2EVWX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with r-caged gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title A newly designed microspectrofluorometer for kinetic studies on protein crystals in combination with x-ray diffraction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2evwX00
2JLYA 3RS5A 1Z6GA 1RE0A 4B2LA 4Z8XA 3AVTA 1E9EA 2O0KA 4G5QA 4ZIRB 1JPNA 1VIAA 2QTFA 1U99A 1SXJA 2ZTSA 3QY0A 4DLXA 4PAOA 1JR3A 1U0LA 5F9FA 3RLFA 4MQBA 1EX7A 2VSOA 4LCBA 5JJIA 5DN6D 4Q03A 4P4UA 2A5YB 4QGAA 2IWHA 3SYNA 5IRCD 4Q1FA 3ZJYA 2OG2A 2CK3D 1G291 1Y3AA 2BEKA 1XB2A 2YHSA 3U3KA 4B34A 2VP0A 2G77B 4Q1CA 4ZKEA 4HSEA 1G5RA 2WM9B 1XPUA 1DARA 4CEHB 5JHHB 1IBRA 1NY5A 3QG5A 2QSZA 1OT3A 4KFRA 3W5JA 5SZJA 5DIFA 2FF7A 2OV2A 2FSIA 4KO8A 4LHYA 3QKSB 2BBWA 4BLRA 4URWR 8OHMA 2FPLA 4ZI2A 1EFHA 1UDXA 4IEIA 2AFHE 3ZVRA 3EAQA 3PUWA 3QF4A 2C96A 4NYMQ 5FTKA 1E2NA 2I1QA 1DAGA 4TYWA 5DI9A 1T9HA 1ZBDA 2ZANA 1BMFA 2GCPA 4W5WA 3GCGA 3GLIE 2AXPA 1E96A 1FP6A 3RWOA 3T1QA 2QT0A 4Q47A 4E5UA 2OE2A 3F8TA 3KQNA 1E2GA 4EQ6A 2NZ8A 2WJIA 2GXAA 2GBLA 3IBYA 1JI0A 3B1WA 3GFOA 1G4AE 3CRRA 2RGNC 3UANA 4G01B 4KU4A 4NCKA 2WWHA 3FWYA 2O8CB 5E7IA 3TAUA 4LRWA 3N2IA 4G5RA 5HKKA 2XTNA 3NXSA 1OH8A 2NQ2C 1YZQA 3JVUA 5FPYA 1AKYA 3SOPA 1P3JA 3U5ZB 2FN4A 4IDNA 4NYMR 3ZIAD 4IXNA 3FKSD 2ZS8A 3PUXA 4LWZA 2PX0A 4OI1A 1E4YA 3QBTA 3W6PA 3ZS8A 5B64A 1AIPA 4M0LA 3F5FA 2ZI9A 2DFKB 1IM2A 5F98A 4B43A 2DFLA 2XNSA 4NKRA 4DB2A 2VHJA 2AL7A 2OM2A 4GRAA 2ONKA 5JI3E 4MUAA 1TU4A 3QKTA 2NG1A 4V0NA 1EFUA 1XCMA 4R2IA 1NMZA 1OH6A 1P75A 3B1VA 1S3GA 2DFTA 4P0TA 3GP8A 1L2TA 2GJKA 2W2VA 2ZAOA 3LDAA 4PC2A 5FL7A 4ARZA 4DLRA 3KXKA 1W7AA 2Z43A 2XOKA 4B3FX 4LI0A 5IK2A 4NCHA 4CEJB 4A0GA 3VR2A 2DWPA 1CS4C 5FOWA 4LX0A 3BFKA 3CM0A 3A4NA 4XSHA 4ZDKA 2ZUDA 2NO9A 1OYWA 3N5CA 3CRQA 4F93B 3FYHA 3QENA 2KBFA 4ZDIA 5JBQA 1DBSA 1XDBA 1D2MA 3L2OB 4S2EA 5A0FA 5AUNB 5KNCA 1CEEA 5BQ5A 2ZJBA 4UXHA 3EARA 1IY1A 1E2MA 2W6ID 1S9DA 2QEQA 4DKXA 4U5XA 3HP1A 4XD7A 4MUBA 3LFUA 1G8YA 1Q22A 2V1UA 2KBEA 2HYDA 1RFLA 4TMVA 1T3LA 2ZRLA 3VFDA 2BMEA 2VP4A 4XSGA 3R7WA 4L4UA 2QP3A 1R4AA 2GETA 2JJ1D 3GJ6A 1QHXA 3CF6R 2HCBA 2V54A 2FA9A 3CF2A 4A1FA 4B2IA 1P2VA 4P32A 5L3QB 4PSVA 3NHAA 4EDHA 5IT5A 2BJVA 2J5XA 1MV5A 2EFDB 3G5UA 4GL2A 1EFRD 2JCSA 4D4MA 4ZPXA 2YYZA 3QXCA 4FCTA 4PFSA 4DLYA 3GLIA 1DS6A 3E70C 1KK2A 3HPQA 5HE9A 3U7GA 2BM1A 3QEJA 2G1JA 2UKDA 2PLRA 5L8VA 3SE0A 3O8BA 3FB4A 4KBGA 3AB3A 4RSGA 2PX3A 2W58A 2YKGA 1Z3IX 1AGRA 1VMAA 3T1TA 3OZXA 2LKDA 1G19A 2PZEA 1IXSB 1R0XA 1SHZA 4YMVA 1E2DA 4JLNA 4OK5A 4OL0A 1SVKA 2IF2A 1A1VA 3FMFA 2QAGC 4O3MA 4F92B 2WICA 3T5GA 4DWJA 1GRQA 1FW6A 3EZFA 3SI7A 4GBMA 3B1ZA 1WQ1R 4V0ME 1KNQA 3T15A 4GZLA 3WNDA 2CVHA 1CP2A 2QBYB 2FEOA 5KNBA 1OPXA 1XD2B 1IY2A 5CLLA 4F91B 3CRVA 1Q12A 4FW9A 4XOIA 1KKLA 4HUQA 4A8JA 5SZIA 5DI3A 5DN6A 3KDSE 3KKQA 2QPOA 4GOXA 2IUUA 3SU8A 2FSGA 1XMIA 3CX8A 1QHGA 2ZAMA 1M7BA 4I81A 1M34E 5EE1A 3GLGE 2Q0HA 2QT1A 2XX3A 3LVQE 5E7JA 1H8ED 2CK3A 2ZIAA 1MO4A 4TL8A 2C03A 2Q6TA 2RGBA 5JSZA 1Q3HA 4O25A 3B1YA 2IYVA 1W0KD 3R9IA 5KDDA 2J0SA 2Z6VA 4ZDWA 3QXHA 4DCNA 1W44A 4E03A 1KYIA 3GLHE 4LJ8A 3B5JA 4JVNA 1EXMA 4M1WA 4P31A 3HPRA 4EJSB 1VPLA 4HYYA 4FXPA 1W0JD 1VG9B 1OB2A 4IEEA 3QVVA 3EWSA 4LYAA 2OUKA 4PZYA 1WF3A 2W00A 5JMTA 1CRQA 3GPLA 3U4QB 3P26A 4W5HA 2F1HA 5EZ6B 2JGNA 2WWXA 2VHQA 4A0FA 3OEED 4UNQA 1YR6A 1WBDA 1ZD9A 3TUJC 1RKBA 2WKPA 2XZPA 4AURA 3D31A 4POAA 3LX8A 4TL6A 4JLAA 4NHOA 2OCAA 1N5LA 2PL3A 2IYYA 5G3ZA 3SYKA 3QXJA 3IPYA 3WY9A 3ZS9A 5CJ2A 5DYIA 2J3EA 2XTMA 3V4FA 2FPMA 1CULC 4G0NA 2REOA 4TYPA 1KSGA 3CWQA 5D3MB 1F2UB 1N6IA 4M1MA 3VU9B 4Q4HA 4DT1B 4BFWA 1XCPA 1Z07A 3Q7QA 1SZPA 3KUDA 5A4JA 1OXVA 3PFIA 3HYTA 3EX7C 2UVQA 1E9RA 3BFXA 4LHWA 4Q48A 4BRWA 3QBVA 1GVNB 2ODBA 1MRNA 2ZJ2A 3AGQA 1IONA 4JSTA 3VR5A 1U8YA 4LGMA 5J5CA 3W90A 3EZ9A 3B9PA 1R0ZA 1OFHA 1ZVQA 2QZ4A 2AK2A 2F1IA 2PJRA 1SVLA 1E98A 3MD0A 1F60A 2QG6A 3VMFA 3QXSA 4HAYA 2ZJYA 1U2RA 1OHHD 4M1KA 4JIMA 1US8A 1KI3A 2ERYA 1VKJA 3BK7A 1AKEA 3B2EA 4V0MA 2PT7A 1VHTA 3H86A 1K6MA 1P2UA 2IYUA 2QAJA 1M7HA 1E79D 2HF9A 3K8YA 3OHMA 4C0KA 4WZAE 3HYRA 3I72A 3R20A 2XSZD 1S96A 4JZKA 5C46F 2KJQA 4JLVA 3UMSA 2D7DA 1AQYA 3MUFA 4BZQA 1U94A 3MFYA 4D4LA 4WXRA 1OJLA 3PQCA 3MSXA 3OE7A 5FPKA 4UJ5A 1NJGA 2HEIA 4MKIA 2GAOA 2VF7A 2AD5A 4C30A 5K8LA 2CCGA 3KB1A 1XPOA 3GJXC 3OIWA 3T1VA 3IIMA 1DPFA 2NZJA 5J47A 3LVRE 2X2EA 5FI1B 3U44B 2KB0A 3SBDA 5H8WA 1KI9A 4A6XA 4BECA 4KFSA 1DE0A 4V03A 4B71A 3IHWA 1WCV1 2GVZC 2L0XA 3I5XA 3GLHA 2CHGA 3CX6A 2VP9A 1GG2A 2FNAA 1TF2A 4JYBA 4TMWA 5FPSA 2G0TA 2EYQA 1UBCA 2Q3MA 2JJ1A 2A5GA 2C78A 4ZDJA 3F0TA 2O8EA 3C4JA 3VR4A 2FE4A 3E5HA 2G1KA 3ICQB 4A92A 5JECA 3TSWA 2IK8A 2QU8A 4BPBA 2XEXA 1CRPA 3Q85A 2JLQA 1Q57A 4PHTA 2G9NA 1A2BA 2ZRAA 3NWJA 1OV4A 1SVSA 1UADA 3RSOA 1KGDA 4XH9B 1XCGB 4EPVA 2EFCB 4Q9KA 2D74A 221PA 1ZRHA 2RAPA 3C41J 4DIEA 1G8FA 1ODFA 4Q9JA 2OXCA 3I73A 2CCKA 4L15A 4QHYA 2OO7A 1G7SA 4I1OA 4PPGA 3WMGA 1XFAA 2P65A 4Q4JB 3KQHA 4AI6A 3CX7A 2Q21A 4IFEA 5DNYB 2ZUCA 3CNLA 1E1RD 2PCLA 4JLPA 4FWTA 1QHYA 3CIOA 4OQNA 2MMCA 3NH9A 