3H87A

Rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
136
structure length
136
Chain Sequence
TDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Toxin/antitoxin
total genus 49
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 3h87A00
5HNKA 5ECYA 1YE5A 2MDTA 1EXNA 1TFRA 3H8WA 3ZDEA 2HWWA 1UT5A 4XGRA 1XO1A 3ORYA 4CHGA 5H4GA 3H8JA 1W8IA 1V96A 4WA8A 4XGQA 2LCQA 1RXWA 5ECDA 5SV2A 5ECWA 2H1OA 1A77A 1O4WA 3ZDDA 3QEAZ 1TAUA 3IX7A 1UT8A 2QIPA 2BSQA 5K8JB 5HMLA 4MJ7A 3H7IA 1UL1X 3ZDCA 5HP4A 3H8SA 3ZVKA 3ZD9A 2HWYA 1V8OA 3I8OA 3Q8LA 3H87A 2DOKA 1MC8A 1BGXT 3ZD8A 3ZDAA 2IZOA 3DBOB 3Q8KA 5FV7A 1TAQA 3QEBZ 2HWXA 3Q8MA 2IHNA 3QE9Y 1B43A 2WP8J 5L6LB 3ZDBA 2H1CA 5L6MB 1A76A 5HMMA 1Y82A 2FE1A 1RXVA 5ED0A 5H4HA 1V8PA 3TNDA
chains in the Genus database with same CATH superfamily
2DC1A 3EZXA 1T4CA 3VR6H 3TLGB 4A73A 5L53A 4Q9DA 1QCYA 1YA8A 4UCQA 1YIOA 2W2KA 2XRZA 4H6PA 5D01A 1P62B 5B4VA 3AI3A 2JLQA 5ER6A 2QZPA 2XNCA 1VPTA 4GEGA 3CCBA 5B7NA 2MINB 4FYHA 3REQB 4F5DA 1Q92A 2FI1A 1I5RA 3QMWA 1GRQA 3IAFA 3OQ1A 4WADA 1JDBB 1PCXA 2EDAA 4M88A 3OLYA 3EULA 4O59O 4FW8A 1VSUA 3LBYA 1RQXA 4PU0A 3B7GA 3TW4A 3DEIA 1U7ZA 1QYDA 1EX9A 5EE5B 2PS0A 3R8CA 4G0YA 5FOQA 1R0RE 3A3PA 2K87A 3B51X 4XJXA 5EE0A 4PZEA 4Y3UA 1GRVA 1LDMA 5ALFA 2C4KA 1S7GA 1YRLA 3GVPA 2NU9A 4J90A 4B4UA 3PA6A 1JHVA 3WYGA 2V3CC 1U7DA 4LKRA 2PX4A 4NPAA 1IPFA 4G5FA 4JZYA 4LJLA 2VL7A 4ZV9A 4C6TA 2ZQYA 2F8SA 5K0JA 4ZDWA 2R7KA 4NWIA 1KZHA 4I5EA 1EKXA 4L9SA 1E5VA 5K6RA 2PXHA 5BP7A 1Z2AA 1Z8DA 3U9LA 1IUNA 1CJVC 4KXQA 4CR8A 4ZPXA 2ZWIA 1XK6A 2FXVA 3DVSX 1A27A 1Z15A 4TMWA 2RK3A 5BSTA 4EOGA 1LPMA 2VIIA 4FJ1A 4I6JA 2HQRA 1ZI6A 2Z3ZA 3OE4A 3HL4A 1X1BA 2ESRA 2PG3A 1IMOA 1JLSA 2PFSA 4N5MA 5E1MA 3HCFA 3RBXA 4GOMD 1TM2A 1SC3A 2ZRKA 3I6ZA 3L4BC 2J9YB 4CM1A 3PTZA 4M1MA 1OFIA 2AQ8A 3LCCA 4PFSA 4RV4A 2L0XA 2G5GX 1NQXA 2IKQA 4ZYUA 3DEKA 4MQ6A 4Z51A 5HP4A 2J9XB 2G08A 1W59A 2PX0A 5JO0A 4KNYA 3QQPA 3DWGA 2O8FA 4G0QA 2JS7A 3B2QA 3ILVA 4K9RA 1OX4A 2OAEA 3O4IA 4A5OA 4CMBA 4XA8A 3ZLJA 3P4XA 2JFZA 3BT7A 2Y3IA 1U9ZA 3PQ6A 3OQVA 1WD7A 4UPEA 3HBLA 4FCCA 5LU9A 1VHQA 2GO1A 3EODA 3GAFA 2VAWA 3Q8XB 4LDJA 1GD1O 1XAGA 4RW0A 5FI1B 2OHOA 1SH7A 4FLFA 1BS9A 3IAXA 2JFNA 1B73A 2DTXA 3RAPR 4KPYA 3MIIA 4ZREA 3KSAC 2YXLA 3RJ5A 5FF9A 5F1PA 1OLXB 3WYCA 1GU0A 3MMZA 3PE4A 1YSCA 1GKKA 3FNIA 4BC1A 2VPIA 3HJCA 2AK3A 4YHHB 4HGOA 1C7EA 1JLLB 2B2XA 4V0SA 2MU1A 3EA5A 2ID9A 1OBVA 4ZEWA 4DEVA 1Y81A 4GIBA 3DVAA 1NIJA 2NXCA 1KPHA 3EIWA 4WVFA 1E64A 1OBOA 4TSKA 3S7TA 3QV1A 3RTEA 5B53A 4EG6A 1ZG3A 1P6UA 2PSFA 2V6IA 2RGAA 1VJ5A 2GXSA 1MAUA 3JD1A 3KJHA 4R31A 4Y2VA 3ZCQA 5M2QA 3OC0A 5EA2A 3MPUA 1AUXA 5AI6A 2BEWB 1ZAYA 3A25A 4LRXA 1PG0A 2Q6KA 3GU3A 2ZR9A 4MWDA 3FUUA 4WK4B 3A6LA 4BZPA 1CUYA 3TKAA 5CXUA 2BKEA 1XZBA 1E1RA 4RTRA 3CRMA 4RJTA 4B75A 4KH0A 4QWMA 4GOKA 2ZR7A 4U9UA 1SD5A 2P7IA 4Z4GA 3UTDA 4ESVA 5U4XA 1E6UA 3A7EA 4EKNB 4PW0A 2D0IA 3G2IA 1MR3F 3BMQB 3CRW1 4O4HB 3K0CC 2OORA 4KOEC 3RDPA 2YFKA 1WXHA 3TX6A 1BDIA 2D0DA 1SCKA 2CFRA 2GK4A 1PGOA 4MROA 5DHQA 3CSSA 1WMAA 1HOTA 2WIKA 2NO4A 2V9PA 3H1GA 4EGFA 3AY6A 4G65A 3ZTYA 1MDFA 4EHNA 3IBCA 4CV0A 2FWNA 4G1CA 1EFAA 4IGKA 1UMDB 1KO4A 2OKCA 2QW8A 5B6PA 2VAVA 3F7MA 1B16A 4LF8B 1NUQA 4Q39A 1ZGCA 4F4JA 4YV1A 1D4ZA 4QPJC 5KIAA 1FFXB 3MQFA 2C9OA 1FCJA 3AYZB 3PUJA 4JODA 1FFSA 3O4JA 3WISA 1GR0A 2IZ7A 3EXFB 5AM0A 2H4XA 3K2IA 5CM8B 2CXUA 3IMCA 5CEJA 2VHUA 3IR5A 5JAHA 1E89A 1R0WA 3E5RA 4J0KA 3BC1A 2Q6TA 3GDHA 2ZSKA 1EFKA 4QODA 1YB4A 1F9EA 5FIUA 5CAEA 5KYWB 3WJ1A 4Q7QA 2IYQA 3PHHA 3Q2KA 4DBLC 4R9RA 3GLGE 5JU6A 1PNOA 3I1JA 3IQXA 3GGJA 1PD1A 4H4EA 1I80A 2UUPA 3LDHA 3O4VA 4RVOA 1J49A 2Q1YA 1Q74A 3WHKA 4QYIB 1UBEA 1JIUA 2CLDX 4KR0A 3Q7TA 4WBSA 3WX0A 4MDFA 5FTKA 4HR7A 2AMYA 3AEKA 4JLJA 1SUDA 1TOAA 4AYXA 2QTRA 4QUJA 4BB6A 4EL5A 4S12A 3G2QA 1YQDA 5B6JA 3OUZA 5GAJA 1EE9A 3EQ8A 2HSZA 4FC6A 1E8MA 2HBZA 3EDYA 4ZK2A 3THWA 2QE7D 2VDRB 2WSSA 3AILA 2HWYA 4OKSA 4V03A 1W36B 3GELA 3G2JA 2B69A 1CIVA 2M98A 1UBMS 1RWWA 2NUAA 3NTOA 3DLBA 4LIPD 4G1MB 4NBNA 1TEVA 4NBUA 1N6IA 2PRYA 5A3QA 3FDIA 3R23A 5IM4F 2XHZA 3WAJA 3WKDA 4A0GA 1DTSA 1SVNA 4RPKA 3IQHX 3RGGA 3PDHA 1E3IA 2ZJ1A 3DR5A 2WFLB 1W94A 1WO8A 1YA4A 4D4KA 3P96A 3DC2A 4M7RA 1YL6A 3BJIC 1M2OB 1UPUA 1W88B 4DDTA 3B52X 3MUNA 3P19A 1OWMA 2FDCA 1J39A 2E4UA 2XUIA 2HRZA 4YN3A 4L7VA 1JFFB 2Y76A 2RHLA 3ESAA 3DCJA 5FOSA 1XVIA 3DFMA 3IA7A 3DL0A 2V7WA 2XQGA 3KOWA 3K1AA 3TBFA 2GX6A 4BCCA 4K1LA 4PSVA 1W85B 4TROA 1PN3A 1GGVA 3TW8A 3LFHA 2A9VA 3LPCA 3F67A 4L6AA 3BOSA 1VKNA 2MYPA 3F1KA 3PGMA 4JC4A 4INAA 5FWNA 2VPTA 3SQLA 1NJ6A 1VXOA 3IMGA 3GIDA 1PJQA 2LW7A 2DQKA 2Q6LA 4C30A 1T3SA 3D6VA 4Q05A 2V7QA 3FWNA 4FCTA 3QXGA 5BR4A 3FOFC 2IU6A 2Z5GA 3DE4X 5A04A 3V7FA 4IVQA 2B30A 4BAGA 4ARCA 3QKUA 3K0SA 2EWMA 1L4LA 2XQJA 1G55A 3G2HA 2ODNA 1JILA 3BMXA 1JF8A 1BHSA 2REQB 3PC8A 1ML4A 4V0QA 1FLAA 2P4UA 4OI1A 3UWSA 4FT4A 4B6JA 4G26A 1Y9AA 1W2GA 3H0KA 5BYKA 5DYWA 3RYCB 3SC2B 1F5SA 4WV3A 2RG1A 5T6MA 2UV8A 5HCIA 3VR3A 1R5NA 5JAUA 4CT5A 3RS3A 4BV8A 1CQXA 2W2PA 3P4YA 5FH9A 1JJBA 2KLHA 4LF9B 2C58A 