3OZEA

Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
263
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of human 5'-deoxy-5'-methyladenosine phosphorylase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords S-methyl-5'-thioadenosine phosphorylase
total genus 88
structure length 263
sequence length 273
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozeA00
3E9ZA 3OZCA 1ULAA 1TCVA 1B8OA 2HSWA 1ODKA 3KUKA 1ULBA 5I3CA 3MB8A 3P0FA 1JDVA 2AI3A 3FB1A 3ONVA 3DPSA 3ODGA 4NSNA 2Q7OE 2QTTA 5B7QA 5F73A 1Y6RA 3OF3A 4OJTA 4DA7A 2QDKA 3FAZA 3DDOA 4QAQA 4JP5A 1SJ9A 3UAZA 1Y1SA 3BGSA 2ISCA 4F3KA 5K1ZA 1JE0A 4GMHA 1ZL2A 4BMYA 4DANA 4H1TA 4OGLA 3BL6A 4IP0A 1V2HE 4MCIA 2H8GA 5F77A 1JDZA 4QATA 4D9HA 3PNPA 4WKPA 4G41A 1A9TA 4TXMA 4R2XA 4WKOA 4F2PA 5EPUA 4LZWA 2OC9A 1K27A 1YR3A 1Y1RA 1PK7A 4R2WA 4YO8A 4TXNA 4OGKA 2HRDA 1CB0A 1PK9A 4YJKA 1TGVA 4EARA 2BSXA 1OTYA 2OC4A 4ECEA 1XE3A 5IU6A 1RXSA 5CXSA 1M73E 1ODJA 4GKAA 3O6VA 1RSZA 1Z37A 1Z39A 3BSFA 4I2VA 4YMLA 4MARA 3SCZA 1QE5A 5DK6A 1K3FA 1RXUA 2A0XA 4BMZA 1C3XA 3O4VA 5C80A 1U1DA 4G89A 3KVVA 1OTXA 2A0YA 1YRYE 3LGSA 4GLJA 5IFKA 3U40A 4DAOA 1SQ6A 4QASA 4QEZA 1PKEA 4G8JA 4DAEA 2PGAA 3DF9A 1U1EA 1Q1GA 1PBNA 2ON6A 4LKRA 2QSUA 4OEHA 1U1GA 5JPCA 1I80A 2AC7A 4D8YA 1Y1QA 3PNSA 1ZOSA 2A0WA 4OF4A 1VFNA 3UAVA 4WKCA 1CG6A 5CYGA 3OOEA 1NC3A 4K6OA 4X24A 3LBAA 1NW4A 1V3QE 3LA8A 1PR4A 5ETJA 1VHJA 1PR0A 4LNHA 5B7NA 1G2OA 1RFGE 1Z33A 3NM6B 4YNBA 1A9RA 1B8NA 1U1CA 4TTAA 4L5AA 2QTGA 4TTIA 3INYA 2B94A 3NBQA 1YBFA 4BMXA 1A9QA 1TCUA 1RYZA 5CCDA 4F2WA 3E9RA 5F7ZA 1ODIA 1V45E 2OXFA 4NS1A 2AI1A 3K8QA 2IQ5A 3UAWA 4DA0A 4TXJA 3OCCA 1PWYE 1A69A 3FUCA 4EB8A 1OUMA 1T8SA 3UT6A 1JE1A 1Z35A 4JOSA 1JPVA 3ENZA 1JDSA 2I4TA 1LV8A 1V4NA 2I8AA 1Y6QA 4U2KA 2RJ3A 4DABA 1LX7A 1PW7A 4WKBA 3KHSA 1OV6A 5F76A 4LNAA 3FWPA 3UAYA 1T8YA 4M1EA 1Z36A 4FFSA 3KVYA 4L6IA 3EUEA 3DJFA 5EFOA 1V41E 1YQQA 3IOMA 1RXYA 4PR3A 4UC0A 3BJEA 3NM4A 4RJ2A 4DA8A 1WTAA 5F7OA 5F78A 3K8OE 2A8YA 4M3NA 4OY3A 1TD1A 1Z38A 4D8XA 2P4SA 4TTJA 3DP9A 4P54A 1ODLA 4F3CA 3P0EA 1PR1A 1VMKA 4L0MA 1PR5A 1OVGA 1N3IA 2AI2A 4DA6A 1A9SA 1Z34A 1NC1A 1PR6A 3QPBA 3EMVA 5F7XA 1Z5NA 4QFBA 1RXCA 3OZEA 5CXQA 3OZBA 3KVRA 4TS3A 1T0UA 1RR6A 4WKNA 1SD2A 4TXLA 3D1VA 1YQUA 5FAKA 3GGSA 3EUFA 3T94A 1PF7E 2QPLA 1VHWA 5B7GA 2OECA 3PHBE 4TXHA 5KB3A 3E0QA 3NM5A 1RCTE 4E1VA 4NY1A 4F1WA 1A9OA 3KU4A 1T8WA 3FOWA 1JYSA 1Z5PA 5CYFA 4DARA 3EEIA 1LVUA 1JP7A 4L5CA 4KN5A 4PNPA 1ECPA 1RT9A 4TS9A 5F7JA 2HWUA 3GB9A 1JDTA 1Y1TA 1SD1A 3UAXA 2GUWA 1T8RA 4M7WA 1K9SA 4D98A 1A9PA 4TYMA 3OZDA 3OPVA 4D8VA 4GLFA 4BN0A 3FNQA 4MCHA 1FXUA 4L5YA 1OU4A 2HN9A 1U1FA 1Z5OA 3MMSA 3TL6A 1JDUA 4QARA 2XRFA 3C74A 5CCEA 3PHCA 4R31A 5EUBA 1PR2A 1TGYA 3IEXA 1V48A 4JWTA 4LDNA 3F8WA 5B7PA 3OOHA
chains in the Genus database with same CATH superfamily
3E9ZA 2Y0CA 2XUIA 1WZUA 2X0KA 1TCVA 4TM7A 1VMIA 4GKVA 2IDJA 1U6KA 4FW9A 2VHCA 4Y7CA 4QXRA 3ZNQA 3BGIA 2BTEA 1PWEA 5EYPA 4JUIA 1HKHA 3DXFA 3FOFC 4RPHA 1DG1G 4K9NA 3SC4A 1Z5GA 2VP0A 3K2QA 3VHXB 3HDGA 1B76A 2ZWOA 2V7UA 3RRFA 1KEKA 1UXIA 3WB1A 1FDWA 2ZBQA 1PGOA 4MV6A 2PBZA 3D4NA 2BWJA 1NW3A 3AG6A 3GCZA 2SCUB 4REOA 1OCEA 4ZEXA 1CE8B 3TTUA 1JG7A 1MOSA 1JR3D 2LD4A 3ZWVA 1FYWA 1Q17A 1RWPA 4RZQA 2DP4E 2EKBA 3CKKA 4BGIA 2EFYA 5C1DA 3FROA 4N5HX 3D7RA 3UN1A 4DV5B 1EQAA 2FSIA 2VP2A 5CA1B 2OBXA 1C7JA 2B4QA 2ZS8A 4PG6A 2AC4A 3AKEA 2GUGA 1I0LA 3PYXA 2O8CA 3GLHB 1QO9A 3PFNA 1XVTA 2C9ZA 1CUXA 4YPOA 3M89A 1VPDA 3QUQA 2C1XA 5GONF 4BKOA 3TGLA 1KPHA 1T3GA 4B3XA 1P33A 4WE3A 1YV9A 1LNZA 5EHIA 2GI4A 1XHEA 4EHDA 1ZI9A 1ZW6A 1GCGA 5IKEA 3IP9A 1NYTA 2AN4A 3JQ7B 1ZGAA 4GMHA 4N5MA 3WL6A 3CWQA 3F3SA 3GUVA 3VZSA 4BMYA 3TLZA 3S70A 3I01A 4HQLA 1K9VF 4NU8X 4PLFA 5KQSA 3A6DA 3V7WA 5IDYA 2XBMA 3NC1C 5CT6A 2HUPA 2V45A 1QAQA 2OBYA 3FUVA 5CDFE 2JGFA 1L5GB 1K6IA 1PW5A 1R50A 3GDHA 4E5PA 1GEEA 2CHFA 1E99A 3K70B 2FLKA 1IXRC 3LVRE 4FMCB 1WQ1R 1CUUA 1XTVA 2C03A 2I78A 4ITUA 1LWNA 4KAAA 4LDZA 3V8MA 1DAFA 3E82A 4M54A 1NNUA 1OIXA 2BM9A 2JZNA 4AQYB 1HOXA 5JVDA 1QF7A 5JO9A 1U8TA 1R4NA 3E4DA 5EZYF 3RSFA 5AKLA 3ZCRA 5IVKA 4JI0B 2Z3WA 3QHPA 4CL0A 4ABTA 1J24A 1LTQA 3PC8A 4PS1A 5JROA 5ALLA 4YBZA 5DI3B 3RREA 4EB0A 2YZ2A 3QF4A 3NJ4A 1ITZA 4YRSA 4UNIA 2ZT8A 1WPXA 1NY6A 1QGUB 3KYCB 1OT3A 3K6KA 3PD0A 5I7SA 1PK9A 2KI5A 4GGPA 3W6PA 2CFOA 4PTYA 5CT4A 3CVUA 2C83A 1U9IA 4A6DA 2QWXA 2F3RA 3JTMA 3PGVA 3I28A 3V1UA 1GRVA 5FJJA 3JQ9A 3T52A 4TL6A 1KFBB 4A6XA 1IEVA 3R4CA 3ZK9A 2BP7A 3CJTA 3AZOA 3OZVA 3LWBA 4RQBA 1NJ5A 1ADFA 1NVKA 1IDN1 3BMNA 3DMNA 4IH1A 1UK8A 2E4AA 3MUNA 4LXQA 1BRTA 1BS1A 1FB5A 4BU0A 2GKSA 1TM7E 1R1DA 3H11B 3WDMA 3C5CA 4RZSA 5IVDA 1G291 2W6ZA 1DKQA 3ITEA 3Q0EA 4KIUA 2IH5A 2Z58A 2C5HA 1QVWA 3IMGA 1QE5A 4KB5A 3SS8A 1A8SA 3M5WA 3O0TA 1GV1A 2HAEA 3NMUF 3ZEIA 1Q11A 4CCSA 4UBJA 5JYEA 3U19A 4XX0B 1Q7BA 2Q4TA 4R1NA 3BMCA 2I6GA 2BFEA 1DUSA 1S5PA 3NKVA 3VPXA 1MABB 1RXIA 4X3OA 2ZUBA 3MRTA 2WILA 3ZGZA 4RK0A 3DMDA 3IA7A 4DF3A 1XRQA 4J4TA 2JA2A 4QXQA 1NHGA 4GX1A 1WA5A 4JB0A 3JWPA 1G3MA 1D04A 4XYEA 2P5TB 3CLTC 2C2XA 2HNAA 3CX3A 5KHAA 1P7VA 