1P5JA

Crystal structure analysis of human serine dehydratase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
GEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQECGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords L-serine dehydratase
publication title Crystallization and preliminary crystallographic analysis of human serine dehydratase.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 319
sequence length 319
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2003-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p5jA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p5jA02
5B53A 1K7FB 2GN0A 4OFXA 1QOPB 3RR2A 5I7WA 5IW8A 5J43A 4HPJB 2CLMB 1J0AA 1WBJB 4D8WA 5T6MA 5CGQB 3ZEIA 3FCAA 1Z7WA 5B3AA 3VSCA 1J0DA 4HO1X 4PCUA 5DW0A 2BHSA 1RQXA 4KKXB 4D9FA 1A5BB 4D8TA 1WDWB 3FGPA 2ZPUA 5CVCA 5J5VA 1QOQB 4D9MA 5I7OA 2GN2A 5B36A 1M54A 2TYSB 4D9IA 3TBHA 1VE1A 5HBGA 3VSAA 1K8YB 4D96A 2ZR8A 4D9BA 1O58A 1D6SA 1P5JA 1J0EA 1F2DA 1K7EB 2J9ZB 4LI3X 4D8UA 5KINB 1TTPB 3PC4A 3X44A 1UINA 3IQGX 4OREX 5DVZA 3PC3A 1UIMA 2CLLB 1K3UB 1VE5A 2BHTA 2CLKB 1TZKA 4JBNA 3AEXA 1BKSB 2C2BA 1TZJA 4L0DA 4L3VA 1KFKB 4L28A 5C3UA 5DBEX 2CLHB 2DH5A 1C8VB 3VC3A 1WTCA 1OASA 3T4PA 4AECA 1KL7A 1V71A 3R0ZA 1C29B 2EFYA 5I7AA 4COOA 1Z7YA 1FCJA 2PQMA 4NEGA 4ZU6X 4I1YA 5B1IA 2O2JA 1JBQA 3V7NA 1C9DB 2J9XB 3L6BA 4QYSA 1X1QA 2C2GA 1KFBB 2ZSJA 4LMBA 4Y6GB 4ZQCB 4HPXB 5IWCA 4HT3B 2RHGB 3BM5A 2CLIB 3SS7X 4D9CA 2EGUA 5I7RA 1TZ2A 1KFJB 4L27A 1J0CA 3HMKA 5JJCA 4AIRA 1A5AB 3IAUA 2ISQA 1KFEB 5EY5B 2RKBA 3IQHX 1K8ZB 1WKVA 2CLFB 4XUGB 4ZU1X 1K7XB 2WSYB 3R0XA 3IQIX 3VSDA 1CW2B 2ECOA 4D9NA 1V7CA 3L6CA 5IXJA 5I7HA 5JISA 1TZMA 1UBSB 5B1HA 1A5SB 2O2EA 4H27A 2Q3DA 2D1FA 1PWHA 1BEUB 2J9YB 1TYZA 5D86A 2DH6A 2TRSB 2TSYB 1TJPB 5E0KB 2GN1A 1FUYB 5DW3A 3X43A 4D9EA 5KZMB 3DKIA 5D87A 1VB3A 3PC2A 1E5XA 3L6RA 4D99A 4D9GA 4HN4B 5B55A 5DBHX 4NU8X 1PWEA 4IL5A 2RH9B 5D84A 2ECQA 2JC3A 1TDJA 1V8ZA 1A50B 3AEYA 3SPXA 4F4FA 2Q3BA 5BW6B 4D97A 4D92A 1J0BA 4JBLA 3CEPB 2CLOB 5I6DA 1TTQB 1KFCB 2V03A 3VBEA 4WX2B 3SS9X 2CLEB 1CX9B 3DWGA 3PR2B 4LMAA 5D85A 1Y7LA 4D9KA 3DWIA 2Q3CA 1K8XB
chains in the Genus database with same CATH superfamily
4DLYA 3H5OA 2IF0A 3WRYC 4UUOA 2BEUB 3VSEA 1NV8A 3T5AA 1FYFA 1G3RA 3UAZA 4P3XA 3ORQA 1R8QA 3OZAA 4RHFA 1RAIA 1HQYE 3W5UA 1AZSC 1OLUA 3ANTA 3FYCA 2PWZA 5TT0A 5EZSA 1H0HA 3F7TA 4NH4A 4WIAA 1QHNA 4K6GA 5E4FA 3S8EA 4X1KA 1C7IA 5E3IA 1EUYA 1J8VA 2JIOA 4C2BA 3OZ7A 1MMFB 1OKKA 3PD0A 4XJXA 1X77A 4BBAA 3MB8A 2HCFA 4AO7A 3B9QA 3WGMA 2CCGA 4EGQA 4J2HA 3GMTA 3GLKA 1CUAA 5HP4A 3P5SA 2PCJA 1KMQA 1VJDA 3MCVA 4YCLA 4QE3A 5AKLA 4DA7A 2NNWB 5C5EA 4KQHA 5ALSA 1EAMA 3Q3VA 5DT9A 4KAAA 1AA6A 1ZK0A 4Y2GA 1TU4A 4EABA 1W35A 1MQAA 4JLJA 4PLGA 5M29A 3OKPA 2EEPA 2GO1A 3FKSA 4LRYA 4PXAA 2IOHA 3OE4A 4AS2A 2W2KA 1E0JA 1M1XB 3O4RA 4HDSA 5EWMA 5JZ9A 2EFGA 5LOVB 4X7BA 3NTRA 3TIVA 4FT2A 2IPAB 4IMPA 3H5LA 1WSAA 1CUZA 5K4HA 2IBSA 2F43B 4NJEB 3GJ8A 2O0LA 4EI9A 3FTDA 3HJUA 4P6VF 2ZVPX 1M2OA 1RYMA 1SKYB 1YQUA 1G20B 1P4JA 3K1TA 3TCNA 2C5HA 2PGNA 3IOMA 4MDFA 4M22A 4OB8A 4O3MA 2Z4RA 4NCXA 1GNVA 3ESZA 1RABA 4YMSA 2ODBA 1Y3CE 3WK4A 2VTBA 5KTPA 5TS3A 4E2XA 4QATA 4WPGA 2X9NA 4S2EA 5HGXA 1FQOA 2BEWA 2ORWA 4ZVPA 2D54A 1VP9A 3A1WA 3AV0B 1TUEA 3CR7A 3V1UA 1HLFA 4F46A 3EC7A 4ZT5A 4F3KA 4LZJA 2EGHA 1K5PA 4R8MA 1U9JA 4JYMA 1NT2A 2JI7A 4YUXA 3OICA 2P6PA 3O26A 2IUFA 4JBWA 6REQB 1B14A 2AXNA 1OA0A 2CHUA 3PUHA 4D26A 1QIKA 4YJFA 1R8XA 3JYOA 2R85A 1QZXA 4MGYR 3BXEA 3DE6X 2A0KA 2H16A 1GG5A 1JE0A 4GH5A 1SCQA 3D43A 3GVXA 3UKDA 3VV2A 3AESB 3KQYA 4A27A 3QH4A 1W48A 3WYCA 4QGFA 1QBGA 2YNMA 1TA0A 2H17A 2UDPA 3UOWA 4MYTA 4ESVA 1EK6A 1HEIA 2XTAA 1GDTA 1TQ2A 3BC1A 1U0GA 2IV3A 3CISA 4MUKA 3P9IA 2WOJA 3PICA 4JNKA 4A91A 3MB5A 4LS3A 3JAMA 3JQ8B 1T35A 2VCEA 1Y3DE 2V6MA 2ZR9A 3GP8A 1OIXA 4DM7A 2QG6A 4DUZB 5KSZA 4YRCA 2V4ZA 4I50A 4ACAA 1FEZA 1HT3A 3FNIA 2ZYDA 4EPXA 1V35A 1RIIA 1J8FA 4M0UA 4ZQIA 4OLAA 5AKXA 1KARA 1UBUS 1JDVA 2NU9A 2YW2A 3ZCTA 4PZEA 3RYHB 1QG6A 1G7TA 1EFPB 3CWQA 3TCXB 5CA1F 1GPMA 3HR8A 1L7VC 5FO1A 3TUJC 5DCUA 3JALA 4ZD6A 5TQ2B 4QWMA 1QGYA 1PG2A 4ENQA 2IHVA 3FSGA 3SIPA 1VG8A 4TKVA 4BNJA 1O6BA 2OC4A 3KYBA 4XM0A 3ZWQA 2OCBA 4D74A 1P5ZB 3BUSA 5TJ9A 4LVOA 1PCXA 4JIMA 4DSOA 1O58A 2GYVA 3IAM6 3ND6A 4QZVA 4FYHA 3S1SA 2GA9A 1PEDA 1UBFA 2QLFA 3AERA 2JKVA 3ENWA 3LNTA 4L7QA 5LA6F 1F2UB 5I3CA 4IG4A 2ZJFA 5DVZA 1JG6A 1UIMA 1WL8A 5CHEA 1UBJS 4F12A 1SQFA 1GDHA 3V7UA 3WAKA 4FZJA 4MMZB 5DN9A 1ZL0A 2E4ZA 1A5TA 3OM8A 2YIVX 5LCXA 4JXXA 1G8SA 3QUCA 2XUKA 4PU0A 3UJ8A 1OREA 4AKHA 4KOEC 1BHJA 2J1LA 2C07A 4GZ3A 1DINA 4XIIA 2I3AA 3T4UA 2NAFA 1NBMD 3OETA 2FW6A 4LZPA 1BCRA 4WEOA 1NM5A 5FUVA 1XZIA 3AIKA 1BE0A 1IRXA 4NECA 1ZNYA 4Z4EA 1ZW1A 4G25A 1LI5A 2PFGA 4XARA 1MRSA 2VOJA 4UE6A 3NEJA 2DTXA 2OESA 3PUYA 3T99A 4DQKA 3CNEA 4QYSA 2AYXA 3ML1A 4RZUA 4X41A 5BN5B 3NAMA 3WKAA 3RTEA 4Y1RA 5JI3E 1LV7A 1XKTA 2VJYA 1W1IA 1O1YA 4HB3A 4XDHA 4P82A 2OQRA 4BVLA 2G6TA 4WY8A 3RSSA 2KX7A 4W5WA 3OZRA 1UQTA 3N8NA 4RIEA 3W4KA 5FUYA 4TKUB 3N1UA 2H9IA 5ED0A 1EFHA 4ZQEA 5MN4A 2EZ4A 4G5RA 