3HH8A

Crystal structure and metal binding properties of the lipoprotein mtsa
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
280
structure length
280
Chain Sequence
SDKLKVVATNSIIADMTKAIAGDKIDLHSIVPIGQDPHEYEPLPEDAEKTSNADVIFYNGINLEDGGQAWFTKLVKNAQKTKNKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAKDPKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSAYIWEINTEEEGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFTDSIAKKGKPGDSYYAMMKWNLDKISEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and metal binding properties of the lipoprotein MtsA, responsible for iron transport in Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Metal binding protein
molecule keywords Metal ABC transporter substrate-binding lipoprotein
total genus 104
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hh8A02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hh8A01
1K0FA 1QGUA 4WNAB 4TKUB 3AESA 4OXRA 3UJPA 5HX7A 4XPIB 3HXPA 4XPIA 2MINB 5JG7A 4ND8B 1L5HA 3EIWA 4WNAA 1MIOB 2PRSA 3EIXA 3GI1A 4UTPA 1K75A 1QGUB 2MINA 1ESZA 4FNAA 2X4LA 1KARA 1K2VN 1L5HB 4FILA 2AFHA 3AESB 4G07A 4LS3A 4N01A 4WZAB 3NU1A 1N2CB 2AFIB 4FKMA 2AFHB 3TEFA 2YNMC 5CX1A 2OSVA 4WZBB 4WZBA 4HN9A 1G20A 4G09A 5GGXA 2PS3A 4NNPA 5BVHA 2QI9F 3G9QA 2Q8QA 1N2CA 3R5TA 4UDNA 3BE5A 3ZK7A 4ND8A 2PS0A 5B58T 1M1YA 4WN9A 3HJTA 4K3VA 3U7QA 2O1EA 2XDQB 3CX3A 4UDOA 3PDIA 3AERA 3AEUA 4TKUA 3ZKAA 5JPDA 4M7OA 1TOAA 1G21B 4FI3F 2XH8A 1QH1A 3PSAA 5M34A 5M2QA 2R7AA 4TKVA 2XV1A 5KHLB 4MX8A 5AFSA 3MINA 1KAHA 3AETB 5BVGB 4PM4A 5BVGA 1M34B 4INOA 2WHYA 4BBPA 4HMQA 4HMPA 4UTOA 2RG7A 1FP4B 2OV1A 4WESA 3K1AA 1M1NB 4B8YA 5GGYA 3ZK9A 3AEKB 3ZTTA 3MFQA 2Q8PA 5CR9A 5KOHB 1H1LA 3TLKA 4OXQA 3ZK8A 4GICA 5JOQA 1N2ZA 3K1AB 2M6KA 2M6LA 2WI8A 5KOHA 3AEUB 4INPA 5JJ5A 5FLYA 2PHZA 3AEKA 4MDYA 1QH8B 1PSZA 2AFIA 2R79A 1FP4A 3AEQB 3MWGA 4WESB 4OVKA 2OV3A 2XUZA 2PS9A 1M34A 3AEQA 3LI2A 1PQ4A 1EFDN 1QH8A 4PAGA 1MIOA 1K7SN 1KAEA 2XY4A 1XVLA 3R5SA 5M3BA 4TKVB 2XDQA 4H0FA 1QH1B 1M1NA 3MWFA 4NNOA 4DBLE 1G21A 2ETVA 3LHSA 3HH8A 5I4KA 2YNMD 4LJSA 5BVHB 5M29A 3PDIB 1H1LB 2XQVA 4HMOA 3MD9A 3AERB 4IRMA 4MLZA 1M1YB 4WN9B 1N4AA 3BE6A 3U7QB 3AETA 3MINB 1N4DA 4MO9A 5KOJA 5KOJB 4WZAA 3PSHA 3TNYA 2OGWA 1G20B 4CL2A 5HDQA 5CX1B 4H59A
chains in the Genus database with same CATH superfamily
4JB3A 2X9NA 5TJ9A 4PIMA 2DFDA 3UJ7A 2EJTA 1VL8A 1T3SA 1M8GA 1X87A 4W9RA 4OHXA 2NUTB 1C5KA 4EIWA 3QU7A 4XM0A 3CLKA 5IDVA 2WTAA 5JH7B 5IHXA 1PU2A 1I3NA 3NGLA 3T99A 4WZAE 4TSKA 4PAMA 1CT9A 5AM4A 2CDBA 2WKRA 2RJOA 1X13A 2NX2A 1KARA 3FTDA 5KNCH 3JAMA 3JQ8B 5EEGA 1HNWB 2ANBA 5KU1A 1WLYA 4PN3A 4PO1A 2QOEA 4HFNA 5GTDA 4ALKA 1E0SA 2H63A 3TUZC 1BVUA 1PFQA 3E4DA 3ED5A 3GYBA 3R20A 4QIHA 5DCUA 2W2LD 3IBGA 3B78A 3NANA 3VPFA 1JVNA 3P2MA 1C8VB 4ZHSA 1D9XA 1SB9A 1TGVA 1NFFA 4PSDA 2QAGC 3AOEA 3VYUB 1RAIA 3QRWA 4C0QC 4D4LA 2Y9MB 4FWTA 5A2QA 2WF7A 3QH4A 3VR3A 1NM5C 2AR7A 1G5PA 2H2FA 2HT6A 4QDOA 4UJ5A 1E96A 4HRYA 3DLBA 4F5WA 1OX6A 2AG6A 3DFZA 1NAIA 4E5VA 4EI2A 5ALYA 3L8EA 3BE4A 4G5GA 1IZ9A 4L2IB 5CJPA 4BQFA 4GBMA 5JWHA 3RJZA 1XQ6A 1OMOA 3WLPA 4KWIA 4ERNA 2KSQA 2JLWA 3CS3A 1JIUA 4FFLA 5D7NA 4QJIA 1DAOA 3AL3A 1JA1A 2GI4A 3QUAA 3RUIA 4INJA 5JXHA 3GXOA 1GPMA 1V41E 4JLKA 4KN8A 2QTCA 1V1JA 2XJ4A 3X1JA 4A92A 4OOFA 1MF7A 1UEIA 3N0WA 1U5CA 1ZK3A 4LYFA 1QTIA 2C1ZA 3ASZA 3ORYA 2ZRDA 1DBIA 1MENA 3QJ5A 1URPA 4RXMA 5FOUA 5K4AA 1FP7A 5C8YA 3FSEA 3WL5A 5JYCA 2W6ZA 4PHCA 5DHQA 1YRWA 5CDYA 1DXYA 2AKAB 3B53X 1Z12A 3O94A 2QE7D 3J7TA 4O1MA 1L5NA 3SNHA 2FOXA 3IPCA 4KI7A 5KOHA 4YCAA 1GAEO 4E5KA 1HDOA 4KSCA 4IKEA 1GA6A 1HBJA 1A8QA 1J2UA 2R8ZA 4A23A 1AQNA 3MT7A 2OPHA 2GN8A 5CRIA 2B92A 3KXIA 2FX2A 2O2GA 2JJ8A 3AC0A 4HLNA 4TUYB 3RYHA 3WGUA 1GDDA 2JKVA 3GAMA 1DJLA 1VFNA 4PNHA 5AKIA 2ZE7A 3RS2A 3LI2A 3TLYA 1PLKA 4A2WA 4EJ6A 4LE1A 3O4RA 4Q66C 1AQIA 2FWIA 3BJMA 3VU9B 1ZCJA 3EWNA 4EW3A 5KNCD 3FROA 1KI1A 4TKVB 3W3AD 1U3UA 4P2BA 2ZXFA 3TBHA 2PRYA 1UXOA 3MD0A 2ISSD 2XGGA 4MWDA 2O0KA 2HJ9A 4FPXA 4FE4A 3L49A 3DZGA 2HRZA 4OP3A 4R16A 3DC2A 5HIIA 4NEHB 3SXJA 1D7AA 4QHSA 5DKFA 1IULA 4QTXA 3SLKA 1N4DA 2CWWA 4OQEA 1NLMA 1RNLA 1BGVA 5F3RA 2FMFA 1G5QA 1R3DA 2QORA 4HAVA 4I3HA 4OJKA 3TXYA 3JYLA 4DARA 4PF1A 3AHGA 4PINA 4QOGA 2G7ZA 1DKRA 1XJQA 2NO0A 3UHPA 3ZCPA 3B5EA 1GRRA 3ZNOA 1WV0A 1ZSNA 4TS3A 5CLHA 4F8YA 5IBQA 3WKCA 2G4CA 3D0KA 5FBWB 2BVNA 4RD0A 3TKAA 1GIAA 1T2DA 3DLAA 3H8SA 3M6MD 5AW1A 1EWYA 1E5XA 5AIBA 3B12A 1ZM9A 1SXJE 3DHVA 2X4IA 1KRXA 1XT6A 1ZJ4A 2C9CA 4FM9A 1KK3A 1E3DA 1ZXXA 2ROQA 2YC4C 3UA3A 3PWSA 2XRYA 5KJ1A 1K6MA 2IXFA 1Z6TA 1FDUA 2YIMA 1KYXA 1OPRA 4LEIA 2AFHB 5D5HA 2AXQA 3DL7A 2OORC 2LRHA 4JEUA 5ALSA 3D8SA 1QKKA 5ED4A 4DIFA 1O96A 4RFSB 4C4PA 1W4LA 3FY4A 4XB1A 4BNJA 1ORVA 3DMTA 4RFVA 5K05A 4TV9F 3TFOA 1OKKA 3ILHA 3FCXA 1IY1A 2N0SA 3AI7A 3AR9A 2OMEA 4Y1EA 1ZH2A 2RHCA 2IGTA 3WL3A 4DMMA 2BTQA 3Q9UA 4NRDA 5D3MB 3IBFA 1LLDA 1LH0A 1XFDA 1YQWA 4OK5A 4YRZA 4LOHA 5CA0A 3BK2A 2JVKA 3QXCA 1CXZA 2WB4A 1DBVO 1QMGA 1G55A 1ULSA 4ZT2A 2QUIA 4Q0MA 4F04A 4BQNA 4S12A 4U6SA 2HK8A 3QYAA 1WDKA 2HRDA 4IMRA 3EZ2A 4RHXA 2X8JB 2OD2A 3MTGA 2C0CA 4Z3OA 4ZT7A 4P4GA 4M3NA 