2A9FA 3SLKA 1W4ZA 1GGJA 3OQNA 1PRYA 1SULA 4XDZA 5K3DA 1KOGA 4ZGBA 4BNIA 3GRAA 2MSDB 1FIUA 3MUEA 1XCJA 3FLAA 1KY3A 2C3YA 5K0TA 5KJ1A 3U48A 1YQ9A 3NEPX 3D9QX 2HHLA 3KLMX 4NZ9A 4GZ3A 3P2OA 3Q9LA 4UEQA 2JIDA 2Q5FA 1Q1EA 2Q5IA 1O0SA 1LPMA 2YWFA 1EFAA 2ON6A 1U7ZA 1O2DA 2QYSA 5JFTA 5KPDA 3OEEA 3ZGXA 1R0WA 5C8YB 3LW7A 2OPBA 4JI1B 5EMHA 2AXNA 3S5JA 4REQA 3PI7A 2AC7A 2GVDC 2G5CA 5BUQA 3JRWA 4R1SA 1TECE 2IYZA 3ZI0A 1U80A 2F59A 4EBBA 1PTKA 2BBOA 3DF7A 3DO8A 1SZJG 1C7EA 4PRLA 5DIFA 2PE5A 1FLAA 3BILA 2JIOA 2YDXA 3PC3A 4QG3A 4DQ0A 4R2IA 2QD2A 4F12A 1N2ZA 1OYVA 1PVDA 3A25A 1Y9AA 4ZANA 5JSKA 1M2HA 3H65A 3VO9A 1WMFA 1R9GA 3GH1A 1B43A 3CUYA 1IM8A 2R8BA 5AVRA 1NF3A 3PQ8A 3IILA 4TL9A 3MT7A 2HCFA 3TMKA 3VH2A 1P91A 1DKOA 3R3WA 4IKOA 4I81A 3B1VA 1W94A 2CVFA 4XQEA 1BX1A 2R6R1 3A1FA 4ZU1X 3FWYA 5C52B 3FDFA 3AUXA 3D6AA 5DO9A 4EHNA 4HP8A 3EAGA 3BIJA 2ZB8A 4INPA 3LA8A 1FE8A 4PO8A 5CPFA 3T0FA 1A9ZA 5DFAA 3TI9A 5CM2Z 4D56A 4D9BA 4JGGA 3ZHOA 1RKBA 3I45A 4IFIA 1AGNA 3K2EA 4RZXA 1WCWA 2NYAA 3ZQ4A 3TTTA 5IBPA 3AR8A 2XKAA 2FQYA 1WEHA 4JJFA 3ZGOA 5JS7A 2RHBA 1J5EB 1B0PA 3M6VA 3S4YA 3U9TA 4KE9A 2I2FA 3QTTA 3AMVA 3DD5A 3EPPA 4WTOA 3EXAA 2R79A 3HRKA 1ORDA 4AJPA 3MSCA 1ZAYA 4JNKA 4YALA 5K3OA 3UCFA 3O03A 2QTGA 2A88A 3CCCA 5E9JA 4BGEA 4FYVA 2BI4A 1XEWX 3IQXA 2VJMA 2M2IA 3B1XA 2M6LA 3MXTA 2GF9A 1R8XA 5CEJA 2N42A 3NTVA 5I47A 5JY1A 4WNIA 2C0CA 1CJBA 4XLLA 4HB2A 5IJWA 4YRZA 3G0BA 4RL4A 1E3TA 4ZA2A 3OX3A 3W2HA 1IYZA 1H8HD 2O8EA 1VJGA 5FUBA 3BTUA 2AOTB 1YZTA 1KFKB 3AONB 1KDRA 5H70A 4Y8VA 1IQRA 3SE7A 3CUKA 3OCJA 1BKSB 4X1IA 3QKRA 2HT6A 3RAPR 4NS1A 4QULA 3PB3A 1PJRA 2YHIA 1ZMXA 4KNVA 3SKYA 3C3DA 3HN6A 3K8QA 2VF7A 5JWHA 4DLZA 2CYAA 3IQZA 5IABA 5GIOE 3FUCA 5C0OE 3R6TA 4IUCS 4NMHA 4CKBA 5D85A 3ROTA 1S01A 3GFFA 1O6BA 4HX2A 1T8SA 2WU8A 4D92A 1NW5A 2GRJA 2DBQA 3MWFA 5C46F 3GZNA 2EIHA 4AJ2A 1AM4D 4B46A 3AUTA 2W6JD 2PSJA 5IM5A 5LL6P 1YB7A 2XMSA 5KNLA 1DAHA 2OBNA 1X1EA 3IUQA 3KUUA 3KOMA 4ER7A 4M0DA 1CJKC 2ZOSA 3GFBA 3HKDA 3TB4A 4PQFA 4LF9B 4FB5A 4BPRA 4J0EA 4XGIA 2R6DA 2W2TA 1AZLA 2WJAA 1WVGA 5ELMA 1V5GA 1DAMA 3E6AA 5D8DA 1XA0A 1YK0A 1DHTA 2UZAA 2AHOA 3QYPA 4J0JA 1PS9A 4M9XA 1YIDA 2FW7A 1U7TA 2DPGA 4RIEA 2NVUB 4ALKA 3LBYA 3IBSA 2C54A 1BCRB 2DFVA 5E2IA 3LUDA 3HBJA 2GNOA 3WNDA 1ISGA 4NLLA 4BNTA 4DR6B 1L5WA 1AX9A 1ZNXA 2FU5C 3A04A 4L07A 4NJMA 4HQ0A 5DXAA 3SX0A 1RQNA 2X77A 2AGVA 3QKSA 1GEGA 1YFZA 3ZHZA 3L0BA 3AV3A 2XUPA 2AD5A 2YY6A 3ZE8A 1KEWA 3OLQA 5SICE 1MQ9A 3SX2A 3LT1A 2W71A 5G0SA 2ZJOA 4DCVA 5BMVA 2Y67A 4X9XA 2DRIA 5LPNA 2HQSA 1Z9BA 4BNKA 1FFYA 1P7ZA 1JIVA 2VHZA 4Q93A 4C05A 1C2YA 4D9JA 3K9CA 3EUEA 1U65A 1FRNA 1NOIA 2BOVA 3HVHA 4H60A 1UC9A 4MYRA 3F46A 5CR9A 4D6XA 1UBEA 3AJ9A 3F2VA 3L8FA 4LV8B 3DMYA 2NU9A 4EGJA 4WESA 1RM3A 1PTJC 5JRZA 3WE7A 3G2MA 3PWTA 2AW5A 1E66A 1KQFA 3ILXA 3RG8A 4DCPA 1K7CA 3GNTA 1P1JA 2IHZA 1EP2B 6NULA 2P41A 2JG3A 1U11A 2EGHA 1K08A 3H2KA 1KEPA 3L7YA 2XWSA 5MN5A 4LBZA 2NUAB 5K0JA 3S2SA 2R7LA 2G7MC 2XE4A 4PV7A 1SVMA 2PKEA 5HS6A 1TIBA 3GVPA 3UGJA 1NBMA 1PSDA 3GT7A 4EVIA 1XEFA 3H9UA 2Y0PA 3FMGA 3KO8A 3PR1A 3TPZA 1IL0A 4XVHA 2VYNA 3UOAB 2VSYA 3P0EA 4UZFA 2EKPA 2YYAA 4OAOA 2AVDA 4L0MA 5FFMA 2IWRA 5CDUA 5JSYA 3UT5A 1Z3IX 3NXKA 2IPXA 1U0SY 1PR6A 3OH8A 5JNLA 2H1SA 4D79A 3FRIA 3SZGA 2OGWA 3FPLA 1PQWA 3AR6A 4RY9A 5JMPA 2ATXA 5TQ2B 1A8UA 2PYZA 4BX3A 1DJOA 2VQDA 4BP1A 3H9BA 3IQFA 3NPAA 3HL4A 1Y7HA 3JQ6A 3SI7A 1UK7A 1ECLA 3H3JA 8LDHA 1T4DA 3FLBA 3TOSA 3H9JA 2JJ1D 4YCDA 3AIMA 4LVCA 4CKEB 2ZSIA 1L7XA 1XMJA 3BREA 3RFXA 5DDIP 5B7GA 3H05A 1Y5LA 5TMPA 4D2IA 1LW6E 3PHBE 1E5TA 4O2AB 2I0FA 1G60A 2BMFA 2GEBA 2WMDA 3K09C 3LCUA 1M0TA 421PA 4CV1A 2JRLA 4HAUA 5F4BA 1H22A 3H2BA 3PFIA 3TUJC 3CGGA 2R00C 1WU8A 2JJ2A 3I2GA 3KV3O 3OWXA 1UKVY 2CMKA 2QW0X 1R4AA 2VTVA 2Y1GA 3CVOA 4NATA 1L5FA 2AFRA 2NV6A 4YT4A 5AVTA 2C61A 3A1DA 5DCLA 3ENKA 4F04A 1ANKA 1QGUA 1TYDE 4EHIA 4V2UA 2ZPTX 1UPTA 2DWCA 2PGDA 5I9BA 2PHZA 2RGEA 1V9LA 5C7OO 3K9FC 3HBNA 3IUMA 1KI1A 2QVBA 3U7HB 4PNPA 3ZY4A 1A8QA 2YZKA 1E8MA 2RH4A 1QKIA 1Y7LA 2QD5A 3EXHA 1KYZA 1I7SB 3VC1A 3CRVA 3TNYA 2Y0BA 1ZKMA 2NVUA 5E3IA 2OV8A 1E9AA 4XA8A 5HFAA 5PNTA 1ZK0A 4EUFA 4AWXA 2Y4OA 3SYKA 2YJ4A 2J3JA 4U0KA 2GPAA 3PQ4A 2Q46A 4BNNA 5LP6F 3TIVA 3IEUA 3ZWYA 1FP7A 3C24A 4A8HA 1SXJE 1DEXA 1KQOA 1QWSA 2WSYB 3A11A 4N5NA 3P9IA 4OMCA 4RMGA 2QMQA 5IJ9A 1ZJ5A 2ZIZA 4ZVQA 1XZGA 7ADHA 3NVAA 1EH5A 2N1BA 4R2JA 1G7TA 3A70A 2QMYA 2NWQA 4MVJH 1JQBA 2QY9A 1M7HA 5IZCC 1LA2A 3RIGA 4LWZA 4N3NA 4EF4A 3HDTA 4JGBA 2AT1A 2X4IA 4H7HA 5CW2A 2J4CA 1PEAA 2AG0A 4MHSA 4QJIA 4CUKA 1NVTA 1DCKA 2CGEA 4LI3X 2HL6A 4RF2A 4YAOA 5DULA 1JHOA 4AJ1A 4EI8A 5L3VA 2N75A 5BSFA 2JLQA 3QVMA 5T6MA 2IE8A 2V6GA 2IUSA 4LYDA 1I6LA 2VYFA 4JI7B 4XIYA 3PR2B 3WLSA 4QREA 4ZK6A 2NV0A 1F4LA 5A3RA 3OPYI 4HGOA 4AXXA 1CDDA 2G1AA 3E7WA 1EVKA 3AKCA 3MMSA 4X93A 2R1TA 1YJAA 3QFFA 3TRDA 1FTGA 2DGDA 3LVBA 4ZVNA 2FW8A 2DE0X 3JZDA 1B74A 1CVLA 2FN4A 1COWD 2R60A 3EFOA 1L6RA 3N0VA 4YHBA 5BOVA 3H2YA 4J1TC 3DV2A 1T25A 4TT3A 4OFWA 4JBYA 4QYWA 4I5IA 3ETJA 2PGJA 2LRHA 2Q49A 2DTDA 2VDOB 4MITA 1UKYA 4S2EA 2RIRA 4IIGA 