3H87A

Rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
136
structure length
136
Chain Sequence
TDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Toxin/antitoxin
total genus 49
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 3h87A00
1XO1A 3ORYA 4XGRA 2HWWA 1V8OA 5SV2A 2IHNA 1RXVA 2H1CA 3Q8KA 1RXWA 5HNKA 3ZDCA 2QIPA 4WA8A 3H7IA 5FV7A 1TAUA 5ECYA 1A77A 2LCQA 3ZDAA 3ZD8A 1TFRA 3ZDEA 5H4HA 1O4WA 1MC8A 3ZD9A 3H8SA 5HMLA 3Q8LA 5ECWA 1B43A 2IZOA 3H8WA 3QEAZ 1V8PA 1V96A 3I8OA 5L6LB 3QEBZ 5HMMA 1UT8A 2H1OA 3ZDDA 1UL1X 3DBOB 2MDTA 3ZDBA 1BGXT 3Q8MA 5H4GA 2BSQA 1Y82A 2DOKA 1YE5A 2FE1A 1A76A 2HWXA 5ED0A 1TAQA 5L6MB 2WP8J 3TNDA 1W8IA 3IX7A 4CHGA 4XGQA 3H87A 3H8JA 5ECDA 5HP4A 1UT5A 5K8JB 2HWYA 3QE9Y 1EXNA 4MJ7A 3ZVKA
chains in the Genus database with same CATH superfamily
4N0DA 4D9CA 1U2GA 3ZIAA 5E2BA 2ZIGA 1ANKA 2ENUA 2NYAA 4PFJA 1TVCA 1NNUA 1EGVB 3IQGX 3ACDA 2GVNA 3OM8A 4OUDA 1NN3A 2RGAA 4FGLA 1MABB 1PYDA 3L84A 2VF5X 3CIOA 3ISTA 3B6EA 2BVNA 4JR1A 4YCDA 4MP6A 5LPNA 1YGPA 3GO4A 4UXIA 3TZLA 1DTWB 4LFAB 4FZ3A 1OGIA 1YS9A 3GGOA 1E1QA 4AF8A 1D5WA 4F3CA 2VP0A 3PWKA 1O7JA 4FGJA 5IF3A 1YTLA 4IINA 4DTIA 3U7JA 1XP8A 2IX3A 1CQZA 2Y6VA 3LV8A 4YJHB 5C8YA 5EYPA 4HXEB 3T41A 1RYBA 2FMTA 1TKCA 3AC0A 4BO8A 1PFYA 3I0NA 4Q4HA 3EEFA 3GJ8A 1VCOA 1YZFA 2R79A 3H2HA 4UBOA 3BZWA 1JEAA 5KHOC 4A8TA 3WO0A 4LYEA 4X8LA 2O0HA 5ADVA 2RH8A 1J1UA 3AHDA 4X93A 1SHLA 3F5MA 3KR9A 1ATZA 2F3PA 1Q17A 4ENPA 1UPTA 3F3YA 3QEAZ 1TM1E 4CKXA 5E4JA 3J80A 1IVYA 1LW6E 4GF5A 4Y2GA 4R71A 4RULA 3HDJA 1PJCA 1PZMA 5CA1F 2PYIA 4DA7A 1HNWB 1FX0B 1LLFA 2R1TB 4M8NE 1XNGA 3ZWWA 3S8YA 2CT8A 1UL1X 2PLNA 2GEUA 1WTAA 2AKAB 2XSZA 1IY2A 1RJFA 3F90A 4RF4A 3F7TA 2RAUA 2OHXA 3NRCA 2QN7A 4BE4A 5AKXA 4QNMA 3SG0A 1T43A 1C9MA 3N0VA 3LUBA 2VWHA 1E6LA 2PH5A 4L75A 4P98A 1BE8A 1E6KA 1CUCA 1UFVA 3SHVA 3ZE8A 4EGJA 1BU5A 3MINB 4HN4B 1GGJA 4JP8A 2DLCX 3AM4A 1HDOA 3HA2A 3JR3A 1TK9A 2WF7A 3EXG1 1NPTO 3D4PA 2WU4A 2JIBA 3E84A 4XH9B 5FP0A 5HOEA 5DBHX 4DR3B 3ZH9B 2WZBA 2XBUA 5FLKA 3ONFA 3PR2B 4EITA 2AWNA 2GD2A 2DX7A 4ZC1A 4I1VA 9LDTA 1TFUA 2C04A 3FVQA 1IXYA 2V59A 4ZQCB 4KJZA 2J5XA 2FQYA 4MUIA 1X87A 1D3AA 1T5DX 1V1JA 3LKDA 3GFTA 4MRVA 3HXLA 4CXMA 1PWHA 3AB8A 3RCBA 4FE3A 5KJEA 1NXQA 3N8DA 4G24A 3RC8A 1SBQA 1KZYC 2QRLA 1VLMA 5F1KA 2Q3MA 2AMVA 3QVJA 1KQFA 3I61A 2OY0A 3NP7A 2JRCA 1EJ2A 2ZBVA 3STWA 2Q8QA 1CRWG 2Z56A 3LWNA 4V0LA 3TL2A 3C87A 3I73A 2XZPA 3O94A 3P2EA 1KOFA 5G02A 4MJXA 4OI4A 1QHGA 3NEJA 2PS3A 2GZ2A 3IH5A 3DV0A 3QOWA 5H5JA 4DDHA 4D44A 1ZMRA 2O59A 4I3FA 3EPHA 3I42A 5K01A 1R8JA 1VBNA 4RMGA 4WXEA 4B87A 3ORQA 4C87A 2OO5C 2I2DA 5IRCD 1V5FA 2FSUA 3LX6A 4Y0VA 4CL0A 2IEYA 3QYPA 5I7EA 3OE5A 4IF6A 1IJEA 1FMLA 3LE8A 3ZY3A 2M32A 3DBLB 6Q21A 3BHJA 4KUHA 1NVUQ 1TF5A 3P0RA 1D2HA 1F4VA 3PCXA 4K9OA 3EXHB 1I01A 3G3EA 1YB6A 4G1UC 5JMTA 3WJAA 5BNIA 4HYQA 1XAJA 1X0VA 2PX0A 2CW5A 1XEWY 3IEUA 2QZSA 3ZDEA 2FFQA 4RPLA 4GPBA 3CTMA 1HTTA 2Q0HA 4MPRA 3AFGA 3VZCA 5L7WA 4INJA 4DDKA 1M2NA 2IXFA 2ONZA 3H4TA 1BG6A 3AU8A 3DUFA 1Y1PA 5C2JB 3JZIA 1XEAA 5FPQA 1VB3A 2NO0A 4QOJA 3GFPA 3WHIA 2JGAA 2WJJA 3EW7A 2YS7A 4HNVA 3I64A 4W8GA 2C82A 4BV9A 4CR8A 4TMWA 1FB5A 4MR7A 2HA4A 3INGA 1A5BB 1N3LA 4DV2B 2OD9A 2VSQA 4LDAA 5AK4A 1U0GA 3MT0A 5DKFA 5ALYA 3EVEA 2DUJA 2RBKA 5I01A 3INTA 3RPEA 1C0KA 1HSOA 3CUKA 3TR6A 3U6KA 4KX3A 4PONA 2X7JA 3DVLA 2IZZA 1L4HA 2H1FA 5JXIA 1JP7A 4AK9A 2CJWA 1N2CE 1EA5A 2D5IA 4MWCA 1E2FA 3C8UA 4PRKA 3UTCA 5A4KA 5IABA 3VKGA 2VHQA 2PMWB 4FFBA 2BZ1A 4HLQB 5K20A 1WNTA 4HN9A 1E3TA 4GYKA 2DETA 1PX2A 2WM8A 4EG0A 5BN1A 2GUGA 3SNKA 1YUMA 3HKDB 1SCDA 2FRXA 3IPCA 1VCNA 3RC1A 4BMPB 2WQ7A 3WMRA 4LDRA 3EUWA 3HUEA 1AV6A 2B8WA 3TIIA 1KFBB 2Q2NA 2WVGA 1GGKA 1RYMA 5HTKA 1KZHA 3ZUPA 4XB2A 1JRLA 3ZJUA 3JPYA 3KELA 2PO7A 4BRWA 1X3SA 1R5NA 1KGSA 3L01A 4S1WA 5JNSA 5CTAA 1T2NA 1KY2A 4ENTA 3GBPA 1NM5C 2GZMA 1ULUA 3K7EA 3N3BC 3D7SA 3ZPXA 2YMQA 1FLDA 1FBTA 1VB5A 5C34B 4B6QA 3GPDG 4CM6A 2A14A 1X74A 1JPNA 3EF0A 1XCJA 3C48A 1RCFA 3I83A 4NCJA 5DYYA 3OJXA 3QRWA 3T3HA 4X97A 3NVDA 4EL0A 4ZI2A 3FYHA 1JXMA 1NURA 1ZCZA 2PD6A 2QY6A 5G0VA 1YVUA 3AYZB 1DX9A 3HXPA 4LZWA 1R5JA 3C5HA 1PT8A 4TXMA 3RB8A 4Q66C 2V3WA 5AFSA 2FPMA 3TVYA 4YN3A 5A0VA 5KU1A 4JBLA 5AHRA 5IZ4A 1USVA 5KS2A 1XALA 1T8UA 4TVBA 3PC7A 5HCIA 4JQCA 4H6XA 3MLBA 2O8EB 1Y34E 1WXGA 2CNDA 5EZYA 5LB2A 4YRKA 2CFRA 5C37A 1WXIA 3O92A 4IYRA 2F17A 4RK1A 1MJNA 4GMGA 2AHRA 3M4YA 4H0CA 2XGMA 4F5EA 3EGDB 4COOA 5CT5A 4CEIA 2WQ6A 3ZWNA 3H2YA 2AE1A 1A9XB 3FZGA 1IDN1 4N7RA 3DOJA 3DUWA 3NH6A 2FSHA 3PJDA 1E2KA 4BB9A 3ADPA 1CZHA 5DLPA 1HDRA 3W8EA 4KR9A 2ZWPA 3HBLA 1M2HA 2EATA 2BKXA 2AX4A 1EHYA 2PD3A 3HA5A 4I5EA 5JDIA 2WJZB 4OBXA 1E1KA 4P53A 5ECYA 4RA6B 5CFNA 4WBNB 1XLTC 3LHDA 1W34A 4M89A 1DEXA 3I72A 4E32A 2QA5A 3ICCA 1Y9JA 2X6TA 3GLHB 4HWRA 1BEZA 3A4VA 3BH7A 4G9EA 1VJRA 2OHHA 5JD4A 3X1YA 1H0SA 4FOPA 5JTUA 2J9XB 1JG4A 3DZIA 1U3CA 4GM0A 3D0OA 2GILA 1N25A 4H7JA 5IJWA 3WJ2A 1BCRB 1U81A 1USWA 2JC3A 3U7GA 2ZYDA 1X2BA 1LLQA 3NBXX 1TMYA 1Z5UA 3RUIA 1NAIA 1NRWA 3BEDA 4DRXA 1OI3A 3QMWA 4YCSA 1K6XA 1C3XA 