3OZEA

Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
263
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-methyl-5'-thioadenosine phosphorylase
publication title Crystal Structure of human 5'-deoxy-5'-methyladenosine phosphorylase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 263
sequence length 273
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozeA00
1Y1QA 4QAQA 3C74A 3UAZA 4QARA 5CCDA 2P4SA 4L6IA 1Z5NA 2AI1A 2PGAA 4WKBA 1Y6RA 3KVVA 4D8VA 1PKEA 1B8OA 2OECA 1U1EA 1T0UA 3FOWA 2OC4A 4R2WA 3BGSA 3K8OE 3NM4A 1OV6A 5CYFA 1Z37A 1A9RA 3F8WA 1Y1RA 2GUWA 3FUCA 4TYMA 4WKCA 3D1VA 1JE0A 3GGSA 4BN0A 1Z36A 1ECPA 4JWTA 4M1EA 4OJTA 4UC0A 1Z38A 1PR5A 4TXMA 4IP0A 1OUMA 3FNQA 3OZBA 1JDVA 1RYZA 3PHBE 4FFSA 4F2WA 1Z39A 5F7OA 4ECEA 3OOEA 1A9OA 1JDZA 1OVGA 1TGYA 4D98A 3UAVA 1LX7A 4BMZA 4OF4A 1A9SA 1JDTA 4L5CA 5B7GA 3E9ZA 1YRYE 4F3KA 1V41E 1K3FA 2HRDA 5FAKA 1FXUA 4L5YA 3P0FA 3BSFA 1PBNA 1ULAA 1JE1A 4PR3A 3NM6B 5CXSA 1CB0A 4X24A 3MB8A 2ISCA 1C3XA 1ODLA 1Z5PA 1PF7E 2A8YA 3P0EA 3SCZA 3KHSA 3OCCA 3FWPA 1SJ9A 1V3QE 1ULBA 1A9TA 1T8SA 4GLFA 4NY1A 1ZL2A 1ODIA 4R31A 4TTJA 1RXUA 3ENZA 4YMLA 4M3NA 3LBAA 3INYA 3ODGA 4OY3A 4QATA 3PNPA 4YO8A 5B7PA 4TTIA 1ZOSA 4LNAA 4LNHA 4DAEA 1Z33A 4OEHA 3PHCA 4F3CA 1TCUA 4R2XA 4YNBA 3DF9A 3TL6A 1VFNA 4KN5A 4I2VA 3EUEA 4G89A 3EEIA 4D8XA 1XE3A 3UAXA 3UAWA 4LDNA 1RXYA 1A9PA 1U1GA 1A69A 5I3CA 1TGVA 1K27A 5F78A 1I80A 2AI2A 3OZCA 1YQQA 1RSZA 2QSUA 4GMHA 4NS1A 3K8QA 5EPUA 1VHJA 1RR6A 1YQUA 3KVYA 4JP5A 1PK7A 1JPVA 1JYSA 4D9HA 1OTYA 1WTAA 2OC9A 2BSXA 3GB9A 2ON6A 4EB8A 3O4VA 1NW4A 3LA8A 3DJFA 4P54A 2QTTA 2B94A 2HWUA 4DAOA 3FB1A 3O6VA 3ONVA 3BL6A 4DABA 1A9QA 1PR1A 4EARA 3LGSA 4G41A 5CXQA 1TD1A 2Q7OE 3QPBA 3KVRA 1NC3A 2A0XA 1SD2A 5ETJA 3IOMA 5F7ZA 3EUFA 4WKOA 4BMXA 4JOSA 1YR3A 4QASA 3DDOA 1OTXA 1PK9A 4DA7A 3E0QA 3PNSA 1V45E 1PR2A 2A0WA 4DA6A 5F77A 1JDUA 5B7QA 4PNPA 5EUBA 1Z35A 4NSNA 5F7JA 4OGKA 5CYGA 3UAYA 4BMYA 5IFKA 1PR6A 1G2OA 1U1DA 1CG6A 1Y1TA 2HSWA 2XRFA 4L0MA 3OF3A 4YJKA 5C80A 3U40A 5IU6A 1JDSA 1V48A 5F7XA 5K1ZA 1V2HE 4L5AA 1NC1A 3E9RA 3EMVA 4GLJA 1U1FA 5JPCA 3NM5A 3DPSA 1VHWA 1Q1GA 1PR4A 2RJ3A 2H8GA 1PR0A 1RFGE 4TXHA 2I8AA 1N3IA 1PWYE 3MMSA 1RCTE 4H1TA 4MARA 3OZDA 1SQ6A 1TCVA 1RXSA 1Z5OA 2IQ5A 5KB3A 1LVUA 4DA0A 1K9SA 4LKRA 5DK6A 4WKPA 2AI3A 5CCEA 4DA8A 3NBQA 4WKNA 4F1WA 4DARA 1Y1SA 2QTGA 3BJEA 1B8NA 4TS3A 4LZWA 4TXNA 4E1VA 2QPLA 3OPVA 1JP7A 3OOHA 1M73E 1ODKA 4TXJA 5F76A 1Y6QA 3T94A 1OU4A 1T8WA 3KUKA 4K6OA 3KU4A 1U1CA 1RT9A 3FAZA 1PW7A 2A0YA 3IEXA 4F2PA 4GKAA 3DP9A 1SD1A 5EFOA 2HN9A 1RXCA 1LV8A 5B7NA 4QEZA 4OGLA 1T8YA 4QFBA 4MCHA 4G8JA 4U2KA 4TS9A 1V4NA 1QE5A 2I4TA 3UT6A 2QDKA 4M7WA 1Z34A 1YBFA 1VMKA 4TTAA 5F73A 2AC7A 4DANA 4MCIA 4D8YA 1T8RA 1ODJA 2OXFA 4TXLA 3OZEA 4RJ2A
chains in the Genus database with same CATH superfamily
4IUYA 4CYMA 2ZYRA 1U2PA 1XEWY 1VCOA 1DT5A 4QNNA 4LWZA 1T9GS 5LD2C 3JSXA 2I91A 1AC5A 1XEXB 1VB5A 1UXJA 3S8MA 3S2GA 4Y67A 4FFBA 1R12A 3U5ZB 4M1KA 5D1HA 1TO1E 1HDOA 1LX6A 1XU7A 2X22A 1Q84A 1ORRA 4P2BA 2SKEA 2Z83A 4X1YA 2WSMA 5DWDA 4EKNB 4TMWA 1SB8A 2Q4BA 4KO3S 4L9SA 4GPAA 3SICE 2P2GA 3RVNA 3E8SA 4HZGA 3PWZA 4CRWB 1UIMA 5CUQA 2FPMA 2BKUA 4EUFA 3FOWA 2RKWA 1DC4A 4MUGA 5EE1A 4AJJA 3G1WA 2JLUA 2QVBA 3AUFA 1EUCA 5EE3A 4DJDC 1K7SN 5KSPA 5JD6A 2CNDA 1H22A 1N2GA 3FYUC 4NCBA 1T0BA 1NONA 4K03A 4AY6A 3KB8A 4RVCA 4RJIA 1YI8A 4HS4A 2CDRA 2DYKA 3HNOA 5JS2A 3DNPA 3VX4A 2D0OB 3HB1A 1NURA 1Q3HA 3WX0A 4AKTA 4GBED 1TM5E 2JFZA 4EELA 3ZQ4A 1Z6QA 3EDYA 2YRXA 1LSUA 1NTRA 2EJTA 3EEYA 4BDTA 2G1UA 1E8MA 3AHIA 3RYIA 1C3EA 2Q1UA 4QBGB 4C6RA 4AJKA 2QZPA 3FCUB 3CCFA 4PYLA 1BROA 2IGBA 3LSTA 3NGMA 5KWVA 1QIMA 1E7YA 2IC5A 1I5OA 2VOEA 4O4HA 4AJ9A 3FKJA 2AF3C 2HZ7A 3KYDA 1CUEA 1V3VA 3H4MA 3SM3A 1AE1A 4NR0A 4KQGA 4AK9A 3HA2A 1OXXK 1NJGA 1JHVA 1V0JA 4GOOD 3DW1X 5HOQA 4G0VA 1CF9A 1GU0A 1IYZA 3KB6A 3KUDA 4UDOA 4XUEA 1RI5A 3O8DA 4PPGA 3J81k 2Q5FA 1VYTA 4ZI7A 4KZPA 3H5NA 3EQ6A 3FNGA 2I9KA 3LRPA 1WWKA 2VK4A 5JLJA 1V7CA 2WM8A 1XZAA 2OD9A 2PBFA 3PV0A 3NIGB 4GM0A 3WGYA 4WA8A 1W36B 5EEHA 1TEZA 3V1UA 3R23A 3WGTA 1T29A 3EE6A 3PL5A 4EZEA 1L6RA 1X7WB 2ZRAA 4GI1A 1Z39A 5F7OA 4Z4FA 4S0XA 2P2SA 1KY2A 2L17A 2VSNA 3M1YA 2XF8A 2H5LA 4ECEA 3OOEA 4BMCA 1WSBA 1SULA 4XJSA 4X3CA 4JV5B 3QU7A 2CLIB 1LU9A 2WYIA 1GG2A 2JJ8A 2ZYHA 3FHJA 3KKPA 4MQFB 5BYJA 1C0EA 1XELA 2BMVA 1FDTA 3K5HA 4ZQBA 4EIWA 1TDJA 3IQWA 2PE5A 5JEDA 3FN4A 1T5IA 2WWIA 3I8SA 2MYNA 1GRNA 4Y7DA 3T8YA 3W9SA 3SJCA 4CMEC 3G7UA 3I2IA 4IDQA 2IV7A 3ROFA 2Z3ZA 2AN1A 5KNLA 1DAIA 3KZOA 4WNYA 4KRYA 4I6JA 2VDUE 3PDJA 1H0SA 2VQDA 3IXQA 3KOMA 3P0IA 1UXIA 4LZNA 1CDDA 2UV8A 4WVLA 2YV2A 4L51A 4NDZA 3AY7A 2QMUA 4TUYB 1ECGA 2WAYA 2FWIA 2BBWA 1K3FA 2EKDA 4KMMA 4QZVA 4BAUA 5AVYA 1SHTX 4AO7A 4CCWA 3IPLA 4J16A 1W76A 3RARA 5I8PA 3OUUA 1ML3A 3LVBA 4TMZA 4UOQA 3U3RA 4IHJA 4MQ5A 3OLVA 4NU6A 1G6HA 3NM6B 4PR3A 1N78A 1UBJS 3OPMA 3AEKA 3R0IA 1KDOA 3IYLW 3Q88A 5JRJA 3OBIA 1M2VB 3FPKA 4Q4DA 1H65A 4YQYA 5GMOA 4FYPA 1UFKA 4XDHA 1Y5LA 1EXNA 3OFSA 5JNVA 4M88A 4MW4A 2OGSA 4UXHA 1GZSA 3E3LA 1RAEA 1EVIA 4HFNA 