2EVWX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with r-caged gtp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A newly designed microspectrofluorometer for kinetic studies on protein crystals in combination with x-ray diffraction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2evwX00
4UXHA 1ZC3A 2DY1A 2C78A 5HCIA 3PXGA 2GBLC 4XVRA 4RCZA 1XCGB 4ZCLA 3RRNA 4IDHA 1E0KA 4NZYA 2V6JA 1JPNA 3LV8A 2OEPA 3DPUA 3MCAA 4KXFB 1VHTA 2FJUA 3MMPA 4ZCIA 3CB4A 3PR1A 1AZTA 3ECCA 4NYMQ 2WMNB 1NMYA 4ZPXA 1LTQA 1ZP6A 1PUJA 3B2EA 4LK2A 621PA 5JZVA 2ZRLA 1ZVQA 4L15A 421PA 4BFUA 1KTVA 3T1QA 2JCSA 3VR1A 2AK3A 3K0SA 1Z22A 1VIAA 4PAQA 1MV5A 3U61B 3DM5A 4ZCMA 1KY2A 3NKVA 1F3OA 3FHTA 1U8YA 4BEBA 4MYUA 1F48A 2JGNA 2GXUA 2QMOA 2ZRCA 1Z08A 2GZHA 2FEMA 1Y3AA 4I1VA 1XWIA 4YDHB 3FHCB 2BKEA 3GEEA 4Q4AA 4CIDA 2VYFA 4WZBE 4Q9JA 1YZTA 4CEIB 2A30A 3CRMA 4YXWD 4MYTA 5KSYA 4NCNA 3VX3A 1XB2A 2JJ1A 1OXUA 3GD7A 1HEIA 3AVWA 2Q6TA 3RSOA 1N5KA 1Z6TA 1P7CA 3BGWA 1W7AA 2XZLA 5FOVA 4PZYA 4C2UA 4JLKA 3ZIAD 4M1TA 1XTIA 3IIKA 1G9XA 3E1SA 3QKSA 3QOFA 1MOZA 2VQSA 3BBPA 3EXAA 3IO3A 1PLLA 3CKLA 4US1R 2QSZA 1ZIOA 1NVUQ 6Q21A 1RRPA 1D2MA 4URVR 4AURA 1P4SA 3PG5A 4DDTA 3FVQA 2MSDB 4AI6A 4TQ9A 1M8PA 4TZ0A 5HCNA 4NE2A 5CJ2A 4WXPA 2A78A 1DARA 2VP5A 3PENA 4XH9B 3B7GA 5HZKA 2HYIC 1DADA 4AWXA 3BC1A 4XWKA 5L3QA 2GKSA 1XXHA 4TLAA 3A37A 4DLYA 1ZRHA 3N70A 1IXRC 1LW7A 4MGKR 4IVQA 3C15C 5DI9A 4Q4HB 3TSZA 4TLBA 1S1MA 4BFWA 2E1RA 4PQYA 2PLRA 3TQFA 1US8A 1NBMD 2GHIA 1G4UR 2F1JA 2GCNA 4V0LA 3U3OA 4Q01A 1HE1C 2WWIA 2CK3D 4EJSC 1UBEA 1QHHB 3IPXA 1UKVY 4TWZA 4GZMA 4DZZA 2EFHB 2RGNC 4C9BA 2FFAA 5L3SA 1E2NA 3X1WA 1XRJA 1HTWA 1TUEA 3IBGA 1GRNA 2WTUA 3RDPA 3B1VA 3UMFA 3TUZC 3L8ZA 4TT3A 3WRYC 2ASEA 2GEUA 4IOKA 1LVGA 1QHSA 4HLDA 1G19A 2IHBA 3B5JA 5TV2A 2QPAA 4TMKA 4RJLA 2QI9C 1S4QA 4DVGA 1SGWA 2GEDA 1R0ZA 2WKRA 4PAOA 4V0OA 5J4HA 4Q4AB 3K09C 3P20A 2A9KA 5FFMA 4JS0A 4M1KA 1PZNA 1IONA 1JXMA 2GF9A 1BYUA 2OBLA 2YZ2A 3I1FA 3I5XA 1MT0A 4DB4A 4HATA 1UFQA 2FWRA 2BOVA 2H18A 2O8EB 4IFBA 1W0KA 4JLMA 1MKYA 4TN1A 1JEEA 2FEOA 4LWZA 4TL6A 1JQLB 3O8DA 4DCNA 2IS1A 3F3YA 4RKEA 3IILA 4ZDIA 3CW2A 2H17A 1R0YA 3WHLA 2WICA 1KSHA 2PT5A 4H1UA 3R8FA 4JLOA 1G8FA 3T5GA 4HB2A 2BKUA 2ANCA 1S96A 1XZQA 3U6KA 5EJEA 5H8WA 1NG9A 221PA 3REFA 3L0SA 1CS4C 2NO7A 2EYUA 4DIEA 4W5JA 2GAOA 3CIOA 1II0A 2P5TB 4OI2A 1EX7A 4P4SA 1E1QA 3VNUA 1LF0A 1A82A 2RH5A 4M2LA 3LBIA 4LZZA 1N2CE 2FN4A 3UMSA 4C4PA 4OHYA 2O5VA 3NC0C 2RMKA 4B2LA 2QQ0A 1LF5A 2CL6X 3K70B 4TSFD 4BLSA 2EFCB 2AWNA 3QG5A 1KK0A 1ZC4A 5J4KA 4PPGA 1FQKA 1OPXA 5FOWA 3HPRA 3O8BA 5GADl 4BLOA 2WPDD 4PANA 2A3RA 4JVSB 3I61A 1E3MA 2AFIE 3OIYA 4N0DA 4DSTA 1EFCA 1M7GA 3K70D 5K8IA 1FX0A 5KSZA 2IC5A 1TF2A 5KDLA 3OE7A 5HZHA 4TTQA 4OQLA 2P0EA 3M6AA 2IWRA 1NIPA 2RGXA 5C1BA 5FTMA 4JYBA 2Z4SA 3EIEA 3AVTA 3BS4A 2V8OA 2VHTA 2H8KA 3DMDA 2V54A 4ACBA 1F2TA 3GPLA 2ORVA 2FSHA 4NH0A 5BYKA 1AGRA 4LOAA 4QOSA 1PVOA 2WOOA 2QENA 2ZR7A 1W48A 4WW0A 1KI1A 1AN0A 3NEJA 1FUKA 2FG5A 1OB5A 4WAUA 2VL7A 1MRNA 4TL7A 1W46A 2ZYVX 2YVUA 2ZE6A 3LBNA 3RS4A 4IJMA 4ACAA 4QJ4A 1E6CA 3W34A 5FUYA 2PH1A 3C7KA 4M1OA 3U7EB 3WMGA 3RWOA 2C9CA 4NYIR 4GP7A 3VHLB 1QHHA 5JWRA 2BJVA 5FL3A 3BB3A 2GK6A 3TAHA 1K6MA 2ZE7A 1ZCAA 1NN3A 2AHOA 3KUDA 4EQ6B 5TMPA 4PXAA 5JEEA 4EPRA 4F4JA 4NU0A 2YWGA 1SULA 1GILA 2ZSDA 2G9NA 3C5HA 3SDZA 1FP6A 4AG6A 2G1JA 4BFZA 2VH5R 1RRFA 2WKPA 3I62A 1M7HA 3SFZA 2C9YA 1WB9A 2J59A 3E5HA 3T34A 2QM8A 3EWSA 2DFKB 1UPTA 4DC9A 2WSSD 1W4RA 3IBYA 1KI9A 4LHZA 2AD1A 4IXNA 4CF7A 1IN4A 1TQ4A 5FUVA 3FDIA 3CR8A 4X8LA 4X8HA 2ZRKA 3FMIA 1NI3A 2RGDA 2O0JA 3CZPA 4DEXA 4LJAA 2BCGY 4G1UC 2WJGA 4JT4A 4Z54A 1SZPA 5FI1B 1QRAA 2W58A 2R6FA 1COWD 4P4UA 3OESA 2IUTA 3GLHA 1TMKA 4DCVA 2BMJA 2Q3MA 4OJKA 2LCFA 4A8JA 4HB4A 4FXPA 3T35A 1P5ZB 4CT4B 1NNEA 2ORWA 2P2LA 2REXB 4RD1A 5K8UA 2B6HA 4PZZA 2EFDB 1T3HA 1PJRA 2XITA 3RS2A 1BKDR 4BFYA 2F3TA 1ZM7A 1YRAA 1E0SA 1SXJC 2ZYTX 4HDQB 2GAAA 2HXYA 3TUJC 1G5RA 3EA5A 4DT1B 1KJZA 4B74A 4AY2A 3WHKA 1N6RA 2V1XA 4QL3A 1YZKA 4IXMA 5FTJA 3TIFA 3WRXC 5B30A 5TARA 1UKZA 4M1SA 4NKRA 3VNVA 3TUIC 2JJ2D 4DLXA 5TXGA 3K9HA 1I4DD 3B78A 4U7DA 4R2HA 1RRCA 3PUYA 3CRW1 1Z2AA 4R2IA 4HSEA 3GLHE 1OXTA 1MO5A 5EZ6B 1HA3A 4M0LA 1P2TA 2VO1A 5FOSA 3W3ZB 4AD8A 1P9RA 4HLUC 5FTLA 1O3YA 2NG1A 1G18A 2Z5FA 4LYHA 4EPYA 4D0GA 3QUSA 4XD7A 3B6EA 1U81A 3AF4A 1NIJA 2QQEA 2WJHA 4V02A 3HYRA 4TMWA 5P21A 1E9EA 1KJWA 4E03A 3QKSB 1TPZA 4I99A 2ZU0C 4US0R 2GA8A 2Q0HA 4UXJA 1P73A 1CJVC 2D2FA 2UVQA 2JASA 4ZKEA 3KXIA 5AK0A 3BK7A 3FYHA 4GOXA 2F6RA 1E2FA 2P6UA 1FNNA 2GZDA 3SQWA 1SKYB 3HU3A 3LBHA 2ZRBA 3KB2A 2QRZA 3AP3A 3NBFA 5LD2B 2QG6A 3FB4A 2N46A 4IDNA 2CJWB 3EZ7A 2NZ8A 4OHVA 1FL9A 4DRZA 5EP4A 4QM7A 3GJ6A 2HF9A 3DEFA 4C0KA 1VECA 2IS4A 1KI4A 1LS1A 1T9HA 4DLTA 5EP2A 5AUOB 2ZSEA 3A4MA 2BIFA 2OXRA 1KKMA 5CLLA 5AUQA 4YDSA 4GBMA 3QXXA 4RD3A 3LWNA 5G41A 1OW3B 1XFAA 1KAGA 3FMOB 4UJ5A 4KVAA 4DT1A 1G7RA 3BWDD 3KJIA 3Q8XB 2NQ2C 2H92A 1SHZA 2FA9A 3QQ5A 3NWJA 3AGQA 3REGA 5DN6A 3C8UA 4KAXA 1L4YA 3ZYCA 1YZGA 5FL7D 3ZH9B 1KK1A 3EARA 2E9SA 4LHWA 1COWA 