3OZEA

Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
263
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-methyl-5'-thioadenosine phosphorylase
publication title Crystal Structure of human 5'-deoxy-5'-methyladenosine phosphorylase
rcsb
source organism Homo sapiens
total genus 88
structure length 263
sequence length 273
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozeA00
3D1VA 2H8GA 3EMVA 1JYSA 1ECPA 3UAYA 5F7XA 4FFSA 3F8WA 4P54A 4YNBA 1Z35A 1PW7A 3U40A 4TTIA 1K9SA 3IOMA 4EB8A 3ONVA 4MARA 2ON6A 1A9PA 1A9SA 1OU4A 1RT9A 5CCEA 4M7WA 3O4VA 1PK7A 3LBAA 4F3KA 5ETJA 3UAWA 1U1GA 3UAVA 4L5CA 1OTYA 4DAEA 3K8QA 3OZDA 3PHBE 4M3NA 3PNPA 3E9ZA 1SJ9A 1T8RA 5I3CA 1JE0A 1T0UA 1QE5A 2ISCA 3LGSA 4TS9A 1Z5OA 4OGKA 1TD1A 4D9HA 1RFGE 4QFBA 1ZOSA 3K8OE 2I4TA 2I8AA 3FOWA 3BL6A 1B8OA 4DABA 4TXMA 4PR3A 1A9OA 1ODIA 2A0WA 4F3CA 4TTAA 1LVUA 3FNQA 3OZCA 4MCIA 2QTGA 4NS1A 1U1FA 1RYZA 1PF7E 1Q1GA 1T8SA 1A9RA 5CXQA 1JE1A 3FB1A 4LKRA 4L6IA 5CXSA 5F7ZA 4K6OA 1OV6A 5CYGA 3EUEA 3BSFA 1T8YA 2QTTA 3KVYA 4WKNA 1Y6QA 2IQ5A 5B7GA 4D8YA 1Y1TA 1RXYA 3E9RA 1V3QE 3UAZA 4I2VA 1RSZA 3P0FA 1NC1A 3OZBA 1LX7A 2AC7A 3SCZA 5FAKA 4PNPA 1RXUA 1SQ6A 1U1CA 4LNHA 1Y6RA 3C74A 5B7QA 1RCTE 4WKBA 1Z38A 4G41A 1ZL2A 4BMZA 1M73E 3O6VA 1CB0A 5B7NA 1PR1A 4L0MA 1V48A 1SD1A 3GGSA 4TS3A 3OZEA 3PHCA 3P0EA 3E0QA 3KUKA 3OOEA 1A9TA 4DANA 2OECA 3EUFA 1V4NA 1PR6A 3NM4A 4OY3A 4NY1A 4G8JA 4X24A 4IP0A 1Y1QA 4L5YA 4WKCA 1PR0A 2BSXA 2GUWA 5F78A 1RR6A 4BMXA 4F2PA 1JDUA 1CG6A 4GMHA 4OGLA 5KB3A 4EARA 3IEXA 2B94A 5JPCA 5K1ZA 3OCCA 4DAOA 1U1EA 4QAQA 1PWYE 3PNSA 3ENZA 4D98A 5F77A 1K27A 3NM5A 4WKPA 2AI1A 4M1EA 4KN5A 1OUMA 4JP5A 3KU4A 3KVVA 2PGAA 3LA8A 2HSWA 4TXJA 1OVGA 3FUCA 3KHSA 1JDZA 3T94A 1OTXA 1PR2A 2A0YA 1V45E 2OXFA 4NSNA 3OPVA 4R2XA 5B7PA 1TCUA 1B8NA 1PKEA 1PBNA 4D8XA 4TXLA 4JOSA 4RJ2A 1SD2A 3EEIA 1YQUA 1Z5PA 1LV8A 1U1DA 4LNAA 2QDKA 5F7JA 4MCHA 2OC4A 1TCVA 1ODJA 1VHJA 4DA0A 2P4SA 4WKOA 4E1VA 3DP9A 1NC3A 4GKAA 3FAZA 1N3IA 1YBFA 4R31A 1ODKA 1Z39A 3BJEA 2AI3A 5F7OA 1ULAA 5C80A 4D8VA 1PR4A 1TGYA 5EPUA 2RJ3A 4F2WA 1Y1SA 1Z33A 4QASA 3INYA 1Y1RA 4UC0A 3QPBA 4BMYA 2OC9A 3OF3A 2QSUA 3DDOA 1VHWA 1XE3A 1Z5NA 1YRYE 3MB8A 5CYFA 2HN9A 1YQQA 4DA8A 4R2WA 4YMLA 1TGVA 3FWPA 3KVRA 1VMKA 4U2KA 4TTJA 5EUBA 1PK9A 1WTAA 2A0XA 1JDTA 1ODLA 1A69A 1YR3A 5IU6A 1NW4A 4H1TA 1V2HE 4JWTA 3UAXA 1RXSA 1Z37A 1JP7A 1Z36A 2Q7OE 4DA6A 1JPVA 1VFNA 5CCDA 5DK6A 4BN0A 4QATA 5EFOA 3TL6A 4DA7A 2AI2A 4TXNA 4TYMA 1G2OA 1C3XA 5F76A 2QPLA 3NBQA 4ECEA 2HRDA 1PR5A 4OEHA 3UT6A 4DARA 3ODGA 1JDVA 4YJKA 4QEZA 5F73A 1V41E 4L5AA 1T8WA 1ULBA 4TXHA 4OF4A 4GLJA 3DJFA 4LDNA 1I80A 4F1WA 1Z34A 2A8YA 4OJTA 3DF9A 3DPSA 2XRFA 1RXCA 4LZWA 3MMSA 1FXUA 2HWUA 1JDSA 4G89A 1A9QA 4QARA 5IFKA 4YO8A 3OOHA 3GB9A 3BGSA 3NM6B 4GLFA 1K3FA
chains in the Genus database with same CATH superfamily
4C0JA 5DJ5A 1TKAA 3WWPA 2MYPA 4AP5A 1O9HA 3UB2A 3JPWA 2BP7A 3W3AA 1ZUD1 4CT4B 1EKXA 2AQHA 4RD2A 3LXMA 3O47A 4LEIA 5FOVA 4CLXA 1PZFA 1U2DA 4UTRA 4FDVA 2K2QB 1XAIA 2Y4NA 4Q9DA 2DTDA 4LC0A 1GCAA 2P4HX 4ZVLA 1YBMA 4LMPA 3VC7A 1Q1NA 3DA8A 1K7XB 4J94A 2C9YA 4KK3A 3E18A 4LZOA 3KM0A 4TMVA 2ETXA 5ALFA 1IG3A 3OJWA 1PW7A 2X86A 3G6WA 1GLVA 1FYVA 4KO2S 5CX1B 1WVIA 4GX2A 4BO8A 2VJDA 3HCBA 3IOMA 3LQQA 1T36A 4Z9XA 5JASA 1EM8A 1VJTA 1LQTA 4XLTA 3P7MA 4X7RA 3NIDB 2R65A 3GLFE 2DBQA 1GEEA 2ON6A 4IDEA 2N9UA 3T7SA 1DP4A 4EF6A 5D1NA 3IVXA 5BWNA 4IKEA 5JVDB 1XKXA 1JQBA 1MUUA 1DAGA 1LFDB 1BFDA 1RT9A 4DUGA 4U7HA 4M7WA 4GBED 2RHOA 2X15A 3V9PA 4B3JA 1NQWA 3JQRA 2FWPA 1P0QA 1X13A 2GPSA 3AERB 3AVOA 2QMZA 3THOA 2DYKA 2L0XA 3KV1A 3WSTA 3F6PA 2H1LA 3RBVA 1IUOA 1JECA 1QE0A 3LRTA 3M1LA 1JFSA 4YDRA 4ND4A 2LRHA 2ZUTA 3V34A 4S12A 1WW3A 1EUCB 2BT4A 2PBZA 2AHRA 1IBLB 1EXMA 4LJAA 4Z3OA 1EX7A 5M2QA 1AA6A 1E7SA 3UMBA 4L9SA 1ZRHA 5FQNA 2HSJA 3FFXA 3OJEA 2JASA 5EHQA 1EWRA 1N0WA 5HMLA 5BNFA 2WWTA 3PXEA 5EJ8A 4M0KA 3LFTA 3LCMA 1K4KA 1U0JA 4M87A 5K3AA 2O8CA 1PEDA 4WXRA 4GBJA 4ZVTA 5JNRA 1GG8A 3N8KA 1MEOA 5CLIA 2A9FA 2QVYX 1IOLA 3LO8A 4MR7B 4P7JA 2E21A 5CVCA 3RFTA 5EZ6B 5KAMA 2NO7A 2EP8A 4FGKA 1WSAA 3VGJA 5EJEA 4OGKA 2VPQA 3TQFA 3F78A 3RTDA 2CEAA 2E3JA 3LUGA 1HTBA 4R1PA 2V9PA 4IF6A 1B2LA 3IVCA 3H5VA 2A86A 5TNXA 3NH6A 1C7ZA 5C1OA 1JLLB 4LGVA 2XW6A 3FMIA 4MYDA 4RUKA 3TVDA 3JQAA 2D6FA 1HDOA 2I8AA 2IP4A 3ZWBA 3SFVA 3JWPA 2O8NA 4Z0TA 3OPYI 1A50B 5EESA 1P7ZA 4LE0A 3T3HA 3V1UA 3Q8WA 1U90A 2I6SA 1OLOA 3S2GA 5AKLA 4KLNA 1L5SA 5G0UA 4ETWA 1KHHA 4NX2A 1BDMA 2ZWPA 5DYYA 3SHFA 1FDUA 3ZHBA 2O8FB 2H18A 3CLTD 1FZQA 3GZNA 3H5AA 4IOMA 4B2IA 4COOA 4K8OA 1RAAA 1SIWA 2QYOA 1D2MA 3HGMA 2E4UA 4LRQA 2XUJA 