1P5JA

Crystal structure analysis of human serine dehydratase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
GEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQECGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-serine dehydratase
publication title Crystallization and preliminary crystallographic analysis of human serine dehydratase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 108
structure length 319
sequence length 319
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2003-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p5jA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p5jA02
2CLEB 4HO1X 1WTCA 4D8UA 3FGPA 5IXJA 2PQMA 2Q3DA 2J9YB 4NU8X 5B3AA 5D84A 2CLHB 1C9DB 4ZU1X 5JISA 2WSYB 1A5AB 3HMKA 3T4PA 1CW2B 1VE5A 3R0XA 1RQXA 4L0DA 2RKBA 1TZ2A 2ZSJA 3L6CA 2Q3CA 1D6SA 4D97A 2C2BA 1K8YB 3ZEIA 2GN0A 2EGUA 4Y6GB 5C3UA 5B36A 5D86A 1QOPB 3TBHA 4D9MA 5D87A 3VSDA 5IWCA 1K7FB 5B55A 1UBSB 3IQIX 2CLFB 5CGQB 5EY5B 4F4FA 4LMAA 4OFXA 1J0CA 2TYSB 4JBLA 5IW8A 3V7NA 1E5XA 4XUGB 1OASA 3SPXA 5I6DA 2DH5A 4JBNA 1K7EB 2ECQA 1K3UB 1V7CA 2C2GA 3PR2B 5I7AA 5KZMB 2Q3BA 4I1YA 1TZJA 4D9NA 1J0EA 4D96A 1M54A 4D92A 4NEGA 1Z7YA 1KFKB 3DWGA 3SS7X 2O2JA 4HPJB 4D99A 3DWIA 3VSCA 2TSYB 3IQHX 1C29B 4L3VA 1QOQB 5B1HA 2GN1A 4PCUA 1WBJB 1KFBB 1VE1A 1TDJA 4OREX 5B1IA 4D9BA 4WX2B 1Y7LA 1V71A 2J9XB 4COOA 1UIMA 4D9IA 2ISQA 1TJPB 2RH9B 4HN4B 4D9EA 3SS9X 2JC3A 2J9ZB 5DBHX 3RR2A 1PWEA 4D9CA 1J0AA 4HT3B 1A50B 3L6RA 5D85A 3X43A 3PC2A 1BEUB 1KL7A 5JJCA 1KFCB 4KKXB 5B53A 3X44A 4D8WA 5CVCA 5J5VA 2O2EA 4D9FA 1C8VB 2TRSB 1K7XB 2ZR8A 3VSAA 2ZPUA 3R0ZA 2V03A 1VB3A 1V8ZA 5J43A 1PWHA 1K8XB 4LI3X 2BHTA 1FUYB 1TTQB 1J0DA 1TZMA 5E0KB 4L28A 4IL5A 1TTPB 3VC3A 1O58A 1KFJB 2BHSA 5DVZA 5I7RA 4L27A 4ZQCB 1F2DA 5I7WA 3AEYA 1BKSB 5I7HA 4LMBA 1KFEB 2D1FA 4ZU6X 3FCAA 1TYZA 4AECA 3L6BA 3PC3A 4AIRA 5KINB 1J0BA 1A5BB 2ECOA 2EFYA 3DKIA 1Z7WA 2RHGB 5DBEX 5T6MA 4D8TA 3PC4A 1JBQA 1X1QA 2DH6A 4QYSA 1UINA 1A5SB 2CLMB 3IAUA 1FCJA 3AEXA 3BM5A 5I7OA 1K8ZB 2CLLB 2CLKB 4HPXB 3VBEA 3CEPB 3IQGX 1WDWB 2GN2A 1TZKA 5DW0A 4H27A 5BW6B 2CLIB 5DW3A 5HBGA 4D9KA 1CX9B 4D9GA 1WKVA 2CLOB 1P5JA
chains in the Genus database with same CATH superfamily
4LDJA 1Z82A 4FPXA 2RKWA 4KYVA 4HR7A 5E8RA 3SDZA 4IJ6A 1PSZA 4WOCA 3ROXA 1E18A 1PT6A 4P81A 4EJ6A 1FJGB 2J8ZA 4KAAA 3PEFA 1HTBA 2F8MA 1NRWA 4U0JA 4L0DA 3UYKA 1WCIA 2I03A 4MVWA 4XLLA 4DM4A 3MXTA 4YAGA 4D0GA 3T5CA 3VISA 4KQFA 1UK8A 1MRZA 2P6MA 2ZDHA 1RM4A 2WUVA 4XQEA 3THSA 3TL2A 1YH3A 1Z4MA 2JD1A 1AV7A 1POXA 4EZEA 1Z5NA 4RK6A 4CUJA 1TT5A 2BOVA 4JN6B 1WHSA 1U5AA 1X3SA 2F7SA 1OI4A 3MW8A 2ZUVA 3KQQA 4PX9A 2FF5A 2IEBA 2MR6A 3DAHA 3ZDAA 2YY5A 3EEOA 1ECCA 5EUCA 3V4SA 5IBRA 4CF7A 1ANKA 4ZVTA 2HV8A 4TKLA 4JP3A 2X6TA 1U0NA 1ESZA 4QTYA 2XNCA 1QC5B 2YASA 5EZSA 3UOWA 4GU5A 2GTPA 4PHHA 4OI4A 2FFAA 1F5NA 5IKPA 3OZVA 4J2OA 1C7ZA 2R8OA 2HHHB 2E4YA 3K1YA 1N8TA 2OCDA 2GPAA 1I1QB 4WY5A 1CBUA 3EGWA 1RBQA 2FLKA 3H0CA 1X8JA 5DSXA 3VSCA 4DWOA 3CSDA 1P2DA 3IELA 5L7TA 4B44A 4YJ3B 3X1KA 3LXRA 4GZ6A 4OREX 1E6KA 1FX0B 3PPVA 4Q9JA 3DHWC 2NUTA 5INTA 4MW6A 3GJYA 2B98A 1E9VA 1N0UA 2JCXA 1XTBA 4UHJA 3DEAA 4QKQA 1BFDA 4L3WA 5C46F 2QP9X 1CR2A 1KMQA 1UQTA 2QRLA 3D02A 4QXMA 4XGIA 4Y2XA 5FBHA 4Q47A 4AG6A 4F6LA 4L08A 1XN4A 2I7TA 2AZTA 2JJ1A 4J9UE 3R5JA 1IEQA 4R84A 4WBXC 3IESA 2Y66A 3WQSB 1AMNA 1HRDA 3AVVA 4N0QA 2OBNA 1IU9A 2C42A 1YR3A 3HN2A 3T9AA 2EZ8A 2ID7A 3AB3A 3GQBA 1IJKA 3PUKA 4FGJA 4LOHA 4TLEA 2DHQA 4QT4A 4AQ7A 3QVVA 1V8DA 2OHHA 2BVNA 4JLVA 4Q05A 4YCCA 2H4JA 2VA9A 3I8XA 2AIRA 4MDFA 3FMPB 3WISA 2A1IA 3WS7A 5ITSA 3JVUA 1T34A 2GAAA 1QP0A 2O2DA 3AR4A 4FGLA 4RDCA 1WUKS 4TQGA 4DKJA 4BLWA 1Y82A 2VG8A 2FQ1A 1AE1A 2PS1A 2GEJA 4BV9A 1KERA 5ALSA 3CX3A 2B5OA 3RYCA 1NMXA 2G80A 4RX1A 1QG2A 3RS8A 3C3KA 3SFVA 4QJ4A 1EFKA 2HDHA 3GJ6A 4OQFA 3LCCA 3PIDA 4MAAA 2AFVA 2D4AA 2OC4A 2DETA 2VDOB 4UVIA 4W9RA 5JD4A 1OI7A 3B6ZA 5A4JA 1FDRA 1NXVA 3EBPA 4O1IA 3KP1A 3W0LB 5JAMA 5KWEA 4OMCA 4CLOB 4IILA 3SE7A 4YRMA 4IVPA 1ADJA 4BB5A 4IV5A 2NUPB 2COEA 3GLGB 4EB6B 2R2AA 3GPCA 3QWIA 4MRRA 5BVHB 4QTUB 1AKMA 5DNWA 2X0FA 4DCMA 1DV1A 3C3EA 2YWHA 4AAYA 1HLGA 4QLBA 4H27A 1JHAA 1G0NA 1V9SA 1W2GA 1XMJA 4LHEA 5HCIA 3GOQA 4D9KA 2WUGA 3LLUA 3D4LA 4B3TB 3IEIA 3C0KA 4DR7B 5FBLB 1MB0A 4YJGA 3EVTA 2PWPA 1ZJZA 3DMNA 3DH0A 3G1UA 1OAOC 4G4IA 1VIAA 2FWBA 4CCYA 3HVUA 4I9HA 1TADA 2DECA 4NOLA 4GLLA 4RMJA 3UK2A 2LV8A 1H6DA 4JLOA 2H29A 3HWRA 1S2GA 4CLHA 2NT4A 3FUWA 3DDOA 3Q7PA 2EGUA 1KZ6A 1SY7A 3AL2A 2HU8A 1JG1A 4N6OA 4V0ME 1P17A 4F2DA 5IASA 1U6KA 1Z36A 3QITA 5LUAA 5BSRA 4O5OA 2F1RA 3ZTWA 3ZXYA 2WKRA 4AMGA 3MWDB 3B5JA 4OJKA 1UPXA 3UFXA 4UU7A 2ERXA 2WY2D 1F0NA 2AT1A 3C3BA 4K9OA 4XEHA 2MSLA 3VU1A 5IK2A 1N9GA 4A27A 1OBVA 3HU3A 4F8YA 5J4VA 3AFOA 4XW2A 4MRSA 3EDYA 2E48A 4XZ3A 1P4JA 1XQXA 4YRNA 4FWTA 3I39X 3JQFC 1U0BB 1QE5A 2OBFA 5C1OA 3DEKA 3RVKA 3Q9UA 3R9XB 4NYIR 3I5MA 1CYDA 3NKVA 4QPNA 3GROA 4ZEWA 5REQA 3V55A 1EVJA 3VU9B 4D79A 1M2WA 5AM0A 3DLPX 5EKUA 3BIWA 2ZEJA 3LWNA 2F1HA 3U1TA 4RUKA 2ONYA 3ZBUA 3EF3A 3I5UA 3WZ2A 1NVWQ 2DPYA 4RXMA 3UMVA 4RGQA 4DM7A 4YAIA 