5CK4A 1Z83A 3A36A 4LJ4A 2W2TA 2G3YA 3OEHA 4FCWA 4CIDA 4XJXA 2BMDA 3LA6A 1O3YA 1KZGB 4GSYA 2FMXA 3RYTC 4DDWA 4A9AA 3U2QA 1II9A 1ZJ6A 1YZGA 5FTMA 2C95A 1GUAA 1KI7A 4Q1EA 1N3BA 3T5DA 3TE6A 1OXTA 4C0QC 1VG1A 2KI5A 2XGJA 1KK0A 2OILA 2Y8EA 1G8HA 4H1VA 2LWIA 4BFTA 3NG1A 5DHFA 4US2R 4QGFA 1XTJA 1ZCBA 2WKRA 3L43A 2B92A 4G3XA 2GHIA 4B74A 1WBBA 2MSEB 1YR7A 4TL9A 1W47A 1GKIA 4AKEA 1YHNA 2ZJ5A 3SR0A 4DC9A 5HZKA 2IX3A 2XJ9A 4M9XA 4R9UC 2GILA 3LW7A 1H8EA 4EFNA 2FFAA 4JT4A 5KNDA 4LY6A 1XX6A 4ITRC 2GRJA 5LD2B 4NH0A 5AR1A 4MYTA 1CF4A 3PEYA 2F9MA 3R9XA 3AF2A 2B8TA 4PC7A 3CR7A 5G53C 3LBNA 5JLJA 2GCOB 3LQRA 1FTSA 4UKDA 2IUTA 3K09A 4BLTA 4DDTA 1HEIA 2AD1A 4OI0A 1CTQA 1N2CE 1W0JA 1NN3A 2YINC 2XXAB 5JHGB 4R7ZA 4EJSC 2GK7A 2AKYA 1XPRA 2JASA 3OF5A 5L3RA 1A2KC 3OIUA 3THYA 2MMGA 3IIKA 3OEEA 3RHFA 4C0JA 1YZNA 2R2AA 3GQBA 1XJQA 1OIWA 3I1FA 5EJEA 3FOZA 3O8DA 3L0IB 3FMPB 4FMCB 3NDBB 4D4KA 4IXMA 2ORIA 3WYGA 4A0RA 1R5BA 4FMCF 3DMNA 2VO1A 5J4LA 4MRRA 5JS7A 1KZ7B 5KPJA 3PIRA 4ZO4A 4QJ3A 4HLDA 1CJVC 3OIYA 3PUZA 4OJKA 2ZVQX 3A8TA 3MMPA 3NTUA 4ZCLA 3I92A 3SBEA 4MYHA 4D26A 1NG1A 2UZ3A 3OESA 4HAUA 3DEFA 4LJ9A 3TAHA 1MO5A 3LV8A 4TLDA 2QQ0A 4KCGA 3FPAA 2JEOA 2PEZA 2C04A 2NGRA 2ZSAA 1AGPA 2RGXA 2SHKA 3AKYA 4FWIB 3RC3A 3VR1A 3ZQ6A 3H2YA 2O8BB 2WKQA 4KI0A 1ZD1A 1Q1QA 5KDOA 3AVYA 3WYAA 1QZXA 1GRRA 3BRWD 3U60B 2V6JA 4C2UA 4QC2A 1BKDR 5AJWA 1NLFA 2XAUA 2JJ2D 4FMDB 4YDSA 1UAAA 4FMDF 3IEVA 2B7BA 1RRPA 2ZSDA 4JKIA 4B75A 4TMZA 2BMJA 4GMDA 4MKGA 1D8TA 1D2EA 2CBZA 1Z63A 1G5TA 1JALA 3Q9LA 1RYHA 1YRBA 4D80A 4CRWB 3K70B 1E79A 1VCOA 2FSFA 2B21A 2R6DA 1G9XA 1T3SA 4FCVA 4CT4B 3EIEA 1NNEA 1TF5A 5H1YA 5B30A 2AWOA 3O8RA 3KJEA 3SQXA 3KKOA 2PZFA 3QKRB 2OEPA 5EP3A 3MAAC 2QPAA 2C9CA 3MLEA 1E2KA 4IOKA 5JJLA 2R6GA 3K9NA 3C8UA 2ZJAA 2D7CA 2P3SA 1KJYA 3V4RA 3ZVMA 3B13B 1G21E 3EW9A 3I62A 1X86B 1NL3A 4KLZA 3R8CA 1WP9A 3U3JA 3SQWA 3BC1A 3U6BA 2PEYA 4RFSB 1TUEA 4NL4H 2QL6A 4X8OA 4NYJQ 1J2JA 5FR1A 3BJIC 3NHBA 2AKAB 4K8OA 3GLFE 2PT5A 2OXRA 5GVSA 2H17A 4NYIQ 3ASYA 5CLQA 3K0AA 2IW3A 4ERNA 2R65A 4MYUA 2J0UA 3U3OA 4LV8B 521PA 4GI7A 1MO3A 2ZEJA 1E0JA 3EIQA 2H7VA 3BH7A 1YKSA 4JS0A 1KSJA 2BBTA 3ADCA 1CR2A 5TXGA 3NEYA 3X1WA 3HWSA 3VTKA 4JBWA 4IOMA 1RRGA 3MCAA 3ZLJA 3IUYA 2NO1A 4RKEA 2OFOA 4DLVA 3CLVA 5BXQC 1AN0A 2P0EA 2QTVB 1D9XA 2RB4A 3AP1A 2DB3A 4TZ6A 5DHAA 2ZYWX 4D0NA 1SXJB 2ZRDA 5HCIA 2QORA 4AYXA 2QY9A 5F2EA 3AH8A 2QMEA 3SJCA 4XWOA 2ZITA 4A36A 3KQKA 2VIIA 1T0HB 2BDTA 3D7MA 5LDDC 2BOVA 1L8QA 2NPFA 1Q44A 2WSSD 2EWWA 1UBGA 2Q3HA 1XZQA 1E1RA 1NSTA 4J0QA 3G0HA 1JR6A 1TEVA 1ZNYA 2J45A 621PA 1AS2A 1LW7A 3KXLA 2UZIR 4DEYA 4S35A 1ZC3A 1LS1A 2PLFA 1NVWQ 4YLGA 1RRCA 1OLOA 1J70A 1QHHA 2FG5A 4Q7LA 1GP2A 4W5JA 2J41A 3DZDA 3K9LA 1WXQA 1YZKA 2QMOA 2XITA 3DZ8A 4TLBA 4M9ZA 2GJSA 3T34A 3AUXA 3CRW1 2J7KA 2YOFA 4TQAA 4Q7MB 4C0BA 2ZE8A 3NIBA 1ZM2A 4HAVA 3E1SA 4OHZA 1G64A 1W2GA 2D3WA 4WBSA 3ZVLA 1KJZA 3BB3A 4JJKA 5TVKA 3TSOA 3DPUA 2GF0A 3QF4B 1FPMA 3CPEA 2VPPA 1P4SA 1UKZA 1NJFA 2HDNB 3K0FA 5G40A 3ZGXA 2VA8A 1A82A 1ZIPA 2ZROA 3QNUA 4JLKA 4YXWA 1JEEA 5C1BA 1NVUQ 2ZREA 3B78A 4MDEA 4BZXA 3DHWC 3VNUA 1O87A 1EESA 1YZTA 2ANBA 1E1QD 4G1UC 5C18A 1Q1ZA 3W8NA 2RGCA 5EXTA 4DCUA 4EQ6B 5JCZA 4QNRA 4H1UA 5LD2C 3AF0A 3C7KA 1Z6TA 2W83A 2P2LA 2NMVA 5FUVA 2NIPA 3REGA 1SKYE 3TUZC 4PQRA 1ZNZA 4KFTA 2YNMA 3REFA 2QAGA 5LB4A 4CEIA 3FGNA 1W36B 4C2TA 4KYUA 4DXAA 3MWLA 1TAGA 3SNHA 3GLFA 4DB4A 4TYQA 1Q1EA 1VHLA 4HAZA 2YOGA 1Z29A 4URVR 1H8HD 1PLJA 2A3RA 1BOFA 1U9IC 1X8LA 3W8RA 2BC9A 2HCJB 2IT1A 1E69A 1E32A 1TU3A 2BKEA 2CXXA 2R6FA 2GTPA 2VHCA 5FPHA 4LHZA 2GWHA 4ZIRA 1UKVY 2CVFA 2VHUA 3BAFA 3IQXA 1Z0FA 2GZDA 5J4YA 4QJ4A 1PZNA 1F48A 4HZUB 1NF3A 1T5LA 3HJNA 1J90A 1GFIA 3OFNA 4TSFA 3CB4A 4C3ZA 2FGJA 2GXQA 2OT3B 3B85A 5J4HA 1P73A 2WVJA 1ZM4A 5CIQA 4YMWA 3ND9A 1NN0A 4UXJA 1G17A 2ERXA 2IS2A 1G7RA 1TQ6A 1KK3A 4IFBA 1FOEB 2CJWA 4BFVA 2W6JD 4LHXA 4TMKA 4Q9IA 1FUUA 1Z0JA 1G16A 3C5CA 3DO6A 3VR6A 3UK6A 1II0A 1UF9A 1N6KA 1N0VC 1BYUA 5BN5A 1P6XA 2AX4A 2ZJZA 3LLUA 5JEEA 1WE2A 2BCGY 4LSGA 1E9AA 2JJ2A 2RCNA 4PSAA 5KSPA 1X3SA 1CLUA 5JRJA 1ZU5A 1X6VA 2ZRHA 5C2JB 4M4SA 2ZE6A 2YWGA 2IS6A 2AHOA 2YJTD 5JFGA 4JKYA 1ESMA 2AR7A 1P72A 3L82B 1ZMXA 2CLDX 3V00A 3R7WB 3K70C 4XWAA 4K81B 1FMJA 4D2IA 1WA5A 2V7QD 2WIBA 1EFCA 2C9YA 2IYRA 3ADKA 4E22A 5IHPA 3C15C 1VDZA 2EWVA 2WAYA 4LHVA 1RW4A 3VQTA 4DDVA 4RD3A 1MABA 4RD0A 3RRNA 3VKHA 5DYGA 4R71A 4WA7A 1YVDA 1DTSA 3NC0C 2WV9A 1I4TD 2EFGA 1IY0A 3KFVA 4GOKA 2VYFA 1MKYA 1UBEA 3GLIB 3ADDA 6Q21A 1Z5ZA 5E3HA 1E6CA 2OSBA 3K53A 1B23P 4IOLA 3GJ8A 3K9HA 4N0DA 3RS0A 3EXAA 2BV3A 1G4UR 3DM9B 3EA0A 3T06B 3U7FB 3ZD6A 3R9WA 2JDID 5G41A 2BKUA 1HY3A 5JJKA 4EPTA 5ANRB 3WNBA 3MGCA 4M8NE 2I4IA 3WP1B 1K5GA 2ZSBA 4KHZA 2XZLA 1CJKC 4UQOA 2CNWA 5CB6A 1G3MA 1G8PA 3WMFA 3HU1A 4B32A 1X1SA 2V4ZA 5FR2A 1IN8A 1XBTA 2MSDB 4HLUC 2A5DA 3B82A 1X1RA 4OJQA 1N6PA 3A1TA 1E9FA 2A78A 5AK0A 5LBIA 5E95A 3PVSA 2Z83A 1DELA 3TW4A 4IKEA 1E9SA 3SEAA 2WTUA 4MA4A 3GJ4A 4V02A 1TNDA 1N0WA 3TH5A 4MDFA 1NVXQ 4Q1BA 4AY2A 1F2TA 1XD9A 3TMKA 3AVVA 4KITB 3QI2A 5DI3B 4TLCA 2X19A 