1U0TA 4RXUA 1LFAA 2XQGA 3ZGOA 2R7KA 1R8XA 3PKJA 4CKEB 5CYPA 5I8PA 3QPVA 4B4WA 1TVCA 3COWA 1GDHA 3LIPA 3W7BA 2F8TA 2B2CA 4AAYA 1IN4A 1KSJA 3EISA 4L4ZA 3T61A 1R4ZA 1TQ4A 2O07A 4NBRA 5DT2A 3TKYA 3GVIA 4BEBA 3SOPA 4KPEC 1QG4A 2FSUA 4B34A 5SYNA 1R6BX 1ZIXA 3AJRA 2CK3D 4NENA 3ZHQA 2OKCA 1L5WA 3LVRE 1RC1A 1VG8A 1T6BY 1VYTA 2GPSA 3BAZA 3IULA 3NBAA 4IQ4A 4L73A 3LYHA 1I4TD 3ZKWA 4C1BA 2AN1A 4XGRA 2PZGA 2V3VA 4RACA 4I08A 5B3KA 4CF4A 3WIOA 2DGDA 3JQBA 4HEJA 4JWKA 3U81A 1M2JA 3F73A 1M6HA 1N1EA 1SZJG 2XNHA 2XOKD 1PYGA 3IQGX 1SVKA 2CYAA 1JG7A 3EH2A 3EMBA 5K8IA 1WY7A 2I6SA 1KI4A 1YC5A 5KNDH 1PWEA 5AW8A 1QANA 3H2HA 3W5IA 3HKCB 1FFAA 1M1NA 4UM8B 1XZDA 3ENQA 1CEQA 5IXYA 2O2YA 2WHEA 3U1BA 2BFFB 3K6JA 1WUYA 1H1LB 1VG9B 4MV7A 2WJ4A 3AERB 3PC4A 4GOMD 1JHUA 1R18A 1TZBA 2PEZA 4EGJA 7GPBA 4EPYA 1K86A 3IR7A 1O08A 5K4GA 5I9IA 3GQBA 2BKVA 2R8PA 3EXHA 3HBFA 4H7PA 4EFDA 1ARZA 2FKAA 1MHTA 1NPYA 2IEAA 4I50F 4FZRA 4PYQA 4WLFA 2X8WA 3OZIA 4TN5A 2XEXA 5LSAA 5CUQA 3RC3A 4EB6B 1KMQA 5CA1F 2JFBA 3THXB 1V48A 4XR9A 3N2EA 3ZZMA 1MAHA 2LW7A 4LJYA 4AKEA 4R41A 1DO0A 1HEYA 3H1BA 1CHDA 3THRA 3GZTB 3PXUA 1ZCZA 3CUEF 3RSFA 4U6NA 4WDRA 3VHXB 2VBGA 4ZANA 2AI1A 2HBQA 2CUKA 4UM5A 4L8GA 5AKYA 5J2UB 3CC8A 3WWPA 1WMSA 1FFDA 3L7LA 3TCKA 1TM5E 1RFLA 1V37A 1W19A 4CQJA 4D9HA 3I04M 3JQ9A 2P3SA 1M67A 5C4GB 3GT3A 4AT1A 5LP6F 3KQWA 4OB6A 1E32A 2BMVA 5KEIA 2FJPA 3F8TA 1QWSA 4G37A 4DMGA 2REQA 3W5BA 1ZWLA 4FCTA 4RZQA 3FM9A 2ZSHA 4ZQEA 3Q7IA 2CBGA 4V3CA 1V9CA 1WNTA 5FT9A 4A5OA 4BNYA 4E7PA 3NR2A 1NLUA 2OK8A 4S1TA 4TGLA 4B83A 3FOAA 4L6AA 4ZYUA 2NU6B 1W49A 3DL4A 3H2KA 1LS6A 4CLRA 1B00A 3OBIA 5L51A 4FOOA 3WYBA 1WXGA 1M3SA 2DQ4A 4YRMA 1TEXA 1GAXA 4EFKA 4ESOA 2DEUA 2EZ9A 3ZU5A 1NGSA 3VR6A 4GI1A 2OLKA 1RXSA 4KO4S 5CITA 3D6TB 2HXSA 2HJSA 1PTJA 1UDAA 2J9FB 5J5CA 1ISJA 1TVMA 2XA2A 1UFVA 4MUBA 2HWYA 2RHTA 4W9MC 2W9XA 2JLQA 4KX3A 4X97A 1P1RA 1PNTA 5HPYB 2AYYA 4L0QA 5IH7A 5K6AA 4LF6B 4YRSA 1CEYA 3T3OA 5LP6B 3H99A 3EVTA 1FP4B 3NZEA 3VZBA 2EG9A 2VF8A 3PFKA 4KXNA 1XCJA 1FLAA 4RMGA 4ZHQB 4DMRA 3L2OB 4LSWA 5FOVA 4D57A 2A5FA 4A0HA 5CYFA 2Z3VA 3EJ6A 3LXRA 4NV3A 1R8YA 4LXXA 1R5NA 1FXWF 3PHCA 4BP9A 1XEFA 4S04A 3Q0TA 3WWYA 4P7GA 4S1VA 1YB1A 3RVLA 4RM2A 1FL9A 1R3UA 2ZKIA 2XCLA 1LVGA 1QNFA 3CVOA 5HZMA 4LJ9A 1GGEA 3AJ8A 1PSZA 2YXPX 2XNDA 3AEQB 4MUAA 4PX5A 1R0BA 3EG9B 3IDQA 3ESDA 4JT4A 5AKZA 3DZ8A 3H4TA 1LQTA 4EG0A 5KBYA 4MZDA 3RM3A 1Q7EA 3E9CA 2PBFA 2PZEA 1DSSG 1KOGA 4FHGA 5F4ZA 4C2TA 3CNLA 4MWTA 4PZUA 3RVRA 3SJZA 5K0TA 1Z63A 4IJ6A 3GRVA 3EDRA 3I3OA 4NS1A 1HQYE 2PGIA 4JBNA 4PX2A 1PP4A 3D2AA 3Q7RA 4YECA 1Y6QA 2YZ2A 2YWFA 2V54A 3QUTA 1Q57A 3BKWA 4QJBA 2WSIA 4B4VA 2C5SA 4DJAA 4EMBA 3I6QA 3PE6A 1P4HA 1G7RA 4UREA 3VR2A 2I8LA 4KE7A 4RY0A 4V38A 2EC5A 4K9SA 2Y76A 1Q1NA 1RT9A 4DYDA 5HKKA 1RHUA 2XT6A 1U11A 5C31A 2OXEA 1WBJB 4PYJA 2ZAOA 3A9CA 3PQ5A 1KKLA 2C4VA 1ZH6A 4Q3EA 4B47A 4Y2TA 2G71A 4ZI2A 1T0BA 2XVYA 3GQBB 2AHOA 2DWQA 3AY0A 4RANA 2AC7A 4BAUA 3MYYA 1TZJA 1KEVA 2IV7A 1T9CA 1NVDA 2JBWA 2VZ9A 3F5SA 4HXEB 3SPXA 1P77A 2OFWA 3AVVA 1SNYA 2ATXA 2C5EA 1FB5A 4G86A 3TQQA 3I12A 2NTVA 1T2VA 2WU3A 5JAQA 3T3NA 1J8FA 3ADDA 1F2UB 2PH5A 2WFLB 4ZAFA 3K92A 1O0BA 1CFJA 1WD5A 2KX7A 3GFRA 3WI7A 4A82A 4EFMA 3CKYA 1EVEA 2CXNA 2O0JA 4U7TB 2Y1DA 5G0SA 1F8FA 1SXJD 4BKRA 1X94A 5E3JA 4R2MA 2H57A 5EPUA 1TW3A 3UYKA 1DIRA 3EB9A 4R7TA 4C5CA 4QDKA 1HRDA 2RB4A 2OYCA 1T6ZA 1ZR4A 4G09A 2Q50A 1Z16A 1E8NA 1T2EA 3UH0A 2EKDA 2XWSA 1GAWA 1RAEA 3B8HA 3IP7A 3OP1A 4NH0A 5E6SA 3OICA 5BUQA 1JHDA 5CPFA 4EGFA 1QU2A 1YB4A 4EMSA 1W1IA 4UHJA 5LOVB 1JFSA 1FS5A 4YAWA 3KFLA 4EI8A 3WBBA 3NONA 2NO7A 2ZZNA 5A4IS 3A4VA 5KJEA 4H4DA 4YLYA 1Z68A 2IYZA 4JOQA 2AF4C 3GUUA 9LDTA 3ZYCA 3L4KA 1H3FA 5H68A 4TUYF 4PZDA 1K7XB 2IEZA 1GCAA 2GBPA 5C34B 4D45A 2YWJA 2R9VA 5G41A 4CBVA 3E3LA 4FUTA 1P2FA 2VSQA 3PNMA 1G42A 2FA9A 4J1QA 1E3TA 2VAWA 3GJYA 4YV7A 2H48A 5AOVA 3I5XA 2AOVA 2GN2A 3EFOB 1VKNA 3A10A 1E0KA 2A9QA 4WACA 3SYLA 3ZHUA 2E4ZA 2QKYA 5IAAA 1FLVA 1BD4A 3CKMA 1JW9B 3OOYA 3FZYA 4I5EA 3KALA 3HFJA 3LGAA 1H1LA 1I2ZA 4TVSA 1PK8A 4RD3A 2G9VA 3PDHA 3DEAA 4ZYXA 2AEMA 3U31A 4D8YA 2HIHA 2C4NA 5KB3A 3FMFA 1JT9A 3DYBA 2CK3A 4JP5A 3TS1A 4LKRA 1YR7A 4JI6B 1U1FA 2HPAA 4XB6B 1FDVA 3HKDA 3VH1A 1ZK4A 1KMHA 3WNQA 1NPTO 1UBSB 1HDZA 3L8DA 4DM7A 4H1WA 5KYXA 4FIDA 2PUEA 2GVDC 1SUBA 1JIKA 4Y6QA 4YJGB 2VP2A 5AM5A 3CUUA 3WGLA 4NC9A 3G8BA 1AQJA 1HG0A 1RC0A 2NZUG 1SCUB 1N3BA 4HQLA 4N5DA 1GM5A 4WUVA 2EG5A 5JCPA 4B3XA 4CL8A 1QHGA 5CM2Z 2CB9A 1OBCA 3A4MA 2PXCA 3KUCA 3ON5A 4X3OA 2Y1GA 1CJVC 2YWEA 2BBSA 3KKZA 5J23A 1NVXQ 5EG5A 5FA8A 1N5RA 2JIPA 3ADCA 3SG0A 1ZNZA 3T9AA 2C07A 1IUPA 1VPEA 1WW2A 3CH5A 1P2SA 4YASA 5BMOA 3JZMA 3MRXA 1N0WA 3WYDA 5T64A 2IYVA 3C4QA 1F4VA 3DKKA 2J5QA 4W7SA 4F3CA 5KOJA 2IQIA 5ALTA 4ND6A 1AA9A 1R1DA 3DT6A 4PO3X 1XEXB 2HMTA 1T8PA 2ZWMA 3GBPA 2FLKA 1PGQA 1KA9H 2I7CA 3AW8A 4TTSA 3AL0C 2AEJA 4F60A 4KEAA 2OKGA 3UJCA 1F51E 3IL2A 2Z83A 2I4MA 2IZZA 1QFXA 5IU6A 5JYEA 4BUCA 5G0VA 2P75A 4Y1GA 2ODQA 1GPWB 3T3DA 4CM1A 4ETNA 3KHTA 2B4QA 3K1ZA 5F33A 3T9CA 3ZZTA 4QGAA 4FTWA 4ND8B 4WLVA 4J94A 2ZWAA 3EIXA 3H0CA 4AUMA 1OW3B 1VLJA 2UYOA 2VDPB 4F71A 4ND1A 5IK2D 1HT2E 