4WUTA

Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
290
structure length
290
Chain Sequence
GEIAVIVKTVNSTFWQNVQKGADAAIGKQKAHTITFQGPAAESAIADQVNMVENAVNRKVDAILLAPSDPDALVPAVKKAWEARIPVVIIDSMLSKDAEKYYQAFLATDNKAAGELAAKAMIQKVGTEGKIAVMSYVAGAGSEIGRVGGFTDYIKANSKLQIVGPYYSQSQMATALNQTTDVLAANADLKGIFGANEPTAIGMGRAIKQAGKAGKLVAIGFDGNQDLQEFVKDGTLEATVVQGSYQMGEKGVDTLLKLLSKEKVEKFIDTGVVVVTKQNIDKPEAKNVLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF AN ABC TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM AGROBACTERIUM VITIS (Avi_5133, TARGET EFI-511220) WITH BOUND D-FUCOSE
rcsb
source organism Agrobacterium vitis
molecule tags Transport protein
molecule keywords ABC transporter substrate binding protein (Ribose)
total genus 98
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wutA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wutA01
2FMIA 2FQXA 1FFGA 4G0MA 4MR8A 3RVQA 4KFCA 4RSMA 2FN9A 5KQPA 4EUKA 4W5OA 3F6PA 5JNTA 4KQ9A 2WJWA 4Z4IA 1ZY2A 2ID7A 3OLVA 3MYYA 4H60A 4JA2A 4PYRA 2IYNA 5D2CA 3CS3A 4DADA 1DRKA 3D8UA 4G0PA 4Q7EA 3IPAA 4RK4A 1KGSA 2RJNA 1D1PA 2QVCA 4KK3A 4WUTA 3H1EA 3F7NA 3C97A 5DKFA 2FMKA 1XHEA 3T95A 1ZH2A 2O20A 4JP1A 4NQRA 3O1JC 4MQFA 2WWVD 3EAFA 1DC8A 5HSGA 4UHJA 2ZAYA 3QLUC 5DTEA 1USIA 2H3HA 2HQOA 2QVGA 5C5CA 4LX8A 3Q7TA 1YS7A 1USKA 2OENG 3JVDA 3N6VA 2PUFA 2RGYA 1KMIY 2CWDA 2JCGA 4KMRA 3SQNA 2RJOA 4DN6A 2R47A 4ZMSA 8ABPA 3BBLA 1GCGA 1LK0A 4ETIA 1RXIA 2HQRA 4OTZA 5EWMA 5BRAA 4IMJB 5HQJA 2PE5A 1F4VA 6CHYA 1VPWA 1PNTA 1Z12A 4MAAA 3CNBA 3IP9A 4MS3B 1NXXA 1ISRA 1XHFA 2FEKA 3VNBA 3O2JA 1EWVA 2TMYA 1JYFA 4ML3A 3JTEA 3EDCA 3UKJA 2HJ9A 4Q6BA 4KREA 4QYWA 4QICA 3GA5A 3H5VA 4N03A 3OO1A 3OM0A 4F06A 1M5UA 3S99A 1RZRA 3DLBA 2BGGA 2WRZA 5FWXA 4RWEA 4MR9B 4ZPJA 1EHCA 1RXEA 1DP4A 4OLAA 3N53A 4L4UA 1NTRA 4RXTA 2ZWMA 2OQRA 5T3YA 2PUDA 4G97A 2PJUA 4IILA 1NXSA 3JY6A 3NHZA 1A04A 3LKVA 1Z2DA 3HJFA 3QLUA 2MYNA 2IDMA 1C0EA 1NXTA 1WETA 2KYRA 1SXGA 4EY3A 2P9HA 2JRLA 3RVLA 4G0QA 5IEJA 4Z4EA 2PL9A 3Q7RA 1Z26A 3CHYA 4YO7A 2HQBA 4EGSA 4ZYLA 4IRXA 4E7PA 2MSWA 3CG4A 3Q15C 3BRQA 1FQWA 3FMVA 2MYTA 4YR7A 1MAVA 2FN8A 4MR8B 4JASB 3GBPA 1W25A 5JNUA 3BRSA 1M2FA 3I09A 1NXVA 4N0PA 4MR7B 4P1ZA 5IEBA 2E4ZA 5FBHA 1LBIA 2JBAA 4MS4B 1P2FA 1JLKA 3EGCA 3GT7A 3H6HA 4DQDA 4MLCA 5HM6A 2QSJA 4KNYA 1CYEA 1NXOA 4F3TA 4RKQA 2B4AA 3SAJA 2NUBA 3H6GA 3OMXA 3E61A 4RK6A 3O2QB 4MR7A 3KKEA 3QLVC 1QQAA 3C6QA 1TJYA 4LRQA 4RXMA 5KC8A 2PUEA 1CHNA 4PE5B 1P8AA 1VKRA 3MA0A 2E4XA 5JNWA 3FDFA 5CNMA 1DRJA 4IF4A 3QELB 3NHMA 2PUAA 3M6MD 3GBVA 4KVFA 4WXEA 3VNAA 1DCFA 1ZVVA 3C3KA 4RK1A 4EVRA 1DG9A 4MS1A 3T6KA 4QYMA 2IPMA 1GCAA 2N9UA 5B3JA 4NV3A 4D6YA 5KWSA 1BDHA 2P4UA 3LFTA 3LTEA 2IPNA 5IUJC 3SM9A 4L85A 3LMKA 4RZSA 2H0AA 3K4HA 4IMIB 2FVYA 2MSLA 3Q9SA 2R4QA 1GLGA 5GQSA 3CZCA 4S04A 2E4UA 4W5TA 2HPHA 2WMYA 2IPAB 3EODA 5TPZA 3N8IA 1RZRD 2NT4A 4EYKA 4G0XA 1YTUA 3EJWA 3LUAA 2RDMA 5CHYA 3KJXA 4LE0A 1P6UA 4TLLB 3O2SB 5JNSA 2YHBA 1D1QA 3A0RB 3SNKA 2IKSA 1FFSA 3H1GA 4EYGA 4O5AA 5TQ0A 4RKRA 3N0RA 2VUIB 2NZUG 4XARA 4JAVC 5T7BA 2X7XA 4Q6WA 1C4WA 1QMPA 2FW0A 1JBEA 3A10A 5TQJA 1UDRA 3HEBA 3QLTA 3CTPA 4UHKA 3A3KA 3OO0A 2FTKE 4OATA 1JDPA 2W42A 2FMHA 4Z9AA 3TD9A 3IP6A 4MLDA 4YS6A 4HNRA 3HO1A 5EWLA 3B2NA 3ROFA 1ABEA 2J48A 2FEPA 1TLFA 1DBQA 5KQGA 1BDIA 3TB6A 4F8JA 2JVJA 3CG0A 1U2QA 1D2AA 3HSYA 4RU1A 5ED4A 4W5RA 1KRXA 3T8YA 3ROTA 1YS6A 3O75A 4W5QA 3HUTA 4YWHA 5ABPA 1PHRA 3QK7A 1L5YA 1YIOA 3IDOA 3CU5A 3RVJA 1P6QA 3KYJB 3FFWA 1YVUA 4MRMB 4Z99A 2VUHB 1MVOA 4KZKA 2IPLA 4N41A 5IUKC 1L5ZA 2VK2A 1LJLA 4ZJPA 2FXIA 5BQ3A 3CKMA 5BR1A 4O1HA 3MM4A 1A0OA 1PEAA 3OLZA 3QLVA 5FBKA 1U2PA 1ZN2A 4P98A 3LUHA 4H3HB 3KLOA 3RQIA 3TMYA 3HXMA 4OLBA 4MS1B 3KSMA 4QPJC 1CEYA 2CHEA 4WT7A 4RXUA 3K9CA 4FB4A 3IP5A 3QELA 3RVMA 2QV0A 4FE7A 3G1WA 2QW1A 3KG2A 3QEMA 1ZHHA 1JDNA 1QO0D 4YV7A 5IUNC 4RY9A 1YK0A 4YLEA 1Z15A 3KYIB 1F51E 1E6LA 3EULA 4KK4A 4RK5A 5KQLA 5TQ2B 3URMA 5JNRA 3LKBA 1Z16A 4HNSA 5BRJA 1D4ZA 2AYZA 2QZJA 4RY8A 4XFKA 1RPJA 3FGZA 3G85A 1VLZA 3LUKA 2A9PA 5GOTA 4KV7A 3FFTA 1NXPA 3N75A 2JVIA 4MQEA 2E4WA 3O1IC 3NNNA 3P9YA 1BAPA 5TQ2A 3CZ5A 3MMNA 1JFVA 2M98A 5KC9A 4JB2A 3H5TA 9ABPA 3GL9A 5IULC 1EWTA 4ETMA 5JS1A 4YGXB 4E7OA 4RK0A 5TPWB 5I4CA 4YCSA 4Z0NA 5DLEA 2MSKA 3LUJA 1DJMA 4EYOA 1FSPA 4EVSA 3OM1A 4LE2A 2FQWA 2L2QA 4RK7A 1LJUA 2LBPA 1TM2A 1ZESA 1EWKA 2NZVG 3CLKA 3RH0A 2A9OA 2WY2D 1LBHA 2LIVA 1U0SY 4NCAA 3Q41A 4G0YA 1DBWA 1YMUA 1ZITA 4W5NA 4OBBA 3IP7A 5IBQA 4RY0A 5TE9A 2DRIA 2FLKA 4MPTA 4G86A 4S05A 1U04A 4IGAA 1M2EA 3HV2A 4Z4HA 3EQZA 3F6CA 4PZ0A 3H5IA 4G0OA 3HUUA 5TPWA 7ABPA 2JK1A 4KRFA 4KPYA 1BVHA 3KTOA 2JB9A 5KI6A 4MS3A 1E2BA 2Q5CA 3LUGA 4LDAA 3MQ4A 1MIHA 4N76A 3JS5A 4MYRA 5CNKA 2LP4Y 4PEVA 3DGEC 1OXKB 3HCWA 3MF4A 5DGCA 4XAQA 1YK1A 1K66A 3CRNA 2JVKA 4CBVA 3O74A 3SY8A 2LPMA 1QPZA 3L6UA 4NICA 2PKXA 3HM9A 1KRWA 2YHAA 3OQMA 4WZZA 2QXYA 2FMFA 2WJAA 3ILYA 4MGEA 1BA2A 2ID9A 3I5AA 3GV0A 5DCLA 2F8TA 1JFTA 2GWRA 4EYQA 3RVPA 3H75A 5TPZD 4LE1A 4Z4GA 2JBAB 3KHTA 4MS4A 1JYEA 3JVIA 2PMCA 3BREA 1Z2EA 3N0WA 2B1JA 5PNTA 1TMYA 4PICA 4YP9A 2VYCA 1PEYA 3NNDA 5IX8A 4NCBA 3O21A 3TX6A 3D02A 5CNIA 