1P5JA

Crystal structure analysis of human serine dehydratase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
b'GEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQECGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-serine dehydratase
molecule tags Lyase
source organism Homo sapiens
publication title Crystallization and preliminary crystallographic analysis of human serine dehydratase.
pubmed doi rcsb
total genus 108
structure length 319
sequence length 319
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2003-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p5jA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p5jA02
4L0DA 4F4FA 4D9KA 2Q3DA 4ZQCB 2C2BA 4KKXB 1TJPB 2ZPUA 1TZ2A 3RR2A 2RHGB 1JBQA 5D87A 1KFBB 3VSCA 1CW2B 5KINB 3L6BA 3FCAA 4HN4B 5B1HA 4D92A 3DWGA 5J5VA 1F2DA 1FCJA 4NEGA 3IAUA 5JISA 3PC4A 3V7NA 4COOA 1J0CA 2TRSB 2Q3BA 3IQHX 2V03A 1KFEB 3ZEIA 3TBHA 1WBJB 2JC3A 4D9MA 5I6DA 1BKSB 3BM5A 3CEPB 2GN0A 1WKVA 1PWEA 1KFKB 1C8VB 1TZMA 3VBEA 4D8WA 1Y7LA 4D9NA 2O2JA 4HPJB 4WX2B 1QOQB 5DVZA 1OASA 3T4PA 1CX9B 1TZJA 5D85A 5C3UA 5DBHX 4H27A 3PC3A 5B3AA 1QOPB 1PWHA 2DH6A 5BW6B 1K3UB 2CLFB 2RKBA 1C9DB 4JBLA 3DWIA 1A50B 5D84A 4AECA 4D97A 1X1QA 3SS9X 1UIMA 1V71A 2WSYB 1K7EB 1V8ZA 2BHTA 1J0BA 4QYSA 3SS7X 3HMKA 3L6RA 3VSDA 5D86A 5B55A 3IQIX 3X43A 1Z7WA 3R0XA 3VC3A 5IWCA 5I7AA 4HT3B 5IXJA 2J9ZB 4D8TA 1J0AA 1RQXA 1K8XB 2CLHB 5I7OA 1O58A 2ECQA 1KL7A 1A5BB 1TTPB 2D1FA 4IL5A 4JBNA 5I7WA 4ZU6X 3FGPA 2TYSB 5HBGA 1TTQB 3AEXA 4HO1X 5I7RA 1D6SA 3L6CA 2Q3CA 1VB3A 5CGQB 2J9YB 4LI3X 3R0ZA 2ISQA 1C29B 2DH5A 4Y6GB 4D9BA 1V7CA 2RH9B 3X44A 3DKIA 2CLIB 5DW3A 1KFCB 2O2EA 4D96A 4L3VA 5DBEX 1UBSB 3PC2A 2BHSA 2TSYB 4D9GA 1J0EA 4L27A 4PCUA 1P5JA 1TYZA 1K8YB 1A5AB 2GN2A 4XUGB 2ZR8A 1VE1A 5I7HA 1WDWB 2C2GA 1E5XA 1VE5A 5DW0A 1Z7YA 3SPXA 2CLEB 4OFXA 1FUYB 2CLKB 2EFYA 4D9CA 5B36A 5KZMB 4HPXB 4D9EA 1UINA 3AEYA 5B53A 4I1YA 4OREX 1K8ZB 4NU8X 4D9IA 5JJCA 4D8UA 2CLOB 5J43A 1WTCA 4LMAA 4LMBA 5CVCA 2J9XB 4ZU1X 1KFJB 5E0KB 5B1IA 2PQMA 1K7XB 2CLMB 2ZSJA 4AIRA 1K7FB 1BEUB 1M54A 4L28A 4D99A 4D9FA 5T6MA 5EY5B 3VSAA 2ECOA 1TDJA 1A5SB 1TZKA 5IW8A 3PR2B 2EGUA 3IQGX 1J0DA 2GN1A 2CLLB
chains in the Genus database with same CATH superfamily
4PN7A 1WHTB 1G5FA 2FCRA 5E1MA 5LUAA 3MS7A 4N18A 3CRMA 4LBYA 2WJHA 3SJAA 1XX6A 3GLUA 4A8JA 2XVZA 2ZTHA 4JP8A 1DCKA 2BW0A 2O1XA 3GJ3A 4Z7NB 1T9KA 4X8OA 3KL2A 3ZQKA 1AQIA 5GAJA 3IL2A 1QF9A 3UQYS 4OEHA 1S8NA 5LXTB 1DOHA 4DDTA 3IHTA 4ZMRA 4OQLA 2JVIA 2Q0XA 5CVTA 3NIGB 2H7XA 4KRYA 2PMBA 1Z35A 2ONZA 1X15A 3LC0A 4DNFA 2EG5A 1I4OA 1OI4A 1THGA 3CZPA 3OT5A 3ZHOA 3V4PB 5LWHA 3GUVA 3PLRA 2GQ0A 2OD9A 1U1CA 1GZHB 2CCJA 3ABOB 3L05A 4ZYXA 5D8DA 2QX7A 2ZITA 1SHLA 3K6SA 1N5IA 3LBAA 1K3TA 2AC7A 4MUFA 5MN6A 3EXEB 4Z9YA 2ZIVB 1KE1A 5E4TA 3E0QA 4WCDA 5JJLA 4PVCA 1R18A 2O14A 5HK8A 1K75A 1OLSA 1T2VA 2YX1A 1NF8A 4MQUA 4RJJA 2B8WA 3DKPA 5B37A 3U6BA 3PC3A 4HFNA 4F8EA 4ERNA 5AW4A 3ZWDA 4CM1A 4ED9A 3WLFA 4S1WA 3WIDA 3RH0A 4CEJB 3ORQA 3MOIA 1SVNA 2HRQA 4M7OA 4E21A 4CEJA 4UM8B 1SEVA 5DCYA 2G0NA 4KR6A 3PNOA 1UIRA 3U3DA 3F3KA 2GETA 3RT1A 1OREA 1U8EA 4QUIA 1MXHA 3WV5A 2REQB 2C4MA 2K2WA 3PS9A 4PQEA 4PN3A 2AKEA 2HV8A 3UMFA 3VZDA 4QU8A 1JWLA 1BE1A 1XDDA 2VPWA 3DD1A 4TRJA 4EFDA 3ITEA 4K2HA 2XHEA 4KQ2A 3OESA 3SJZA 1VL0A 4DVGA 1TTPB 2ZJ0A 1J49A 3HCCA 4JXKA 1N6HA 1WUKS 2ZUVA 3FGPA 3KU4A 3KV1A 3LT4A 3O8DA 2CC2A 2CFIA 2O3JA 5NULA 5TIIA 4P3PA 5AKLA 4HN2A 3WADA 1GPH1 1SELA 3IDSA 2G5CA 3O8QA 5B7GA 3BIXA 3MTBA 3PQ2A 1MB3A 3EDOA 3DE3X 4QARA 4FHEA 5CB6A 3U1BA 2WA1A 3GB9A 4L3VA 5CM8B 3OQNA 3ROZA 2OAP1 2QY6A 1D09A 1KXJA 1AZLA 3PC2A 1OLXB 3B9RA 4HSEA 1AF7A 3STTA 4D45A 5DXJA 4IGIA 4IHJF 1PQYA 4CDGA 1DKNA 3ETEA 5L40A 3AW8A 4FR0A 3L77A 4E03A 4TLAA 4RXTA 1C0EA 1ZNYA 4Z5XA 4J75A 1NXWA 3I1FA 1QR6A 3LDUA 4FE7A 2ST1A 2O7NA 3OBIA 5C8VA 5I7UA 1JH9A 1YIDA 2BUBA 5G3ZA 1NBEA 1GPJA 3COPA 3F5QA 3VTZA 5J43A 2I2FA 1B0ZA 1MDFA 4GI2A 4DOMA 4RPJA 1IJFA 2ADMA 1UWCA 2Q4DA 1JMVA 5CXXA 1TT7A 3AKYA 3RROA 1D7OA 3FY4A 4H6WA 1YJCA 5FLXA 2RCNA 2H08A 4LZNA 3PTAA 4NAUA 4Z1OA 1K88A 5JJBA 4HS4A 5KYKA 1QIKA 5L8VA 3CZMA 2IU6A 1Q57A 4NK5A 2ACVA 4WA7A 4EHFA 2J3LA 2R8PA 3P26A 2Q3DA 2O8NA 4YN3A 4BX9A 2Y3IA 3B9BA 3FJ1A 5KKNB 4RORA 4YP7A 4XIJA 4M8SA 2JBAB 3DAHA 3H18A 2OXIA 1TL7C 4AM8A 2IP1A 3JATA 2GKGA 3TB4A 3L7MA 4R9NA 4J0JA 1PLJA 1BFDA 4NEHB 3D7MA 4JQYA 3L4BA 3IBCA 1TJ3A 3ZU5A 3MJDA 1S2OA 3K8YA 3E9RA 2R0QC 4L8GA 1E60A 4PRZA 1N2SA 2AHOA 2P79A 4G4SO 4RXUA 4UQOA 2OGWA 1IULA 1I7PA 2DU8A 3QBEA 5LPNA 3IEMA 1GU0A 2G63A 4CG2A 1GG8A 1XUOA 2Z5LA 1ACMA 1UBCA 1V8PA 3D3JA 2B98A 2YJ4A 1WVIA 3EGEA 5F3RA 5HRCA 1VRWA 1TM3E 1I8TA 2WJGA 4PNZA 1OLXA 2QORA 4UNPA 4UQLA 2FW8A 3NHAA 1G2PA 2A92A 5JMOA 1FZTA 2BFDA 3TLEA 2XTJA 3QITA 3GLFE 1GQOA 4WNAA 1QYWA 4EY7A 2A35A 2PMWB 1Z6YA 5HZKA 1CVLA 3T06B 5I9LA 4GXTA 4UJ3A 4FFSA 3PC7A 2VCHA 1GRQA 1CR1A 4LX0A 3CH5A 2IHTA 4ZYYA 1PQPA 5KX5A 3FZQA 1DGQA 1T3SA 2ZIXB 3NJ4A 5CBKA 1T15A 2DQYA 3ILXA 3OETA 4ALIA 1RWVA 3MW8A 5JASA 3EQ7A 2EATA 1JG3A 2HIAA 5IARA 3R3VA 3T7CA 3TLKA 4D8YA 1TM1E 1Y8CA 4BWVA 2VQ3A 1Q83A 4G37A 