3FSEA 3HPRA 3PPVA 2W2KA 3UXMA 1P7CA 4D99A 4G86A 2OCXA 4O4HB 1QZ3A 4KR9A 3JYNA 2HWWA 5JNSA 1L7VC 2VG8A 4NDAA 4WOPA 3E27A 2JJMA 3DZFA 3TTVA 2ZAOA 4H1HA 2C7BA 3F71A 4ZDWA 1K86A 3TX6A 3OOHA 4WK4B 4IQ4A 1K8XB 1Y7TA 1OWPA 3REOA 3RGGA 4QLOA 4LHXA 2BFCB 3V4OA 1IG0A 4HZUA 1ZGCA 4RELA 3SZUA 5HF5A 4IHQA 3RGWS 2DHDA 1BQEA 3RYCB 3C7KA 4NBKA 2ATCA 4N7BA 1BG6A 1V7PC 2BEKA 2AK3A 2DAPA 4RL6A 1CZOA 4MUJA 5I3CA 1A0OA 1T9ZA 2A9OA 5EFZA 4P5PA 2PQMA 3F47A 3IVCA 3AB3A 3R44A 5DBHX 5KDDA 2BH2A 2DUWA 3A58B 4NU5A 4Q7JB 3WLKX 3A2LA 3WBJA 4B3CA 1JYEA 4JBIA 4DIDA 2O2DA 3U39A 4YQZA 2GHRA 5LMUB 1L0BA 1Q57A 4OQXA 1IN1A 3CURA 5C31A 5IUNC 1K7XB 2KX7A 5JSUA 2X41A 1QGOA 1XXHB 1CVIA 5IF3A 4MV9A 3OLCX 1SRQA 3T5GA 1JHXA 1E6EA 1H0RA 4QHSA 4X95A 4NBWA 1RPNA 4PO9A 4D26A 1YC5A 2ZM5A 3BF8A 1SGWA 1TZ2A 4V0LA 4AO6A 1F38A 5EKDA 6PFKA 4F4FA 4ZK2A 2QJRA 3CGWA 4N01A 3H1BA 3I1IA 4KAXA 3WL4A 2QU7A 1E94E 2A78A 3HBLA 1TJYA 2ETXA 3JPWA 1Y1SA 3BK2A 4OHWA 4OU4A 2QVYX 3NGLA 4WXYB 5DSZA 5EWJB 3IHTA 4RWEA 3TMYA 4N3GA 4DG5A 1RCUA 1TK3A 4YJ3A 4FX2A 1NNLA 3NHUA 4DANA 1K7EB 3OO1A 5DXJA 1FPQA 4WH0A 1Z4QA 1OZFA 1YS6A 2QRNA 3QW4B 1JEEA 3WFIA 3ASYA 4N9WA 4ENUA 1QK4A 3PC4A 3OTGA 4C4RA 5BWNA 3PPIA 4WSOA 3AU9A 2AFVA 3RUFA 4YP5A 4LOJA 4WKPA 2EF1A 2XT0A 3GRYA 3I4FA 1DTWB 3AYZB 4G41A 3DNMA 4HDSA 4M9QA 1JFFB 4WLEA 4KMSA 2JJQA 1L7DA 4RK6A 4F2PA 1H0SA 3ENWA 4G24A 1HNXB 3QMPA 3D3WB 1LI7A 2PUHA 2BFFA 2IPNA 3GNSA 5H3CA 4QLBA 3ZD8A 4YV2A 1MAWA 5LLTA 4K9RA 2F55A 1JZSA 5BWOA 4HH1A 1Z2EA 1T9KA 4H3VA 3IAEA 3TTSA 2XZLA 1O6GA 2F43B 2EP8A 3F9IA 4XB6B 1IN4A 3H5IA 3NDJA 4HTAA 2XUQA 4EDFA 1YFKA 2R44A 1J5XA 2XIQA 3P0HA 5HIIA 2FPLA 2C2OA 2CKMA 2DG2A 5AM2A 2IXBA 3ZY5A 1I2DA 4ZQHA 1M73E 4MV7A 1QHNA 2D0OB 1FXWF 2RI0A 5YASA 1C3OA 1TQ8A 3S2GA 2VPYA 1WVMA 5CX1B 1O1YA 1OZAA 2X9VA 4NQRA 2MSEB 1MB9A 4ZAYA 3KSBC 1JRLA 4W6QA 4R7ZA 1RQGA 1HZJA 1SC4A 4PG4A 2NU7B 1JLLA 1WXXA 1FX0B 5HMMA 2C5EA 2IIBA 3P9RA 3WOHA 3W6NA 1WLYA 4DTIA 1VLLA 4Q4AB 4I3FA 3IR7A 4PAQA 1G98A 3AM3A 4Z54A 4DW8A 1HT1E 5DEIA 4FWTA 3BSWA 1M2GA 4QGSA 2QN6A 1EK6A 2BD0A 2ZAYA 3W7AA 1AKEA 5KNBD 4I3HA 2LNDA 1VRVA 1Z6XA 2RG7A 3U7QB 5CA0F 5E1DA 3ZVMA 1KH3A 3L2OB 3BGWA 4H7EA 3KVVA 4HNAA 5C81A 2G9NA 1OI7A 1CWUA 5AJUA 1MOQA 1B41A 2A1TR 1WWKA 1XP5A 1P5RA 4JJZA 4BNWA 3O4RA 4LVNA 1JLMA 3ACCA 4L7QA 1DWQA 3E7FA 4GI1A 4XEUA 5HE9A 2FXIA 4ZVUA 4X20A 3W5CA 1FTQA 4MI6A 3WJAA 4EMUA 3MD9A 1AQJA 3N87A 3B5IA 1RXVA 2A33A 5HJ7A 3E1GA 2PGAA 2YKGA 2QUBA 2VJYA 4FSXA 1GG5A 3QYFA 4ENQA 2AMVA 5EJ5A 4BPBA 3QJ5A 1ECGA 3ZY6A 1DLIA 3AXSA 4TV8B 3PC7A 2HMVA 4DV7B 1AF7A 1SZCA 1U1GA 4FYWA 1AHHA 4M60A 2QDXA 2PS1A 3PD7A 3QKWA 4HH3C 4UHCA 4ENVA 4QUHA 1Y8AA 1G41A 1M8JA 3AEYA 2C9BA 2GPSA 2AZDA 1P39A 3AEUA 3FHOA 5HM8A 5I7EA 4JN6B 3PNSA 1C8KA 2LKCA 4L6AA 1V6SA 4PINA 3WV4A 4KV7A 4Q3NA 2R1ZA 4BNXA 4CKYA 3AL0C 2B69A 1EWRA 1L4LA 4TSRA 5E6SB 4OJYA 3TJRA 2YNMA 5BSRA 4C1BA 2O0HA 1U3FA 4PLYA 1JIQA 1LFDB 1T9GR 4LJ8A 2JAOA 4PGAA 3GJ7A 4L0DA 3CF0A 3W0LB 3NWOA 2OL4A 2HMTA 2X1LA 2RGUA 3FTCA 4JZKA 4O8ZA 4FX5A 4Q02A 5HW0A 2X4DA 1QRUA 2JLYA 1NQWA 4J7AA 1RPTA 1MFZA 1S2LA 2P9HA 2O5RA 2OK8A 3B3GA 4ZEWA 3MWLA 4C0WA 4EI7A 2D5IA 3F4KA 4N49A 4ND7A 4R1TA 1ZOOA 4OB6A 4XYBA 2UU9B 3ZR4B 3GL9A 2NZUG 2PD3A 1PR4A 1UEIA 3G5LA 3GT3A 1H1LB 1NUQA 1PL0A 1WCV1 4PW0A 1SOAA 2R68A 4XIIA 5ETJA 5KKAA 1JS1X 1LSJA 2QQ5A 3VSEA 1EXNA 1GPYA 4KX3A 1U8CB 4E2FA 4UHEA 3COPA 1VYUA 1EEXB 2A5FA 3CN9A 3I9JA 4IDOA 3X2EA 5AD1A 2PJDA 2QG9A 3HY4A 4AAYA 5KWJA 5KX5A 1W19A 2HA6A 1HFWA 4RX1A 3WB0A 1RIFA 4R2LA 5TVKA 5LMZA 1UDBA 4LMBA 3KT6A 3K1TA 4KI0A 3L06A 2YHSA 4TZKA 1SVUA 1PYGA 4A92A 3EWSA 4MUKA 3U2QA 3W90A 1OIWA 4MJLA 1YBFA 3IP8A 1JXQA 3DZ8A 4CGYA 3BJZA 4ALIA 4EGFA 2RAUA 4ARCA 3AQIA 4RPJA 1H3EA 5CB0A 2FMTA 1N6PA 2XDQB 3D43A 3TL2A 5AKJA 3VR6D 2V58A 4DNPA 3G23A 3KJQA 4IH4A 2PM8A 1RYZA 2RB4A 3O8BA 1JA9A 3AU8A 2XGSA 3G0DA 8AT1A 1MPXA 4DQXA 4NH0A 1R64A 4RZUA 5I7RA 1QU2A 4P1ZA 1IN7A 1G38A 2IHYA 5SZIA 4KIJA 4ZD6A 2YTZA 4B80A 2RGCA 4EY5A 3USCS 2PD4A 5KINB 3OKAA 1P4HA 1XA3A 4O0MA 4YP6A 2IOFA 1W88A 3VJRA 3M9XA 3H2GA 3MCUA 5AVXA 5E1OA 1R12A 4LF8B 1M2FA 4R6WA 1EB8A 2B7LA 3ZH2A 2NUPB 4I1YA 2IXFA 5EJMA 2LCIA 4KC0A 3HY6A 5A9SB 5ALXA 2GARA 1F4VA 3BFXA 2IZ0A 4XWKA 1UWLA 1W87A 3DOEA 3P45A 1RD4A 1ISIA 2FNAA 1FNMA 4DY6A 3FTFA 2TMDA 4KQHA 3CVXA 4BMNA 3C1TA 2ZI5A 1ISFA 1ZITA 1Q1QA 1LPAB 2GBLC 3E7PA 1Z5ZA 3QJYA 3RT1A 3EDMA 4IJ5A 2BN4A 2ZW9A 3KB8A 2QTRA 3U6BA 1DIBA 2XJ9A 2JFHA 3QP9A 1IXYA 1C1DB 4CT0A 3BB3A 4MRAA 3G2OA 3P0JA 5E8JA 1E79D 2QM8A 1SHJA 2ZYWX 4Z0TA 5GGYA 3ORQA 3A3OA 3WDSA 4KPEC 2ADFA 3HC7A 5EMNA 2ZI6A 4E13A 1LS1A 2M32A 1ZIDA 5CCXA 1SAYA 1CP3A 3SJUA 1E5DA 1JR2A 2OUIA 3T3PB 5LZ5A 3GLHA 4DABA 2GDZA 1W49A 2GF0A 4CM6A 3ZV4A 1OJLA 4OUDB 3LP6A 1KDPA 4A5SA 3MA0A 1VXOA 3O73A 3ER9A 3QM1A 1O8BA 4I5DA 3AF3A 1R16A 2J7PA 5BR1A 1UMBB 3VX3A 2ERXA 3D3QA 2B8NA 2ASVA 1J0XO 1NG9A 2R7NA 2HCBA 2QBYB 1KEZA 4D02A 4MV5A 1H6BA 3D2BA 3L7CA 3DL7A 2EOAA 2I62A 2LR0A 4LRSB 1RXYA 2AG6A 3JRXA 1CY4A 3DNPA 1GTMA 5JC8A 3ZY2A 4Y2JA 1NL3A 2R8YA 3TKLA 4RJ2A 1XJWA 2BHNA 3DYIA 3ON5A 4GPD1 1AZSC 1JQDA 2FEXA 