1OWOA 3T3NA 2OZLA 4XTRA 3ZI4A 4EO7A 4E2XA 2ZG6A 1P1RA 1UMDB 1RWNA 2HDOA 1IVSA 3PEYA 3RS5A 4YJ2B 1DG9A 3W3AD 4OI1A 2J41A 3B38A 4F72A 1WUHS 2HTFA 1DEOA 2YL2A 2WI8A 3K15A 4MV5A 3RASA 4N0DA 3W1EA 1JG7A 2AFHE 2FJUA 2XBUA 2YXBA 3U2QA 1QR2A 5BV0A 4J4HA 4S2EA 1G55A 3P0RA 2IYXA 1N2IA 4EWLA 3NUGA 2C2OA 5IDQA 3QKSB 3BSYA 521PA 4TTVA 2IXEA 4IKOA 1C1XB 1O58A 2VDLB 2WG1A 2JAUA 3LQFA 4DA0A 4ZZ2A 2P4UA 3ZE7A 4OQEA 2XT9A 1Y80A 1VG0B 1L4HA 3B2QA 3EZ9A 3T5BA 1PI3A 5B6JA 1H85A 4EARA 3EY4A 3HL0A 4RCZA 4RVGA 1Z4NA 1M73E 3WA7A 5BW4A 1ZH2A 3I2FA 1J0BA 3NHKA 4GQAA 2C99A 1D7AA 3GRFA 4IICA 3W34A 5KJ6A 4XIYA 1Y3CE 3TRJA 1JA1A 3PGKA 3RYTC 1DDGA 4Q3CA 2IDMA 1EM8A 1WU8A 2QUHA 3HUDA 1M8KA 1VGQA 2QHXA 4PY2A 1Z9BA 1O6CA 3NYIA 4UUOA 3TQTA 2P9EA 1HH4A 2PFKA 5CR9A 4ARUA 1UJ5A 2H1HA 3DP7A 1YZNA 2BDEA 5B4UA 3ZI0A 3Q3HA 4GBMA 4Q4JB 2IPLA 4G9EA 1IOVA 3WADA 2HU5A 1DUSA 3AUKA 4P22A 3ROFA 3VV3A 3PQ5A 1G3UA 3OZIA 4N54A 1ZAKA 1QYXA 1AQYA 4RJLA 4LHYA 1AX9A 4RULA 1EHIA 3F3KA 1PBTA 3KV1A 4KLZA 5THKA 2VDRB 3GLUA 1K92A 1OW3B 1QB7A 2AMYA 3BIOA 1ZM7A 2D1RA 3D8TA 4G9GA 4YBRA 4XWKA 1S3GA 4GBED 2QN6A 1F3OA 1A72A 1O03A 4UQOA 4Q03A 2M1ZA 2WBLC 2W37A 3BE5A 3DF9A 3IBSA 3MRSA 4Q1FA 4C2TA 2HX1A 1GNPA 2FPSA 3T8YA 4TUYB 4FOLA 3TEJA 4LE0A 2GS9A 3ZY3A 4ZAWA 3TTWA 4UEWA 1AKRA 4EQ6B 1VCOA 2BFCB 4LRSB 3ZGLA 4BV8A 4TPKA 4WN9B 4QJ5A 3K2QA 1LCIA 2VYNA 5SYMA 4B7ZA 2CDCA 1RP1A 1CNEA 2HSJA 2JGDA 2XUPA 3DDNA 3G2MA 5EE9A 5T67A 1Y9AA 5AOVA 2P2GA 1IPFA 2D2FA 5L53A 1LDNA 1WXHA 3TDMA 5CUQA 2BFFA 2FPRA 4F91B 1CDDA 4EG8A 5ANRB 5FHRA 2O1SA 1SK9A 1YQDA 2AK3A 2PT5A 3EMVA 4B87A 1MIHA 4DDMA 4JJKA 2HJSA 4XWAA 3GPIA 4WPGA 2B1JA 3TEMA 4LXUA 4GPIB 1L5FA 3W9UA 5IEJA 2IC5A 1ZNWA 1QANA 4RESA 1H2BA 5CDHA 3B85A 4YT5A 4YRSA 3IFSA 4FXOA 5M29A 3OWOA 3Q98A 2O2GA 3WIBA 4AC9A 2PQ6A 1ABBA 1GQSA 1TYEB 1UDRA 3AY7A 3IRVA 2V7EA 4UM5A 1JP7A 1HE1C 2C8VA 2Z5GA 1BYUA 3UAXA 3VNSA 3D5EA 4W7HA 1Y4DE 1H2RS 4WCVA 1R9JA 1M3SA 3H99A 3LP8A 4OXXA 4U7FA 3K3PA 2QD1A 5FUVA 1CCWA 1R5JA 4F6RA 2HM7A 1RI2A 5F7XA 5KOJB 1H4QA 1YIOA 2IS1A 1Z07A 4QU0A 4YCMA 5IT5A 4JJZA 4X85A 1FDUA 4JS0A 2WSSA 4I9UA 4Y6QA 1PG2A 1U8FO 4ARBA 4AKTA 5BQFA 1QIFA 2GN9A 1PJSA 3WRXA 1QYCA 2QRVB 2JGLA 1VKZA 2HA2A 8ADHA 3V00A 3NKFA 2IX3A 1W1WA 1GA4A 2Y1CA 3LQYA 3PWZA 2OQVA 2QQ5A 1JFFB 3Q7SA 1RJGA 1MIOB 3HG7A 4C4XA 3ETHA 6AT1A 4CKBB 4HCJA 2J7PA 2ESRA 1E2PA 2QX9A 2GZMA 2PMWB 3U7QB 1PJLA 3GG9A 4KAXA 5LQRA 4J0JA 3TPFA 1SBCA 3F5SA 4HLNA 4ZANA 1ORVA 2ECKA 4Z7QB 3QBEA 4DRXA 2VRCD 3DUFA 4X66B 2W42A 4OSOA 1K06A 3T34A 3Q2OA 2Z1DA 4RKEA 1EA7A 1FIUA 4TXHA 5JAZA 3BKWA 4KL8S 3WNQA 4PEVA 3BGIA 3RYFB 1N5OX 4TRMA 4YBZA 1BFKA 1K75A 1M0WA 5K09A 2JZOA 3EAFA 3VJKA 1XNQB 4BKOA 2FF7A 2PUEA 2RG7A 1R27A 3P0IA 1PFQA 2Z08A 3KSZO 4K2AA 4PXSA 2FLVA 1D09A 2XGOA 4BECA 1V6CA 3O0DA 3WLKX 1NN5A 1UM9B 5JDCA 3IJPA 2ZPAA 2MTBA 3AFHA 4YMUA 3AFIA 2C2ZA 3IAEA 1AS3A 2NO4A 1R50A 2ZBQA 2EWWA 2IXFA 3R6DA 2HEIA 2Z4RA 1J70A 3DMTC 2OR3A 4NONA 4RXTA 5K0NA 3BX1A 3K2BA 3Q7EA 2BRUA 5EMJA 3N8IA 1IY9A 2DFDA 3E3NA 4BRZA 1SOVA 5JISA 1APBA 3ZV5A 4C7XA 3M9XA 1JX6A 1V0JA 3ZDXB 4EZIA 5AKEA 5HR5A 2BFBB 1PR6A 1KRWA 2FSVA 4HQNA 1UPTA 4UZEA 4DABA 3JWEA 1GT6A 1NUUA 3FSGD 3RSZA 4XM1A 1GT91 3TLMA 5DBIA 5GONB 1X8KA 1RHRA 5I7VA 1WD5A 4XWOA 3G3EA 1WB9A 5E6SB 5DDIP 4PAWA 3RRXA 2VQ6A 3PXXA 4W8OA 4XX0A 3DL0A 4G85A 5CLQA 1JNXX 1GSHA 1N1DA 3AI3A 3MCTA 2YIVX 4C04A 1Q19A 3FOAA 1WBBA 4F4JA 1H2EA 2IFTA 3NHAA 3OAAD 1RVDA 4NK4A 3TG2A 1EX6A 1UJNA 4UQLA 3KQKA 1XU9A 4HP8A 1BDJA 2JNWA 5HQJA 1TVEA 5JNLA 5L4SA 5U9CA 3KKQA 3LS2A 3PYXA 4LMRA 4RM3A 3NHJA 5GWXA 3TW0A 3U9SA 4LAFA 2B94A 3FLMA 3N53A 3FVTA 1BFUA 1QR6A 1ORHA 3AHGA 1XROA 4WK2B 1W4RA 4XOIA 5NULA 4CDRA 1WPQA 4RKWA 3VMFA 3UUEA 4CKZA 1RRKA 5CYFA 2DTEA 8AT1A 3UWSA 4MGZR 4ZOLB 3PWKA 3F5MA 1L8QA 1BXGB 4NZPA 2QMZA 3RC7A 2SBTA 3FNIA 3KJQA 4WXEA 3WP0A 4RETA 1DXYA 3VDMA 3QEKA 1EDDA 2DR2A 4R9VA 1NTOA 1U2EA 1U9IC 3CNNA 1Y5NA 3R3XA 4L4YA 5GV8A 4YRGA 2XOKD 4WT7A 2KBEA 4GOJA 1YC5A 3GRVA 2QXTA 1XQ1A 2ID4A 3VYTB 5CJ2A 2RHLA 1DC8A 1T35A 3RIYA 2DUUA 5KSOA 3I92A 3FMVA 2H9AA 3I6BA 4M0LA 1BCSB 3VHXA 2OP0A 3F97A 4MZDA 4F8EA 1Q7BA 4A16A 3RJ9A 2BELA 1DAMA 3JARB 3Q8LA 3LT2A 4QEDA 5CB8A 1MRNA 2G07A 3EA0A 4QQRA 5L8VA 4ZQIA 3DZCA 4M0FA 4FNGA 2QORA 4G24A 2GDJA 3DFZA 2VAPA 3BYZA 4OLJA 3VNUA 1I01A 2VPZA 2C97A 3AL0C 1W73A 2X1VA 4AMZA 2NLOA 3NHRA 5MN5A 3KLMX 1CZHA 1DPGA 3BDIA 3M6AA 3QQ5A 4PRZA 5HFNA 5LXTF 4DNFA 5CLIA 5JG7A 4NBSA 4RSMA 3UF0A 1DFGA 5BSMA 4QFBA 3ODGA 3V2UA 1CQIB 2GQ0A 2RJNA 4TLLB 5LYJA 1XWFA 4KG7A 4E4TA 4B43A 2XRFA 4YACA 4ZEOA 3RVNA 3PDJA 2EKPA 2G09A 3H6KA 1OBCA 3SXPA 1X87A 4W5JA 4RH1A 1C81A 2VQDA 5F5LA 2YFQA 1X39A 5AJVB 5CM9C 5AJXA 1AZWA 1CZKA 2PRIA 2JCBA 4MCAA 5U4QA 5CVEA 5HKAA 5IFKA 3D3EA 1UFQA 1QGYA 3GC6A 1ORTA 1SHLA 2RHOA 3GNSA 3VPXA 1C0LA 4BN4A 1W0KD 4J0GA 3GEEA 1CLEA 4MS3A 4HGPA 3VM6A 3WXMA 1TUBA 2FB9A 1TVKA 3LHKA 3TRFA 1Z2DA 2FRVA 1UXHA 3B5IA 5EIAA 2VJPA 3SZLA 2R7LA 2HWXA 1YS1X 3PC7A 1HKUA 2HPVA 1BVRA 3CZ9A 3EBOA 2O0HA 4LQDA 4L75A 1P45A 5IBPA 5BNFA 1TQ2A 4EI9A 3AOGA 1V16B 2W2PA 2IF2A 1XTVA 1YU6A 1Z5VA 2L18A 5CD9A 1QVVA 3DBRB 3P9QA 