3AHEA 3BMCA 4LMBA 2IOHA 4CIWA 1KZ7B 3QPCA 5CMLA 2FFJA 2P27A 5JH7A 1W581 1ECGA 1UXJA 4CQNA 1S8FA 1YS6A 1EDOA 1XTBA 2ZRNA 3FZNA 4M55A 5CK5A 4JQOA 5JYEA 3DD5A 5CM9C 1OFIA 1T9GR 2F17A 1FVFA 1CZRA 5DTIA 1BE1A 1NW5A 1X38A 3OA2A 4EKDA 3LUKA 2ZQZA 3PA8A 3PR2B 1XALA 4EG7A 5JJBA 2OPHA 4RA6B 3RC3A 3OLZA 1XCBA 3AFGA 4PIPA 5LYJB 5IZCA 2ZTMA 3A10A 4NMWA 2B7BA 1OIVA 2Q29A 5C7IO 2Q45A 4FIDA 4MB0A 3UJHA 3EUEA 2YIMA 4CG2A 3K9HA 1UP7A 4PPGA 3GL9A 4WA8A 5JT1A 2AFHE 3EZ6A 4MVJG 3ZCXA 1J2JA 1LBTA 1Q6ZA 3RSZA 4F4CA 3OY7A 4BNDA 2RGNA 2XZTA 1RLIA 4RK4A 4EW3A 2OEPA 4CCYA 2Q07A 2FEOA 3L7KA 5CX4A 4OMCA 2P0EA 4KKVA 1I8TA 4U2DA 3JQDA 1Y1TA 4Z3DA 2WJ4A 1T5BA 1UBFA 1VZ3A 5IZCC 1WV0A 1ONSA 3RJ5A 4I1VA 3ZJTA 1CJUC 2IS4A 1W8DA 1XF9A 4MRVA 2HI0A 3FZQA 3GEEA 4JI0B 5JS8A 2A2ZA 3WBKA 3ZQKA 3HXPA 1NC1A 3F7TA 2AC7A 3MGBA 3L92A 1S4QA 3IP1A 3SCZA 2ROQA 3CGWA 4I1PA 1N1MA 4PNPA 4Z9BA 4F6LA 3RVQA 4RL4A 4D3XA 1E0SA 2EWWA 5BNIA 2VJCA 3GWZA 2O3JA 2XDAA 2BHTA 2JCXA 2SKEA 1PYDA 2VSFA 3A9TA 4GMXA 2YZNA 1CPYA 2I5PO 4LZAA 4ZRMA 2X5NA 3DE4X 5A05A 5DYGA 4DMKA 5JCJD 2XUHA 3RV3A 3U0BA 5M04A 1PG2A 1U1CA 1AKRA 4G01B 3SNKA 3BILA 3VAYA 4PCLA 1RCTE 2RHGB 2A6PA 1R0BA 4KVAA 2VPYA 3GLHB 2GF0A 1CUEA 3HUUA 4RD6A 1ZJWA 4H9GA 1ORHA 4HGOA 3TXYA 4E4TA 3VPXA 3LJKA 1E5TA 1E3MA 4I8IA 1F38A 4G2TA 3SY8A 1IWPB 3Q2IA 4L0MA 1C30A 3CB4A 4F71A 5GGXA 4ZJUA 3S8YA 5J4KA 2WLSA 3KYCB 3Q7PA 3B1YA 3SS7X 3W2EA 3X2SA 1WHTB 3HCCA 3GCDA 5K0SA 1ZISA 5AJYA 3TFQA 1SU8A 3K70B 5T4EA 3K9BA 3WYFA 1NNUA 4ZODA 4R1UA 3HUEA 1CF2O 1U3GA 4L78A 1TVKA 3PHCA 1MRSA 1R1DA 2E5FA 1C5KA 3ZZTA 4EPXA 3A11A 4IBOA 4BVEA 3OOEA 3JW8A 4QUGA 5JMPA 3OZFA 4JSTA 4EQZA 3UCEA 1YZYA 2ZAYA 1XCJA 3IT2A 5LZ7A 2FR8A 5DLYA 1BMFD 1VZ2A 3MOGA 1HDXA 2E85A 3E22B 1WQ1R 4DW8A 3L7LA 1R4MB 1ZXLA 2FGKA 3JCZA 3S81A 1N5JA 1VA5A 1Y1QA 1E5DA 5CXUA 1JQLB 1C7FA 1QNFA 2FN3A 2ZI9A 5K51A 1IZYA 4Y9RA 1WLSA 2H11A 2ORVA 1JG3A 3NBKA 3NHWA 4PYMA 4W5WA 4F2PA 4HLCA 5HVNA 1Z88A 4JXJA 3HEMA 3HCNA 3WB0A 2A9QA 1BO6A 1OXXK 1RHMA 1E89A 2P9ZA 2PUJA 1WSBA 1ZRMA 1PP4A 1JPNA 1Z2EA 2IQIA 2OK8A 1NUHA 3WHLA 4JYCA 3L2OB 5E4TA 2QLFA 3A2LA 4L5IA 1XCGB 1RQRA 1CUXA 2AJLI 3EZXA 4OI0A 4J0CA 1DGQA 1R8JA 1V7QA 2FW1A 2ZCVA 4HBGA 4JKYA 4GI3A 1B1AA 5D7BA 4BKRA 4BNWA 4EX6A 5C5EA 4V38A 4OV6B 2FN8A 4W4TA 4YYEA 1EQ2A 3FOEC 2OP1A 1ZMOA 3K2IA 1DAEA 1YR9A 1PZMA 1R3DA 1FFYA 2XE8A 2ECPA 1IUPA 2CUKA 4BN0A 5LXTA 2C61A 4A2QA 3CX4A 5KQRA 1DAPA 3KU4A 3HK2A 1WQ4A 2CKMA 3A4YA 3V1YA 1EFTA 1ZK2A 4YP9A 5JCPA 3B1FA 1A5AB 5AM4A 4ZQCB 4CV1A 1Z17A 4ECAA 3QVGB 4FMCB 4E03A 2H4XA 3QYFA 4MSUA 3WDLA 3DNFA 3EGOA 1O6CA 1FSPA 1UFQA 3VU1A 1O87A 1ZRSA 4ANFA 1OTXA 1E6MA 3EGXB 3GJ0A 2TSYB 4Q00A 4PYLA 5BN1A 1M2KA 3ED5A 1U9ZA 4XCQA 3PJGA 3AR6A 1ZJ5A 2O05A 4GMFA 1CZNA 1Z7WA 2PSSA 4R2XA 4RIHA 4K81B 1GADO 3E3LA 1KO4A 3LDUA 4F45A 1MH1A 4WV3A 4LCJA 1DBSA 3BMQA 4ZVRA 2HA5A 3ESCA 1C3LA 7GPBA 4R8KA 1G0OA 2H2FA 2XSZA 2A7QA 5JQGA 3JPYA 3TOCA 2I1WA 4ZK6A 1G16A 3CT6A 3RSFA 3M3PA 4G4SO 3AUKA 1G7RA 2JLWA 5C52B 4OM7A 4UVEA 1MJGA 3AIOA 1QZTA 4R54A 4MUMA 4MCHA 1VBNA 1G21B 4DJFC 5KYYB 4KJZA 1NG9A 5K0ZA 2GTIA 2JFHA 2LBPA 3ONWA 4S1VA 1X7ZB 4G5OA 1JT2A 1ODJA 1VTKA 3ANMA 2DPMA 2QN6A 3E7PA 3FBGA 3WMEA 4W6QA 2GEVA 3WK5A 2F55A 2GLXA 3CMCO 3HBAA 4FIZA 1E2KA 2C9MA 4M1KA 5G41A 3W3ZB 4CV0A 4BIIA 4C4AA 5CEJA 2FRXA 2WQ6A 4II2A 2W6NA 1ONNA 1PFKA 3JD1A 3DP9A 3I09A 4G5YA 1ILWA 1BA3A 1GNQA 3PG5A 4PHHA 4XJTA 4OK3A 5CGZA 1RLMA 4R31A 3ZX5A 4AQ7A 3DKRA 4BYGA 1NN5A 1D6JA 1GTG1 2GCOA 4MRRA 2Y3IA 1H66A 4Y2GA 1JEYA 4ZOAA 1P0CA 2PZFA 5DULA 3UGTA 1BTOA 5C80A 3DE0X 1UJBA 2C7RA 3KLBA 4GDFA 5CDSA 4HFRA 4G2NA 4CF4A 5HJ2A 3YASA 2JHPA 3O7WA 3H13A 1UQTA 5HBGA 4MV0A 3HXTA 4WFKA 1AV7A 3UUEA 1RLJA 3WLJA 1JDBB 2CMDA 3D4BA 1GEGA 3HDQA 3DDNA 4N18A 3ZKWB 4UDNA 1C4KA 5CW1A 2IS6A 3NNSA 1QRSA 4KZPA 2EKQA 3HJGA 5HFNA 4ZQHA 1RVDA 4DEXA 5CAEA 1KJWA 4EYOA 1WCIB 1V3UA 2RI1A 2VDRB 3B2QA 1QH9A 3ASZA 4HJRA 4BCBA 3KJXA 1SCUA 2DCUA 4PGHA 1KDVA 1Y1RA 2Q4BA 3EISA 2AXEA 2WSSD 4MGKR 2FWIA 3U2QA 3SVLA 3LTNC 1YK0A 3DH0A 2ODAA 2GMWA 4CMBA 5L40A 1R5NA 4BKQA 2XF2A 3KYBA 1JEOA 3NVKI 2YC4C 4YTEA 1SQ5A 3ZI0A 3SIPA 2KS6A 4CFYA 5DYNA 1H4SA 1A8HA 2F1IA 4OUDA 3HKCA 1KY3A 1L6IA 4UXJA 5DBFA 3NTUA 4RTLA 1EGVB 1JZSA 3AK4A 2FMXA 1KAOA 2JC3A 1VRCA 2QB5A 4ROSA 4TKUB 3RS2A 2WP8J 4WAUA 5GZ3A 1ZWLA 3L7MA 4QQKA 4KUGA 1CTQA 1N2CB 2J7PA 2QM8A 3QGMA 3QMPA 4Q03A 5H02A 2C5GA 1QKJA 4B0OA 1RAHA 1E9VA 1NZFA 3PUVA 5L45A 2A78A 5D6OA 2BKXA 4DQ0A 2C99A 1NJFA 1RI1A 2XF8A 3FWPA 4FT4A 3U4IA 3KVRA 2WM8A 1O9GA 1P8AA 2OD7A 4UQPA 4CMEC 3CW8X 1VE1A 1FNSA 4JKOA 1AZTA 4HZIA 4YRCA 2AOTA 1JEQA 1H3NA 2GCPA 1ZOIA 2NTNA 