3HH8A

Crystal structure and metal binding properties of the lipoprotein mtsa
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
280
structure length
280
Chain Sequence
SDKLKVVATNSIIADMTKAIAGDKIDLHSIVPIGQDPHEYEPLPEDAEKTSNADVIFYNGINLEDGGQAWFTKLVKNAQKTKNKDYFAVSDGIDVIYLEGASEKGKEDPHAWLNLENGIIYSKNIAKQLIAKDPKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIAENKKLIVTSEGCFKYFSKAYGVPSAYIWEINTEEEGTPDQISSLIEKLKVIKPSALFVESSVDRRPMETVSKDSGIPIYSEIFTDSIAKKGKPGDSYYAMMKWNLDKISEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and metal binding properties of the lipoprotein MtsA, responsible for iron transport in Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Metal binding protein
molecule keywords Metal ABC transporter substrate-binding lipoprotein
total genus 104
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hh8A02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hh8A01
2M6KA 4TKVA 4HMPA 4G07A 4WZAB 5M29A 3HJTA 3LHSA 5I4KA 1K2VN 5KOJA 4TKUB 2PS9A 3R5SA 1FP4B 1KAEA 2AFHA 1M1YB 3MWGA 4XPIA 3AEQB 4HMQA 1QH1A 4WESB 3TNYA 2XDQA 4UDOA 1KARA 4PAGA 3AEKB 4B8YA 5M34A 4WNAA 1QGUA 4INPA 3BE5A 2M6LA 2XQVA 3AEUA 4MO9A 3TEFA 4WZBB 3K1AA 4LS3A 5KOJB 3MD9A 3AESA 1K0FA 1K7SN 1H1LA 2OV1A 4UTOA 4WZAA 3ZK9A 1N2ZA 4OXRA 4MDYA 2PHZA 3AERB 2OSVA 1QH1B 4WESA 4WN9B 3ZK7A 4XPIB 2WHYA 2XUZA 2Q8PA 2Q8QA 2AFIB 1M1NA 1G21B 2QI9F 1TOAA 4FI3F 5CX1A 5FLYA 3PSHA 2OV3A 4BBPA 3MINB 1G20A 3HH8A 5M3BA 4INOA 1N2CB 2R79A 3G9QA 2MINB 1PSZA 4H0FA 4HN9A 5BVHB 3EIXA 3MFQA 4G09A 1ESZA 4H59A 4PM4A 5GGYA 1KAHA 1L5HB 1L5HA 2XV1A 4TKUA 4HMOA 4FNAA 3U7QA 4UTPA 4OXQA 2XDQB 4WZBA 5JG7A 3HXPA 5BVGA 3AEQA 4K3VA 1N4AA 4MX8A 5JOQA 2AFIA 2RG7A 1N4DA 1M1YA 4WN9A 4DBLE 3ZK8A 1MIOA 5BVGB 2O1EA 1QH8A 5KOHA 1G20B 3AERA 5GGXA 3EIWA 4GICA 5JJ5A 1QGUB 5HDQA 4ND8A 5KHLB 4ND8B 1QH8B 2OGWA 3AEKA 1M1NB 3PSAA 1EFDN 4TKVB 5CX1B 5B58T 3ZTTA 1M34A 3AEUB 2YNMC 5CR9A 4M7OA 3UJPA 2X4LA 3BE6A 4UDNA 3AESB 1H1LB 2PS0A 3U7QB 5JPDA 4MLZA 4CL2A 1MIOB 2R7AA 4IRMA 3NU1A 2PRSA 5AFSA 2PS3A 1G21A 4N01A 3CX3A 3ZKAA 3LI2A 2AFHB 1FP4A 2XY4A 5HX7A 1N2CA 3MWFA 1XVLA 4NNPA 2ETVA 1PQ4A 2WI8A 3GI1A 3AETB 1K75A 3PDIA 2MINA 4OVKA 4WNAB 4FKMA 3TLKA 2YNMD 3R5TA 5M2QA 4LJSA 3AETA 3PDIB 3MINA 3K1AB 4NNOA 5KOHB 4FILA 5BVHA 1M34B 2XH8A
chains in the Genus database with same CATH superfamily
4OG2A 1BA2A 4AZWA 4EBBA 4RK4A 3CH6A 5K6TA 4DR6B 2WSSD 3A2LA 4PYKA 3PC7A 1QWOA 2C5GA 2IA5A 4TWIA 2W2VA 1Q22A 5KWJA 3N05A 3SJZA 3ESXA 3PRKE 2PMBA 4BE4A 2J08A 3PPXA 1TT5B 4KI0A 1W36D 2NXWA 5G0SA 2X8JB 1XMIA 1EGAA 3BSSA 3O2SB 5MN6A 3TINA 4OXYA 4C0XA 1Z36A 1D4AA 4TUYB 3FG9A 2VPTA 1IN5A 1LGYA 1PFUA 5FFNA 1RYZA 1UMKA 2A4MA 2LD4A 2ORWA 3CMCO 4X90A 1SFRA 4Q4LA 1VHJA 3T95A 3VO1A 3LBIA 1L4LA 4M83A 5BV8A 3VZQA 3CPHA 2P9GA 1ZUHA 2OYSA 4JT9A 5FR1A 3QVXA 4C08A 1A9RA 2NO1A 4ZYXA 4KQMA 2AYYA 1K0FA 4OHCA 5CT4A 2PBZA 3GROA 3NM4A 4JC5A 2H2AA 2BISA 4M0MA 3U1BA 5B5SA 1KFJB 4P34A 4WCFB 4FLMA 3UK7A 1TMYA 4MCHA 3D43A 4FZ5A 3GMDA 3UH1A 1US8A 3V4SA 2WHQA 3TFWA 4WFKA 2MYPA 4MYUA 1I80A 4V0MA 4G23A 5A3QA 4J2OA 3ZV5A 4BYMA 2M32A 3KUXA 3I5MA 1ONNA 3H4TA 3SHOA 3D6TB 4CM4B 3L8GA 3T52A 1FFBA 2YINC 1GYPA 3DFIA 3AVYA 5I8ZA 3R5XA 2BEWA 4KN9S 4ZK6A 4D9IA 2B35A 3CEHA 2AJCA 3KOWA 4GVLA 2P30A 3MWEA 1RABA 4O02B 2IK8A 1P0CA 5A5GA 4A9AA 2BM0A 3V4LA 1ZVVA 3IE2A 2NZ2A 5IJZA 2B4TO 2QRNA 4TSFA 1EUCA 4K3VA 4C4PA 1S3IA 2ZSDA 3NDRA 5HMLA 1N4DA 1L3BA 1VMEA 3SHVA 3SJBA 2GT1A 1J8MF 1E2UA 3CG4A 3HBAA 3NTUA 3L77A 4HX2A 3S40A 2QVXX 2GZDA 4YY3B 4N8DA 4QOEA 3PNLA 4Q39A 2PX3A 4FC6A 2C5FA 2IX9A 3FNQA 4FMDF 1VKHA 4GR4A 4RV9A 1QDLB 2QUZA 3ISVA 2VNIA 2YZ7A 4GOXA 1R37A 5EJ9A 4OQ4A 2UU9B 2NLOA 3H2HA 3H11A 2JBWA 4V3CA 2FMUA 4LOJA 4UHJA 3I1FA 4G0ZA 3H2JA 3C3YA 3I4LA 1E9BA 1O96A 1P45A 1NBEA 1LVGA 3AESB 3M4YA 1Z6QA 3R3JA 5CRIA 5SICE 2HNAA 5T4BA 3RW9A 3WP0A 1JEYB 4JKYA 2PCLA 2QN8A 2XOKD 3ONFA 4IRMA 4L5JA 4FZRA 2HK7A 3VKHA 4IW3B 4HP8A 1H3FA 4K3UA 3PWTA 1T9AA 3OOJA 4OHXA 3TR5A 1RJFA 3ND7A 2WFAA 4Z4CA 3CLTC 2XWBF 8ATCA 5JMWA 3CZMA 4YI5A 2GWRA 3ADDA 3CX4A 4FFNA 4EKGA 2GN2A 3MINA 1E0AA 4OV6B 3L5KA 4JQSA 1HV8A 3AR3A 5AVTA 1E61A 1E0SA 1YCGA 4GZLA 1K5GA 4CRWB 9MHTA 2K4MA 4KDEA 1JA9A 6REQA 4QG7A 4WZAB 4LYYA 2DPLA 4TGLA 3D3JA 3SICE 1A9YA 3QHAA 3G5TA 4LYAA 5THXA 3WK5A 2I29A 3QKRB 3V1YA 4IFTA 3IR7A 1E32A 1ZS9A 3NYIA 1RIIA 1B6TA 3OBIA 4WBNA 4WFQA 2Y67A 4U7GA 3CA8A 4F2GA 3ZWQA 4XSVA 3SBXA 3U81A 1SOMA 4NATA 5CVEA 3ZVRA 4LQCA 4OK6A 1QFMA 5CEJA 5DGDA 5JAIA 3E03A 4B3CA 2J9FA 3FLBA 4RSGA 1W93A 5E7QA 3K8YA 3KQNA 2O3RA 2ZIXB 3WYDA 5F7JA 3CGWA 4D56A 1NAHA 2WHXA 3FCYA 1G0OA 2G9ZA 5LJIA 1XYGA 1SCQA 4QBIA 3RSOA 1B6SA 1N2CE 2PRZA 4P83A 1QQBA 3I2YX 2PAFA 2OXFA 3CUVA 4CTOA 3AFHA 3U4CA 3ROGA 4P2GA 4DVGA 1P31A 3R76A 3CVYA 4DS3A 1ZSYA 4HV4A 4QFMA 4XGRA 5G4KA 3SFZA 4Y6GB 1NQVA 2NYVA 5B3JA 4CM8B 3EC1A 4G2NA 1WCWA 2CKDA 1SEVA 3DBHB 1J2YA 1U3WA 2YZNA 2ADFA 1A8SA 1PT9A 3KPYA 4LXIA 3RIEA 4BLVA 4E2FA 3BORA 3DEAA 1Z7GA 5REQA 5JU6A 3IR5A 3EQ9A 2H07A 4NEHB 4H6WA 2NADA 2OCDA 2FUCA 3E2MA 3MBKA 1MIHA 4X63A 3E53A 5L4LA 1Q0SA 2HXGA 2D54A 2BMFA 2N1BA 2VUHB 3B52X 1CKEA 5AM5A 4DLLA 4Q7MB 3RC2A 