1Z6XA 4ZQGA 4EB3A 2NTEA 1EI9A 4J75A 1G63A 2WFLA 1H9AA 3DEJA 1RSZA 4WMLA 2Y2UA 3VKVA 4HNSA 1JA0A 1FP1D 4M7OA 2EQBA 2F1KA 5B3LA 1JU3A 3NTVA 4YNBA 4C6TA 4JVSB 3HJBA 5CYPA 4L7QA 4D8XA 3C39A 2R7LA 5HQ3A 5DWDA 4NFLA 5F52A 1YZHA 3U9TA 2QAGA 2GKSA 2IPXA 5HWSA 2WWXA 1E4VA 2IT1A 3QW4B 3BXFA 5IT5A 1JQBA 2J3EA 3G2MA 3S81A 2E9SA 2O2HA 4HXGA 1Z3CA 2PTHA 2YXNA 3M6UA 4QXQA 5C1PA 1X13A 1T9DA 1ITZA 4BUZA 4CEHB 4O63O 4WWHA 2GESA 2ZJ1A 4LK3A 2PKEA 2Y05A 3PLAE 1KU6A 2ZJFA 2JCGA 3M1IA 4KFRA 2QTVB 5KVCA 4TMFA 2OCPA 2Q1XA 1DLIA 4HDMA 2NXEA 4L5IA 3RH0A 4JYAB 3HGQA 3LZ6A 4QYXA 3UPDA 3ZNPA 4BXOA 5TT1A 4W82A 3I5YA 4PPQA 1H2RS 2NWQA 2XDQA 2IYUA 3MCUA 5JVDA 1I24A 3G5LA 4XUEA 5K0BA 3KKNA 3GF4A 4H7HA 1FLAA 2C8LA 4XQGA 1XXLA 4BRSA 4XIIA 1XD9A 3LKBA 4OKIA 3CEAA 4QAQA 1OBHA 2C5HA 4O5OA 3OA2A 1DBRA 3PHGA 1M8JA 2B83A 2CUKA 2PWPA 3GOQA 3KB6A 3QMPA 1X7YB 1YAJA 3GU3A 1MJGA 3VISA 1QYXA 2X5OA 2GBGA 1EFAA 1FP4A 4V0RA 3VR4D 2QN2A 2V4ZA 5ADHA 3FNBA 4IP0A 3DE2X 1R6UA 1GTVA 3NYIA 4BBJA 5JALA 4TRNA 1KU0A 1M2VB 3OE7A 5LP1A 2AA3A 2QQ5A 2YRXA 4DBVO 1TJNA 2G80A 4I5GA 1ISJA 3TSZA 3CGWA 2IPLA 4KXMA 5JSKA 3WL8A 4QJ4A 1S8NA 2ZRPA 3VKFA 5BV0A 4S1PA 3DDZX 1TEXA 3PFIA 4MA0A 2OQVA 3NWBA 1QHHB 4M1SA 3UCXA 4X8MA 4UM8B 2EQ5A 1GO2A 1QR6A 2QVCA 4R7TA 3UW1A 3WL5A 1RNLA 4MQUA 2Z4TA 2FKAA 1TJ5A 2G5PA 3KC2A 4L1KA 5F5LA 4AJ1A 3IP5A 3KYDA 5NLLA 1IQ0A 5IJ9B 2QW0X 2XTAA 2H07A 1H5UA 4HZIA 3WQQA 4BQPA 3UH0A 5K3CA 3OM9A 2O8CA 3BMOB 2EG5A 4X54A 4G8DA 4FJ0A 4OU4A 4PAMA 4BQIA 3SVTA 3OTOB 2FWIA 3OTGA 2XRZA 4EYEA 5AVQA 3RBVA 1MC5A 4GS5A 4A2QA 4YR9A 1UADA 2HPVA 5AJUA 1NNSA 2RK4A 2GX6A 3QVOA 3SICE 1KJIA 1WXHA 2IZ6A 2V97A 4G3XA 4JLVA 5E1BA 3WIBA 1E2JA 3R3JA 2GCEA 1JU4A 1TL7C 2W6JD 1OBOA 1WA5A 1CF4A 1W9HA 1X6VA 4CM7A 3KV3O 4D6PA 2ZIVB 3INYA 5BWLA 3L8YA 1H22A 4CEJA 1OE0A 1Z29A 2TMDA 2NUPB 5EHXA 2XUKA 3LVBA 4BZWA 1A3CA 2HU5A 1IQPA 2VZ0A 1MX3A 1C9JA 1H2AS 2CXXA 3FPAA 1E3LA 2OFOA 2ZB2A 3B1ZA 4X63A 2Z8XA 1JPVA 4LI0A 1KSFX 3MRVA 4ZQHA 2RJNA 2EV9A 3CZQA 5D84A 4DRYA 4XLLA 2PJUA 2DR2A 3MXTA 2C2ZA 3UAOA 4C14A 4E4TA 4IQGA 3EMKA 3KEGA 1RZRD 1MDFA 3KXIA 4LI3X 3GBVA 1DQNA 1TF7A 4YV1A 5A7FA 1E7QA 1NBAA 1NXPA 2OHJA 5CLGA 1RRGA 1BRMA 3ICEA 4FXPA 1FSSA 2Q3DA 3ABQB 4LV8B 3HL0A 1A9PA 1I3CA 4ABTA 1FJGB 4CIYA 3AUTA 4WLUA 2X8WA 4H15A 4U6QA 3UC5A 4NMXB 2CUTA 1U9CA 3HQ4O 4NVRA 3PRKE 4TOIA 2OCGA 3DKPA 4GX1A 2QRVB 5IMSA 3NNDA 1MB0A 4JYBA 1NVDA 1W7AA 3N6XA 1RXCA 4TUYF 5E4FA 5DIFA 2YCLA 3OIWA 4UTNA 4P5EA 4OHKA 1K8RA 4QGHA 3L9XA 3D7LA 2NU8A 3H5RA 2AWOA 3UENA 3KVNA 3CMCO 3OZUA 1LNSA 2R3SA 3SHWA 3L4KA 2EJCA 1KP9A 2MMGA 1DEOA 1Y82A 1ODIA 2WJ4A 1XU4A 1YE5A 1JBEA 3QOYA 1AKYA 4YGXB 1A5SB 1RLUA 1NUQA 3CLSC 3NAMA 4P6VF 3T54A 2QT0A 4BP8A 1O9BA 1L1EA 2QGFA 4X85A 1UBUS 4CKZA 2IXGA 2UXDB 5HQJA 5JCOA 3ZE7A 5IXJA 2VHJA 1MZVA 4KQFA 1QGDA 2X4LA 4PSUA 5BSHA 2YV2A 3AR3A 3BTSA 3ZBTA 2JFBA 3FFAA 3IELA 2Q45A 1ODCA 4M55A 5EWJB 4EH1A 4ZJPA 2IK8A 4IWNA 2H4HA 5A5VA 4NZYA 3DP7A 4W4TA 5JRZA 3OQIB 4AY4A 1PR3A 3ILXA 1QC5A 5EHZA 4J0EA 2PLRA 1NC3A 1Z35A 3QMVA 3UXYA 5JUWA 3QE9Y 2OGUA 1IN4A 4ZZIA 3A3NA 4B9EA 3RU9A 2WJAA 3I09A 3KALA 1DO0A 3IUJA 3RAGA 4NYMQ 2G36A 4M98A 4PG5A 3PFNA 5TR9A 4U9HS 2P9CA 3OD1A 1JKXA 4E15A 2SCUA 3WV4A 2VJBA 3GLQA 3U17A 2E1RA 1J7JA 4WY2A 1NQ5A 2DFNA 1WL8A 1RXVA 2G9UA 3IDAA 2ZRQA 4EG4A 2BR3A 2ZJAA 3E23A 1O94D 2OVBA 3COPA 3G82C 4Q24A 1BOOA 1S7GA 3GDOA 1F8YA 3D7NA 2ONJA 3KB2A 3S5JA 1P9NA 1L4EA 1RWWA 3I6YA 3OQMA 4QAJA 3D0KA 4EUFA 4L7VA 3ZVLA 5B7QA 1V3VA 1ZXXA 1AGPA 1JG1A 4LNUA 4HAZA 2J67A 3K0KA 3OIUA 1O8BA 5T41A 2BBTA 5TX7A 5I4IA 3TUZC 2QTTA 3LSTA 2WMDA 3SX4A 2IS1A 4XM0A 3VV3A 1XBTA 2VQSA 1SXJD 1I10A 1L4KA 4ZZ2A 4UFPA 5FTJA 1YR1A 3Q6MA 4EJFA 3GNLA 4N03A 4PZPA 2HBZA 3V6LA 2EG9A 4G4JA 2VQ6A 5KNBD 3SXJA 4X20B 2ID9A 3K0BA 1OI7A 4KVFA 3TTVA 4D8VA 1CUFA 2PJZA 2BCGY 2PR7A 4QU0A 4YRAA 3IPRA 1Z4KA 3AJ8A 4IOMA 2GBIA 4G36A 4JT8A 4Y30A 4DNFA 1M1NA 4Z53A 1UBTS 1GL7A 1F0KA 1QTRA 1XVIA 2E82A 1YA8A 3D3QA 1HYHA 2ZPTX 1HT2E 1O6FA 2I4LA 2P1DA 2CLKB 3K5HA 4U7WA 3VO9A 1TYZA 3RNLA 3L5OA 1N6RA 3DDSA 1NKVA 1DRVA 2HSWA 3AERB 4FDVA 4J07A 4FIDA 2XYQA 5KTSA 1T2EA 3FRIA 3DD1A 1KTVA 2M1XA 3QXHA 4QIHA 2H0AA 2H06A 4ID9A 2B4YA 4GC5A 3GFVA 1IHXA 3EUFA 4KQ1A 2GPYA 4D6XA 1VFPA 2HDOA 2XRFA 3H05A 3RVMA 2HA2A 5BOSB 3H4MA 2PRYA 1FFCA 4J7AA 3SR4A 2HQRA 3T5BA 2XADA 1PL7A 4QTUB 2OYRA 2VPTA 1JHPA 1QIKA 3R8CA 1NIPA 1O2DA 4R2JA 3I2YX 4I08A 5JROA 3W0LB 2ALJA 2YIJA 5HK9A 3BIFA 5TNXA 2VYNA 3PWSA 1ZN8A 1NW9B 2JFZA 1JIJA 1OXKB 5E0KB 3AVWA 1I2BA 3CTPA 1CDDA 2AD5A 4MCIA 2ZFUA 4G07A 5B4TA 2BRUA 5JATA 1HO3A 1BXGA 1XVVA 2XQIA 1P7VA 3FSEA 4RNDB 5F21A 1KQNA 4AFNA 4DIMA 4DNXA 3U61B 4KR2A 4AKSA 5JPCA 4L74A 1E2EA 1XB2A 4F04A 3BF7A 3LBIA 1FYFA 2OHIA 4ITUA 4N65A 2XJ4A 1R00A 4MVJD 2CF6A 4MW0A 1GRRA 4LXYA 4YS6A 4INAA 4PRZA 3QKIA 4MQ5A 2W42A 3PIRA 2COKA 4U2KA 5EERA 4QBIA 4WNCA 2I6QA 4MQLA 3RAEC 2FN3A 3W1WA 3PXXA 5K3SA 3QPDA 2IP1A 3V1YA 3QY0A 3ETJA 4ZALA 1YQWA 1C8KA 1VJ0A 1K97A 3SQNA 3WWEA 1EE9A 4IDQA 4YDRA 3IAM6 4PLZA 4EPRA 3IHKA 1A7AA 3O2SB 1KEKA 2B7CA 1WXFA 3DNFA 3RABA 1JUDA 2R5FA 