1KI9A 1LSJA 3AXSA 3HS3A 4PBTA 4Q9KA 2JVIA 1KSGA 2PNJA 4NY1A 2QX7A 4J2HA 4NU5A 3KL2A 1SXGA 1MJGM 4RESA 1XMJA 5TPZA 4ECEA 1M8JA 1W34A 3AEXA 1T1GA 3BZBA 3SF8B 3BL5A 3MYRA 5EXDA 4M89A 4N5NA 2G77B 3NTQA 3W8RA 3G0DA 4E21A 4BN4A 2H1IA 9MHTA 1EFTA 4NZNA 3FNHA 2PS3A 5JRZA 3PPVA 1V71A 4BMVA 3SJAA 3B13B 1RFGE 1ZIYA 2A9PA 3PGKA 1RTTA 2VH5R 2ZI4A 4YJKA 4MMXB 4QDXA 3ZE6A 3SC6A 2HJHA 3BS4A 4ZYTA 3GGJA 2IP4A 3ZDDA 2Y3IA 1DHRA 2GBGA 2GOYA 3PL1A 1W0CA 2X2OA 3A6JA 3DTVB 3MT9A 4NAUA 4JQSA 4Y6RA 2G67A 4UC0A 4BKUA 2BE7A 1AKEA 5IKOA 2AWNA 3ME5A 5IUKC 1E2LA 1UANA 3C5VA 3P2EA 2P9YA 1X80B 3GA5A 5F78A 1O95A 1J39A 5IDYA 3U4QB 2ZWVA 3IPYA 3OPQA 3DP7A 5DYGA 5EKUA 2YUTA 1TQ2A 2JZCA 3KRTA 1Y3DE 3BRWD 1DRWA 4JXKA 4L3OA 3UJ9A 1U3VA 4DJEC 1OFUX 4JOBA 3ML1A 4LUCA 4UU0A 5FCDA 4PLZA 2M6RA 2I78A 5I3CA 3EPHA 3RD5A 4FFPA 2YY5A 4GVXA 4QJ5A 4M1EA 3R0ZA 2ZXEA 4LKOA 2P0YA 3GF4A 2O54A 4H3SA 4QOEA 4I4NA 1EI9A 4YP7A 2NSLA 1ZGJA 4JBWA 4NJMB 3KXDA 1O6ZA 4D56A 2C1XA 3JYNA 1FW6A 3HLTA 1XD9A 3WYGA 3JX9A 4B3FX 2F2TA 4D9EA 1NN3A 3C98A 1RACA 2J33A 2ST1A 3CCBA 4IUYA 4MPPA 2FCAA 4UUBA 1UKEA 4KIGA 1VE6A 3ISTA 1LSUA 4K9PA 5E7JA 4IVNA 3WQRA 1R6DA 3ZY4A 4F4FA 2QTTA 4Q05A 4WASA 3MT8A 3RT1A 1W75A 4BVBA 2AZMA 3EZYA 1SQSA 4MS1A 3VKFA 3K15A 2FFJA 3K09C 2P6UA 3Q1KA 4MRRA 2ZVQX 5C8ZA 4R7ZA 1C3EA 4OI4A 1PEAA 3OTGA 2NPOA 4UFNA 4B7AA 1MB9A 1VHQA 4NNOA 4B17A 4DVGA 1XQYA 3NNNA 3DCYA 4MYUA 3O8LA 4B31A 1MJGA 2YNMD 4B74A 1A2KC 1E7YA 4BMPB 2CNNA 1C0PA 2YOGA 4MLCA 4A2CA 721PA 2PJZA 2A57A 2OEPA 1WHTA 1WBDA 1W36B 2P9QA 4XLLA 5DPMA 4FCWA 3P9CA 5HE9A 2NU7A 2GZHA 4L51A 2CXTA 2I4OA 2LBPA 2WSMA 1PKXA 3DZBA 3EPPA 3F3YA 4WOKA 1I30A 4YPVA 2Q7XA 3MF4A 1Q17A 4BCBA 1VSQA 3FD8A 4EI7A 3EZNA 4ZI3A 2UYCA 3L06A 2IZ1A 3EQ8A 4OQXA 3GLGB 4X1KB 4IMPA 2ZS7A 3H1EA 4D7AA 3N7UA 2W43A 4GMKA 5G1NA 4R8RA 4JR0A 2VBIA 2ZUDA 4P8RA 4G1EB 2DKFA 3ZGXA 1CS0A 2E3JA 4I0WB 3QEKA 1OAOC 4IWNA 3WK9A 4NE7A 3ZBQA 4AF8A 1LJ8A 2HQOA 1RYHA 4GYKA 2GETA 1Q1ZA 3RANA 4XIYA 3W8DA 1D09A 3C3MA 1CJKC 1TGYA 3PEUA 2Z9DA 2A5DA 1FW8A 1M6YA 1XTVA 3IMEA 4C3UA 4DM3A 4DR2B 4NJEB 2VXBA 2YY6A 2NVOA 3LECA 4HY3A 3RH0A 5IBRA 3K9BA 1ILWA 3CSDA 2XNJA 3N0XA 1IE3A 3H9GA 3N28A 4F46A 4P6VF 3HXMA 3T7KA 1G3QA 4J91A 4E07A 4AJPA 1HR0B 2QM0A 3WQSB 1GZ4A 1Q95A 1U8UA 3EASA 3FPFA 3RBAA 1ZW6A 1YQEA 2IT1A 4ZZ0A 2QUHA 3WL8A 2FPPA 1E7SA 4UHHA 3O5AA 1NMEA 3QIAA 3H6HA 1CJCA 2JGLA 3MWEB 5J1SB 1ULAA 5JFTA 3IUPA 1ZCBA 1XCLA 1THMA 4A91A 5BQXA 3PC2A 2WFZA 3H05A 1EUDB 2O7NA 2VDQB 3K6KA 3EAQA 5H4HA 3ZV5A 3QEBZ 1V16A 4WBXC 3C5WP 2PMKA 3SC2B 3AG6A 2EL7A 5B53A 2Q5HA 5A5DA 2GNAA 2AUMA 5CCBA 2KBFA 4WXYB 5ALQA 1UXKA 4OBBA 3CJQA 2INGX 5BNTA 3TZBA 3Q85A 2QTNA 4TV8A 4X61A 3VKVA 5FBQB 5G0UA 1K6EA 1M2GA 2XWBF 4B3HA 3K32A 1AKQA 1B6GA 2VPIA 1EDZA 1YRQA 4C7BA 4IOMA 4HG2A 4NZPA 2RI0A 4RABA 1X6VA 1QIEA 3G8DA 1KHTA 1BMTA 1N2OA 4P32A 1T1RA 1ENPA 1MQ9A 2MYPA 3B1VA 4HLCA 4EA8A 1Y4DE 3M6FA 1U8ZA 4OUDB 1A76A 3HO8A 2NLOA 2EFGA 3T1NA 1RXWA 5EMKA 1QYIA 2PHZA 3JQFC 2CKMA 4D41A 4YP5A 2QQ0A 2FPIB 3RYIB 1WBBA 2GPYA 2H4WA 4NHOA 1H4VB 3LKZA 1SHZA 3L0BA 4Q1EA 3PG5A 3PX2A 2QRHA 3A0UA 3SSMA 3IO5A 4DHWA 5AVVA 2QAIA 3FVQA 1OWMA 2I6FA 3MJCA 3PU6A 1N5JA 2IS4A 3GVHA 4N82A 4FBGA 1U0BB 3CUKA 5HDBB 1VRCA 4AY5A 3IUSA 2RCNA 2ZBRA 1QRRA 3C5EA 4Z9AA 4Q9HA 2D54A 2OFOA 2GBLC 1XBTA 1YONA 3IEUA 4MQFB 3SYTA 2NUPB 4J7XA 3QLUC 5CU7A 1LC0A 4FFWA 1RJDA 5A3SA 5A4DA 3BVPA 4PNPA 4Q19A 1L3CA 3SR0A 1FZQA 2ZSBA 1G5RA 1HYEA 4QYSA 4C6SA 1JJAA 1SWVA 1U3FA 2EAUA 4X71A 4ROSA 3SDSA 5FORA 4AYWA 2OZKA 4GMGA 2QD1A 1D2GA 2E0IA 3GLQA 1C1YA 3N2LA 4OH1A 2P78A 4RVHA 1UPCA 3C1UA 5CHYA 3W8EA 2GCNA 3FPBA 3GRUA 3TZKA 1PWYE 3GVCA 4CU5A 1WP9A 1KWGA 3RYTC 4BX8A 3MB8A 2IXEA 1ORTA 5H8WA 3ZGVA 1NBHA 4JYPA 2FZKA 1P6UA 2WJWA 5IVIA 3T3MB 3E9YA 3P9PA 3C1TA 2CV2A 2W6ID 2GAFA 4J7UA 1NOJA 1EQAA 2H2IA 1XWFA 4K9QA 5EMJA 3L7JA 5AI5A 3UKJA 3H5LA 2Y2VA 1M7BA 2I7DA 3QKUA 2ZTUA 1G3UA 3INRA 3KFVA 1LCIA 4DCVA 4DQLA 4TMFA 5TMEA 1T24A 2QUAA 2ID8A 1TEZA 3U60B 1YULA 4HB4A 5K0JA 4WDQA 2XF8A 3CLSC 5AUQA 2X42A 3LGSA 5BYKA 1ZM4A 4B6QA 4WK2B 2C2YA 4PHHA 2DETA 2AL7A 4KYVA 4HZIA 4HH0A 3PPWA 3G89A 4UXIA 1UXHA 3QVVA 5F98A 1S02A 1AS3A 1WHSB 1F06A 4K6HA 4XD7A 3T3IA 5A1JA 3AI1A 1JH9A 2G1PA 1SCJA 3WZLA 1WUIS 3WQQA 3C6QA 1JAIA 1OIWA 4K86A 4UD6A 1T9KA 2OCYC 4ZCTA 1ZJ5A 4YUAA 1G21B 3IXQA 4Q4HA 2Q6KA 4OOEA 4LSZA 2CXRA 2ZYSA 3ND8A 1YZFA 5EUCA 3U40A 2DERA 3OEYA 5JPIA 5J4KA 4WSOA 3T1VA 3M6XA 3PC8A 2BMFA 1ZNXA 1SC4A 3FUCA 1IEQA 2AOUB 4Z3DA 4C7KA 2X5JO 4TWJA 4DY4A 3GIDA 4QOHA 4EELA 4Z7JA 4QRDA 5KYYA 2JFXA 4KMRA 4IILA 4EY5A 1IHXA 3OFJA 5FOXA 2WA2A 4YA6A 3OWOA 1GOTA 2Q1UA 3RFVA 3V7FA 4QREA 3ZU2A 1GFZA 2PKQP 1P6QA 3NX4A 3PNYA 4BNKA 4CMHA 1D03A 3OCYA 1NVUQ 2BT4A 2FWNA 3ETCA 4QU5A 1CJTC 1PK7A 1XYGA 2R8BA 1D2NA 3G7UA 3KLPX 2OXTA 3N0TA 2ORVA 2HDWA 4QUAA 4AICA 3QMMA 3IUNA 4ZYYA 4L15A 4YO7A 3LJKA 1ZICA 1JI3A 2IUYA 2QG4A 4IJVA 4RS4A 1WIWA 2FQWA 4LOKA 4RY2A 3HCDA 3HJCA 1SK9A 5IPFA 3W0LB 1I5OA 3T0FA 4IQ0A 1OAAA 1OE0A 1J6UA 2XCIA 3BPSA 4JXJA 4B3MB 4ZYLA 3M5PA 4B79A 3PDWA 1HNXB 2G82A 4FHFA 3UK0A 1JZQA 4HSGA 1Q7RA 2UU9B 4IZOA 5JRDS 4MI6A 4DIEA 1BOFA 1Z34A 2IXDA 3MJ4A 4N0PA 