5B3JC 3LOPA 1OXBB 1DCMA 3OMWA 4GPAA 3E3MA 3NBMA 1AB5A 1JH9A 1APBA 4D6XA 1R8JA 1EFAA 3LUCA 5EWJA 3C3WA 3M9XA 1M5TA 5FWYA 3DGFC 3JPYA 1Y1LA 2GKGA 1USGA 2IOYA 1E6MA 2LUOA 3JPWA 1SRRA 4JOQA 3N0XA 1HEYA 3OQNA 4XXHA 2A9RA 1Z25A 3A0UA 2MYUA 5JS2A 3C3MA 2PLNA 3F73A 3H5LA 3HZHA 1YMVA 5EWJB 1QP7A 3DZDA 1Z18A 3L49A 1MB3A 3QEKA 1EAYA 2L17A 1AB6A 5EWMB 5JNVA 1JHZA 1ABFA 4ETNA 3RVKA 3MIZA 1U8TA 3HDVA 2FQYA 3BILA 3QEMB 3QX9A 1JL3A 3KS9A 3R0JA 1BDJA 3OLXA 1MB0A 3RVRA 4ZMRA 5C5EA 3H1FA 4H3KB 1JX6A 3H5OA 5FWYB 4FE4A 1Z17A 3IPCA 3HK2A 3ILHA 1H9CA 5CNJA 1K68A 2PAFA 1QQBA 4XASA 2PUGA 2FLWA 2E4YA 4M88A 5KQMA 1ZAYA 4N47A 3T38A 4GNRA 4RV5A 2R25B 4MQFB 3TO5A 2L18A 1J56A 4RS3A 5TQ0B 1ZH4A 1W9HA 1DBPA 3W9SA 3KLNA 1QO0A 2L19A 1QP0A 1SXIA 1VRVA 4LDZA 4O1IA 3OLYA 2F8SA 1NATA 2GBPA 4MQEB 5E3JA 1RNLA 3DLHA 3GRCA 4RDCA 3UK0A 4MR9A 1I3CA 1DC7A 5F64A 2MYPA 1PNRA 3CFYA 3RVNA 2M1ZA 3H5WA 1ZDMA 1ZGGA 2AYXA 4B09A 4XLTA 4N0QA 1NY5A 1URPA 1T34A 4G0ZA 1S8NA 3RVSA 4HNQA 1IIBA 3OLWA 4YRZA 4JB0A 3OQOA 4LZLA 2FEWB 4TMYA 3HS3A 2PL1A 1PUXA 3RVOA 3UUGA 3M9WA 1QKKA 1GUDA 1ZGZA 2V0NA 4KQCA 4HYEA 1SD5A 1SXHA 1XWWA 1Z13A 2GX6A 2CHFA 2WB4A 2HSGA 3QX8A 3DBIA 2PUBA 3FFXA 6ABPA 5IC5A 3O1HB 2NT3A 3HDGA 1D5WA 4F12A 4F11A 3LUDA 3SG0A 3I42A 2GI4A 3EQ2A 4Y9TA 1QNLA 2A9QA 3I45A 2QU7A 5EWLB 3Q7SA 2CD7A 3KCNA 4D74A 1ISSA 2QR3A 1TVMA 4WWHA 4Z4CA 2XDYA 2PUCA 5FWXB 3GWGA 1NXWA 2R48A 3NNSA 1E6KA 4TLMB 4WXMA 4EVQA 1JFSA 2FSPA 1A2OA 1DZ3A 2E4VA 1FFWA 2I6FA 1JF8A 5HKOA 3LUFA 2FKAA 1B00A 1DCKA 4Z4FA 3HVRA 4OG2A 1QP4A 1JWLA 3GYBA 1GUBA 4MRMA 4TN5A 4Z9BA
chains in the Genus database with same CATH superfamily
3ONEA 4XWWA 4YA6A 2ZRKA 4Q3DA 4DPMA 2PV0A 1OZHA 3KEOA 2H54A 3NPMA 1NLMA 2AZ4A 1G3QA 2RC5A 3QWHA 3IAEA 1MTOA 2QX4A 2MR6A 4O4IF 3C3YA 3K31A 3WZ2A 1XT6A 4G67A 4CPDA 5LQNA 4H7FA 3FFBA 1YR7A 3OPYA 1JPUA 4POAA 4G1CA 2J5RA 3RV4A 1XQ6A 3LCRA 5B30A 1BX1A 1DXYA 4KVAA 1UANA 2I6SA 2OZLB 3OTWA 4EL5A 2QVCA 4KR0A 1ZR4A 3U0VA 4CL3A 1QAQA 3G9QA 4TQ9A 1XHEA 4K5QA 3DKRA 3M1YA 2CJFA 3O3OB 4EZIA 1O2DA 3ETJA 3K92A 2IUUA 1QF6A 4TTAA 3EAFA 3EVNA 1MC8A 1DC8A 1Z5UA 2PLAA 2FCRA 4O25A 3VV2A 3QE9Y 1WQ3A 1B41A 1MEEA 2DG2A 3CNEA 2QVGA 4WMLA 3K9FC 2ZYWX 1E64A 3MLBA 4DJAA 2AI2A 4QHYA 1OZ0A 2ZYDA 2CSXA 2C7BA 1L7EA 1X1BA 4EZEA 2RJOA 1VTKA 3GCWA 3N2YA 4XCXA 3ZBQA 1Q3TA 4TL6A 3ND7A 3Q8XB 5FI5A 3AUKA 4UPEA 1ULZA 1W4AA 2HQRA 3S0JA 4CCYA 2O57A 5IAAA 1HLPA 2E18A 1YI0A 2Q6TA 2QY9A 3JAWA 2FSUA 2OORC 1KZ4A 5FYDA 1M2OA 3H4IA 4MYCA 3TSWA 1IY1A 2VT6A 3HJHA 4NBLA 5EHZA 1GAEO 5FUXA 4U0JA 4BZPA 1VDMA 3MCWA 1TM7E 2JF0A 3O2JA 5E6UA 2TMYA 1JYFA 1XRRA 4UPVA 1KTIA 3RIGA 5JO0A 1X8JA 3DDWA 3C2QA 4Q6BA 3R3JA 1Z4LA 2F1KA 2QSZA 3S28A 3TR0A 1FSGA 1DX9A 4DDVA 1N4DA 1VJGA 1JFLA 5K3FB 5J47A 3UFXA 2FMTA 5B1SA 1VQ1A 1OW3B 3NTUA 4ZT5A 1ZVMA 2P1ZA 4MUNA 3AKZA 3DVLA 2HU2A 2WYHA 5IFKA 1FVHA 2W37A 1FQKA 4RXTA 3RARA 3TW8B 4TKUA 4DWJA 5U9CA 2OQRA 2YMLA 4WN9A 3GMDA 4B48A 2PUDA 1WTCA 2JFGA 5CM8B 1U8ZA 1KPHA 4IILA 3WGMA 4E33A 1A8UA 2VWGA 2BISA 4FINA 1UQUA 3HCDA 4FONA 3OU7A 2IYUA 3TH5A 4M8NE 1TT5B 2QRMA 1SXGA 2QLTA 1Z8DA 5KOHB 3K0SA 2KW5A 2GLTA 3H9GA 3UGTA 2QUIA 2X2FA 4KQ6A 4R3UC 4ZOCA 1KYYA 4YP7A 5JI3E 3BD6A 3OSZA 1RYMA 3GHHA 4ENRA 5DP1A 2VTBA 1II8B 3PRYA 4JI1B 4DEXA 4E7PA 2NPOA 2XXJA 1P75A 1L4KA 5A5FA 2A1TR 1QTIA 4A8JA 3VPHA 1NG1A 3LVBA 1TMOA 3GBPA 4F97A 5KAPA 2M32A 4UQOA 3NBKA 5KYXA 4QD3A 3SBOA 1F8UA 2BZ1A 3WG9A 2YZNA 5H02A 1SVWA 3I3SR 2R9VA 3QWAA 4U9HS 5LZ2A 3SMQA 3SJZA 4S35A 3VTAA 1P2FA 1JLKA 1YI8A 2TECE 2Q3DA 1VRWA 4KXVA 3SPXA 2CL0X 1SBYA 2FSHA 1U2DC 2Y76A 4XM0A 4JI2B 4RVGA 3V5NA 1F0YA 1U6IA 1WQ4A 1FLVA 4ARSA 3EEFA 1CUEA 1RKVA 4MR7A 3P45A 1DO0A 4OXKA 3WYDA 1FJGB 1JR3D 3D8RA 2VAPA 1F8GA 4EF5A 3BX1A 1DS6A 3AFHA 4C22A 1OJLA 4NAHA 3ASVA 4KB5A 4GKVA 3WL8A 3T5MA 2IF2A 4K6HA 1O6FA 2QP9X 5LL6P 1NBIA 3KKKA 4LJ7A 2E4XA 3AJAA 3ZQKA 4CU5A 1P4JA 1KAQA 1W9MA 1OXSC 1A82A 1XZQA 2J87A 4J29A 4WXEA 2BHSA 3PNOA 1VA5A 2IPXA 1H6BA 1XJQA 2OZEA 4PSVA 4GGMX 2FZLA 3FGOA 5C5IA 1TZ2A 1G8AA 1YQTA 4WZBA 1GYQA 1F3OA 1S8OA 1M34B 4NDNE 1XWIA 2ZDQA 2C0QA 4FT4A 1B0PA 1E0SA 4HN9A 3KZCA 1E69A 4ZQHA 2HK7A 1Q7CA 3FHTA 3EW7A 3P2EA 1RI3A 2QVXX 4C7KA 5B7PA 2BKVA 1YZ3A 2P4UA 2P67A 3LG2A 1M1YB 1JILA 1ZMRA 4KEAA 4L6CA 1O4WA 3QE4A 3LDFA 3Q5EA 3QSGA 4I14A 3GVPA 1L5HA 3SKYA 5JANA 2FWNA 2C82A 1OBCA 2FVYA 5AKLA 5GP1A 2VZLA 4EFDA 3VKWA 4E22A 2OV3A 3WGYA 2ACVA 3M3PA 3H9CA 5DTRA 3U4GA 1JLLB 3MJEA 2PZJA 1G21E 2I80A 2HA5A 4U2CA 1RLOA 5DLQC 1K86A 2J9XB 5AYVA 2GZ3A 5BN5A 4K7JA 1TUIA 2HSEA 2C3OA 2P3OA 3PL5A 2YFHA 4M8LA 5GWXA 1ZJWA 3IDAA 4X00A 2CXNA 2IL1A 3KEGA 2V8OA 5I48A 4TTSA 1OSNA 1UF9A 2ACEA 3JRNA 1Q17A 3LFHA 3W2EA 1ZUNB 4RMNA 1O9GA 1QM5A 1GCIA 4QKQA 5AVYA 1OB5A 2VUIB 2NZUG 3ENWA 3ZU5A 3ZQ6A 4DCMA 5IWAB 1M3SA 2ATIA 1C2YA 1HDRA 2ZVQX 3AJDA 4AUEA 4DW8A 3C3AA 1Y7LA 1MB9A 3O38A 4FVTA 2XVYA 2IYXA 4DLYA 3PDIA 2YV5A 1JDPA 3H1TA 5EXSA 2Q3LA 1PZFA 1FFXB 4CN9A 3UPUA 4WV3A 4JBGA 3TZ6A 4KYUA 5B4TA 2H4ZA 1IAVA 2NYAA 1II8A 3NHKA 2VHCA 1XZCA 1DV1A 2H65A 4NCHA 2OFFA 3PNVA 4WNYA 2O8BA 3BICA 4RTNA 2JVJA 3N7TA 5K99A 1H0HA 1N36B 2VG8A 2B8TA 4JWKA 4HHEA 3RHTA 3STTA 3RK4A 2VQFB 