4F45A 2OA0A 4W5QA 4PNZA 1JIVA 2GTIA 4Z2YA 1PG2A 1A8QA 2R97A 4WNIA 3WJ1A 5G0SA 1E1LA 4BN4A 2DERA 2ACKA 3AZOA 3GA7A 1K7FB 2Y92A 4BEJA 1S0UA 2IBMA 3AXSA 3IPYA 4GM1A 5HIAA 2QM8A 5LQAA 1HPLA 2QLFA 2ZEJA 3TS1A 2L18A 4LX0A 4BNKA 1TT5B 3QVKA 2EERA 2YRFA 5F51A 4D0NA 2FFBA 3DM9B 4Y9DA 1YQGA 5HDQA 3COVA 1CUSA 3KXLA 3BCSA 5EXEA 1B73A 1JR6A 1NP6A 4NYJQ 4GECA 5KTNA 2E6KA 1YC2A 2VBCA 4KI7A 1RJ9B 4YT5A 2R60A 3MTEA 3P27A 2OYSA 1MQ8B 3EPJA 3CX3A 4ENWA 1RLOA 4UE6A 2NXCA 1RPNA 4FFNA 5CX1A 2WT4A 3OTWA 4JR2A 3IDFA 4PO1A 4QTTB 3W5JA 5TY0A 1JGTA 4C5AA 3UXEA 4OH1A 2CNWD 2VJAA 4RMJA 4AZ0B 1CY7A 1PGQA 1WXXA 2MHCA 4KFUA 2QV0A 2IP4A 1E63A 2D4AA 2OV4A 3V46A 4BMVA 3A7EA 1CNFA 1U2DA 1KEZA 2QYTA 2SKEA 4F9EA 3A10A 4GI1A 1CUXA 1EPUA 4YJGB 4MWBA 5LDGA 1T1SA 4MYTA 3RIHA 3ZJ5A 2CC2A 1YFJA 1X8JA 4Z4GA 4E51A 3RFTA 3U0BA 4D25A 1EJ0A 1E4EA 2OTCA 3DQZA 1PP4A 1T2CA 4YXFA 2NVBA 2ZJ8A 1CJSA 3BTOA 4BP9A 3AVUA 4Q4CA 2AEEA 2WAYA 4E1BA 2B2NA 3MCTA 4RGVA 2Z43A 4Q47A 4ESEA 1DDOA 1FDWA 1OU0A 1OW3B 2W2OA 3CLHA 4JT4A 5ADUS 5D51S 1DAPA 1YKFA 4S1OA 1N5RA 1G60A 3WADA 5BVHB 2VF7A 2D1TA 4LXGA 1D2GA 3LDGA 4C30A 1E3MA 1BDBA 3WRXC 5G1PA 2G40A 3OOJA 4I1RA 5BVGA 1CLEA 3HR7A 1JLRA 4JKIA 1EGMB 1K68A 1KQOA 2V4MA 4DTCA 5BYKA 3PGMA 3KU1A 5AICA 1J7KA 3DG9A 1WCWA 1NHGA 2ZR9A 3JD4A 3OFND 2ATCA 3PYXA 3VOSA 4G1MB 5FNVB 2P7IA 2C92A 3DEFA 4R8KA 1V71A 7REQB 1BVYF 4RORA 3WLTA 1K7EB 5FAXA 3RJ9A 1W75A 4C4PA 2OC9A 2VP9A 2GCOA 1IC6A 2J32A 2C42A 4BMZA 3FYUA 2AMJA 2ZSIA 4RD0A 3ROQA 4AZ3B 4MS3A 2ZIFA 4P4GA 3LYAA 4FTWA 3RSLA 3FDXA 5EXSA 4QPCA 4CNBA 4R1OA 2ID8A 2C98A 1IHUA 1DG3A 4Q34A 4LWOA 3ZS8A 1OBFO 3FZNA 3NKLA 2QPAA 4WZAB 2R87A 1GEEA 3S55A 3EOZA 3ESQA 4IIGA 3UVEA 3LSYA 4GO1A 1DC6A 5J2TA 1NT2A 2OLKA 2ODWA 3FCXA 3GZ4A 3HB5X 2Q4TA 2BL4A 2C61A 1WQ3A 4J4HA 1JAHA 5CTJA 4QG3A 2IOHA 3CLUC 1BS2A 3DJFA 1HQDA 1NLFA 2ORIA 1RQXA 4WAUA 3UWOA 3IEIA 3HB0A 3KLOA 2BOVA 1LRJA 1U0BB 2O2SA 2WIGA 4J7XA 4PHCA 2YZ7A 2AR7A 4A8JA 2JLUA 2JCVA 4OY3A 3GJSA 2LCQA 1MXHA 3FTQA 4LOAA 4L76A 2R1VA 3AHCA 4LHWA 3U37A 2IUSA 1XTIA 4HWPA 1UANA 2GJKA 3PX3A 2HCFA 3DOUA 4Q1BA 4LRWA 1I2AA 1PN3A 3KYCA 3FRJA 1T0HB 2YJNA 1S4QA 3AHJA 3PNYA 4B3DA 5BUQA 1CHDA 3MMNA 3KS9A 4XIYA 3C15C 3PHIA 1Z37A 1ORHA 1SOVA 3ONDA 3BKWA 2VWPA 3Q7TA 5LYJA 1QX3A 3L82B 4WV3A 3K1AB 2R66A 4B2IA 3SC2A 3EQ7A 1M10A 4ZRMA 4PIMA 4G5SA 2QW1A 821PA 1OPRA 1AN0A 1EB8A 2VZ9A 2X22A 1PEKE 5DBEX 4KR3A 1XDBA 1PAUA 3TCNA 2XTJA 2XUAA 2QJRA 3OECA 4IDFA 4IV0A 2IGTA 2ODQA 4Y9TA 3VPFA 5B7PA 5M04A 1Z06A 3TG2A 1G8GA 2P5TB 4MULA 3KPWA 4MVYA 4PBRA 5SY4A 3PGVA 4EKYA 4FYMA 1UFKA 3H4VA 5CNIA 5I51A 1NQTA 1PTKA 2Q1WA 3OJLA 4O6VA 2WM9B 1TZBA 3IP9A 1X7WB 3D6HA 4Q02A 5AK6A 2ZRAA 1TC2A 3EQZA 3HDYA 3DHVA 1YR8A 5K4GA 3TLAA 1RM4A 1PT5A 4LY9A 3BMCB 2IIVA 2GWHA 4BNGA 1F0NA 3MBKA 1UP6A 3D2LA 3SN6A 4DJJA 2UVPA 2HXSA 2QZ4A 3EHDA 3TE6A 5CB4A 4KK4A 2I7DA 5LP6A 2ZZNA 2WJGA 4UBKA 3TRKA 3HR4A 5C5DA 1QUEA 3ICPA 1MO2A 1TW2A 3KR1A 4CMCA 3B1FA 5B7NA 1O03A 2EKQA 1PNVA 3TDMA 1PS9A 1GIAA 4M7WA 1BX1A 4B3IA 5I7FA 4RTMA 1MEJA 2GARA 1H85A 4N6OA 1KFKB 2IY8A 4AMUA 4LJ4A 2ZU0C 4CMEA 3NHUA 2XVXA 1GAWA 4JIGA 4P2GA 2R8YA 1FSPA 1HE5A 5A1JA 1UJ5A 1QAMA 4XQ9A 4BWGA 2F3RA 3ELWA 4QZVA 4R6WA 5FWNA 2W0MA 2Q1YA 3G5TA 1Q0RA 1ISSA 3DS8A 1Z4PX 1SUBA 1YWGO 4MW9A 5TQ0B 3DVQX 4RK7A 3IPXA 4Q3KA 4OHZA 5C53B 2F4VB 3O03A 1LDNA 1LVUA 3AF1A 1GV1A 4EHBA 3E3LA 5AW4A 3D8HA 1GQFA 2HC9A 3AP2A 5IN4A 3LP5A 1T0UA 4NOKA 1Z2EA 1RQLA 2PH1A 3HM9A 4HLCA 3OVMA 4EG6A 5D3MB 2RDMA 3OIYA 4FCVA 1MXFA 5EQTA 1O6ZA 1LC3A 3NIGB 4YECA 2G08A 1SBHA 3T5PA 4QQ8A 2BGMA 2NV2B 3AEUB 1QYCA 4P4UA 4XM2A 4DMRA 1I7QB 1OAOC 4BKOA 4HLUA 1WPXA 5B12A 5CG2A 4X1IA 3NVKI 3G79A 4LE2A 1R0YA 3ZZUA 1WHSA 3K0EA 4UHBA 3TQTA 2C2XA 3VDXA 3CLKA 3RFFA 2FJPA 4BNHA 3CQ9A 2Q50A 1QDLB 2OO3A 1RWNA 4EY7A 5F5NA 4Z49A 3ASVA 3EG5A 1E2LA 1SQSA 1G16A 1YQEA 2AYYA 4TWZA 3KHKA 4FOSA 1YIOA 4US1R 3WS7A 5J47A 1DUIA 1OXMA 4UMVA 3TCKA 4CM4B 2AJCA 4UOQA 4G37A 3DAYA 5FUQA 2P6MA 4D9HA 1J25A 1HC7A 2OGTA 3EZXA 4V0QA 3SHFA 3U4HA 4OQFA 1XFDA 5JS6A 4TV8B 2F3UA 2FETA 3HVHA 5HJ7A 4TYWA 1KIAA 2YW2A 4XCQA 4RV9A 3LQQA 2EDCA 2BBOA 3A1VA 5BXYA 1EX1A 3ZLVA 1ZOLA 2ZRGA 3DMYA 5EP2A 1KPGA 1P0CA 3FGOA 1B26A 3O9MA 1K0UA 3D3NA 3MJFA 2W2LA 4AXXA 1VL0A 4EQZA 2PMEA 2ID4A 4X66B 1JKFA 2C4UA 2GFHA 2O1EA 3KZKA 3NZEA 3CRQA 5FTLA 2OFXA 3FOBA 4LSWA 4B5LA 3HA7A 3VR5A 2VUIB 1EFVB 2CVZA 1RM0A 5A4FS 5MGNA 1R0ZA 3I6ZA 4U00A 1LDBA 4DWOA 3MTIA 4OYHA 3GWZA 2Q9UA 3KBBA 4GX0A 4Y3UA 2AN5A 5J9FA 1D6JA 1E3QA 1B7GO 1LSUA 2V6IA 3FCYA 3P26A 4EMUA 2V1UA 1UKCA 5L3SB 2CWDA 3NCTA 4N47A 3CVUA 2ZATA 1Z4QA 2H51A 4X94A 5JD6A 3TI7A 4RKEA 1YJQA 1A7JA 1K3TA 4MI6A 4LXUA 4D3SA 3NM4A 1PT9A 4XX0B 4G5QA 4RKFA 3RF6A 2QI9F 2WHPB 3AF4A 4GLFA 1NBOA 1NLMA 4AUNA 3BD6A 5AMXA 2NU6A 2P77A 3LT2A 2BMAA 3SI7A 2A5LA 4B43A 1N2XA 1MQAA 4DLPA 3O8CA 4KQ2A 2HTFA 2VT7A 2ZB7A 3OUZA 4EKIA 1WNFA 3C43A 3CZAA 4D5GA 4MIEA 4BNUA 4V1CA 4P08A 1FUUA 2QTLA 3FLAA 3ZZ0A 2IUYA 2PANA 4XB1A 1RC1A 1VBKA 3UMJA 4MW1A 4O8CA 1JNXX 4I9UA 3RD5A 3U4CA 1A9RA 1Y81A 4JJIA 5B3JA 1HTWA 1Q1NA 2O7RA 3CX8A 3P2MA 