4Y9UA 2ODWA 3EHEA 3HSSA 3QJGA 1KDYA 4N7BA 1H2WA 4OVKA 3PC3A 1J1ZA 1SKAA 4LJ6A 2K2WA 1EA5A 2G5CA 5FTJA 2RGXA 4NDAA 3V97A 3EGXA 4X6YA 1LBSA 3NHKA 4PG4A 4PV7A 4RF4A 5JS8A 2QAGB 1RVV1 4DILA 1PR2A 1DQNA 2ODTX 4RIIA 2Q7DA 3K72B 1PQWA 1I6MA 1A5ZA 1JEQB 1BEZA 2AEFA 2IEBA 4UARA 5AW5A 3L6UA 2BZ0A 2D5IA 4QASA 2VKQA 4FZJA 4Y7DA 5EWLB 5HF8A 1U8FO 4N9WA 1ACLA 2DULA 5GJBA 2PJDA 3CLUC 1CZOA 1ZITA 1ODLA 3WWZA 1D4OA 1TCUA 2C8LA 1UJ2A 3HWSA 4K03A 1Y98A 4NP6A 1ZGHA 3AKYA 3RWMB 2QV7A 2MYNA 3EA4A 1ZMXA 4G4GA 3W5VA 1ZJWA 3A8TA 4B4OA 1PTKA 3PUHA 2OAQ1 4FT2A 4UCQA 2GN9A 3A4IA 2GRUA 4Z8XA 2I3BA 2E89A 2QRVB 1E0JA 1LA2A 3G3EA 5KIAA 1QZTA 1FNBA 4IIYA 4RAQA 5EJGA 2P4EA 2DCMA 1MIOB 2EL9A 3WB9A 3HE3A 4MO2A 1JIVA 2BY4A 1QIHA 1C2TA 3RV3A 4KWTA 1E2BA 5IT5A 1XMSA 1YCDA 3LCRA 2HR1A 2WYIA 2N47A 1A9ZA 3HYCA 1F9AA 3L0OA 2O3UA 3AF4A 2FW8A 3OIWA 4G07A 2BCJQ 5SV2A 4DNXA 1NW5A 2K4MA 3GLFA 4PRKA 2Z8ZA 3AVOA 2IHYA 2OBLA 4CRWB 2LKDA 2YJGA 4FYIA 1EWKA 2YIJA 3MJTA 4WBSA 3WRXA 1D6NA 2BFBA 1DIGA 3P5SA 2FHSA 16PKA 4YO8A 3E7PA 2EHJA 3PCXA 1KC1A 2PUJA 5DM4A 1JGTA 3JW8A 3R7NA 3DJFA 3U3XA 4OMCA 1WZCA 2PMDA 1QUFA 3OA2A 4MUXA 1Z4NA 2M6SA 4R5HA 4DKJA 1HDCA 4JKIA 5HMMA 2ZSAA 3CX6A 1E64A 3E9NA 3NKVA 4CHGA 1T1SA 2GLTA 3ZZNA 4M8NE 3IUBA 4HS9A 6ADHA 5GM2A 1E6WA 2BKUA 3R6WA 4QARA 5JISA 4PG7A 3UUFA 3IOEA 3BIJA 1VLQA 4X62B 2JRLA 1VLHA 3E3MA 3INYA 3FNFA 3UN1A 1Q0UA 2QMHA 1K7CA 2J07A 1JX6A 3IOCA 4G0UA 2BEUA 1NBEA 1QPBA 3RFFA 3R9XB 3F9IA 2PIAA 3N87A 1Y9JA 4RY9A 2FUG1 3OWHA 2XPCA 2FKNA 3I9OA 3QY0A 1Q0ZA 2PCJA 5HF9A 4AY2A 3ZTTA 3ZDBA 2H00A 3DDUA 3RYFA 1QIMA 2IIBA 2P8SA 1IFXA 2ZZKA 3ZNNA 2Q3JA 4I1IA 2C29D 3LCJA 1CR6A 3CUYA 2VXYA 3OZXA 4R8LA 4EAAA 4C14A 5I7WA 4NARA 1QF9A 1HV8A 1TIBA 5LB2A 2O14A 4MV4A 3G5AA 3SNKA 1MW8X 1MPTA 3OFVA 2RKWA 2J0UB 2G9QA 2FV8A 1L5QA 2QDXA 1BXGB 3G59A 3G5TA 4UASA 4BB9A 4XYLA 3DZIA 2GZ2A 4F4CA 2X2EA 1XLUA 2E4VA 2X5OA 4A0QA 4RY8A 3MIIA 4FZVA 4UHBA 1G17A 1NF3A 3CWCA 7MDHA 4OLFA 5LLTA 4AMVA 3C3BA 4JJ4A 4NU0A 2V7UA 4N47A 4AG3A 3OC6A 2GBCA 2WD7A 3OQOA 3CGGA 1KZGB 1P0MA 3EZ6A 3OWXA 5F2EA 1S2GA 1CZNA 4BGEA 1K5DA 1KAEA 5F9HA 2A3NA 3DDHA 5HSGA 2UZAA 2YDXA 3DT8A 4GVLA 4II7A 5DHPA 3R6TA 1U3GA 3NDJA 3BRQA 3KG2A 3BB4A 1VJ5A 3ODGA 3QYPA 3AF2A 4JLMA 3RVJA 3A14A 4UPEA 2FW6A 2V5AA 2XTAA 4G26A 1NQVA 2ZJOA 3HDJA 5JSHA 2XB2A 2QPOA 3UFXA 1MOSA 4KXXA 2C96A 2P5YA 4ARSA 4OBXA 2OQVA 2QTZA 3RE1A 3EXIA 2BFCA 3HZRA 1L5GB 3CYFA 4BKQA 2B4YA 2QBYA 1SOUA 1OASA 4JHLA 2BRUC 3AHDA 3D3NA 3GT0A 1OZHA 5GVRA 3OM8A 4KXVA 2AKYA 1WVGA 3BTSA 2A0FA 3C8MA 3FPJA 3GEDA 3HYSA 3LC2O 4RPHA 4PLCA 3I83A 4OCZA 4Y9SA 3TI7A 4EQ6B 4US2R 3TW8B 3HY6A 1EBFA 4NF2A 3U4AA 5L9AA 2L18A 4Z8YA 4IOKA 3UJPA 5FOQA 3G7SA 2QTLA 2XTNA 2Q5QA 3G88A 5FBKA 1ESEA 1Z0AA 3QFFA 4PCVA 4R8SA 4ZEMA 4AS2A 3ILSA 5JECA 1R2QA 4MW4A 4KQKA 5AKKA 1K75A 2REBA 1NZJA 3R3JA 2DPLA 3UUWA 1PIWA 4QWWA 4O0LA 3JWHA 4I6JA 2I4TA 4QAQA 3QYJA 2B1JA 4Q9NA 1F6WA 4MMYB 2A1TS 4BU0A 4E94A 4ZMBA 2IX3A 5DSXA 1N2CB 1XZQA 3KTAA 3M1AA 1HM5A 2J8ZA 4QFCA 4I9FA 2ZRBA 1CU1A 2C0PA 3NT2A 4KH0A 4EM6A 5AM2A 4K28A 2F55A 1DCFA 2LDXA 1PZXA 3RDPA 5KDOA 4WLUA 2HW8A 1M1XB 2WIJA 3IOYA 5DEIA 1U0HC 2BEVB 1TIPA 2MYTA 2WF5A 5IVKA 1E9RA 1BS2A 4XYBA 4DSAA 1FX0A 1ZD3A 2NVBA 2HK6A 1O97C 3H5IA 2F8MA 4GZMA 5DP2A 4LK3A 2BGRA 5H82A 1Z74A 2TECE 5F5XA 2E2WA 3MBIA 4A8TA 2C00A 1I4WA 2ZTVA 3K0FA 3T5TA 2VJAA 3TNDA 3HVUA 1UKCA 3CZMA 2P2DA 3DE6X 1PS8A 4KO2S 4BTVA 4DBZA 1WPXA 1JJ7A 1HYHA 3L9XA 4YALA 3IJ5A 4H6WA 1P2UA 1C8LA 4YJDA 3REGA 1UZNA 2WLTA 3AEZA 4EPWA 5BVGA 2B5VA 4F92B 4YXWD 2ZJ8A 3MMNA 4ZT5A 4YQEA 2H06A 4F6RA 4DV6B 2C77A 1QGAA 5ITSA 1U7PA 4JJAA 3QMVA 4AMBA 1SUAA 1LDGA 2BR3A 5IK2A 3HY3A 1TUBB 1XZPA 4O3FA 3UMFA 2CNKA 5ALZA 1UDXA 3K73O 3W9BA 2W48A 3AR4A 2K6GA 4GW3A 1P2DA 3HJAA 1EFPB 5DX1A 5B4VA 1XN1A 3B48A 4HGPA 2P6MA 1DTSA 4RF3A 1SUSA 2B4TO 1CUJA 2XHZA 3UJAA 2IP1A 2JI4A 1BS9A 3WLRA 2Z5VA 4JZKA 2ZT7A 3AQ4A 3R44A 4X92A 5EAIA 1YS2X 1JKMA 1NUSA 1T5OA 1XUOA 3A3OA 3B82A 1J9ZA 4MICA 4HFRA 1R0YA 2ATEA 5ALWA 4QG3A 3EPJA 1HE3A 1BQEA 1KXZA 1XAIA 3L7YA 4M7WA 3KR0A 4RTJA 4UCXA 4JGBA 2CJWB 2HXYA 3AEQA 1Z28A 1XLWA 2JHCA 3L0ZA 3SVZA 3UPDA 1NASA 2OV4A 1NVTA 3ANTA 1H0SA 2PEYA 2MU1A 4H6PA 3U4CA 1F1BA 3DBLB 2WJVA 3H97A 1YFLA 1Q0TA 1QG6A 4GDFA 1EESA 3DLPX 3K9WA 4Z4CA 1IMJA 1RCFA 4HQRA 3QE4A 4RMHA 2R7NA 1S2LA 3O9ZA 1WQ1R 5GOZA 4I99A 2WIFA 2G63A 1AF4A 1YIDA 1ZISA 2QSJA 2V9CA 3IXMA 4K8RB 2GEBA 4UPVA 3MTDA 5A9TA 3VR4H 1QP0A 2QVLA 4G23A 1VSTA 1DNPA 2GILA 4QUBA 4BQQA 2WE7A 3FHCB 2RK3A 3PTAA 3IAM1 1Z2EA 1ECLA 3X1XA 1H8HA 3IOBA 4Q18A 4NJEA 4BO2A 2ZJ1A 3M34A 5E2BA 3A2NA 2NU8B 4FFBA 5D00A 3A32A 4BP8A 1D7OA 3LUGA 4OMDA 5D6OA 3GAFA 4YRAA 3QXXA 4C0SA 2VHCA 5IDWA 1HFWA 1D4ZA 3H1GA 4X8LA 4F97A 3D4OA 2VUIB 2XLCA 3WKAA 3F7MA 3ZDAA 1KORA 2FHPA 2BL4A 2OZPA 3G82C 2OBBA 3PJGA 4O08A 5AUNB 3F0TA 1I6LA 3TQFA 1RADA 4ZCIA 5NLLA 4DJTA 3S81A 3O3OB 4F6LA 1H4QA 1CZUA 1LK0A 2JFQA 1YB5A 1ZX1A 4P22A 2V7XA 3I4FA 5JQWA 1UMDB 4BKPA 1JHYA 4A0RA 2DPYA 4FGWA 4RPIA 4JOCA 4O4IA 2Z43A 1L1QA 1DLIA 2XNSA 4CETA 2FPMA 3DBHB 2JAQA 1INLA 3CX3A 1TA0A 3D0QA 1NVWQ 4M1OA 1NJGA 4HWKA 2IDMA 4LX8A 4CQMA 1RBYA 4NYJR 1L8AA 3UANA 1GKIA 