2W93A 2MYUA 2Q9AA 4RA6A 5HE8A 3IXMA 1UBEA 3IO5A 4FFBA 2AGVA 3PZRA 2P3SA 3WIUA 4JC4A 3EDRA 1P60A 1TW2A 4JGBA 4YK7A 3HL0A 4OHBA 5BN3A 2V7EA 1DBSA 2PCLA 3C24A 5ADVA 1CY4A 1Q7RA 2R5NA 5DBOA 4PZUA 5SY9A 1GGEA 4TQUS 3PC8A 3NVKI 2WKPA 5B1HA 2ZWPA 1X19A 2YMPA 4L85A 5LQCA 3FY4A 4O02B 1IZZA 1EHYA 2RHTA 1ISMA 2BKAA 4CNQA 2R7KA 4OJQA 1F51E 4JLAA 3CVVA 1LQTA 5CAEA 1WCIA 2VHZA 4Q24A 2GSWA 4DCMA 4AY2A 1L7EA 4M0EA 1KXZA 1Q3KA 1G0OA 1II8A 1UJ5A 2R8PA 2WJ3A 1Y34E 1GRCA 3OOHA 5AKKA 5JJKA 1DAOA 2OQ2A 1BX3A 1RMYA 3V3KA 2XQJA 2JZCA 4RA9B 4JR0A 4LTDA 1TRHA 1MDBA 4MJ7A 1YRWA 2IFTA 1QDEA 1FLDA 2YZ2A 3TGPA 1CF9A 2JG3A 2IZ7A 2ZJ2A 4LBYA 1E2PA 1G19A 4F3TA 1M34A 3ZXIA 1MABA 2HO5A 1PFYA 2IP1A 4QUHA 3QKWA 4JQYA 4RHEA 4WK2B 3SBXA 2XVZA 3GEGA 4V2UA 3T9BA 4CODB 2ERYA 2HIMA 1XC7A 2IHTA 1KRHA 3WYNA 4Z5XA 4YC7A 1JYEA 1P1KA 1H1LA 2EKLA 4BX8A 3N70A 4H59A 1PJLA 3UN1A 2PO7A 4PYLA 2YWGA 1E2LA 4S3MA 4BMYA 1PTJC 3H0CA 2I65A 1E3MA 4DT1B 1EUZA 1H2FA 2ZS8A 1DQPA 2X7JA 4RJJA 4B40A 1UPFA 1LGYA 1SVSA 1J90A 2JEOA 4Q9NA 4HVLA 2ILTA 3B1YA 2ZYRA 5BWLA 3Q11A 3SZMA 2XA1A 4OCZA 3ZOKA 5EJGA 4BLRA 2AV6A 2IHJA 2O2IA 2XOEA 1FRNA 4WD3A 3RAGA 4XXHA 2VK4A 2OD2A 3IPLA 3IQXA 4NYJR 4BO5A 4N76A 1Y33E 4Y2QA 3WICA 2AC7A 4C6SA 1KDZA 4Q4HA 3KX2A 3S99A 2GN2A 1V7QA 5JFTA 1JBEA 3BK2A 3M9WA 4BATA 2ZE8A 2R8RA 3KQPA 4CMKA 4RHTA 2PWPA 4V1CB 3KDSE 2ACKA 4TRRA 2B37A 4YHHB 4E3WA 2DXIA 2P3QA 1I33A 3E7DA 3MSXA 3UUFA 3A2KA 3K09C 2HPHA 3CUWA 4JXKA 3HZRA 4NYMR 4TVKA 3WOVA 4ARUA 5DULA 2G28A 5JXHA 2FR0A 3CF4A 4OUDA 3R6LA 1MP0A 1PFVA 3I2YX 3GT4A 5DTMA 5IWAB 1TZJA 4HATA 5HK8A 5AUPB 3DTTA 3M6UA 1HBJA 5DMXA 1WHTB 3PTLA 5JZMA 1JZSA 1NQVA 4PIPA 4OHUA 3KBOA 1X8LA 3R09A 3BKXA 3G89A 1NDUA 3JWGA 4EW3A 2HPVA 1NLMA 3QG5A 4PBRA 1CNEA 2JGFA 4CM3A 4CQNA 5D6NA 5JNWA 1A4XA 5T4HA 3ZHCA 1ZVVA 1C9DB 4ETNA 1I13A 2P69A 4YQEA 4JT4A 3QWBA 5KVCA 5FCDA 3GZNB 4RGVA 5CYOA 1P9LA 5ER9A 7YASA 4QYTA 1WSWA 3CF6R 2IX9A 1CTQA 4ARBA 5A6VA 1NW6A 1PD1A 5I7RA 2XMBA 4U7WA 5FBHA 3H2JA 4LCBA 3W6ZA 3ME5A 4HGQA 5FBZA 3ABQB 3ZGYA 2J3EA 2RK4A 3PT5A 2YYYA 2W6PA 3LUCA 4TT3D 1C3OB 1CKEA 2Y0PA 5EP4A 4A73A 5JLJA 3SWWA 3I4FA 4RWZA 4B6OA 2A4KA 3QKRA 2R8EA 3HJGA 1A82A 3PX7A 1JQ5A 5CCEA 1NVWQ 1JHUA 4CMJA 1GXSA 1MB9A 3NO4A 3QTBA 4TMXA 1TJ5A 4L78A 5EG5A 4X90A 2Q9UA 3GDGA 1T2FA 3O8QB 3KFLA 3K1AA 2NU6B 1NQAO 2PMBA 4HWGA 4EB6A 2QW8A 3ZU2A 3K70D 4YRJA 4EG5A 4B7XA 5LDHA 1VG0B 3DXZA 3HVUA 3KR9A 3C5HA 4ZEWA 3X1WA 1NF2A 4MCIA 5JWRA 2IY9A 3WLHA 3A6FA 4AS1A 1Z2EA 2VSNA 5DMHA 3QLJA 4BU0A 4BWFB 1CU1A 2AHOA 3D8HA 4B5KA 4L5BA 4ZAZA 4D9GA 3NC1C 4NV1A 4KN6A 4RMJA 3TXXA 3KJZA 2PSSA 2LR0A 4AIIA 2W6NA 2PGXA 4MR9B 1JB1A 1OAKA 3H6GA 4OATA 2E6KA 1IK6A 2HF9A 2WFLA 3K9GA 5BQPA 5LLSA 4MQLA 1GNLA 3KYJB 3V1MA 2V03A 4CFZA 1IBCA 4KI0A 4Z99A 1JXAA 1DJMA 1VL2A 2WSLA 3EDOA 3Q0IA 4RABA 1CXZA 5E9WA 2H2DA 4F1WA 1G3UA 2Q3EA 1PFKA 3HJRA 4ENVA 4PNZA 1U5BB 2C4HA 3DV0B 2ASEA 4P4SA 1SXJC 3DFZA 3AVUA 1KKLA 5I7WA 2QP4A 3L46A 5LZ9A 1RT9A 4OU4A 1X1CA 2C04A 3ESCA 1K6EA 1T1IA 2BGRA 1FTWA 2I6FA 3L4BA 3OP1A 4M1YA 1SCNE 4TPKA 4WY5A 5JUWA 3THWB 3VDXA 3JTEA 1FVOA 4QFBA 3ZZNA 1RRPA 3OJOA 4DMUB 4H08A 5DX0A 4Z0PA 4CDGA 2FUG6 4I9GA 2GBFA 2QRUA 1AV7A 1GG8A 4GKVA 1ECBA 1K9VF 3A31A 1CJVC 3QFRA 4LCEA 3ADKA 2GCGA 2C9YA 2JK0A 2O6HA 1IJEA 1ZVKA 3FH0A 4DPKA 1V4VA 3OIWA 4GL4A 4D4HA 4D9MA 1IVYA 3NWPA 4ZHQF 2ZIVB 2B8NA 4IQ0A 4YCNA 1O54A 1DWOA 3KTDA 3OESA 1QE5A 2XNDA 4P7JA 5JVDB 1XMQB 1L5HB 1KAGA 2BMEA 3BDAA 3SZLA 3ZJVA 1W88B 3D4IA 2FPLA 2UZ1A 4R5MA 4S1OA 3V1KA 3KOOA 3TAUA 1LVGA 2OXIA 4UMVA 3CCBA 4PTLA 3ZD9A 1X6VA 5A7HA 1OY1A 3A11A 1GL6A 3R2JA 4M9QA 4W7SA 1CUCA 3USCS 4TWRA 5D8DA 1RAAA 3CLHA 4CEJA 3TB4A 1AUPA 3AF5A 1V41E 3UCEA 1IM2A 5IF3A 5MN6A 2WG0A 4YJ3F 1X9HA 5KNLA 3GZTB 1OWNA 1EUCB 2OAEA 3BWYA 5IPFA 4LF8B 4XSHA 4M88A 3PP8A 3FROA 3QE2A 3PQ2A 2GNPA 3TOVA 3SZUA 3DSRA 3UK1A 2IYWA 1B0ZA 1G5IA 1L9KA 2HNAA 2RGYA 2TMGA 3DEAA 3HJTA 1UBTS 4IVQA 3RS9A 3VUFA 1PK8A 2M6KA 1XL1A 2FEMA 3ENQA 4NVRA 3IKLA 1M33A 2RH5A 4RDHA 3UT5B 1N1EA 4QRIA 2IX3A 4DLXA 1CYDA 2ZPAA 3CWCA 4O2BA 3FAKA 2EOAA 1T2CA 2JHPA 1Y9DA 3G7UA 4UE2A 3W3AH 3M6LA 1KFJB 2GCOB 3OLCX 2OEPA 4MQ5A 5CP8A 4AZ0B 8LDHA 2ISQA 2NSLA 2QUHA 3S2IA 3WZ2A 1A9XA 2P41A 3JSAA 4G6ZA 4XPZA 1U0RA 3ICOA 4L0MA 2Q3JA 2VRCA 2XXAA 5FA8A 1L8LA 4BKMA 3HXPA 3GFRA 1RFLA 4L73A 3UV3A 2V98A 2GF2A 4CXMA 3K2EA 4JJ7A 3I42A 3O2JA 3LVQE 3QITA 3R24A 5I4KA 1YR9A 3NKVA 1AURA 2JEYA 4O33A 1HFJA 3LTEA 2QTHA 3T5TA 2JIMA 3LZCA 4FUQA 1KTVA 1LTQA 2FZGA 2VT7A 1GSAA 2WJYA 4IDBA 4TLLB 3RWMB 3BTSA 3DPUA 1QONA 4ZAWA 4GQAA 5AM0A 2BM8A 2PKWA 3H1EA 1BIFA 2JGJA 1UC5B 1C9JA 2YICA 1J6UA 1B15A 2PL5A 3WMWA 1NAIA 3RT9A 2X6QA 1SNYA 3WYAA 1K9SA 1NC3A 4CQMD 1QHHA 2PUFA 2OBNA 4LSGA 3MYRA 4J0HA 4JB2A 4R8LA 3KQNA 5IYZB 2VTKA 3ENNA 3D3WA 3I04A 3OM0A 3OY2A 5E6SB 1RYNA 4D8XA 3QIVA 2HW8A 1PR0A 2HFJA 2QYHA 1KJZA 5AW3A 3P4XA 3A3OA 4ESEA 4CKCA 3H6KA 3C6QA 4WBNF 4FXOA 4JCCA 3F2VA 4YUYA 2CLMB 2QV0A 2X0EA 3MQ4A 3IEPA 1UPUA 2XD4A 4C3UA 2QAGC 2FKNA 1BFUA 2EERA 2XV1A 1G16A 5KWSA 1R9GA 5TMBA 5A5EA 2JLYA 2C95A 3OG9A 4K9NA 3OIDA 4HAUA 4Y6OA 2FX5A 1W5TA 2QG4A 3ESRA 4DIKA 1ZVJA 