2O2JA 4BZZA 5IP5A 1V8DA 5A6SA 9MHTA 1L7BA 2WSSA 5MGNA 3K9BA 4PX3A 5EMMA 4K3UA 1G59A 5DRYA 4ZDKA 1QBGA 4MJ3A 1SEPA 3H1TA 1SEVA 2HCRA 4RSHA 4CV2A 5EHZA 4J76A 4BLUA 4MYHA 5IVPA 4PLCA 2QRQA 2QXUA 5BXYA 5JWOA 1FVFA 1YMQA 5JADA 1UKZA 1X7ZB 1SNYA 3UJDA 3WHIA 4B3IA 1X1SA 4KVAA 1JQKA 1KY4A 1NF2A 4JIMA 5D86A 5DNEA 3LX6A 3R6DA 2PUTA 3WQRA 4F93B 3HDJA 4IXDA 3E9DA 4EG6A 3SQOA 5M5BA 3AJDA 2IEZA 2ZUUA 4ZAFA 3SYLA 4EPRA 2O8BB 4LF4B 5FWNA 3ZWNA 3A2MA 4QQRA 4PPFA 1SU4A 3T7AA 3CEMA 2C2HA 3WGQA 2FFJA 1F3LA 1L5HB 2Q1XA 3E5RA 4M36A 2CHGA 4OHKA 3OQJA 5AHRA 3VTAA 5JS1A 3ZDFA 3DZHA 1HMYA 1XHLA 4MCAA 4AULA 4NYIQ 2R85A 2ASEA 3CLKA 4HGRA 4RIHA 3QJGA 4RIIA 3PHIA 1T4BA 3LO5A 3OQIA 1VDZA 4FZ3A 2QRLA 4S04A 4D44A 2OQ2A 3W8RA 1QFXA 4J16A 1USIA 3RRMA 3VAAA 3K35A 1R88A 4OJKA 5KJCA 4GW3A 3D1LA 4FHFA 3HEBA 4F71A 3DXYA 3MGAA 3Q12A 2TECE 1ZOLA 1XX6A 2VF5X 2ZITA 1GG2A 4MRMA 1RHQA 4FMDB 4GGMX 4HDSB 5JQGF 1PD0A 5IN4A 2OCDA 1Q7EA 2GHQA 5DK4A 2C2WA 1XNQB 1DRUA 1KKLA 3RSGA 2ZJFA 1NTOA 3T6KA 3ZQUA 1J1UA 1KR5A 5T67A 5ER6A 2BM1A 3DXZA 3OJOA 4J0HA 5FPQA 3E2PA 5JBIA 2JGDA 2QMEA 2NIPA 2YYSA 3P94A 4JYBA 5DNDA 5LQUA 5HZMA 2ZDHA 4EF5A 5HR5A 4JEHA 3T4UA 1E1QA 1HEYA 3EFBA 7MHTA 1KBZA 4A2QA 1M5RA 3OCZA 3SBXA 3T3OA 3L6RA 1HFJA 2CJWA 1NJGA 3QKTA 2CNWD 4LHWA 4PGGA 1LDNA 1B0ZA 4BNHA 1U2GA 1HDGO 1RKVA 4JLBA 4KYTA 3ZBQA 4Y2HA 3LCVB 2O5VA 4YGYA 4OGGA 1GM5A 1W2HA 2H0AA 3JAWA 5A05A 5EJ8A 1J21A 1EFKA 2AX4A 3SMQA 1UJ6A 2NAFA 3FJOA 5JZMA 2H65A 1TQ6A 4US0R 2J0UB 2W2KB 5D87A 4CG2A 2P2YA 4RM2A 5GWXA 4KR3A 1JYFA 3H8JA 4OLJA 3ZS9A 1GADO 1I7LA 1TADA 2J0UA 2JFFA 3WYCA 3Q7RA 1G64A 1BVYF 4X71A 4B3RB 2GLTA 1VL2A 2O3JA 3L82B 4ZHQB 3ID6C 1V39A 4ME6A 4LCEA 2C20A 1BXGB 1WD7A 2KM1A 1LXCA 3QU2A 2QTFA 1ZOPA 2QT9A 1JU4A 1PL8A 3CVWA 2PFKA 1LBEA 2JLCA 3FI0A 3PEWA 3L1KA 1O6CA 3HUUA 3X1WA 4XRGA 4NXMB 4YB8A 5K20A 3RU3A 3OFSA 1QO0A 1G8PA 3QE4A 3S6JA 4BUCA 3DBVO 2Q5EA 3C6YA 5F2OA 1JPJA 4LDPA 1U1FA 5EE3A 1JWLA 3MCTA 4BVFA 1N0UA 2O5EA 4M1QA 4LOHA 3LTNC 1NQXA 1G1AA 1WV1A 1N5RA 2C3MA 4BNVA 2BEWA 4JXJA 3AR9A 2XRFA 1E63A 3V8BA 3BB4A 1WF3A 2A3RA 4KN9S 2GBLA 1ODSA 2O1EA 3B89A 2HTEA 3AF2A 3LQYA 4GSLA 4MI9A 4XUDA 3HWX1 1H2AS 2NGRA 3CSSA 3VPAA 1DKRA 3D31A 8MHTA 3HHEA 4EPWA 2GK7A 3M4JA 3RC1A 2WTBA 3D59A 2K2WA 3IMEA 4P82A 1E6MA 1P6UA 3NYWA 1QH0A 2CNOA 5AKGA 2X13A 2NUTA 3KUCA 3QENA 3R6WA 2PYIA 3G1TA 1C9KA 3L6EA 1XZNA 4IHJF 1DBPA 1M72A 4MH0R 2ZJBA 5GZ6A 3ITKA 1RVDA 5J2TB 3F8WA 4LPSA 4EA6A 4LF7B 1E98A 5GP1A 5FYDA 2PMWB 1VI6A 5I6DA 5JJBA 5K45A 4ARAA 2ZM6B 2IXEA 5DGCA 1N9GA 3W1EA 4U02A 4CTKA 4HSEA 3WMGA 4JJGA 2WP0A 1ZM3A 3U4IA 4MR9B 5F98A 4ZARA 1KR2A 1ULAA 3B48A 4A0HA 2FWRA 5ALVA 5IYZA 4AQ7A 1T5OA 2AUTA 1FFSA 5ERXA 1T10A 3M6AA 1N5OX 3VBEA 3KUKA 1ULBA 2YUIA 4QT4A 3D3EA 4G5GA 3RU9A 1JJ7A 1O7JA 1RBMA 3K1AA 3QYAA 3GLFE 2BE7A 3UO8B 1C4XA 3GNQA 4BJ1A 3IGFA 1HLPA 1YTLA 3KLOA 3N8HA 2I1LA 1J0CA 4CM5A 1V26A 1U0OC 4MB0A 4YHHB 2NQTA 2YMPA 3EOBI 4I19A 3ODGA 5IJ9B 1EDZA 4HDMB 1ESZA 3FFWA 4ZJPA 1O6ZA 2LV8A 5T4EA 3RPEA 5BV0A 4HL6A 1DKUA 1N3BA 4WACA 4W82A 4FSHA 2A5YB 4PWZA 3RS0A 4EO9A 3M6FA 4BP8A 1Y6RA 2Q45A 1NW6A 3QVXA 1L5LA 4M7RA 2GCEA 2JIZA 1VGQA 3MT0A 4KPUA 5LOVA 4H6XA 1XC7A 1TVMA 3I6QA 4KQ9A 3R1IA 1U3WA 5G40A 1ZR2A 4GUAA 3OFND 4JHLA 4PSUA 1VKJA 2UUBB 1DS6A 1QIIA 4U2CA 5H7XA 3EAFA 3PD1A 3A3PA 4GOMD 3F9CA 5CK5A 4BMOB 3IJ5A 3Q7EA 5CMLA 4CNBA 4TV8F 2FQ1A 4CETA 3R5JA 3U3MA 1TE2A 1Y9ZA 3LF2A 3O74A 3OIFA 4RS4A 5G53C 1SZDA 5JAUA 4OL0A 3U4MA 1XWWA 2OWDA 2XGMA 2C4HA 2R5WA 4BLRA 2BMDA 4DEVA 1P2BA 3QKUA 2W2XA 3R0IA 3C14C 3OE4A 4O4IF 4CFSA 1ISJA 2ZWIA 4A2CA 1JG1A 1JB1A 1PGPA 2H2GA 1L4EA 3GUUA 3NTUA 3AI1A 2XPCA 4B7XA 1RI3A 1NYQA 1GYPA 3CBGA 2PUGA 2FKNA 3DDZX 1JUDA 2C4TA 1KRWA 1DVRA 3UW1A 1TUEA 2B36A 2D6FA 3R24A 1N7JA 5L7WA 3VR1A 4GP9A 3EGWA 3EVAA 1BA3A 1MTOA 4TQAA 5CDSA 3AC0A 4IILA 3FETA 5DM2A 2GTPA 3H3FA 5SY4A 3JQQA 4DIKA 2HW8A 2VRCA 5LB4A 2GSDA 4V38A 3RUEA 1O0CA 2WM2A 3T9AA 4QYTA 1KERA 4AMGA 5IHPA 5FPYA 3DB2A 1C1XB 3I9FA 3JZMA 3DDWA 3NUZA 1YHZA 3FGOA 4C4XA 2CXHA 1MAAA 1SA0A 3A10A 3SXPA 2OM2A 2GN6A 1UQRA 2O7RA 3BDVA 5IU6A 3B1WA 2DBZA 3HSKA 4KQ6A 4NYIR 1M1YA 2CB0A 2HJ9A 3S29A 3SS9X 4GQAA 2KS6A 8ADHA 4XEHA 4H4CA 2MTBA 3NTLA 3OIVA 2H1WA 3MMPA 1KWGA 4ZVKA 5ICGA 2FGJA 1P3JA 4EZEA 3C97A 3G13A 3WP0A 1P7YA 4JWKA 3KXPA 4Z0NA 5E7MA 5C3UA 2O14A 3T38A 4JB2A 4WLFA 4F7WA 4YMLA 1QHIA 3UXEA 4BQPA 3CKYA 3A8TA 1RXUA 3TSCA 4DB4A 3FVRA 4WCFB 4B40A 5EWMA 4REQB 1BD3A 1EFDN 5IMBA 3WK6A 3FZYA 3H16A 4A8PA 3PXUA 1HY3A 2J3MA 4EY4A 1TKBA 4HXGA 5E6RA 5K2MA 1NTRA 2WA1A 3IAHA 3ZHTA 3P0IA 5EJ4A 3KSDO 1FNDA 2BKUA 2L42A 4GC9A 1YWGO 4PZDA 2YVAA 3E9MA 3TLYA 4ZYWA 3SVZA 3QPWA 5IW8A 5MHTA 1UDXA 3DAHA 1IQPA 4G89A 4GXRA 5HRCA 3OE7A 5IT0A 1FUYB 3GCDA 1X7HA 4R1UA 4C6TA 5MF6A 1MT0A 1FP6A 4MQUA 4WFIA 5JOQA 4A8JB 1FU8A 3RSQA 3WK9A 3Q1LA 1YRYE 3R7FA 3WLJA 4H15A 2GTIA 4F4CA 4D5GA 2XZTA 5IAOA 5ALOA 2YICA 3BD7A 1YVDA 4Q3EA 3TSAA 5IDQA 2CNKA 4G36A 4NPAA 1XTUA 4N0DA 5K3EA 2CUTA 3SVLA 1KI3A 3BCSA 4NE7A 1NM5A 4LKOA 3O90A 4QODA 5FYQA 4E1AA 4X7PA 1NOKA 1ZNQO 1ZN9A 2QSUA 4IIUA 4IX9A 1R4NB 1F6WA 