3H87A

Rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
136
structure length
136
Chain Sequence
TDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/antitoxin
molecule keywords Putative uncharacterized protein
publication title The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 49
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 3h87A00
3H7IA 3ZDCA 1Y82A 5L6LB 2DOKA 5ECYA 3ZDBA 3Q8MA 4MJ7A 2WP8J 1RXWA 4XGQA 3H8WA 3ORYA 5ECDA 3IX7A 1TAQA 3QEAZ 2QIPA 3H8JA 5H4HA 5H4GA 1A77A 3DBOB 1W8IA 2H1CA 1UT8A 5SV2A 2HWYA 5HMLA 3Q8KA 1V8PA 2H1OA 3H8SA 3QEBZ 2HWWA 3ZD9A 1EXNA 2HWXA 1A76A 3ZD8A 2IZOA 1RXVA 1UL1X 2MDTA 1B43A 3ZDEA 5HMMA 1YE5A 1BGXT 5K8JB 3TNDA 5HNKA 1TAUA 1V8OA 4XGRA 3ZDAA 3Q8LA 1V96A 3H87A 1TFRA 1UT5A 3ZDDA 3QE9Y 2LCQA 1XO1A 1O4WA 3I8OA 2BSQA 3ZVKA 4CHGA 2IHNA 5L6MB 5HP4A 2FE1A 1MC8A 5FV7A 5ED0A 5ECWA 4WA8A
chains in the Genus database with same CATH superfamily
2CXHA 4YLYA 2I3BA 1FB5A 4EL5A 5K0SA 1OAKA 1W2WB 5IYZA 5IT0A 2BI7A 4X85A 5D6OA 3R7BA 1KS9A 3O1HB 2OORA 5IG2A 4OQFA 2ZJ0A 3H2YA 3HZRA 4MYDA 3SI7A 2ABWA 4G5XA 3RVLA 2BGNA 3JYOA 1SQSA 1JQ5A 1RI1A 5DBEX 4P3NA 3IEPA 2C9CA 1G1MA 3W8NA 1TTQB 3DV2A 5DNCA 2GF0A 1H85A 4C30A 4KX3A 5EI5A 3LQQA 5KOJB 3KSRA 3W5DA 1O9GA 3E5RA 1R10A 3N6XA 4ZODA 5ALIA 3RAGA 1ZOPA 3IPXA 4B3IA 4FE4A 2DHDA 5CCEA 3WKAA 1X3LA 5HRCA 1HE4A 3MRVA 1DO8A 2YUIA 1UJ5A 3FSEA 2G67A 1U6IA 4Y2GA 4EY7A 1QDEA 3KOZA 5K8UA 1GSIA 5LUBA 2HXYA 1KOGA 5T7BA 4I1UA 4RK5A 4JY7A 4ZT3A 4CV2A 2C2HA 3HVKA 1I32A 4NCBA 5GINE 2RGDA 2E5LB 3F7OA 4YRAA 1QG4A 5IRCD 1ILEA 1BDBA 3C8DA 4K8OA 4LOAA 4XWAA 4PGHA 3ZW8A 5KYKA 1SEPA 3UATA 1B0ZA 1PJCA 2I2BA 2JFUA 3DZDA 1SUSA 3TVYA 2HH9A 3KG2A 1RKUA 2OG2A 1Z28A 3CNLA 3P2KA 5KYUA 3ZHXA 9GPBA 1IJFA 1IOVA 5JAHA 2AK3A 4JX9A 1YR9A 2BL4A 2XUJA 3NORA 5TT1A 1EVLA 3OZ7A 2R5FA 1BEUB 4R7TA 5CJPA 2Q0SA 4AULA 2R6DA 3CNQS 4KAFA 2ZYIA 4BDSA 1VKJA 4HDMB 5KYXA 1N9GB 3E2MA 2AFRA 4OGWA 4EGFA 2Y0PA 3R1IA 4LDNA 4WFJA 1RQRA 1FS6A 2VZLA 2DLNA 1YASA 5EEGA 4C0QC 3HU3A 4DYVA 4EPVA 2DQSA 5AVWA 1W88B 3IHTA 3KWFA 3AB8A 4WBNF 1OGIA 2IHJA 3NT5A 3WDMA 2XSZA 4JLMA 2QM8A 3I1IA 2IHTA 3PGVA 4H6XA 2CW5A 3NEAA 1IN1A 2G82A 2IWRA 3WB0A 3TDNA 3MRTA 4BMSA 4TT8A 2GYVA 4NU5A 1IVNA 3O8RA 2O2HA 1P77A 5HIJA 4HFRA 3ROEA 3HUEA 1Q0HA 4MUGA 1UADA 4JR2A 3T99A 2NUAA 2DR3A 4UM8B 1PYGA 1YS6A 1OBFO 2AH5A 3AW8A 3G0CA 3KSAC 3QLVC 4DQUA 1D07A 1I4DD 4EKIA 3ZDYB 4XDHA 3ED1A 1JQDA 3R6DA 1B00A 4LYJA 5T64A 3P26A 1IJEA 4GKJB 1R00A 2ZBQA 2FPPB 1PT7A 3ET5A 3HDTA 3IVCA 3H9QA 3VZDA 1KU6A 3BZWA 4EG6A 4IIBA 1H2YA 5M34A 4UDOA 3Q9NA 1LPPA 2FFAA 3SX4A 1WBBA 4MULA 2J7PD 4BGDA 1W34A 3EFHA 3T7DA 4X9XA 1XMSA 2GLUA 3P5SA 1WUKS 4NFLA 2QL9A 2Q5HA 4OMUA 4RVSA 3MUFA 4ZXFA 5F7ZA 3UB4A 5CA0F 4CF6A 3H42B 1KI6B 4PYRA 3QA9A 3HXKA 3R3WA 5CB8A 3UAZA 4EZIA 3KAPA 2ODEA 3LFHA 4MKIA 1C8KA 3YASA 1W73A 5TT0A 5LKRA 1H2ZA 1GVHA 2XUAA 3ICOA 2IW3A 3WYFA 4RTKA 3OM9A 4YAGA 5TF0A 1Z6ZA 2QKYA 2FDCA 1CLUA 5EFZA 4KN8A 5CDUA 4NE7A 3LT0A 3NZEA 5FEMA 3UA4A 4BNKA 3FA2A 2GXUA 3FUXA 4PC1A 5CX4A 2RJNA 2WI8A 2WTAA 5ESRA 3GPLA 5TX7A 2TMKA 4BVKA 4EB3A 1N7GA 2VDOB 5JLJA 2PHZA 5L45A 2A94A 2ZJ6A 3EWAA 3PRYA 3QKIA 1CUIA 4IVPA 1FQKA 2J0VA 2IOYA 4U8HA 5TMEA 4ALIA 1M1YA 1V3VA 5A71A 3CUYA 1E1NA 4MVJH 2WMNB 3PXXA 5LZ2A 4ZIRB 1WAMA 3I9V1 4IIJB 4M7WA 1X7DA 1ESCA 4RHCA 4RPIA 1UXHA 3ABQB 3EVTA 4KLZA 1VJDA 4FMDF 5HQJA 4XWYA 2I2XB 4F11A 2FMIA 3KTFA 3THRA 1TYAE 3KHUA 2I5PO 1CW2B 1ZJ4A 3H0CA 3CLRD 3NQ41 4LXHA 1N0HA 4OA5A 1G4AE 2ZRMA 2Z5GA 4UE2A 2W0SA 1AM4D 5DHFA 4NECA 3AVYA 3TOZA 2ZWVA 2QTMA 4Y8VA 4MUEA 5BXYA 4XAQA 4GOKA 3GLRA 3L0DA 5FP0A 3PX7A 3P97A 1KDVA 4Z2AA 2W2VA 3JARB 2L0XA 2VQDA 3ER6A 4M3NA 4OJTA 3U1VA 3THYA 1YS9A 4D8TA 4OJNA 3I72A 3OIYA 1NN3A 1U0SY 1PBNA 2ZS9A 1Y7PA 4KTTE 4RHTA 3DDCA 3NMUF 2ORVA 2HJRA 1C7EA 1TU4A 2P4UA 4I46A 1HLPA 5LP6F 2ZRDA 5SZHB 3B2NA 4NAUA 1X3SA 2VJQA 3O4FA 1IHOA 3QBEA 4PR3A 5CX1A 5E9JA 4DDMA 3UMSA 2O5EA 3R6TA 2PR2A 1DG1G 4JL6A 5KAPA 3TAUA 4CM4A 3PEWA 3DB1A 3QMWA 4I50A 1GA1A 4C4YA 3SIXA 4OHCA 1XWIA 3DMHA 3H1GA 5GONB 1ZQ9A 4GL2A 3QUSA 4LVNA 1XJ5A 1EM8A 3IMCA 3EW9A 1CJTC 5T4HA 1KDYA 4C2BA 4HJRA 2BKUA 2GGSA 3T15A 5C4IA 3Q7IA 3OM8A 4P22A 1GNRA 4BO6A 2RGBA 1JHRA 3LXUX 4QRIA 5LMCA 3ENQA 2R8PA 3HB4X 4LIPD 1U1IA 5HM8A 2D0IA 2UU9B 3K1AB 2ZSAA 5JJLA 1IOLA 2IQIA 1GAQA 1E79A 1Q1ZA 3G59A 1ISIA 4ZQBA 3AH8A 4IINA 5TQ0A 2Z2ZA 1WU7A 3GJ0A 1GTJ1 2VJAA 3T5GA 1FUUA 3WMRA 1IUKA 3SJUA 4UXIA 4ZD6A 5A05A 1XDWA 2JL1A 3K9GA 3LSTA 4HMPA 3V1KA 2YQZA 3KEQA 3EK2A 1E20A 2ZT8A 2Z1DA 3MMZA 5CTJA 3E2PA 3TM5A 4BN4A 3BA1A 5C31A 4CPDA 3A28A 3I9LA 1EDDA 2XB8A 3P4UA 4BQFA 3V4OA 3W34A 3RWMB 3KV1A 3DTNA 3GXOA 1N3IA 4HGYA 3KKMA 5LU8A 4CUJA 2JRLA 4DBZA 3R7DA 3K0AA 2Q6LA 1LDMA 3JWJA 4LCEA 1RYYA 3B9QA 4IVQA 3MJCA 2NADA 3CWCA 1P7CA 1E0SA 3T9DA 1EVEA 3B20A 1PLLA 5ALHA 3VXKA 4Y9RA 5ARCA 3RVQA 1PVOA 4B3DA 4GC9A 1QYRA 1I7PA 2A1UA 1KAHA 5JALA 3EIHA 3S2YA 2HWKA 4A2QA 3LVRE 4S2EA 1E0JA 1DEXA 4R71A 5ECDA 4LHVA 3OCXA 2HU7A 2I54A 2FOLA 2NIPA 5C7LO 1SHZA 1OH6A 2JIDA 2R5NA 1TM1E 2G3YA 3TUZC 3EYWA 3J7TA 3KWJA 1A7KA 3SLRA 