2WILA 4JUCA 4E30A 1L1RA 1JLRA 4RD0A 2VXCA 4DMGA 3AB3A 4CZ2A 3NWJA 4ZYLA 3O82A 2CW5A 2DR3A 4OQLA 2DFNA 3Q2OA 4QDUA 2F9LA 4TM8A 2NW6A 4IXTA 2Q4TA 2XMPA 3DM9B 2GS9A 3MTIA 4LCBA 3WP1B 4I9UA 2DWQA 5CA1A 8LDHA 3X0DA 2NV6A 2D0OB 2PUVA 4KR9A 2PRSA 1J1UA 3WGVA 3Q1KA 2E55A 2PLWA 1GPDG 4TROA 1N34B 1EK6A 2FPXA 2MU1A 4IQFA 4OX9B 2PSHA 4QPZA 3FY4A 3MN1A 3TCKA 3U26A 1HZZC 3SD7A 3GAAA 1IN6A 1C3JA 3T52A 3AKDA 4JDPA 5HRAA 5KHAA 3ZBUA 2QW8A 4F5DA 1SU6A 2BJVA 4RIEA 3AKYA 4JBWA 4OTZA 3FF4A 1TJ3A 1JHOA 3BWXA 2HHCA 3K1JA 4W99A 1EUQA 2YHIA 1QO9A 2A58A 4HDKB 1FRZA 4HDRB 2D0DA 4E2XA 4B45A 3R76A 1B3RA 2GCEA 2WICA 4NCJA 4YMWA 3LFUA 4XQEA 3K6RA 1VHTA 1U7WA 3VUEA 3V8NA 1J7KA 1SM4A 4TXHA 5HG0A 1GNVA 3FX2A 4OF4A 4LGYA 3K20A 3PZRA 4RABA 1QS0B 2DY1A 3AO0B 2BGIA 4LXGA 1ST3A 2QD3A 3AG6A 4LZJA 3U4AA 4DCCA 3FCCA 1TC1A 1V8ZA 1QCYA 4IDGA 2VT2A 3PDJA 4CEIA 4ZEWA 4CQMA 2OZPA 3BWBA 3W9BA 3PPXA 3FPFA 4LZWA 1Y8RB 2CLSA 2AYZA 2PWPA 1F6DA 2VDUE 3KL2A 3O4FA 1QHYA 1T2UA 4N0QA 2L2QA 3RYHB 1K89A 1WPQA 2O2JA 2RAUA 4K0KB 5K0FA 1LS6A 2J4FA 4G89A 4JC0A 1E7QA 1J39A 2VHQA 1JU4A 3I12A 2Q6VA 4G1EB 4OQZA 2ATCA 4HV4A 4D9FA 4DLAA 3UMCA 3WYBA 5KOYA 4FGSA 1E6CA 1JBQA 1W34A 4OKIA 3W2HA 3OJCA 1J1ZA 3NM6B 2FLWA 1ECPA 3UXYA 4F6RA 1XO1A 4B47A 1P5RA 3E5NA 3HVRA 3CVOA 4MHSA 4PCVA 3ZGOA 5KTMA 3T5AA 3CLTC 1SO8A 5YASA 3ESQA 4I4TF 3NX4A 3JAKB 4GPD1 4IL5A 1NVVR 2QD4A 4PYIA 3QH4A 5HF8A 2OCKA 1KOJA 1YJBA 2VXOA 4N7BA 4Q3CA 1XEWY 2VKTA 2VQFB 2FB9A 5BOSB 2VYQA 4QHYA 5D00A 1GSAA 4BHTA 3PS9A 5T3YA 3SYRA 4F12A 3PTLA 4CFZA 3LU1A 1YC5A 1RHQA 2R11A 2X5JO 5LA6F 4M86A 1U9CA 3TEMA 3FNFA 4EB8A 1KVUA 1QIDA 4BLRA 3AW9A 3MC1A 5FL7A 4E6EA 1J0AA 1G8JA 1N1EA 2DX7A 3HB9A 5CHYA 3V8EA 5HR5A 4V0LA 2VA8A 4MV6A 2WG0A 4QTZA 5AI6A 1YQWA 3SYTA 4ND8B 3W5UA 4A82A 2PEZA 5JYBA 4M7PA 3ICVA 4PW0A 4JVMA 1YJQA 3I01M 3QP9A 1GT91 4X7PA 1V6CA 1ZP6A 2Z6UA 2G88A 4MAAA 5JJ5A 2W2KB 4ZGWA 4UAJA 1JU3A 2FQWA 2P1DA 2X42A 2IH4A 1L9XA 3UAWA 4E21A 1HDEA 5C5IA 1G4UR 4Y18A 2V7VA 3N6VA 3OOWA 4XB1A 3GEPA 1GSIA 1U7OA 2P5TB 2ZPTX 3AR7A 3ILVA 4FUTA 1FDRA 4OHPA 2PS1A 1PDVA 4LHXA 3EB9A 3BZUA 1FXWA 2OQRA 3JQFA 4ZALA 3RS3A 1X70A 2PT5A 2JNWA 1G5FA 3ZCUA 1NDUA 1E3IA 2C3OA 4RHXA 4CIXA 5BN4B 3B2EA 3ND8A 3OZDA 5CH3A 4DCTA 1PGNA 2Q2VA 3H84A 4JU8A 5T6MA 3PHBE 4HX2A 2ZE5A 3I61A 4TL8A 1HTTA 4LSMA 5LP6A 1Y9AA 1J0XO 1E3WB 2H2GA 3COWA 1BEUB 4I4IA 5DXJA 1D4OA 2DCMA 5H3HA 4M1TA 2BH9A 4LRSB 3V4FA 1CJVC 4I7EA 2UYCA 2XB4A 2Y05A 2WT9A 2WY2D 3M2TA 4L02A 3O8QA 5ECYA 4DUGD 2HJVA 4RO0A 1KXJA 4HDOB 3MTGA 1H2AS 1TA9A 2ZTLA 4TL9A 1QRAA 4MJLA 5KSZA 5EE1A 3H2KA 4PGFA 4RZUA 1ZY2A 3OQOA 2VWPA 3LS2A 1C3OA 1ZONA 3HKDA 4C14A 4D3YA 1ZD8A 2FW7A 2PFGA 4ZO6A 2CL0X 3AJRA 5DHRA 4WA7A 2VDNB 3EDCA 4OL0A 4GEGA 4INJA 1MO5A 2GRUA 5CFMA 3ELBA 2NP6A 1Y82A 1L7MA 3P9IA 4LI0A 4LSZA 4YMTA 2QTHA 3I92A 4F3CA 2QTVB 3P96A 1ESCA 2HY7A 3ABIA 3MMZA 3QFHA 3CNEA 4PFSA 4ZRNA 2HT1A 3VYSB 1KQNA 3G8YA 4EGCB 5BYKA 3OWXA 1SOUA 3BEDA 3OZVA 2H5LA 4FSHA 3TSAA 4CM5A 5CFPA 5I9IA 4JI3B 3CYFA 3TKLA 3LHIA 4WL0A 3HLTA 1YDHA 4KLCA 4LC9A 4JYZA 3ICQB 2QIOA 4KR3A 5GJWC 3WRXA 3KC2A 3X1WA 5CXQA 1GYQA 2LE0A 2BFCA 1OBOA 2QD5A 1UP6A 4AZ3B 3R7WA 2R1ZA 4BFXA 3K70D 3JQ7B 5H0IA 2BRUA 1AN0A 2MMGA 1CUJA 5J59A 1F8XA 3TLBA 3K6SB 3U5ZB 2Y68A 3ACDA 1OV6A 3GXBA 2YH2A 2FWNA 1TM4E 2WHYA 4OBXA 3OA0A 3QK7A 2ATEA 2WE8A 3B1XA 3BSFA 3EF1A 3I9V6 2O2SA 3VTFA 5CFQA 5FV7A 1LTQA 4Q9JA 4CXMA 2ZI7A 2BISA 4B2PA 3LUPA 1GV1A 5D86A 1F4VA 4OHKA 5DU2A 4DZZA 1M5RA 1GQFA 4L8LA 2IVFA 3UK1A 1G4AE 1P2BA 2ATXA 2BHRA 4XCVA 3TKAA 3TM4A 2MSLA 3TSZA 4MMZB 3GFBA 2J46A 3SK0A 2IBMA 1ZGZA 1KMMA 2J5QA 2V58A 4HEHA 4IHQA 4KAAA 4CM4A 4EG0A 1EWQA 1U5BA 4DCNA 1EWKA 4FFVA 1CDDA 2CB0A 1DI0A 2G8LA 5LMNB 3CPSA 1TM1E 3IP5A 2P6OA 4M1YA 4AURA 1MN6A 2XD9A 2JLUA 3HU1A 1QYXA 1J8FA 2E1PA 4EWLA 2J0EA 3C3BA 1BRMA 5D3KA 1SZCA 2Z95A 1NXWA 3R3VA 2VG8A 4DY4A 1IDN1 3G2JA 3HYNA 3LPDA 5KYTA 2VT7A 3RS5A 3HCFA 1ZCAA 1J06A 2QMHA 3GPLA 2C8JA 3VDQA 1M2NA 5DGCA 4CLRA 1KU0A 1J07A 4TZTA 5JSUA 5K0BA 3FTEA 1H93A 3EOZA 4HB2A 1EFRA 3L6DA 5JEEA 4DCSA 1KVRA 2I6GA 3CVVA 1RVV1 4GQAA 1PFQA 5J4HA 4B4KA 5DM0A 4F4UA 3TPCA 3PC2A 3NASA 4MVJI 2NAPA 1NVUQ 3JWJA 1TMGE 4X95A 6REQA 5HFAA 2WWYA 1J97A 1P0PA 1LLQA 1LK7A 1T0HB 3HVHA 4NYJR 4NABA 4U5QA 4M0CA 5L3SA 5BSKA 3NEJA 4RHCA 3AVUA 3PKZA 2QT1A 4UCFA 4WKBA 3WTBA 1X9HA 5BSTA 2PZAA 1KJJA 3QE2A 3PFFA 4J07A 4TMYA 3MQ4A 5EGNA 5MN4A 2ADMA 4RLFA 1XD2A 4PPNA 1RD4A 3UG7A 4LYYA 5EHNA 3RARA 1ZGBA 2OCXA 3JRXA 4ZHSA 5LYJF 1IZZA 4HN2A 3QTLA 3RS8A 1F6BA 2I8LA 2A67A 2OCIA 1ZL0A 5JFOA 2HM7A 1YR6A 2E4XA 2IZZA 2OBYA 4MPJA 3GGSA 4TS3A 4DRXB 3HUDA 3QUTA 4RNDB 3F7NA 4C4YA 