3QM1A 3VPGA 2I4IA 1UZAA 3CRVA 4HN4B 4IDBA 4OX9B 2P68A 1VLHA 4TQUS 4RA9B 2WWRA 5JZVA 3N5CA 3SAJA 1RYBA 2PA3A 1WSAA 3BXPA 3TM5A 5A1JA 2J3QA 2G07A 1UR5A 4LGYA 5CEFA 4P22A 5JDCC 1UFRA 1VKOA 2A5GA 4OHBA 1V2HE 1JR4A 3CKYA 2XCIA 5GV8A 4Y1RB 3TW8B 1N6PA 1HL7A 1B0ZA 2E5WA 2JAQA 2YBEA 3EZ7A 3MOSA 1YZVA 4G4SP 4QBFA 1Z39A 4XCXA 3PVZA 3TTUA 1OLUB 5IP5A 4JEIA 4BKMA 2JVIA 2Y0PA 1X7GA 2ZAGA 2G7ZA 4C3UA 1TXGA 3DGFC 1P9OA 1LSUA 3F6CA 3IT0A 3H2ZA 4TS4A 3F97A 4XTRA 4BNFA 3W9BA 5TXGA 1NNEA 5D87A 2ZW9A 4L74A 1Y4ZA 1HZZC 1CJVC 4D0LB 4ENQA 3URMA 3HB5X 2KYRA 3UAOA 5KNDH 4OEHA 1UK8A 4AUNA 2RGNC 2EWMA 4QPJC 1U8CB 4KPGA 2MINA 3D5EA 1SC4A 3Q87B 4H0CA 4KAAA 1E79A 1GFSA 1HDYA 3O1IC 1WF3A 4I4LA 3SR4A 5IZ4A 3H8WA 2AJLI 3X1ZA 3DB2A 4JH0A 4Z7NB 4OLHA 3FSJX 1LLUA 2ZI7A 4JJ8A 5JJLA 4HZUB 1XRLA 2HA4A 4Y0NA 4BDTA 4C0KA 3D8RA 3HKDB 1R88A 1Z6PA 2R85A 3CLUC 1L1RA 3L6CA 4J3JA 4JHXA 4FJ2A 4WMLA 2YC4C 1PT7A 1JN0A 4OJQA 3RUEA 1S7CA 2OCLA 1ISPA 1E7WA 3NHKA 2JGEA 1PS8A 3HPQA 5JQGB 4MUFA 3LXUX 1TZBA 5A0TA 1XAJA 2VDKB 4P7JA 1BXRA 5CT9A 3FNRA 1ZRSA 3JARA 3NXKA 3RUDA 3ZTWA 4ENVA 2CXNA 5CYFA 4LDJA 5E1BA 2CLLB 4JLSA 4Q7EA 2P4EA 4GMDA 3AWIA 5A5FA 1JDUA 3VAYA 3WMRA 4MAMA 2V9CA 3WQQA 3G0GA 1IQUA 2DU8A 1W30A 3ODGA 4OAQA 5EEHA 5JCJD 2G4LA 2Q3BA 5AK4A 2GZRA 2QY6A 1FDIA 1HMPA 3B5EA 5DYTA 4B2LA 3T3NA 3M0EA 4CQJA 5AM0A 2NVUB 1T5BA 3GGCA 1EH5A 1I14A 2IE8A 5FPHA 1EDDA 2W6NA 3E82A 1UXOA 3LDAA 4NJOA 4ZC1A 4DLAA 1SBHA 2Q1UA 2ZI6A 1XZPA 4JOQA 1BJRE 5FAKA 4CL3A 1EZ4A 1YB7A 2YWGA 2JS7A 2X1VA 1Y8CA 4O0LA 4BB5A 2X2FA 2QKYA 1KZ7B 2FK8A 3RB8A 4LF6B 1I8TA 1VPLA 3PLRA 1YMQA 4MKXA 4Y6LA 5AOCA 3R7FA 4LF7B 3PL5A 3RPEA 1XNRB 3JD0A 4YMIA 1BE1A 1GA4A 1SC9A 5BWLA 2XRYA 4BRWA 3OUTA 3ZHRA 3K6SA 3P5BA 2Z83A 5CVTA 1W1IA 4DMKA 2AYXA 2XPCA 2XWSA 4DUPA 5BSFA 3QPBA 1VZ2A 4IX9A 3U37A 2O59A 2CDAA 3KO8A 2C99A 2I4TA 1ID8A 4PO8A 5J5VA 4CCWA 3ZK8A 4HNTA 4AMYA 3C8ZA 4C05A 4HDRA 2G80A 4TTTS 1XTSA 3O94A 4UD2A 4KO2S 3V4RA 1R0KA 3KHSA 4LWOA 5C80A 5LDGA 3ANNA 2OK7A 1I2AA 3SZUA 1X7YA 5GZ3A 3J7TA 2X1LA 1U8AA 4HLUA 2XCSB 1J24A 3B20A 2GTIA 1ISIA 4YJ2F 4IGEA 2AE2A 3CNNA 4LY9A 1I3NA 2GD0A 4ZMBA 2ZUBA 3C3DA 1QB8A 4RD6A 2YRFA 3QQ5A 1T36B 4BRUA 2VAMA 3ACCA 2VDPB 3HDYA 3ZI0A 3SC3A 1G21A 4U6QA 1MAWA 5B2ZA 3MRVA 5KOIA 5ELLA 4UCQA 2SICE 2ZIXA 1BKYA 3KZMA 5FX2A 3MWFA 3DULA 5F7OA 2GDZA 3AETB 7ADHA 3CVOA 1XMOB 2NX2A 4JX9A 2JBAB 4LXUA 2WZBA 2FPSA 1XWFA 1OXUA 2BMJA 2H57A 3QEMA 1P4SA 2AKEA 1QBKC 3COYA 1MW8X 2IIVA 4HSEA 1EX1A 1KSJA 1PL8A 3AU9A 2INGX 3QBTA 4CNBA 4KDRA 4P7KA 2ZTLA 2I4NA 1LS1A 2GM9A 3KUUA 1OYYA 4PZDA 3S99A 1ZKMA 4HH3C 4HB0A 2C77A 3IHKA 1MV5A 1O9BA 1PHRA 4CF3A 2O8EB 2YTZA 1Y3IA 1YZLA 3EA5A 3KZKA 3QYFA 2D0PB 2O7QA 3VTAA 1DKNA 4MUJA 1PIWA 1T0JB 4C5CA 4YMLA 2V7TA 3K7EA 2DUNA 3D7SA 3R5HA 1GT91 4TUYA 5TQJA 4C2TA 1F8FA 1R6BX 1WD7A 4RIGA 3IKTA 5KJ1A 4RK6A 1E2DA 1UEIA 3MAJA 4KAJA 4J7XA 4KXLA 2ZGVA 4Y9UA 4YNBA 3CPSA 1KMMA 2Z4RA 3E2IA 3Q7PA 4P36A 3KPUA 5TPWB 1JBEA 4LJRA 1WDLA 4DMRA 3QU7A 1QP7A 4DIEA 3T5MA 1RHUA 4TYQA 5CVUA 1VJRA 2F3TA 1R9JA 1K7XB 2VOJA 5K3FA 1KYXA 5F2NA 1LJ8A 1WXFA 3I42A 3KSRA 4MRMB 1JBQA 4MICA 4WZAA 1G19A 3CZ9A 2ZSAA 3RFXA 1SZDA 4HEA1 1L4YA 2Q62A 2EATA 5EIXA 2FPXA 4JLDA 4OI4A 2PX2A 2J1LA 1VCOA 3K4HA 4TVOA 1UXHA 3TRHA 2GD1O 5DRTA 2A58A 4FCWA 3UNXA 4EHFA 3DEYX 1AO0A 3R0VA 4PO1A 1CY2A 4HDMB 1DC8A 2EHJA 2W8BB 3BD8A 1QPBA 4GG1A 3OE4A 5EUBA 5I3CA 2G88A 3HRKA 4ZIRB 2YCLA 1SBTA 4M22A 4QYTA 4Y9TA 4IWNA 4DA8A 3KB8A 1TCBA 3U40A 1XD2B 2B2XA 2NTEA 2W2XA 4ZCSA 5KPDA 2JAPA 1LVUA 2V7QD 5IF3A 5FWDA 1Q7BA 2Z1MA 2GYUA 1Z47A 1U0LA 5AK0A 1L5HA 4GL4A 1G17A 2VJMB 3M89A 4MEBA 1D6NA 4R05A 2GA9A 3KVOA 3O82A 4N4AA 2CNWA 5LC1A 5JY6A 1YVRA 2EKQA 4IQGA 1BTOA 4RPLA 2NV0A 3CPJB 4G65A 1U04A 3N8HA 4QM7A 4GLFA 1IUOA 1GRQA 2ZREA 1A8UA 2B0CA 2YBDA 3QWFA 1W4LA 3A9UA 3AR6A 1HFEL 3IAXA 2J45A 1BVYF 3IQEA 4MIEA 2NUPA 4RF2A 4DZZA 4EPWA 5COQA 4C7OB 3BN3A 2AXEA 1IBKB 1QE5A 5D8DA 3DCJA 3DDNA 2E87A 2DPGA 5C9ZA 1E2IA 1MC1A 2C5BA 3I1IA 3L93A 4KUGA 4PHCA 3UAWA 3UVEA 1U1GA 5KI6A 1J00A 1CP3A 3WKCA 1HX7A 4TV8B 2L69A 4V0ME 1W2GA 2JCGA 5DXAA 1Z4MA 1W59A 3KEGA 4M1EA 4ZCIA 5BNWA 1EIWA 5FWYB 3B53X 5DISB 3U7QB 3EW9A 1C41A 4G1MB 1P77A 5K6RA 1PNVA 3GOQA 3EPKA 1V37A 2BHRA 1QJ4A 4Q9JA 1LVHA 2YV3A 2A9KA 1DCMA 2DHEA 1KQGA 4X1OA 1JAIA 4BLPA 4CMBA 5A4JA 3CW9A 2Y05A 3A1EA 3NWJA 1DELA 2AR0A 2I6TA 3QWAA 1XDGA 3QUTA 4I3GA 1JR6A 4R2WA 5L3RA 3SY8A 4ESHA 3HKCB 3FKSA 1ZN8A 3QLJA 4RS3A 3F5QA 4GS5A 1WXHA 3JPWA 4LN1A 4R4JA 4YRKA 5IUJC 1YBAA 4NJMB 1I5OA 5J63A 3PQ7A 1EKXA 1DOZA 3C8MA 4O3MA 3QLEA 2B7CA 2JFUA 4DWJA 2MR6A 1M76A 2PNFA 2IZ1A 4BVBA 5F12A 4OPMA 5AJXA 1C0IA 3CF0A 4ALKA 4D80A 2QP3A 3E23A 5A7FA 1Y42X 3NORA 4EDFA 1PSDA 3E3NA 4G85A 3JVDA 3QVSA 4JC8A 2ZANA 3WV5A 1X2BA 3GJSA 2RB4A 1KARA 2YCBA 1GQFA 1P1JA 1KFKB 3OA2A 2C83A 2JAWA 4HWKA 2BYTA 2O57A 4ZZIA 4ARIA 1FSPA 2DFLA 4EARA 3TZQA 1OAKA 5JSUA 4HPXB 5JY1A 1NLZA 2A1TR 2JFOA 4DLBA 1NN3A 2CEAA 2ZRFA 3MMXA 5B1SA 2PX8A 3GDOA 2Q0SA 4MO9A 3TKAA 3SC6A 3LD9A 2I03A 2VYVA 2IUTA 3PNKA 1CZOA 1JIIA 4GXRA 5T57A 4CKWA 4G0QA 1PDOA 3HACA 1F8UA 1NQAO 5AKXA 3HBFA 3TEMA 2IX3A 4LHZA 3DLBA 3DDWA 5CBPA 1WVMA 4IVNA 2JANA 