1L8XA 2AOTA 4ZOQI 4N49A 3QU9A 4L8LA 4MWOA 1DC5A 3LUPA 4YI5A 2KM1A 4M9CA 5IARA 2VWGA 1JXOA 2QUBA 3NHZA 4JLUA 4WWHA 2XOXA 3WYEA 4E12A 4BPBA 1JFRA 1OOEA 1SXJB 2AHRA 2ZAMA 1TTPB 2XDQB 4FFRA 2MOKA 4G84A 3ZCTA 2RDMA 1IOVA 1C1XA 1IULA 2WSBA 1UXHA 3WKCA 1A2QA 4EZEA 2OV8A 5THXA 4DV1B 4XDHA 1PDVA 1X0VA 4QOGA 3V9PA 4F46A 3HU2A 5LKAA 3KAQA 2IEZA 3PFBA 1Z62A 3MWDB 1E0SA 4H0NA 1E4OA 4DT1A 1D5CA 5C5DA 3D6HA 2FUKA 4YMHA 1SFRA 4W1SA 1YB5A 1JVSA 1KZ6A 1E9CA 3AUFA 1ZJJA 5CEEA 1KDOA 2OOKA 2OGSA 3WLNA 3OEHA 1KK1A 5AK5A 1N1DA 2J7PA 4F5YA 5HUHA 1DRJA 2CWDA 4D9MA 4PWYA 1EE1A 3NONA 3DCYA 2CCKA 3RARA 2WYIA 1ND5A 3LYAA 1A98A 1GZSA 1QHHA 4S1WA 4U6NA 5BSKA 2BHRA 1WD5A 3OIVA 1UWLA 1EGQA 1G18A 1OUMA 1KTVA 1HOXA 4PG5A 5K4AA 2REBA 5JRDS 2R8RA 2PKRA 3VAYA 4QQKA 3CLSD 2F4VB 2PZAA 4KVGA 2IYYA 3EVTA 4K9NA 5DNCA 1TEXA 5E6UB 3MJRA 1GNPA 2B8NA 2FZ4A 2IYXA 3F6RA 3SHWA 3VV3A 3ZD8A 4MV0A 4TL8A 1PS8A 1H2WA 1QRAA 4RC9A 5J3JA 1FYXA 3U9TA 3AHGA 3CUVA 2C94A 1Y1PA 3GQVA 4J9UE 1A8PA 1NNSA 2I1QA 5HCNA 3WLHA 5IEBA 4F72A 4RY9A 3OHMA 3A2KA 1PFKA 3G8AA 4KIFA 2NP7A 2BEVB 2PJDA 1TQ4A 2WFAA 2CY0A 2X40A 1GTRA 3B70A 1K7XB 3SXUB 1WP4A 1JFSA 2I5PO 3L6RA 5KVVA 2W2LD 5KKNB 1VI2A 1HE2A 5EL0A 4EVSA 5GV8A 4Q1FA 4LSWA 4AG6A 1ID1A 4OQ4A 1DKRA 1UMBB 3N70A 3OPYI 2PXCA 5TQ2A 4B4WA 1QU2A 1YCDA 1P2SA 3I5UA 1NA5A 1V8PA 3AR6A 1X70A 4IY1A 4JJFA 2JVIA 4OHOA 1FP4B 3JAKA 4DLUA 2Q7OE 3RNLA 1U0LA 4CF6A 2MJLA 3L4SO 2W6PA 2JFVA 4DLYA 1M34E 4U7TB 1CRPA 2YQ5A 2XWBF 1TKBA 3IBGA 3WK8A 1SOMA 4E31A 4UQPA 5I7EA 1WR8A 1FNNA 1U3WA 1SHTX 5EJ9A 2A86A 4REQA 3UAZA 1R8SA 1KKLA 1LS6A 1AUOA 3IUJA 1T3HA 1DHTA 3EVFA 4MMXB 2P9GA 4XH9B 4BO0A 5FHRA 4E4TA 3RAJA 4K03A 5MFPA 3DEJA 5LM3A 3T9BA 1EFVB 1ZH0A 1YR9A 2RONA 2ODBA 3E23A 2EZUA 5J2UA 1TU4A 1QGUB 4XEHA 2BDUA 3GLFA 2WWWA 3TQRA 1QX4A 4R6XA 3VSBA 1ZS9A 3BMOB 1G7CA 2WSMA 4JYMA 1ZNQO 2HA7A 2YJTD 4RD1A 5YASA 3URKA 3U7HB 3DKIA 1ZH6A 5BWNA 3AF2A 2J3DA 4ZXFA 4FMCB 2B9EA 3MBIA 1QYXA 2V7QD 1ZRMA 3E9EA 3B38A 3JWIA 2PRKA 4X3OA 3VNQA 3JWGA 3C4QA 4UNPA 4DLPA 3FVRA 4RTSA 4JT4A 1DEHA 2H92A 2W2OA 4KE8A 5FLXA 3OLCX 3D4NA 1QIEA 4IRMA 2P5YA 4K9KA 1SBCA 5M5BA 1EGAA 4GDMA 4B32A 1GY8A 4ENUA 1W47A 3FTCA 5DCWA 3ZHXA 2EGGA 5LDHA 4DIDA 3VTFA 3TECE 1I0ZA 1TYDE 2I6GA 1YMUA 4EKEA 1N8TA 3AV3A 3ONNA 4PZDA 3FCYA 3L7IA 3L7DA 3DZCA 4RH0A 4DQDA 4A8JC 3RGWS 5JVDF 2NQ2C 4FOSA 5JAQA 1K8QA 2IE0A 3WGOA 3FOZA 2D13A 5T57A 1R8XA 3I61A 1FVXA 4QJ4A 5SZIA 3ESDA 4BP3A 3OY2A 4CDGA 4YRGA 2WBLC 2Q3DA 3NALA 4KG7A 2H4FA 3TL6A 3ZI0A 1IHPA 3O8DA 4IM7A 4DSTA 1UF9A 2YYAA 3OFNA 3VOTA 5ICGA 4K40A 1UJBA 2IEBA 5JD6A 1D2CA 3S1SA 1QHFA 1XD2B 1AT1A 2ZI9A 4FEAA 3L01A 2JHFA 4XGKA 2F8MA 3JSAA 2WJPA 4QTXA 3TI7A 3F5FA 1ZCJA 1GTMA 1GVNB 4CM5A 5KQRA 4MTCA 2X7HA 1U1CA 1VRVA 2FLKA 5C1PA 1YFJA 1RXIA 3V8MA 4UVIA 2WPNA 2KX7A 3H6HA 3W8NA 1SJ9A 1OPXA 3D3WB 4Q00A 5D1NA 1IM5A 3LT1A 4ZARA 4Q01A 1FFGA 1SVSA 1SVLA 2QJWA 4RIEA 1CNFA 2Y27A 1YUNA 1X1SA 2Y92A 2OBYA 3UGTA 3HA3A 2B5VA 4FJ0A 2QGZA 3H0CA 2X2EA 2EJBA 2GN6A 2H1RA 2NO9A 3KOMA 4PZYA 2X0EA 5IYZA 1QHIA 1Y33E 1BWQA 3OEHD 2J7PD 1SUIA 1F8FA 1RZVA 5CVDA 4G89A 3RJ9A 1IBKB 1WHTB 2DPLA 3C16C 2FEPA 3RH0A 4K9OA 1W8DA 3EW9A 2Z09A 2YH2A 3TTXA 3QKTA 1DC4A 3DPIA 4BO4A 1UM9B 2WE8A 2B1JA 4OP2A 1UWVA 4YROA 5BV2P 2W9XA 3I01A 3M1YA 1UJ5A 5CT6A 4WBNF 1WB4A 5B4UA 4MQBA 5AVXA 1YR6A 2ACKA 3MZ0A 5HILA 2O2CA 3JPYA 4BLOA 4CUJA 1QOQB 2HQ1A 4NZZA 4WXHA 5GADl 2TMKA 2VUTA 1UDWA 2G67A 2GWHA 2ZIVB 3M4JA 3X2EA 3K6SA 4W5HA 1IU9A 4EJ2A 4JXZA 4RE6A 1KVTA 1RKVA 1QSGA 3F46A 1V1JA 4TKUA 4C2AA 2FQQA 3BBLA 4TL7A 4Q4CA 4Z5XA 1SUPA 1MJGM 1J7KA 4FR2A 4MUKA 1IY0A 3IA2A 2UXBB 2JGRA 4OBBA 5I7WA 4P84A 4D6YA 4LV6A 2X7JA 3JD3A 3RS8A 4N7MA 1E1MA 4X95A 2ZUSA 4BZXA 2Z3VA 3QX3A 5JY1A 2C97A 4C4PA 1TJ3A 1OFGA 1OXBB 1SUSA 3GEDA 3OAAD 1TM5E 1KY5A 1LEHA 2OVFA 2Y9MB 2ZYRA 5FHQA 3AQIA 3L1KA 3PR2B 1EFCA 4JOCA 3NEYA 5EOVA 1VIDA 3LQQA 4UCXA 2VAXA 3I34X 4P4SB 4ZJZA 4BQNA 3NGLA 1A82A 3ZDDA 3ZCRA 4ZOEA 2OYSA 4Y9TA 2AOWA 3KVOA 1NW4A 3NWBA 4M0PA 1GDTA 3GLVA 3L4BA 4ZV4A 3ROTA 4F3RA 2J3JA 1N5JA 3RSCA 2P77A 3ANNA 5DRTA 4CG1A 4HWRA 1Z4IA 4X1IB 5AOVA 1QMGA 5JHGB 1BWPA 1UBLS 5LNK6 4RO0A 5IVHA 2YJ5A 1ZMTA 4PBRA 3VZRA 4DSUA 1SCIA 1F0YA 2O06A 4TLEA 1SKYB 4WKBA 2AUTA 4JASB 5KNBH 5G0VA 4CN8A 5IZ4A 1RLTA 4U8GA 4CEIB 4DE5A 1DB3A 1E1CB 1ICEA 3MWLA 4KN5A 1JDUA 2QP4A 3UKJA 4PINA 3EQZA 2OHHA 1XMJA 4WASA 2QTGA 3COSA 2H18A 3H9EO 3UEOA 3ZEIA 4EO9A 2XUKA 1KEKA 3ZGYA 4YP5A 2R84A 2NV0A 3NIWA 4G0VA 1ZR2A 1E4VA 2H7CA 1M8GA 2AYZA 2C2GA 2GESA 4GMFA 4E70A 2VJOA 2OP0A 3OOWA 4EHIA 5LXTA 1Q0UA 4EHAA 1QP8A 1V7CA 4DDHA 5BV0A 4F92B 3W7VA 2DHDA 4P22A 2JKZA 1RI5A 1EBUA 2BFDA 4PFKA 5DBOA 3T1NA 4DXHA 2F1IA 2V5UA 1UFRA 2YY6A 1THGA 3FFTA 5HFNA 4PRZA 4C6SA 4B9AA 5LB2A 3ZQJA 5C5EA 3Q8MA 3VJRA 3W4IA 4HX9A 2UZ0A 5IJWA 3MCVA 4BYMA 4JVSB 4AG3A 1ACJA 1Z68A 2BFAA 3ETEA 4Q7JB 5H68A 7REQA 4XWKA 4V0ME 4K2HA 5CLJA 5FORA 3P1JA 4G01B 2YRWA 4PVDA 1PJBA 4B4OA 3NRBA 5GQSA 3FR8A 1JEJA 2C96A 5HMMA 3UYLA 1LI4A 2PYIA 3HLYA 3I3SR 3LK7A 5JNLA 4O63O 1KBZA 2XRFA 1TTHA 2FE1A 3D31A 1R6VA 1S2MA 3JVDA 3MJ4A 