4MCJA 4QG7A 1PT7A 3T9DA 3DT9A 3G68A 1P1RA 2WABA 4IDNA 3WLMA 4BZWA 2FB9A 2GEDA 3VVCA 3LRPA 4BB0A 1E8NA 4DV2B 1SU8A 3GYGA 3W4IA 2ZDQA 4Z54A 3AKEA 2RCNA 3LHKA 2PIDA 4FVTA 3QLEA 4E2FA 5K9ZA 2V7QD 3UXEA 2AN5A 5HR5A 2R96A 1VKRA 1H3FA 3OZEA 3VV3A 4G1MB 4ZT6A 1BHQ1 1QJ4A 1DG9A 2LWIA 4QT0A 2G82A 3AEKA 1TFUA 2A5GA 2HMWA 3EEBA 4NBNA 4Q3OA 4QRDA 5T41A 3S8MA 3UV6A 4A6XA 5I4CA 1NN1A 3REGA 3X1XA 4AYXA 4UHDA 1I80A 3MILA 3OLQA 3BIOA 3QPWA 4KR2A 3NHYA 4QEZA 1CS4C 1OA1A 1Q92A 2DWOA 1XN4A 4Q4JA 1YGPA 2PAAA 3LZDA 3I0NA 3ZTWA 2QVBA 4IGAA 4TLDA 1DOAA 3EYWA 1KL7A 1OGIA 2Y0CA 3NBMA 3CR8A 1D0IA 2EL9A 2VPQA 3PNLA 2LIVA 2A9VA 2PS3A 3DB1A 2C77A 1PVOA 4F11A 1CK4A 5JAHA 4MAMA 4W8HA 2QMQA 4CMIA 1AG9A 1C1HA 1SA0B 1DG1G 2I7TA 4D6XA 4PXSA 5DI9A 3D8NA 2Z08A 4UHCA 4PFJA 3DEYX 4BMVA 3GYBA 1KYVA 4MR8A 4ZPJA 3MINA 2BZ0A 3M4XA 2EGUA 4OK3A 3R6GA 1JHOA 1J5PA 1YDHA 2NZVG 1KY2A 4MRPA 4MVJA 3GGPA 2PL9A 3LC0A 2ONCA 2PQ2A 2X3YA 4H3KB 4W7IA 2I67A 4IGIA 1OX6A 4Q82A 2PD4A 1HGXA 2GWRA 1IEWA 4J7CA 4M3NA 4HQ6A 3K5HA 4I5DA 5G4KB 4DWWA 3GRRA 4AZ3A 2NUPB 1X42A 4WADA 4MK4A 4BYGA 2BMWA 4RZIA 3CRQA 3WFZA 4PNEA 4GQIA 2DP4E 2D1FA 3GFOA 4XOUA 3WS7A 2VDLB 3OLZA 2IOFA 2QOEA 3H1PA 3NWBA 1T2AA 3ANLA 4JQOA 3R0QA 6YASA 1H6DA 3FR8A 5DWQA 4ECEA 4LNAA 2VH1A 2BFOA 4LDPA 5E1DA 5E1MA 3G23A 3GLIA 4J1QA 4RVGA 1ZNXA 2X77A 3JX9A 4UZEA 3V8QA 2W6ID 5CHYA 2Z2JA 1LRLA 1XZEA 4JJFA 4HWKA 4L0CA 3TLJA 1G64A 4LWZA 2E87A 3ND9A 5JC8A 4Z4IA 4G4JA 2DRIA 3LQ1A 1V8ZA 4FR5A 7ABPA 1KF0A 2H2AA 2X5OA 2MU1A 1LPPA 3DMYA 3OQ1A 3STYA 3SBEA 3WMRA 5IJWA 2ZRNA 3Q40A 2WAYA 1KPHA 2HL6A 1PU2A 3HUFA 3MVEA 3OIYA 2Y0EA 4G81A 4K8OA 4WNIA 1ZL2A 5MF6A 4GRAA 2D1YA 5K0CA 5MN5A 5EJ6A 3FWPA 3PC6A 3JR7A 1UFKA 4LXQA 121PA 3OJ0A 1UMDB 3CE6A 3RYIA 3CN7A 1YCDA 2NO6A 2GB4A 4L8FA 5B7NA 1QRDA 1DQSA 1NNUA 2BI7A 1E9EA 2CN1A 3IOCA 4BNDB 1HDYA 3C6BA 3NVAA 4LBVA 4U5XA 4TL6A 3ZW7A 2FPRA 2GBPA 2HGSA 1H22A 3K71B 2PX2A 3LNCA 5D6OA 3EJWA 3L43A 5SZJA 2J7KA 3COWA 4LF6B 3EFEA 4HLQB 2H57A 4I4CA 2OFXA 3JARB 1DRJA 2V0NA 4UUPA 1DRUA 4YQZA 3UFXA 1W2GA 1PQ4A 2JFFA 1R27A 4M55A 5AQ1A 1DCMA 1M54A 4URVR 4MCAA 2X14A 2SKCA 3P0IA 2BSQA 3L93A 3QVJA 1QTRA 1V9SA 2DC1A 3LECA 1YV9A 3UOGA 4HQFA 1PR5A 1PWXA 2NVUB 3BE6A 1GFWA 1IK4A 3LUFA 3RUAA 3KXDA 3PC4A 4FWIB 1XDWA 1T4CA 5I45A 3COJA 2X8LA 5KQLA 3DD5A 3BB4A 5EINA 5CA0F 3CMMA 4G4GA 4CF7A 3QVGA 1OFUA 1PWYE 3E15A 5F2NA 2DERA 1JEQB 1BE6A 2C2BA 2CXRA 4UM7A 4LY6A 2P4QA 2YN2A 2H0AA 2O2ZA 2WJZB 5LLTA 1ZI8A 1WTCA 1DEXA 4OXIA 5DOZA 4BGIA 3HJFA 4LZAA 4E5MA 2CF5A 5LWQA 2GS9A 3PHCA 2FW1A 4MNTA 4LRUA 2GF9A 3MMPA 1U28A 1XLUA 1QZZA 5L95A 3P9NA 3V2UA 1MQ8B 4KYIB 4NBTA 1FMJA 4LXTA 1JWAB 1QV7A 1ILWA 4ZAGA 5FHRA 3GLGB 3FLEA 1Y6JA 1BH6A 4OXKA 1ZWLA 4FMBB 5HDBB 4RTPA 1UPXA 5KOYA 1WUYA 4JL8A 5KCZA 4OQXA 2JFQA 3PKJA 4KWIA 2VUTA 2VP4A 1CRQA 5IF9A 5E6RB 3TQSA 1YFJA 4K1XA 2P6MA 1PDWA 2J41A 3MEQA 1Z4KA 2EWMA 2QRGA 4KR0A 2ZWOA 1JFVA 4XDZA 3SM3A 5BMVB 3N28A 4KGXA 2CJFA 1YK0A 2JLCA 2GI4A 5PNTA 2O8FA 2JD2A 2ZI5A 1PR3A 2Q6KA 1FFXA 3B3FA 2ZCUA 1MHTA 4L9AA 1KR2A 3L1HA 3EXHC 3MMNA 1T9GS 4YJGA 3DLTA 3BWBA 3WHLA 1Z0SA 3NBFA 2PUJA 3AOGA 4MI9A 1ZD4A 2DH6A 2ZJ1A 1VBNA 4GXNA 3UHOA 4J9VA 4F2PA 1M83A 4O4LF 2FMFA 1MQ9A 1YFZA 2PKQO 3OCYA 1XZ8A 3P0HA 2RCYA 4PZ0A 5K8CA 3TL6A 5KNBA 4HDKB 5J1SB 2PUEA 1OV4A 4KW7A 1J2RA 1R0CA 2B1IA 2YJZA 3JZMA 5ERGB 3OIVA 3LP8A 3P26A 1E99A 1R16A 2QQGA 1LWNA 3OPYB 3FSRA 2X13A 3PYMA 4G0QA 3V8BA 1QSGA 4AFNA 3U44B 4PHGA 3R9XA 2NPOA 1GAWA 3DDNA 3PWTA 1QTIA 4U00A 4MQEB 3TSZA 2J5XA 4LDRA 2JAPA 3WK9A 4ID9A 1BEEA 1PE0A 2UYQA 3T06B 5KNDA 3TR5A 1G59A 1YBHA 4KTVE 3DZCA 5K03A 3OEWA 2XRFA 4YMWA 1DFHA 3KQMA 5K99A 3R76A 2G1JA 3DZKA 2I3ZA 1U8XX 2XMPA 2QWXA 4OXXA 2HV9A 3QU4A 2NVWA 2OKCA 4A7PA 3H5IA 3SZRA 4UTRA 3EFHA 1GA1A 4RTOA 3HRKA 3E8SA 2VDPB 5K0ZA 5B3AA 4PE5B 4E1VA 1NP6A 1P77A 2HA3A 4I6GA 3GPIA 4M37A 3AI7A 4A0HA 1I8TA 1KAEA 3GRFA 1OIWA 3HGTA 1C3LA 4AJNA 4KQGA 3TRJA 2XF2A 2G0TA 1KKMA 2IYYA 1TYCA 3KU1A 5I5EA 3ELDA 1SC6A 2PS1A 8ABPA 3JZAA 3ORFA 4IDCA 5FORA 1XWWA 1QCYA 2NU7A 3LL4A 4NL4H 4QA9A 4RU1A 3P2KA 1OR8A 1ORWA 4KMMA 4CGZA 1JAHA 1VI2A 4F84A 2EU8A 1D6SA 1IDN1 2F3UA 1F2DA 2JNWA 3B85A 5IJ9B 5IN4A 2IH4A 2C7GA 2IYLD 2VZ0A 1U1EA 2XT0A 1JSRA 4FMPA 4G4SO 5BMVA 1X7ZB 2R1VA 4M87A 4V0MA 4V0OA 3CZCA 3BFJA 4MGHA 3RRMA 5F9FA 3VKFA 2O7QA 5ITWA 1ZEMA 2VSXA 3S7TA 4F5WA 3PS9A 2EX4A 4UAUA 1NHGA 2FNAA 3AEXA 1OZHA 1P5HA 3L2OB 1K8QA 1AOXA 3AR7A 3MAGA 2XMDA 3P9QA 3RIXA 4BBJA 5JE8A 1XCPA 4HQNA 3UBTA 1NN5A 5D51S 4KQCA 4MOWA 4DKJA 4I6EA 3GT0A 1WDTA 5FYQA 1EJ2A 1EB8A 4TLBA 5L7YA 2QTBA 5KU7A 5EXDA 2D8MA 5CXUA 5FR1A 3VO8A 4U7HA 2O7NA 3USES 3DAFA 1ZI9A 4OHYA 3FRHA 1QRTA 2DX7A 5JJIA 3NYQA 3LCRA 3RSOA 5FPKA 1KGDA 2XEDA 4I9UA 2HT1A 3R5SA 1L5FA 5AW9A 4KREA 4L5YA 1I0LA 4FDUA 4IDEA 3CZAA 3UJBA 2O5EA 3TIGA 2VNAA 3BDVA 1H65A 4EO9A 3KXKA 5I9SA 4U7JA 1QO0D 5CNIA 5EQJB 2W43A 5GOZA 5B64A 1XTSA 1SBHA 2GESA 2Y99A 5IEBA 3A4VA 4O2RA 2VJCA 4EIWA 3RADC 2XITA 2HR1A 1Z17A 2E5WA 1VL1A 4EHKA 1TJYA 4D0NA 1PQPA 4A15A 3HJBA 4UD6A 1JH9A 2IHUA 1L7AA 4C0AC 3UAGA 1UBSB 2P9QA 3D6TB 4J03A 5DGXA 5CTJA 3WBKA 1OXXK 2CFSA 4JCOA 1O4VA 