3HH8A

Crystal structure and metal binding properties of the lipoprotein mtsa
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
280
structure length
280
Chain Sequence
SDKLKVVATNSIIADMTKAIAGDKIDLHSIVPIGQDPHEYEPLPEDAEKTSNADVIFYNGINLEDGGQAWFTKLVKNAQKTKNKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAKDPKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSAYIWEINTEEEGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFTDSIAKKGKPGDSYYAMMKWNLDKISEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Metal ABC transporter substrate-binding lipoprotein
publication title Crystal structure and metal binding properties of the lipoprotein MtsA, responsible for iron transport in Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
total genus 104
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hh8A02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hh8A01
2X4LA 1G21B 3PDIA 3R5TA 3AEKA 4UDNA 5AFSA 5BVGB 1QH1A 2XV1A 3G9QA 4UTPA 1L5HA 2XH8A 4HMPA 3AETB 5CX1B 5JG7A 4DBLE 4G07A 2M6LA 1M1NB 4PM4A 1ESZA 1PQ4A 1N4DA 2ETVA 3K1AA 3ZKAA 5KOJA 2OV3A 4H59A 4XPIA 3ZK7A 2AFHA 5KOHA 2XDQB 2Q8QA 4INOA 4NNOA 3EIWA 3AEUA 1H1LA 4OXRA 4WZBB 5BVHB 3MWGA 2WI8A 1G20B 4WN9B 3MINB 4LS3A 3AERA 5I4KA 4MDYA 4TKVA 3CX3A 3R5SA 3TEFA 1QGUA 3PSAA 3LHSA 1M1YA 4NNPA 4WZAA 3U7QA 5HX7A 1MIOB 2MINA 1KAEA 4B8YA 2R79A 2Q8PA 2QI9F 4HMQA 2OV1A 2PRSA 1QH8B 4WESB 1G21A 4ND8B 2OGWA 3HXPA 4FNAA 1KAHA 2XUZA 3ZTTA 5JPDA 3AETA 5CX1A 4UDOA 2RG7A 4WNAB 4GICA 1M1NA 4TKUB 3TNYA 4K3VA 3ZK9A 3PSHA 3MD9A 3UJPA 3AESB 1K7SN 2XDQA 1M34B 4N01A 4IRMA 2O1EA 4H0FA 4OVKA 1TOAA 4WZBA 5BVHA 4WN9A 5M3BA 1G20A 4BBPA 3MINA 4MX8A 5HDQA 3AEQB 1FP4B 4PAGA 2PHZA 5M34A 1K0FA 4FILA 2AFIB 5GGXA 1N2CB 4M7OA 5BVGA 3PDIB 3AEKB 4HN9A 1MIOA 2YNMC 1K75A 1QH1B 1N2ZA 2PS3A 2OSVA 4MLZA 1L5HB 4CL2A 5M29A 2XY4A 3HH8A 4FKMA 3EIXA 1QH8A 4WESA 1K2VN 2PS0A 1XVLA 4ND8A 3BE6A 3K1AB 5KOJB 1EFDN 4XPIB 5KOHB 2AFHB 5CR9A 4UTOA 4WNAA 3AEUB 1H1LB 4TKUA 5B58T 4MO9A 2YNMD 4FI3F 4OXQA 1N4AA 5GGYA 3AERB 3MFQA 5M2QA 3AESA 5JOQA 1M34A 5FLYA 5KHLB 4TKVB 3ZK8A 4LJSA 1QGUB 3GI1A 1M1YB 4WZAB 2M6KA 3U7QB 4HMOA 3AEQA 1FP4A 2MINB 3NU1A 5JJ5A 2XQVA 3HJTA 3TLKA 1PSZA 2WHYA 4INPA 1KARA 3LI2A 2AFIA 3BE5A 2PS9A 4G09A 3MWFA 2R7AA 1N2CA
chains in the Genus database with same CATH superfamily
3LCMA 3V7WA 4F93B 3RADC 2VP9A 3HZRA 4X95A 4Q4JA 3TLMA 4H3KB 4O8ZA 1L5ZA 3EZXA 1WHTA 1UPUA 4QGSA 2DWPA 5EC8A 3I4FA 2X0RA 1SRQA 5EPOA 1ZH2A 1NZJA 1SAYA 5BYBA 5U4XA 2OK8A 3AM5A 4AP9A 4U4AA 3PQ3A 2QX6A 1JHYA 2NTNA 1K5PA 1NDHA 3IP9A 1GZUA 4Y2UA 4JBIA 3B6MA 4L5YA 4YJGA 1HSZA 1CQWA 4OKSA 5FKJA 3B1VA 3FZQA 2JFPA 2OAGA 3V3KA 3Q6IA 4JELA 3FZGA 2IEDA 2F3QA 4QGBA 1U0GA 2W6ID 1J2TA 2QNBA 4DSAA 2X9NA 4QATA 5MN6A 1LBTA 1XTTA 5BNFA 1Z22A 5F52A 3KHTA 1ST3A 4OMDA 5ELLA 1B0AA 3UQZA 1O6GA 1JXOA 3DAFA 2GXUA 1EX1A 3ANSA 1ZA1A 1GU1A 1VIDA 1C8VB 1ZCZA 2X5KO 4RTSA 1JTEA 1R64A 4WBNF 1P2FA 4BKOA 4B84A 4PAWA 3CZQA 2Q8PA 3ZBTA 3AEZA 3SC2A 2CK3D 4J90A 4M60A 1CUSA 1VPLA 4CMIA 4PW0A 1EFRA 4URWR 4CLEA 4DA9A 1MW8X 3A7EA 4FFBA 3TNLA 2PUEA 3AVXA 3R3YA 2Z0MA 4ZPXA 4ARZA 4YRAA 3R0XA 1SVSA 3ZCXA 3GUCA 1HQKA 4HQKA 1M7GA 1B42A 1WZIA 2WZBA 4GBMA 4XYMA 2FFAA 3HJAA 4DXAA 4B3GA 2P9GA 5IM5A 2F1HA 1YHNA 3V4RA 2YMMA 3WK5A 3RCBA 5BN3A 2LRHA 2X14A 5EMNA 5F2EA 1XMPA 4KR9A 3VPGA 1QK4A 3U7HB 1ZNXA 1FYVA 1CJBA 3T7AA 4EGJA 1DBVO 2CL0X 4OVKA 1NG1A 3H19A 1M8FA 4WN9A 2I91A 3GGCA 3WLHA 3PFFA 2ZT7A 1TZMA 2P7HA 3FN4A 2J0SA 1ORWA 2RB4A 4D9BA 1K0FA 3RSFA 2HLHA 1XVAA 4EYGA 1Z4IA 1SD5A 4HGNA 5K3DA 4A82A 1UMDA 1N3IA 3DR5A 4MYSA 1F14A 4YRIA 4DY6A 3D6AA 1JJFA 3DAGA 4MITA 3RJ5A 2W2VA 3ETCA 4NOMA 3OJOA 4DNQA 5KNCD 1F06A 1GRNA 3KKEA 3RVBA 3HUDA 5C3UA 3U37A 2VHUA 3Q7QA 1C0KA 4FKMA 3OEWA 4HHEA 4TUYB 2Y2VA 1E5TA 3NHRA 2I8CA 1FB5A 4KQHA 5FOWA 3CPEA 1QFSA 3D8TA 3H6KA 4IMRA 3MUOA 3QBVA 5DGIA 1ZSYA 5D01A 1XRMA 2RB5A 3IVAA 4C05A 5KINB 1E8NA 3C8DA 1Z7GA 3KDPA 2LCQA 2HFKA 3R6LA 2RI1A 4MINA 5E38A 2DR3A 1KMIY 1KMCA 2PVSA 4L7QA 5IT9A 3ROEA 4QXRA 5LIPA 3EUEA 4BYGA 2JDID 4BU0A 1N6IA 1R0KA 2XUPA 4QD3A 5LZ4A 1I14A 1J1IA 2VH5R 2K7FA 2CXOA 3ZCPA 2CL7X 4M1EA 2HWYA 1E3JA 4F4DA 1E4EB 1SFRA 1W59A 2ZTLA 4EMBA 1FUKA 2B7LA 4QXAA 3WYBA 3SZGA 4DCCA 3SU8A 2DKOA 4LNAA 1R8SA 3LX6A 3JYLA 5JARA 5AVRA 1L1EA 2WZQA 4LDZA 3AHEA 1EVZA 5BUCA 3G2KA 1J8QA 4M9ZA 3CKKA 1GNTA 2A9QA 1V5GA 5CVEA 3G0BA 1ZYUA 4D8WA 4DLKA 4CIVA 4Q7QA 1ZVJA 4DWWA 3WBJA 3LLMA 1V8BA 4LCEA 1M2OA 3U0VA 3JD3A 5I5EA 3Q6MA 4HLCA 5CFNA 3V5NA 3C3MA 4WOJA 3JALB 3SXPA 2XDQB 4HDRA 3AFGA 2D1YA 3WJAA 2YYSA 3TXAA 3VC7A 2JBWA 3AEUA 4IQ0A 2R4TA 2GN2A 3FUWA 4KBFA 4WNIA 3S8MA 3ETNA 4J1SA 4RXMA 5GZ3A 2FR0A 1FE8A 1S8NA 4HNAA 1ZM7A 3D8HA 2XUOA 3KPJA 4M8SA 5F2KA 1MVNA 2Q5LA 3BXHA 2WG1A 3TZBA 4J1NA 2H7YA 4CYMA 621PA 3IKMB 2CZQA 4DVGA 5HQ3A 1NSYA 3L7YA 2FRDA 3BWYA 3KC2A 1XFDA 5K8LA 5KU1A 2J46A 1G8AA 1EFPB 4GFDA 2WJVA 4OBXA 3VR2A 4LYEA 1X86B 5DLPA 4M99A 4OAPA 4LC9A 4MUEA 2O7QA 4RDHA 4BVGA 4CNQA 4KRFA 4BO1A 1MEEA 3ESDA 1WXGA 3O9MA 4LOKA 1J2YA 3HYNA 1F7VA 3K5HA 2XMGA 2R00C 5LOVA 3JQFC 2PIAA 4NY1A 2GZDA 4QWWA 3GD7A 5FPQA 2IY7A 4RPIA 5B1IA 3JVEA 4DSNA 