4M36A 4CTJA 2H4FA 4IEFB 1IXKA 3ED5A 4UNNA 4HBGA 1T8RA 4FXPA 1FDRA 1AKRA 3RIYA 3QFTA 1MO4A 4UDNA 2JFPA 3QE0A 4J0QA 4WTOA 1TZ2A 5EA2A 4NX2A 4ZZ3A 3IO5A 2H4JA 1EFLA 1A2QA 4UPEA 3UJCA 1GNSA 2Y0EA 1RRCA 2ET6A 4M46A 3N58A 1A8HA 4XH9B 2QP3A 3ZCVA 2P2NA 4W5RA 1IHYA 5AIBA 2FUCA 1T8YA 3I32A 2PO7A 1QFMA 2PWPA 3CH4B 3ENWA 3EW7A 3NUGA 4OI1A 2EQBA 1H2FA 2X0DA 4C6SA 3EXEB 4H7EA 2WA2A 5KSPA 2E2WA 1RQNA 2R60A 2QJWA 3OQIB 4TKZA 4MMXB 1EIWA 1SCDA 2HRQA 3GPIA 2HJVA 1XQ1A 3GAZA 4FHEA 4FWBA 2XRMA 1L4BA 1ZEMA 4AXBA 5C7IO 3C8MA 3KKKA 2PXHA 4N3GA 3LIPA 4HF7A 3RU7A 1MGOA 4CV3A 2CXPA 1DXYA 2QRVB 4M2LA 2QAIA 3LY8A 3OCZA 1YZKA 1SRRA 3IHLA 4JC4A 2EBFX 2WYVA 1HDIA 5EJ9A 5FUVA 1UM9B 1NVEA 3BG5A 1NHWA 1H8HD 1T3LA 1U0JA 4ES6A 1JTVA 2QZ9A 4AJNA 4ZI3A 1W19A 5IBRA 3HYSA 4CKWA 2DFDA 1XTVA 1E6MA 2E3JA 1UC5B 2TYSB 1LKZA 1NQAO 2QGFA 1XROA 3FTPA 1T5SA 3NDIA 4H4CA 1JW9B 3AB7A 3EGOA 3DKVA 4QOIA 4E14A 2JJ8A 4YT5A 5B1IA 1KGDA 1B76A 3A9VA 4WESA 3OAAA 3EBPA 4D8WA 4U7GA 1TQHA 1EGHA 1DIBA 1T29A 1C80A 4V02A 2FSVC 1EZ4A 1E5QA 1GTG1 1NSFA 2VP3A 4JEHA 3KJNA 3DGFC 2JKZA 4O1HA 4DEXA 1YMUA 4DA4A 1G6Q1 1QAQA 2PKYX 1G2IA 4G25A 4NJEA 2SBTA 1U2ZA 3KZVA 2EFCB 2FF5A 4V0KA 4WV3A 1I6MA 4DDKA 4MWTA 2ERCA 1EA5A 4WASA 4EFNA 4MS4A 1PR1A 4ZYVA 3F6SA 1DTWB 5CLQA 1J22A 2OO3A 3O8QB 2IY9A 4FMDB 3GUZA 4FQ7A 5EJIA 5ELLA 5CG1A 2WB2A 4P5EA 1PHPA 2VJMB 3LLUA 1SUBA 3CUUA 2XXAA 4BWYA 2Q2VA 1KJIA 4IWNA 3BHNA 4WZAB 1VYHA 3FYUB 4DCSA 2LW7A 5CD9A 5I4KA 1QHHB 4XVQA 2OFOA 3H11A 3IPCA 1DBPA 5L3VA 4DFDA 1YJCA 4F21A 4BP9A 2RHJA 3MJSA 1VPDA 4D4HA 3D3WA 2AXQA 4PAOA 1GPDG 4DJ5X 2I6QA 4JQSA 3RRFA 4OQDA 1FJXA 1ZEJA 4FKZA 2LVBA 4XB6B 3W79A 3M6IA 1QVWA 2IC5A 2HV8A 4KHZA 5A4JA 3GJ8A 3P9NA 5JYEA 3CLTD 4MGZR 5H68A 1N78A 2Q0QA 2JLZA 3W3AD 3MJRA 1H2EA 5LP6B 1EFAA 3B8EA 5KWVA 1AQLA 1P2FA 3E35A 1Q1GA 2XNHA 5T3YA 4WY8A 2XVZA 3N74A 1WKCA 1DJNA 4G5FA 1NR5A 1JIIA 3LLVA 3AVTA 1ZK3A 2P2ZA 2WYUA 4LNHA 3TCNA 3TTYA 4YJ2A 4L74A 1KYZA 1T9GS 4QLOA 5E0KB 2K7FA 2EBUA 1PRYA 1NQUA 4D5GA 4FIDA 1G5FA 1L7RA 1W2HA 2AQ8A 3VNRA 2ZSIA 3N8IA 1AN0A 1ZOLA 5FBKA 4EKYA 2YIJA 4BJ1A 4QDZA 4Q3CA 1E2QA 6YASA 1HLDA 1Y9JA 3EGXA 4BO5A 3K0KA 3PPWA 1X38A 4JV5B 3WHPA 4RJJA 5J1SB 4XIGS 2R7MA 1UJ4A 5CYPA 5D1HA 4L50A 4REOA 2IF0A 4G9EA 4COOA 4Z4GA 2VPZA 3P9IA 2NLOA 4IMPA 2P79A 3PI6A 1G16A 2MDTA 3OEED 1Y8QB 2IX3A 1A04A 1S9HA 3WNVA 5T57A 2J7KA 1O95C 1F6WA 3NGXA 4XASA 2V3CC 1M0TA 1U2RA 1Z9BA 4CT0A 3GDFA 1HG0A 3P7MA 1LSOA 1AE1A 1MO3A 3KB2A 1I1OA 4RA6A 4D8VA 1V5WA 5GWXA 4YLGA 5CYGA 4AB1A 2HPAA 3N7TA 3OHPA 2BONA 1NNI1 1XEXA 2AG6A 1BEEA 2ZTMA 5CPBA 3GRFA 5FYQA 4A73A 2OXFA 2HSDA 2VDLB 3W6NA 4ED9A 1GNVA 2IP1A 4PX9A 1UC8A 5KS2A 2K7ZA 3C7TA 2YZMA 3FVRA 3KU1A 4GZMA 1L4MA 1C1HA 5LLTA 2QU7A 2ZYTX 2VJPA 2G7ZA 5DSZA 3T9EA 1QQ5A 2NVWA 2PS3A 4RCVA 3RHFA 1BVHA 3M5PA 3VKWA 2FGKA 1AZLA 2AG8A 2GUGA 2AFIA 3NBXX 3G88A 3QEMB 3U3ZA 2QQGA 3ER8A 2BEVB 4UE3S 2IJGX 2H2DA 1GQRA 2NXEA 3GFSA 5KWEA 1LWNA 3U7IA 2MSWA 3E6AA 2JJ1D 4KK3A 4XLTA 5KNBH 5L95A 5ILOA 1CHNA 3MMPA 1LJLA 2FK8A 4NJMB 3GCDA 4EUEA 4WLFA 1Q57A 5LM3A 2C2OA 2WTMA 3QKRB 2AL7A 4J7AA 4N5DA 4QUGA 3IUSA 4WAUA 1CR6A 2B2CA 4EHJA 3V1TC 4MIEA 3HY6A 1PP4A 3G9QA 2FUKA 1EG2A 3L79A 4AJEA 1RM0A 2AN9A 1KFCB 2V8OA 4PYQA 3AU9A 2LR0A 3ZY5A 3BL6A 4KU4A 1N9KA 4ZV4A 3ESQA 3JQFA 1OFUX 3EGDA 4BJ5A 4CYMA 5DEIA 4IYRA 4OJMX 2M6LA 2WUWE 3WMEA 1UKAA 1Z0FA 2L69A 4KDCA 1H0SA 5D7BA 2B0CA 4IM7A 3SZLA 3TLGB 4DA8A 1T9CA 4YCCA 2CDAA 3EEOA 4DDHA 1VLJA 1X9HA 2R8BA 5LL6P 2WU0A 4U2CA 1JA1A 1V1MA 1VLZA 2C7VA 4PAWA 2JBHA 4L4XA 4NCXA 1F8XA 3KQOA 5D85A 4UQPA 1MTOA 3VDXA 1CQJB 4OBEA 4BNNA 1N3BA 1UMCB 1YHYA 2OXCA 3CU5A 1T35A 4ZMRA 1XMJA 2B7CA 1CRWG 4MQMA 1UJ2A 1OBHA 4HSGA 4CHTA 4KR3A 1QHXA 1XTPA 1GG9A 4FMCF 3A4NA 4UNPA 2ZYUX 3E9NA 3SQDA 4LHEA 5CAEB 2DYKA 1NX9A 2QYOA 4ND6A 4HB0A 1V5GA 5KKAA 1LDNA 1TAQA 2A0FA 1JHQA 4MR8A 4HKTA 4LKOA 1X6VA 4R3WA 2A7XA 4X1IB 3UHOA 5CDFE 3I45A 4EB8A 3QX8A 4B46A 1A77A 2B0JA 4N6OA 3SSNA 2ZYWX 2FG6C 3RW9A 2P78A 2QMEA 4UVHA 4D1YA 2ZE6A 2A78A 3U4GA 2JAOA 2R4UA 2X1LA 3VH3A 2GWRA 5KNLA 1JE0A 4ROSA 3WISA 1Q0SA 121PA 4KXQA 1ZMRA 3O0TA 1FYXA 2XV1A 1V37A 1EZZA 1US8B 5CBPB 2DT5A 5KJCA 3UQZA 5BN1A 5FTLA 2WQ6A 1R18A 3LC0A 1QZXA 3ZHOA 1K06A 1LPNA 1DS6A 3JASB 4PCLA 2BUBA 2K2WA 1Q22A 3ZEIA 4C5BA 3P9RA 4Q9JA 1QRAA 2PANA 2HQBA 3H2JA 3OI7A 3OKAA 3PEYA 4HH4A 3VJLA 2WIGA 4JNCA 3EGEA 3KEGA 4KHPB 4R31A 5JDCC 2NMVA 1GN8A 3KFXA 3NXSA 1BO6A 3MN1A 3O9ZA 4X20B 1MJ5A 1N6LA 5ALYA 3P1JA 1QYVA 2V45A 3VVLA 1QBGA 4Q4HA 3R40A 3WLSA 1SJ9A 3CJRA 2DPLA 4F6RB 2V03A 1X15A 4DABA 5IZ4A 3AI2A 3PWKA 3R9WA 4C6TA 3MUOA 1CZRA 1Z26A 4HI0E 1G41A 2B8NA 4GWKA 5AW9A 4XCVA 1RFGE 3ETNA 5AK3A 1BXRA 3CRMA 3K9FC 5C1BA 1R9NA 2P6PA 3L04A 2WFZA 3BFVA 1G5QA 2JFQA 4RIEA 2CLDX 3IRUA 4WK6A 1MB3A 3ECCA 1QIDA 4FLMA 4FFBB 1NUUA 1UBSB 3AR7A 3LUDA 3RSHA 2C4NA 3O8DA 1RQGA 4NV3A 3FZGA 1DI0A 4P93A 3PXUA 1OU4A 4NE2A 3DDWA 3WZLA 1JMVA 3BWEA 1QNLA 4O4LF 1D6NA 4UVEA 3ZJTA 1F7UA 4YC7A 1SHUX 4JCCA 1OFIA 3ANNA 1CVLA 3ZXUB 1YS4A 2MOKA 3MT7A 4WFQA 5IXJA 3KR9A 4B3JA 3FWNA 1TE2A 3V2UA 3QHAA 4G0NA 4AJKA 1AGYA 4DAEA 