4RK6A 1GV1A 4BWGA 4W1SA 1A9YA 2ODBA 1MRSA 3A6GA 5DNDA 3GGSA 4X1IA 1JJVA 1UAYA 3DPSA 3LLUA 1IWBB 2D3TA 1LLDA 2G4LA 5C3MA 2H63A 5JMTA 1LW6E 4NFYA 4OB8A 4WUTA 5MDHA 1Z28A 3O8NA 2Q6TA 3E8XA 4I9GA 3H42B 5BSUA 3LYHA 3BXOA 2PFSA 3KJQA 2A9KA 2WI8A 4CCYB 2DUNA 2ILTA 3EVNA 3P9KA 4X3OA 3QX9A 4C0SA 3FOFC 3A9CA 4B3JA 1YDMA 1P5JA 4XUGB 5FL7D 4DLWA 5KVSA 1DE0A 2ZRFA 3RRYA 1L7MA 3AG5A 3T1QA 5AUNB 1IHDA 2H8GA 2YFKA 5DOVA 4MA5A 4X6XA 3W5DA 3GLIB 1R8JA 3G79A 3PNKA 1BS9A 1SPXA 2BJWA 5A1TA 1EVZA 3ZGYA 1TD1A 1YL7A 2HIMA 2I55A 4MLZA 3AJRA 2RC5A 4HI0E 5EE9A 5HFAA 3TSWA 1XPUA 5SY6A 5BMVF 1CR6A 4QG3A 3DZDA 5AKKA 4PYIA 3RB8A 3WL4A 1TLFA 1JR6A 3EOZA 1MAHA 2X4IA 2V7UA 3ET4A 1V26A 4IJ5A 1QU3A 5AKEA 1QRSA 2IQIA 3UH1A 3MELA 3KJNA 4UKDA 1FY2A 4HFRA 1JGTA 4OHPA 3CXUA 4RVHA 4EAAA 4EY8A 2VDOB 3ZJ5A 3ZWMA 4WHMA 3KEMA 4OHWA 3AETB 1R66A 1AHPA 1N2GA 1H4QA 2QBYB 5IFLA 1V1RA 4BVEA 1GO2A 5JS1A 3RIMA 2ZIZA 3IKMB 5DXAA 1VE7A 3HE3A 1R5JA 3QYFA 2OYRA 3MUNA 3IV9A 1XMPA 3IT1A 2CL6X 2AD1A 3GAFA 4ZHSA 1GFZA 4PZDA 1PG5A 1EGVB 3ND5A 1UOQA 3F8SA 2FF7A 2WD7A 4INZA 4HZIA 3N8NA 4PRKA 1YCFA 2ZSEA 2FLKA 2HBQA 1H1TA 1NUUA 3OBBA 4G5HA 3RIYA 3LE8A 3NAZA 2J1LA 2HOQA 4U2BA 5DNVA 3VH1A 3IX7A 1ESMA 3LGSA 3C5HA 2J8ZA 1JV2B 2V0NA 2NMVA 1WD7A 1F14A 4MGHA 2C9CA 2NXJA 2FP4A 1KIAA 1UT8A 3V2HA 4H7IA 3O1LA 5AK3A 3EA0A 2EF1A 3PUZA 2CXRA 3QELA 1X7ZB 2RHLA 1XEXA 2VJMA 2OV1A 2RI6A 3DULA 1EA5A 4PLHA 2E0IA 4N3GA 2AFHE 3QVXA 4N39A 3UKOA 1Z5VA 4BB9A 1EDEA 1O77A 5H1YA 3IOMA 1VMEA 4NX2A 5AJTA 3L0CA 3O4JA 1J39A 1W25A 4HATA 4JJIA 3WNQA 5TQJA 2WTEA 2XCTB 4TL8A 1EXDA 2VL7A 3TNFA 1X1BA 1UANA 4G86A 4FFBB 1ZNWA 3PGKA 4M0MA 3ENWA 3H8VA 1QCYA 4KR0A 4QNNA 2IDJA 1TMGE 3MT0A 3CX4A 5DCLA 2BFDB 3K6KA 4U4AA 1JECA 3FOAA 4AWXA 4KTVE 1TX4B 3ZJYA 5C51B 3QU5A 4AROA 4UZEA 3KO8A 2WPDA 1EWKA 4R4JA 1JQEA 2ZWAA 1XXHA 3QVGB 4BVGA 1DC4A 2ZIXA 3Q7TA 1UBSB 1FOEB 2R11A 2BGGA 4J6FA 3ZNPA 2PT7A 3MNFA 3IP7A 1QIIA 3QJGA 4YJ3A 4RK0A 3L04A 1FX1A 3AEUB 3VNAA 2DTDA 3EBOA 2D00A 3PQ6A 1TPZA 1KZ9A 1Y3HA 1HT3A 3F90A 4KLRA 2CDNA 2A9RA 1DIGA 2VTBB 1W4BA 2J9FB 1MP0A 4TLBA 3B6EA 2ZWVA 4QWWA 5CM9C 1A0OA 2W0SA 2V7GA 4PZPA 3BXPA 4K9QA 3G8BA 1FBTA 1ONOA 1UBHS 4OLJA 4TWJA 3I4FA 4YRQA 4B0PA 5DTQA 5HS6A 4ZU1X 3WQQA 4N8SA 4U7PB 3NEPX 4ZRDA 2ZSJA 2JGRA 3HBLA 4ETNA 5D6OA 1Z38A 4C7XA 1KMQA 2ZJ5A 2A4MA 4EB6B 1X0XA 3R76A 4YQYA 1XSEA 1CJBA 1A5SB 2JIMA 5BN5B 3VC1A 3TRFA 1U0SY 4TM7A 5A9RA 4MYCA 4BCCA 1DWUA 2IUFA 3DXXA 2QUKA 4F1JA 4B3DA 2PNJA 3WAGA 1CUZA 4KKXB 1OKKA 3FUXA 4HDSA 4Y2TA 5KNCA 5J2TF 1MC5A 3PI6A 3ZVLA 3I92A 2FLWA 1G8PA 4OHUA 5D00A 1GRCA 1BDMA 2JD1A 2RHTA 4MR8B 2V8BA 2JIZA 3BXEA 3GCGA 4C1NA 3L6BA 4JX8A 3BQMB 2PO5A 5J5VA 5JISA 1JR3D 1PAUA 5CW2A 1N5LA 5DNAA 1HMPA 3SIRA 3GLGE 3A1TA 1B2RA 1EXMA 1J09A 2IHVA 4LI0A 5E9JA 3ZW8A 4B3IA 4RMIA 3IA7A 3EAGA 4NBKA 2CEKA 3WK7A 1I10A 4BNJA 3RSFA 3KKEA 2QKYA 1NE7A 1P9NA 2V7EA 2WMNB 3A4MA 3NM4A 4BO0A 1U7DA 2CJFA 4GOJA 3ROQA 5ADWA 2FN9A 4R2KA 5C8DA 3PKJA 1PF7E 2G08A 4V2UA 5HF8A 1US8A 3C16C 1NYQA 3U4MA 1T6NA 2BF4A 3MK31 1REQA 3TI9A 4MA0A 1STOA 4HVCA 5LJLA 2FSSA 4X63A 1TU3A 5ALIA 3S2IA 3WP0A 2XNDD 3HJAA 2RHCA 3NIDB 4GI3A 4H15A 2JCGA 2HUPA 5DX0A 4CMHA 4R9VA 3AYXB 3B52X 3BHIA 4NE2A 5KDLA 4E5KA 3U3RA 4MJXA 4QDUA 3BGSA 2EW1A 4B0OA 3KYCB 3EXHA 3K53A 3KQMA 1KYXA 5JR3A 1Z4LA 2V5UA 3Q3CA 4Z9AA 3L7OA 3Q3GE 1O4WA 3URMA 4LJLA 1SPBS 1N1EA 5BP7A 3R7AA 2P9CA 5DULA 1YOBA 2ZUDA 4XZ3A 5IANA 3I9JA 1J06A 4UXHA 4LE1A 2CMKA 2W6ID 1VJ5A 3O74A 4NBLA 3VQTA 4YDRA 4P34A 4U7WA 3SYLA 4EY5A 1R0YA 3KIPA 2OKCA 3E82A 1A8PA 3VYWA 4BV9A 3HJRA 9ATCA 1ZVMA 1C4WA 4EL5A 4BXOB 3GFGA 5K0GA 3PICA 4GI5A 3TLGA 3ZQ6A 1FB5A 1KY3A 2XE6A 1JKMA 4U3JA 2ORED 3SC4A 5DYNA 5FULA 1AA9A 2QT9A 4QRHA 3T4XA 2VSOA 3OECA 3ZWKA 3ZXUB 1IOVA 4XOUA 3FYSA 1QUFA 1WW3A 4Y9UA 4K1XA 1UJ5A 3AMVA 2LW7A 3FGNA 3U9LA 3IPLA 4CTNA 3CXRA 3QGMA 4E2ZA 4L57A 5JW6A 2YUTA 3BSFA 4NU8X 4EG3A 1JQ5A 1M0EA 3ROGA 1K92A 4UDNA 2OO5C 4J0IA 3AM3A 1RBMA 2G0TA 1T3ZA 2CFOA 2CL7X 2I4MA 4DV5B 3V1TC 4MS4B 2PANA 2BEWB 3FZNA 3OFSA 4OJNA 3X2SA 2WF6A 1LVGA 5TE9A 1SY7A 5JY1A 4GDFA 2ZI9A 3ZJUA 3D02A 4OB7A 4RVFA 1GYRA 1BTOA 1TYDE 1CUBA 4OXRA 2JCYA 4QXOA 1M2EA 1K7CA 2XWBF 4LWZA 4Q37A 4YRCA 1JRLA 5EIHA 3JQFC 4TMXA 3OIUA 5DSZA 6PFKA 1WPQA 3DJFA 2IZOA 3CH7A 4ML3A 3HCPA 3N0WA 3G8YA 3JQ8A 1YRHA 2A88A 5KINB 3TKYA 1KMHA 1I3NA 2JZOA 4FBGA 5GJBA 2QTCA 1HGXA 3P2KA 4Q12A 1TA9A 1UPCA 2IPNA 3AZQA 3L7YA 3Q9UA 5DNEA 2A3RA 2DR3A 5IVPA 1QH0A 3PWKA 4U2FA 1HYQA 2C94A 3A25A 1GL7A 1QSGA 3AB3A 1EHCA 1AK2A 3FROA 2ZIGA 2HH9A 1WCV1 1PKXA 1HG1A 2ABWA 1QANA 3CZ4A 3MJSA 1A69A 3FMGA 1C1DB 4DJTA 2VEDA 3DLBA 1RJEA 2D0OB 2I6FA 4V3BA 2AW5A 4PSKA 1JLMA 2Q1TA 4G0OA 4ZVRA 3WRXA 1N32B 3PEEA 1NVTA 1JR3A 1XLTA 3FTEA 2QZJA 1A7JA 4HQ6A 4IKPA 1J6UA 4J2TA 1IIRA 4LVUA 5AR1A 3AR3A 1AB5A 3UAYA 1OBFO 2NPFA 2CDBA 1O54A 5B5SA 1UH5A 3HPRA 1XDUA 4TTQA 1Q7EA 5K6AC 1J8YF 1DWOA 3N39C 3G49A 3CUEF 4RNCA 5ES3A 4EUNA 4F2HA 3JZAA 4LYEA 1E8DA 2ANBA 4JK3A 3QKUA 3KPWA 5CP8A 5FUWA 4F06A 5LZ4A 3OAAD 1X1SA 4LYHA 3HR4A 3DD5A 5ECYA 2FUNB 2YHIB 1U3WA 1KF0A 2BONA 3GL9A 1KL7A 1RP7A 1Y1RA 1AC5A 2OVFA 2W5UA 2ZTMA 5AWFC 