1JR3E 3H17A 3JVVA 1S96A 4HG2A 1E61A 4E5VA 1NLUA 3HFJA 5B1YA 3EUFA 4TOIA 5BV1A 2F43A 1XG5A 4FMDB 2QVYX 5DTQA 4AWAA 3AEUB 2R84A 3AGQA 3QXGA 3PSHA 4H3HB 4FE3A 2BJVA 1SVWA 1J39A 1JQKA 3D3WB 1OLXB 2XH8A 3E82A 2NO0A 4KTTE 1NMQA 3L5OA 3EW9A 2W6QA 2HK7A 3EDCA 4X3PA 1XVIA 1O94D 3EVDA 4KWHA 2VHZA 3QM1A 1BDIA 3ABZA 1MX5A 5EPUA 5KX5F 2PZMA 2I6SA 3B8HA 6CHYA 2Q5OA 4LXHA 2IVFA 3O5AA 4CCWA 3PGMA 3TQFA 3M9WA 4YX9A 1EBFA 1GGJA 1UAAA 1MJNA 3DZ8A 4HB2A 5DP2A 1IIBA 3QVGA 2EF0A 1E4OA 3DOUA 3VPHA 2X8WA 3GJ4A 5P21A 3DWGA 5CX1B 1QORA 1T8TA 1GPH1 1S9HA 1U0JA 2YYAA 5EWJB 3AVOA 2FQYA 2Z43A 3MEQA 4Q18A 1FY2A 4R0NA 4B4WA 1SPBS 2J9GA 4MWTA 3RUFA 2FN8A 3SX4A 3UPUA 2AHOA 2XD4A 2ACKA 1SPXA 5JDIA 3GP8A 3REQA 2HQRA 2AW3A 1IATA 4K81B 1ZDMA 3Q6NA 1HDGO 3ACBA 3NTVA 3MFYA 3BGOS 1Z22A 4LDPA 1PT7A 2HHJA 3BGDA 3GFTA 3OF3A 4C43A 2IS6A 4BJ6A 1QFMA 1KPHA 2F67A 1BGWA 4JWTA 3LO5A 3QV1A 4YJKA 2REQB 2P9QA 4S24A 2PBRA 4B35A 1L5SA 3U80A 2JGIA 4YQYA 5BRJA 4A92A 2ZPUA 2DUMA 1BAPA 3A25A 3LHIA 1DV2A 1E32A 3Q85A 2VATA 2RIPA 4KXWA 3TD2A 5IKMA 3RARA 2EL7A 1TF5A 3KQLA 3JQEA 5JPIA 3WYBA 5JCPA 5AO9A 4FZRA 4BMOB 2QAJA 4E5SA 1VECA 3OIFA 4IDQA 3QOYA 3MJRA 4L5YA 5TMBA 5LQCA 2A0UA 1W8IA 3SP1A 3G0DA 4WNAB 1E6MA 2HXSA 2QM3A 4Q3OA 5BRNA 5FOQA 2E37A 5K4HA 1CD5A 3LDHA 3FIUA 3TINA 4HNAB 2JAPA 5IYZF 3EF0A 1K3TA 2PG3A 3EMBA 3EOZA 4YUYA 1X14A 5EG5A 4EFKA 1BS2A 1JT2A 2UZ3A 5H83A 3T3MB 4KW7A 2CDAA 1VKHA 2P27A 2QPOA 1QC5A 2P3LA 3T4EA 3O2NA 3ZU3A 2O0KA 3QYJA 2FX5A 3DMYA 4F38A 5GJWC 3I9OA 1M0SA 3W2EA 1A7JA 2ZM6B 1E1RD 2P2DA 5LBUA 2KLBA 5TMDA 1UKCA 2W71A 1H6AA 3MBKA 4PZLA 4K6OA 3QVTA 4PYIA 4YJ3A 5TJ9A 4EITA 4Y2VA 3UJHA 1FX0A 2XDQB 1S2IA 2OESA 5EI5A 2RB5A 3GXBA 2ICAA 1FFCA 4ROSA 2JW5A 2XKJE 2QRJA 4JJFA 3CPSA 1C0KA 3ORYA 1LLCA 4KGVA 1HV8A 3U4CA 3VVCA 3ZCTA 5D2CA 4Q3EA 3T4PA 4RENA 1NFQA 5L4LA 5MDHA 1OFTA 3AMVA 1Y8RB 3QIVA 3M34A 4MYHA 1T26A 1PJQA 3ZGZA 2C04A 2IU4A 2IZ5A 3AKCA 3OEHA 4OQZA 2DHDA 1SKBA 4AX8A 4DIMA 4CETA 1NW7A 3JZFA 4WECA 1DQRA 2E4AA 5C3UA 3HB4X 4L4UA 3SOZA 4BQSA 1YVEI 1YBHA 4ZYVA 3TVDA 1DAHA 4DA8A 2WFZA 2GLUA 4KPFC 2HK6A 2DYKA 1T9AA 1W5AA 4PFSA 5EEGA 3IODA 3I61A 1U9ZA 1KMMA 3FMOB 2FG5A 3HZRA 1WZEA 3PI6A 1E0JA 3DZBA 2DT8A 1HZJA 1P91A 2BBWA 2L0XA 2ZVPX 3OCCA 5EMHA 4WD3A 5AVOA 2IEDA 2PZEA 2VHYA 3EARA 1JU3A 4WA7A 4PS1A 4ZI2A 2FUCA 4HATA 4HTAA 2C2GA 3I12A 2EQ5A 4HGQA 5D5PA 2VYVA 1EWVA 2PZGA 1JQJC 1LX7A 3O2QB 4UTZA 4XWTA 2J5KA 3GLSA 4PFJA 1U3FA 3O4IA 4ZALA 2B7BA 1VJTA 3W3AA 3VNAA 4CLOA 2BR4A 1I0ZA 5EMLA 3DMGA 2NUPA 3T0GA 2P7IA 4DWWA 3GLGA 1NMEA 3MOIA 3SHWA 4EB6A 3ZVMA 2QI9C 1ISIA 3A6ZA 4M46A 4UFPA 2FZ4A 3A7EA 2JGFA 1SCAA 2PX4A 3EWIA 3PNSA 1M1ZA 4QUHA 4F3YA 5BVHA 2C9ZA 4QM7A 3B1KA 4BMYA 4XUEA 5CNKA 5FDFA 2AVNA 3G2LA 2XNKA 3KZNA 2R1UA 4BIMA 2OK8A 3UW3A 2G83A 4HYTA 4RIHA 3BC1A 1OAKA 1OBOA 1JEDA 1OT5A 3S28A 4WERA 1NT4A 4HX9A 4DJJA 2A8YA 3JATB 2IY8A 4DB4A 4EMSA 1L9XA 1KH1A 1EVLA 4BYGA 4KWTA 1SUEA 1FYXA 3G23A 2XRMA 3UHOA 1SXPA 1Z0FA 4JBHA 1CUXA 1DZ3A 1U3VA 1U94A 3C87A 4O63O 4Y2HA 3MGKA 5DGDA 1POWA 3WLSA 4JU9A 5I4IA 4M60A 1TZMA 4OO3A 4AS3A 1E5DA 2K4MA 1WRBA 2BUAA 4PSCA 2Q9CA 2XCTB 1KQ3A 3P9CA 1R8SA 3F3MA 3WL8A 2Q07A 1KQNA 5DEOA 5M34A 2HWWA 4OP1A 3FN4A 1GLVA 3QRWA 3HA5A 3MJSA 5JSUA 3BFKA 1EK5A 4GGPA 5D3KA 1Z6PA 3MWDA 4FS3A 4QL3A 5L7WA 2NTEA 3LBYA 3IV9A 3NJ8A 3GEMA 3CEJA 1Q3HA 1QX4A 1G3IA 1SHUX 1WMSA 4L0CA 1Z37A 4CKCB 3EVAA 3LCVB 1Y63A 1I30A 2FGKA 4CF6A 1GKLA 2IE8A 3BGSA 3T9EA 3AEXA 3ZZ1A 1A7UA 2VVTA 4TWJA 3JWPA 4NX2A 1OTXA 3MAJA 1TUGA 1VBKA 1KDZA 3KXLA 2AH5A 3R9XA 1OAOA 2FG6C 2GM9A 1HR0B 4URHA 2R85A 4K46A 3VU9A 4P3PA 3QLEA 2BFMA 3IAFA 4JVOA 4FE7A 2Y9MB 4LN1A 3FNBA 4K1XA 2HZ7A 1SBZA 3MCVA 1R0WA 1VIMA 3MJFA 4HMQA 3RVQA 3DZDA 2OCLA 3EG5A 1UKZA 4YP6A 3LUPA 1BQ4A 1Y9DA 7REQB 4D3DA 5GADl 1EAMA 2MT9A 4MI3A 1VL6A 3I9JA 4KVGA 3QZUA 1N6RA 1UMDA 3H5LA 1N2CE 2Z2XA 4IHAA 2Q3CA 5BSKA 4YJ2A 3E53A 4TLBA 3CE9A 1P0FA 1WXWA 1YZKA 3TR5A 5I47A 4OKSA 4OUKX 10MHA 3JPWA 1KAOA 2IXTA 3VOTA 3FPGA 5DE3A 1EZ4A 4ZAGA 2BHLA 3PQ2A 1LW6E 4Y2YA 3C7TA 3JR3A 1BRTA 1WW8A 3OOJA 1QRRA 3GMTA 2CLCX 3W2FA 3QKSA 5C52B 5JSYA 1C1XA 1M66A 5K6TA 1ZR4A 3Q2KA 4C6SA 1ZN9A 2EX0A 3MWLA 1JN0A 2W4IA 3W3ZB 4ZMRA 1KRXA 3CVOA 1PQYA 5G41A 1T2DA 1H2YA 2VJBA 3RS0A 1OA1A 2QD5A 4KUGA 3R8XA 4EYKA 2JGAA 1T91A 4QYXA 1LI4A 4KE7A 5DYIA 3GR6A 3N58A 1KDOA 1DDOA 1FA9A 5JLJA 2UUPA 3JXEA 2B82A 2F3SA 4NZMA 1FFYA 1U0OC 1X7ZB 1XQ6A 1XTUA 4FWBA 3EDRA 1G8YA 1I4OA 1HO3A 4QODA 4XLZA 2YWEA 4YAJA 1JE1A 3IIEA 2GB4A 1C30B 2VN8A 1GZ5A 2P6PA 1TAGA 4GG1A 4Q4JA 2CT8A 1LWNA 4Q12A 3NIBA 3R1IA 5DI3A 2O8DB 1FMJA 1HM5A 1SCBA 2AG5A 3BH0A 4TYYA 1NJ5A 4JLDA 3B3FA 2ABWA 4H7FA 2R6HA 4RLHA 5FIUA 4BGEA 3BHMA 3U60B 1X86B 3E5MA 3TE7A 1BMTA 1ZW6A 2P67A 2Q2VA 5K45A 1SUPA 1CUFA 3P9PA 1L6RA 1Q0UA 3ZZNA 1T43A 3AVWA 3TJMA 1Z29A 2ZAMA 3I3OA 4X62B 1G3QA 1OREA 2R6JA 4EA9A 2C2XA 1M2VB 3OWHA 5LOVB 4KXYA 4EEXA 1V9LA 2HIMA 3KWFA 4L5JA 1OVGA 4WH0A 3NDIA 4TUYA 5B58C 3NHWA 5JAUA 1J1IA 2J3HA 4WLUA 1W34A 5L3QB 5CDYA 5FWDA 4I5DA 4RVUA 4EQ6A 2AYYA 2BFCA 3IKTA 4WN9A 4TXLA 3WYDA 1NG9A 5JLAA 3UEOA 1XDDA 2VWHA 4KHPB 4L85A 4QGAA 3FBTA 3SQOA 