5DGXA 5L3SA 4URXR 3X1DA 4WZBE 1R5OA 2ZE7A 4CEJA 1DG3A 2N42A 3THXB 1II8A 1NBMD 2OCYC 2P6NA 2V55B 2R6AA 3DDCA 5JSZB 3SHWA 3RABA 1YZLA 1W46A 4NPHA 1Q0UA 1KAOA 2XNDD 1HE8B 5BYKA 3U61B 4QG7A 3NBXX 4QGGA 3VKGA 4NCJA 4ESVA 2REXB 4CZ2A 4HATA 1RIFA 2GJ8A 2IXGA 3MRSA 2V1XA 2CHVA 3CNNA 1HH4A 3ZDQA 3FDIA 3AM1A 3LW8A 3SDZA 2X2FA 5C4MA 4OHYA 1G3IA 1T0JB 4AKHA 1T8UA 2HLDD 5JWOA 2WSMA 1GTVA 4DLTA 1GL9B 5LPNA 3JVVA 4RD2A 4OQXA 4PPNA 1FTNA 1UM8A 4UNRA 5L3QA 1ZAKA 2C8VA 2H1LA 3PR1A 2IXFA 3H1TA 5JCPA 2V3CC 2CE7A 1NLZA 1E1QA 4E07A 4AYWA 3KQLA 3TSZA 1QDEA 4Y0AA 1FQJA 3THWB 3GMTA 4LJ7A 2GZAA 4MGYR 3PEVA 4BGDA 1CJUC 3TIFA 4Q7JB 4NU0A 4PO8A 3MJHA 2R9VA 2A5JA 5FBQB 3UG6A 2ZR7A 4LYFA 3Q3JB 4URUR 2FFQA 5E4FA 1LFDB 4L9WA 3PUYA 1DVRA 4UNSA 4P4SB 5JWHA 2OBLA 2VF8A 3DL0A 3QEOA 1U8ZA 2REBA 4KJZA 1WB9A 3AV0B 1W36C 2H8KA 5FUYA 3Q5DA 4DSOA 4ZV4A 4XTCS 1PLKA 3GEEA 3KKPA 1OF1A 3AVQA 2HJVA 5EE5B 5EXSA 3WBJA 4LV6A 4ZCMA 2QBYA 4IDPA 2FSHA 5FL3A 2WHXA 1MT0A 3S1AA 1T3HA 2TMKA 2VP2A 4RD4A 5EZ5A 5B2ZA 2GCNA 4Q00A 3CWZA 5JWRA 1CJMA 3LY5A 1TX4B 3KJHA 5DH9A 3TK1A 1IN6A 2F3TA 3LLMA 4CGZA 1ZUNB 2C5LA 1T4GA 3IQWA 3BB1A 5KHOC 2LKCA 3BD9A 1NBME 1AZSC 5E7MA 4F4JA 1A7JA 1Z6AA 1XJCA 2ZE5A 3SHFA 1GM5A 1QHSA 3H0KA 1YRAA 2GJAA 2NO6A 2W6JA 5EE3A 5FTNA 2GAAA 2JJ8A 4IOJA 5GJCA 5BN4A 1CJTC 1ZCAA 2ZR0A 1IQPA 3HDTA 2C2HA 2O8DA 4G5GA 2H5EA 4EKDA 4LDJA 5HCNA 1DAHA 5EXPA 3ZIAA 3GLGB 3FKSA 1E2JA 1NMXA 2ZI6A 4EPWA 3CPHA 2DPXA 4JBYA 4JYCA 5DISB 5IF9A 2VP6A 2J87A 1NRJB 3RRZA 3GLHB 3K0CC 4EPYA 1M2OB 2FU5C 2QPTA 2OCPA 1W4CA 4OQFA 5CK5A 3RAPR 2O8EB 2V7QA 1Z28A 2QENA 1VYUA 2FOLA 3LWNA 1TF7A 4CT5A 2ODEA 1NSFA 1E2QA 3NBYC 4MH0R 4Q1AA 4MRSA 3AVXA 2ZYTX 5TV2A 3BIFA 5J4KA 3I4LA 1F2UA 3VU9A 5FBVB 1I4LD 1YR9A 3CUEF 4V0OA 4PPQA 4DT1A 1CR1A 1JNYA 2ZRCA 2NPIA 3VKWA 3WHLA 2VSFA 4D81A 4DRZA 4F38A 4B3BA 4LYHA 1JEDA 2P6UA 4AG5A 1ZM7A 2W6IA 2WJHA 2GXUA 1NLYA 1E9CA 1IN4A 1VCNA 3B7GA 4XVRA 2RHMA 5KYKA 2ZRKA 3KL4A 2BM0A 2ZRGA 3I8XA 2FX3A 3D8BA 2QI9C 1OXXK 1E94E 1XWIA 4PZZA 5EP1A 1LB1B 4WAUA 2ZI5A 2H57A 4LBZA 2NOAA 5FFMA 5SZKB 1FX0B 1PLLA 1UEJA 2ECKA 1JXOA 2JLSA 4CF7A 1UKYA 1ZYUA 1IJFA 4C4PA 1CBUA 1D9ZA 1EFRA 4CVNA 4Q1DA 3AF3A 4LOAA 1W5TA 1J8MF 3NBZC 3DOFA 2ZU6A 1ZW6A 3GJ7A 2JLWA 3Q5EA 4PR0A 2GA8A 1JJ7A 4Q9LA 5TDHA 5GJVC 3I5YA 2CCJA 2CHQA 4RZ2A 3SJAA 1LY1A 2JAQA 2CL6X 1EX6A 2WZQA 3VR3A 1G3QA 4M2LA 1P9NA 5CYPA 1NBMA 1CXZA 3IBGA 4II7A 1N5IA 4ACBA 4BASA 3GJ0A 3CW2A 5HR5A 2WAXA 2CE2X 4NTZA 1ZIOA 4TLAA 2IYQA 3U3MA 1KDTA 1XEWY 2NO0A 4MGIR 3U44A 4RZUA 1XMSA 4A2WA 4AYTA 2VH5R 1BH2A 1T8TA 4MKHA 4DSTA 5J40A 1BIFA 1OXSC 2X1VA 3DKPA 3V9PA 3BWDD 4IHQA 1TQDA 2H16A 3AKCA 2ZYUX 4HEJA 2JIZD 2QP9X 3GEHA 3L0OA 4TWZA 3A6PC 3TR0A 2R62A 3QF7A 4DLUA 1ONBA 4WOPA 5FH9A 2NO7A 2R6CA 4LC1A 2HLDA 5KU1A 3THYB 3UATA 3WNCA 1Z6YA 2VLIA 1IHUA 2EW1A 4JLDA 4R2HA 2A7QA 2QP4A 1HT1E 1AS3A 2P5TB 3QSYA 2FH5B 1F3OA 1M8PA 3G82C 3WRYC 2VRWA 1KMQA 4PSKA 1SKQA 4F7WA 1OFTA 2OFXA 5CB8A 4BFSA 4DVGA 3NVAA 1PUJA 2WOOA 3Q72A 3I8SA 4BEBA 4B2PA 1AA9A 3L8YA 2QM8A 1W0KA 2F7SA 3W3AA 1W48A 4Q9HA 2AK3A 1DEKA 5UKDA 1TPZA 2IYLD 5C4GB 5KPDA 2KSQA 1GIAA 4PC3A 1G6OA 1NN1A 3BFVA 1OKKD 4FIDA 4Q4JA 4O2LA 5CM9C 3W5IA 4RZ3A 2RH5A 4LJ5A 1QG4A 3RS2A 2H92A 3EZ2A 1JJVA 3TR5A 4JL5A 4Q18A 1GZSA 4C7OA 4I4LA 1HA3A 1JB1A 2QTHA 2FDCA 2BMFA 3E2IA 5BYJA 5EP2A 3QIAA 2BCJQ 5JRZA 3BGWA 3TKLA 4AIIA 2RGAA 2IUSA 1Z06A 2AXNA 3NBFA 3EPHA 4US0R 3EWAA 3L0PA 4B3GA 1R10A 4YC7A 4A2PA 3RC8A 1XTSA 3QJYA 1DO0A 3I32A 1KTVA 2ZXUA 2DFNA 2F43B 3ZQJA 4GMXA 3FE2A 1U90A 5F3WB 1ZUHA 2ZYVX 1K5DA 2J1LA 4B47A 1C1YA 1GSIA 2WWIA 1EWRA 1TQ4A 1P2SA 2BEJA 4LBWA 4Q02A 5EUQB 1DAFA 1ZU4A 1E2HA 2OFWA 3AVOA 2W2XA 1W4AA 2IA5A 4URYR 4EAQA 1KHTA 2OESA 4ZI3A 1XRJA 3FMOB 1EWQA 3LBIA 2LCFA 1ZNWA 1L4YA 4OHVA 3GEIA 3L8ZA 5DO9A 5FOXA 3FFAA 4TLEA 3ICEA 1WMSA 2JATA 1EGAA 4LJ6A 1XXHB 2D62A 3TGPA 4HB2A 1Z08A 3P27A 3LH5A 4XVQA 5TB5A 5FBWB 1OHHA 4PANA 1ZM9A 1OIXA 2E1RA 3VX3A 2XXAA 1X8JA 2OHFA 4M1OA 1XEXA 3K0AB 1W36D 4MKFA 2IS1A 3NEJA 1NG9A 2J0UB 5HKKD 3FMIA 2A30A 2XSZA 4PZLA 1U9IA 4CDGA 4HDCA 3DKVA 3IIJA 5FOUA 3W34A 2E9SA 1N5JA 5EUMA 4LYJA 4OHWA 1TTTA 2N1BA 4PPFA 4KSCA 2GNOA 1RJ9B 5FOVA 2ZRMA 4PXAA 3KTAA 2FWRA 1JXMA 3WXMA 4D0LB 1ZC4A 2WJYA 1ETUA 2IS4A 3CNOA 2RGNA 3F3YA 3GFTA 4Q19A 2R8RA 3SFZA 1AQUA 2HT6A 1UKEA 4Q4AA 1LS6A 4GNKA 2CMKA 5IDVA 3LO5A 3HR8A 2PZGA 2R44A 3RANA 3NC1C 2BIFA 2O8BA 2HXSA 4HDOB 5FL7D 4HAWA 4TTRA 4YMSA 1ZNXA 1W2HA 3TBKA 1TUIA 3EC2A 2G0NA 2OLJA 1SGWA 3MG9A 2VP5A 1CU1A 1Z0KA 1QHHB 4FMBB 1XF9A 3UXMA 4RD1A 1Z8FA 3VX4A 2ZRFA 3IEUA 3LAWA 1DG1G 1WDTA 4QJ5A 3PITA 2FZ4A 2FGKA 4C0LA 3KX2A 3QPWA 4M1YA 2EVWX 2QMUA 3EPKA 3CZPA 1FP7A 2DWQA 2X77A 4X8MA 3UG7A 1OW3B 1RZ3A 3T61A 5TARA 4PO1A 2B8WA 4RKFA 3X1XA 4C0HA 3T35A 4ON9A 1GAJA 4AD8A 1PVOA 2ZRIA 3X1YA 3H84A 4TQUS 1E0SA 4M21A 4MGZR 3FTQA 4RZXA 3RRYA 3IHLA 2ZU0C 3PUVA 4IVRA 1KAGA 4DLZA 3LXXA 2ORWA 1GL7A 3AQ4A 3QXXA 5HPYB 5AWFC 1NVVR 2F1JA 3DVLA 4RFSA 4Q66C 121PA 1VTKA 3RDPA 1TADA 1X8KA 2GDJA 2GVDC 1QHIA 3K0EA 2ONJA 1KI6A 2WOJA 2J7PD 4OHXA 3I61A 2O8FA 2YOHA 2JIZA 2ZPTX 4JSYA 