4RHXA 5AWFC 4ZKEA 1OIVA 2VXYA 4M8KA 1YA8A 1JLMA 1F38A 9GPBA 1FSSA 1W85B 2C9ZA 1NX6A 4X7MA 1QG2A 3RHSA 4ECAA 1XRRA 2NP7A 1R00A 4UAJA 4IGFA 1XTRA 1FYXA 1LB1B 3DEIA 3MGCA 1XRMA 4UJ3A 4WCFB 3W7AA 4B79A 1F5SA 1LPBB 3UJBA 3C7DB 4IH1A 2X23A 3GFQA 5IC5A 5JASA 2WA2A 3CLRC 2CT8A 3G7NA 3E7XA 4B7ZA 5JXGA 1FTGA 2FZLA 1FYFA 1NYTA 1MC4A 3E1KA 4NY1A 4AF8A 2NTYC 4KWIA 2G9NA 4C06A 3CZMA 5C8YB 1NM5C 3L6DA 5DXAA 3MZ0A 3PX7A 3CURA 4WOPA 3ZHTA 4QJ3A 1KJIA 3HYLA 2COUA 2G4CA 1WNFA 3FYTA 2J0UA 3ODGA 4K81B 4OY3A 4WFIA 1MDFA 2D2XA 3D9QX 3NHBA 5K8IA 1P73A 3WLRA 3F74A 4R9RA 3TMYA 4F96A 2Q0SA 3Q9UA 3CUVA 3S2IA 3U9TA 1GQRA 4OQZA 1FRVA 1ZYUA 2XTZA 4KLCA 1GFSA 3MMZA 5KNDH 3LUKA 2O8EB 1A9XA 3NMUF 1OBOA 2P77A 3FDJA 5I3ZA 1A8SA 2VPPA 3IALA 2JAHA 1VDMA 2OA0A 4I2VA 3IGFA 5ELLA 3SJUA 4A8JA 1RWNA 4KXFB 2MWMA 1UCFA 4FXOA 4BVHA 1I10A 1O7JA 4C2BA 2EEZA 3PEFA 3NOQA 3KKLA 4JUAA 5A5FA 1LC0A 2QM7A 2OHFA 5BN5A 1RXYA 2IXFA 2CHQA 4LX8A 2BGKA 1RPNA 3T0FA 1U31A 3C1TA 4LOKA 3TBFA 4L9WA 4MEBA 3FDZA 3GLIE 1FXWF 4QTTB 4AWAA 2GTHA 4RZIA 3GFPA 4KVZA 4FBMA 1NDHA 1F0NA 1XVAA 2XGSA 3C5WP 3FPHA 4O02B 3SLKA 1JAIA 5KYTA 1T3ZA 2WIDA 3LNCA 3ZD6A 2Y1GA 1SCKA 2K4MA 1DWOA 2O1EA 4EJMA 4LGVA 2V7QD 3DHNA 2E85A 5KYXB 2FXVA 1BFUA 2JZOA 1J07A 4ZAWA 1KF0A 3AHJA 1PZNA 1FQOA 1Z73A 3NETA 3QG5A 4BEVA 1EK0A 3AH8A 4B3IA 1BKYA 1Q7BA 3IKJA 1OR8A 1ACJA 4G5GA 4ZV9A 2XD4A 2M6KA 7MDHA 4D82A 4BDSA 3W4IA 1P1IA 1QFJA 3RLFA 2Q5LA 3KQMA 3LT2A 2PO7A 1P5HA 3VV3A 3ZKWA 2P6RA 3H2HA 1QK5A 1P0QA 5LZ4A 1MRZA 2HWWA 1KAHA 3E18A 2M6SA 3FOEC 2JVKA 3BRCA 4UCWA 3GCXA 3UW3A 3K0CC 4K26A 5SY6A 4CM8A 4W5OA 4FD3A 4QGHA 2X1VA 1VECA 3PFNA 2G63A 4Q1AA 2H0QA 2KBFA 4UDYX 1Q7EA 4LRXA 1ZH2A 1EFLA 3F5QA 1Y89A 1GRQA 1P8JA 1KOJA 2K6GA 1YZTA 4G3XA 3RUFA 4NPCA 4EGJA 4CKZA 1H3FA 1ETHA 1QG4A 1UBMS 5TQ2A 1ESEA 3D3NA 2Z43A 3WNVA 2PH5A 3FI0A 1P8AA 1V6CA 4IYRA 5LQAA 4FCVA 2A5FA 5KNCD 3W1EA 2R11A 1GZ5A 2IYFA 2B78A 4IVRA 1QVRA 3KLMX 1R50A 4CV1A 3T5CA 1P2GA 3I1FA 3JCZA 2PNJA 1F6BA 3RSQA 1CF4A 1YULA 4EY4A 1L5FA 1VCHA 5JSZB 8OHMA 3G17A 3AB7A 1ZGAA 3R6TA 5AK3A 4GR4A 3IILA 5DM0A 4GGOA 4CZ2A 4XIJA 5E3IA 1N9GA 3A1TA 3A1SA 4Q7EA 3X1ZA 3AYZB 3Q3EA 4LMRA 1S2MA 3A6GA 3BK7A 5IH3A 1OWMA 1XPOA 3K0HA 4N6OA 3RTAA 3DXXA 1V47A 1M75A 1MBZA 3N2IA 4HH0A 4BWVA 2JLSA 3KVRA 2H3EA 4W1PA 4RUKA 1VIDA 1WABA 1YQTA 1NZJA 3CUTA 3E5MA 3EW9A 4JMLA 3U3OA 2JHGA 5AW6A 4Q9HA 4E09A 4YCJA 5IBPA 3DCNA 4UNSA 1I5RA 5HJ5A 1UQRA 4IZHA 3ZK8A 3SC6A 1KL7A 4K9PA 1DIRA 3FYDA 1J42A 1P2DA 3OLXA 3DE6X 4ARCA 5JDCA 5TMBA 3DKVA 2LD4A 2NAFA 2XI4A 3MTGA 2VFAA 4PQYA 2FSSA 5FQNA 2ZBVA 3KE9A 4A0RA 1FFSA 1U2DA 4OGWA 5EIXA 1DQYA 1RAGA 3K9BA 5K3FB 2RGYA 3HKEA 3Q40A 2CXHA 3ZE8A 5A6SA 2PS3A 2UVPB 5FHQA 2JLRA 3WZMA 2W11A 3D8SA 5AJTA 3UCFA 2HFKA 3WZ2A 3Q7QA 3SGLA 5IXYA 4B7UA 1EWVA 1QZXA 2FSVC 3G0GA 1Q3KA 5ADWA 2LR0A 3IAXA 4PSKA 3ICCA 2HSJA 2BR5A 4DSTA 4RVNA 1BDJA 4CEHA 3IAS6 4LGYA 2VTBA 4M7RA 5CDGA 3USZA 4OATA 2QL9A 4M0DA 3A9UA 4N0DA 1IQRA 2EL9A 1K6IA 2D4AA 1IFXA 5CM9C 2ZYAA 1GLVA 2W8ZA 1Q17A 4A6EA 5A3QA 2RGCA 2VDNB 3MILA 5DTJA 3I4FA 4ZA2A 3WR5A 1V11A 4I99A 1P44A 1DBRA 3OD5A 3IIIA 2HMWA 2PX2A 3JRNA 4FHEA 4KO2S 1E1LA 1JI3A 1V3TA 1WXHA 3V8BA 1ISGA 4PX2A 1K97A 1KVQA 1Y7HA 3D2AA 3CLHA 3CLUC 3EA5A 5CAEA 4II2A 3PQDA 5I45A 3C39A 1EDEA 1KVTA 1MAVA 2VC2B 1Q11A 3DOHA 4KQCA 3WDSA 1DRWA 2QPAA 5DNDA 1KU0A 1XTKA 5IAGA 3FPJA 1VL1A 1RXIA 1SZJG 2XECA 1QJCA 3Q9LA 1HDYA 5JCOC 5ALFA 2HXYA 4PZEA 3ZWDA 4TMYA 3W4KA 4B3BA 4ENTA 2VSQA 5A3SA 3ABRB 5H4GA 1LF5A 1R10A 1YASA 2GNPA 1K6JA 1DLIA 1XTPA 4LOLA 4QO8A 3F98A 2FFBA 4K6HA 4DCOA 3BILA 4XLZA 1LZKA 1ZN7A 1D03A 4QLOA 4AJ4A 3GJZA 5KYUB 5BWLA 3OJWA 1KJ8A 1RE1A 3NASA 1TAQA 1DDOA 5SY9A 2VHQA 1ZNZA 1ATZA 2IUUA 1O4VA 3IDQA 4R40A 1W2GA 3SZGA 4ZJYA 4JU9A 4N3AA 3O8QB 4N39A 3R9IA 1RS0A 4E5NA 3U7HB 2I9PA 1BHSA 5T6MA 3OTGA 4DZRA 5KWJA 2LW7A 1Z0DA 3HRIA 1EQAA 2QSJA 2R6FA 2YHBA 1TA0A 3HC7A 2Q5EA 2VDPB 5B2EA 3TNJA 3DCYA 4DCPA 3VC1A 2W2KB 1JHQA 1EBFA 3WAKA 2XAAA 2GD6A 1M7HA 2HADA 2R00A 1E60A 3SJ7A 4ZKDA 1JQJC 4UQPA 2ATEA 3A05A 3PSAA 4I3HA 3IT0A 2M6LA 3NBQA 1WBJB 2OV2A 1YR2A 5KQLA 4DARA 4GKJB 4X1KB 3FDXA 4GEKA 4HQKA 3BXGA 4D3FA 1KAQA 1GAXA 4RYDA 4JLDA 3M33A 2O3TA 2WK1A 2HO5A 2HV8A 2BTQB 1K5DA 3U4IA 2ZYVX 5ITZA 4ZANA 4DV6B 1T5SA 4RVFA 3VMMA 2CVZA 1ZOOA 4HDMA 3W05A 4YONB 4WCFC 1H8ED 3UQZA 3DR3A 1J2EA 1Q50A 3RUHA 1DTWB 3FGNA 3PS9A 1NSTA 5F76A 5CBKA 4BUJA 4KO1S 4HWGA 2JI9A 4B7XA 2E4YA 3KUKA 4W63A 3EWAA 3O8CA 3HNRA 2J0SA 1FUEA 2ZE8A 5L3RA 3LQ1A 4P4NA 4Q9DA 3VBEA 1JRLA 4Q18A 3ZW9A 1PEAA 3NFRA 1KJJA 3AF2A 3K4HA 3RYFB 2C5SA 4DLSA 5K3OA 4GXQA 3MWKA 3PUYA 4NU0A 1Z0KA 2XA1A 1D6SA 1A88A 1QH8B 3DTNA 3KOYA 5EQJB 4AZTA 3HKCB 3M5DA 1NBEA 3GGOA 3B6IA 2YY6A 4LQLA 1SD1A 4C87A 3I6ZA 5EFOA 1C7FA 2IY7A 1PSWA 3HXLA 1K8ZB 1GG9A 3OUTA 1OROA 3R3HA 4GYKA 5HKKD 4QOFA 1E1CB 1UMBB 5EWMA 4H3SA 4O4LB 2VH2A 1XZFA 5AI5A 3ENNA 4LQDA 1SMKA 4L8FA 1NIJA 1R5NA 2H54A 4HI0E 1Y8QB 4Q7KA 3RIGA 1G8YA 5BV8A 1CBUA 2ICAA 2EYUA 3QXCA 4GS5A 4NZMA 2J4DA 4GGMX 4ZRDA 1L5NA 5JV5A 2EG9A 4HQ0A 4YASA 3NBMA 1EUYA 1YU9A 4DBZA 1QO0A 3AQ4A 4QQ8A 4MA0A 