2R5NA 1NXWA 4IF6A 3CUSA 1UK9A 4DMGA 1CBUA 3LQRA 4YRLA 1W2WB 3O91A 4D8YA 4AECA 2KBEA 3C7AA 3DVQX 2Z4RA 3E0XA 1VB5A 4Q1DA 1KWKA 1CRPA 1CG6A 5CYGA 1EBUA 2GRUA 1GPWB 2J6CA 2PWBA 1XD2B 1I3CA 2MWMA 4WOBA 5EMLA 1SXJB 4C21A 2WFLA 1V7QA 3L4JA 2JAHA 1DC8A 2WF9A 3EDOA 1FBTA 5BV2P 1BDIA 3FYUC 5IYZF 5FUXA 2C7RA 4AB1A 3MLBA 1KVSA 4QSHA 4EPYA 1KO5A 1ONNA 2M98A 3WMEA 1TU4A 1RLJA 2G0NA 1G4HA 1KYWA 1YBVA 3LT5A 1DTSA 1RWNA 2YY7A 4UVGA 1S3IA 3I4CA 2FGKA 1J56A 4MWCA 1SXQA 4BKUA 2H7VA 2PTGA 1VHJA 2COKA 3AX6A 1ZSNA 2ZB2A 4L57A 5CIWA 4YUXA 5IAKA 3QKRB 1UPUA 2RGXA 5DHSA 1G2OA 2EU8A 5E4JA 2BGGA 3IVAA 5C5EA 1GG9A 2WHPB 1SUDA 3O2SB 4RSGA 4CLEA 2FPPA 4CN8A 3AIIA 1WHTA 3W4IA 3I5YA 2ZRPA 1DUIA 1KS2A 1QHXA 2ZE8A 1V47A 2ZRCA 4IX1A 4L8VA 4M0LA 5B1HA 5FWYA 2PUBA 1TZJA 1EEHA 1NMEA 3NB0A 5GJCA 3U13A 4BMCA 5I7HA 3HXTA 3EGEA 2RH9B 3MSXA 4ZJYA 2DXIA 1CIPA 2ZATA 4JLSA 1FUIA 1TVKB 4N1AA 4OQFA 4QAJA 3ZE6A 5M29A 3INYA 2YXLA 5UKDA 4KITB 2NTYC 1H65A 1EE1A 4HNAB 3U4DA 2QVLA 2O48X 2YYZA 2R7AA 3SM3A 4AG6A 1XXLA 3PG5A 4BECA 3GRVA 2FFAA 3ZCVA 3TQOA 1IM2A 3ELYA 4G4IA 4M76B 1YDWA 2VNKA 3N0WA 4TV9A 1GLNA 1PT8A 2O06A 4ZO8A 5JIBA 5CCDA 2JW5A 1KAHA 3B20A 3R77A 5B12A 5F3DA 1F8XA 2WKWA 1RU3A 1X8LA 4MV1A 4GWGA 1EM6A 2VYCA 1X74A 5C8YA 3LHDA 1ZK3A 3QBTA 4HXFB 1RRMA 4OLFA 2B8EA 2YXBA 3ZS8A 4ZHSA 4HBGA 3DTVD 2O8CB 1V45E 8ATCA 4A82A 2RBGA 1FDRA 4WL0A 4R69A 1DKNA 1TYBE 2CD7A 1IIRA 5DZSA 4B6PA 1G5TA 1UXGA 1OPXA 2QTAA 4HN4B 3LH5A 4TYYA 4QVKA 3VTKA 3KKMA 4X7BA 5DVZA 1T43A 4BV8A 1QTQA 3VYRB 3LUFA 4LJRA 3UV3A 3OQ6A 2Y27A 5JYDA 3BSYA 5FP0A 1ADBA 4LSMA 4RE6A 5CNIA 5A4MS 1SVSA 1PP4A 1E4OA 5JAPA 5JH7B 1CR6A 2X3YA 4NCBA 5A02A 4EH1A 2GJAA 4NNOA 1PT6A 2HWKA 4QC2A 4ZOCA 2EJWA 2FCRA 3MWEA 2R8PA 1Q16A 3IIMA 1JEYA 4HN2A 1KPGA 4D3DA 3VYUB 4WXHA 5INTA 3QE2A 5IKPA 4HGQA 4KRYA 2BFWA 1NKTA 2FZ5A 1NA5A 3GN2A 1P9OA 4WZZA 4CT4B 1SKUA 3EULA 4ZI2A 2D5AA 1FS5A 5I7WA 4Q7MB 3TB6A 2RJ3A 2I6UA 2RONA 3WWDA 1LEHA 3SYMA 4C2AA 2I5PO 3U1BA 3OTWA 2R8OA 4HDKB 2WZDA 2VDMB 3G5AA 2NVBA 1ZD9A 3ZHSA 1L4NA 1Y6ZA 1M1ZA 3G2KA 4WD3A 2Z30A 1EIWA 3ZXUB 5E6SA 4LSZA 2I3AA 2TMKA 3WYAA 3QVTA 3JWIA 1AKWA 2V7GA 4YJ3B 3DQPA 3NIBA 2VAMA 4PX9A 1OZGA 2Y2VA 4LX0A 5DWVA 4ICIA 5ESWA 5FT9A 2HY7A 1R0BA 2FH5B 4ZO4A 3UAGA 1C4WA 3A37A 4YX9A 4W5RA 4AYWA 1NUHA 3EH1A 4MR9A 4NYMR 4CMCA 4EJ2A 4RK5A 4LWPA 3LI2A 4ARIA 4E4RA 2FPOA 2JI6A 3BICA 2VHWA 4ZPXA 3SU8A 3K8OE 3WL3A 5CXXA 1G66A 2J3QA 3SSOA 2GCIA 4YECA 2XQFA 3SBOA 4DKJA 1E3WA 1YJXA 4NIMA 2WE8A 4M1MA 3UCXA 1FP2A 2OD9A 4I7EA 4QELA 5B1SA 2O8EB 4YJ2F 5LJLA 4W5OA 4YJ2B 3NYIA 3DP9A 5KYVA 3RBZA 2I7VA 3T3GA 2CJXA 5M7EA 1CIVA 4CDGA 2H4HA 4L15A 1KJ9A 4HNVA 4H2DA 4XOIA 4Z8XA 2CF6A 2Q1UA 4P80A 5EIWA 3CWZA 4DA6A 4EYEA 4IG4A 4JSTA 2ETVA 2QHXA 4RIFA 1MMFB 3ODPA 1PNRA 2GZAA 1XTQA 2OLJA 4Y2SA 1EM8B 1F8FA 3HKCA 4NFHA 1R0RE 3PUXA 4UJ3A 5CT8A 5EZSA 1RXCA 2AEFA 5JCJA 1S1MA 4BO9A 1TTTA 4HOYA 3U17A 4RLSA 5MN6A 2NP7A 1NRXA 2PKWA 1Y82A 3C6XA 4N47A 3D1VA 1IFXA 3DBHB 2AEEA 1M8GA 2ZVDA 3SZMA 3ANXA 1WZEA 1Z6GA 4ER5A 2FSPA 1VL0A 2QOEA 5GONA 3TTYA 2A4KA 4FT2A 3ZG6A 3B9BA 3H9CA 4BOYA 4G1MB 4NL4H 1FU4A 3UENA 1I0IA 4RADA 4LMRA 3DLBA 2Y1OA 3DKVA 3NM5A 3A3YA 4C0HA 1Z4JA 4EEZA 2BJWA 4W8GA 1OX6A 2Q5HA 1SCUB 4ON9A 5KOJB 4KACA 4FMPA 3MK31 5I48A 4Y2GA 4BB0A 1KIAA 2QPAA 3S40A 3A3KA 2Q6VA 4PIVA 4IIFA 3K53A 5JQGB 3A14A 3IIKA 5EJ6A 4E31A 4EJMA 5C5DA 2QRZA 2VSXA 4Q3LA 3NCTA 1FFDA 3R3ZA 2YC2C 4BJ5A 4MZXA 4P08A 2ATEA 4WOJA 4UAUA 2ZJ2A 3B70A 4BKPA 2J3IA 4BMVA 2OCAA 4MQFA 4X7RA 3KTAA 4LFBB 3ZCPA 2Q9CA 3VDRA 2YR0A 2P67A 1Z0KA 2IITA 1EVLA 1I5OA 3O5AA 4OH7A 4RGQA 3AF0A 3F6CA 2EFDB 1M6NA 2AYZA 2ZSFA 3GPDG 3KLPX 3L0PA 3FMVA 4B87A 1EVIA 4PRYA 1DEOA 1XDDA 2J5BA 5LZ9A 3OA2A 4P31A 5K9ZA 2AFHE 2EBWA 2BBWA 3UKJA 1JL3A 5M34A 4MS1A 1FJXA 4RQUA 4H18A 1CW2B 3OWHA 3K1JA 3U09A 4E0BA 2C88A 1YTUA 1H9CA 1LK5A 1K1EA 1F2UB 4S0ZA 1A9PA 1QF9A 2I1VB 2JGNA 1GO2A 1JTFA 3QLTA 2IYYA 1VG8A 1D2RA 4WNYA 3IAS1 3UY4A 1JDPA 1EP3B 3G9TA 4UM7A 1KMHB 3AFHA 1N2EA 4BFUA 5E6RB 1L8QA 4D8VA 2HHHB 3GRUA 1XTTA 4NABA 4B4WA 1QH8A 4BN0A 4A0GA 4EI2A 3P2MA 2M1ZA 3AR7A 4Y6OA 1QIJA 1XBTA 4IEIA 3A06A 3RVKA 1IJBA 4PLHA 5ALIA 2HK6A 4AJEA 1VRCA 1JIJA 3AP1A 3GFSA 1RABA 4FI3F 1H8HA 2P2ZA 1T9HA 1XK7A 3GRRA 4D4JA 3E03A 1TCBA 2WZCA 5CP8A 3ROFA 3RUAA 3ZWXA 3UMMA 4B76A 2OD2A 1XKLA 4IJ6A 3R76A 3J81A 1CUBA 1L8XA 1D5CA 1MENA 3G7UA 3HUFA 3EZ7A 2XQJA 4NMMA 1X13A 2ZLBA 4Y1RA 2GPTA 2VAWA 5FI5A 4FYJA 4YUZA 2PXAA 5B57C 3FBTA 2PEYA 1YU9A 1GL9B 3LLMA 2A9RA 3M2PA 3DDHA 4IJQA 1MZVA 1SQGA 1Y63A 4OHPA 4TS1A 3GRFA 4KGZA 1QJCA 2PLWA 3FZGA 3P4UA 4Q82A 1X8XA 1FK8A 8OHMA 3K6SB 1TO1E 5T3UA 5SYNA 1YIAA 2BUAA 2LKDA 2ZYDA 3L01A 3TLAA 4A0QA 4M0KA 3VAZA 3H1PA 4OSOA 4D9NA 3BCHA 2EX0A 2HU7A 2VPIA 4FUTA 4K2AA 4L0QA 4B17A 1KYTA 4BIIA 3R0XA 4O2AA 3S99A 3OE1A 4BRUA 3RFVA 4YROA 4ALNA 2W2PA 1XZ8A 4H7JA 1KMMA 4FR0A 4NK5A 2P0AA 4EQ6B 3DCNA 5KX5B 1NVXQ 4O3MA 3OTOB 1PWZA 4N8SA 3IBGA 5A5GA 1MA3A 2I6FA 4B31A 2JFOA 1GFIA 2XMPA 1GNPA 5IKXA 1WW3A 3F1KA 3EIOA 1W44A 5JW6A 2FE1A 5JV5A 3WL8A 2XF8A 3T1NA 1K5DA 3MIZA 4NBNA 5FWXA 1HG1A 2QTLA 4HDCA 3UB2A 