3NBFA 4B34A 1F6DA 5HW0A 2BFWA 4WKPA 1L1EA 4YCJA 4R8LA 1GO2A 1BE8A 3KVRA 4BJ3A 1IPHA 4DSNA 2BWJA 3CF4G 4Y2UA 3UMVA 1Z8HA 3KQSA 2IUUA 1GFWA 4OJYA 5JO9A 3LO8A 3PNLA 2W37A 5TIIA 4X24A 4DM7A 4PAQA 2IUTA 3A6ZA 2ZSAA 5BR7A 5K3AA 1YDMA 5C51B 1ORWA 1JL3A 4JQSA 2H8GA 3WP0A 5ADUS 1JYSA 2FCAA 5H9VA 3K0CA 3ONVA 1EXWA 2E55A 4I9HA 2BM8A 4P2BA 4Q34A 1XF9A 1A4IA 1Z3IX 2H29A 4DZZA 3Q7IA 3K0FA 3EPJA 2X22A 5F9FA 1JX6A 4LZPA 4MRAA 4EKGA 3PYXA 5JZOA 1QX3A 2JAPA 4Q4AA 3CX8A 1Z5GA 4FFBB 4HZUB 4LCBA 4OHFA 2RK6A 3TRFA 4BRZA 4LHSA 1QHEA 2WMYA 1T13A 4KO3S 4XCXA 1O6FA 3L7OA 2YQZA 1TM4E 4TN1A 4FTWA 4U2EA 4PF1A 5EJEA 4QXRA 3C98A 2DHRA 3QYFA 1TT7A 2HMVA 2VA8A 2IPXA 3KWMA 3P71T 4N8SA 1N2HA 4WFKA 3NCHA 4H7HA 2VHQA 4UDOA 2VQFB 4D56A 4P4NA 5IAKA 4R16A 2Z0MA 3JQPA 4PG4A 3PL5A 3PXUA 4MGEA 4UBMA 1BVRA 3KOYA 5AKZA 5EP1A 1MX9A 3K1ZA 3QUTA 4IG9A 1RXEA 3EQ7A 5ETJA 1V41E 5U9CA 1PFQA 3DMPA 4OHPA 4FHCA 3LWNA 2AHOA 4WESA 1M3SA 2H1VA 4FUQA 3QP9A 4RIGA 4ED9A 1ZQ1A 3AUXA 1LLDA 2QSJA 4WCDA 3NTUA 3FTFA 1HG0A 1Q1AA 1XYVA 3QMVA 3UA3A 3LQYA 1H5UA 5EJFA 3OCVA 5HFAA 4G86A 2AZDA 4L08A 5SY9A 1PG5A 3TCKA 3AONB 4D7AA 1S7CA 1OJLA 3I01M 1I4EB 1LCIA 2I54A 2PKQO 2XDAA 1LPAB 4S2EA 1TMGE 4EJMA 4WZBB 4ER6A 1R0BA 3I52A 1IYZA 1XPOA 2YTZA 1Z9BA 3B6EA 1D1TA 5B7QA 1PWHA 1W5FA 1EWRA 3HFJA 3MERA 3UMGA 1KZGB 1UL1X 3WSWA 2CLOB 3HCCA 3KG2A 3LQ1A 5T3UA 3KSUA 1KO1A 4Q5IA 2YWXA 3E9ZA 3HDYA 3P32A 3V5NA 2W42A 1TMOA 4DKJA 1U8YA 2LKDA 3GFSA 1NU6A 3L0IB 4HEQA 1CJBA 2ZSDA 3C24A 4MV1A 1XVVA 1L4UA 1GYRA 2GPYA 2ZIXB 1IZYA 4GUDA 4A15A 2FSFA 2PMKA 3M1IA 3P5BA 1V1RA 1E9EA 1ZKDA 3G82C 3K9HA 4P8RA 3BGVA 8GPBA 5IBCA 1OWLA 1T36B 3LLSA 1K8ZB 2P0YA 3C45A 3EXIB 2B4QA 5CW2A 2IH5A 3E81A 3C6BA 3V6MA 3CINA 3LY7A 4MS4A 4P92A 1XTIA 4I19A 3E05A 4N5NA 1KI6B 2CXXA 3K20A 2PLWA 3NRJA 1C2TA 3OFSA 4IMIB 5EI5A 2YUTA 4J91A 4A8HA 1BA3A 1RC0A 3MCTA 1Z63A 3T7KA 3T5AA 1Z2OX 4LI0A 1UMCA 2Q4EA 4C0JA 2RG7A 1S0UA 2YX1A 3U44A 1Q12A 4FLEA 1FFCA 2PUWA 2X8JB 2F9MA 5A6VA 1FDRA 1N2SA 5FPTA 2VDQB 1BEEA 5F7XA 4V3CA 3RC3A 4ZCMA 4HF7A 5CJJA 3VYRB 4KITB 2F1HA 4ZU3A 3LWDA 5KQMA 5IVIA 3ZTWA 3KK0A 1TB4A 3A4NA 2EF0A 4ZVQA 3ZHQA 4DPLA 1TK2A 4RTOA 4N0QA 5DM0A 3SR0A 1J20A 1GTSA 2R3SA 3U0VA 3Q6MA 1NVGA 4Y9UA 2DR3A 1Y5MA 2Y71A 3P9PA 3OO1A 2RGGA 3N8NA 4PHHA 3AG5A 4NDZA 4KEAA 2C03A 2GD1O 4FXOA 1H94A 3A9CA 4ZQFA 3A8TA 2ZS8A 4P53A 3QOFA 2QTHA 5KPJA 4IMJB 2F1RA 1K4KA 3F47A 4ITUA 2JIRA 3FGOA 2GBFA 2R47A 5JMPA 1EWKA 2PS3A 4FEYA 3LLUA 3IUYA 1AKYA 3GH3A 2AKEA 1HSZA 3KHUA 3PPYA 1A9OA 2H57A 3KJQA 4YHBA 1DS6A 2J3KA 5HXAA 4Q4JB 2ZRNA 3O5AA 1X6VA 3TL3A 2I65A 2COKA 3GMSA 1DWOA 3EVDA 1HDRA 3ZK7A 2REOA 4BAUA 1GA6A 1WCIB 3OEWA 4QYMA 1P1FA 2YYSA 5IC6A 4AWXA 1HL7A 2F3PA 2D8AA 5EJMA 4ZGWA 1KYZA 3QEMB 4KR2A 4OHKA 3NBMA 5ITWA 1Z8FA 3GVIA 4GG1A 2ZRLA 3H2ZA 1R10A 5LJLA 1PT8A 4I5GA 1AKTA 1DRVA 1D5WA 1JLMA 3EXEA 4FEEA 1DAEA 4LVOA 3AXSA 4O3FA 4P2GA 2ZRIA 1RYHA 4QYTA 4TLMB 4AJ2A 4E5PA 1I7QB 4RHUA 4N0MA 4PN7A 2I2DA 1KVUA 1OPRA 1SVUA 1US8B 2BMAA 5LQKA 3HKBA 3PRHA 3O8QB 4WLUA 1T6NA 1MJFA 1SCUA 1T8UA 4MVJI 2FG6C 2IP1A 3BB4A 4UHFA 3ZHCA 4B43A 2W6MA 1RS0A 2V45A 1H2HA 4UUOA 5BXQC 4UFNA 5BRNA 4GLJA 2I78A 3WGKA 3BMCB 1J33A 2OG1A 2EP8A 2OV1A 4R40A 5CB8A 5CG1A 2E4WA 1C9KA 4BWGA 2J3LA 4G5XA 3BRWA 3LE8A 3NAZA 4ZVLA 1VMKA 4KAAA 3USZA 4XIIA 1HFWA 1P3DA 3IELA 2D06A 1SCDA 1FLNA 2AX4A 3P2JA 3RFUA 3DFFA 4WVLA 1TJPB 4J0GA 5ALGA 4B6RA 2E0IA 1OAAA 1P0PA 2XT9A 4YMLA 3JYLA 3WL8A 1XFAA 3CCFA 1D6SA 4PAMA 1JPNA 1ZD5A 7ADHA 1T2VA 5IJ0B 2A1TS 5IMSA 1EFLA 2C78A 3B9BA 1JQJC 4QFCA 3GCXA 2ATXA 2I8LA 4KGZA 2R0QC 5KU7A 1R6TA 4URHA 2C7GA 3NEAA 2V8BA 1T2DA 2H52A 2X3FA 5L7WA 3DAGA 3IXLA 2EJCA 5EJAA 5IASA 4C04A 1BO6A 1OXMA 1TKRA 2VJAA 3I04A 5CPFA 1XZEA 3DBOB 1YDGA 2I80A 3L8DA 4LYFA 2RHJA 2WVAA 5IJ9B 1P74A 1SPXA 3L9XA 4N1AA 1XN1A 1ESCA 2N9UA 2NUPB 2Q5OA 4X85A 2B6HA 4FYVA 3C6QA 3AUUA 4ZYVA 4JJ7A 3CXRA 4RSMA 1Z6PA 1REQA 3WG9A 2ZJYA 4X7RA 3CF2A 1A76A 1Q1NA 3TINA 2VJNA 4LF6B 3KOXA 1X9IA 2G9UA 1K08A 5A6SA 5ITZA 1KRHA 5D5HA 3HR4A 5J2UF 4LVCA 1X42A 2RB4A 2X9QA 3WICA 1WBDA 4HZIA 1NG9A 2ZM6B 4WGFA 1GGNA 4ZVOA 1NAIA 5JCZA 1UKAA 1W7AA 4OHCA 3PICA 4B7XA 5EIXA 2P7HA 4RZIA 3TNYA 5CNIA 3AESA 1L4MA 1WU7A 3UHOA 5B12A 2PMCA 4LXHA 4YMVA 3UT6A 4HC4A 3QI7A 3T1OA 4DJFC 1AGYA 1T10A 5CFOA 4O2BB 1AKUA 2XA2A 3LRTA 1I5EA 3BBPA 1PT6A 2AMLA 4OP1A 4OLJA 1KAMA 3K9FC 5IT4A 2IP4A 3D3EA 3NM6B 4GYYA 3W79A 4DRXB 3NTVA 3P9SA 4BGUA 2QTBA 1Y9DA 3I8SA 1T1RA 1N7GA 1NRWA 1TC1A 1L8LA 4X1YB 3ZWPA 1YRWA 1P1JA 2AKAB 1ZUD1 4F4IA 4HUJA 3Q88A 4XYEA 1IHUA 4DCSA 1WXFA 2X77A 5TMBA 4MW2A 3R5JA 2NVUA 4IGEA 5ALPA 2B9VA 4BTVA 4S1VA 1H4QA 1WCWA 8ABPA 1KAQA 1BWRA 4GRAA 4R1UA 3OEEA 3SIXA 4MV6A 4MLPA 5AI0A 3QLJA 4D45A 4MXDA 2DG2A 2I7TA 4KW7A 4RVGA 1Y6FA 3ACDA 1RIFA 2Y0BA 1SQSA 1VCMA 2CLEB 4MGZR 5KMGA 1L5FA 5HIJA 4JLNA 4LSMA 2QU8A 3GFRA 4D8VA 3QFCA 2EARA 4LPKA 4P33A 4D96A 1RYEA 3ROMA 1S96A 3DOEA 3NFRA 3ZHZA 4D8UA 2ZTMA 3R9IA 5HJ7A 2R11A 2I3BA 1TL7C 1WDWB 3PRJA 4DL9A 4FU0A 3GRYA 2QZSA 1M5UA 3QYAA 1QG0A 4EY5A 3RTDA 5CCDA 3FPLA 1ZBQA 3W8FA 1YIAA 4A8JA 3F9CA 4ARIA 