2I29A 2IYTA 4XQCA 1FDUA 3GC6A 4YV2A 1K7YA 3KV3O 2CXRA 3B9RA 2HRBA 4FHCA 4N40A 2HLPA 5HS4A 4U3JB 4ZJUA 3GDWA 1BFUA 1XJ0A 5LA6A 2R97A 3VC1A 1CY7A 1BEEA 2UV8A 3ZWVA 4BMYA 1P6QA 4MW0A 3TZHA 5KNCH 4R9SA 3TTUA 3R9KA 2CMGA 2ERYA 2J45A 3TUIC 4Q4LA 1O6ZA 3C98A 4G1UC 4MWBA 2FRDA 3EBPA 2ZAIA 3QLVA 4JYBA 1A2QA 4I3GA 2CJPA 4E13A 1JUDA 2XCRB 2XYHA 2ODTX 2HJRA 3IQZA 4FB5A 1UFQA 3RQIA 1G3MA 4OA5A 1G8KA 5ILOA 1N57A 3D8TA 2FW6A 4D4HA 4A10A 3HC7A 3IP5A 3UXEA 1DADA 1WLYA 2Q9BA 4YP6A 1RWMA 1O0CA 1KBQA 2Q5JA 3EZLA 2QW1A 3IUNA 1V71A 2D0DA 3FBTA 3L05A 2O2CA 3KJZA 5ELLA 1O8CA 2OP1A 1FOEB 4OGLA 3QV2A 2ZRNA 4DRXB 1HMYA 1KJWA 2ZWPA 4AMZA 2UYOA 1TIBA 1VMIA 4GYJA 2X5OA 2P9EA 2QL7A 1FNNA 4L5YA 4ZQCB 5AVOA 1L8XA 4ZEOA 4A9AA 3K94A 4CLOA 2NTJA 5ALWA 5FL7D 5H16A 2J3QA 4HCJA 4P4SA 3U6KA 1UP4A 2D5LA 2QPTA 1WW3A 1JHYA 1Z82A 1ZUIA 3N2LA 4MQEA 3KYBA 1IXZA 3JATB 5EYPA 1Y42X 3BD8A 5TQ2A 5TS3A 3PVZA 3CZ5A 4QBIA 3C6XA 4V0MA 3ZTTA 4DR7B 2IY9A 1PYDA 3KAPA 3RBVA 4NZPA 3L2OB 3IMGA 1G20B 4N49A 3L9WA 4DNXA 4EAQA 5ICMA 2P2GA 3KZNA 2Z09A 2WI8A 3QXJA 1YVDA 4RO0A 1DO2A 3JALB 4YCSA 2AWNA 1LW6E 3RYCB 4QDOA 5DW0A 3DAGA 1VLHA 2BFBA 1DJMA 1ZLYA 5KTKA 3WLLA 1L4LA 4I0WB 1DIBA 1UBUS 2PX4A 5IBPA 1JHRA 4JI6B 3WGHA 3WIDA 2NZVG 2PUJA 3RH0A 1I01A 1SQ5A 2J5BA 1T25A 2HHCA 2WLTA 2Z8YA 3MINA 4RC9A 4B4OA 5K0FA 1EG2A 1L8QA 4JXKA 3AR5A 3H11A 1H2HA 1OPXA 4FFOA 4R01A 5A05A 1L5GB 3UY4A 3FNIA 3CRZA 1GGNA 1TAQA 1UPBA 5H3CA 5I7WA 5DGHA 3ZHSA 1WNTA 2PGIA 4AZVA 5A3VA 2HHHB 1S4QA 3WJ1A 3HUUA 1U8CB 2C3YA 2QM0A 3VO2A 4R51A 2NADA 5E0KB 1IQRA 1V39A 3GJ6A 1KFKB 1Y4SA 3OQ1A 4M9UA 2HHLA 4ZARA 5EGSA 1UPCA 2AZDA 3D3JA 3GGCA 2IYOA 3HYCA 4FHDA 3TNFA 3ZZTA 4UNRA 3L0CA 4XAQA 5JYCA 1KYZA 5EMMA 1POXA 3G82C 4CBVA 4D3ZA 5BSGA 2LPMA 3F74A 1ZM7A 3DNPA 3U4IA 2R8PA 4M2LA 4NOLA 1ZIOA 4Q4CA 4M1EA 4MV0A 4B6QA 4MHSA 4EABA 1U3CA 2AXPA 1DZIA 3S2IA 3T5PA 1OXVA 2PDAA 4WL0A 4BNLA 1RAGA 2ANBA 4JUBA 3SP1A 2JIPA 2WHYA 3GV0A 3SYTA 1H0KA 5TXGA 1RZVA 3NIGB 3IIIA 3C6KA 4OREX 2HIHA 3P32A 3H75A 2X9NA 4EHKA 1XDUA 2O3RA 4GVXA 3U44B 3JVIA 4DMUB 3BREA 1RWXA 2B1JA 2IHKA 3ESQA 3AOGA 1MW9X 4QYXA 4ARZA 3FNGA 2CLHB 2P5TB 5F52A 2VNHA 2C03A 4MMYB 5CFLA 4CLEA 2NUPB 1BOFA 1YB2A 5C7YA 4HQFA 3S2SA 3LYUA 4I50F 4KR9A 5A71A 3A2KA 3FAZA 1N92A 1IBCA 2R1UA 4GPD1 2QYOA 1VM6A 4RH0A 3L82B 5J43A 5ADUS 2CB0A 4EPWA 4BVEA 2JA2A 4DR4B 5IBRA 4JLJA 2EFJA 4F3YA 1J2YA 1YMQA 2GKGA 5AK6A 1C0KA 4P33A 2AIRA 1U7TA 5IKEA 5JZOA 4UTVA 1DJNA 4QFCA 1UAGA 5D3ZA 4AJHA 2NU9A 3FHLA 4B76A 2YOHA 3A1DA 5CCXA 2J7KA 5CHEA 1BXZA 2AJTA 2WVHA 5F4BA 2DBYA 1VI6A 2IFTA 3HCNA 5DGDA 3BIJA 3W5CA 4DPKA 2MDTA 3LX8A 4GRAA 4ZVNA 1WXGA 1UK8A 4GC9A 1Q1ZA 1TOAA 1C5KA 1OZAA 2AMYA 2V6MA 1X15A 3GK3A 3I1IA 3PQCA 3QX9A 2GVDC 4IV8A 4MQUA 1ZD3A 3C6MA 2LTAA 3RVRA 3R8FA 4AU1A 2CKMA 2F3SA 4MIKA 1WL8A 4NG4A 4JXJA 2G1AA 2XZOA 4XGKA 2JLCA 1MW8X 4POOA 2Q6VA 1RXCA 1QQBA 3M49A 3RF6A 4LNAA 1S7GA 2QPLA 4RY2A 3CSUA 4MUIA 4BKQA 2IUYA 1BW9A 1NNUA 4ND7A 4K3UA 3AJEA 5A4DA 2XMRA 4YO8A 4YRRA 4C0BA 4D96A 3RLIA 4RS3A 2B25A 1Y5NA 3KSAC 5E4JA 1T9BA 1D6JA 2JNWA 1X0VA 1FDVA 1QO0A 1UBCA 4TKVA 2JARA 2OPHA 3GAAA 3H2HA 2FOIA 3RHZA 3WGTA 2X4GA 4UVEA 5MGNA 4X1KB 4AF7A 2F8SA 1C7QA 3ZHUA 3AXTA 3ZDRA 4NMHA 1R4NB 1SBIA 2WICA 3OT1B 5FPKA 1W49A 4UDYX 1OFIA 1AZWA 1KAMA 1KEEB 1TT5A 1NHGA 5KBYA 2OWEA 3BFJA 3E9QA 5JAMA 3GFRA 5BN4A 3ZHBA 4MZDA 3AF4A 3LLCA 3U80A 4BJ1A 1M8KA 3VTFA 1EU1A 3HKDB 1UQTA 3VDNB 1EESA 2Y1LA 1PEDA 2QN9A 3KXKA 1IJEA 5BW5A 1CT9A 2BDTA 2VUUA 1WULS 4NCXA 4D99A 4EKYA 3TSYA 4PAOA 1VGRA 3WKDA 2EP8A 2ZJZA 4B85A 3AGQA 4TMYA 1PUXA 4L15A 2Q3JA 3WBJA 2VPPA 4K6FA 1QKKA 4YXWA 4KDFA 1AXEA 3UUFA 1HQKA 2V03A 4HYEA 2OBBA 1JU4A 5EKUA 3NORA 4ZTBA 3VKVA 3W4JA 5I7OA 4DEVA 1NZFA 5KEIA 3L7JA 5GJCA 1M34E 2OHIA 2F64A 2PYDA 4GG1A 3W9UA 2MJLA 4K9SA 2IVFA 3O1HB 1QC5A 2PMDA 4HMQA 3OTOB 2KJQA 1FLDA 2R2GA 1D5WA 1NN5A 4N5DA 5EMNA 4FW9A 5DTQA 3GMTA 4XYEA 3ZX5A 1R6XA 3V4LA 1QRRA 1ZEJA 5ALKA 3TZBA 3VHLB 3L79A 2PKQP 5TS2A 2HF7A 3A9TA 4IJ6A 1TGYA 2AZMA 4RD3A 4E21A 2HW8A 4EPRA 2BR5A 4DLZA 4AAYA 2PUCA 4H6XA 2IHNA 2QM3A 4H2DA 4HVAA 4K9NA 4FD2A 2X22A 5THQA 4YRQA 2CXQA 1C0LA 1L5OA 3LWDA 1ORHA 2RGNC 3OE5A 4MKZA 1GPBA 2FWMX 3P9ZA 2BMFA 3ZIUA 2F3RA 4EY4A 3UJNA 2ZIWB 3LP6A 2YWGA 4J16A 4Y2GA 2F55A 3SHOA 4N5LA 1NIPA 1O4VA 5FPTA 1XRSB 3P97A 1C1XA 4ZZ1A 3GN2A 1GFWA 2VBIA 5FFNA 4GQBA 1EA5A 1RKUA 1KC3A 5KNCD 4QBTA 1FFGA 2FKNA 4MI3A 4AXXA 1MGOA 4DGSA 2HFJA 1PTKA 4Q66C 3N0TA 5JNTA 3PFHA 4GGOA 2OC9A 2FPOA 4NF2A 5C32A 1HO3A 1E1LA 1IBRA 3OBIA 5FOWA 2QTWB 4L8LA 4F71A 3OLVA 4PZUA 2ZSJA 4UU7A 2P4EA 5IW8A 1LJ8A 1YR6A 2IV3A 1U7WA 4EO7A 3RC8A 2F1RA 3K6KA 3MUNA 1T2VA 2O8FB 4A8HA 1WOYA 1X7XB 3EAQA 3IPAA 4RPGA 5JE8A 5BUCA 4OB6A 5EP2A 5GGXA 4KE8A 3GH3A 4IYRA 2B5OA 1KI6A 2ZP1A 1Y3FE 2OE2A 2Q5HA 3IA7A 2VPZA 4CM5A 4DHEA 3R0ZA 6REQB 3FIJA 4JBWA 4F60A 3L7DA 1WPRA 2ICAA 3ETHA 2XB8A 3ZGNA 1I3OA 4HX2A 3FSGA 1KYWA 1UFVA 3CX8A 3ANSA 2ZJ4A 4LHZA 1WUKS 2FZVA 3TPCA 4AJ2A 4C7JA 1XJWA 1N2JA 3STVA 2PX8A 5AJWA 4LYDA 5BQOA 5E1OA 2BZGA 2C00A 3K53A 3JVDA 5DHRA 4BKRA 3IESA 3VZSA 1H5QA 5B1DA 4CMHA 4ERNA 3JWIA 2W2KB 1LGYA 2W2OA 3KB6A 1X8KA 4YT4A 1WSDA 2H07A 1D04A 