4BGUA 1C3OB 3ZCQA 1NYRA 2QL6A 3IVGA 3NPAA 2RGGA 4UTVA 3MWLA 2PUAA 4MUXA 1UAAA 2ZTUA 4QAQA 1NJFA 2QX8A 3PUHA 1QE5A 1NJ8A 4M9QA 5EGNA 4IDEA 1FFSA 4JYCA 1LC3A 3UUFA 4D96A 4QVGA 1YWGO 2IEDA 4CLDA 4DCSA 3JSXA 3PQCA 2Q7DA 1SAYA 4FM9A 4U1RA 4DDMA 1U7TA 1ZWLA 4FN5A 2B1RA 4HZUA 3WIEA 1W5EA 1N6KA 1MGOA 1VE1A 2G7MC 3UGTA 3R8CA 1RHUA 5JPIA 4HDAA 3D8HA 2IH4A 2D3WA 4D02A 2W93A 2XTAA 3AI2A 4QPCA 5ADUS 2D7JA 2ZI5A 3EPKA 2ZJYA 3LVFO 2W6QA 4BYGA 4GWKA 2WIKA 4K46A 4NZZA 4DR2B 2N42A 3FGZA 4DILA 2BGKA 4KITB 2QXUA 2O07A 4GT1A 4YMWA 2J09A 4AXBA 4DLBA 4ZHQA 2ASVA 4PANA 2HT6A 4W1RA 5JZOA 1YZVA 1UQTA 2HCTA 1GU1A 2I99A 3EODA 4O8ZA 3HG7A 3C3EA 4KW7A 5C37A 1XVIA 5HKOA 4QATA 4ATNA 3AR9A 1EFAA 1CR0A 1P75A 2FQXA 3T94A 1HG0A 1LH0A 1KDOA 2I5PO 4IJ6A 5DK6A 3TAXA 4URFA 1VL5A 2V54A 2VP5A 3I37X 1LQ2A 1S4QA 2BI4A 2V1UA 3L0YA 1YA4A 3COZA 3O38A 1ODIA 4HTFB 1DAOA 1RI2A 5LZ5A 3W34A 4DE5A 4DV6B 5FAKA 3ME5A 1HDCA 4TLCA 1GQQA 1XD2A 5BWBA 3PP8A 1Z34A 3WJAA 1IBSA 1QX3A 2HB6A 1QYCA 1SU8A 3QLVA 2ZSIA 3AR2A 4YCCA 1ZFNA 4D1YA 2Q5OA 4CM4B 2O52A 2Q3BA 3PGMA 5BMVA 3SQWA 3OPYB 5AIAA 1HLPA 4DLKA 3ZDDA 1E2FA 3E2PA 3GFRA 3IAFA 2VJAA 3DDNA 4H0CA 3S68A 1QAMA 3E58A 3HADA 5BT9A 4DCNA 1N1MA 2GB4A 1TKBA 3NGLA 4JXJA 4QM6A 2BSAA 2RARA 1S6YA 1QGED 1K6EA 4G07A 2QW0X 1OASA 4M88A 5KBYA 2LWIA 2ZJ4A 3OJCA 2A67A 3LX5A 2XYRA 3DGEC 2XDWA 4NKRA 2OZVA 1PFUA 4DQDA 5AVTA 3VR5A 1VA5A 3TSCA 5I45A 2C3UA 3E3AA 4IIYA 4REQB 5D3QA 4HNQA 1SUSA 1L4GA 3IFSA 4KVAA 5JYEA 3EPHA 1E58A 3TMKA 1HV8A 3KSUA 1GUBA 2BIFA 2GEDA 2K4MA 3GDGA 3C4QA 1RTKA 1OSNA 3D7LA 1V71A 3EMDA 3LKZA 4P4SB 4IUCS 4QUJA 1XKLA 4V1CA 3C8ZA 3EZYA 3HMKA 4PAQA 5AM4A 3RSHA 3OZCA 4JYBA 3ZWAA 1Y3AA 4K9MA 2I4IA 5KYYB 2X23A 1U2PA 5AXDA 2EFEB 1M34A 4BN5A 5CDUA 2PPLA 5KWJA 2ZUUA 4R1SA 5ENVA 1XRPA 2EARA 3M9WA 1H0KA 4WDQA 1OJ7A 3NT5A 1VG0B 4PGMA 1X2BA 2V65A 2ZTVA 3BWBA 3ND9A 3L43A 5EP2A 4JI3B 4BJ5A 4YT4A 4NENA 2FZ4A 2O7VA 4RV4A 2FPKA 2PYDA 4TPKA 4LRUA 4DQKA 1SVMA 4P80A 3V97A 3A28A 1QLHA 3ER9A 4IIGA 3IIKA 5EQJB 5KTNA 3X0DA 4UU8A 2NYUA 1N0IA 1YI8A 2ORIA 3FCUB 3TBKA 3THSA 3SD7A 3WIOA 4B3MB 3MUEA 3OZSA 4DCPA 1DBWA 4HQOA 2XUDA 3FUUA 3HLTA 4QEZA 3UNXA 2IYPA 5AVWA 1V3TA 1UDWA 3R4VA 4WZBB 1OB2A 4FIDA 4XUCA 4U6NA 3IEIA 2WFAA 5AI4A 2J9RA 5HMLA 3UC5A 3O90A 2WKQA 3NTXA 4JMLA 1MO3A 3ZY6A 3OE7D 3OM9A 1DO2A 2AXPA 3C87A 3VI4B 3Q6NA 1XDSA 2WFMA 1LTQA 4YP9A 1ODSA 2HWYA 5B3JA 1JAHA 4FR5A 2Q2VA 1E2LA 5FF9A 3A3PA 3ZQJA 2K6GA 3V33A 4A0QA 2VDVE 3WNCA 4F85A 1BYIA 1QH1B 3RTCA 5THKA 1OH8A 1NXTA 5HKAA 3NX4A 3C3MA 3LM8A 2BM9A 2DWUA 1P4AA 2ZQZA 2Z30A 3D5TA 2J6HA 2G07A 4C0WA 1BDIA 4L6CA 4ZD6A 1YE3A 3F49S 4QL3A 3P94A 5HKLA 3G0IA 3TXXA 1YMQA 4BBAA 3EGXA 1Y8RB 1NWHA 4D80A 4DNQA 4EEXA 1G16A 1E8MA 1O6GA 1ZM9A 3PYMA 4U7HA 3ZUPA 5B3JC 1GQFA 1ZPDA 3NWPA 1A8HA 2PTHA 2VAMA 2ZBQA 3HU3A 2MINB 3LL7A 2X7HA 4FILA 1YT5A 1DIAA 4GVXA 3PJFA 4DLVA 3O7MA 4ILEA 4ZRNA 1T3LA 4WBNA 2PA3A 3EGIA 3L4BC 5JCJD 1K68A 5MN5A 5BMOA 1GYPA 4BQRA 1IUOA 3NFYA 2C8JA 1F2DA 5T7BA 2WPNA 2Z3ZA 3M6VA 5KX5F 1RT9A 2PT5A 2R7NA 4NSNA 2FDRA 1BN7A 3GUZA 1IHOA 2C9ZA 1H8HA 1LTKA 1Y3FE 3CSUA 3GRPA 3R3ZA 1Y9JA 1GPLA 4M0CA 3QMVA 1QDLB 5FLEX 3D0KA 4F91B 1LS6A 2OM6A 2R4TA 1SKYB 3NVMB 2BV3A 1UT5A 1XDZA 1Y42X 1E7MA 4FFPA 1GITA 1SC1A 4FNAA 4WVFA 1MQSA 2HSGA 4HRXA 5BN4B 2AMFA 1EAYA 3FIJA 2ZYTX 3MCUA 2PZMA 3H84A 3O2SB 2PLNA 4NV3A 1BKYA 4QREA 2I9PA 3GJTA 5K8JB 4KU4A 2AUTA 3BWYA 3ZG6A 1PWHA 1XMIA 5D7NA 2YDXA 3RIXA 3RHTA 3U3MA 1F48A 1PVDA 1C9DB 4NK4A 5ERYA 1XNQB 1GGFA 3CRNA 4MWBA 1ZJWA 2FCAA 2ADFA 3LXRA 2BMJA 1XJCA 4W63A 2WUGA 4I4TA 4TLLB 2XF8A 1CD5A 1T10A 3SXUB 1DIHA 1T26A 1EFCA 1PR2A 1TCAA 1ZIDA 5JTUA 3HVIA 3UJCA 3K96A 2D2XA 2C58A 2ZSFA 3RYFA 3R0XA 3ODGA 3BT7A 3A6PC 1L5MA 4J0HA 4GSLA 3EVCA 2JFUA 1YR6A 2Q6VA 3E5HA 3SFVA 3K2BA 4KQMA 1TKAA 2ORVA 2R7LA 1JQJC 5J4VA 4FOLA 2BFOA 2IW1A 2XSZD 4GR9A 5TX7A 5BYKA 1WSAA 2X9QA 5DYIA 3DR3A 1F7VA 4HMPA 1CBUA 5CD9A 1JKFA 4HXGA 3KPVA 2VP0A 4KGXA 4KWCA 1E7SA 3D64A 1GZ3A 1J22A 3NBQA 4ZALA 4EYQA 3EUAA 4ZK6A 1PRYA 2ATIA 1C80A 4Q02A 2IBMA 3FVVA 1NURA 1VI5A 1PJRA 1UBRS 2H1IA 2XEXA 2QA5A 1FQKA 1RRMA 2HK8A 3OFJA 4I3HA 4DA9A 4RLFA 4CKCB 1LLQA 3KWFA 3DZIA 4QPNA 3UW3A 2Q0SA 3CZ9A 2I71A 1GNVA 4NATA 4RL4A 3IHKA 3KDSE 3IAS1 5HXAA 2CFSA 2Q50A 1IY9A 3O2QB 3BGDA 1YL5A 4PICA 1S0UA 4FFBA 1UEXC 1W73A 3QXGA 4FJ0A 4FWBA 4N9QA 2FUG6 3KQSA 1C3XA 4WXRA 4TSKA 1JDBB 1DC7A 4NV0A 1N36B 4GD3Q 1NBMD 1YACA 2ZYUX 5FA6A 4US2R 2XLCA 3TD9A 3TW8B 3O2JA 3ZI0A 1YR2A 3WWEA 4LC9A 2BHNA 3HJNA 4PC7A 1DG9A 5LQUA 2OZPA 3OQJA 1Z6XA 1DC8A 4E2WA 3FI9A 3SEFA 1JPVA 1BEUB 1K7FB 5ENDA 2IHUA 2HQSA 4ZVNA 1NVMB 3ITNA 3RJTA 5KTPA 2CZQA 4HGNA 5K45A 3B60A 3O8OA 2GKSA 5FKJA 3LL4A 1AO3A 3SC6A 3DTNA 4R6WA 5K9ZA 4CMEC 1F9EA 1ZR2A 1RKBA 2GD2A 2FG6C 1GPYA 3DEHA 3I5MA 1FTYA 3AKDA 3IQZA 1QYXA 1G64A 1TM7E 4G1MB 3E3MA 3L7BA 3NANA 4RH1A 2FPXA 4BYMA 3DVQX 1XRMA 2VLIA 3LQYA 3VR4D 4LJ8A 4N8DA 1WXFA 3TRIA 4EPXA 1PK9A 4IJQA 4LV5B 1YNOA 4YDSA 1GKKA 1G3IA 3ELUA 4JVMA 3VKGA 3P9SA 2ZSAA 1RVDA 4CQMA 3T99A 5DTMA 1RWPA 4GKAA 4FX5A 3TIVA 4PYLA 1L4BA 4MUEA 2PE5A 3CZRA 3IMFA 3HB9A 4UNRA 1YS9A 4QTTB 3VR5H 1Q3TA 4JSRA 