1RKQA 1N0WA 2R86A 2JFFA 1TA0A 4QOJA 1UL1X 1XI2A 4W1SA 1E5LA 4L8LA 1RHRA 3PXUA 1R15A 3CZ5A 4PFJA 3A9VA 3IIKA 5E3JA 4KYTA 4PIPA 7YASA 1JHRA 1GR0A 2A9QA 4PXSA 3MMPA 4DM7A 4HYTA 4NFHA 1JQ3A 1Y33E 3NGMA 2EP5A 4ISBA 2FSFA 1GU1A 3KHTA 4MINA 4RZSA 3QE4A 1RWWA 1XJ0A 1NBIA 1FDTA 3GLSA 5JVDF 5JASA 4NIMA 3ST7A 2ZIEA 1M2NA 2D1QA 2WUEA 1UPAA 4KQIA 4PGAA 4OHVA 1ABEA 4FN4A 3P0FA 1KEVA 1ZEMA 1T0UA 2O07A 4WCFC 3STYA 3U0BA 1Z18A 5BQ3A 1ODLA 2VXCA 4GI3A 4BMYA 3JU3A 1PQWA 4LA4A 5IC6A 5E1DA 2WJIA 3SGLA 1GQYA 1HQKA 1Q1AA 3INTA 3FTPA 3Q0IA 5IS2A 5EC8A 2CLOB 4BDSA 4DN6A 3A6JA 5KHLB 2DBVO 5JBNA 1X9IA 3FYHA 3WVNA 1NR1A 1PEAA 1JB9A 1Z0ZA 4UXHA 1NX6A 5TC4A 4IJ6A 1PJQA 2AZ4A 3FWPA 2Q4OA 5BSEA 2PH7A 5JDCA 3QVGB 3TQQA 3P20A 3EGDA 3Q9NA 4P8RA 5AKIA 4ZVNA 1TLLA 3DEFA 1DQNA 5AHKA 1T2VA 3RI3A 2OCGA 3GVCA 5JCZA 3PI6A 3BJMA 1A9OA 4ZZ1A 3MWYW 4V1CA 2XVMA 4AVYA 2VRBA 1P61B 1JEOA 3P2YA 4EVSA 4FKMA 2X0RA 1UWCA 1SR8A 1PVOA 2IODA 2AD1A 1U3VA 2VK8A 4XIYA 1Q6ZA 4HH1A 5K3FB 1V26A 1X9GA 5FFFA 4AX4A 3FETA 6CHYA 5ALMA 2BFBA 5DM0A 3K2EA 2F8TA 3O0TA 1LLCA 1QF6A 3NYRA 2R6CA 4XYEA 4L8WB 4QGBA 3FX2A 2A3NA 3RKRA 3WQBA 1U2EA 2YJZA 4CNQA 1GWNA 1T9DA 3B1KA 3UT5B 4ZA2A 1F8XA 5DKFA 5CM9C 1F48A 2CJXA 2FLKA 2K6GA 1E4EB 3IESA 1ZN7A 1QKJA 1U0FA 2HJHA 4QC2A 5CX4A 1RNLA 2XSZD 2O8DA 1ONSA 4R9UC 3TDNA 2BP7B 4RVFA 2HSGA 1ADJA 2W6IA 3V2IA 1XK6A 3VKUA 3IEIA 2OGZA 2GXQA 1AKNA 4D4GA 3GRFA 2WE8A 2GBLC 3CLHA 1H2YA 3NHZA 4UM9D 2IE0A 2M6LA 4DJTA 1I32A 2NWQA 2DUWA 2OMKA 5FA8A 1M7GA 4ANFA 1Q0PA 4J8PA 3OCJA 1RC0A 2FOXA 4OQPA 4B5LA 5C8DA 1T15A 4ICIA 1TW3A 4MVJG 4Q00A 4RMGA 3ZLVA 2MSEB 3JATB 3I8SA 2OSVA 5HEKA 1WVGA 5JT1A 2Y6VA 3E7DA 1ISJA 4WN9B 4L5YA 2OLEA 4IQ0A 4WH0A 2AR7A 2ZKLA 2XUQA 2ES4A 3ILHA 4YCLA 4MH0R 4L16A 3B6KA 1KYTA 2EDCA 1LPPA 1G9SA 3T3PB 1SXJB 3FWNA 2JGFA 5CNIA 1UPXA 3VPAA 4DLKA 3RFVA 2P5YA 1SD1A 2WOJA 4K2AA 4L3OA 4S0ZA 5DX1A 3RKSA 3R7LA 1ZJZA 1Q92A 3DZCA 3NWPA 2CNLA 1F0KA 1TK2A 2ZRGA 1DRJA 1N25A 5H59A 4CR7A 2GERA 4DZRA 4YV7A 2O54A 4N8SA 1XDZA 1SY7A 1AV7A 2CHUA 4PG5A 5F76A 4B4KA 2PUGA 1AG9A 4NHOA 1G291 3ZEIA 5IBPA 1DOHA 5DBEX 3HEMA 5DHTA 3PD7A 1L5VA 1O0SA 4MR9A 3MTBA 1O8CA 4Q9NA 4BO7A 3DONA 4I81A 4FX5A 4IDFA 3D7MA 1CIPA 4HDOB 3P0EA 3D7NA 3PQ4A 4DUGA 2A7XA 3LPDA 3RRXA 1T9HA 3GRKA 4HSGA 4MW5A 5B1EA 1THMA 3WLJA 4NJMA 4ND5A 3B6MA 2J0SA 2IXTA 2RHGB 1X92A 4A1FA 1VMAA 3AUKA 2GPAA 5E38A 3RYFA 2C3PA 4C0AC 1FFYA 5J43A 1VLLA 1WB5A 2Z2YA 1LDNA 3OQIB 4RIHA 4IMIB 2VKTA 2XGMA 1E9VA 3BRWA 3GPDG 3ZH2A 1A5ZA 1O08A 2ZT6A 4UTZA 1JDTA 4M8KA 3G0HA 4HNSA 4B6EA 1GVNB 4TWRA 3TXAA 1Y8QA 4ODIA 1MPXA 3IMFA 1Q6YA 1Y5MA 4Y8VA 5DP1A 1JAZA 3H9QA 2MSKA 2E6KA 1AIPA 2OENG 5THQA 1TQHA 5EVJA 1FP4A 1OLSB 4EQ6B 1XEWX 3L9XA 1A7KA 2XQGA 3ZKWB 3MJRA 1JHQA 1P8AA 1LRJA 1E96A 2X76A 2ZIGA 3HYTA 1RWPA 3HB1A 3QKTA 1F20A 4HR7A 4CQMD 4HNRA 3QOXA 3JWGA 3EZYA 5FUWA 2OV2A 4FFOA 2WYOA 5A2QA 2BKVA 1SKUA 4ZRMA 1OX6A 1UH5A 2ZVDA 3DE1X 3KTFA 3OE7A 4LHWA 4LJAA 5AHWA 4AN1A 2VXBA 1PS9A 4DDTA 1E0DA 4IS2A 4XGQA 5LBUA 2Q3LA 5ALDA 4M88A 1S2LA 2WNIA 4Q1CA 2ZI5A 5A6VA 3UKJA 4E5NA 1OBVA 5EQTA 3Q3JB 1H2FA 1V7PC 4IQ4A 1I6WA 1KK1A 1XVIA 3QTBA 4C0LA 1YVPA 3V97A 3ACBA 1FU4A 1RVDA 1XZKA 1KE1A 3NBQA 4UZEA 1FP2A 3NAGA 4DB2A 5FUYA 4E32A 2H1IA 4DSTA 4ZYLA 4YROA 1A4XA 1XB2A 2CL7X 4F5YA 5GP1A 3JZMA 2BEUA 4E4TA 2HUPA 2QLBA 3LWBA 4JJEA 3AKEA 4BFCA 3CNOA 5DO9A 1YDHA 1M6NA 2A1IA 2TMKA 1VE5A 2ZSBA 3IUNA 5SV2A 2AEEA 3K9GA 2IZOA 2XQJA 3DHNA 1U6KA 2IYLD 4P7FA 2BZGA 5DX8A 4B79A 1E8MA 2D7JA 3VUFA 3MRTA 1AGYA 4OFWA 1SBYA 1IVSA 5D5QA 3UIEA 1JQDA 5DM1A 2F4VB 3WV4A 2X3YA 4I4IA 4MV1A 2AFIB 3AOGA 1L8OA 3EHDA 3KXDA 2CFTA 2OO7A 2I34A 3H05A 4KZKA 2JATA 5KMGA 1R4MB 5B6IA 2YH2A 2A8YA 3C6KA 2BIFA 4A27A 2HO5A 4DQ0A 2ZSFA 1IE3A 2QQFA 2XTAA 3H0KA 3ISJA 4J94A 4QQ8A 3KBBA 1ZHHA 4XJVA 4I4CA 1U2TA 2RHJA 3EASA 4B87A 1V8ZA 2VZLA 5G0TA 4B17A 5K0ZA 3A8TA 2CYCA 3AF1A 3PWZA 1BOOA 4MS3B 3EGEA 1RS0A 5K3DA 1GGEA 4DV2B 1HORA 1ZP6A 3WDSA 4DCNA 1A1SA 3UCXA 3D4PA 5CDFE 4GX5A 1YNOA 4Z1MA 4JBYA 1VL1A 2XKBA 4FEGA 3PNYA 4FDVA 4KQWA 3H4VA 3KTAA 3NEJA 3R5JA 1MIOA 2P4SA 5CBPB 4MYTA 3HWRA 4YMUA 1OB2A 1GNTA 2VRCA 2EXXA 4XI9A 2IYOA 5FP0A 3TXYA 4E12A 2WHPB 5DE3A 3GT7A 4ZARA 2Y9MB 1Q3HA 2ZM5A 1Z0FA 3HN2A 1PV2A 2BOVA 4DJFC 4PO3X 3N7TA 3F8TA 5HIKA 2A1UA 2DMRA 2NW6A 1JX6A 3UT5A 3RANA 2XZTA 2NU8B 2Z6VA 3W8RA 5F78A 1BGXT 1E3QA 2ODWA 3ZE9A 2FN7A 4ZC8A 3IP7A 2FWAA 4HFMA 2HRDA 2HMUA 2ZUUA 4AKTA 1ZOOA 2PV0A 4OLBA 1JHZA 2V59A 3LF2A 1KDTA 3AQ4A 1KKLA 4P53A 4C6HA 4EY3A 2YWBA 4KLZA 1T13A 2R6HA 5LIPA 3RKUA 4BEVA 3G3EA 3W5DA 2BP7A 2BGRA 1IEXA 2PUJA 2REBA 2OG2A 2J0VA 4G63A 1OU4A 1M2EA 2A5JA 1W8IA 5JJIA 4YRIA 1O77A 4K8RB 1LQUA 1NLMA 1XGKA 2PKEA 3ICVA 3R5TA 1OPRA 1EVZA 3GEMA 4PHGA 4UW9A 4P98A 5K1ZA 1ZOPA 3JVVA 4TSKA 4F71A 4DR7B 5CD9A 4BMXA 2J6CA 2CXTA 4MVWA 2VYNA 4DREA 5LJLA 1AGRA 3E70C 1JHAA 2XGJA 1ULHA 2X58A 4UEQA 4JKIA 4BEWA 2VH5R 4HMPA 1FC0A 5LN1A 2QRPA 3FGOA 4PYLA 1KBOA 4EKNB 1NNLA 1I9GA 1P5ZB 2NQ8A 4Q7KA 2P69A 3QFSA 4XGIA 3QBDA 3VVLA 5I7HA 1FQWA 2NM0A 4RA6B 1Y6RA 4ZOAA 1U7XA 5G40A 4N76A 3TNFA 3I6IA 1D3AA 4KAFA 3TSWA 4XD2A 5HKLA 1CEYA 3V8PA 3ZU4A 1EA7A 3HUDA 2LDBA 2ZE5A 5JRZA 1K3FA 