1W36B 1JZTA 3O4RA 4A3SA 4AG6A 1HR0B 3P0EA 4JSTA 3UN1A 2BMEA 2Y66A 1GY8A 2WICA 2HMYB 5FORA 4RD4A 4H27A 4YDQA 2HRCA 2HU2A 4E1AA 2GCEA 3MS4A 4JUBA 5EMLA 5JUWA 2FOIA 2GWRA 1Y7IA 1Y3FE 4I1OA 1TU0A 1TF5A 1US8B 3LWZA 5F76A 2AH5A 3JATB 5HBGA 2FLVA 5IU6A 4KQXA 4M6WA 1BIFA 5FJJA 3TF5A 1N2SA 2GBLC 2VDWA 3DB1A 1FJGB 4R83A 3C8HA 4WCDA 1UF9A 3ZGXA 4R8MA 4DUGD 2ECFA 5HSGA 3L07A 4ZC1A 3SXUB 5C9ZA 3VPCA 2IYXA 2W6PA 4D44A 4MCJA 4EKGA 5LD2B 3EHDA 3P0FA 4F71A 4YPVA 2NGRA 2A35A 4OI1A 3W8NA 4DUPA 1A4RA 4FX5A 3C43A 2WYWA 2IYLD 3L7KA 3CLTD 3LV8A 3NC1C 3R0QA 4QICA 3VBEA 4QT0A 4P33A 4ZVKA 1RM5A 2GCPA 1KY3A 2H18A 4LUCA 1ICIA 1AM4D 4E5UA 4QOEA 2V54A 4UEWA 3VBCA 1XZGA 2M2IA 2ERXA 1KK2A 3HZOA 1NNEA 4S3MA 3LA8A 1BKYA 3GCZA 1T36B 4YT8A 5THQA 1R18A 4HQOA 2PKWA 3KYJB 1L3BA 3DEZA 1N5JA 5FOQA 3MA0A 4ZOLF 1QJ4A 4M54A 1T5TA 3GMSA 2X8WA 2ZVJA 3I9MA 2ZFUA 1YQQA 1IOZA 3PFGA 4ZI7A 1JXQA 5BR8B 3VISA 3L0ZA 3EZNA 4RELA 1AZWA 1QWOA 3L6UA 4WE3A 1G8KA 2IU4A 2Q50A 3GELA 3JYNA 4MJ3A 3GPDG 2VBCA 4FQ5A 1IQ0A 2QMQA 4HN4B 1GQ2A 1JYSA 5FWYA 1SH7A 1LLUA 5JVDB 3L0YA 3PFIA 4B7CA 4MPDA 5LQKA 5D5PA 1CCWA 3WA7A 1IFXA 1GGKA 4CHGA 5LSAA 3OQPA 1PR6A 1U7TA 1Z2PX 3PV0A 3WIDA 5JI2E 1MO3A 4D9GA 2BGWA 2PRJA 5JFOA 3P0IA 1NU6A 1R00A 1R4NA 4IXWA 4TTPA 4CMKA 4L28A 2PL9A 4IMPA 1JFRA 3AWIA 3L7CA 4PFJA 4CR6A 1LK7A 1V43A 1U3DA 3BL5A 1N7HA 4MQLA 3W77A 5L7YA 1EUQA 3EXHB 1FYXA 3A1WA 4CLHA 1V7ZA 2YRWA 4R6WA 2PNJA 3THYA 2BTEA 3R9XA 1VJ5A 2QN6A 2E55A 1DC4A 2D0IA 2RHCA 3HUFA 3DQQA 4E07A 4MARA 3FD8A 4K03A 4Q24A 4MTCA 1DAIA 4MVJG 1NN0A 2X5JO 3GD5A 4FLFA 4HAUA 2AJ8A 1O9HA 1I10A 3QX8A 1B93A 3O95A 2YN0A 5FV7A 1F0KA 4A03A 1NQUA 4R2JA 3L1IA 2PL1A 4Q4AA 3VO8A 4FKZA 4OQZA 1JILA 4EB0A 5FXMA 1A5ZA 4IUDS 2QTTA 3VZCA 1VE9A 3K53A 4N47A 1Y3AA 1H2BA 3ZTWA 5EGNA 1X1QA 4F60A 2BFWA 2E21A 4DV3B 3C1AA 1XRQA 4FHCA 4TPKA 1DJLA 3LT1A 1WB6A 2O48X 3BCSA 3EBOA 2CHFA 4U9HS 5D85A 4CIBA 1WZNA 1T29A 2ECOA 2X19A 4RFVA 4D81A 4MP3A 4WNCA 1L4EA 3QJYA 3DZFA 4OGWA 5LQMA 1YVPA 2V6BA 3LQ1A 2JIBA 2X2EA 3C1TA 2QQFA 4IF6A 2W7TA 2OGZA 4QECA 4O4LA 2Q6KA 4RANA 1XU9A 5E95A 3S1LA 3FDZA 4RS3A 4OFBA 3LIPA 4X5OA 1IB0A 5JCPA 1UXKA 4LTDA 1PZXA 1WDMA 1JU4A 2AV6A 3SYNA 5F23A 5EIBD 2RGBA 2IS2A 1Q57A 5EZQA 1MMFB 2WT9A 1JN0A 5A7GA 1YL7A 3WOVA 1QG2A 5KPJA 1E3LA 2GYVA 3SQNA 1VG9B 1QG0A 2FN9A 2AR0A 1BE0A 4GU5A 3D8SA 2G9UA 2PS3A 1IIBA 2YICA 3PGA1 3R7SA 3SCZA 1NI3A 1BDMA 4EF6A 1XTQA 2OUIA 3MF4A 4IHKA 1G19A 4P7GA 3KBOA 4WESA 4ZRMA 3ROZA 3RWMB 4MRVA 4WFJA 3DTTA 4X3PA 1Z0ZA 3PGLA 2Q9AA 4NV1A 1P9OA 1BOFA 1XQWA 4TSKA 1KZHA 1QPZA 4J7CA 2PGDA 4ISCA 8GPBA 1HFKA 3TN7A 4PPQA 3N76A 1EFUA 2CXNA 2VAVA 4MWTA 4TKUA 4B48A 3P32A 5DNCA 1PEAA 4KO2S 1EWTA 2VWHA 3E5RA 4IOKA 4AY5A 1WXFA 3HU2A 4IH4A 4JR1A 4KODA 1CHDA 3WLSA 4FU0A 4C03A 1Y1TA 3ZCUA 1E64A 1NM5A 1VM6A 3Q85A 4MQBA 3W8DA 1GLGA 1V37A 5PNTA 3GJ6A 2NYAA 3MWLA 3WDLA 7AT1A 1Z6QA 5H5JA 1IVNA 5LXTF 1RHUA 2G1JA 4X97A 3GAFA 3BDAA 3EQ8A 3MJDA 3RSOA 3TEMA 1F38A 2AG8A 1T91A 3JQ7A 1C1YA 1C7EA 2CMFA 1JHAA 1NBIA 1OU4A 2WD9A 3E9CA 4M0FA 1W46A 3QVJA 1FL9A 4MCHA 4NESA 4G56A 4E5DA 4LGMA 3T7RA 2QZSA 1T4CA 1Y8RA 2CUKA 2FXIA 4QXMA 3UAXA 1NP3A 3HYTA 2H9IA 3T6KA 3U9SA 1SO8A 3AR8A 3P7MA 1QS0A 3IPYA 3QEAZ 3QBTA 4KV7A 3RI3A 3O3MB 4CT0A 4ENWA 3R7NA 1UJ2A 3WMXA 4OQMA 2OLJA 4BFYA 4OGGA 1FY2A 2B83A 2CZCA 3TM5A 3A1CA 5DYIA 4IZ6A 3C7AA 3M6WA 3UKOA 2C5EA 4BFLA 3P1JA 4CQJA 4F96A 5TRTA 2IXGA 2DUJA 2ODQA 4TRMA 4D9KA 5GZ1A 1QBKC 3L4KA 4BQRA 3KL4A 4DN6A 2XBMA 1TM5E 3Q4GA 1IM5A 2CWDA 2VHYA 2VUIB 2W98A 3PSAA 4P8RA 2QVCA 4B2YA 5JD6A 2QTAA 4W82A 5HX7A 4DEXA 4JX9A 4F4UA 3KHSA 1FXSA 2I8LA 4P3YA 4YGYA 3M1AA 1W5TA 4YCMA 1GKYA 3D31A 5CT8A 3CV3A 1BE6A 4ZAWA 1DMRA 3A9WA 4XLZA 3H16A 1BU5A 2WWRA 2OZPA 2Z98A 4FKBA 5EL0A 5AVKA 1EZZA 2ANBA 1WUHS 4I55A 4OHCA 5AI9A 3R76A 3THOA 3O8CA 1NSTA 3H7IA 4YONB 3GJSA 5AM5A 3HJHA 4P7BA 2QLNA 4PZLA 1GPH1 1R0CA 3QPVA 1KJWA 1H5UA 1CW2B 3SZMA 4I36A 1PWHA 1UKEA 4ZMRA 4R9SA 1FQKA 3QKWA 4TT3A 3C6BA 5JAMA 5JV5A 4C0BA 5B1DA 1MVLA 2F48A 2PA0A 2OBLA 5FBZA 4KNVA 4LNUB 1Y3IA 5M34A 3GRUA 4LISA 3CH7A 2QUZA 4RKRA 1DELA 2O7SA 3I53A 5DNVA 3ZJTA 2G9ZA 3ZGNA 2BEWA 3DZBA 2Z5LA 3FR8A 2GM3A 3B13B 1XLWA 4Y0VA 5P8WA 2M6RA 4KIUA 4MHSA 1UEIA 3ZHXA 4EAAA 1JAZA 2XT6A 4KR0A 1YR9A 1ZQ1A 1EX7A 4PXAA 2OYRA 3RASA 3RVOA 4TZKA 1P2GA 4ZAZA 1X74A 1Z2EA 3AR4A 4MW7A 4OL9A 2J3KA 3MUEA 1P1JA 1X80B 3VFDA 1ZI6A 2NZ2A 1V3VA 4ENVA 4ZFNA 2K4MA 3QMVA 4J91A 3ZV7A 1XMVA 2Z8ZA 1U1CA 3DPIA 3R7WA 5FHQA 4YJ2B 1KJZA 1IJBA 1YRLA 1CT9A 2ATXA 2OE2A 1NI5A 3EVDA 3R09A 5HILA 5IS2A 5T8KA 3I1JA 1P7WA 4E15A 3DEFA 1A3CA 4N82A 5KYXB 5F3WB 5LP6C 2UUBB 2VPTA 2ZR0A 1XRLA 2RG1A 3BE8A 1UQRA 2Z5FA 1E2HA 1V8FA 1CQIB 4MV1A 2FVYA 3G59A 1JDUA 1DBSA 3WBFA 1NE7A 4FFRA 2P0YA 4B6GA 3KVRA 4LX8A 4DHEA 3HN7A 3ITDA 4C6RA 1FW8A 5BT8A 5I7SA 2CKMA 3NT2A 1F4LA 1SUSA 4XLTA 2WA1A 4FBGA 2QT1A 2VQSA 5KNCH 4OHYA 2IXBA 4MRMA 3TMYA 4LQCA 4O2RA 4UNQA 2ZIWB 4K9SA 2H9YA 1U2DC 1JH9A 1J49A 5BNZA 3QVVA 3FETA 1GGHA 5E7JA 6YASA 1E1LA 3TQQA 1E7SA 3JZDA 4CM8A 4EVSA 4FOTA 3AVTA 4NP6A 1U0OC 3DLHA 1E60A 1U1FA 4RFSB 2IBSA 2D5IA 4Z6KA 5I9SA 5IT0A 1KGDA 3KAQA 4JAVC 4W7IA 1GPMA 5LQSA 1NPYA 1KJNA 4RF5A 