4D0SA 1ODTC 4C2TA 1OXBB 3L0PA 1XCMA 3OH8A 4BGDA 3UPUA 1C9YA 1XCBA 2OAGA 3I01A 3NC1C 4RK6A 4AF7A 1R8QA 2H31A 2BMDA 1UXKA 3T4PA 3TECE 4QELA 4KCGA 3WK8A 4FT4A 5BSRA 3TE6A 4ZGGA 2XVMA 1S1CA 2D1RA 4ZT3A 2IXTA 3HYSA 2GRAA 2ZWAA 1EGMB 3MRTA 3V7UA 2J3IA 4D8YA 4UBJA 1IVNA 1K4KA 3S44A 3PJFA 1OFVA 4BUCA 3U6BA 4RJ2A 2GPYA 2IYWA 4QPNA 4RAOA 4BGVA 3CRZA 4ER3A 2RB5A 1Y1QA 3VUFA 3G8YA 3Q12A 4BNFA 2JRLA 3WYFA 4NXNB 1C1XB 2R8EA 1I4WA 4DIDA 2GK4A 5GONA 1Y4SA 1Y48E 4IIJB 1W49A 1EUDB 4V0MA 4CBVA 5LP6F 1O5TA 2QXTA 3W5SA 4DMRA 1NV9A 2BHTA 3C8MA 3KVVA 5LMCA 4FOOA 5LB4A 2BKVA 5AUNB 1E6LA 3HCWA 3JRXA 2WWTA 4OA8A 5CK4A 1ZU5A 3U48A 2UXDB 1X1TA 3JVEA 4I9NA 4PTYA 3V4LA 3F67A 2XA9A 3WGKA 3OJFA 5L4NA 2VUHB 1PJ3A 1NSYA 5CD1A 2RI0A 2WFLA 5JMOA 2ZM6B 4FQ5A 4RZHA 4G24A 1K8QA 3CZCA 5E6UB 2WNSA 2ZUEA 4NCKA 2W6NA 4KREA 2QSYA 3QVWA 4E5YA 1BWPA 3MJ4A 1UKAA 2JJ1D 3PDIB 3FF1A 4HDOB 4JX9A 3EXFA 4YCAA 3VTAA 3OJCA 2EBHX 2B2CA 3UWKA 5IKEA 2ZJ1A 2BFDA 1U6JA 2H5EA 4OQ4A 4FSXA 1Y7LA 3CRNA 1OREA 1FVFA 3VPFA 4N18A 5L7WA 3A70A 1U99A 3JQ7A 3EMDA 3R0QA 4GI5A 1QYDA 2ZI6A 3FCYA 4JWTA 4KYVA 2Q4OA 2OCAA 4YCSA 4AMVA 3C3DA 3KK0A 3WL5A 1ZKDA 1K4MA 4RENA 2PMEA 3OAAD 3E9NA 3C6YA 4A8TA 2VOJA 3GUZA 1JMKC 3NIDB 3IBYA 3ZWAA 2FETA 3UWSA 4CFZA 4CIXA 3K9NA 4AKSA 2QI9C 5FADA 3ER9A 3JWEA 4L6CA 4XSGA 1FYVA 3NUZA 3EGWA 5DOZA 4A0SA 5J2UF 4AZWA 4WA7A 4OK5A 3CZAA 4PYMA 3NHFA 2PFSA 3F8TA 4FHZA 3PC8C 1JX6A 2R0QC 4ERNA 3GLRA 2DWOA 4D8TA 4DMHA 3H3JA 3G79A 4LJKA 5ER9A 3PC6A 4AM8A 5HRUA 1PI3A 1HQYE 5EHXA 4QU5A 3TLMA 3RCBA 1EM8A 4P93A 3IT3A 2OXIA 1GN8A 4HSEA 1GZUA 4HT3B 3DEZA 3S81A 2P6UA 1K89A 2VYNA 2WD9A 1IY0A 2RARA 3AEYA 2D3TA 3T3GA 3IP8A 4BZZA 3PF9A 4H9GA 4X7RA 4QKQA 3R0VA 1CJMA 5C9ZA 5ALNA 2H4JA 3K0BA 3HADA 4KJZA 2Y0BA 1BX1A 1UBTS 4OHUA 1HNXB 4FCTA 3WA6A 1KTVA 5HQTA 1XMIA 2D74A 5B6PA 1L1RA 3C5HA 1FS6A 1RPAA 1SCBA 2EJWA 3T34A 3KD3A 3V8NA 1WXFA 1YQ9A 3LS2A 3ZCUA 1NJ2A 2GHIA 4EKIA 2BFFB 2PEYA 1OSNA 2IELA 5E7IA 5IKOA 3RT9A 1P5RA 4JQSA 2C4NA 1PGNA 5FAKA 4MI3A 3AO0B 4EI7A 4GI2A 3GLQA 5AXDA 5L3VA 5TVGA 2R84A 3WXMA 1YFJA 2ZXUA 3L5OA 3T5AA 1J0EA 1JE1A 4PZ0A 2YQZA 2CDAA 2HK6A 3M6AA 4M54A 4HN2A 5CXSA 3V80A 1CB0A 1ADJA 4HLCA 3RC7A 4YRAA 1VB3A 3ESDA 4WXPA 1F51E 3PPWA 1JG4A 4L4ZA 1YO6A 2TECE 3B7PA 4G5QA 4PXAA 1H5UA 2G1AA 2FA9A 4KG7A 3RVSA 2O7NA 2HW8A 2CYCA 1LJUA 1VC2A 2AG1A 2R79A 2E9SA 2YXNA 3FJOA 3D1LA 4KQHA 1ZH4A 2Q1XA 4WBXC 1TM3E 2OBMA 3P0EA 1KRHA 4YYZA 5IBRA 2RHDA 3UKJA 3AL3A 3GEPA 3U6KA 4UM9B 4MO2A 4CMIA 5EJ8A 4J2HA 3OM1A 1FLDA 4PPFA 1X2BA 4PN7A 2VDMB 4XZ3A 2W2QA 5LJIA 1YAHA 3STWA 2GAIA 3OP4A 4U3JB 4MDEA 3RWBA 3D1JA 2JFUA 3C8HA 5JROA 1YRBA 4J9VA 4V02A 3X2SA 2B0JA 1EESA 1F0PA 1ODIA 2IYRA 4IEEA 4R4JA 4R31A 4H7FA 4Z9BA 4ZALA 2GJ9A 3U7EB 1KOFA 2Z58A 1PV1A 3BN3A 3QEMA 2WJ4A 2BP7A 2Z4SA 3QF4B 5BQPA 2W6IA 2C9OA 3KPWA 3LGXA 4UTOA 5CVJA 1SH7A 1FQKA 5SY4A 4HAUA 2SKDA 2DBRA 4YRPA 4R6WA 4R7TA 1BCSA 3P2YA 3CT4A 4F84A 1Y3CE 1CX9B 1W48A 4BASA 1Y3FE 3FZYA 3KG2A 4DOMA 3QLUA 3TOSA 1CQJB 2LDBA 3PGKA 1ID1A 1E2PA 1W4LA 4Q39A 4U2CA 1RI4A 2ZU6A 4EGSA 2V9CA 2D7DA 1Z8NA 3BXFA 3L0OA 2BISA 3PJDA 1U3GA 1SG6A 3JD1A 5IN5A 2PSDA 3T4EA 3UGTA 4Q4AB 4E3ZA 3OEEA 5B3KA 4GZ3A 1J8VA 2FHSA 4LY3A 4WXHA 4F85A 3V3TA 1J8QA 2HJ9A 4YBZA 1XRLA 3TWOA 2HGZA 3T35A 4B33A 2D0PB 3AY3A 4C6TA 2IPAB 3PE4A 2YFHA 3E82A 3L8CA 4BEJA 1G3IA 3G5MA 3ITNA 5LKRA 2VSOA 5IT5A 4DV7B 4TMKA 1V5IA 1N3LA 2FP4A 3SZ3A 1S2IA 1OPRA 4GOLD 3PEEA 1KJZA 2V8OA 5KKAA 3VHLB 4AJLA 4EEXA 2V6GA 1UPAA 1LBEA 2BBTA 2XUHA 5HF8A 2UUCB 4HGPA 3JYHA 5ERGB 5AIBA 1DCFA 2GZMA 3RABA 2F7SA 4LY9A 1PTKA 1HH4A 4TGLA 4F1KA 2I67A 2P8JA 3ZQUA 3COPA 3FPCA 1F7UA 3IMCA 1YQUA 4EKEA 4JUCA 2A6PA 5A71A 2OVFA 2PPVA 4GPIB 3PDUA 4XR9A 3GYGA 1XLUA 3T5BA 5E7QA 1T3TA 1JKFA 1Z0FA 1N6HA 3P9NA 1VHLA 1EIWA 1BQ4A 1KI8A 1M1UA 5ALOA 4DV3B 3ZC3A 3HYRA 1DFGA 5JVDA 3ZGLA 4BWYA 3QV2A 1NW4A 1QF9A 3FCEA 4UVHA 3L4KA 1KI7A 3IJPA 3H11A 3R6WA 4JJKA 4JI1B 5TGDA 4CWAA 1E7WA 1JU3A 2C2ZA 3QX9A 3QW2A 4HXEB 5H70A 1NY6A 3W5JA 2HU7A 2JIRA 4GSYA 4MWCA 5DX1A 1NBME 1PJAA 1N6RA 2GF9A 3WHPA 1UMCA 4PC3A 1DU4A 2EWVA 4G5XA 1MA3A 3RUEA 4UUNA 2G04A 4TOIA 2Y92A 2C83A 4BLOA 4Z4QA 1DC6A 1XYYA 1NPDA 2FJPA 2PBLA 3O8LA 4LNUB 4NV1A 4YJ3A 5G40A 1XLTC 1B74A 4MQ6A 5REQA 3R8CA 1QONA 3K5WA 2UYCA 5FV7A 4X44A 1A9QA 2WEKA 1JHZA 3IBGA 1G59A 5BRJA 2QJTA 4QPZA 5DHAA 3ADDA 1B8UA 3BS4A 3FZEA 3RAGA 3FGOA 4QT4A 3LNTA 2ZJOA 4U9UA 4GL4A 4X8MA 5JQWA 3DSRA 3Q72A 4AZ3B 1RYMA 4KDCA 4PLYA 5ICFA 3AONB 4I50F 1NMYA 4MUHA 2LP4Y 2JGEA 5L6MB 4N82A 1ZWKA 4FNAA 2HL6A 3HJBA 4FMCB 5DISB 3IPXA 4X0EA 3F6RA 2QZ9A 2EG5A 2RHWA 4WLFA 4FYYA 3TRHA 3OM8A 1OWPA 2Q5QA 5L51A 1WBBA 3TKYA 1ZAKA 2AJCA 2VP5A 5FWXB 4JUIA 4AJNA 4NCXA 4X6XA 5CGQB 3JWGA 3QBEA 5FUVA 5K6AC 2O3RA 4L28A 1V1JA 3IVXA 1XZHA 2B6HA 3EYWA 2I3BA 3A2MA 1OTXA 1X7YB 1FMTA 1ULUA 5ICEA 3E0QA 2ZSAA 3K8ZA 3DBOB 3UM9A 3R8XA 4RTMA 2O06A 1E99A 5IULC 4FW8A 3EOZA 2JKVA 1MB2A 1YQDA 3EXHA 4G0NA 3DS8A 3RRNA 4BNDB 3RTEA 1TKBA 4Z2AA 4JI0B 1Z4QA 4E22A 3ITDA 3ASUA 4BCCA 2HMYB 1MEJA 1I0LA 2OHOA 3AFMA 3VQTA 5HS4A 4K0KB 5EUBA 1T15A 1UC8A 2Q50A 4B2IA 1SELA 