3VHLB 1VDZA 1ZCAA 1J20A 2HDHA 3I5AA 1LBIA 4ZOLA 5E4YA 5C7YA 5EJFA 2F4VB 1HE1C 1D0VA 4A7PA 4UCWA 1QRSA 4NYMQ 3TM4A 5ALHA 2D8MA 1Z8NA 1YZGA 2Q99A 2VAPA 4MCJA 4QC2A 5EMMA 3A6DA 5EHGA 2D0DA 3ZWVA 2FGKA 3PUWA 4R7GA 1T6NA 1I51A 5EKTA 4D43A 4JDUA 1YIAA 2I3ZA 2AFRA 1U8CB 2DUJA 2W6JA 1XF9A 5TY0A 4BE7B 2Q5CA 3IS3A 1E3IA 3IHKA 1XG5A 4PX9A 3OZAA 5KKAA 3UHOA 4DV2B 4EUHA 3ZCTA 2X6QA 1XRMA 2PX4A 1C0KA 4UFPA 1L1FA 1U2GC 3CCFA 4I4TA 1CRLA 2ZAGA 5B7GA 2DC1A 2DH6A 3UICA 2E21A 5IMSA 4FB5A 2NZXA 2PJRA 3AFIA 3BWVA 3ZZ1A 4G0WA 4UEWA 1P72A 1DEAA 4GM0A 3VC3A 3QX3A 3B3QA 1SEVA 3OLQA 5TVGA 2XXJA 5L3QB 1H2HA 2BHNA 2GA9A 3UV6A 1IM2A 5FO0A 4X1IA 3UGKA 4C7OA 5KC8A 1IPHA 2IYFA 3B2EA 4LRUA 3PFBA 4QQKA 5K3FB 5IJ0A 3GOQA 3PIIA 1XEAA 5JC1A 3U5ZB 3U7HB 3A25A 1UDCA 3CTPA 2VRBA 4J1TC 5GONB 3FJYA 4E30A 4GP9A 4Z7NB 4OLAA 4R0MA 1NFQA 2Y99A 3PQCA 4R9RA 3R9WA 2C5FA 1QIIA 3KKMA 4NPHA 1B0PA 2ZJ5A 1FTYA 4IICA 1ACJA 6CHYA 2VF5X 2DFTA 2C9DA 5K0SA 3EZ7A 5HK8A 1B23P 1CY7A 4S35A 3RTEA 3E5HA 2QSUA 1SQGA 1Z9BA 3RK4A 2NZWA 4FYVA 1W85A 3P5BA 3TTSA 1U0NA 3S44A 2VNAA 2NYVA 3OMWA 1JI0A 1FS4A 3VKUA 1XMIA 1DELA 2CFRA 1WSAA 3I2GA 2MHCA 2R8XA 1CF2O 2VXCA 4AECA 5HK9A 4YCMA 1J99A 5F35A 1OILA 2A9VA 3UMSA 4ZKEA 1I1NA 4HDKA 1ISHA 1UUFA 2QTFA 2OENG 3VYRB 2H2WA 4ACBA 1R74A 1UINA 3GI1A 1KJYA 5IUJC 1LQ2A 4B6GA 1QYXA 4MJ7A 1O4WA 5I7AA 4M83A 4BJHB 1NTOA 4AO8A 5JVDA 3MWJA 2JGEA 4EVRA 3GO4A 1OR8A 2B7LA 3EVNA 3EIUA 3KLBA 2VLIA 2ID7A 2NTJA 2GM4A 1Z7YA 4E08A 3VO8A 1UXIA 1JXAA 4DJJA 5CLJA 5KTRA 3KKKA 2BR5A 2VPTA 4UDNA 3IJRA 4Y2YA 1QOQB 1XTBA 2IQ5A 1DU4A 1XXLA 1Q2XA 5LWQA 3ZWWA 1P2BA 2JI7A 4ZCLA 1RD4A 4MW7A 1R9MA 3K0SA 5FWDA 3WGGA 4RZXA 5TPWA 4PTZA 4MIEA 2C7OA 1WPQA 1GU7A 2FEPA 4A8JA 1F20A 2VBCA 4HZGA 4XIIA 2P2LA 1NJ2A 1SCBA 2UAGA 1Q19A 2R00C 3ZN2A 3OURA 4N1AA 3LTEA 1IZZA 2V6IA 4PSAA 4W82A 4DT1A 3D4LA 4JBHA 5HF6A 2OO5A 3M5CA 4HBZA 5KWJA 2NOAA 1XDGA 2Q3CA 1OXVA 2ZJFA 4QTUB 4ZPXA 2AK3A 1NYLA 5AVXA 3OPMA 6PFKA 3GG2A 1IATA 1Y8QA 4QATA 2FN3A 1T13A 2NNWB 5LDDC 3I05A 5IKXA 4Q48A 2D7CA 1ODCA 3QXHA 3NWPA 3NJ8A 2QZSA 2CMKA 5JSUA 4K0KB 3U56A 1V8PA 4PRYA 3IAS1 2PMBA 4ZAGA 3TG8A 3K9GA 4IDDA 5I9BA 3SLGA 2ONCA 3RT7A 3NV7A 5JAHA 3VUFA 1JILA 4ZCRA 1K88A 1LNSA 3E61A 2VJMA 4GI7A 3O9MA 4U9UA 4KPYA 1A9QA 2NO1A 1QBGA 1K8RA 4G9EA 2DT8A 2RARA 1SHKA 4P4SB 2XUKA 3Q5DA 5A3RA 4LAFA 5CTJA 1N2CE 1PEDA 3HGMA 1E1MA 1GUZA 3R5KA 1N75A 2JLAA 4AL4A 1CUDA 1XRRA 2NZYA 3SE0A 2GH1A 2AX4A 2Z5FA 3DBIA 2J3QA 2VDJA 4X1YB 1ZK2A 3PQ8A 1T9GS 1KO1A 4RKFA 5IVHA 5HYVA 3NHMA 4II3A 1MJ5A 1TLTA 3KXLA 4DMKA 2HYDA 3KVOA 5HKAA 4FNGA 1S2OA 3GL9A 2XVXA 3H9JA 1XKLA 4GMXA 4JMLA 1ADYA 5EERA 5G02A 1XVTA 5A6SB 4HMOA 10MHA 4F8EA 4ZEXA 4EDFA 5MFPA 5LPNA 2P9JA 2BTEA 1MW9X 2A84A 1QP8A 4MGHA 4C06A 4LXUA 1B76A 3FYSA 2HO4A 3WNBA 3JWIA 4ENRA 5DM1A 4E22A 3MHPA 2I4LA 3MWLA 3EXEB 3PXBA 1AV7A 1Q6YA 2WG1A 1Z17A 3ODPA 5B30A 4BFLA 3COVA 2WMYA 1RE0A 2WYVA 3AJEA 4CTKA 3T52A 4DNOA 1O0CA 1DTEA 1FTQA 1ZH0A 3K8OE 4QKQA 2ZIUB 4KGZA 1PR9A 5CK5A 3ORSA 1JB1A 3W5AA 2EBFX 4G8BA 3BZWA 1U2GA 1ORIA 2W2QA 3P19A 4A16A 4QUHA 1UAYA 4CLOB 1NFRA 1E2DA 4X64B 3N75A 3PLRA 1W88A 1VXRA 2ZUVA 3KX2A 1C7FA 4LRTB 1A7KA 3VC2A 2CT8A 3CF4G 3OJCA 1EDBA 1FRZA 1KSHA 4PYIA 4Q9JA 3ZIAD 3CO5A 3QVWA 4YGYA 2B8WA 4ANFA 5GGXA 1FS6A 2CV1A 4B43A 4F2HA 1TIKA 4WY5A 5KDDA 4NATA 3HA2A 1JN0A 4LXGA 3MEQA 3TZEA 1KQGA 3HYTA 3HXTA 3P0EA 3SR3A 4AP6A 1TCAA 1P73A 4IGIA 2VRNA 1E3LA 3MG9A 4OFXA 3K2EA 1QYWA 4UHEA 1M2HA 3CWQA 4TTQA 1TJ3A 4BJ6A 5FUBA 4LF5B 3M4XA 3WNCA 2ZLBA 2PBLA 3KJQA 3ER8A 5G3ZA 2GQ0A 3QVJA 4OM7A 4PZ9A 4Y2HA 3HMQA 3WVNA 2EZ4A 2AQ8A 3NV9A 4L8LA 1OHHD 1FXSA 2KHZA 4OJTA 5HFJA 3BM5A 4F91B 3EDQA 1UC8A 4KK3A 2ZIZA 3K5WA 4O33A 4ZQGA 5IAKA 1F4LA 1UOQA 4NBTA 4QDJA 4YY3B 3LRTA 1C9DB 1EGAA 4K26A 2PKYX 5AHWA 1YA8A 2UUBB 3QOFA 4HMPA 1EHCA 3ROXA 2ZIXA 4MJLA 4JODA 4UVDA 2WG0A 1LTQA 4I55B 4QNRA 1D3AA 3QK7A 2DFNA 5GGYA 1Q7TA 5TEVA 3W1WA 1EDEA 2F9LA 1JIXA 5DM0A 1IWOA 1ZJ6A 3QELA 4OGLA 1G63A 1Z0ZA 2VDUE 4XGQA 3KKEA 1KYIA 1JE0A 1JKXA 3EW9A 1EINA 1CNEA 1H2BA 5ITVA 4IL5A 2PVCA 3GT4A 1RHKA 2BBWA 2B4KA 4X54A 1ZM2A 5EZYF 3ZWMA 1GUAA 4X7BA 5FPTA 2ZI7A 3NIBA 4UQOA 5I9LA 3U7GA 4F4IA 2W98A 4JEHA 1B74A 2JARA 2HQBA 4CMBA 4LQLA 3SBEA 2O8CB 4YMHA 3DM5A 3BDIA 3HB5X 3SC2A 1EK5A 1WD7A 3T12A 3EA5A 2HF2A 1Z13A 4QU8A 3F2IA 1Q91A 3MXOA 3FPKA 4DNFA 5IM5A 2I2DA 1Z2PX 2XMBA 4RH0A 5ED0A 3U39A 4JLNA 2IHKA 1QH8A 1RDFA 4DANA 2ZYRA 4YAUA 3GMTA 1E1NA 2F4NA 1CKEA 2ZK7A 4PXSA 3O91A 2G9RA 4F1KA 2PXAA 2X9LA 3A3YA 3BBLA 4MTLA 3MK31 2OV2A 3PDIB 4XCQA 1V39A 2CLKB 1X3SA 2RAPA 3RFCA 3RTBA 1E6UA 3WYCA 3R6GA 4ACAA 1N32B 4EKEA 1CF9A 4ZDJA 3ER9A 4REQA 3LBIA 4LJ4A 2OHOA 3MGAA 3LYAA 2NU8A 3QXGA 4F3NA 2MR5A 2R68A 4H2DA 4Y6SA 1QHEA 4U2EA 4Z54A 1D07A 2G9NA 1QQ5A 2J5XA 5EJ6A 1YVPA 3ZWPA 5DXFA 1NXXA 5J4VA 1N34B 2G88A 2XVAA 4ZN6A 3JRNA 4CI0B 4N39A 5CA0F 1GTL1 4R51A 3ZWXA 1OV4A 1L7MA 1JFVA 1ZRSA 2ZIAA 3I4CA 3KHKA 1JB9A 1NP7A 1QZZA 1ZG3A 2VQ3A 3C6YA 2YR0A 2FWJA 4GGMX 4JGIA 4Q7JB 4DSZA 13PKA 3CKLA 5ADVA 4B9EA 3K05A 3R0XA 4Q3CA 4RCVA 2H7XA 1IBMB 4FNAA 3A6LA 1HT0A 3ZV4A 3IBSA 4E2ZA 1TM2A 1ES9A 1KAOA 4LZJA 5L7YA 1BS1A 2FCRA 2ZSEA 3VJKA 3ZY5A 