5K6AA 4TTVA 2ENUA 1R5OA 2JJ2A 5BQOA 3WMGA 4YCLA 1C0LA 1HUQA 1QR2A 1SXJB 4DFDA 1QAMA 2JDIA 4GRIA 3ZTWA 1R0XA 1VJ1A 3R7FA 3TR5A 1ZIPA 3WQRA 2D0PB 3B6MA 3DZGA 3H5LA 3HWWA 5JCOA 3WIBA 4XWOA 2GJKA 2QG6A 1E0DA 5TQJA 5BNZA 4V0MA 4KQXA 4X8LA 2PUWA 5ALOA 2DFLA 1Y81A 2IHYA 5HBRA 2B98A 3Q7IA 1FUKA 2YCLA 4LXHA 1T26A 2OV2A 2GR9A 3IAEA 4J9VA 2PIAA 4ZCPA 2G9QA 3UFBA 4BNUA 5ENZA 2AEJA 3U4QB 4WLEA 2VCHA 1Z7BA 4HH0A 1QC5B 1NSTA 2J30A 2BGRA 1DAFA 2HV8A 4FNGA 4DC9A 1U63A 2AN4A 4JNKA 4MWBA 5FD8A 4HWRA 4F5ZA 3RQIA 3CRZA 4DC1A 3UPTA 2V03A 1FL9A 4J6FA 4X7MA 4PIVA 3DWIA 1L5WA 3N3BC 4LXUA 1P31A 3KWLA 4H3VA 4EFNA 1EYZA 2G5PA 1M5TA 2AD5A 2HBQA 2JK1A 4FW9A 4PG6A 4DV0B 3DMGA 3MT7A 4ZC1A 5KKAA 4QAQA 3W8EA 1UKEA 3PNMA 3DL0A 2H2HA 1EDEA 1DFIA 4PAMA 4O4HA 1I5EA 1I2CA 4EHDA 5C5CA 3OX2A 3C8DA 1Z22A 3ICCA 3J7TA 4FR5A 2OV8A 4LJKA 2YZGA 3G0DA 5CT8A 5REQB 3HB5X 1ZH0A 2J7KA 4DDUA 3TL3A 2GKSA 3W5BA 2FMKA 5T8KA 3QEMB 2X22A 4YMUA 2HNBA 3W7BA 3BSWA 1BVHA 1Y3DE 4DVGA 4LJ9A 2Y27A 3NRBA 3JATB 5I7WA 3QSYA 8MHTA 1M54A 1QXSA 2PU7A 4JLDA 2ILVA 4U3JB 3EGDA 5F2NA 4P22A 1OVGA 3OI7A 4AWXA 5K6RA 1SC6A 3GDHA 5JAIA 1QDEA 4AB1A 3E8XA 1ZITA 4MI9A 4E6PA 3CVWA 1C9EA 3TTTA 1FX0B 1Y80A 4F1JA 3NW9A 4NSNA 4E5KA 3IPXA 1PS0A 3PQFA 3Q7SA 1FYEA 1RTKA 4XD7A 2POCA 2CJWB 4ZU6X 3GOQA 4R51A 3RS0A 3RYTC 1UK7A 4GGPA 2HEGA 1SKUA 1RI5A 4P4GA 1XCPA 1OLUA 1TRKA 2RAVA 2FKAA 3AWDA 2CZQA 2BFOA 3AC0A 3F97A 3QIVA 4KAXA 3T9AA 5CIQA 2CBGA 8ADHA 1JIUA 2VZLA 2EKBA 2FWBA 1YF3A 4D74A 3KXIA 3LPCA 1P17A 2H7CA 2A1TR 3GN1A 1M76A 2B7CA 1TW3A 1W25A 5LQCA 3SZ3A 2ZJ5A 4PRYA 5KYUA 2OFOA 1GQQA 1E3LA 4ZDWA 1T0JB 1YOVA 1KDZA 3V4PB 2ZCJA 3IKLA 5TEVA 1ZINA 5DGHA 1FFBA 4Q4AA 5KNDA 1KWKA 1ICIA 4QYTA 3RRXA 1QVRA 3BXGA 1N2BA 2R79A 4QOGA 3VR4A 2OC4A 5JUWA 4Z4FA 3BGWA 2OZKA 1RLOA 1XZJA 5A9TA 4DLNA 3W9YA 3SP1A 3WV4A 4XVCA 2GCNA 3V4RA 4O02B 3VMMA 4IOJA 1NJ1A 4YMHA 1T10A 5FNVB 5EMNA 5B3AA 2CNKA 4OJMX 2DXIA 3V3KA 1WBBA 1IXYA 1X3LA 2NO9A 3B3JA 3D1JA 3LL4A 5H68A 4A7PA 4ISCA 3KNZA 4JFAA 4FOSA 3OT5A 1G8SA 3VC3A 4X1IB 4L0QA 1SC9A 3ZNOA 3FSJX 1NUQA 2QQ5A 5JXIA 2EGUA 4ISBA 4U9IS 4KC0A 3K0CA 2BBSA 2GK6A 4FMCF 3FHCB 3QKSB 4II7A 5EMKA 1TF7A 1S8AA 2R68A 1JSCA 3NMUF 2G17A 1E7MA 1RWWA 3RTGA 4FOLA 4C0QC 4WOJA 3AFMA 2WKSA 2V0GA 4BL5A 2EZ4A 2YNMD 4E7OA 1KMHB 2O1WA 3KX2A 4MQ4A 4Q7EA 3FCXA 5EPUA 4BO3A 4CKXA 1L7VC 2CFIA 5F1OA 5B58C 1G5RA 1XB2A 4MKZA 3RAGA 2C96A 3TJZA 2Z3ZA 5ANRB 1I36A 5EN4A 4PQFA 1RYBA 2ZXUA 1H23A 1I51A 1LY1A 1XAHA 4DLXA 1P3DA 5GIPE 4MIYA 3OFSA 3G2PA 2YJNA 4NCNA 4EY5A 3DT8A 4ZHQB 1L5ZA 4KXNA 2FSIA 2O5VA 3CKLA 1L4KA 3OQ1A 3PENA 4NENB 2Z1MA 5SYMA 2I3GA 3PPYA 1HT3A 3NR2A 4FUQA 3RRJA 4FFBA 4B7CA 4DNOA 4ZI7A 4LXXA 3REQB 1W9MA 1Z3IX 7MDHA 4W5NA 2CJFA 2BAGA 4XX0A 3WLIA 3WA6A 2JFVA 1TU0A 2WNSA 2I2WA 3SE0A 3RYFB 4R7ZA 4Z9YA 3E03A 1I0LA 4Z7NB 1EXDA 1E64A 2MSWA 2RH8A 5EMMA 4J0GA 1L7XA 3IS3A 4ICIA 4E5UA 4LMAA 3WIEA 3GZNB 4Q18A 4OHBA 4MWSA 5NLLA 4KAJA 3KJQA 4E5VA 3WLHA 1JAHA 4DQXA 2UUCB 1YD7A 3BMCB 3I6MA 4YJGB 1ODLA 4AXXA 4KQCA 1ZJ4A 2X7JA 2QXTA 3PR1A 2FMUA 5JH7B 1JSLA 3P4XA 1ULHA 2VK4A 1MMFB 2RHMA 1FTGA 4LMRA 3VPFA 4M99A 3IMEA 4YAEA 2NTVA 2ECOA 2GBGA 4H1TA 2XTAA 4G25A 3FGPA 3CO5A 4CYMA 1Z16A 4XRGA 2Q1WA 2XBUA 4KXQA 4KFTA 3ZY3A 1YNSA 4Y67A 4Y6GB 1TECE 1Q91A 5KSOA 4DCVA 1SKMA 2HRBA 5CDTA 5CFZA 7REQA 3B36A 1AGXA 3B48A 5G2OA 2VNSA 4L5JA 4F93B 3UGQA 1BQ3A 2PJRA 2PH1A 4FKZA 1E63A 1WIWA 1ZWKA 2C9DA 4XPIA 3OE7A 1ZUIA 3DMNA 1Z2AA 2RBKA 1GZ6A 2O1EA 5L3QA 2OQIA 3SYMA 3AVYA 3THYA 2VAXA 3DZHA 5D7NA 5AJTA 4BNDB 1JIIA 1B8UA 5M34A 1EUDA 2J09A 2VJLA 2W2LD 1XZPA 1JDVA 1EVJA 2XCLA 4YJKA 1G8YA 5HF9A 2Q3DA 4OIFA 4DM3A 1BCSA 5C1PA 2UDPA 4IDDA 4WXHA 5F73A 1Z8NA 3VNRA 3IJEB 1F6WA 1ZH6A 3E9NA 3GZ4A 4RPKA 2B4YA 2YR0A 1IHOA 4E0BA 5J9FA 2ID4A 1HQYE 4MK4A 1TVEA 3JU3A 3IOYA 4KQJA 2NNWB 1VG1A 2ISQA 2I4MA 3NDJA 3MF4A 5JS1A 2AVDA 2DBYA 1N2XA 2NZJA 1OF1A 1SEPA 5DCUA 2HA6A 3NBMA 4F3TA 1E5XA 1B23P 4PLHA 2CBXA 3TRHA 1TCCA 1ATZA 5ISMA 1NUTA 1V4BA 4TT8A 2R62A 2W0SA 3KJHA 4ZIRA 1VG9B 3EAGA 2C8KA 3CRMA 3Q5GA 1D0IA 4BVGA 2H0AA 2HK6A 1W2HA 1MTZA 1ID8A 3FHTA 3GB9A 3WQBA 5HWSA 2RK3A 4RFVA 1O6BA 1KIMA 1N5RA 2DUJA 4BUJA 2XIJA 3KXLA 3U3ZA 3D7SA 2HQSA 2ZVPX 3GD5A 4BCCA 5IBPA 4Y9UA 1TUEA 1O95C 1ZLXA 4URHA 4ZCIA 3T1NA 4YWJA 2DTEA 3KXPA 3BQMB 3PUKA 4PICA 3E5RA 4YXFA 5DNWA 4DLLA 4CIAA 3WWZA 5DV9A 1KMQA 4PS0A 4LG1A 1HSZA 1NBME 1X92A 2DPXA 2FZCA 2ZGVA 3H8SA 4KYVA 2ZWVA 1S2MA 1ZNXA 3AL3A 5BXYA 1CQIA 3GLHE 4QG7A 5DB4A 1CRPA 1NYLA 4QLAA 2NLOA 3OOSA 1H6CA 4RSGA 3RIGA 1P81A 4LRYA 4XVUA 10MHA 4QECA 2ZG6A 5A0FA 1POWA 1FLNA 2OFXA 3BXXA 3LQRA 1N6PA 2PS9A 3UMYA 1RPZA 1CUHA 