2ZIAA 1UKVY 3MGAA 5IYZF 3STXA 5IFKA 1PK8A 1YC2A 2J9RA 3L3BA 1OH5A 4QICA 4F7WA 2YOFA 4ZC8A 2QD5A 4ZAGA 1F2DA 3KKEA 3EDQA 1J21A 2BFBA 3FAZA 3QHQA 1JEYB 4EJSB 3BH0A 2GF0A 1R9NA 4I08A 4KGDA 3UJNA 3W2TA 4YDSA 5JZBA 4JWTA 2A4KA 3QBJA 3FOAA 4QG7A 3A2NA 4PQEA 5CFMA 3DMDA 3GEPA 3TRDA 3UA4A 2WHPB 5K4GA 4MHTA 4MIOA 5WRFA 2X0JA 5I3CA 3EYAA 2OQVA 2ZSFA 3FDFA 5EG5A 1MB4A 4MUEA 1JZTA 4EA7A 4CEJA 2FF7A 2Q46A 1KY4A 3CRRA 3SC4A 5A03A 1CCWA 1P60A 1QGDA 1KI1A 1EP2B 2WYHA 3L6EA 4CIAA 4G5RA 1PR6A 2OXRA 4KQXA 1ACMA 2P9QA 1PNRA 4GMXA 3QEBZ 3D64A 4Q3OA 2G72A 1WW8A 3WWOA 1K63A 1K97A 2P0AA 1X1DA 2QD2A 4OL0A 4FNMA 2C9MA 2EFYA 3DD1A 3T06B 1DC8A 2JI4A 4NENB 3KR2A 3PXAA 2C4MA 3OZRA 4YJ2B 1SRQA 1GA4A 1ANKA 2OFWA 2QMQA 2QZ9A 1NJ2A 4J0IA 2WHYA 5T3YA 3FCEA 3UV6A 2H9AA 1FX0B 3H0EA 4HNAA 4JLWA 1PV2A 4MV8A 1USWA 2GMWA 2IK8A 3TJRA 1TAHA 1T4CB 4JLSA 3TX2A 5C0OE 1Y63A 1DPGA 1ZJWA 4GXTA 2W2KB 3DKRA 1U2ZA 3JQAD 2I8AA 1SHKA 4EI9A 5KNCA 2B36A 4INJA 1U3TA 4WD3A 5ALDA 2FUEA 2MTBA 1QP4A 2AQKA 2ZJ3A 2AUNA 1B41A 1DJQA 4J07A 4CQLA 3BICA 4D43A 5L40A 3NIGB 4DCGA 2AZMA 1QDUA 3K2BA 3GEEA 5BYBA 3K2EA 2HRBA 1BX1A 2Q2WA 3CSDA 1DARA 1JQKA 1R9JA 2XCIA 3DZKA 3N8GA 3ZWMA 4EI2A 4EIWA 1LF5A 4A2CA 1L5RA 1SBTA 5JMTA 2FRVA 1RD4A 2J59A 2IOFK 3HSYA 3O92A 3EFOA 1U3FA 2GPTA 2H2WA 3CE6A 2H1LA 3MT8A 1ZIPA 1CZKA 4DLLA 3AR9A 1QH0A 3R4CA 1VYVA 2XUFA 1G9XA 5KWEA 1VCOA 4C6TB 3I04M 4OLAA 1EDZA 2NTJA 3A3NA 4I50A 3JYHA 4QQFA 4I4TF 3U3ZA 2PJRA 1GM5A 1E2IA 3O8BA 1ULSA 4WOJA 4C0KA 4IQFA 2O2DA 4G25A 1L4KA 1SGWA 4HBGA 3GCDA 2OYRA 5IANA 5MGNA 3VUEA 4LXIA 4EY4A 4YRSA 1VGVA 3QXHA 2HTEA 5KOHA 3TR6A 4F8EA 1E9SA 1WUHS 2AMFA 2JGKA 2IX3A 4ZXPA 3G23A 4KR9A 4P7FA 1H2YA 3ISJA 4UDNA 3CONA 5DM2A 1SG6A 3ICOA 1F2TA 3AP3A 421PA 1QYIA 2C5HA 5DM4A 1J4AA 2P3OA 3GROA 3QXSA 4P4TA 2A4MA 4I3HA 4P34A 1P4HA 1Q77A 3GDOA 3GFVA 1DKQA 1PL6A 1X9GA 3AM3A 4C03A 5IABA 1K3FA 2ZI6A 3KR0A 1P7YA 4HYEA 1PDOA 4IGFA 1KK3A 2VEOA 5FBLB 3TE6A 2YWRA 4ZO7A 1CG6A 5F64A 3QA3E 3UY4A 4MRNA 4BVHA 2O8FB 1CSEE 5UKDA 2G6TA 1M7GA 1T9BA 2H85A 2UKDA 3INNA 3OJEA 1N9GA 1NPYA 4YRTA 1YUMA 3SY8A 2G70A 3SYMA 4DC9A 4IFIA 3IMFA 1AVTA 1FDSA 1GRRA 1KSGA 1QB8A 3OEED 2N46A 3C1AA 1E7YA 1CUBA 1TCVA 3EBPA 4KIWA 4BNNA 2Y2UA 1WB5A 2VJLA 3K9GA 1Y3AA 4I6GA 5EESA 1B6RA 4AZ3A 4BMPB 4BN4A 4JYPA 3MWYW 4YO7A 5CCEA 4HSEA 4G63A 3T7JA 4E5DA 4YX9A 4CQNA 4B7AA 1K6XA 1CUCA 3DDOA 1BEZA 3IURA 3TXXA 4BECA 1FZQA 1GPBA 1XDDA 1XDBA 3QBDA 3RSOA 4EG1A 3U17A 1RLIA 4UHDA 2C2MA 2O8EA 1Q14A 2J46A 2PE5A 1BTOA 4BQSA 3V42A 5K0NA 3DVAB 4RA6B 3NU1A 3QVOA 3IOYA 3IMKA 3H8VA 3CUTA 5HKAA 5CXXA 2WP8J 2WA2A 5JC8A 2VSYA 3OX2A 5IVDA 1IJBA 2PUVA 4WIAA 1XQVA 2IHUA 2F48A 5JQGA 4CWAA 5FPKA 1T6ZA 1VJTA 3ZWKA 4M21A 2MSKA 5KYTA 2XNJA 1N57A 1R15A 1NW8A 3H99A 4HCJA 1MG0A 2Z9BA 2AYYA 3T7CA 4C89A 4E3ZA 1ZEJA 3TN7A 2I9PA 3O1IC 1YBFA 1ZM7A 1UC5B 3F4BA 1Z38A 1Z6XA 5HM6A 4JYAB 2G63A 1QFXA 3UAWA 4ISBA 5EHXA 2I29A 2R48A 1H4TA 3WGIA 2H48A 2HKIA 3N3BC 1V8DA 5JD5A 1DKPA 4XM2A 4X64B 4H17A 2Q1TA 4DR1B 5LFAA 5EN4A 3UJPA 1GG8A 2Q41A 1I5OA 1HEYA 1U8FO 4M1OA 3EISA 4Q9HA 4UEQA 2HPVA 2GK6A 3N7AA 5FUQA 4DR6B 3BERA 4IV0A 1S01A 3QA9A 3W5UA 1JH9A 2P9EA 1ENYA 2E1RA 2YWGA 3AZOA 4BLTA 3EF1A 3IUBA 5GP1A 4W1RA 4MUMA 1U7UA 4MP3A 1XZFA 5SY6A 2WD9A 4O5AA 5HGXA 4XVHA 4J0EA 5JY6A 3BF7A 2DBZA 4X1KB 4O2AF 2R87A 5DIZA 2HN9A 5KNCD 4JFAA 1BOFA 1CKEA 3B9PA 4UNIA 4ZT7A 4TV9A 4V0RA 1T6YA 1X87A 4CLHA 5CAEB 3ITDA 1MXHA 3JYNA 3Q41A 4IF6A 4S2UA 3WOVA 4HN4B 1KQ3A 5CDSA 3COWA 1B76A 1DXOA 3GLSA 4TV8A 3UB2A 1M1UA 1PJLA 1TQ8A 4ZAXA 5F77A 3RW9A 4QYXA 3R3HA 3EA4A 2I4OA 5JCPA 1H6CA 1WVGA 3I42A 3M6VA 3M6FA 2CSUA 3ROEA 2Q5EA 2YHIA 4QUAA 3ZE0B 1DCFA 3JVVA 4QZVA 2CK3A 2P9FA 1FTNA 4RVFA 1V0JA 3AEKB 2EJUA 3PNMA 3ZKWA 2I33A 4LQLA 3P0JA 5TGDA 1MGOA 1FUIA 3BA1A 4CR7A 5DGTA 4UTNA 4BC0A 5J43A 3A4IA 3THWB 4S35A 3HGQA 5DGIA 1Y42X 2HMAA 3FD8A 3JAWA 2QXUA 2HEGA 3UKDA 5LMNB 4XIFA 1N78A 5LP6C 4BN5A 2HA2A 1NLMA 5EIOA 4DWOA 1Z4PX 3CNOA 2NUAB 3KYIB 3KEMA 2O1EA 4YAWA 3WGYA 2AJDA 4JITA 2PRZA 2PVSA 2FR1A 2WT9A 4I4IA 1P9RA 5TMDA 3UMFA 3EASA 4A2PA 3K3PA 4MPRA 3II6X 1E79A 3I9NA 2EGUA 2JFGA 2PA3A 1CY8A 3HB9A 4PWZA 1QF7A 4NESA 2GJSA 1W0KA 2OCKA 2X0IA 2XKAA 3IIKA 4OXQA 2DVMA 3TMYA 2HY7A 2PQMA 1P3JA 4IJKA 4ZZ1A 4B81A 2CT8A 5FJJA 1Z3CA 3GGSA 4YRIA 1NN5A 3ANTA 3UPUA 1E7WA 1GKLA 2VDPB 3C4VA 4PC3A 4GE0A 4M8NE 2ZTUA 1FUUA 1K6IA 2IY7A 3EQ2A 2GF9A 2G28A 2JKVA 4H1TA 4MS3A 3K1AB 5G02A 3KPUA 4EPRA 5DTRA 2NLOA 2X4GA 3TW8B 1VQ1A 2E4XA 2FSIA 4L4SA 4DAOA 4RZ3A 2Y2VA 4L2IB 1GU1A 3KELA 3VRHA 4MJLA 4LY3A 3INRA 3VR4H 4XYLA 4LJRA 2V7VA 1ESDA 1NF9A 2C7BA 4UKDA 1EM8A 1OU4A 5H5JA 1C1YA 1WPGA 4ZEXA 1JEDA 5TT1A 3WDSA 1IEQA 2DSTA 2X9GA 4GAEA 4IOJA 4G0WA 1JHZA 5CUQA 2WRZA 1MIHA 1XZGA 3IJPA 3P9KA 4KP7A 4LOJA 4RPIA 2DFNA 5ESWA 3ZN2A 1JMYA 2E5LB 4KLNA 4IAOA 4AURA 2C5EA 2ZBGA 3GY0A 1QE3A 4B4KA 2PJZA 4EMSA 1DTWB 1N7IA 1DQRA 5K7SA 2WDZA 3LNTA 3QWIA 4I36A 1RWVA 3L40A 2BZ1A 2CLMB 2G5PA 2IHJA 1E69A 2PPLA 4PFJA 4E4RA 4FNGA 2OBXA 2Y68A 4IFEA 2WT4A 1CNEA 1B4DA 3KALA 3X2SA 3NTQA 4BBAA 2AOTB 1ZL2A 2A9QA 5KTNA 