4X7BA 1THTA 1CX9B 3LNCA 2EBHX 4HO1X 5IMBA 4U2GA 4S04A 3MLAA 1UDAA 2PV7A 1OLXA 4Z0NA 5E4YA 1VJTA 1NI4A 4R9RA 1Z4JA 3JVUA 4F2HA 1JZSA 2FSIA 4OV6B 4DREA 2IU6A 2KHZA 3N2ZB 4QUJA 3REGA 1D5WA 1Q0RA 1YMQA 1XXHE 4LTDA 5TPZD 3A11A 1WXQA 5M04A 1YUNA 1M74A 1DEAA 2B7LA 2HRZA 2XF8A 3SOPA 3SEQA 3U7HB 1J8QA 4BZWA 2I91A 2VPXA 4DRZA 3EPPA 4RNCA 1U3GA 4IR7A 5IHPA 5BT9A 1QOQB 2GXQA 2GXAA 4ZK6A 3G3EA 1XZCA 3R09A 4ZCRA 2I22A 1A88A 3P9YA 3PPIA 4UE6A 2D1QA 1ATZA 2ADOA 3CLSC 2OL4A 3DZ8A 2WTXA 4RVUA 3ADCA 1KK2A 1FTSA 1PWXA 2GN0A 2ODNA 4KFTA 4YP5A 3N2IA 4YAWA 4YP0A 3UOWA 1THMA 4PQGA 1PWEA 4PV7A 5LUAA 1EWKA 5DXFA 5FYDA 3MK31 1J9ZA 1JV2B 4KNVA 4WZAE 4MLCA 4B74A 4BBZA 4Z4QA 5CIWA 2YX1A 4P4GA 2FPXA 3QFRA 2FOXA 1MH1A 4PNHA 4LZJA 3DE5X 1WUJS 2NXJA 1HO3A 2XNKA 1ZLXA 5JEDA 2ID9A 2XQFA 3E03A 3RFUA 4D9FA 3TIGA 5AK4A 2YMMA 3BVPA 3WLMA 2WWWA 2DFNA 5FI5A 3O3MB 5KZMB 3HXLA 1Z29A 2F8LA 3N53A 3PC2A 2A57A 3IE2A 4DV1B 3DMYA 2OCAA 3G0HA 2QOEA 3IXMA 1NUSA 3BWBA 3B9BA 3OTGA 2XCSB 3PC3A 2R44A 4ZRDA 2GBGA 3JWEA 5KWIA 1ZN7A 2KB0A 2WIKA 1HSZA 3ZD8A 4OJQA 2OCGA 4ZEMA 2WSYB 2RGXA 2OZLB 1ZI9A 5DMHA 1GGHA 4Z7NB 3O31A 2CFOA 2FVXA 2M6SA 2ZROA 1BMQA 2Q3LA 2YW9A 5HQ3B 2JHPA 3TB4A 3I39X 1G63A 5C46F 3PHJA 3A32A 4YRFA 2NU8A 5CVVA 5BWNA 1TEXA 3KX2A 4XDZA 1I4WA 3ROKA 1E0DA 4URYR 1CP2A 1PF7E 4ZRNA 5THQA 3U16A 1NW8A 3CISA 4EBBA 4QTXA 4GI5A 2Z4TA 4BVEA 1PFQA 4OTZA 3LTEA 1DJPA 1GG5A 1DELA 2QBYA 4KWEA 3NRJA 2F67A 1PR4A 3TQSA 2QLFA 3C3AA 1B4DA 4CDMA 3O8OB 2CLCX 5AESA 1RAEA 2VDPB 1IXYA 3PDWA 1XTUA 5JPDA 2YFHA 4GYJA 4HHEA 1T2CA 2F3QA 3IVGA 5F3RA 1VJ1A 1JWLA 3BAFA 4P0QB 5MN4A 4F5ZA 4IV8A 4Z0TA 1PZGA 5IEBA 3B6ZA 2IL1A 2CXNA 2I6SA 5TARA 1LBSA 5FO1A 1T2UA 3TFWA 3V8PA 3WYGA 1DRUA 1FP4B 1FZQA 1RPAA 1WSDA 1DKLA 2FKAA 2WJAA 3I73A 3TKLA 5BN4B 3ZGXA 1LA2A 1QPGA 2G25A 4QJIA 2FW9A 1E2GA 1TKBA 5AMXA 1Z56C 4FI3C 4FMCB 1P3DA 2WBLC 2GM5A 1M67A 1P5RA 3L40A 3HP7A 1E62A 4EY5A 5GZ1A 1N2EA 4PZ0A 5EP1A 4INJA 1L7QA 2RBEA 1SXHA 5IXSA 3CE6A 4QPNA 4DR5B 1B41A 3V8EA 1WA5A 4FC6A 2GRAA 1Q0TA 4DLAA 5HIMA 4NEGA 1GSAA 3HXMA 4YFYA 2PH5A 2ZUDA 3E8MA 5ESWA 2GN8A 1P0FA 1O6ZA 1OZ0A 4BNIA 1AKEA 2HQ1A 3USCS 2B30A 3FFTA 3NXKA 3R6GA 2G5CA 4HXGA 1V8ZA 1IB6A 2OLEA 3PXCX 3CHYA 4TLMB 4G8DA 5ECWA 3CRVA 4RHUA 1Y33E 2H57A 1XUOA 3WKEA 3OCCA 2J5XA 2C1EA 5E0OA 1EFRA 4GYWA 4A0HA 2FRDC 4GZ6A 2ZIVB 2BH2A 1TVKA 3PIRA 4QGSA 3FBGA 4O2LA 4JBLA 2VSFA 1IQPA 3K6SA 5ALEA 3IPLA 2Y1EA 1NBIA 1F9EA 4ISCA 1VJ5A 4RORA 4TMVA 2XNDD 1P5JA 3FI9A 3H2BA 1QV9A 3BTUA 2GZ2A 4OAPA 1Y9DA 5HS4A 2WPDD 5FUMA 2ZRKA 4BVGA 2ZRPA 3I6BA 4MYRA 5DIFA 3UBMA 1TXGA 3ETEA 4QNNA 1WZ2A 1DBVO 3GJYA 4REQA 1NZDA 1Y8RB 4V2UA 2A84A 3DLBA 1JKJB 4LC0A 1J99A 5F7OA 1Y5RA 3PLAE 1ULAA 4X24A 1T6XA 3TKAA 1R6XA 2QTVA 1K5GA 1RQXA 2EXXA 4DT1A 1Q7CA 4EG1A 2HNBA 1Z47A 3KU4A 4QBKA 5BQ3A 5EE9A 1JU3A 3KQLA 1YB4A 4RIFA 1ETUA 4BQIA 2YHUA 5CYOA 2VCYA 4C7XA 4PVDA 1G20B 2WDPA 4EHAA 1KI7A 3AEYA 3IP6A 1RLUA 3IILA 4O4IF 2D54A 3QX9A 3HNRA 1DU4A 2YWGA 4XEHA 4ZT5A 4DMRA 1G4UR 4HXYA 4NBUA 4O4LB 4TXLA 7MHTA 1VGRA 2ZR8A 1WB6A 4MVJF 4QKQA 3FDZB 3OY2A 4N5IX 5I7SA 4QE3A 1NY6A 3QH4A 5JEEA 2P3OA 1ZKDA 1ADGA 1RBYA 2H4XA 3U4IA 4GGOA 3W2FA 2NPOA 3K5HA 1OFTA 4PYOA 4UZEA 3AEZA 3OPMA 3UWDA 1X7WA 1PL8A 4KO2S 3K2QA 4L3VA 5A3SA 4L9SA 5DIZA 1WZIA 1EE2A 3PL5A 1CNEA 1WY5A 2CLOB 3GIWA 4WA7A 1SXQA 1ZH0A 4HPJB 5GP1A 2WMYA 2P2DA 4HWRA 3L7DA 4RTSA 2BFCA 5FF9A 3L6DA 4CIWA 1BE0A 3Q11A 4IS2A 3NO4A 4H7HA 4ZEOA 1G5TA 1BVUA 1RWNA 4RZQA 5K0BA 3PG5A 2YHSA 1P73A 1ZL2A 2Y3IA 3AKEA 1IBSA 1IWOA 2AFHA 2C5SA 2VTBB 4ARSA 1IZ8A 4L8GA 4UM9D 1ZU4A 3RI3A 3EQ7A 3RE1A 1DZIA 1MRZA 4I14A 3Q7EA 4CMIA 1JILA 3F2VA 4FGLA 2WAXA 4JKIA 4QWWA 1SURA 4OHYA 1F14A 1JI3A 2F9MA 4NNOA 1UP7A 3CINA 3UAOA 4NAHA 3EZXA 1CERA 1ORVA 1T5HX 1ZM2A 2YDXA 3EXHA 4MQUA 1TJ5A 4O02B 5HP4A 1MC1A 3G7NA 1VIYA 4QQRA 4UULA 3ESDA 1EUDA 2VAPA 1DWUA 2AMLA 1G60A 4BXOB 3SLKA 2IYFA 4CMEC 3DXYA 3RROA 3PCXA 4DLLA 4KQFA 1SVUA 2C88A 4OHRA 3U4DA 5KSOA 3DL4A 1RM4A 1BZYA 1WDTA 4RGQA 1OFVA 5IXYA 2WJIA 5JAUA 1E7QA 1UBKS 4I66A 4L0QA 2PH7A 3LVBA 4O08A 4M1WA 4UU0A 5HRUA 4XPIA 1FFYA 1TMYA 5DH9A 1Y3IA 3M82A 4D0RA 2ESRA 1WO8A 3RRBA 4PNEA 5B3AA 2ERXA 2WVHA 3B6EA 2G4LA 2G8NA 3RVDA 2XTMA 4WKNA 1KNQA 2VT7A 2D0DA 2BP7B 1WX1A 2N42A 2B4YA 2NSLA 2BIFA 2VYFA 2YQ5A 3DXZA 4NZOA 4MPJA 4PEVA 2QB5A 4NNJA 1U0HC 2ZIXB 3EIXA 4OI2A 5E2AA 3W9YA 2ZZMA 1V45E 1ZH6A 1NFRA 2CLHB 3Q9UA 4FHGA 4IDHA 1UKZA 3JPWA 1AQIA 3IB3A 1K92A 1KIAA 4GM0A 3DVLA 5L3SA 2Q7XA 4QVKA 3EZ7A 4ZV9A 1HE2A 5GJVC 4CR6A 1Q2UA 2FZCA 3CF2A 3C5EA 1JFLA 4RMGA 1E6EA 1ZC4A 1LWOA 2IEBA 4Q3KA 4ARVA 4IIXA 2WUDA 5L4NA 1GZ7A 1KJZA 1SHKA 2FA9A 1E66A 2C42A 4PLTA 2E21A 1NKTA 4PQEA 4V0ME 4XYEA 4PPNA 4RV4A 3M4JA 4YAFA 5NULA 2O8CA 3IAS6 4MAFA 1PJ2A 2GN1A 3NB0A 4OYYA 4BTEA 1QO0A 1QIMA 4LJKA 4NZNA 1LLFA 3AJEA 3ZLTA 1VBFA 4DVGA 2X3YA 2HXSA 4DPMA 1PT6A 4OD0A 1Z6GA 1CUGA 1CUJA 5G1PA 1VPWA 1E3WB 1U7DA 2FXIA 2Q1WA 3IVXA 4GEGA 3HDYA 1FW8A 4JFRA 4MLPA 4YA6A 5EWLB 3SF8B 2BDEA 5BY2A 1QFJA 1YQGA 2NO4A 2X40A 2JFGA 3RRYA 2G9RA 3DFZA 3MT0A 3WSWA 4DG9A 3NHLA 4HTFB 2J0UA 5F78A 5AJZA 5AKIA 