3QW2A 4BJ5A 2Y1GA 2PRYA 3T1HB 3AINA 4HUQB 1P31A 2YXEA 3OWHA 3IXLA 1RPZA 2VC2B 3KQQA 1K66A 1L7XA 5F2KA 2HYIC 1Z29A 5FH9A 4LVNA 5GWXA 1Y1SA 1G98A 3T0GA 4AJHA 2O8DB 2QMEA 5CFLA 4E5VA 1COWA 3MRVA 3O4GA 1K7CA 5FUWA 2QRNA 2IYZA 2FMKA 1Z6PA 2Y93A 3EEOA 1L8XA 3RSQA 5AWFC 2EIXA 5LMNB 1SCUB 1YQDA 2LDXA 1T1GA 5ES4B 4BV9A 1LLCA 3DHEA 2XQIA 2AOXA 4IOKA 4P34A 1CX9B 4YRGA 3X0DA 2XGMA 1SR8A 2DPHA 3BL6A 4CMHA 2F8TA 2TECE 1DX6A 4DV7B 2J87A 5FFMA 4HAWA 5TX7A 4W5QA 2ZIXB 1XCJA 3VX4A 2Y1DA 4IXWA 5REQA 1WULS 3AHHA 1X13A 1MJNA 2SKEA 2YV3A 3DO8A 4DILA 3SOPA 3VR4A 1C1XB 3VR5A 1JQJC 1WZ2A 1Y8QB 2XB4A 4TLCA 3PHLA 1CRZA 5GONA 4F5EA 5FWAA 1QO7A 4PHTA 3OJWA 1RTTA 2Z04A 3VO1A 1G9SA 4DW8A 3CRZA 5J5VA 4D5GA 5BW4A 3MXTA 1I94B 3AHGA 1P7YA 1NUAA 3BB1A 4L5JA 4DXAA 1VKZA 1J1ZA 4P53A 3VHQA 1DOHA 1G8AA 3WMEA 3UK6A 2EFDB 4XGQA 5HFJA 1JSXA 3KHSA 1PG0A 1M5UA 1OXSC 3U4IA 4IS2A 1Z6XA 4NI5A 4RCVA 5AM5A 5DF1A 3CLKA 5DBIA 5A3RA 2J5KA 4NEQA 3VKVA 3ZWVA 1SXJB 2I4TA 1JIVA 1BCSB 3DWFA 1VSBA 3E0QA 3LSYA 3VR3D 4A5SA 4YAWA 4FDAA 3NTQA 3DUWA 5HJ2A 1TXGA 3EXG2 5JATA 2ZUSA 5F64A 2G4CA 2P8SA 3D81A 1XE3A 3EW9A 2LTAA 1XEFA 2WTUA 1SVIA 3VYTB 5JWOA 5A1TA 1PT9A 4FS8A 1LBTA 4V0NA 5FA5A 4EW2A 4G1UC 1II9A 4IJQA 4YGXB 1O2DA 5IDQA 5AESA 1NF8A 1MJ5A 4QU5A 2WP8J 1TGVA 4FIZA 2F1HA 2YWFA 3MTDA 3NLLA 4ZZIA 3OIGA 4ZQCB 4EA9A 3J80A 3D1JA 2ZIAA 1AUXA 1QKIA 3D6NB 4OY3A 2EW2A 4EI2A 1B0AA 2YHUA 3JAWA 1WD7A 2ZGVA 3JD0A 1UJ6A 5JPDA 3WDKA 1T2VA 4DWVA 4IGEA 3RSCA 5B3JA 3DCIA 3M49A 1TCCA 4RIIA 2VZ9A 4H0NA 4AG6A 2A9RA 3CXUA 1EBFA 4PPNA 4UCQA 5DDIP 4XFJA 2AD5A 1LF5A 1H4VB 5DSZA 5HTKA 4G0UA 2P1DA 3IMFA 1RPAA 3ZH9B 4BMCA 5JCOC 2E5FA 3C3YA 5JS8A 2XW6A 3EIXA 1JQEA 1GPKA 2GEJA 4IMRA 4NU0A 4UUQA 5KNCA 1FTSA 2F64A 1NYRA 4PLFA 3RC9A 3TDMA 4IPTA 4ZIRA 3UK0A 1G6OA 1I51A 5EWLB 3J81A 4AN4A 3TG2A 1PDOA 2B4KA 1Z5PA 3UANA 4IVNA 1T43A 3Q7EA 1E59A 3QVTA 1RC1A 4UVGA 4XVQA 5EJMA 4DLSA 1MB4A 1WLSA 4H31A 2J5QA 3UTDA 1IPFA 1SC1A 3OLVA 1GSHA 2JC3A 2Z09A 2XPCA 2OR3A 1Q16A 1XRNA 2C3UA 3G2PA 5FF9A 5GY7A 1UWLA 2H29A 3IVRA 4KO4S 1TIBA 1A9OA 1P74A 1PAUA 2B21A 1QORA 2IBMA 2XIQA 2AG1A 5GJCA 3HCCA 4WGGA 4P35A 3TTXA 1EVIA 2QD2A 2XUPA 4MUEA 4HX2A 1KEEA 1TK9A 1TVCA 4EG6A 5JNSA 1R4MB 1UMCB 3AG6A 4I7EA 1L7DA 3WGQA 2W58A 3ZDCA 1W2HA 3QPDA 1UUFA 2JIPA 2V9CA 1A96A 3GAFA 4HXYA 4W82A 3M1AA 2EHJA 2F00A 5JALA 4D8WA 3DL2A 1E2JA 1V5WA 2EP7A 1G9TA 3Q2OA 4DZTA 4FLEA 4JJ8A 1WRBA 2IXFA 3FWYA 1GZSA 3I09A 3EARA 4G8JA 4ZOLA 1V8OA 2O2XA 4J16A 5EYPB 3B3QA 1QE0A 4S35A 1H0RA 2B5WA 4D0RA 5L53A 3HZHA 1OC2A 2OP0A 3WMGA 1VHQA 1A2BA 1ADYA 2JI4A 2WTMA 1XFAA 5LUBA 4CIAA 2IRWA 3HBAA 4KJXA 1RYHA 1OLSB 3IOBA 3PPYA 3W77A 1MGPA 2QJRA 1YJ5A 5FFNA 3H04A 1WCV1 4AN1A 4UZSA 3BJZA 3BPSA 4M0FA 1B43A 1PS0A 3KJGA 1YC5A 2BSXA 4BQNA 4XWOA 3T9CA 2ZDHA 5EOVA 2DQKA 3V1YA 1A98A 2AJCA 2FQXA 3PQEA 5C2JB 4JJ6A 3FB4A 5KYGA 1ISPA 4CGYA 5BNZA 3UH0A 4H60A 1T2DA 3HKCA 3K1JA 3PNYA 2QAGB 5BOVA 4ZYTA 5JMOA 3RYCA 4QLAA 1QR6A 2WOOA 2WAXA 2XNJA 3TOXA 1WXFA 4BGEA 4DANA 4F60A 4FB5A 3PRYA 4J7AA 1YJQA 3IAAA 5CX1A 3TGLA 3RRFA 5LP1A 1L4EA 3PV0A 4JI3B 4MW7A 1B73A 2ZJ3A 5C1OA 3R0JA 5K3EA 1W4RA 1BD3A 3FPLA 4DSUA 5CVTA 4YIHA 4OGKA 4CF4A 1VHWA 2SICE 4WCFC 3V97A 1HK7A 4Y1EA 2ZB2A 2ZW9A 4BLOA 3D4BA 3OC0A 4IJ5A 3CZ4A 3UH1A 5LLDA 1U65A 4J0FA 1YB2A 4XDYA 2X8JB 3K9WA 4WN9A 5ENZA 1EXWA 1WS6A 4DQLA 3CR3C 2OPBA 1E79D 1DMSA 1H2RS 4LGMA 3W7AA 3ZHBA 4ZVOA 3ZCUA 3KTAA 2HHCA 3CS3A 3UQZA 1BAPA 4B3RB 4PTZA 1VKNA 2FP4B 2AEJA 3TD6A 3RIGA 1E2MA 3RYFA 5FRDA 4TZ0A 4IG9A 1V7CA 1YB1A 4OQZA 1HDZA 1QVVA 1KEZA 3CNHA 4DTIA 3IV7A 1ZC4A 1KAOA 4RXTA 1J33A 3DLBA 4RVFA 3WL6A 4YAIA 1CC1S 1Q77A 2J3QA 3KUUA 3CZ9A 3UENA 1DGQA 1Z25A 5L3QB 1NNLA 2FRDC 2LW7A 1TMGE 3D3KA 1C7EA 2IGBA 3DVAA 3DBLA 1RRKA 4FEEA 4DL9A 2ZBQA 4CYMA 4LJ5A 1E1NA 3IT3A 4LNUB 4UUNA 4DJFC 1M2VB 1QHYA 4K3UA 4LVUA 3MJSA 3EBLA 2IHYA 4BUJA 1ZNWA 3C3MA 3QLUA 5FD8A 2HMAA 2HU8A 4KLAA 4D56A 2QPTA 4IIGA 1OLXA 1J56A 3FG9A 1X1EA 1L4KA 1TTTA 1FUKA 1GGFA 2PNFA 2C97A 5HSGA 1XK6A 2V3VA 3UWSA 4BO8A 3D6FA 3H2BA 5EXXA 1QYXA 2UVQA 4A03A 3ELBA 3EGVA 3NHAA 4XA8A 3F71A 2BPOA 4HBGA 1Z2PX 1ZGBA 2FWIA 2WIFA 4M60A 5CLLA 4ALMA 1C7ZA 3AFOA 3HUTA 4GVXA 2PBFA 2VYND 4F06A 4GYWA 1Y7HA 4BCBA 5J4YA 5DGCA 1IHYA 1RW4A 1O95A 1VRWA 2R1UA 1XU9A 1ZQ9A 4MV0A 4QYXA 1H5UA 4JH0A 4OYLA 3LO5A 4KYVA 4Q00A 3MC1A 4PQGA 4PSDA 4YV1A 1BSVA 2EWWA 2QNIA 3HB1A 1JEDA 1W4BA 2PUDA 2WVHA 2O6LA 5KI6A 1FU7A 4XZ3A 3GOHA 5AKEA 3G2HA 1WP9A 1H1DA 4K1LA 4E08A 3KT3A 2D1TA 4JI1B 5CIYA 3G0HA 3IKMB 2ZUEA 4CT4B 1MN6A 3FNHA 3W2IA 5HKKD 4QPDA 1U1FA 3TBHA 2VP6A 4PO1A 4PWZA 5LP6A 2J5BA 5CM8B 4NYJQ 1P1FA 1Z5OA 2R8XA 2AFIB 2OBFA 3AJ8A 3CSUA 3JQBC 1Q0TA 5K0SA 4F38A 2PT5A 2IV7A 3GP3A 3SX4A 2OXFA 4ZREA 4RH0A 5CGZA 2GXSA 4BQFA 1K3UB 2OV2A 5KVQA 1OAOC 2FEPA 3H86A 3WIDA 3QU7A 3GJRA 3QF4B 5A02A 4ZDJA 4GOLD 2V7VA 2I7CA 1YZGA 4MUAA 2XX3A 4GBMA 3LXXA 4PG4A 3UK2A 4ZALA 1VDZA 1VP3A 2DSNA 3RUHA 5ANRB 4EVRA 3CYFA 2G4LA 2YWCA 4EECA 3PNBA 4NYMQ 5LQMA 3IEMA 2ZVDA 1GM5A 1JKFA 2QT1A 4AG3A 1J2JA 2EDAA 4ZODA 3SCZA 1WZEA 3WL3A 1K7SN 1ESMA 1PW5A 4GMKA 5B1IA 1O0BA 2O2YA 2R8YA 1HM5A 2NGRA 2VG8A 