3NXSA 1E9RA 3ZVLA 4PPNA 1VDZA 5L8VA 2XXAA 3DVLA 4DBLC 5DISB 3D3QA 1KDPA 2OFXA 4FCVA 1KDTA 4PO9A 3V4FA 3W6PA 1B0UA 4G01B 5KSPA 4BZXA 3PEUA 2ZXUA 2PZGA 1XD2B 5JSZB 1W0JA 3KKMA 1Q0UA 1RIFA 1KOFA 4Q21A 2QE7D 4G3XA 3GLHB 4HYYA 1J8MF 1W0KD 4PHTA 4A8JB 4RFVA 1ZU4A 3CWZA 5LD2C 1OH5A 3CNLA 4DDVA 3QF4A 4D25A 4BFSA 1OKKA 3T5DA 1J99A 2QBYA 4TYYA 2OBMA 1BIFA 1AA9A 1L7VC 1CTQA 3UATA 3QXJA 1RFLA 1YRBA 5JRZA 1N5LA 2P67A 3MUFA 4M1WA 3R7WB 2R2AA 3WBKA 3MRSA 1XEXB 2W2XA 2ZJ2A 3VKWA 1RJ9B 1II9A 3EZ9A 2N42A 5DE3A 4XSHA 4P31A 2IS6A 1M7BA 2WJVA 4Q1DA 3G82C 4B3BA 3SS8A 2JLUA 4GMXA 2ZJZA 5H1YA 4PPFA 4U5XA 3IEVA 1F5NA 2FFBA 2Z83A 3SU8A 2J5XA 1HURA 2ZI9A 4K81B 1VPLA 3RHFA 2OFWA 1SVSA 4ILEA 1GM5A 1FX0B 1C9KA 1GRQA 1DAHA 4PHHA 2ZJOA 3SBDA 3CRVA 1JR3A 2BMDA 2QE7A 1YJ5A 1J70A 4AG5A 1XEWX 2EU8A 1RZ3A 2YC4C 4QJ3A 1KI8A 1MR3F 1QHNA 3CPEA 3GJ3A 3IQWA 4ASUD 5HKKD 2HUPA 1DTSA 4ABYA 1B23P 3P1JA 4B3FX 3CX7A 1F2TB 3MG9A 2CDNA 4YMSA 5AJZA 4ZIRB 4JL5A 1RE0A 1D2EA 5CK5A 4KJZA 4JJKA 3UANA 1Q21A 2ZRNA 3EC2A 3IHWA 5D3QA 1BMFD 1UKYA 1KNXA 2LKDA 5LDDC 1E2LA 4Q1EA 1IN6A 1Z6AA 2GXSA 1RYHA 1G20E 2FPLA 2P5SA 2QUZA 3CBQA 4A1FA 4LDJA 2ZS9A 2CNWD 4Q47A 4BFXA 4EPVA 2VIIA 4V0MA 1SXJE 1SKYE 4GFDA 1KSFX 2C99A 5J4VA 3U6BA 1YZLA 2R8RA 1KZGB 5J4LA 4U00A 5G3ZA 4KO8A 4C7OA 4EQ6A 1WDTA 1Z0IA 1KMHB 1FTSA 3FKSA 2J7KA 1E98A 3IPYA 1W4CA 3LA6A 3U3JA 4TT3D 1AIPA 4FMCB 1KYIA 3GFOA 4CRWB 1EK0A 3RS7A 3HWSA 3CONA 3B1XA 1OFHA 1MH1A 5BWMA 1WF3A 1XCPA 4JMPA 5FBRB 2ZQ5A 4PSVA 4JKIA 3ADDA 3X1YA 2F3RA 3TJZA 3OFND 2CMKA 2ZJ5A 4Q1CA 4Y0AA 1G7TA 3KQLA 4TTRA 4LGMA 5CYPA 3LXXA 2Y8EA 1NVVR 3NBXX 2X77A 4TMVA 4ZI3A 3W3AA 4YC7A 3MFYA 2W2TA 2HDNB 3TKLA 1M2OB 4MGIR 1H8ED 2HEIA 4EPXA 4F4IA 4M9XA 4KYIB 1UAAA 1NSTA 3LVRE 3LD9A 3SR0A 2GTPA 2WSSA 4KCGA 4PC7A 1I2MA 4AIIA 2WM9B 1QHIA 2PX0A 3FMPB 3OEED 4Q4JB 5E95A 5JJLA 4KLZA 3P32A 3VFDA 3AKEA 4PQFA 3CH4B 2O8DA 1SQ5A 2L0XA 4LBYA 3W6OA 3LFUA 5H68A 1GL7A 3EPJA 1XBTA 5C46F 4TLDA 3FFBA 1UBCA 4XOIA 5JI3E 5DSZA 3ICEA 1SVOA 4B3DA 2R65A 4DUGA 4ZIRA 3IUYA 3SJAA 5EE0A 2AKYA 4BASA 2GJ8A 5AR1A 4JLBA 2F1IA 1SHKA 2ZYUX 2IYWA 4QXAA 3CRQA 3TK1A 3GJ0A 4EJSB 3OEHA 1US8B 3IO5A 4E22A 1UDXA 4MDEA 1SXJD 3BJIC 3Q5DA 5AJVB 2V3CC 2FF7A 2WJYA 4R9UC 3A36A 2C77A 4R98A 3NDBB 1TNDA 3W8RA 1XMIA 5BW8A 2AN9A 5FBQB 2AWOA 1P75A 2ZUCA 2JJ2A 1EFRA 1OIVA 5F9HA 2QROA 4Q02A 3JZAA 3KFXA 1NVWQ 3OIWA 4M8NE 4FIDA 1CP2A 1AKYA 4JL6A 1IY0A 4BGDA 2CLCX 1HE8B 1JB1A 2DPXA 2QMHA 1R6BX 1QHGA 2XZOA 3ICQB 1IXSB 3QXCA 2R6GA 4TL8A 1XZPA 1U0JA 4HAUA 3LQRA 3PUVA 3QXHA 2IK8A 3K70C 1KI6A 3VR4A 4BLTA 2NGRA 1KI3A 5JWHA 3VR5A 4IDOA 4Q4JA 3SJCA 2D7DA 1IOZA 4JLDA 4TQUS 3H2YA 2ODWA 4DSUA 1E0JA 4K46A 1OE0A 3GJ7A 1OB2A 1TF7A 1D8TA 2GILA 1ZW6A 4DHEA 4MGYR 5DHAA 5E7JA 3NIBA 4QC2A 3UMRA 3B82A 2GVZC 4Q03A 4AKHA 1GOTA 2BVNA 2CLSA 2YYZA 3CUEF 3EZ2A 4LI0A 1VCIA 2BWJA 4FW9A 2RKOA 5DIFA 3NBYC 1V5WA 4CDGA 1YR8A 4Z51A 1Z0AA 4Q7JB 3RABA 2DFNA 4TQAA 3BH0A 1WQ1R 1CJMA 4H9GA 1VG0B 4YMTA 4LX0A 3W90A 2PJRA 5KDDA 2FV8A 2RGNA 5C18A 2D74A 1TX4B 3CNOA 4LPSA 2ZR9A 5CK4A 1QBKC 1RPZA 3NVAA 3LX5A 3F0TA 3I4LA 3WMFA 4GPTA 4UJ3A 5TVKA 4B32A 4MKGA 4D80A 3KUCA 2OCPA 3MSXA 2QTFA 2X2FA 3IEUA 1EWRA 5KHOC 3CF2A 2NZJA 4PC3A 1QG2A 5E3HA 1JR6A 2Q9BA 3K0FB 1LS6A 2OV2A 4Q9IA 3LNCA 1A2BA 2XEXA 1TF5A 1S9HA 3N2IA 5IF9A 3KTAB 3FWYA 2AL7A 3SFVA 5KDOA 3A1TA 1ZCBA 3GEHA 3JZMA 3OAAA 3F8TA 4FCTA 1IBRA 1T0JB 3DZ8A 4D81A 2YWEA 2GZAA 4IKEA 4IW3B 2DWPA 3SHWA 4UXIA 1EFUA 5DI3A 1IJFA 2OXCA 1S0UA 5UKDA 4C0JA 2BBWA 5FR1A 2XZPA 4IVPA 1E79A 1ELOA 2ZETA 1FQJA 4BEJA 5LPNA 2JJ8A 4QNRA 2B8TA 5JECA 4CEJA 1ZJ6A 4HEJA 1IY1A 1Z0FA 3QEOA 4HUTA 1N6IA 1ZNXA 5EXXA 2F7SA 1G3UA 4LSGA 2VSFA 2Z43A 5EZ5A 2VLIA 4B73A 4DXAA 4RZXA 1D9ZA 2B7BA 5FPYA 1G8HA 2XGJA 3THXB 2O8BA 1RYFA 3T06B 8OHMA 3U7FB 1NSFA 3QF4B 1HY3A 1T8UA 4C30A 1OH7A 3EW9A 3D8BA 1FPMA 1M1YE 4FWTA 1NVXQ 2KWIA 4GT1A 4HB3A 4B44A 2IYVA 3R9WA 1KO5A 1W0JD 1SVKA 4G5QA 4P33A 5FTNA 5L3QB 5HKKA 2OG2A 3Q5EA 4MH0R 2A5FA 2JLRA 2F43B 1MO6A 1TQ6A 2FSGA 5DGXA 1E4VA 3MWYW 4OYHA 5F98A 3W8NA 3TNFA 3AVPA 2PCLA 4JLVA 3QSYA 2I1VB 1R8SA 4CGZA 2KSQA 4IEEA 2BBTA 4I1OA 3T61A 4S2EA 1G4AE 1EFRD 2WWFA 2IL1A 1S3GA 1T6NA 2WV9A 1DO2A 2RB4A 3GLIB 2BM0A 4C0AC 1W44A 1E9FA 4Q5IA 4EDHA 3BIFA 1VTKA 3AP2A 5SZJA 1K8RA 3TW8B 1E1QD 1FTNA 1Q20A 3VKHA 4ZKDA 4JSTA 4IDQA 4UQOA 1DAKA 3EX7C 3AB3A 4TSFA 1NY6A 4WBSA 1FW6A 2CLDX 4XVUA 3KDSE 3BFXA 2MMCA 2OM2A 1AQUA 2PX3A 1DOAA 2ZE5A 1ZD1A 1UM8A 2OT3B 3QF7A 3RLFA 3VU9A 2ZVPX 1GNRA 2D06A 3C5CA 4PC2A 1P9WA 1YKSA 4AYTA 1N6PA 3B1YA 1GIAA 3IGFA 2FU5C 3C41J 1XJCA 1CR4A 1NLFA 2C98A 2WZQA 1U99A 4WIAA 3ADKA 1YR9A 4ASUA 2O8EA 2GEVA 3PFIA 1CIPA 4Q00A 2JDID 2OFOA 3AUXA 2XTMA 3SC3A 1C1YA 4V0NA 4PC1A 2GXAA 1AS2A 3WYFA 2WJJA 4M21A 1P2UA 1Z5ZA 2IA5A 2IYXA 3SJBA 2IYZA 1XTRA 2G83A 2ZI7A 1VHLA 3UG6A 2IX3A 2QN6A 1CR1A 2AK2A 2KI5A 1FUUA 2D2EA 2I4IA 4IOLA 3X1XA 4DKXA 5FPKA 1Z6GA 2XNSA 4HLUA 2HLDA 2WIBA 2OZEA 1GFIA 3GJ5A 1RKBA 4YXWA 5JI2E 2J45A 4Z1MA 4ITRC 5FPHA 1LNZA 3AGPA 2GETA 4MRNA 1GKIA 3HPQA 1G6HA 3OEEA 3OAAD 4Q7LA 1ZUNB 2HXSA 3P27A 4OJQA 3NEYA 1A1VA 