1SQ0A 4YAGA 1XCOA 5J5AA 4Z8XA 5ALNA 1FJ2A 2UV8A 3JQFA 1E69A 1MGPA 1CPYA 1TM4E 3VPGA 3EVNA 1UXHA 2FZ4A 4NPCA 4G84A 4K6OA 4EMTA 4DCGA 2WDPA 3TQHA 4YC7A 3T7CA 1QS0B 3ASUA 1UBJS 2G1AA 1XMPA 2G09A 3IX7A 3AUUA 3FWYA 3H75A 3QTLA 1GZHB 3A6ZA 3EBOA 4Z9XA 5EQJB 2GD1O 3SXUB 2B1JA 4D9FA 4K6CA 5COAA 5AVSA 1ENOA 5FDFA 1EVZA 4O4LF 1WSBA 5FWXB 4RVHA 4N8SA 3HKBB 4COKA 2FPIA 1UJBA 2EAUA 1JHUA 3JYOA 4K9SA 5T3UA 4DCCA 5IBCA 2IGBA 3A4NA 4MEBA 1IUOA 2VDJA 1YOBA 4R8SA 3DYIA 3HJCA 3THSA 1WMEA 1EIWA 5K4HA 1JIQA 3R6GA 1XN1A 4HMQA 4LV6A 1Y1TA 4QU9A 1YO6A 1DKUA 1MAUA 1IZZA 4HNHA 4TSRA 3UAGA 5CDHA 5J63A 4YXWA 5F12A 1V1MA 5E38A 4C4RA 4PTLA 1COWA 3FJOA 4QNRA 1KBOA 3DBIA 5ED4A 1L7DA 2EFHB 3BA6A 1HEIA 3IBFA 3V7FA 3FSRA 3QBTA 4KC0A 2CXTA 3TX6A 1GG8A 4RH3A 2OZLA 2Z1MA 4HAIA 3OETA 3CPEA 2XWJI 4RZ3A 2K87A 4XJVA 5K0ZA 1YJAA 5BMVF 1ZHOA 4HMOA 4IG9A 4RLQA 1W36D 4LRQA 1H8HD 2Q9BA 2I1LA 1NXSA 1NOKA 4QYMA 5GPBA 3LOPA 1PK7A 2HA6A 4FEYA 3SBXA 1G8JA 3W8RA 1JTFA 3ZDQA 1OH8A 4Q9IA 2CVQA 1TQHA 4GRIA 4KQMA 5JY1A 3RJZA 2ODNA 1QRAA 3W7VA 4R0VA 2NU7A 3WNDA 2VUUA 5K5EA 5BSRA 2QE7D 2R7AA 2XQGA 4A3SA 1XA3A 5JSQA 5IMBA 1CSEE 1PGOA 1ABEA 3I32A 4KW7A 5EE0A 2QQFA 5ESRA 2BFPA 4BU1A 4ZAGA 5BSVA 1DPFA 2AQ8A 2FMUA 3GLIE 1JEDA 2GXSA 1Q7EA 3NXKA 1IN7A 3RJMA 2C2HA 1ZESA 3G1WA 3UXMA 1T5SA 2TMGA 1LF0A 2RHTA 4YRIA 1DJMA 1QFJA 2O3JA 4GSLA 3FOZA 3FPJA 5GTDA 2DVMA 3MWJA 3LBHA 4JR0A 3BBLA 4JT2A 2AI3A 2OAP1 4AC9A 5MN4A 1AGRA 2RGEA 3U1BA 4F8EA 1U7HA 5ALJA 3TIVA 3WO1A 4EJ2A 5HUQA 3H13A 2EBWA 2WG2A 4A23A 1ZN9A 2O1SA 2Q5FA 3EXFA 3WP0A 5I4CA 1CJMA 2QM0A 3IVMA 2EKZA 1XYYA 3EBLA 3G2IA 3NEAA 2QTFA 3NTLA 4HKTA 2XYPA 2FSFA 1NBMA 1ZI8A 4GWLA 4NEHB 1J2JA 3BCUA 5EKTA 5BQFA 4MI9A 3KFVA 4PZCA 3R3UA 3WBFA 2FWAA 3MBIA 2CF5A 1F48A 3WLRA 2IXEA 4BBZA 2FPLA 4DKXA 2O3UA 3A2LA 3DO5A 2VDQB 5FYDA 3EMBA 2FEOA 3LPDA 2ZRNA 3E6AA 1D1PA 4B2YA 1K8QA 1GQYA 1BJRE 4HMPA 4QKQA 1SK8A 3H1EA 3E9RA 5I8ZA 5HF5A 2HMVA 1DQRA 4GGOA 4OHMA 3I2GA 1CW2B 3EA5A 1DO8A 3K72B 3N5CA 4LS3A 4JQYA 4OSEA 1NI3A 3CT6A 4C21A 4EP1A 5AW6A 2H08A 1DAGA 4M1EA 3O2QB 1TM2A 1NVKA 1WCYA 5TV2A 2W83A 4JSTA 3GVPA 1M1YB 1MIOB 2ZWAA 4V39A 2Z8YM 2J7PD 3DCJA 5CM8B 4NMLA 5DSTA 4CMIA 2CV0A 3T5CA 1DCKA 4QEKA 1RADA 3QKRA 3W3ZB 3GRYA 5EWLA 1Q7TA 1UT5A 5HR5A 1T34A 1EAYA 4U2GA 1O9HA 4LZLA 2R86A 1AQYA 3F2IA 5TPZA 3I1IA 3TM4A 1Q21A 5G2OA 3CX6A 3U7IA 2FPKA 4BLOA 2X7HA 3DYBA 1EK1A 4DDWA 1YHZA 1UOQA 2GAFA 2W90A 1JDVA 2QG6A 3O3MB 2B4RO 3DBRB 4GPIB 5ENDA 1MQSA 1TAGA 2EHDA 3NDBB 1QU2A 3QU2A 1E9VA 3CZRA 3P45A 4PPFA 1P5JA 4B2LA 3KHUA 1R3DA 2KBFA 1I6MA 1ZQ1A 3W6UA 2YKGA 4FGUA 1A50B 2P6NA 1P0QA 3JVEA 5BWNA 1HDYA 2HRQA 5CT4A 1YR6A 1D4OA 4ZIRA 2RK3A 2JAPA 4J0FA 4K40A 2CBXA 2QX6A 4R1LA 5DYWA 4L27A 3AQ4A 2AF4C 4M6WA 2VAPA 1LPNA 5IT0A 2O19A 2PIDA 2OXIA 2IV3A 5EG5A 4ZCPA 1F5NA 1P1CA 2VCHA 3ZTTA 4OATA 3TH5A 3WNBA 1W4RA 1M0SA 3L1KA 3R7FA 2E4AA 4IIJB 1NVMB 1ZL0A 3LF1A 1QQBA 4PG7A 2HCBA 4Y9UA 4DIKA 5LZ5A 4ZT7A 5GQSA 2CDNA 1WM1A 2PWZA 5DNAA 3HY6A 4KXNA 4MYDA 5B1SA 3W5HA 4NYIR 4UJ5A 4PYIA 5CHYA 4BVGA 1B76A 4KL8S 4AKEA 4BGDA 1MOSA 3A9UA 3RV4A 4GT1A 4RF5A 3WSTA 3I9V6 1NQOA 1V9LA 2DUWA 4HDNA 3VV2A 3HUDA 4BN0A 4FEGA 2RI1A 3Q98A 1Y8QB 3EQ2A 3W79A 3ADOA 3ZG6A 2CE7A 1BWPA 2QRHA 3WBJA 1HLDA 4NBTA 2CD9A 3NO4A 3OP1A 3O5AA 1NVVQ 4P80A 4RU1A 3X1WA 1Z25A 3D6VA 1HG1A 1XDWA 1UC9A 2Q5IA 3CGGA 1EQAA 1JQKA 4PXSA 5DHRA 4MA5A 2D0DA 2GYWA 2OM6A 5CLQA 2Q5QA 1E9EA 1OZ0A 1Y3IA 2QRZA 4MYRA 2Q7DA 4LBZA 4PXYA 2SECE 5JS7A 3CKYA 3D7KA 2I4RA 3DBOB 1BE0A 4HEQA 1XZIA 4B09A 4POOA 13PKA 2I6FA 1H65A 4G01B 3V7WA 1KBQA 3SEAA 3BMNA 3BWCA 1JILA 2QAGC 3B1WA 1X1BA 3WFIA 5CDUA 4ETNA 1T2UA 3WGJA 2LZ0A 1E3DA 1U8ZA 2O2YA 1ZH8A 4OA5A 3DLPX 3B13B 1QO0D 3V97A 5H4GA 1U1DA 4TWIA 3IT3A 1JYEA 5AKEA 1HK7A 3OAAD 2J48A 4BLTA 1EM8A 2H4YA 1U7TA 4HL6A 3C3EA 3LOQA 4G5RA 3BQNB 2RH4A 4LCJA 4ZAFA 3BIWA 3S1LA 4DQDA 1IJFA 3K70C 3GLTA 1N9GA 2C2BA 3ENQA 5CIQA 1G5PA 3V2GA 3QU9A 2CNKA 1YF3A 1SWWA 1P2BA 4S1VA 5BQPA 4ESOA 2H3EA 4QXMA 1TVMA 1NF9A 1S2DA 1LQ2A 1Z4NA 1ZCFA 5JEDA 1BWSA 1X0XA 1ZD2P 2OGWA 4MV9A 1TU4A 3AIIA 1NZFA 4MTCA 4N1AA 4DV0B 1T25A 4L73A 3TJZA 2VTBB 4RJIA 1E77A 3GGJA 3OZAA 3BDVA 1E2HA 2ZP1A 2ZBDA 3H1TA 1YB2A 3KDAA 3HR8A 4L5JA 4V0ME 1TRKA 3T5GA 5KOYA 3W9UA 4JS0A 1L5LA 2IXBA 2WIKA 2YDYA 4K26A 4DE5A 1XQVA 1QGED 1CUVA 1VPLA 5FPHA 5KQRA 2YHIB 1LTHR 4HQ0A 1BYUA 2LCFA 5DN6A 2JZNA 2IZ5A 2KJQA 4NONA 2J4FA 2YWFA 3UK2A 1W1IA 3EG9A 3QI2A 3UTDA 2LDBA 1A1VA 1JSLA 3ABZA 4GRDA 2BDTA 4FQ8A 4N4AA 4PX5A 3PL1A 1W85B 4JASB 4REQB 3U3RA 2AL7A 2QR2A 3R1IA 1DLJA 5F9HA 3EZYA 1WXWA 4ODIA 4L4SA 3EYAA 4WKOA 1DEAA 1YRAA 3SNHA 3BQ9A 4F8JA 3IUBA 2REBA 1ODKA 2PCLA 3EZ9A 4W5NA 4UZEA 1RPTA 4QGAA 3AM3A 1AMNA 4F9TA 4HT3B 4FX2A 3CNEA 4YJHA 4EMBA 3A7DA 1KVTA 3ENNA 2W6QA 5MGBA 1Z2DA 4KYUA 3FMGA 4UEOA 1KDPA 2CNOA 3P2KA 1VJ5A 3JWPA 3F98A 3PENA 3QPUA 3RJ5A 4LYYA 2RHLA 4FDMA 1ZGGA 2NVUB 1T5BA 2XA2A 1FBNA 2OFWA 4TS1A 3RW9A 4ZDJA 2XI4A 2WYWA 3COJA 3Q12A 3P0EA 2R47A 4Q9HA 3A2NA 5BQOA 5CYFA 4HGPA 3IEXA 2IYAA 1DKMA 4J4TA 2XWQA 4CGZA 4D74A 2Y2VA 2X1MA 1R9GA 1SG9A 2JAHA 