1AX9A 5AVSA 4INAA 4PZEA 4B6SA 1P3DA 1RRKA 2PUWA 4GSYA 4OSPA 4R40A 3JWEA 4BNTA 4ZYUA 1U5BA 5AW1A 5B37A 1P7ZA 2ZB2A 3WB0A 3R7WB 1DIHA 4NXNB 1ZMRA 2NPOA 4LDNA 2PL5A 2R8EA 2JGMA 5TARA 4D9EA 2VQEB 2UVDA 1C14A 3A4LA 4LRTB 4XDYA 2WWGA 4Y18A 3FUXA 1LUAA 4A0RA 2FR0A 4WVLA 4J75A 4L0CA 1W87A 1JEAA 2C1XA 1XC7A 2BONA 4AF7A 1U2RA 3WTCA 2GZ3A 1YI8A 2ZUSA 4PZLA 2JLBA 5FJIA 4DYHA 5HE8A 1C29B 3L43A 1AC5A 3A9TA 4UU8A 2ET6A 2UZAA 4ZAFA 4CBVA 1WB4A 5BWMA 4GU5A 1OH5A 1SQ6A 3PXDA 3ZVKA 2WIAA 1M0EA 4LECA 4K6KA 1A4UA 4C01A 2VC2B 5IPFA 4FGUA 2AC4A 3GRRA 5IVHA 2PGJA 4PY2A 2P2CA 1ZU4A 3RIMA 4QXRA 3RVMA 4AECA 5KNCA 4D9KA 1W8DA 3RSQA 3HDVA 1ULSA 3C3CA 3B38A 4ALNA 2XGGA 4HNUA 2FZKA 4FOTA 1QJCA 3OSUA 4S1OA 2YHIA 4RPHA 3QXCA 4E0BA 1M2KA 3JAKA 1R5BA 3O0DA 2CF6A 5ITZA 2J48A 4WXYB 4A0SA 3LW7A 4BEJA 3PF9A 5IAGA 2P65A 4WN9A 1EWRA 2CBZA 2NYUA 1NBAA 3UGQA 2F00A 1RT9A 1KDRA 3MGBA 5EKTA 3WR5A 2GNAA 5JD4A 2ZE8A 5B1HA 4A82A 1VYUA 4OQEA 3ZDEA 1P5JA 2ATIA 2D4AA 4U9HS 3OP4A 2PGNA 3A05A 1Z3CA 3FVTA 1AS0A 4O29A 4Q7JB 1KI6B 2IYYA 3AV3A 1W4RA 4O2BB 3MA0A 4RJJA 3TSYA 1H2RS 4AO8A 4PYJA 1KY4A 3E48A 1E9RA 5AKYA 3MK31 5JADA 1ICEA 3NH6A 1CY0A 5EJ6A 4ZT5A 1PLKA 3RTEA 4WTOA 4DLZA 4BCBA 1EVQA 2DSTA 1GN8A 1PV1A 4KN6A 2Y1KA 1C1XA 2OGUA 3DNMA 2JKVA 5EWLB 4QT4A 1RD4A 3OZVA 4CG1A 3IVCA 4UVGA 5IABA 1CUAA 5ECYA 4G8BA 4P4NA 4OI1A 4IWXA 4XWWA 4RJIA 1CQJA 2G0AA 5BR4A 1E8NA 1YGYA 3QGMA 4GPTA 1QZTA 5PNTA 3ESYA 1HEYA 1NV8A 4CM4A 2K7FA 4ZPXA 2AWNA 2POQX 3HO6A 3D7KA 5BUQA 5KTSA 2CDBA 4DIBA 3OZDA 2OC9A 2QU8A 2XDAA 2ZUWA 1UUFA 1ZVKA 3DMGA 3SF8B 2B82A 2H0AA 3GPIA 3NPMA 1REQA 1PX2A 1QO0D 4H77A 4IDOA 4PQRA 1NF2A 5BPFA 5JNUA 3PGVA 3A37A 4YCNA 3ZE1B 3AVVA 4NOLA 3HU2A 5EKXA 1A71A 1ZN2A 1EVLA 1GPNA 2Y68A 4OF4A 4QTXA 2FWMX 1X3LA 1Q0UA 1R5NA 4LC0A 5DYWA 3SQMA 5LMCA 3H3XA 3PXXA 2X15A 2FUEA 3SOZA 3F7TA 1A2BA 5FEMA 4YCSA 3T4XA 3TRIA 5LKAA 4GGMX 1FDUA 4M9ZA 3ZKWA 1Y3HA 1TRHA 3FLAA 1HZJA 5DTQA 2JKYA 1K1EA 1E5VA 4C76A 5IT5A 3ANLA 4Y30A 4RC9A 2VCEA 3KWFA 3CEMA 4YJHA 2AE1A 1R1DA 5CXXA 3OOEA 1EB9A 4PHFA 1MO2A 1AXRA 2AMJA 4J16C 3VKVA 4NZPA 1JI0A 2B92A 2ZJ5A 3K1AA 5JAQA 3UENA 1DRKA 4H3SA 1MO6A 2BTQA 4TSFD 4IYJA 4EO4A 4LJ8A 4OHYA 2FEXA 2IUEA 1SCBA 3DE6X 3FIJA 3KTAB 4M21A 3G2KA 4IJQA 4YJKA 3ZDYB 3KKNA 1O6BA 2VT2A 2ZWPA 3ETGA 1MMFB 2VZ9A 1N8NA 4E4RA 4EENA 1JLLA 1I3MA 3FWKA 2V3VA 4EELA 2IKQA 1Y37A 4FJ1A 4ZI7B 2XDWA 3EZ9A 1FVHA 1H2EA 3HGMA 3UT0A 5TMPA 1EFAA 4QJ4A 4OFBA 2NU8A 1BEZA 3HNRA 3PBKA 4M9QA 5E0KB 1KNQA 5EWJA 3A6GA 4HXEB 3PYXA 3MIZA 4BLQA 1BDMA 4QNRA 5A05A 4R2MA 4HNVA 1F17A 2EGUA 4NFSA 2G09A 1AZWA 3QOWA 4X84A 3UTDA 5LQMA 3ABSB 1SUDA 1I3OA 2PJUA 2ZETA 4FNAA 4EJMA 1ZSNA 2Z6AA 4GGOA 3Q15C 4IXNA 1OWLA 2A92A 2VHYA 1SU6A 5AXBA 4YPOA 1OI3A 3QE0A 3KYBA 4U00A 5IH7A 1W85A 3NM5A 5DLDA 4K0RA 1CF4A 1TM4E 2XCUA 2H7XA 5FR2A 4ITUA 1FJXA 3USCS 4D97A 1GIAA 1C8VB 1PK9A 5THKA 5KSZA 1VIVA 3GFBA 4DV4B 4H0NA 4IMPA 3SEZA 4IH4A 2W0SA 1NP6A 1JLHA 1Q77A 1XJWA 3JRNA 4I4TA 4P81A 4QYSA 4BZQA 3LTNC 4DUGD 3CNBA 1Z38A 2R6AA 4FYMA 2C9DA 2P9QA 3D6NB 4NBKA 2VBCA 1ADGA 5CAEB 4H6PA 3EXEB 3R0QA 3WLOA 3ZBPA 2PS0A 1DADA 1RI3A 2BKAA 3PE4A 4GF5A 2D13A 2YUIA 1Z0UA 5MHTA 2WD7B 4C89A 3F3YA 1KMNA 1IXZA 1UP6A 5FH9A 4ARCA 1O2DA 2HLDD 2PS3A 5AVKA 4B8WA 4L3VA 1S8NA 2V7XA 3ZQ6A 4ENSA 1LDMA 5HRUA 2W2OA 5B4UA 1CQWA 1FMFA 1DTSA 4HNAA 4RKEA 5IJXA 4Z9BA 3W3ZB 5IG2A 2SHKA 3LUCA 1KC3A 3GXBA 2WKQA 5JAHA 2HSZA 3NHMA 1DC6A 3C15C 4LXTA 4RBNA 3DBHA 3TG2A 4QEZA 1JT2A 2H2HA 1OZGA 1NZJA 3DAPA 4REOA 4MJ3A 1AO3A 1FP7A 1V6CA 4OXXA 3FNIA 1IBCA 5HZMA 5JANA 2XNKA 5EINA 3QITA 3QF4B 3QPVA 3NTQA 2BRUA 1HMYA 1GZ5A 5T3UA 4BNDA 1I2CA 1J8DA 1J99A 3Q40A 2CHEA 3FBTA 4BAUA 4PIMA 1L5KA 1HLDA 1ZZEA 1OLXA 1M1YB 5I01A 4C2BA 1H4QA 3D6VA 4LSMA 3OOYA 4LE1A 1RQ2A 3OKPA 1SUSA 4HX9A 1OV4A 4TRJA 3S5UA 3B13B 3D3KA 3EXAA 2FWPA 4LVNA 1B0AA 2QL9A 2HRBA 2WM8A 3D2BA 1Z62A 5DLEA 4XSGA 3UPDA 1KI8A 3ZD9A 2HSDA 2RHCA 4DADA 4MUYA 3KVYA 4F5EA 2GH1A 4MUIA 3K1JA 3A6FA 1Z35A 4QBKA 1GZDA 4LNHA 1YL6A 3PIRA 1O95C 1W5FA 3ITDA 1KIAA 4K8OA 1R6AA 1RTKA 2CB9A 4NENA 3KYCB 2VO1A 4BMCA 10MHA 1YV9A 1RZUA 2R47A 4MYRA 5D84A 2H17A 4PQFA 1U7UA 3FWYA 5CA1B 1N5DA 3NC0C 3NRJA 1GZUA 4TWJA 2PKCA 4WNYA 6AT1A 3IAM6 4FYXA 5ALEA 3RUPA 3P0JA 3GIDA 3ZOZA 1NLYA 3Q5DA 4G67A 1T4MA 1YUMA 2VHJA 1QRTA 2HSJA 2HI0A 1U7ZA 1CJTC 3FCXA 3PTLA 1OIVA 2C94A 1N6KA 2L42A 2RIRA 1QIGA 4R8LA 3ZHXA 2FYTA 1L1FA 1EVKA 3FUWA 4LYJA 4UUOA 3DL0A 4BQQA 2EBHX 1O5IA 3PFWO 1OWMA 4Z4HA 6Q21A 2PAAA 2WM3A 5E2IA 2B8NA 4LI0A 5P8WA 3SQOA 3S2IA 4E70A 1GZVA 3RVDA 1X7HA 3HA7A 1WHTB 1GCUA 3G2JA 4M1KA 1X6VA 4WDQA 4EAAA 4C7XA 5B4TA 1DHRA 3ROMA 4PLCA 3DEHA 1M1UA 2X8LA 2ZRIA 3GWZA 4WI1A 3VNRA 2P1DA 2XOXA 3TMAA 5IAOA 4PGHA 4BZXA 2RAVA 2I78A 2VHXA 1JT9A 3I64A 4U2GA 5K0JA 3MERA 4FEAA 5GM1A 4MPTA 1NJSA 3LL7A 3VTZA 2V7EA 2WHPA 2RHLA 3DD1A 1CQXA 4QNMA 1DB3A 2QGZA 1V1MA 1DXYA 2GI4A 5ALGA 4D74A 2F67A 4DY6A 3NTOA 2B4RO 2DWPA 4JVSB 4YCCA 3I73A 4LC1A 5DM70 2XUOA 3F6BX 3R4VA 1LY1A 3D5QA 1UBLS 3TZEA 4JLNA 3G7NA 4P0QB 1CUXA 3TLGA 2IXBA 2JJ1D 2OFPA 3DFMA 3ETCA 3N2EA 1QOQB 1S9DA 4Z86A 1XZFA 3CCBA 1IM2A 1KYZA 2WTAA 2ZTMA 4L28A 5FTWA 1RRFA 4IOLA 1AT1A 1WPGA 