3KKOA 2PCJA 2X2EA 5CDFE 2PMKA 2VP9A 2HCBA 2OAQ1 4PHGA 2BJWA 2C5LA 1NY5A 1CULC 1P2VA 2QGZA 2XTZA 4TTPA 1YZNA 2QT0A 2ZIAA 3ZS8A 3ASZA 2OE2A 3KTAA 3OEHD 4LBZA 2R6CA 1SXJA 2W0SA 3N5CA 1W5SA 2ZI4A 4IRUB 1NJFA 1E2GA 3LX8A 5F9FA 2XXAB 1GRRA 1UBGA 2XAUA 3B60A 4GMDA 1JQJC 5JEDA 2EVWX 2JDIA 4N0EA 3ETLA 5CB6A 1Z0JA 1T8TA 1XD2A 4TYPA 4LHXA 1G64A 1D6JA 2F55A 1W47A 3PUXA 4QBIA 2IXGA 2GDJA 5B58C 2P6RA 4BWYA 1HT1E 1E1RD 1NN0A 2XX3A 1GNPA 4QJ5A 3THOA 2OILA 5FBWB 1HV8A 1UJ2A 2IYRA 2ZRAA 4RZUA 4DCTA 3ZGXA 1H8EA 1PUIA 2H5EA 1G8PA 1FOEB 4XSGA 1CR0A 1K5GA 4FN5A 2QAGC 3ZD7A 2IBMA 4AKGA 2OBNA 4OK3A 4OKSA 1Z28A 1Z0KA 4RD2A 4XWOA 3TVTA 3BOSA 2ZRDA 4NCJA 1E94E 3EWAA 2GJ9A 1Z2CA 3AP1A 3PUZA 2GWHA 3AVXA 2H57A 3KKQA 2TMKA 2C04A 1T3SA 1SVIA 3RNLA 1HH4A 1ZM2A 1TL7C 5EQTA 2KE5A 1BO6A 1E2QA 4JBXA 4MRRA 4JLAA 1SVLA 2A5GA 2DBYA 1VG8A 4ZI2A 4BPBA 2OUKA 4DDWA 4WOPA 3BFVA 4QRHA 2CCJA 1XTSA 3UXMA 3LAWA 1GKUB 3C14C 1VIYA 3I92A 1SXJB 1WA5A 4QBHA 1XMVA 3Q9LA 4CEHB 2QP3A 3AQ4A 3AM1A 1VCOA 1NKTA 4V03A 2ZTSA 1RVDA 2WHXA 3SHFA 1ANKA 4KBGA 2QM7A 4A82A 4URUR 1GNQA 3RS3A 1WE2A 4FWIB 4B2IA 3GLGA 4DLUA 1TQ2A 3OIUA 3AF1A 3W6NA 1CR2A 2J0SA 2VTKA 3K0AB 1BMFA 4DLVA 1WXQA 2D7CA 3NC1C 2NPFA 4LV6A 3TR0A 4JKYA 1VCMA 4BUJA 1AJEA 3THXA 2O8BB 3EIQA 4GZLA 1P62B 2A5JA 2Z6VA 4OI1A 4A6PA 4KODA 2ZUDA 4A0RA 3RRZA 3A1VA 1DBSA 3CZQA 2GXQA 3LLMA 5HE8A 2DCUA 2J0UB 2IXFA 2UZ3A 3L0IB 1X8JA 2PMDA 4NCIA 2R62A 3VTKA 1Q1QA 3EPHA 2WMOB 3LW8A 3WNCA 3HDTA 4AYWA 5B64A 5IT5A 2BMEA 4TYQA 1E79D 4E07A 3ZVMA 4B33A 1KSJA 1OH6A 1R0WA 3K0CC 3LXRA 5CDFA 1ZYUA 1G3IA 2BEKA 4OQNA 5JHHB 1KDOA 5LB4A 4NONA 2PZEA 1WRBA 3T1TA 2HCJB 3KL4A 1E2JA 2VRWA 2QEQA 4GP6A 5FPSA 4S35A 3QE0A 3AF3A 4A15A 2WWWA 3CNNA 4TLEA 3O8RA 2GJKA 3ZVRA 4F4CA 4PAMA 4EUNA 4DLWA 3AVOA 3W5JA 1UF9A 1E9CA 1K5DA 1OXSC 4JVNA 4NP6A 4C7OB 1P3JA 3RS5A 4MUBA 3OFNA 3VKGA 3AF2A 1R8QA 4WVFA 1KGDA 1IQPA 1KY3A 4JVLA 4RSGA 1AK2A 1OYWA 2FFQA 2JLQA 2NPIA 2OLKA 4KV9A 4M9SA 3DHWC 3FKQA 3MAAC 2MSCB 1IN7A 3DZDA 3QBVA 4A4DA 1W4AA 2ORIA 4JJZA 2WWYA 2QTHA 4YLGA 5DI3B 5J47A 3K0EA 3CX6A 2J9RA 1UEJA 2AXPA 3VR2A 3WP0A 3TE6A 2QRNA 3U3MA 3ZZUA 2OCYC 3SYKA 4C0LA 1XJQA 2QGNA 3WYGA 1OSNA 3W9YA 2ZVQX 3D7MA 5D3MB 1W2HA 4LC0A 4CEHA 3RVBA 1MRSA 4CYMA 1IHUA 3OIVA 1ESNA 4JBYA 5EP3A 2IUUA 3GLIE 4I4LA 2C03A 1A4RA 2QZ4A 3BB4A 1V43A 4Q1AA 5FUXA 3LVQE 1MABA 5EP1A 4F91B 5TY0A 3H84A 2G0NA 2Q9CA 3DO6A 2ERXA 4EIWA 4F38A 1X8KA 2H16A 5B2ZA 2R6DA 3VX4A 2VBCA 4KVGA 4P4SB 4LCBA 3CM0A 3O47A 4NTZA 1P72A 3W5IA 1ESMA 5AJXA 1HQCA 2CCGA 2ZSAA 2CE2X 1VG9B 1F2UA 4Q9LA 3SNHA 5KNCA 1ZMXA 4D4MA 3I8SA 3KX2A 1T91A 2ZRFA 4IDPA 4QBGB 2GJSA 2Q9AA 3LLUA 2VSXA 3A1UA 4OQXA 2AFHE 5LB2A 4MKFA 4HAYA 3PIRA 5GJCA 5J40A 2BMFA 2IT1A 2W2VA 3E2IA 3LO5A 3PQCA 4O3MA 4A6XA 4MRPA 1Z8FA 4BECA 2GCOB 4B48A 4LPKA 3K9LA 3OZXA 1II8A 1T5IA 2RAPA 4RZ2A 2RHMA 3G0HA 4AKIA 4EFLA 4OL0A 3I72A 4LJ9A 4NBSA 2J0QA 2QMUA 2ZPTX 3BRWD 2FMXA 4XJXA 3ZZ0A 1MO4A 4A0GA 3KZ1E 3KQHA 2RGAA 3CPJB 3U7HB 3JVUA 2BDTA 4BFTA 2SHKA 3L43A 1UEIA 2N1BA 3AV0B 3NHBA 2OCBA 4URYR 5EUMA 2VP0A 1OF1A 3KQKA 3KJGA 3Q72A 4RD6A 3S1AB 1P2SA 2V55B 4B3GA 5A4JA 1OV4A 5SZHB 2HT1A 1TEVA 1AGPA 3R20A 4UNQA 3QKRB 4X8MA 3WBJA 2IUSA 1XMJA 1X8LA 3QNUA 2FE4A 4K8OA 3VR6A 3X1ZA 4BLPA 4LHYA 1T3LA 3ADCA 4LJ7A 3U44B 3DL0A 1E1RA 1W4BA 3TVDA 4ZDKA 1ODFA 1E4YA 4PO1A 1J7KA 3U4QB 2YNMA 2CHVA 4XVQA 4AC9A 1DAMA 1Z29A 2ZYWX 5JFGA 3GJXC 1ZU5A 3B85A 2HV8A 3FFAA 3NG1A 3VHXA 4RKFA 3KQNA 2ERYA 2QBYB 5EXSA 1I2DA 3TAUA 3SYLA 5ANRB 3A6PC 1M34E 2C95A 1QHXA 5BN3A 3R9XA 3SE0A 3HU2A 1QZXA 1XXHB 4Q1FA 5KSOA 1WMSA 2D3WA 1XEXA 2JLXA 1Z63A 4D4JA 4Z8XA 1A5TA 1VYUA 4Q4HA 2IF0A 4LRWA 1G8YA 5AJYA 1S2MA 3WNDA 4DLSA 4JT2A 1Z0DA 4Q1BA 4LBVA 1WP9A 2AD5A 4GOJA 4H1VA 4UNNA 4BQSA 1D9XA 4G5SA 1N6HA 3FKSD 1Y63A 2WWGA 1OFTA 4F92B 2JLVA 3DDCA 4JBWA 3DMNA 1XCMA 3QY0A 3IIJA 5K8TA 2G0TA 1NBME 1GL6A 1XEWY 3K0FA 1RC8A 4C3ZA 2VHCA 2PLFA 2YC2C 3NH6A 2JLWA 3CH5A 2XJ9A 4YMVA 3ND9A 1E2KA 5CM8B 5FTKA 3RRYA 3O8CA 2FH5B 4BLQA 3C16C 2QTVB 4RY2A 1E9AA 5DNYB 4UKDA 2P3SA 3ZQJA 1Q57A 4CT5A 1M74A 3SQXA 5J4YA 4JLNA 5EXTA 5JBQA 2RHDA 2IS2A 4BE7B 3ZIAA 3RC3A 5E7MA 1CU1A 1X86B 1YHNA 2MMGA 4A36A 4PX9A 2H1LA 1Z83A 2I3BA 4KFRA 5BN4A 1NVVQ 3I3SR 1L8QA 1DO0A 1N0WA 1DAIA 1F2UB 1L4UA 3D6TB 4OHZA 4IOMA 3ZLJA 1GG2A 3TW4A 3THWB 4L9SA 2P6NA 2WKQA 1ZNZA 4HAVA 1KO7A 3KKPA 4OQMA 4D82A 3F5FA 1OLOA 3DKPA 1GSIA 2JIZA 3QJYA 3UWKA 1A2KC 1N3BA 5CYOA 3J81k 2AKAB 2YOHA 3UK6A 2QP4A 3KB1A 4Q18A 3R8CA 1H65A 5M04A 1G3MA 4ZDWA 3A58B 3E70C 1UDWA 1L2TA 2K5UA 2H7VA 2CBZA 3QI2A 1KZ7B 4OHWA 4Y0VA 2KBFA 2OHFA 3BH7A 1EESA 5IHPA 1S3SA 2DFLA 2WOJA 2ZITA 4C0HA 1CJKC 1HUQA 2WWHA 5IK2A 2R9VA 1IXZA 4O2LA 2A7QA 2CK3A 1DPFA 4EAQA 1F6BA 3GLFB 2NTYC 2AXNA 3MLEA 3MWKA 1ZUHA 2UKDA 3MD0A 1YE8A 1YZQA 1NG1A 3LDAA 4O2RA 1OKKD 4DWJA 4YQFA 2JLYA 3Q7PA 4MUAA 1LFDB 1IJEA 2ZANA 2IYQA 3NDPA 5J5CA 1BYIA 2PEYA 2GESA 721PA 5DH9A 1CKEA 4NYIQ 2GF0A 1YZUA 3QBTA 2ZSFA 4JVMA 2PL3A 2QMEA 3TRFA 3P4XA 3KFVA 1CXZA 2W83A 2O8DB 3QPWA 2W6IA 4MQBA 4RD0A 3AEZA 1NJGA 1G41A 3EIHA 3A1SA 1XMSA 2BV3A 1G1MA 1JJ7A 