1AQ6A 1SU4A 2QL9A 2MSEB 2QNIA 4HDNB 4RTOA 4V2IA 2P8SA 4LZZA 5B6PA 4HAOA 4NFSA 4ZCSA 4BNZA 3S44A 2Z98A 3AVPA 2X8JB 3LX8A 3UAGA 1CDEA 4UVDA 4CGZA 5F23A 1HSOA 2EEPA 1E18A 5FHQA 2J45A 4YCSA 3SZGA 4KN8A 3OTHA 5IUKC 1U8AA 3N2KB 4AS1A 4H08A 2PSEA 3DBRA 4NULA 4I0WB 4ZT2A 1UODA 1VDZA 2QTMA 4AJIA 2R8EA 2X58A 1BFUA 4GNKA 5EQTA 1XRRA 2M6KA 1UIMA 1TXGA 4QUAA 4CNBA 3T0FA 2OFOA 4Z4HA 2GWRA 1Z7BA 3DTTA 3HL0A 4PTLA 3FRIA 4OO3A 1NLFA 5EZYA 1L5SA 5F3DA 1JW9B 1PJ8A 3RWMB 1W4AA 4HQKA 1AUXA 2EJCA 3R6DA 3CUVA 2WV7A 5E1BA 5FX2A 2NO6A 4HXEB 4A6EA 2OB2A 2ON6A 1Z74A 2UZIR 4TMTA 5DWDA 5LU8A 2ERCA 2X5KO 3VO9A 1YASA 2NSJA 2UYHA 2UVQA 1Z3IX 2EQBA 3DFUA 3W4IA 4BKOA 1L6IA 4JOQA 1SXQA 4WEQA 5TT0A 2GESA 3KLNA 1SWWA 1L7BA 4QULA 1NAHA 3CW8X 1O96B 1UR5A 5CA0A 3ZKWA 3AXTA 3BJRA 3HGQA 4ECEA 4EF5A 1T9BA 4RKYA 2Z2KA 2XADA 3P5BA 1TYCA 3O91A 1MR3F 1XPJA 4ZT5A 4B7AA 4OX9Y 3HR7A 4HRYA 4FYXA 3Q8KA 4Q21A 2W8BA 4KAAA 2MCFA 1XK6A 2HI0A 4F2WA 5BWLA 4HAIA 1U4OA 2CT8A 1ZHHA 2EWMA 2YIVX 1G7RA 1GNTA 3B1VA 3B1JA 1L3IA 4IMIB 2JJ8A 4Q1VA 1VRVA 5C1OA 5JEDA 5ITSA 4BO1A 4JROA 1H9BA 5L4SA 1DC3A 1CYDA 1Z0IA 2LCIA 3QKWA 4I08A 1SVOA 3QP9A 5GZ6A 4D4HA 5J5AA 3STYA 1G60A 3GRRA 1KMHB 3LUAA 4I1YA 4EVIA 4OJKA 1PR9A 4HB3A 4YRJA 2MR6A 4KMRA 1J5EB 3H5OA 4BCBA 1DT5A 1TK2A 3EXG2 3GDOA 3IMEA 3J7TA 4NCXA 3OM0A 3BS4A 4RV5A 3VZRA 3HBMA 1I0ZA 4M0PA 4G2TA 5BSGA 3R74A 3CF0A 5CITA 5A06A 2QWXA 2W22A 1TADA 5IJ9A 1OLUB 2VHCA 4PO8A 4FDLA 1G18A 1BGWA 1TOAA 1D04A 1Q19A 5HCNA 3TCKA 2R6GA 4BPRA 5AHWA 3JR7A 4P83A 5LQJA 5EKXA 3LNCA 2W7TA 1HTTA 2XMGA 5T5QA 3RRNA 3PNLA 4F96A 2KLBA 1E6CA 4N3AA 2CV0A 2V6FA 1R3UA 1OV6A 2J5KA 3F1LA 3R44A 4ZVLA 1V9SA 1YBHA 5ECWA 3RNOA 5A4JA 4GVLA 3ZC3A 3JR3A 4GC9A 5JY6A 2YVLA 1AMNA 1Z13A 1D2AA 1SVSA 3E1KA 2Y9MB 2IZ1A 3A3KA 4LOIA 4N5IX 2ONCA 4RD0A 4OMFG 1UBGA 2HA0A 4WEOA 2C54A 1DHRA 3C1AA 2JLBA 5IBCA 1AHIA 1U3TA 2ZRLA 3LSYA 3TO5A 4AX4A 1U90A 3CUYA 5A4MS 5EI5A 4NCAA 1N2HA 4F6CA 5CCEA 3GBSA 2EIXA 4HJRA 2VR1A 5DTJA 3QVUA 4PPFA 1N4DA 4OI1A 5HE9A 4OY3A 3EQZA 1JHQA 4I14A 4IY1A 2XUJA 3HDTA 3P2JA 5B1EA 3ZK9A 2AX3A 4X92A 1JDBC 3HV0A 3IXMA 2B94A 2NZ2A 4IOMA 4O4IF 4D0LB 4A7PA 4EW3A 2NO1A 2VTBA 1N5DA 4HJXA 3SEZA 5JSUA 5D2CA 1TECE 5JPCA 5C81A 3L4JA 1O6FA 1V96A 1DBQA 4UVIA 3EXHC 5DBHX 3U1TA 1BCRB 5C4MA 3HCWA 1A1SA 1M5RA 3QVWA 4XW2A 2CUNA 3DR5A 4GOOD 2HSEA 4QT4A 4B46A 5IJ0A 2JLYA 2GGSA 3CNBA 4FK8A 3C14C 2C2HA 5CNJA 3OEHD 5D3MA 2HA6A 2WYUA 4MCAA 2APJA 4CKWA 5CD1A 2VK4A 2A1TS 4HEA1 1F6WA 1R6AA 3KQHA 3QWAA 2WQ7A 1WCXA 2HWWA 3OT1A 3U4HA 3UHOA 5CLJA 1RHQA 2AW3A 4EI2A 5EUCA 5F7OA 3PDCA 4HB4A 4KLCA 1W9MA 3BWCA 1DHTA 3ZU4A 1YB4A 2I6XA 5FBRB 3ZWWA 3UBTA 1TLTA 2HT1A 2YS6A 3LY8A 4OSPA 3PD0A 3ROPA 2QTWB 2QB5A 1TJ5A 1M83A 1U5CA 3SQNA 3QHPA 4Q7EA 4AZSA 1NMSA 2E4UA 3ONNA 4M1ZA 2QI9F 1IM5A 1P74A 5IC5A 4W6ZA 2QRPA 1COWD 1ELOA 4NOJA 4WOBA 1EX1A 1KP9A 2WSLA 4LQLA 1JYFA 4CODB 5EQDA 3SAJA 4EJ0A 5H68A 1Q1EA 4RANA 2YQ5A 5DYTA 3OZFA 1HDGO 5HQTA 4XEUA 4ANFA 1H65A 1ULTA 1P45A 3RUFA 1YI1A 3BXZA 3QPBA 3GRVA 2BF7A 3KHUA 4YCDA 2GARA 1PT5A 3NNSA 4LGVA 4LF7B 1VOTA 1Z7YA 2PGOA 4PVDA 1N6PA 4HAUA 3DOOA 3I1IA 3MQFA 4F72A 4HK4A 4Y2VA 2DWQA 1IFXA 3U7QB 4B6RA 5AXBA 2MSLA 1GCOA 2IOYA 1L9KA 3UJNA 4IYRA 1A4XA 3QVJA 5JCOA 1RQ2A 2HN9A 4MYHA 4PR3A 2C5LA 3VNQA 4FLMA 4RK5A 4CKXA 4M7RA 4J7CA 5FOWA 3LUPA 1DCMA 1SC9A 1WA5A 2QAIA 2P4SA 2GERA 2EFDB 3HFGA 2BM1A 4ZYVA 4MKGA 1AQNA 2VJLA 3WIUA 4N6NA 3EFOB 3OZWA 3P9ZA 3S1AA 3ZK7A 4I1PA 3FUTA 5FBWB 3PHLA 3MRVA 4ZQCB 2GPSA 2C82A 1ZK1A 4IIEA 2ID4A 2GUWA 4V02A 1Y9DA 2A9JA 2V4UA 2V3WA 4XSVA 3FBWA 1OWMA 3HZOA 2D4HA 3NP9A 1WDTA 5SV2A 5LZ2A 2NLOA 2HCRA 1Z2EA 2QM8A 3P0HA 3R3YA 1Z6GA 2GT1A 4B3SB 3OP4A 4I4NA 3GZNA 1E1DA 1FFHA 2JARA 3EARA 4GYYA 1KJ9A 4M8KA 5IM4A 1SC4A 4IQ0A 3BK1A 3RVJA 1YU9A 3L8MA 1V43A 2O2HA 2QD2A 1M34B 2JIDA 3CG4A 3IUNA 4KUEA 3OFND 1JDTA 4D9MA 1AN9A 3WRYC 2UUOA 4O2AF 3ZD9A 3TTXA 1YTLA 3OPXA 3EVEA 5TXGA 4N0MA 2GAFA 3H75A 3SC2A 3E03A 1RAHA 3MWDB 4F8JA 5CFLA 4WLUA 5K1ZA 1F8GA 1LF0A 1L5WA 3GLQA 3RTGA 5DXFA 1N8KA 2O54A 2Q27A 1I2AA 1VIYA 2WV9A 1Z88A 4MULA 3ZI4A 4DRXA 5G0TA 3EEQA 1OH5A 2WIJA 3EHDA 4YRNA 5BW8A 2NGRA 1U0JA 3BBPA 3NBYC 1XJ5A 4ID3A 4LYJA 5EG5A 5LNK1 4ZT4A 3FWYA 3GWGA 4NQZA 4EHKA 1DCFA 4KXVA 3IP1A 1XP5A 2CVOA 1FFDA 1ZI8A 3RVNA 3E61A 5JAZA 4XB2A 1QFSA 3OPYA 1U94A 2C5FA 2FEOA 2OAGA 1VXOA 2EFHB 3E53A 3RSSA 3PIRA 4IX9A 5EJIA 1WZ2A 2FMHA 4DM3A 1QKJA 2FX3A 1POWA 3NOXA 2QMYA 2TS1A 1EVIA 1HKHA 2I67A 3KD3A 1E9BA 1DRJA 1XN4A 3WLAA 3OQIB 3H3JA 3DSRA 1L5LA 1CXZA 3M9LA 3G85A 5CGQB 3HYLA 4RLHA 4TUYB 3ZZNA 4K05A 3D6UA 3EDRA 2YCLA 5DIZA 4FSDA 3CE6A 4B44A 2BKVA 2HRRA 2JNWA 2RIRA 5IABA 3KFVA 1SRQA 4H3VA 1RU3A 1UBTS 4GLJA 3IP6A 1AS3A 2EF0A 4DCMA 1AKTA 3MCWA 1ESNA 4XDYA 1V5FA 4HBGA 5DLEA 3RF6A 1FDVA 1AE1A 3RVSA 5IKMA 2IEBA 2C9BA 4MMZB 1DJQA 4NCJA 1Q0LA 2CXOA 4K9PA 4DEXA 2IS1A 4LDQA 1KI1A 4RSGA 4PYJA 3TQHA 1HDIA 3DKVA 3H9CA 3D43A 3CF6R 1NXOA 1WNFA 5LCXA 3DLCA 3TYXA 2GPJA 4QO8A 2C5GA 4DLXA 3SLRA 3JYNA 1ONSA 2JHGA 2VDWA 4MTLA 5IT5A 3FPSA 1JSXA 1QV9A 2B7BA 1GV0A 2R79A 3IDFA 2YN2A 3OEEA 2PGIA 3WGYA 4LV8B 4PZ9A 2VRWA 4AWAA 1SUBA 4BJHB 