2XOKA 1Q7GA 1U2DC 1ZN8A 3RYIA 1J5EB 1T0BA 4DYHA 1ZZEA 4BO2A 5E95A 3TSOA 2RJ3A 3MRXA 1GZ3A 2C3PA 1CUXA 1T8WA 1A9PA 1UPCA 4IQGA 5JW6A 1CD5A 1JWBB 2REXB 5JALA 3IDAA 3PEFA 2ZWPA 4INOA 3H5VA 1LZLA 3KXIA 4R2KA 4J0QA 1YAJA 4IIHA 1YZUA 3RG2A 4I8XA 3RG8A 3Q9LA 3MWKA 3ZOKA 3ZV3A 2O7RA 1YWGO 2B1GA 2V0NA 2PCJA 4DT1B 5BN3B 5L9AA 1F8XA 3E4DA 4TLLB 4K87A 1X8KA 1YBVA 3N0RA 2AF3C 4ZO6A 4KMMA 1CJUC 2I2FA 1L8QA 4DWVA 1GNRA 5A5FA 5K2MA 4M0KA 1AA9A 3TBKA 3D8HA 3TXYA 2HO5A 4DR3B 1PFUA 2VO1A 1BMQA 1FYEA 4PPFA 2J0SA 1XD9A 2UYGA 4E2XA 3DC7A 1EJBA 1JBQA 1QHHB 3P9RA 1PT5A 1DC6A 2CVHA 3WB2A 1SKQA 2GDJA 2Q4RA 2QI9F 5BSUA 2QSUA 5I48A 5CCXA 2Z1DA 1YS9A 1KZ9A 4O4JF 1U9IC 3OX4A 3KLPX 1P2UA 3ZCVA 3ILSA 1Q1QA 3T3EA 5HRAA 3C6XA 1IEXA 3JQEA 1NIPA 3K72B 4B6QA 4N7RA 1Y4ZA 5JJCA 5GGXA 2FMXA 4BQQA 2QBYA 4K0KB 1PVVA 3ELDA 1C80A 5G2OA 1XTTA 1XAJA 4ZYXA 3SM9A 4NCJA 5JYDA 2Z2JA 1H3FA 3EAGA 2JZNA 3ZLTA 2ZIZA 1P6XA 2QRVA 4TYYA 1E7SA 3IIEA 3ENKA 4IUBS 4MR8A 1P4SA 3EDRA 5FFFA 3WL7A 3R3YA 2DHQA 1RI2A 3U4GA 4KQMA 1T8SA 4MO9A 3Q12A 3ZNPA 3EIUA 2YBEA 3SHQA 4D79A 1QZUA 1W0JA 4F8YA 1JG4A 3ZEAA 2ZJBA 2DKOA 3L49A 3MN1A 4AMBA 2BAGA 4B6GA 1XALA 5DI9A 4B4DA 2O2HA 2F1KA 5E1DA 2FJPA 1Z34A 3EJ6A 3I72A 1QCCA 5IAEA 1JR2A 3ME5A 2G4CA 2Q2QA 5GONA 3W3AH 4CLOA 5TQ2B 3NHBA 4BLUA 4UZFA 2HIAA 2PT6A 4KDCA 4BIIA 2CNLA 2DUUA 4TVKA 3V4SA 3ZJ5A 3ZCPA 1EFHA 3JAKB 4B45A 5ALJA 2JLUA 1DAKA 1B2LA 1J22A 1HO3A 1QAQA 1L7XA 2R1ZA 3OSUA 4L75A 3I0NA 3UT0A 4IRXA 3VGPA 1QH1B 3HUFA 1Z4OA 2ZT8A 4ZO8A 1H2AS 2C3MA 2VSFA 1VLZA 3DT6A 4IW3B 4OXKA 3SKXA 2ADFA 2OV2A 3FDJA 2JFUA 1PR0A 2DFTA 2VP4A 4DCNA 5DLDA 1W0KD 4IJ6A 1U4OA 1DXQA 2P4SA 4REQB 2X3UA 4D74A 1BN6A 2I6XA 4LJYA 1NV8A 1QCZA 2E37A 1NURA 2VSQA 4FDTA 1KE2A 3M2PA 4Q18A 3IJRA 4R9UC 4FVTA 4RY8A 2YXBA 4HQKA 2WV9A 4OJNA 1FUKA 2EZ4A 1TW3A 2B2NA 1YK1A 1ORTA 2EBUA 3MT0A 5AK0A 5J2UB 3WWYA 5TSDA 2QUHA 3TDKA 1NKVA 5E4FA 3GLFB 3TKLA 2WPDA 4DV2B 2BHTA 1W96A 3PPXA 3U37A 1EVJA 5KTRA 4LK2A 3S7ZA 1CR4A 3Q3JB 3AJEA 1G16A 5JCOC 4UDYX 5CDYA 2PR7A 1U6KA 3MJEA 4I8DA 1VXRA 4B85A 2A5GA 4JI3B 9LDTA 3WWCA 4ZODA 3B3JA 2R6JA 2IS4A 3CHYA 3IIIA 4LCEA 5FUVA 2DRIA 1ZJ6A 4PXAA 4FNOA 5ECGC 1SXQA 3NDBB 4DQVA 2QSYA 3DXZA 5HS4A 4WE3A 1Q3KA 4NZMA 1IWBB 5D86A 1CY4A 2PH1A 1JFLA 1NT4A 1SD1A 4YH1A 4FZRA 2LDBA 1WXIA 1SQ6A 4FI3F 3NBXX 1XEFA 3V8QA 4CM8A 3NHWA 3U09A 2BGMA 3MT7A 1B15A 5K0EA 1I2MA 1SURA 1U8XX 1SA0A 2GHIA 2XEDA 2XMQA 3U1BA 3Q2IA 1DIAA 4AX8A 1PBNA 2IPLA 5I4BA 2IEGA 3KWJA 1M2VA 3V4ZA 2XOKD 3MJHA 5GPBA 2ZYGA 4F5EA 2X76A 1U5BA 2VS1A 4LXXA 1TIKA 1ZM4A 3P9IA 1YVUA 1FU8A 3PITA 1BHJA 1L7NA 2WJIA 2ZXEA 3Q7SA 1JR3E 3A06A 1AQ6A 2D5LA 3E70C 3K09C 3OIUA 4IDAA 3LBNA 4DLBA 1RBMA 3UWMA 2JD0A 3ONFA 2OGWA 4OAPA 3Q0EA 1P0MA 4KQEA 2WP0A 3N07A 1EYZA 3GRRA 1DUIA 1ZD8A 4QHTA 1OC2A 3O9VA 4RHYA 2D7JA 2WTEA 3FDXA 3R09A 4GYWA 1GUFA 5JD3A 5AOBA 3QG5A 3A1VA 1C3OA 1S2GA 1Z6QA 4KOAA 2OXCA 2GCNA 1ES9A 2BMJA 2GK3A 3FRHA 5ALOA 3AM4A 4R7TA 5CLGA 3TVDA 5F5LA 1KTIA 1IB6A 1PUIA 5KTTA 3AL3A 4U02A 2O5CA 3T7EA 4F9FA 5FFNA 5IYZB 2AS0A 4A27A 1UPBA 5I4KA 1PK7A 2V7XA 3W9YA 2Q3HA 2QLJA 1XRLA 2W8BA 1ZQ9A 3G5MA 4TTIA 4XSGA 3WSTA 4KMSA 3BCHA 4F96A 3F6SA 2I76A 3PDJA 3LVBA 1RQ2A 5M7EA 3QNUA 3AHIA 3EHDA 2GN2A 5DT2A 2J31A 2M32A 4M1EA 1O95C 1NBEA 3DDNA 1OIVA 3IAAA 3VSCA 4YRMA 4KXXA 2XIQA 4ALLA 1P2TA 4JYBA 1X8XA 4GS5A 1MQSA 3LY9A 4Y6LA 5MN4A 2IEAA 4YRPA 3SZUA 1AUQA 1PQWA 2FQYA 1CLUA 1YMQA 2AFIE 2FDXA 3FRJA 3KP1A 3AKCA 5EIFA 4KQHA 2GN4A 4FKMA 4GZLA 3I2FA 1R88A 1U0FA 2OE2A 2YV5A 2Z98A 3SAJA 3DHNA 3GMDA 3KKMA 1H1TA 1PRYA 3IAS1 5CA1A 2GJ8A 3K6SB 2MYNA 3ICCA 4OXRA 4UBOA 4WQMA 2NSHA 4QJBA 1O2DA 1VCHA 1VYTA 4LWOA 4NV1A 1UP4A 1MH1A 4ND3A 4TKUB 1CZLA 3EC7A 4GGMX 4H7DA 4JBXA 1D3AA 3NQ41 1PJRA 3MLBA 4HO1X 2ADMA 2QRPA 3MLAA 1Q0LA 1EGMB 1W0JD 2ZS9A 4Q9NA 1YZNA 1H2ZA 4HVAA 1DG1G 3H9CA 3D3KA 1EXNA 3IBTA 4ZI7F 2JGLA 1XE3A 4KHZA 2ZSEA 4E22A 1WKBA 4BN0A 3ZHBA 1VDZA 4O33A 4RETA 3LDUA 2NQTA 1YVEI 3ZJYA 5E7QA 3F6CA 4E1AA 4D9HA 1JAIA 1AZTA 4UUBA 3DAYA 3GNSA 3X1XA 2YVKA 2XLBA 2NTVA 4PSDA 2GEKA 5CIYA 1J2EA 2X4LA 5A9SA 5A71A 1KJNA 3M6LA 4B46A 1CPYA 4G9EA 3ZHTA 3H8JA 2ZUTA 2I4NA 3N0WA 2NU6A 5AHKA 1XU4A 4II2A 3TKYA 3WK4A 3OQOA 1XCMA 5D3KA 2CNKA 1P1HA 1BH6A 1E7RA 2MMGA 3QFRA 4QXAA 5NLLA 2FOIA 3TOCA 1LLUA 1VRWA 3RRYA 1XJQA 2Q9AA 5I9TA 4NMXB 1DBIA 4CL3A 1MG5A 4AIRA 1SVIA 1LVHA 4HWTA 2HCFA 3IUPA 4PNPA 5AVOA 1E96A 4H27A 2DQZA 4RXUA 1RR6A 5ALIA 3T8YA 2H3HA 5HM8A 1EUYA 1RBZA 5ITSA 5EWLA 3IMEA 2CLLB 1H42A 3LUBA 5FBRB 3STHA 1H5QA 1DLJA 4NONA 2VPWA 1K0FA 3L7NA 2WPDD 3OBIA 4WEQA 3V8RA 4EG7A 2HU8A 3LX4A 2BIFA 1KARA 2PO5A 1ZCZA 4J1NA 3L8YA 1LFAA 5EWMA 4Q66C 3RB8A 2OVBA 3DP9A 2ORVA 3OOEA 4NHEA 5TRTA 5LXTB 2GBCA 4PZLA 1DKNA 2VWQA 1BRTA 1NXXA 3LOQA 2CXTA 3RC1A 2BFDB 4OXNA 1U1DA 4PZCA 4DMCA 3WKAA 2LV8A 2VZEA 3ZWAA 4UXHA 2X23A 3I9V1 3RRNA 4C43A 1VKJA 1CS0A 4KODA 5B1YA 1GL9B 1VSVA 2OZPA 2PLAA 2IY8A 4G24A 4I5FA 3UANA 1PU2A 3WGNA 3IPYA 3U60B 4PCUA 1H2XA 4HP8A 1J8YF 4JNCA 4HH3C 4KAFA 3K1TA 3RRFA 3W78A 4BV2A 5A7HA 3TPFA 1XT6A 2CHUA 1XNJA 2B1QA 1I3KA 4LDNA 4M54A 4ERNA 