5C35A 4HZUB 3LOQA 1N33B 2W8BA 1SBHA 5HW0A 4G1VA 4IYJA 2JGRA 1U2ZA 2J3JA 4PC1A 1CP2A 3GJSA 5E6UB 5EJ9A 4LIPD 4RD1A 4KQ2A 4TPKA 3EX7C 4ENSA 3OUZA 3NVAA 5L7WA 2I66A 4ZEVA 4UQPA 1JAHA 1ZDMA 5BYBA 2DCUA 1NMQA 3QVXA 4QJ3A 1X39A 1YKGA 5IJXA 3CLVA 4RQUA 1C1XB 4RA6B 3UK1A 4KAJA 3T5GA 2OECA 3V1YA 3G85A 4E14A 3PGLA 2PUDA 2B61A 1ISMA 3BHIA 2FR8A 3KZOA 4IUDS 3M6LA 5FXMA 5CB4B 2PZJA 3GGPA 4HXFB 3UCFA 1GU1A 4MS1B 1UP7A 1SUWA 3FRIA 4ZC8A 5ESDA 2X76A 1B8VA 1EFPA 1VE9A 3A4YA 3L0PA 3L43A 1UJ4A 1I3OA 4G2TA 2H4JA 1ECJA 2FDXA 2GTIA 2DYKA 2VJKA 2PGJA 1JMKC 5LA6F 1W2WB 3ZXSA 2ZBQA 5EZSA 2PQ2A 2IY7A 4NCHA 1LX7A 1YOBA 4AKTA 4L8YA 2BMEA 4X85A 2XCQA 2PYDA 3IV9A 3D6UA 3U44A 4TS1A 2E9SA 5FULA 2WQ7A 2W58A 1VJGA 4NZOA 4LC9A 1JS1X 1FYEA 1WMBA 2GZMA 2X7HA 1H66A 1R8SA 1XQVA 3JQRA 4NYIR 5GJCA 1IOWA 2P2YA 3MQ4A 3T06B 4YJ2A 3PNLA 5LZ7A 3AY3A 2P8JA 2W2MA 1W9HA 4KN6A 2ZBPA 3INNA 4NVRA 1Z4MA 3WZ2A 3CBQA 4S3MA 4WKOA 1JNYA 1RAAA 3NHSA 2YW9A 2GYVA 2RHMA 5DYTA 3QSYA 4EY6A 4WA7A 5BWBA 4NMXB 2IEDA 1IEVA 1PNQA 1PSDA 4EF6A 1K92A 1Z4KA 2PUCA 1I1QB 2C2MA 3LUJA 4C0BA 3M83A 1GGMA 2R97A 2NUAB 4OHRA 1WKCA 4YJ3A 4KTTE 1OIXA 5IDXA 4WMLA 3FPCA 5ALOA 4P82A 1KPIA 3FMIA 1JR2A 1EFDN 1QP4A 2PZBA 2UZIR 1FNMA 2OZLA 3BD6A 3U7JA 3UAVA 1O6GA 4P84A 1YR3A 2POCA 3ED1A 3UAZA 4A03A 2PSEA 4NBLA 3V1UA 2ENWA 2A0XA 1TD9A 5A5EA 2HU5A 4DABA 2E1PA 1BMFA 1N8NA 2J1LA 2D1QA 1JXMA 3BHJA 4FCCA 1GT6A 4L16A 4V03A 1F0NA 3F7NA 5E4JA 3ZY3A 2P2GA 1SXQA 1XL0A 3IBTA 2RHDA 3RREA 5KJCA 4Q82A 4WN9B 1VHWA 4TZKA 3R7WA 1A2OA 3E23A 3NFYA 3W2IA 4E4RA 4EDHA 4AN1A 1JZSA 1L6IA 3COZA 1ILEA 2CCJA 3X1YA 2DUUA 4GH5A 4YFVA 4A6EA 1YR6A 2GJKA 4CV0A 3PFCA 2YQZA 3IB3A 5LA6A 4ZJZA 4OSPA 2QN2A 4UNQA 3UB3A 2RBEA 1KEZA 2JVJA 3PFHA 5F52A 3AMVA 1Q3KA 3QOXA 2RD2A 5EPEA 2BFCB 1GNQA 3L41A 1WO8A 3QUQA 4XH9B 5K3SA 2D0PB 1XYYA 3FTFA 4IX9A 4GSYA 2E55A 2PRSA 2ZAYA 5G3YA 3FVVA 4FQ5A 1LK5A 2Q0SA 1DWQA 2QW0X 3GEHA 3C39A 4KAFA 1KI8A 1T35A 4I9UA 4U02A 1NLZA 3DFKA 3LBNA 4LQCA 1WNFA 5C5DA 4ZQHA 2VUSA 1N6IA 4C4OA 2FX5A 1VB5A 2IPNA 2H7VA 4H7HA 4Q39A 4RD6A 4LNUA 3RUFA 1W73A 4ZVRA 4BP3A 3LUDA 2AIRA 3HB0A 1YCHA 4JU8A 1Q14A 3SHOA 3SFVA 5H59A 4QBTA 2IUUA 1TKAA 1ZRHA 4OAPA 4O02B 4ZICA 3LKDA 4AJKA 2JJMA 3FOZA 2XX3A 1W8DA 3C6BA 1IQPA 3D0RA 1LV7A 4TWZA 4ZXFA 4INZA 4BJ5A 2DTXA 3MOGA 3P20A 1Z4LA 4J0FA 2J87A 2FLVA 1SU8A 1FDWA 2C88A 2J9YB 4YWJA 4D4KA 4CODB 4LC0A 5COAA 1ONBA 3GC6A 3TLGA 2WUDA 4AS3A 1P75A 3TD2A 1XTQA 2VCYA 3RRZA 5IKMA 1FMFA 1Q3HA 5F2OA 4ZOQI 3A2LA 3L1HA 1DS6A 4TMZA 4JJFA 2X6RA 3B7PA 3QU4A 5JDIA 1JBKA 2XR1A 4IMIB 5DNCA 3ICEA 4GL2A 1KC3A 4DDVA 3EYWA 3LUCA 2CDAA 1E4OA 5LNK1 4IHJB 1II0A 1B16A 3D6HA 5ADUS 4F7DA 3AFNA 3OUUA 4F3KA 2BJHA 1F38A 2OO3A 2JJYA 2Q8PA 3PV0A 1FXWA 2RFLA 5CR9A 3GPLA 3GCDA 4P31A 5AUPB 1JLLA 1IPEA 1QGDA 1QR6A 1VCHA 3P9SA 1X7YA 1G8FA 3R3HA 4WN3A 1PW5A 4HDNA 1C7EA 3X0DA 1SEPA 3DFUA 4K6OA 2WM2A 4PQRA 5C8YB 1X3LA 1EWRA 5H1YA 1X42A 2GO7A 2XLBA 3F97A 2OPBA 2XT9A 3O1LA 5FPSA 2EYUA 4D81A 1MX1A 3A05A 5F3WB 3UW1A 2XBLA 1TMYA 1W2HA 4U2DA 3KL4A 2P6RA 3KLOA 1R10A 1CUZA 5HKOA 1V6SA 2QLFA 4Q24A 4MITA 2ZUEA 5DNDA 2VHJA 3E9MA 3N2NA 2DOKA 4JLBA 1WEHA 4KUGA 4PAGA 2XF2A 1WXDA 3P7MA 3QX9A 4J8PA 1DMSA 1C0LA 2OAEA 1YDHA 4KDCA 3FHOA 2HBZA 3IELA 4MUNA 3ROFA 1IHOA 1KJWA 1Z7EA 4A9AA 3OETA 5E9AA 4P7JA 3AZOA 4U63A 4R2XA 4RIEA 1Z37A 4EHFA 5MGNA 2WW8A 1HE8B 1T3ZA 3BRSA 3N0VA 4P54A 4KNYA 3GFGA 5E8RA 2H7YA 1EFUA 5BWNA 4QECA 1RKBA 4HNAB 4L85A 3WIVA 9ABPA 5C37A 1HLPA 4OGFA 4BKMA 3HA3A 2G76A 4RV9A 1EXVA 2JG3A 4NI5A 1WZ2A 2QVXX 3U3MA 3G2QA 1KP2A 1SCIA 1NN0A 2XUIA 3JQ7B 3H8JA 1X0XA 4HX9A 2BM8A 2JAPA 4WD3A 3N2YA 3C8UA 4M8LA 4M53A 3HVJA 3OKAA 4RJIA 5JCOA 4JVLA 3AR7A 1ID8A 1PFVA 2B21A 3IP6A 1DX4A 5EXPA 3CEAA 3CRZA 1GTZA 2UV8A 3N39C 4RL6A 3TNLA 5A1TA 3KQHA 1B0ZA 4LWZA 3HR8A 4Y9TA 5BMVA 4LZWA 5LQUA 1ODJA 1EU1A 5CXUA 5J5VA 4E5SA 4TOIA 2F17A 1ZN9A 5CXQA 5H3CA 2C5LA 4U7WA 2DPXA 3BRWA 1E6EA 2XTZA 1J0DA 2P9HA 4WZAB 2IF2A 1RPNA 2A1UB 5HS4A 1HNZB 4L5IA 1JQAA 1QS0B 3WB0A 1HRKA 1QF7A 3R77A 4I8XA 1SUFA 3P9KA 3CX8A 4N5MA 3R5TA 4LJ8A 5DULA 1VPWA 1DRJA 3K9QO 3E7FA 4P08A 3EVBA 5E1MA 3UMVA 5LU8A 4PHGA 4US0R 1KGDA 4TYMA 3G2OA 3AVYA 1IIBA 1U1GA 2GASA 5KQSA 2QTVB 5HZGA 1UBGA 4DR7B 2O8FB 4G84A 4MQUA 1UIMA 4TTAA 3Q3CA 4ZGWA 1KDRA 2XWQA 5E9QA 3V3KA 2IUFA 1YJBA 1U4SA 3E84A 3K9NA 1SKYB 3AV0B 3V8PA 4BWFB 2H17A 3VVCA 2FSVA 3CIOA 5BXQC 4D3SA 4I46A 4DA9A 3IAAA 2RHRA 2XBMA 3KOXA 3QZUA 2IWHA 3TUJC 4RD2A 5JDIC 2EQAA 3F7TA 5EE9A 3I92A 1KFKB 1KNXA 5BSTA 4OAQA 3KSZO 4CW7A 1RE1A 2ZR0A 2H4YA 3ESRA 3FYDA 5B6JA 3LX4A 5CT5A 3FWKA 2X5XA 2W4MA 2C04A 1DIHA 3KEOA 2BE9A 2I65A 2V8BA 3CR3C 4MKGA 1AY0A 3CWZA 2V7QD 3K4PA 1PJ3A 4MWSA 2RC5A 5T5QA 1UFKA 1YJQA 3ISVA 5EMLA 3ZV3A 1DJQA 2GM5A 2AC4A 5FLYA 4CKCB 2QROA 1CTQA 3M3PA 2VAVA 3I72A 5DO9A 3GNLA 3ENVA 1E0DA 3VJLA 2VF7A 3W2FA 1KZ6A 3KZXA 4X44A 5CTAA 4DYVA 4JXZA 3HN7A 1XHEA 3NHYA 2I29A 2O4UX 3GJXC 3FNEA 4TMWA 5C7LO 5KYUB 1SKYE 3P45A 1V25A 2QPLA 3GDGA 4LJ7A 3QOYA 2D8AA 1E1YA 4HWGA 4M9UA 4B3GA 2FPWA 3VHQA 2PUVA 2WSLA 3OJLA 3UY4A 2C82A 2CWDA 2WV7A 4RHUA 3E03A 5FUQA 2G7MC 1E3WB 1Q5PA 2HU2A 3TIXB 1VKJA 3IJEB 2IYTA 4IIHA 3EGEA 5DOVA 