1IN7A 1E99A 3DMDA 4HLQB 2IWRA 821PA 1P9RA 1CR4A 4LK2A 4HLUA 5BW8A 4A6PA 1XNJA 1JECA 4AKIA 3RS7A 4AK9A 5CIWA 2XB4A 2FV8A 3CH4B 4GP6A 1N6RA 1FL9A 2OBMA 3P1JA 2RHDA 1M1YE 3JZAA 1C9KA 1KNXA 4YMUA 3KXIA 4P4TA 3NKVA 4DHEA 1P61B 1G8GA 4BFUA 1VECA 2JA1A 1GNPA 2J0VA 3NH6A 2VQSA 4ABYA 1G41A 2F9LA 4IW3B 4BFXA 1OKKA 3QKUA 4RVCA 2BHRA 3BERA 1ELOA 1NY6A 1S8FA 3KB2A 1XJ0A 2HT1A 3B60A 2NTYC 4WVFA 2CJWB 4AWXA 1H65A 3BORA 1E2IA 3ZVNA 1LF5A 4FI3C 4PHHA 1S3SA 3PEWA 2VBCA 3I3SR 1ZP6A 2A5FA 3A1VA 1QHNA 4U02A 4F4IA 5HE8A 4CW7A 3AVWA 4JLBA 4QBGB 4PC1A 4RY2A 1KMHA 1JQLB 4XTRA 1G20E 3KKMA 1OFIA 2GZHA 5CDFE 2GF9A 4IVPA 1IN5A 1ESNA 5SZHB 1AJEA 4DLSA 2IYTA 4MRVA 4V0KA 1A4RA 2WMNB 3SZRA 3Q8XB 2WPDD 1DOAA 1XTRA 1QF9A 3LX5A 4BFZA 2GESA 5AUPB 4YONB 1UPTA 1P2TA 4IVQA 3AGPA 1L4UA 2Q9CA 2HJGA 4YDHB 1C4OA 1E0KA 1VCIA 5AJYA 3AVUA 5GVRA 3SJZA 4ACAA 4LV5B 5CM8B 3JZMA 3VHLB 3EIHA 4ARZB 4DCSA 3DOEA 4TQ9A 4U00A 1V5WA 3K1JA 3L0SA 1MABB 3IO3A 1AM4D 3UWOA 1XMJA 4DBLC 5EE0A 2QSYA 1KO8A 2WBLC 4OBEA 2VHTA 1KDPA 2Z4SA 4PQYA 3THOA 1P5ZB 4BLSA 4CEHA 3QUSA 1G5PA 3ZYCA 1F5NA 4JVMA 2G83A 2D2FA 4QKQA 3QKSA 3EG5A 1Z2CA 2O5VA 3GFPA 1SULA 3P4XA 4IDQA 4JJZA 1G7CA 2B7CA 1B0UA 1LVGA 4Q4LA 1Y63A 4QM7A 1SKYB 1Z0DA 3SN6A 5GJWC 4NCIA 4DIDA 4PHFA 4GFDA 4GT1A 4BEJA 1Q3TA 2ZJ8A 1SQ5A 3W3ZB 3WYFA 1UJ2A 4IDOA 4M53A 2WMOB 3WRXC 1JAIA 1JAHA 3H4MA 2OZEA 2YC2C 3BXZA 4M1SA 1E3MA 1E0AA 2ORVA 4A2QA 1NP6A 4MRNA 1HYQA 1I2MA 4OI2A 5KSYA 4HZUA 4GDFA 1D6JA 1AZTA 1FUKA 5G3YA 1OB5A 1BS1A 5BWMA 4HI0E 3TLXA 2ASEA 1S2MA 1F2TB 5KSZA 3ASZA 3U3RA 5EQTA 2O8CA 4I1VA 4I99A 1ANKA 2WWFA 2YVUA 1T91A 4FD2A 5L3SB 4QNMA 3U7HB 1YE8A 4Z51A 2EU8A 2WJGA 5JS8A 4FINA 3ZH9B 3TVTA 3OE7D 1XMVA 2PMDA 1TL7C 1R6BX 3UIEA 2FFHA 1II8B 3CF0A 4KYIB 4L16A 2FJUA 4M22A 1XU4A 3VHXA 1GOTA 3QPUA 1KY3A 1DAKA 3FFBA 4NP6A 1J8YF 5FUWA 4EFLA 4I1UA 3RSLA 1MOZA 4XIGS 1GILA 1MO6A 1WRBA 3CR8A 3K0CA 3TJZA 5JI2E 2EQBA 4QOSA 5F9HA 1KI8A 1Z47A 3B1XA 1OE0A 5CDFA 4PX9A 2CL0X 1OH7A 3KJGA 3UWKA 2GJ9A 3LXRA 1SXJC 5D3QA 1R8QA 4CYMA 4HUQB 4A8JB 5KOYA 4PQFA 4PO9A 1BYIA 2WSSA 4EPXA 4XWKA 1E2FA 1XZPA 3CBQA 1NN5A 1KIMA 2XTZA 1HT2E 1NKSA 1XEWX 2ZUBA 3A4LA 3KQUA 4PAMA 2J0QA 1U8AA 5JZVA 2P6RA 4P3YA 2QRZA 3CRMA 3PEUA 3TUIC 2YWHA 3KUCA 1E4VA 1N5KA 3CO5A 3SC3A 1QVRA 4NCNA 1RC8A 2ZS9A 2FPKA 2HYIC 4ZCIA 1W49A 3ND8A 4BWYA 4A15A 1XTKA 2FEMA 4Q7KA 1KI2A 2J7PA 5FTJA 4AKGA 3X1ZA 1RVDA 3CKLA 4G5SA 4M1TA 1LNZA 3SYLA 2OBNA 4TN1A 5L3VA 2O52A 1QRAA 1MH1A 3EC1A 5CJPA 3T12A 3OEHD 4U7DA 4PAQA 1COWD 4D25A 1OXUA 1I2DA 1QG2A 4IRUB 3FHTA 1NIPA 3A1WA 1QVAA 1RYFA 1Z0AA 1JQJC 1OH5A 1J7KA 4WZ6A 1HURA 1S0UA 2PMKA 1OSNA 2VL7A 3UMFA 4KFUA 1IXZA 2YWEA 3S1AB 5CITA 2Z4RA 4A0HA 4Q4HB 1GRNA 4DSNA 3HU2A 1KY2A 1R0WA 2W0MA 3HR7A 4GP7A 5GADl 3IO5A 4DCVA 4X8LA 1PJRA 1E2LA 2GBLC 4L5BA 4Z1MD 1LF0A 1XD8A 2I3BA 2P67A 3VAAA 2ZRBA 4ESHA 2XZOA 4KODA 4EFMA 2Z0MA 3LRPA 1DAEA 1ZD8A 3THXA 2O0JA 4OYHA 4RCZA 2XJ4A 2D2EA 2O8DB 3B9QA 4BLOA 2EFEB 1E9BA 1R0YA 3PXGA 3Q7PA 3ETLA 1H8HA 3AF4A 4B76A 1HQCA 5DLQC 5H68A 1FQKA 1TMKA 1CR0A 2QN6A 4HDQB 3AP2A 3D6TB 1DO2A 1US8B 1XD2A 3PCRB 5H70A 2MSCB 1SVWA 2WPDA 2QA5A 1FFHA 5AUOB 3IDQA 1EK0A 1R5NA 1A5TA 1N6LA 4MITA 4OI4A 4TTQA 2Q3FA 4A82A 4HZIA 1KSHA 4D82A 2B6HA 1EG7A 1W1WA 1IAQA 2HV8A 4W9MC 4RFVA 2ZS7A 4B73A 2GXSA 1I4DD 2A9KA 3TVDA 4BZPA 2RGEA 2ODWA 3MJRA 1FMLA 5HTKA 1YR8A 3TNFA 3THWA 1P60A 3M1IA 5FBLB 3SJBA 3P32A 3O8CA 2ANCA 5CYOA 5KDLA 1VG8A 2AFIE 2AN9A 4OK3A 4RD6A 1FZQA 2ZETA 4DZZA 3R8FA 3GJ5A 4JBXA 4Y0VA 1GITA 1PV4A 1Q1BA 3QVUA 2V8OA 4TL7A 2EYUA 4EJSA 1KKMA 1NI3A 4NE2A 4Q5IA 3U4QA 4HLCA 2V6IA 1EFTA 4P4SA 2IL1A 4L8GA 1YZUA 1RRFA 3EASA 1R8SA 4B44A 4OQLA 4GZMA 2IEZA 1XP8A 1T5IA 4UNNA 2DBYA 2J59A 4NMMA 4Z8YA 2PJZA 4DUGD 2RGGA 1MR3F 1G1MA 2FFBA 3C16C 4Q21A 4Q01A 2ZQ5A 1GKUB 4LJYA 4Z54A 1CKEA 1YQTA 3VNVA 5LB2A 5EE9A 4XVUA 5D3MA 3IILA 4TMTA 1UDWA 1Z22A 2ZVPX 2YV5A 4QXAA 1UEIA 1AK2A 2DY1A 5B57C 4HAXA 2OCBA 2QE7D 2DR3A 3RWMB 3LBHA 1OYYA 2JDIA 4KXFB 2ZM5A 2E87A 1GL6A 1S1MA 2C98A 2O0HA 4JVLA 3RS3A 3BE4A 2FZLA 1U98A 2OLKA 5DE3A 2G6BA 3QG1A 4B48A 5K8IA 2C99A 2J9RA 1SHKA 1ZUIA 4URZR 3GLGA 2QROA 4L9SA 4WXPA 4O0MA 2GKSA 3PV0A 5AJXA 5GJBA 2JLRA 2GEUA 3SS8A 2WWWA 3LQQA 4IJMA 3B6EA 3BB4A 4JL8A 1HUQA 4TT3D 3BH6A 4HB3A 1BO6A 1ZM3A 1M6NA 2ODNA 4BLPA 4A4DA 1W4RA 3K70D 3SFVA 4NZYA 2ZSFA 3GJ3A 4KAXA 4DDUA 5P21A 4LC0A 2F1RA 1M7GA 2Q9BA 2QQEA 2ZJOA 1KO5A 3AUYA 4C0SA 1GKYA 2ZRPA 3PENA 4I1SA 4IDHA 4LPSA 3ONWA 1XTIA 4A8JC 2BBSA 2VTKA 1S9HA 2Q9AA 1E9DA 1GNRA 2ATVA 3AVPA 4ILEA 4AC9A 5K8TA 1SVOA 1GDDA 1F6BA 3BH0A 5FUXA 1FNNA 4MRPA 2ZSEA 3B8HA 4M9QA 2F6RA 3W9YA 2N46A 1KO1A 4LUCA 3IPXA 2XNDA 4K46A 3M4YA 1QBKC 2ZI3A 4DJTA 1IOZA 2PBRA 2QUZA 2ZI4A 3ZZTA 4NBSA 4ASUD 1VG0B 3CPJB 1TQ2A 3U7EB 4C7OB 4X8HA 2QM7A 2P5SA 4F4CA 1NKTA 2ZI7A 1COWA 2BWJA 3N2EA 4QFMA 2DCUA 5FPTA 4PTLA 5AUQA 3FKQA 4LBVA 4E09A 3OAAD 1FX0A 1HV8A 3TQFA 2DHRA 5KSOA 4DLWA 5KTYA 1VIYA 3TQCA 4JMPA 1GNQA 4W7SA 2IBMA 5TMPA 1KK1A 1UFQA 5FTLA 3A58B 2BJWA 1OFUX 3UPUA 3O47A 1IXRC 1J99A 3OIVA 4QBFA 1W5SA 1SXJD 4B33A 1VYVA 3PJRA 4YMTA 2JLVA 