4NCAA 1QUFA 3JRWA 2EKLA 4XX1A 4OOFA 1AKQA 1U0FA 3IQXA 3O3MB 5D3QA 4KLCA 4GYKA 1I4LD 1MZVA 2WWGA 2X1LA 2B9EA 4LJSA 3V8VA 3GFOA 4KFSA 4E7PA 5IRCD 5IN4A 4GVPA 4RANA 1M8PA 2FFRA 2DX7A 4N8EA 2B1RA 3GVCA 3QUCA 4RK1A 1YR7A 4JXXA 4G4JA 1N36B 1VYTA 4QGHA 2ALJA 2QMUA 3FIJA 4HL6A 4BRSA 2RHCA 3SKYA 4OXRA 1NL3A 2ZI4A 3LPAA 5SZKB 1JFLA 3NBXX 4E09A 2BGWA 5CT4A 4BJ3A 3ZWVA 2Y1FA 3PSAA 1CVRA 1GM5A 2BM9A 2NXCA 3DG9A 1P7ZA 1C3EA 2DSNA 2AJCA 1HOTA 5TLSA 1PYDA 4EW3A 4IHQA 2WYIA 2BGTA 1K5DA 3TDKA 4CCSA 3GW8A 4EG7A 5CFLA 4PO9A 3KU1A 3ST7A 3OAAA 2J5RA 1JSRA 3PQ3A 1L4BA 4MRMB 5KOJA 3U0BA 3EGOA 1XLVA 2W4QA 3W6ZA 1CP2A 1KO4A 2QM8A 2Z09A 3AP2A 1E0DA 1N5KA 1YDMA 2NAPA 3SQWA 4M4SA 3QUBA 3DBVO 3N0TA 4NBRA 1P3Y1 4HEA1 4DUZB 2YMMA 3MLBA 2QRVA 3I01A 3BL8A 4M9SA 3WLHA 4FI3F 1FSSA 2M1XA 1LV8A 4Q3KA 1L5LA 4QGSA 3GLFE 1MJ5A 1JFFA 3VYSB 4LJLA 1MIOA 5DISB 3U9TA 4BTVA 1CUSA 3P96A 4FFSA 4RZUA 1YDHA 2W00A 2ZB3A 3D3KA 3DEYX 2VUIB 4QNMA 4BBAA 3SIXA 4CKBA 2ZUBA 2E21A 1DIAA 3N8GA 4LZAA 5EUQB 4M83A 3LI2A 3U7QA 4GKKB 3TLYA 4LXXA 1E6LA 3TS1A 4DLWA 3WFIA 1ODIA 1EFVB 2YMQA 4D9NA 4GKJB 2J59A 2VXYA 2XOKA 4GH5A 4DIOA 5HKBA 1E1YA 1KMIY 2EX1A 2BAGA 5DK4A 5HTOA 1XZCA 1JW9B 3QFHA 5EJAA 4LYGA 3RYFA 1O97C 4B2YA 2OB1A 3H5RA 4D9BA 4P4UA 4XWWA 4WADA 4ZOQI 2O2CA 1R6XA 3QVSA 4YRCA 3D7KA 1AGRA 2JC3A 3FYDA 3NH9A 5EUMA 2DPMA 1SA0B 4TV9F 1UM9A 4FJ0A 2YW9A 1F4PA 2DEUA 3HJCA 2JD0A 5AI8A 3AIKA 3G85A 1KWGA 4RNDB 3PNVA 1R8YA 5SV2A 4D9FA 4C07A 2GNPA 5K0ZA 4EW2A 3PL5A 2AZ4A 2ZI5A 3UATA 2VUSA 3VGJA 2H0QA 2WTXA 5F7JA 1SIWA 3VYUB 1YMQA 3PHGA 4QUJA 3U81A 3F73A 4I9GA 4MUAA 2KX7A 2D0IA 1IN8A 2RGXA 3PICA 4ZRDA 3N3BC 5HDQA 1WQ4A 3V7YA 1YGPA 1I1NA 4RF3A 1Q1QA 3ZS9A 4JHXA 1R4MB 2V5AA 1JVNA 5GONA 5I5EA 1AA9A 1A4XA 1WCYA 4I50F 4K6FA 5E6SA 1W0KA 5HEKA 3OPNA 3CN7A 4A6DA 4ISCA 5I7WA 4MW7A 2AXPA 5HZHA 3A9TA 4PZZA 5LD2C 3UM9A 4URXR 2VHUA 5G0WA 4CT4B 3VYRB 3F5QA 3NT2A 4PAQA 5CFQA 2CLSA 4OHYA 3GMSA 5ED0A 4FFBB 3BTVA 1PG0A 2VJKA 3IPXA 1N9KA 4MCIA 3ZDRA 2JD2A 4YV0A 1BE6A 3GUHA 4M76B 2NTNA 4I36A 1AVTA 3F8TA 3COPA 3GP5A 4TSRA 2CNLA 3FD8A 4EHBA 1HKHA 1KR5A 5G4KB 5JIBA 3DMTA 1BA2A 1VSVA 3N7TA 3FCYA 3BMQB 4RVHA 5B3KA 1VJRA 3WHPA 4N7RA 3TECE 4ZOLA 2XUDA 2OXTA 3VFDA 6PFKA 5EJGA 1D1SA 1EGMB 1KO8A 1BXGA 1NG1A 1XALA 3GJ3A 3RJTA 4F86A 1NF8A 5KB3A 2BR3A 4L5CA 3L0BA 1R12A 4IH1A 3FLEA 5D84A 4GWGA 2JKYA 1SZCA 3LFHA 5L3RA 5AW6A 5LD2B 3MTIA 2BMVA 1NW8A 2QL5A 3OICA 2V7WA 1BCSA 2X76A 1B00A 1D0SA 5D86A 2H65A 1ZCJA 5A3RA 2IOFK 3JARA 1NVVQ 1CUUA 2IPOA 4HKTA 3MD9A 1S9DA 4BC1A 4JNKA 3ICQB 4K26A 2Z6QA 3INGA 5UKDA 3MXOA 2O48X 3KPJA 2X4GA 1PFKA 3OZAA 3UT5B 2WVGA 4OFBA 4E31A 2C1ZA 5KKCA 4ZV7A 2WJPA 4IWXA 3QEMB 1ST2A 2CUTA 4HX2A 4TT3D 4G0QA 4I6JA 4L0QA 5GZ6A 5A7GA 3A6DA 5JD6A 2R60A 5A7HA 2L17A 5EMNA 1CQIA 4DCGA 1M8GA 2WA1A 3CPJB 1BXRB 1ZI8A 4FIDA 4Y0NA 2O07A 1MO6A 1NW6A 4U9IS 2A0YA 3T7AA 4BNNA 2X7XA 1H4VB 2L42A 3IA7A 1OX6A 5FYDA 3ZE2B 4CCAA 5AVWA 2CL0X 3U62A 2D7DA 3RRBA 3QH4A 4IHKA 5EJ4A 5L40A 1RTTA 1PGJA 1U9IA 1ESEA 1VIVA 4RD2A 4DUGD 5KPJA 1H93A 1MO4A 2XCOA 1BDMA 2FPIB 3O1LA 1IDOA 4MEBA 4K9SA 2R79A 3EQ9A 3L1KA 1BE1A 3NBZC 3EQ2A 5D1NA 4OQNA 2CVHA 4AZWA 3B5EA 1GGEA 4JJEA 3ZNQA 3GAZA 4PX5A 2PAAA 3R3VA 1Y7PA 3LDAA 4IO0A 4K1LA 1RZRD 4QASA 1I32A 1KAEA 1ZNZA 4G23A 1NVAA 1TO6A 2QTNA 4X54A 4TKMA 3WGTA 4K3VA 1PWYE 5DGXA 2CNWD 2B92A 4PSAA 3ZWDA 4CUKA 2BZSA 1SOMA 3RUEA 2FW0A 2HRQA 2WSMA 1SUDA 3AR5A 1PP4A 4TTAA 3RFTA 1V16A 2CFTA 3WG9A 4NFHA 5T5QA 1NSFA 1Z2CA 1X2EA 3DBRA 4A91A 5J2UF 3WFJA 1TM5E 2C2KA 4MUKA 3T0FA 3STUA 3HA2A 4ML3A 2IYUA 1AHNA 2OD2A 3KXKA 4PBSA 5DK6A 5A3VA 4OX9B 1GPUA 4LGMA 4TMXA 3L0CA 2XY4A 5A3JA 4MWSA 4AKIA 3G5TA 4EL5A 2QMYA 3BJEA 1GNQA 1T0BA 3AEUA 4I3FA 5TMEA 4HFRA 2P9JA 1OT3A 3GG2A 4HWGA 1MAAA 3D3WA 3ETCA 1F2DA 1OLXA 2VOEA 3JD3A 4QUEA 5CB0A 2GTIA 3AJ8A 3IUSA 1SKAA 5CVJA 2QYSA 3UWMA 3O4RA 1R7RA 4GL4A 4BJ1A 1SBYA 4B3FX 1DGQA 5C34B 2B8WA 3NWBA 3E9ZA 4UCQA 1CIPA 5CW2A 5FORA 5A04A 3NEPX 1XHLA 3OJCA 3ENVA 3G68A 1REQB 3V97A 1T2UA 1WM1A 1Z4KA 1JG2A 3KSAC 1JLHA 1NF2A 4IDGA 4KQ1A 3AP1A 2VT3A 1PTKA 4ZOEA 1KZ1A 2IP4A 1AKYA 3NHUA 5CX1A 3DCNA 5B6PA 4K9LA 3QSYA 4RK7A 5IAKA 1I4TD 3H9EO 4C5AA 4UQPA 1LSUA 3NNDA 2MWMA 2PUHA 3ONWA 2I6XA 5YASA 4BVFA 3RRJA 3IP8A 3ETJA 1UBMS 3NS7A 5KU1A 2UXDB 2JLBA 3AJ9A 1KOLA 3QTBA 3VU0A 2FDCA 4J0KA 1UMBB 1QHFA 5HUQA 3LK6A 3RT1A 1ZIPA 5T4FA 1HFJA 2EJUA 4RA6B 2REQA 4C7MA 1N2SA 3GNQA 3LLMA 2GK4A 5CBPB 2C0CA 2RH5A 1NQTA 4NDZA 2V65A 4WK4B 1OIVA 2I34A 1L7DA 3GJZA 3HFGA 4FXPA 1C1DA 4MVJA 4PLPA 1E60A 4GMGA 4DGSA 2GZ3A 2IH2A 3FOBA 3U44B 3HY4A 4ZVRA 1DUIA 1EWRA 3W2GA 1W7AA 3KL4A 4DB2A 1OB2A 2REOA 3L0SA 2ZE6A 2RHTA 1M2KA 3KQVA 3HEAA 3SX2A 1T6BY 2C07A 1Z2AA 4C0XA 1QU2A 3II6X 1PZEA 1DBSA 1PSDA 1GTMA 2JFYA 1XK7A 2Z8YM 3D3QA 3B1FA 4XUGB 4ZAVA 3RKSA 1UBTS 1QF7A 1OTYA 2NX2A 4KFUA 5DHRA 1L8AA 5LZ8A 4BVGA 3H1FA 4WNAA 1AKUA 1JEOA 1K6EA 2WJHA 5BOVA 4F0JA 4KK3A 1JXQA 1MQ8B 2R8RA 1O1YA 4CG1A 1Z26A 1VE7A 2VHTA 2W11A 1HE3A 4HNAA 1CY6A 1LTKA 4MRAA 1QFYA 5K8CA 1ZWKA 1I4WA 2VCHA 1YQTA 2EDAA 3IQFA 3D7NA 4LNUB 5EINA 3RUDA 2QP4A 2X3YA 4IUYA 3K6RA 5DBGA 5ES3A 2HN9A 2JLYA 1XZGA 