1FU4A 4D9FA 4EHJA 1Z2PX 1FYEA 1IRIA 1AQUA 1AF4A 1SKAA 1FXUA 4UM5A 5BSRA 1PD1A 4C6TA 4JBGA 4QU5A 5CEJA 5DF1A 4DR4B 5K0CA 3AHDA 5DX1A 1I5RA 2VXOA 3ODPA 4GGOA 4TMKA 3VVCA 1YQUA 4QDJA 2X6TA 2X0DA 3RCBA 3JALA 1OD6A 2XPCA 2ZI4A 1N1DA 2QP9X 2FW7A 3WVNA 4JU9A 2IYLD 2JJQA 3GJZA 4II7A 3K9BA 1DBSA 1YUBA 1TC1A 3PUJA 1QE3A 2AOVA 1AKVA 3OHMA 2J67A 4RD4A 3FKQA 2ZROA 3IPRA 2WSSD 3Q5DA 1W5BA 2QUBA 2XUFA 4FOOA 4LNUB 4MAMA 2J0SA 1E2IA 3DF7A 4X66B 1G4UR 1B3RA 3SJUA 3F9RA 4JC5A 2W6CX 3U0VA 2IYRA 2ECFA 2PCJA 7AT1A 1I13A 2OUIA 1U9YA 2WU8A 3MSXA 2JC3A 4EG1A 4DSOA 5KOIA 2QRZA 4I5EA 3WFJA 3I76A 4ZT6A 4Z54A 2H2FA 2NZ8A 3MGCA 1LRKA 2F00A 4IF4A 5FI1B 2GSWA 1KYVA 4MP3A 2E2WA 2GA9A 2XECA 1HSZA 1G8AA 2TMKA 1AK9A 1FLVA 2MIIA 4L8YA 2QV0A 2RSLA 3GFBA 3N0XA 5C4GB 3TPCA 4AFNA 4C7BA 1ZUNA 3C8DA 2C2MA 2A1UB 1JG1A 5JNTA 2EG9A 4WKGA 1E1CA 1HE3A 3R4CA 3ZKAA 1WDLA 4BU1A 1YTUA 3NM6B 1E1CB 1BKDR 3PITA 2WJJA 3K4HA 1L7QA 2FMFA 4PWYA 5JWOA 4QXQA 3CN7A 2IJGX 4TTIA 3LHSA 1QHGA 5DT9A 1C7FA 4OOEA 2QYTA 1IOWA 3GVXA 2FRDC 5K6AA 4BFUA 4D43A 4YHBA 1R9NA 3QMPA 3BKWA 1ACLA 1M1YB 2NUAA 3F8TA 4RENA 5KJEA 5L4NA 5LDGA 1T1IA 4F46A 1CY2A 4RTPA 2GCGA 2H2AA 5AFSA 1ABFA 3DBOB 4CXMA 1TMKA 3OUUA 1C3VA 1I6WA 1CS4C 3W2EA 1NFFA 1ZGHA 1DVRA 2ZRDA 3C97A 1OZ0A 1QGDA 4RS4A 5HKKA 1Y7PA 2Z6VA 3ZWOA 1HZZC 3PXXA 1QYDA 2QVLA 3UUWA 1WR8A 3ECAA 3KUXA 4KYTA 5D5QA 1PJ2A 3ZHCA 1PDVA 1KK0A 4B35A 4EI9A 1G3UA 1SB9A 1FYFA 3WL5A 5CDSA 3I9OA 5GJVC 2YMLA 1PEKE 3K70B 3QKRA 1Y6ZA 1TIBA 2HWKA 3ZX5A 1E4OA 3K0FB 5F2EA 2F67A 4O4JF 4FOTA 3RJMA 1P33A 5EIWA 1JALA 2AR9A 2FPUA 2GDZA 3DYBA 1JAIA 1K8ZB 3DYVA 3GUHA 4IZHA 4RA6B 3WLEA 1VE3A 2AVNA 3N1UA 2B0CA 4RA6A 4QQKA 4FKMA 3ELWA 2C07A 5LDHA 3JQGA 4MI6A 2XGJA 1W0KD 2OORC 3NUGA 4QX6A 4RX1A 5H5JA 1GGVA 4YMGA 4S35A 5JJ5A 1ECLA 2ERXA 2A0YA 3QPAA 2L19A 5ECGC 3I23A 4KQCA 1E4EB 5CAEA 1L5YA 5I7VA 1OMOA 3CLSD 3VSAA 2PEYA 3AVOA 4BQFA 1XJ0A 5T41A 3GGGA 4XR4A 2VP4A 4E5YA 3TWOA 2C31A 1C41A 1RRCA 2FKAA 2QW1A 1UP7A 4LJ4A 4XKJA 4K9KA 4H35A 3HXQA 1UMCA 2EHJA 5LFAA 1IVYA 3MCZA 1J8MF 1SJ9A 3HDGA 4MPRA 2I4RA 1FDOA 2VPQA 2WWIA 1T2DA 3DXYA 3THOA 1ZGZA 2WOJA 1FP4B 4FONA 4NS4A 2JIQA 1BWPA 2QNBA 2H6EA 4NC9A 2F1JA 3D2BA 2RHDA 4DA4A 4Z9FA 2IPLA 3R8FA 2NAPA 1QZXA 3BHJA 3Q4GA 2W4QA 1PJZA 2J0EA 1FX0A 2H06A 4WLOA 1UPAA 3RODA 4Q19A 1HR0B 3GVCA 3GAAA 4YJ2B 2O06A 3IT3A 1MABA 1NBHA 5ALVA 5AVZA 1NBMA 3FPGA 4JEHA 4Q0MA 3NTOA 5LP6C 5T4FA 3PQ4A 3PFKA 1QQBA 5KJCA 1W0KA 3OZEA 1NP7A 4NVRA 3CEPB 4CF4A 1FSSA 2XNCA 1XA4A 4JSTA 4QGBA 4XIGS 4HNAA 4KXFB 4OHVA 3D3WB 3VPAA 4TTAA 2PUEA 3IE1A 1ZN2A 4Q4HB 4V1CI 1CYEA 5C5DA 5ERXA 4QJ3A 1NQ5A 1WCIB 4NOMA 1SZJG 3TJZA 4OP2A 1ABEA 3SYRA 1VA4A 1E6MA 1GT91 5AJWA 2R65A 5EXDA 1XIVA 2YWHA 3C5EA 1K89A 4UM9D 1F8YA 1HKUA 4NCNA 3IB6A 2CLFB 4LRQA 2DR0A 4FPXA 5IVHA 4ZC8A 4FB5A 2IEAA 2V97A 4C78A 1HT2E 4UOEA 4QPZA 5BVGA 3KQKA 3BXGA 1FW6A 1THMA 4DNPA 1V8ZA 3ETHA 3SFZA 1NN5A 3L0PA 4X1IB 1E96A 1GUYA 2XOKD 4Y1GA 2HMSA 3A9TA 1Z7WA 1U0OC 2P5YA 2QHXA 1F12A 1JWAB 2X14A 4HVTA 4LSWA 4LZLA 1HDXA 3OP1A 3W6NA 4BHTA 3FOEC 3LT2A 1L0BA 5B58C 2BPOA 4YJDA 1RI4A 2HRZA 2QSUA 4YASA 3BA6A 3F4BA 3IP3A 2AI1A 2VSFA 3H9GA 5L3QB 3IVRA 4L9RA 1NZJA 2XD4A 3KOXA 3NWOA 4Q9AA 4BNVA 5FNVA 2UXCB 1ADJA 3QELB 4MHSA 2O4CA 1YFZA 1OBCA 2ZI6A 1UOPA 4X20A 1CY4A 4ICIA 2OZKA 4PM4A 1LGYA 2D5CA 3Q3IA 1QJ4A 2IYZA 1BROA 1BXGB 4FYIA 4Q3EA 2BFFA 4OM7A 4XXHA 4E7PA 1GAXA 1VFNA 1ISSA 2V0GA 1DBRA 1Z26A 4IGKA 3I04M 4ESHA 5A5VA 4YJFA 1O0SA 4C4RA 3QM1A 4CF6A 2PJUA 2V7PA 1YGYA 4BECA 2XCSB 3ZCTA 1W4LA 3MTAA 2WWVD 3TOSA 4BNTA 1MB0A 1PFVA 1P2GA 5EWLA 2P69A 5TT1A 2GM4A 2D0DA 2C1ZA 2OCKA 4OMCA 3ONFA 2B4YA 2OCBA 4L73A 3B9PA 2VHJA 4N5LA 1U11A 3KOOA 1Z0DA 3KKPA 1WSDA 4LE0A 5DHFA 5A2GA 1EFVB 4HRAA 2H11A 1FFCA 1G9XA 4DIKA 2PUDA 2Z6AA 2EKLA 1E2NA 2WTNA 1IJEA 4YROA 4NG5A 1FTWA 3EJ6A 1NW6A 4AJLA 2JDIA 2CLMB 3UEOA 3R7FA 1FZQA 2GJAA 1OI2A 5CU7A 3IEXA 3VR0A 5T6MA 4RO0A 3NP7A 2F4VB 4A0HA 1WMAA 1GSHA 2PTGA 4I1RA 4J1TA 4WSOA 1E1MA 5LXTF 3SXUA 5GVSA 1PQUA 1XYYA 4R3NA 2EC5A 2BTOA 2H7YA 3BMOA 2VLBA 2VJCA 4O2BA 3ABZA 1MV5A 1QFXA 5C52B 4DLTA 2I1LA 1W4CA 3WISA 2E82A 4QUGA 4HP8A 3RVDA 4MXDA 4X64B 2FSPA 1PKEA 4PCVA 3M89A 2WUFA 4EELA 3MTQA 2ZSHA 2DBQA 2A14A 3EZLA 2AL7A 1ZC4A 4J0EA 5GMOA 2D1SA 1GGEA 3Q9LA 3IAUA 1P91A 3A1DA 4Q3AA 4YCJA 2C2YA 4B6QA 4E11A 1C3LA 4OHMA 4UE6A 1L8LA 1QWSA 2R48A 3FDZA 2NSLA 4IR7A 2RH8A 4AJEA 1UMBB 2Y1EA 4WOJA 1IN4A 3IAS6 5KHOC 3GO4A 4EM6A 3GGOA 2O5EA 5AI5A 2W71A 3OCCA 3MWEA 3TLXA 3U44B 3MJVA 5KVAA 2Z43A 1FP4A 2O50A 2IZ7A 2ZBRA 3JQDA 2EFCB 1DU4A 4OLFA 4G67A 4JMPA 4MZDA 1YR8A 1RI3A 2B5VA 3GT3A 2IU0A 2HW8A 5LYJB 4UDXX 5K0NA 1AKEA 4TN5A 4WZAA 2YV2A 4PR0A 4CMBA 4R2XA 3Q7IA 5MHTA 1C7JA 2EJWA 1QFZA 5C8YB 3PWTA 2Q2WA 3G0DA 2WQZA 2D5IA 2QUAA 5AKGA 1OF1A 2INGX 5HIMA 5BWNA 1OJLA 2XZTA 4RL6A 3UGQA 1WMSA 1LB1B 2QTLA 1O4VA 3GZ4A 3AESA 4XFDA 2WYVA 4B3FX 3W5CA 2G9RA 5F7JA 2G67A 3CV3A 5HIJA 2GD0A 1Z5NA 2ZBGA 1OFUA 4IV0A 4G41A 2I91A 4OHYA 2AMJA 3NATA 3OZ7A 2BE7A 3RD5A 3UK7A 4DV3B 5DBOA 1L5QA 4YC7A 4E51A 4B48A 1E0DA 3CY6A 3FAKA 2P2NA 4R2LA 1MA0A 2LZ0A 2VDLB 3CW2A 3F46A 3IEPA 4H7JA 5CH3A 3ZKWB 