4NS1A 2NXEA 1KIFA 3CX3A 1RLMA 2P62A 1T9CA 5KDOA 4KWTA 1UMBB 3NBUA 2ZJOA 3ETDA 1C9MA 4ITUA 5HOEA 2AUNA 2HA7A 4B6FA 4PCVA 3QA3E 2HQSA 1TIPA 5EE1A 4UDNA 3MWYW 3WA7A 4LJ4A 2F67A 5GPBA 4A0GA 2FCRA 1F2TB 4Q01A 3LW7A 1A04A 1XOIA 2P5UA 4K05A 4AC9A 4F9EA 4YT8A 3HB5X 1VL8A 1Q5PA 1ZK4A 2K7ZA 3HWRA 4FJ1A 1A9YA 2C4NA 4Q9HA 3VSDA 4GXRA 1ELOA 1RM4A 5K6RA 4ZJZA 1ULAA 4CIDA 1XMIA 1TCVA 2RIPA 4HFRA 5FWYB 2PKEA 3L8DA 2DLNA 1TZCA 3FGZA 4MZDA 3GFTA 1H9CA 5EI5A 2NACA 1TTHA 3UWPA 3WNZA 1TEZA 3EIQA 2UU9B 1RWNA 2WWWA 5C51B 5K0GA 4NHOA 3IDFA 1K5DA 1G41A 2EJUA 1NMEA 3ZEAA 2P9BA 2AZMA 3VJMA 4HQ0A 3EXEA 1N2IA 5DM0A 5FPQA 1XZDA 2YJ5A 3W4JA 2D2FA 2Z0MA 3EDYA 3N6RA 3TTTA 3QVLA 3CUUA 4GOMD 3GPBA 4OHWA 4ZCTA 2JS7A 2JGKA 3C6KA 5CFQA 1SVKA 4A2CA 3R6DA 4ZP1A 4NS4A 4CN9A 4HVAA 3JD1A 1OB5A 2FJUA 3AQIA 4YRKA 4BPRA 4FQ5A 4WA7A 3N5CA 2Q0XA 2ZTLA 4TUYB 4HGNA 5JNTA 1KSJA 2GZHA 4O1MA 3RKUA 2HNBA 2XDYA 1XMVA 1EBBA 5IDVA 1E20A 3QLVC 5CFRA 1GGJA 2WJAA 2YN0A 5KQMA 3NHUA 1KKUA 1ZM3A 1Q1NA 1WUIS 3EXHB 4MPRA 2GZMA 4G1EB 2QSYA 1EDEA 3OOEA 4XX0A 2C4VA 2K4MA 2KI5A 2Q5HA 1UBNA 4JR1A 4MYUA 4WNAA 3W5AA 1KMCA 1F20A 1G2QA 5J2TF 4BP9A 2P2LA 1U2SA 1AUOA 1GY8A 2WIDA 3DOOA 1QHFA 1MRZA 3ANYB 3HLYA 1QRUA 5KDDA 3ZDXB 5IDWA 2PZBA 2YOGA 3GJZA 4IJUA 4LXGA 3X2SA 1LBEA 3ZS9A 3HVRA 4DWJA 2VXCA 3JQRA 221PA 1CR4A 2HXSA 2CBGA 3TLGA 3KTOA 5AKZA 2VYVD 3KSMA 3WLEA 1RKQA 4EGAA 3SJBA 4H3SA 3FCOA 1J0EA 3B2EA 1QHEA 2V8BA 2Q50A 1W1UA 1QBKC 4JR2A 1RXWA 2I3BA 2B6NA 1H2ZA 1PJ8A 2NOAA 3H2GA 5EE3A 5FWXA 4ZYYA 4RETA 3HY6A 1ZITA 2BEVA 2AQ8A 4GWKA 4JI8B 3D0OA 3OF3A 3F7OA 4FYWA 4ROTA 5EGNA 2W6MA 3S2SA 1GRNA 1NW5A 4ZGWA 3VKHA 3C15C 2RGDA 4UW9A 3JPWA 3CVUA 3EYAA 1K6MA 5CDSA 4MYSA 4F9GA 2ZWVA 2HBYA 3C2QA 2N9UA 2O3RA 3UG7A 2DSTA 3IBFA 3ER9A 2UZ0A 3AZQA 1JG2A 1Z68A 2OV8A 3Q85A 1F4PA 2N75A 2ZQYA 4OKSA 4R83A 3EUFA 4RY0A 1JJAA 2AK3A 3HJCA 3SHFA 4IIUA 2POQX 3ZWNA 4IJMA 2A35A 3HDQA 3V4RA 1NXWA 4JUDX 3U3KA 3UHPA 2DT5A 3ETGA 1KI2A 2CCKA 3CO0S 1TAUA 1QC5B 2HK6A 4MVJG 1JEYA 3B1VA 2R66A 3WRVA 1ZY2A 1D5CA 1ZH2A 1KMIY 2IQIA 3AFHA 1BU5A 4KWHA 4LPSA 1E2FA 1PR6A 2RSLA 1PR1A 1U1DA 3LBIA 2NXJA 1LW7A 3L4SO 5EKDA 3BK1A 4KR6A 2Q5IA 2P9CA 4M86A 4H7JA 4IHQA 4BWYA 3A14A 4L4YA 4R3NA 3OX3A 2YZGA 1VBKA 1GKYA 2EYQA 2ZRAA 4FFNA 4HWRA 4MS3A 5DYTA 1E5VA 4B09A 3NT2A 1CZOA 4CDNA 3GBSA 4GOND 1Z6TA 5J1TB 2ZI6A 5JO0A 4Z86A 1V8BA 4QRHA 2UKDA 1KA9H 5EP3A 4D4MA 4F3RA 1K06A 2KE5A 2OXTA 3H7IA 4KQWA 1SCKA 3N5KA 4QGGA 4ZI7F 2GZ1A 3C1TA 3QKUA 4IIHA 4TROA 4D41A 2RHMA 1YR7A 2F9MA 2OWEA 3B8EA 2O3JA 4OL0A 5K1ZA 1IWBB 3DBRB 1XXHE 2ZROA 3L5OA 4FN4A 2H8KA 3KHKA 1W8IA 2ETVA 2ZYTX 3KTFA 4I4NA 4IS3A 5F3DA 3WLLA 3AEQA 2IHKA 4LY0A 3T4EA 4WKOA 1W0KA 1W36C 1N0IA 4RKQA 3V2HA 2MTBA 2JK1A 2OXRA 2QXYA 4FD3A 4FSDA 4I8DA 4MLDA 3KZVA 1E9AA 2WTNA 2EJTA 5KWIA 4AICA 4EBBA 3QBDA 3UHFA 4B3BA 4CM4B 2YMLA 3UMRA 1I24A 1N0VC 2FLVA 1ZJ6A 5CXXA 1ND6A 1XJCA 2FF7A 2WF7A 4G1VA 2A6PA 2OY0A 3L77A 1X1AA 3U9TA 3HUDA 3WHIA 1Z2DA 2XOKA 4MRSA 4RX1A 2MINB 3ABIA 1T6YA 3FIUA 1W0JA 4R81A 2GZSA 2I03A 3KQUA 3MTEA 4S0ZA 4KN9S 1H8HA 4YBZA 1M1YE 3GD7A 2JD0A 2HWYA 5JRJA 3K6SB 1Z6GA 2NWQA 1D2AA 1XA4A 4ALIA 5GZ3A 1YQGA 5IM4A 1P9WA 3A9CA 2G67A 1F7UA 5JT1A 1DDGA 2PFSA 1G8HA 3EUAA 5CW2A 5LL6P 1LZLA 1GPNA 2P8JA 5B36A 2FPPA 3JV7A 2ZE6A 1FFDA 2QVLA 1S3GA 3JD4A 5BR4A 2NUTA 1HV8A 2ZJYA 2PN1A 1GT6A 2HWKA 3MF4A 1FQJA 4H7EA 5DU2A 3EISA 1XNRB 3VDRA 2DUMA 1NXOA 3TXAA 1RZRD 1APBA 3GWGA 1YHZA 2AX3A 5FPSA 4GPEA 5AXDA 5JLAA 3PLAE 2CLLB 5KMGB 3DE1X 4GL2A 8ADHA 4RUKA 2V6IA 3QX7A 5DSTA 3U3DA 1JHPA 3OF5A 4B6QA 4UCXA 5BXYA 1JT9A 3MWEA 5FOXA 3WIVA 4L0DA 3I05A 1Z0AA 5ABPA 2CLHB 3PKZA 4K40A 4C06A 4YECA 4DY4A 2B82A 4RJ2A 5P21A 3UM9A 1NVUQ 4HL6A 1X8JA 1ID1A 1NBWB 5FB3A 1U2DC 4I99A 1LH0A 2JJMA 5ALVA 1VHTA 1VMKA 1SUPA 4JD5A 1NU8A 4HNGA 3BJIC 1CIVA 1XKLA 2JIRA 4ZVVA 3PWSA 5CVVA 2ZWAA 4RPLA 1NG1A 4DV4B 4HV4A 3FJYA 1L3CA 1RYYA 1QX3A 4I9HA 2FU5C 5ERYA 4RV9A 3CB2A 3W6PA 4DLWA 3U60B 4I50F 4R0NA 3ZWXA 1EVYA 4Q12A 4ZT3A 1ML3A 4Q7JB 4R8VA 1EUDA 3JU3A 1NV9A 4S2UA 4D8YA 2XMQA 5KVSA 5ITVA 1RHKA 1PHPA 1FXSA 1Y1RA 2QRMA 3N2YA 3UMCA 5J2UA 1N32B 4LQDA 4RKRA 1TGYA 4KVZA 4YN3A 4E46A 4LE0A 4L57A 2FK7A 3DMTA 2VJOA 1U9YA 4N6NA 2HDHA 4UHJA 3TZBA 1UXHA 3RSHA 4FGWA 4P93A 5BVGA 4L0QA 2BGTA 2QLBA 4ASUD 2RAPA 2PS9A 2E85A 5SICE 1X1RA 4ZDIA 1H2BA 5F77A 4RGYA 4QWWA 2CLDX 2XLBA 3FFBA 4OAOA 5KJEA 5CFZA 3N6VA 3PEYA 4JSYA 1UR5A 1LS6A 1YBVA 3A25A 2X1LA 3E58A 3GPDG 3SLRA 1KPGA 2ZIFA 4BLSA 4ZZ1A 2HRRA 4NOKA 1N2CB 3E5MA 3D5EA 2PYDA 4HX5A 4TV9A 2XBUA 3S2EA 1V7ZA 2ZBEA 1JF8A 3UMBA 2EBHX 4HN4B 3ZY6A 3EFOB 1ZUHA 5HIKA 2GJ8A 4R1TA 4DLTA 1O5OA 2HI0A 2DAPA 1C7RA 2Y0DA 3CC8A 5DHQA 1OWLA 3GG9A 2GHQA 2ECQA 4UJ5A 1XZLA 3G9QA 5I7UA 3NHPA 2JGAA 4CQLB 1SJ9A 3L7IA 3L1IA 1KY3A 1NFFA 4LQLA 4D92A 3FPCA 3W2GA 5F12A 2O14A 1YFLA 5K8JB 1XFDA 2XNCA 3KZOA 1ZCJA 1GUFA 4FCVA 4RH1A 1XSEA 5GM1A 3TM5A 4GMDA 3PR2B 1G42A 1Y5NA 3W5IA 3TG8A 2GXQA 2BE7A 1XTKA 3M83A 4NKRA 5GJVC 5IASA 3LXUX 4IEIA 3PYLA 4JLOA 2PFKA 3IQEA 2CJWA 4HQOA 1QFMA 4B9EA 3UYLA 3PXCX 3HA2A 4M6WB 1DAIA 3QA9A 4F56A 5AW7A 4KQ1A 3IJ5A 2GPNA 2IYOA 2ZLBA 4IKPA 