4UUAA 1OPXA 4ND1A 2BFCB 4HDNB 4PPQA 3ZXUB 1I4DD 2GPWA 2IRWA 1UH5A 2EYQA 3WB9A 1R4NA 1O95A 1DWUA 4OQNA 4JKOA 3QUQA 4IO0A 2Q5OA 3TQRA 3EJWA 4OMUA 3ZZNA 4OKNA 1UDBA 1II9A 3C3CA 1NIPA 3O4IA 4LSWA 4MUBA 5HZGA 4BRWA 3D7SA 4LJAA 5K2OA 4DCUA 1FDVA 4OFZA 4DV2B 1ILWA 1B43A 4KRXA 3D6TB 3K32A 3CUUA 1RZ3A 3K2QA 3WKBA 5JMWA 2FPGA 1Z06A 1Z0ZA 1IZ7A 3ONDA 3QI7A 3MN1A 4H3VA 5I4CA 4BWGA 5KHLB 2C7QA 4TRJA 2ISSD 4NCNA 4X94A 4BATA 4HDAA 1E32A 4L8GA 2OO5C 1IEVA 4FMPA 1EVEA 4BZPA 3H1PA 1KMQA 2B98A 4H7PA 4YGXB 5ADVA 1WD5A 3EEQA 3QKWA 3Q7SA 2VXBA 4RFSA 4AULA 3W34A 3K35A 3N5CA 2Z6UA 3R0JA 3ZLUA 4RVSA 3UW1A 4DNOA 2HA3A 3AUAA 3KPYA 3OU6A 4N41A 1L7OA 1DARA 2QTWB 3ZDAA 2QD4A 1E0JA 5DN9A 1G20B 5K3CA 1W4AA 3URMA 1BN6A 3AL2A 1RWPA 1XEAA 3UHPA 5KEIA 2WYWA 2WUVA 3S29A 5KSWB 1NXSA 2RK6A 4ON9A 2BBOA 2KI5A 3FAKA 4L95C 1S4QA 3DQQA 4B83A 5HOEA 5KO2A 4ZCPA 1N4AA 3RRMA 3T52A 4QUJA 4OK3A 3KQOA 4J3NA 3A4NA 4OHKA 4XM1A 3IE2A 1TU3A 2HK7A 5EHNA 1EFVA 4HQFA 4R1OA 2QAIA 5BY2A 3GO4A 3JALB 1AOXA 2JGDA 1M1XB 2PSFA 1NW5A 2G17A 1G5IA 3GUCA 3ZYZA 2F62A 4BNJA 2G5CA 2CNLA 4REMA 3PKJA 4B84A 4CN9A 1WXDA 4D26A 1XLVA 5ESXA 2BE7A 2C4HA 3H19A 4AMYA 3CC8A 2FWNA 1JFRA 5CT8A 3HCEA 2X0DA 1XMJA 3ITKA 1K6MA 1XVIA 2A30A 1UEJA 3G2LA 1M5RA 2Q6LA 1B15A 1S1MA 1WCV1 5EJIA 3L4BA 2V5UA 2DU8A 2J3JA 3A6HA 4R7GA 4ZDWA 1PG5A 1JP7A 4XVRA 2VQ3A 3A11A 3N74A 4U7TB 1XZEA 4URVR 2A0FA 5FEUA 4KFTA 1PUIA 4ZOLB 2OLJA 3FWKA 4RPCA 4MH0R 1KY3A 1QGYA 1XFAA 3CWQA 2BM0A 4XXHA 3VDNB 3DE7X 3D4OA 2JC3A 4OH1A 3L8HA 3ANSA 2DQ4A 3W5UA 4YP5A 1FDWA 2Z8XA 1XU9A 3FDIA 3M1IA 4NMLA 3QKUA 2DR3A 2ZJYA 3WWYA 1PW7A 2ZWOA 5D6OA 1EZ4A 1XZDA 2DUNA 1SK9A 4ZAXA 1GT6A 2QUJA 4PG7A 3V9AA 3K1ZA 1KI6A 4BPRA 1XTZA 4KC0A 1PWHA 1R8YA 1ZSYA 5DI3B 4HJRA 2ZREA 2Q4TA 5BURA 1IHOA 1RACA 3COJA 2VVTA 3LDUA 2BEKA 1IIRA 1RRVA 3MTEA 1YDHA 5DOVA 1KWKA 1TF7A 4RLSA 7ADHA 1WXGA 2WWYA 4DM7A 4MZDA 4WEOA 5FO1A 1BMDA 5JJIA 1LV8A 4DG8A 5B7NA 3D81A 3O73A 2YXPX 3Q10A 3V3KA 2NVBA 2X9NA 2OHIA 2XOXA 1YQGA 2BI7A 4W82A 2PRKA 1D1SA 4YROA 1MH9A 4RCZA 2PJDA 4XFDA 3RWMB 4BFSA 1NULA 4AMUA 3K9CA 2QTLA 1EX6A 1DELA 3WP1B 1RJDA 1XIVA 2I4TA 2UYQA 2Z9DA 4KOAA 1KEUA 1KDRA 2AJLI 4GP7A 4HUJA 3A6PC 1GCUA 3V8EA 1HURA 1EVZA 4KXXA 2A9FA 3T9DA 2BFBB 3U60B 1Z34A 1N8TA 5C4MA 1KQFA 1SBCA 1XMXA 3MNFA 5JQGA 1T1SA 1U0TA 3EGXA 3LDFA 1AA9A 1MQSA 5INTA 1KWGA 2JIMA 5FPKA 1Q15A 3B3AA 3AERA 3FFXA 4W7IA 4C7OA 4Y9DA 2DPYA 2AYZA 4YAEA 1DRUA 2M2IA 1N6PA 2BFNA 3UK6A 4CEHB 5IAEA 3I3OA 1SUCA 4DANA 4BFYA 3P4YA 5IMBA 3ZWCA 4TXLA 3ZV4A 821PA 1VPTA 4HN9A 4MPRA 1AGYA 3WP0A 4M0FA 4NONA 1A2QA 4FMDB 1E2UA 4J2OA 5U4QA 1AHIA 2B1JA 1FXSA 1GGJA 2AYYA 2COKA 4KGDA 3NCTA 1AQUA 2IOFK 5DE3A 1PFWA 2HA0A 2ATXA 1XNQB 2B2XA 5BNFA 2N75A 2G83A 4W7HA 4DBVO 3JV7A 3D3QA 4HDCA 4M37A 1VKNA 2ZFUA 3EC2A 1KNXA 3V00A 4COKA 2MDTA 4YP6A 1JEOA 5CX1A 4YWHA 4IDDA 4XH9B 3TIIA 1VKRA 2IVFA 3BWDD 4GVXA 4AN1A 3ZLVA 2KLBA 4JVSB 4Z3OA 1WW8A 4UNNA 3QEBZ 1FFXA 5CEJA 1BFDA 4PNHA 1D6MA 4JIMA 2KJQA 4G37A 2NUAA 1M2EA 2X6RA 3CQ9A 4IIGA 5EIAA 1EFHA 3Q2KA 4JL8A 1JKIA 4L5JA 4BRZA 1YCGA 3CUEF 4MR9B 3U3MA 4EX7A 1C9DB 5JY1A 4EO9A 3U39A 2C94A 4PGHA 4TM7A 5HZKA 3U62A 3ZWMA 5F52A 1TYBE 1P80A 1VL8A 1G21A 2IHKA 3B6MA 3PXDA 5FI0B 1WQ4A 5TF4A 2I22A 2IBMA 4QPDA 3WGUA 1LVHA 3V4VB 3A4YA 3TS1A 3ZXIA 4D02A 1BXRB 2OORA 3JQAA 1QX3A 1UL1X 1GSHA 1QO0D 3DZIA 3G23A 3HY6A 2BKAA 3BDAA 4Q15A 1WVGA 5ALQA 3UFXA 3CNNA 2BR3A 4HNHA 4BQEA 2BFMA 1OU0A 1XK6A 4Q7JB 3SR3A 1E18A 1GJRA 3AXSA 1TI7A 3FMOB 1SOAA 4IH9A 3UG6A 5EHZA 2DQYA 4RQBA 3RYHB 1W96A 1DEAA 2EW8A 1SC4A 1WZCA 1CRLA 2NU8A 3MGKA 3ENVA 3HH8A 4N0PA 2O8DA 3CEMA 5CFRA 3CX7A 3F9CA 2QN6A 1TQHA 2EKBA 1EE1A 1ZNWA 1V16B 2Z2ZA 3JTMA 3I5UA 2UZ0A 1Z6XA 4BNGA 2UDPA 1XKXA 1FEZA 2WILA 1R0KA 2IOFA 3OZRA 4CTKA 2PN1A 5CDUA 1RYZA 4BX2A 1HDXA 5LMNB 5FOWA 5JD5A 1U8XX 3I4CA 2CNWA 2VJPA 4X84A 3QQPA 2OHXA 1U28A 2XRZA 3I92A 4WXEA 4E5UA 2GA8A 3K72B 1RLUA 1FU4A 2Q0XA 4AUEA 1W6RA 3CW8X 5BW6B 4PX9A 4YJ2B 5IXJA 1E0AA 3HCNA 4LVNA 4RY0A 3KNZA 1SXJE 2NZVG 3D0OA 3V2IA 3IVAA 1OV4A 1Y8RA 1QOZA 5HJ7A 1JH9A 1TK3A 1W1WA 4Z2YA 4JELA 4Z7NB 4L4UA 1JXQA 5TS3A 3TZLA 2OMEA 4LCJA 3E8XA 1GA1A 5HILA 1B0ZA 1Q2UA 2C5BA 3A3KA 3B36A 4NCHA 1KK2A 4IDGA 1Z4OA 2H1HA 4WZBB 2I2AA 3EODA 1KAGA 3PC4A 1H0HA 4BJHB 1SZPA 5IZCA 1QP0A 2VP0A 2GN1A 4QUIA 1FC0A 2CLEB 4FI3C 5TXGA 1RI2A 1IIBA 3EPHA 4FDUA 4MCJA 2LRHA 2ADMA 3FGPA 2TMYA 4OGGA 3ZV6A 3LZ6A 4NPAA 3PD1A 2FWRA 2FMXA 4JCCA 3E3AA 3ESAA 5DULA 4P32A 1L5ZA 5JWOA 3KQPA 1CEYA 4BIIA 2Z4RA 1LBIA 1E2LA 2P5YA 1LPAB 4YRSA 1PBNA 2EZUA 3G3EA 5CB4B 1EP9A 3BIFA 3MRXA 4KITB 4K9NA 3WWOA 2AHOA 1BZYA 1KH2A 1Z15A 2B0CA 4I6GA 3PXXA 2VP3A 2PYDA 4GBJA 1VPEA 1Q57A 4GEGA 3COVA 2OD2A 4KXLA 3R40A 2J45A 2YL2A 3S1AA 2HGSA 4P7BA 3SU8A 1Y6GA 3VVMA 5IXSA 1CUAA 2GYVA 4FNMA 3BAFA 3LYAA 4XUGB 4EB6A 1L8AA 3FCCA 4MO9A 4QFMA 3P27A 2OO7A 2H2HA 2VP2A 3OCWA 5CG2A 2XCRB 4MRMB 2XDQA 3LRTA 2X0JA 3OIVA 2FWMX 5BR8B 3DEKA 4Q02A 4HVCA 2LDXA 5J2TF 4FK8A 2PGNA 3FWPA 1ZU4A 3PK0A 4RELA 3CKLA 1Q12A 2WJVA 3AF3A 4AY5A 2QMEA 2A5LA 5THQA 3U4HA 8MHTA 1ZL2A 5L3ZA 5BNWA 4IKOA 2WJPA 3QVTA 