1KA 4KIWA 3D8RA 4R1OA 3M2TA 4YTEA 3VHLB 1G1MA 1OC2A 3MJHA 3V3KA 3L04A 2BR3A 2ENWA 2H4FA 2JH9A 3R7SA 4CTOA 1GFIA 3A2MA 3FRJA 4A92A 1R7RA 1QRRA 4BZXA 3S3TA 4EY6A 5KVAA 3O83A 1W25A 2ODAA 1AVTA 4R2HA 3RT7A 4EAAA 3WBKA 2OYRA 4D3DA 3NAQA 4J7AA 1P1HA 3E82A 5CVCA 1JI3A 4B5LA 3D1JA 3LRPA 3WVNA 1UMCA 2CBXA 4R7TA 4O3FA 1RZRD 1YQWA 4Q7KA 1IN5A 2DQKA 3DKKA 2CV2A 1QB8A 3FYCA 2H2DA 4CV1A 3I34X 3PZBA 1U6JA 2ZUEA 5JPDA 2X40A 4QFMA 3O8DA 1RBMA 2QGZA 1FUUA 2ZJ3A 3H4TA 4HNRA 2CF5A 4II2A 5BSUA 4EB6A 1SR8A 4QGSA 5IHPA 1DOZA 5LZ7A 3GLHB 1BMTA 2JHGA 2HCBA 1ADYA 1PHRA 3U17A 1W4ZA 1E77A 1A04A 1HBJA 1SD2A 3NBMA 1AT1A 4DCSA 4BO0A 1E0DA 3L4EA 3N0XA 4LDJA 1SVWA 5ADUS 4XRGA 1MQAA 4KGVA 2QIOA 4Z4HA 3GGDA 2BJWA 4PM4A 2QNRA 3SQXA 3A2KA 2Q4DA 3KQYA 2C98A 4YIKA 2C5GA 1C50A 1DIAA 1PR3A 1Z16A 2D1SA 5DNCA 2GETA 3TTYA 3UWPA 1Z13A 1MG5A 3ZCQA 1JGTA 2Z04A 3HEBA 3FCAA 3V32A 2W6JD