1YRAA 3WMEA 4PG5A 4RGBA 5BRAA 2VDPB 2EFCB 1MEOA 2ZIEA 2LZ0A 3BUSA 3K6RA 5KNCA 3RSLA 3FPKA 5MFPA 4J1SA 1OT5A 1J0EA 1DQYA 3KUKA 1TYEB 2WT8A 3CO0S 3DG9A 1JG3A 1PU2A 3OHPA 4N0EA 2PCLA 1E98A 4ZKEA 5HQ3A 1G9TA 1QHFA 2OCXA 4M9XA 1G8YA 4PGGA 2GJ8A 4CM3A 3E9YA 3MJHA 3ISJA 4MVJD 4I9UA 3AEQA 1ELOA 2C2YA 3ADPA 3N0VA 5JYBA 3HUDA 1W5TA 1PLKA 2JIBA 3TE6A 2KLBA 4FEEA 4OGGA 1BO6A 3BL8A 3ISVA 3JYNA 3GFSA 4G5YA 5F5XA 2JJ1A 3VNSA 3RJMA 1D6SA 4BV8A 4Q3NA 4WZAE 2ZU6A 4NBNA 4I4TA 1HY3A 3THXA 4HQLA 1Z4IA 5KJCA 4N1AA 3G89A 5EKSA 3HVUA 1T29A 5T4FA 2ZI3A 1XZJA 1A8HA 3DEHA 4LHWA 2H8KA 13PKA 2CLIB 4OSOA 5DI3B 4DMMA 3S1AB 3B7WA 2VYVA 3CLRD 4WD3A 3JY6A 4N3GA 4O63O 4MROA 1Z2DA 1PEKE 2M6LA 4L5BA 2IDMA 3LQRA 2J3LA 1KSFX 2WWIA 3ZY6A 1QVRA 4PNPA 4EEZA 4GZLA 3UICA 3RVLA 2WIAA 4I19A 3NVKI 3D1VA 3X3HA 4HTFA 1RC1A 2GSDA 1KU6A 3UT5B 3OA0A 1G2PA 4GOLD 4IL5A 2XUJA 1SM4A 3QI7A 1DX6A 3DLAA 5HBRA 1KY2A 2NSYA 2QLLA 2GN4A 3QG5A 1SBCA 3GJYA 5ICGA 3D0OA 1QH8B 2A86A 1GJRA 4IVQA 4OF4A 1T8YA 1C3JA 2A5JA 3FIUA 2HMSA 3PWSA 3VVMA 1EFVB 2CT8A 3GJZA 4QDXA 4J2TA 1TJPB 4WY2A 1C8KA 2N0SA 2AFVA 1P61B 3C6YA 2WSIA 1PL0A 5EYPB 1GPMA 1B2LA 4WA7A 1MC4A 2XQKA 3L7OA 2Q28A 1IHYA 1SVOA 5AJUA 5ALSA 3VSDA 4F3TA 5IMSA 3L1HA 3RJZA 3JZFA 2QJWA 2J3KA 4RD2A 4I5EA 1G2OA 3V7FA 1YR3A 4GX0A 4Y6QA 1K3TA 1P2UA 4L4SA 4L74A 1NJFA 4JT2A 4ZI7B 4BZWA 2XD4A 3SJ7A 3OTQA 2B94A 2WM8A 2AG8A 4OGFA 2DFTA 3LPCA 3IQIX 2WC1A 3JQ7B 2JHGA 3FHOA 1YB4A 4XJXA 2QRZA 3LHKA 2B9VA 1V8FA 2PSHA 1FSZA 4P5DA 2QBYB 4FYIA 1I4OA 1NVUQ 3MINB 4WNAA 1IHUA 1MV5A 3HYTA 4HQKA 1L3IA 1FP7A 3OCCA 4M98A 4QQRA 4C4ZA 5FWNA 2HT1A 5E9WA 1U3TA 5G3YA 5B3JA 5BYKA 2JGKA 1YZNA 2ZUUA 2LXNA 3PGA1 2ZTLA 3OFSA 4O5OA 3GLFE 5K8LA 2XSZD 3S4YA 2I1QA 1AM4D 2ZRMA 3QPAA 1YCFA 4RVNA 2EGGA 1KMNA 3G1TA 4K9OA 5AP9A 4G5QA 3KQLA 1HYQA 1H2XA 2HPHA 3M4NA 2QYSA 1NFQA 3HNPA 3N8IA 4JJKA 3U26A 4AJPA 3FMGA 4S24A 3LXXA 2D8AA 2CSUA 3MGKA 2NUTA 4DREA 2Y99A 4MW4A 5CX4A 3GGPA 2PD3A 4ALIA 4TQAA 4YAOA 5I5GA 3FFAA 4Q9DA 1DELA 1QOZA 2WIDA 5KSOA 3IKMB 4XH9B 4MTCA 3JU3A 3RKUA 1Z2NX 1Z5VA 3MK31 4IDCA 1IK6A 2R0QC 2ZOSA 3Q9UA 3A05A 2NXWA 3A10A 1EQAA 2IE8A 3NC1C 2AF3C 3QITA 5TQJA 4C20A 2ZPTX 2XZPA 3KZXA 3QLTA 4XPZA 2Q4TA 3U44A 1GZ3A 2ASEA 3HVKA 2W6ZA 1HQYE 3AVVA 1C7EA 1VFNA 4DDTA 1H1LA 3T3MB 5K0ZA 3TZCA 1RBQA 2GNAA 5CJ2A 5H82A 1C7ZA 2OAEA 3WKAA 3HXLA 1ABEA 2J48A 4QJIA 1BRTA 5TJHA 3HY4A 3CYFA 3PJEA 4U7TB 3DZKA 2ZS7A 4MWEA 3TB6A 1LUAA 2OCGA 3I34X 4M0LA 4F9TA 3T94A 3HSYA 1JS1X 4RU1A 1E62A 1RLUA 1UXOA 3VNUA 2GEBA 1VMEA 2WINI 3FJ1A 4NBTA 1ESDA 4QJ5A 1V8PA 5KYGA 5HS6A 1RRCA 4OXQA 1XTIA 3C5HA 4DA8A 1GL9B 2AXQA 2QTHA 1HE4A 2WG1A 1UZNA 3K9HA 5CCEA 2XECA 4F21A 2R8XA 3RYHA 3LSYA 2J41A 4RVDA 2IPLA 1XFAA 2YVAA 4BX2A 1PK9A 5BQ3A 6LDHA 1B76A 3E82A 3A6GA 1GUBA 4DV3B 1LNSA 1PG5A 3KKZA 4I3HA 3E0XA 1Y81A 2CLDX 4M1OA 4RPKA 2CFOA 2BKEA 2DBRA 4F93B 3TQSA 2O8CB 4FFPA 3TRKA 4TM8A 3W5IA 4HDRB 2K7FA 4WH0A 1G7TA 4B6OA 3LXUX 1VPTA 4FFRA 3AR6A 4JV5B 2VBFA 1T0JB 3D3NA 4BE7B 3OA2A 2ADFA 1IVYA 1CB7A 3R0XA 4BWGA 4UE6A 3WWDA 5J4KA 1SB8A 5HIKA 3VPGA 1M6WA 4OYLA 5CVEA 1DRUA 3NGLA 4UHHA 4GKJB 1R0LA 3WAJA 4QIHA 4R1LA 3EULA 4H31A 4F2WA 1GA4A 1TZJA 3B52X 4IEIA 4X7BA 3KD2A 3H2KA 3H2YA 4JQZA 4RKEA 3KB8A 4YK7A 4ALKA 4LTNA 1IHPA 2I3BA 4QXRA 4RVCA 3WSTA 1NFFA 3TKYA 3ZCSA 2W2MA 2VRCA 721PA 1Q19A 2AR9A 4KU4A 4BL5A 1R00A 4IVPA 3LZCA 2PUTA 3ERCA 2JAQA 1Z6GA 3W3AA 1BEUB 1DLJA 3UIEA 3M34A 1JJIA 4CFSA 1FB5A 3P9YA 5INTA 5CMLA 3BK7A 4A92A 1L6IA 4AXBA 4GR9A 2UZ1B 4MB0A 2HDHA 1X74A 2PH7A 4G4IA 4JB2A 5GVRA 1N7IA 1EYZA 1MAWA 4L8GA 1T5TA 4W1RA 3W04A 4C0WA 4EBFA 2ZVPX 4QRIA 4B4UA 3P9XA 2PKYX 2YV1A 3DLIA 4TXHA 1SIUA 2GOYA 4KFUA 1VLJA 2HUPA 4C78A 2R60A 2B83A 3EEYA 3IILA 2EKBA 3IPLA 5CW2A 2L2QA 4RK7A 2IV7A 4FMCF 1PF7E 1XP8A 2ZJ0A 1ULBA 3EXFB 3IB3A 3HR4A 4L07A 3RTAA 3CLKA 4XSGA 2HX1A 3KKQA 1BCSB 1BHSA 5EMKA 5IF9A 1KRHA 3EQ8A 2NO5A 3A4MA 5C1OA 1JGTA 4G4GA 2WD7B 3OQIB 1U2ZA 4JYPA 4MWTA 4NIMA 2XY4A 3F2IA 3BGSA 3QPDA 5JAQA 3G0OA 2WG2A 3AVOA 2X3UA 3MHTA 3VKHA 2WP8J 1C1HA 3ROPA 4R8MA 3OJEA 3N8DA 1HSZA 4PZ0A 4E1VA 3X1KA 3BSSA 4FDVA 4FD3A 1R9MA 4FHZA 5HFAA 5EKTA 4ZHQA 4YQEA 1BS1A 3HXOA 2VN8A 1CHDA 2BTOA 2ZGVA 5EJ2A 2ZANA 3C1OA 4P31A 5G0WA 1YFJA 1SU8A 1U9CA 3EPJA 4D0RA 4WBNF 5AUNB 5F23A 3DGEC 1AHHA 3EEOA 3GLTA 4OLFA 4IIHA 1J8MF 4ZEXA 4W1QA 2PWYA 4MUBA 1EJ0A 3BMCA 4D9CA 3QVGB 5BMVB 3C8HA 1I4LD 4LPSA 3KX2A 3K4PA 2BUAA 3GFTA 1JKJA 3EB9A 3TEFA 5AM4A 2X1LA 4B80A 5C8DA 1E79A 2FW8A 2GHTA 3IURA 1FX0B 3LRXA 3MB5A 4Y0VA 2CWWA 1Q2UA 2XMZA 1VI5A 1ZU4A 1FFXA 3FTPA 1H1TA 3PUIA 4J8PA 4L72A 4Q16A 3SDZA 3H1AA 2WTEA 4QUEA 2PKWA 1G8SA 8ADHA 2CL7X 2WIFA 3HDYA 3C6ZA 1HYGA 2OGTA 4RIEA 4YP9A 3G1UA 1T2AA 3SOZA 3HU3A 4EPVA 3Q87B 1FMFA 1FDSA 1UMCA 2W58A 5AVSA 2BKAA 3RC7A 3CPJB 1M2KA 2J6CA 1GFZA 3L4BA 4JQOA 5FF9A 3NBMA 1F1JA 2VYQA 4LMRA 3WXBA 4U3JA 5CFPA 3ZVKA 1PSDA 3K0BA 4F3NA 2B8NA 1N2HA 3S2ZA 3KL2A 4EAAA 3SYRA 1T26A 3DV0A 3H2ZA 2AG1A 3H4TA 4JVOA 4ZO9A 3DGFC 4RETA 1Y1LA 4Z0PA 4R2LA 2CD9A 1E6MA 3JPWA 2BDEA 1TUGA 1HM5A 1ETHA 1S02A 1U28A 2AUTA 2FN7A 2P9JA 3OKFA 1K97A 1OI3A 4LQDA 5LVAA 4F1WA 4ZGGA 3F73A 1IUOA 2XB6A 3ZWOA 2ABWA 3KE8A 3Q8LA 