3K70C 1LC0A 1O5OA 2PX5A 2R8PA 2Y67A 1XXHB 4W82A 5CB4B 4DR1B 1XZAA 2QJOA 2VAVA 2PGJA 3E1SA 4A8JC 1WCYA 1BN7A 4DCJA 2BTEA 2BEVA 2R47A 3GELA 2JLCA 3WGTA 4WIAA 4AUKA 2Y77A 5KDLA 3H6HA 3NONA 4MUEA 5L95A 5KINB 1UT6A 5EVJA 2PPLA 3M9LA 3CZMA 3H9UA 1WCXA 3RUFA 2ZYSA 2C3PA 3F3SA 3NDIA 4ZAYA 4BX0A 2PJDA 3SM3A 1N36B 1SCIA 2JIZA 3F73A 1BDHA 1YB6A 1XGKA 2P62A 2G9ZA 2DG2A 1ANKA 1GL9B 3I2GA 4NBSA 4OHMA 5KWEA 1FRFS 2OV3A 5TQ0B 2EBFX 1CUAA 2OB2A 2R7LA 5FTWA 5A6VA 5K8CA 5TVKA 3TM5A 3RUAA 5LC1A 2IXEA 3UH0A 3O1IC 2R00C 4QBHA 3IP9A 2E4YA 1IOWA 3E23A 1RZVA 2BMDA 5L8VA 4UATA 1FFCA 3KJFA 4MI3A 2EOAA 3GLRA 4H0NA 1NULA 2YZ7A 1P7CA 3BD6A 4WFIA 1DAIA 1I3MA 3JYPA 3WO0A 2BFFA 4ZDKA 1SVMA 1M2VB 3ORRA 5I9TA 4NU5A 1L5QA 3V5NA 3CJQA 4F04A 5CLHA 3B9QA 3NHSA 1TK3A 4X00A 5LXTB 3CKKA 3HBNA 3HFRA 3O91A 3PXAA 4HWTA 4N65A 2WM2A 4KYUA 2HLHA 1BZYA 5DMHA 3SKVA 1REQA 1XQVA 2OGSA 4LSGA 2X9NA 2L42A 2L19A 1HGXA 4CTMA 3GLIA 4D7AA 1PJ3A 1E99A 1M9NA 1C4WA 2I4TA 2YXLA 4NIMA 3OQVA 3W5HA 2DUNA 3DD1A 1DCTA 2Z2IA 1FP1D 1S4MA 3PPVA 1K8XB 5HIMA 1ADBA 4L8FA 4WXPA 5AW5A 3CLRD 4FN4A 2BUBA 4A26A 5JS6A 4LF9B 5BMVB 4MUIA 4GF5A 4UHBA 1FVXA 3JZFA 1Z6ZA 1MAWA 3P9XA 3V8QA 5MGNA 1VCMA 2OHVA 2QM0A 3DAYA 1B0UA 1ODIA 3ETNA 4K3VA 1O3YA 2JEYA 2EQ5A 2Q3CA 2E82A 2ZYVX 3BQNB 4RDIA 5ADHA 1E1CB 4DQLA 2R4QA 3BMQB 1GTMA 3K53A 3OZCA 4KNWA 1LXCA 3QMWA 4JI6B 2VT6A 2W70A 3SJUA 4PBRA 4BNNA 4I1IA 4UEJA 4L85A 1DG9A 2XCOA 4WHMA 5DEIA 4E1BA 2EJVA 1DINA 2YYAA 4RV9A 4KWEA 2QIPA 3DNPA 4P4SA 4JB3A 1VJRA 1VDMA 2BM8A 2WMDA 4MQBA 1D2RA 3MT9A 2X7HA 1IZ7A 1VPTA 2WJWA 3OPXA 4EL5A 1AXEA 1LH0A 1Z4JA 3BB3A 1EBUA 4DNQA 4UM8B 3VHQA 1AS2A 3MBOA 1TA4A 1NUSA 2UZ1A 2FW8A 3CF2A 1J09A 2GFIA 3GQBB 3FD8A 4KFCA 2XUQA 1SXJD 1S8NA 3VZDA 4J0HA 4TWIA 4O08A 5HNKA 4QBTA 4HK4A 1NLUA 4GGOA 3V1TC 3RNLA 5AXCA 3QENA 4RDCA 1SN7A 4LE2A 4M89A 3MCWA 1XHEA 3LX5A 1TU4A 4BO0A 1I6WA 3UATA 5C9ZA 1G21E 2X0KA 4OQQA 2G9VA 1O6FA 3V4SA 1JQEA 4O4IB 4DJDC 5IKMA 3AUUA 1JDNA 2I34A 1HWYA 3FJ1A 1FFGA 1RAGA 3C16C 3IAS1 3C6ZA 2WD7A 3UUWA 5HE8A 5KJ1A 2FWMX 4HCJA 2RKBA 4PNHA 4M0PA 3GV0A 4WJZA 2HDWA 3NWEA 2CNLA 5IK2A 3H0CA 1RCUA 2H6EA 4FTWA 4D3SA 3FDFA 3U7HB 3JYNA 3ZYCA 1STOA 2QUHA 3C8UA 1DBQA 2A5JA 4GD3Q 1CY1A 1LX7A 3OM8A 4JOQA 2WWRA 4PFKA 4MHTA 3FPBA 2FSGA 1HR0B 3QX3A 2H4HA 1JDBC 1IDOA 1QHGA 4EFDA 4MPDA 3I5XA 3LP5A 4J43A 3H3FA 3WRYC 2XEXA 4QO8A 4QIHA 4MINA 1YQEA 1E6KA 1DL5A 2Y4OA 4I6GA 3T3OA 5A4DA 3U31A 1HH4A 4BXOB 1I6KA 3BKXA 4Q7JB 4D5GA 1JGTA 3VH2A 4LY6A 1O8CA 1RIIA 3U37A 4XI9A 4FD2A 1QQBA 1I5RA 4P80A 4R3WA 2D13A 3GEHA 4DUZB 1PUXA 2ZRCA 4J16A 3WKDA 2WVHA 3H2SA 2YY6A 3Q88A 5K8UA 1X94A 5JAUA 1AX9A 4MA5A 3C8MA 5E8JA 1TI7A 5B7NA 3GH1A 2ZAGA 1SZPA 5FFNA 2CJXA 5HK9A 1G17A 5IT5A 3N2KB 1FS6A 2Z1NA 4W5TA 5P8WA 1FU7A 1NLMA 2P69A 5DHAA 1FJXA 3EEFA 3ZDDA 2BMEA 3SHQA 4DBLC 5JJLA 2LCIA 1K6XA 5G40A 1IN8A 1DB3A 4QRHA 3RRMA 1G8MA 4UHJA 3GYGA 4UUPA 3ADBA 3B7PA 1VIAA 3HLKA 4YGYA 4BX2A 1W36D 4H1UA 4OQ4A 1N2CE 5JYCA 1TIPA 4XVRA 2ZBEA 1UUFA 1A8SA 3EEYA 2JAUA 3SQLA 4DBLE 4RY8A 3HCDA 4G0YA 3C3XA 4LQLA 5CA1B 1I7LA 4X3CA 2W4MA 5I9SA 3SBXA 3FGOA 1IRIA 3MTJA 4J0QA 3H18A 4I66A 1VI6A 1WLYA 3T3NA 1FC0A 1OHHA 2P2LA 4AJ2A 1S3GA 4CN8A 2YV5A 4MROA 2GZDA 4NG5A 1JSZA 1NBEA 3VVBA 1W29A 1NVKA 2AUTA 3DVAB 3I42A 3A6FA 1GFIA 1NV9A 3IQIX 5HIJA 3TEJA 4P5DA 3WGUA 3FGNA 3QY0A 4UUQA 1PQPA 5KC9A 1E4VA 1MXFA 4IVRA 1E92A 4YP5A 1IULA 2DPGA 3FA2A 2V5AA 2RMKA 4EG5A 4HWOA 3BUSA 4N48A 3DUWA 3N8IA 3RYCB 1QGUB 1AIPA 3FFAA 3K6KA 4FCWA 1ISSA 1DOAA 1QZUA 1R66A 1RKVA 2E6UX 2KPOA 3DFIA 3E4CA 3ECSA 4PYNA 5DSZA 2B69A 2YNMC 3G9UA 1YXMA 1OBHA 3HJRA 4MEBA 4D25A 4RTQA 1GPUA 4V2IA 3DTNA 3NV7A 4RK7A 1FNBA 7ABPA 3LZ6A 4I5FA 3DEHA 3RKRA 5HOQA 2R85A 3A1CA 2AN9A 2EJTA 3PDUA 1AA9A 4BVLA 2P90A 4XKJA 2HCTA 3C8HA 4F4FA 4I1YA 4D9GA 3A05A 2E37A 2V6FA 3OUZA 2XE6A 3FOAA 3LBNA 3NS7A 1JTFA 3HZRA 4H7IA 5KDDA 3FLBA 1TIBA 5K99A 2GN6A 3IMKA 2SNIE 4JLWA 5CFLA 1C9MA 1YVPA 3WLPA 3FLMA 3DVLA 3DAPA 1GNPA 2XEDA 3B89A 4G81A 4KVZA 4OH1A 5ITWA 3RSLA 3UWKA 4L74A 4ER0A 4YRBA 4C03A 1LPSA 4Z51A 3OPVA 5HKLA 3E61A 3N2GB 3M49A 3ZDRA 2K7FA 1I2AA 4EYQA 3ZK7A 5BN3A 1CV2A 5IJZA 3DQZA 1YQGA 2CCKA 1ADFA 3WO1A 4AJ9A 2FEXA 5B57C 1KEEA 3CCBA 1X19A 3PITA 4D0RA 4D0GA 4CLOA 1GYRA 1KAEA 4CM7A 3JQAD 5EGSA 1SCKA 5C1DA 2AKYA 4Z53A 2LV8A 3D7KA 3N2IA 4H08A 4WNAA 1MO4A 4YP6A 3PHGA 3REGA 4DLPA 1VYHA 2Z6AA 2HXGA 1U94A 2F8MA 3AETB 4HY3A 4LHZA 4HDSA 2GAJA 1QF6A 1MC4A 2EHDA 1Z4NA 2RFLA 3AR4A 3IJPA 1PNTA 1CY2A 2RGUA 4NQZA 4B83A 3L6OO 3MPUA 2A84A 3C4VA 1KVQA 2I65A 3BDIA 4FFPA 2J8ZA 4I08A 3M6VA 1U0GA 2X2PA 3HA3A 4ARAA 3C5EA 3FMGA 3IEPA 4DR6B 2WU0A 1IEWA 5KQSA 