1RJWA 3LVRE 1P60A 3ZEAA 3E1KA 1U2GC 1DE0A 1O6BA 2PN1A 3WG9A 4EEXA 1U7DA 4LWQA 4BAGA 2O8FB 3NUZA 1OFGA 2W4IA 3CH4B 3CUEF 4HNHA 1JALA 5FOTA 5CG1A 4EYQA 3L4JA 3ODPA 1UBRS 2NP7A 3LVBA 1CQJB 3U6BA 3ADDA 2JI8A 3ROKA 3KYCB 3W2HA 1MDBA 2QI9F 3LX8A 5E1BA 3ST7A 1N57A 1Y7LA 4F6RB 1T9GR 3AF2A 4I50A 4LGCA 5H1YA 2P6OA 7ABPA 5F3DA 3TZCA 2QRUA 1N6RA 2ZBQA 4X3OA 1FFBA 1R4MB 1Y98A 4K7JA 2ZRGA 2BFOA 3CWZA 4TTSA 3RRJA 4YMHA 2I34A 3RAFC 1UM9B 4ZDWA 4D9JA 4E1VA 1N34B 2D2FA 1PUXA 3CWQA 4LZZA 1YKSA 5DM1A 3BXZA 3R5JA 4P35A 2O4UX 3UENA 3KWLA 1JE1A 2F1IA 5EZYA 5K5EA 1MOQA 2VZEA 4QARA 4CFSA 2DR0A 4EGAA 4RK1A 3PJRA 3FCOA 3BFKA 3H8JA 2YXDA 3DOCA 4YO7A 3F2IA 5CD1A 4L27A 3LPAA 1TK3A 4N18A 3QU2A 1ISPA 3L4SO 3FLBA 3AM4A 4C3VA 1TT5B 1EZ1A 1M0SA 3OT4A 2OENG 2P90A 2FPXA 4BJHB 2Z6QA 1VG0B 4K6MA 4QVKA 2KHZA 3FIUA 2NPOA 3HCDA 3SYKA 4K1LA 1CZOA 5BOSB 4B85A 2EZTA 1GQFA 4Q4DA 3VDRA 1I4TD 4L08A 3WGYA 5TJ9A 2XUQA 4CF5A 2BEVA 2NZJA 3UMMA 3MEQA 1J5EB 4DG8A 5TMDA 2BM0A 1R6XA 4UU0A 4MRAA 1WS6A 2O8NA 2JFVA 3DVAB 4X1YB 5G2OA 3D6VA 3IHKA 4CV3A 3LCJA 4RAQA 5IHXA 4GSLA 1PHPA 1M34E 1LLFA 2G0AA 4OUDA 4TX1A 5CLHA 3H87A 2C3UA 1YJ5A 5FLYA 4LHSA 3M4NA 4Z4GA 5H80A 1R37A 1CY8A 1UKZA 2XLCA 1Y6FA 3ETLA 1K6XA 4F6LA 1ZUHA 3B2NA 1OAOA 4QBTA 4LYDA 4ZCSA 2OZEA 4V38A 3OBBA 2C9OA 3R8CA 3RUIA 1BTOA 1TEZA 3EZFA 1ZJWA 1F6WA 5FDFA 3DE0X 2RGCA 1LNQA 1W0KA 1FDIA 4PNEA 2BY4A 5AW3A 3TQOA 1AKEA 2DYKA 2WD7A 3SYRA 1K6JA 4QBIA 3Q0EA 5JG7A 2B8TA 2AYXA 3ZIUA 2BONA 2E1RA 3VTZA 4BWGA 4LK2A 1LBHA 3I6QA 3QUCA 4JU9A 4OHVA 5H83A 4JV5B 4L16A 4DT1A 1Q77A 4QPPA 3M1LA 3TLXA 3KQKA 2XVAA 3KEMA 3QWBA 1IZ7A 2FYTA 1JHOA 3HQ4O 2P2CA 4Q4LA 4XSGA 4YALA 1E2JA 1T8WA 4KSCA 1X2EA 1EJ6A 2XTZA 3MWGA 5AESA 4Y2SA 1UADA 4B4OA 1CBUA 4KMMA 1V7QA 4QL3A 4ZO7A 2TSYB 5F78A 3FSRA 5JSHA 1JEDA 5JZMA 4ZVSA 2IS4A 2V7QA 1XA3A 3CX3A 1J22A 3ER6A 3W5CA 1PR3A 2WYVA 4IS3A 4P4SB 5H02A 2NTJA 2PU7A 4XGQA 3NM4A 3HMKA 4JBHA 4BO6A 1Z56C 1HTWA 2RGEA 5GTDA 5L4SA 3A9CA 1UBTS 2CFTA 2XF8A 4MUJA 3DVRX 2FZLA 1XK6A 1RWVA 2W00A 3G88A 5CH5A 3OPVA 5FUBA 5DOZA 1SXJE 1C9MA 1G7TA 3NOOA 1N0VC 2P77A 3JQQA 4G84A 3H2BA 4IXTA 4K05A 4JT8A 4TYPA 4YTEA 2YN4A 1OIVA 5GONF 3VH1A 5EG5A 1AKQA 2ZWVA 2CDCA 3NASA 3JQGB 1NURA 1XQ9A 4HWPA 3VSCA 3MCZA 1C4XA 3BWCA 4DUYB 5G3YA 1P0FA 2ZUVA 4H7KA 3OEED 3LDUA 3R0IA 4HLQB 4AUNA 4F2WA 5FYDA 5JU6A 4Z4IA 3ABZA 3B3AA 3CX4A 4FNGA 1D09A 3DQZA 4IKPA 3T4PA 2CSXA 2GCGA 3HJFA 5IN5A 4CIXA 3TNFA 2NO1A 3E7FA 3OU7A 2V7XA 4GYJA 5HTOA 1ZWKA 3QPAA 4OP2A 4GKAA 5HJ5A 4LI0A 5EZSA 3JAWA 3T5MA 4JXZA 2AN4A 2CBGA 4E08A 3K6SB 2W6IA 3FF1A 3ULKA 1YIDA 1BN6A 1QBGA 2WU4A 3IUYA 4AJJA 1CRWG 3KO8A 1IHPA 2AHOA 2BF7A 3HWRA 4YRRA 4AUMA 5KYWA 4ZI2A 1DHTA 3AI1A 3OQVA 4RENA 1QG6A 5KQPA 3BFPA 4ND8A 1MO6A 1ICEA 4R31A 3VZPA 1BD4A 2JI6A 5ITWA 4DMRA 5D00A 2FFBA 2CK3A 1SHZA 4AL4A 2PMDA 1HLDA 2H5JA 4B71A 3CVYA 1JWLA 2OESA 2XLBA 2V03A 5J5VA 4JI8B 1V7PC 2YHAA 3K6RA 3AQIA 1BS1A 1MA3A 4LYFA 2AJDA 2IEBA 1OA0A 3GDGA 3ZU2A 1IDN1 2EQ5A 3A4TA 1AUPA 5ITSA 1PX0A 2ONZA 1SVLA 3CNOA 3AHCA 3GEIA 1GZ5A 4KE8A 5EP3A 1Q84A 5JJ5A 1E0SA 1UP6A 5BSUA 2J7KA 1QQTA 2CFCA 3AOEC 5GJCA 2Y6VA 3PWSA 1FSFA 3IAFA 3LOQA 2JVIA 4CMEA 2XCUA 3OWOA 4H1WA 4Q1EA 5AW8A 2FQWA 3MTBA 3DZCA 3OWXA 2YJ4A 2NTEA 5EVJA 1IN1A 1E3WB 1GPYA 2B3TA 1ZK2A 2PBZA 3UXMA 5GM1A 1T9HA 5F5LA 4Q6WA 1TU4A 4WJZA 1W85B 4MQMA 4ND7A 5CT5A 3VPXA 1GFWA 4NKRA 1N7GA 2PH3A 2ODNA 1BFUA 4I1YA 2HA2A 3QELB 1D6NA 3UKDA 5KOJA 1PTKA 4HWTA 4U7TB 4JJKA 5KNCA 2OOKA 5AW1A 2VTVA 2XDAA 1HUQA 4UHDA 3FUVA 4XFDA 5LLSA 3AHFA 2Q9CA 4JSYA 4LXTA 4EY8A 1T9CA 2JLAA 3AP3A 3LU1A 4Z9FA 1N5DA 1TQ8A 2G5TA 3H6HA 3PHBE 5JNTA 2HN9A 3S2ZA 2FPGA 2OYCA 3QE4A 4C5AA 4ZVQA 3GJQA 4R8KA 1C30A 1NV9A 4ESEA 1CDOA 1OBHA 3NB0A 4IIBA 3WYNA 3DLIA 1H4VB 3IKVA 2BGGA 1O97D 2WYIA 4F45A 1MCZA 3AY6A 4UUQA 5HQTA 4LTNA 1PLJA 3CMCO 3OM9A 4GGPA 1P0QA 3ZX5A 3RU2A 2ZYAA 3HEAA 4G23A 1YRWA 3CW9A 3ZCTA 3FOCA 1W36D 3DVLA 2I1QA 2BEJA 1RHMA 5K0TA 2GBFA 3V4LA 3W0LB 1OBOA 4AJOA 1U80A 1YV9A 4BMSA 3RC8A 4OXYA 5J2TA 1GYQA 1Z74A 1AHHA 4MV3A 1AC5A 2DPGA 3AONB 1E20A 1QHHA 2WFMA 1X2BA 3A3KA 1Z3IX 3FGPA 4JBXA 5ADHA 2FKAA 4DPKA 1R6UA 1T25A 1M54A 3LYLA 3W34A 4LXQA 3QKRB 4I3GA 3NZEA 4UUAA 3SE7A 5EHXA 3MXOA 2Q4OA 4C20A 2A6PA 3BVPA 4ROTA 2Q7OE 1B43A 1RQXA 3QP9A 2NUAA 3L6DA 1YVEI 3T5BA 2FPLA 1MLDA 1PW7A 1BA2A 1PDOA 5COBA 3GGJA 3BBPA 3RVSA 2KWIA 1LPAB 1A5BB 1WBJB 2XRMA 4QOHA 4AD8A 2MSNA 3C6QA 3HACA 3L0IB 1A7UA 3JTEA 2BLNA 2B1JA 4CGYA 3PX7A 5EUQB 3O38A 2D2VA 5EQTA 3ZUPA 1NJ6A 2QN8A 4LZWA 2G17A 4KQ1A 1ZVKA 2GILA 4U7WA 1XEXA 4M2LA 5J9FA 1U0RA 4Z4EA 3PZRA 4H1VA 1AKUA 2NU7B 4JUFA 1AUVA 1MH1A 2O20A 4FQ8A 4YVFA 3TSCA 4CV1A 4ER7A 1ZHHA 3OJEA 3LRPA 1N5RA 3EASA 3M2PA 3P2YA 4Y2VA 1IZ0A 5BV8A 4HLDA 1DFGA 3DC2A 4KLNA 4QHSA 3U81A 4RORA 3P2OA 1IHYA 4Y7DA 4XM1A 3RFXA 2CMHA 1IQRA 2J7PA 4XW2A 3KBBA 3W6OA 3I2KA 5M2QA 1AHPA 4WEOA 4UULA 2CHGA 4N0EA 4U6QA 1BRMA 1J2JA 1EE1A 3I1IA 1EP9A 3NBXX 3QTTA 1B26A 1G6OA 1R6TA 2VYVD 3GI1A 1EGMB 3K3PA 3O3OB 1KF0A 4ARSA 1EDBA 3AVQA 4BIIA 1D9ZA 5EXDA 1UDAA 2D5LA 4K26A 5ER6A 4DMKA 1PAUA 2RH4A 2ZI7A 3M4JA 1NRJB 2QXYA 4HYTA 4UTZA 2WF6A 1Z0FA 4MMZB 3L8FA 1TJYA 4BAUA 2NU9B 