4QHTA 4M9SA 1JR3D 2EFHB 3KZ1E 4OQMA 4KV9A 5HZHA 4B6EA 4Z1MA 4HUTA 2XB2A 3X2SA 4YXWD 1GWNA 1HTWA 4KLNA 1NIJA 2J46A 2CEAA 1XXHE 3KFXA 721PA 1G18A 3IKJA 1VCMA 3NDPA 3UMRA 5FBRB 3EA5A 3K9GA 1M74A 3ZZ0A 5EP4A 4D6PA 1E2PA 3FHCB 4B3XA 2RMKA 1KI1A 1YU9A 1MRSA 4P33A 4ZKDA 1KI4A 2ZRNA 5M04A 4TZ0A 1KO7A 1DADA 2F55A 3BOSA 5EXXA 4NDZA 3QPVA 2H18A 2WIAA 2OAQ1 4C0AC 2AWNA 2IEYA 4QL3A 5JEDA 4JVSB 1KSFX 4N3NA 1XEXB 1HE1C 2ZRJA 3M0EA 1R7RA 4BUJA 3A1SA 3DM5A 1W4BA 2DWOA 3D3QA 3AF1A 5BN3A 3WHKA 1KJWA 4N1AA 3FHOA 3W6NA 1KOFA 3IGFA 4EPRA 1BMFD 4B3DA 4QHSA 3CH5A 4WW0A 3C5HA 3W6OA 2KE5A 4AG6A 3T1OA 1N25A 5A5GA 3KTAB 2JLZA 4H9GA 2HUPA 4N0EA 5B58C 4DSUA 3N70A 3U6KA 3A37A 1Z2AA 1G6HA 3RS4A 2WJVA 3OFND 4TSFD 3UKDA 1T6NA 4YQFA 1N0UA 2GCOA 4B6FA 3PG5A 4Q4AB 4LBYA 1RPZA 3MWKA 2YC4C 4WIAA 1SVMA 3QE0A 4BE7B 4KVAA 1JPJA 4UNPA 5TY0A 1XEFA 2IHBA 3ZZUA 4QM6A 4JLJA 4LPKA 3EZ7A 3RVBA 3K0SA 1N6HA 2GEVA 3RRMA 4BFYA 4TYYA 2CDNA 3MWJA 3FVQA 4B35A 2G88A 3AEZA 1G7TA 3AKEA 4KBFA 2QMHA 3P20A 1P62B 4DUGA 4HB0A 1SVIA 1SXJE 1E2EA 1AS0A 1KDRA 1JR3E 2JLUA 5ELXA 4R98A 4JLMA 3EZ6A 2F43A 1P7CA 2D06A 5K8UA 4QRHA 3MWYW 1K8RA 1Z0IA 4D4JA 2F3RA 2V9PA 3CZQA 3TW8B 4D0GA 2QRNA 1PUIA 2WJJA 2QGZA 1U81A 3LNCA 2DYKA 2Z5FA 3BS4A 3GD7A 3M6AA 2VEDA 4LZZA 4PHGA 2QE7A 2IC5A 2HF8A 4KSBA 2A2ZA 5FOSA 4JT2A 1UBFA 4QGHA 1KO4A 4RCYA 2XOKD 1NVVQ 4FN5A 5AJZA 4BQSA 5IK2D 2IYXA 3QQ5A 4BRUA 1OIVA 2RKOA 3WP0A 1VYTA 4GOJA 3QOFA 1CIPA 4G5OA 1HQYE 2CL7X 2CLCX 4TMXA 2C9OA 1N6OA 1XXHA 3AKDA 4TYNA 3A4MA 3A1UA 5FOTA 4MYCA 1IJEA 1XTQA 2IYZA 2W0SA 2ZR9A 1U0HC 1Q21A 1DAIA 4RJLA 4QBHA 1KI6B 3HU3A 4QBIA 2IXEA 2O8FB 2ATXA 4TT3A 4GPTA 3KKNA 4XD7D 5FI0B 4PC6A 3WBKA 4DCTA 1G3UA 1U0JA 3BBPA 1L7VC 2X8AA 3AP3A 1V43A 2KWIA 2WWYA 1D5CA 2QGNA 1DAMA 1TEXA 4C9BA 2CNWD 2IHYA 1D2NA 3K0FB 1FNMA 2IF0A 2IYWA 3LD9A 3QKRA 1G3RA 3P4YA 5KUTA 4BLQA 1KDOA 2YZ2A 3ADBA 4OKSA 3C14C 4OK6A 4KVGA 4B3CA 1N6NA 1RJ9A 2GEDA 5J4VA 4NONA 1R2QA 1ZINA 2PCJA 2IYSA 1S4QA 4O2RA 2WWGA 2RGDA 2OAP1 4HB4A 1LV7A 3EPLA 4UXIA 4EIWA 3ECCA 4EUNA 3CONA 4MGKR 2JLXA 421PA 1P9WA 1NMYA 2YWFA 3ZD7A 2CLSA 4TTPA 4JL6A 1LTQA 4US1R 2BBOA 1JBKA 2K5UA 4LJAA 3RNLA 1Z6XA 4V0LA 4ASUA 2VSXA 4NYJR 3K09C 2PH1A 2QNRA 2BVNA 3J81k 4JLOA 2D4HA 2QAGB 4DEXA 4CEIB 3WMEA 2HXYA 4NYIR 5AJVB 3TRFA 2C77A 3KJIA 3EPJA 1Q20A 3GLFB 5KO2A 2GK6A 2I1VB 4UJ3A 3OAAA 1YJ5A 1KMHB 5DSZA 1S1CA
chains in the Genus database with same CATH superfamily
2WG0A 3FI9A 4B6GA 3TQSA 1ISMA 4OQPA 4HNSA 4WE3A 4C6SA 1NDUA 1ODSA 2PX4A 2QRQA 4Z8XA 1T5SA 1E9EA 2FDRA 1Q16A 3A6PC 1W75A 4RJIA 3K1YA 1JPNA 1WY5A 2H2WA 5KNBD 4JEIA 1TO6A 1JGTA 4F71A 4HK4A 2Q50A 1U0RA 4EUKA 3AERA 4G0ZA 4OXNA 3ZTWA 3KBBA 5M2QA 1VJ0A 3EFHA 1U0LA 1GCGA 2PHZA 3QA9A 3AEKB 1NKVA 4GEKA 4MQBA 4PCLA 3D5EA 3RLFA 3RUAA 4AF6A 5B1SA 5JJIA 3VKHA 4X1YA 1Q0ZA 1ZFNA 3G0IA 4EARA 4EL5A 3GNQA 1QB7A 1YZFA 3L6OO 3OP1A 1EKXA 2A5YB 2ARKA 4QGAA 4ID9A 4GGOA 3ROPA 3SYNA 4C4YA 5AM4A 4TV9A 4K87A 1V3QE 3N76A 4AUKA 3ZJYA 1Z16A 2OG2A 4JU9A 4N0QA 3T4PA 3ROZA 5IDQA 1XNQB 4JEHA 3EISA 1Y3AA 4D6XA 2ZJ1A 4B34A 1SC9A 4GX1A 4RQUA 5JNWA 1RZRD 2G77B 1WDMA 4ZKEA 4V1CI 3ND7A 4GG1A 3SHTA 2ZSIA 1IBRA 2UUPA 3ABRB 3QG5A 4RA6B 4ZVPA 5JAZA 1EE2A 4BKMA 2CN1A 4HNAA 3HLYA 4NQZA 4M0KA 4OHMA 4UBNA 3DDNA 3JYPA 4GLLA 4LHYA 4BZWA 2X9GA 4JLWA 4YCMA 1Z18A 4WEOA 3V4SA 3NNNA 4X9XA 4IEIA 4HCJA 2AC2A 3EAQA 1C50A 1KPIA 1C3LA 1YBFA 5I7RA 4UFNA 3G02A 4L51A 2I1QA 5FTKA 5B1HA 2YQZA 5DI9A 2WHPB 3QU4A 4L5JA 4YVFA 1ZBDA 4PZDA 4WN9A 4D6YA 2IELA 1W1UA 2D13A 2OD7A 2Y77A 2ZANA 3MILA 3GLIE 3OJEA 1A9XA 1PT5A 5EVJA 1ODIA 2GYWA 2CZCA 1WD5A 4Q47A 1CYEA 3R5TA 1L6IA 1TE2A 2OE2A 2UDPA 5BMVA 1U7ZA 1QO0D 1FFWA 1X15A 4H0FA 3WSVA 3KQNA 3ROTA 3MLAA 4MB0A 4NBUA 2GXAA 1LXCA 2PH7A 3BF7A 3FJOA 1UZAA 3FM9A 3GB9A 1VPEA 1M1YB 3MOSA 1PF7E 4EYEA 5JNTA 4F2DA 3JQ9A 3N8GA 2WWHA 4C4TA 3GEMA 3IX7A 4HAIA 5E7IA 2ZSJA 3R3YA 2E49A 1T26A 3ZDEA 1J5XA 3GAMA 1GGMA 4XZ3A 2XTNA 3JZDA 3S44A 1OUMA 3IVGA 4R0MA 4FZJA 1YZQA 4R83A 1DRUA 3CVXA 3H7IA 1V8PA 1QAMA 1YQ9A 4HRVA 3AIMA 3SOPA 1FSGA 2BF7A 4IHJF 4LWZA 3FKSD 2ZS8A 3NHYA 5J2UB 1E4YA 1Y4DE 2NXEA 3ZS8A 4UVDA 1ZG3A 3LWDA 2Y1LA 2VJNA 5I5EA 3VNAA 2RBGA 3RROA 3WDKA 2VTBB 2SKDA 1WW2A 4DB2A 1GV1A 1QYWA 3ZXYA 1BROA 2OM2A 4Y7DA 4GRAA 4B6RA 5JI3E 1TIKA 1E7SA 2ZIUB 3FW1A 2P75A 2DSNA 4AMVA 2QX9A 3L8FA 4U7TB 3GFBA 6REQA 2PRSA 4V0NA 3R3JA 1DO8A 1OH6A 3RREA 1UAGA 3E1KA 4EJ6A 1HFEL 1YMQA 5IH7A 3BQMB 4BV3A 3QMWA 3VH3A 2WU4A 2ZYAA 2W2VA 1OZFA 4FS3A 1W7AA 4PC2A 4KLAA 3ZZ1A 1I30A 2Z43A 2XOKA 2J3MA 3OHSX 3QEMA 4YJGA 4MGHA 4B3FX 4DJEC 3AY6A 5LXTA 1FNSA 4MCAA 1Z7WA 5FOWA 2HREA 4N4AA 5DHSA 3S7TA 3NOXA 4F0JA 4ZDKA 3L9XA 4RDCA 3DT6A 1TC2A 3N5CA 1YQDA 4F93B 4OEHA 4NDAA 3ZWMA 2G7MC 1JDBC 1AHIA 3EG9A 2KBFA 3KKKA 3M82A 3WB2A 4E2XA 4EUHA 5JBQA 1XDBA 1CEEA 4S2EA 4I7EA 1UWVA 2C2MA 3T8YA 3EJWA 1IY1A 2F8LA 2RG7A 3D64A 1TZKA 2PANA 3HP1A 3LFUA 1N9GA 1WR8A 4FYVA 4XD7A 4XLTA 2KBEA 4D8VA 2V1UA 3VFDA 2V7BA 2ZRLA 2VH1A 3WLLA 3R0IA 4OFBA 3ZBUA 1UIMA 2VP4A 4X62B 4IIJB 4E32A 3KR0A 4L4UA 1LBQA 3G23A 2GETA 2BKAA 3GJ6A 1PJZA 2HCFA 3EF3A 