2Z6VA 3KDPA 4PM4A 2P67A 4R2LA 3A9WA 3LA6A 1CV2A 1JALA 4G5FA 1RWMA 5JZMA 3DOFA 2FG6C 3MOGA 2OESA 3U44A 3LDHA 3PZBA 1EB9A 2GN2A 1E7MA 3ZQ4A 3NORA 5M3BA 1W6UA 2B98A 3QMMA 3FDJA 3P52A 4GX5A 1G6OA 2OWDA 3AB7A 4P8RA 3V1LA 1NI4B 4XVUA 1JHRA 5IBRA 2ZRJA 3KL2A 4OIMA 3MINA 1D1QA 1LWNA 4JJFA 4KBFA 5FO0A 4CL2A 2BH2A 4JBGA 1TD1A 1YDFA 4BNDA 3NAGA 4I3GA 1ZW1A 2FFAA 1NATA 3WE7A 3NPMA 3WNQA 4KXLA 2JLRA 3CVYA 3JQ8B 2ORWA 2X8AA 3PYMA 5AKGA 3VNSA 4M0PA 1GUFA 2NYVA 4ZI7B 4C2TA 4NK5A 1GR1A 1DC5A 2J87A 1LB1B 3WK4A 7ABPA 5IH3A 4D0RA 5ILQA 2MYTA 4O1HA 5LYYA 4R51A 1H6DA 4EEZA 4AG6A 3F97A 3H8JA 4CRWB 4E5YA 4IIJF 1N8KA 1QU3A 3VPDA 1FDTA 3QSGA 2CXPA 2GFIA 3G9ZA 1GZUA 1LI4A 2YY7A 3MPOA 4OJMX 3SJZA 3QY9A 4HVLA 4RTLA 3WAGA 1MFZA 2X0KA 1I7NA 2G82A 5KQMA 4GOOD 4S2UA 4MS1A 1U8UA 4BE9A 1YDEA 3W9YA 4P1ZA 4MWTA 5EVJA 2PWYA 2IJGX 4Y2UA 2LP4Y 1AF7A 2V58A 5DXJA 4D1YA 1IM2A 5EKDA 1AXEA 1GPLA 1VMAA 2FUG6 4DLWA 5ITZA 3TRHA 5IK2D 2XZLA 3NGMA 1ODLA 1E20A 1FTQA 2HQ1A 1JLMA 4J2HA 3KBOA 4CJXA 5HS4A 4UAJA 4TYPA 1VPWA 3ADCA 2M98A 1C14A 3QHQA 2Q7OE 3A9CA 2P8JA 4DY6A 4LBWA 2GPWA 3LUAA 2XECA 2ZM5A 2PL9A 4BLRA 3SYMA 3LUJA 2VEDA 4DPKA 5ICMA 3FOAA 1IG0A 3C7AA 3KKLA 2P3OA 3CZ9A 4Q05A 3V00A 3AUYA 4F38A 3T3NA 3DBLA 2WAOA 3RRZA 2R4UA 4OX9Y 1OOEA 1ORDA 3WNZA 1SG6A 3ZDRA 4DWJA 1JFFB 3EXHA 4DMHA 1N3YA 3EF1A 1KEEB 3VHRA 4BMYA 4EFKA 5EJ4A 4Z4IA 1YASA 3PICA 3BGVA 4RGQA 4DBLE 4QUAA 3BBPA 1PJSA 4C0BA 4DQLA 3QU4A 1Q1QA 4R2HA 4AJEA 1NJGA 4DLRA 2P7HA 4AM8A 5BW4A 4AP9A 2FR1A 2J08A 2XXJA 2PZMA 2ZQYA 3Q7RA 1MJ5A 3EH1A 1S8OA 4ZXPA 1QG6A 1RP1A 2O7VA 3TSOA 1UJMA 1FDVA 3SOPA 3GV0A 3QKUA 1RJGA 3Q7PA 2QN1A 2C5FA 2XQJA 1OWMA 1YI0A 3E3AA 4AY3A 3D1VA 4MJ3A 1UK9A 1HDZA 1XZAA 3STUA 1DC8A 1V3UA 2C9BA 2PGOA 4JLMA 4EUEA 4OHWA 3RS9A 1H0RA 1PQYA 3Q7EA 2BWJA 1RYYA 1XWFA 2IXAA 3BXZA 3ORSA 3U09A 2YVUA 4S04A 5ELXA 4O2LA 3PFFA 5GM2A 3RIYA 2FMKA 3ZXUB 4QJ5A 3UKJA 1ABFA 2VPQA 1RQGA 4ETWA 3M9LA 4FKBA 1GZVA 3MTBA 4GKAA 2P9BA 1ZUHA 2J45A 3FUXA 4OSPA 3FVWA 3C2QA 1GRCA 4V2UA 3HKDA 2DFKB 3D9QX 2CHFA 4TYMA 3DNPA 3EVGA 4RQTA 5THQA 2EZ9A 3GLUA 4HFJA 4WH0A 1FTGA 1P4AA 4V1CI 1WAMA 5DTRA 3SZRA 3THRA 5DRTA 3DLBA 3Q88A 3OOWA 4RVOA 4EB8A 4EFMA 2REQB 1NE2A 1FYWA 4R01A 4CQMB 2QD4A 2Q3HA 2EX4A 2IU6A 4KHZA 3PC4A 2XAUA 1GZ7A 1T9BA 3CWCA 5BRAA 1GXSB 1ZLYA 2IU0A 4DMCA 2VJOA 3GP3A 3ROEA 4YJ2F 4H7IA 1P0IA 2WF6A 3FNEA 2AOTA 3AGQA 4O0MA 3T38A 5FH9A 3IE1A 5F2NA 4M83A 4FYWA 1HUQA 2R8XA 2VXYA 4FYHA 1F9EA 3HEAA 3NTRA 5IC5A 2QM7A 2IYSA 2W0SA 4HX2A 2VXCA 2QV7A 1RHQA 3EVZA 4KE9A 4TPKA 1C8BA 1BKSB 1AUOA 1MR3F 2WR8A 3PX2A 4WCDA 1O89A 3RS2A 1KO1A 1ONNA 1X15A 2UYQA 4MVCA 4A0QA 5CDTA 1P77A 5LIRA 2AG0A 1YVEI 4YRSA 5BR1A 3PJRA 3SBOA 1CEQA 3MAJA 3VVLA 1XZNA 5DLYA 3EGCA 4O2AB 4FT2A 4AP6A 2I29A 1P2DA 3AUJB 3WR5A 4DVJA 1L8OA 2PGLA 3BB4A 2RI0A 2Z2IA 3EGDA 3PF9A 3Q2KA 4FZ5A 2PSSA 3GRUA 4TUYA 2R7MA 2V7UA 4X7MA 1OMOA 4DMKA 3NBZC 4PC6A 1XMSA 1OWNA 3SGLA 3U48A 3DFMA 1G6KA 4W9NA 3U16A 2B21A 1BJTA 1Q3KA 1XZJA 1BMFD 5AW8A 2OBNA 3HH8A 2PZAA 1U9JA 2Z6AA 1HFKA 1AHHA 3KZCA 1ZBQA 5EE3A 3ZLUA 1EYZA 2EF1A 3MCWA 4TMKA 4ATNA 5AM3A 5B58C 5M29A 3MWDB 2YXBA 1E2IA 1OFTA 4WBNA 3GLGE 4E2XA 5IVKA 3N2KB 3GLHA 2WUVA 2HMTA 3CS3A 4PXAA 1CUAA 3G0GA 1E7YA 1WIWA 4JUIA 4OGKA 1Y1QA 1JQ5A 3Q3JB 3M5DA 1W87A 2XW6A 3L06A 4RM3A 4I4LA 4PLTA 2CXQA 1WDKA 3UJ6A 1BCRA 1CF2O 3AR9A 1Q0HA 4FBGA 4MVJF 1GILA 3UK6A 4FFMA 1OXVA 2DWQA 1Y4ZA 2G9ZA 3CW2A 5KX5B 4WXHA 2O54A 3KUDA 2CMFA 4AI6A 1E9DA 2PBFA 2XCQA 1AKMA 4UMFA 3HN7A 5CLJA 1K2VN 4Q9DA 3TLZA 1I4TD 5CIWA 2PMCA 3M6FA 2CFSA 1C1XB 2RKOA 1JF8A 4Y2QA 4ON9A 4TTIA 4DA4A 1SXIA 1V43A 3QH4A 4XJXA 2GSDA 2P27A 3CISA 1XYGA 4ZQEA 4YT4A 4MAFA 3KSAC 1DU4A 3PB3A 2GR9A 1VE1A 2W43A 3L02A 3OU7A 1YULA 1LF5A 1P75A 4FONA 4M54A 4RGYA 2W2VA 5L7YA 1MHTA 4LSGA 5KNCD 1P80A 2FEWB 1NVBA 3GFRA 3T61A 4JJGA 3RR2A 3AIKA 1VLJA 1YCHA 3AXTA 3P5SA 3ITDA 4P4SA 2G1PA 3O93A 1A27A 3GGPA 2XYGA 3GEPA 3ZLBA 3VNQA 2MR6A 1BEUB 1HOTA 1VG0B 2QTVA 2ZIUB 4OQQA 1QYWA 2RJOA 4NTZA 4RANA 5HFJA 1UQUA 4XWTA 1Y3DE 2KE5A 4ZCQA 1XVAA 3PGA1 2UVDA 4KQGA 4XEHA 3Q0IA 1MN6A 4ZPXA 2XKAA 1M6HA 3KYBA 1HT3A 3VRHA 4IHAA 2II6A 4QBGB 4GWKA 1YDHA 3T7DA 3KJIA 3OKFA 4RTOA 2XLCA 2BFFB 2CB9A 3GZNB 4R1TA 5A6SB 4HDSA 4U7JA 5HPYB 2AQIA 4G1BA 4K6HA 3TL6A 2Q07A 3CO0S 3HFSA 4PGGA 1Z12A 4Q1FA 1XU7A 2RGGA 4E5MA 2OQ2A 2G07A 4CV2A 3UANA 1X7YA 2G9RA 5FQOA 5FKJA 1FDUA 2X2FA 3DV9A 4P32A 4WY5A 4MXDA 4R8MA 1YJ8A 3GI1A 3QEOA 4Q9LA 2W00A 3IJEB 1GZ6A 3PEYA 1M2VA 4OFWA 1CS0B 1C0LA 3BD8A 1UJ2A 4UUAA 4R05A 5CEEA 3DTVA 2RSLA 2J6CA 2JH9A 4Z0HO 1NYRA 3CR7A 3OT4A 3V7YA 2JFHA 2VA8A 3OF3A 4QTYA 2X3UA 3DT8A 4JQOA 1TIPA 2VNHA 1DC7A 2C00A 2R00A 2FN7A 2OBFA 2ZZKA 4ZCLA 1QHHA 2H5IA 2J5BA 3HABA 4L02A 2YL2A 3WGMA 4HUTA 5DB4A 1UH5A 3IYLW 1LBSA 3ANTA 4U7FA 2CLLB 1B8VA 1QE0A 3MFQA 3WFJA 4YK7A 5IJ9A 1ZEJA 4KTVE 4X90A 1JH8A 3UHAA 2PQMA 2Q27A 3ANSA 2UZ4A 4HD8A 1P2TA 3BMOA 1LTKA 2V7PA 3AHGA 1KYQA 3UO8B 4LFCB 4DFDA 1ZNQO 1R50A 2EXXA 5I7VA 3I3OA 4B80A 2EARA 3OC6A 3ZDFA 3TRDA 1XTKA 2G9VA 2W6ZA 5L4LA 3C6MA 2V7VA 2GK3A 4GG1A 1QQAA 1Q0UA 4IJUA 1EMDA 