1W49A 2DHRA 1GKYA 2QPOA 1BS1A 1U9IC 2ZREA 4D0LB 3FMFA 3LY5A 4B34A 1XTKA 1UKEA 1RJ9A 4M53A 1P9NA 1E99A 4QGFA 2V9PA 1YR6A 5IK2D 1JR3D 5KTYA 5IDVA 3SYNA 2FX3A 4P3YA 3B13B 1Q1EA 3D31A 1X1SA 5HPYB 1LB1B 2QY9A 4KITB 3IKJA 4PHFA 1YU9A 2QP9X 1HQYE 3ZVNA 2O8FA 5CIQA 1EX6A 2YOGA 1IAQA 4G5OA 4IVRA 1RW4A 1OXXK 3TR5A 2XOKA 2BBOA 4A9AA 1C4OA 3EA0A 2OSBA 1OFUX 4AK9A 4OBEA 1OHHA 1TADA 3RSLA 2GJAA 3ZZTA 2RGEA 1W36C 3AVYA 2JLSA 4ESVA 3GLFE 2YINC 1CJUC 2CHGA 1KSGA 2W00A 4FMDB 2Q21A 2IHYA 5FOXA 1P60A 3M1IA 3CR7A 4DDUA 3ONWA 4FI3C 4JZKA 4CVNA 2X8AA 4YMWA 1QG4A 2EFGA 4UNSA 1ZINA 5EXPA 4QGHA 1JJVA 1JNYA 4D4LA 3CF6R 2FNAA 3VQTA 5BXQC 1U90A 4M1MA 4DIDA 1AKEA 3SN6A 3P26A 2BEJA 5JCPA 4WZAE 2Q3FA 4B75A 2RGCA 4HZIA 1BOFA 4DEYA 1XEFA 2J1LA 2QAGB 3CO5A 2F1HA 2HF8A 3OE7D 4AKEA 2B21A 1T5LA 3B1ZA 4JLJA 2ZI5A 3Q3JB 5JS7A 1S9DA 1KAOA 4V0KA 2IW3A 2ZRMA 5EE5B 4TYWA 2WWXA 1QVRA 3KXKA 4MKHA 1FNMA 5DLQC 4W9MC 5F2EA 1KDRA 2VF8A 3GFTA 2J87A 2YJTD 2JA1A 1DEKA 5K8LA 1W2GA 1HYQA 3PVSA 2FOLA 3VAAA 2QORA 2XSZD 1G291 4LYFA 4F7WA 1OXVA 5G40A 4OI0A 1DS6A 3RANA 1NMZA 3EAQA 4X8OA 2J41A 4QFMA 1TQDA 3A4LA 4YMUA 3K0CA 2FPKA 5FH9A 1CRQA 1VMAA 2ZJ8A 3AF0A 1XU4A 4RZ3A 5DYGA 2IXEA 2G1KA 2ODBA 3PV0A 4IHQA 3A1WA 3AVVA 2YV5A 5CJPA 4POAA 2OCAA 2G77B 2G3YA 2B7CA 1G5PA 1GWNA 4XIGS 3R9IA 1Q1BA 2J0UA 1ZNYA 1D5CA 3ZDQA 4M9ZA 2W6ID 3CX8A 4KI0A 5FOUA 4DUGD 1Z6YA 5TB5A 4HDCA 1QVAA 4JSYA 2VF7A 2WVJA 3B8HA 1ZBDA 1OT3A 1KO4A 1UADA 2ODNA 1N25A 2Z4RA 2J0VA 2RGGA 3QXSA 2VEDA 1XXHE 1JPJA 1N5IA 3JVVA 4Z8YA 3UKDA 4EPWA 1G7SA 1R7RA 2FGKA 3PEYA 4GL2A 4RFSA 3U2QA 5CIWA 4JIMA 4OK6A 5EE9A 2XTNA 2RGBA 3U3RA 1KK3A 3TLXA 1R0XA 5KNBA 3THYB 4LJ8A 3WNBA 3GLIA 4TYNA 4J0QA 1R10A 4L8GA 3EZFA 3U44A 2XOKD 4MGZR 2XJ4A 3LQQA 4Q9HA 2OLJA 1SVMA 2A5DA 1JALA 3CF0A 4CEIA 1OHHD 4PSAA 2CL7X 1ZM4A 3G5UA 1N6KA 1OIXA 4R7ZA 3WXMA 2ZJAA 4HZUB 1XD9A 2YWHA 3BH6A 2FGJA 1Z06A 4G5RA 4TMXA 4TMTA 2BCJQ 3EC1A 1QDEA 4PZLA 2QNRA 4D2IA 4Q48A 2C96A 2ZROA 3OHMA 1P61B 2B92A 3IQXA 3GMTA 1E2EA 3QENA 2NO1A 4A2QA 2EW1A 4D4KA 2A2ZA 4QHTA 1E32A 1W36B 2V7QA 3MJRA 1NL3A 3P4YA 3GJ8A 3CPHA 5DO9A 3I32A 3H1TA 1JAHA 3UIEA 2HJGA 5FR2A 4D6PA 5CITA 4MRVA 4Q4LA 2CHQA 4MRSA 3T1OA 1R4AA 1DELA 3K9NA 2ONJA 1W5TA 4KU4A 4A0FA 5HE9A 1IN8A 4B3XA 3BE4A 2PBRA 2V1UA 4QGAA 2ECKA 3LRPA 4M9QA 5FI0B 2ZUBA 4HAXA 1XJ0A 4LYAA 3Q7QA 5KNDA 1T0HB 1U8AA 4B76A 1E2IA 3FOZA 2CVHA 2IEZA 5AUNB 3EG5A 2QA5A 3WMEA 2WAXA 1F60A 2OESA 1GP2A 1IY2A 1NF3A 3HR7A 2DWQA 1KHTA 2WBLC 4HUQA 3L82B 4FMDF 2NMVA 4XD7D 4AYXA 1E9SA 1M6NA 3SZRA 5BN5A 3T12A 1XPRA 3HR8A 3PEVA 1Q3HA 121PA 1JECA 1ZAKA 3X1DA 2YKGA 2FPMA 1XNJA 4QKQA 3ZS9A 2HT6A 1GITA 4XWAA 2O0KA 2ZRPA 4M1YA 2ZI3A 4GI7A 1LV7A 2DYKA 2V7QD 4P32A 3V4RA 3U7GA 3ASYA 4LJ5A 4EPTA 2WPDA 2V4ZA 4HAZA 3NH9A 4XTCS 3ND8A 4W5WA 3PEWA 1S8FA 4QHSA 5C4GB 2FZLA 2IYYA 1J8YF 5EE3A 3THYA 1DAFA 1JBKA 4US2R 3KXLA 1N0UA 4GSYA 2G6BA 5FOTA 4RCYA 4B43A 4EFMA 4IEIA 3TH5A 4N1AA 2GCOA 3IIMA 2VHJA 1U2RA 4LC1A 3RRMA 4DCSA 1XPOA 2PJZA 4NDZA 2REOA 4NMMA 4G5GA 1AQYA 5KPJA 4QM6A 2O8CB 1DE0A 3T15A 5JWOA 4YONB 4E5UA 2G88A 1CBUA 3ADBA 2PZFA 4A0HA 5HR5A 3X2SA 5HTKA 3GLGE 3QKRA 5SZKB 5GJVC 2DR3A 3NTUA 1IN5A 3QIAA 3BFKA 1KIMA 2QT1A 4DLZA 2LKCA 2WIAA 2I1QA 4L16A 3VU9B 5JMTA 5JSZA 1S1CA 1YVDA 2ANBA 4NYJR 2IYUA 4JLPA 2ATXA 4Q9KA 1BH2A 4XTRA 1NLZA 1KKLA 2QAGA 5DN6D 2ONKA 2DFTA 4HI0E 1FMJA 3RWMB 4PPQA 3HU1A 3B1WA 4M22A 2IEYA 3K9GA 3B9PA 3MWLA 5C4MA 4WXRA 1AS3A 3U5ZB 4O0MA 1OH8A 1Z47A 4UNRA 1FP7A 2YHSA 2FDCA 4B6FA 1E9DA 1EXMA 1R5BA 2FSIA 1I4TD 3WP1B 3FE2A 5L3SB 5GVRA 1KMHA 1JEDA 3QVUA 5KPDA 2UZIR 3H0KA 5E4FA 2VP6A 3TMKA 2ZAMA 4B3CA 1II8B 1Q44A 2PEZA 2JATA 4FMBB 1E2DA 1XD8A 1Z6XA 4BLRA 2QU8A 2KB0A 1NBMA 4URWR 4GRAA 4NCHA 3I73A 4IOJA 3DM9B 4C0QC 4KLNA 2P65A 3LW7A 2OAP1 5FPTA 2F9LA 4QBFA 4ERNA 4WZ6A 2BBSA 2XSZA 4PSKA 3V00A 1WBDA 4EFNA 3FTQA 2A5YB 2BHRA 1ONBA 2CEAA 4E09A 2XNDA 3RC8A 5AJWA 2QPTA 3HJNA 4OQFA 1N5JA 2W6JA 3FPAA 3LH5A 3L0OA 4KSBA 3RYTC 1U0HC 3GEIA 2GCPA 4M4SA 1NN1A 2GRJA 5A0FA 2HLDD 4CEJB 1ZUIA 3ZQ6A 4DJTA 3UG7A 1PLKA 2Q3HA 4JYCA 2C2HA 3N2EA 3H4MA 4Z1MD 1Q1ZA 1JAIA 5G53C 5SZIA 1VKJA 1H8HD 2F43A 4JL8A 2GVDC 2LWIA 2ZAOA 4I81A 4L4UA 4L5BA 2C9OA 2O8CA 5L3VA 1CRPA 5JLJA 521PA 3TGPA 2CE7A 1R5OA 4GOKA 1TU4A 1G17A 1I4LD 1U94A 1XTJA 3NHAA 5IRCD 5JJKA 5ELXA 3KKNA 1PV4A 1TUIA 4II7A 2VP2A 3R7WA 1CJTC 2ZJYA 2V6IA 1YQTA 2O0HA 2FSFA 1J2JA 1G21E 1G8GA 1OJLA 2YOFA 3K1JA 1GAJA 3L2OB 1TAGA 5CM9C 1TEXA 4KFSA 3DKVA 3SEAA 5JS8A 3Q85A 4DB2A 5TDHA 5GVSA 1ZNWA 1NLYA 1ZM3A 3NBZC 2B8WA 4W5HA 2CVFA 4Q7KA 1VYVA 2ZEJA 4GDFA 3U3KA 3SI7A 2GNOA 1EFTA 4NYJQ 4CZ2A 2O52A 1NRJB 3ZD6A 3PJRA 3L8YA 3HP1A 4B71A 4URXR 3WYAA 2R44A 4B47A 2REBA 4C0BA 3QKUA 3ZJYA 2VPPA 2ZI6A 4V0ME 2J46A 2EYQA 3AKDA 4Q19A 3QPVA 4I1SA 2KBEA 1FMLA 1NMXA 2IF2A 4O25A 1HT2E 2X19A 2ZRIA 3DOFA 3T1VA 5DHFA 3QEJA 3HYTA 2JAQA 1UBFA 2IYSA 4QNMA 5JRJA 1LY1A 1ZD8A 4WA7A 4ON9A 1WBBA 1VG1A 1TU3A 1CLUA 1XP8A 2ZE8A 1W1WA 1Q22A 3I5YA 2JEOA 1KI7A 4LV5B 1ETUA 4TLCA 4DSNA 4CW7A 4ESHA 3EPKA 3K0AA 1WCV1 4ZDJA 4B35A 1SVWA 4FD2A 1XF9A 2ZM5A 3K53A 1XX6A 4I1UA 