3BULA 3PDCA 4O2AB 4D0GA 5I8WA 4LF8B 3BB1A 3ODGA 3C5EA 4YQFA 3OHSX 5AVKA 1MO3A 2YJNA 4UEJA 4RZ2A 4Z3DA 4M9QA 4PC6A 4AECA 5HQTA 2O2HA 4AO7A 4CMEC 1EVLA 2VRWA 3AC0A 4EB8A 1CR6A 3B6MA 3T4EA 4J9VA 4V0QA 2M6KA 4RANA 1I5RA 1QH9A 1SC9A 3H83A 5ALMA 3PRJA 5EIXA 2FUG6 1Z17A 5ALIA 5CR9A 4JLPA 2D4HA 3W2GA 2G4VA 1ZH0A 3M9LA 2XKKA 5E7JA 3WWOA 4RJKA 2Y1KA 1JIIA 5HIAA 1TZBA 1VXRA 1Y5MA 1DHRA 2FRVA 1U28C 3I92A 1KF0A 4LMAA 4R2KA 3K9WA 4Q3BA 1ONBA 5J2TF 2AJ8A 2Q3BA 3SZLA 3HACA 5A62A 1I13A 3U5ZB 4XM1A 3I8OA 4B8YA 2XKJE 4ZEMA 4G9GA 1L4BA 3IXLA 5L95A 1J9EA 2EDAA 3RU2A 3COSA 4P5EA 4I5FA 1SCAA 2XNDA 3NX4A 1UFRA 2L19A 3TD6A 4A0FA 2HJGA 5JVDB 1A7UA 2HPVA 4LDZA 4O1IA 4ZTUB 1YTLA 1RXWA 5CLHA 1GL3A 2BW0A 3F3SA 2A3NA 3HDTA 1QYWA 3QX7A 3GRCA 4HH1A 2ZCVA 4FMDB 2IYLD 4NVRA 2WU3A 5JQWA 5LP1A 1WXHA 4W8HA 1PVOA 4TTTS 1EP9A 3JQDA 3CSDA 2OLKA 1T5OA 2P2CA 2Q3FA 4KBYA 1P1KA 4YASA 5DGTA 3VBEA 4AYTA 4DIMA 4AQYB 1PNRA 3R3SA 2XMBA 4LSZA 1V35A 4MV5A 4A6PA 1HFEL 3TXAA 4N5NA 4O4HA 2DCUA 3VH4A 3N2NA 3OLWA 4LF9B 1F06A 3AF2A 5CU7A 3JWJA 1QH1A 1RAEA 3A70A 4DG5A 2O8DB 4BB6A 1OWNA 2O54A 2WHPA 1T8SA 3C3CA 3FPAA 3VH2A 5F9HA 2CMKA 3ZTWA 1Z2OX 2DVMA 4M0FA 2YIJA 3D6UA 1LWOA 4H7HA 2O7VA 1LNQA 1KYXA 3NTXA 3B3GA 2C0PA 1DHTA 1YGYA 3C3XA 1BXRA 3PGLA 3RS2A 3FM9A 3FFXA 3CW9A 3GCZA 3I73A 5E0OA 3UJAA 3IAAA 3BWVA 4X3PA 4U00A 3PTAA 1B6RA 3TQIA 2R86A 1Y8AA 3ER9A 1WCWA 1GZDA 2JS7A 4HYTA 1T4BA 3FWZA 4XWTA 1JZQA 1Q0ZA 1NFRA 1RWBA 5BQ5A 3RUCA 1AVTA 4P0QB 1UK7A 3DFMA 2W93A 1G17A 4TTRA 3L8DA 1EUCB 5HF5A 1SOVA 4KH0A 5JSHA 3FPHA 1NXWA 1QXSA 4UJ5A 1X14A 1I6MA 2IYFA 1E2LA 4EQ6B 1J0BA 4QWWA 1Q0PA 2YJ3A 3IS3A 3U7GA 1BKDR 4XX0B 5TMPA 1V16A 2GK4A 1CQJB 2H51A 3LUFA 5D1HA 1Y34E 5HE8A 4B81A 1XYVA 3FF1A 1YV9A 3P0EA 3T3EA 1HA3A 4OMDA 3M6WA 3OM8A 3JV7A 3AHCA 3KJIA 3T9FA 1FBNA 5M29A 2VC2B 1LF5A 1OX4B 4QUIA 4ARIA 1AT1A 4GLFA 2GM5A 2ID7A 3SEQA 4BAZA 4PPGA 3HG7A 4QJ3A 1O95A 3LQFA 4ABTA 1NW9B 3QA3E 3FUXA 1TVKB 2VXYA 4JGIA 10MHA 1C4OA 3REQA 1XIVA 3THSA 1UH5A 3RIEA 5A4FS 2P1DA 3KFLA 2Q3MA 3F7NA 1HORA 3DUWA 4EO9A 2JKZA 4M8SA 1YL7A 2I6GA 3OLCX 4G41A 1ZHOA 1BGVA 3FOWA 5HCUA 5EXPA 3VR2A 3ZHXA 2Y66A 1ZUHA 3KLPX 3WS7A 3D4PA 5HSGA 4ITUA 4FOSA 4IH9A 4LRYA 4UHJA 2DUMA 121PA 1NV9A 3R9WA 1CZHA 1GRVA 3AHHA 1XX6A 5KB3A 1ACJA 1CEQA 4FEYA 3AB7A 1P33A 1T6XA 2YJGA 1N6OA 2OPBA 1CR2A 3CF0A 3NTLA 3JD1A 2XJ4A 4P0TA 1R10A 4CWAA 5C1BA 4K8OA 2V3CC 2V9CA 4ZMSA 4PXSA 4B6SA 2O5EA 3BYZA 4R0VA 1ZI9A 1PT8A 3AUUA 1U0TA 4RA9B 1QIMA 5EUCA 1EWQA 4JI8B 4I1OA 1F4VA 4LQCA 3ZY5A 3O3CA 4KGVA 1LCIA 5L3SA 1UP7A 3ASZA 4KN9S 3O1LA 3UVEA 5A7FA 1OTXA 4HGNA 4EGJA 1MA0A 1ZN9A 2FF7A 1XK6A 421PA 4Q19A 3ZWBA 1ZXLA 4UFPA 1WIWA 2CVOA 5JDCC 2V9ZA 3MXTA 4M49A 3HDHA 2OHHA 5EKXA 3V4OA 4Q3KA 3VU9A 2D8MA 1HE3A 2ARKA 2IF0A 3GJ4A 3CLSD 2J5QA 3WYNA 2JLXA 2RGUA 2GZSA 1QVWA 2Q6KA 1LBQA 4JYMA 4Q4HA 4ZT3A 5JJCA 2CHUA 5BR4A 4AK9A 1PFQA 5LP6F 4F06A 3MIIA 1USUA 5E7IA 2VDUE 1OFUX 1M5UA 2BUCA 1E2JA 1HTBA 2GCOA 1ISJA 3HVJA 2MIIA 3PPYA 3CV3A 4F6LA 1Z34A 4MR9B 1RXEA 4LZJA 1RWPA 2FX5A 3GF4A 4YT2A 5JDIC 4HZIA 4N7BA 1U90A 5T3YA 3ZE0B 5BWLA 5CFRA 1IZYA 2ZSDA 2QAGA 3D81A 4XIIA 1E7SA 4X66B 2AOVA 1LFDB 2C9OA 4D79A 2C7GA 1WBDA 4WN3A 1OOEA 3RYIB 2AZTA 3UW3A 2BT4A 3FZGA 3E03A 2B1RA 1C0EA 2DSNA 1GDDA 1CQIA 2B4YA 2R3SA 3ZCPA 1OASA 4YIHA 4G2TA 1NUSA 1XF1A 5DTMA 3Q7RA 4G24A 1SCDA 4AJKA 4DAEA 1P0IA 5AM1A 4CMAA 5ANRB 4PLTA 3OWOA 3G8YA 1WUIS 4QPZA 2FGJA 4E08A 3HKCA 4Q48A 4YR7A 3O91A 4N18A 4KIJA 4D8TA 2RH4A 1V7QA 1NC1A 2IHZA 3BTUA 4N9QA 1E3EA 2ZJ7A 4PO8A 5H59A 4N0MA 1Q74A 1C3OB 1SURA 2GZ1A 3I0MA 4ND6A 3DHVA 4ZPXA 3TIGA 5A1JA 3P19A 4XB2A 2FX3A 3IX7A 4XUCA 4I1IA 4PQFA 5P8WA 4N39A 4BFYA 2D0OB 3PPWA 1T4CB 2XOKA 4PONA 3KOUA 1T3GA 3MCTA 3ROQA 1SKMA 4KOAA 2G63A 2PK3A 2CDRA 3DEFA 4MWGA 3DWEX 1TJYA 4L50A 1C9EA 2HTEA 2SKEA 2BBOA 5BSMA 3MMSA 4JB8A 1C1XB 1R9JA 1GAQA 4II7A 3A3PA 1D2GA 1F5SA 1R3UA 2AMVA 4JQYA 5BMVF 5CEJA 4BEVA 1RXVA 1Y4ZA 2NQ8A 2MU1A 1TB4A 3AL3A 4IDHA 4OUDB 4KVFA 1NJ8A 3CKLA 3VHXA 3GLRA 4BMCA 5BPHA 4C0AC 3EOBI 5JD4A 4WBNB 3F6YA 3L41A 5L6MB 3LF2A 5BORA 1F2DA 1ZK2A 3SC6A 2XTAA 1ML3A 1UWLA 4DLRA 2IITA 4WKGA 4P4LA 4B2PA 5AVTA 4L9AA 4P84A 4P8RA 5FWAA 3SR3A 3WL7A 3GJRA 4DJTA 1KK2A 5C81A 2AI1A 1KDYA 4D0NA 4INAA 3E35A 3OT5A 3AYXB 3EH1A 3EOAI 3H16A 3CUYA 5T4BA 3TLBA 1KI6B 4Q9LA 2WNHA 1HNNA 4LKRA 4DCUA 5BWBA 2AUNA 2D1RA 2VDMB 2ZI4A 3BH0A 4OJQA 4RZSA 4TRNA 4C4SA 4WTOA 5JS7A 1KJNA 4M0PA 4P3PA 1WU8A 1AA6A 4AN1A 3EIFA 3NHFA 3N2KA 2J0SA 1NMQA 4YI3A 3HEAA 2VPYA 5DOZA 5DYIA 4EP1A 3NJ4A 4DL9A 3BXGA 5BSTA 1UC5B 3A9VA 3O82A 4MUFA 4ESEA 3W9YA 1Q0SA 5K8UA 3KD3A 4JVSB 3U81A 2YHSA 2HADA 3IT1A 4S12A 3EQ7A 2W11A 4RKRA 4YJGA 3SJCA 2G5TA 4A2PA 5AVUA 3NONA 4CEIA 1FX0A 2D6FA 4Y1RB 4XDYA 1SG0A 3MILA 1DBIA 3UGQA 5K0SA 2XVMA 3S68A 4EPYA 1A7AA 5CT8A 3L5OA 3SVLA 1T24A 4ZANA 1I5EA 2FV8A 1GSHA 3LLSA 4KQHA 3V46A 4B47A 2H5LA 4DKJA 1YJ5A 1IEWA 2AFIB 2OV8A 3V4FA 4OHWA 1CIPA 1OAAA 3GCGA 5DRYA 1PZMA 3ITDA 4NX2A 2EX4A 3D6JA 3NVDA 5DN6A 3HO1A 5HUJA 2HU5A 2GPNA 4MRVA 4D25A 1AKQA 4OHXA 3HKCB 1GY8A 2WPDD 3R9IA 4FEAA 4IG4A 2QL5A 1G8PA 2F1OA 3A58B 5JSKA 4CU2A 4MSUA 4MWCA 3ZIAD 1TEXA 3IA2A 4LY6A 