3EPRA 4JIGA 3AB8A 3I9V1 2XT0A 5EFZA 4F5ZA 4AB1A 4Q48A 3RC2A 1GNPA 2PWBA 3PVCA 5FWYA 1MJFA 1XLUA 3ZBQA 4JJZA 4UUNA 1RJDA 2PZEA 4MW6A 4TYMA 1O5IA 1W0JD 1WZCA 3GZTB 3QTBA 4KO2S 1ZHFA 1V16B 3EUEA 2NPIA 1WXWA 3D6HA 4RESA 2WE7A 4NZ9A 1QRRA 1XRQA 4HXYA 1AKNA 3IPYA 2F9FA 4JLVA 1WUIS 3HCAA 2OD2A 4S0XA 3TTTA 5HHTA 5IK2A 3RABA 3BKXA 2G77B 1BDBA 1SXIA 1ZK0A 1WXXA 4QBKA 2Z9BA 4O02B 3RC9A 1WX1A 5LKAA 4PO3X 1CSEE 2EKQA 3NHPA 2BBWA 5I8PA 4WERA 4Q16A 1E5XA 1UJ6A 3KBBA 5IT0A 2VYFA 3M1LA 4HH0A 1LJLA 2PQ0A 2ZULA 4RXMA 4CI0B 2O1SA 2YHAA 2GYVA 1QWOA 3W6UA 2A5DA 2I2AA 3RRMA 2OZLA 3LUGA 1Z4JA 1QVRA 2Z9CA 4NU5A 1V1MB 2HJVA 4R1UA 2Q21A 3FYUC 4L16A 1PT8A 2Q5HA 4A1FA 1HC7A 4WFKA 3HHPA 1KYWA 3S4YA 2WYIA 2QRGA 1UOEA 3EFEA 3LG2A 4H60A 3TGPA 5BUQA 3GCDA 4NICA 4PTZA 3DH0A 3KE9A 1OYOA 1RJGA 2JLSA 3HCOA 1B7GO 3K1YA 2B35A 3KNZA 1GUFA 1V11B 2FDXA 1T43A 4E1BA 4TXHA 5CVJA 4TYNA 3STVA 3TQRA 5AUOB 4FNOA 1OC4A 4I1OA 2ZYWX 1DS6A 4FZVA 1NM5A 4Z8XA 3JX9A 4OL9A 1P60A 1S3SA 2WJWA 5JTTA 1OX4A 3UUEA 2FFQA 3VC2A 2IPMA 1PT7A 5J1TB 4BE7B 3QXXA 5D51S 5JJKA 2ZBPA 2R2GA 1IM2A 5JNRA 4D44A 1MX5A 4QD3A 2JK1A 5L6LB 1DUVG 1UPFA 3BH0A 4W5WA 5JOQA 3DWGA 3GP3A 1U8YA 1GG9A 1Q95A 4IFTA 4QOIA 1KRXA 4GZLA 3FCEA 4AZVA 5A62A 1D2CA 4DFDA 3CZQA 4AMZA 1HE1C 1REQB 4J2OA 4NYMR 2C2OA 5F5XA 2R1TB 3HP4A 2Q9UA 4HDRB 3Q0TA 5FNVF 3ULKA 1XZNA 4HSGA 2NWQA 3NCHA 5E8JA 4GPEA 2J3KA 2ZI7A 1Y0BA 2I3BA 1PSWA 2A4KA 3II6X 1S3FA 4L5BA 2F3PA 4BMYA 3CRRA 1CB7A 3VRHA 2PIDA 3MLEA 5JCXA 1PG0A 1W85B 4FQ7A 2XYPA 1GIAA 1M10A 3T54A 4YXWA 2WM9B 1P1HA 3UWOA 1W2HA 2OPBA 1SR8A 1ARZA 1IB0A 1MAWA 1JA1A 2ZJ6A 4Z4EA 2X3UA 1WM1A 2RGCA 3L0SA 4GX1A 4D42A 1VJRA 3PKIA 4D6XA 1AGYA 4F4CA 3KQLA 4RAOA 1A76A 4EKEA 3SHQA 2XJ9A 3PXGA 4F2GA 1QIEA 4U7JA 2FPGA 3SNHA 2XVAA 2GN4A 3H86A 4IF6A 1FVHA 1R0XA 1CS0A 3GEBA 1P4HA 3JTMA 3NT2A 5TS2A 1T2FA 1SUDA 4B9AA 4AKHA 4QQ8A 2AJCA 1KJQA 3NUZA 3QK7A 2C88A 4MP8A 4U2KA 1XCPA 4FMPA 2YINC 3T7TA 2G0AA 1I2CA 2ZYDA 1F20A 4MWZA 4D7AA 2FWMX 1V7ZA 4JKYA 3TLMA 4LXTA 1D6SA 2JH9A 4GUAA 3EY9A 2XD9A 5LMUB 2FXIA 4UAUA 3NTUA 5DGCA 3COVA 4DLPA 2ZYVX 1F1JA 4WKNA 5AKXA 4N48A 3OQBA 4LSMA 1OIXA 3U7EB 3VYSB 2XQJA 1MFPA 1NRIA 1FEZA 3KEFA 4PYMA 3IOBA 3K31A 5K3EA 4ASUD 1SIWA 2I1QA 3WQRA 4IDCA 4K9SA 3T1HB 3GPDG 3ADKA 3LVRE 2OYCA 2B3TA 1SOWA 3QE0A 1JFRA 1HDRA 1YBVA 4K6CA 1FMLA 1BH6A 1I7NA 4XEHA 5K2MA 3SBOA 1R6TA 4OFXA 2CLKB 3GJ0A 2VH2A 3C74A 1FVOA 4B4KA 4K6FA 4BWFB 1Y48E 3QPVA 2Q6LA 2VP3A 3BMCB 1OLSB 2QQGA 4HC4A 1KJIA 2E87A 3FKSA 4QDTA 4Y2XA 5ICSA 3HNOA 1VHJA 3SI7A 1KFJB 2WMYA 3WAJA 5EHIA 1NC3A 1W34A 2C5HA 2QZSA 5ENZA 5FL3A 4JP2A 4R3UC 4WCVA 5HZHA 1AXRA 4LHVA 4P86A 3EOBI 2RBGA 3FLEA 1JLLB 1DWQA 4GZ5A 3RS7A 2NTEA 1YUMA 2JCXA 3AK4A 3T5TA 1A8IA 3DB2A 4J03A 3KQPA 5E8RA 1TVCA 3WDKA 2AKYA 4BFVA 1ORHA 3PQ7A 3RRJA 5CTAA 3T3PB 1X86B 1K1EA 2PSSA 3UXMA 5IDWA 4C6RA 1E66A 2I78A 4IDOA 4JAVC 1XJQA 3N53A 2Q62A 2BH9A 2JFPA 4OJYA 1SBIA 2PUVA 4HKTA 2RGXA 1YJQA 3WMEA 5CDFE 3F78A 1QG6A 4XUDA 1G0NA 5FBZA 3IULA 1YQTA 4EGAA 2QLLA 4AICA 3KTFA 2RK6A 1DRKA 3H83A 5CB4F 3LTNC 2OHJA 2WT9A 1JEYB 5AJHA 1MNAA 1NYTA 2O0KA 4Z53A 1N33B 4PAGA 3DUFA 1EUDB 3AONB 3M6MD 4YCMA 3PT5A 4FYPA 4KSBA 4DIMA 2CZCA 4EZBA 2P6OA 3E9QA 2XITA 3G2NA 1C2YA 3NEJA 3H7AA 3KFXA 4UHHA 4P92A 1KYZA 4B4VA 4I50F 4K26A 1CLEA 1L4MA 2A33A 3ZHXA 3BUSA 4MUYA 4WZAE 3EMBA 2ATXA 3B78A 3BSWA 3EYWA 3MM4A 2Z8YA 3E9YA 2BMAA 3RK1A 4JV5B 1PUIA 2VBCA 3GDFA 2UDPA 1GU7A 1BEZA 4BMCA 1CHNA 1JHAA 1AKUA 3OEWA 4G36A 3WKBA 4MUMA 1THTA 3ANMA 3G5UA 4I6JA 3SDBA 4EHBA 1C4XA 3VPFA 1W88B 3W7VA 2RDMA 1ZVKA 1IWPB 1TU4A 3AUFA 3H9UA 1L5VA 2BFEA 4G23A 4HQFA 4K0RA 2PUFA 2IS4A 3LWNA 5GPBA 3LRTA 4UU0A 5B55A 3NU1A 2J5BA 3F6RA 1G5PA 3GDWA 2VJBA 2P30A 3MWFA 5FBHA 3LC2O 1W2WB 3RC7A 4ZEWA 3CE9A 3B7PA 3D3NA 2VI5A 1MVOA 4CDRA 7ADHA 2B8JA 5TQ0A 3HKBB 1D8TA 4DUGD 1V45E 4EVRA 2GPNA 5IT9A 1KK1A 2O5CA 2MOKA 4GP6A 5BXYA 2PV0A 1E9CA 3ZE1B 5HSGA 5EOVA 3MJRA 2QLFA 5DYYA 4DQVA 4XWOA 2WJYA 3BCRA 3H5WA 2DCUA 1U99A 4HOYA 3QHAA 2PUBA 1ZX1A 3Q8XB 5I9IA 5SY9A 3RI3A 1ZD4A 3TGWA 1U3CA 5BURA 4B4WA 2XXAA 2GYWA 4ZZ3A 1O7JA 1P77A 1II9A 3KD2A 1CQIA 2C95A 3ANNA 1TT5A 2YWCA 2OL4A 5FI0B 2HR1A 3LGAA 3AUYA 1LDYA 1SKQA 4GXNA 2QZPA 1LZLA 2IYEA 4HLQB 2DCMA 1H9AA 1K8YB 2X9LA 4I1IA 2AXQA 4KE9A 4L2IA 3A2LA 1JAZA 3CLRC 4P08A 4CMCA 2RI0A 3EOAI 1EFPA 5GWXA 1PCXA 1YA8A 1Z33A 4DADA 2J30A 2PH1A 3ORRA 3DV2A 1F4LA 4NWIA 1YD7A 3KFLA 1T25A 1F9AA 5LL6P 1IG0A 1TMOA 3IELA 1MHTA 4IDPA 4AIIA 4NJMA 3CKMA 3YASA 2C3PA 2BM0A 2QZZA 4GI7A 3EWSA 5TMEA 5JDIA 1TQHA 3ID6C 2IZ0A 1M67A 5FBQB 3EN0A 3PNYA 2CYCA 1USIA 3OY7A 3VKHA 3KQTA 2HU8A 2FV8A 4G0ZA 5LLDA 1X74A 2C4HA 2CB9A 2EX1A 2YHUA 3CUTA 3ZEAA 3FPJA 4ZOBA 1RLTA 4BGEA 2EGUA 5KVQA 1DFGA 1GAWA 4IO1A 5KNCD 3DLAA 1T8YA 4C4PA 1XNRB 3FKJA 4JP3A 1Y9EA 2BCJQ 2A5FA 2H4JA 3R40A 1Z25A 3LP6A 4P22A 5FBKA 4XGNA 2WT4A 2H3HA 3L1KA 4M1YA 3OZDA 3D7KA 4ZOLB 1A9XB 1GP2A 4Q3BA 3HB5X 5ED4A 1NXSA 1Y9AA 4MX8A 4O2AB 3NWEA 3S8EA 5B58T 1S9DA 1IDN1 4HDKA 4PSVA 3IERA 2XCLA 3F3SA 4G6ZA 2QM0A 4ND2A 3GRUA 1WTAA 3EULA 4Q5IA 3D3EA 4PIMA 3CJTA 4GC5A 1GTVA 3CF4A 4TLEA 3V1UA 3AV0B 3FWNA 5ER9A 3O2NA 