3KBBA 4R3WA 2CBXA 4WA8A 2GBIA 1EX1A 1E6EA 4W9RA 3FYUA 1YONA 3BJRA 3C7CB 4G0OA 4CV0A 1EK5A 2F6RA 1A7JA 2IYFA 1N8TA 5CFMA 5ICSA 4L22A 1BS1A 2YUTA 4NMWA 1ACLA 2QT9A 5DT2A 4GUDA 1T3HA 1YUBA 1Z28A 3ZGNA 2IYXA 2O48X 3K2IA 4PQYA 3KJXA 1T4MA 5DEOA 2I91A 2R84A 4KAJA 4ARIA 3TQFA 2XYRA 3WYEA 4TYYA 3F3SA 5E8JA 4TRMA 5AW6A 4BGVA 2YX1A 4C7XA 1GAEO 1ZJWA 4C0XA 4GI1A 4MKFA 4MV1A 1NURA 2QX8A 3GAZA 3UAYA 4ZCIA 5HKBA 2JCGA 3AY6A 4OP3A 4H3VA 3F2IA 5FWNA 3D4LA 1J70A 3HH8A 2JAWA 4DVJA 2WV9A 3HK2A 1KJIA 3CCFA 1FRQA 4YMVA 3WGIA 3Q8LA 1DXOA 1P45A 1DPGA 4RVUA 1INLA 5K3FA 2CCJA 1G20E 1OROA 1Z4NA 3T3IA 4R68A 3G9UA 4HQKA 1QYVA 2BKEA 1QF6A 2QY9A 3SX0A 3N8DA 1ZK1A 2PTGA 1CULC 2PKCA 4DN6A 3NJ8A 1NRWA 2AFVA 1DQYA 4FYYA 2PTHA 1BO6A 3ZBUA 5I8ZA 3HCBA 5A5FA 5BNIA 2AQIA 3WLNA 1ARZA 3E22A 3ETHA 4EHBA 5AI9A 2BZGA 2Q7XA 3T9AA 1NPTO 1JIXA 3OE7D 4GOKA 4NG4A 4GD3Q 1UKCA 3KSUA 1UFOA 3F97A 3EWIA 2RDMA 2ISSD 3H5TA 1THMA 4JQSA 3JQ9A 3U37A 5IMSA 3O93A 1ZIXA 2ZAIA 3C4QA 3D0KA 3L0IB 4L6AA 5ITZA 3U4CA 4X1IB 4F8EA 2Z2YA 2NQ8A 5AYVA 3STHA 5E1BA 2GTHA 3OU6A 4JBIA 2Q5OA 4EKDA 4Z2AA 3LT0A 3DKRA 4WCFB 2VXBA 2QN1A 2Q21A 3LWDA 4LPKA 2PS0A 4UBIA 1PVVA 2QBYA 1WDMA 1EWTA 2LV8A 4WRRA 4YT2A 2HM7A 4E94A 5BORA 1NR7A 4QGAA 3TW4A 4JXJA 2Y4NA 1PKXA 3RASA 1ZH6A 2R6R1 5JCPA 4CKEB 2D1QA 1HDXA 5EGSA 3FX2A 3DXFA 4EFLA 1TLTA 1R5OA 1J0BA 4QREA 1ONNA 1SXPA 2CLOB 5CAEB 4RS4A 1RWBA 3O3MB 5FUMA 3OO1A 3N59A 3T3MB 2HBRA 1CE8B 2SNIE 1LWOA 3HEMA 3M2PA 4FLMA 4NOJA 5H59A 4TTIA 4BTVA 2E5LB 2MYPA 3DVSX 1HX7A 4X1OA 1WJGA 1V1MA 1DRVA 1EZ1A 3DVQX 4TMYA 4I4TF 1OKKD 3KYCA 4D5EA 2OT3B 1FVFA 4DB4A 16PKA 4TTTS 4Q6WA 2QL7A 5DI3A 5AXBA 1MC5A 3EIHA 1GV1A 2AC4A 2CFCA 2FQWA 4YCSA 1UZNA 1P0FA 1U98A 2GH1A 1ZIDA 2Z1MA 4RMGA 5AVZA 4XPIB 5EA2A 4JT8A 4G9BA 1JLRA 3LIPA 2BEUA 2VJMB 3M9LA 4WE3A 1DHTA 4A92A 4EA8A 2ZE7A 3A1SA 3LY9A 2N42A 3OJFA 4K6FA 5I3ZA 3QVVA 3MBOA 3EGXB 4MWTA 4QQFA 3ZK8A 1EX6A 4JMLA 2VXYA 1ORIA 1II0A 1L8QA 2ZYUX 4W99A 4A4DA 2DETA 2IH2A 4J07A 1Z3IX 2PH7A 1GZ3A 1HDRA 4EOGA 2E4VA 3EG5A 5HK9A 3HB0A 4B4OA 4RF3A 3EN0A 4F96A 4PIVA 4M8KA 4QJ4A 4DQVA 4B3HA 3RVOA 3U7HB 1KBOA 4BASA 1MG5A 4MULA 3R7BA 3OTQA 2JLZA 2JRLA 4GR5A 2PLNA 1KQ3A 1OASA 5FNZA 5E9QA 1NC1A 3CXRA 3LT2A 4ND6A 1LPOA 4BNWA 3JQ6A 3X1KA 3C4VA 4G67A 3N0XA 3UWDA 3F47A 3M82A 5CW1A 3U9LA 4J8PA 5TIIA 2FPSA 5LOVA 3C16C 3CLVA 3GRUA 1YH3A 4NBUA 1E9RA 2FZVA 4O2LA 3TSYA 4A0QA 2PUGA 1IIRA 4O5AA 3LQQA 4DV3B 1E2HA 3LY7A 3QQ5A 4J94A 2GVZC 4HADA 4J1NA 2QZZA 3D2BA 5EZ6B 1AKYA 1L5VA 3CCCA 2F43A 4A0RA 2P6OA 3WLIA 2VTEA 4NJEA 4ENWA 4Z1OA 4PNHA 2BGUA 1H6AA 1KNXA 1N7JA 1MG0A 2B0CA 2ZRJA 1DIOB 4KN5A 3PJGA 4N8DA 3JD3A 3H42B 2ZULA 3ED5A 1DKRA 1G20A 2QZJA 4M7OA 5FI0B 3RKSA 3SM9A 4BS9A 3BSSA 1G21B 1TM5E 2VTDA 5IAKA 1G291 2IZZA 2YHBA 3MMXA 2IS4A 1EG7A 2NYUA 1A7KA 2YW9A 4MGZR 4OK5A 1T8TA 4QSMA 1KPIA 1NXPA 1GFIA 4KMOA 2OK8A 3JQAA 5A0FA 2OPHA 1CUYA 2AA3A 1NW7A 4KFTA 3ZDEA 1D1QA 2BR5A 1YQEA 2IKQA 4JUCA 3GRAA 4YIKA 1G5TA 2PVPA 3FMPB 3V9PA 4A1OA 4F5DA 2AR7A 3A4YA 3KHTA 2ARKA 4L16A 2GLUA 2H92A 2PKQP 3IPXA 3V9AA 1FRZA 3EAQA 2PMWB 1ISFA 1L2TA 3DAHA 4M7PA 2PHZA 3FMIA 1Q0SA 1DTEA 5JXWA 4Q93A 2QD1A 2A78A 4ZVQA 6REQA 2PDAA 4MVCA 1TF7A 3BMNB 4FKZA 1IOWA 1GCOA 3FNFA 1XYVA 5EVJA 2BYTA 3WE7A 1UKVY 1P0QA 4PONA 1RE0A 5IHXA 3AESA 1XNJA 2CY0A 3E9NA 1HNXB 3KUDA 4R7TA 1VLVA 4ALLA 1EG2A 3ORSA 1QRSA 4YP7A 1ZUWA 1N7GA 4UHHA 3ESDA 4EZIA 1B42A 1HLGA 5FOTA 1SZJG 3BA6A 2Z58A 1Q7BA 1Y8ZA 3WJ7A 1ZAYA 1TA9A 3E3AA 5T57A 4CG2A 1AZTA 1TD1A 1SPXA 3FSGD 3JQ8A 4IWYA 4TN5A 3DEFA 5D5QA 5T6MA 4YAEA 4CF6A 4QOEA 5HM8A 1AZWA 3WP1B 2HRCA 4JLSA 2P2YA 4P08A 3CVYA 4FHGA 4CMEC 5IJZA 2JCSA 5IH7A 1A5ZA 3PHBE 1XPUA 3LP5A 1FS4A 1FVXA 1W9MA 1DHRA 3U0VA 1XXLA 5C8YA 1WDWB 2MMGA 5DH9A 1W76A 4R2WA 3QVMA 4D79A 1ZCBA 3DZBA 2Q1UA 3M5DA 3RSFA 2AOUB 2HIGA 2RGUA 1LI4A 1Q3HA 1NRIA 3GCXA 5F73A 1EFPA 2IDMA 2PA3A 3RYHA 3IT0A 4GLLA 5CBPB 2QKYA 4G4SP 5TQ2A 3WGKA 1VYVA 4M53A 1KOLA 4QD3A 3HB4X 4RORA 1E18A 1NVFA 3PEEA 3IQGX 2ZRIA 5B2EA 2F3SA 4YRSA 5JJ5A 4R8RA 3SN6A 1TO1E 1CT9A 2I29A 2UYGA 2WNHA 1BA2A 5TLSA 1I4OA 4OHKA 5AI6A 4J6FA 3W5HA 5CEEA 3R77A 4II3A 3W6NA 4Z4QA 3UT6A 4IXTA 4HYYA 2WW8A 1XALA 4ZQFA 1WBDA 4XD7A 1F2UA 4AJIA 4AECA 3C3PA 1VMAA 3A37A 2V5UA 2IYNA 5SZHB 1WUTA 4QYIB 1SXQA 1Z8HA 3WFJA 1XJ5A 3C6YA 2V7UA 3VC2A 1Z39A 3IA7A 4LJ7A 3B6ZA 4R1PA 3F8SA 1SC4A 2WLSA 1IL0A 5DYYA 2VHJA 3DLCA 4EFKA 3AETB 1XEWX 3R5XA 3BGSA 1VE9A 1YSCA 3R7FA 4EKGA 3T3NA 4TYWA 1JI0A 3BF8A 4PGMA 4PRZA 2OCLA 2A7QA 4J91A 1QANA 2RGAA 3QV2A 2UUBB 3OQOA 2I6GA 1GSIA 4FCCA 3EW7A 2QN8A 1XZMA 4OMFG 1YBFA 3I2KA 3GOQA 3HLTA 1YKGA 4JOQA 3M6WA 1NLUA 2C5LA 1T0BA 2CHEA 3E5NA 4PAQA 4BNHA 3NP7A 2YWEA 3OZWA 2OZPA 3AVOA 5BN5A 2PLAA 1YRBA 4JFAA 5A4IS 1CQIB 2JGRA 1WNTA 3HO6A 3U5TA 3QFFA 2H08A 1AN9A 4PZAA 3RC8A 2BW0A 4TKUA 1A5SB 3A4TA 1P4RA 5EKXA 5CDGA 2PNJA 5U1PA 4J7XA 2YN4A 4NAVA 1OYYA 2NYVA 5AM4A 4HAYA 3ROKA 2Y92A 3ABRB 4WOJA 1TPYA 3QVWA 1DTWB 2C1ZA 3HVIA 4WLEA 4C4TA 3KETA 3EWNA 4YS6A 521PA 5LJLA 2XDAA 1KJWA 5EMLA 1JJIA 1JWBB 5K8TA 1EK0A 2HJSA 1XTPA 3BE8A 1KSGA 3ZE7A 4TN1A 2ZYAA 1O77A 1HEYA 1N4AA 2EBUA 3GIDA 4PGFA 