2E87A 2AX4A 2ZRGA 4UNPA 3K8YA 4QGGA 4LJYA 1X6VA 1N6LA 1CF4A 5FBVB 4HDOB 4NYMR 4Q7MB 3TBKA 3GJ4A 3PITA 5AUPB 4IFEA 2CL0X 2NIPA 4C2TA 2J7PD 3IHLA 4OI4A 1DVRA 4MYHA 4Q66C 4KFUA 2CXXA 1PLJA 3UWOA 3MGCA 1NP6A 1P6XA 1R2QA 2KJQA 3PCRB 4HLCA 1GZSA 1YR7A 3WY9A 1OFIA 4C0SA 1EG7A 4NL4H 4HLQB 3TQCA 1TTTA 2VP4A 4KBFA 4RFSB 2FZ4A 1KO8A 2D62A 2AR7A 4D0NA 4HZUA 3V9PA 3MWJA 4LYJA 5CLQA 4N3NA 2XNDD 2JJ1D 4PFSA 3BERA 1W36D 1G7CA 4MITA 1Q12A 4P4TA 5FL7A 2FFHA 2OO7A 3EPLA 1D2NA 2ZRJA 5L3RA 1U98A 5G3YA 3GLFA 1G6OA 3S1AA 2DWOA 1OYYA 1G16A 3SJZA 3QG1A 4DSOA 1KO1A 2GK7A 2C8VA 2NO6A 5KOYA 3MJHA 1G3RA 1JXOA 1GL9B 3FHOA 1AZSC 5KO2A 5GJWC 2ZJBA 4GNKA 3AVQA 2Z0MA 5JCZA 2ZSBA 5KYKA 3GCGA 4PC6A 4KHZA 2ZRHA 2EFEB 1J90A 3EZ6A 4L9WA 2IWHA 1VYTA 4PQRA 3AUYA 3A8TA 3K09A 4FCWA 2EWVA 4KYUA 3THWA 3BB1A 4A2PA 1N0VC 4A92A 4F93B 1A7JA 4QHYA 4R71A 1Q3TA 3DOEA 4KFTA 2WJIA 4OK5A 5CB8A 4LY6A 2F9MA 5E7IA 2ODEA 5FBLB 4BRUA 4G0NA 4HUQB 4LUCA 1G5TA 4URZR 1FZQA 4MKIA 4EKDA 4BZQA 2IYTA 4HB0A 4NPHA 1XTQA 2VSOA 1G3QA 3QKTA 2WAYA 4A8JC 1KMQA 4RVCA 2HJVA 4FINA 2EWWA 4DCUA 4W7SA 3UPUA 2QSYA 1AM4D 1E2MA 3A4NA 3OF5A 3TSWA 1R5NA 4KSCA 5BYJA 1JI0A 4NCKA 2WSMA 4EJSA 1DAGA 1U9IA 3VMFA 1GUAA 3QVVA 5JJIA 1DAEA 5DYIA 2O8FB 3RS0A 3VR3A 1EWQA 4HAWA 3FGNA 1SKQA 1VCNA 2XB4A 4B2PA 2PT7A 5H70A 3BD9A 3GLGB 3GP8A 5A5GA 5KU1A 3SBEA 1QHYA 1ZIPA 2JLZA 5F3WB 2VA8A 3GQBA 4LJ6A 2R6AA 3B9QA 3RAPR 2JIZD 3BAFA 4P0TA 1N6NA 4PR0A 4BFVA 1E9BA 3AKYA 2W0MA 1E69A 4TL9A 3AKCA 4ARZA 3EASA 1O87A 3BORA 2MSEB 3CRRA 4RD4A 1GVNB 1KI6B 2IYLD 4DLRA 1JR3E 1ZM9A 2NO0A 2YWFA 4FMCF 2BC9A 4NHOA 1KNQA 2X1VA 4PO8A 4QG7A 3IDQA 1XDBA 2J7PA 4PTLA 1Z3IX 1AS0A 2W6JD 1X1RA 2CNWA 3GFPA 3U60B 1MABB 5FUWA 3KQUA 2CCKA 4MYCA 1KK2A 1DG1G 2RCNA 4ZO4A 3C4JA 4BZPA 1DG3A 4U02A 5C2JB 2NO9A 1E96A 2D4HA 2EQBA 2VHQA 1EGAA 2ZR0A 5EE1A 4OHXA 3M0EA 2ZS8A 2ZU6A 4ZV4A 5KUTA 1ZD9A 5GJBA 1RRGA 1E2HA 1EFHA 2BM1A 3QPUA 5BQ5A 3KJEA 1MO3A 3TSOA 1CEEA 3BXZA 3U4QA 2QAJA 5EUQB 1H8HA 1OIWA 4TMZA 1T4GA 4LHVA 1U8ZA 4A2WA 3CLVA 3SOPA 3AVUA 2CJWA 2HYDA 1KI2A 4LV8B 3KJHA 1Z07A 1NKSA 4LJ4A 1NN5A 1KJYA 1N6OA 5JHGB 2J3EA 1X3SA 4B6EA 4TZ6A 1E2PA 1U0LA 2ZS7A 3CWQA 3PUWA 3AH8A 5AWFC 1E0AA 4MA4A 3L0PA 2QL6A 4MDFA 2XB2A 3M4YA 2ATVA 4LBWA 5LBIA 2DB3A 1FFHA 3H86A 4ARZB 2NOAA 2GBLA 1GDDA 2F1RA 5B57C 2VHUA 1XPUA 4BRWA 1IM2A 1GTVA 821PA 1QF9A 4D26A 3I8XA 5D3MA
chains in the Genus database with same CATH superfamily
1IY8A 3MB8A 4F86A 4JASB 2C78A 3P0JA 2H6EA 4V0RA 3ZUGA 5K3CA 4L3VA 2CB0A 4ZCLA 3QHAA 5IPFA 3Q87B 3E7WA 4NZYA 1SUWA 2V6JA 1JPNA 2NU7A 4MVWA 1XWWA 4O4JB 5TMEA 3GIWA 4KPEC 3OG9A 5BSEA 3MMPA 1ZWKA 4BAZA 3D6JA 5ALEA 3PR1A 2WMNB 1NMYA 4XGKA 2EP5A 3L04A 1FFGA 2Y1XA 1PUJA 3NR2A 4S1NA 621PA 1FRFS 1DCFA 1Z6PA 1ZVQA 2JI8A 1G20B 4UBLA 3IVAA 1NXVA 1IG0A 1DWQA 3OJXA 3IX7A 3T1QA 3ZWYA 3DNMA 2VBFA 1Z22A 2MYNA 2OB1A 1UMKA 4LXXA 4PAQA 3NTRA 4O4IA 4J1TC 3DM5A 1PNQA 4XZ3A 3ZWVA 1XTVA 5U4QA 4LOKA 3AY7A 4LDQA 1KY5A 2WFAA 1U8YA 3GA0A 4Y1RA 3NCHA 4B7UA 2GXUA 1SIWA 2QMOA 4YT4A 2NSJA 1Y3AA 3GZNA 4I1VA 3WOHA 4CODB 4ZOQI 3H2GA 3M6FA 4MS4A 1ZJJA 3C74A 3U3ZA 3G85A 2BKEA 3GEEA 2R4QA 4Q4AA 4E7OA 4EUEA 1KJJA 4FGLA 1Q0TA 2FUNB 3CSUA 4PAGA 3R7DA 1ULBA 2A0XA 5FWYA 1Z3CA 2R8ZA 3AUAA 1XTPA 3RYCB 1KH1A 4MYTA 1VKNA 3ZU5A 4NCNA 4YXWD 5KSYA 1FRNA 4LZNA 5ABPA 3ABRB 3FF1A 3W5BA 1EWQA 1KEPA 5ICGA 3IAXA 1N5KA 3ITKA 4HDKB 4JENA 3CLRD 4LNUB 4PZYA 4UPVA 3NAMA 3NWPA 3ZIAD 1J8FA 4R8KA 3DA8A 3QKSA 5CX1A 1MOZA 4H7KA 1GLVA 3BBPA 3IO3A 1PLLA 2RG7A 3K1TA 5CVVA 3TX2A 3NUQA 3FX2A 3IRVA 1ZIOA 1CZNA 2PKQO 3RD5A 3U4AA 1D2MA 2BI7A 3RYFA 3A25A 4DDTA 3MT7A 3FVQA 4NOMA 2MSDB 3N7TA 3GF4A 3PUKA 3O4RA 1KJ8A 2NV2B 5U9CA 1ODJA 4W5OA 4FFBA 5CJ2A 2XUQA 2A78A 3GLTA 1IY9A 1DARA 4MR7A 4EFKA 5EJ6A 1XJWA 3LGAA 3PENA 5HZKA 5K6RA 3IE2A 2OBYA 5K6AA 5KTRA 1J8DA 3H9GA 3A6ZA 2PRKA 4RMNA 2ZCUA 2F8MA 2GKSA 1B6GA 4XGRA 1JNXX 4TLAA 2Y9MB 4JJ6A 4KXQA 4GICA 1Y3CE 3N70A 1M5RA 1RXUA 3C15C 4JB0A 4Q4HB 3VAZA 1MC8A 1PJ3A 1S1MA 2FJPA 2E1RA 3ZLUA 4BL5A 3L4JA 1YF3A 3TQFA 3BEDA 2AEMA 4P7GA 2WP0A 3O8QA 5ED4A 4KRYA 3SZUA 4V0LA 2IITA 2V3WA 5AHXA 3U0VA 4HNSA 4Q01A 1HE1C 5BT9A 4QZVA 5HCUA 3NXKA 5AOCA 3BTOA 2ZDQA 2R5WA 1J0DA 3KQQA 5CDGA 5JATA 3JD0A 4ND3A 2B99A 1L0BA 3U26A 3GGGA 5LWHA 2AN4A 1XMXA 2GK4A 4H15A 3X1WA 4S1VA 1NFQA 1N0HA 4GC9A 1Z74A 1L7EA 3C85A 3ANLA 3WGNA 4AM8A 4F3TA 1CUAA 2O6LA 3RDPA 2OQRA 1RQLA 1T26A 2PGLA 5EMHA 3UMFA 4C4OA 4CKBB 2XRYA 3TUZC 4TT3A 1SMKA 1L4LA 2TYSB 2GEUA 4MQ5A 1GARA 2F17A 3AYZB 1XOIA 1G19A 2VJPA 3B5JA 4MHOA 4Y9UA 4NK4A 5TV2A 1P39A 2O2EA 4OQYA 4WUVA 4MRMA 1X1BA 4BU0A 3HB9A 1S4QA 5IP5A 1K08A 3L8EA 3C3MA 1OR8A 3V3KA 3WQRA 4DVGA 3BSYA 7MHTA 3QU2A 5IT9A 4DHWA 2R8PA 3HCAA 2BFEA 1C3LA 2EGUA 3EXHB 4J0IA 4X7BA 1V6SA 3C3XA 1T9CA 3THWB 4UEQA 3DXXA 3FDZA 4NPCA 1A9SA 1MT0A 2XWSA 4HATA 3BRQA 1QZUA 1BXKA 1ZIDA 3JV7A 4I6EA 3ZPXA 5CB4A 2JH3A 3I01M 1N75A 3T52A 4DQDA 2V4MA 4YQEA 4INZA 2NU7B 4TN1A 1JEEA 1JG2A 2DMRA 2AI2A 3HDYA 1AKNA 1JQLB 1OXBB 4LQDA 3DDOA 5CT8A 4A91A 3JVDA 5CVTA 1J9ZA 4RKEA 1LBQA 5ADUS 3JRNA 1TT5A 1ISFA 3MBOA 4EZBA 3AZOA 