4B6JA 3N2NA 3VJRA 4FD3A 3WP1B 4QUDA 2AVNA 4YO8A 1BVHA 3O21A 4JBXA 2Y0BA 1R27A 1ZK4A 1C7ZA 4GEKA 5I4BA 1I6KA 1W76A 2WTBA 3K1AB 4H15A 3VM6A 4CIAA 4HPWA 1VG1A 4BB9A 4JN6B 2WLTA 3T0IA 2SBTA 5HCUA 3E8MA 3JD4A 2RHMA 3VSBA 4QGSA 2B83A 3F73A 3NBUA 3M82A 3B51X 5E8JA 2XKJE 3PNSA 3PT5A 4H1HA 3C5CA 5ES3A 2DTEA 3GFSA 1H3EA 1WU8A 5KSYA 3R5SA 2Y1FA 4E7PA 4IVPA 3WRYA 3H7IA 4KBYA 2GN6A 3OZTA 3TEJA 3NDJA 1J8QA 1WUHS 2R8YA 2O3JA 3STXA 1PUXA 1MJ5A 3CO0S 5DYGA 4DA6A 3S28A 5LUAA 1ATIA 2NQ2C 4IDCA 5DTEA 4AFNA 5JAUA 1I30A 3JYPA 3OEYA 1QIFA 2ECKA 1FUKA 1E7YA 4Y3UA 2XBMA 1FLAA 2RC6A 3GNTA 4RX1A 4E3ZA 1DT5A 1JPVA 4J49A 4F3TA 4YV0A 1RZVA 3ABOB 3VYTB 5AW3A 4NZ9A 1ZUNB 2W6ZA 1SQFA 3W77A 4ES6A 4RPJA 4UXJA 4ZCTA 3MHPA 4KR0A 1DFIA 2GVNA 4R8VA 5HQ3B 2K2QB 2P1RA 1A5SB 2PUCA 1JEJA 2B8TA 3PEVA 4Z0TA 1XLVA 4ZU3A 4L5IA 2IELA 2CSXA 5FWXA 2J6HA 1FS6A 1JHUA 3GLFA 3OT1A 4MP8A 1AZTA 2QYHA 2AFRA 3REGA 3TPFA 2HPHA 4M38A 1Q3KA 3ZWWA 4CXMA 4ZV7A 2DJ5A 5IYZA 4F4UA 1T6XA 3ZD8A 4ZIRA 1FCJA 4Y0AA 5KNCD 1KDYA 4X24A 1LBEA 4UOZA 1CFZA 4CTKA 5CAEA 4A0QA 1GTSA 3I62A 2G1AA 4J29A 1KYIA 1AQUA 4LHVA 2FE4A 5G2OA 1MX9A 3PC4A 3KQVA 5FL3A 4NV0A 3PC3A 4ENPA 2VH2A 1UJ2A 2VDNB 3SSAA 1MQSA 1TCAA 2FP4B 3RJMA 2PSHA 4MA5A 5KBYA 1I94B 2Q2QA 2FKNA 4EZEA 2PMCA 2KE5A 4TKMA 2WTUA 2EFGA 4AJOA 3M4XA 3WFJA 1HZZA 4ARAA 1EUYA 1DV1A 2DWUA 3U3ZA 1A77A 1ISSA 4LV6A 1ZK3A 5ICFA 4ZQBA 2XMQA 2J3JA 4E13A 3FMVA 1UPCA 1N7IA 4LTNA 2L18A 3DZKA 5EZ5A 4OAOA 3P4YA 3E6AA 2I6QA 3DPIA 1BRTA 2JEOA 3MCTA 3IKMB 4I1YA 1F7UA 4JODA 4AY4A 5T7BA 3DVSX 1Y98A 1ZBQA 3ELBA 5SZKB 4CM5A 2ZDQA 3I4CA 3KQHA 4GLLA 3ZJTA 4K05A 3CVUA 4YMSA 3IL2A 1T3TA 2GPTA 4Y7CA 3BE4A 3BE6A 3PFNA 4TT8A 3ZQUA 5C8YB 3LPNA 1JZSA 2NVOA 1SU4A 5DI9A 5H3HA 3CPEA 4B3IA 1MVOA 3PHHA 3G89A 1T91A 4C2UA 3ICEA 3RS9A 1YQGA 1C2YA 4HDSA 2JLYA 5JO9A 3SKXA 3G8CA 2H5EA 2Q5EA 3BCRA 4NNPA 4ID3A 4BJ5A 3TNJA 4ERNA 3ILSA 5AHRA 1HTWA 3V4FA 5SY9A 3AG5A 3HCWA 3RF6A 2BM1A 4J91A 3UV3A 2IPAB 3VR6H 5KYYA 1KYQA 1OFUA 1SVOA 4FX2A 3HYNA 1J0BA 1B8NA 1Q1EA 1ZD3A 1O6CA 3E8XA 1QHGA 3SVLA 1Y6JA 2VDUE 4CT0A 4ZZ3A 2E4VA 3LHSA 1O94A 4I66A 3FYTA 4LNAA 1N2XA 4XQEA 1POXA 3LHIA 3K9QO 2VFAA 1L5WA 1OWOA 2ZVQX 3HVIA 4IF6A 5AXAA 2CJFA 1FRNA 1X1DA 3EAGA 3PR1A 4IPTA 4QXQA 4BVEA 5AUPB 3HYRA 3R7DA 1QIJA 2F90A 5ALNA 2ZYSA 3PHCA 4A2WA 4ZJUA 1WXGA 1BMFD 4C04A 3IP8A 1X7WB 3EK2A 5ECDA 3I72A 4J6EA 5SYNA 3TSZA 3JSAA 4Q7QA 3NATA 2IZ7A 4UU0A 4RTQA 1JFRA 2YKGA 1U2PA 2YRXA 1ADBA 4QBHA 3MC1A 1ZRNA 5CXSA 1M1YE 2QZSA 3KKMA 1JE1A 3IUYA 3E61A 2ORYA 4G8JA 3ZWYA 1V9LA 2J7KA 4NVRA 3V48A 1ZHFA 1EX7A 1K7SN 2H11A 3VZSA 4D8UA 1DV2A 2QLMA 4DEVA 3IMKA 3DFZA 5F77A 3UGJA 1CIVA 4KFUA 4EA8A 2C5EA 1DI0A 4F85A 1UKBA 2Q6IA 4M1OA 1XXHE 1EMDA 4DV3B 3MUOA 3O8DA 4KR7A 1N6LA 4JB2A 3CR3C 2I66A 3FF4A 1FNDA 4KNWA 2OV3A 4YO7A 1MC4A 3M6AA 3AC0A 4PLFA 4DIUA 4LZPA 2KW5A 2WSMA 4CM7A 1X7ZB 4PZ0A 4QRHA 4RF4A 4AB1A 3X2SA 3QWBA 3WWEA 1JGTA 3UFBA 5K0EA 3W5AA 1JG3A 2EF1A 3U7HB 4QTYA 2ZBPA 4FKZA 3D2CA 4N12A 1PNRA 3FPSA 4ZTBA 1N9GA 1PQPA 1S3GA 3FZGA 4WCVA 4MKZA 3ORFA 4FDTA 1E69A 3L3BA 1B0UA 4KPEC 4ZGBA 2FEPA 1TT5A 4GR5A 2CSUA 2BBOA 4AJNA 1UZUA 2GPWA 3SEFA 3FPLA 4XVQA 3VC7A 4K40A 3OMLA 1RXCA 1XEAA 3G9TA 4ZKEA 1XHEA 3WSVA 3AERA 2VT6A 3G8BA 1RXUA 3WGVA 4L51A 3WAKA 2I4LA 3QLVA 5HQJA 1AUPA 1O6GA 1P44A 2C20A 5DN9A 1E7RA 4ARZA 1PT6A 2G5TA 3GUYA 3KLOA 3TE6A 1RRMA 4R0MA 2CVFA 3U39A 6PFKA 3GLFE 1DINA 1G8PA 2G82A 3LQRA 4DG9A 2EFDB 4HDAA 4D6PA 3CTMA 4UM8B 3R23A 2A2ZA 3LCJA 2HOQA 3PK0A 2MU1A 3ETHA 3T1NA 3GYBA 2XW6A 1XMJA 2ZDHA 4YR9A 1U2SA 2FZLA 4MWCA 3W5SA 2I9PA 1H4TA 2JHFA 4Y98A 1VA5A 1M1ZA 1TO1E 2JFPA 3UJ3X 5FI1B 4CFZA 2HL6A 1VJTA 2C9OA 1IN8A 3DCYA 3RTAA 2NZ8A 4R3NA 2Q5LA 1T2CA 4A91A 2HCFA 3GLTA 16PKA 1CD5A 1MNAA 3VU0A 1KKMA 3DLTA 3I9V6 1PUJA 1TVMA 4BN0A 3QU5A 4B4DA 1IM8A 2PZKA 3LU1A 5DNVA 1K9SA 1LC0A 3KQUA 4ZQIA 4W7IA 2JH8A 1IXYA 5IFLA 1D0IA 4J1QA 5CCDA 4A16A 2HEGA 5HIJA 5FWXB 4RDCA 3IAHA 4MZXA 3DO5A 4TYNA 1GPLA 2HCTA 5BSUA 2QR5A 2FMIA 3DT8A 4UVHA 1SVUA 3MWGA 2V97A 4P3PA 1OVMA 2ZR0A 4FT2A 1IYZA 3C0KA 3HA3A 5BXYA 3OQOA 3HCFA 4XDZA 3V8EA 2WU8A 3G0DA 1XG5A 2I4RA 1H8HD 2DY0A 1UKVY 1E2NA 1AXEA 1NM5C 1H0KA 1QHNA 5HKBA 1P1CA 3RC9A 4W1QA 1XZIA 4RIIA 5HF9A 2R60A 2Y1GA 1V47A 3VMMA 1AKRA 3IAS1 3AILA 3P2JA 3OZCA 3WGQA 2IZZA 3T8YA 2Z3WA 3PJFA 4M8NE 4I1OA 2RK3A 4O8ZA 2Q7DA 4AQ7A 1GZ4A 2XMRA 2YHUA 3MWLA 3LOPA 1TGVA 2O8BB 4GUDA 2PN1A 2A30A 3P0RA 1ZO8A 3IQGX 1XEXA 3AL2A 1ADCA 4RFSB 4CM9D 4NBSA 1PR4A 2D5CA 3AR4A 3U3MA 1VHTA 4Y2TA 1VMIA 2B6HA 2RHRA 2EFEB 3HVJA 3MT7A 4UCFA 4DMLA 2M6RA 3I3OA 3MWDB 2X4DA 4ZHSA 2Z9CA 1OTXA 4XPIB 1URPA 3IXMA 3NJ8A 5DJ5A 1CJKC 3FTNA 4S2UA 3W6UA 1U8TA 2IGBA 3RE1A 3BB3A 4JQCA 3ASVA 1T8RA 3R3ZA 5J9FA 4AS1A 2EKDA 1X13A 1P2VA 4KAXA 3UGKA 3U7FB 1JTEA 2J07A 2JK0A 3LLCA 3LQ1A 3GVPA 1F7VA 2HSEA 4NV1A 1G2PA 4MVJH 3WI7A 1JIUA 4RDHA 2VDVE 3E22B 4P7GA 1G18A 5JD3A 3CIFA 3HN7A 4MNTA 1RBYA 1U2DA 1E4OA 1MR3F 1RWMA 2OECA 2YUTA 5DNEA 4DJJA 4KI7A 1YL7A 4BFZA 4BVKA 1TVKB 1BXGB 1WHTA 3PGMA 4K5QA 3F8SA 3RCBA 1J70A 1Y1LA 3MGCA 3UYLA 4OO3A 1GRCA 5TEVA 4DCJA 2MSCB 2XZLA 2EEZA 2M1ZA 1WG8A 1FYEA 2ZVPX 4FMDB 4HWRA 4D0NA 5A5VA 1GCIA 2RONA 2G71A 