2RONA 1WXIA 3WWCA 1TPZA 1OFHA 4XDZA 1CRWG 2QEQA 3TRKA 5ESRA 2JD2A 2WE7A 2DTXA 5FBWB 1UPUA 4RF4A 4D8WA 2O5CA 5L4NA 1CZLA 4HRYA 3M6IA 1Q0SA 1ZCZA 3HRIA 3UV3A 2UXCB 1I6MA 2BIFA 2KLBA 3BKWA 1DQZA 2VH5R 3AVPA 5L7TA 4AAYA 1NX9A 2V55B 4I8DA 4JJKA 2WU8A 3SFTA 4V0RA 1RRFA 2RGYA 4UU7A 4YGXB 1L4MA 4JC5A 2CNWA 1US8A 2PMDA 4JNCA 4NKRA 5C3UA 3V7UA 2P0AA 2Q5EA 5AKJA 1QNLA 5DLEA 2AG6A 3QQPA 1Y8QA 5DNVA 5FBKA 2BCGY 3ZWMA 2Q5OA 2VUUA 3G5AA 4Y6PA 4MGYR 5T6BA 1HX7A 4WXYB 1QK3A 2IPXA 1PRYA 3EASA 4KOEC 1DIGA 3OJ0A 5BVGB 5LP6B 5CM2Z 4AJ1A 5BNTA 3DQQA 3P9ZA 3B1VA 3OU7A 3TVTA 1U04A 3K0KA 2DBZA 3U3RA 4RAOA 3AIIA 1SKQA 1NVEA 2JI6A 1GAJA 1FQWA 1RQNA 3DOEA 1OXVA 3HU2A 4KXVA 2QRPA 1OZAA 3UJ6A 1A88A 5JAQA 1WUIS 4D44A 1RNLA 8OHMA 1E2MA 4DV3B 2BTQB 4DA8A 3I3SR 4R2WA 1GUYA 1SQGA 5A3JA 1B16A 3ORSA 3B7WA 1R6VA 1XQ9A 3CISA 1WUKS 3F5MA 3L8DA 4WGFA 1E3QA 3CH7A 3OETA 5G53C 4E70A 3A6ZA 3IL2A 2EBWA 1SVUA 5FNVF 4OAPA 2IBSA 3DR5A 3OPQA 3GFPA 3T0GA 3VI4B 1HM5A 1SG0A 4N3BA 1JEJA 4X20B 1W0JD 2Q6IA 1KNXA 3D7RA 5HZGA 3IHTA 1FSFA 3DYIA 3V8RA 1JLKA 1RACA 3M3HA 1T2EA 4KIUA 3CZAA 5AVWA 1RJWA 5ESXA 2Q1XA 2EKLA 3BTSA 3ZYZA 4H7HA 3FE2A 3V48A 4RK1A 4XSGA 2XHEA 1K4YA 1RBMA 2CHGA 2VYVA 4TV8B 5AVYA 4HAUA 1CKEA 3WVNA 2VYNA 1IEXA 3H8VA 2DY0A 2BJHA 1P4JA 2EF1A 2O2GA 1B2RA 3FPAA 4MS1B 3IAXA 1E0AA 1MIOA 1S9DA 1X74A 3KDPA 4RZSA 2H9AA 2HNKA 3FFBA 1XRLA 1SAYA 3GH3A 3KPJA 4B3HA 1KJYA 5CCDA 5WRFA 5B5SA 2I7DA 1GNSA 2AFIE 4WK4B 5HRUA 4R1NA 3TL6A 2O6HA 1H9CA 2RI6A 2WTAA 3MTDA 3COSA 3D4PA 1E0JA 3CS3A 4LV5B 1NM5C 1USWA 3LUBA 2Q1TA 4M98A 3NBQA 1TOAA 4AUMA 2EKZA 2XDYA 5T4BA 4M9ZA 4TWJA 1GR1A 3QHAA 4S35A 3CONA 3HRKA 2YIVX 3W2TA 1ZMBA 3QHPA 4LNUB 5G02A 3HU3A 2DUMA 3PA6A 3ZE2B 4EKGA 5LU9A 2AXQA 4X65B 2RK4A 1LPAB 1N9KA 2AG1A 3H0KA 4FONA 4NJEB 4ZPJA 1D2HA 2ENWA 1TW2A 1GGFA 3HDYA 1V41E 4ZHQF 2ZE7A 5LOVB 1SVIA 1P7PA 1UIMA 1Y7LA 3RVJA 4CM4B 1DT5A 2PGOA 1DCFA 2Q5IA 5TPWA 5DOZA 3WKCA 3U81A 5G1NA 4WK6A 1GG2A 2W43A 4X54A 4CBVA 1X7XA 2JIOA 4R16A 5EINA 3CRVA 4RTNA 3LUCA 3H6KA 2OO3A 3G8CA 1W85A 2C2BA 3K4QA 3DEAA 4Q0MA 1L5KA 4S05A 3BE4A 1PX2A 1CC1S 3CVXA 1CY4A 3JR7A 2XRFA 4G1FA 4DSNA 1K75A 2IHTA 1KEVA 3AM4A 1SBHA 3HQ4O 4PRKA 2CLMB 2XUGA 3LTEA 2J48A 2CLDX 3D8BA 4H7DA 3R7DA 2D54A 3SMQA 1M34B 1P4HA 3QNMA 4K0RA 3UZUA 4F4IA 4ZYTA 4LV8B 3KWJA 1XDWA 1Z83A 4I9NA 2VQ6A 2J4CA 2B4KA 3CLRC 5JH7F 3TNJA 2GB4A 5C8ZA 4ZTUB 3EULA 1J8QA 2RJNA 4IDQA 2WHPA 2JPDA 4CM8A 1UJ6A 5C31A 4B4DA 5IDWA 3EMVA 3ZNNA 2A9KA 1ZICA 1JQ5A 1JYSA 1QPBA 1H8HA 4NL4H 3DKPA 4J1TA 1JXQA 4PHCA 4YK7A 5HIAA 2FV8A 3MWEA 2V7XA 4UNPA 2PS3A 2G1KA 4GSKA 4B87A 2RAPA 1IZ0A 1Q7BA 4KR0A 2JFQA 3KWFA 4FZ3A 4EY3A 5M7EA 1YR8A 1XTIA 5E7MA 2ZREA 2DQ4A 2NUAB 3I72A 4Y2QA 4G56A 2ZAMA 4O59O 2J3LA 3D3JA 4U0JA 2CZCA 3IVRA 2P9FA 1W47A 3I2FA 1Y3AA 3K3PA 4OUKX 1YA6A 1PJTA 3DDUA 2Z6QA 1KTIA 1X2EA 5CTJA 2XBMA 1M1NA 1PV1A 1DDOA 1SBYA 4CKZA 3OY2A 1SXJC 1O96A 4GPBA 1EFDN 4MUYA 3RVDA 5JS2A 4R01A 3AX6A 2YYYA 2R8YA 4TYNA 4HG2A 3OCYA 1ZOPA 2CFTA 2C84A 3QEAZ 4TUYA 4MCAA 1ZMRA 2ZRBA 2H48A 3HDVA 4JBXA 5AWFC 1Y34E 1SXJE 5IBQA 3BXZA 5KTSA 5HGXA 3MWGA 5F1YA 2Q9CA 1IH8A 1SU7A 1G6KA 1M7BA 3NYWA 1OMOA 1LDNA 3CZRA 4F92B 4GVXA 5ER9A 2NSDA 1T1JA 3AUAA 4MW1A 1NURA 4IIJA 3LYUA 2AWNA 4HGZA 4PGAA 4NULA 4PZPA 4UUAA 1VQ1A 3T0FA 4HF7A 2FNAA 4NBKA 4R1QA 9MHTA 1ID1A 4N5DA 2FG7C 1Q0UA 5TC4A 1KH1A 2B1RA 1GRCA 4ZEVA 4UFNA 2PUGA 2GCGA 2IS1A 3LDFA 3K8QA 2HIGA 4ZD6A 2AZ4A 5SZIA 2IIBA 3WOVA 3S8MA 4TWZA 4YLYA 2M6SA 4B34A 1QLHA 4XARA 5B3JC 2BE9A 2I2DA 4TQ9A 1SCDA 1OWMA 5DHFA 5IVHA 4TQGA 5FEUA 4OU5A 4OATA 3OX3A 1PI3A 4QX6A 4O1HA 3R7LA 3K32A 3ZWCA 4UPVA 1D9ZA 2R97A 2PRIA 4MUBA 1QCZA 1OWPA 1Q7GA 4B5LA 3MILA 2H1SA 3NNNA 1E1NA 2HO4A 2JFFA 1K8QA 1YV9A 3H9GA 3WK8A 4EL0A 2XUKA 4I8XA 3SF0A 4BO5A 5KQLA 3OT1B 4DB4A 2WB2A 5FWXA 3K8OE 3L4BC 3RSSA 3TZKA 1XCOA 1J5EB 3QNUA 4A6PA 2CWWA 3T5GA 4W5HA 2I7CA 1T2FA 4NQRA 2JFBA 1U8FO 2OXTA 3K6JA 1G1AA 3AJ8A 3ITDA 5CNJA 2P4EA 3UKDA 1QH8B 3ZLVA 1QTQA 2IEDA 1JIXA 3F71A 3IOEA 4P34A 4D41A 3QBJA 3OICA 3RVNA 2P4QA 3AHIA 3LBYA 4JC8A 1KQ3A 2ZKIA 4QGAA 3H9QA 4BVJA 3HE3A 4MRPA 4OI1A 2VNJA 4AMGA 1N8NA 2P30A 4DDMA 4HXFB 2F62A 1DVRA 1E77A 1E9FA 2MSNA 2BBWA 3Q3VA 4C4PA 4ZFNA 2JLSA 1UZUA 4DM4A 1L7DA 3GWGA 3U1VA 5AIBA 1HE4A 1C3VA 3P5SA 4WE3A 2XGOA 2GF9A 1RKQA 5F3WB 1YA8A 1W36C 1OPRA 2VBGA 3ZUGA 2ZYTX 3TRDA 3OVMA 2NUPA 5KMGB 2J7PD 3TDKA 2G04A 2VPWA 3VTKA 5JQWA 1MJNA 1GN8A 4RESA 2EP7A 4MQFA 2GD1O 4OP2A 4G5QA 2II6A 3GMIA 3NCHA 4RHEA 1NATA 5DHUA 2QZ9A 3PHIA 4JV5B 1XAJA 3KQKA 4I5GA 2JI8A 3EXHA 3MINB 3PL5A 2XB9A 3KYDA 4H0FA 3Q2KA 2O0MA 4G67A 2H1VA 5CYGA 3DBLB 3ZUPA 1Z4MA 1CNMA 