3EGWA 5DJ5A 2P6OA 4EKDA 1IQUA 4I81A 4GE0A 4MVWA 4YMIA 1C0LA 5TVGA 3SPXA 4WRRA 1E1KA 1T6BY 3B1XA 1DAFA 3RYCB 5IKXA 2TSYB 3CX6A 1PSZA 3DDSA 3PL1A 3U62A 3QP9A 3V00A 4ZDIA 1J39A 2XZTA 3EMKA 2PZAA 3Q2KA 1TJNA 4RVOA 5IFKA 2XKKA 3B1YA 4M55A 3QU2A 3SM9A 1TPZA 2P0YA 3OT1B 4RD3A 1UBJS 5ICFA 4L72A 4XFKA 1UZMA 4H31A 4M1EA 3MPUA 5FIUA 2HA7A 2OORC 4YTEA 1M6YA 1Z68A 3I6MA 2EARA 2IH5A 1WTAA 1MPTA 3VSAA 1P7YA 3VV3A 1BU8A 1BVYF 1NR1A 2XHZA 3AIOA 3F73A 1C9DB 1CZOA 2GBCA 3ML1A 4KAXA 1J0EA 2N9UA 2XCQA 4RK4A 3RUIA 3D8NA 1K8RA 4YNBA 4HC4A 2I4NA 3EOAI 4OHPA 4BNYA 1NVFA 3IA7A 2BEKA 3H4VA 4P4UA 4NDNE 1G3IA 3B3QA 4RXUA 2X6TA 1LBTA 1SU8A 2Q5LA 1XTRA 3JYQA 1T4CB 4HB4A 4MKRA 2MT9A 2PLWA 3EG9A 4RPJA 4Z2YA 4HYEA 5KYWA 4B7CA 3F49S 1HL7A 1LH0A 3AC0A 3IEIA 3R7WA 3RR2A 2RKBA 5CFPA 3LUCA 1E2NA 2VHTA 2X5XA 4R1UA 3M4YA 4PFSA 5AK6A 3TFOA 1NJFA 1JRLA 4AG3A 5KUTA 1SKUA 4JN6B 3WXBA 1ZCBA 4JJEA 1XMOB 2VJKA 4RGBA 2JI6A 5BN5B 2Y0CA 1W36C 1ANKA 5EUQB 4IILA 4MB0A 4XTRA 2VF7A 5TJ9A 3AWIA 2AS0A 1OC4A 3HCAA 2WJ4A 2PMWB 4AY6A 2V55B 3HRKA 1A8PA 4C6RA 3GRAA 1TJ3A 3LLMA 4R2MA 4ZTZB 2J48A 1NIPA 1ZR2A 1IQRA 1ZG3A 3BIJA 1F2TB 4ND7A 1TC2A 2AOWA 2D0OB 3CLUD 3EA4A 5DKFA 5EIHA 5F7JA 4ZJZA 1LPSA 4HS4A 2R1TA 4E5KA 5KC8A 3CT4A 3TD9A 3GVIA 3H5NA 3RH0A 1R8XA 4AF6A 3HL0A 4D3DA 3FDXA 1T24A 4FCTA 5JZ9A 4W5TA 1CJSA 4O0MA 2GZHA 2UUBB 3VNUA 1HM5A 1R5BA 2ILTA 3ROMA 4PHGA 5ILGA 1POXA 4KUHA 2M1XA 3AY7A 3HDQA 3IGFA 4LWPA 3R3UA 5DF1A 3NUQA 4UC0A 1C1YA 4MQ4A 4PO3X 1OAOA 3O21A 1UEIA 4Q0MA 2EV9A 5A3VA 4B80A 2F1IA 4C01A 5L9AA 3ELBA 1Q1EA 4H7KA 4PXSA 9LDTA 4I1PA 2V96A 2PQ6A 1VCNA 3QNWA 3T1NA 1LI4A 4F71A 2BRUC 2AG1A 2H92A 1Z0AA 1DWQA 2MMCA 2A9VA 3DDOA 4I5IA 3MIIA 3A6KA 4EQZA 3ZWMA 3RSSA 1WBDA 2QYSA 3C8HA 1U0TA 1ZBQA 5K0NA 4E03A 4LE2A 1T3HA 3OHMA 4DM3A 4MWZA 4KWHA 3AWDA 3PQ4A 2X19A 1SGWA 2W43A 3LP6A 4FYXA 3UMVA 5C18A 2JLQA 4LMRA 5IK2A 1A7JA 1XD8A 1YE5A 2L19A 1E0AA 4WLUA 1A95A 2W9XA 3AUFA 3P4XA 2OESA 3GYGA 1Z8HA 1ZA1A 1GD1O 3OCJA 4M9SA 3I04M 1JR3E 5JSYA 1ISRA 2AIRA 4UARA 1G20E 4WCFB 3PFFA 1QP8A 3A1DA 1TQDA 3KOMA 3P94A 4XDYA 4NK4A 4BNXA 3Q8LA 3NM4A 1YK0A 4MV8A 4RSGA 2YJGA 5BOVA 1NW3A 3EAGA 1I10A 1Z0ZA 1EHCA 3FKSD 5DM70 1U0LA 3STXA 2ID7A 1ACMA 2G1AA 3KJEA 4MPRA 2H6EA 3SWWA 4GLJA 1A0OA 3WL7A 1QHGA 3V7UA 3GZJA 1N75A 2P2GA 2PRIA 3GA7A 3VC7A 4CR8A 1SOAA 1U5CA 1XE3A 3UPTA 1HLGA 2J3KA 3JX9A 1SD2A 3K5WA 4QTZA 5TF4A 1W35A 2EJWA 4C4AA 3BXFA 4UUNA 3DULA 1I94B 5DGDA 5HIKA 1R8QA 5KIAA 4G86A 5JNSA 5BT8A 3E53A 4HG2A 3VR5A 3UYLA 2XRYA 3SNHA 2IHNA 1HI9A 1W46A 3FMVA 5DM2A 3U19A 4GMXA 5DYNA 2QP9X 2COUA 4LPSA 3LCUA 3NIWA 4HQ0A 4XM2A 5I5GA 3TQHA 4YWHA 1H9AA 1YCGA 4LY9A 2FPWA 3FMFA 5ERXA 3RS4A 4TMYA 1F3OA 1UMBA 2OOKA 4AP6A 3ZU6A 2ZSUA 2OHXA 3MWEA 1S02A 1NYTA 2FN3A 5J4YA 4A3SA 2EERA 2G7MC 2WFMA 4YAIA 4ZO7A 5I9MA 3PS9A 4DEVA 4TYQA 1IJKA 3H5TA 4LJ6A 1T6NA 2RHRA 3ZDBA 2OQVA 3FOAA 2GD6A 4YR9A 4MO9A 2GMWA 3URKA 3GMDA 1OFGA 3Q72A 4QAJA 2QVGA 3EZGA 3G2NA 3O8NA 2GJ4A 4V03A 3SF0A 2QF7A 2OV8A 3HDHA 3LQRA 3QE4A 3Q88A 2AMYA 2HTFA 4NV1A 4Q1EA 1ISPA 5EUBA 3LDGA 3LF1A 4Z4EA 3J81A 2Z09A 1UBOS 1RLMA 1S1MA 3KBBA 4MR9B 2JAPA 4RXTA 3TBFA 1X80B 4MS3A 3ICEA 3O92A 4JHLA 4JB0A 3FKJA 2XADA 5FUXA 3QPDA 3JQAD 4QVGA 4DYDA 4M9XA 4Q48A 2RCYA 3A4LA 3IEKA 4PE5B 1EI9A 1T2FA 2X14A 5FAXA 2QIPA 4HYYA 1GGFA 3H6HA 1E1MA 1EUCA 4IHKA 4Q7MB 4QREA 4EJMA 3ASVA 3U7QA 6REQA 3CKKA 4R98A 4E5YA 1G66A 2R62A 5EZ5A 4EITA 1P2GA 1JFFA 3Q8KA 2A5YB 4BZXA 2QTNA 3DYIA 1MB0A 1R8YA 1U3TA 3K2IA 3WFIA 1R15A 2HB6A 1T2DA 3DZJA 1KSFX 1G2PA 3DEHA 4BRWA 4D2IA 2JKVA 1RRKA 4B34A 5IX8A 2JI8A 4R0MA 2GKGA 2V9CA 4FP9A 5REQA 1P6XA 4QXOA 1LDGA 1U8FO 4BLPA 2PUEA 4RUKA 5CCBA 4RF3A 1KJ9A 4JASB 3LUHA 3I2YX 1MABA 2P27A 4ZVQA 1CUFA 2AOUB 4I1RA 2RK3A 5CW1A 1BXGA 1FRQA 4F4UA 2QVCA 1W48A 1XQ9A 4QFMA 3CURA 1IBCA 1E6KA 5HNKA 1GM5A 1B3RA 3BDVA 3V46A 3VZQA 2C94A 1MB2A 1XK7A 4XB2A 4L9RA 5HPYB 4BFWA 1ZIDA 5DU2A 2G09A 4KV7A 3H3XA 3GA5A 2R1ZA 2OSVA 4RLFA 4XGRA 4X92A 2UYYA 1DQPA 2W6ID 1LSJA 3JD3A 1ABEA 3CH7A 3NOVA 1U04A 2A7QA 4K6CA 1S8FA 4TUYA 5FADA 3TEJA 1R8SA 3NFYA 4MO2A 4E6PA 5JD4A 3KB6A 5MN6A 3AYXB 1BGWA 1Q3TA 4MS1B 2GA9A 4J4BA 3UANA 3D54D 1QLHA 1R4MB 2RGEA 3F7MA 1E58A 2HU2A 5AM2A 2AYZA 2IU0A 1NP3A 4G0WA 2ZS8A 3A25A 4K6OA 1YO6A 1HKUA 4BIMA 3OZCA 4GM4A 4QLAA 1PFWA 3NDRA 1UFKA 2R8YA 2YYSA 1K2WA 4EKNB 4EKEA 3LQ2A 3V4RA 4JLNA 1SHLA 3VU9A 3PI7A 4JJ4A 3DFUA 3UMBA 5KMGB 3LP8A 4QBFA 5DM4A 1AKWA 2H1FA 5KTRA 1XDSA 4LJRA 3RT9A 2EZTA 4HH1A 1PEKE 5AJHA 2VRCD 1QLJA 4Z7OB 3IO3A 4A82A 4EMBA 2IY8A 2OHHA 1L5HB 2CFRA 3MTJA 4NYIR 2I4IA 3JZDA 4MV3A 2G08A 3LHDA 2VK4A 1ZITA 4AC9A 4DLPA 3T94A 3B38A 1QFYA 4DMUB 5LXTF 4QUEA 1Y3DE 1KKUA 2WFLA 4E5MA 1Y7LA 1H6AA 1YRBA 1Z6QA 1BQEA 5DV9A 4F9FA 5KJFA 3SKYA 1YZFA 3DLTA 4QPPA 4LZLA 3WAGA 4CCYA 4KITB 4E1AA 4NMLA 2E48A 3EQ2A 4CMIB 5KVCA 5ICMA 1S8AA 2JHCA 1IN4A 1B0PA 1KKMA 3SEZA 4G4GA 4X3CA 2XVMA 1L4LA 4E33A 4ZICA 3H9GA 3NPMA 4Z49A 1O0CA 2BFDB 1BX1A 2BKLA 1O6CA 1FYWA 1PQWA 1ZMOA 4JWKA 4QXRA 1P2DA 2ZT7A 3OPYI 4JQOA 5CFMA 1XPOA 1M2OA 1USGA 2JLVA 1CEEA 2XUHA 1SVOA 3DEIA 2RDMA 3AUJB 4ZAYA 