4CIYA 5AHOA 1OREA 1TUBB 1GQQA 4JIGA 2FMUA 2G04A 3BILA 4C3OB 3X1JA 4F4UA 4X90A 1U99A 3D7KA 3UXMA 1UQTA 3QPAA 1GG9A 3KE8A 2BLLA 4F85A 2R5FA 4PXSA 1U0SY 2Z2XA 5KNDA 3QJ5A 1IJKA 2CYAA 1EESA 5BSFA 1HFEL 1OXKB 3K0AB 4DUZB 4YEDA 2DCUA 4P54A 2CHFA 3GRVA 1QM5A 4HPJB 2LXNA 4OQDA 4XJSA 1OWPA 5F52A 3LKBA 3KD3A 2VXOA 3RT1A 4D4IA 1J2YA 4FSXA 4GOJA 4Z9FA 1B8UA 2FLVA 3C87A 1H3NA 1JSCA 3GQBB 5B30A 1II9A 4GP6A 1WXWA 3FF1A 2YVUA 4MTLA 3UMMA 4Q4DA 5H59A 4W7IA 4U2GA 3NYRA 4L28A 4Z4HA 4JYCA 4YB8A 1TYZA 3A9VA 2IYAA 4TV8F 3GW8A 4EVIA 2IIQA 1AURA 1B8NA 2YXNA 3N5CA 2MMCA 4IWNA 1XDGA 4LHYA 1X7XA 3U81A 4Q4AB 4BX9A 2IF2A 2XOEA 3ER9A 1ELOA 4HH4A 2D7DA 1RHUA 3KO8A 3ORQA 2RD2A 1C41A 3QNMA 1KEEA 3GNTA 1J2JA 1NASA 1ZHFA 4DMRA 1KDVA 5HKOA 3FH0A 1J70A 2BFFA 5JEDA 1LQ2A 4OJMX 1FXWF 3QOWA 4Q3BA 4C4AA 2QLMA 3PPWA 1O94C 2J3QA 3VISA 2WG0A 3R6LA 2YRXA 2HH9A 2HYIC 1T91A 1SN7A 2QGNA 3ZGXA 1BCSA 3MWJA 4LKOA 4UU1A 2YYZA 1RRKA 3CNEA 3TSYA 3VTKA 1T1IA 1Q7TA 2B8WA 2CHGA 1K5PA 2C82A 3AF5A 3ID6C 1GPJA 4R51A 1RQLA 3BHNA 5DHAA 2J48A 4WESB 3BIWA 4Z0TA 5HKBA 1XVTA 4B2IA 2ZEJA 4BY9E 5AVWA 5AOAA 1T43A 2B8JA 2AC2A 3IR6A 2ERXA 5DLPA 3RHZA 5ICSA 4UEKA 4YRRA 4N0EA 2RHWA 1NFFA 3B5IA 1K2WA 3MSXA 4FEGA 5JS7A 1N34B 1PI3A 4I4LA 3N9IA 4EMBA 3ANSA 1PGNA 5TC4A 1IUPA 1YOVA 1H0SA 5FPYA 3ZUGA 1L6IA 1ZK4A 2F2TA 2ZJ5A 5G3YA 4BWFB 1LC3A 1G7SA 1TLTA 3RQSA 4S24A 5IJAA 3H2KA 2QPOA 1FDVA 1T2NA 3PX2A 4I1OA 1CQPA 4A7PA 7YASA 5LP6A 1FFBA 2OK7A 3GLIA 1Z6ZA 1L5ZA 2ZJ0A 4M1TA 4WK6A 3O8RA 1CF2O 2YV4A 1KYTA 2I3ZA 2GPWA 4JT8A 2RKWA 3NUGA 4AZ0A 3BEDA 3E7XA 2BR5A 2WZCA 4JL6A 5F51A 1NJGA 1YRQA 1V1RB 2WIFA 4ZEVA 1EZZA 1GYPA 4ND2A 3KXLA 2JI8A 1FTQA 5JH7A 2XQIA 1DX6A 5T41A 3AP2A 5EP2A 2VBCA 4URYR 3F90A 5FT9A 1WUIS 1Z07A 2FG7C 4M6WA 3CW8X 4JMPA 2HM7A 1WY7A 3LYUA 4XOUA 4NABA 1UMCB 3V8PA 3MJDA 3EWSA 1MBZA 2C0QA 3LZCA 3U44B 2J3MA 1QHXA 5I7VA 3EOZA 3LKZA 2I1LA 3BTOA 2P75A 1NKTA 5LSAA 5JZ9A 2AWOA 4KTTE 4CF3A 2B5WA 1YDFA 2XTJA 4RLHA 3LAWA 1D04A 1HYHA 2QAGC 3LJKA 4OHBA 3N7TA 3SF0A 5IVKA 2EQBA 2PS1A 2QAJA 4Q4HA 4WOKA 4QL3A 1BD4A 4L02A 3UJDA 5JPCA 2VTEA 4Q47A 5HX7A 1MC4A 2H1HA 2EZ9A 4GLOA 4MITA 4DDMA 1CJCA 2IOHA 1RRCA 4PO1A 1YR8A 4L5CA 2O14A 2XRMA 4AKIA 2X14A 2BGTA 2H08A 4HYTA 1U4SA 2FFQA 3INGA 4LZLA 2O19A 1PW5A 821PA 4GQAA 5IBRA 4YV7A 3TNFA 1O5IA 2XAUA 1XDSA 1N2JA 2V6JA 3QK7A 2ZYSA 4PC2A 2NUTA 1I4DD 4UNRA 1FUEA 2GUWA 3I8XA 4QQNA 1PKEA 4M0DA 3TNDA 1ABBA 3EEQA 4GEKA 3PSHA 2IXFA 2PBZA 2PX6A 3JRWA 3K31A 2XD9A 2H5IA 2I3DA 3CZCA 2I4RA 2IH4A 1YGPA 3D6AA 5ICFA 1F4PA 1UPAA 1V3TA 1SB8A 3OCZA 1U2DA 3AL2A 3KVYA 4URWR 4OMFG 3LP6A 1S6YA 4ETNA 4Y8VA 5JYCA 2BEUA 1EBFA 2Z8YA 2AE2A 3VOSA 1JNYA 2HWWA 2VA9A 2IELA 4OHYA 1ZVJA 1SKUA 2FTKE 4EGJA 5FL7A 5C53B 1KH2A 1YKFA 4LTNA 2A9KA 4IS3A 4Q7KA 3EXEB 1HMYA 2OENG 4BRWA 3C5CA 4CZ2A 1LPBB 2ONYA 3ORYA 4ZDJA 2R00C 1P18A 2EDCA 3HKBB 4JP1A 3TLKA 4G5HA 5H4GA 4YPFA 5ER9A 4ERXA 1N2ZA 1RWBA 4O8CA 1KJJA 3SZOA 2EFHB 2V96A 1NZFA 2WDPA 4FK8A 4WKCA 2XA9A 5LVAA 5KX5F 4OQPA 1I2DA 1O0BA 3O7WA 2XE8A 1VJDA 2HTFA 1ZUWA 4I0WB 4UREA 3C6MA 4PO3X 1S9HA 3GPIA 4LWZA 3LY8A 2WWRA 2EFCB 5K3OA 3TLCA 4UE2A 4ZRDA 1CYDA 1KS9A 3IAEA 5HF9A 2ZUVA 5F1OA 3L7MA 3W5HA 2SKCA 4MUJA 2A14A 3T41A 1KGSA 1M2NA 2ZAOA 4OQNA 5EEGA 5ELMA 1UAGA 5BN5B 4ZTUB 3RS2A 5GONF 5KYVA 3SQMA 4FUTA 4EW1A 4PX3A 3PNBA 3DMTC 3JQAB 4PNEA 4WSOA 5FTWA 3ECSA 1G6HA 4PLGA 4QXMA 1VHJA 4PIPA 5TE9A 3A37A 4NV0A 4NECA 2ZIUB 4J29A 3TGLA 1XRSB 4MV9A 1QVZA 1TCCA 1J1ZA 3V6LA 5KNLA 4FE4A 3OD5A 1YL5A 4QUDA 4PY2A 4JVNA 2EERA 2YOHA 3KIPA 1B0PA 2QD1A 1V5EA 4I1VA 4AW9A 2G76A 5I3ZA 5GIPE 5B3JC 1NVVQ 1LX6A 1ZGZA 1GU7A 5CBKA 3IAM6 3SZ3A 2LD4A 1P33A 4BVBA 1XG5A 2NMVA 1HT3A 1KOGA 4I6EA 3HA5A 5CT5A 1XXHE 1GSIA 1REQB 1T5OA 1UK7A 2D4AA 3H19A 4BX3A 1OH7A 2VHTA 2P9JA 1U2TA 3VVCA 3EPKA 4LXGA 4TS4A 5A6SB 2VK1A 5ITZB 2PKCA 2A0XA 1VL8A 4ND7A 4DAEA 5HYVA 1U9CA 4LFCB 4W7SA 4X8MA 1YHNA 1BS2A 1XB2A 4BNDA 3ZIDA 1E1KA 1Q83A 1XDZA 1PTJC 3NLLA 5EMLA 4EY3A 3PDIA 3AESB 1Y4DE 3NEPX 4O4IB 4X45A 3ZVRA 1PJ2A 5IK2D 5KAPA 3ZX4A 4F3KA 1KWGA 4KFCA 4ZZ2A 3H86A 3OPXA 3RT9A 4QATA 4Y6RA 3UMRA 4WNAA 4WXPA 3TRIA 3W8DA 4L72A 1GGKA 1ZHHA 2WF5A 2Q1WA 5KQPA 2IY9A 3PKJA 4NFSA 2HIHA 4LRWA 5LOVA 2D0PB 2ZWAA 2BY4A 2OFOA 3UJBA 2KS6A 4MGYR 3VZDA 4JV5B 1JS1X 4H18A 4L5JA 4YCMA 4DR5B 2A59A 3F8SA 5CVUA 5MHTA 1KMNA 1JQBA 5CU7A 2JBAA 3FPEA 4ON9A 3CMCO 3I64A 2PAAA 1BEUB 2OTCA 3REGA 3J80A 2NVUB 3KXDA 3IV9A 1VYUA 5AM5A 4GYKA 4YRNA 2IODA 4NQZA 5DOVA 1DEOA 1N2GA 1XAIA 1M6YA 3PPVA 3QZUA 5IS2A 5BV1A 3HG7A 4UOZA 3WL3A 5JCOA 2Q2VA 3OM8A 3E35A 2QV0A 3KPWA 4WH0A 2G83A 2C7VA 3IQGX 4Z0NA 1JYFA 2PUEA 1LI5A 5CX1A 4Q3CA 1DC3A 2VWHA 3CPSA 1E2KA 3A4VA 1NMQA 3GEBA 1QK4A 1RRGA 4LMRA 5KTYA 2P90A 4QPPA 1Y5IA 3K4QA 5JCJA 1KKMA 4E5UA 5AFSA 2RC6A 3ST7A 1NQAO 3LOUA 1N1MA 4FOOA 3U4MA 1JR4A 1A9RA 1E9FA 1ODJA 2QQ5A 2HHJA 5DX1A 4N01A 5P8WA 2GO7A 4JI0B 5ANRB 1Z5UA 3SLKA 1KERA 2OT3B 4GWKA 4EHKA 1L8OA 1UEXC 2X19A 4GQBA 3ZNQA 3ITEA 4G67A 1XJWA 2HBRA 3V1TC 4Z6KA 5LNK1 1RQNA 3DV9A 2VP2A 3KXPA 4KXLA 4X7MA 4H08A 1ZLYA 2AK2A 3FPJA 2EJTA 2BFBB 3GXBA 