3NEAA 4CLRB 1QQAA 2H17A 1R4MA 1XN1A 2Q0XA 3PNMA 3ZE7A 4F6CA 1KSHA 2PT5A 2NW6A 2QRQA 3MS2A 3OKCA 3PHJA 3QEKA 5A05A 3RFFA 1EIWA 3PQ5A 4HB2A 3I9V6 4HDAA 5ENVA 2CFTA 1NG9A 4MVJA 3EG9B 4EHDA 3L0SA 1CS4C 2NO7A 2EYUA 2AEJA 3T0IA 3I5MA 1S2DA 2GAOA 4K6MA 1II0A 5EJ7A 2P5TB 1V41E 3ZD9A 1E1QA 3I64A 3ZCPA 5L4NA 3S99A 4WJZA 4LZZA 2QJWA 4C3VA 4IMPA 1CIJA 2BSXA 2FN4A 3UMSA 5L40A 4Q4CA 4QUAA 5A5EA 1Z16A 1LF5A 3EEFA 4PG5A 1M67A 3NHSA 4LZJA 5ALXA 2JCGA 3GCZA 3QV2A 4BLSA 3A4VA 3QG5A 1KK0A 4K03A 3ZTYA 1PCXA 3VU8A 3QPBA 2DKOA 4HEHA 1QYXA 1FQKA 3JQAA 2D8AA 4KLCA 3MTEA 1LDBA 1OA0A 2EJTA 2X2PA 3QUBA 4K87A 3EY4A 4BLOA 4QGBA 2UZ1B 2AFIE 3LDUA 4L8YA 4D92A 4DSTA 2QRHA 1EFCA 1U3UA 3NUGA 4RU1A 5EEGA 3CR3C 3GZTB 3BSFA 3Q1KA 1V9SA 5K8IA 2G9QA 1DIAA 5KSZA 4NZPA 3F96A 1LEHA 3PDIA 3UHAA 4GP9A 1YC2A 4KQEA 4MMXB 4TTQA 4OQLA 1EMDA 1HLGA 3DT8A 1UP4A 1OX4A 2HTEA 1NIPA 5C1BA 3WGZA 2H7YA 4I55B 2CXNA 3IUQA 3GNLA 5H81A 3EXIB 4R0MA 3EIEA 4ZYWA 3AVTA 2FKNA 1C41A 2V8OA 2K7FA 1TM5E 2AI3A 3FBGA 1N7GA 3UV7A 4MJXA 2BE9A 4ACBA 4EHIA 4X41A 1EZ4A 2JFWA 4MUEA 3RU7A 5JCOA 5BYKA 2ENUA 2BTQA 2ZB4A 1I6LA 5AVUA 2YQ4A 2ZR7A 3OZGA 4YRJA 1CR6A 1X13A 2EQAA 4P82A 3N58A 1AN0A 1SOUA 3NEJA 4GZ6A 5EHNA 2FG5A 5A7HA 3ZY6A 4INJA 4OMUA 1JQEA 3VO1A 1Z2EA 4TL7A 3VGJA 2W2NA 1K7EB 1XELA 2JFPA 1E1DA 4P86A 4QJ4A 4YJFB 1ST3A 5FUYA 1KP9A 3OT1B 1E7MA 3G0GA 4M1OA 3JASB 5IYZF 5B3JA 3T99A 3O2QB 3NM4A 3WGGA 1ZRNA 3PVZA 4NYIR 3QHPA 4PIPA 2FRXA 4U3JA 2XH8A 3A27A 2BJVA 2ZBGA 3WDKA 2O8FA 2GK6A 3NOQA 3FBTA 3T7KA 2PXCA 4J07A 1YAHA 4B82A 3V7UA 3AESB 1I0IA 3WWDA 2CNNA 3HNPA 1J20A 3KC2A 4YRDA 2V3VA 1NJ1A 5IDQA 1P2GA 3HB1A 3DMRA 1J4AA 2YWGA 3EQZA 3O4JA 4B83A 2C3YA 2G9NA 1DBRA 4MMYB 1FP6A 4BFZA 5FUQA 3H6HA 2I6TA 2PL5A 3RKSA 1IZ9A 4E46A 3Q8LA 3L7AA 4J4HA 5HUQA 2VK4A 2VYQA 5AW1A 1SBTA 1GAWA 2EZ8A 3GLFA 2BM8A 1EE2A 3I34X 4J9UE 1SBNE 4MUIA 4WZBB 1KYWA 3NHWA 2BGGA 1EU1A 4DC9A 4JC0A 4N12A 2DQKA 3IQHX 1HEYA 4MW2A 2PG3A 4GSLA 3RFXA 2AD1A 1DDGA 1LQTA 2P8SA 4G8CA 4HC4A 1OX6A 4IP0A 4CF7A 3FDIA 4F72A 2GRUA 3QYPA 4X8LA 1F0PA 2BGUA 3SX0A 2OGZA 3LMKA 1JBEA 1FU7A 2FF5A 2AMJA 5GONF 2O0JA 2V7UA 1JJAA 3WQBA 1ZHFA 1JHRA 4ALNA 4LJAA 1QX3A 4Z54A 2P79A 4MRAA 1EWTA 1WPXA 4H6PA 1QRAA 3VZQA 4UPEA 1R3DA 3EDOA 5THXA 1M66A 4OJKA 2LCFA 5PGMA 4A8JA 3V4SA 4HB4A 4KR7A 3ZK8A 2XMRA 3CUVA 1NNEA 3I09A 3R23A 2REXB 3OFJA 4PYOA 1TCUA 2B6HA 2WAAA 4RD1A 3UT5B 2RGRA 3WRYA 1KOJA 4GR5A 4N6NA 4BFYA 3TW6A 4F9EA 2JGDB 3GFSA 3VH2A 1YRAA 3KVNA 3FNQA 4Y1RB 5KYYB 3N5KA 4B7AA 1Z4IA 2MINB 2GAAA 4DT1B 1J0CA 2EBFX 3EA5A 4FI3F 3TUJC 4C22A 4B74A 4AY2A 2QX7A 1VMDA 1R88A 1YZKA 3TIFA 4ZGBA 3BGDA 3TCNA 4FBGA 2JI6A 1U3CA 4W6QA 4KN8A 3TUIC 3DYBA 4EG6A 2BGNA 2JJ2D 2YN2A 3EZXA 2HFJA 4IXTA 5TNXA 2FXVA 4U7DA 5K0TA 1HPLA 2M1XA 1H5QA 4AS2A 3MTIA 3DL7A 3CRW1 4C88A 4E6EA 4DIUA 4XEHA 5CNMA 2I34A 2CXPA 5EWLB 5GMOA 1M2JA 1YFJA 2X58A 1P2TA 2BFEB 4RXTA 5L53A 1ZD3A 4AD8A 3IODA 2PD4A 4HLUC 5G4KB 5FTLA 3GL9A 3URKA 2N0SA 5K3EA 1W6UA 1VPEA 5LOVF 3OM0A 1IBLB 5KJEA 1Z4JA 3TXYA 4DR2B 1UXIA 1SXHA 4KMOA 4LYHA 3VR5D 3RYCA 1PEYA 2X0EA 2NYVA 2W93A 3MLBA 4QEZA 4EPYA 1ZSVA 3QUSA 1CY2A 2EX1A 2XQVA 2GMWA 4UBJA 3BGOS 1NNSA 4M9CA 3AHGA 1AXRA 1Q50A 3F4LA 2XRMA 3OU7A 2O14A 4TMWA 5TQ2A 4F1JA 1IHDA 4LGCA 3Q1LA 4TRJA 2Q6VA 3GMIA 3TJRA 4BJ5A 2DQZA 4KXVA 4JX9A 2YY7A 4HYEA 1GUZA 2ZU0C 4GL4A 4I99A 4KDCA 5CD1A 1P73A 1ORDA 1B76A 4GX5A 2D2FA 4K6GA 4RPJA 2H8GA 5TQVA 4CMBA 5BUQA 3KXIA 5MHTA 2OBFA 3UB3A 5KTMA 1WLSA 1HETA 3FYHA 2C57A 2F6RA 4GOXA 4KN6A 2VJOA 3O8QB 2WVHA 3LBHA 2D8MA 4ZAFA 3WLTA 2QRZA 2YHUA 2Y67A 5LD2B 2QG6A 3FB4A 4NCAA 1EBUA 1ZRSA 3EZ7A 3DO5A 1IXKA 2WIJA 1VJGA 3GUHA 2VZ8A 3IPRA 1N5MA 1PG2A 1PFGA 3TSCA 3FOEC 3U4DA 3OZAA 4MUGA 4N3GA 1QF6A 1LS1A 3N07A 4DLTA 3DW1X 2X9NA 2Z8ZA 3HVIA 3JATB 5AUOB 3IKVA 4R1TA 1MB9A 3F9CA 2BIFA 1KKMA 3V34A 3PICA 4GBMA 2N9UA 4MCIA 4KUGA 1BE6A 3HV2A 3RT7A 3LT0A 4RMGA 5G41A 3SEFA 1OW3B 2JCBA 2UUCB 4MQMA 3WZLA 2V5UA 3BWDD 3Q8XB 4I3FA 1SHZA 3QQ5A 4OHMA 3L9WA 2FP4A 3KELA 3NWJA 1LBHA 1L4YA 1HFEL 5ESDA 3ZH9B 3N2KA 3K4HA 1T5BA 3PQ3A 2X13A 4MUMA 4JDUA 4LHWA 3I9KA 3NONA 2Q5HA 4L3WA 2XXAA 2QLMA 2QLTA 4DBLC 5DISB 1KDPA 4FCVA 2OG1A 4AKSA 1EINA 3K0BA 4ZYZA 1B0UA 3M82A 5DPMA 4BZXA 2JJQA 3PEUA 3LBFA 1PDWA 2DULA 1PJAA 3MXOA 3ZY4A 5CXQA 3DQQA 2ZXUA 4RA9A 1RJDA 1Q0UA 4KQ2A 4ZQFA 3WL7A 3TECE 4DMKA 3BE8A 1RHMA 4G0PA 4Q21A 5K1ZA 3T7EA 3DHYA 4BNWA 1PS0A 1U9ZA 2C8JA 3HCWA 3B9BA 3H4VA 4NY1A 3K94A 3VSDA 4RFVA 1H6CA 1M9NA 3CWZA 4UQPA 3QF4A 2O8BB 3T5DA 3VUEA 1J99A 3ZCXA 3Q2KA 4TYYA 2OBMA 4N7JA 4OFWA 3GEPA 1L7VC 4KW7A 1CTQA 1AUQA 2OCDA 5EJ5A 2O1SA 2FPPA 4ZICA 2X41A 3WBKA 4M1WA 3IQGX 4IGFA 3NCTA 4H3VA 4Q1VA 1OTHA 1RJ9B 4FMPA 3VSEA 1II9A 3GJRA 4G0UA 4QVGA 4IBOA 4DZTA 3TBHA 5DE3A 2DT8A 3ZWBA 2IS6A 2W6MA 3H5OA 4O4IB 1WV1A 1OD6A 3Q2IA 1QDLB 4HNTA 1G59A 2EX4A 3SS8A 5JW6A 4GMXA 1RCUA 3FLAA 4HWRA 4C43A 1TCBA 2C7BA 1I10A 2CDRA 4PPFA 4C1NA 4EI8A 3SU8A 4BKUA 2IFTA 1HURA 5EWLA 2BFMA 4K81B 3DCYA 2Z09A 1RE1A 4P2GA 1NF2A 2XTJA 3IMEA 3L9XA 1ESZA 1N2BA 1SHUX 1T2EA 4ICIA 4BMCA 1OI7A 5I4IA 3S8EA 3R5KA 1FUIA 1GRQA 