1AKMA 4UDNA 1EUDA 4DVJA 2Q5EA 4MV9A 2OO7A 4AUKA 3ZXSA 3THXA 5JRZA 1NVAA 1KYZA 4YP1A 3D81A 2VYQA 5DCUA 4B2IA 1E1DA 2ZRPA 4OB7A 4Y2JA 3V8NA 3ZD6A 1SUIA 2J45A 4IEIA 1PK9A 3HR8A 2YYAA 3UYLA 4PM4A 5BOVA 1MB9A 1RPNA 4IYRA 3PHCA 3FTFA 1K66A 4FI3C 3TQSA 4JEUA 3GLFA 1RWXA 1RYNA 3M9XA 1D8TA 3IIIA 3NBUA 3TBFA 1E2DA 5KJ6A 3H1BA 2WHQA 3BIJA 5CFRA 2ZAIA 5KS2A 4EPVA 1N33B 2I6FA 4TMWA 1GNVA 3COZA 3I23A 5JHGB 4G6ZA 3LP8A 5CFOA 2XWBF 1BN7A 1VL1A 1FW6A 2P2ZA 2PEZA 2VJYA 3R3ZA 4H18A 4IFIA 3RBXA 5BRNA 4R8VA 3V1MA 3M49A 5AVXA 1IG0A 2LE0A 2FG7C 4UCXA 1UDXA 4PYLA 3ZWAA 1P17A 2PMFA 2HJVA 3I9FA 2VFAA 4GOOD 4OO3A 3RUAA 3X2FA 2HQSA 2WJIA 2C3MA 3Q3HA 5F7JA 2GNAA 5KWVA 5GP1A 2B20A 3U44A 3FYHA 2HWWA 4DLYA 2I3ZA 2KPOA 3JQAB 3LBIA 4X6XA 4BGUA 6REQB 1GGNA 1J23A 3GR6A 1JMYA 3THRA 2XYHA 5CAEA 1MABA 1RRKA 2QTVA 3DXXA 2QPOA 2B4KA 2RI6A 4PEVA 2CHEA 1KJIA 4QEZA 2Z04A 1IOLA 5HFJA 3WLAA 1MO4A 1D2RA 3IVXA 4E94A 5EUBA 5IAOA 1QZXA 3WAGA 4AMGA 4DDTA 2V98A 4WDRA 5K8VA 3QVSA 5IZCA 4EOGA 3K30A 3FIJA 3OY7A 2O2XA 1GQSA 2E5WA 3C7TA 3BGVA 3IR5A 3S81A 2VR1A 3DNPA 1OLOA 4QFMA 4BNUA 2VSXA 1R6DA 3WLFA 1EVQA 3HDYA 821PA 5M3BA 1NJ8A 4UZFA 3WO0A 1TAQA 4G37A 3NBZC 2F64A 4WWHA 4UNPA 4NYMR 3O6VA 1K9SA 4MRSA 2TS1A 1BH6A 1Z6XA 1G8HA 3AH8A 2F4NA 1V3QE 3RIHA 1JTFA 4HQ0A 1R9JA 1ODLA 2HBQA 3F8WA 4JGIA 4K8OA 5H3HA 5MGNA 5JE8A 3IDQA 5J59A 3GWZA 2ZROA 4DGQA 4CUZA 1SUBA 2GXQA 4RX1A 4HF7A 4G1VA 3BIXA 3LAWA 3BMOA 4M8LA 4MLPA 1UBFA 1SRRA 3NHMA 3FWPA 1M1UA 4H16A 3T9FA 1IHDA 1HZZA 4OK6A 1ISJA 3BE6A 5JMPA 1XMJA 5BWMA 1XNJA 3W6ZA 5AUOB 3B1JA 1A8PA 1Y6ZA 1ANKA 3DONA 2AUTA 3E05A 4KH1A 2VQEB 3LSTA 2IYAA 1U1IA 3EFEA 5JJKA 4KVGA 1DV1A 1DUVG 1H1LB 2I1VB 1BMTA 3DTYA 4FYHA 2O52A 4ZALA 1OX6A 3LUFA 3TCNA 2VQ3A 4OA5A 3BCUA 3ZU5A 4C14A 2I6UA 2IEAA 2GF9A 2G08A 2H16A 3N8KA 1MPTA 3AESA 1A95A 1OW3B 1MX1A 1WY5A 2HQOA 1SUFA 2P9BA 4OF4A 1C8LA 3IDSA 3R7DA 3EPHA 1BDBA 4C08A 2H7VA 3LGSA 1UKCA 4L9AA 2QN2A 3A11A 1L3CA 1SBQA 3SR4A 1UBGA 4F5WA 4A2QA 4YRQA 4D8YA 2IPAB 1NASA 3RJ9A 1JLHA 2Y67A 3NWOA 3DMTA 4GBJA 4KWTA 1I6KA 2BZGA 3BE5A 4D0LB 2IQIA 2BGIA 3KV1A 4CL3A 4IIEA 1QSGA 1Q91A 3LCRA 3AR2A 3TRJA 3G9QA 2XXJA 3IV6A 2JHPA 4R8SA 2EP7A 4GZ3A 5BQFA 1E69A 4Q1BA 1XJCA 1PVOA 2VDQB 5TQJA 1X1DA 1H65A 4O2BF 2OCDA 3WK4A 4FC6A 2NTYC 3G2QA 4MWZA 1L4GA 1BVYF 2HA5A 2M1ZA 2PEYA 1FDOA 3PT5A 1KJYA 1ZM9A 2PX5A 3VKUA 3LCVB 4S0XA 3DV2A 4FUQA 3R3XA 4AS3A 5TQ0B 3RYFB 2JKVA 1PR5A 1VKZA 2C7VA 1A9PA 1Q7GA 1TADA 1N3LA 1YGYA 2AXQA 2JGEA 2YZ2A 3RUDA 5A2GA 5LP1A 4EHAA 3ER8A 1SEVA 3ZWWA 2PU5A 3ZZ1A 1P4AA 3OJFA 3D0KA 2OAQ1 1WIWA 3VA7A 1KDPA 1ODKA 1SHTX 3NS7A 4PLHA 1GTVA 2ZZKA 3AEXA 3EZ9A 4PG4A 3SSMA 3RVKA 2XE7A 4L73A 4M9SA 3OIWA 3NUGA 2ZR9A 1ID8A 3HYLA 2P1ZA 3FCEA 3AF5A 4GR9A 5ECGC 1AG9A 2VRWA 4JJ6A 4UD6A 2KS6A 4Y7CA 3T9DA 4BFUA 3D2BA 2WA2A 5DBFA 3ZD9A 2W2LD 5FWXB 3UK7A 5B6JA 4W5HA 3GJRA 3RHSA 1PKEA 2NO0A 2ZRJA 2DP4E 5AM0A 4X9XA 4JP5A 4XGKA 5DN9A 3MCWA 5SY4A 1VHDA 2Z5VA 4RKWA 4LF5B 3L46A 1X1CA 3H1FA 3O26A 1QYXA 5I8WA 5CYFA 3K70C 1C8KA 1P0CA 1VIVA 2JGLA 5ALMA 1Z38A 1FFEA 3L6CA 3V1YA 3DE6X 3WMWA 3WKEA 4AU1A 1WCWA 5I7RA 1XVVA 3N53A 2QUBA 1RJFA 2GOYA 5FI3A 2P9QA 3CX7A 2DLNA 2Y1WA 5E0KB 3K73O 3OOSA 3R0ZA 1E7MA 2WU1A 3KOZA 3KZCA 3LF1A 3PC4A 1B7GO 5ULLA 5C5CA 2YZKA 4R7ZA 1FMJA 3CVWA 2JLUA 3V9AA 2MSKA 4CV0A 3UBMA 4NENB 2D2EA 2WUVA 4PTZA 3NHUA 3RQSA 2V1XA 1W88B 3DXFA 1J8MF 3GEDA 3HBMA 3KR0A 3OX2A 4N0PA 4B3MB 1LS6A 3DQPA 1IH8A 4MLZA 1T5DX 2QRKA 1E6EA 4G5FA 1T3SA 1LDYA 1UK9A 2DFLA 4TTAA 4YT2A 4MZXA 2GPYA 4J0QA 4N6NA 4BVBA 3R1IA 1E0KA 2R1ZA 1YE3A 3NJ8A 3RSZA 3RVNA 5L45A 5KWEA 3E22A 4B0PA 2G4CA 1NJ1A 3BK2A 3KQSA 3Q3VA 4OPMA 5BSWA 2YCLA 2D13A 4GD3Q 4KKXB 4PE5B 2CF5A 4QVIA 4BJ5A 4AKHA 2G6BA 5CURA 3CVXA 3IIEA 1M1ZA 2Z3ZA 3WHIA 4ATNA 1CZLA 3WKAA 2PWAA 5JBIA 4E5NA 1T9DA 1Y5LA 4OGLA 5JXHA 3VHLB 5KAPA 3WQRA 1QGUB 2VZ9A 1JSZA 4JI1B 2WWVD 3DDZX 4U00A 4WUVA 3KXPA 3K1JA 4WINA 5GPBA 3ZW8A 2I5PO 3A26A 3EIOA 1Z2OX 4N49A 1TKRA 1J2RA 1E3DA 3MWFA 3ZZ0A 2X4LA 5I5GA 1QKKA 2A8YA 1X7GA 4YJFB 4BKUA 1E3MA 3CJRA 4C7MA 1A2BA 2OCPA 4E14A 2F90A 5AP9A 2F8TA 1E63A 3MNFA 4ZVPA 3GLHA 1ZS9A 4OQLA 1EFLA 4JJ8A 1W1WA 3N87A 3S2YA 4F3RA 1PT5A 3WI7A 4X24A 1A50B 3GLGE 1P4RA 2ZSAA 1S8OA 2Q3BA 3WWCA 2J30A 4CKCB 1T0PA 4I1UA 2OFWA 3GLRA 4WAUA 2JLBA 5HPYB 3IBTA 4C7VA 3TQRA 4CF7A 1JEYA 1F0PA 1G5IA 4Y1EA 1TD1A 2QG4A 4MQUA 3QFHA 1Y89A 4LSMA 4ZCIA 3BHNA 3HA2A 1EJBA 2SKCA 5BSMA 1TM2A 3KJEA 4DLSA 5KPDA 4GO1A 1KQPA 3L4BA 1X7XA 4XOUA 3SFZA 4CG0A 4CM9A 1ORIA 3FZEA 3Q3GE 3EG5A 5A1JA 1VI5A 1NQ5A 2HRZA 5HP4A 1CE8B 5LIRA 2HKIA 1A9YA 2OXEA 2C8KA 3AI3A 1MN6A 5DWDA 4GPD1 2PG3A 1JXMA 2VXOA 2D62A 1QF7A 1SG9A 4G0UA 5ANRB 2BM8A 3UMFA 1NWHA 3AUFA 1VE5A 4HQ6A 3SS8A 1L7PA 4JI3B 1Z7WA 4FCTA 3KKZA 2A14A 4QGHA 3IP7A 3H5OA 4GMHA 5LYYA 4XQ9A 4DQXA 1NQXA 3K0CA 1WY7A 4YROA 3SX0A 1PEKE 1M7HA 1KH3A 4UOQA 4X20B 1M5RA 3NWBA 3CEHA 4BQEA 4L0CA 1F8FA 2BKVA 2EGGA 1NC1A 1XK7A 5KSZA 3E35A 4RL6A 5DJ5A 5K3BA 2Z2YA 1M34B 3T3PB 5C37A 5KIAA 2V3CC 2XNKA 1XX6A 3G82C 4FFLA 3M1IA 3GFBA 3PXCX 2FSHA 4WZBA 1VMIA 4LJAA 4YJHB 5B7QA 5KYTA 1HLFA 4AT1A 4PR3A 4YUXA 1NVFA 4P5EA 2PY6A 5AHXA 5J23A 2DUWA 5JWHA 5HKBA 1J06A 