3OOHA 4XA8A 4ASUA 3OESA 4EGJA 4N01A 2Z95A 4FMCF 3TRIA 3GH1A 3HYLA 2Y77A 3BXOA 1ISSA 3HJGA 4PPNA 4IXWA 3N0WA 2O8NA 5CT8A 3W7BA 2VC2B 4MKXA 2XDQA 3JQ8B 3ADDA 2ONCA 3A6JA 3G0IA 1PR0A 3UWPA 3WMXA 2HJ9A 1LFDB 1V5IA 4EM6A 1W5SA 2XJ4A 1G2QA 1N0IA 4OYRA 3UWDA 1Y8RA 3H18A 2Q6TA 3TZHA 2GK3A 5COQA 2JRLA 1VOTA 3P27A 3RS3A 1KYWA 4EHIA 4KH1A 1ZEJA 1QP4A 3UYLA 2IKQA 2QN1A 5DVZA 4EQZA 4Y9SA 2A92A 4DV6B 1YRWA 3I1IA 1GAXA 2Z5FA 2Z8ZA 3DCYA 1Q1NA 1V47A 4TV8B 5ALEA 4YPOA 3L0ZA 5TSDA 3I9LA 3PUHA 4F3NA 3ROTA 3OTGA 4MVJG 2YRXA 1TZCA 3M83A 4U2BA 5DTMA 3UANA 3HNRA 1Z7WA 2GYWA 3KR2A 4DW8A 1E1QA 2R1TB 3QPWA 3COWA 2B8NA 3KKPA 3L02A 2QYOA 4QYSA 4Z9YA 3WYAA 4P4GA 4XYLA 3NCHA 3ADKA 2XAUA 5DNAA 2AN9A 4J1TC 4QTXA 3AKDA 1CETA 3RU2A 3CRRA 4W63A 4DBVO 5LXTB 1IXSB 2I67A 3K5HA 3NYRA 3C5EA 5E4JA 3VPDA 1YKSA 1DG3A 1VKOA 4MP3A 4YUAA 2C5BA 4D4MA 1XFDA 3GNLA 5DT2A 3ZWXA 1V5GA 2GD0A 3GYGA 3H5IA 1G5HA 2Z57A 2ONJA 4D8UA 3LWDA 4C3OB 4G1EB 1ESMA 1XXHE 4URYR 5KOHB 1P8JA 4Z9BA 3DMRA 3OM1A 1YBFA 1ZP6A 3QLUA 2GMWA 4UHDA 1W30A 2H1FA 2Q4TA 1TCVA 4GE3A 3AFMA 4YXWD 3KHSA 4CLDA 4DSUA 3GBPA 4OU5A 1E2DA 1TL7C 1V2HE 3LH5A 4OHPA 3SEAA 4EYOA 4NYJQ 1VLHA 3CG4A 1P80A 3PQ8A 3G2IA 4RVSA 3CW9A 1OXMA 1S2NA 1JV2B 1XRSB 3NIFB 4JFAA 3K5IA 1T1GA 3QMPA 4QOJA 4YHBA 4TQAA 2GZ2A 3UPTA 3JATA 5ALUA 1Q0RA 3LC7O 1RKVA 5B55A 3H13A 2ZWAA 4C0JA 2Q2WA 3R7LA 3U4GA 2XE8A 4ND5A 1PS8A 3DXYA 4NS1A 4TYMA 5AR1A 2ZVDA 4L8VA 5HZKA 3TFQA 3BWDD 3FOWA 3VTAA 2NACA 4Y2RA 1ZSVA 2ZRAA 3M7IA 4GL2A 3BXPA 4Z8YA 4Z7OB 3MUOA 4QG7A 5I7AA 3BL6A 1T5OA 2YDXA 3LECA 4QVIA 1SXHA 2VBFA 2I8CA 2ZIFA 3TTYA 4BUJA 5B3JC 2YMLA 3GEDA 3BUSA 3LQ2A 4DJFC 4F71A 1VCNA 4NBNA 3KOMA 2R0QC 2OHXA 3ZGYA 2OHFA 3D8SA 1I2BA 2B4AA 2ZQ5A 4IXMA 2QMOA 3W1VA 2V6JA 4CKCA 2RC6A 4KX5A 1FUIA 1MBZA 1XB2A 3DLIA 4YDRA 4IJQA 4C0AC 1UJ2A 3FDJA 1JJAA 3B52X 3B6KA 4B74A 1I7SB 5TDHA 3S29A 2P1DA 2RGBA 2JZNA 3MINB 4HAWA 4M7RA 2AEMA 1S3IA 3AR7A 1T3LA 3RR2A 4QXPA 1PQWA 1NVBA 3ET5A 2E82A 1M67A 4N49A 5AKLA 3QY0A 1G2OA 1KFCB 5TVKA 4ZJZA 2WUEA 1KY3A 5B58T 1OWMA 5BXYA 3O8OB 4DDTA 1YJ5A 1YOBA 2PSDA 3LYAA 2V7XA 5KUTA 3FDZB 3QEJA 2LCFA 5CT9A 1YQ9A 2RKOA 4A8HA 2P69A 3CIOA 1ZOPA 7REQA 4UBNA 2AOUB 2G9ZA 1VGVA 2V7UA 2LIVA 1E2IA 1XRQA 2NTJA 1RXYA 3EDOA 4BO7A 5LN1A 3ECCA 4CHGA 4O33A 5C9ZA 1CFZA 1JHOA 1EESA 1JVSA 1RRPA 3A36A 3OHMA 1P1BA 1V37A 3UCFA 1FXWF 1ABFA 2ZJBA 3FRJA 4OGKA 4TVKA 4DLTA 4FFDA 1GAJA 1DMSA 3W04A 3F7NA 4ZYYA 1BKSB 4L78A 5AQEA 5KVSA 3TKLA 7MHTA 1F7UA 3VTKA 5L4NA 3K8QA 4MAMA 5LR6A 4F5EA 3EZYA 4HN9A 2DHCA 2QYTA 1JBQA 4AMBA 3A2KA 2R3SA 3QBDA 4Z0NA 1RNLA 5CAEB 1JAYA 4FEGA 1SQGA 2K7ZA 3M5CA 3OTIA 4I0WB 4ETNA 3CJQA 4HDOB 3O47A 3RDPA 3WAGA 3PA6A 1MZPA 2XIQA 3H4VA 1LBHA 1NXPA 4P4NA 3UGKA 5K0BA 4C06A 3KT8A 1MV8A 1UWCA 5J4LA 2JA2A 2KI5A 3BIXA 3VR3A 4XEUA 2YJGA 4WL0A 1XTJA 1UJ6A 2BGJA 4FDTA 4ZARA 3FYSA 3SIWA 2HREA 3EJWA 4AUKA 3TNJA 4EUHA 2CL6X 1L4MA 3I0NA 3LUHA 1HZZC 5EZYB 2PJRA 4ZRMA 2A0WA 3QJGA 3ELUA 2I65A 3UJAA 4MV6A 2V6BA 4ZU1X 4ZYZA 2BUBA 3S44A 3DLHA 3A37A 4A7PA 2GPJA 4Q3LA 3LYHA 4BASA 2DHRA 1FU4A 1Q0PA 1XAGA 3GK3A 2JGEA 3K8OE 2PO7A 3QG1A 4NCKA 2I6QA 4QOIA 2V5VA 3WLEA 2IEIA 1SVMA 2D7CA 3DMDA 4EY8A 2PUDA 2ZBUA 1QOPB 2PXAA 4MI6A 2BEJA 3Q5GA 3ZX4A 4YP1A 2FZGA 3CR8A 4YLYA 1VLZA 2W2MA 5FADA 4YCSA 5TC4A 3FDIA 2PZJA 1Q7EA 3H2SA 1NVKA 1M2VA 3C3CA 5LWHA 2X0IA 1P4SA 5D5QA 1TXGA 4E15A 1G20E 3HYSA 4ZA2A 2XF8A 1KJQA 1B15A 2Z9BA 3LPMA 5L3QA 3PB3A 2EEPA 4US0R 1EK0A 3DD1A 4R98A 1P5ZB 3KAJA 5DZSA 1NHGA 3FCUB 5HYVA 1Y8ZA 2M6RA 3E1GA 3D4NA 3ONNA 4RDIA 4TSKA 2PGNA 2HCBA 2EP8A 3C2QA 5EWMB 1KZ7B 1QKJA 2OHVA 4MWBA 4LYDA 1WBJB 2DBRA 2HXGA 3RKUA 1S2DA 3LUJA 3O90A 4RELA 1QTQA 1LQTA 2OGSA 3AUUA 1MVNA 4KX3A 3EPPA 3TPCA 4YCAA 3SS8A 1BW9B 1E3SA 3K1TA 2Q0QA 1F2UB 2WJZB 3STWA 4ZKEA 2VDMB 3SICE 1DIRA 1BN6A 2KW5A 2BKVA 4UM9D 5FQNA 2FR1A 3HY3A 1N7IA 3L6RA 2XGGA 4NBTA 1T3SA 3B2NA 4IQGA 5LB2A 2BM0A 2RGCA 3F98A 1LDGA 4JJIA 5J5VA 3DGEC 4FFLA 1V96A 1TCAA 2YS6A 1XKQA 2RAUA 1GJRA 3B7WA 4OQDA 2Q2OA 2PUFA 1J8DA 4YR7A 5HP4A 4FYMA 3I62A 4OP3A 4UDNA 3FKQA 3HV0A 4LHVA 2I4LA 4AXXA 2DZDA 2JIMA 4MRMA 1IEWA 3GAMA 2H8KA 2J30A 1LRJA 3EH2A 4NG4A 4EYEA 4W5TA 1YR9A 4BLTA 2CUNA 2VHEA 2OV6A 4Z8XA 1JE0A 4P38A 3QXXA 4L22A 3TUJC 4KE8A 4ECAA 2Q7DA 5J4KA 1M34A 1MRSA 4CQNA 2C9CA 3ZBPA 1TCBA 3F3YA 3M6UA 2IK8A 3LLCA 3O8BA 3NJRA 2ZETA 1IOWA 2BFOA 2ZYVX 4L5BA 4L4SA 2NWQA 4UNNA 4E2YA 2HW8A 1A2BA 1K6MA 1S0UA 2FFJA 3EHEA 3H5AA 1L1FA 3R7AA 3PXCX 1YZYA 4RIGA 4J4BA 3E35A 1RTKA 1VRVA 4IQ8A 1PQUA 4HH1A 4IWYA 4II3A 4POAA 2PUCA 1EFRD 2O8EB 4KWEA 3PGLA 4JQZA 3WL7A 4EW1A 1FU7A 4EX6A 4F9EA 4L4ZA 2GX6A 1ZVVA 1NULA 3TIIA 1HFEL 1KQPA 3JZIA 2YR0A 5JAQA 3IP6A 3GLKA 4WZAB 3CGGA 2JHAA 1KQOA 1OWPA 5CX4A 1JAIA 2VNKA 1GCAA 4E03A 4OGWA 3RANA 4UDOA 3T94A 4KC0A 4C3VA 2Y76A 5I8ZA 3A6HA 2BYTA 4RO0A 4YJHA 1U2ZA 2EG5A 5LJLA 2JPDA 1ZG3A 2YJ3A 1SA0A 3PPXA 4QNNA 1UXIA 4QVGA 4ZVVA 1DFIA 3LBFA 3ON5A 1D6NA 1II8B 4P53A 1TI7A 5EE1A 3FFXA 5ELLA 3RSFA 2E49A 2YV3A 4KGXA 1W4ZA 4PG5A 4R2MA 1AC5A 1UWVA 2C9YA 2Z3WA 4PLWA 1ZUIA 3ORSA 4UHHA 2BF7A 4MB6A 1SBIA 4ZZ3A 1HURA 3IAS1 3X2SA 2AOVA 5LZ2A 2O20A 3OQ1A 