1QO9A 3H5VA 1JDBB 3AX6A 5KHAA 1RMTA 3L0ZA 1T36A 4E4RA 2VATA 3ADPA 3DXFA 5DGTA 1FYVA 1U11A 2WWTA 2PX0A 3R3YA 1WXIA 3ONDA 5DVZA 5B4UA 3KD2A 1LSUA 3C15C 1XZAA 3PEVA 4HL6A 3MS4A 2SHKA 5CMLA 3DB2A 4DJAA 3DCNA 3FI0A 5FPPA 3X43A 4EYGA 4TYWA 2QD5A 1TUBA 3H7AA 2RH9B 2BFEB 5CUQA 4PSAA 4WJLA 1I2ZA 1WE2A 1CY8A 5ER9A 2A5DA 2QDXA 3SSAA 1H2BA 1II8A 2C5GA 4MVJE 1A9XB 4F8EA 1HGXA 5LQJA 4CDNA 5EJ8A 1RRVA 1AGNA 1INLA 1DV1A 1V47A 1U3CA 1WQ3A 1EVYA 1KA9H 2WG2A 4QAQA 3HYRA 4K9DA 4KI7A 2QI9C 4RD2A 5HBRA 2J32A 3VR6H 4PN3A 1X7HA 4F0JA 1KKLA 1C9YA 1D0IA 1JXAA 3QF7A 4G1BA 4NE9A 2EQ5A 5TQVA 3UJNA 2WJZB 1SQ5A 3IP1A 3LOQA 4WCVA 4JT4A 5H70A 1RKBA 1VE3A 4O63O 1RYHA 3N5CA 3ISTA 1C3EA 3T4UA 4F4DA 1KHHA 1D9XA 4FSDA 4MKXA 4MPPA 3A27A 2ZCJA 1UBEA 1NMEA 2Q5QA 4L07A 3NGLA 4QXPA 4LYDA 5I9TA 3HCNA 1T9KA 2YV1A 4I3HA 1UXOA 5KOJA 3H2GA 2EEZA 1XZFA 3Q7SA 4KZKA 2NAPA 2P8SA 4LOLA 3BT7A 4CQMB 3IDOA 4OHUA 3HPRA 3TCKA 4ZMBA 1BX0A 3V4SA 1WDKA 1H2HA 3Q9SA 4JP8A 4CM9A 2EIHA 1KQ3A 1YVUA 2I4MA 2VXYA 2XI4A 1TMGE 2NQ8A 3JCZA 2KMLA 4LXUA 3N2GA 4S2UA 1L1FA 4M1QA 1ZUWA 3C6XA 2W2LD 4ZJYA 2ZI7A 3DHNA 4DV2B 1SCNE 3L3BA 2VBGA 5AI9A 4EJFA 4FILA 2VXOA 3U81A 4D9HA 3A0UA 1JT2A 3B85A 2AJBA 4L0CA 2JIZA 4LYYA 4LSGA 3X2EA 2IS2A 4V38A 1OAAA 1CUSA 1VM6A 3L6RA 3KJZA 1V71A 1XQVA 5HOEA 5KREA 1PW7A 4NY1A 4ZJPA 5BOSB 5FH9A 4QFDA 1FDWA 1Q74A 1IULA 3BS4A 2VDVE 2CF5A 3NNSA 4DC0A 4DDTA 1LNZA 2NZJA 2NYRA 2PPVA 3E7XA 3Q3HA 5DX1A 1GL9B 3G85A 4NBSA 5F5XA 5BYAA 2PGLA 1AZWA 4QGAA 4KFUA 1ESMA 1VA4A 1V5EA 1K0FA 3KXKA 1N9GA 3NHUA 4HDMA 4QJ4A 4D79A 1NXTA 3B3JA 1EDZA 4TWZA 4YS6A 4ER3A 4LF7B 2IS6A 3THOA 2DT8A 3VPGA 3V7FA 1JH9A 1W88A 1X7XB 1Z5NA 4LV5B 2O14A 2H59A 1PKXA 3HI6A 2DULA 1GV0A 2EU8A 3C45A 4TTPA 2O07A 4JA2A 4D25A 3SKXA 3UMFA 4E5UA 1ENOA 3QPAA 2WNHA 3MBKA 1LZKA 4MW7A 1K6MA 3G8YA 1QYIA 3AERB 1ACLA 3DO5A 4QT0A 4DV5B 4BVBA 2YWEA 3F5MA 1C1XB 4I36A 4ZPJA 4IV5A 4RGVA 1G1AA 1Y37A 1W0CA 1KETA 4JLKA 5CJJA 1TYBE 1J24A 5EJFA 2BTQB 1E6CA 3NWEA 4EUFA 4L9WA 1Z4IA 3HSSA 3F8TA 1FNNA 1G8JA 2PSJA 3CZRA 1ZMTA 3IDAA 2O0KA 4RD0A 4YAEA 2W8BB 3QMPA 4AS1A 1DAPA 3DFFA 4NMWA 1JYSA 1KJJA 4B45A 1UT8A 3MJ4A 2I4LA 1Z25A 4FFVA 5I7WA 2FPPA 3NGMA 1Y1SA 5TS3A 1GJRA 3O91A 4ZALA 1VPVA 1NNLA 2GHIA 3AI1A 4HY3A 4MCAA 1J20A 4RKWA 4EDHA 2GJ8A 4LZWA 2ZBRA 2PE5A 3QXSA 4IGFA 4EYSA 3EFOB 2BCJQ 1CG6A 1M2HA 2VWHA 5DX0A 3M33A 5F64A 5JBNA 2F1HA 1KI6A 1U8ZA 1JB9A 3K9WA 1UWCA 4UHJA 1MDFA 3OD5A 3OPQA 3L4BA 3JQBA 4XD2A 1S3GA 2HMWA 3CNOA 3SDSA 4F4HA 4JYBA 1YJBA 3BICA 4V0LA 3TO5A 2CXOA 4D4MA 2HQRA 1J8MF 3DOCA 4R4JA 3UK0A 1N8TA 1X86B 1LV7A 3DGEC 3IT1A 3ZK8A 2ASVA 2QUZA 1D2MA 3KR0A 3L0PA 3ZXSA 1E60A 3JD4A 3RHTA 4DR3B 5B64A 1Y8AA 3DTVB 3CJQA 4TLDA 4BPBA 2HA4A 1NMYA 1KVQA 1UAYA 2J3DA 2RAVA 4X44A 4B1FA 2FW7A 1SR8A 3QLEA 3OEHD 2HBYA 3W8FA 3ZHYA 1UXIA 4XM0A 3ZHUA 4U5XA 1L5YA 3KWMA 3FDIA 2ZJ3A 4KN6A 2J5KA 2GDZA 4ZIRA 4IIJA 2VNJA 1PVDA 5JS7A 3H1AA 5FQOA 4DLNA 3WQSB 3FKQA 3HSKA 3ROTA 2QJRA 3N05A 3FXAA 2OHOA 2QR2A 3GRYA 2GI4A 2NYVA 5L53A 2V5AA 2XUQA 2X4GA 4BECA 4YMHA 1GIAA 3D6NB 5JT1A 2FPRA 2YIVX 5ITSA 1F60A 4HRYA 1U2TA 1K4KA 1DUSA 2AB0A 4Y9UA 4DBLC 3D7MA 2AQKA 1CF2O 4JU8A 1ECJA 2RHLA 3LL4A 3AV0B 3UV3A 1VYVA 5DK4A 2QUBA 2IDZA 4XM1A 5B2FA 1E2JA 4B3TB 1A82A 4ND8B 3JARA 3PQFA 3QK7A 4LDJA 1DBWA 1M6VB 3H13A 5GIOE 3ZI4A 1TC1A 3UUFA 4BNTA 3SBOA 2B61A 3EVZA 4LISA 5HKOA 2D00A 2ZOSA 3RGWS 1ZZEA 2FHPA 3K9BA 3T7JA 5SZKB 3C48A 1J25A 1GG8A 3DG9A 4G5OA 1FBNA 3LZ6A 4R9NA 1HY3A 5HZMA 1AMNA 3GBSA 2PX6A 3D6TB 3KK0A 3JRXA 2VSNA 1H5QA 5FV7A 2WOOA 4FZVA 1FUKA 1QNFA 1H66A 5GV8A 1I3NA 3AMVA 3JS5A 4QM7A 5FKJA 2C57A 5CXUA 4KXXA 1RRPA 1G5RA 3N76A 2CJFA 5GONA 5BSUA 4HMQA 3PCRB 3SYRA 2E1PA 5JRJA 2XUFA 1Z38A 4LJAA 2JLCA 5IT5A 5EJ5A 2GAJA 3DZFA 4BFVA 3BKXA 1L3CA 1KMCA 1WZNA 4WADA 2I55A 2Y0BA 3N0RA 3NBKA 1C3JA 4TT3A 3MUEA 4E2FA 1LBEA 1RAGA 3GHHA 4ZYZA 4FJ1A 2QT9A 3HJUA 3C6MA 3GA0A 4FFDA 4Z7QB 1D09A 1QJ4A 2WPNA 3K1AA 2EWMA 5DTRA 4KBYA 3OKCA 1J4AA 2FX5A 4G0VA 3HJFA 3OIWA 4OUKX 4OFWA 1AMOA 2QM3A 4IAOA 1ODSA 3B1KA 1TEZA 2QZJA 3OCUA 3OOYA 1VKOA 2XVXA 4MJ3A 3P2OA 4Z86A 3L9XA 1AKNA 5HKAA 3V4PB 3SIPA 4XW2A 2NZVG 4LRWA 4CM8B 4JVOA 3OJEA 1L1EA 2D3TA 3PHIA 1Z7EA 4MA0A 4WNCA 1XZQA 5CIYA 3OO1A 2RH8A 3P27A 5H16A 4RPLA 2V0GA 3ESBA 1HH4A 4QZVA 3WQHA 3KD3A 4QQFA 2GHRA 1YI1A 4YH1A 5DW3A 2GRUA 3PC4A 4B2IA 2ZR9A 3E5MA 3RTAA 4ZU1X 2IV3A 4EBFA 4TKVB 5CDFA 2V0CA 1H2RS 2DPXA 4QXMA 3AR8A 4CMKA 1N1GA 2WAAA 3FROA 2GA8A 3I04A 3OA0A 4JLSA 3UJAA 3OPYB 4RZ2A 1A9XA 3MTGA 4DCOA 2OC9A 4RKYA 5C5IA 5DNYB 3JYPA 2HCJB 1DDGA 5J2TF 3VBEA 4CT4B 2DQYA 2WA1A 2J6CA 2KLHA 2WW8A 1E6UA 3C3EA 1PLKA 4WKBA 5EQJB 1PNOA 1GDHA 1L4FA 3LC1O 4TRRA 5BRNA 5A04A 2FN8A 1DXOA 2IXGA 3NIBA 1RHJA 2B36A 3PSAA 1V96A 4HP8A 2WT8A 3A6PC 2BZ0A 3KE8A 1NP7A 2ZREA 2DPHA 2FZEA 3ZW7A 1VLVA 1Z0JA 2PX3A 4MAAA 2BHNA 4MV0A 4PGGA 5LA6F 1VE1A 2WP0A 3FPKA 5IAOA 1ORRA 1VMIA 5BNWA 1NDQA 4J6EA 1MJFA 2PZKA 3R0JA 4KDEA 4EY4A 1JYFA 2FEMA 4Q4AB 2C4TA 2IHVA 1Q6ZA 2ZWMA 2NVUB 1FDVA 4D3SA 2JBAB 1MIOB 4WBNA 2FP3A 4A16A 5AVYA 2VVTA 3VR3D 3LS2A 5L40A 2B6HA 2Q1XA 3HJNA 3QV1A 1D2NA 