4MVJP 3TFQA 5LP6F 2QGNA 2DRIA 1NNSA 1FRNA 2CN1A 5CXXA 3UMSA 3MWJA 1SKQA 2ZTVA 1WUJS 4HN9A 3PKJA 3MTIA 1SKAA 4YLGA 1JIVA 4DCJA 1QO7A 1DZ3A 1X1AA 1WDKA 2SBTA 3K09C 1LPOA 3EDQA 3A32A 2HJHA 1RM4A 1T35A 1BEUB 1Z8FA 2ABWA 2F3PA 1I24A 3JARB 4KQFA 2Q1WA 2IITA 2ZYHA 3BSFA 3WHPA 5HKOA 4MUFA 1TPZA 3RAJA 4H3VA 1N2EA 3SD7A 2WFAA 3RS9A 1P4JA 3BFVA 3PHJA 4IEEA 4LV5B 4QNRA 3CKLA 3RT9A 1UKVY 4ZU1X 3OZ7A 4F7WA 4HXYA 4IFEA 4XTRA 1ZWLA 4R1PA 1OFTA 5A4JA 1SZJG 5FV4A 1TJ4A 3RT7A 1C1XA 4L4RA 4CKEA 4CG2A 1HMYA 4C6TA 2HFJA 2OLKA 3TUJC 2EKLA 1LB1B 1WEKA 2R8XA 3AF6A 4CETA 1R8YA 1K06A 1ZMBA 4GLFA 4V1CB 1H2HA 1NI4B 1YDWA 2R5WA 1V8PA 2XUDA 4G9EA 4LXUA 3R75A 5IVKA 1DOZA 1LI5A 4CTMA 1MGPA 1PWYE 2YHIB 3P2JA 3KTAB 1GIAA 4M86A 1BYIA 4WN3A 4JXKA 4MB2A 4CLOA 1B15A 3EMVA 3BQMB 4O5OA 2EFEB 1SXJB 1Z13A 2UUOA 1F3LA 2W6ZA 3W5DA 1DKUA 1EFVB 3SHOA 2PPLA 2V1UA 1ULSA 3EDMA 5TS2A 1ADGA 1JJ7A 3I5UA 1YQWA 2V97A 4JFAA 1R0LA 1QWSA 4XM2A 3T8YA 2AXPA 2JG3A 1CJTC 3UMYA 3CNHA 5B64A 1R0YA 2FF5A 3QX3A 1JJAA 2Q4DA 1KFCB 4FOPA 4GMKA 5DTQA 3ZHUA 4ESOA 3FWYA 4F38A 1YRHA 1RJEA 3AUJB 5LNK1 2BFPA 4BLRA 2ZI5A 3BB3A 3TLZA 3WJ1A 1RI3A 1O96B 2G76A 4K8RB 3ZDDA 4G5QA 4MQ6A 3HI4A 3IMCA 1AUQA 1GKUB 1QFJA 2WYHA 4H0NA 4AIIA 2Q9UA 2GCIA 2IELA 3QLTA 4I1IA 1OVMA 4IXMA 4BEVA 1RYYA 4CEJB 1MIOB 1JFVA 3C87A 1DG9A 3DO8A 4DR2B 1JMKC 4U7JA 4F0JA 4PZAA 2WB4A 1RW4A 1T13A 2PGJA 2ZI9A 2J9FB 1I5OA 1WX1A 3E48A 3N9IA 2Y68A 3OZEA 1P5JA 1XEWY 4M7WA 1B0UA 1QRRA 3K7EA 3MK31 3ONFA 4FS8A 3TDKA 4AX4A 3ZQ6A 3D3JA 1XD2B 4K40A 1Y80A 3FRHA 3HXPA 4DQVA 3UOAB 3PQCA 4YWJA 4O2BB 2X6QA 3IPCA 4Y2HA 3KAPA 5E1DA 4XGNA 1LY1A 1Z6ZA 2UAGA 5LKRA 3PJFA 4BGIA 1H2XA 1R8QA 4NQRA 1DTSA 2FPSA 1C81A 2D2XA 2GAJA 2H1RA 2OHHA 2ALJA 1AMOA 1A96A 3RS2A 4GI7A 1N6PA 3M3PA 2YFHA 2P6UA 1YDGA 2XMSA 1OYOA 3B7PA 4QPZA 1BEZA 2G25A 2XA1A 5ARDA 3V1UA 4PGMA 2V7VA 4QO7A 1Y7TA 4LYGA 3ZHOA 1CRPA 3Q3JB 3L6OO 4CQMD 4KMSA 3GJZA 5B12A 4KRGA 4PLVA 4FCCA 3SY8A 3HK2A 1VHJA 1X7WB 2RFLA 4E2WA 1Y82A 2L18A 1RR6A 3S29A 3QENA 3NHPA 1DQZA 2JFNA 1RS0A 3BA6A 4KI7A 1USWA 4Q3EA 2RK4A 4RMJA 1Z63A 4C6SA 5CW2A 1KAMA 3MRTA 1ZKMA 2NM0A 2QVXX 4N8EA 5DN6A 2WM8A 4KVAA 4UM7A 4C2AA 4ZZ2A 1EQAA 4Y6QA 1JLLB 3F9RA 1E9FA 2WAMA 5CMLA 5AKXA 1BKSB 4L2IB 1PLLA 1ECLA 1VKRA 4N4AA 3IA7A 2J3DA 2CVFA 4HG2A 1GZDA 2YZNA 3RVLA 2HJ9A 3P2KA 3IIKA 4KLRA 3VZQA 2HXGA 3VJLA 4BKMA 4AC9A 4B4KA 3G1WA 1KQFA 1QKJA 2LIPA 1UK8A 4FPXA 3S4YA 1JG7A 5BURA 2GZRA 4PHTA 3O3NB 4ZANA 3PUJA 3WK9A 4AZVA 5J58A 1JJIA 2KE5A 2X2PA 1OBCA 4DV0B 3G8YA 3CRW1 1KZ9A 4J4TA 5EPUA 4BBZA 1D2NA 1L4BA 2QROA 2R60A 2ZR8A 2GB4A 3QEOA 1RTKA 4LHYA 2PUFA 5CPFA 3QNUA 1NW7A 1KJ9A 5C0OE 2A0UA 2X5NA 2ZM5A 2VJOA 1F9AA 2MSEB 1LDGA 1WXXA 3TLKA 3UK6A 4CMGA 3T0FA 2Y93A 3CVOA 2A0KA 4X8MA 3OEEA 1EG7A 3BMCB 4EHIA 3VR5A 1QTQA 2Q5FA 5HKLA 3QLJA 3FKQA 3IIMA 1VZ3A 2ZXFA 1U0EA 1V7CA 2AG5A 2MR5A 2O0MA 2X58A 3KJIA 1DXQA 1OMOA 3BXXA 3R3JA 1P18A 3EMBA 4TUYA 3KLNA 2BD0A 2GK3A 3EGIA 4UQOA 1QGAA 2WAYA 1DIHA 4ZI3A 4FEGA 3KZVA 3EXFB 1SELA 1YR7A 1E1NA 4I6JA 3IDFA 4ZCTA 2F8SA 4JMLA 1KZ4A 4LBVA 4LE2A 3UUGA 1BJRE 3MOSA 5ICEA 1ZD2P 3AYZB 3B20A 3OOYA 2QRHA 3PFCA 4E6PA 4QJ3A 5JQWA 2C0QA 2IUEA 2WTMA 3RYHB 3FLAA 3H1AA 1UDWA 1OXBB 1OPRA 1JHRA 5JJBA 4J0KA 4L0DA 4ZPJA 1RLTA 4ZT3A 2P65A 3UMJA 1JBEA 1TUGA 1QQ5A 3PEVA 2HLPA 1OPXA 2IP1A 3OCVA 3PR2B 1DJPA 4TLLB 1E4EA 3A9SA 4BBAA 4GH5A 3CFYA 3ETHA 4UBNA 5CVCA 3JQ9A 2HIGA 4GOJA 5KJEA 3UPUA 4KRXA 4IDAA 5KJFA 1OZGA 2QR5A 1NP7A 2X8JB 2F62A 3MBOA 2W0MA 4OIMA 3HN2A 3AHGA 3ICEA 4ZVNA 2H1LA 2EJTA 4DR1B 3ADKA 4RSRA 2E4YA 1K3UB 2QRMA 3RF7A 2EZ9A 3VPHA 3R5XA 2H17A 3W5UA 1TM1E 2HIMA 4IOMA 2FMFA 1Z0DA 2B9EA 2CVOA 1F51E 3OOJA 3GOHA 5F77A 1DRVA 5LWQA 5EI5A 2JAUA 1FU8A 3PXGA 3JALA 2OSBA 2PTHA 2XDQA 4X94A 2EKQA 2ISCA 3GW8A 5F51A 4TKZA 4OHKA 2ONKA 3P9YA 1A72A 4UUBA 5E8JA 3BD6A 2PUHA 2NUPB 2MYTA 4FGUA 3USZA 1DTEA 2HPHA 2GN9A 5JSQA 3R0VA 1TC2A 1LKZA 3HC7A 4IWXA 5EOVA 2DX7A 2AL7A 1T0UA 2HXSA 4QUGA 2PS1A 1KNQA 2YASA 3O8OB 2WKPA 1REQB 2R6GA 3NETA 1EFPA 1Y33E 2WJHA 4EO7A 3ERCA 4TM8A 3WNVA 3FA2A 4Q9IA 4B8WA 4EB8A 1E62A 2J3MA 3ZBUA 2C3OA 1GYRA 5A3VA 3SIXA 3THSA 4DEVA 1JWAB 4PZ9A 1XI2A 1PHRA 2NVBA 4DMLA 1GQYA 3K0FB 4M7PA 5CDUA 2E6KA 5FTKA 3IMGA 1CXZA 2XWQA 2FA9A 3T3OA 1VA5A 2G8LA 3LF2A 2JIMA 4OJKA 3WFJA 4W9NC 3KSUA 3EPRA 4LBZA 5BN4B 2GZAA 5FBQB 5JNWA 4TMYA 5MFZA 5ARCA 4ZGWA 3RS7A 3SJZA 1UFRA 1SZDA 1CDDA 1KKUA 2GXSA 2CY0A 121PA 2E87A 3FZYA 4DV1B 3VRHA 2I9PA 4WVFA 1QE0A 5LDDC 2AUMA 3JZFA 1OIXA 1US8A 2H4WA 2I7CA 3JATA 1XOIA 5D8DA 5KTSA 1FNBA 4Q39A 5JI3E 1ZVQA 2I55A 2YJGA 3K20A 2NO5A 3UF0A 2CYBA 4KQKA 3GJ4A 1SQGA 1ZGBA 3I6MA 4Z0NA 1UFQA 2JLSA 1KH1A 1S89A 3SXUA 1BX1A 2NG1A 2ZYRA 2ACVA 3RC3A 3U4AA 3M7IA 4OJMX 1FFDA 1K5DA 1TA0A 3NHKA 3AY0A 2FZCA 1IHOA 3IEKA 2I6SA 3MGCA 2GHTA 4HGRA 2A3RA 4ZT7A 3NOVA 1F1JA 1XRNA 2BKUA 3DKVA 4GKVA 2IPNA 5C1IA 4UOEA 3LS2A 4H59A 2QB5A 3QXHA 4DKJA 5DBEX 1C7RA 5JYDA 4ZAYA 3V4SA 3LH5A 2C88A 5KMGB 3B48A 2CNLA 4H15A 2DUNA 1LSJA 2VF4X 4QJ5A 5T8KC 1Z06A 4MW0A 4Q3NA 5CFZA 4FHDA 4I7EA 4J0EA 3ZE9A 1T36A 4BUCA 4M8IA 1FTNA 5AJUA 5B5SA 4YCLA 4KUGA 4Y6LA 1X6VA 3L41A 4H7FA 1SD1A 1RE0A 3CZRA 3ELUA 1RCUA 3PB3A 