2Z8YA 1FX1A 4O2AF 2OYRA 2IU3A 5JEEA 2FZWA 4Y6SA 2J87A 3G0IA 3DBLA 1U2GA 4CU5A 2VYND 3T1OA 3VPSA 5K3AA 1PNOA 1RWVA 4YMLA 1G9XA 2IY9A 3V1NA 1U2SA 2C8JA 2PUAA 3G6WA 4MV8A 3LW7A 3O47A 4LMPA 1I0IA 4TZ6A 4IHJF 2GAOA 1AKMA 2WMYA 3EISA 1L5GB 4EHHA 2TMKA 2IEZA 3QFTA 4II3A 2XDAA 1A1SA 8AT1A 5IDWA 4DQXA 1AMOA 1AV7A 1TUGA 3KQVA 5ULLA 2JA2A 2PKQP 2JCXA 5FEMA 4OJKA 3THRA 4DAEA 1IPFA 2RSLA 3KOWA 2FE4A 4X64B 3H9GA 4B31A 1SVMA 4LXUA 2AEJA 1UZAA 4P81A 5JU6A 4TN1A 3GP3A 3EH2A 1MGPA 2YJ5A 2ENUA 3C5VA 3R5HA 1SKMA 5FO0A 1BKDR 4JXZA 5HXAA 1FRNA 3UKOA 4O8ZA 2ZS7A 5TE9A 3P1JA 1O8CA 2R47A 2YBDA 3NH6A 3TQIA 5EZQA 3TZHA 10MHA 3I01M 1A8IA 3UAWA 1VI6A 1A5SB 3SZRA 1IZYA 3F96A 2HXGA 2IYXA 3DUFB 1A9PA 3PC7A 4C30A 2Q4DA 1W1IA 2A94A 2PGOA 2QRKA 4NE7A 3UV7A 3ZOKA 5HF6A 4F21A 3AW8A 3KCQA 3V8MA 1BGXT 2OZLB 2V6JA 3EBPA 4EH1A 1KOGA 3G5UA 4G1MB 4KVFA 5CCXA 4MGKR 1BMQA 4P22A 1TGVA 3PFCA 2QY6A 1O6GA 2WMDA 3VPHA 1RAHA 2FPXA 5BSTA 4OAOA 4UU1A 4PGFA 3E2PA 2BCGY 3MLBA 3A14A 1FA9A 3V7YA 3DVAB 2JIQA 1RSZA 3EZ6A 3MRVA 3HCCA 3LG2A 4ARSA 1I1OA 3M7IA 4JD5A 3CJRA 3ZOZA 1GRRA 2IYPA 3WJAA 4X54A 3WHIA 2RAVA 3MWJA 3VPDA 4PR0A 3F8SA 1KIAA 3CVYA 1W75A 1NR5A 4IHKA 2V5AA 3GZNB 5AW2A 1WCYA 2YWEA 3D6FA 4OXXA 4KYTA 3AUKA 4ETMA 3GX1A 1U2ZA 3VFDA 5KJ1A 4EJSA 5DNWA 5TPWA 5K01A 4P0PB 3FTNA 4AQYB 2LE0A 2VZ8A 5L95A 2R4TA 1PLKA 2CVPA 2VP9A 2OG1A 2Q3HA 1UR5A 3CRVA 3BRWA 3GJ3A 4HVAA 4FB4A 3OQHA 1HZZA 3NBUA 1V5WA 3LPMA 1DBPA 5HHTA 1LPPA 1FDIA 3EZGA 1IUOA 3QVSA 5C8DA 1ZAYA 3E9DA 3KEFA 4DHEA 4UXJA 4DDHA 2HWUA 1J5EB 4UMDA 4JLKA 4RMJA 4R1UA 3Q5EA 4HF7A 2VJOA 3OEED 4Z3DA 2PKXA 3FIUA 3NVKI 1QFZA 2CEAA 1AUPA 4JEMA 4BC1A 4HY3A 5TEWA 3M1AA 1L6IA 3VR2D 1K8RA 5BPFA 1P7CA 5CVCA 2X3YA 3D6VA 2HT6A 3WXBA 1R6VA 4Y2QA 1GWNA 5CFLA 1T1RA 4FYWA 2VATA 1QAQA 4OOEA 4YRCA 1UM9B 1M2JA 1UKEA 1DL5A 2OB2A 3ACCA 3OCYA 3W8EA 3W3AH 1WCIA 1REQB 3WL7A 1GKKA 5CLJA 1VDZA 2FW6A 3R7LA 3UOWA 3KT3A 2EZTA 4O25A 3CLTC 2R6JA 5AVOA 1HNNA 2DFKB 4G9EA 2BEVB 2DFVA 4V03A 5JNRA 4WCVA 1IMJA 2F8TA 4GE0A 3DBHB 4B81A 2N42A 4R81A 2PM8A 5F2EA 2BN4A 2W6ZA 3LZCA 1PZFA 1SOVA 5KPDA 1NYLA 3IL2A 1MJFA 2RGGA 4H18A 3BVPA 4EABA 5IJAA 2PUWA 4NATA 4LC1A 4JI3B 2C2YA 4Y2JA 1W1UA 2QS9A 4LYAA 4N7RA 2Q2QA 1J8MF 1YZHA 3CNOA 3PENA 4OM7A 2V7WA 2W22A 3E58A 4RPGA 5GM2A 5KNBA 4WNAB 3CVVA 3I8XA 5LUBA 1PFQA 4CLRA 4WFKA 5LLTA 1DXHA 3DEHA 4BVGA 2P9GA 2N9UA 1CEEA 5TLSA 5BYBA 5F64A 3SF8A 3BUSA 5KYKA 4XDYA 2JRCA 1O0BA 1MB3A 4QTXA 3HCOA 1NWHA 3F71A 4Z9YA 2WD7B 3LTEA 2OCBA 3CRRA 3Q0IA 3SKVA 3I1IA 2OCYC 3WLNA 2PTGA 3C3MA 3F3SA 1IRXA 1F4LA 1DHRA 3BD9A 3E6AA 2XXJA 1T24A 5G4KA 2ZRBA 1K5HA 4XX1A 1S7CA 5J5CA 1NZDA 1TT7A 4CT5A 5L45A 3E05A 1DOHA 1PDWA 1T2VA 3TAUA 1RTKA 2AFHA 4L76A 3ANNA 2CE2X 1H23A 2OM2A 3FOZA 4TTPA 4QA9A 1WB4A 2AX4A 1M10A 1UF9A 1VLZA 2ZIZA 3AW9A 5BR1A 5BWOA 4OAPA 4XCXA 3EQ2A 1V48A 3I5MA 3KU1A 1HORA 2BDEA 2HV9A 2ADOA 2PR7A 3VKVA 4C2UA 1YJQA 1COWA 3L05A 5ECDA 3T9EA 4L78A 4FSHA 1GR0A 3B2NA 3T3IA 3P20A 4CF5A 2YWHA 4RCYA 3CX3A 3VVBA 1RM4A 4BNNA 1NC1A 3UCXA 3U3ZA 3BWYA 4URWR 4Y6LA 1L7EA 2H1RA 1XYVA 2VHUA 3DAPA 3E9RA 2A5YB 3LK6A 4K05A 4C29A 4NC9A 3PQ8A 4I7EA 3RJZA 4KPEC 3R76A 4JAVC 4B6PA 3FPAA 2J08A 4E1BA 5HWSA 1AB5A 1DV2A 2XX3A 1VJGA 3GDHA 1OHHD 5CEEA 5H3LA 3UH0A 3A04A 2R66A 1Y7TA 3LXRA 1LGYA 3BE6A 4JLPA 1U8CB 3S3TA 1DINA 1TC1A 4FP9A 3W06A 4DN6A 1I4LD 3O21A 2FN4A 4DIFA 2PUEA 1AS3A 3HDVA 3V48A 2ONCA 3FWHA 4Y1FA 2PFGA 3Q3CA 1FQWA 1CLUA 1BE1A 1N3IA 1PQYA 2O8VA 3E81A 3MT0A 4PRYA 2DJIA 4MARA 3TRFA 3W9BA 1Z9BA 2GN6A 4RK4A 3WKAA 6GPBA 2R62A 3G8BA 2GO7A 3DG9A 1PX2A 4HNGA 5KWIA 4YAJA 2CLLB 3C4VA 4BHTA 4CETA 2CZCA 4OREX 1R4ZA 1MG0A 1PTJC 1SA0B 2V03A 5D87A 4RNDB 2JAXA 1WDKA 4RNCA 5D3MB 1RHUA 4ARUA 3C4QA 1TUBB 1DIGA 2CXRA 2M1ZA 2I65A 2WIBA 2WTBA 3DL2A 4MWBA 1G8SA 3BBLA 4ZMRA 4OHRA 1UJ2A 1QS0A 3QVUA 4INJA 3IO3A 5DX0A 1A8PA 5GGXA 3ZY2A 3E3NA 3FCXA 1O95D 2F43A 4LPSA 1Y37A 2IDJA 4BKOA 2O8FA 4GICA 3OO1A 3CWZA 1U9YA 1JLLA 2V74B 4NECA 1W4CA 3IKMB 5E1MA 3R7FA 1S8OA 2EJBA 2QDXA 3AB8A 1HE1C 3FBTA 3IE0A 3HUTA 4H59A 4N5LA 3K05A 4ZP1A 5FTNA 3WOHA 4JC5A 5ITVA 4ZK2A 1XWWA 3PR2B 1MJNA 4C88A 4C43A 3ENQA 2OQIA 2CXQA 2AUMA 1KZ4A 3K70C 4US2R 4NESA 1X9HA 5B1IA 3MWLA 4DCCA 4XOIA 4XPZA 1NW9B 1Y34E 1NR1A 4YRQA 5E8JA 1RWMA 3ZV5A 4X41A 5B5SA 4EGCB 1BA3A 4NAHA 5E2IA 4G0QA 4D4MA 5A2QA 1HX7A 2D1QA 3AF1A 1U1CA 3L6EA 1R6BX 5DRYA 1G8GA 1B2RA 1PV2A 1B42A 2VEDA 1YR8A 5LB2A 1Y98A 2VNAA 4CKCB 5C3UA 3ZS8A 5C46F 3ZUGA 3KJIA 3LDHA 1Z5ZA 4YV7A 4ERXA 2I8CA 2R8XA 1H85A 1T13A 2YV4A 3EMBA 4Y1RB 3NBYC 5FLKA 4DPKA 4GKAA 4EF4A 2AN9A 4A7PA 3ZCXA 2WE7A 2HJVA 1XG5A 5CEFA 3D3WB 4NNJA 4WAUA 3H87A 3O3CA 5P21A 3ZJ5A 1RJ9B 2FMHA 2VJDA 4AX4A 2OWDA 1I94B 4DMMA 2HMVA 1CZNA 4UATA 2CEKA 1TD9A 3R3SA 4A9AA 2DLDA 1UBCA 1SVOA 2H1FA 2P9QA 3PPIA 5I9SA 2F1JA 2IPOA 3PNOA 4JFRA 3IC5A 5AH0A 2P27A 3EGIA 4KWHA 4UKDA 1EK1A 1Q2XA 1QE5A 1S0UA 4JDPA 4MQUA 1DG9A 1GQSA 1Z0UA 4QDJA 4COOA 4KH1A 4MJLA 5LZ2A 1Z6GA 4K9KA 2HHLA 4TMTA 2I55A 1A8HA 1D0VA 1V71A 4M7WA 3WGHA 3T7CA 4DZZA 5K0GA 2D1FA 5AVXA 1U9IC 3JQQA 2JKYA 5L3QB 4LRWA 3WMWA 1PW5A 3CF2A 3MCWA 1L4MA 