2R1ZA 2XD9A 1FSGA 2FGKA 2YHBA 2Y99A 4MW7A 1WE2A 1YQEA 2O1EA 2WPDA 3BK7A 4MO2A 5I6DA 1XWIA 4GW3A 3UHOA 1BA3A 1R74A 2ODNA 1E2GA 1JHDA 1KJQA 1S7GA 2RGXA 3BHNA 3CH7A 1CQZA 3NUQA 1P75A 1K0UA 3GUUA 4LZWA 5EGSA 5ARCA 4WBNF 4F6LA 4ZO9A 5BQXA 2HLPA 5B1YA 3LRXA 3TTWA 2XQKA 4G0YA 4JI7B 4PANA 3G2LA 4KGZA 1WXQA 3MWEB 1KMIY 5IM5A 3SEQA 3TX2A 5FDFA 2BUAA 3AF0A 4MLZA 4ND6A 3RT1A 3PA6A 1QGYA 2SCUA 2G1PA 4YCMA 3W06A 2VLIA 1ZJWA 1FPMA 1CUBA 3B6ZA 3N8DA 5F2KA 3CM0A 3K5WA 3GQBA 2ETVA 3BD9A 3FUTA 4GPBA 4PWYA 2W48A 3ELDA 1DL5A 1PJ8A 3H5LA 2XECA 3PPYA 4FU0A 2X0FA 1YZGA 2GXAA 3LXMA 3EF3A 4YP9A 4DANA 1RYMA 3HEAA 4NYIQ 5BY2A 1YR9A 5DF1A 2XH8A 5U4QA 2R1TB 3PUIA 1MT3A 1WXDA 2PUTA 4KW7A 4W82A 5FLEX 4B45A 1E0JA 3D8NA 2ODPA 4KTTE 5H9WA 2PKQP 3NPAA 3VJLA 5TMDA 1YJAA 3CS3A 1C80A 3L4JA 2KJQA 1GAEO 3P4UA 5CHEA 1UWLA 3KIPA 3DOFA 4TMWA 3Q3HA 1M54A 2Z08A 1IG3A 2C4NA 4PS1A 4ZREA 2CYBA 2X9NA 1Z0JA 4ZAXA 1RCTE 1X8LA 1RHQA 4X93A 4FYPA 3EPLA 5JALA 3NC1C 1E3MA 1X80B 4LJ9A 4P3OA 1B4DA 4N5HX 4KJZA 4OMUA 1B00A 3SXJA 4X65B 2GQ0A 3DPUA 5FORA 2PK3A 1JZQA 1U0JA 3GA0A 4FLFA 4IICA 1K6XA 1H3NA 2MR5A 3KFVA 4PYRA 4EDHA 2I9KA 3G9UA 4IZIA 2JGNA 3A4VA 3CGGA 4TZ0A 2E9SA 4DA0A 3U4GA 1KPGA 1B26A 4NKRA 1IOWA 4LS3A 4D82A 2JFWA 4Z6KA 1IY1A 1OT5A 3OKFA 4CM6A 4AU1A 2VXOA 1U11A 5K7SA 2GNOA 2OV8A 2VYFA 3PB3A 2ADMA 5JMPA 1Z25A 1QNLA 1W4BA 4F1WA 4CQNA 4GM0A 1T1JA 6NULA 1JYFA 1CT9A 3A11A 4HUTA 2ZRMA 1P80A 2N3ZA 3F3KA 1QTQA 3IT3A 2CV0A 4UHFA 3SHQA 1XSEA 1K88A 1KZ4A 3K9NA 3IUPA 4DQDA 3BGIA 3MG9A 5L51A 5KYXB 4DIOA 2YZGA 1VLQA 5ER9A 4I2VA 2Q5IA 3HR4A 1A7UA 3FFAA 4DSNA 1VQ1A 4KNVA 1KFCB 2C5HA 3O8BA 4IUCS 4LRSB 3RC3A 3TFQA 4ALMA 4D9GA 3ESBA 3RQIA 4RXTA 2Q6VA 4D9MA 4CEHB 2JGLA 1DXOA 1X0VA 4WK6A 1HI9A 5DOZA 1OZFA 3CSSA 4GT1A 3CX6A 2Z09A 1HDOA 1VRVA 1HXHA 4IIVA 1ZH0A 4NECA 1Q21A 2JGKA 2ZJ1A 3LGAA 5FTMA 1WO8A 4LZJA 1ZD9A 3NQ41 4GXTA 4POOA 1EAMA 4EUEA 4Z0HO 2FW8A 4BPBA 5FUMA 1GL9B 1PU2A 3CWQA 4QWWA 4WBSA 1D09A 4FWBA 4U3JB 4H3HB 4J1TC 5AI0A 3HB9A 1SZCA 3U19A 1VBNA 4L8GA 2AW5A 2IPNA 4N3CA 5HFNA 1ODSA 1DKRA 4LY3A 3FZYA 2MYTA 3Q6IA 4WERA 3FM9A 1DC7A 3WTBA 2F9MA 5BV0A 1WMBA 2HIHA 1R6XA 4YQZA 2JARA 4V0QA 5FUXA 4YLYA 3DP9A 1Q7CA 1SWVA 2QTVA 5KYUA 4C07A 4FMCF 4RANA 3K35A 2ZDGA 1MNQA 1PZXA 3MELA 5HOQA 1J0DA 4RA9A 1F2VA 4GNRA 4H7DA 4ZEWA 1DAHA 2GM3A 2H2DA 1P3Y1 3TRFA 3PTAA 1FA9A 3F4BA 3IHWA 3PEEA 4ESEA 1E7SA 1PVVA 2FWNA 3KEMA 4JK3A 5EP3A 2XAUA 4CQLB 1XZNA 1RHJA 2CJWA 1RYFA 2ZLBA 3II6X 5KQMA 2RGGA 3FPKA 4Y1RA 3LQQA 3FGZA 4YRCA 4L9AA 2ZWAA 2FEMA 1GAJA 1K7FB 2XRFA 2LKDA 1NPTO 3BULA 1P60A 3INYA 3OZXA 4PQEA 5A7HA 3ZIDA 4I5IA 4US1R 5JBQA 1IULA 2ENWA 5L4SA 2VTBA 1R9MA 2YW2A 4LV5B 1IIBA 4BWFB 4MWZA 2QLNA 2M2IA 3WBKA 3I0ZA 1JWAB 4D3SA 1SHZA 2E18A 4EB3A 1V7QA 2XE4A 2P67A 4G9BA 4EA6A 1U5AA 1YHNA 1UM8A 4PPFA 3MCWA 5L6MB 2Q3MA 4J7AA 3S2GA 3TXXA 3P9IA 5BWCA 1O94D 2ZRKA 4RZ3A 1NW7A 3EZLA 2BMEA 4MVJD 3X0DA 5LXTB 3HCDA 1XCGB 4TVSA 3EPHA 4WLEA 4FYKA 1QLJA 4B7AA 4M0PA 1Z2PX 4QELA 2C5AA 2B1IA 2WYWA 2G40A 4YYZA 5TVKA 1ZI9A 3RS8A 1EGHA 4P3YA 3ZU5A 3R6WA 5HBGA 3DAFA 4MA4A 1E1YA 2H1OA 3ESZA 1QZUA 4DRZA 4EI2A 2CLSA 3BTUA 4P31A 1JVNA 1LFDB 1V8BA 4UJ3A 4KR6A 1SKBA 3CN7A 1QE0A 1P72A 1Z12A 3RRMA 4F6CA 3WJAA 3F5DA 4FR2A 1YBHA 3G2NA 4K9SA 4Z8XA 3C8UA 3QVTA 2ZYTX 2CMFA 2IYEA 2BE9A 3FPEA 4GM1A 5LR6A 5DLYA 4JZYA 2IUSA 5K4HA 3MM4A 4OQDA 1HDZA 2ILVA 2IPXA 1CY4A 4JXKA 1YULA 3Q1LA 3V4ZA 1QK3A 4EUHA 3SYKA 1WWKA 2QD4A 1I3CA 4OHKA 2J3KA 1N6NA 1AUQA 4HB2A 1F3OA 1SHUX 4KXMA 4PC3A 2GYVA 2SCUB 1WTAA 2JI7A 3LVFO 1Z82A 4G09A 4IDEA 1N1DA 1SM4A 1L5LA 2Z8YM 1W9MA 1C9NA 1NQWA 3L8ZA 3NBMA 4G0OA 3K8OE 2PVSA 2XV1A 2G9VA 1WABA 4IIJA 3DV9A 3NASA 1DCKA 2QUIA 3N59A 3E9RA 2C9BA 3KRTA 3N2ZB 4Y2VA 5WRFA 2YVLA 5BVGA 1QQ5A 1TEVA 3DVRX 3QX3A 4K2HA 1XDDA 3EWIA 3O3NB 1F4VA 4POAA 2R96A 2XYQA 4QX6A 4KGVA 4B83A 3OQBA 3L6RA 1G20B 3LC2O 2WDZA 4MVJP 3P45A 2HR1A 1M74A 4JC0A 4WZAE 1IFXA 2NTJA 1P1IA 4L78A 4ZVPA 4FLEA 3TL2A 1EFDN 2BGIA 1JDJA 1B41A 2PKYX 3VFDA 2NOAA 1T6ZA 1W35A 1MABA 1FP1D 3PKJA 5CR9A 5FIUA 5T67A 1EHYA 1BN7A 3V3TA 3K6JA 1QZZA 2X4LA 1Z15A 2AUNA 2P8JA 1EFRA 1E62A 4LYEA 3GJYA 4HGNA 1RQNA 3A6LA 3WGIA 1QG2A 1X80A 1IHYA 1ZWKA 4YMTA 1N92A 1OROA 4XXHA 1V95A 3CLTD 5C8YF 3OFNA 2C58A 4JUAA 4ON9A 1BO6A 2VSXA 2VBIA 1K4MA 2PLWA 2HTFA 3ZE8A 2R8BA 4WOKA 4BNZA 2GBPA 5FA6A 3TQOA 1E1KA 4RD4A 3GEIA 2WPNA 4D3ZA 4ESOA 3LV8A 1JPJA 1CY7A 1JXMA 2GWHA 2N9UA 3OICA 4HNGA 4E30A 1ZJ6A 3P9QA 1ZMTA 5EMHA 5DK4A 4HAXA 5C4GB 4ZMRA 5AUOB 3HY3A 4JIMA 3CT4A 5DN6D 2EP7A 4I3HA 4N8EA 5D3MB 3W8DA 2AF3C 2A14A 2G5PA 1KHTA 4U2FA 2GA8A 1KI2A 2WV9A 1CUYA 3L7LA 5EN4A 4R69A 4QGGA 4RQBA 3X1XA 1N57A 2JASA 2RGEA 4I1UA 2NMVA 5ESDA 3QNWA 3MEQA 1N36B 4UNQA 1N3YA 4ER3A 1SXGA 3KKOA 1CY1A 5MFZA 1QK5A 1WDWB 3LWDA 3KQQA 4KFRA 4XVUA 2RJNA 4N9WA 4LRXA 1YQ9A 4YP6A 3N2YA 3OQPA 5L9AA 3JXEA 5AJUA 3ZLTA 4A1OA 2QYTA 1G2IA 4KGXA 5ARBA 1TYZA 2YWCA 3VPHA 4EOGA 5EE5B 4JBGA 4JLMA 4DTCA 1QYVA 3C3MA 4XUGB 5AWFC 2QDXA 1X8KA 1CF9A 3ADOA 4YH1A 5CFOA 3F0TA 4L4YA 2Z0MA 1PFWA 2H85A 1W52X 3WG9A 4D3XA 2D5BA 1NY6A 2ONKA 3EXHA 3DBLA 3H13A 3JASA 3R6GA 3H8JA 4L0MA 2GCNA 1KH2A 3FYSA 3OFKA 5CA0B 1OZHA 1VIDA 