2KMLA 5DWQA 2ZB8A 2PTGA 3OJLA 1CIJA 2FB9A 3H1TA 4L4SA 5EFZA 3ZWMA 4A0RA 1AB5A 2AQKA 3VYRB 2W2XA 2OLEA 5G4LA 2VYVA 2QP4A 5DM4A 3HDGA 4NS1A 3RK1A 4NX2A 1K5GA 5EZ5A 5U9CA 1IULA 2P3QA 4HAIA 1NYRA 4BV9A 5A3QA 3V7YA 5FI0B 5JVDA 2O0HA 2QM8A 3VYUB 2BUBA 5LBTA 2R5FA 2ONYA 2HHHB 1YCDA 2B7BA 2I3DA 3OQ6A 3GYBA 4C0LA 4EG7A 5JFTA 5JIBA 1Y9EA 1S1CA 4JIGA 3OZRA 2Y4OA 1G3UA 2H92A 3C0KA 2I4TA 4GX2A 5G1OA 2X23A 1AT1A 2VJAA 1G42A 2WPNA 3HLTA 2GPNA 4LXXA 4PINA 1YRQA 1NMXA 3OICA 3D6NB 3CX6A 3EXHA 5EIAA 5JD4A 2X41A 1E2PA 1V9LA 1K8QA 4FE3A 1ZISA 3TOZA 1AKYA 2P0AA 4OH7A 2HC9A 3TZ6A 2NV2B 3EVCA 2IA5A 1EFHA 1WA5A 1YUBA 1D04A 1U2EA 3IL2A 2ZJZA 4IO1A 3E9ZA 2R84A 2YH2A 1PNVA 3C85A 5ALNA 5JR3A 2Q46A 1WL8A 3KB1A 4I3FA 1Y9AA 2ZIVB 1PQPA 4YQYA 4EL5A 3KQHA 2RCYA 3R3UA 2H00A 3NJ4A 3K05A 3QYPA 1DIOB 4GBED 4KKVA 4GI3A 3V1LA 3OT5A 3K1AB 4JDPA 3KTDA 5ILOA 3GP8A 2RGNC 2BJHA 2DGDA 1NUAA 1C3JA 1ZJJA 3SHTA 3VPAA 3H0CA 1V8OA 3JS5A 3KKOA 4N7BA 3VYTB 2CVZA 3JQDA 4GXRA 1NF9A 2HD4A 4FI3F 1DKPA 1X9IA 4CF4A 4KV9A 3FSJX 4E5VA 3P4YA 4HNRA 4ND5A 4B4DA 2H6EA 3D2CA 4QEKA 1Y42X 3KD3A 1W35A 2AIRA 4GZLA 4H7EA 4RFLA 1I3CA 4I4CA 4TKVB 5EKXA 4A27A 4ND3A 5LA6F 2VTKA 1RAGA 3AEYA 3MW8A 4G1CA 4Z53A 1CY6A 2Y77A 1D4AA 1ENYA 1SBCA 3U2QA 2I2WA 1H42A 3BKXA 1K7CA 2Z8YM 4MYHA 2WSSD 2XRZA 4I9FA 1UPTA 1P1IA 1ZH8A 3AZOA 3S5UA 1SD2A 1GKIA 4JC5A 4MS3B 3TVYA 3WZ2A 5IVDA 2H54A 3LXRA 2UYCA 1KFEB 4M0CA 2LBPA 2D5AA 2P8SA 4BNNA 1WCYA 2W8BB 3C97A 2IU3A 4FBLA 4RNDB 3VKVA 4Q9HA 3IQDB 3LQQA 5FUYA 1ZCAA 1JQJC 4WXPA 4PQEA 3NDBB 4TWRA 1QUFA 2OFPA 3CRZA 2D1SA 2W9XA 5K2MA 3TUIC 3NMUF 4QTXA 4RDXA 2QQ0A 4UU8A 3INRA 3RLIA 2HTEA 3OMWA 5LLTA 1WETA 4Z5XA 5A7FA 4AN4A 2JJ1D 4LCJA 1U9CA 2HBZA 4KPFC 5AD1A 1G4UR 3DCIA 4NBVA 3FYUC 4TOIA 4Z4FA 4LFAB 3P9XA 5ALUA 1GPKA 4OX9B 2QM3A 1NPDA 4Q3LA 1WSBA 3UT6A 2K5UA 2BCEA 2HCFA 1IU9A 3GGDA 5H59A 5BUZA 2MCFA 3W4JA 1BWRA 2R4UA 1NYLA 4CIYA 4QGAA 3NKLA 4GPEA 4ZDJA 1GFIA 1K86A 3PNOA 2HCTA 1M74A 3C3AA 5GJWC 3SP1A 5JATA 3GPLA 4C7OB 5G3ZA 4RMIA 2G82A 1E2NA 4LCBA 1YFKA 5CT4A 3H5VA 3Q98A 3PLAE 1PJQA 1L5VA 1FNMA 1CDZA 3T35A 1GT91 2BR4A 2CLDX 3U3DA 1IWPB 4XQCA 3B78A 2HO5A 3ED5A 1JEEA 3BXGA 2O5CA 1R3DA 3RV3A 4JP1A 2NV6A 2FUNB 4KZPA 4GGOA 2D0DA 2JLVA 1CRQA 1QIHA 4WLFA 1FXWA 3DEHA 1M2WA 1N6NA 4E6EA 4EHDA 1DC5A 3A3PA 1ZSVA 4A0QA 2HHCA 5JNRA 3HJRA 2EX0A 4QSHA 4IHJF 2OBBA 4TV8F 1GARA 5ALTA 4EMTA 4E13A 5JAUA 1XALA 1AOXA 4CQLB 3HV0A 2P9CA 3I2GA 1YQTA 1GPLA 1IEXA 2G04A 1KO5A 3T41A 3AVOA 2VSQA 3CQ9A 3QWAA 4M9CA 5THKA 4BGDA 2GF2A 2VYND 2C5HA 4OATA 4F8EA 1VFPA 5AW0A 4CR8A 5BVGA 3L84A 3AVUA 3MAJA 4BUZA 4FWIB 3TPFA 3VYVA 4BWVA 2VPXA 1WUYA 4H77A 4AZSA 1XPUA 5ALRA 4HXEB 2R62A 4J1TC 2NUBA 2PD4A 1QTRA 1Y3HA 2R9VA 5K01A 1UEXC 4Q9NA 1UXHA 4FYWA 3ZHYA 5BP7A 3M83A 3EZ6A 1SC1A 3A3NA 4KW7A 4EDFA 1Y9ZA 3FJ1A 2FX3A 3GLGB 3KQOA 3GP5A 4MRNA 3B3GA 5DT9A 3TL2A 2IZOA 3AKEA 2QPAA 1DFIA 4REMA 2W22A 5KOHB 1C7QA 1E1CB 1S3FA 1OTXA 2P27A 2ZAYA 1YDHA 1UOOA 2FSGA 2VHJA 4G5RA 3T3IA 2I8AA 2W2LA 5FX2A 1MU0A 2CDNA 2H1IA 3LKDA 3O83A 1VPWA 2DH6A 3DP7A 4TRRA 2QP9X 1ZI9A 1Z16A 2JJ2D 3PTZA 5DPMA 1PJ3A 5IG2A 1D3AA 2WYOA 5FYQA 2DUMA 4O0MA 5LCXA 3TJZA 3V7NA 5ADVA 4EH1A 2J6HA 3JTMA 5LKAA 5C2JB 2Y2UA 4ZJZA 1KORA 1XTRA 2YJ5A 1FP6A 3VHRA 2D7DA 2J4DA 1K3FA 3GNQA 3AR6A 2UVDA 3C3KA 4LNUA 3W3AD 4TMVA 1UJ4A 1M7BA 1F5SA 3H5AA 4MK4A 3IAM6 2D0OB 4RQUA 4YQFA 1V9SA 2ACEA 5EKDA 3KVOA 5B3JC 1YJCA 2AZDA 4X3CA 1L5RA 2ODPA 4LOAA 4AI6A 3X1KA 1SOUA 4ZGGA 4C5CA 4JBWA 2A84A 5IAJA 1HO3A 3NTRA 4BO7A 1VOTA 5HZMA 3N5KA 4R1SA 3ZZNA 1OY1A 3LHDA 4B43A 2WUFA 1C9JA 2R751 3GPCA 3IKLA 4XFJA 4FNMA 5AXDA 3T7EA 5I7FA 2ZUSA 1MRZA 1X80A 4RH0A 3ZV3A 5K8CA 1RQNA 3PC6A 4X6YA 5AI4A 5EWLB 3K1TA 2WHPB 1EXDA 4LMPA 3TPCA 3M33A 4INOA 1I33A 3R7AA 1NBEA 3DBVO 2I4LA 3AX6A 1QZUA 1FTYA 4YJ2A 3DFMA 4GZ5A 10MHA 1E0AA 1ODCA 1V1MB 3I2FA 5I48A 2WWXA 4GHWA 4P1ZA 4RIGA 5GOZA 1FZTA 4MDYA 4PLTA 4U6SA 5KYXA 3T52A 5KYYB 1U6IA 2Z57A 2G1UA 5FRDA 2QLTA 2WAOA 1V45E 5CNMA 1CQIA 3ND7A 2ASVA 4PC1A 1ZFNA 2IX9A 4ZMSA 2VLBA 4IJMA 1FDTA 4MRRA 4PQYA 4D3ZA 1JEJA 1WPXA 2VDJA 4MV8A 3KQLA 2E48A 4CMEC 2VTDA 3I5YA 3OUTA 2ZJ1A 1Z5GA 1AKNA 2ZTMA 1IBLB 4KMRA 4NFYA 1DT5A 4M1OA 5K45A 1XZKA 4MLCA 4PAMA 3QXXA 4JJAA 1QHGA 4E11A 4QYSA 2J67A 4JYMA 4ZV9A 3LUPA 1KYWA 4LJRA 1IY0A 1JHDA 3IESA 1NRIA 4B3BA 1MB3A 4DWJA 4D96A 3U39A 4ENPA 1Z5NA 2IYQA 2J4CA 3F3MA 4AWBA 1TM4E 4RFSA 5AOCA 1G38A 4O4JB 3TD2A 2QTCA 4PFKA 2D6FA 2BOVA 2C4UA 3B3QA 1RXYA 1MV8A 2XMDA 2ZK7A 3PQ6A 3QHAA 1TJNA 2V4UA 4IWNA 4KK3A 4ZVVA 1WPGA 2DHEA 3IAAA 3IOEA 2VWQA 5A1TA 3N28A 4H0FA 1O8BA 1SVOA 1RI1A 2V5AA 2ZXUA 3HKDB 3BTOA 4LGVA 2WTEA 5DHPA 1J9EA 2QXTA 3NHLA 1XNGA 3GA7A 5FQNA 3FI9A 3SBDA 2O8FA 3RTEA 3L18A 3F7NA 4B6FA 4RZSA 1L8XA 1RLUA 3BAZA 4CIAA 1RRFA 2H0RA 4BNKA 2HSWA 2RBKA 4LSWA 4B9AA 1CQJA 4BOYA 3CLRD 3U3XA 3EZGA 3UGKA 2NP6A 4RJLA 3KYCA 1K7XB 4GRDA 2RGXA 4K9MA 3VO9A 4F6RA 4MPRA 2AD1A 2OBFA 4EY4A 1N77A 1FCJA 1TRHA 1A04A 5CEFA 3HP4A 2R7KA 2PLRA 1DWQA 1R4MA 3CM0A 2PQMA 1JRLA 3E15A 3L1JA 2NNWB 3Q2OA 4GPAA 5EJAA 5TT0A 2JI4A 4DLRA 5J4HA 1UM9A 3C7CB 1OROA 3PQ8A 1NUTA 1CZUA 4NE9A 2P2SA 3PC3A 2PFGA 2O0JA 2NT4A 1DPGA 1O03A 