2CJPA 3HWX1 5C31A 5DK4A 3WK6A 4MPDA 2HQSA 3R5HA 4A8JC 1C0IA 3FPKA 1W9MA 3ZBPA 4JB8A 3OCVA 2JLSA 4UEKA 5CLHA 1QMGA 1OPXA 2WT9A 1DBIA 2DFLA 1POWA 2NUPA 4NU6A 1IQUA 2AFIB 1Z62A 5EY5B 3ZCTA 3ANMA 1NW7A 1NRXA 2RHRA 1SCUB 3DBHB 3EW9A 1KDRA 2O23A 2YZ2A 3FI9A 1L5FA 4QPDA 4RSMA 3KQOA 5TDHA 4CKCB 3CYFA 1XMOB 3HWRA 1N5LA 1B2RA 2VIIA 5C7LO 4NAHA 1WDWB 2R11A 3F1KA 2ZVQX 2P0YA 4RCYA 4UNSA 3WKDA 4UBIA 2ATXA 3ZWOA 2QTMA 5HQTA 4OA8A 2HK7A 3EGXB 5FL7D 1TKAA 3JD0A 2ZBEA 3PXAA 3P9SA 3WYAA 2JFUA 3HJAA 5LBIA 4OGFA 1CUWA 2FRVA 3T1QA 4FYVA 1AKEA 2IHJA 1TYDE 2NOAA 3FLEA 5LXTF 1UMBA 5CW2A 3UFXA 5KI6A 1XN4A 1WCIB 3AHHA 3I6MA 1TU3A 1H8HA 4QA9A 3VJKA 1J39A 4D96A 2SKDA 4HNQA 4WJZA 1G8PA 1P1BA 5HILA 3U31A 2R8EA 3W2EA 4QUEA 1J4AA 2QRVA 3QUSA 3OUTA 1E2BA 1G3UA 3QUQA 2OR3A 4FOLA 1VKZA 2IH2A 2FZ5A 4DZTA 5KTOA 5CCXA 1FFXB 1FFAA 3JQCA 2ZYTX 2BP7B 2GBLC 4AKTA 1QK3A 2QQEA 4B6GA 4YV2A 4TTAA 2YZKA 2YWCA 3NEYA 1X3LA 1VE5A 1X9HA 3PUIA 4WEQA 3LHKA 5IKXA 3O75A 5LQMA 4Q12A 5ALUA 5KYWB 4LYJA 2YCBA 4YP7A 3S2IA 4N3BA 5A04A 1U3FA 1JI0A 1VBFA 3D7RA 3QVXA 4CHTA 4EIWA 3HSKA 1KZ1A 1CZKA 3E8XA 4I7EA 4K05A 1Z6GA 4TV9B 4I1PA 2MOKA 2WY2D 1CQIA 4OP3A 4RFVA 1B8PA 3DL0A 1A8UA 5EP4A 1ND5A 1T0PA 3OLZA 4FR2A 1XF1A 2YXPX 3NHYA 4ARZB 1UIRA 4J9UE 2Q49A 4IKPA 4CUJA 1GGVA 3BTVA 2CLEB 4LJSA 2E21A 4ZARA 4AYWA 3DAGA 2WKSA 3CSSA 3HEMA 1EFLA 5KBYA 2WWGA 2GAAA 4DMLA 2R6FA 4XWOA 1KEWA 1K4MA 2ZIWB 2WWFA 2HSZA 3BA1A 5KX5F 1PQ4A 4KNYA 3VU9B 4R0MA 3R6TA 1F8XA 4IDCA 4ZYLA 2JPDA 1RIIA 5CFZA 1T1JA 1WS6A 3DFUA 3GR6A 1EDOA 5E0OA 3WBKA 4HSGA 3M3PA 9ABPA 3AY3A 2Q3LA 3BK1A 3TEMA 3CBGA 1E0JA 3EVBA 3VAZA 4YRGA 2XDYA 4LWPA 3X1MA 2UXCB 2YUIA 4IIUA 3QEMB 1HA3A 4OHPA 4K1XA 3VTFA 1K86A 4RJ2A 1PD1A 2HSEA 3Q9UA 1M8PA 1L0BA 1DDGA 1ZVJA 2DB3A 5DI3B 4HLUC 4MUEA 1EK6A 1BS1A 2R6AA 3BDIA 1ZD4A 2C4MA 3G88A 3GPIA 3NHMA 1GPNA 1DBVO 2XNDA 3L9WA 5A4DA 1EGQA 1XDUA 1ZH0A 1ZITA 1E9CA 1TMOA 4R8RA 1JB9A 2BFDB 2MINA 4GOND 4K8OA 1WPRA 2JH3A 4YWHA 2X2EA 3VYWA 2ADOA 1RIFA 3BM5A 1BX0A 4HNGA 5EN4A 4KSCA 1T8RA 3G0HA 3HWWA 3O4JA 3U5TA 3WGVA 2H2HA 3D8BA 2DY1A 2J7PA 3DZCA 3EPKA 4KLCA 1ZUIA 4MVXA 4ND7A 3KWFA 5EHGA 1A4RA 1PJLA 4OBWA 1XTTA 3G9UA 4IIEA 4BTLA 2XUOA 4UTPA 3VNVA 3DF9A 3LO5A 1DJQA 3PWZA 2I6TA 5JNLA 1VGRA 1P3DA 1M2WA 1RKXA 4FYJA 3T4XA 2XTNA 2A94A 3SDSA 3I1JA 3LQ2A 4HH4A 3FWNA 4L5YA 2VJLA 1IXZA 1FEZA 2GBFA 2QENA 3NBKA 3QXCA 4X20A 1ZINA 5DXFA 3NTUA 1X92A 1LH0A 1DV2A 4M9CA 1ZIPA 2Q21A 3ZW7A 4KPGA 4LYHA 4O4HB 5A4JA 1F2DA 3ZKWB 4B6FA 4RVSA 1L4NA 3TOVA 3IDOA 4EGFA 4QPNA 1AB6A 1Y6ZA 3PQCA 3QYFA 1QP4A 2BJVA 3VO8A 4ZZ1A 2AKEA 4NXMB 2OKGA 1MJFA 2C0QA 1CY6A 3PP8A 3OMLA 4MGIR 2BM9A 3D4OA 2YMMA 4J16A 3AERA 3VHXA 4UOZA 3AUKA 3OESA 3OT1A 4DMGA 1MO4A 2CJXA 2FUCA 4RVDA 3JAMA 3PNVA 4WX2B 3A32A 5CXQA 1S3SA 2RC5A 2XTZA 4FX5A 4LRTB 2W6OA 4WGGA 1ONOA 5AH0A 4WFIA 1LNQA 2NG1A 2X8BA 4UM9B 4BFWA 2JLYA 3L0BA 1EZ1A 1JYSA 1B42A 3Q5DA 3QFHA 1FSZA 2P0AA 3QLTA 4DJ5X 1YZNA 2RGYA 3AKYA 5FJIA 3OKPA 1CYEA 3GFBA 1JLHA 2JD0A 1JLLA 3C97A 4IKOA 3VDQA 1X1TA 3ZN2A 3E2IA 4JDPA 5CAEB 1AD2A 4F84A 3LWDA 1NX6A 1GTZA 2F2TA 1DAFA 3KU4A 3A8TA 2HBYA 3KSDO 2FEXA 4CHGA 4I1UA 6AT1A 1DJNA 2HHAA 2I87A 2EFCB 2NADA 3DMGA 1TKRA 2GZHA 2RGBA 3JQFC 3SBEA 4OCZA 4P82A 4L6AA 5BSFA 1JI3A 2UYOA 4YPOA 4UQLA 1QIGA 1MFPA 3T1VA 5K3OA 1Z0FA 2A1IA 2FOXA 3UWKA 2AFHE 5IDWA 4TRRA 3CRVA 5EL0A 1ZMTA 5BO5A 1TKBA 1LC0A 2C5EA 3DZFA 4CF5A 4C4SA 1FA9A 1TQ6A 3WKEA 3ZIDA 3PPWA 4MDFA 3KZOA 2JEYA 2VS1A 2OMEA 4Q9AA 2BGNA 1G55A 4GOLD 3QJYA 3ZZTA 5HGJA 1E0SA 1V37A 4U7GA 4HX5A 3QVSA 2XHZA 2CHQA 5AYVA 1J5PA 1ARZA 3GJ0A 1AV7A 2I1VB 5A3JA 1I13A 2HU7A 4BQSA 1ZJJA 4AZVA 1AURA 3FTEA 5A5FA 3SAJA 5KPDA 4D3YA 2J3LA 2JIMA 4GIBA 4C01A 3QWIA 1KMHA 1VBMA 2FWMX 2PA0A 3NIWA 1PEYA 3CA8A 4RIFA 1GLNA 1B00A 1JG3A 1H0HA 4KUGA 2P9EA 2WG0A 1OYYA 4P3OA 5G53C 3WLIA 5I7OA 3SYKA 3C8DA 3PEVA 3MS7A 1VIYA 1FJXA 4BNTA 1KYIA 2IPNA 2QL6A 4EJSA 4LC9A 1ZM7A 1E5DA 3OTHA 2R6HA 1EJBA 4C05A 1GVHA 4OGWA 5KOJB 4ZYVA 4I50B 2XQKA 2AKYA 3C0KA 3KVVA 4Q3NA 4TMZA 5BY2A 5MDHA 3DZDA 4TVKA 1G2IA 1VCIA 4FOOA 3TW8B 1TT5A 1Z2NX 4B4DA 3A0RB 1GPJA 4JROA 1ULBA 4PZZA 1E1NA 2FMFA 4WZBE 1F17A 5CXSA 4DEXA 2AZTA 5JNTA 1TPZA 1IN6A 4KN9S 3TWOA 5LMNB 1IJKA 1XTQA 3H9EO 3GAFA 1XNRB 1RJ9A 2IZOA 2CLOB 4OLFA 2AZ4A 5EGNA 1KC1A 2VRNA 3DOOA 4Q3EA 2JL1A 3FAZA 1QORA 1Z38A 4KE8A 3PE3A 2YNMA 4CQLB 4CIBA 1Z7EA 1KH1A 1QXSA 3KIPA 3DB2A 1VM6A 3BWDD 4HZGA 4OHRA 4Y2RA 4AZ0A 4CLEA 1WUYA 5AVXA 5JD5A 2FLWA 4IL5A 4B9AA 2XE6A 4MPPA 3WZMA 1JVNA 3F5QA 1G21B 2VYFA 5HOQA 5JWOA 2BZSA 4G9BA 5FBQB 2N42A 1YK0A 2RGCA 3BAZA 4EI2A 2I1WA 4OLJA 1UK8A 1F1BA 1SA0B 4IHJF 4YJGA 2GD0A 2LWIA 2YQ4A 3C3WA 3GEHA 3PE4A 4RHCA 2IH4A 2VLBA 1T91A 4IDOA 5C81A 4EW3A 1X1CA 4G1VA 4I8XA 4NS4A 1RXSA 2ZJBA 4HGZA 1AZTA 2YJ4A 1C7FA 1VSBA 4X3PA 5F78A 3MHPA 1FS4A 3NASA 4O4JB 3UKDA 4B85A 1GL9B 4UHFA 4QASA 4E2FA 1R6VA 5AD1A 4HFNA 3LAWA 3UIEA 3H16A 1PZHA 4HTAA 1RRVA 3GAAA 5FA6A 5FAKA 1JSXA 1MKYA 2RJ3A 2VYVD 3AF0A 1U0NA 1PCXA 2XCOA 3E05A 3MB8A 3C8ZA 4MQ6A 5CH8A 3RHFA 3L93A 3WLNA 4MV1A 1H2FA 3M6VA 4HGNA 4GVPA 5FBRB 3IULA 