1EK6A 5BUSA 3RVDA 1GPYA 4LRUA 5LU8A 3K09A 3UICA 3QOYA 1F12A 2CGEA 5FL7D 2HWKA 5EHIA 3TQIA 4MVJM 5EIHA 1RWOA 2OZVA 2EQAA 3FWKA 2I62A 1NOKA 1BJRE 5JMOA 4ND6A 2BYTA 2D4HA 4NU6A 2X0NA 3LXRA 3PWSA 4EBBA 1XTSA 1Y7IA 4C06A 3BREA 4QOJA 3IQWA 3HNRA 1Z0FA 4CEJB 1U3UA 2P9TA 3BG5A 4JUIA 4GKJB 1NVMB 3L7JA 1ECBA 5TMEA 4CMAA 3IEXA 4J7AA 4URXR 4RKQA 2FRDC 5DYNA 3C3YA 2ZVPX 4PAGA 3CUUA 1EVYA 4TTSA 1F1BA 5FPQA 5CA1F 2LR0A 3CR3C 1ETHA 2VEDA 3ZBPA 3A58B 1TCBA 3H9BA 4Z3KA 4OIFA 1BXGA 4XCQA 1ZNXA 4E32A 3JRXA 5HZKA 3GP8A 2JJ1A 2XTZA 4QEZA 4MVCA 1Y9EA 1L5HA 3IEVA 2FPSA 2F3SA 2Q5IA 2GUGA 2Y1WA 1F6WA 3CUWA 4MYRA 4ZVTA 3D3QA 1ZIXA 2WWHA 4AX4A 4HNAB 4R7GA 2ATCA 2ERCA 2E89A 2QRMA 4EKDA 3IP9A 1AKNA 3UC9A 1WSAA 4CU2A 2IPOA 3I6BA 4BWYA 2DZDA 3GRFA 2FWBA 3VR5A 3O82A 3R6TA 4CBVA 4BB0A 1Z0IA 2V5AA 5CRIA 1MW8X 1T8YA 3TZHA 1G5PA 1E3SA 3IJ5A 3IR7A 4H6XA 4CQLB 2R8OA 2WSIA 5JS6A 2QVGA 4UEWA 1V9SA 4FGLA 4MYDA 4WXMA 4D41A 3SS7X 3O74A 1KMHA 2D59A 2Y99A 4NEGA 3QU7A 2HCBA 3RSHA 3PNQA 1S9DA 3K8YA 3OZIA 3P94A 2NAPA 1WWKA 3P9NA 3NG1A 3HDVA 3PEUA 3IT2A 3ND9A 3UCFA 1QQ5A 3EFOB 1HV8A 5A5GA 2JC3A 1WVMA 2XKBA 4RCYA 4P3XA 4RGQA 3TZCA 3B1ZA 1ZA1A 4JVMA 5JROA 3GUHA 5J1SB 1M5RA 4CT4B 2EG9A 3UWOA 4ZK6A 2HLPA 1G6KA 2GPNA 4Z4IA 1E2BA 5DFAA 4J3NA 1LLCA 4K9LA 5L3RA 1GSAA 4X3PA 3Q11A 3SBOA 1BMFA 3WGTA 4I50B 4Q7EA 4F2PA 2B99A 2ATIA 4GPIB 4XEUA 4GVLA 2IH2A 1J0CA 2ZDHA 1KMCA 1WKCA 2JAXA 3BE8A 1U5AA 2FF5A 4ML3A 4IDDA 1YS1X 2ZT6A 1VLQA 2WF7A 1C0IA 3TLJA 4HDSA 2ODWA 2WWXA 4YCDA 4YP9A 3E1KA 3IKVA 1KWKA 3EX7C 5KOHB 2GPJA 4AL4A 3L93A 4GECA 1C9MA 1E3WA 1N0UA 2IX9A 2WMNB 1D2GA 1QYCA 2R4UA 3PYLA 2CNNA 4EEXA 5AVYA 1M83A 4CLRA 2WJJA 4BIMA 4F4CA 3C41J 4AC9A 1HEIA 4KPFC 3A4LA 3A9RA 5ECWA 2G1AA 2OGZA 1JN0A 1Z28A 1J8DA 3M6UA 4G1VA 2ZRJA 3DBRA 3DHYA 3FLEA 1RJGA 3KPVA 1UOQA 4BQEA 3BFVA 2HK6A 1N9GB 1UIMA 4HAYA 3BORA 3ICWA 3ND5A 1NBWB 2OV3A 4RVSA 2J6HA 2GVZC 1OT3A 4UTXA 3ML1A 4WY8A 5I9BA 2I7CA 5JE8A 3CZ4A 2VZ8A 4RMHA 2BMVA 4RUKA 5BWMA 1SNYA 2D5IA 3H9UA 1QOPB 5FI3A 3OP4A 3HACA 4Q48A 5KHAA 2DCMA 4Q9IA 2D1SA 4YONB 1FSPA 2JCVA 1WXQA 1L1RA 1MFZA 1RYFA 2HRQA 2E2WA 4C1BA 1ZK0A 4L6IA 2PYDA 4XQGA 2JD1A 2JJMA 2GJAA 1OA0A 3FUVA 4FKBA 5JCJD 5KYXA 4UDXX 1MXFA 3V2GA 3ZE1B 1E7MA 1A8HA 1OAKA 3OM9A 3QF7A 5BT9A 3EG9A 3JQQA 5LIPA 4YAIA 2OB2A 1GXSA 1YZHA 3UVEA 2HQOA 2XUJA 2ZBUA 3VHRA 3LA8A 5DV9A 2H4HA 5JNSA 3L8HA 1NATA 1DC7A 1ZMXA 2VP5A 3BULA 3Q1KA 4OU5A 3D1VA 1H1DA 2WUEA 3U3JA 3DOJA 2Y1GA 5FBHA 2C0CA 5TS3A 5JQGB 2R1VA 1NI4A 5CT4A 4HXEB 1SU4A 4EG3A 1GOTA 2HDNB 3R4VA 3CIFA 4L8WB 1VLJA 3KT8A 2IHKA 2HD4A 4DA6A 2HJHA 4D9CA 2RB5A 2HB6A 4P81A 5LUAA 2BE9A 2P9ZA 4W5JA 4YCNA 2QS9A 4TOIA 4LAFA 3T3DA 4OJQA 3RRJA 3UH0A 1VJCA 2XT0A 2XTNA 1VKOA 4KR6A 2WK1A 2IZ0A 1SPBS 1D07A 2J30A 2DT5A 4RDIA 4MAMA 3V3KA 4Q82A 4DJ5X 1JIVA 4TMYA 3ELYA 4BGVA 4KL8S 4YP1A 2XITA 3H5IA 5F12A 3E5NA 5EMMA 3WGZA 3B1FA 1KI3A 1FS5A 5FOXA 3JU3A 4UTZA 1WA5A 2C8JA 4E5MA 2QPLA 1XTZA 4N5HX 1KYXA 1R2QA 3B13B 1SXGA 4FQ7A 1RAFA 3NZEA 2JJ1D 3DNFA 3M34A 4H59A 4ZCSA 4E13A 4KDRA 5ICEA 2P6RA 4X6LA 4Z7NB 2PIAA 3FIJA 4Q1BA 3FKJA 3L9WA 1DXYA 4HDCA 1UDCA 1O94A 1QZTA 4AMVA 5AKYA 3LC2O 4FR5A 1QHSA 1JPJA 2H2IA 5FR1A 3T15A 1FNBA 4PIMA 3RVMA 5LP6F 1HYQA 1RAIA 2R8BA 1CEYA 1MQ9A 3CW9A 1MO2A 3ACCA 3ECCA 4CG2A 5LZ4A 3ROXA 3VR5D 1ZN2A 4LDAA 2Q2NA 1R6BX 4TV9B 1XU9A 2C5AA 2PM8A 2XBLA 4K6MA 1AX9A 2AD1A 3E0XA 4BNYA 3EMBA 3ZGLA 5E3JA 3ZLVA 2B1IA 4QTUB 6REQA 3VX3A 1WLSA 1Q20A 1YI1A 2VDLB 3NYIA 4IJWA 4MKRA 1S4QA 5LKRA 2XF2A 1FUYB 2EG5A 2AR0A 2J45A 2PQ6A 1ADCA 3OP1A 4XGQA 3FCCA 2ZI5A 2BCEA 2PZFA 4DRZA 3LX5A 4PC6A 2FZCA 3R3JA 2DHCA 3ZKWB 4CMEC 4DLSA 1RM5A 3GNQA 4G0PA 4M22A 5ALLA 4DLTA 2CVOA 2C2ZA 2V4MA 3MK31 2AT1A 1JALA 4G37A 4M1YA 5JMWA 2PZEA 4KB5A 4H7IA 4B3JA 2C84A 1QO9A 3PD0A 2O5EA 5LD2B 2VOEA 1V8BA 1UZAA 1JW9B 3JAWB 4XRGA 3ZS8A 1BMFD 1TAUA 3HVIA 4C0LA 2C9DA 2JD2A 4G5SA 3HJTA 5EQFA 5AM3A 4L27A 1OILA 2QTFA 2ZUFA 1XZMA 1TJ4A 1O0SA 2JBHA 2WTMA 4HATA 1T9HA 3D0QA 2DUMA 4C4TA 3AVQA 4INPA 4E2ZA 2F3QA 3GPLA 2IYEA 4K81B 4RD4A 1PWXA 3TI9A 3BTUA 3NM4A 3R2JA 3T9EA 2ACVA 4WLOA 3CJQA 2ZROA 3TZQA 3FMPB 4B3CA 5DM60 4GP9A 4N3GA 2WTBA 4MULA 2H1FA 4IVRA 4NZPA 4R5MA 1I3OA 4YUAA 2AG8A 1AOXA 3E22A 1C7FA 3EUEA 4UAVA 4OATA 4NBTA 1XCJA 1Q5PA 3AY7A 4P38A 4C7JA 1NBMA 3EIEA 3NC0C 4MVJF 5IJXA 1JZQA 4ACAA 1PEDA 2J09A 4ND1A 1EIWA 4MS3B 1X7DA 1PX0A 1XROA 1TZCA 2QAGA 4NV3A 4E5YA 5DNWA 3UJCA 3EY4A 1UBGA 5L7YA 3H1TA 4N3CA 5JI2E 5BR1A 3A1UA 3PQDA 3D7NA 1ZK3A 4Q7MB 4LE2A 3L05A 3PDWA 4WLVA 5CB4F 4R0NA 3GFPA 4Z3DA 4BMVA 3ZZ0A 2CHVA 3M70A 4JBNA 3UV3A 2C7PA 1E3QA 3SJCA 2XIJA 4JHLA 4L3WA 4L1KA 2GLTA 2VHWA 2J9FA 4RLSA 5BURA 1YT5A 4QARA 4QJ3A 1ESNA 3WFIA 4IWXA 3HLTA 3ORHA 3RRBA 1VL6A 3EZYA 4CUZA 1N0HA 1J25A 2GGSA 3U4QA 1MNAA 1SU7A 4UMDA 1Y5LA 4MPJA 4H7JA 4FE7A 3FTNA 3A1SA 1ULBA 5I5EA 3S8YA 3L92A 4EMUA 4UHJA 1MGPA 1GQRA 3KQOA 1SBHA 4PTYA 2RBGA 1FW6A 3C5EA 3CWCA 3MILA 3BAZA 4KO8A 2W22A 3CX6A 5EKDA 3CB2A 3SCZA 4QIHA 4HPXB 2GYYA 3RYIB 1IUOA 3B6MA 5BQ3A 3CVOA 1X7ZA 3IE0A 1L5OA 2FRXA 1WDKA 1CQWA 1YCFA 1CY1A 2QX7A 2KBEA 