2YNMD 3TCKA 4CLDA 3ER9A 4QU9A 3B5JA 1RJDA 2DG2A 2RAFA 3UFXB 5FAKA 3L49A 5ICSA 5JCZA 4JUCA 3MERA 1JEAA 3KR9A 5JOQA 2NSJA 1FSPA 1AVTA 1NUHA 3CG4A 3O8NA 3G0DA 1QHYA 1EA5A 5LQDA 1TZBA 4EPTA 2B6HA 5C8YF 1J0DA 2R8EA 1I2ZA 4FGLA 1RWWA 2BCGY 1UMBB 1EJ2A 2C2MA 2W93A 3FWHA 4MI9A 5H3LA 1SXJD 2DY0A 1VHLA 2CV0A 4G9GA 1H23A 3FAKA 1O57A 3QLVC 4HRXA 1ZM2A 2XB8A 1SCDA 2OCLA 3AI7A 3SF8B 5A4FS 2R8BA 2WWIA 3IUQA 3NATA 3PL5A 5J43A 2IPMA 2QLBA 1T5HX 3D1VA 4NU6A 1TT5A 5ERYA 3TO5A 3LLVA 1KO4A 1EVIA 4ZDIA 3D3QA 2PKQO 3P9ZA 3G6KA 4YN3A 3UC5A 5BOSA 5I45A 2CHQA 1NNUA 2Y0EA 4YDHB 4EG4A 2E5LB 1UFVA 4FDUA 4EG0A 4C21A 3MC1A 5CITA 2BFFB 5EE5B 2NQ8A 3CR7A 3WP1B 2YMQA 1K68A 3MQFA 3R3HA 5EWMB 4MIEA 3WYGA 4RZ2A 3W5AA 2BHNA 2G06A 5CH3A 3AR5A 4EKNB 2AZMA 3H0KA 4ML3A 4JLWA 3DVAA 4KHZA 4X1YA 2R44A 2ZYVX 3G2JA 1EA7A 2OR3A 5LA6B 1ZIXA 3T3EA 1RRCA 1YS9A 1A69A 4PSVA 1ENPA 1Z33A 2BM9A 2GTPA 5D5HA 3R5SA 2WU0A 3OY2A 4PTYA 4AJPA 4OYHA 5DHAA 4K9KA 1OLUB 3IAS1 2HEIA 2GFQA 4MPTA 4D2IA 2H5LA 4N3CA 3TDMA 4YMTA 4DIFA 1YTLA 3SQDA 4NZPA 1NXTA 3IOCA 1YB2A 1SPXA 3AY7A 3GMTA 2XOKD 3I1FA 3M4ZA 4YRDA 1AKVA 5BV0A 1H1TA 2CXTA 1N5LA 3F96A 5AYVA 1BH2A 2KX7A 2Q3DA 1ULZA 4FZJA 3O2JA 5DI9A 1AA6A 4MQ5A 4DYDA 2G5GX 3FROA 3ZHQA 1D2CA 3DVQX 4O25A 1NUPA 4QBGB 3S5JA 4ETIA 3JQ8B 2C83A 2EWMA 1UEJA 1RRVA 1ZMXA 2BFCB 3PWZA 4EY5A 5K99A 4WV3A 5ENVA 3NCTA 1MJGM 1V0JA 4G81A 3P0RA 3RKSA 4F1WA 3PNPA 2I7VA 2A0WA 3UJDA 2QAGC 1FX0B 3N8DA 1DEKA 1NW5A 3B5IA 3CLTC 1YGPA 3OM0A 4LC0A 1ABEA 3REOA 4YXFA 3CUTA 1POXA 3OCJA 4EUFA 2PKXA 2I99A 2O3RA 1NXQA 2W2MA 3GCXA 3IQGX 3PEUA 4OCZA 4N7JA 1UUFA 1NKVA 4GM1A 4EGQA 4US2R 3V6MA 4P4SA 1DARA 1QGOA 2BGKA 4LDRA 5CM9C 2KB0A 2R1UA 4IZHA 1HWYA 4MEBA 3EXEB 4B6JA 1HMPA 1YZUA 4BLQA 5ECYA 3OE4A 2B0JA 4XQGA 5TMEA 1ZU4A 4X8OA 2C96A 2R8ZA 1JR3E 2WINI 4FDMA 3IRUA 3PC8C 1EDEA 5THXA 4CM6A 1CG6A 3SSAA 3WIOA 2BSXA 1CVLA 2RH5A 4TXHA 1WKCA 1R8JA 1JAIA 3HDHA 3KVNA 3NKFA 5D3KA 1R9NA 1HM5A 2PKRA 3CPSA 3JQGA 1H2FA 1ORTA 1RI2A 4IIYA 5D2CA 5JY6A 5AW9A 4IHJB 3V8EA 3ZJUA 1DVRA 1MOZA 1RXUA 4HDKB 4TV8B 2RC5A 2YV1A 3NTQA 3ZLVA 4DNOA 3EEFA 4MA4A 4A0HA 1XQXA 1C3VA 2RGAA 1VXOA 2A94A 4CCAA 2CFOA 4KXYA 4YMUA 2G67A 4URXR 5K8IA 1L4MA 5C4GB 3MB5A 4H60A 5CIYA 2N75A 1U3FA 3GFOA 4QXOA 4GOXA 4DG5A 4L95C 2W2OA 4MKGA 3LYUA 2RGYA 2R7AA 2AI3A 2ZDGA 3C6XA 2EBUA 5EIFA 4DJFC 3DZJA 4ALLA 1GRCA 4XCQA 4ABTA 1Y48E 3U16A 3K6SA 2O8DB 3M0EA 4FYJA 4YMWA 3QVXA 2C9BA 3V8QA 2B30A 3B6JA 2COUA 5EHZA 1FMTA 2R68A 1USUA 4J0HA 2VXBA 4YAJA 1X8LA 1DS6A 1X77A 4BE7B 4PC7A 1LI7A 3QIVA 2I3BA 2P2GA 2OBNA 2AXNA 3BMXA 3CUWA 4QQ8A 2PRKA 3PL1A 2XB4A 2IHKA 1NMYA 2DKNA 2YJNA 2YS7A 3KWFA 2IOQA 3ONDA 4G63A 3RRZA 4D4KA 4ZQHA 1WZ2A 4NNOA 3L7DA 2FP4B 1TYEB 4LRXA 4II3A 1G20B 3OFND 5EHGA 4QUDA 4B33A 5B1YA 1NRXA 1E7RA 3G2HA 4WOPA 4FMDB 4QGFA 2HTFA 4XARA 3O2SB 5CLIA 4D9MA 4PGGA 3A2LA 2BGMA 4FSXA 4REOA 4BCCA 1XMOB 4DREA 1RMQA 3C6ZA 3OIGA 3JQEA 3TI7A 2PSHA 2BWJA 1FNNA 1VMDA 1WMSA 3MILA 1OYYA 5B30A 2ATEA 4KI0A 3RSQA 4AMYA 2O8VA 1R3UA 4YFYA 2ZB4A 1S3SA 2PSEA 4EA7A 1ZIDA 4TLCA 2A58A 1F12A 2OWDA 3D7NA 2C5GA 3DXYA 3LQRA 1IY9A 3A9TA 3QBEA 2YMLA 4KDRA 2FEXA 5FD8A 5FJIA 1W0JD 3MOIA 1E3WA 3EARA 2I66A 1EP3B 1RZVA 1T5LA 1B8VA 4LXYA 4D3YA 5FWNA 5JADA 3VDMA 1W85A 4UXJA 1J56A 1N9GB 4HAWA 2IVFA 3BSYA 2GMWA 5HEKA 3K70B 1SOVA 2AQIA 5BR7A 3QELA 3UGQA 3ROXA 5KKNB 1QR6A 2GM5A 1I7NA 3MELA 2BRUA 2IYYA 2XX3A 4KG7A 4DCTA 4S05A 1HYBA 2VATA 5AK3A 5DLYA 5EHQA 3UAZA 4G41A 1FP4B 5IZ4A 4RHTA 3IUBA 4CTOA 4RKQA 1K7YA 3DD1A 1GTRA 1JBKA 1LRKA 2HK7A 2IIBA 4ZO4A 4QHTA 4XDYA 4HNVA 3CCFA 1DAOA 3IHTA 3C3WA 4FXOA 3R9WA 2WE8A 5LBIA 4BDTA 4YFVA 4UHKA 4X7RA 3BH6A 4YUZA 4GQBA 3X1WA 5KDDA 2XKBA 3GRFA 2BGUA 4FYMA 3TOSA 1QRUA 1IC6A 1PIWA 3BOSA 2W37A 4KXNA 2JLRA 3SS9X 1CFJA 2FEKA 1WB4A 2ATVA 2BSAA 1DAGA 3PPIA 4IG4A 1EFDN 3FVRA 5IBPA 1KEUA 4P86A 4Q1VA 3H9UA 2XGMA 3B2QA 1USIA 5HF8A 2OHIA 3WA6A 1P61B 3QF4B 1GCAA 1SBYA 4J43A 4Z9XA 5ECWA 3F1KA 3MAGA 4ICIA 2IU6A 5AVSA 1T0IA 3K8QA 4ZCQA 4C7BA 4YRKA 1HYQA 1EM8B 1U8AA 2GCOB 2Z8YA 3DE3X 3PHHA 4Q3DA 3WZLA 4JYPA 3ONWA 3MS2A 1MD9A 3QKRA 4GAEA 1NKTA 2GJ8A 4JLJA 4M1KA 4P34A 5CVUA 1GV1A 1GA4A 1XB2A 2H4ZA 3WRWA 3ZY5A 3RHZA 3AU8A 2IV7A 2OCIA 1U6KA 1YZTA 2XJ9A 5DHQA 3RUEA 2YFYA 3WO1A 5L4NA 4KQ2A 3PNVA 2BFAA 2DHCA 4IS2A 1M83A 4LV8B 2EJBA 4MMYB 3F6EX 3H9CA 2D3WA 3OKFA 2C2XA 3BK1A 1PRYA 4RU1A 5A4AA 1I5EA 2ZYGA 2GAFA 1GNQA 1HFJA 3WIVA 4P4UA 1QE3A 3ZUGA 4PQRA 3IURA 2W42A 4D4LA 2IHNA 4XGRA 2D06A 2Z56A 5CYOA 4ZEOA 1CTQA 2Z2ZA 2NU7A 4FWTA 2FPMA 2OKCA 2R6FA 1Z6YA 3HEMA 5CJ2A 2CUTA 1Q0UA 1Z4OA 3WRXA 2PX3A 4Q0MA 3F5SA 3D4OA 3U9LA 1J25A 1GCIA 1K88A 2QRNA 3JQBC 4TYMA 1EQUA 3VQTA 1QCCA 3AF3A 1N6LA 3JAKB 5AO9A 5FR1A 3ZCQA 1OFUX 1U2PA 2ORIA 4O1MA 3PRYA 4KIWA 3WFIA 4W8GA 4EO9A 2W11A 2J8ZA 4EYEA 1G1AA 1HPLA 2LXNA 4DJAA 4FW8A 4WJLA 3DJFA 1L7XA 4TMKA 2GEBA 2ZM6B 3X1XA 5AXBA 3SQXA 4RWEA 3TB4A 3COJA 2NU9A 2OCXA 2GZHA 3M6UA 3VOSA 4B46A 4X65B 1XQYA 3BHIA 1OB2A 4IL5A 3NTVA 2A86A 5ALPA 2UU9B 4BMYA 3HJGA 1V5EA 2G4VA 3CF4A 4OHRA 4AECA 1A9TA 1G3QA 3NLLA 5TPZD 2ZUTA 2HHLA 4CPDA 2IOFA 5ELXA 2WIJA 1I0ZA 5G1NA 4MUKA 1IEVA 2BH9A 5AJTA 1P81A 1CETA 1CSEE 4BRUA 