2SNIE 1ZGCA 4LY0A 4Z54A 1FFGA 3WK9A 3QVXA 2FAXA 3I6YA 3QITA 4DRXA 2P65A 4J91A 3E03A 2R65A 3QQ5A 1CUYA 1CJVC 1P4AA 1SU4A 2G09A 3CX8A 2WHRA 1FZTA 1Z4JA 4WK2B 4EY7A 4EL5A 4G01B 3ZY4A 5C1DA 4G0XA 3KPJA 4BQSA 5FP0A 5A1TA 5IS2A 4DPLA 1ZJWA 2D7CA 2FV8A 3KUXA 4KQ9A 2Y2VA 1SIBE 2CMFA 4IIBA 2F4VB 2JIDA 3OOJA 1UODA 3WRXC 1IJKA 2PZFA 5C5DA 5IWAB 3MCTA 4NBNA 1ZW6A 4GR5A 2G7ZA 5FBHA 3H6KA 3NHSA 1U9ZA 1IBMB 4HYYA 4GECA 5KOIA 3H99A 4RMHA 2PUGA 1E2FA 2NZWA 2FMKA 1GKLA 5EMHA 2JGFA 3G0HA 2NQ8A 3FHCB 5EOVA 1YK0A 4DY6A 2ODAA 2TMGA 3MWYW 4OFWA 2HRCA 4YLYA 1O9HA 3KC2A 3NWPA 3G02A 1ZM9A 3MLEA 3OQIA 4R2WA 1VCMA 3A2NA 3O8OB 5ARDA 4H2DA 2WU3A 3DMTA 3NM4A 4FLFA 5DGHA 4ZFNA 5EJ9A 3N2KA 3L7MA 2WNIA 3LUAA 4PW0A 1U8EA 3AEUA 1XRQA 1WB9A 1AQ6A 3CX6A 4X8HA 1X6VA 2GUWA 1BD3A 2VQSA 2Z1DA 3DKKA 4RO0A 3FNIA 2HF9A 1RAAA 3KHTA 3SFVA 1IBSA 4D6YA 4YUXA 5T7BA 3KJQA 3VU8A 2AF4C 4KEAA 3OJ0A 1AKNA 1P7ZA 1VBKA 4PO1A 4WLOA 4YJFB 5KDDA 2JW5A 4NZZA 1ONNA 2G72A 1BWQA 2RHRA 2JK1A 2VWGA 3OZWA 2ZVJA 3LU1A 3LBIA 1Q95A 4FOTA 3NHYA 1IPEA 3IUNA 3OZ7A 3PTZA 3G7SA 4WN3A 3UMSA 4LFBB 4B0OA 1GNTA 4BL5A 2VDVE 1JQKA 1TX4B 2A57A 2C2OA 4UDNA 3KPVA 1RYYA 1ZR4A 1RXEA 2H2IA 3S0JA 5BUZA 1OUMA 5TPZA 1RPTA 3NBZC 3E4DA 4NBVA 4EFNA 4LC0A 1U4SA 3CMMA 4RORA 2VJYA 4FGWA 1FLAA 2WM2A 1HOTA 2I3ZA 2VO1A 2ZUSA 4W4TA 4B3TB 1JDBC 2ZKIA 4F8YA 1Q0RA 3RKRA 5KSOA 1KDTA 4H15A 4ZTZB 1RXVA 1FFBA 3DXYA 4YJGA 4LQ4A 4EGFA 2E48A 2JFNA 2Z6AA 2XNJA 4KR3A 1GTG1 1CD5A 1EUZA 1E62A 1XTQA 5JY6A 1MZPA 1FBTA 4BCDA 1KQNA 1A9OA 3BMOB 5EJAA 3ABQB 3ND8A 4TZTA 3OMWA 4EG7A 2IVZA 4MIYA 3OT4A 1YVUA 1H9CA 1LX7A 4UVGA 1ADFA 1C2YA 2YZNA 5TMDA 2ZEJA 3BIOA 3RPEA 1GILA 1KI3A 5EMJA 2JLXA 5GPBA 1Z07A 2QMOA 1QM5A 3AV3A 2JLVA 2W2MA 3CT6A 4G4SO 1OX4B 3DT6A 2Q6TA 3P9IA 1C7ZA 4FW9A 2I8LA 3MW8A 3AR9A 1W25A 4CF7A 2X7JA 3HM9A 5IKMA 1R8SA 2HBYA 4MV5A 3TX2A 1ZEJA 1XD8A 2Y68A 2NMVA 1W8DA 2XZTA 4P5DA 5T67A 2P3SA 1W581 4AB1A 2HHJA 1E96A 3NEPX 3S2SA 4HNTA 4PHTA 4ZVQA 4ARZB 1B41A 8ABPA 1J90A 5HR5A 3K6SB 3T3MB 4L22A 3OFNA 3CW2A 2CSXA 4DLXA 4XJXA 1UDRA 5AQEA 1CY2A 3CN7A 4MUXA 1SKYB 3BDIA 4JBIA 3J7AC 4TSFD 3NRBA 1ZONA 5IYZF 3WWCA 4NNOA 2A1IA 3D4PA 1R6UA 2QIPA 2Z2JA 3KWMA 3NHZA 5DGTA 4BCBA 5B55A 3ZY6A 1XMOB 2JS7A 3EARA 5HG0A 4OK6A 2I34A 1LY1A 1E59A 4EYKA 1QIEA 2C58A 4TL8A 2G6BA 5CJJA 4DV0B 2DULA 4GYYA 4UTPA 3FA2A 4WDRA 2XCSB 1VL0A 2XBLA 2ZRFA 1NLMA 1XQYA 3SHTA 1JG1A 3BTOA 1IHPA 1OFTA 3HDYA 3IQIX 4X3PA 1K7YA 4BYGA 2B36A 2OPBA 1SURA 2ZQ5A 5IKPA 1AN9A 2FEXA 4BLSA 4NFHA 4TL7A 1CY0A 3MYYA 3EXIA 1T36B 1YA4A 2FKAA 5BV7A 3QA9A 5JS8A 3AEXA 4Z4CA 4LRUA 2JCYA 4U7PB 4JOBA 2ATVA 2Z9BA 4TTJA 1JHRA 4HB4A 5HIKA 1C1DA 1EM6A 1M8JA 3QUCA 4U7FA 1L0BA 1EDDA 3UWOA 2HC9A 3STHA 4YHHB 1CE8B 1BYIA 3IH5A 4MGYR 3KJZA 3MWEB 3Q0TA 4S3MA 4E2WA 1RWBA 2JLWA 1DQSA 1O97D 5IT9A 5CW1A 1WMFA 3LW8A 1E94E 2LUOA 4TTIA 4XYMA 1L7QA 4F3TA 3RVOA 3ZHYA 1II0A 3AVPA 3JAKB 5TIIA 1TKRA 1H2YA 2J9XB 4NK4A 1Z33A 2ZAOA 2JD2A 3ICWA 1MFPA 4TKUA 1NBWB 4XSHA 2DY0A 3JASA 1F3OA 4XVUA 5CBPB 3DF9A 2X9LA 3DYBA 3MUOA 4D46A 1F8XA 4LOAA 5BVHB 3GOQA 4GX1A 5I4KA 1WETA 4Q3LA 3TEFA 5IM5A 1VKZA 3ZGZA 3EEIA 4PNEA 3CH6A 4GOJA 1XE3A 2CVOA 3C70A 3UAXA 2HMUA 1Z7BA 1N4DA 2QENA 2W8BA 1PS8A 2PQ0A 2VNHA 2WJAA 1A3CA 5ICGA 4UFNA 1YL6A 3OPQA 1NAHA 2VHCA 4JJ4A 4J0FA 4O1HA 2H00A 3UC5A 3C6MA 2B6NA 1ZGHA 2ZE6A 3PD7A 2ORVA 1FFCA 2W4MA 2AD1A 2I2WA 3PQCA 4B3DA 3RS0A 3GT7A 4J7AA 5EG5A 1ZK0A 2HIHA 3S70A 2GSDA 1K27A 1ZK1A 2IUEA 4BBAA 4HNAA 1W52X 3ZHVA 2BBSA 4M4SA 2Q7DA 3VDQA 2QQEA 2QZJA 5HUQA 1S7GA 4CL8A 2J48A 3MJSA 1FNDA 1D04A 1NNUA 4MYSA 4YP1A 1FZQA 4KL8S 1EP1B 1XZBA 1PK7A 4PFKA 4RGVA 2PMWB 4XVQA 1X7ZB 2PGXA 3GZJA 5EYPA 5TQVA 4TKMA 2KQUA 1GL9B 2OWEA 4M0LA 1KYYA 3WO1A 1DCKA 3VYWA 2RCNA 2R6HA 1PJTA 3B6KA 2PDAA 3RS3A 4I5FA 3ZX5A 4EB8A 3HEMA 5NLLA 1LK7A 4CN8A 3WNCA 2FW7A 2P3LA 5AFSA 4D9MA 5KC8A 1AK2A 3P2EA 1GZ6A 3E70C 1FNCA 1KO4A 4V0RA 5JH7A 4HXFB 2BSQA 2HNKA 4BY9E 1QHIA 4O4JF 1NGSA 4RTRA 2OD7A 5EIFA 3W04A 2N0SA 1GEEA 4LS3A 2CL5A 4FE7A 4J0QA 3CLSD 3OG9A 4FSDA 3FOCA 5COBA 3CJTA 3DAHA 2XVAA 3UJ3X 4WZBE 2PUHA 2OZEA 2RH4A 5JDIA 1I6WA 3PHIA 1ZGJA 1BWSA 4J6EA 2CJWA 3IT2A 1XKQA 2ETXA 2HHCA 4HPJB 3ADBA 2YMQA 3IXLA 3X44A 3ZU4A 1L7PA 2BM9A 3EDQA 1D4OA 1K0FA 1QZZA 2B1RA 4M86A 2EXXA 4EK9A 5H68A 4ZK6A 3R6LA 1UDCA 3SMQA 2HMAA 2X2PA 1I2MA 3MXTA 2WP8J 2GXUA 5EWLA 4C04A 3DPUA 3ER6A 1SVLA 2X0IA 2C7OA 4AKEA 1ZM7A 3L41A 2AOUB 3PHGA 3ZCQA 1IM2A 1U7PA 1OX5A 2NAPA 4AURA 1V9LA 3ME5A 4K2AA 2F64A 3N5KA 5DJ5A 3EUFA 2WHPB 1BS9A 4D57A 2FVXA 1ITZA 1DO0A 4MV1A 3GBVA 3GLIA 4ARIA 3WWZA 4JOSA 2ZRQA 2RDMA 3CF6R 2D00A 1BIFA 3ASVA 2OMKA 3MWGA 3PPXA 4ZOEA 1CZHA 3NPAA 5AJZA 4C0AC 1V9CA 3JQ9A 3GNLA 4DDVA 2ZIXA 1QGZA 3R0ZA 3IVCA 5FPYA 4A2PA 2A3NA 4BNVA 3R4VA 1V45E 2P5UA 1MEOA 2B4AA 5A9TA 2JHAA 4TMFA 3BRWD 4XOUA 5MFPA 4W7SA 3B52X 5A03A 4DJJA 2PQ2A 2QN1A 2WUDA 3WMRA 1ISPA 1ZH6A 2PSSA 1ZD5A 5B7QA 2I03A 3TSCA 5A9SB 1PQUA 1VPWA 3VDRA 4XIGS 5KKCA 3NWJA 1XKLA 1GG8A 3F4LA 1D2NA 5K0ZA 1X92A 4OU4A 1QAOA 4WADA 3OE5A 3KELA 3LC7O 3GUHA 2NPOA 3IUSA 3L1UA 1SC1A 2E82A 1BMTA 5T3YA 4G63A 1U3TA 1HYEA 