3ETLA 2WT4A 4K9OA 4UTRA 2Q3BA 1EKXA 3BMCB 3HA5A 1GZ7A 2C95A 1IHPA 3SZMA 1GKKA 3O8RA 2KB0A 4G01B 3C74A 2ADFA 1JDPA 4FK8A 4IJKA 4UMDA 1FYFA 2G8NA 5IF3A 3VZRA 3OZSA 4OI0A 1VGRA 3IVAA 2JLUA 4IRXA 1BJTA 1RMQA 4Z5XA 5U9CA 2PWBA 4KXQA 2R5FA 1IUNA 1DADA 5EQJB 2N1MA 3TTUA 2H1FA 1PYOA 4PR0A 1T10A 3KQSA 4DM4A 5IT4A 2FRXA 3D7SA 3T0GA 3PQFA 3V2IA 1UOPA 2MSWA 4FJ2A 5JI2E 4LNHA 3HL0A 3V48A 1GL9B 3GRFA 4OSEA 3UQZA 4QXOA 4C1NA 4EYQA 1OF1A 2QTGA 3MMXA 3PF9A 3I73A 1E2MA 1Y5RA 3D8UA 1ESNA 3R7LA 5JO9A 3SX2A 3V4PB 2ZBFA 2AMYA 2PX0A 3HWWA 2WIBA 3HXKA 1L7EA 1VKOA 5J58A 3OESA 1AHNA 4LF4B 1A9XB 2GXUA 4XPZA 2CY0A 2I6XA 1PNRA 2IOFK 1Q7CA 3QKRA 4XWYA 4WBNF 5AW6A 4LOLA 4GZ5A 4I1UA 5JBNA 1Z08A 1NQ5A 4BFSA 2WZDA 4RKWA 3PCRB 4RFLA 2JA1A 5IDQA 1A88A 3TH5A 5ITZB 1TO2E 3UATA 4WKCA 4XWAA 4JLAA 5P21A 4L28A 1FQKA 3HCBA 4XUCA 4ALLA 4BMDA 1JHMA 1E3WA 2DFVA 1V96A 1U9CA 4OPMA 1BQ4A 2HXGA 3I6MA 4JSRA 4UE2A 3SGLA 2O6LA 4UMEA 3BMOA 4E2XA 4WXRA 2ZJ3A 2TSYB 2Z1DA 3JD1A 3ZD9A 3GJ0A 4B5LA 1H4TA 4HTFA 2WVHA 2CLLB 4DADA 1K5PA 1FXUA 3SZGA 1D04A 1N1DA 3DL2A 3DMHA 3PKIA 3ZWCA 2AN3A 2VSYA 3LHFA 3TYXA 1U1DA 3AF0A 3K2BA 3HG7A 3T9EA 4DLZA 1XRJA 4Y0NA 5EA2A 1HXHA 5DX0A 1T0PA 5JQGB 1DXHA 4X8OA 3NBQA 2OMKA 3HWX1 5K6RA 4Q4LA 4AP5A 2RIPA 3IUQA 3K1YA 4GQBA 4MB2A 1XO1A 1FBTA 3LGXA 1CX9B 4WESA 2BN4A 1KZ9A 5DTIA 2LKCA 4FFVA 3WLAA 1RZRA 1H4SA 1AKMA 3MFYA 5IKEA 4N8EA 3WLIA 3C3EA 2LDBA 4OHUA 1EUZA 1ZHHA 3F6RA 3IP5A 5K0FA 2HQ1A 1DT3A 2JFWA 4S1PA 4DCJA 1OGIA 2J7KA 3RIHA 5ARCA 4BNLA 2FFRA 3B5JA 4D74A 3CGWA 5FAKA 2CBZA 3CLTC 3KK0A 1Z6AA 4AZTA 1WW3A 1IN1A 4DF3A 1O94D 1XSEA 2JIDA 1YI8A 2FG7C 3HKEA 2IYOA 2P2SA 3NHWA 1XROA 3F49S 3OJFA 2HV8A 3U6BA 4FYJA 3IESA 3ZEAA 4TTIA 2Z04A 4MVJI 3DEZA 4UUQA 2WYUA 2HLDD 4YIKA 4GKAA 5GADl 2F8LA 3EVDA 3LRPA 3NMUF 4FOTA 4HPXB 3QTBA 1H85A 2EV9A 1ZOPA 3FB4A 4M0FA 4CKXA 4GLJA 4CIWA 2Q4OA 3A3NA 2BDTA 3D9QX 4GX2A 5FP0A 4R69A 1A98A 1D8TA 2H29A 2BHRA 1IXKA 2OP0A 2Y0EA 3N3AC 2IZ6A 4EL0A 3B7WA 1U9ZA 2WUGA 4LZOA 3V6MA 2WD8A 5HIMA 3INTA 4P3NA 2QB5A 3OD5A 3BUSA 4EECA 3BE6A 1AZWA 1CY0A 2Q1YA 4C0KA 3EFHA 1FEZA 4V1CB 4J2TA 2GD0A 3OZVA 4YCSA 4JWTA 3PNKA 3F4LA 4QU0A 4HT3B 2O20A 4CIVA 4KOEC 1E60A 2AX3A 4IIDA 2VR1A 4WXEA 2F43A 5CDTA 3QBEA 1YZ3A 1V5FA 1B6RA 1SCKA 5HE8A 1TVEA 3BGWA 1CERA 4HPJB 3ZV6A 5EXXA 3NNSA 2QRVA 4OM8A 3D3WB 4Q3KA 1W5AA 4G0MA 3L7DA 4ZO8A 3UB2A 3RT9A 3UXEA 5EL0A 2HBRA 5I9SA 1YS1X 2W00A 2V3CC 1RC8A 2ORYA 4LDNA 1AN9A 3C6MA 1F8UA 4JCCA 4URVR 3VUEA 1XCOA 3WDMA 5LMCA 1YUNA 2YXNA 2ZRJA 3A1DA 4PLWA 4DAEA 3FPAA 1XTKA 2A0WA 4LECA 3WYAA 5KMGB 2H1LA 2JCGA 1K9SA 4OQ4A 3UAXA 1GTSA 1ECFA 1YHYA 2O2HA 3NIGB 3U1VA 1DE0A 1XJ5A 4WZBA 4U8HA 5BVHA 3WO0A 4WKGA 1EWQA 4IIJB 3WMXA 5L8VA 1OXMA 4GMDA 1GRQA 1BYUA 5K1ZA 4C0XA 3VNVA 1EE1A 3FH0A 1P9NA 4G0ZA 4YUWA 4HDKB 2HL6A 2ZSFA 5KWVA 2ZBEA 3WDSA 3ZQ6A 2EERA 3DLHA 4A8JC 2V6GA 1G38A 5B1HA 3AVTA 2EJWA 2GK6A 2JS7A 4M7OA 1WTAA 4AJEA 4L4YA 5A3QA 2HSWA 1EM6A 1U99A 2RH5A 2IU6A 3HP1A 4HEQA 1E3QA 4CEJA 1Y7TA 2AOXA 3IMFA 1RBMA 1L9KA 4G0OA 3SXPA 1KTIA 1YS4A 3RAJA 3RPEA 4B0OA 5KS2A 5DM70 1NVAA 2EW8A 3BT7A 3V9AA 2XGSA 4ZEWA 2F1JA 3X1ZA 5JSZA 3FN4A 2HQRA 1TU3A 5LYYA 2V7WA 2VP9A 3OIYA 4M1ZA 4RE6A 4QPZA 4UTOA 1FA9A 3F4BA 5DBGA 5HM8A 4LFAB 1HTTA 3ZGZA 2DSNA 2NW6A 5DCLA 2B35A 3OX2A 4MJXA 3RIEA 4EB0A 5LZ4A 2WOOA 3OU7A 3FLBA 4Y9RA 4LQ4A 2OSBA 4G1FA 4JL6A 4Q3DA 2BI8A 4HDNB 2XHEA 2Z2JA 2IX9A 2WYOA 2XRZA 1XWIA 4RHFA 1S7GA 3AGPA 3OKFA 1EPUA 3FFXA 3PT9A 3S29A 4NBNA 2O2JA 1T8TA 2R0QC 2W2PA 2OHXA 3H6KA 1MMFB 3FSRA 4WKPA 4BNDB 2V7TA 2XQIA 5EVJA 1NUTA 5DZSA 2FK7A 2AOUA 1NMZA 3HDHA 8GPBA 3JZDA 5J59A 3GZNB 3O4HA 2NU9B 4CR7A 5ICMA 3EWSA 1JSCA 3VTAA 4GWLA 4KBFA 4N7RA 4PZAA 2AJ8A 2PKCA 4MKIA 1E4EB 4QHTA 2J6IA 4YRPA 1R12A 4M8SA 4JQZA 2P3OA 1M6WA 1EEHA 4YJFB 4EHBA 1VYHA 2C92A 3IAUA 2ZI3A 3N3BC 1MA3A 1L4FA 1YJAA 2G1KA 4AKSA 1E1QA 4MP6A 2NT4A 4X0EA 3P2KA 1JLSA 2VUTA 1XK6A 2ZIVB 3EY4A 8ABPA 3RRJA 1CEEA 2H07A 1YFZA 1UBKS 1UCFA 3JALA 1Q6ZA 2DY1A 4C4ZA 2AMFA 4H77A 1GZVA 2FPKA 3CHYA 5HG0A 1G20B 2XMQA 3IP9A 1NLFA 5H5JA 6LDHA 1SZDA 3KU1A 4E4TA 1P45A 3B8EA 3DPSA 1S01A 1JBEA 1JTEA 1RQ7A 2QXYA 2GF2A 3Q0IA 5CPBA 4J49A 1ONOA 4CM9A 2MMGA 3VFDA 1YDFA 2NYAA 1VCNA 5DBHX 4JV5B 2JDIA 2WTEA 3ZV7A 1GEGA 4DL9A 5C1PA 5JH7A 1QAOA 4JUCA 3MTBA 1ISIA 3IP3A 1CWUA 2QX9A 1D2CA 3DDWA 3LPCA 3KSUA 5GZ6A 3RSHA 1US8B 1DKQA 2FVYA 2PGOA 5L95A 4C3VA 1PV2A 3A1NA 3RIXA 2R3SA 4TTJA 2IE8A 4CF6A 3K2QA 4EF5A 1OQAA 2M32A 3BFVA 3G2PA 1N6KA 3QWHA 4G1BA 4TTTS 1MIHA 2C4MA 4KFSA 3FWHA 4KH1A 4WKNA 2R1VB 2JGFA 4WY2A 4A73A 4BVFA 4CMGA 1BVYF 4LRWA 3G13A 3IFSA 4WBNB 3UWSA 4B7ZA 5CBPB 1GSAA 4CHTA 2NUPA 3NM6B 4QUJA 3CTMA 1KKUA 2WF8A 1OYOA 4P7KA 4WN9A 5KYXB 2GK7A 3T15A 3AR3A 3ZQKA 3QY9A 2GESA 5AESA 4TXHA 5JS7A 1WEKA 1XJCA 3L07A 4N76A 1NNUA 2WINI 1C41A 2C3MA 4I1SA 4RK4A 1SIOA 2FOIA 2PGDA 3IIEA 3LLVA 5H02A 1QFYA 1Y9ZA 2WAYA 2HC9A 3TEMA 2BISA 2NO4A 3F71A 3IMKA 4OYRA 2HA5A 5EOVA 3O9VA 4EFLA 4QM6A 2ET6A 2YJ3A 3SI7A 1CBUA 4IVQA 1DFHA 5C2JB 2Z1NA 3WB1A 1RCTE 2O05A 4NMWA 2BZ1A 1MC4A 4CUKA 4U2GA 2WZCA 1WE2A 3UYLA 4CKWA 4G8DA 3BAFA 1K3UB 1MNAA 2YFKA 2NYRA 3K1AA 3R2JA 5EIBC 4MKHA 3RHFA 1YHZA 3F6BX 