5KDDA 1FL9A 1W5TA 4R2LA 4E09A 4WXMA 2OHJA 5AXCA 3NHWA 4BKUA 5JYCA 2GCPA 3STHA 3TIVA 5KEIA 3DTVB 1BU5A 2YIJA 4XW2A 4QOIA 2AOUB 5D1NA 4CM1A 2EX0A 2VA9A 3VOAA 4EJ6A 3S29A 3ZWVA 1JIQA 1FNBA 4OQFA 5JSZA 1K08A 3DBVO 1N5IA 4UARA 4G0WA 1PGPA 4ZJZA 3ZR4B 1R4NB 2FQQA 4RZUA 3EOZA 1U80A 2C5SA 4GI1A 1Q74A 1WB6A 1KO1A 1CRWG 1X7YB 1N5MA 1E7MA 3OJOA 4O2AB 4F60A 1UM9B 4U5XA 5DM2A 4G37A 1GNSA 3L1JA 4X1YA 1UINA 2E4XA 3ER6A 4UQLA 4HJRA 3AEQA 4EVQA 2OZVA 4IV0A 4WXEA 4CF4A 3WNQA 1ML3A 4UU7A 3WYGA 5CD1A 1CQIB 3LKVA 1HSZA 4M9SA 5LU9A 2D6FA 3THSA 1I7PA 3ZLJA 1PLLA 1P19A 5IEJA 3K1YA 5AM2A 2XADA 3GCZA 4ZU1X 3X1YA 2NZWA 1NXXA 3PQ6A 3PUWA 2VPYA 2VDWA 3RBXA 2QW0X 4GOOD 1UBTS 3AM4A 3LPLA 4WFJA 4HDNB 2BMVA 2YMMA 4PYMA 2V9ZA 4JJ7A 1EFTA 3F5SA 3PNVA 5KTTA 1WF6A 1SD2A 4Q4DA 4LZLA 4XB2A 4GI7A 3BKXA 2CJYA 1E98A 2VJMA 4I3FA 1MKYA 4HVAA 2IH5A 2EBWA 3NVAA 3HKEA 3A58B 3I34X 4CGYA 2DX7A 5FBVB 4NJEA 5IXJA 2BFWA 5DTJA 4IHKA 4R1OA 4R83A 2AN3A 1Y34E 2NU9B 4BNNA 4OJNA 4DTIA 1N33B 2AI2A 5EWMA 4CIBA 3ERCA 1ZD8A 4M98A 4DHEA 2ODTX 2FVXA 3OG9A 1J09A 1L4HA 4LEIA 5ALPA 4BMVA 4Z7QB 1Y9AA 2AHRA 5KOHB 1EK6A 1Y3CE 3QV2A 3FPHA 4XIIA 1K92A 2P4QA 4EUKA 4F4IA 1J2UA 9GPBA 1IL0A 1ES9A 3IDFA 3SYNA 1Z8HA 2D1RA 2ZAYA 3ZY2A 4BO8A 3PGLA 4TKVA 3DVAA 4AJ9A 4AZVA 2I7TA 1UK9A 1XEWY 1T9BA 2NTNA 3AV0B 3KOUA 2BGWA 2DTXA 3UJ9A 1QPZA 4Q1EA 1SQ5A 1G98A 2WIFA 1EFPB 3AEYA 3CJQA 3ELYA 1FUEA 1GTG1 4ZD6A 5AUQA 5GPBA 1L8LA 4R8MA 2GETA 4G1VA 3L0SA 4LWQA 4OJMX 2PUAA 3E5HA 4F4DA 3BFPA 2BHLA 3B1XA 3CO5A 1J8YF 2ECPA 4NQRA 5GZ6A 5JPIA 4CQLA 2R0QC 5FLKA 1D2CA 5TPZD 3VR2A 3UATA 3QVKA 1YKSA 4QHSA 1B6GA 1KP9A 1DARA 3C3EA 3C45A 1MQ9A 4B3SB 3H84A 5AVXA 4U7HA 2YWXA 3ZGOA 4E5SA 4E46A 2VTBB 1P3JA 1PYGA 1V45E 2BGNA 1TM5E 2ECOA 4GBED 4ZO4A 3LT2A 3TEFA 2R87A 5CA1A 1CE8B 1IUPA 2YDYA 3JQ8B 3OD1A 1ZGJA 1I4TD 5EWLA 4DWWA 3NV9A 5KQGA 4JP2A 1ORRA 2YR0A 4X92A 1RI1A 1V7ZA 2V6FA 3ICWA 3TQSA 3JW8A 3NOXA 3EXFA 3WGUA 1DDOA 3F46A 3NOOA 3FTFA 4ATNA 2GHRA 3C70A 1UBUS 1UT5A 3KQOA 1A7JA 4BFLA 5KQLA 5LVAA 3V42A 4N6GA 4JY7A 3MS4A 2QSJA 4G5RA 4TM8A 1TKRA 4ILEA 4F5DA 2QJWA 1UFVA 1YZHA 1KBQA 2DVMA 4K03A 3HV2A 3HJBA 4CLXA 4FB4A 4L22A 1A5TA 4AJLA 4WW0A 3JQFC 2D0OB 1SVNA 2GKSA 5D51S 2HSWA 1AM4D 4BQOA 4HN9A 1ZD2P 4CZ2A 2DHCA 3F3MA 4MV3A 5ALLA 9LDTA 1V2GA 1O5TA 4O2RA 4C0HA 3W6OA 1IQRA 1F2UB 1LLQA 1SIUA 4IJMA 3UGTA 3RC8A 3GDFA 3TCNA 4C30A 4KHPB 3FSEA 4BNDB 1FDOA 2YJGA 2UZ3A 2PEZA 3H17A 3J81k 4DV6B 3QEBZ 2GMWA 1CNMA 1M1YA 2ZUTA 1IM5A 3VR3D 4OATA 4A8JC 4GI5A 3SPXA 2VPXA 2GVDC 3LFHA 4MQFA 1VYTA 3E9QA 1HLFA 1EX9A 4X7BA 4CQMA 1WXWA 3AGQA 1ADYA 1TJYA 1JQ5A 2GRJA 2JGIA 3G6KA 3EG5A 5A9SA 5BMVB 4TL6A 3RVBA 5A3JA 5C81A 3DMTC 4HOYA 3QVLA 2QVLA 3CH5A 4L2IB 1B8OA 2X1HA 3S7TA 4KODA 4OB8A 2NVBA 4P1ZA 1ULTA 5FNZA 1VHLA 2CHQA 2F48A 3AR7A 1YJCA 1FZQA 4EI8A 1FVFA 2NXCA 4H6VA 5LMUB 3M6LA 5CB0A 3HI6A 1B0PA 2BFDB 2J5QA 3UMBA 1IY9A 3T9CA 1ZIXA 2UDPA 3B2QA 2CNOA 3KD2A 4O3FA 1HYEA 3PA8A 5AOBA 4OH1A 5B7QA 4KK4A 1TM2A 1HC7A 3RTCA 1ENOA 1V25A 4G5FA 2FK7A 3DM9B 2QRVB 4H18A 5DGIA 3QVVA 1PF7E 3MTIA 3O74A 3TD9A 3QF7A 3T5AA 1XDUA 4FS3A 3TPZA 3WBJA 3GCDA 4KQ9A 4QJBA 4B3JA 4YR7A 4J0GA 3ZNQA 5ALOA 4KDFA 2QORA 2WJYA 2G36A 3VYSB 5A03A 5LQKA 1ZVQA 2RAFA 1NP7A 1UBNA 3DS8A 3OUUA 4YAKA 2B30A 4KQCA 1KSHA 3ROXA 4LFBB 1FDWA 2QUBA 2WMYA 2YHAA 3IS3A 2YWJA 3KKKA 4BVGA 1OJLA 4NBTA 1OLOA 2JLXA 4B84A 4ZCQA 1UCFA 4KLCA 2PPLA 2W6CX 3BQ9A 4I55F 2IEZA 4YUWA 1T4GA 1DWPA 5CUQA 2HA6A 5EXDA 4B33A 4CW7A 1L5MA 1YJBA 5M34A 5GADl 5UKDA 2OZEA 3LPCA 3OP1A 1R12A 2R8RA 3DE4X 3U4QB 4INPA 3RJ5A 3WDKA 1K7CA 1PNTA 4URWR 4IXMA 1LPNA 3KXIA 2VRCD 3EX7C 1E59A 2GZAA 5FULA 1N5KA 3M49A 2IS4A 3UC9A 1RKVA 5KX5F 1XAIA 2R66A 3ZCSA 3L0YA 4KBGA 3D0QA 2D3WA 2QVYX 4XGKA 2QTHA 5C1PA 1A9ZA 4LJLA 3BQMB 4I9GA 1PE0A 2O7RA 3L6DA 1QH1B 1VCIA 5KSOA 3ADBA 5LXTF 1EP2B 2OAP1 4ITRC 2YXDA 1CF2O 3R3WA 4IY1A 2VYVD 3ZI7A 2PH1A 1N0UA 2QYSA 3DF7A 4WNCA 3UMCA 3L7YA 4OP2A 2A9OA 1M2GA 2ERYA 3NUGA 3RAEC 4A15A 3Q41A 1OIXA 5I47A 2QPAA 5JHGB 3FZNA 3L7BA 4D99A 5K6AA 2CF5A 3HFGA 2HU8A 4PC6A 1E9CA 3Q11A 4Q34A 3DLPX 4E51A 3M81A 4MGYR 1MB0A 1S5PA 3EIHA 2TRSB 2D2VA 2HX1A 3C6BA 4MI3A 1JECA 2TSYB 4RHUA 1PJTA 3L1KA 5IJWA 1F6DA 4KYUA 2BBSA 3WSTA 3S1AB 1UBHS 1WUTA 2IPOA 1EE1A 4UCXA 4EB6A 1RJGA 3M1AA 3OTQA 5AM1A 1DIRA 1GY8A 1GCOA 3AUYA 3KOYA 2HIAA 3REQA 3CW2A 2XUJA 4MKGA 5LQSA 3AI3A 3FR8A 4B48A 1YHYA 1A8IA 4RTKA 5MGNA 2XB2A 2A94A 2WDPA 1RWNA 4HFRA 3HZHA 1Q0HA 4R5HA 5KHAA 2J4FA 4MKFA 2ERCA 4LTDA 4KL8S 1IWOA 1TNDA 4ZMSA 4GO1A 4ZVKA 4ZEXA 5EE3A 3R7NA 5FHQA 3T1HB 4BBZA 4PPGA 3L8FA 3SSMA 1EWQA 4OB7A 2BPOA 2WQZA 2BEUB 3U1TA 4M9UA 5AQ1A 4JI4B 3GVHA 4M0KA 3W5IA 2OQIA 5FNVA 4B81A 1NSFA 4O2AA 3ZIAD 1BW9B 1HE5A 4KV7A 4QJ3A 1T8SA 4MIYA 3DZDA 1QIDA 3GJ4A 5DYNA 3SWWA 4HYYA 3IJ5A 1Z2DA 5BQPA 5I7OA 1PGJA 2HXSA 5FEUA 1VG8A 2BW0A 3EXIB 1E2QA 1LDEA 1N7JA 3M4ZA 4H1TA 4YT5A 1GR1A 1XA3A 3AY6A 3IB6A 2ZYAA 2CNBA 2ZSHA 1ND6A 1KMQA 2C54A 4WNAB 1Z22A 3FSGD 4V0RA 3BJRA 2D7CA 3FFTA 3ON5A 4IHQA 3H7AA 3QKSA 3VR6A 1Y5LA 3LYUA 1J49A 2O0MA 4PN7A 4BGEA 2FX5A 2ZKIA 3A3KA 1RXIA 5KOYA 1MJGA 4UATA 4C4RA 2H59A 3WWDA 1BCSA 3LLVA 4IEEA 4QDXA 4E5DA 5JAZA 5E9AA 