3PLAE 5HUHA 4JS0A 4P35A 1YS4A 2Q6KA 2P5UA 2WW8A 2H5IA 2YYYA 4MR7A 1LRLA 2DY1A 3G7SA 2IS2A 1F9AA 2Q6IA 5SY6A 5BN1A 4KGDA 4PZYA 4ZQGA 2IPMA 1YO6A 4JBHA 1C9EA 3DW1X 4TVSA 1G4AE 3JAWB 4KNYA 3KD3A 5JBNA 1CQJA 4L4ZA 3FPBA 4P7KA 1MTZA 1I13A 3CFYA 1P72A 1XMOB 3ZIAD 1A8HA 3EQ6A 1QE0A 4DDWA 2F3TA 3KEOA 4AZ3B 4HAYA 5B7QA 3HCNA 4L72A 3KFLA 3PL5A 4P3XA 1QOPB 3MJVA 4X3PA 2CVQA 3MTEA 2XWQA 5CEFA 1XUOA 1KDZA 1SRRA 3KYDB 1RLOA 3B5EA 1C1YA 2PVPA 4IO1A 4H77A 1ESMA 1SO8A 4QAQA 1L7MA 3CRRA 4Z9AA 1SPXA 1B1CA 1LH0A 3D4PA 4FBMA 3CLRD 4MRNA 4UTZA 3M5CA 3JALA 3A1UA 3JYHA 3K4PA 4FFVA 3IVGA 1F7UA 2JRCA 3ZW8A 2PZKA 4OVKA 3P96A 1QMPA 4NVRA 4QOIA 1A2OA 1OLXA 1VL1A 3B5JA 5JJCA 1USWA 1YACA 4A15A 4UHDA 4LJLA 3P2YA 1YBHA 3PHJA 3QU9A 2WHRA 1EUZA 4RFSB 2IYLD 2LDBA 1XZJA 2VBGA 4JBLA 3H5VA 3JD2A 4R1LA 2PKQO 2ZXFA 2J87A 5AJXA 1Z5WA 5CG1A 2W2MA 5B4TA 3IMKA 3O3MB 2WWYA 2FZKA 4E51A 2ZYHA 2IOHA 1N8KA 3OESA 3I2JA 4NJEB 1A9TA 1KRHA 2BE9A 3GFTA 4AVYA 1IY2A 3F8SA 3U0VA 4GBED 2JFQA 1MV8A 4GVPA 4BGUA 2G25A 2OC9A 3KZVA 4CIVA 5KVCA 4IJWA 1BWQA 3VYWA 2OTCA 4ZVOA 9LDBA 2XT6A 4IVRA 1S2NA 5L3ZA 4R71A 3GROA 1EFLA 1DG3A 4K9QA 4OG2A 2GYUA 3MPUA 4Y6GB 3UHFA 3OBIA 4FLFA 3C8ZA 4XUEA 4BKRA 4KR7A 4P4NA 1IB0A 2OZLB 2H29A 4YJHB 4YJKA 5IARA 1Y4DE 3TI7A 2DC1A 4FGJA 1CUJA 3H5LA 2AXPA 1HDIA 2VUSA 5K0NA 1OTYA 4AN1A 4ECAA 1P2TA 1F2TA 4CKEA 2HC9A 2NTNA 2X3FA 1QTRA 3DHVA 3EDCA 2DPYA 1NRWA 2IEBA 3N2LA 4H16A 2JD0A 4O2BB 4PHFA 5H3LA 3ZOKA 5DNUA 5JFGA 1NBOA 5HKOA 1N8SA 1D2MA 1F0KA 3GZJA 2UYOA 4NE2A 2H1IA 1QR2A 4RJIA 4US1R 4EMTA 4GKAA 4YP7A 9GPBA 2MSLA 1EK2A 3ZX5A 4DVGA 3L8CA 1TPZA 4YT2A 3L0YA 1JBKA 5JD4A 3O6VA 2BTOA 1YJQA 1Z5UA 5ALEA 3PC6A 2QL5A 4ZKEA 2OB2A 2AZXA 4JLAA 3W3ZB 3T7CA 1GSIA 2MINB 4Y1FA 5EPOA 3O2NA 1IK6A 2DH5A 3QU5A 5KO2A 1FX1A 3K9GA 3V97A 3DC7A 5BW5A 3NVKI 1U8YA 3KTFA 4AY2A 2QJWA 4RLQA 2JEZA 1QPGA 3CG4A 4M99A 2EC5A 1Z28A 2V6MA 1C1HA 2H4ZA 1ZBQA 1K7YA 1ZK4A 1NUSA 2X1MA 2X8LA 3KSRA 3QVKA 3R40A 4B48A 1TJPB 3A9VA 4FD2A 4GMFA 1TYAE 1CJVC 3IRUA 4AT1A 3W5UA 2EFCB 5ALHA 2HIHA 1BOFA 4BZWA 1NIJA 3UNXA 2FG5A 5JNWA 4UHBA 1EX6A 4PN3A 3NHBA 4X44A 2GFIA 5EP1A 1X0XA 1V4BA 3GGDA 3PXCX 1EESA 3PJRA 1EYZA 3CRNA 1KAEA 3L7OA 1B23P 2DWPA 3U40A 5I01A 2DJIA 2GRAA 3AETB 3BMNB 2CBGA 4RA9A 3KR9A 1QYWA 1ECBA 1XDWA 4WZBB 5TQ0B 2DHEA 6LDHA 2Q3JA 2YX1A 3JS5A 2OXIA 4E5MA 2IA5A 4I55B 4S1OA 3CE6A 1EFPB 3HH8A 4FQ8A 2FOLA 3K6JA 3P27A 3PQ7A 3ELWA 1RQLA 4HS9A 4MQ6A 3TH5A 4J90A 1KMQA 3DF9A 4N4AA 4PG7A 1WUKS 2BGTA 4BVAA 4PNZA 1OHHA 1N6HA 5E4YA 3U3ZA 5HIKA 4RTJA 3N8DA 2NO7A 1PUJA 3BJIC 3DBRA 3VNRA 3W9UA 3M34A 1HZZA 1UBLS 3UHJA 5CFNA 2IXAA 1VBKA 2R66A 3JQPA 1NXXA 1C81A 1KSJA 2GK4A 1XCGB 1V11B 4RETA 2QX7A 3OU7A 1IRXA 4MPJA 1RI5A 5FBZA 3UAVA 1A4RA 4WKCA 4MQEA 1PWHA 4XX0A 1V11A 1MAVA 4Q48A 5AVZA 5I4CA 4IH9A 2PMFA 4I36A 4R68A 2X9NA 3LYUA 2BGLA 4QSMA 4YUYA 3VHXA 1U9ZA 2GYYA 2CB9A 4P0PB 2PSHA 2I4OA 1A96A 1V3TA 3T12A 4Z3DA 2I65A 3MOGA 3V42A 2BR5A 4Q4LA 3EXIA 1WP4A 4Q6WA 5CK4A 1XAJA 2BAGA 3EZ2A 4H4DA 4OH1A 5C5IA 3KX2A 3K92A 4V03A 3EA0A 3GFPA 3F4BA 3LQ1A 1CS0A 3RVMA 3S55A 5AJYA 2QRHA 4IRXA 2FXVA 1REQA 4MULA 4MWTA 4NPHA 3LKVA 3ZNNA 2R6ZA 3NGMA 3SOPA 4TMWA 3CNLA 2CE7A 3WMFA 2FMKA 4N5LA 3KKQA 2VT7A 4IDBA 3B3QA 2Z2KA 3PSAA 3RBVA 2ZBFA 4NQZA 2OUKA 4PLTA 1QYRA 4D0GA 1CQIB 3Q7QA 5JYCA 4OP1A 3E05A 2IFTA 5A4JA 1VYVA 1R8JA 2YZ7A 1YQTA 4BO4A 3C6QA 2DUUA 3BXZA 4US2R 1GL3A 4BLTA 3EY9A 3U3DA 2D0IA 2ZTLA 2Y6UA 1PSZA 1I51A 1E9VA 1YUMA 2QYHA 3DLTA 4L9AA 2R6HA 2VUHB 5AM0A 1Z6TA 1VHQA 4GQBA 4RMIA 5IZ4A 3T9BA 1RAHA 1W75A 3NAZA 5BN5A 1C30A 2ISQA 1XG5A 1R4MB 3PQCA 3AVVA 4YJHA 1NJ2A 5KSYA 2H4WA 4Y2QA 5F1KA 1XDUA 5FD8A 2EL9A 4GSKA 3DD1A 5ES3A 4YA6A 3U7IA 3SDSA 3TZCA 4U6QA 1PG0A 2XVXA 3QK7A 1NT4A 2AFHB 4LJ6A 5LQSA 3GVHA 3SLRA 1JH8A 5CJ2A 5IANA 3GGGA 4OJQA 4EG5A 5BWCA 4JMLA 1GTJ1 5IJZA 3VI4B 3ADBA 4PHTA 5EQTA 1V7ZA 1FXSA 4GECA 5FTNA 2ATIA 3AI2A 3WDKA 3ZQ6A 5KC9A 1E4EB 1H6CA 1A7KA 2BJHA 2P78A 3RM3A 3FHJA 3BXGA 5DSXA 4C4PA 1MRNA 3FCOA 1EK5A 1G3QA 3ZU4A 2WRZA 2XNCA 2O8FA 1U2ZA 1EXMA 1W85A 2M6RA 2AL7A 1XSEA 2NXEA 2QI9C 5AI9A 3G8DA 5H80A 1WUJS 3S2FA 2GSWA 1YL7A 2XNDD 4DPKA 2DQSA 2GPJA 3AL2A 5DM0A 5F5NA 4UNRA 4BZXA 2ZI4A 4RJLA 4DCGA 3BTVA 4DRYA 2I6QA 3LDGA 1NXTA 3ZLVA 4RANA 2OV3A 2CVZA 1HOTA 2QLBA 1J0EA 3I9LA 2DZDA 3PWSA 2J7PD 3G9UA 3NWEA 4DDKA 1DRWA 1X7DA 2FR1A 4ZOQI 3PKJA 1GOTA 2YZNA 1YDFA 5BYBA 4HZIA 1Q0SA 1MC4A 2WZQA 4P0TA 4BLWA 1Y7IA 1EZ4A 2BTQB 2OCGA 1JFSA 3VGJA 2PJUA 4F11A 2LW7A 1CS4C 2OSBA 2W42A 1Q0ZA 1VYHA 4ZEOA 3CVVA 1RQXA 4CI0B 3WO1A 4P22A 1BU5A 3E58A 3SF8A 4EJSC 1E1NA 3EVBA 3JQ9C 2GN8A 1ZJ4A 4ILKA 1Y8RA 4UUAA 2BCGY 3BXOA 5CB4A 3GLFA 2D2VA 4O25A 3DEHA 4ZT2A 4PCLA 2EARA 1L3CA 2VDLB 2J08A 3QVGB 3VU8A 3X44A 5BUCA 3PHLA 5KZMB 3GLIB 2JKZA 3N59A 1EI9A 4QVGA 2F3SA 2QIPA 2JI4A 2P6RA 4D25A 2MYUA 2O2GA 3VYTB 4MYUA 3JD1A 3RC9A 3O9VA 1QG6A 1ZK1A 5ED0A 4HH0A 3RYHB 3PKZA 4GRIA 1A1VA 4O63O 3ZJYA 4L4RA 4C7BA 1D2HA 3WGGA 3SZ3A 5CVTA 1AGYA 5AR1A 5K05A 4W5TA 3LUKA 2R1VA 3VHLB 3D6TB 4GQIA 3GD5A 5DEOA 4X63A 1DI0A 1EA5A 3BQ9A 2LIPA 2D5BA 2WHYA 1J90A 3AZQA 3DJFA 3QZUA 