2JASA 3NTOA 5C8VA 3RAFC 1CZLA 2GAOA 3ENNA 3QMWA 4I1VA 1ADGA 3L7LA 2EKZA 1R4MA 1NYRA 4AJOA 5LKAA 1USIA 1TAHA 3UKOA 4CKYA 2KLHA 3ICOA 1U8UA 2FGJA 4QQFA 2O5RA 2WKWA 4MQLA 4NYMQ 3FDXA 1ZC3A 4CLRB 1ZGBA 2D0PB 4FGKA 4XD2A 1KO7A 4D99A 3DEHA 3OZTA 5H9VA 3ZNPA 1NIJA 2V6IA 1XZEA 4FFBA 4G1UC 2J33A 1Z5ZA 2F3TA 1TO1E 3GHHA 4MV8A 1SULA 4M1QA 1T9BA 2B1IA 1W75A 1I2DA 4H18A 4MV0A 3ZJUA 4OLHA 3FKSD 2B30A 4K86A 3DTYA 1LNQA 3HP4A 2L82A 3OF2A 5G4KA 2OBMA 2YMPA 3HR4A 3STXA 4M8IA 1G5TA 1PWEA 4CLXA 3BMQA 5K99A 1GPKA 3C1TA 4Q1EA 4YTEA 1NLFA 4FONA 1FBTA 1JYEA 2DUWA 5JMPA 1ZD2P 4DEXA 3KZVA 4ZOAA 4Q01A 5IUJC 1ZMBA 3KSMA 1D03A 1UQRA 1XRPA 1ZOIA 1H8EA 2VRNA 2XMCA 3AILA 3FMGA 4NMXB 2QBYB 3OX4A 5IHXA 3ZGXA 2CDBA 4DLKA 5B7NA 3PEEA 1OFUX 1QO0D 2RAFA 1P74A 2R66A 2J09A 2WYOA 2QJOA 1WO8A 4GMFA 1U7TA 1CY8A 2VO1A 3ZNOA 3TUIC 4F7WA 5MHTA 1CERA 4RZSA 3W8DA 3EGCA 2V9CA 4F4IA 1ZVKA 3BL5A 1VZ3A 5ERGB 4OQQA 3UKJA 2G5GX 3T7IA 4D0SA 3AONB 2AFIE 2HDNB 3LDFA 5TQVA 1N5RA 3IP9A 5AK6A 4YI3A 4IP0A 1RAIA 2QSYA 4FFPA 4LYFA 4AECA 4KITB 1SVLA 2X13A 5JECA 3UT5A 3MTDA 4DILA 5JS1A 4LXIA 1QV9A 1Z08A 2P9GA 3QEMA 3RHTA 3T38A 4DV3B 3PJRA 4YDHB 1XMOB 4RHXA 4S2UA 1NQUA 1BXRA 2A1TR 2H0RA 1ZU4A 3AR8A 5J23A 1P2GA 4CIYA 1YE5A 2VHXA 4XFDA 1M9NA 4H2DA 2QD2A 1EJ0A 1UC9A 2VTVA 2VPXA 3IQGX 4YT8A 4ENSA 2JI7A 4AZ3A 3P26A 1J06A 1TA0A 4KI7A 2G1PA 2IS4A 2DAPA 5KTPA 1F06A 4YS6A 3DPSA 2FPIA 1RBZA 4D3ZA 2GBPA 1GFSA 2C5LA 3DMFA 1MX1A 1RACA 1EMDA 3HVIA 2WQ7A 1Y6GA 1F9AA 1QP8A 3DL4A 4C7OB 1QHEA 1A8HA 3K1AB 3VI4B 4D25A 1SURA 3AF5A 1Z35A 4L07A 4M0EA 4MGEA 1RXUA 2CYBA 4G8BA 2P90A 4DG9A 1GLGA 1UFOA 3MA0A 4M88A 4N5MA 2QWXA 3ICWA 3WO1A 5KC9A 3ESYA 5KMGB 2GFQA 1G2PA 3EPRA 1IBSA 4Z4IA 4GRIA 4Q93A 3GX1A 3O84A 1JIVA 2ONKA 3KAKA 2JHPA 4WBNF 3C6MA 4M1OA 3BVPA 5KAPA 3L05A 3KBBA 5KWJA 1IVNA 4RHYA 4MJLA 3ADCA 4ZTZB 1G5QA 1NPYA 4OGGA 4D4IA 3PBKA 3ZJ4A 3HJNA 4U2CA 4B3XA 1I9GA 3LMKA 3SD7A 4QGFA 4QO7A 1C41A 1RC0A 5CPFA 5HF9A 2VPIA 3KZCA 1O9BA 2PEYA 3I9V6 2QLJA 1ZR2A 1KMHB 1EXMA 3PQ6A 3GUUA 3BXGA 3JQ7B 3E27A 4UTXA 4CTJA 4UTNA 5BMVB 2KSQA 2GNAA 3F71A 2YN2A 4PCUA 2AJDA 2Q4OA 3QVKA 1I7DA 2GJKA 1CEQA 1REQA 1D0VA 1ONOA 2COUA 4GI2A 1DIOB 5D5HA 4XPZA 4CM1A 5JZOA 1GUYA 2AG1A 3DHVA 3MRVA 1GNRA 4TLMB 3ZE9A 2ZRMA 1PJCA 3BRWD 4K6CA 1QH9A 2OFXA 5AJTA 4NE7A 2W2LA 4WWHA 2BBSA 2PKEA 1G9XA 3H9GA 4IM7A 4O4LB 2GJSA 3RV4A 1Z4QA 5E4FA 2ZT8A 4J3NA 1W5TA 4ARZB 1Y1PA 2HMAA 2XF2A 2ZTUA 4NU5A 4UUQA 4OFZA 3GY0A 1E9AA 1YRYE 2H52A 4LSMA 1BMDA 3UAOA 3J81k 2FG7C 1OVMA 2WYUA 3K30A 5AJYA 1FFAA 1FFEA 3TH5A 3LTEA 1JKMA 1L3CA 1UMBA 3TTTA 1PQ4A 2EJBA 3B6MA 2VF4X 2D2VA 3Q7QA 4V0NA 5KNDH 4FCVA 4RA6A 1JB9A 2DFKB 2FCAA 4ZYWA 1GAQA 3A6FA 5CBPA 5JEEA 2GF0A 3CVJA 3UWOA 3ZOKA 4FZVA 2X9LA 2PGDA 2GCGA 1JKFA 2OSVA 4V0QA 1N57A 3RS9A 1TYCA 1XJ0A 3K53A 2DFPA 2G04A 4RGVA 3I0MA 2JANA 3ZGVA 3TWOA 3EMKA 3SX0A 3U44A 2DPLA 4DA4A 2EBHX 1YC2A 2C88A 2LUOA 2P6RA 3ZTTA 4UFNA 4X8OA 4BJ5A 1XTSA 2QA5A 3GWGA 3MCUA 4NS4A 5DBEX 4YMLA 3UMRA 1L7PA 4KE9A 1IZ9A 5CB4F 4E5KA 5DM60 3DBOB 2W6PA 2QPLA 4MS4B 3S68A 5A9SB 1RJWA 2NTVA 2V8OA 5J9FA 1HUQA 4BUZA 1N8NA 4F4DA 1QJCA 1U1CA 5KJCA 3NIWA 4G1BA 4UVGA 5EVJA 4JXZA 5AUNB 3IDFA 3OMXA 5G2OA 2G9NA 4F46A 2H63A 1MD9A 3EVBA 3ZWAA 4UHKA 4OG2A 3TQSA 3OPQA 4LNUA 2LNDA 4O2BF 3L6EA 2I7VA 4CMIB 1F4LA 1YFKA 2RD2A 1GUBA 1NYTA 2QL6A 3TQIA 5KTRA 4ZTUB 1HWYA 2XYGA 5I51A 1PL7A 3AU9A 4RW0A 3O31A 4C76A 2G9UA 2PKQO 2AOWA 1VE5A 3R0XA 2C0PA 2RIRA 2ATCA 2Q5IA 3OX1A 4BMVA 1AO0A 1QAMA 2Q6LA 1F48A 4AUNA 1PZFA 4Z4QA 4EFMA 4NL4H 1XVLA 1VL1A 3JQ8A 5I7EA 1CY2A 1N2XA 1MJGM 1TQDA 2B8JA 5FUWA 1A9RA 1CUZA 1S8NA 3KLBA 3OIDA 1NY5A 1D7OA 4UAVA 1KNQA 3JZDA 2WVJA 3M2PA 4LOAA 4MLDA 4CMCA 1YZFA 2F3PA 1I7PA 1XOIA 5KSZA 1TCCA 3U3ZA 5JAHA 1G8KA 3NC1C 4BP1A 5KYYB 1FW8A 3PDIB 4XWGA 1UBJS 4IDFA 2FMHA 4M1ZA 1WDMA 4G2TA 3OJXA 1JTEA 4S0XA 4TL9A 3LIIA 2V55B 5F4BA 4ALJA 2ZTSA 3PR2B 4YGYA 2XRYA 1DX4A 2HA5A 3MB8A 1IK4A 2ODWA 2P40A 3F47A 1H1TA 4TV8A 5THXA 5JYDA 4MA5A 4HVAA 2QTAA 3O21A 2FPPB 2D8AA 4QT0A 2P8SA 1K0UA 1P5RA 1UT5A 4L3VA 1YXMA 4M89A 2PJUA 3BSWA 4DPLA 1K2WA 2R1TA 1TKBA 1OGYA 3NX4A 4M99A 1LS6A 2BSAA 4RD4A 5LA6F 1QYDA 3CCCA 5FUQA 2Q99A 3H3JA 2KWIA 3TLGB 5FULA 4XYBA 1GILA 1T3ZA 5C5EA 3CLTC 3AG6A 5CNMA 5LXTA 3A1UA 1F2TB 4JT4A 2RDMA 4UEOA 1S3FA 4HDSB 4ZXFA 1FVFA 1XDUA 4H6VA 4HK4A 2CUZA 2GSDA 2IL1A 2R6GA 3L3BA 4O8ZA 4WOBA 5IVPA 4LSZA 4HNGA 4F9FA 3VH2A 1CEXA 1K7XB 5JFOA 1LS1A 5CDFE 3SXJA 5KOHA 2ETXA 4HZIA 2GYYA 2IH4A 1QK5A 3CT4A 3WR5A 1W36D 1SCQA 2PWZA 3KYJB 1GFIA 3S6JA 3O26A 3DS8A 4TTPA 1Z4PX 4L28A 3GFQA 2VP5A 4IJWA 1XE3A 5AK3A 4K87A 3WRVA 2EDCA 3W79A 2ZTLA 4DLUA 4Q00A 2H54A 4JP1A 1R3UA 4TQ9A 4KIGA 1DC7A 4HDQB 4BNVA 4W5WA 4R71A 1YTUA 4FHDA 1IN5A 4UJ3A 3R3ZA 1H2XA 1LJ8A 2FVXA 3FHJA 4J1TA 4UJ5A 3DW1X 3SM9A 1Q5PA 3NMUF 1C80A 3BKXA 4PXAA 1WY7A 1N5IA 4C4RA 1M5RA 5CITA 3U26A 5FWAA 3ZWOA 5G53C 2RBKA 4NATA 3TNFA 1O6ZA 4DFDA 4LBVA 1FNSA 2FA9A 3FR7A 3FPFA 3VR5D 4MEJA 1LRKA 1KGSA 4MPRA 3V1NA 1GIAA 3GRCA 3I4LA 5I3CA 2YXNA 4AG5A 2C2WA 2H9IA 2GBGA 2X0EA 1BCRB 2Q5EA 1USUA 1PAUA 2NPOA 5BVGB 3MT7A 2VZEA 2M98A 2DY0A 3T9FA 3SNHA 2WF5A 