4E21A 1O3YA 5AMXA 4TL7A 4U9IS 4HDCA 1AIPA 1ZGAA 2XOXA 2QRHA 3EG9B 3RUPA 5PGMA 5BPFA 3R4CA 2J0VA 1CBUA 2ZU6A 4IOMA 5LA6B 3TZHA 5K0JA 2GBLC 4A16A 4FP9A 4AUMA 4HQRA 5EMMA 1O0CA 1LLQA 4RA9A 1BVUA 1IB6A 3PIDA 1G5QA 1KH1A 4JBGA 3RGGA 3V33A 2ZYIA 3KPJA 2G08A 3S4YA 2OHVA 1MAWA 4NH0A 1AKUA 1XVAA 2NZ2A 2VNJA 1PUIA 2GO7A 2HKIA 3I01M 3STUA 4JFRA 4X92A 5B6IA 4I66A 2D2IA 3L7NA 1OBCA 3K0FB 2PH3A 3LLMA 3OX1A 4UEKA 2Z6QA 1K3TA 1UWKA 5JH7B 2Z98A 2HHLA 2NXNA 2OCXA 3QI7A 2OBBA 4NDAA 3GGDA 3ONDA 3RBAA 1B8NA 3ASUA 4HI0E 2JBHA 3KEFA 4IX9A 2EKBA 3N53A 4HMQA 2E4YA 2VDOB 2DKNA 2PUAA 1F2VA 1CZNA 1QIEA 1J9EA 1QIJA 1W36B 2AXEA 4GDMA 5DX8A 1MB2A 2HMSA 3FI9A 1EGHA 1O97C 1XAGA 4I3HA 2QROA 3QX9A 1U31A 2BFCB 4IDOA 5KKNB 1ZGCA 3G6KA 1FYDA 4HAXA 1AF4A 1KVTA 1Z2AA 4KWCA 3ZKWB 2ZAYA 4PSUA 3RVLA 2ZVJA 2IZ1A 1E1DA 1HEUA 1U6JA 1PQWA 1U80A 1FBNA 1ZA2A 1ZRSA 3HM2A 4H15A 4Q15A 4RFVA 4ZI2A 3NFRA 5TEWA 3FVQA 3I4CA 3ZCXA 2RHLA 1RIFA 2XYGA 2HLDA 4XR4A 4C4ZA 3IBGA 3BFKA 3VR6H 4BKRA 2YVLA 1R4AA 2I2WA 4DQDA 5INTA 3QFTA 4XWYA 3AF0A 4D4LA 1K86A 4KACA 2DWUA 3N3AC 2AS0A 2YBDA 3VFDA 5AHWA 3T7RA 3HXQA 3BFPA 4GI3A 5DM4A 3F6RA 1MFPA 5CXSA 5H4HA 3TINA 3A26A 4CUKA 1H9BA 1BOOA 1L5SA 1ZNQO 2PXCA 1CFJA 2IDZA 2QHXA 3NQ41 2R751 1YKSA 1HWYA 2POCA 1EEHA 4OM7A 1QVZA 1FDOA 1M8JA 4YAOA 1ZR4A 3A6ZA 4FGKA 1TZ2A 2IODA 1IQPA 4DV5B 2WEKA 1GJRA 3MT9A 4JWKA 3RTDA 4S04A 4U9UA 3FCCA 3TM4A 5JU6A 3VNBA 1JTEA 2VPTA 1NQWA 3GZNA 3HU3A 2GHIA 3ZZTA 3QVSA 3H9GA 3K0CA 1CD5A 1QYIA 2FDCA 1JHYA 4YRIA 3FDJA 4MO9A 5CMLA 3Q3EA 3BBLA 5EN4A 2LCQA 4EQ6B 1Z4MA 2HJ9A 4AMVA 4HFMA 4RF4A 1C3OA 2FSGA 1UBLS 2IOFK 4QUBA 4F4UA 4UTNA 2R6HA 1PGOA 4B3GA 3GLUA 4I9FA 3AI1A 2TMKA 4TRNA 1N25A 2TSYB 1YHNA 1YOBA 2UYYA 4P1ZA 5LWHA 1AK2A 1U4OA 2HWWA 3B9BA 2JLAA 2NXWA 3O4HA 3VHXB 4FGLA 3AH8A 1L5OA 4AWBA 1JPUA 1KQPA 1T6XA 1YRHA 1CR2A 2Z6VA 3KKEA 3O8QA 2NU6A 3R3UA 4OI0A 3GRCA 1FMFA 3UAOA 4BFWA 4F72A 1JT2A 2CXUA 2L42A 4F6RB 2EQAA 1AB6A 4MVJP 4FINA 1DL5A 3VO9A 3TLMA 2C3YA 2OE2A 5EP1A 5AKHA 4RTJA 1CY0A 4LHSA 4RFLA 1XTTA 2BR4A 3TNLA 3FWZA 1IUOA 5DM1A 1HYGA 3ROTA 3LLSA 2VDJA 1ZUD1 1SIUA 3NIWA 2QW0X 1GZDA 2ZTMA 1QG4A 3U26A 1R0ZA 7MDHA 5FBKA 2QR3A 4WVLA 2C0CA 2BMAA 4LGVA 1N7IA 5DTJA 4JEUA 5C35A 5DHAA 4ZV7A 3KB8A 2E1PA 3GLFB 1HTWA 5IT9A 2ZIEA 1FP7A 1NT4A 5BPHA 2XNDD 1E6MA 1U5BA 5KTMA 2BOVA 4HDOB 3DV0A 4XLZA 3ITEA 1TAGA 5F7XA 3AXSA 3ZVMA 1MJGA 3I1YA 4MV9A 1NQTA 2WHRA 1AMNA 4JVNA 4MYHA 5M3BA 4LN1A 2I3GA 4A9AA 4BN5A 2WM8A 2OUIA 1RQRA 3G0CA 2ZBRA 4N5NA 3A2NA 3THWA 3L0YA 5KSOA 5K3DA 4JP8A 1A9PA 4Q48A 1BN7A 2I6UA 3K0AB 3RS0A 3NTLA 2YV5A 4H0FA 2QA5A 4U6NA 3TI7A 2B20A 4I19A 4Z3OA 3S5UA 1MX3A 1VFPA 4LG1A 2AMJA 1NF9A 3QKRB 4IFEA 5JZVA 1PFWA 2WPNA 3C1AA 1V16B 3DVLA 3FCXA 3IHLA 4GLBA 4FC7A 3LX8A 4BJHB 4TTPA 4PY2A 4Q9LA 5FL3A 3C3XA 3FA2A 3JR3A 4YRAA 2RAUA 1L5HA 1JU9A 1SBIA 5JVDA 4HH4A 1UK6A 2VNSA 3BMOB 3CNBA 3MM4A 1W88A 4Y0NA 1B2RA 1N57A 1RLJA 4J0CA 4EMTA 4DMRA 2R79A 1F60A 4KQEA 1OW3B 5KOIA 4X84A 4R2XA 4Y67A 3T4PA 4YP6A 2WM9B 2Q6IA 1N34B 3WISA 4EY7A 3GEBA 3L07A 1C29B 1OGYA 3ER6A 3ZV3A 3AP3A 4K9SA 4DCTA 3LDHA 421PA 2BLNA 4BLQA 1T4DA 1HOXA 1O57A 1TE2A 2VRCD 2J6CA 1EUCA 3C4JA 2OA0A 3WZLA 4H1WA 3FDXA 4AY6A 2XE8A 2GOYA 2FMIA 1KEWA 3PPXA 1W30A 2JD1A 3FMOB 3PXBA 3U31A 4U39A 5BWOA 1FTNA 1NATA 2IE8A 5L45A 1ZVQA 4DG5A 1R6AA 3W78A 3V4FA 3LHDA 1KS2A 2R97A 2YWBA 3NVMB 4ZXFA 3RV3A 3W9UA 2M2IA 4X95A 5B7PA 3CN9A 3VUEA 3HJNA 4C89A 1RMTA 3AB7A 3ADOA 3D0RA 1SU7A 2PG3A 3I58A 4GP7A 3SJ7A 1YB7A 1RXCA 1BYIA 1USVA 3LFHA 2WMOB 5F23A 2JCVA 2GCOA 4L9RA 2I0FA 5D7NA 721PA 3O3CA 4AZ0A 1YI8A 3QG1A 4JX8A 3PJDA 5KYUA 4HEA1 4H9GA 3A58B 3CURA 4OF4A 1UDCA 1GL3A 2VDRB 1DQNA 1OILA 3N8IA 3PDIB 4JJEA 2HJHA 4MLPA 2DFDA 5KAMA 3U4QA 1JDNA 1GUDA 1YWGO 3JWJA 2ZBVA 4QOFA 4B74A 2JFZA 3ZBPA 4DV6B 3I1IA 4NARA 1HKHA 3PI7A 3SS8A 2LCIA 2X1VA 4LEIA 1T5HX 2V5VA 3BZWA 4GR9A 3STXA 4R2HA 3B52X 4GC5A 4DTCA 5C8DA 1V9LA 1PI3A 4E07A 1W4LA 1D7OA 4N41A 5JWHA 4BNTA 5EWJA 3M3PA 3HCPA 3RE1A 3PLNA 4XJVA 5DFAA 2FSFA 3VPGA 2FCAA 4IQGA 3VZQA 1NBIA 2O5RA 3RUIA 1O6GA 3IXQA 5DASA 4NFHA 5KIAA 5L4SA 1C4WA 4E13A 2PGLA 3CU5A 1JDZA 3MYYA 3KELA 1G63A 3UPTA 2YQ4A 2HQRA 1TQ6A 2WIBA 4HXGA 1J00A 1K7FB 2HSDA 2I62A 2O06A 4YJ3B 1ZM4A 3UOAB 1C50A 1XLTA 3BF7A 5E6SA 5IYZA 1G2OA 5IUKC 3ZEIA 2X86A 1CZHA 3IVXA 1SG9A 3DB2A 4TYNA 4Q9DA 2X7XA 3B2NA 4DDUA 2BRUA 1KO8A 1VSTA 1XQYA 4PRYA 2FX3A 3D1LA 4TMFA 4G5SA 2OAP1 2FFHA 5AKGA 1U3WA 2PL1A 1QUEA 1C7FA 3DR3A 3OWOA 5AHKA 4DLLA 3MD9A 3H9UA 2Q4DA 1MC8A 4QO8A 3LFTA 4IINA 1D2MA 3R3JA 1KMMA 1JAXA 2CEAA 1CUEA 1A9XB 1FFHA 1S9DA 1Z2NX 3F9RA 4PYNA 5A9SB 1FDWA 5K8IA 2FPWA 5EKTA 3LY5A 1E2IA 3H5WA 3MUOA 5J47A 1ZG3A 1RYDA 4P4NA 3GRZA 4NCNA 3P2IA 1BW9B 1W87A 3BRSA 4G26A 4UM9D 4B83A 4EI7A 2AZDA 4DC1A 1WCXA 2WWGA 1VLZA 5GGXA 1YHYA 2A1IA 1OFGA 4P92A 4D25A 4KR9A 1K1EA 1UKAA 3AOEC 4RS3A 3U81A 4AD8A 2RAVA 4KFSA 5THKA 2DH5A 2XGSA 2FEXA 5DCLA 2Z6AA 3SVLA 2HWXA 4ZAYA 5FQOA 3EMVA 4CV1A 4C7OB 3WRYA 4NESA 1M9NA 3S55A 2X5XA 2O59A 4YACA 2PJZA 5H81A 4BP8A 4MVJD 1NOKA 4JY7A 3VAYA 1OB2A 1T6NA 3NV9A 4U7TB 3WXMA 1G6KA 5K6TA 2P9HA 2GPYA 1Y5IA 3WB0A 5CT9A 