4ARUA 2CMDA 1RM3A 2ZSFA 1MX1A 3IKMB 3EIEA 3WC4A 4M8IA 2WHYA 4HDSB 1YFZA 2J5RA 3JQQA 3GLFB 3UHPA 4N7JA 3VKVA 2PUAA 1C8BA 5BNZA 1C3XA 5K3AA 4TRNA 3TZLA 5JBQA 3MTDA 4P08A 3OQIA 4CL0A 1OXSC 1NQ5A 3BERA 4D4IA 4F4IA 2YVQA 5IASA 3A1CA 3LPDA 3EZ9A 1AGXA 1PR0A 2MSLA 3O47A 5AOVA 2VP0A 1RU3A 1YXMA 3WBJA 4Q39A 1OGYA 2H31A 3C14C 4QGGA 2QRVA 3PUWA 2O8FB 2J87A 4Q6BA 5SYAA 4L5CA 4YXFA 2OVBA 3ZV6A 2YTZA 2PSDA 2ZUTA 1UM9A 1S7GA 3A37A 1GQYA 2Y76A 2X0JA 4Q7KA 4X7MA 3UB2A 1UDBA 2NW6A 4XCQA 4BRZA 4C04A 2DHEA 2PZMA 2RC5A 4KREA 5CA0A 2A3RA 4C22A 4OI0A 5IF9A 2DBQA 3ITDA 1R6TA 4GMDA 2CE7A 2CK3D 4N6NA 1GZ4A 3Q3IA 5JNWA 2HCTA 4P7BA 4YUYA 4OVKA 4GQBA 2VTVA 1ISSA 2HA6A 2YVLA 3DKPA 1JX6A 3U3OA 2WLTA 3CR8A 2FE4A 4MWBA 3LA8A 3N59A 1P1JA 5KTYA 2CV0A 1XXHA 2G9NA 1W5TA 2JLSA 2K4MA 4GI2A 4YPFA 4W99A 1W76A 4FDAA 3EEIA 1PG2A 1UK6A 1XD2B 1H4TA 1NXVA 2ST1A 1CCWA 4H7IA 3K7EA 4UCWA 2Q5FA 1T43A 2E4XA 4FLFA 3JD2A 3GWZA 3A1NA 1N4AA 1APBA 1FJGB 1AC5A 1B0AA 2UV8A 3SVLA 2JDIA 3DLPX 1DTWA 2FWRA 1VBKA 3CLTC 4M54A 1CZHA 4NPAA 4YUAA 3KTOA 2ZPAA 3HYLA 5KTKA 1E1RD 3ANTA 3ITNA 4FVTA 4AZWA 1CBUA 1XU7A 1VB3A 1LD3A 3OPXA 4WZAA 2WYHA 4X94A 3UZUA 2JJYA 3FYUA 3RASA 3HBLA 1QHHA 1C3LA 1DFGA 4C1BA 4DNOA 2FX3A 5B55A 5KOHB 4PWYA 3N07A 4RMJA 2UZ0A 1DO2A 4MQFB 1XAGA 2WINI 4NZ9A 5PNTA 4B87A 1B15A 1QAOA 2Q3EA 2VBIA 2HHCA 3AFOA 1II0A 3BFXA 2Q8NA 3K9HA 3LZCA 4JSRA 4YRRA 2EJCA 3NLLA 2ZVPX 5AKXA 1EINA 3D5QA 1VECA 4YJ3F 2HIGA 2V1UA 4GO1A 4DIOA 1PJ3A 3K8YA 5J9FA 1EBBA 4M0LA 5LP6A 1Y3AA 5EFOA 1VHWA 4XKJA 6ADHA 3ME5A 3BQ9A 1TFRA 2AN5A 2VT3A 3IDZA 1YC2A 1WKBA 1FVXA 4G4IA 2CV1A 3S0JA 1UQUA 2FV8A 4OHMA 4UMFA 4FLEA 1PN3A 2W2XA 4F85A 1DAHA 4KYUA 2B3TA 4AJIA 3DOEA 5HXAA 1R74A 3AF6A 1K7YA 2EFJA 4E0BA 5LR6A 3FHOA 2QNIA 2IITA 3DOOA 5JY6A 3IUYA 4DCPA 4ABTA 2BM9A 2I7XA 4RD4A 3QI7A 1YI8A 2Y9PB 1C9JA 1XRJA 1XTJA 3DBHB 2KS6A 4PZAA 1VXRA 1ST3A 3KYCB 5EJMA 4BNWA 1EH5A 1KNXA 4U63A 4K7JA 2WD9A 4E1BA 3PNYA 4MUYA 1E2BA 1IFXA 2AI3A 2DTEA 3WFZA 1URPA 2J3HA 4DJJA 3D7KA 4K2HA 4ZVVA 1KU0A 1ZM3A 2WD7B 2J3LA 5KNDA 1D1SA 5EP2A 3ESCA 5JVDF 1XAHA 2Q28A 2DJIA 1KY4A 2P30A 1N8KA 3KEMA 3T0IA 3UWPA 1Y8QA 2C2WA 4D0SA 4CKXA 1ODIA 1EFVB 3SBEA 5JSUA 5IH3A 4MA5A 2QN8A 2WLSA 1YCDA 4O5OA 4N7RA 3R20A 1OC2A 4JBXA 5CFZA 4HNTA 2GYYA 4TTIA 4J8PA 4YMSA 4AKIA 4QPZA 1OT3A 4GQIA 5AQ1A 4NLLA 4KVZA 3TCXB 4U7PB 4DRYA 2CKMA 3DZHA 4MLDA 3TE7A 3UKOA 4HYQA 2QMYA 1QX4A 4A8TA 2CCGA 5LB2A 4FB5A 5BR7A 3BIOA 3KYDB 3P2IA 4W5QA 4PG5A 4ID3A 2YXLA 3GPDG 4ZAVA 4GOXA 1SAYA 2QX9A 3QEMA 1D6MA 1JSRA 3SYTA 4RULA 2BEVA 1SWVA 3PQDA 2LBPA 4B47A 4WNIA 1ZJJA 3EULA 5HF5A 1TTTA 1NJGA 1WPGA 5J2TB 4ETWA 3DE7X 2PO5A 1KZ1A 4TKMA 1HFKA 3VPCA 3BXGA 1VOTA 3EVBA 2AUNA 4LQDA 3QFFA 3P8ZA 4NJMA 4C89A 4DILA 3QKRA 4U39A 3TAHA 2CSXA 1UK9A 2J67A 5BWCA 4GPAA 3OTQA 4PHHA 1KEVA 2DFVA 2RK6A 5ES4B 3QA3E 1BW9A 2P40A 5LA6B 1WB5A 1G0NA 2X2EA 2XDWA 3E05A 2XT9A 1U5AA 4I5FA 4IP0A 1NBOA 1EK1A 1K7XB 3NOXA 5JQGF 1PO7A 2R96A 2IZ7A 3TLGA 3HL4A 3LAWA 1JHDA 1CC1S 3FOEC 1R1DA 3CUEF 3W7AA 4E5DA 1MAUA 5KINB 1L5WA 1ZFNA 4MKHA 1RE1A 4F56A 3S81A 1JG6A 1VPEA 2JC3A 2YVUA 1FX0A 1CQJA 2OHJA 3IBTA 3K6KA 1UMCA 4ZFNA 1F6BA 5HKBA 4J1TA 4ZYTA 3L8MA 2I33A 2XUDA 3T3GA 3I9NA 1CQIB 2NNWB 2AOXA 3C87A 4F3RA 3DMPA 2X7JA 3TLMA 4HAIA 3QYFA 4U2KA 4DCJA 2C2YA 3QV2A 4JB2A 5A6VA 1ZO8A 1YJQA 1AN9A 2I7DA 3ZCPA 3K5IA 5CAEA 5ARBA 2PUWA 3VZPA 4JJ6A 3BOSA 1OW3B 2ZTHA 3M70A 3B70A 2VUHB 3AESB 5C1DA 2CV2A 3U44A 4DR7B 2DQKA 5E9QA 2KW5A 2R47A 3C7CB 3COPA 1Q0UA 4MVJM 4WCDA 4X1IA 3ZS9A 4C29A 5CB0A 4JJ7A 1KI2A 1BRMA 2V4UA 4IDPA 2QAGC 2P9GA 2LD4A 2CVHA 2W11A 3DBIA 4ZU6X 1RE0A 3DJYA 3EVCA 1EHIA 1SN7A 3FR8A 4ZAFA 2OBNA 3E7DA 3ID6C 2JFZA 1R12A 4ALLA 3P9ZA 1DP4A 2CHGA 4KLNA 5C8VA 1RJDA 2Z5FA 1DE0A 1L8QA 1US8A 2H51A 2PLAA 5CBPA 4NMMA 4RY9A 1WV1A 3LT4A 1JDUA 1MAHA 1W6RA 3JASA 3NIFB 5FFMA 3PXGA 1GPBA 3I5MA 5TRTA 1O6FA 4NG5A 4TROA 1J07A 3FY4A 4KIJA 5JO0A 3VTFA 4EK9A 1VSQA 1ABBA 3UMYA 1JIJA 1HQKA 4X20A 5LDDC 2AEFA 4UTVA 1W4RA 4PXYA 1R0YA 2QZSA 1FU7A 4F6RA 1X0VA 2OAEA 2XYVA 4RL6A 3GLFE 4MQ6A 4WINA 2XKBA 4HFJA 3U9LA 1ZGJA 1KYVA 3T52A 3VOAA 4DIMA 1TQ8A 3QOYA 2I8LA 3I0MA 3AXTA 3I2JA 3DDHA 3WRWA 4FFBA 1EX1A 1DOAA 3DLIA 5FWXB 4YEDA 3ZX4A 1ZOIA 5J63A 1DLIA 1ORTA 4RIHA 5FTNA 4FHFA 5HKLA 4YMUA 4PSDA 4PYLA 1PJBA 1UBLS 1NE7A 2C4WA 1GL6A 3LHIA 3T9BA 3DMTA 2DE0X 2BN4A 2PUVA 4DYHA 5JNVA 1RPJA 2YWBA 1PFKA 1H2WA 1QCYA 2JNWA 3K4PA 1O94A 5AH0A 1W0JD 1NOKA 4YJ3B 3RSOA 4C7OB 1VI5A 3QLUA 2JF0A 2VF4X 2COKA 4R6WA 2AJCA 3O2QB 4Q9NA 1P62B 1RBQA 3KS9A 2IP4A 3SGLA 3TDKA 2WVAA 4YCLA 4B76A 2I8CA 3I2HA 4DIFA 3S6JA 1PJLA 1GPMA 2Y1DA 3H18A 2E82A 2MJLA 4TTVA 5EHZA 2PZEA 4LRXA 1Y9AA 2YOFA 3PDCA 2ONKA 3KB1A 4PHTA 3P96A 4M60A 3DVAB 3QX3A 1E2KA 3QBTA 1YNSA 3LBAA 1CUVA 1SIOA 1R0KA 5KDDA 4ZV7A 3A8TA 5HCUA 5ALFA 2PWBA 3PTZA 3RIGA 1FDOA 3KT6A 2XXBA 4P84A 3U9SA 2NM0A 4LYAA 2KLBA 1RJWA 3H65A 1KDOA 5IBPA 2ZJ8A 5IUJC 1HK7A 4LF4B 4LBVA 3NHRA 3PA8A 1V0JA 1E69A 2XEDA 3A4VA 3RIEA 4YRBA 2ZAMA 3FIUA 5JVDB 3TNDA 1ISGA 1CKEA 2RGGA 4D4KA 1A5SB 3EQ6A 2Z2YA 4B6EA 3CR3C 4R2WA 5T3UA 3ZWNA 1L7BA 1XRSB 4FFWA 