3B1WA 4P81A 3PZRA 5KWVA 1WMBA 4BNUA 2DY1A 3TX2A 2WHQA 1G6OA 4P4SA 5K0FA 1YZQA 1GL6A 1A4IA 4HPJB 3TLBA 1E1RA 5JSHA 5FP0A 4X1YA 3R7WA 2D2VA 3BCSA 4FFDA 4RY0A 4XSHA 3V32A 4ACBA 4HLUC 1D4FA 2WNIA 3ADCA 1WU8A 3FHCB 4P33A 3SHTA 2MSWA 1QOPB 2A30A 1EUDA 3NYIA 1JR4A 1TTHA 1JBEA 4KXNA 4LZWA 5D84A 3U31A 5LOVA 1DJMA 1VLLA 4OM8A 3S0JA 4G24A 3ONDA 4IILA 4JLJA 4Q82A 3WYGA 3VR3A 3MD0A 3NHFA 2QGZA 3CKLA 2PX5A 4AN4A 1P2TA 1RHRA 1B8OA 2H5IA 4ZQFA 3X43A 1TO2E 4LCEA 3AR4A 1JBKA 3QNMA 1QK5A 4OMUA 5A7HA 1II8A 2YW2A 5BN4A 3ONWA 4RZXA 5LZ7A 1ORWA 3DO8A 1NTRA 2FR0A 1DKUA 2IC5A 4JNCA 4N4AA 1LXCA 2NZVG 2SNIE 3JWPA 4RS3A 4CTKA 2NU7B 1U0EA 4PFQA 1NR1A 5LZ8A 3WXMA 3C8HA 4AS3A 4DT1A 1ZICA 1L4YA 3FTNA 1X87A 2BZGA 3OJLA 1MA3A 1MVNA 1L5RA 3LQKA 4FMCB 2VIIA 4M8LA 1VXRA 4QXRA 1XLWA 2G1AA 1C8KA 3UCXA 3WLPA 2W2VA 2QTVA 2H1OA 4M55A 4N0PA 3AX6A 5FYDA 1C8LA 4BBZA 1E7QA 2RONA 2VRBA 3NTLA 4RZIA 1JB1A 5LYYA 1DIRA 2HGZA 3R24A 3GJ7A 3WBJA 4O4LA 5KKCA 2ZBFA 4QOSA 2CHVA 4YIHA 2WP0A 5IVDA 1FP1D 4CT0A 1EJBA 1QNFA 4TGLA 4FB4A 4YFYA 2X7JA 3OF5A 2D8AA 4JGGA 4MWTA 2PUGA 2BKEA 2CFCA 1LK7A 2EFYA 3KP1A 4BFLA 5DHSA 3DHVA 1FFEA 2AZDA 1NE2A 1M9NA 1T4GA 1YJ5A 4OHOA 5B1DA 1FL9A 3W04A 2IP2A 1OILA 2SHKA 1LEHA 1E4EA 4HAZA 2QIOA 4IUDS 3QRWA 2X1MA 1UJBA 2I6GA 2ODEA 4PQRA 4MS3B 2OLKA 4CN8A 1N78A 1X2EA 4B1FA 4TMFA 5KWEA 1U98A 1U6KA 3JAKB 4CKCA 3JRXA 3KZOA 4ALLA 5LD2C 1H9CA 1JXAA 4AP9A 5EJ8A 8ABPA 3X1JA 1I6MA 1KI7A 6REQA 3ZDBA 4F38A 3J81k 4JI0B 2BD0A 5TARA 4WN9A 1BWSA 2ZDGA 1DNPA 2NO5A 2QTTA 4MYDA 1S7GA 4RUKA 4TV8F 5JH7B 4J1QA 2HHAA 3RHFA 5EWLB 1JJFA 4YCLA 1Y1PA 2VG8A 3HUTA 4N6GA 1W29A 2D06A 2JASA 2FETA 3QE3A 3JZDA 1C14A 1QMGA 3G8CA 4W7IA 5WRFA 4H3SA 4DPKA 1X7XA 2FVXA 4JDPA 3V4RA 1VPTA 1AV7A 1Z4KA 3TBFA 1UJCA 5MN4A 1M8GA 2Z95A 2P1DA 3BD6A 3CCCA 1PZNA 1EINA 3LLSA 4J3JA 3RSLA 3WDMA 2BLLA 1YJ8A 1RXVA 4HNAB 1AM4D 4GICA 3S2FA 1QAOA 3CH6A 3KU1A 4H6VA 5DM1A 1SKYE 4XE5A 3V48A 5K51A 4ABYA 2GVNA 1BXRB 2HNKA 1ODKA 1EK2A 2AJDA 3A6JA 4Q4DA 3ZLVA 4D9NA 1M6EX 2VHQA 5I51A 1RWBA 1SVLA 4WCFA 4ZODA 3VV3A 4AG5A 3K2EA 1GNRA 1L4KA 4ZVSA 4POOA 3W2HA 1R8SA 5C3UA 3GJQA 2AR0A 4NYMQ 2P4EA 3T3MB 3NHZA 5KSWB 4UEOA 4HYEA 5BRAA 5TMPA 4K3VA 1BOOA 1UP6A 2YIDA 2VDQB 2MMCA 3GT0A 3OA0A 3RK4A 3MILA 4BLRA 3K0KA 5FEUA 3KJZA 2PKXA 1UKCA 2TMYA 3LS2A 1TZCA 5K6TA 2QF7A 1WXHA 1EVKA 1ZA2A 4KQ9A 4YGXB 3RTAA 4CKWB 2ZZMA 1LDEA 3VYVA 2G8NA 2WJPA 1LDNA 1CJMA 1XDWA 2FWAA 4LKOA 5IYZF 3U4DA 3TF5A 3PD1A 3NIWA 1N57A 4GM0A 4HDSB 3O0DA 1KDZA 4FMDF 1FJGB 1JIJA 1CIPA 3R7LA 2LE0A 5AHRA 1LI7A 4I66A 2GX6A 3QPWA 3ZVKA 4OHFA 5JYCA 2VYVA 1Q0HA 2J9YB 1NT4A 4M1EA 3EW7A 6GPBA 1YMVA 3SLGA 5JH7A 4EPTA 1NVVR 5DLQC 2BUAA 1PWYE 1WV1A 3RSOA 4CUJA 1GPNA 2F3UA 3VPXA 4D8WA 2PGDA 5JI2E 3EQ6A 4IZIA 2IWHA 1E77A 2Y77A 1Y1TA 5J4LA 4WXPA 4LMPA 1PE0A 3H4VA 1KAQA 3WB2A 2R1VA 3M49A 3I72A 3RQIA 3QU2A 2BHRA 2R8OA 3G3EA 1BRMA 5ALRA 4NJEB 1GGJA 1VE9A 3JQBA 3N59A 4XB1A 3VPBA 1H94A 3IV6A 3PQEA 4PPNA 3TK1A 2E7ZA 3W78A 2ZTSA 2RB5A 2H4HA 4UPEA 4Q4LA 2UZ1B 1JKIA 4U9UA 4S0ZA 2IA5A 4L5JA 4TS3A 4X5OA 3QE2A 2VDPB 3EWNA 1DAHA 3SF0A 3U56A 2NUPB 4P4LA 1CQJB 2HHLA 3MT9A 2A57A 4FZ5A 4MW0A 2IP4A 4S2EA 3RU2A 3I9MA 3T3DA 3NO4A 3VDXA 3K30A 1L7DA 3KZMA 4JITA 1LNSA 1S1CA 4OI2A 1JVBA 2PXCA 3ESBA 3GUCA 4MVCA 5BSEA 4IQ8A 3KPYA 2FUEA 5HF6A 1E2QA 1EFUA 1N3LA 4EEKA 2YJNA 1E0JA 1D9XA 1OAOA 1VP3A 2B4QA 2PXXA 1KXZA 3AQ4A 3EVGA 3AL2A 3C3BA 3L8ZA 3I42A 4GRIA 1LLCA 4BEWA 2WMDA 1KFBB 1MRZA 3RC1A 3RS8A 1NI4B 4Q7LA 5E6RA 1YZKA 4YT8A 1G3QA 3KKLA 3TCXB 3TCNA 3R7BA 5CK5A 2HLDA 3OE1A 2E37A 1OLUA 1E69A 2RG7A 5DHAA 2X8JA 3PHGA 1FCJA 4C7OB 2L0XA 2H9YA 3M34A 1DTWA 1A1VA 2Q4TA 3Q3VA 2NZYA 2YC4C 4IEFB 3TD6A 2BEKA 4HWGA 1D03A 5AK5A 1LJUA 1NG1A 2GPAA 1Z0ZA 2D2EA 3LUFA 3OKFA 4QTXA 2YWXA 3F5DA 4P3OA 4O08A 1F60A 3WNBA 1HPLA 4Y9RA 1ISPA 3WJ2A 3NXKA 2G4CA 1DWPA 3F5MA 5EJFA 1ID8A 3O93A 5FOTA 4C1BA 1JT2A 5ESWA 3WV4A 3OFKA 5HQ3A 3HN6A 5J4KA 4ZVTA 3F7OA 5C8XA 4ND5A 3KVYA 2OBLA 5EP3A 2QYHA 2F64A 3GARA 3NIBA 4FLFA 4CF5A 5JFTA 3B6MA 4AKGA 2NTJA 2DECA 4JELA 3H4TA 1T0BA 3TOZA 4ER6A 1FXWA 4JLBA 3I62A 1PVVA 1VI2A 3H7IA 1PK7A 3H05A 4ITVA 4RZSA 4EWLA 3FCOA 5EPOA 3JD1A 5A5DA 4N03A 3KVVA 3F74A 2ZB8A 3WYFA 1NBME 5E3JA 3LDGA 1RE1A 5JVDA 4UATA 1FRNA 2ZE6A 3SS7X 5ULLA 1ND5A 4MMXB 3K72B 4WFIA 1V6CA 4OH7A 4IGEA 3AJ9A 3MWJA 1VYTA 1Z4QA 2AJBA 4JL8A 4WPGA 1MQ9A 3KKKA 4BUJA 1ZOIA 1H05A 1EJ0A 3ORFA 1JFLA 1N9KA 3LOUA 5I7WA 4EJFA 3C41J 3LPDA 1A2QA 2GBLC 2B34A 2ZUFA 1UJ2A 3DTYA 1JU9A 4GM1A 4FD2A 4F92B 3N9IA 4MRMA 5AP9A 4YV1A 4RVCA 2Q6IA 2NU8B 5HS4A 1JIKA 5FPKA 4KXWA 4G4SP 5ALXA 3Q9NA 4IQ4A 5HK9A 3PFHA 1HYBA 4FMCF 3ZDYB 1I1OA 2XEDA 4KQ6A 1P1KA 1MVLA 3IUQA 3EFBA 1TEVA 1EUCA 4OQNA 1ZM3A 3WG9A 4YYEA 4EPRA 4QLAA 4R81A 4D3FA 2HXGA 5EIEA 4FU0A 3O1JC 1Z06A 3CZAA 4Y3UA 5ALZA 1KEVA 2FOXA 2AUMA 4V0ME 4AUNA 1J5PA 4TSFD 5K2OA 1A9OA 3A3OA 3VH2A 1WSWA 3WWOA 1NMXA 4TL9A 5H02A 5LU9A 1AQYA 1I3KA 4GOLD 1G4HA 1I0IA 3IDQA 4Y2HA 4HQ0A 4TLMB 4TT3D 4M9CA 4GPAA 2HKIA 2BSQA 1U0TA 2AFRA 2DM6A 4C08A 1THZA 4MVJG 2GN8A 3RKSA 4KV7A 3LSTA 3S2UA 5JJCA 1SD1A 1T2EA 1UK7A 2HO5A 3AVTA 1J4AA 3L4KA 1Y7HA 4X84A 1OX6A 