4LW8A 1T3HA 3GLRA 5LFAA 2XGOA 3HJFA 3PTAA 4HC4A 2MT9A 3AUUA 3TSYA 3GN1A 2ZUTA 2JC3A 1T36B 5F7OA 1C3VA 1M0SA 2Q4DA 1P2SA 3JQRA 4KW7A 4DNXA 3NV9A 1CUFA 1YB1A 1SVIA 1V1MA 2VOEA 2B5WA 2C92A 3IR6A 2PDAA 3Q40A 5ALQA 4BY9E 2HBRA 1X15A 4BNDA 4W5HA 4B3TB 1D2GA 2IXTA 2I6SA 3D7LA 2ZWPA 4AUNA 3JTEA 3ELBA 1CULC 3BG5A 1MB3A 1VMKA 2JATA 2JGAA 3JSXA 5DRTA 3RWMB 3GDOA 3FGPA 3CLVA 2MMCA 4ARSA 4M9UA 3M82A 5JLAA 2HB6A 1MOPA 2OM6A 1AHIA 4LK2A 4M88A 5IWCA 5F7XA 3LC7O 3O31A 4KXLA 2GB4A 2FHSA 3O7WA 4JCOA 4XIGS 4ZVTA 1WXEA 4RMNA 3W04A 1SUPA 2PU5A 3VX4A 4RDIA 3ZLTA 2J3LA 2Y1DA 2I91A 3ET5A 3KZNA 4I5EA 4TXLA 3UW3A 2PO7A 4AP6A 4PBTA 4CCYA 2C07A 4EG7A 4DM7A 1G63A 2GWHA 1UZUA 5FAKA 4XWWA 1UMDA 3ZYZA 2QLTA 3S7ZA 1SU7A 1O03A 3I6IA 3EXG2 4P3NA 5DYIA 4EG4A 2LVBA 3JWHA 4K0RA 2I7XA 3FKQA 3G59A 3PNMA 5EWLA 1YR1A 2Z8XA 3IKTA 3HFGA 4YMVA 1QR6A 2CZCA 5JNTA 2QN3A 4H27A 2R00A 4WADA 4UD2A 1T6XA 1RI2A 1M1YE 1QXSA 3BWDD 1I1NA 2H4XA 2ZI9A 4QGBA 1O5TA 2MSCB 4X54A 2X9LA 2B5OA 2DKNA 4XRRA 5TPZA 1HRDA 1PFVA 1UQUA 3IALA 1DARA 4PFJA 5MN4A 2XE7A 4B7ZA 4LC9A 4PANA 2G76A 4CEHA 3WA7A 2JD1A 4DLTA 1YQXA 2W6OA 4W6ZA 4OBWA 4EVQA 4AZWA 1QHYA 4JUDX 4L5CA 1UDWA 1AIPA 3DFZA 3EN0A 2IZOA 4B71A 3V8NA 1CYDA 3GOHA 3S44A 2ZKLA 1RE0A 1PEDA 2X5OA 5DN6D 4FU0A 1X38A 1M1NA 4G1CA 3VH1A 1XQXA 3GCXA 2BEUA 3GMDA 2WFZA 4G97A 4YFVA 1F8UA 4RQAA 1RM5A 2X8AA 1A7UA 1D6NA 1T4MA 2QORA 2EDCA 4TL7A 4AMZA 1K9SA 4L2IA 1I7NA 5FDFA 4J0CA 3HKBB 3TLCA 3U44B 4JJKA 1VBFA 2VSFA 2XH8A 4GS5A 3I2IA 1GARA 1NUTA 2C3PA 1FSSA 1RTTA 3C3EA 1JT2A 1SBHA 3IUEA 4JBGA 3DAYA 1L5KA 3PZBA 3WLHA 1U4OA 1SIOA 1C8BA 2EEZA 1J70A 4IRMA 4CM4A 4CKWB 5ILOA 2PUAA 3IDZA 4EK9A 4DR2B 1H2YA 2N1MA 2FVXA 1HL3A 1F20A 1CFJA 4XWAA 3AHHA 4KQJA 1ZVVA 2RB5A 2JCGA 3HR7A 2WJHA 2VT6A 3UICA 1F7VA 3DEZA 3UHOA 1Q1BA 1G5PA 2I8LA 3H2JA 5I4KA 4NBLA 2GVZC 1ETUA 2VHQA 1RM0A 1C3OB 1EXDA 5B53A 1IAVA 3D8SA 4IMRA 3COJA 5FHQA 5KNCH 2PA3A 2PA0A 1OBHA 4EFNA 1D4ZA 3NWJA 1G8KA 1ZG3A 2H7YA 4DVJA 1XQWA 1ML3A 3GJRA 5KYYB 5AW2A 1H05A 1SB9A 4KVZA 2OESA 1LK0A 3BH7A 3V34A 5LZ7A 2AMLA 3NJ8A 5TJHA 2WM3A 4LC0A 4AROA 3W8NA 2NVOA 1RLTA 3KQSA 1NQTA 3BCRA 3SLGA 3FNFA 2ID4A 2Q2NA 1VP3A 1JR3A 1PT9A 1D2AA 1RQRA 1PR2A 1UBJS 2PQ2A 3I6MA 4L73A 4KOEC 5GADl 5D3MB 5HBRA 1VIDA 2QRVB 2XQKA 3EC7A 3IP7A 3M1LA 5LD2B 2HMUA 3Q7PA 4JLMA 3EX7C 4XR9A 2QNRA 2QROA 3KP1A 4TYQA 2H31A 3JALB 1E3IA 4LYEA 4RFLA 5IBQA 5KI6A 1A77A 1DWPA 2Y76A 2GEJA 3AH8A 3M7IA 4I6EA 3WK5A 4KIWA 4CLRA 2DQYA 4PC3A 4BGDA 1FQWA 3VFDA 2ES4A 2BMVA 3U3RA 1YA4A 4URUR 4ZO7A 1B8OA 5H16A 4NBRA 2VHVA 4XB1A 1O95C 3FE2A 2J0EA 5DF1A 1WDWB 2X0IA 1CS0B 3RARA 4ETIA 5TIIA 4MW4A 4DR3B 4GOOD 4NI5A 3WAKA 3TZ6A 2FR8A 4D42A 3R4VA 2RGDA 3LT0A 1X0VA 1X1TA 1WKCA 4IQ8A 4L9RA 4LXYA 1XL1A 4PLZA 3QVUA 3TS1A 2FMUA 3NI2A 4KZKA 3ONVA 3GAAA 3OJWA 4KV9A 1FVXA 1O54A 2HT1A 2WZBA 2DMRA 3RVDA 1NXVA 2IF2A 3D2LA 5H81A 4LE0A 2XNSA 2ZJ4A 4ND4A 1MO3A 5GIPE 1U4NA 2R8RA 2WG2A 3ZJUA 3TQFA 4OB7A 1PJ3A 5DJ5A 5TEVA 4I14A 4KIGA 4HNUA 2DHRA 3BFJA 3RRNA 3ZEAA 1NAIA 4ZOLA 3QEMB 3W77A 3PEYA 1Y42X 2I34A 2ONZA 3HA7A 3N75A 4MICA 1QUFA 2I7CA 3T99A 3WSWA 1XZPA 3NHLA 3KPUA 4FC7A 4HVAA 5HFJA 4CEHB 5IHXA 3Q3EA 1RHMA 3F7NA 4JP2A 4L8LA 4DMMA 3UWSA 3BGSA 2XMBA 3KS9A 2H18A 4G5YA 4KWHA 3QXSA 3VYSB 3OEHD 4QQFA 3SXUA 4KX5A 1WZNA 5K1ZA 2Y1LA 2X3UA 4IGFA 1LD3A 3B6JA 2AVNA 4Q12A 2G0AA 2H00A 4DQUA 3CH6A 1QVVA 4KQEA 4UQOA 5ECWA 3S5UA 3EE6A 2NZJA 3H5WA 4FNAA 4LRXA 3DZJA 3WB9A 1V2HE 1VSUA 3PTLA 1GPDG 5GOZA 4DQVA 2G8LA 1NBME 2V9PA 5I51A 3RYCA 1PZGA 2OO5C 2P8SA 3MWEB 4MX8A 1VKRA 2ZR9A 3MLAA 1AUQA 3T3IA 3K15A 4EHHA 3K6SA 3ZGLA 1M34A 2O20A 1X86B 1SG0A 3KXLA 5IAAA 3PJGA 1QGZA 5EJFA 5J2UF 3WV5A 3CLHA 2C77A 3DTVB 2OFOA 3BH6A 1G2PA 1LJUA 1QKKA 1T35A 1KPIA 1QORA 1UADA 3BE5A 4M53A 4ZPJA 5DCUA 3GJ5A 4X41A 3HZRA 3LGXA 5ALYA 2VLIA 2YXDA 4BLSA 4RTSA 3U7FB 2OCLA 1QV6A 3OC0A 4RZ3A 4BDTA 4D41A 4B73A 1KYXA 1Y7PA 3V00A 2BFNA 4YO8A 4DIOA 3QKIA 4TXNA 1H4QA 2V03A 3W1WA 2HRDA 2NZXA 2P4HX 5BR7A 1QX4A 5TQVA 3I5MA 2PVCA 2VJKA 2IYEA 1LPNA 3KXKA 3COSA 3D4OA 4QQKA 1OH8A 1P1BA 4B2IA 4F9TA 5ALKA 3FCEA 1TRKA 3G9XA 2YQ5A 4U5XA 4W5JA 4ECEA 4AS2A 2LZ0A 3SC2A 2XXAB 2OHVA 3DC2A 4F4DA 2HBYA 3TZQA 5BPHA 4PCVA 2LUOA 4BKMA 4U7HA 2P91A 2DQZA 2VNIA 2ZS7A 3RC7A 1C14A 3E22A 4KPFC 1MH9A 4Q1EA 5J4KA 4P93A 4RTQA 1FDIA 1DO0A 2PBRA 3QU4A 1IONA 5AXDA 1DXOA 4ND3A 4NULA 1HFKA 1ODFA 3GMIA 1IB6A 4QJ4A 1EWKA 4DXDA 3U4QA 5TXGA 1KI7A 1XV5A 2H5EA 5JXIA 1KYVA 2YVUA 1J2JA 1GZ7A 1ZQ9A 4CCAA 3OG9A 4F6RB 3IP3A 3HYRA 3MTGA 1KKUA 1UBUS 2A0XA 4RWZA 3WIVA 5JDIC 1G6Q1 1E2KA 3G6KA 2F1JA 4NEGA 3D6UA 4WAUA 3QX9A 1RJEA 1P1KA 1NBHA 3CBQA 3AY6A 2V98A 3KOYA 4GT1A 1P4JA 4C43A 1T8PA 1OAKA 5LYJB 2OILA 1SN7A 3OUTA 5EEGA 3TZHA 4CN9A 2EATA 1Y8QB 3V8RA 4JIGA 2IUYA 2VCHA 4GLJA 4S1PA 1CUWA 1H6AA 1NDUA 2P40A 2V7XA 2X6TA 5IFKA 3K0SA 1CE8A 2BONA 1I94B 1EVZA 2FY8A 2NTJA 3QWIA 4DIBA 8GPBA 2XMRA 1ENZA 1M33A 1TFRA 3L07A 1LU9A 3IR5A 4GVLA 3WNQA 3A4YA 3CF4A 3WLQA 4G8JA 1RCFA 5HTOA 1TB4A 1I1QB 1RAIA 2FF5A 1CDZA 4PSKA 1RNLA 3BXFA 1GKLA 1KAGA 1O87A 3AEKA 4H31A 2J0VA 2W7TA 1CV2A 4EP1A 3B3JA 