4WZZA 2IUFA 5EFOA 4BKRA 3WB9A 2A0YA 4ANFA 5BPHA 2QX4A 3FPHA 2XRYA 1N2IA 1GKKA 3K94A 3FVQA 3QHQA 4GC9A 3PEFA 2XJ4A 4GPZA 4JWTA 1SC4A 4K88A 1XAGA 5IDWA 3LUCA 3GJ0A 2FZ4A 5JXWA 1T8UA 2EDCA 2NNLD 3IOBA 4FINA 4PAGA 4HEA1 3L0SA 1BO6A 3L4BC 4I8IA 2FN3A 3ZBPA 3ZPXA 3G9TA 2XCSB 1R4ZA 2P69A 2WB2A 4OP3A 3O8LA 1AK9A 2EL7A 3N0TA 3NAGA 1AJEA 3U5TA 2X8LA 1GGVA 1JB9A 2JJYA 3AXSA 3OCUA 4Q93A 5JD5A 2HQRA 1TMGE 3M5WA 3NBKA 4Y2RA 1TO6A 1TA9A 2VNJA 2AJCA 4QOFA 4EECA 5IKMA 1X7HA 3JQAA 2FW8A 1BZYA 1I7LA 1RAFA 4R1UA 5KYVA 6REQA 1NR1A 3OBIA 1H8HD 3DMRA 2ZYUX 1FJ2A 3EG9B 5DKFA 1AN0A 3LKBA 3W8FA 4PX3A 4DLZA 2AMJA 1M0TA 1G7SA 4JJFA 4IV5A 4ARBA 3TINA 5L3SB 1LDBA 1Z5UA 2VP3A 3ZWXA 4EG6A 3BJMA 3IAEA 2H07A 3NAMA 3UA3A 4RKYA 1W0CA 4EPXA 2DT5A 2JK0A 2DCUA 4UW9A 1ULBA 4DR6B 2BL4A 3NTLA 4P32A 2AI1A 2BJWA 5G1PA 4DM3A 3GUYA 1CHNA 2P6PA 1F2TB 1YD7A 3GUVA 4EZIA 3PA8A 4UMFA 4TKLA 4TVKA 1D9XA 1I2BA 2XXAB 3KQTA 4BN5A 1Q0QA 4BTLA 2A4MA 1CYEA 2JLQA 3I9V1 2OUKA 1GT6A 2YDXA 4Z9BA 1YJ8A 2PUVA 4PY2A 4ZVRA 3IT3A 2UYOA 4IH9A 1DKRA 3IALA 1G41A 2IKQA 3GPBA 4M1YA 5KCZA 2H06A 3GK3A 1YJXA 2JHCA 3DPUA 5AI8A 1RHKA 2ENWA 2RGDA 4M88A 5IC6A 3W8EA 1JQDA 4J7XA 3TLAA 4DV7B 1GD1O 1U7XA 1GLVA 2HX1A 3F6CA 2JAOA 1HE2A 3FTCA 5JMTA 4ER6A 2F17A 3RTGA 3OTOB 1KK0A 2I1LA 1XTSA 4WGFA 1H1LA 1LXCA 1X3LA 4H7PA 2HSEA 5JXIA 3L0PA 2VNIA 3MUFA 2GESA 4WASA 1L1QA 1T0HB 2VPQA 3WIUA 5CDTA 5JQGF 2NVUB 3T15A 4R81A 2FQXA 3RGWS 3AP1A 2OO5A 4ZYYA 1MTOA 2XMCA 3OFJA 5BWBA 4BX9A 5DWVA 4MLDA 5B6IA 3VVMA 4C2UA 4ZZ1A 1KEKA 3CG0A 4Z8YA 2C0CA 2X0DA 4LDQA 3E5MA 4CMJA 3EPKA 3O4GA 1FU7A 5C3MA 1OE0A 1Q14A 3BS4A 3C98A 4OBBA 4RS4A 3TFOA 3VNUA 4KEAA 4LGYA 5AVOA 2GVNA 4OLJA 2FW6A 3L1VA 4TLMB 3VR3D 1GILA 1D07A 3GFQA 5DASA 1VLHA 1DWOA 3WFZA 3O93A 4O08A 1KOLA 4BP3A 2R85A 2WSSA 4I50F 2VHEA 3GX1A 4JA0A 1D4ZA 3JSXA 3ZI4A 2C4WA 4H6VA 1HDXA 1ZGZA 1KTIA 1JQKA 2QJWA 3VDXA 2E4VA 1NOIA 1ZG3A 1C7IA 1XLTC 4G2TA 4XM0A 3A1TA 4BB6A 2G71A 1KDZA 3QMMA 1PZFA 1QHXA 2Q6VA 3L1UA 5L3RA 4DLNA 5TQ0A 3RYFA 2VPZA 3K0AB 5DYGA 4URUR 4BX8A 1TOAA 4NBNA 1AX9A 3A1EA 1Y0BA 3ISVA 5G0WA 3TMKA 5EZYF 3ENWA 2CNNA 2JRLA 1MX5A 4YO8A 4ZTUB 1KDVA 4LE0A 3S6JA 3VOAA 4RHYA 3CIOA 2Y1FA 4YACA 1WTAA 2JJ1A 1U90A 1T1JA 3K92A 2WIAA 3AVPA 1H6DA 4M0UA 3UW1A 3H8WA 3QYAA 1U3GA 1V6SA 4Y6SA 1P2VA 2XITA 1YJQA 1YZKA 2VS1A 4CODB 4QTTB 5TE9A 1NN5A 2FZEA 3H5LA 2JH8A 1KAGA 2YXLA 1P3DA 4WIAA 3KKMA 5FWXA 2O2EA 3WBKA 3WMEA 4Z4HA 3HVKA 4IM7A 4QYTA 4BVHA 1LDNA 2FWJA 3QEMB 3ZQUA 4K6GA 4GXNA 5CHEA 3VH3A 2FK7A 2JGAA 3UCXA 3QLUC 1XVIA 4PLGA 4DQLA 5BWOA 4PYKA 2ZAGA 1XZFA 2C5LA 3ORRA 4BGVA 5EMKA 1AGPA 1HORA 5C4MA 4MVXA 2CBZA 4G1BA 1OH7A 1DRWA 2O3UA 3T1YB 2CVQA 4PSKA 4DDKA 5ITZB 4HH0A 2QG6A 1AS3A 1IRXA 4RJIA 2R2GA 4I19A 4DIEA 4F85A 3FRIA 4DOMA 4YIHA 4IZIA 1IN5A 1KVRA 3O92A 1BQEA 4J6FA 5LUBA 3LK6A 3T5GA 1A7JA 1ODSA 5EWJB 4KWHA 2M6KA 3AF1A 4EA9A 2PUCA 3TSAA 3U48A 8ATCA 1E1YA 4IBOA 1XDUA 4DLTA 1E2MA 4HEJA 4TV9B 4E5PA 4LZPA 4OEHA 4NENA 3DEYX 1ZUWA 1FSGA 3G8BA 4Y67A 3UW3A 1SVIA 1W88A 3MJ4A 4F86A 2WDPA 1WWKA 4DDMA 1UBHS 4AJLA 2HF9A 4WOKA 1J33A 2LR0A 4HZUB 3V6LA 2VYNA 4Z1OA 4BPRA 2PZMA 3LC7O 3K16A 4TLAA 3B8HA 1N32B 5IW8A 4MB6A 3SIRA 2F4VB 3CLVA 1RWOA 3ZNPA 4MICA 1AKWA 3ORSA 2WQ6A 4L8FA 4CIDA 1G8MA 4AS1A 3CEMA 4WD3A 2VSFA 3CB2A 4JEIA 3N2LA 2ZT6A 4IIGA 4RHXA 1JKIA 5H82A 2X22A 5FLEX 5T4FA 1QGUA 3QEBZ 3VR6D 3R41A 5CDGA 3K9GA 4ZYTA 2SICE 2IDMA 1NLMA 4IJ6A 1QDUA 2HJWA 2WJAA 1QP4A 1BEEA 1TLFA 1RWQA 3V2HA 4JHLA 3KU1A 1H3EA 3QOYA 3KSBC 2WJPA 1X15A 1JHMA 2DQSA 2R47A 4V2IA 1LEHA 4YJFA 1SIBE 3C4JA 3CE9A 1V1JA 2HQBA 3W3AA 2IU0A 5EE3A 3NGMA 2NZVG 2Y1LA 1W49A 3I28A 3I9JA 4J7UA 3ZDZB 1MJGA 4BAZA 3EPLA 3F6SA 5FLXA 4GYKA 1YCGA 4OFWA 1ZK4A 2VNAA 1WKBA 3GG9A 4M87A 4HNSA 3A1VA 2O4CA 3CA8A 4CKCA 1C0PA 2CYCA 2FJUA 4ZYZA 1FX1A 2AA3A 4NBUA 1FDUA 3AJRA 2OP0A 3FXAA 3ZGLA 3QSYA 1TE2A 4RXUA 1MKYA 2MWMA 3STYA 5AKGA 3NNNA 4II7A 4CL8A 3TD6A 5JNSA 5HDQA 1MQSA 1L5MA 3PFNA 2BI7A 3ND9A 3FTEA 4FILA 3BEDA 1GPWB 1Q1EA 1WW3A 1CE8A 3UUFA 5JMWA 1D1SA 3FJYA 3B9RA 4MUXA 1GG5A 3G5AA 3N8GA 3H2HA 4RCZA 2I4IA 2Q49A 3DWEX 1WDLA 3H7AA 3JQ9C 4RETA 4EFNA 5CFPA 3SE0A 3DDHA 3SQOA 3VDNB 5IEJA 2X0FA 3BFJA 3OLZA 3KFXA 1OXKB 3F7OA 4D80A 2ZJ3A 1TB4A 3V4VB 2ZRDA 1S7GA 3OZVA 3RSGA 2HJGA 4FD3A 3AB8A 4LDAA 1L5FA 1PJSA 3D3NA 4LHEA 3UT5B 3ZE8A 4ED9A 1XYYA 4Q6BA 2D74A 1VXRA 2YVAA 4X20A 2BMVA 1A5TA 3CKYA 5EZ6B 3VTAA 4EFKA 3WSWA 2OD9A 1LUAA 3WB1A 3D5EA 2JH3A 3STTA 1T2CA 3JPWA 4L75A 3E18A 3I9LA 3C4VA 3AMVA 1V1RB 1M34A 4AP6A 3ZWQA 4D0GA 5JH7A 4YJHA 4N48A 2BMFA 2P4EA 3MMZA 4PIMA 1XZEA 3G02A 4ZT2A 1OWLA 4BO2A 1QQBA 2XYVA 1EI9A 1TI7A 4UHEA 4CM4B 2WG2A 4MUAA 3CRQA 5HIAA 2OOSA 3ADPA 3EF1A 3PIIA 2F3TA 5FLKA 4EJFA 4W7SA 1CR1A 1JIUA 2B0CA 2BI8A 2PMWB 3A9VA 1D4OA 2E9SA 4EI8A 5FPKA 3F46A 4JLUA 1RKQA 1MAWA 2GBLA 3C6YA 3GF4A 4KR6A 1G3IA 2ORWA 4PZEA 3U7IA 1D2AA 1PJZA 3WLEA 2PYZA 1RRMA 1W93A 3F67A 3MPOA 1QVVA 4PLFA 1ABBA 2PT7A 1W9HA 3DFIA 3KKKA 4CDNA 4HTFB 1R7RA 1U2QA 3E8MA 2FWNA 3FPAA 3JARA 2PQ0A 2B21A 3NKVA 3OTHA 3Q41A 4F91B 1U94A 1U7UA 1VCIA 3E23A 4EBBA 2Z5GA 3TL3A 1O97C 3MT8A 3N7TA 3LUHA 1EWQA 2ZYWX 1XTJA 1U98A 1E2FA 2C97A 3DBIA 4PVDA