3VR4D 2FA9A 3QEAZ 1PG5A 1XCLA 4TN5A 4E2YA 1P2VA 5FO1A 5L3QB 3NHAA 4TV8B 1SIOA 1ZL2A 2EFDB 1IL0A 1LLCA 3G5UA 4GL2A 1EFRD 2PGIA 5IUNC 3SKVA 3D0RA 2O7QA 4ZPXA 3S70A 3OTGA 4FCTA 1U3WA 4DLYA 1FDTA 1DS6A 3E70C 5HE9A 3WI7A 4NG4A 4I5GA 2O6HA 3JW8A 1C5KA 3MF4A 5JSYA 2YIDA 3AIOA 2PLRA 3Q8LA 3O8BA 3FB4A 1NRIA 4IJUA 1OCEA 2PX3A 1ZUWA 3D0QA 1Z3IX 1OWPA 4F9GA 2W6QA 1TVCA 4YAFA 3RG2A 1KQPA 1IXSB 4JBHA 1SHZA 4YMVA 2UZ1A 5KYVA 1QV6A 4FXOA 4Q16A 5IVIA 1Q0LA 3PYXA 4F1JA 3QE2A 2O14A 3NFYA 2BFNA 6LDHA 2Q6LA 4DQKA 3A9TA 4EY6A 3JZFA 3EZFA 5KYUA 2QIPA 1NBWB 5LA6F 3K31A 3DF9A 4GBMA 1WQ1R 1KNQA 2ETXA 1F8YA 2J9ZB 1SKMA 3WNDA 5GTDA 4PG4A 1PEYA 2VP3A 1FCJA 2IV2X 1HDIA 5CT6A 4WNCA 2IU0A 1OPXA 1XD2B 4GXRA 4UBIA 3DFIA 3U62A 3JAKA 3RK1A 1RM5A 1WMDA 5L6MB 4LRQA 3I6MA 1NLUA 3PTZA 2HM7A 2XODA 2ZBRA 4I3FA 4JUFA 1NUUA 4CCAA 4M0DA 2RK6A 3ZHUA 3CN7A 2ZB3A 5DI3A 3A7EA 5DN6A 1NI4B 4MICA 4RVFA 2PH5A 2QPOA 5EJMA 3DFKA 3DW1X 2IUUA 1QHGA 4I81A 2ZSHA 2R00A 2I8AA 3GLGE 2VPYA 3WG9A 3I09A 2P62A 3LVQE 5E7JA 2XUQA 2JRCA 4CFYA 1ZVMA 2RB5A 2CK3A 4V1CA 4M60A 3UTDA 1I3OA 2VNIA 4C6TA 1Y1QA 2XRMA 1WVMA 4O25A 4P3XA 2TMGA 1WCWA 4BKPA 1BWSA 3A4IA 3TL3A 4EW1A 1ZESA 3QXHA 1W44A 4DTIA 1KYIA 4LJ8A 4RIFA 3TBHA 3FCAA 2Z2XA 3UK1A 3W2FA 1E5DA 3GLRA 3HPRA 1J4AA 3I8OA 4EJSB 2R1TB 2HCRA 3O9MA 1B3BA 3RBAA 1W0JD 2P3OA 4J0JA 4DA8A 1LJUA 3GRPA 5IAKA 3GPLA 2DETA 4W5HA 3OTQA 2X4IA 2JLZA 4D9CA 4WUVA 4YO8A 2FF5A 4RM2A 4YRBA 2I7DA 3NBMA 4GQAA 5IEBA 4Y2SA 2I2CA 3HJAA 4W6ZA 3OEED 4UNQA 2H4HA 3TLEA 1N8NA 1X2EA 1ZD9A 5A5VA 4UHDA 2W2LD 1JR4A 2WVHA 4TKLA 3RI3A 1Z4OA 5IVHA 4RKWA 1IZ0A 3V33A 2H1HA 5JY6A 3IL2A 4FHZA 3AB8A 1PJTA 1TZCA 5D2CA 1X87A 3IPYA 2EJTA 1JFFB 1NVGA 2FMTA 1E1KA 4GDMA 2XTMA 5DYIA 2FPMA 1CULC 2FUEA 1CNFA 2JD2A 2REOA 3CWQA 3G59A 3MFQA 1F2UB 5IN5A 3PUKA 1N3IA 3ZZNA 4K0RA 4AB1A 1K8XB 1GPWB 3GNTA 1X7ZB 4KQ1A 2XVZA 5BQ3A 1VMKA 1V1MB 3OOHA 4RTQA 1SOWA 4QUIA 5AHRA 3PFIA 3HYTA 4KE6A 5EJ8A 5B3JC 1XLUA 3C45A 2XDQB 5CBPB 1E9RA 1SPXA 5CEFA 4O8ZA 3QBVA 1GVNB 3JSAA 1KBQA 2Y0DA 1JH9A 3HN2A 3OPMA 5J5CA 4V2IA 3B9PA 1R0ZA 3CUYA 4MXDA 1L3CA 9MHTA 3GJYA 1KC3A 2AK2A 2F1IA 1R0CA 1RABA 3TRJA 1VL6A 2QG6A 2Z3WA 3N0RA 2NZUG 3WLSA 2B83A 3ZI4A 4M1KA 4JIMA 1X42A 1TJNA 2F4NA 3WLQA 5CVTA 1NMQA 4J03A 1KQ3A 2X40A 2XUIA 3BK1A 1IE3A 4BP1A 3QOWA 4UUQA 5LBTA 2ORED 1AKEA 1FPQA 3B2EA 3CTPA 3NV7A 1PTKA 1QQ7A 4Z1OA 1U2SA 2IYUA 2JIBA 4QPZA 4C0KA 5ICFA 3SSOA 4WZAE 4B4OA 3I72A 4Q0MA 3DH0A 5C46F 4W5TA 1JHPA 2KJQA 3CJRA 4GYWA 1JFRA 3VA7A 4IWNA 3TZHA 3VH2A 3A3NA 4KO2S 4BZQA 2H54A 1OJLA 4QPDA 5DM0A 3MSXA 1ZGCA 5FPKA 2O57A 1FBNA 4M9UA 3CCCA 3A3PA 1RYNA 5EC8A 3STWA 1NA5A 1XDZA 2D2IA 5LQDA 1M34A 2ZUWA 5KKAA 4MRAA 2A0FA 3KB1A 5FWDA 3BTOA 3OIWA 2Y6VA 2HWWA 2X2EA 3LS2A 2KB0A 3HKEB 1RU3A 1U4NA 1EVLA 3F6RA 3WJAA 4A6XA 4EI2A 1JHQA 4V03A 4B71A 3COSA 3IHWA 3SKYA 3D4NA 2L0XA 3ZX5A 3QK7A 4JQSA 1PWXA 3WXBA 1YRQA 2CHGA 1STOA 3A0UA 4JP8A 3HP4A 4JYBA 1QGZA 1P1RA 4TMWA 2DJIA 2INGX 2RK3A 5FPSA 2NZXA 3RU7A 4D9BA 4ZDJA 2JJ1A 2A5GA 4XM1A 4JP5A 3C4JA 2G1KA 2O19A 1E1NA 3TSWA 2IK8A 2XWJI 2XQIA 1KAMA 4PIVA 2QU8A 3IUJA 3N1UA 2FWJA 2JLQA 1Q57A 4TXMA 3W9BA 1A2BA 5HJ7A 2IH2A 7MHTA 2EWMA 1EA5A 1OV4A 3L18A 5ESDA 5TQ2B 2R0QC 1T2DA 1RAAA 1XCGB 2H1SA 3BWCA 3IMCA 1Z82A 2GB4A 5IKEA 2JK0A 2D74A 3SSAA 4ATNA 3SVZA 3ZWBA 2RAPA 4D3YA 5JS1A 3JQPA 4GQIA 4ZT3A 3STYA 2ACEA 3I73A 3OQBA 4I9UA 3RHZA 2OKCA 3I9V1 4L15A 4QHYA 4YRFA 2OO7A 2P1RA 2H5LA 3WMGA 3KAPA 4Q4JB 1D1QA 4JUAA 4UU1A 4HQRA 4OGWA 3FYCA 5DBOA 1E1RD 1BWQA 4JLPA 5F33A 3T0GA 1MV8A 3GLUA 2YRXA 2G9ZA 2F9FA 5F4BA 4FJ2A 1MC4A 3QUQA 2B82A 2G3YA 1J2RA 3TNJA 4BN5A 4ZOBA 4CIDA 1N8SA 3LPDA 2Q5OA 4JJ7A 5LU9A 2RJ3A 2QG4A 4P7BA 1KZGB 4GSYA 4YJKA 1AO3A 1LRLA 3DUFA 4A9AA 1Z45A 1H2FA 3U2QA 1II9A 4Z4EA 5CDTA 1YZGA 4WN3A 3BIJA 5A7GA 4G4IA 4J0IA 1EGVB 1N3BA 3T5DA 1YNSA 1OXTA 3NUQA 3AF6A 1PP4A 3WRXC 1KK0A 2Y8EA 1PNQA 1G8HA 3EZXA 5AVVA 3G1WA 3QEBZ 3TS1A 3NG1A 4HVTA 1KJ8A 1N2ZA 4J07A 4UMFA 1ZCBA 5T7BA 4RJTA 1U2GC 2MSEB 3N59A 4QASA 3LQ4A 5ICSA 1WBBA 3SZGA 3JQBC 1VL2A 4G81A 3JALB 4PSUA 2YW9A 5AM5A 2ZJ5A 4BNFA 3LUHA 1NXTA 5IBPA 5B53A 4F45A 5KBYA 1P3Y1 4BO0A 1YVRA 2ZB4A 3FCYA 1JQDA 1NUHA 1ZONA 1SQ6A 1H8EA 1E2UA 2BEVB 3DTVB 3N6VA 4JT4A 4L6AA 1Y3CE 5KNDA 4K6HA 1QPBA 3CZ4A 2VOJA 1NW9B 3N74A 3OM9A 4YR9A 5KOJA 1CF4A 3R9XA 1K06A 3MMSA 4FE3A 2V7XA 3RFVA 5CX1B 4FM9A 3K09A 2JL1A 3E2MA 3VSBA 5BPHA 4DR6B 3CYFA 1F17A 5CA0F 3FCOA 1NN3A 4AT1A 1R27A 2RGRA 3S8MA 2AKYA 1GTZA 1U8FO 3DWEX 3JRXA 1NQTA 4L07A 3RQIA 2Q49A 3OF5A 4E51A 1ZXXA 1MJGA 3GL9A 3O8OB 1HBJA 3IIKA 1PU2A 1Y3DE 2QM0A 5AXAA 2M6SA 4P38A 1X7WA 3GQBA 5EJEA 4QREA 3SIPA 3QVKA 5FLKA 4GGPA 3TTVA 3VPXA 4RJJA 1MAUA 2WJAA 3EUAA 3GVPA 2EW8A 4FFPA 2A0WA 4MEAA 3DGEC 5EIFA 3DUWA 4A0RA 4U3JB 1NUAA 2VO1A 3KELA 1YHYA 3A6HA 4LCJA 5J4LA 4KXMA 1EVQA 1JIIA 3FIUA 4MRRA 5JJCA 1G5HA 1ZQ9A 4ZO4A 5THXA 4QJ3A 4BQFA 3RRJA 1G59A 5KX5B 1C1XB 5DNUA 3MMPA 3DT8A 2X8JB 3OC6A 2OP1A 3K20A 2AUTA 2JD0A 4V3CA 1UWCA 2FVYA 4MYHA 1NG1A 2UZ3A 4HAUA 1UBKS 4OB6A 1A97A 4K9RA 4R1QA 4ZVTA 3LV8A 5LYJA 3TAHA 3V3TA 3BT7A 2YFKA 2QQ0A 1E5LA 