4RENA 3C3YA 3RFCA 3SVZA 2QLMA 1Z0IA 3KWLA 5DXAA 4M9CA 4AZTA 1AGRA 5J5VA 1CNMA 4O6VA 1II9A 1MA3A 2GBLC 2QVLA 3PF8A 4ETMA 4N8DA 1V7CA 3D0KA 1JN0A 5FI1B 3CVUA 4YCJA 1O8CA 1WF3A 1KK3A 1MJGM 2VRWA 4WERA 1OROA 1T0UA 2ATEA 5DM0A 3K0SA 2H48A 4HUTA 4JBYA 1OV6A 1TM3E 1Z6AA 1OPRA 4J1NA 4UFOA 3AUTA 4YRDA 1KH2A 2FUG6 1EPUA 3AG5A 3ILXA 1CY7A 5KYGA 2ZTUA 1WB9A 1SXGA 5AHRA 4Q05A 3WRXA 4DIUA 2OPBA 3UOGA 4KMRA 5LQUA 2O4CA 2XY4A 1IIRA 4HDAA 1ULBA 1EJ0A 2OZLA 2MSDB 3IOEA 3LUAA 3R5XA 4UUPA 2ZB4A 4UTRA 4I9UA 3VM6A 5HQ3A 5IDWA 3IDQA 5FXMA 2JZNA 3QKWA 4CG1A 1VQ1A 3N3BC 3H0KA 4RSRA 3D7RA 5JCOA 2Q3DA 3IP5A 3KL4A 3NTLA 4OH1A 1DX4A 4UMVA 1EIZA 1VCMA 3FWPA 3HS3A 4IFBA 3E15A 4LNAA 1JPNA 3BXXA 1XYGA 3RAJA 5KYNA 4UNIA 2EHDA 1IN8A 3C8UA 1JVBA 4KVAA 4JEMA 4ZVUA 2YHIB 1Y1PA 3TW6A 3TRJA 5CNIA 3L0BA 3T1VA 2AUMA 3ZYCA 5JYCA 4UCXA 2OK8A 2O54A 3IJEB 5KSYA 1UPFA 3AFMA 1RWMA 3BE5A 4W1SA 3OM1A 2CXRA 2QTBA 3JSAA 2CCJA 3KVVA 3WWZA 3O8OA 5DEOA 4E46A 4XTCS 3ZWYA 1PDWA 2HJSA 1AQ6A 1ZGCA 2YBEA 3HKCA 2C4KA 3LX6A 1LVGA 2DX7A 2VLBA 4GL4A 1XSEA 3V33A 4ZK2A 3C16C 3O03A 1KI1A 2XNCA 2RH5A 1LS6A 4LJ7A 5JE8A 4RTJA 4KQHA 1OHHA 1JNXX 2RAFA 2GN9A 1J90A 5I9BA 2OGWA 2AXNA 4X8MA 3AL0C 3GJSA 3PQ6A 1FP4A 1AOXA 1XZNA 2VH1A 5HF9A 2ZIWB 4L5AA 5DI3B 3VJMA 2DFKB 2CUTA 4O2RA 5BN4A 5LZ4A 2BM0A 2V65A 4MCIA 1L3IA 2IIQA 1OASA 2PWAA 3BQNB 2O8DB 2LNDA 3W1VA 1E3EA 2PS1A 2V7QD 3KJIA 3PRKE 4DN6A 3TB6A 1ZHFA 2M98A 2REOA 2BHSA 4LGCA 4ZCTA 1E64A 3UN1A 1JTFA 1WABA 5KB3A 4YRKA 3LQ4A 1QH1B 2L2QA 2DVMA 3CW8X 3IB6A 3RC7A 1YOVB 3L7NA 2QX8A 1OWMA 4AJJA 1B42A 1WDWB 3NDBB 3F4BA 2HXGA 3BF8A 4HAOA 4LOHA 4JELA 3SQNA 3DLHA 4AN0A 1YD7A 1MQ8B 3CG0A 3DCIA 4UBOA 2X0FA 4AYTA 1G8FA 4OB7A 3RVRA 1MX5A 1G7CA 4MQBA 3X2SA 4EPXA 4LS3A 2WVGA 2RK4A 4I3FA 3GJZA 3O8LA 4HCJA 4KR2A 1NMZA 1O3YA 4P7FA 3QFSA 1N5DA 1HDYA 3IAS1 5B2EA 5JADA 4NSNA 4TMWA 2WAOA 1K2VN 1HDOA 2O8VA 4ITUA 1HE1C 4MUBA 5I7AA 4H17A 4MKGA 2Y0DA 4YP9A 1BH2A 3DP7A 1JEQB 1OQAA 1BIFA 3EWIA 3OE7A 4HZUB 2IH4A 3FZQA 4Q1FA 1PYDA 4WDQA 2JLAA 4F2GA 1BHQ1 2HU5A 5A0TA 1DHRA 1CY4A 2ATIA 5I8PA 1Y8RA 4GPEA 3QSGA 5EWMB 3U7GA 1F8GA 4NQRA 3QRWA 1JKJA 4E51A 2G40A 5F3DA 2W98A 3T38A 4EJ0A 3W5IA 3D3EA 5FB3A 2BJVA 4LF5B 3NTQA 3G82C 3O84A 4YBZA 1U3FA 3RBVA 1BQ4A 3QJ5A 1QF6A 2ORED 5GIPE 1JR3A 2V9ZA 3VR4A 1JHOA 3FX2A 4ESHA 3PUZA 4AZ3B 1DQNA 2G1KA 1G20A 3PRHA 4Y9DA 2BDTA 4JUFA 3LCCA 1TTHA 4D41A 2HEGA 2MHCA 4HWOA 1YAHA 5JSQA 2JH9A 2JJ1A 4R8MA 1DCTA 1T5IA 2Q1SA 4O4LA 2O50A 3I1YA 1XQ6A 2YFYA 2AF4C 1WP9A 1JJBA 3FDZA 3I4CA 4MYCA 2C3YA 4OSEA 1ZM9A 4WIAA 2H1LA 4DNFA 2C9YA 1KO8A 4R5HA 5ENDA 2B21A 5ETJA 5JCZA 2VCHA 2FPIB 2OD2A 3GOQA 3OETA 3IALA 2ZATA 3TI9A 4AJHA 5IUKC 1P18A 3D7LA 1NULA 3M9XA 5CB6A 2YNMA 4JBGA 4RAQA 5DTEA 5EIWA 4CWAA 4MIOA 3BJRA 1FFDA 3CV3A 3M9WA 4G0PA 2D1FA 5GVRA 3M4XA 4GLLA 2C7GA 5LZ7A 3T5BA 4NDZA 1PS8A 2I2DA 3MS7A 2Q5JA 3RRXA 3VPSA 3CVXA 2RGAA 4WK0B 2RHWA 1C81A 1QYDA 4AMGA 5JQWA 4IO1A 2UXBB 3T7KA 1HSOA 3ZGOA 3TX2A 2R2GA 3L1KA 3QLTA 5JARA 3AW9A 2BKVA 2VTBA 3ZGNA 1JIVA 3A9SA 3IAHA 3JZFA 2R7NA 1CWUA 4QHTA 2W2NA 4DG5A 2W0MA 1DCMA 2C2KA 1OI2A 2CL6X 3JQ7A 4H7DA 1GSHA 4DXHA 2HT1A 4QOGA 3PJRA 3QX7A 3B36A 1VHQA 1E8MA 3FYSA 3KHKA 3PDIB 1GOTA 3DL0A 2BH9A 2YMLA 3QTBA 2NZYA 1KVUA 1Z2EA 4G1CA 4KGZA 4RFVA 5IAEA 2MYTA 5HMLA 3UUGA 1XF9A 3HFRA 5JMOA 1ML3A 4B8WA 4AICA 2W4IA 4BXOA 2FZ4A 1FSSA 3KKZA 3IHKA 4RJKA 1HKHA 4WJKB 4OLJA 4RXMA 1Z5GA 3BE4A 3C7AA 1EJBA 4GPBA 4AKGA 3C5CA 4FCVA 2HNKA 3GZNB 4B6FA 4AY2A 1L4EA 4HNSA 3I30X 5AOBA 1RXVA 2GCOB 1M6HA 5B2ZA 4HN4B 4X7RA 1E9CA 3WTBA 4LQLA 2TMDA 1P5FA 1UL1X 1ZJ5A 5EJ7A 4FD3A 3G23A 5U4QA 2FU5C 4JVSB 3U40A 4CM5A 2BUAA 3SYMA 4TQUS 4AFNA 1AT1A 1DKMA 1ULHA 1YL7A 2BP7A 1OYYA 2O5VA 2QQEA 4KL8S 3FNQA 1UPXA 2ZIXA 4JR1A 1OD6A 1L5LA 2Z8YM 2R5WA 1SCAA 4CBVA 1U0EA 4L5JA 2V4MA 4BV9A 1L7MA 3ZK7A 3OO0A 5EPEA 4MB6A 1Y5NA 4NAVA 2UUCB 3FYCA 1YFLA 2QE7A 3R0VA 3ZH9B 3AVVA 2I7CA 3IMKA 3OQ1A 4I5DA 4LJSA 1QP4A 3U6BA 3USZA 3C4QA 3E2IA 2J9GA 4RVFA 2SKEA 4TGLA 1ECLA 1HPLA 1KH1A 2ZTLA 3NAMA 4E12A 4ETIA 3UOAB 3G0BA 3O3NB 4N3BA 4ZREA 2RD2A 4ZYYA 2Q07A 2HK9A 2XMGA 1QUFA 5I7RA 5ANRB 1HNZB 5LKAA 1P6QA 3DNMA 1TCVA 3K0CA 4L75A 1DPFA 4MZXA 2JCBA 2WT4A 4JP1A 2AKYA 5BORA 3OZXA 4EZBA 3BULA 2ZRBA 1E1YA 1V8DA 2ZIEA 4M1MA 1DRKA 1RACA 4D7AA 1DJLA 4IIGA 1NJSA 2PNJA 4Q21A 5BSMA 1HZJA 1G5HA 4UNQA 4FS3A 2XGMA 4FKBA 2CD7A 4DCMA 2QRKA 2ZI3A 1NL3A 3ICCA 4XQ9A 5EWLA 3SF8A 1ZCZA 4HVLA 1CRPA 2DFTA 3DT6A 1GKIA 3HUUA 1U9ZA 1XRRA 2XCIA 3A6EA 4HTFA 5GGYA 4BUZA 4DIDA 5B30A 3L18A 3PFIA 4MW4A 4XJTA 1CZLA 1FZTA 1WB4A 2YN2A 3S2GA 1X94A 1R9MA 3TL3A 1JWBB 5CK5A 3T1QA 4D3ZA 2O2DA 1GYQA 3HJGA 3QPVA 1W9MA 3FFWA 3KSBC 3WIDA 1OA1A 4IDQA 3RYCA 3T5MA 2H1SA 4DRXB 2IXDA 4ZO4A 5JWRA 1Z36A 1E1CB 4WVLA 1O2DA 3GCWA 3BWMA 2H85A 2MTBA 5BYJA 5TPZA 1MX3A 4ZPXA 1PV2A 2PFKA 3OT1A 2JGJA 1A9RA 1I3OA 2ZRGA 1F2UB 3Q5EA 4R1TA 1IAQA 5MGBA 2DJ5A 2IH2A 3HB1A 3KPVA 5BWMA 1CNFA 1MO2A 1ZISA 1QKKA 2RGUA 4XYMA 2HFKA 1ZD3A 2YY6A 1LQTA 4DBVO 2AR0A 1OFUA 1A96A 2VNKA 4OFXA 1G5IA 5IJ9B 4PSUA 3ER9A 2B9EA 2YKGA 2H2HA 4N65A 4HNQA 4JI1B 1K8XB 8LDHA 