4YP7A 1JS1X 1X1SA 3MQ4A 4JT4A 5FNVA 2I6UA 3SLRA 4KFSA 2XRFA 3VNUA 1OGIA 4N9WA 4ETIA 1CEXA 4TWAA 2FEMA 3QU4A 3AKYA 4CM4A 5C5CA 1KH1A 3PUHA 4PINA 3NPMA 3WC4A 4ROSA 3ZDRA 5FBVB 4G6ZA 1YL5A 3MD0A 1II8A 2OZVA 3DHEA 3FLEA 4MS4B 4R7ZA 2PA0A 3RRYA 2RE8A 2PT9A 3VO1A 4QTUB 4L4SA 2Z2IA 4OJNA 1B6SA 3ZV3A 2IH2A 4WECA 2DFNA 1NXTA 5DVZA 5EXDA 1W87A 4B8WA 4GL2A 4PONA 4YAFA 4EG0A 3D7MA 5I9MA 2GDJA 2GOYA 2R6AA 4TWRA 3G2IA 2BTOA 1MB4A 4C20A 1SAYA 1KYXA 3KSZO 4DJEC 1X8LA 1YZGA 2NNLD 3DDHA 5KTYA 2UVDA 4W9NC 1PYOA 3B1VA 3NX4A 5E6SA 4PLZA 9MHTA 5LP6B 4YUWA 1RWWA 4MV4A 5JPCA 3SEAA 2XIQA 4MJ7A 1DEXA 1B1CA 2ZT5A 4A1FA 2R86A 4RMNA 2Z8YM 4ESVA 5EKUA 1V26A 1KMHB 2ATCA 3NM5A 5E9WA 1CUUA 2ZCJA 1Q1GA 1UOPA 2IITA 2RJ3A 2VDOB 1YA6A 3U7QA 3FPLA 5KYYB 3OY7A 4KQEA 3NTLA 3ZLTA 3IFSA 3TXAA 4YR7A 1DBQA 4JHLA 2MCFA 4ZMSA 1FFEA 2GJKA 1N7JA 5BMVF 3A9WA 5BYAA 4QT0A 4Z4GA 3HB9A 2FEAA 2VBGA 3OZDA 1L1FA 4H0FA 4NU8X 4EUKA 4W8HA 2Z0MA 1BVUA 1Z5OA 4JEIA 3DDCA 4MJXA 1KK1A 2QF7A 3RJMA 3GC6A 2Y1KA 4N1AA 5C0OE 1SKBA 1NA5A 2FRDA 2R97A 3OA0A 4DA0A 1E9AA 3IAM6 1IN4A 2YRFA 4LV5B 1JEEA 2QN3A 5EIBD 2PYZA 3UJHA 4AZ0B 4HDSB 4RYLA 5FFNA 4I81A 1U8YA 3TPCA 2IKSA 4JT2A 1WMEA 3LYLA 4FFLA 4HRXA 1AXRA 4LZPA 2YJ3A 4WKNA 5EXPA 3VH1A 1NE2A 1N7HA 1GGMA 2WJ6A 3AM5A 3PQ6A 4HWPA 4Q82A 5GOZA 5DKFA 4FGSA 2EEPA 3AHEA 1X94A 1PEKE 2CZGA 5EQDA 2ZRLA 3C87A 4TV9A 1S96A 2VKTA 2UXCB 5I7UA 1ND6A 3R4CA 1J00A 4B5LA 4YBRA 1NQTA 3AR3A 3SIWA 4AJOA 4CM9A 5BNZA 5MN5A 4DR1B 1N34B 2AQIA 3SXUB 2Q3BA 4FFNA 4KIWA 1GQYA 4E1VA 4RFVA 1GPKA 1COWD 1VRCA 4PX3A 1W44A 1QYXA 2WY2D 1I3MA 3MPOA 4Q1BA 5J2UB 3O1IC 3DFFA 3ZI4A 2ZB4A 4TV8A 1MA0A 3A1FA 1JEQA 1U81A 1GUYA 3GRCA 4P4SA 1OU4A 4UNIA 4XIFA 4CV0A 4EUSA 5FLXA 1QHYA 4NABA 4YDHB 4JLMA 121PA 5DDIP 5A1JA 5EJ4A 5G4LA 1T9DA 3NORA 1R0CA 2Q3LA 1M76A 1M1ZA 3CLKA 2OP0A 4IMJB 1X7XA 1IXSB 1W34A 2CXOA 3FAZA 3PFKA 5AHKA 4QTYA 4EENA 2F3SA 3IEXA 4NE9A 4TTVA 4DR3B 2HA6A 4DV4B 2KHZA 2VT2A 5JS7A 3L8EA 5TC4A 2JAPA 2KWIA 3DD1A 5LYJF 2VRNA 4Y1EA 4H1VA 4K40A 3T41A 1XMQB 3LMKA 3C41J 4QFCA 1BE8A 4Q4HA 4XWAA 2PVCA 4ZI5A 4FYVA 5EJFA 4YPFA 3VZPA 4IIUA 3PTAA 5H59A 1EJ6A 4WSOA 3K5IA 5BN3B 2D54A 3FCAA 3ZIAA 3DFZA 3HXQA 4QFBA 2F1OA 5K0LA 4XB6B 4WWHA 4GPD1 1FP4B 3RK0A 3HXOA 4RD4A 3ISTA 3H8WA 5LNK6 5JC8A 2FPSA 2A58A 3E7WA 1XZ8A 3G89A 3N70A 5H80A 5FPSA 3BXPA 1Z74A 4PIPA 1LCIA 3AR4A 3PUXA 4HBZA 4QNMA 4MGEA 4EECA 1UFOA 1JNXX 4QX6A 5CLGA 5DM70 4OL0A 2Y67A 2LKCA 3PUIA 5FFMA 2M6RA 3ZCPA 1C30A 4QOJA 2DE0X 5L53A 2HIAA 2VHXA 2VWPA 2X8LA 4HAIA 3KJHA 1IG3A 1YOVA 4C7BA 1TAHA 1VLQA 3HL4A 3AHHA 2AUNA 3PUWA 3VI3B 1ONPA 3PTLA 1M0WA 4KMOA 4LUCA 3AG5A 1ZO8A 4X20B 4ZO4A 3VR3D 1OLUB 1E6UA 3BEDA 4MKGA 4BAGA 2XWPA 1DI0A 1U8ZA 2JASA 2X9GA 4L08A 1TMKA 5EZYF 1MAHA 4MKFA 4QBKA 4HX2A 1EFPA 2VZEA 3OMLA 2FRXA 2RIRA 4GRAA 3WGMA 2LTAA 4M1MA 4TKVB 3U2QA 1FSPA 4HTFA 4TQUS 5LYYA 3VR3A 3HPQA 4O2BF 3GIWA 3WK6A 3HRKA 1U0HC 2PSEA 3CZ9A 1YHNA 4HNUA 4Q3CA 1P7PA 1AIPA 4G8DA 1XDUA 1CK4A 1N6KA 1MX5A 3RVKA 4OMFG 3AEZA 1IULA 1DE0A 2O23A 3VR6H 1Z5NA 2NUBA 4GVPA 3W78A 3R3WA 2PPLA 5CVUA 5LXTF 5T4HA 1H1TA 1P7VA 1R3DA 2XUKA 2Y1FA 2OOKA 4Y3UA 2FR0A 1ILEA 3CXUA 5AW7A 2FZCA 2LNDA 3SQNA 3GLGB 1SOMA 4FFPA 5GZ1A 5FOXA 4TQAA 3L7IA 4A4DA 4F86A 1E2GA 3F6SA 5IJ0B 2CJXA 3C3YA 3R09A 1YFLA 4EPXA 1N5RA 4YLGA 3GZTB 3V2UA 3HBJA 2H9IA 3UCEA 2DBYA 3I9MA 1SXIA 4AKGA 4C89A 1US8B 1DADA 3C6BA 4PQGA 5KTRA 1P2UA 3ADPA 4DR6B 1SR8A 2X0EA 3SX0A 3VHRA 3GLFB 3LAWA 5BXQC 1L3BA 3BD6A 3SC2A 4CT4B 4TYMA 4MW6A 3Q6NA 3I9KA 4CF3A 4LC9A 3ZWYA 3K0FB 4YJHA 3RT7A 3BC1A 3D5EA 3HDJA 2EGHA 2P8SA 4KKVA 1JIVA 4MYDA 3WNQA 1W30A 1PT6A 3NHPA 4ZHQA 2HSEA 4PIVA 5L9AA 3UKDA 1F0KA 3M81A 3NOVA 3NVAA 3SYKA 4Q01A 2ZIGA 5KWEA 4P34A 1E9SA 3X2FA 2X8JA 1OC4A 4OHYA 3EULA 4IO1A 1SZCA 2IPLA 2HY7A 1EAMA 1KY4A 3UANA 3WLEA 2OPHA 3UHJA 2XHEA 1MW9X 4OXNA 3O4HA 4JSYA 3O03A 1FUYB 4DL9A 1EI9A 4IJQA 4ZD6A 3GFSA 3D6JA 4UHFA 1N2CE 2WWFA 3C5CA 4N0MA 4BEWA 1I4TD 3GA5A 3KFVA 1EHCA 1X1DA 1G38A 1JPNA 3R6GA 1QOQB 1CUIA 4EHFA 2FEPA 2HB6A 1Z2PX 3CZPA 3RSZA 5LR6A 3DZFA 1OFIA 4KMSA 4L5IA 2D5LA 2QTNA 5HKOA 3E9CA 4JC8A 3T3DA 2G67A 2MSWA 1BTOA 1E2KA 2WSYB 3EOAI 3UAVA 2ZG6A 4V38A 4I19A 5U1PA 4JVNA 3EF1A 1KEEA 1NQVA 3BD7A 4WZAE 3RAFC 1RDFA 1T26A 1V8PA 2AFRA 2GYYA 2H9AA 3PXCX 4IS2A 2W6QA 1AS2A 3L1VA 4XYBA 5AR1A 1O4WA 1Z22A 2ZB8A 1GFZA 4XQCA 4CTMA 1MX1A 1TU0A 1U3UA 2I7VA 2ZRGA 3K0AA 4LSMA 4RXUA 1L4NA 3PA6A 2A1TR 3T7JA 1KOLA 5C7YA 3OPNA 1TJ4A 2Y99A 2Q0HA 1Z18A 5C1PA 4PAMA 1IM5A 4JR1A 1J8YF 1WR8A 3OF2A 5B3LA 1U5BB 4RFLA 2FG6C 4LVCA 4U1RA 1QVAA 1X80B 1L4BA 2Y0DA 3CVOA 3FB4A 4L8YA 4WESA 1H0RA 4AJ1A 1N1EA 2BR4A 2CK3A 5BW8A 6REQB 3VA7A 3ETNA 2BKLA 4IDHA 1XZLA 1KAEA 2O1XA 4M76B 4CLDA 1Z4IA 5B1EA 4BE4A 3DO6A 3HTXA 4KAAA 4INZA 1E92A 2CMDA 3EGCA 1K3UB 1G5TA 3UK1A 3KZMA 4I50B 3HYTA 2FLVA 2C20A 2GAAA 1O03A 1U7WA 3KAPA 1YIDA 3W6ZA 1U94A 2QROA 3GH3A 3HLYA 2J4CA 3L7OA 1MOQA 2VNSA 3KYCA 3O91A 4ISBA 5LP6C 2DUWA 4OXKA 2P4EA 3CB2A 3DFUA 3DM5A 1CHNA 3O1LA 3SN6A 3QTTA 4UEJA 4I4TA 2B7CA 5AICA 1H6DA 2AG6A 5A5EA 1A9TA 4ZREA 5C3MA 2P3OA 5IC6A 3K71B 3R77A 