2FK7A 4KCGA 3OKAA 1N77A 4CHGA 5FUQA 2ZXEA 3AKYA 3VR1A 2TECE 3P9YA 4L3WA 1M6EX 1AHNA 3JD3A 4PFQA 4U2CA 1RMTA 4A1OA 5LN1A 1AO0A 5C51B 3AFGA 4L0QA 1ISPA 3CNEA 2JBAA 4MWZA 5I9MA 1Q1QA 2W7TA 2J5QA 1ZCZA 2OXEA 2FQXA 1QZXA 3AEUB 3O92A 4WLEA 4JN6B 5IASA 2OV3A 3OUTA 4QC2A 1KOJA 3MGGA 1N5MA 4FMDB 4AVYA 2JJ2D 2QN7A 2AJBA 4DBZA 1UAAA 3F6BX 1CE8B 4KQKA 4HF7A 4QRDA 3QLJA 1S2GA 2H00A 4UEJA 5JD5A 2QXTA 3MOGA 1T36A 3ONNA 2QVZX 2NU6B 1JG2A 1P80A 1G5TA 3LCUA 4P36A 1JALA 4D80A 2WU8A 4LFBB 3H4TA 3WS7A 1ZGBA 4UASA 2BE9A 3PHCA 2FSFA 2B21A 5BSUA 3RV3A 1PVDA 2WFLA 1AZLA 1EXWA 4D98A 3ZTYA 4C5CA 4YPOA 2YVLA 5KOHB 2X42A 4O4HB 2OEPA 1IMOA 3MLEA 5EP3A 3ZY2A 2V0NA 4Q7QA 1JQ3A 5BNWA 1VP3A 1XQ6A 1Z38A 4RIHA 4KDEA 3LU1A 2GO1A 2DUUA 3DLTA 5G4KB 2WYUA 3UV7A 5LOVA 4ZOLA 4OAOA 4FOSA 3SXJA 3U3JA 2CZQA 2PEYA 1JEAA 2FR1A 1TUEA 5BV1A 3MBIA 4IJQA 1NX9A 2J9FB 1ISIA 1JL3A 1JZSA 1KF0A 2QL6A 3GPBA 2FEXA 3EDOA 3PX2A 4G9GA 4NJEA 4NYJQ 4R8MA 5F5NA 5FR1A 4KR3A 1F4LA 4O4JB 5IJ0A 3BJIC 4K8OA 2HHAA 1T10A 1BX0A 1Z2OX 2PT5A 1JA9A 4NZNA 4YNBA 2I67A 5DX1A 5CLQA 1FDRA 5GVSA 4I50B 1AGXA 1A77A 4MYUA 3U3OA 1I51A 2FPOA 3H2KA 3KPVA 4G24A 4LV8B 2ZYGA 4MUMA 521PA 2Q9UA 1N2CA 3K4QA 3OPVA 4FGLA 4AO8A 4I2VA 1RWPA 1U8CB 4F85A 1YKSA 4N41A 3QFTA 2BBTA 3WGYA 3JQAA 2I29A 1PT7A 2I76A 2CD7A 2WHRA 3DLCA 3MGAA 3VTKA 4JBWA 3GVCA 4JROA 1NTOA 5A06A 3VAYA 4DLVA 2VRCD 2CFRA 2FK8A 2QTVB 4FW8A 2G80A 1CPYA 2RH8A 4F12A 1HOXA 2ZYWX 4Q9AA 4DCCA 4MW2A 3FMGA 4Y6QA 2VYVD 4EYOA 1ZCJA 1MZPA 4D9JA 4XGQA 3ZXXA 1IZYA 1VLLA 2VIIA 3ZGNA 3KQKA 2BDTA 2EJCA 2KMLA 4QZVA 3NHFA 2C57A 1D8AA 1OBHA 1Q44A 1UBGA 2Y2UA 3K6KA 1H2AS 1XELA 1P74A 2H31A 4PR3A 4ZYVA 3FCUB 5B1EA 3FG9A 3NYRA 3NVDA 2P4UA 3QZUA 2DPLA 1Q7RA 2J45A 4KTVE 3E82A 1LW7A 3KXLA 3ZWQA 2X8WA 4FZ5A 5CFRA 1Q0TA 4ZVOA 4K9NA 1GGJA 1PGQA 2QWXA 1NVWQ 1A88A 1C9DB 1EFKA 4B0PA 1C3OA 1OLOA 1PWHA 3O4FA 2FG5A 4HXGA 4IIFA 1GP2A 4W5JA 3R09A 1SBTA 4P3NA 2K7ZA 3WIBA 1JJIA 2G4CA 2MOKA 2GJSA 3GRFA 1PFKA 3CRW1 3E9ZA 3UQYS 3TW6A 4Q7MB 5DASA 1JIXA 2QAIA 4C0BA 4DA6A 5FCDA 4U6NA 4FQ8A 4HAVA 2FPIB 4EQZA 2D3WA 3G3EA 2DQZA 3AG6A 3GYBA 2I71A 4FZRA 4PSCA 4URHA 3O31A 3PXBA 5TVKA 3PD1A 3QF4B 1FPMA 1JB9A 5EFZA 3RT7A 1P5FA 2VPPA 3KV3O 1W25A 4ZEVA 5G40A 2VA8A 4D97A 4JLKA 4X95A 4YXWA 3HM9A 2VZ0A 4NBLA 4IQ0A 5AM3A 3GO4A 4MDEA 4YACA 1VA5A 4BZXA 3O03A 4FX2A 4GPAA 5JVDB 4L27A 2XUHA 2Q46A 2ANBA 2EKQA 3LIPA 4G1UC 1VE1A 3B38A 2NO5A 4OPMA 4IFTA 4RY9A 2RGYA 3HCWA 1G2QA 1XTPA 1FFAA 2VDWA 4RXTA 4FYYA 1G21A 1NZJA 1OLXB 4F4UA 3AF0A 1IRIA 4MVJD 1IWOA 4UUOA 1GG9A 4HGYA 4Y1RB 1I7QB 1K3UB 2NIPA 1D6NA 1FDUA 2P9HA 3DLAA 4IQGA 4KIGA 1XZDA 4KR0A 4DILA 3A3KA 1YRHA 4NZMA 1DI0A 3TUZC 4LOKA 3HXQA 2H85A 4ZVRA 1PS9A 1ZNZA 2VHEA 3P5SA 2QAGA 5FFNA 4CEIA 3FGNA 3LXMA 2QLNA 1N4AA 1TB4A 4KYUA 5G0WA 3DDSA 2Y27A 1EA7A 1TAGA 2PJUA 3I9V6 3INGA 4IIYA 2A0UA 3NYWA 1VFNA 3TIIA 4U4AA 5HJEA 1XZ8A 1U9IC 4ARIA 1W96A 3ELUA 2GZSA 1J09A 1TU3A 4CIVA 3CLHA 2RHGB 2QLMA 4J4BA 2CXXA 2X14A 4NPCA 4B83A 1JF8A 5EWMA 3M70A 5FPHA 1P17A 4LHZA 4R5HA 2CVFA 1KR2A 3KZCA 1ZMRA 3RQSA 3JYLA 3SC2B 2KS6A 2Z8YA 1I7PA 1QBGA 2DLNA 4QJ4A 3SSNA 5J4YA 1L8OA 1NF3A 3NHPA 4GRDA 3DB2A 4TTTS 4TSFA 2CHUA 3K15A 2GT1A 2FGJA 2HLNA 2OT3B 4K8RB 2OZPA 1VBMA 3H11A 3QLVA 4KN8A 5J4HA 1NN0A 1RQRA 1C7RA 1ZHHA 2ECOA 4ANFA 3PE6A 1G17A 3N7AA 4TUYB 5FLYA 4Y9TA 1TQ6A 2P3LA 3IPAA 4IFBA 2WMYA 4K7JA 1E8NA 4BFVA 1QH1A 4AN4A 3PQFA 1DQSA 4TMKA 4Q9IA 2FPPB 2P41A 2PO5A 3M81A 1Z0JA 3C5CA 4L7VA 3V7NA 1J56A 5A1JA 5JBNA 3VR6A 2G5TA 1NBIA 1U6JA 3N8DA 4MW7A 1W6UA 4UUPA 3PGJA 3U7QA 3GBVA 3WWDA 3X3HA 4IUYA 2V98A 2AX4A 3LPMA 3LYUA 4YRGA 5HSGA 2BCGY 3UKJA 1E77A 1REQA 1FVOA 3TLJA 4FC7A 2RCNA 1S8OA 4PSAA 4WOJA 5J5AA 2X5XA 3HACA 4X92A 3FUUA 4ABTA 1FYVA 2R8YA 4QT4A 2CNKA 5HRUA 2XDAA 2ZKIA 4LMPA 1EGQA 4CF4A 1XMXA 1X14A 3Q3VA 2WP8J 2A9JA 1VZ2A 3GGOA 1IIRA 4WESA 5F73A 1B8PA 1P72A 5JTUA 3EB9A 3RU3A 2JH8A 5H3HA 2ZWOA 4OCZA 1OC4A 2Y0BA 3TIXB 1CZOA 5K0JA 4H31A 1MVOA 4MO9A 5FWXA 3IJPA 4HVLA 1EFCA 3ADKA 3WIOA 4DARA 2PUBA 4WOKA 2OUIA 3V46A 1VDZA 3FPSA 4H6PA 2ENWA 4D9GA 1S5PA 4HX9A 4C2BA 1L5NA 4D9FA 1Q74A 2FN8A 2IIQA 3FRIA 1MABA 2J3KA 3QYAA 4RD0A 5EHQA 4DNOA 1T9AA 5DYGA 3TCNA 4GKJB 1R9NA 1YVDA 1K8ZB 1UZUA 1DIGA 1I4TD 1U1CA 3KFVA 4G1VA 2YX1A 3NVMB 3OQHA 3UZUA 3GLIB 2BUAA 2DTEA 4TZKA 2A4MA 3WAKA 1IDN1 1U5BA 3K53A 5CLFA 1QHEA 1R6AA 1Y82A 2AA3A 1XYYA 4IOLA 4JASB 1CB0A 1SO8A 1GRVA 2AMFA 3GZ4A 3U31A 3EDRA 1TJ5A 5KJCA 4BS9A 3U7FB 4IQ4A 3ZD6A 2JDID 3K32A 1HY3A 3GFGA 2PPLA 2Q3DA 2YMPA 1TVKB 2CJPA 2DQSA 4HX5A 2I4IA 2MINB 4ZO6A 4BAGA 4KHZA 2BI8A 1YB2A 1S01A 2XIJA 5BO5A 3A27A 3V8NA 4E1AA 4U7GA 1Y9JA 2W2MA 4ZVMA 1G3MA 2PUVA 4IIJF 3H5AA 3EPRA 4RPCA 4UHFA 5FR2A 4B32A 2CB9A 1XBTA 2MSDB 1UKAA 3EFBA 3N3BC 4HLUC 5DW0A 1J0DA 2GZRA 1X1RA 3AZOA 1N6PA 4IIEA 1E9FA 2P9ZA 2A14A 4RQAA 1PT6A 5AK0A 4PXSA 4C03A 4MI9A 1CX9B 1I4WA 2Z83A 4NOMA 4TV8F 1TCCA 3VHQA 5LMCA 4N54A 3OQVA 3GBSA 2QUHA 4IKEA 1U8UA 2BE7A 2OGTA 3T6KA 2Q8QA 2G0AA 2WYIA 2KPOA 3EXEB 1TNDA 4V02A 5BR7A 3UW1A 5HZMA 3TH5A 4NNPA 4DPKA 1GGFA 1FNDA 3F9CA 2ADMA 5AKXA 4D56A 1NVXQ 