1NOKA 1PNQA 1G66A 1FDWA 3HUTA 3CZ4A 3L4BC 5IARA 3IQXA 2OQVA 3T12A 3AHIA 2GZRA 1VLQA 3O9VA 2O0LA 4CM1A 2FHSA 1KYQA 1Z45A 3HN6A 4K6CA 5IUKC 1XQYA 4NV1A 1L5ZA 5CK4A 4TYWA 4JUDX 2EYQA 2W43A 1PUJA 4DARA 3BXHA 4DOMA 2QMZA 4QYIA 1LVUA 1UWKA 5EN4A 2ZETA 5H0IA 3DBHB 3K3PA 1LFAA 1EP2B 3ZDXB 5LB2A 2Y0CA 2Q45A 2ZR8A 3CXRA 4Q7MB 3RTGA 5LQJA 3I61A 1FP4A 4CF3A 3PDUA 1JAXA 1ESMA 4NZYA 1M6VA 4TZKA 1PDOA 1RR6A 1XTVA 5H5JA 1JG7A 1ZXXA 1F20A 4D98A 4E88A 5JATA 1V0JA 4G3XA 2R65A 2X4DA 1N2CE 3KG2A 4C1BA 1TPYA 4JI7B 4YV7A 1WMBA 4TLAA 4QREA 2QTMA 1NU6A 1TZCA 2IYEA 1NY6A 4G5FA 1J2JA 1NQUA 5AJYA 3C16C 5FBQB 4JLWA 2RHDA 2J6BA 2A88A 3ELBA 1LWNA 4KXUA 5ECDA 2R1ZA 4RY8A 4XFKA 1UBTS 3T5AA 2DLDA 2VAMA 2Y68A 1EQUA 4Z3OA 4HSGA 5I45A 5KYUA 3BRWA 1X42A 3WLPA 4CHGA 2FPMA 3I76A 3LI2A 2Z2KA 1K6MA 2X42A 4QOIA 5JARA 3FJOA 4HDAA 4YMTA 1UP6A 2JGRA 1PBNA 1HXHA 4O2BB 1RC0A 1GGHA 3MJFA 4TLBA 3EVDA 4WOBA 1N6NA 1NR5A 3VH3A 1R64A 2ZCUA 5TPWB 2V58A 1B0UA 2HHJA 1ZIPA 1LPMA 3DONA 2B2CA 1JFFA 3NV7A 4OXRA 3TKLA 1U2GA 3LUJA 5AVJA 3RC1A 3UMCA 2ORED 1NW6A 3PUZA 3KRTA 2RGWA 3AETA 2HAEA 4JX8A 1EKXA 1VCMA 2YYZA 3H18A 3QXGA 5JCPA 4Y2UA 3FKJA 2I9KA 1CRPA 1MVLA 4QHSA 1DVRA 3DZGA 1UEJA 5AKJA 5BVHA 1RRKA 1T2FA 2A9OA 3M6VA 4OVKA 1LBHA 3D54D 3K2IA 3QUBA 1E4EB 5EERA 4DIEA 4QBFA 3RREA 1HE1C 3F5DA 3ABZA 3PGKA 2VNSA 4CXMA 2O2SA 1CJMA 3F1LA 1YD7A 4C0LA 2H7VA 5JOQA 3PC7A 4WK6A 3WDMA 3EIQA 3EDMA 5TEVA 4YXWD 2CJWA 5ALZA 2OV2A 3R3HA 1OLUB 2R00C 2QF7A 3HB0A 1MHTA 4WW0A 3LUGA 1CFZA 4DUYB 3L93A 2RGEA 1V1RA 3AFMA 3PWTA 2Q62A 4QNRA 1RQNA 3ZEAA 2FPGA 1CDZA 1SVMA 2VNAA 1HKUA 3PR3A 3L3BA 5CK5A 3AFIA 1L1FA 4EQ6A 2EBWA 4QUHA 4EIWA 2C9YA 2OBMA 3KQKA 1Q22A 2HMUA 2C9ZA 1KRWA 3AM3A 2EQ5A 3AM5A 3NLLA 2XX3A 1A88A 4ZI7F 1UJ2A 1Q15A 3A4NA 3EXAA 1U7OA 1KZHA 5K3EA 4ZWNA 1B3RA 5FPHA 3HN2A 1PS9A 4L9RA 2O06A 3VR4A 3DB2A 1GXSB 2EW2A 3FKQA 3TRFA 1DJOA 1HI9A 2HLHA 3E7XA 5DYYA 4J0QA 2O6LA 4O3FA 3V80A 1NUUA 1G0NA 1OX4A 1V5WA 2F2TA 4DMGA 4CM4A 4F4DA 4QYTA 1RYNA 4YALA 1P5FA 1YOVA 4MRRA 2AOXA 1D6NA 4RQUA 5J2UF 1OKKA 1K7FB 3L1VA 3HNRA 2YN0A 4TVKA 1C41A 2I2CA 3K9BA 5FR1A 3IBCA 1XDSA 4QXPA 3JYLA 2G0AA 2JJQA 5KDLA 4BNJA 3GLIE 1FUEA 4NJMB 4OQZA 1GG8A 3CB2A 3UCFA 4MUJA 4M7OA 3G2QA 3NHAA 4FYJA 2IYYA 2YNMA 2ZIAA 4KQIA 1FRNA 4ERXA 4NAUA 5LWQA 3C3WA 5IAJA 3LWNA 4BMNA 4G1VA 1M5TA 2PZKA 2FZWA 3R5SA 4BVLA 3PVCA 4ODIA 1JMYA 2P9ZA 3ZCVA 1OYYA 1ZINA 3UM9A 4IEEA 3I2JA 5GAJA 4QUKA 1N2OA 1T8PA 4XXHA 2K4MA 1VCOA 3G8DA 4YMLA 2JIZA 4R0MA 4WINA 4TS9A 1N5RA 1XLWA 4HDQB 3BXOA 2M6SA 3AY0A 1MORA 2PKCA 5UKDA 1T6NA 4DIOA 3RSOA 1W47A 4MRSA 3P26A 5BP7A 3GOHA 2J5KA 4X20A 3C4JA 3TSCA 4O2RA 1U0EA 3EDYA 3UPDA 4CUJA 1JFFB 1NP3A 4Z86A 3ADBA 2O8EA 4REOA 3AUTA 3GLHE 3H5OA 3QZUA 3NIDB 1GL7A 3WRVA 3GUCA 4B6JA 3AETB 2XZTA 3G0BA 3ZDYB 2ZZMA 3TQTA 3DMGA 1J06A 3FKSA 4N48A 2HMAA 4HB2A 4FI3C 1MIOB 3QU4A 4G07A 1J24A 4QYSA 4WECA 4JLBA 5BVHB 1ZNYA 5L53A 4IJKA 1H2RS 3HU2A 4HXEB 4W1PA 4R31A 1ZQ1A 3OD1A 3PRHA 2VWQA 1NQVA 1WPQA 1X92A 4A23A 2HGZA 3HCEA 3CBQA 3GEIA 5TQ0B 4DFDA 2C88A 8ATCA 1OWMA 5KSWB 1TF7A 4MKIA 1TX4B 3NUZA 2HY7A 4I1PA 1ZN8A 4P4NA 3SVTA 1VRVA 1KP9A 1WLSA 2OECA 1C7IA 3BDIA 3U1VA 4DBLE 2I3DA 2DHQA 4CM6A 2ID4A 5JPDA 2GCPA 2QMYA 2KB0A 4EUHA 5F2NA 1YQ9A 1MA3A 1A50B 3HP7A 3N39C 3SN6A 2GXUA 1F2TA 2CUNA 3A6HA 3KSDO 4L28A 1K5HA 4BBPA 3BA1A 1A27A 3KHUA 3RBZA 1K63A 3EIXA 5ESDA 1AGNA 4AWXA 4ZIRB 3HFRA 5HBGA 4R54A 2AFHB 4C7VA 1X86B 2QZ4A 5FADA 1RCFA 1G5FA 3JX9A 3TD2A 2DTEA 2QIOA 3LDAA 5TRTA 3T15A 5L4SA 4BCDA 2H4YA 2OMKA 2V7BA 3KDSE 4QQKA 3HXQA 1AV6A 2Q21A 2XT9A 1D09A 5GIPE 1CC1S 1EUDA 2V7UA 3I5UA 5BWOA 2ZYUX 2NUPA 5DYNA 1AKYA 3T1YB 3WOVA 4RTQA 2YQZA 3DLPX 1FVXA 2EG9A 2O2DA 4N5HX 3S44A 2A0KA 1L5QA 2XCOA 2ONZA 3NHRA 5CDFE 5CYOA 5FTWA 3KQQA 2ZT5A 4QWMA 5DRTA 1EFLA 4GM0A 1N0VC 3DL0A 1PO7A 2VQDA 4J91A 4JLMA 4CETA 1UMDA 1MO2A 5L8VA 3IBTA 3L7IA 4V0KA 1RRGA 3E15A 4FZ3A 1QWOA 2QU7A 4DQVA 3L0PA 3Q7SA 4ND5A 1R0SA 1M0WA 4TWZA 4RYDA 3RSZA 4D74A 4HV4A 1QTNA 2NNWB 5A03A 5FWXB 2B61A 3IL2A 4HQOA 4YAUA 2BWJA 4GZ5A 4WXMA 5IDVA 1DZ3A 3LJKA 1T9DA 3EYWA 4FFBA 4O4LA 1CUSA 4P9NA 3WLEA 2GO7A 1TTHA 2QTFA 3LO8A 4NECA 1Q14A 2FKAA 4KHZA 3TCKA 2JFFA 1LPAB 3CR3C 4L5IA 1CY1A 3F71A 4TT3A 1QP4A 2I4TA 4KIWA 1ACMA 2H00A 4XRGA 4C6TA 5JW6A 1Q0RA 3WYFA 1JIUA 1IDOA 5A04A 3QBJA 3OKPA 2FN9A 5B58T 1YBAA 2R7MA 3DEZA 5BV2P 4UAGA 5LQMA 4PYJA 3H99A 5JCXA 2VIIA 4QLOA 2GD2A 1U1FA 4RSRA 3WGGA 1FZTA 3AR2A 3X2SA 3ZZMA 4HNVA 2IDJA 4BFUA 4PYQA 3HB5X 2GA9A 4JJIA 1OJ7A 2H1HA 2HH9A 1X7WB 3F9IA 4LVCA 5FNVB 3ZGYA 5B5SA 2JAHA 4DADA 3K0EA 3FI9A 2Y27A 2RJNA 1Z35A 1E2UA 3BFXA 2J07A 3DDSA 2IH4A 3BWCA 3T95A 5GINE 1HZZC 3BG5A 1W0JD 1VSBA 3BE5A 1ULTA 4G01B 2AMLA 5FBZA 4JMLA 3ZDBA 2O6HA 4IM7A 4FNMA 5EZ5A 2J8ZA 1G64A 2Z6AA 3G88A 4A0QA 1C0IA 1M1ZA 1CCWA 2BH9A 3HU1A 1USKA 1RHJA 4P81A 5SY6A 2D0IA 4HUQA 1HT3A 4DN6A 4RZHA 4HAZA 4O2BF 5HTKA 3SE7A 3OCVA 5L3QB 4HR7A 2VS1A 3HCRA 2DTDA 4KUEA 1EBBA 4RENA 1TMGE 1Z6XA 1FTQA 2DFDA 3I9FA 4RHTA 5CDTA 1Q77A 4MJXA 1JAIA 1IQPA 4OHKA 4C4PA 3GRZA 2DWQA 3KUXA 4X6YA 1SUFA 3WWEA 3IE2A 3KYCB 3FVVA 2V96A 1Z12A 4BNKA 3O26A 4FYPA 3R3UA 4PLPA 5CLIA 4ZFNA 1I2MA 1NXXA 4FS3A 