3DA8A 3H5OA 4TTJA 1WMBA 4AJKA 1MO3A 3H87A 5FFMA 1H0RA 3GQVA 2IH5A 2EBWA 3V1LA 1PTJC 2FOLA 3G0OA 3MINA 4E2FA 1YR2A 3ANYB 3HXPA 3KZ1E 1TZ2A 1WG8A 3RV3A 4DV2B 3F5FA 5DGCA 4DQDA 1DRVA 3PTZA 1HG0A 5FNVF 2GBIA 1EFHA 2ACVA 3SR3A 1DCMA 4JKOA 3C3DA 3O8OA 4ZCQA 3WZMA 1VL0A 1VLLA 3T06B 3UB2A 5JJKA 2R65A 1U9YA 3FDZA 3LPNA 4GBGA 4LVCA 5E6RB 5A7FA 1GNLA 3UT0A 5AVRA 1BROA 1HI9A 1DB3A 3PNMA 3CLSD 2J0QA 2AOUA 4IG9A 2JLZA 5D1HA 1JZSA 3ZCQA 1KYQA 1QHNA 3KE9A 2PBLA 2HK8A 4HNHA 5B3JA 4XUCA 5IW8A 1MB4A 2ZE7A 4FWIB 1T9KA 2CDNA 3CCBA 5MF6A 2MSEB 4Q1DA 2D62A 2Z83A 4GEGA 1KJ8A 1CUYA 1XI2A 2ZT5A 1GQQA 2HB6A 4PSDA 3ZBQA 5IT9A 1VJGA 3CX4A 4NBUA 1LWOA 3OC0A 3WKCA 1SC6A 4CG2A 1ZSYA 5EJEA 2A86A 2WICA 3R41A 1Y0BA 3PUZA 3IVCA 1O0BA 2J32A 3FFBA 3Q8XB 3K4QA 1SCJA 2JBAB 4RD1A 3EQ6A 3IE1A 1HLPA 3MS4A 2NTYC 5K8VA 1YL6A 4FEYA 1E6UA 5CAEA 1HL3A 1HTTA 3PA8A 5A02A 3QSGA 5ER6A 3QW4B 4JJAA 4YRFA 1NVXQ 2QOEA 5DLEA 3WIVA 1YJ8A 1FLAA 2G9QA 1I36A 3I04M 3JQQA 1TW2A 4UD6A 4RQBA 4KN8A 4WNYA 5IJ9B 4BO5A 4S04A 2G8LA 2SICE 5E7QA 5EOVA 2XTAA 3CF0A 2W6JD 2XWBF 4A6XA 4EFDA 1TVCA 1FQKA 2QMHA 1XK6A 2XW6A 4RL4A 5EZYA 4NZ9A 3RSCA 4URWR 4DPMA 5SZIA 3CRMA 2NMVA 4RXUA 3LBAA 3WP1B 1JLMA 2NIPA 1Z0KA 1XKXA 1PUXA 4NV1A 5CVUA 5ADVA 5M2QA 2OCBA 5GJBA 1QS0B 2PL5A 5HOQA 5BW8A 3E2IA 4O2LA 1YVPA 1HNNA 2QU8A 2YDYA 3ONFA 3R3HA 3DOJA 2XGMA 4R05A 5KKAA 1XQYA 2WWXA 3HYTA 4JC4A 4DEYA 5KPDA 2QG6A 4AWBA 4ZT7A 5E1OA 5DX0A 4DZRA 4YXFA 2IOYA 3AEYA 1DAIA 3VZBA 3GV0A 4FILA 2NP6A 2H48A 3R7WB 4DCOA 5CYGA 4G4SO 3STYA 1U3DA 5EGNA 1H6BA 1DAKA 3ZDZB 3DLTA 1T5DX 5KNCA 4V1CB 3C8MA 1P1IA 5AICA 2QMEA 2ODQA 4PRKA 4GVLA 3WDSA 2HCTA 5K4AA 4RA9A 4NK5A 5KNBA 3FI9A 2H08A 1XRNA 4Q39A 1XIVA 2PWAA 5T3YA 3ZLBA 3AVTA 5TF0A 4JSYA 4A03A 1PR1A 1LGYA 1PJ8A 3KKNA 1OB5A 3ECSA 5F3RA 3GGJA 5J1SB 3WLRA 4FZ5A 4PPGA 1ILEA 2B69A 1SKYB 2Y4NA 1YOVB 5EWMA 3WDLA 5E7IA 1NFRA 3GUCA 1KEWA 1U0TA 3EC2A 2NV0A 3LDGA 4I8IA 4LY6A 2H07A 4POOA 1GVNB 1WPXA 1OSNA 1B16A 2NO1A 3RPEA 1T15A 4KZPA 2FHPA 2HFKA 3CH4B 1C3XA 3K94A 2W6OA 4GQIA 2ZB7A 1BW9A 4QQKA 3I5YA 2ZRLA 5FPPA 1F2UA 4H31A 5JXIA 1EVQA 2QN9A 3L7NA 4RVDA 2FE1A 4PLGA 5E0OA 1WVMA 1TD9A 2Y0EA 2GPTA 2OM6A 3L7DA 1R4NB 1UC8A 3EUAA 3R6WA 2VXOA 4LV8B 2AN3A 4U63A 1FP7A 1RYZA 2O3JA 3HXLA 1WHTB 4KMRA 1TJ5A 5JD5A 2YWCA 4CEJB 1FNBA 3TTVA 2WV9A 1AUXA 2RHBA 3ACCA 2QZJA 3KT0A 1KETA 4M8KA 4OHFA 3R7BA 1LEHA 3DC7A 2HRZA 5L45A 4OGLA 4EGSA 4HAVA 1X9HA 4LXGA 2FSPA 1FNDA 4WLEA 4BVJA 2ECQA 4MUXA 9ATCA 3FKSA 1Q91A 2O8BB 3UAYA 1M5UA 3VMMA 3AX6A 5KWVA 4FQ8A 2HTEA 4ER0A 1J0EA 3QU5A 3HTXA 4UUBA 1Z3IX 2UVQA 3O2SB 4ZVOA 3WZLA 1P2TA 2WABA 5GQSA 5LYYA 4Q1BA 3VVLA 1DEHA 4Y9UA 2F4NA 1UBLS 4UCXA 1TTTA 2C9OA 4X94A 1DJNA 4ZO4A 2VKQA 5ICSA 1RABA 3U16A 2ZI6A 2PRZA 4JQOA 2IV3A 1N2OA 2O8EA 1EJ2A 1CJMA 1N6IA 4ALIA 2INGX 1GGNA 1WIWA 3ESRA 4IS2A 2VWGA 4J07A 4KTVE 4XDHA 1SM4A 4LI0A 1VM6A 3JSXA 4RWZA 5JJLA 3SHFA 3ENZA 5K6AC 2OZVA 1E94E 1NUAA 1Q16A 4JX9A 2QTMA 1D2CA 3R5TA 2X23A 4UBOA 4WZAA 4B45A 3QUAA 4JVNA 3TOZA 1VSQA 2WT9A 4NNPA 2ZDQA 4BS9A 2QRKA 1YZGA 1L8OA 8LDHA 3I6MA 1IAVA 4HRXA 4R1OA 4INPA 4DNPA 1PEAA 2CBGA 2IYOA 3G9UA 2JEYA 5EE0A 2QTLA 4MYSA 4PN7A 1WOYA 2C78A 3KFLA 1WTAA 3FG9A 1CR4A 2WD7B 3BRCA 2LKCA 1O5OA 2F8TA 3P5BA 3SM3A 2NV6A 1XL1A 5JNVA 4X1OA 1U98A 1Y4UA 3C14C 1II8A 5DJ5A 3LHSA 5I8PA 4RJTA 1BX0A 4A0GA 1IHYA 1SHKA 2X9NA 2HOQA 2IHBA 4G09A 4O2AF 4ZQCB 4DMGA 4EENA 3B48A 3EOBI 4DMFA 4QARA 1I3CA 1ZU5A 2F3UA 2QTZA 1SFRA 4NYIQ 3CLRC 1KKLA 5AJUA 1RRMA 3FWZA 1EU1A 2Z4SA 4UTOA 3SYNA 3G9XA 2X9GA 1QG4A 2TMYA 2V7VA 2Z2JA 2WNSA 3KKMA 2W2NA 4B9AA 2FSUA 4PVDA 3IUBA 4WAUA 1YB5A 3OY2A 1NMSA 2CLMB 3VVBA 1YDFA 4CLRA 1W25A 3IKJA 3MD0A 4TS3A 4BY9E 3TQCA 1FYVA 4Z6KA 1B23P 4E3ZA 5HK8A 4EA6A 4A15A 2R2GA 3K0FB 3ILVA 2QQ0A 3C3WA 4QECA 3RBXA 4CEIA 2RH8A 3OLZA 2VZ9A 4YPVA 1KIMA 2ZIUB 2DJIA 4F56A 3OJEA 5GVRA 2JCVA 4A4DA 3HH8A 1I6KA 4DLLA 3HKBB 3EULA 4XJVA 4YGXB 3MHPA 1ECJA 5DMHA 2RGAA 3MSCA 1TUIA 4HAXA 5FA5A 3PUWA 2Q8QA 1VSUA 2I7XA 1UFRA 2ORIA 2CK3D 5ENZA 3LPDA 1R15A 4NPAA 1QNLA 3I45A 5B37A 1ESNA 3PVCA 4EY3A 3WGKA 1E9BA 4IF4A 5G0SA 2A9JA 1TQHA 5CB6A 1ZK0A 3LRXA 1Z4IA 3EAGA 1I4DD 2WM3A 2QBYA 4JB2A 1XMIA 1VKRA 2Q4EA 4Z0TA 2VBCA 3TSAA 3QVJA 4HRYA 2R8YA 4BTEA 4GPD1 2KMLA 2F59A 1VDZA 3MUNA 4P5EA 1M0TA 4F85A 1A98A 5FWYB 3R5HA 1BH6A 3M81A 3OM9A 1JHRA 1WUTA 3OPVA 2OBXA 4OF4A 1SK8A 1US8B 1Z39A 3SN6A 3DFIA 4S12A 2XB9A 4LF5B 4QYMA 1E8NA 4IS3A 2PZFA 2RHHA 3D8BA 4J2TA 2YJ6A 3B7PA 3ZW7A 2Z8XA 1N33B 1NRIA 3CB4A 4W8HA 4TWIA 5JALA 5KSYA 5AW2A 3WOHA 4R2HA 3HO8A 2D8MA 2ILVA 1GL3A 1YCDA 3N8DA 3O75A 1ZHHA 3QHAA 2NZYA 1ZVMA 2BPOA 1TEXA 4W5HA 1A9XB 3A1FA 5F2KA 2JLXA 1ZAYA 1QOZA 1RAAA 1ISJA 1TMGE 4LZZA 3AEZA 1YZUA 4BMXA 3WLPA 4JXJA 3KOOA 2R48A 2DOKA 4RC9A 3D4BA 1CTQA 5CDSA 4YHHB 1JDNA 4COOA 1VI5A 2ZDGA 3UO8B 2FZEA 1M1YA 1KJJA 4OHMA 4GX0A 1I6LA 1TPYA 5JADA 3OMLA 4Y9RA 3CHYA 4Y1EA 2W0SA 3PEUA 3GLHB 4IG4A 2D5AA 1N6NA 1NLMA 3QVXA 5EXPA 3KK0A 3S2UA 1KI6B 2F9FA 2FQXA 4BEJA 4U5XA 4DNQA 4YUXA 2Q0SA 2PE5A 1C8LA 4C7OA 3PHLA 3K1AA 3R0ZA 1L5GB 2WU4A 3DT9A 3FDFA 1NJ2A 4L4RA 4DSZA 3CMMA 1R6VA 4HPWA 5KMGA 3NIDB 4CM5A 3ME5A 