1XQVA 2XCSB 3HE3A 3ETCA 3QI2A 5KYXB 4DGSA 4XQEA 1RTTA 3QVLA 1BW9A 1RHQA 3O8LA 4OMUA 4DRXA 4MV3A 1U4SA 3E7PA 2EERA 1PQUA 3GFFA 4YP5A 3B7PA 4N3BA 1Y5IA 2G06A 2ZE7A 4CEJA 2OCYC 3SR3A 4Y9RA 1KDYA 4R2XA 2GKGA 4B7UA 1KXZA 2XYHA 5ULLA 4FGKA 1YZLA 4HTFA 5J2TA 1U1GA 4CMCA 2E3JA 2XNDD 3LP5A 3OZWA 4UEWA 2NUTB 4QG7A 1NV9A 3LCMA 5E6UA 5BYKA 4QGGA 2OCIA 1JT2A 4TWJA 5DNEA 3VKGA 3IULA 4YREA 2P2ZA 4OD0A 3COPA 1FC0A 3WGKA 2V1XA 3QUAA 1F6WA 5EUBA 1XN1A 2C0PA 3ZDQA 2HNKA 3IDSA 3SDZA 3RVRA 3PFCA 1N5DA 1ND6A 2EFJA 3MERA 2MYPA 3B6KA 1MW8X 1HDYA 4E2ZA 1T8UA 5B5SA 1T5DX 1GTJ1 1YR3A 4R16A 3IBFA 1V3TA 5KJEA 4UQLA 4CN9A 1R4MB 5LPNA 1K7XB 4JMLA 3ZDAA 3DHEA 4HDRA 1EGMB 1NBHA 1WOMA 5JCOC 2HBYA 1PJ8A 1ZAKA 1M2FA 3NC4A 2H1LA 2MSWA 4U9IS 5TJHA 3PR1A 3HCBA 1Q17A 2R6ZA 4CU5A 1B3RA 5JCPA 1QO9A 2CE7A 1NLZA 1VJ5A 1E1QA 3BZBA 4O4IB 4PRKA 4AYWA 3KQLA 1QDEA 1LSSA 5AKKA 3OQJA 1YUMA 2B8NA 4DYHA 3JU3A 3GMTA 2GZAA 3DZGA 3PEVA 4HDKA 3DKKA 3EQ6A 5ILGA 4Q7JB 2JC3A 1BX3A 1G8AA 3HCOA 3ISTA 3OLXA 4COKA 2A5JA 3FNRA 4UPVA 4AJ1A 2JI7A 3UG6A 2C4TA 4BYGA 2FFQA 1JSLA 1LFDB 3HA3A 2H52A 1PR5A 5HF6A 4UNSA 1P19A 1Z0SA 3JQ9C 4XDHA 5BNIA 4P4SB 4F5ZA 5IBCA 2VF8A 4EFKA 4JI4B 2CFOA 4G9EA 2REBA 3H5TA 3LIIA 3DV2A 4KGDA 1C8BA 2XMGA 1PLKA 3A9UA 4R31A 4DREA 4IH4A 3AVQA 4R6XA 4ONEA 4S1PA 4DA9A 3AFMA 3HMQA 5AVJA 5CBKA 4KOAA 3PNYA 3BWVA 3DVQX 3SS9X 4HYQA 1RWQA 3GUZA 3SGLA 2JGFA 3GJSA 4IKOA 4CM5A 3I9JA 2PBFA 2KQUA 2Z5LA 2O7VA 5FL3A 2Z95A 1TKCA 2C4HA 4OM8A 1I13A 4RD4A 3MCTA 2GD2A 5EZ5A 1WW3A 3CWZA 4Q00A 2UXCB 2WD7B 3KJHA 5LKRA 3C70A 3KZXA 4CGZA 4S3MA 3C8MA 4QAQA 4TXJA 1DXYA 1JI3A 3KLMX 4BMOB 3ENKA 5AVYA 3UBMA 3OCCA 2LKCA 3BD9A 1I2BA 1NBME 1VI5A 2QMYA 4PX2A 4F4JA 5IJXA 2R97A 2Q6OA 2ZE5A 4KUEA 5HUJA 3N28A 3RJZA 4IJVA 5EE3A 2QR2A 4Z9XA 3JATB 3PKZA 4HLNA 2PMCA 1KXJA 1MX5A 1KH1A 1ZCAA 2YJNA 3N87A 2V6FA 2ZR0A 4J6FA 4X20B 2XB6A 5TVGA 2C2HA 2GR9A 3H9CA 5AKZA 5ELMA 2BL4A 4LDJA 3RTBA 4WZBA 4ADSG 3ZGYA 3LZ6A 1MTZA 1LJLA 1OA0A 1YOVB 3GLGB 3OT1B 1NMXA 1Q19A 4YJDA 1IM8A 4EPWA 5ENVA 3CPHA 4YDRA 3DXXA 4ZMSA 4ITUA 2C4WA 2DPXA 1EZ1A 3UW3A 1UL1X 1Z26A 2J67A 4JYCA 2I03A 2KM1A 4ZRNA 1J9ZA 3HCPA 3OJOA 3ICOA 5EXDA 2J87A 3VR0A 3VUEA 3VZBA 4LGCA 3S28A 3ZV7A 4BAUA 4EJMA 3U16A 3AYXB 3IPRA 4F2WA 4EPYA 3PDJA 1L4GA 3GCWA 4B40A 3PUIA 1MAWA 3NW9A 3S99A 2QPTA 3IUSA 2EKDA 4EY5A 1D07A 4KVZA 1UH5A 1X7XB 2WHEA 4OY3A 4BPRA 1YR1A 2HI0A 5BSKA 2ETVA 2QENA 2O8EB 4MLPA 4S1WA 2Q3BA 1BGWA 1VB5A 2H9IA 5JH7A 3H5RA 3BBLA 3DEAA 1NSFA 1E2QA 1EX1A 1SB9A 2QQGA 2VNSA 2P9GA 3Q6MA 4MH0R 1R0BA 4YPFA 3ZPXA 4MRSA 1J0AA 3MINA 1YWGO 1UJBA 4GMGA 3DMHA 2DQKA 3V1UA 3W6UA 4D02A 1QJCA 3KJNA 1Z8NA 3I30X 1YB4A 2WAAA 5FBVB 1I4LD 2A5LA 3C74A 1L7OA 1E3WB 2PZ8A 1D4FA 2BFEB 1EQAA 1XRPA 4I9NA 1QQ6A 1Y4AE 4F56A 4DFDA 2XUZA 1BDIA 1NHGA 4MV5A 2NM0A 4JI6B 3WHLA 2P1DA 3K9QO 4D81A 3LUGA 5DCLA 4LZNA 1JEDA 1S8NA 2IPMA 2P6UA 4ZTZB 2VAMA 4AG5A 4ZTUB 3ZGZA 4QVIA 3TTTA 2W6IA 1NLYA 3H83A 1JEYB 2WIJA 1IN4A 3EGDA 3D8HA 1L5SA 1Z62A 2ZRKA 5KYKA 2BM0A 2JW5A 2QI9C 3G6KA 2HOQA 2C5GA 1K66A 4MK4A 1E94E 4NS4A 1LB1B 1JP7A 5LWQA 4W6QA 2ZI5A 4MW5A 2JAXA 1DWPA 2XOXA 2NOAA 4HH4A 3DMGA 3TNDA 2ECKA 1UEJA 2JLSA 3R0VA 2EAUA 1RXIA 5ALJA 3DZCA 3OJWA 4UCWA 1ZYUA 2O2GA 5HJ5A 1E8DA 1HGXA 3WWZA 4WOCA 2R8BA 3KJFA 3JQGA 2QVGA 3HS3A 4AUMA 4F97A 3IAHA 1PG0A 3B12A 1B43A 3DOFA 1UMDB 1KE2A 1M5RA 1OGJA 2ENUA 4IDCA 3ME5A 1ZN9A 4XPZA 4GVPA 4HQLA 4LISA 5JROA 1O8BA 3LUFA 4EZEA 2LIPA 4F9EA 1VRCA 5LQMA 5M34A 2JAQA 2CL6X 1LNSA 3CMCO 5EZYF 4MKXA 4WZAB 1EX6A 2WZQA 2VNHA 4I55A 3VR3A 4KZPA 4J1QA 4AN1A 1IUPA 1G3QA 2XMCA 4DUYB 4C6HA 1XXLA 4FZVA 4HQOA 4IZ6A 3OPYA 3SCZA 1N5IA 4EO4A 4BASA 3CW2A 1VL5A 2V6GA 3KC2A 1RAEA 3EXHA 3HFSA 3KQMA 2RJOA 2FP3A 1XEWY 3OZFA 3STTA 2VHYA 3LRTA 3P71T 3UVEA 4AYTA 2Z6QA 5JCJD 4PXYA 3VSAA 1OXSC 1QOZA 2X1VA 1F8UA 1TM2A 1YFZA 2AG8A 2H2IA 1TQDA 3AKCA 1U4OA 3PHJA 4IHQA 2YJGA 5DW3A 5I7OA 3A9VA 5AW4A 1G2PA 2I80A 3QRWA 1P1HA 2I2BA 2Q27A 3VC1A 3TN7A 4LTDA 2NO7A 2R6CA 5AVKA 3KPJA 4MLDA 4QEDA 1PJQA 1TK2A 1DL5A 2BI4A 5IC6A 3DO8A 3THYB 4IICA 4RFLA 3DYVA 3E8XA 3Q6NA 5BVGA 4PS0A 4A5OA 4GBJA 1AS3A 1HT1E 2ZKLA 3LUPA 2VUSA 3G82C 5TS2A 2A1IA 2Q6KA 1NAIA 2WZBA 2V97A 3NR2A 3R6DA 1PUJA 2WOOA 1ZD3A 2OLEA 3AONB 3GGPA 4BMYA 5AKJA 5AVQA 3I53A 3W3AA 2F7SA 3CVWA 5UKDA 5C4GB 3RVDA 3C39A 3OMXA 1GIAA 4BNLA 3A2NA 2R68A 4QXQA 1I94B 1EDBA 1QG4A 2PU7A 4IHKA 1ORWA 5IXSA 3ORHA 3W6ZA 3F7MA 2W6NA 4Y6LA 4C7OA 1SBYA 1JB1A 3UICA 5KVCA 2QN3A 4K2HA 2QTWB 4OMCA 10MHA 2BCJQ 1SXIA 3TKLA 2P9JA 1DXQA 2FUG1 1W581 2RGAA 5EKDA 3V1NA 1B26A 1J20A 1XT6A 4MNTA 5D5PA 3VZDA 2XVMA 1XNGA 5C9ZA 3EPHA 2QXUA 3AX6A 4II3A 3LYLA 4B3GA 5JG7A 2BGUA 3FY4A 4A2CA 4KB5A 3WISA 2GHQA 2JHPA 4KLRA 3QJYA 4YCCA 1O94C 1POWA 3VZRA 1ZMOA 2Y6UA 4PPYA 1IJKA 2F43B 3UJPA 4HDMB 3ULKA 1U90A 4A8HA 3ZQJA 1NYRA 1SD1A 3EBOA 3I52A 4ZAXA 1WQ4A 1K5DA 1N7JA 1TAHA 1KP2A 2VUUA 3ICVA 4JC4A 4ZQCB 4CKWA 3JAWB 2PX2A 2WWIA 3IDZA 3WGTA 1NWCA 1P2SA 1TQ4A 2JGIA 4MZDA 1E3LA 4ZHQA 3QU7A 4CQMB 5EUQB 2JIPA 1G4HA 1SBIA 1TFUA 1UJNA 2FSUA 2BFMA 1FFXB 1W4AA 1U8XX 1ZGJA 2OFWA 3AVOA 4MS3B 4BFLA