4Y1FA 3MN1A 4JLDA 4RQBA 1IJFA 2O7VA 3S2YA 1ZNYA 2VDOB 2ARKA 5FQNA 3HV2A 1FK8A 2X22A 4FE3A 5IP5A 4CV3A 1YDEA 4YMTA 1E6MA 4YAFA 4YJ2B 1LPAB 4J6FA 5JVDF 4INPA 1OU0A 4KPFC 2BRUA 5CDHA 3B38A 3H17A 3QBTA 5F3DA 4AYXA 2B2XA 4E3WA 4NMLA 2Y92A 1DOAA 2ONJA 4DWJA 4RJJA 2IY8A 2R48A 4H7JA 4WPGA 4WFKA 4QJ4A 4XKJA 5FBLB 4V0LA 3T7CA 1KJJA 2JGAA 4AX4A 1E9AA 4FKBA 4CM4A 1N5OX 2BGIA 1DFIA 1GSIA 4QSMA 1E2IA 2WWYA 3HM2A 3ZE9A 1CUYA 3OBBA 4N4AA 3KT6A 5G1OA 4DLVA 4K6MA 1EFVA 3BF7A 1GADO 3CVVA 2WT8A 1I7DA 2COKA 1GPYA 3IQIX 3BD7A 3I9FA 5IJ9A 5KNCA 1OI3A 2WPDA 5CB4A 1LDBA 2O5CA 1U1EA 2H9IA 5KSOA 3IVXA 2QN9A 2V97A 4HRAA 1XTRA 3UWMA 3F78A 5AW9A 2VYNA 1P5HA 5AVOA 2IY9A 1PFKA 3GLUA 3RROA 2R11A 4CTJA 1EX7A 4CMAA 3IQZA 3PXAA 2RGBA 1NT4A 2HUNA 4JOSA 3QE9Y 3EGCA 1DHTA 3E4CA 4XX0A 1N3IA 4DJ5X 5FX2A 3QPBA 5KYGA 2Z6UA 3SP1A 4W1RA 1U7HA 1ZKMA 2GJSA 4AJNA 5B1EA 1IDN1 2P9ZA 3I2HA 3DE0X 4HWOA 2QE7A 2XCUA 4B87A 1FFYA 4ASUA 1QZUA 4O6VA 1CDEA 3N58A 3NAZA 3O2JA 4KUEA 3EAGA 4RLFA 1G8AA 3FUVA 2Z57A 1KRHA 1J5XA 3MAGA 1GR1A 3N2GA 4FSHA 5TVKA 5HQ3B 3RJ5A 5JZ9A 2NP6A 4Q37A 3VHXA 1JHPA 2VYQA 4EO4A 3AU8A 1FMCA 1O5TA 3SX4A 1QHNA 2CYBA 3ZW7A 2UVPB 3KZMA 2O6HA 2WTMA 4WNIA 3DMGA 4AQ7A 2C8KA 1JZTA 2C5HA 3O8DA 3I39X 4JSYA 5L45A 4LWOA 4HWSA 4EB6A 3MAAC 4JVMA 4NPAA 1J0AA 1Y1SA 5FEUA 4XVCA 5AD1A 2A59A 2Z95A 1CVRA 3DNMA 3BORA 4KXLA 4PO8A 5A0FA 3VU3A 3ZQUA 4HUJA 3EUFA 1XZEA 4IWYA 5HOQA 3HC7A 1NPDA 1ZGGA 3GJ8A 4UU1A 5LLSA 3W7AA 3KU4A 1PT6A 2D1TA 4IIVA 4IGAA 4DIUA 5IXJA 4N5IX 2VHUA 2D2IA 3AFGA 2I2CA 1Q21A 1TMGE 1OBVA 4DRZA 1T2UA 2Q6IA 1UBJS 1RWOA 3PXCX 4MVJP 4BNWA 5HZHA 1UC9A 1ETUA 3E22B 2ZSKA 3JQ7A 1HGXA 1S3IA 2UYGA 1NW9B 3I9JA 2D1SA 2R1TA 4LFBB 4BV2A 2JKYA 1E1LA 3IXLA 5AI8A 3VU1A 4D02A 1GRCA 3FDJA 1TUBA 3GJQA 1JT2A 2V7VA 4KLRA 2ABWA 1Z5WA 2GPTA 2VHQA 2GHTA 1ZAYA 4E5NA 3W2EA 5FA5A 4FIZA 5K01A 2GMWA 1FX1A 2DKNA 4JLJA 4MAFA 2CUZA 4Z49A 2HWWA 1I3MA 3DBVO 2MSEB 5TT0A 2X0NA 3JQ9C 2WBLC 1CQIA 4D3ZA 4QTTB 1PEYA 2BGKA 1E7QA 2PSDA 1F8YA 1TZKA 4NL4H 4BZXA 2JBHA 4IPTA 2I87A 4TLAA 3HJFA 5IXSA 5LOVF 4OYLA 2VWPA 4MKZA 3CZQA 3SQOA 4CG3A 1CQJA 2ZR7A 2CZGA 1BXGA 1OHHA 4KO1S 2WMDA 4OG2A 2WT9A 4I55A 2H8GA 1FZTA 1JECA 1UADA 1ST3A 4OEHA 2GTHA 1WZIA 2OV3A 3SQNA 1LJUA 4PG8A 1EVKA 3HFRA 4H1TA 3IEMA 1N2EA 1ZZEA 1OFIA 3BIWA 3DVRX 2O0LA 3GNTA 4ERXA 3DOIA 2J85A 2VSFA 4KSBA 3FOCA 3HCAA 1X1TA 3NDRA 4ZDWA 2W70A 2BKEA 2D59A 1P2VA 2PD3A 1LPPA 4YCJA 5KHOC 1OXSC 1RRFA 2OVBA 3EC2A 1AHHA 1R37A 4PPGA 5FTNA 2R8OA 1M2OA 1OC4A 4JYMA 4IS2A 1GDTA 2ZFUA 4W63A 3B6ZA 2PQ0A 2Q3DA 1Q15A 3AXTA 1J7KA 2QX8A 1T26A 1E3JA 4FDMA 4JNCA 1HDEA 3G2KA 3NLLA 1I01A 4UNIA 4WZAA 2UXBB 1T8SA 4J4TA 1B14A 4KQGA 2W2TA 1LKZA 4RYDA 3S8MA 1ADFA 3DW1X 4O4LF 5BV1A 3BREA 3E9ZA 1WVIA 3V8EA 4MYTA 3IAXA 1A9PA 2QN3A 1RBZA 2D5LA 1MH9A 1XHFA 5IVDA 2NQ8A 3IAM6 4C21A 4WH0A 1G41A 2DSTA 2GSWA 1G9SA 1A77A 3IA2A 5TF4A 1MZPA 2VRWA 2JGDB 2A4MA 4KQHA 3KYIB 1XVAA 2SECE 5DE3A 4EYGA 3A4LA 1NDQA 1M54A 2VDVE 3AWIA 4M37A 4EG3A 2VP0A 3CO0S 1KE2A 2Q9AA 2B83A 1W46A 1V1RB 2EBWA 4B33A 1GQSA 1PZNA 1P18A 3R0QA 2WDPA 5CFLA 4FNOA 2X1VA 4OQZA 4U0JA 3UXMA 1NR1A 3GVXA 3H4IA 1FLNA 2ZUTA 4GYWA 3EVCA 5DI3B 1G20A 4AJOA 3ITNA 1NNEA 4OXIA 4NNPA 4XUGB 2P62A 1LD3A 1VYUA 2A58A 5J4YA 3THWB 1NMSA 3H11A 2FR8C 1TC1A 3DA8A 3I0NA 2HNKA 4Q93A 2HGZA 1W8IA 2VPXA 3M3HA 5FI5A 4CL0A 3KZNA 2PUGA 3V1LA 3P94A 1DEHA 5A6SA 4G24A 2EYQA 1F2DA 3FFWA 1I1HA 3PQEA 1TQDA 3A6HA 4FGLA 3SWWA 4DB4A 2GF9A 3I9LA 4BNVA 2EP7A 3OT1A 3VR5D 4NIMA 4DSUA 4S05A 4UUAA 2O9JA 2AUNA 2NZ8A 2AYZA 1NWHA 1GLNA 1E7RA 1K8QA 1XMPA 3OCJA 3ZXIA 4E31A 3PXDA 4POAA 1A9TA 1MAVA 1OPXA 3MW8A 3EZGA 2WIDA 4M49A 5C0OE 3RJTA 5LYJF 3DE2X 4CCYA 2H4FA 1B7GO 1BZYA 3H5NA 4W5OA 4Z4EA 2YW2A 1LPMA 5E7MA 4E33A 4F2DA 1OLSB 1M6VA 2Z56A 4O25A 1QM5A 3ACCA 5JSYA 4YRIA 1OLXA 4ETMA 5FV4A 3WK8A 2QP9X 4IFBA 1V3VA 2FJ0A 2HOQA 4MQMA 3WIUA 5DSZA 2CMHA 3G2JA 2Q8NA 4OSOA 3ZK8A 3IEVA 2X9VA 3EGXB 4LY9A 1FJHA 4L7VA 5DH9A 3RRBA 2B37A 5FUYA 3AVXA 3A9RA 2HMUA 1BCSB 5HMLA 2DQZA 1Q83A 5KYNA 2JIBA 4CT0A 1U3WA 5HXAA 4ENPA 3W1EA 1I3LA 2NTNA 1PAUA 2VYVA 3K0AB 1VL6A 4R01A 4OHCA 4C05A 5LXTB 2XGMA 1IBRA 4G5QA 1W5SA 1V43A 1CUUA 2IXTA 3F3SA 1RKUA 2CNLA 3JQFA 5ESXA 3UOWA 4B2LA 4F5ZA 3FLMA 1E77A 3BIFA 3H5RA 5KTYA 2FRDA 4DA8A 3EF0A 2CLDX 3KXPA 1G5FA 3R3XA 1FP2A 4GP7A 3VX3A 4I1PA 2FEWB 4NDZA 1GPUA 4UM9D 4E5PA 3U09A 2C9OA 3WK4A 5KNBA 3NRJA 1QR2A 5DLPA 2ORIA 3R7SA 1EG7A 4U2KA 5TE9A 1YL6A 3VI3B 4H1VA 4CYMA 4PCLA 1VMIA 3O8CA 2DBVO 3OE5A 4UBIA 5F21A 3J81A 3FF1A 2JI9A 2J3DA 1NBAA 4EJSA 4DPMA 1JPJA 4ZAVA 2FZ5A 3JRXA 4OIFA 2JASA 4C0AC 5BWCA 1ZUNA 3MGGA 1LPNA 2GN0A 4OQLA 4BATA 3Q8MA 1QIDA 4L9WA 5CAEB 3OUTA 3LUFA 2D74A 1M2FA 1R0KA 2PT9A 5EPOA 1UQTA 1RPTA 2C3OA 2IITA 2PL5A 2CXSA 4G3XA 4QRIA 1KZYC 1KY2A 1J0EA 2IFTA 4N9QA 4CTNA 3WG9A 1Z15A 3K96A 4YK7A 2P2ZA 1BXKA 1SHJA 3FGZA 1PGOA 3ZOKA 2HY7A 1M7GA 4KB5A 2UZ0A 2VPYA 2WVGA 4LDRA 4Y6LA 4FUQA 4BS9A 4EKDA 1GNVA 3C8HA 7REQA 1XD8A 4XGNA 3HCRA 3OHPA 2P0EA 1IUOA 4PC3A 5GZ3A 2C7VA 3H1TA 5ERXA 3V2UA 3T5AA 1AO3A 2C20A 1EM8B 1PHRA 2R4TA 1MQAA 1ZNWA 2QRQA 3EVFA 3QIVA 4GZ3A 3ZXYA 4ZT6A 1K3FA 3ZPXA 1GPJA 2QK4A 1K8YB 3M5WA 2OXI<