1XMXA 1CZKA 2G4VA 3IPLA 1KIMA 4HKTA 3PGLA 3D6NB 4HD8A 5AVQA 4OEHA 5CU7A 5JG7A 3KJEA 3W9YA 3CV3A 1ESCA 4G5HA 4M86A 5FI0B 5ITVA 1IRIA 5AW9A 1DXQA 1DP4A 1E5QA 1HQCA 1CQIA 3OT4A 1U0LA 1QYIA 1F1BA 2MU1A 1BVUA 1E3DA 4FP9A 4Z9YA 1MKYA 5KYWB 4QM6A 1C8LA 1P1FA 2QRMA 2BKAA 3FLEA 4B4DA 1S3SA 1AH2A 2ZXEA 2JAXA 3I64A 2AJTA 3MJTA 3OOEA 1NFFA 1NW8A 3GPCA 5H4GA 1NC3A 2QQ0A 5A5DA 2F7SA 1V71A 3IAFA 4AKGA 1SC6A 1HUQA 1XNHA 3QY9A 4CV0A 1BS9A 3W9BA 1OB2A 3I12A 1U0HC 3ZCQA 2ZSJA 1QGED 3VZRA 4OPMA 1V3UA 3ZJTA 3ED1A 1RS0A 5L7YA 3WGTA 4HV4A 1QAOA 1WDLA 3P4XA 1NQOA 2VPWA 2CDAA 3L05A 1NW4A 1AKYA 3E8MA 4G4SO 2ESRA 4DWVA 2NMVA 4E07A 1DXYA 3URMA 5BMOA 1I2MA 1NP6A 3MOIA 4CT5A 4LBVA 1JJIA 1L5OA 5FOVA 1KJQA 2G82A 2EW8A 5DH9A 4E6EA 3L1JA 4O4JB 5L6LB 3DEKA 2XOXA 3IIEA 4E11A 4HBZA 3HB5X 1NI3A 5JAMA 2IHTA 2HJSA 4V3CA 2F67A 3DTVA 2YWHA 1THGA 3I04A 4IIDA 4P2GA 4YRMA 1EBBA 2ZE5A 3SD7A 5JQWA 3C4JA 1P9NA 1E2IA 1WQ4A 2E49A 1BE1A 2HQRA 2JI7A 2WICA 3O82A 2PD6A 4IMPA 4MPPA 1DQSA 4RAQA 4U7GA 4D43A 4U2EA 2FAXA 2ID7A 4FZ5A 5IMSA 1X7WB 3W2EA 3GJQA 2B0CA 2QB5A 2ERYA 4MLDA 5IFLA 4R84A 3DFKA 1L8OA 3ZHRA 3PRJA 3K0CC 3EBPA 4GM4A 1YRBA 2Q8PA 3K30A 3LLVA 2CCGA 3N7UA 4V2IA 3PCRB 4F9GA 2Q8QA 2CWWA 3FPGA 1BVRA 3GU3A 1G9TA 5ALSA 5FOSA 2C7QA 2VKTA 3DCJA 5K0CA 4L8FA 4FQ5A 1VGVA 1B3RA 3T54A 3OX4A 3P2IA 3ZGNA 3GY0A 3CHYA 1AURA 3E9QA 3E9RA 3IOCA 3OQIB 5D5PA 2E5FA 2RI1A 3MINB 1Z18A 4UXIA 4WKGA 4O4IB 3UPDA 4GPAA 3WRXC 3WGMA 2BMAA 1GZ6A 5KCMA 3O7MA 4D3SA 3TECE 4CNQA 2O8NA 4UULA 1WHTB 4C7JA 1HYBA 5HM6A 1GNSA 1DQNA 5KDOA 3VQTA 1KYYA 1I3MA 3KSAC 3NX4A 3P20A 4I55F 1YT5A 1MEOA 1AC5A 3UT6A 5JUWA 2NYVA 4ID9A 3GG9A 2ZYSA 1Y6JA 2IP1A 2QTZA 1ZL0A 4X97A 1XRJA 1QFSA 4BC1A 3JASA 5CBKA 1X7YB 3CZPA 4IO0A 1FNNA 2HPVA 3H86A 3AETA 4RA9B 1ZIPA 3RH0A 4FMBB 4E08A 2B6NA 2FFRA 4X5OA 3MTQA 4J2TA 1T1RA 1N5MA 2HHAA 3FCYA 4RVHA 2LTAA 4UAJA 2YWGA 5LOVF 3HNRA 1FRZA 4K1XA 1XTZA 3DE5X 2IV7A 1EFPA 4B82A 3O93A 4EJSA 3OSUA 4OYHA 1XZQA 1XU7A 3L8HA 4JITA 1DU4A 3G68A 3LFUA 4E5DA 2UXDB 4C0KA 2W6NA 1GL6A 2WQZA 2DPXA 2J09A 2M1XA 2W4IA 5TQ0A 1MG0A 1U8EA 3ESAA 4QDTA 4CQLA 4AIRA 1UJNA 4IDAA 2WJGA 5HF8A 1KDYA 2CLFB 5AJZA 3OF5A 2EFJA 5K2OA 2L2QA 4CIYA 2FG6C 1B26A 1PJSA 4DYHA 3LQQA 4ZEMA 1W0KA 1DV2A 3MN1A 3ETLA 2UYCA 1PS8A 3DZBA 1QGDA 4J2HA 3CIOA 2XWBF 2MIIA 3K4HA 1M83A 2A1UA 2Y1KA 4EY3A 4M1EA 2XE6A 1WNFA 2VSOA 4R8VA 2JDID 3PYLA 3QTBA 2GBPA 3RKRA 3KCNA 3KZCA 3G0OA 3ONFA 1D5WA 4GX5A 3MMZA 4B2YA 4S05A 1QMGA 4PAGA 4LQLA 1NZDA 3KPJA 4BNZA 4BJ6A 2H5JA 1WTAA 1JN0A 2OO7A 3QIAA 3THSA 4D9MA 2H1OA 5JD5A 4UDNA 4D74A 5EE1A 5DOZA 2JAQA 2HA2A 3CINA 3EW9A 3FOAA 4HFMA 4MKIA 1VGRA 4OY3A 4WCDA 1PFGA 1Z38A 5SYMA 1U2DC 3UWDA 5JXGA 3I0MA 1ZY2A 3LS2A 1AGXA 4TTJA 4Z2YA 4UMFA 2GLXA 4PFKA 2AG5A 3ET4A 4R7GA 1NM5C 2CLMB 3ZU5A 1FMTA 4JFAA 4I50F 4WINA 4YONB 1GQ2A 1KJ8A 3ESXA 1S2MA 3EZ9A 2GD0A 3L92A 3KBBA 1NKVA 1G8AA 4ETMA 3K9QO 4FJ2A 5FF9A 3CNBA 5BW6B 1PR5A 2OV4A 4NCNA 2Y68A 4W1SA 4WCFA 4HEJA 1SVNA 3BBLA 1W48A 3ZXXA 1A9SA 4YAGA 5KQLA 2HR1A 2OGSA 1QK3A 5AVOA 5TQ2A 4Z6KA 3B9QA 5DBFA 1BN7A 2FRDA 2ZVJA 1Q21A 4QKQA 1IPFA 4M0FA 1Y8ZA 1QFJA 3HO6A 2ZBEA 3D54D 3KU1A 4ANFA 3UHPA 1MHTA 4YPFA 2VZ0A 1ISHA 4RVDA 5T4FA 4EG3A 1YU6A 1JJAA 2IOFK 5KTRA 5JO0A 3C5HA 5KWEA 1AZWA 4R01A 3QXCA 4GKKB 3QEJA 2Z9BA 2DKOA 2VR1A 3A36A 1B6RA 3CR8A 4PYQA 5A3VA 1BQ3A 3WKDA 4D9IA 3BCUA 4BCDA 1RMQA 4BCBA 4Z51A 1VKHA 1K4MA 5LLDA 3E0QA 2G77B 3A26A 3GBPA 4ZI3A 2X7XA 4AY6A 1VKNA 4IGKA 1S8FA 1O08A 5AUNB 3M5PA 1ZLYA 4NH4A 4ND8B 2VP6A 4MR8A 2Q50A 1SBCA 4V0MA 4HDOB 3K0FA 1W76A 1FZQA 1T8WA 1LSUA 3LCCA 4KXYA 4MUBA 1CZHA 2VJBA 2CNLA 2VS1A 2D1FA 1MOZA 2GCGA 1Q3TA 1Q6YA 1WEKA 4IOJA 3VZQA 4S3MA 3EPLA 3MB5A 1RAAA 2IELA 5K6AC 3AHGA 1VHDA 1ZGZA 2O1WA 3V46A 4YXWA 1U5BB 4Q05A 4MVCA 4UPEA 1DMSA 1M0EA 5K8LA 3HRIA 1F4PA 3F5MA 3MOSA 5DP1A 5AFSA 1D0SA 1ZA1A 2FLVA 1I0ZA 2W8BA 3IIIA 1SUWA 1D9XA 5AJTA 3RYFB 1P0FA 1S02A 4G0WA 4H6VA 3QVWA 2P9QA 2A7XA 3TLGA 1MQ8B 4RDHA 3CZ4A 1AQNA 2ZIWB 4LOAA 4W9NC 1S1CA 5TF4A 4DR1B 1BCSA 2R6GA 2V5AA 3F98A 2FN7A 3H4MA 4MV3A 4LK3A 4RD6A 4XUCA 2PN1A 4P5EA 3UT0A 3OOSA 3W5VA 3IUNA 2PUWA 4ND6A 4EHFA 1LTHR 1KY5A 1E62A 3BMCB 3I01M 3UJ9A 3V7FA 4CF4A 1TLLA 1LV7A 1RYNA 2P30A 2RHJA 3PNKA 1Z4MA 3QVOA 4KDEA 2V0GA 3FNQA 3WGHA 4DA4A 1HDOA 3RS9A 4BVBA 4OQLA 4A1OA 1E1QD 2ZETA 4C6HA 2YJZA 4OI1A 3SZLA 4NE9A 4EY8A 2HN9A 4WDRA 2QV0A 1ADCA 3RHTA 2VDJA 4QPJC 2FPWA 2Y3IA 4TLCA 3CR7A 2WU3A 3IA2A 3CQ9A 4BMDA 4BFZA 4C4TA 4WFQA 2AG8A 3KAKA 3SZOA 2CNNA 2XY4A 5C51B 5C8YF 2AFIA 1ULTA 1QVZA 1TA9A 1XCBA 4MK4A 3DE7X 4MUAA 1OGJA 2Z4TA 3L6DA 4MVXA 1H1DA 4V39A 4I1RA 3FUTA 2AN9A 2AXEA 1KVQA 3ML1A 1UPFA 2QVXX 4JOBA 2GWRA 4MWEA 4DIFA 1E7WA 2CW5A 3WKCA 5IAEA 1ZIXA 4DV1B 4BC0A 1TGYA 4KFTA 1JLRA 1R5JA 2D1RA 4II3A 3NKFA 3LP8A 4NJOA 4QGAA 3T1TA 3W8FA 4MCJA 4IICA 3IXMA 4QBGB 1UJCA 2IYNA 3HYCA 3KT0A 4MRSA 3ZUPA 4TZ6A 1G42A 1DIRA 1JA0A 4O2BA 1FQOA 3ZN2A 3OZCA 5LWHA 3DEAA 4JGIA 1KAOA 2IBSA 1CIJA 1HDEA 4UXJA 1R10A 2C99A 1RRPA 1KI6A 4JJ7A 2EZUA 2F8SA 1ZDMA 3SKXA 4BBAA 3P2KA 3LC1O 3WGIA 3W2IA 1LPOA 3VDXA 1ZJYA 2NV2B 3ACBA 3DT8A 4WA7A