1E8MA 2J0VA 3OIUA 5EOVA 1Z68A 2JEZA 5B2ZA 3UM9A 1ADGA 1T4GA 4TLCA 2HA3A 5C8YB 5L4SA 2EG5A 3BFPA 2OR3A 4KE9A 2QTTA 4ZGBA 2J33A 3TZCA 3L8CA 4QGFA 1VE7A 1GUZA 1FTYA 2HSGA 3LC2O 3OZRA 3PUYA 1Z8HA 3URKA 1Y6QA 2X1LA 2HYIC 2H06A 3OHPA 5IAGA 1QHSA 3RVKA 1UJMA 3NKVA 5LXTF 1WB9A 3CUEF 4QPPA 4IOKA 3B9BA 1SKAA 3UHJA 2H51A 3CTPA 3PHLA 3QV2A 4NK4A 4Q7LA 1AXRA 4QELA 3D8UA 3ENNA 3TPFA 2Q4RA 2W6IA 1NI5A 4GNKA 2GNAA 4JJAA 3L8GA 5LZ2A 1E1KA 3PFGA 1OJLA 1XA0A 4WZAA 5CIWA 1YCGA 2EQBA 1ITZA 2ZJ7A 2P6UA 3DWGA 4LZNA 4C5BA 4TLAA 1M0TA 3DW3X 4UTPA 2GHTA 3F67A 3KAKA 5BMVF 4MMXB 4PYQA 3TNFA 4KV7A 2C7BA 3KQTA 3PQ5A 3T1VA 2F3UA 3K15A 4LIPD 5BSUA 3NBXX 4Y2TA 5EMHA 3ZCVA 3GFSA 4TZ6A 2EYQA 1NQVA 1P62B 1RZRD 1ZN2A 4C3VA 4CG3A 5ABPA 5AVUA 2ZRKA 4W7SA 2QTLA 2AOXA 3VM6A 2XECA 1KBQA 1YJAA 2HWKA 1JIJA 3EBPA 1UBTS 1M2JA 1P77A 1THGA 2QAGA 3S27A 1H6BA 4CL0A 1IBSA 1V2GA 5HZKA 4RNCA 4NAVA 1C0PA 4AM8A 2XCSB 3E5HA 1LNSA 4MPPA 3BD8A 1K4MA 5THQA 4DPLA 4FN5A 4BMZA 2VDWB 4YRDA 1V1RB 5IAAA 3PD0A 1JIQA 4J1NA 3GJSA 4CQMD 4ITVA 2C2ZA 3MMPA 4FFBB 3Q10A 1SBCA 2RK6A 4ARZA 1D0SA 3MVEA 3H99A 4GC9A 4MDFA 3GRZA 4KYTA 5L7YA 3R8CA 3O94A 4RZQA 5IHXA 3HMKA 2PKYX 1NBIA 4AY4A 5I4BA 4XSVA 1HQDA 3FPSA 1M0WA 4UZSA 3RAJA 6ABPA 3EPKA 4MW6A 2A9VA 1TUBA 4J1SA 4CEJB 4OFBA 3ZE1B 3H9BA 3FNHA 2ID7A 5IM5A 3FRIA 5BVHA 4ZOBA 1EE1A 3NV9A 3TRIA 4BNJA 4I6EA 1VLMA 4O4IF 4CM9A 2W5UA 4EENA 1LSUA 4KIJA 3NDRA 5THXA 1W59A 1JDPA 4IV0A 4NU8X 4XE5A 1ORWA 5AKYA 1WRBA 3TW8A 5I8WA 1EFVA 3EZYA 3B9RA 5CVVA 3GLFA 4K9DA 4GICA 1ZNYA 2W6JD 1YZNA 3B2NA 3H42B 3H3JA 2X9QA 4UOQA 3AR2A 5TGDA 1DE0A 2ZBQA 1YRBA 4KXWA 4GXQA 1U11A 1JDUA 2ZYDA 3U6BA 3W5SA 3ZVNA 1JWAB 3RWOA 4F9TA 4RVHA 4YRTA 5KQGA 3OQBA 2B94A 1L1FA 1GAQA 1XN1A 4MPTA 3NAQA 2QYSA 4M9UA 3H2IA 2IKSA 1WZEA 2CDCA 2F43B 4DAOA 1M6VB 4WMLA 5CD9A 4H3HB 2FPPB 3WIOA 1E6LA 5F52A 3TOSA 5AVQA 5JJCA 2VZ0A 4BC1A 1NJ8A 2B8JA 3R0XA 4K7JA 4AC9A 1NUPA 1GCUA 3WWDA 3COJA 1NWCA 1ZD1A 2RGNC 3PIIA 1JXMA 3ZK9A 2VP4A 2F1JA 2AI1A 5FA5A 4KG7A 3TLGB 1YNOA 4Y1EA 1K63A 5IWCA 1DIRA 5EJFA 4Q02A 2GLTA 5GMOA 4TOIA 1KOFA 5E3JA 2TMGA 3O3MB 5BQPA 4LHYA 5KPDA 4JSRA 3S1LA 4ZP1A 5FA6A 1HFEL 4AYWA 1N6KA 1E4YA 2IY9A 4KNVA 4YJHA 3L82B 4BTEA 4MV1A 1HFKA 1LPBB 2XWJI 2B6HA 3FUCA 3EVTA 4LZLA 4WEQA 1JEEA 2PR7A 2ZJ1A 3KBBA 4LFCB 1JI0A 1VE9A 1XJQA 2GWHA 4KGXA 3CSSA 3EG5A 2QP3A 1JT9A 1DELA 4OB6A 5GY7A 5K4GA 2Z8XA 2WIDA 1S01A 1PX0A 2O2DA 2J07A 2V0CA 3OE1A 1DKRA 2NX2A 2RCNA 2VTBB 3L4EA 5B7PA 3HFGA 4MDYA 4DIKA 5CA1F 1SOAA 1KYZA 1CJBA 4M8SA 3U9SA 1DWUA 1ETHA 4ETMA 4GKBA 5JMOA 3MFQA 5DI9A 4FX5A 4Q9IA 5J2UB 1UBHS 4D8XA 1QG2A 4E51A 2ZDGA 4JQCA 4Z8YA 2WK1A 4CODB 2NSLA 4RJ2A 4FWBA 3PLAE 4P98A 1R5BA 1R8SA 1U4NA 1OX5A 1YQUA 3EEIA 1NR1A 4YBRA 4EHKA 3F6CA 4G5RA 3PQEA 3I52A 1CT9A 2ZU0C 4ASUD 3DULA 4HO1X 4ZXFA 2WA1A 1CQIB 2GK3A 3HUFA 5BRAA 2ZBDA 3TECE 1FDIA 2WAOA 1JHXA 3LUDA 3T7TA 2L82A 1IVYA 3I6IA 4IJUA 3PCXA 3ZHCA 1KF0A 2W2NA 1XD9A 3BIOA 4K9MA 4JKIA 1GU0A 4B8WA 3OKAA 2BSAA 2UV8A 1NJGA 3FVVA 3QXHA 4TV9A 4DLKA 1MC8A 2B99A 1Q0ZA 1C3EA 2AX3A 3HFJA 5BRJA 3R0QA 2ZPAA 1L7RA 3VR3A 3DTVA 2E0IA 2BEVB 4UTNA 4DKJA 1EG7A 5T4HA 3ZXXA 3WISA 4CEHB 5D51S 2Y0PA 2RCYA 4QWMA 4TM7A 3GBSA 2G9NA 3EN0A 1YS7A 1X42A 5MN6A 2I99A 4QXQA 1HEUA 2XQGA 1A1SA 1VLQA 2FR8C 2VAMA 3L7CA 4RSHA 1RJ9B 1VXOA 3EZ7A 1VECA 1XXHE 2VBCA 2AFHA 3K2BA 4M46A 5DPMA 3RS4A 1LJ8A 1MJFA 2ZT6A 3PUIA 1K88A 1G3QA 1XAGA 2JIDA 1QYVA 5JXGA 4G5GA 4MV9A 1NXVA 2BELA 2O6LA 5BV0A 1DV1A 4DG5A 2EX0A 4YCJA 3UG6A 2YMPA 5AKXA 1Y9JA 1RPTA 1OPXA 1R6DA 2AD1A 2RJ3A 4MW5A 1JWLA 4IRXA 1HQKA 4LK3A 4NZNA 5AIAA 5T5QA 5JALA 4DR3B 5A7FA 4J1QA 1OR8A 1UT5A 1Y7HA 1LJLA 4BZXA 4CKWA 5JECA 3AF3A 4FOTA 3JYLA 1NN3A 2CVQA 3AJAA 3INYA 4LDRA 4MH0R 4UC0A 5EP3A 5BN5A 5MDHA 1QBKC 4GU5A 3IQGX 3VZQA 5DNCA 2XJ4A 2ZKLA 4DG9A 1UMKA 4FYMA 3QPVA 1E2EA 2WIGA 3L07A 5LUBA 1VMDA 1YA4A 4IVQA 5A9SB 3DDOA 3UCFA 4F38A 1W87A 1OYYA 2FQQA 5FUBA 2VRCD 3D0OA 3NBUA 4PXYA 2WZBA 2FSPA 5F2EA 4FEEA 1Q84A 1GJRA 4KLZA 3GLIB 3B6ZA 3B6KA 4LRWA 3UJ3X 3WHPA 4KQHA 8ATCA 2B30A 3QBVA 3PD7A 3RUIA 1EFRD 5K3CA 3CA8A 4B7ZA 3A3NA 4OQNA 3Q41A 2GERA 2YBEA 3QUSA 5DM2A 4D79A 5HZHA 2ZYUX 1HETA 1SUAA 3L05A 1R8XA 3GK3A 4OKSA 5AHOA 4I99A 4NMMA 4I4NA 4MYUA 1FPQA 2YHBA 4WH0A 4YI3A 4ZCRA 1XVTA 2AEEA 1XUOA 4ZN6A 4QTYA 4K9OA 3EXG1 4FX2A 4KQEA 1NUUA 1GTVA 2BMJA 5I8PA 5C18A 1T6ZA 2AC2A 2CHEA 1J22A 1CNEA 1J8DA 3L06A 3VPHA 4QYIA 3UFXA 1XA4A 3RCBA 5AW7A 3C85A 3WSWA 2V6BA 5E6SA 1U0SY 5IU6A 1P74A 2NXEA 2FUKA 3HKEA 3MOIA 4P4SB 4NE9A 3RK0A 3UYLA 3WAJA 2JCBA 1G7TA 1XSEA 4EJSA 1NNSA 5F51A 4P7GA 4G0QA 3I8SA 4D4HA 4ZVMA 4YRMA 4EO4A 3RADC 2UZ1B 3C3EA 2OFPA 