4NAUA 5C35A 3EIEA 4JLOA 3SQOA 1O3YA 3O1JC 1CZKA 1OXUA 3BFPA 4TX1A 5LVAA 1C4OA 2IHVA 1RXUA 4MWTA 3NXSA 2BYTA 4UMFA 4YXWA 2RHOA 3QZUA 5EJ2A 5B36A 3RRFA 1AHPA 1GNPA 2YICA 3K09C 5AVQA 1PK8A 3BQ9A 4POAA 5C4IA 3UMBA 4XLTA 2J41A 3GG9A 3UVEA 1EMDA 1OTHA 1C29B 2FHPA 1GXSA 5I7EA 3WIOA 3SEZA 1WMBA 3QMVA 4XWKA 4X45A 3H83A 4Q3OA 3JARA 4R2XA 1LVGA 3IP9A 4KLRA 4OKIA 3U49A 4CIWA 4Y6OA 5I9NA 2GLXA 1K86A 3ZXYA 4X8OA 1W0JA 2HSDA 2C2WA 3X1JA 5KMGB 3TL6A 1HT2E 2H16A 2RGAA 1JTVA 1EX9A 1OKKD 3AETB 5GP1A 4B0PA 3A2KA 1IB0A 2R6DA 2WYUA 1D2AA 4IJUA 4XGNA 2X0FA 3OFND 1CUSA 3LP8A 1Y8CA 1MF7A 2Q2WA 2AMFA 3CS3A 4LBWA 4C6SA 1R4MA 4J76A 1XXLA 2CFTA 3BJZA 2XYQA 3PU6A 3VR4D 5ED4A 5HX7A 1C7EA 2VZ9A 5BSKA 4TQ9A 5T57A 4RPKA 1A69A 2Q9AA 3KQWA 5IDYA 2ZUTA 3T9AA 5JFTA 4DVGA 1PJQA 5EQFA 3VGPA 2JGLA 3IMGA 2HPZA 3N75A 2JFVA 4WOBA 5THXA 2HJWA 3JAWA 4LF7B 2EL7A 3RREA 1X3SA 3E22A 3L1JA 3O7WA 1XTSA 4NS1A 5HQJA 4C3OB 1VHJA 4NENA 4Y7CA 1FPQA 5DI9A 2GEDA 4UHHA 2QP3A 1NPTO 2YOFA 1SZDA 2YV5A 1QO7A 2A1UA 3GUUA 5I5GA 1AK1A 3CNEA 5BNIA 2OCLA 2RJNA 4CW7A 1MIHA 2REQA 1RHMA 4JP5A 3R7SA 3ED1A 1ZJ4A 1PZXA 3NP7A 2E2WA 3QOFA 4FZRA 2E87A 1WTAA 2GUGA 2HDNB 3IB6A 3VSDA 2WKQA 4JSTA 3RNLA 3WSVA 4REQA 4BVFA 2GYWA 5KSYA 1E3DA 1Z26A 2XUGA 4GVLA 4K0RA 1BDMA 3IHTA 3TNFA 4CL0A 5JAIA 4PG4A 2H1SA 2ZBEA 3MAAC 4ZO6A 3BKWA 2YS7A 3N2YA 5EKTA 4ZYXA 1E63A 1LSOA 3AR7A 2E18A 2FN9A 3KBOA 3UPDA 3LA8A 3FUXA 4KPUB 4JJIA 2QJOA 5ALEA 2PJZA 3KJNA 3DT8A 4A91A 2NV2B 3RG2A 3BSSA 4F4IA 1VYVA 4LXIA 4YAGA 3OF5A 3FNHA 3G68A 4IR7A 4LOIA 3WWPA 2G1KA 3CUWA 3QYJA 4XI9A 1ZGZA 2J59A 3BAZA 2HT1A 5DTQA 2MHCA 3ET5A 3BTUA 3FZQA 3WGNA 4E07A 1RKUA 5E4YA 3DFKA 4JVMA 2ZRJA 2X6QA 1ZBQA 4DV5B 3DULA 5KOJB 1LPMA 3HKDB 2P9BA 1KZ6A 4KFCA 1XEXA 2BEUB 3RS8A 3L0BA 3B78A 1YS9A 3O90A 4RHFA 3VVLA 4CR6A 1O2DA 4CODB 2GEFA 3LGSA 4TVBA 5AK6A 1QRRA 1TD1A 3KWJA 4CKEB 2C07A 4HLQB 4YAUA 5LZ7A 1M6VA 3DWIA 1VJ1A 1LDMA 4ETNA 2HJSA 2PH3A 4YQFA 3A1VA 3AM4A 3IQHX 1U7HA 3BE5A 3ZDXB 2GVDC 1EXMA 1NC3A 3P9CA 1AGPA 4C7JA 4E5SA 1WMDA 1WU8A 1P7YA 1YIAA 3TOVA 4CI0B 1SD2A 2R8OA 3JVIA 4K3VA 4KXQA 1U7TA 4Y2YA 3NBKA 3QWIA 3ETCA 4LGMA 3TW8B 1SKYE 1KBOA 2QE7A 4NU5A 4MAMA 4N6GA 1HMPA 2ZOSA 3COWA 2NACA 4ZI3A 1WY5A 5B64A 1TLFA 3WMEA 3KETA 5IBCA 3WGZA 4RKEA 4ESEA 1R5JA 4ALNA 1AZLA 1G5QA 1WUIS 2ZYSA 3WLTA 1KK0A 1LWNA 4B4VA 1DT3A 4Q47A 1IU9A 1QKIA 2ACWA 4RE6A 1E3MA 4S35A 5BORA 2CLKB 5FTMA 4GUDA 2LPMA 3P4XA 4LOJA 4AMGA 1VI2A 3LIPA 2ODWA 4F3RA 1YTLA 3QNMA 4IIYA 4K8RB 4F06A 3KDPA 2H11A 1W0CA 3SXJA 3LBYA 1NXQA 1Z35A 2GX6A 3FSJX 4NSNA 3GFGA 2B35A 4XIYA 1U5AA 1U2RA 2KYRA 5DFAA 3DVRX 5FPTA 3UAYA 2UUOA 4UARA 3PUZA 5FOUA 4ZV4A 1I33A 1DAKA 1RMQA 4OVKA 3VR0A 3QVGA 2FMIA 3B13B 3O83A 1QHGA 4N40A 4NOKA 5FTWA 2WSIA 2II6A 5JCOA 4YMTA 1KZGB 2C8VA 2OAP1 3EDCA 1IXZA 3M49A 3IMKA 4YRFA 5JWHA 5TR9A 3VSCA 4E51A 1KO1A 1GLGA 2AR9A 2ZS8A 4QU9A 2E4UA 3JYLA 3G2NA 4C4OA 1KKMA 5UKDA 1JBKA 1LSSA 1P1RA 2HK8A 4OUDB 5K1ZA 3T99A 4CMJA 4MQFA 4NL4H 1NBMA 1Z17A 2IYZA 4GDMA 4ND8B 4D4KA 5IHXA 4PPNA 3WGIA 4A15A 2A84A 3DE3X 4YUAA 1M2OA 4ZTBA 5AJYA 1TVKA 4XW2A 4MS3B 2HA5A 1FFHA 3I8OA 4OBXA 1F60A 2H2GA 2GNOA 2QQ0A 1LK0A 4BZQA 1GA4A 1G7SA 4UE3S 5E0KB 4HLUC 3H4VA 2O5EA 2QQFA 1VHWA 4R9VA 4TUYA 4L16A 3SP1A 1E1NA 1OH6A 3FOBA 4JT8A 1V6SA 4XQEA 1DXOA 1G1MA 1XCOA 4U2GA 3T3EA 1PWYE 3QE2A 5C8ZA 1T91A 3ND5A 1ADYA 1Z8FA 3R5FA 4GE3A 5K0SA 2V6BA 1THMA 2ZCUA 1NFQA 3CEPB 3PLNA 4U7JA 1C3OB 2D5CA 5CNMA 3LFUA 3MT8A 1SBTA 1W6UA 2PKQO 3TNDA 2PGJA 1UXOA 3TTWA 4RK1A 5I9TA 2EFJA 2WFMA 5KYGA 3A6ZA 2RGRA 1RRMA 1GN9A 2X0NA 2VPTA 4QL3A 1W85A 2W83A 1KYQA 3KSUA 4G5YA 4TYQA 4WKPA 1T34A 5BW4A 1PFKA 2ZJ0A 3OCJA 5D3ZA 2DM6A 3DVLA 1YCDA 2H0RA 4N4AA 2PKYX 1VYUA 3N6VA 2XRYA 4X91A 4FFBB 3BT7A 5A3JA 1DKRA 3IP7A 3V8QA 4X1YB 3G2PA 3WNBA 5EKXA 3WDLA 4E3WA 3I5YA 3IR5A 4GPBA 2O6LA 5IBQA 5KZMB 4A0FA 2PCLA 1E5VA 1NFRA 1ONBA 4INPA 4IL5A 4A5OA 1U0JA 4LCEA 2YWFA 5JYBA 5C8YA 1PR9A 4UM7A 3EVBA 3I2GA 4AAYA 1VA4A 4PBSA 3WRYC 4KLZA 3WLFA 4ICIA 3WYDA 4YP0A 4Y2HA 1ZN2A 3AOGA 2WMOB 4BTVA 3H2SA 2NO0A 1XMPA 3KTOA 5KNCH 1PFYA 1ZI6A 4NJEB 3QY9A 1I6MA 1FU8A 2R60A 5A5GA 5FWYB 4Z4HA 4DCGA 4O5AA 2RAPA 4D8WA 1UKZA 4J7UA 4ENQA 2RCYA 3RYIB 4BRUA 5DNUA 4RF5A 5B1SA 2WIAA 5KCZA 4PLPA 4MVJD 2EQ5A 5LM3A 1E3EA 2FPIB 2NX2A 3LP6A 2QUAA 1S2GA 4ND6A 3ZVRA 4B80A 5FUQA 4O4HB 1WTCA 4LWQA 4BO7A 1H2FA 2OBXA 3BCHA 3FKQA 3KYDB 4PSAA 5K8TA 1C4KA 2X9VA 1ACMA 3MBKA 1W4BA 2W5UA 3H3XA 4B6OA 3R9XB 2QG9A 3ZE2B 3N28A 4IDCA 1SUIA 1K2WA 3T7AA 1NVMB 5DHRA 4A92A 5FBQB 4RJTA 2VHZA 2YDXA 2ZW9A 3LK7A 2QTFA 3PWTA 1NUQA 1OWNA 3WQSB 4NIMA 2G08A 5FYDA 4R3WA 2GI4A 3CBGA 2AT1A 3PYMA 5D01A 2KM1A 4YUZA 2J8ZA 1WOYA 2DFLA 4UCQA 3JAMA 2IEYA 4CIYA 3F90A 2BFAA 3K6KA 4CM9D 2B8JA 5DSTA 3OIUA 5JAOA 2E4ZA 3DUWA 2B5VA 4BV9A 3LCVB 1KAMA 3BHJA 5HS6A 3I9V6 4RM2A 4FZJA 5GAJA 2IT1A 2QTRA 6ADHA 2UUAB 1G8HA 4BX0A 3KD2A 1T8RA 1D1QA 3WYBA 2FPKA 1Y0BA 1YGPA 5CHEA 4D44A 1HLDA 3T7TA 2HLDA 2ONYA 1N7GA 3GNQA 3K1AB 3BMXA 2VPIA 1Q0ZA 2H18A 5JRDS 1RIFA 1U4NA 4G0ZA 3V8PA 5JT1A 3SI7A 3X1XA 5J2TB 5GIOE 1T5BA 4FOPA 4WZ6A 2ZYIA 4LF9B 1Q7CA 4BNWA