8GPBA 3IAS6 2M6LA 4G2NA 2FX2A 1XEXB 4X8LA 1MW9X 1PU2A 3GVXA 5AK4A 3WGGA 3DZIA 5JFGA 1NC1A 3LXMA 1L4NA 1PNTA 2H5LA 1EZ1A 5ALQA 3KS9A 5CXUA 5K51A 3U39A 5I7HA 1VZ2A 4RHFA 2WJIA 1DRJA 4AT1A 2G25A 4IAOA 1CY0A 4DM3A 3P7MA 2AJLI 3IIKA 2R6ZA 1ZISA 721PA 5TV2A 2Z8YA 2ROQA 3PEWA 1OXUA 2XMBA 2QR2A 4AN1A 1KEUA 3JV7A 3LHDA 3WDKA 4KGZA 1SD5A 5HUHA 3THWB 1RPNA 3VO2A 1Q83A 3LU1A 5JXGA 4RIEA 2WKSA 4EIWA 1SC4A 1EFTA 3AZOA 4TMKA 2RC5A 4HFNA 1KMHA 4EGFA 5AVTA 3JQ7A 5FV4A 1P9WA 2OG1A 2YNMD 1M7GA 3GOHA 1LW7A 2CMDA 2IYLD 2J4FA 4L8WB 4K5QA 3IP5A 3DVQX 3VKVA 1ZSNA 4GM4A 2ZUUA 4EHFA 4X3OA 2PSSA 3AF4A 4K0KB 4AP6A 2Y99A 2QGZA 4XD7D 4PGFA 4UAJA 3RSQA 3TNYA 5JNSA 2AHRA 5HS6A 2JFZA 1DS6A 4O4LA 1DKUA 4IYRA 2AMJA 1EWQA 3EXIB 3UJ7A 1PWXA 1RU3A 3PENA 5HRCA 4ARZA 1JEYB 3O82A 1FFWA 4JLNA 1SG9A 3NEYA 3UJ8A 4R31A 5C8YB 2FW8A 2M6SA 1ZJ6A 4FFWA 1G1AA 3S2SA 1ZONA 2CLFB 1H5UA 2WB4A 3ABOB 4LK3A 1BE8A 1D2MA 2P0YA 3B78A 1HT0A 3R7DA 3IA2A 3V42A 2ARKA 3FCXA 3ZXUB 1G8AA 4G41A 3RW9A 4JQSA 5JSHA 1U0LA 1XDWA 1Z4JA 4JBNA 4BGDA 4FJ1A 4CDNA 5BUZA 1YHYA 2C8LA 4IMIB 3ZWKA 2F2TA 2PU7A 2OGUA 4KR0A 4LJRA 4HGZA 2DERA 4M9XA 2XCUA 3OZDA 1RMTA 2CFOA 1CRZA 4DIDA 4B3DA 4KPYA 4NICA 1QK3A 1SCUB 3GUZA 4UNIA 4EF4A 1ZJ5A 3TGLA 5BR8B 1RHQA 4FIZA 5AI4A 5CCEA 5ED4A 1SJ9A 3B53X 2J1LA 4MS4A 5A9SA 5G3ZA 2X8LA 3M1LA 2PSHA 3CS3A 3K6JA 1Y81A 3NUQA 3ANMA 3WLTA 3N07A 3V1MA 2IZ0A 1WLSA 3ZGOA 1N25A 4LYAA 3RWBA 1UQUA 3FE2A 1E1NA 4MR8B 1QXSA 2JAXA 4OYLA 4O08A 2J85A 1E9SA 3HV2A 3JYLA 3Q2IA 3FNHA 3JYOA 4CMIA 1CFJA 3MWFA 3IDQA 3CC8A 2LTAA 5EKDA 3L93A 3EGDB 4JB8A 2CN1A 3ZHTA 1B6SA 1D2GA 3EXEB 3KAQA 3TO5A 3S99A 3JQAB 4B5LA 5J47A 1ZHOA 2C5GA 2IPNA 2H92A 4MB2A 4FYKA 4QATA 1Q14A 3M6LA 1RAHA 5ITWA 4PQRA 3I5XA 3GEPA 1IRIA 4N5HX 2J0EA 2Y0PA 5IN5A 4DARA 2VXCA 4CTNA 4R83A 3FYCA 2XUJA 1NBWB 1Y8AA 1JDUA 1M6YA 3KDPA 5CGZA 4B3RB 2WZCA 2QTHA 4L0MA 5TPZD 2GFHA 4JLJA 2XQVA 3W5SA 5KYYA 4J1NA 2RK6A 5COBA 3PDIA 1Z83A 1T13A 1FU8A 2JLAA 3GDGA 3QG5A 4RTQA 4EHKA 1GEGA 5HIJA 3BOSA 3GHYA 4FR5A 5KYXB 3I1FA 4R1TA 4ATNA 4ZOCA 3MCWA 5EJIA 5I7SA 1TK2A 3I83A 4AO8A 1T9GS 1T5IA 4KB5A 4O4HB 4EKEA 3NM4A 3T3GA 2HNAA 3VBEA 2EGHA 2FPPA 4WTOA 1YACA 5CA1B 2OHGA 2WUWE 3OE5A 3IE0A 2OYCA 5JZBA 3AEQB 1X0XA 3P45A 4PC7A 1VJCA 2QNRA 3CRQA 1WB4A 4AYTA 4XUDA 2ZYGA 4BAZA 4F04A 5ITZA 3KB1A 2ZWMA 1H69A 1TKRA 2QLBA 3DQPA 5F51A 3RSGA 4D80A 5K9ZA 2FR8C 2G0NA 4Z0HO 1G21B 5HZGA 4J2HA 1IEXA 1LZLA 2NZWA 1PEYA 2PLFA 4KKVA 3TLGA 1TJNA 5C80A 5CEEA 1YJBA 1JIQA 4RCVA 1QHGA 1Q11A 3OFKA 4N39A 1W44A 1F2TA 3OZFA 4OU4A 2ZPTX 3BT7A 4KSBA 1OJ7A 3R3WA 1WAMA 3M82A 2JFOA 4TMVA 5AVVA 1KMCA 1AG9A 3V8NA 2HZBA 3X0DA 5FXMA 1P5FA 3WFZA 4UUPA 1KGDA 2WMOB 2PZBA 3CRVA 3DNPA 1PE0A 5G1OA 3BAZA 3VR1A 3OTOB 2FWAA 4QOEA 1HYEA 3NFRA 3FW1A 4PSUA 5CH3A 3T3DA 1E1KA 5K0CA 2BKLA 1P2VA 5A4KA 1JXAA 5K05A 3CVYA 4FT2A 1PEKE 3V1TC 2DTDA 2O1XA 3BPSA 4HQLA 3MFQA 2BWJA 5J40A 1R0LA 5LQKA 4IIJB 3D5QA 2WDPA 2GA9A 4WJZA 3HXQA 2VTBB 5LU8A 2Q4DA 5H3CA 4FP9A 4G63A 4WCFC 4WKNA 3V4ZA 2I33A 1U7OA 1E6EA 4WGGA 5CLFA 1CXZA 4YUVA 3UV7A 4D96A 2ZUDA 2PA0A 3EQZA 4CM9D 3K70D 2C4VA 2Y68A 2HSWA 2ODAA 1PEDA 4V0LA 2N42A 5NLLA 3QTTA 3CV3A 1IPHA 2XQIA 2ZQZA 3QUQA 4Q3AA 5DM4A 5FB3A 1T2EA 4C30A 4HVCA 4JUBA 1O6FA 3M1AA 4NOMA 1OHHA 2DPGA 4N03A 1ZI9A 1U31A 1BVUA 4DYVA 3OG9A 2WFLA 2V5UA 2OV2A 4C6TA 2GEBA 4YH1A 3R3SA 2A0KA 2P5TB 2YN4A 4MV9A 1MQAA 3ZVRA 2YWFA 4C7JA 5SYAA 1SAYA 1BCRA 1V11B 1DBWA 4W1SA 3VOAA 1MP0A 5PGMA 1NSTA 3PXUA 2WTEA 4O4JB 4XCQA 5HA5A 2MSWA 3E70C 4P33A 4B6FA 3LYLA 1FF9A 2CKMA 1J5EB 1N6HA 5TVGA 3WOVA 1NR5A 4H1WA 1M1NB 3SSNA 4Q16A 5JBNA 5HILA 3P20A 5IS2A 3Q1LA 3IMEA 5EC8A 1PR5A 2PX2A 1MT0A 4IV0A 1UK9A 1OZGA 2W8ZA 4GO1A 4EH1A 2IJGX 4II2A 4LGVA 3UH1A 4C0QC 1BHSA 4YP7A 2HRRA 1IHDA 2NUBA 3MAAC 2FP4B 1XCLA 3KSBC 5H70A 1IHUA 2P3OA 4CF4A 5HWSA 3UUWA 4BFWA 5E6RA 1CB7A 1IZ0A 5EJ5A 5I01A 3NVMB 2QSJA 1I7NA 2V7BA 1VA5A 3P4UA 3QU9A 3F6BX 4UUNA 4YIKA 5A03A 2DU8A 1IQUA 2W2KB 4MI1A 1P7VA 1ML3A 4E1BA 1KAQA 4H17A 1MHTA 2MSKA 1DHRA 1GDDA 4JK3A 4JLUA 3GGSA 5HJ2A 2AEEA 3LCMA 1B4DA 4D98A 4Y7DA 3OTHA 3H9CA 5LJIA 2AGVA 3NWOA 4B79A 1YCFA 1FTYA 1JXOA 1YR1A 1YB7A 2GBCA 2VJCA 1KDVA 1CC1S 1R6TA 2X15A 2FN7A 4ZD6A 5KQMA 4W4TA 4Q9IA 3H4MA 3CX8A 5FFNA 1HY3A 2B99A 3B1XA 1OLUB 4N6NA 2JBAA 3WICA 3KOWA 3EZFA 1PTJA 3I2GA 4M0PA 5KYWB 1O87A 2YWXA 2WMNB 1AQUA 3AYZB 5D51S 2VP3A 1D9ZA 4WZ6A 3VR2D 2XNDD 3CB2A 4JROA 3BK2A 1ECFA 1PR9A 1SUWA 4FN4A 3V1KA 4D56A 2QM0A 2WFMA 3F96A 5BSGA 1EXWA 3IP1A 4DSTA 2JLSA 3KB6A 4TROA 4R68A 1QGOA 4AK9A 3AI7A 1P60A 2DKFA 1XNGA 3FNFA 4WEQA 5EKTA 1YL5A 4BCDA 2O3SA 3I6ZA 4DSAA 4URZR 3RSLA 1HEIA 4KQ6A 1IBKB 5HQ3B 5GV7A 1K7FB 3CU5A 3QPCA 3NP7A 3DULA 1SZDA 3CCFA 2HHAA 1RCTE 2WHXA 4BMZA 1QS0A 3OD1A 4EB8A 3HYNA 1J0CA 1H8HD 2WQZA 2XV1A 1ECBA 5ARCA 5E4TA 3ZZUA 3D6AA 3P94A 1EG7A 3DAPA 2VHCA 2B7LA 3EOAI 2A0XA 3TQQA 1N8KA 4EX7A 5TS2A 2B3TA 1HEUA 3SXUB 3EG9B 1OZAA 4H0FA 4R2LA 2ASVA 3NV9A 3U37A 3SSAA 1U7DA 5HVNA 1ZUNB 2YHUA 3R7WA 3I6YA 4D2IA 4HNUA 3GJQA 2QRZA 2PGJA 5HJ7A 3H84A 3BJZA 4DHEA 4JC5A 4GW3A 2GN6A 2I6TA 4MXDA 5ER9A 3ZDQA 1X74A 5K7SA 1IBMB 1U2QA 4X6XA 2GZ1A