3HCOA 1W5AA 2E55A 2QUBA 3MFYA 4J29A 4M8SA 2PUEA 1Z9BA 1NJ6A 3HYRA 5JCPA 1ZYUA 4J2TA 2HLHA 1WU8A 3R3HA 3F8TA 2DFVA 5CW1A 3MJTA 3CT4A 5E4YA 5CDGA 1M0TA 4MYUA 5K03A 2QRQA 1MVLA 3QA9A 5AOAA 3ZDXB 2UDPA 2P30A 4OHCA 2J33A 3DC2A 3KPJA 4AKHA 3G2HA 4DANA 1JYFA 1JXOA 3K9CA 3O4GA 4E5KA 1M2JA 5SY9A 7REQA 2W4QA 3WWCA 2IWHA 5JAIA 2QT1A 3TDNA 5DX1A 1NASA 4G1FA 4YTEA 2AMYA 5LBUA 1P1HA 2D59A 2C94A 1IAVA 2AG8A 3D6UA 4AZ3A 1MOZA 4I6EA 3UN1A 4RHFA 1E18A 4WK0B 3ZXSA 4B31A 2XJ9A 4UTZA 4GOKA 2FLVA 2ROQA 3EF3A 1CZRA 4J49A 2BJWA 2ACWA 3HCRA 1WCV1 2WUEA 4NQRA 1ZICA 2XXBA 5IYZF 1UC8A 2NXWA 4MV8A 1ETHA 4EKGA 4WZAA 2CFIA 1OKKA 1XDDA 5ALVA 4UDNA 2GM5A 4P34A 5BRJA 2RK6A 2JGNA 2CZGA 3JQ9C 3VMFA 4ETMA 5BV8A 1IE3A 1TXGA 2HUNA 3FYCA 1N0IA 2CXSA 4OM8A 2QHXA 3X44A 3OEHD 2VDRB 5HNKA 2PUWA 1Q1ZA 2I99A 2W6IA 3CMMA 2V7WA 3V6MA 1OX5A 2WPDD 1HORA 1Y80A 4CIVA 5D1NA 3JVDA 1QLHA 3QQ5A 4JGIA 2X0RA 3JAKB 3P32A 1ZVVA 3IERA 3ETDA 4YRCA 3ZE1B 1SXQA 1C80A 3BG5A 4TXHA 3T1NA 4DM7A 1X7ZB 3DW1X 1G3QA 2NTVA 4BX8A 4L07A 3ZOKA 3VDNB 1E6UA 1XZCA 3ROFA 4LXHA 5ALWA 3JRWA 4HTFB 1G3RA 1JHQA 1JS1X 1T9KA 3DKRA 1N2HA 1R0LA 2XCIA 2B5WA 1Y9AA 3S2EA 2JFGA 3W78A 1KS9A 5MN6A 3HO8A 2GH1A 4LPSA 5ENZA 1G4AE 3TW4A 3WX0A 3K1AA 1NQAO 1XMVA 2JI6A 1FCJA 1SBTA 3MJCA 3OX1A 4FP9A 4I1IA 4CQMD 1C0PA 4NBSA 1NU8A 4HFRA 2YYAA 4LHSA 1YZYA 4KYIB 3ZU2A 4DNOA 2WYVA 1QH0A 3G8BA 3I0ZA 3NW9A 5LJLA 1IN8A 1HM5A 2ZB3A 5DHTA 3ONNA 4GP7A 4W1RA 2IEAA 3IAEA 3N0TA 3VO2A 4H3VA 3C1OA 3FB1A 4RPHA 1SBNE 1SO8A 3S1AB 1ESEA 2X9QA 1YA6A 5BSGA 1C30A 5KWSA 3BWYA 3SEZA 4R40A 3JQPA 1KO7A 1YB1A 4LTMA 4WXYB 3R6DA 4YGYA 4Q4AA 3SXPA 2I78A 1UEIA 4MP3A 3LO8A 3L1VA 4Z1MA 5KKAA 3SF0A 3D6FA 1W48A 3DZ8A 5AJWA 3KT0A 3B70A 3TOXA 2GSWA 4RZHA 5E3IA 3GPBA 1H5QA 1QX4A 1I36A 2Q8NA 4QVKA 1GR0A 3DDHA 1OJ7A 3UFBA 1AS2A 4U1RA 4B34A 2VVTA 1O94C 1ZCBA 3G23A 3HCDA 4UUMA 3HB7A 1X7DA 3WLFA 1M74A 4L22A 3NFYA 2CXUA 4MO2A 4S12A 2JJQA 3G0DA 1TEVA 2GEVA 5CU7A 4ZANA 4N5HX 1YB4A 3PFKA 2IV7A 4GPZA 5KWEA 4QOFA 1YZUA 4TT8A 3ROZA 2BGGA 1SEPA 4RJTA 1THMA 2H4JA 1U1CA 3AEYA 4EY6A 2QUJA 3THYA 2BONA 3KSUA 2R8BA 1U02A 1LPAB 1QIEA 1PR1A 2HHJA 2PZLA 1ORWA 2ZVPX 5REQB 2PXCA 1FLNA 3SKYA 3UMVA 4PHFA 5BURA 4WKBA 3KCNA 1SXJC 3BICA 1RQ2A 3JWHA 1ZMXA 4RLFA 3IIMA 1CIJA 2VATA 3IIJA 5B2EA 3W5AA 5TQ0A 1PJTA 2QMQA 3HDGA 2OGZA 5AW5A 3GQVA 5K09A 5LKAA 2EFYA 3R77A 1Z73A 3E2MA 2JZOA 4PSKA 5FEUA 2C9MA 5ESDA 1DELA 3FXAA 5JJ5A 4YCNA 1BHO1 1WCXA 1T1IA 2JJ1D 3FFWA 4IRMA 4MK4A 4B3JA 4D8TA 2G71A 5D3MA 2F4NA 3C4VA 4BNNA 4BWYA 4LHZA 4TTQA 4D79A 4Q4HB 2JD1A 3HRKA 1PZEA 3UWSA 2DLDA 1ZW6A 2Z04A 1JN0A 2HIMA 3D43A 4GI5A 1CWUA 2PVPA 3RHZA 4QXAA 5B1YA 4WQMA 1AUPA 4PPGA 2H1CA 1YR7A 4NF2A 4EDFA 4B2PA 1KQGA 1RXWA 3MA0A 1FU7A 4UEJA 4OHXA 5GWXA 5K4AA 1Z2OX 1YMUA 1VKOA 4W5OA 1S8FA 2UUOA 5ES3A 3NNNA 1QWSA 2XYVA 4IOJA 3I37X 3FBWA 3ILYA 2IW1A 3Q8WA 4QUBA 2TS1A 4KGZA 1GPDG 4CM4A 4RK6A 3SHTA 3T3DA 2CK3D 4RF3A 2G3YA 5ES4B 1W8DA 4X44A 4O4JF 1LCIA 1JQJC 3E7WA 3FUWA 3P7MA 1KI8A 1ZX1A 2IF0A 4XYBA 4DLKA 1AKUA 1JMKC 2GK6A 2AQKA 2J6BA 5G3ZA 1XTBA 3HHEA 3P0JA 4LY3A 3BSWA 3JTMA 2QF7A 4EF4A 4DR6B 5FLEX 2FGKA 2IU3A 4I6GA 4GOXA 1L3IA 2QMYA 1HT0A 3TLJA 1XYVA 1UJ6A 2I9KA 1OBVA 1TUEA 2F9FA 1CUJA 1U5BB 1Y1RA 3HCEA 4UDYX 3BRWA 3ZYCA 2VRWA 4JNCA 5AVWA 2V6BA 1EFVA 3IKVA 1GPWB 4KIUA 2PDAA 4Y2TA 2JA1A 4Y6OA 1Z7WA 3KT3A 2ATIA 5C3MA 1Z68A 3CKMA 5FPYA 1YVDA 2QG4A 1WZNA 3GPLA 2VNKA 2G83A 1E2QA 3KOUA 1I4DD 1PK9A 5L3SA 2XWPA 4MB0A 2JLQA 2F9MA 2C1ZA 3EJWA 4OHOA 5HIKA 2V54A 4F3YA 4PR3A 2IYWA 1ENPA 4QELA 2V7BA 3ZI4A 1I5OA 4AS1A 1VE7A 2H9IA 4EVIA 2HFJA 1SJ9A 2JIDA 3ZDBA 2W8ZA 3HCCA 4RETA 2EZ4A 3D8RA 4A5OA 2V5VA 4R83A 3KKMA 4D9IA 3VJRA 4KO1S 4RBNA 4KQIA 4FZJA 1KAHA 1KO8A 1CT9A 1O58A 2SICE 1UKZA 3T5MA 4MUNA 4PLFA 2I7TA 4X95A 3DV0B 3LX5A 1S2GA 1P73A 4K9KA 4ZVMA 1GFSA 2WJPA 4QLAA 4RDIA 1UAAA 3QVMA 2DY0A 1WUTA 4DZZA 1MNQA 1Z3IX 1BS9A 1C8VB 4L57A 2H0RA 3GD5A 3KX2A 3CNHA 1CERA 1FFSA 5A9TA 1QS0A 1T4BA 2RG7A 1N36B 1MB3A 5JNRA 5ERXA 3AR4A 1T9GS 4MKXA 5ALIA 3SXUA 3VYSB 1J0XO 4JA0A 4WLOA 1JJVA 4D99A 3ZY5A 4BVBA 1O6CA 1RAAA 2L0XA 1IHYA 4PLYA 4MGKR 3PXDA 1X1AA 4AT1A 5KREA 3FBGA 5FWXA 1XHLA 4NYJR 5TVGA 3HKBA 3PQEA 4KLRA 1YUBA 5F35A 3DPSA 1R27A 4YHBA 1BQEA 4Y2XA 4YYEA 1ZWLA 3ZNNA 3W6OA 1ZD9A 5H8WA 5I4BA 2YV5A 3W4KA 1HE3A 2WHEA 3I4FA 4Q01A 5CFRA 4C0AC 1P0PA 4P58A 1P9LA 4K1LA 1YCFA 1RRKA 4JUFA 1GA4A 3F6YA 1Y5MA 2EW8A 3EVTA 2QIPA 2XKBA 3JYLA 2B1GA 4D4LA 4MV5A 3IBYA 1CDOA 2EQAA 4N9WA 4L78A 4XGKA 4LDNA 4AX4A 1AMOA 4LYAA 4HPJB 4NMMA 1D03A 3CURA 5AOCA 4OYRA 5T6MA 4URHA 4LA4A 4UUNA 1S2OA 2JLVA 2G76A 2GZ1A 3G8CA 2OMKA 3SC3A 5C51B 2FF7A 4LYDA 3BZUA 1SN7A 4EYGA 4ML3A 621PA 1JLKA 1QYRA 3DO8A 2DWCA 3R5FA 3CZPA 3OMWA 4QYTA 1R8SA 1SELA 1CFJA 5L3QA 2CN1A 2GRJA 1Z07A 3FCAA 2EEZA 4L0MA 3HCNA 2BE7A 5JSYA 3TR5A 1XSEA 4BO6A 2I2FA 3GBSA 5K0EA 4OPMA 5F3WB 1NZDA 3EXHC 4BIMA 2W98A 1L4LA 2RIPA 2WSMA 1K92A 2H65A 3SJCA 3A70A 2PRSA 3BXPA 4URFA 4KWIA 1I4EB 3T94A 1Z33A 2DR0A 2NTJA 1OAKA 1FZTA 2FZLA 2RHJA 5AI6A 2JI4A 4HQFA 2G0NA 2ZRFA 3AQIA 4HDKB 1ZISA 2Q2WA 2NV6A 3ZY4A 