1NMQA 3PJFA 1K63A 3FFXA 4J6FA 1P81A 1X2EA 2BWJA 4LTNA 4NBVA 3WQRA 1Y7IA 4KYTA 1T4CA 2BR3A 1PK8A 3Q12A 4JJIA 3OJCA 2GO7A 1ZK1A 3KE9A 5LD2B 2CXSA 1O5IA 1PDVA 2I7VA 3CLUC 4FCCA 1T10A 4WKGA 3K0AB 1NFQA 1C7RA 1YB6A 3AQ4A 1U2PA 3ADDA 4AYXA 1Q95A 2OO5C 4QTUB 5LYYA 1XPUA 2QT1A 4O29A 3HMKA 3Q2OA 5BN5A 1FNBA 1KRHA 1Q7BA 2C7QA 4B7UA 3L8EA 1TZJA 3PICA 3NCHA 4PPQA 3SMVA 4AY5A 1LUAA 3WTCA 4HUJA 1T91A 2R68A 3EUFA 4NBWA 3TZCA 1L7EA 1ZY2A 2E85A 4XLLA 3ZWCA 3H5AA 3KHTA 1LX7A 1T4MA 2NZ2A 1D2AA 4N0QA 3OOSA 4KPGA 4O4IA 1F2TA 2B8TA 4BVJA 4JB8A 1JQJC 1TO6A 2JFXA 4G0OA 7GPBA 4Q3AA 2PYZA 4AUEA 1IH8A 4YRCA 1CRLA 1LZLA 4MVJA 5K3BA 1F2VA 2R6JA 1EWYA 3HCFA 4H9GA 3FHCB 4YCDA 3G1UA 2J3EA 2YN4A 1P7VA 1S2NA 3SM3A 3VO9A 3L5KA 4KE6A 2D1RA 1A4XA 2HSGA 2HLHA 4IHAA 3IIEA 2D3WA 4OI4A 1SU7A 4P3XA 1J21A 4LGYA 2GCNA 1C4XA 5G40A 5AVSA 4YASA 2V6FA 1BMFA 1QR2A 2F3UA 3DOUA 2X1HA 2RHGB 2YS6A 2NUTB 2GZMA 3G7SA 1O57A 3T06B 2DHRA 4DV4B 1OBVA 3EDMA 1RWQA 1ZZGA 1LK7A 2YWCA 3QQPA 4QYIB 1TUEA 4R9SA 4RABA 3EC7A 5DN6A 3WL6A 4M83A 4KPFC 3TRFA 4UOZA 3ZKWB 5KQLA 2IEGA 1OLUB 2PLRA 4RPHA 3S1AB 3B82A 2XZLA 2YYYA 5K1ZA 4D4GA 2QTGA 1DGQA 1M2FA 3KAQA 1CD5A 3VAZA 2P68A 4DUPA 5JQGB 5U1PA 1PL7A 3MPOA 4GSYA 4A0SA 1HZZA 4R2IA 3E0QA 1AKQA 1GA6A 4E3ZA 4ENRA 2W2KB 3MJFA 1T3SA 2XB9A 3ELUA 4TV8F 3ZVLA 1C2YA 2W6JA 4CCSA 1QFSA 1L4UA 3R5JA 3UBTA 3L05A 4F5WA 1SVIA 4H1VA 3MGGA 2N0SA 2Q2NA 4TZ6A 2ZI6A 4PYKA 1P45A 1SBNE 1WQ1R 3S70A 4ANFA 2ZS7A 4M49A 2ATVA 4C08A 3LUKA 4WCFA 4GH5A 4KOEC 3O4GA 1TPYA 2B1GA 2V1XA 2G80A 1LVHA 4CIDA 4MGEA 5I48A 4XX1A 1WNTA 3IESA 3OSZA 5SYNA 3PQ5A 5BQFA 3LQFA 2Q4DA 4IH4A 1QONA 2PZGA 4QUIA 2PMEA 2Q3JA 1B73A 3QU9A 3NYRA 1ZN9A 1WXHA 4RGYA 2H9IA 5EE0A 3D1JA 4DLUA 5AW7A 3MFQA 221PA 1Z2PX 3AVUA 1KAQA 3T7RA 5AW4A 4PPFA 1IZZA 1IPEA 1Z4PX 3IPRA 4XR9A 1O0SA 5KCZA 2QVBA 2VP9A 2QMQA 2O8EB 4QULA 4ZOEA 2J85A 5JAQA 4S1NA 1DX6A 3FPEA 4ML3A 3T7EA 4BLRA 1FSFA 3QVWA 2E4YA 5LC1A 4DC1A 3D3NA 1NPYA 4NYJR 1AXEA 5LFAA 1JLRA 2GBIA 3U49A 1V26A 1A7AA 4X93A 3AVWA 1YULA 4NC9A 2HWWA 2G1UA 3V97A 1EGAA 2P5UA 2B4AA 3R2JA 2MR6A 3EJ6A 2QPOA 2VPTA 3T1TA 2XWSA 3E3AA 3VFDA 3K8QA 3Q41A 4OQPA 3RG8A 2I6FA 1KI8A 3ZQUA 3CTPA 1P4RA 2Y1XA 1CUAA 5THKA 3O95A 4FEGA 4UUMA 5TDHA 3EXIB 5GADl 2X15A 3L0IB 2Q6IA 3W2EA 2QPAA 2HN9A 3ZV4A 1F6DA 5K8JB 3AEUB 5IKOA 4YJGB 3QPCA 2HU8A 2R00C 4U2FA 4MR9A 4O3MA 1HTBA 3PBKA 3HWRA 4KQ2A 4F60A 1X80A 4OXNA 4NK5A 2JVIA 4F72A 1XQXA 1GNPA 2BGKA 2AC2A 2RHMA 4N54A 1HQDA 2O7NA 3A9TA 1MJGA 3NAQA 4INPA 2F3SA 1T6ZA 3UB3A 4N4AA 1JWAB 4JC0A 3ZBQA 4ZOAA 3OH8A 3D0OA 1R0ZA 2JI7A 3EG5A 5GPBA 4D8XA 1TM7E 3K92A 4JUDX 3RUEA 4DSOA 3F1KA 4MEJA 4U9IS 2PT9A 3NHSA 3EE6A 4U0JA 3TQFA 4NYIQ 2B2XA 3GEEA 1M1NB 2XMRA 5EIOA 1BH6A 1CUCA 1K9VF 3KP1A 3P2JA 3WLAA 2CLSA 2RAUA 2HRRA 2C99A 2SECE 1RYMA 1ZR4A 3ANSA 3BJMA 3RO7A 3L7OA 5JXWA 1MIHA 4L3OA 1N6NA 3CBQA 3OPNA 3W8DA 2YXEA 3CSDA 4OG2A 3TZ6A 1QHSA 1A9ZA 5JAIA 5HK8A 1SXIA 3A1FA 2UVDA 2OGZA 4D57A 1KAGA 4POAA 1HQYE 5EIBC 4FYMA 2AOUA 1XA0A 1S2IA 4C03A 2F4VB 2PIAA 4J03A 2C5BA 4AWAA 4DY6A 1GTL1 3LCMA 3MQFA 5C5DA 1XP5A 1WXDA 3LF2A 4Q24A 4EFDA 3THWB 2I29A 3WWYA 4HZGA 5JTTA 4J4TA 5FBWB 3ZIAD 3FCYA 4KR6A 4FFSA 3HACA 3D4OA 2FVYA 3ZBPA 3NIGB 4MV7A 1A9SA 3KKEA 1ENYA 2Y2VA 3SX0A 2PXCA 3JTEA 4BX3A 4QJ3A 4B3RB 4P6VF 2ZJFA 4YMTA 1XRMA 3LJKA 4RJIA 3JRNA 4P81A 3VZSA 3H84A 4EVRA 3WL8A 3LZDA 1T8PA 4MS1A 3IBSA 3PT5A 4BO2A 4E3WA 3KXPA 1BWPA 1R4MA 2INGX 1KTIA 1ZUIA 5ALMA 4H60A 3WB9A 4ZI5A 2YOGA 3TGWA 1YJXA 4W9MC 3T3NA 2ZUEA 1HC7A 5FCDA 5DP2A 1YJ5A 3VOSA 5LZ8A 4BB9A 1XZHA 1DKOA 6NULA 9MHTA 1XNHA 1JVSA 5FPYA 4AL4A 2IUFA 3L92A 5IJ0B 2YJTD 3ADKA 4LXYA 1FFXB 3H6GA 3KVYA 5EIFA 3WGLA 4IYJA 5KMGA 4HWGA 3PEFA 4C4TA 2XTAA 3C74A 4TWIA 1OWPA 2VUUA 2J9YB 3SMQA 4AUNA 2ZJ1A 3OIVA 4JYMA 1L5HA 4ZGWA 1PFVA 2BBOA 3P0RA 4YGYA 3A2NA 1YIOA 2A67A 3ZCRA 4FC7A 4BX2A 4S0XA 5AKZA 4P3KA 4I1IA 1NM5A 3TLKA 1WUYA 2WJJA 5K0TA 3L8FA 2X2PA 3B89A 4GI3A 2QRLA 4AMUA 1IY9A 4LPKA 5CYFA 3VH1A 2CVOA 4RU1A 2JI4A 1RKQA 2LXNA 2WWXA 3IV7A 4MV5A 3VSCA 1FBTA 1PJAA 4L2IB 4CEIB 4C7MA 3B3AA 4TM7A 1X1RA 2XMDA 3MAGA 4XGNA 1OCEA 5KWJA 4F45A 1PIWA 2PAFA 2FUEA 3NRCA 3OX2A 4ARBA 4DV0B 2OEPA 2GPJA 2YFKA 2VJOA 3QENA 2BFDA 2GQ0A 2EP8A 5B53A 4QUKA 1P2TA 5FFFA 5FL7D 3FGPA 1YDWA 3ST7A 3NVKI 4L4RA 4TV8B 1RLTA 1EJ2A 1R6VA 1G8MA 3A0RB 3JZMA 4KO3S 3U5ZB 2P11A 3REOA 5F52A 3JYNA 4K1LA 1Q1AA 3ZEAA 3OMLA 2REXB 5I9IA 3H2KA 1G291 2C4HA 3SHWA 4C05A 4KE7A 1ULTA 1UANA 2FWMX 3IUQA 3MNFA 4RADA 1J1ZA 2CWWA 9ATCA 4DWWA 1Z12A 4KXFB 1DIRA 4KRYA 3WGVA 2HEIA 3U0VA 1ZUD1 4UAVA 2WM8A 1YH3A 2BFEA 4CEHB 2XNSA 2JIOA 3KDAA 1EUYA 1JHAA 2A1IA 1QG0A 1D4ZA 3I58A 1N2ZA 3O5AA 4GOLD 4MTCA 3BMXA 4G0ZA 3WSTA 4DLTA 1SOVA 4HNHA 4DQXA 1T1JA 3EDYA 1ZIOA 2A1TS 3OMWA 4ZWNA 2LKCA 3RANA 5BSGA 2OAGA 3ROFA 2CSUA 4J49A 1G6HA 1YACA 4O5AA 4OQMA 4QECA 4QRDA 1MQSA 4TKUB 3L4SO 4DUGD 2P9ZA 3E9YA 4F86A 2X41A 2OBLA 4XVUA 4A0FA 3ETCA 2V9PA 5DK6A 3RUHA 4NP6A 3DM5A 3I3OA 4ZT7A 4GXQA 3LT5A 3D2AA 5L3ZA 1XKTA 4EECA 2QWXA 3NHJA 4FXOA 5B6PA 1FDIA 5CM9C 1R0BA 2ZXFA 3A1TA 4KDFA 3QW2A 2XUIA 3CG4A 4AO6A 4Z51A