2IU0A 4MQ6A 4EFKA 3EF3A 3RRMA 2WKWA 1M7GA 3EAGA 4I08A 3RRXA 4DZTA 4X1YA 5EE0A 5AT1A 1VYUA 3FB4A 4HO1X 2XUAA 2MSNA 4NHEA 2X6RA 1Y6FA 5G41A 1Y9DA 4PPYA 3LT0A 2H1VA 4FMPA 1MOPA 4MMZB 4U7GA 1QKIA 4ZDJA 2F4NA 2IZZA 1LDNA 2RHMA 2V6JA 4FGLA 4UATA 4N03A 4YROA 5K0EA 1JHDA 1IBSA 5DXJA 1OC4A 4H7KA 4NULA 3ZXXA 5AUPB 4I50A 2BGGA 5FT9A 4UXIA 5IJ9A 2HDOA 5B7GA 1XMVA 3SSMA 4WLNA 4X7MA 3STWA 2DJ5A 4L4UA 4DA4A 1NTRA 3GU3A 3JQFC 1QQ7A 2NTVA 4TWRA 3TLAA 5I9MA 1IC6A 2J1LA 1MH9A 1ENOA 1H94A 2VHEA 3IEMA 3I2YX 4PNZA 4QPDA 1M2NA 1E7YA 4QFMA 1DSSG 3JQAB 3PZRA 1U6JA 4RA6A 1C9YA 1ZI8A 2QV7A 1VMKA 2H8GA 3LQKA 3Q7PA 4ROSA 2X0FA 3WDLA 3AILA 3UCXA 3ZCQA 1EPUA 1XNQB 3FTEA 3WV5A 1TEZA 4TX1A 4QEDA 4IRXA 1LDEA 2CNKA 1GQYA 4XB1A 1I4DD 3CG4A 3S8MA 4BYGA 4Y2QA 4FYKA 5A2GA 2B30A 2QIPA 4R6WA 2ODAA 4UHFA 1FLAA 1GGEA 1L5SA 4EB6B 2HC9A 4LHXA 4UU8A 4ZVRA 1OMOA 4U7PB 1T2UA 4AMYA 4CR8A 4YONB 4AMVA 2XUQA 3AR9A 4ZQFA 1XC7A 4EYEA 1YDHA 2I1LA 3MT0A 3OFKA 1E1DA 4ZVKA 1C8LA 2G1UA 1EFTA 2PEYA 2Q2OA 4M7PA 3QVVA 5U4QA 3T3HA 3U3XA 4V1CI 5KYUB 2M2IA 4P7KA 1XEAA 4REQA 4QG3A 2RAUA 4KMOA 1QIFA 3PF8A 3VO8A 4C0KA 4HDNB 4RKQA 4Q7LA 3K0CA 3L8GA 4W9MC 4CRWB 2XE7A 2R6DA 1FK8A 4P4SB 3KKEA 2A1UB 2A92A 4DJFC 3WV4A 2QZSA 3WKCA 5JSUA 5KC8A 5ECGC 4ZZ2A 2NWQA 2ERCA 1TRHA 3KVRA 5I9SA 5M5BA 2VJOA 4KLAA 3N2GB 3ZVMA 1LU9A 3NAMA 4PCLA 4IF4A 3QELB 2AQKA 3TZKA 3PDHA 2WJZB 5COAA 2CDCA 3N5KA 3IXMA 5FI3A 3SX4A 4ZCRA 4ZJZA 1ZD4A 1DX4A 1HG0A 5E4TA 3JALA 2YXNA 3PEVA 3I2GA 5E9JA 2ZUBA 1JN0A 3ZDQA 2BMEA 3VR2D 2PH3A 4CGYA 2D2EA 5G4LA 1FFHA 5LQUA 4KZPA 4DIBA 2VJQA 4J90A 5JMWA 1QV9A 4FSXA 5AWFC 3VR4H 1P2SA 5L40A 3BTOA 5ED0A 1O5IA 2W6JD 1W8DA 4I6JA 5ESXA 1PK8A 4R3NA 4LBWA 1TA0A 2YIDA 3A3YA 1E1CB 4DNOA 4DLSA 3CISA 3FSRA 4OIMA 1W19A 3HPRA 4D80A 3KJXA 3GFFA 3W6NA 1UXHA 3ELDA 3O2SB 2ECKA 1L5LA 4ENWA 2Z3WA 1F0KA 1XR3A 2FK8A 3HBLA 4HNAB 1FMTA 2QUZA 5JEDA 4C7OA 2P79A 4HSEA 4RZ3A 4AMUA 1OH5A 3E9EA 1SUDA 3DBRA 1PQPA 2BM9A 4JYCA 1FXSA 3LXMA 3V4VB 1SC4A 4GW3A 4K6OA 3GZNA 1WCV1 5CH5A 1QPGA 1FXUA 5CT4A 4JSTA 5BN5B 1AQ6A 1FEZA 1JYSA 1RT9A 1VYHA 3DCIA 3ZI7A 3KELA 5E38A 2JKVA 2NYUA 2YX1A 3LVRE 3OIYA 2DC1A 1KZ9A 2W2TA 3QPCA 4LMBA 4Q34A 2YHIA 3ZCRA 1QDUA 3S29A 2JFYA 4D92A 1DL5A 3C3JA 3VAAA 2R5NA 4MLDA 1FXWA 3FY4A 3F7OA 5FIUA 1VKHA 2CK3D 3B2NA 3KSUA 4S1PA 1LTHR 5KQGA 3W79A 2W2XA 4URWR 2NIPA 2YHUA 2YZMA 1RBMA 3DKKA 3OY2A 4KDCA 5DPMA 1RHRA 4AZWA 4F8JA 4PX2A 5IAOA 2W6MA 4A5SA 1KOGA 1TAHA 1ADYA 2VNIA 3GUHA 3IEPA 3SX0A 3ROTA 4B73A 3DC7A 5D3KA 3NTRA 5I9LA 1JQAA 5K3AA 3ZUGA 1S3IA 3X0DA 1RDFA 5KYKA 4KO1S 4CJXA 1CIVA 2XE8A 3P0IA 4TXNA 4DTIA 2J85A 3L4EA 4J3JA 3LTNC 3DQPA 3CBGA 5FI0B 3FFWA 4E5SA 1X80A 4PFJA 1EVQA 3HA7A 1YRWA 4N41A 2RONA 4J4HA 3RYIA 1M66A 4QBKA 4EI8A 3OQVA 1FMJA 2C61A 4LDQA 3PGXA 4BVKA 4CM8B 5IT9A 2GPAA 4QUGA 1KU0A 4WOCA 3UNXA 2WFMA 1DOAA 3NHBA 1P7CA 1DAEA 3VR5A 3WICA 4FC7A 1YB1A 3KLOA 4U8HA 2X5JO 4MA4A 3RRYA 1SU4A 3NO4A 4PFSA 3HXMA 3NTVA 2VT7A 1IJBA 3NGXA 4C2UA 4JDPA 5HQ3B 1IZ9A 1WHTB 1CZRA 2H5EA 1DINA 2BTQA 4NJEB 3B89A 3JQAD 3PA8A 3QELA 3IJEB 3I6BA 3UAWA 2PX3A 4EWLA 2XNSA 4BTEA 2V1XA 4R1NA 2EP7A 2HYIC 1HX7A 1XZMA 2QROA 1YK0A 2YKGA 1DARA 1VG8A 5T6MA 4IFBA 3ZR4B 2WWWA 4OQXA 4LGMA 5AVRA 1R37A 1KI4A 4U2KA 1M0TA 1ZZEA 2VDVE 2JJ2D 4HL6A 1TTTA 3T4UA 3IT3A 1N6RA 2DT5A 3IEXA 4JBHA 3X1YA 2IS2A 1CULC 2I7TA 1DIGA 3N7UA 1NXPA 4NTZA 4PHTA 1PNVA 2VZEA 2EATA 1MO5A 1EBUA 3PXBA 3CH4B 3R23A 1D2HA 1Z08A 1MPTA 2RGGA 2E55A 3DBLA 2A5FA 2P6RA 1CJKC 2TSYB 3C7CB 1VSUA 3R09A 1IU9A 1GAXA 3WC4A 2RK6A 3EHDA 3DL4A 3L6RA 4D45A 1U5CA 5KDDA 3OZDA 3CCFA 4K9QA 4EUNA 4Q4JB 3STHA 5AICA 5A4AA 2UYHA 1FFEA 3E1KA 3ESZA 1Q7TA 1T5BA 3VH1A 2GFHA 4X8HA 2QU8A 2R8ZA 1EUZA 2DOKA 4FI3F 5LQAA 3FYUA 5D5HA 3D1LA 1U99A 1AQNA 1N0HA 3SBDA 2BGRA 3UG7A 4F2DA 4F3CA 4DV5B 1XMXA 1ZESA 2WILA 2AEJA 4CDMA 2ZAMA 3LECA 4JVLA 5CXXA 1XEFA 4MW7A 2D59A 1W4BA 3DMRA 4KAJA 3C1UA 4RHUA 1YMUA 3BMNA 1RACA 1KY4A 2RGBA 3IP7A 3TBFA 4OHPA 5DWDA 1VMDA 2O2GA 3MGCA 2BFBB 1EFRD 1NI4B 1IBMB 3ILVA 2OSVA 2OG2A 2GAJA 4Q3CA 2PUWA 3H8VA 4GH5A 3JAMA 4YMIA 1SWWA 1GA1A 1Z37A 2I2WA 3F5FA 1D5CA 2GEDA 1DAKA 3H2IA 2Q5CA 4ND4A 4LEIA 4P83A 4UBIA 1I1QB 3EA5A 4PBTA 3INYA 1DQNA 4RZUA 1DDIA 1OXKB 3K1JA 3KQPA 5JS8A 5BYBA 1K66A 1M1UA 1NZJA 4MKFA 3C41J 3NAZA 2FPIB 2NPIA 3UN1A 3GDGA 3TAHA 4R2JA 3V8QA 3T5GA 1CLEA 1L4FA 3WE7A 3NH9A 3VUFA 1KKUA 3ZWMA 3GLKA 4NK4A 1OC2A 4QELA 4XD2A 3H8JA 1QU3A 3N8HA 5LCXA 1JAYA 1NBMD 3OIGA 4KIFA 3Q3EA 1BGXT 1AC5A 4MYUA 3ZBTA 4ESVA 3WK9A 3U56A 5DM2A 5DEIA 4UTPA 4HRXA 4ZAXA 1QFSA 5K09A 1K4KA 1QK5A 1H3NA 2FFRA 2HPZA 3DF9A 3DMHA 4PLYA 3N0WA 4RIIA 1NSFA 1F2UA 1S3FA 3EG9B 4C07A 2YBDA 4NCBA 4L9SA 4DE5A 1WB6A 2ECFA 4AIRA 1J39A 2H52A 3Q2OA 3GJSA 3TW6A 5ITVA 2E37A 2W0SA 1OXBB 5HF6A 1DTWA 1GPJA 1PJAA 2W4QA 1Z3IX 1QUFA 4PCAA 5DGXA 5EE5B 1AUXA 1VKOA 4CHTA 1N9ZA 1EFAA 1U7ZA 2QAJA 3K6JA 1JDBB 1R16A 3FNRA 4GYKA 3IB6A 1YQWA 2DBZA 2Y1DA 2XNCA 1NTOA 2AKAB 3OC0A 3FR7A 3UXHA 5CA0B 1YUNA 5DYTA 5FNZA 1SXQA 3RFFA 1DKRA 4S0ZA 5IWCA 2II6A 2VCHA 1XQ9A 5DK6A 1Q5PA 1QNFA 1QR2A 1TUEA 4YT8A 4OB8A 3RSFA 3WGVA 1D0VA 2PG3A 5K9ZA 2PT5A 3KUCA 4X54A 1TM1E 3QEBZ 3VJMA 3DNFA 3R5TA 