2XOKA 3B1ZA 5SZIA 5LBUA 4LDPA 5NLLA 4QFDA 3V8VA 3ADPA 3BDVA 3WMGA 3DAPA 3V8BA 1DJPA 2KM1A 3DOHA 3E1GA 3TQFA 1GNSA 1KU0A 3LGXA 4H18A 3DFIA 4FFRA 3D0QA 1L1QA 4YJKA 1U7OA 2FGKA 4DHWA 3K5HA 5LR6A 1JPUA 1H2ZA 3X1ZA 1DBVO 2Q45A 3H2GA 4RFVA 1NDQA 2Q99A 5SYAA 1KK3A 3RR2A 3ZK8A 4LYDA 4B81A 4EF6A 3ORYA 5BO5A 1JFTA 2C0PA 4FS3A 1QH8A 3L7DA 1MJGA 1JH8A 3NHSA 4NLLA 5EPEA 1K06A 4GBGA 5HFNA 2RC6A 1ZR4A 5IMSA 5KSZA 1U0NA 4PZ0A 4P8RA 4YFVA 4RJKA 4P3NA 4CM4A 2BKXA 1SQSA 1T0JB 2FPPA 2AR7A 2VZLA 3CJQA 4DIOA 5CEFA 2Y4NA 1I4EB 1Z4PX 4IGFA 4LNUA 4V39A 3FUVA 4I50B 1KFEB 1V25A 4Q1FA 1KQOA 3I9LA 4ND4A 1KDYA 5LQRA 2WTXA 4YMSA 4AC9A 4LYYA 5P8WA 1I6KA 3FD8A 2YV3A 2VJYA 5DBGA 4DN6A 4LISA 5H3CA 1L1EA 3W2GA 2P4HX 3OC0A 1CX9B 3O82A 3ZHQA 2B82A 2F8SA 2GAIA 4FCWA 4ZN6A 1OHHD 4QSHA 3K0CC 1V1MA 4RKFA 5THXA 4PG4A 4N0DA 3PNQA 1DEXA 3BGOS 5AM5A 2B20A 1I36A 4MVJE 1PR5A 1A50B 2VNSA 3DWIA 3P96A 4BJ1A 3GZNB 3KJFA 4BFCA 1O89A 1EK0A 1IWOA 3U17A 3LUJA 4FTWA 5DGDA 5K3CA 3BORA 4NQRA 2VSXA 2B92A 2VDWB 1EGHA 1O2DA 3E2MA 2ZGVA 3V7YA 1N5RA 5B3LA 1SCIA 3K1TA 3DAOA 4ZXPA 4D6PA 1QO0D 3T5AA 1CZRA 2YRFA 2E18A 1H6CA 2BCEA 2XNKA 3A6KA 3ENQA 3F6PA 3SC2B 3T3IA 5I7OA 2ZUBA 3CNLA 2GVZC 4ZCIA 2FH5B 1CEQA 1BMTA 1MEJA 3MJ4A 2P91A 4JBNA 4S1TA 1JSZA 3GRYA 4FMDB 4BN4A 4KXUA 3NHRA 4D46A 1V47A 4RHEA 4TV9A 4XCXA 4Y6GB 5DHPA 5E4FA 2GFHA 1AUOA 4NCKA 1AA6A 2RH9B 4Z0PA 3TDMA 2IL1A 3VV2A 3ZCSA 1KZHA 3I0MA 1B14A 3GCZA 4DG8A 2VYVD 1EFKA 1DLIA 5F1OA 4YCAA 5JLJA 5HJEA 1OCEA 1QFMA 2O0HA 3MEQA 3UWDA 5HKKD 1DJOA 1HQDA 2CHQA 3HM2A 1CE8A 4WD3A 4XYEA 5LQMA 3AHJA 1GAJA 5BUZA 2F1KA 3IAXA 1A5TA 1BSVA 3UW1A 1IEWA 2E5WA 3EXEA 5LBTA 1SC6A 4AQDA 5JNUA 3T1TA 3CVVA 3REOA 1AGXA 4Z2AA 1Z0AA 2HF8A 4MICA 2WEKA 3VNBA 3SHVA 2H48A 1NATA 3GLFA 3I04A 2IVZA 2HPVA 3C1TA 3PPVA 2XIQA 3A1VA 3O3NB 3NT4A 4I2VA 4I1SA 1CUGA 4EQZA 1ORTA 3U26A 2POQX 1DKLA 1XMJA 3KJGA 1WPGA 4NU6A 2NAFA 1M72A 1PZHA 1XQYA 1NBAA 2A0XA 3EF1A 5ITZB 4DV0B 4KQEA 2G1PA 1EAMA 1KEEB 4G5XA 4B45A 1JVSA 1HMYA 1KY2A 2CVPA 3KQNA 1B73A 1OGJA 4US0R 5FO0A 1W93A 5CT8A 1GPDG 3IRUA 3GUUA 3JZFA 5EL0A 4BMVA 2ZT8A 4FZ3A 4NPCA 4ZK2A 1C30B 3ADOA 3IV7A 3GLHE 4MV8A 1ZSVA 1BWQA 1PWZA 3V5NA 1BX1A 1IVNA 2W2MA 3UV6A 1GUDA 4AURA 4CMGA 5FOQA 3QF4A 5KSPA 1EVQA 2YFYA 2W2LD 2G9QA 3I0NA 2VHYA 3W06A 4OF4A 5BNIA 1U2DC 2FY8A 2X6QA 4REOA 4EPYA 4KNVA 2GXAA 2QAGA 4JOBA 4NI5A 1L8OA 2QG4A 3DMGA 3O7WA 1E7YA 1LWNA 1J8DA 3FSEA 3OCWA 1A9PA 3KT3A 3HK2A 4PSCA 4A16A 1U8UA 2XTZA 5LC1A 2ZYIA 4COOA 2OE2A 1Q1BA 5ITVA 2VBFA 4JT2A 2X1LA 1E1NA 1K4MA 3GT4A 3IIMA 1X1RA 1IPEA 5KYXB 3K9FC 1SXJB 4FDVA 2Y1OA 3WGNA 4EVQA 1HH4A 5TPZA 1QHSA 2WINI 4OYHA 1M7BA 3H97A 4RGBA 3HBFA 2R84A 4HV4A 1VJ0A 1XZBA 2YHIA 4HY3A 3I32A 2QBYA 3AUJB 3RUDA 4J8PA 3ZCPA 1Z16A 2JGEA 3F4KA 1L6RA 3EGDB 3QXSA 3TEJA 3T34A 1SK9A 3MLBA 1FU7A 3FR8A 4HR7A 1EG2A 2C7VA 1QHXA 2OTCA 1GARA 2VDJA 3K0FA 4AKIA 1P17A 3I5UA 3KR0A 3GJ4A 3SK0A 5HGXA 5M2QA 3H8JA 4HUTA 4H9GA 4YDHB 4D5GA 3R3XA 2I6TA 2JFQA 1ORIA 1BU8A 1LPAB 4ZA2A 2BGJA 3KOZA 1CK4A 2C3MA 4MW9A 5L45A 3K6RA 4U5XA 3DZHA 4A0FA 1H0SA 1RSZA 4UE2A 1I3LA 2Z3VA 2J4CA 3V1MA 3EHEA 5EERA 1VHWA 3SN6A 2ACWA 3UF0A 3ZOKA 3G88A 3Q11A 4MRVA 1U81A 1N6NA 2XOEA 2HPZA 3W7BA 4BMXA 2HUNA 2FSVC 2JGNA 1JKJA 3QF4B 3T1OA 4MTCA 4AJKA 1S7CA 3G2IA 2OWDA 5DW3A 1G59A 3ZCRA 2OT3B 4YUXA 2G6BA 4Y2SA 3PJGA 4DQUA 3EAFA 3K05A 2HZ7A 4J6EA 2M1ZA 4IJVA 2ZR9A 3LK6A 3SHWA 1APBA 3G2MA 3EPJA 5JFOA 2PZ8A 5F7ZA 3NJ8A 5D6NA 2RH5A 1J9GA 4IV5A 5B36A 3OIFA 3NWJA 3PNMA 3FBTA 4G85A 1HDYA 3FAZA 1QG4A 1RZVA 1TA4A 1LNZA 1CR4A 2OCGA 2W43A 1N25A 3LQ1A 4KAXA 3KEQA 1Y5LA 1ZAYA 2PZKA 3H04A 4EATA 2VP2A 4P0TA 3VR3D 3LCVB 3TLAA 1OU0A 1O3YA 3AEKB 2NV2B 3HRIA 3QMMA 1WLSA 3SZRA 5KS2A 3DW3X 2JHCA 2Y76A 1RXEA 1A88A 3LA8A 2H1WA 3DMTC 1W2GA 1ZD1A 4OXXA 1CIVA 5REQA 1ZIXA 4RJLA 5TPZD 5TVKA 4CLXA 1G1AA 4KPYA 1L4UA 4KXMA 3G8AA 5KUTA 4E4TA 2G17A 4U02A 1EBFA 3HA3A 3NHKA 2LIPA 5G4KB 1SFRA 4BLQA 1FRFS 3FMPB 1EWYA 1KO4A 4CT4B 1T9GS 3U4GA 1YCHA 3ENVA 1XDBA 3KCNA 3AP1A 4O2BB 4RIGA 1E3TA 3CVXA 5A0VA 1RPJA 1NV8A 2HXYA 3BFKA 1LQTA 1PU2A 5E7MA 1TUBA 1Y1LA 4TWAA 4ACAA 3CBQA 4MRAA 3CURA 2G5GX 3Q3JB 4MWEA 5JNVA 5E1DA 3VOBA 1K5PA 1MO5A 2VQDA 3FPFA 4XD7A 1URPA 4C89A 2JGDB 4F4JA 4O4IB 4NBVA 2ZVDA 1ULZA 3AH8A 3CHYA 3QVLA 5M3BA 1U9IC 1EHIA 2PZLA 3CRZA 3F8WA 4IX1A 4O4IA 4RIEA 4OJMX 3SQMA 4TKVA 3AOEC 2PHZA 1KJYA 4MV3A 4PSAA 2PYIA 5KHAA 1WBJB 4PYQA 4CZ2A 1SULA 4U9HS 4GYWA 1PD0A 5JI3E 5CLQA 1U0BB 2G5PA 3JAKA 3QOFA 1PWEA 3F2VA 2X0IA 1DOAA 1ZL0A 3K9LA 3NHUA 4LRWA 3LP8A 1KOJA 2J5XA 3PUYA 3VU8A 4AMVA 3G1UA 1G6HA 3U9SA 1P29A 3WQHA 2G82A 2BELA 1G6Q1 4JH0A 4OHCA 4DWOA 3UK2A 4X7BA 2A0FA 2FKNA 1AKYA 5KTSA 1OXTA 1FSZA 3FLAA 1VSQA 4O4LF 1Q1ZA 4J7XA 4J0DA 5E6SB 1PNTA 2WF9A 4JB2A 4PGGA 1BJRE 4UBJA 2WVJA 1MABB 4WK2B 3WZ2A 5IP5A 3UHPA 2R25B 2OESA 5IBPA 1EK5A 1IONA 2R6HA 3ND6A 4NCBA 2PNFA 1KBZA 3UUGA 2V6JA 1TM5E 3PWSA 4J90A 5EZQA 4GX2A 3UG6A 4GE3A 3EVAA 4LRTB 4DQLA 1Z29A 5IXJA 1OYYA 1CCWA 2JFXA 1A82A 5THQA 3ASVA 3SJ7A 4BAUA 4CEHB 2B8TA 3HWWA 3ZBPA 4CM8A 4KR3A 1U8ZA 1UZNA 3GMSA 3ZY5A 4TYYA 3IQWA 3E23A 1U28A 4X24A 4XWYA 5F77A 1O8CA 2WNHA