1HURA 1ZD1A 2H4XA 4NFYA 1E4YA 3GJ7A 1OUMA 2P2GA 1N6IA 1D09A 5ILGA 2PJDA 1TEZA 2H1OA 5CH3A 2V3CC 2XZDA 1AQLA 1LX6A 4W1PA 1VKHA 4QUIA 4QDUA 5J43A 1QAOA 3A1WA 1IBRA 4N8DA 2QLBA 3C45A 4UTXA 3O4IA 5JAMA 4K3VA 4LXQA 4RZUA 4AP5A 1JR3D 2RHWA 4XXHA 3QUAA 4IDHA 3BUSA 3NRJA 4ZEXA 3R7BA 3EBPA 4ALKA 1LBHA 1YVPA 2L19A 4B32A 2K2QB 3B1VA 1J2RA 5EZYB 5HBGA 3U3OA 3A28A 3N9IA 2Y3IA 2O8NA 3LD9A 1J09A 4YAOA 1KZGB 4C0QC 4CEIB 1HY3A 2WHRA 3WDSA 3IQXA 4JI8B 4FLEA 2XMQA 2YY6A 3A1DA 1HX7A 1VG8A 3U7FB 2CJYA 2HSDA 4D46A 1IY9A 2RAPA 4C1BA 1GQOA 5AUQA 3L92A 4I66A 5E4TA 4IMIB 3MGCA 3NONA 3QA3E 4PGMA 1RR6A 3NALA 2J3MA 2WTBA 2XWSA 4L5CA 5DBGA 5HKLA 5H70A 4OHVA 4TT3A 1XRSB 2OG2A 3I8SA 4RPIA 3ZGNA 4ASUD 1W0JA 1J5XA 3EIHA 4JOCA 2CB0A 1IPFA 5I47A 1M1YA 1RWBA 4EHAA 1YOVB 3T3MB 1P8JA 1UJCA 1IAQA 1M6EX 1SVKA 2WJHA 3E4CA 5DF1A 1N2CB 3DL7A 5EPOA 1I4LD 4UULA 4AY6A 5EGSA 5F98A 5IJZA 4ZJYA 1B74A 1OB2A 2GN1A 1T2DA 4P3YA 5AHOA 4N54A 3SJBA 1ZCAA 5AKLA 1B1AA 1NVFA 3HSSA 1Q2UA 1SCQA 3CUVA 4UCFA 4D41A 1NMYA 4KOEC 1QVZA 1Q1BA 3P5BA 1CQWA 4P22A 4P4TA 3CNQS 2WFLB 2CL6X 2P68A 3DBRA 4D0SA 4BBPA 4D0GA 5ISMA 2ERYA 4HQLA 4D4JA 1Y7LA 4YO8A 3HKEB 1Y4UA 2RGNC 2COEA 3V9PA 1B6GA 3BWXA 3SE0A 5HKOA 1STOA 4AF7A 3AEQB 3LW8A 5BV1A 4FHZA 3SZUA 3ZXYA 1OIVA 4OUKX 4LVNA 4JBWA 5K05A 4JEUA 2AN1A 3AJRA 3LQKA 1GN9A 1EEXB 1MG5A 4E88A 5DOVA 2XZTA 2QX9A 4UM9D 3WG9A 4IIJA 2WNIA 4RJLA 3TAHA 4NPHA 5J3JA 1QKIA 1Y0BA 5ARDA 4HDMB 2EYQA 1IZ9A 2F90A 1XA0A 2O2CA 2PG3A 5H02A 5LMUB 2ZBUA 4EX7A 2L2QA 2F43B 2GNAA 5LD2B 3RS3A 4IQFA 3ETGA 5K3DA 2G8NA 2X1VA 4KIFA 4M1TA 2PTGA 4BFYA 3AL0C 1UMCA 5JAPA 1CLUA 1Y8QA 4IXDA 4G0OA 2DFPA 4JYMA 3O8QB 2XCUA 5K2OA 4FMCF 3LCRA 4RXTA 5CIYA 1KMCA 3KQVA 3QELB 2XR1A 2FP3A 5DLDA 3M89A 1A71A 3NBFA 3VHQA 4DIOA 5FBVB 1FP4B 4A8PA 1FDRA 3FGNA 1X8XA 4ZYYA 3E3MA 1ECCA 3KSZO 4LW8A 3TNLA 3VX3A 3HCWA 2C31A 8MHTA 2A9VA 1ECFA 1UC5B 3I5MA 4B47A 1GL6A 4QYSA 4RGBA 4UD6A 5KHLB 3TM5A 4D2IA 4BPBA 2JFFA 3EZFA 5IW8A 4U6NA 3T06B 4KPEC 1TLLA 1V8FA 2HEGA 2QMOA 3F4LA 2YHBA 3VC7A 3VR6D 5A6VA 1EWQA 2H5EA 1JHDA 2Y9PB 2YX1A 1NUPA 1MA0A 1WMAA 3I9KA 4P7KA 5CJPA 5B1EA 4C20A 5J23A 2I8CA 2OFFA 1ZGBA 3TQCA 3VVMA 4LMRA 3RLFA 4AVYA 3K5PA 4BO7A 4HV4A 5K0SA 3A36A 3HZRA 3KYDB 3MM4A 3MTGA 5F77A 3FIUA 3H65A 2PZKA 3KQYA 3FMFA 3HDHA 5ALRA 1Y6JA 3R75A 3ZBQA 1A98A 3M1LA 3TRJA 4ZOQI 1GSOA 1W5FA 2XEDA 3T3GA 3R8FA 1S2MA 2VCYA 1M2OB 2P65A 4BO4A 1O95D 3JSXA 5HG0A 2NQ2C 5DULA 4MUYA 4JL8A 5K1ZA 1M9NA 4AJ2A 3HN6A 3EWNA 4MVJP 3U39A 3JRXA 4UPEA 1SUDA 4Q9NA 4MLDA 5D86A 2VTBA 4IGKA 3BN3A 1BX3A 2AV6A 3F49S 3UQYS 4EVQA 5FORA 1RI4A 3AFIA 1KE1A 2EGGA 1Z39A 2D2VA 4MIKA 4HDOB 3GA5A 2A5DA 1MORA 2IYVA 2Z2JA 4MVJE 5FWDA 5H3HA 5FB3A 1OHHA 5A3VA 4GDMA 4CG2A 1DOZA 3ZGVA 4JB3A 4AJLA 4CT0A 3SC6A 3WOHA 2PRIA 4DN6A 4B3SB 3AP1A 5LLDA 2D1RA 1WV0A 3TZEA 2HYIC 2JJ2A 3OZRA 1NULA 2JGFA 1M6VB 1PZGA 4LRSB 4C4TA 1C2TA 1JWBB 1BXZA 1AKWA 4QDKA 1OGJA 3WXBA 3X0DA 1W1WA 1Y3FE 4QRHA 1FU4A 3DFZA 2JIZD 3R4VA 1U31A 5AJXA 1CP3A 3HFRA 4Q18A 4REQA 3CJQA 2QN8A 3WIEA 1APBA 1GYRA 3UC9A 1YC5A 2DWPA 2Z08A 4GXQA 1SKAA 3K94A 4HWOA 2YV1A 3FOEC 4ENVA 3AEZA 4C88A 5KVAA 3HFGA 4MW4A 2OORA 4LZOA 2IYZA 3ELDA 2HBQA 1N1EA 5JAQA 2J85A 2OVFA 4X91A 1IG3A 4D4GA 3CLUD 5J2UF 2XDWA 4KNWA 4OQDA 2OC4A 1Y48E 4CCYA 1C7EA 2Q29A 2GHTA 3AG5A 4MW7A 4AICA 5GINE 4IXMA 3ESRA 4TL9A 4BMOB 2GA8A 1KOLA 3UOGA 1AKQA 3FAKA 1J0EA 4IVNA 3FHOA 3MHTA 2VAMA 1AZWA 1ESMA 3VC3A 5FIUA 4ZO8A 5EUCA 3OY2A 4WERA 3FPEA 1AT1A 3CUWA 1Q91A 4JP1A 3HMKA 3K8ZA 4YP6A 3TQSA 4EI9A 1S2LA 1PG0A 3C8HA 4LKRA 2NZ2A 3ORHA 4KCGA 16PKA 1A95A 3CJRA 3O1HB 4P31A 1IONA 1H8EA 1RJEA 1PJ2A 2WJ6A 1ORIA 1RM3A 3N07A 1V41E 4RVCA 3RSOA 5CA0F 3TFOA 1E92A 3DEZA 4KDFA 2QVYX 5EJMA 3ONWA 3L4BC 1OLXA 4Q03A 4HVAA 1CJTC 2CL7X 3CRRA 1H2WA 2NYRA 1P0FA 2P3QA 5AKJA 4FB4A 3M4NA 5CNJA 3RADC 2LRHA 3GLVA 3F6RA 4INPA 1LBQA 3ZE9A 2DG2A 4BBAA 4AAYA 4W5TA 3UICA 3QIAA 4LVUA 1T13A 4AN0A 1RCTE 1JA9A 5L7TA 1WPQA 2PAAA 4TL7A 2AG5A 4BFZA 4BX9A 5B4VA 1OI4A 1EFCA 4HQKA 4ZOLF 3DONA 1X42A 4KLNA 3DE4X 1TX4B 3DMNA 1NN1A 4D9BA 1GCUA 3NDIA 3LXMA 1A2BA 2B8TA 3NBUA 5CYOA 1ORVA 2NXJA 3WGOA 1TJYA 1AE1A 4Q7EA 2EIHA 4RD1A 4A6DA 1L7RA 4HG2A 1TT7A 1Y42X 4BO9A 4UVGA 3PFHA 1OWOA 3RK1A 3FB4A 5HP4A 1T8SA 1L4UA 2J4DA 3JU3A 4LNUB 4OL9A 3UMSA 3PNSA 3LPLA 3ZZNA 4BYMA 5IULC 4MJLA 2QTNA 4KWEA 3GVIA 3KM0A 2R6R1 5KMGB 3LGSA 4UBMA 3LOUA 1HLGA 5A5EA 5LQNA 5BN3B 3KP1A 4OXYA 4PYKA 1QHYA 4Y6PA 7MHTA 4L8LA 3KWLA 1JIKA 2K7ZA 5DOZA 3BREA 2HIAA 1KEVA 2FFJA 2HJGA 4J0HA 1D1SA 2JB9A 4KHPB 1M5TA 1BD4A 3U7RA 1M1NB 1NP7A 1LEHA 2INGX 3F2VA 4Z9AA 4WDQA 1NP3A 1ACMA 2ZI5A 4FBLA 5GM1A 1WW2A 3JX9A 4NK4A 3TBFA 3VVBA 4C2AA 1IY1A 1C9NA 4CV0A 1B6SA 4FMDF 2COUA 2OCBA 2GWRA 3KRTA 3L8GA 4JHLA 1E0KA 4A0HA 3RGGA 4B40A 3TOSA 1Q19A 2PX6A 1JFFA 1U0EA 3P19A 1MAHA 4QX6A 3FJ1A 1CQXA 1SVUA 5FI3A 1U2ZA 4ICIA 4BZPA 4QULA 2Q3JA 3D6TB 3HXKA 3L79A 4G4SP 2AJ8A 2WJVA 5GGYA 4OO3A 1VLHA 1EX7A 4U0KA 4WOJA 2YWXA 2B7LA 3ZIAD 5E2AA 3RE1A 4A91A 4EG5A 3EPLA 1RI3A 1WHTB 5AKIA 4TLBA 1FUIA 3ETNA 4LMBA 4KZKA 2O3SA 2G7MC 1MH9A 4YB8A 4TTRA