1AU9A 3FPKA 4PHHA 1OI4A 4FLMA 1JQDA 1P1HA 1IVYA 4NS1A 5IJAA 1XE3A 5ALNA 1K88A 1HXHA 1XEWX 4BAGA 4W6ZA 3IB6A 1RZ3A 1DWOA 4WCFA 3NBMA 1KI8A 1MR3F 2G9ZA 1ZMOA 3PL1A 1Z4LA 2A33A 2WG2A 2O5EA 1W30A 3N59A 1CC1S 2AQ8A 3O2JA 5L3ZA 2ZCVA 4HQ6A 3BL6A 3LKDA 3IT1A 4B3FX 3MG9A 2Y1EA 4ROTA 2BCEA 1USWA 1Z8HA 2JS7A 2YRWA 4QTUB 3UKOA 4XVHA 4BNFA 2CFOA 5BNIA 5HM8A 5KB3A 1RE0A 4CUZA 4LMRA 4KJZA 2DBQA 5DULA 1Q21A 5NLLA 2WIDA 1V5FA 5HM6A 1Z5NA 1K6EA 1XUOA 1IN6A 1Z6AA 1E1LA 2A1TS 3L7LA 4RPCA 3BCRA 1I13A 5ALWA 5YASA 4AJKA 4TS3A 4I1PA 1QBGA 1XKQA 4G36A 4XEUA 2Z04A 3AFMA 3BHMA 4LDJA 4A1FA 4IDEA 4Q47A 1MG5A 4BFXA 4TKVA 4BGEA 3OJOA 3DAHA 2UXDB 1P4HA 1KXJA 1KSFX 2C99A 2NAPA 3ETJA 5DW0A 2R8RA 3I2FA 3R76A 1DXHA 1L4GA 1NQWA 2GB4A 4AO8A 4C7OA 1ZJ4A 1QKKA 4OB8A 4RV5A 3ROGA 4BZQA 3NGLA 1Z0IA 3CLUD 3PD0A 1WXHA 3G9TA 3G6KA 3WL5A 3PX2A 2FN8A 2V9CA 3N86A 3EZGA 3NKFA 4QAJA 4TT3D 2FLWA 2V0NA 2E49A 4FMCB 3TVYA 2EGGA 1CUSA 1G60A 3MOGA 4AXXA 2I1WA 4CRWB 1DI0A 1EK0A 2JIOA 3RS7A 2XYHA 4E94A 3NKLA 3B1XA 1AT1A 4IIBA 3SZLA 3FLEA 5BWMA 1U4OA 5IJ9A 1XCPA 4JMPA 2ZQ5A 2Y4NA 5EIBC 4ZHSA 4ZRNA 4NENB 3AR3A 2WF7A 3ADDA 3X1YA 4YT2A 3TJZA 1Y9DA 3OHSX 1ZH4A 3D43A 3FFWA 4Q24A 3B6ZA 4EMBA 4X65B 1GUDA 2VOEA 4YGYA 1CHNA 3FHJA 3Q6IA 5IC5A 3DNFA 3Q7RA 4UDNA 5GINE 3UJ9A 4ZI3A 4GMHA 3W3AA 5D3KA 2C0QA 3MFYA 2A9FA 4ZAGA 4OMCA 2HDNB 5EMMA 1LSUA 4N82A 5IH7A 1E18A 3IRUA 4FE4A 4JYAB 2QU7A 1CUEA 3EEBA 5KOIA 4D57A 2QJFA 3NOXA 2D2IA 1MX5A 5BMVB 3OJ0A 4LN1A 2QL7A 4J1NA 1IMJA 3NJRA 3U31A 1NQOA 2D00A 2G8NA 4AIIA 2WM9B 1QHIA 5JJLA 4QYMA 3QX7A 1KZ9A 2IPOA 3HO6A 4GYKA 5ARBA 3PLAE 4MVJD 1ACJA 1QUEA 2MR5A 1YONA 4MQFA 1E6KA 2Q99A 4MNTA 5AM0A 4MVJH 2AOWA 3FCAA 3TTXA 5BW6B 1EKXA 1F0YA 5C46F 3E3AA 1X7DA 1HO3A 4DQVA 4DDKA 4NF2A 5JI3E 1ICIA 4EZIA 5DSZA 2PX5A 4MIKA 1SVOA 4UM5A 5K3OA 4X90A 2R65A 4DUGA 1Z7EA 4XYEA 3W9UA 5EE0A 2AKYA 2GPJA 1XLTA 2O4CA 3MWDA 2GJ8A 3OTIA 4FNMA 2F1IA 2W7TA 2OCXA 2XQKA 4I7EA 2IV7A 1O08A 2Z6QA 1DC5A 2I6QA 2ZYUX 2IYWA 4QXAA 1KOGA 1U3VA 4LK3A 3SLKA 1AE1A 3VU1A 3WL6A 2X8JA 4CL3A 1AMUA 3IO5A 2NADA 3Q5DA 1EK1A 4HXYA 3SEQA 1IC6A 1G63A 3CNBA 1R66A 1IEWA 1QIEA 2AUNA 3VX3A 2WJYA 2JANA 1XL1A 4RZHA 5G0WA 3CSSA 1TZJA 4FNOA 3DEHA 2EKBA 2XB8A 3IR7A 1TNDA 5I5GA 4U7TB 1TE2A 2YXLA 3ZJTA 4PBSA 2H4JA 5FBQB 4ZCSA 5IJXA 1P0FA 4I4IA 4L0DA 1CY0A 3CZMA 2QL5A 5F9HA 3S2IA 1C30B 2WSBA 3LK6A 1Z39A 5FPQA 1NVWQ 3PNBA 3HY3A 2D6FA 2IPLA 3CZ5A 1EZZA 2QOEA 1L5YA 1ZMBA 4A6DA 4CV1A 1R6BX 3AETA 4TL8A 4LF7B 2ZKIA 3FTEA 1U0JA 3PGJA 5HK8A 4HAUA 3LQRA 3AI7A 3THRA 3DL4A 3MNFA 3K6RA 1KI6A 5EINA 4DR7B 1UMCB 2XKKA 2IYAA 3CXRA 2O7QA 2OZLA 3G7NA 4IQFA 4IDOA 3SJCA 1JE0A 1IOZA 2P75A 4TQUS 4DSUA 4QSMA 1OZGA 3CZCA 1GTG1 1O0CA 2VDLB 3HKEB 4ROSA 4Y2VA 4EF4A 1D8TA 1KYYA 1ZW6A 2C1EA 2VPIA 2ZYHA 2UV8A 3JQRA 4DHEA 4XVCA 1QCYA 3HZHA 1U2DA 5A4KA 4NBLA 5KWJA 1QO0A 2GVZC 3KQPA 4DWVA 1WDKA 4GNRA 5AVRA 1CEYA 2YJZA 3NBYC 2DOKA 4CDGA 4Z51A 4B7XA 4C0XA 2WMYA 4LWOA 1L5ZA 2AUTA 2DFNA 2QTGA 2QRLA 4Q7JB 3T7SA 1CJMA 1Z75A 1CHDA 3MCZA 4H9GA 4ZD6A 4B6QA 1VG0B 4P35A 1SU8A 1G20A 3HLKA 3JQ9A 4PO3X 4GWLA 3W90A 4JUBA 2PJRA 5KDDA 4WLVA 3NV7A 1R4NB 4LPSA 1YQQA 1LLDA 2ZR9A 1WHTA 2Q2NA 4P83A 3KR2A 3NVAA 3GG2A 4FQ7A 3LX5A 2ODTX 4J2OA 2FW8A 4UJ3A 4D80A 1WDWB 4XQEA 2NUAB 1Y8ZA 3VYUB 1LUAA 3HCNA 3IBSA 2AW5A 3IEUA 1YDFA 1P6UA 3DMYA 3LLCA 3P0IA 1H2YA 2I4OA 4PGGA 5KHOC 5LM3A 1UDCA 3O4GA 3VTAA 1LS6A 4Q9IA 3B5IA 3BL5A 1A2BA 3LE8A 1TF5A 5IF9A 3RUHA 4GEKA 1XQVA 3ZEIA 2AL7A 4FSHA 5KDOA 2BKXA 1QIHA 1ZCBA 3GEHA 4M55A 4PIVA 2FWIA 4NE7A 5DTMA 2FQQA 1WU7A 3T5CA 2V5AA 2PU7A 1C7JA 4M37A 1GFWA 4UXIA 7YASA 3TNLA 2J85A 5UKDA 2OXCA 1S0UA 1JYEA 3H83A 1EBFA 3AJ8A 3LQKA 4WVLA 4YMIA 5FR1A 4C5CA 1PSZA 2RJ3A 1VRCA 1ELOA 2XZPA 5EIEA 1J5EB 4HMPA 2IBTA 4AN0A 1ZJ6A 1Z0FA 4QYIA 4HUTA 4MKZA 1MW8X 4JI1B 4K26A 5CXXA 2P2YA 1ZH8A 2IP1A 4RWZA 3MVEA 4QT4A 2HA3A 2VSFA 4HJRA 4JLUA 3FPCA 3I58A 3IEXA 4QD3A 1E7YA 1DUIA 2F9FA 2YXNA 4ND2A 4DNXA 3DD1A 2EFJA 4W9RA 4G0VA 2WHEA 2JFUA 3THXB 5ALKA 1NSFA 1HY3A 1T8UA 1OH7A 3EW9A 3VPSA 1FPMA 2WTAA 3LHIA 1NVXQ 1G4HA 4HB3A 4XJTA 1O96A 2VG8A 4ZQBA 5H0IA 2P1ZA 3F74A 4GWKA 4M8SA 1QIGA 5FTNA 1Z0SA 3G02A 4K1XA 1KC1A 4OAOA 3F6EX 3TCXB 3PC8A 2J8ZA 3T41A 2XWBF 4CU5A 1XCLA 2F43B 1AK1A 1TQ6A 3L7OA 4M0PA 1H6DA 5DGXA 1E8MA 3MWYW 5F98A 3ZBUA 2HSWA 3CUWA 3AUTA 3L1UA 1X1CA 1RXYA 1KDVA 4RM3A 3AVPA 3SYRA 1VJTA 3PQEA 3TOVA 2I1VB 5JPIA 4GE0A 1KZYC 1T0BA 2GASA 2O2YA 3OCWA 1XLVA 4HBZA 4J1QA 1BXGA 1A9RA 4L0CA 1G4AE 5ER6A 1R0RE 3PQ7A 2IL1A 1VM6A 4RQTA 5HTOA 1OU0A 1T6NA 1DDOA 4IF4A 1LDGA 4R05A 2JFHA 4RHEA 5DOZA 3GLIB 1J0EA 3TO5A 3PI6A 2BM0A 1LLCA 4DR4B 2H4ZA 1N77A 2WB2A 1B6SA 4OQEA 1CUUA 1EGQA 1FUEA 1K6XA 4RMHA 4D1YA 1M76A 1ZR4A 3KXPA 1X92A 2FPIA 3QWBA 5C5DA 1K8RA 4WDQA 1KRXA 3MILA 3QTLA 1MP0A 3QWIA 1SG0A 3AJEA 4JSTA 1FLNA 1NVDA 1H5NA 2AF3C 3L05A 5DJ5A 5FWYB 1MN6A 2GQ0A 4C0WA 4CKWA 4X5OA 1NY6A 2W6NA 1BH6A 5EQJB 2CLDX 4XVUA 2XODA 1PI3A 1ISJA 1ONOA 3IBTA 4CV3A 2ZE5A 3QF7A 2FWPA 3IXLA 3KQWA 4UOEA 4WLUA 3GYGA 2ACVA 4BCDA 1N6PA 2QTTA 1CY7A 1GIAA 3EIWA 1BC5A 4BO5A 2FU5C 3WOVA 1J7JA 