3GLGE 2VP9A 2F4VB 2VZ8A 1Y3BE 2BM9A 4UREA 3ZCQA 3OOWA 3G9TA 2FQ1A 3FPGA 4TV8B 3DD1A 4QAQA 1CY6A 3EQ9A 2P2ZA 1CCWA 2WYIA 2I6XA 1SA0A 1NX6A 5I9MA 1N6OA 1UZAA 4IDAA 5M5BA 1PJ3A 1KTIA 5JSKA 4WBNB 4OMUA 3EAGA 3VMMA 3VU8A 1I7PA 4DVGA 5E7JA 2HY7A 1NRXA 2CUZA 1YS7A 3RVNA 2BWJA 1XQVA 4QL3A 1X8XA 2ACVA 4ZTBA 5J2UF 4LCJA 4F86A 1KEVA 1RLTA 4V3BA 1V6SA 3K8OE 2CXNA 4YV0A 3OY7A 3P45A 4P4LA 1X7YA 2PMDA 5E0KB 3KRTA 5G4KA 3KZCA 3SSAA 2A3RA 3E7XA 2GEKA 3TLAA 4Y2JA 1DIRA 1T5IA 4PC6A 5FHQA 2NUPA 2AD1A 4IW3B 4MS1B 4O4JA 5B2ZA 4DG8A 1L5ZA 3NUGA 3QMWA 3DGFC 1WZCA 2VF5X 4EPWA 4E4TA 5FAKA 2FPIB 3H8VA 3X1ZA 1LVUA 4OOFA 3PF9A 1WMEA 3DL0A 4P2GA 3RK1A 4KPFC 4ZRMA 2DPXA 2VCYA 5AXCA 2XNKA 3MT0A 4QYMA 4EWLA 1UP4A 4U2BA 1MNQA 1VE7A 5BRAA 2ZS9A 5F98A 1O87A 5E7QA 1EP9A 1XD2B 1ZBQA 2H4JA 4L4SA 4QO7A 3UXMA 4ZKDA 1SIWA 2JGLA 2QK4A 3PU6A 3R44A 4IIDA 3FKQA 4UKDA 1W59A 4Y6QA 3HCNA 5GZ6A 2ODQA 4DYHA 4EDFA 1B16A 3GQBB 2B5OA 3JVVA 4Q4JB 4PFSA 1MO6A 1PP4A 3OPVA 2KQUA 4KI7A 2GFIA 2HRQA 1JYFA 4OXYA 3T12A 5I01A 5EKUA 3LT1A 5IAGA 1TMOA 4BEJA 2YHIB 4KYUA 3T34A 3EVCA 3LYUA 3L7AA 1UMDA 1MAHA 1QH0A 3DDZX 4JA0A 4XAQA 3UJ3X 4KSCA 3V32A 5AVXA 2NVBA 4HR7A 4KFCA 1A4RA 2ZKLA 1R18A 4MINA 2R44A 4BNDA 3N2EA 3QHAA 4LY9A 3LXMA 3RC3A 5J4KA 4ON9A 4NZZA 1NX9A 3W79A 3AJEA 3KM0A 1D1SA 2PVCA 2I71A 4I8XA 4D96A 4ZI5A 1R9JA 3H2YA 5A3QA 3ENKA 3JARA 3WGLA 1P8AA 3CB4A 3KT8A 2O05A 2C57A 4IDFA 1PZFA 4BJ3A 2Z9BA 3MTGA 3B8HA 4F85A 1GHTA 2P9YA 4DHWA 3EZXA 4FZVA 4XQ0A 2OCKA 1I2AA 4X24A 3SYNA 2XNSA 3BEDA 3H83A 2OCYC 4M1MA 1AXEA 2NVUA 1RLIA 3OPQA 2P11A 1JG1A 4BNUA 4QUAA 2C61A 1IXRC 1ZUNB 2WIGA 4U02A 1KK3A 3NHJA 4B44A 3CRW1 1GRQA 3OZXA 3L8HA 2P0AA 2QG9A 3LXRA 3QOWA 1H4QA 4UFOA 1E64A 3VH4A 2HRZA 3ZE0B 1XHEA 9ABPA 3EE6A 1YTUA 4B17A 1JEQA 4Z9XA 3SEZA 3KCQA 3F3YA 5KTNA 3N2KB 1L4UA 1PBNA 3G0GA 4BL5A 3DONA 4BTLA 4B2YA 4CHGA 1OT3A 1P3Y1 4Q37A 1VCHA 4ZEXA 4F71A 4IDDA 2VK2A 3L7LA 1G4UR 2HHAA 1PZGA 4DIEA 4ZOBA 3U9SA 3EZ6A 1GL9B 4KP7A 4R7GA 2P35A 1G8KA 2NV2B 1Z6AA 2C7BA 3ZHVA 4Z49A 1A1SA 2AF4C 2IEYA 3G2MA 4YH1A 3WC4A 4CLOB 1YZUA 5EY5B 2WYOA 2L17A 3QEKA 3ZD8A 4AF7A 3GLGA 3KOZA 3RK4A 3ILYA 5K01A 1J97A 4U9HS 4R1QA 2XUFA 3NWEA 2UZAA 4UVDA 3CZRA 2FY8A 3U3OA 5KNBD 4X3OA 2Y2UA 3ZHTA 3HUUA 3GIWA 3PTZA 4PAGA 4XDGA 5E6RA 2ZIUB 3K94A 1XZNA 4QEKA 1CY7A 4LYEA 1L5KA 2FHSA 3W2HA 1P3DA 1PWHA 1NOIA 1EM8B 1Y5RA 1V96A 2E4XA 1PTKA 2H1VA 3GELA 2X0FA 4BIIA 4OU5A 1E5DA 3PQ8A 3BQMB 3FGOA 1RWVA 3AONB 4P31A 1GZ6A 5EXSA 1OTXA 2V6FA 1IYZA 2QE6A 2ZTVA 3RCBA 1MEJA 2ID8A 4C1BA 5IX8A 1U0BB 2DHQA 1PR2A 1T8RA 4P7GA 3CPEA 3M3HA 3AR8A 4HVTA 4ZV4A 1PX0A 1VKHA 1Y9JA 5TS2A 5I4IA 1RKXA 2PQ6A 3IUBA 1T5DX 4MW0A 4UNIA 2XAUA 3CZMA 3COPA 3GX1A 3H1AA 3NTOA 1XZBA 4HDKA 4RPJA 1B1CA 4J3JA 5CA0B 1X0XA 3G9ZA 4D02A 1RXVA 3L0DA 4TTSA 3OPYA 1JU3A 4TSKA 5E2BA 1Z6YA 1AN0A 2E89A 1YDFA 3U44A 1Z2CA 1WV1A 1LDYA 3U48A 2PX5A 4MQEA 1JPVA 1JA1A 1Z26A 4GX2A 4JA2A 2FUCA 2ZUCA 3E3LA 5JAMA 3AC0A 4ETWA 1OFTA 4N48A 3P0EA 5E3HA 2D5IA 4MW1A 1NR5A 3AUKA 5GV7A 5ALIA 1VBMA 3EQ6A 1GNPA 3ZQJA 4C3ZA 1L4FA 1LJLA 5EMJA 1SCIA 4K6HA 2X15A 3EGEA 5B3KA 2H52A 3HDYA 1CF4A 1GTG1 4NFYA 5DE3A 1KP2A 4BX2A 5ALFA 1NNSA 2DFNA 3VVLA 1LRKA 2C88A 5AHOA 3UQYS 1O7JA 2QTTA 1Z6ZA 2J46A 1Y1LA 4RQBA 1K7EB 1SUAA 2GEVA 4C4RA 4KXYA 3EZYA 4FS3A 4RJKA 5KUTA 3AGPA 3M0EA 3MHTA 2R00C 2AFHE 2XYHA 2B99A 4O4HA 2C4MA 3BWXA 2ZRKA 1QHIA 1P0IA 4V0KA 5EQFA 2BHTA 3BD7A 1V3TA 4BNZA 5B30A 2G9ZA 4HS9A 4L3OA 5HF6A 5IJ9A 3B48A 4KBYA 1GD1O 1W47A 1PJSA 1X7ZA 2ODNA 3QNUA 1NVVR 4QFCA 3SHTA 2BJVA 3WYDA 4DXDA 4O4LB 4EUSA 5B7GA 2IL1A 1FQWA 1R0KA 1JV2B 1MA0A 1MVNA 1PTJA 3PPIA 4FSXA 3RIEA 3GUVA 1U0FA 2HHJA 2GCNA 4ZCRA 3FM9A 3IURA 5C3MA 2XZPA 4DUGA 4EGFA 4RCZA 1AK1A 2CMDA 3I04M 5ALGA 2WF8A 3KKZA 5EIFA 3V7NA 1VPWA 4RJLA 3UG6A 1H94A 1C1DB 2ZB8A 4IMIB 3FHCB 3L18A 4RAOA 2QE7A 4QUDA 3EIFA 1HNNA 2JANA 4G63A 5G3ZA 3HVHA 2BGWA 1C3EA 2I80A 1VPLA 2J6BA 1SRRA 4OJYA 5I8PA 5JQGF 1R4ZA 3GNLA 4M83A 2XZTA 3HC7A 3I2FA 1WXIA 4GXQA 4JKYA 4JYAB 4IR7A 4DIBA 3ECSA 3LCCA 2EZ8A 2Y2VA 1TKRA 4UU0A 3P2MA 1S8AA 1RAHA 3T61A 3IELA 1ZD1A 2ZJ5A 3C8MA 3GY0A 3QWAA 4QX6A 5A9RA 1COWD 4DC9A 4DAEA 5HRCA 1G5HA 3K09A 3INNA 3VYSB 5AVSA 1WETA 3NPAA 5BY2A 1TEVA 2VAPA 5EZ5A 4TM7A 1C80A 3MSCA 3T5DA 3QVXA 3SICE 1L1RA 3UWKA 2RI0A 2QQ0A 1GYPA 2QJFA 2RH8A 4Q1VA 4B4KA 5CURA 2ZRCA 3T1YB 2I1LA 3QXXA 5HW0A 2I76A 4Q7QA 2IOYA 3LU1A 5CTAA 2RE8A 1VIAA 2J4FA 1DV1A 1UOQA 1AQLA 2OSVA 3PUXA 5EPOA 2Y77A 3VOBA 1E4EB 3G5UA 1AQ6A 3T9FA 1Z0KA 4HUQA 4WZAB 4G1FA 1A7AA 1G66A 1E3QA 4JYBA 2R48A 4GX1A 4LHYA 4MS4B 3ESAA 5T6BA 3C43A 1RVDA 4N8SA 2O8DA 5LB4A 3OAAA 2VDWB 1K2WA 4XKJA 3VR4D 5A03A 3X2EA 2C58A 3DP7A 2RHCA 3C5VA 4MKGA 3E27A 4WX2B 3VR5D 4B7CA 4CRWB 2WJ4A 4X65B 3IIIA 4UASA 3T7JA 2G1UA 3A6JA 4OJTA 5LU9A 3EHDA 3VJRA 1Z75A 3WQHA 3VZSA 1RI5A 3VTKA 2X0NA 4CKXA 4ESHA 4DCGA 1NP3A 5KYNA 2B7LA 1SCUA 1O96B 4QHYA 5JNUA 1X80B 2XB9A 4F4CA 1KU6A 1ORHA 1T29A 4FYXA 5IKEA 1PGNA 1JA9A 1RRFA 4NCJA 4YAGA 3CGGA 5IJAA 2O19A 1F6BA 1RQNA 1YS2X 3LC7O 3WSWA 4RF5A 2CMFA 1F38A 5JBIA 4C2UA 4MEAA 2ZIXA 2GK4A 3NRJA 2D00A 4G09A 4MVJM 2AMFA 3D4OA 4JL6A 2ZBFA