3VVCA 1L5VA 1LLUA 1QAOA 2VBGA 3K8ZA 1HE8B 2AGVA 1VA4A 2W83A 1H2FA 2WU4A 2VQ6A 3RVKA 4EY8A 2C2BA 5IYZF 1QZ3A 2AL7A 3GB9A 3Q8MA 1ZR2A 3KS9A 3QPWA 2QP4A 4TVOA 5LB4A 5BVGB 2HT6A 1JX6A 3F78A 1RQPA 3D4IA 1DBVO 1B6TA 1U7UA 2R6FA 4P08A 4DSNA 1FRQA 4DCNA 1AGRA 5IXSA 5KVAA 4FFWA 1FFCA 1HLGA 3OCXA 3VX3A 3LX5A 2QXTA 2ZRFA 1EEHA 4Q02A 2VDKB 4JX9A 3U0BA 2CZQA 3FTFA 3FPSA 1WXWA 4RBNA 2FZEA 2Y6VA 4HB0A 3CZ9A 3MB8A 3N05A 1UDWA 4NH0A 4HBZA 1OXXK 3LE8A 5DYWA 1TL7C 2EFDB 1EXMA 2GBCA 4MDHA 4OV6B 3HYSA 4UVHA 1G3RA 3HJCA 4BLRA 4UE2A 2FFHA 2W9XA 3D3EA 3GFQA 4R1OA 1AS2A 4HZGA 5E95A 1X1CA 3ENNA 5CEEA 1SOWA 5CB8A 1IOVA 1JSXA 3RIHA 4JQCA 1EJBA 1R6VA 2QT9A 4MJ3A 2XXAA 4PQEA 4MUXA 5I5EA 2H63A 3RF7A 1SKYB 3A7DA 3PVSA 1ZJ5A 3Q0TA 3V3TA 5M04A 3C43A 2J0UB 2G04A 1Z0AA 4TUYA 4EY5A 2QYTA 2AR7A 3CR8A 3TQFA 1SAYA 1YOBA 3L0YA 3UWOA 1ZNZA 5A4IS 1GTSA 2D00A 2BCEA 5MN4A 4BLSA 1P0MA 4OJTA 2FWBA 1GRCA 2DQKA 3HBFA 1BGWA 1CIJA 1QIIA 4I6EA 4MUYA 4LZLA 4CQMB 3NW9A 1UXGA 3R20A 3WRXC 4C76A 3WO0A 3PENA 1OGYA 2B6NA 5C7IO 3U9LA 1JHUA 2ZWAA 2PXCA 3IR7A 4I1SA 1AUVA 3RJTA 4BU0A 2I1VB 3FCUB 4W5HA 3MYRA 1V26A 4CQMD 3GFVA 1E3LA 1HDYA 3R76A 1P4SA 4NBVA 4R83A 1ZCZA 2WF8A 3ZYZA 4F12A 3LUDA 1ZCJA 1BIFA 1SOUA 3T99A 2GI4A 3EUEA 3DDCA 1YZQA 2UDPA 2X0KA 5GOZA 5EZ6B 1UPTA 2Q0SA 3RAFC 2JFBA 1R4ZA 3AM4A 2WYOA 4QULA 1H42A 4ZVTA 1ZQ9A 3W78A 2EIHA 4COKA 3SZMA 1H2ZA 1PS8A 1UKYA 4ZO6A 4B83A 4EARA 3WJ7A 3NEYA 5KTOA 1ORIA 4OKIA 2JD1A 5TT1A 3BIFA 3ZBPA 2QORA 1KDOA 3B5EA 3WLRA 2KLHA 4WEOA 3HSSA 2REXB 1EINA 4DR3B 3H3JA 3O7MA 3SXUA 1WEHA 4OFXA 4QAJA 3D9QX 1KNQA 2COKA 4ZAVA 5FQOA 5KQSA 3GLIA 2JG3A 4GOXA 4E12A 2LW7A 3BHIA 1PTJC 5EUQB 5KQPA 5DHQA 4HGPA 1DEAA 2C84A 3OX4A 4C2TA 2COUA 4CM9D 2E5FA 4NK5A 4WE3A 3NC4A 3O8NA 3MYYA 4PO3X 4BN4A 4E03A 5HWSA 4PYRA 3DBOB 2EJWA 2A7QA 4I5IA 4LQ4A 3OOYA 3EMBA 5JQGB 2CXOA 2XWPA 1LW7A 3IDFA 4BNIA 1YQXA 4YXFA 5DFAA 3G2KA 1R7RA 1CY6A 2JD2A 2ZTHA 3B3JA 1ZH2A 4J0IA 4OI4A 1JT9A 4NQRA 3D4LA 4NCIA 5CA1B 3TBKA 4LVUA 3EH2A 1HDGO 1V2HE 2X8BA 4FLMA 4A03A 1J1UA 1XLUA 1RHMA 2YMPA 2O0KA 3QKRA 2BBWA 1AN9A 3JQRA 4N54A 4YUVA 1ECCA 2OENG 4C0SA 3PBKA 2ZIGA 3CA8A 4YREA 5EIWA 1Z6PA 3SHFA 1ISPA 2ZIFA 3HL0A 5FBWB 1I5OA 1GCGA 1I1HA 1LK0A 2BHTA 4BTVA 2PEZA 4MV3A 3I8SA 2FP4B 1L4GA 4BCCA 1P3JA 4KPGA 1VPWA 1WB5A 4XX1A 4YTEA 2FU5C 3VKGA 1W7AA 1QE3A 3KBOA 3BFPA 2OXTA 1YR2A 1LDGA 5LWHA 2MT9A 4G5SA 4DDMA 3AG5A 3G49A 1YA8A 4JI0B 3G9ZA 3JR3A 2QXUA 3H19A 1QQTA 1NXQA 2J9YB 1MD9A 2HJ9A 1QFYA 2ON6A 3WVNA 5L4NA 1N2BA 3IP1A 4ZTZB 3EUWA 5F9FA 2D5BA 2ZJ8A 1EUCA 4H1WA 1VPEA 4Q00A 2BGNA 4G8BA 1EHCA 1SIOA 5JIBA 4OLAA 5IYZB 4FOTA 1MOZA 3L8ZA 3WI7A 3EEQA 3HLYA 5G0SA 2W2NA 5DB4A 5A4KA 2QTVB 2YXDA 2V6BA 4U7HA 3RYHB 2BMWA 3VSCA 3A04A 1L7MA 5B57C 4XTCS 1IG0A 1LI5A 1R0RE 3RFUA 3TQHA 4IFEA 1OREA 3TINA 5JH7B 2X1HA 1MJ5A 3TTTA 1KSHA 4Q47A 4ZJYA 4F56A 1Y5RA 1EVYA 5IEJA 1TE2A 3UJBA 1B73A 1WW2A 1NRWA 1OA1A 4DLVA 4FFMA 2PSEA 1RE0A 3L7NA 3R5JA 4JU8A 2I34A 4XUDA 4DG9A 1C14A 1XEWX 5LXTA 4MHTA 1U2DA 2ZSUA 5IM4F 2XHEA 3TW8A 3W1WA 5JISA 1RIFA 3BFKA 1LSSA 2ZVDA 5BNFA 3D5QA 1LBIA 4BNZA 2HDWA 3DJYA 3N28A 4HLQB 4JT8A 1CETA 3PS9A 4L08A 4PM4A 3RG2A 3T41A 4DLWA 4BQSA 4B5LA 3DM5A 3OQPA 2C5EA 3GRPA 5DE3A 5EHGA 5KKNB 1A8QA 3BWBA 1QLHA 2Y93A 1LZLA 4YDHB 2NUBA 4LGCA 3G13A 4BNNA 3GDHA 4BO1A 1V6AA 4RGVA 4FUTA 4Z6KA 2ZYHA 3FZQA 4JEIA 3EDQA 1PV4A 1TNDA 4IIUA 3I9JA 5H3HA 4H7PA 1XCOA 3UT6A 3EZFA 1JQLB 1BCRA 5HJ2A 3BQ9A 4AJ4A 3CZRA 3RQSA 1RQLA 4ONEA 2H92A 4JR1A 1EXVA 3B7GA 3G2NA 3AUAA 4MKGA 3CGGA 4H3SA 3LT5A 4NPAA 1U5AA 3CB4A 2HEIA 4RZXA 4UTNA 3S2UA 1CPYA 5F7JA 4WFKA 4KGXA 3NOXA 5DLYA 1PHPA 1SELA 2GEVA 4GOND 2WU1A 3NT2A 4PAQA 2PWPA 5HW0A 4H7DA 3NBYC 5D5QA 2EFYA 4QJBA 2HSWA 4B45A 5BYJA 3FRIA 1MRZA 4PN7A 4IH1A 4JKOA 3JQ7A 3IAS6 3GUVA 1F2VA 1I7PA 3BZWA 5DVZA 1NSTA 3L02A 4HB4A 4OLJA 3TAXA 4S1NA 3HUEA 1ODSA 4OP2A 2BKLA 2H0AA 1VL0A 3SMVA 5D6NA 4LHVA 5IVIA 4BO0A 1RP7A 1X70A 2QE7A 5AKKA 1XAIA 1HOTA 2BFCB 3D6TB 1EFRA 4KKVA 2H16A 4V0LA 4V2UA 3U3ZA 4CKXA 4J4BA 4AICA 5MDHA 3WL6A 3BERA 4EECA 3AVWA 3L1KA 4NV0A 3ZZ1A 4F04A 4QTXA 2AOUB 3M89A 3RS0A 2O3SA 3JWGA 4BKUA 4YJ2F 4FR0A 1JI0A 2HF9A 2JGIA 1OI2A 1ZO8A 3L7LA 4ND3A 2VDOB 2JGDA 4KCGA 3WGQA 5IYZA 1YC2A 3SF0A 5KAMA 3ESYA 1JQ3A 4GUDA 2PKEA 3CVVA 1IBKB 1BROA 1DEKA 4OXNA 4FBGA 4X64B 4URHA 2I4RA 5FOTA 3QE2A 1H9BA 1JA9A 4P93A 5REQA 2WLSA 2CNWA 2VXCA 3K96A 1PVVA 2A9VA 3A6DA 1JLLA 4G1BA 5JSQA 5A7GA 3CVJA 5BWNA 1I1OA 1UWCA 5TR9A 3H1PA 4RUKA 2NV2B 1NM5A 4LRTB 1WMDA 3D3WB 3MTAA 2YY5A 2R6AA 2F3UA 2C5GA 2VJLA 1UMCB 2OTCA 3ESXA 3MTDA 5ARDA 5BV1A 4DWWA 2QN1A 2BF4A 3IIJA 3UV6A 1Y1QA 4F3KA 3L0IB 3SNHA 1PR1A 3E9ZA 1GQOA 3ZUPA 4CM9A 3VPBA 4BNWA 4EB3A 3CVOA 5LDDC 2D2VA 3A9RA 1E1RA 2FQQA 1P7ZA 3OFJA 4AJOA 3EARA 3CQ9A 1N3LA 1PRYA 2ZQYA 4MITA 1FY2A 2IIBA 2LKDA 3E7FA 2Z1MA 4K6MA 1H9AA 4OXXA 1JEOA 2D4AA 2J59A 1E61A 2FXIA 1R0XA 2XUPA 3ES9A 3EGOA 3QYPA 1OVGA 1PEAA 3OLZA 1RRFA 1EDZA 4JR2A 4WXYB 3AUXA 4JEHA 3WK5A 3A4IA 5LYYA 4CV3A 1TQ8A 4Q3LA 3IE1A 2O8BB 2JGLA 1CEYA 1Q7RA 4L0DA 1SKYE 2CHEA 4I6GA 2LV8A 3D3QA 4WCVA 5GPBA 1RMTA 2ZSFA 5HRCA 2Z8XA 2Q8PA 4D9GA 3G1WA 3K0AA 3MWYW 5IUNC 5JXWA 1TO1E 1XB2A