4KR2A 2WZQA 5TC4A 4WIAA 1I6KA 3WAGA 4X66B 4CM8B 1A7AA 1OWNA 1RQXA 1EVZA 2B2XA 2QLNA 1CIPA 2VAVA 2WIGA 2X3YA 2ZUWA 4ODIA 5IZCA 2C7PA 5IXSA 5CEEA 4PC1A 3DO8A 2GBCA 1P2UA 3H8VA 5DXJA 1YL7A 2IA5A 2IYXA 3CBGA 2NSDA 3H1PA 4DREA 2G83A 3HM9A 4QLBA 1J25A 4ZT4A 4A16A 2I4IA 1FUUA 2D2EA 3ONVA 4ISCA 4B79A 2QXTA 4XUEA 5BOVA 1ND5A 2IHZA 4DKXA 4E14A 2XNSA 1ISRA 1Z5GA 5HMMA 1GFIA 1SUCA 3IUBA 4HDRA 1I24A 4ITRC 1DAPA 4C7BA 3EDMA 4J2HA 2PRYA 1SM4A 4X93A 3GDFA 2IIQA 1GTL1 2HIMA 3KKOA 4RC9A 2PCJA 3PKIA 4EG8A 1E63A 2IIBA 2J9FB 2XQFA 3QVWA 1T2FA 4RSMA 4Y1GA 4YUWA 3IOEA 2HCBA 2BJWA 3NYWA 1B16A 3ES9A 1PF7E 3T4UA 1B0PA 3VPAA 1P2VA 2QGZA 1QFZA 1YZNA 2QT0A 3QVTA 2GHQA 2WZBA 2BFBA 5AKKA 1L3IA 1JKXA 5I7SA 4FZ5A 4XOUA 1XU7A 1U7UA 3KTAA 1VCHA 2R6CA 3S2YA 2JHCA 3DHEA 1JHZA 1MG0A 3N5CA 4INAA 1W5SA 1VA4A 4S1TA 2Y1KA 3K73O 1NJFA 4RENA 1WOMA 1E2GA 3AY3A 4FIZA 4C6RA 3N2LA 2EJVA 4CR6A 1C29B 1J2TA 2D2VA 3RVLA 5DNUA 3ZDYB 4D9HA 3GPDG 4LCJA 2P90A 1V11A 4GMDA 5TQJA 2JDIA 1Q0PA 1JDNA 1TK3A 1KBOA 1WDLA 3HZZA 1Z0JA 4N0EA 4ARUA 4MS3A 4PFQA 4RIGA 4PNEA 4K9PA 2BEWB 4WI1A 5G0VA 3ZY5A 1D6JA 1HG1A 4DMUB 1JIXA 1UBMS 1DKPA 2W5UA 2CGEA 3A0RB 5H3LA 5ALHA 1AX9A 4CG2A 2RHOA 2VDQB 3P2JA 4U8GA 5DOVA 5I51A 1BTOA 2QJOA 3LZCA 4WGGA 4CMIA 1AKRA 4XUDA 5CVCA 3D1JA 4IIJB 2XX3A 3AY6A 3EIOA 1GNPA 2VWQA 4QJ5A 1I9CA 1PIWA 2LW7A 5LQSA 3THOA 1GYRA 2IYRA 1ZL0A 3R3JA 3LCMA 1A8HA 4NJMA 4R2XA 3AFHA 4DCTA 3RVPA 2H5EA 5TQ2B 5JSKA 3ZQ4A 1ULTA 1JHDA 1IEVA 1CR0A 1K5GA 1LI7A 2QAGC 2ES4A 2UAGA 4NJEA 1SCDA 2QVCA 5JCXA 4XE5A 4AKGA 3DHVA 2VAXA 2B4QA 1KP3A 3GRPA 4A5SA 1C50A 4OKSA 2AFIA 1Z28A 3OO1A 1Z0KA 1O5TA 4M1ZA 1M3SA 4MJ7A 4BV9A 5A9RA 5B4UA 3VOBA 2X14A 2GJ9A 1MVNA 2WC1A 3LUPA 3PUZA 3DE4X 4HQLA 1L7XA 2GWHA 4IYJA 1CS0B 2H57A 3AV3A 4L27A 1IQ0A 3AVXA 1SVIA 3RNLA 1TL7C 3S2ZA 5EQTA 4U7GA 4F11A 1SVLA 1ZSNA 5A0TA 2A5GA 1QR2A 1Y8QA 2XKAA 4A2CA 2DX7A 1VG8A 3BAZA 3CF4G 4RXMA 5H4HA 4ERXA 5B4VA 2I6XA 2UUBB 3F9IA 1RHUA 3BFVA 3GI1A 4YBRA 2P9EA 3P0EA 4PFJA 4ZZ1A 1W35A 1ZRMA 4MJ3A 3RADC 3M2PA 1GKUB 3P94A 1RBQA 3W8FA 1KAHA 4KACA 5SY9A 1SXJB 4WLFA 1Q1GA 4CEHB 2OBXA 5C8YF 2QP3A 1OBVA 1T4BA 3D54D 1NKTA 4H08A 5T57A 2WYIA 1GGKA 1RI5A 4BB5A 4U4AA 4CKWB 4CM4A 2EP8A 2VHYA 3SHFA 4R1OA 1ANKA 2ZBEA 2QM7A 1Y1LA 4IGEA 3ZI7A 5BSTA 3E3OA 3GLGA 4FWIB 4YMGA 1ZA2A 1HYHA 3DV0A 4DLUA 4N54A 3W6NA 5BQPA 2OZKA 2VTKA 3BHNA 2FN7A 1UBKS 2IVZA 5J23A 1OC2A 4HDMB 1TZBA 1BZYA 3IS3A 4LV6A 3D6HA 1VCMA 3W1EA 2LGJA 1UP6A 3LWBA 4GZLA 2A5JA 4DLPA 2Z6VA 1LKZA 4ZVRA 4KODA 2G7MC 2X9QA 2ZKLA 2ZUDA 5AI4A 3RLIA 3U39A 1DBSA 4KGDA 2R8YA 5J5VA 3SKYA 4BX9A 2DCUA 1ZGZA 4KN9S 2J0UB 4AJEA 4DQ0A 3TX6A 2G9VA 3E22B 4BV2A 4NCIA 4NJEB 1JV2B 2J0EA 2R62A 3VTKA 4AY4A 3EPHA 3IT3A 3LW8A 2Q50A 5KTTA 3F7NA 3AFIA 5IKPA 5IT5A 4KTTE 4U7PB 1E79D 4BDTA 1QPZA 3Q0IA 1SZDA 4IO0A 5KTKA 5KYUA 4B33A 3ZVMA 2J32A 3KHKA 2XCIA 5BV0A 4YDRA 1HYEA 4QUGA 1FTWA 2GVNA 1G3IA 2BEKA 2BM9A 2JIRA 3ST7A 3VHXB 3IKTA 1YVEI 5CRIA 3PQ8A 1QZTA 4DMFA 5JARA 2C0PA 2WA1A 3KT8A 1AKWA 5AHKA 3Q11A 4YWHA 5HF8A 5LQRA 2LCIA 1QFMA 5BY2A 1U1DA 3O8RA 3CNNA 3L93A 2GJKA 3ZVRA 1DG9A 3JWHA 3I8OA 5CFOA 5IN4A 3C7CB 3K7EA 1UF9A 2XDYA 3N7AA 1Z62A 4DQXA 1QLJA 2EBHX 3ERCA 4C7OB 1GDHA 1NBHA 4MUBA 1RPZA 2O57A 2PR7A 1IQPA 5J9FA 1IYZA 5JUWA 3O3OB 1KY3A 2EKQA 4L0MA 2NPIA 1P0CA 2DH6A 1X2EA 1ULZA 2PVPA 4F4FA 2MSCB 1F1JA 3HG7A 2RC6A 4E5NA 2ORIA 4JJZA 2AZXA 4F4HA 2GCIA 2I7TA 2CHUA 3R1IA 3O1HB 3NWOA 4YLGA 5P8WA 5J47A 3K0EA 3AINA 2J9RA 1O97C 4F4UA 3LF1A 3ITEA 3MB5A 5FI3A 3VR2A 2RB5A 1QHEA 2QRNA 1CZUA 4WINA 1JHQA 2GEFA 3TE6A 2QI9F 3UN1A 3ZZUA 4M76B 3CVXA 3LT5A 2QGNA 2RHBA 1I36A 4K86A 2PRIA 4ZHQA 1C2YA 1F3LA 3AF5A 1DOZA 2Y05A 5K3FB 5JSQA 3DWGA 2FEWB 1FRVA 1X74A 4XGIA 4CYMA 1IHUA 1NQ5A 3G2OA 3GJQA 3JQQA 1PS9A 5DW3A 5LJLA 4HNVA 4XIFA 2EHDA 1YS2X 3BB4A 3OZVA 2UYHA 3FYTA 1Y7HA 1ZKDA 3HKCA 3DKKA 3FWNA 2XQGA 3DO6A 3M6UA 2G76A 1KP2A 3EAGA 4PF1A 4B17A 5B2ZA 4C3UA 2R6DA 4J0CA 4KVGA 3UHOA 1BWSA 1GPLA 3MSCA 5DM60 4TLLB 3CM0A 3OE4A 4NTZA 2CV2A 3WJ1A 3FCXA 3V1MA 1EUCA 1YB6A 2E3JA 2GD2A 1VOTA 2CCGA 4HFRA 4OXNA 4D6XA 2PRJA 4V3CA 1A96A 1F2UA 4ALJA 1PT6A 5KNCA 1ZMXA 2P4EA 3KX2A 1U2TA 3LVFO 1A2QA 1NBEA 5LYJA 2PNJA 2VPZA 2WJPA 4QO8A 4DLLA 2VSXA 1RWBA 4Q0MA 5F2NA 4OQXA 4RAQA 3R5XA 4MKFA 1HMPA 1NYTA 2AMVA 4HAYA 1LBSA 5J40A 4WFJA 3RIYA 3UBTA 2Q8PA 3LO5A 1NPDA 3AHCA 2NPOA 4A6XA 4MRPA 3QEMA 3OZ7A 5JO9A 1KZHA 4G4IA 3H19A 4BECA 1BD4A 3ER6A 4P22A 3LY9A 1C5KA 3K9LA 2PXAA 1S8AA 2RHMA 2ZRQA 4B84A 3LX4A 1HNXB 4ZCTA 3G0HA 2O48X 1EWYA 3WIEA 3I72A 4OUDB 4NBSA 2ZPTX 5HDBB 2MYUA 2IPXA 3IA7A 3EEQA 4WL0A 3HSSA 2O05A 3BXPA 5KX5F 5GZ6A 1IZZA 3JVUA 3VPXA 5EUMA 2HTFA 3KBBA 1V5EA 3KL2A 4KNWA 1SCUA 2ZAGA 3SZMA 5BVGB 3ZKWB 3M3DA 3DR3A 2C3UA 1X7WB 4LRUA 4CIBA 2BMVA 5BSMA 3NVDA 4OYLA 5EHZA 1CPYA 2QDXA 3QFSA 3PDIB 2R60A 2QX6A 3CRZA 4TXJA 1WG8A 4HVTA 4X7PA 5JAMA 1W8IA 5B3KA 1QO0D 5I5EA 1EWKA 5LLSA 1T1EA 2VUIB 1ZN7A 2XUIA 3V2HA 1M72A 2HNKA 4L4YA 4UNQA 5DBGA 3URMA 2WT8A 1GNTA 3IE0A 3WBJA 1L5SA 3DG9A 2W6ZA 3KEMA 4JOBA 2VPYA 3ADCA 3X1ZA 5HQJA 3ZUPA 4Z4QA 2OM6A 3DS8A 4QDOA 2VT2A 3W2HA