4DJEC 3IX7A 1JA1A 5IN4A 4C7BA 3IVAA 2V03A 4CN8A 1MAUA 3GLUA 1ECFA 3SS8A 3VU3A 3I9KA 5ALWA 2EGHA 4DCSA 4M3NA 5GWXA 2F1KA 4TT3D 5FHRA 4FQ5A 3AP1A 2FU5C 2VRWA 1IZYA 3B1VA 1ODKA 3DMTA 3FJYA 2DUJA 3AOEC 3PGA1 4H7PA 2AUMA 4N0MA 5FFMA 3WLAA 1PJAA 4EYSA 3I9V1 4JITA 3HBNA 2ZZNA 5EIBC 2FKAA 3DVLA 5F33A 4BJ1A 1YFJA 1CNEA 1EG2A 2O8VA 1R66A 2ZYRA 1UFOA 1H65A 3LKZA 3A6EA 4MQLA 5CYGA 2WJZB 4G1CA 1UPBA 1ZIOA 2X7XA 3CLRD 4GX0A 4ENTA 2E4UA 9ATCA 1LNZA 1YFZA 5H4HA 4DCGA 4BLOA 5CA1F 5MN5A 1NI4A 1W5AA 1TF7A 1RWKA 2ONCA 3GBSA 3I04A 4LXXA 4NH0A 1QFSA 1JHYA 4YASA 2Q6KA 3F9IA 1AF7A 5AR1A 5BWBA 3F98A 1J7KA 3JQBA 5LWQA 4HDKA 1PK8A 3M3PA 4NCBA 1Z8NA 2F4NA 4CL0A 1IOLA 2JBHA 4MB6A 3QHPA 4M60A 2KLHA 1QO0A 2MSNA 4RSMA 4HWOA 5AK5A 2NTVA 3UKDA 3V32A 1RWQA 2EIXA 3CC8A 3IAS6 3OPNA 1EDBA 4MR9B 4XQ9A 5BN3A 3DE0X 3FJ1A 4IHAA 1JG2A 4L5CA 2R79A 4UHBA 2W2LA 4YPFA 1HDGO 1JA0A 4B82A 1KRHA 4B4VA 3N58A 4R84A 1YJ5A 2WAYA 3UWMA 5ELXA 3TLJA 3TBKA 2DHRA 1LX6A 1VYHA 1IBRA 3P1JA 5CLQA 1UBEA 1QVZA 2GFHA 4IP0A 2JL1A 1JQKA 1VJDA 2B2CA 2FDXA 1AK9A 2W43A 1L5SA 2XLBA 4FTWA 3HVUA 2LIVA 3AINA 3KHUA 4HZGA 3G5AA 3NBZC 1K7YA 4HN2A 1T4DA 4CMCA 1AE1A 2UYGA 4HX5A 2YMPA 3HB0A 1DG3A 2GBGA 1P7WA 4JLUA 4Q3BA 5LDHA 5H3LA 2IP4A 2CXSA 4EATA 1ORVA 4R81A 4JLKA 3WX0A 2IYZA 4JT4A 1OFUX 4TTJA 2BKXA 1U7DA 3SM9A 1WBBA 1M34A 1ORDA 3AEUB 3O83A 5EJ7A 3Q7QA 3AY0A 4D92A 5HUHA 4QAJA 3A3OA 1KEKA 1H2WA 2O5VA 3P52A 2DT5A 1UBOS 1KF0A 1BMQA 3NBFA 1AMOA 1BIFA 1UPTA 1S2IA 1T9GR 1YUNA 2MOKA 3VISA 5B57C 1SPXA 2G17A 4ERXA 4WK2B 2JLVA 5KS2A 1KO5A 4GEGA 3VC2A 1EXDA 5D01A 3PX3A 1YIDA 5JDIA 1XKLA 4KSYA 3MWJA 1ZONA 2EQ5A 1YXMA 4MVXA 1IOZA 1TZJA 4ZYZA 3EDRA 4MP3A 2IOYA 3EQ7A 5HCNA 4DABA 4HLCA 3EQZA 1UBJS 2V0NA 3VOTA 1I2DA 2D5IA 1RI5A 3BFJA 4B4OA 4DIMA 1CUVA 3KDPA 2DERA 3N0WA 2YJ6A 3AT1A 1HO3A 1EGVB 1S6YA 1WY5A 2O4UX 2X9GA 2XBLA 5BN5B 5KYVA 1KHHA 2FV8A 5KJCA 2OO5C 1EZ1A 3EOBI 4RVOA 2QG6A 5KTPA 4RTPA 4BP3A 1EUQA 2G6BA 1E9EA 2VTVA 5I5GA 2ZVJA 4LJ5A 1CCWA 4N18A 2BZ0A 4CE6A 3T99A 5JH7A 4TXMA 2Y77A 5LBIA 1TKBA 5LKRA 1X70A 5HRCA 2XZOA 3QSYA 2DC1A 3N07A 4ZVTA 5ICGA 3D31A 4ZAGA 4E14A 1TRKA 2WSSA 3JY6A 3LWNA 3KXLA 4DW8A 2QL7A 3ET5A 4PEVA 3RIXA 1JVSA 1N6HA 5EP1A 2OXIA 2ZJ6A 5BN4B 2BY4A 3COZA 2OK8A 1HE3A 1NVFA 4ALLA 1CY6A 4DAOA 2F1OA 3I5XA 1V8PA 3GJXC 4BLWA 4KLRA 1NI3A 3KUCA 1HOXA 4PX9A 1M2HA 5IDQA 3E7PA 3JQ9C 4ARZB 4GLOA 1UJ5A 1BQ3A 2DPHA 2JCYA 3L7DA 5FB3A 5KOJB 4MRAA 1K27A 2LRHA 3O90A 2WWXA 3S2SA 5LUBA 4YDQA 1J9GA 1U5CA 3NHLA 1E6EA 3BXGA 4ZQEA 4YREA 4IAOA 5GVSA 1U7PA 4UNIA 1YS1X 3EXFB 2O0KA 1IJEA 1AHHA 1W4ZA 1BGVA 2IVZA 1NJGA 4GBGA 1QO9A 3OIDA 2WTXA 2O06A 2OZLB 4RPIA 2DFVA 2B1RA 4Q1AA 2HY7A 3KTDA 2QUKA 2YJTD 3R77A 4LHYA 2AA3A 1JKIA 1FSZA 2HJRA 4TKZA 5IRCD 3DFUA 3LHDA 1U8FO 2X0JA 4EGSA 4AWBA 2DQZA 1WA5A 4I1PA 13PKA 4O4IA 1S96A 1USVA 1EE9A 1H2HA 2GN0A 2OBXA 2OKCA 2JIPA 5GJCA 3DPSA 1XU4A 1ARZA 3BXFA 5F5XA 1IZ0A 1HYQA 1RLTA 2HMWA 1TMOA 1MJGM 5ALZA 1JILA 2AMFA 4GXQA 2ZE6A 3GXOA 3I6MA 1TQ4A 1R8YA 1MXHA 1WDKA 1XCMA 2XVAA 3AONB 3AHHA 3C4VA 4MX8A 3BGDA 5DT9A 3NS7A 4RNCA 4A4DA 4DCUA 5LB4A 1TFUA 1GQRA 2OFOA 5FPPA 4G4GA 2X9QA 4IVQA 2CZQA 1XMSA 1JG1A 3REFA 3L8CA 3PHIA 2QV7A 4BHTA 3AHGA 5ALVA 3KBOA 5DGTA 3OTOB 2V8OA 3QLUA 3THWB 1GXSA 3K2QA 4YVFA 5IHXA 3TYXA 3FH0A 4X97A 3HU3A 2UXBB 5K99A 2DWOA 3T3OA 3OIUA 2ZR7A 3QBJA 3VX3A 4AKIA 1JIVA 1XZAA 3PKIA 4KPYA 1F6WA 1KAGA 3KAQA 1GCGA 3W3AA 4ZO8A 4RD2A 2XUKA 5IX8A 5K8VA 3HKBB 3JTEA 1FJ2A 5F7ZA 4CEJB 5GJBA 1V16B 1WKBA 1MORA 2RGDA 4YJDA 3B5JA 4YIKA 3KWLA 3ZW7A 3HDJA 3REQB 4XB1A 1PN3A 2YQ5A 4IOMA 5KC8A 2X3FA 4IMRA 3ROQA 1T2EA 1X14A 2VWPA 4PNPA 4WCDA 4I99A 1VJ1A 1KO8A 2WD8A 3B3JA 5FBRB 3JQ6A 1U65A 3PDIB 4ZHQF 1JUDA 1LPBB 2OWEA 4EK9A 5CDFA 1W29A 5HOEA 5AVQA 2VJOA 4S35A 1XVUA 2OHFA 2IQIA 2PSEA 1LSJA 3IDOA 3HY6A 5DW0A 4HDKB 1QIHA 3B36A 4CI9A 1W44A 4NESA 3KOZA 1P33A 2OD9A 5M29A 3P2IA 2Q2NA 4BZPA 1WL8A 3OZAA 5I8PA 3EY9A 4RK7A 4O1IA 1JXQA 3SYTA 2IXAA 4JT8A 3EDMA 3K70C 3CWZA 2K7ZA 4P84A 2HWUA 1ODIA 4EBFA 3OPYB 5C7OO 3PR3A 3AHDA 2HNKA 1L7MA 5F1PA 2Z98A 4NARA 5BUSA 5CCXA 2VSYA 3K96A 4Z5XA 1EQUA 3IAFA 1Z2EA 1I1HA 1UWVA 1Y7IA 2J4DA 2VK1A 5C3MA 2W8BA 1YBMA 1C7QA 2V6BA 3Q9LA 4D8XA 1L7QA 1BDJA 1NT4A 2A9FA 3PUZA 5EP2A 4XWYA 1ZNXA 2R8OA 5TV2A 3OY7A 1OIWA 3CZQA 4KE9A 2EKLA 3FMPB 3JYOA 3M1LA 4YALA 3BPSA 3FDJA 5LBTA 4S04A 4LCJA 5FI0B 3ICPA 4FSHA 1F9EA 1G3UA 1NX9A 4IHJB 4XCVA 5K4AA 3RR2A 2OO3A 1N3BA 4MUHA 4WDRA 1MJFA 4OI2A 1B23P 4TLBA 5BMVF 2GR9A 4J9UE 4BNLA 4ZTUB 5SZIA 5NULA 1VOTA 2FF7A 2NG1A 3E84A 4Z9YA 2AOTB 1G6OA 2I2XB 3AM5A 5FLYA 1LW7A 3HR7A 3K9HA 3LFTA 3LX4A 2JIMA 4EY7A 5A4AA 2IIBA 1JU9A 5EXEA 5TRTA 1PEDA 3ZV3A 4BE9A 4XJTA 5AW6A 5KYKA 1QPGA 3LY9A 3FVQA 3K0KA 3M4NA 4UMFA 5BT9A 3RDPA 1U8UA 4A6EA 3GGGA 1HURA 4NFLA 1IH8A 1E1CA 3SBOA 2WWVD 4YV1A 1MVNA 1XBTA 3O84A 2GJ8A 2QENA 4M1TA 1CB7A 1VSTA 2QAGB 3NNDA 1P81A 3TD2A 3SBDA 4UBKA 4RD3A 2ID7A 3U7QA 3HGQA 2JRLA 1PUIA 5ETJA 5DYYA 5TY0A 2PYDA 3DCIA 1AKTA 2BF7A 8OHMA 3RVQA 3AVOA 2XIJA 3I8XA 1MTZA 5LYJA 1XX6A 1W1UA 2YVUA 5EIOA 5CLHA 4S05A 1NDHA 3SSNA 4OGWA 1K8YB 3PUKA 2JGAA 4ZAWA 5TF0A 1LI7A 1G38A 4RWEA 1J0AA 2C4HA 1WXIA 2C2GA 2RC5<