1PKXA 3M5DA 2BI8A 4RVDA 2R00A 4TTPA 2ID4A 4NZ9A 4CLXA 3HZOA 3D8TA 1JKFA 3NVMB 3DAPA 3SVLA 3VR6A 4ENTA 4WOCA 1GUBA 2P0EA 1WMDA 2Q07A 1FRZA 3MCAA 3GLTA 4M60A 4X94A 3VAAA 5ES4B 2PKQP 1WSDA 1M75A 4PGAA 4DEXA 2WR8A 1QKIA 3OJLA 4CV3A 1VPWA 3AERA 721PA 3AVTA 4YRDA 4C0HA 2GZRA 2VLIA 2IYFA 5KYNA 2VNHA 1IHDA 4JOQA 4YMSA 2G5CA 3P9XA 3QIVA 1LBEA 1U7HA 2OKGA 1RTTA 4R0MA 3KUKA 5C2JB 3OF2A 3OKCA 3R77A 1E8DA 5C7LO 2YW9A 1HZZC 4CHTA 3OE5A 1ADBA 4H6WA 2VUIB 4CMIA 5H0IA 1XKXA 2IL1A 5HFJA 4JL5A 4QLOA 4KR7A 1HE8B 3G68A 4LFAB 2BJWA 3DMTA 3BE4A 5A4DA 3OQMA 3A14A 3THYA 2EP7A 5AW0A 1PS9A 1QWSA 2LWIA 3DSRA 1NN0A 2UVDA 4NYJR 2RHTA 2IV3A 3TOSA 2NYAA 1ENZA 5KYGA 1FW8A 4ZOBA 2QBYB 1PJAA 1JXMA 2ZPTX 3A1FA 3EXHC 2VQ6A 1W581 3OA0A 1LLFA 4MV4A 5ALSA 5B3JA 4P93A 3GZJA 4ZTBA 4J2TA 3UC5A 4MR8B 4O29A 2AJLI 5DN9A 4I1RA 3OC6A 2F9FA 2R2GA 2W2NA 1PK9A 3ZD7A 1ESMA 2EFGA 4TXMA 1STOA 4Z1MA 4QLBA 2YWHA 2JASA 4G1EB 1RJ9A 2Y67A 3IHLA 2BF7A 1T3LA 3OQPA 4TRMA 2NX2A 3CH5A 3BS4A 3PUXA 4L6CA 1DOAA 2JH9A 3R6GA 2XYQA 5JPIA 1PV1A 1VE1A 2Z4TA 4F04A 4GQIA 5TQVA 4CLOB 3SSAA 1E2DA 3X1DA 5L3VA 3CLHA 2VAMA 4IDNA 4W9RA 5EXSA 1XBTA 3BWEA 5KO2A 1B74A 5REQA 3RAGA 4W9NC 4L95C 3G0OA 3LUDA 2CJYA 4BFXA 3JVUA 2G9VA 1K98A 2ZBFA 3AM5A 5ESXA 3H4VA 3SJ7A 3THOA 3E8XA 5D2CA 2G0AA 1DIBA 1A50B 3DZBA 3RANA 3SQOA 1U0OC 4MLCA 4TMFA 1XHEA 1FJHA 1WPRA 2ORIA 1Y0BA 3WE7A 3LY5A 4FBGA 4M7OA 1KR2A 1MX3A 4FCVA 5IWCA 1IN7A 4PPGA 1GDDA 2ZTSA 1T8TA 3KEFA 1P5HA 4IKOA 4LDZA 4LYGA 4N6OA 3LDGA 1NBMD 2X5KO 1SG9A 3WLLA 1TEZA 2UUCB 4BNJA 3X1YA 1GILA 1UKEA 1Z2DA 2PGAA 4H2DA 2QDXA 1MH9A 3NAQA 1OLUA 3GLUA 1TJNA 1GFZA 4Q37A 1Z4NA 3VOAA 4DRYA 4GNKA 4QDKA 1L5QA 4EENA 1XQXA 3PXGA 3FXAA 4R1TA 4R98A 1WP9A 2W2VA 4LISA 4KE9A 1LK0A 1L5VA 4S05A 1PQUA 1XFDA 1Y7PA 2CXHA 3DXXA 1TT5A 4H0CA 4YREA 1WABA 3SMVA 4EX7A 4IJQA 1FTSA 3KQQA 2BUAA 3CPEA 2A6PA 1MHTA 2E85A 3LLCA 4HXFB 1SZCA 1U0JA 4M9XA 1N5IA 1UT6A 3PQ3A 3QF4A 3L07A 3RUIA 1H3EA 1UC4B 1KJQA 3EC2A 1J0AA 3LT2A 3MOSA 2BDEA 3EMKA 5LDGA 3RUEA 1YJXA 3IP7A 4RJIA 1K5GA 2SECE 4Q03A 5G1NA 3S55A 4ENSA 2P2ZA 2VNAA 3NT5A 1CFZA 4V2IA 1I2ZA 1JIQA 3CV3A 4D3FA 4HRXA 1L5WA 1TYCA 5BYAA 4CM8B 3KZCA 2GEUA 1V37A 3L79A 5DIFA 3BWCA 1GNVA 5T8KC 2VJYA 3THRA 3TZBA 2Y9PB 1SA0B 3EDCA 1UK6A 2QIOA 3MCZA 4DA4A 2QSZA 2FSHA 2NV2B 5AJHA 1M2VB 4MRVA 2YJ6A 3PJGA 4PYLA 4ZOLA 1U5BB 4A8TA 4G5YA 3DYVA 2QTZA 1VSQA 3I5MA 2F8TA 1FMTA 3RJZA 2HLDA 3KYCA 1ZESA 2W2MA 5DW3A 1RM3A 3R8XA 2QTMA 3LSYA 4RXMA 4EYQA 1ZOIA 2IU4A 3N3AC 2CZQA 4YO8A 2WILA 5AW5A 2JJ8A 4BQIA 5LC1A 1XYGA 5ISMA 1GKYA 1DZIA 1IRIA 1MTOA 1JJFA 4GW3A 2BFMA 1C3OB 2W2TA 2GEVA 2ZLBA 1G4HA 2E4VA 2FRDA 3DGFC 3P9QA 1RMYA 3AFOA 4D8XA 4EA6A 1XNRB 1GNSA 5C37A 2F3RA 3ESXA 2VRWA 1UZLA 5LCXA 3UT5B 1GUZA 1PJTA 5AHXA 5E0OA 1TW2A 2WYUA 3QVMA 4TWZA 5TJHA 5D3QA 2J8ZA 4P5PA 1PG2A 1BQEA 1F06A 4IDPA 2GXAA 4MUAA 5CHEA 3RTCA 4M98A 5CVEA 3FDZA 3H9QA 2EX1A 3E5MA 2AZTA 4NCXA 1IBCA 2D8MA 3WK6A 2ORED 3O21A 1F9AA 2NWQA 3QJGA 4OSOA 3IP3A 1P39A 4MVJP 5ARCA 3U0BA 4HQ6A 3L7KA 4OK5A 4FSHA 1E1YA 1SO8A 4IOMA 5KYYA 1KL7A 4MUGA 4LJ4A 1E6WA 3AR3A 1OROA 4HYQA 1ZIYA 4MYSA 1KH3A 5EJ5A 4HOYA 4X7PA 1D1SA 5H83A 2A1UA 2QENA 4ZOAA 2DPGA 3F5MA 1CRQA 4QPNA 3ON5A 4EPYA 2YKGA 1BSVA 4V3BA 3AZQA 4ZOCA 1DMSA 3HXQA 1DHRA 3GLGA 3FYUC 2XTMA 3JPWA 4ZCPA 4FR0A 2I4IA 4OYLA 4RY2A 1XC7A 1KDRA 5CA1B 3CN7A 2WTNA 4CKEA 1KC3A 2O8BB 1OGIA 4US2R 2ZS7A 4QGSA 3R7FA 1YZGA 5CFQA 1BKYA 3E7PA 1R37A 3ANXA 1G9SA 1BC5A 3HWX1 2G7ZA 5CM9C 1BGWA 1F8GA 1ZICA 4DA0A 2HHHB 3U7JA 3QMPA 1Q1ZA 1A7KA 4MQUA 3RYHA 3P9YA 1P2DA 2CNDA 3JQ8A 2BP7A 2KYRA 3HCDA 3FA2A 3F0TA 3KYBA 4TYNA 1U0EA 1XZNA 2G71A 1V35A 4GMKA 1YE5A 1MOPA 4M8IA 4OXIA 4XYGA 3TD2A 4DG5A 2G1KA 3PEYA 4F6RA 3BWMA 3AI2A 1IZ9A 5IJZA 1OE0A 4EO4A 5ILOA 2QP3A 1AMUA 4JH0A 1KJZA 3E27A 3TD6A 1LRJA 5A9SB 4Y2TA 2IA5A 4A6XA 2WJGA 3VGJA 2ZJ7A 1LRKA 2X13A 4N40A 4TM7A 2X41A 1O7JA 5AW4A 2NU6B 3S3TA 2PHZA 4DWWA 4LF5B 4MYCA 4QO8A 5F33A 1WXEA 3TK1A 3C74A 5LQRA 2GAJA 2PTHA 3ZE6A 1CC1S 2B4TO 2LBPA 3PE6A 4TSRA 3IRUA 4FN5A 4BO7A 4HSGA 4HFMA 4LOAA 4M38A 2R60A 1OBFO 3G7NA 1ZW6A 1BXRA 1U6JA 5H02A 2PSEA 2I4MA 4LRSB 1YL7A 4RYDA 3IEMA 4GI3A 2QXTA 1N4AA 5JV5A 3LZDA 4CL0A 1UQUA 5EWLB 4AB1A 2LVBA 3ZU5A 2UYCA 4RU1A 2AYXA 2VH1A 3CZRA 3NJ8A 4ND8A 5JS8A 1PEYA 4KHPB 4G2NA 4PYIA 1W2WB 4A0QA 4UFOA 4CF7A 1JLHA 1KR5A 2JDIA 2QLLA 2F6RA 3UMYA 4W6ZA 4JT2A 1P91A 3S0JA 1E2NA 4U7JA 3QKRA 1JVNA 3U1TA 4DMLA 1DIRA 1GTG1 4EUNA 3T54A 1AZWA 1YQQA 2CYBA 2Q1UA 3MS4A 2ZBEA 4JQCA 4BBZA 2OOSA 4FMDF 5F2NA 3LNCA 4KYVA 1QLJA 4BO5A 2FUG6 1ZJZA 5CVJA 5K51A 2Q99A 4DY4A 4NX2A 3R1IA 3T3MB 1JZSA 1ZC3A 4OGGA 1JEQA 1FVHA 1VHWA 4POOA 1C1HA 3CR8A 4CKYA 4D3ZA 2EWVA 4C4YA 1CS0B 1NFRA 1WQ1R 4HDNA 1L5NA 4AWBA 5U1PA 3WQQA 2W0MA 3IESA 3QLUA 3UGKA 3WLMA 5HIAA 4N6GA 1GTL1 2PX3A 1O5TA 4N8DA 2WABA 3PQCA 2GKSA 3QVXA 1U80A 3BXEA 1P1RA 5KJCA 2DU8A 1Y5RA 5HQJA 1PS0A 4MRSA 4EB6A 1KQGA 2GHQA 1KAEA 2OO5A 3CRNA 4R2WA 4JI1B 5JHHB 3ETDA 4EG8A 4QM6A 2Q3MA 3NVKI 3JWEA 3BL5A 3SEFA 3ZDAA 2ACWA 1B8VA 2IU0A 2RHDA 2HLDD 1NRXA 2TMGA 3W5IA 5T4FA 4DCTA 4DYDA 4JDPA