3L1JA 3EFOB 5K0TA 3IXLA 4GPEA 4BE9A 3DO8A 1XKTA 3FHOA 1P72A 1KGSA 4YQZA 4NAUA 1DIOB 3LP6A 3FOFC 5A2QA 1VPLA 1FSGA 3NGLA 4LJSA 4TXNA 3U62A 3W5VA 3B20A 4KPUB 4ALMA 2FEWB 4AJKA 1ECBA 2IOYA 5LP6F 2Q2QA 1ZVVA 3PEWA 4WECA 2FPGA 1ZM3A 2QTNA 2QYTA 4JSYA 3SBEA 4YXWD 5TT0A 1GKKA 4GUAA 2B2XA 2WD9A 5LBUA 3BK1A 2ZDHA 1W6RA 1GKIA 2CYCA 4CTNA 1VCNA 5JXWA 4F5WA 4G0UA 2W83A 2ONZA 2YWBA 2JGDB 4L5AA 3ICEA 1B6GA 3IAUA 2EBUA 4QDXA 4AIIA 5EKXA 3GUYA 1RXEA 4X90A 5AXAA 1YONA 2PS0A 1BAPA 3GU3A 3P8ZA 4RDHA 5KBYA 3TTYA 1MG5A 2XE7A 4NDAA 1I7SB 4R05A 4UDOA 1IAQA 3T54A 4EY4A 1CEQA 3TTUA 5D01A 3GGJA 4CMKA 2ZFUA 1BE8A 3DOHA 3HNRA 2PWBA 1YS9A 2GJ9A 4DZRA 3W04A 4G0NA 2YJ4A 4K8RB 4LVOA 1GU1A 1C7JA 1E2DA 1Q74A 2EZUA 3DPSA 3I9V1 1ND6A 4MRNA 2E4VA 4PEVA 5JO9A 2VSQA 2PNJA 2EXXA 3JAWA 1JKXA 5I7OA 4L8YA 5D5HA 4URWR 3HNPA 1WG8A 1UDCA 2QPAA 4NCAA 3GLGB 2P7IA 1OE0A 5EZYB 3DFMA 3KJNA 2V1UA 3U7JA 2J6IA 2QTAA 2HF2A 1YIDA 3HJCA 2XAAA 4O63O 2QN1A 4B33A 4QGSA 5JU6A 5HHTA 1H94A 4TV8F 1GZVA 3FYHA 3P4YA 2IHVA 3LQ1A 1ZAYA 2VNAA 1PZGA 2B92A 1GM5A 3LYAA 4XIFA 2PLNA 4O2AA 2OO5A 2WP0A 2LDBA 3HN6A 3B70A 4FDUA 4MRSA 2C98A 3L6RA 3Q8MA 3F7MA 1VPWA 3ER8A 2P5SA 1QMPA 5DBEX 2RGEA 3SG0A 4KQMA 4P3YA 3VJMA 1II0A 3MTEA 2CXQA 1A2OA 2J3MA 5EQJB 3F8WA 3GGOA 5AI8A 1JB1A 1UKVY 3MXTA 4C30A 3RIYA 4CM6A 2Q3FA 2SCUB 4XD7D 1DZ3A 4KDRA 3OMWA 3L1KA 4KHZA 3GNQA 3N2EA 1T9AA 3BFVA 1XPOA 4K6KA 1W0KA 3A6HA 4AJ4A 2V59A 4LF6B 1BGXT 1MOQA 5DF1A 4C0LA 1BN6A 2LKCA 2WSYB 4HYTA 1BKYA 1JUDA 1Y8CA 1ISGA 4GHWA 1K7YA 1VI2A 2VHJA 4F96A 1DRUA 3LUJA 2OB1A 4WLVA 1AV6A 2DLDA 5LOVF 4CCWA 3RVSA 2QQFA 1WWKA 4OLHA 4MKFA 1Q14A 3EZGA 3R23A 4FB5A 5JNSA 2ZSIA 3O4VA 2YC2C 5JZ9A 3VH1A 1ZK0A 2Q3EA 1WKBA 2JKVA 2V8BA 3WFZA 4O2LA 1UFKA 4EMSA 3HXOA 4I14A 2VBIA 3D3QA 1UF9A 2RBGA 3GLUA 3WE7A 1H22A 1RRGA 1SRQA 4IDOA 4LX0A 4ALNA 1M6YA 4QSHA 4J90A 3VR4D 5HYVA 5T7BA 1PCXA 3DT6A 4D26A 5LL6P 4G5FA 4MYSA 1TC2A 4PBTA 5IABA 3AJEA 2JGEA 4L16A 3CZCA 4W63A 1WV1A 5HA5A 4AG5A 3IODA 2BH2A 1LWOA 2BFEA 4HZUA 2VR1A 4TX1A 3F8TA 2O2EA 1T3HA 1HOXA 1SJ9A 1AQ6A 3I9MA 1ZHFA 5DRTA 3ZU4A 3ZBQA 2WHXA 3UNXA 2R8BA 1QVZA 4FCTA 4JVOA 1G63A 2VPPA 4QPDA 4XXHA 3SX0A 4K9PA 1Y63A 3TJRA 1N1GA 4HUQB 4L3VA 3IIMA 3KCNA 4L07A 4L8VA 5D2CA 2QTRA 3FUVA 1NIPA 4GOND 4IIUA 5JD6A 3GVPA 1DKMA 1G3RA 3IP7A 1NVAA 3JXEA 4FR2A 4G0WA 3FG9A 2OAP1 4ABYA 1ZYUA 1F2TB 1SVLA 4M53A 5CG2A 1K6JA 3SLRA 3L4SO 4QXRA 3ZEAA 3D6NB 1IJBA 2FUG6 2Z8YA 4AN4A 5DHSA 1DSSG 4QULA 4TXMA 3WDSA 3FOCA 4QOHA 5BWBA 2WJ3A 2IPNA 2A5YB 1FS5A 3GMSA 1EJ2A 3HWRA 3NIGB 5FJJA 2V6GA 3QV1A 5AMXA 2A9RA 3UHAA 4BNMA 3U3JA 1PIWA 4MUXA 3WXBA 4RK0A 2O54A 2D0IA 3QF4B 1RXWA 4B6RA 2ALJA 2DPHA 5AW4A 3RK4A 1I3CA 2PT6A 2X8BA 3KS9A 2CD7A 2YOHA 2REOA 4L28A 2HCJB 1WETA 2JHCA 4AF7A 3SYNA 4NS1A 1I6LA 2DUWA 1S6YA 4JBNA 2JFYA 3KLNA 5JMWA 4LRUA 5LQNA 5EXDA 3SJAA 2AEFA 2ODWA 3D8NA 2APJA 1Y5IA 1SVOA 4NV1A 1XD8A 4OXYA 3SLGA 5KKNB 3BOSA 4KO3S 4YALA 2Q5FA 1LSSA 1BKDR 5K8VA 4NFLA 4CMEA 4JR2A 2PKXA 5GOZA 3SPXA 4L9RA 4IG9A 1H5UA 5EKUA 3B53X 4UU8A 2HYDA 5CT5A 3K8YA 1AJEA 3PP8A 2ODEA 2O8DA 1UODA 1GL6A 2HOQA 1X1DA 3HCOA 4O4HF 3IE0A 5AUQA 4FFNA 1NYQA 1NBOA 2C58A 3QLJA 1ZSVA 1OB5A 3Q6MA 4X63A 1Z63A 2VHZA 5AQEA 1U4SA 3LXXA 3SSOA 2YJGA 3KR2A 1AK1A 4GGMX 1SK8A 4R2HA 3EHEA 2JGKA 2IUEA 3REFA 4MQLA 1Y8ZA 4X66B 4B3MB 3EG9A 4BGIA 1P5ZB 4WD3A 5EVCA 3RIMA 1FFSA 3PRHA 5ALHA 4PRZA 3L5KA 2J9XB 2ZBGA 4K3UA 3OZBA 5CP8A 4ZQGA 1WZIA 1QQ6A 1DAMA 1JKJB 1SD5A 3VO2A 5CFNA 1NSFA 3LLMA 4Y6SA 1US8B 4Q6BA 3MMXA 1VIYA 2PJUA 1U81A 1D6SA 3I32A 4XQGA 1GT6A 3UGKA 3HI6A 3Q11A 3GGDA 1X86B 3JD0A 2NUTB 3Q9SA 4WESA 1QOZA 3DSRA 3FF1A 4FHGA 5DLPA 1P5HA 3HJNA 5JSZA 1RQ2A 4V02A 1DLJA 4WI1A 2FQ1A 3Q40A 2EL7A 5F4ZA 2NU6B 1GY8A 5LP6C 3CVYA 3C74A 5JRJA 1NHWA 1PZEA 2QUJA 4ONEA 3UH1A 1I3KA 3I9KA 3KZCA 4QWWA 4J7AA 1GQYA 1LI7A 3DV2A 3V42A 3HP4A 2QL5A 1A3CA 1HK7A 4M8NE 1VLZA 2BGJA 3A32A 4YECA 4BP3A 4KREA 2XXAA 1KO1A 1ZEJA 3O2SB 4JHXA 4DEVA 4P7BA 2JJQA 4HAXA 4AY6A 1P60A 4EGJA 3TLEA 2FWJA 4GECA 3WB1A 4XYLA 3W06A 4DOMA 3QWBA 1KYQA 4EI2A 4RGBA 2I87A 1KVSA 2X77A 3O8NA 2WW8A 4PG5A 4FDTA 2W2QA 1XRRA 2ZEJA 4Y0VA 4D3ZA 5C8YF 1YCFA 1BIFA 2ZUCA 3CB2A 1NW8A 2JH8A 5F9MA 4DUPA 4DR4B 1KI1A 5GQSA 3A4NA 1AB5A 1Y4AE 3CQ9A 3UTDA 2CNOA 4ZGGA 2TS1A 4PO8A 4BNHA 3R3YA 2B8NA 5AUOB 2QV0A 2OK7A 4UJ3A 3P0EA 4RQUA 3T7AA 2CFRA 4K9RA 2DHDA 4RBNA 4YP7A 5T67A 4CI9A 3O4RA 3PRYA 4F0JA 3MJVA 1YE5A 2W8BA 1PJQA 1UFRA 4EYSA 4HJXA 1V4NA 2X13A 3FPKA 3T34A 4GZ5A 5A03A 4PZ9A 1Y3BE 2GPWA 3BXEA 3L7AA 4WKCA 3SX2A 2O7NA 3OZUA 4JJFA 4ESEA 1XMOB 3A9VA 1L7NA 1J2YA 3GJ6A 4IJVA 3KQOA 3P0HA 3C7KA 3DFZA 3UWOA 1CUBA 3QVJA 2C2XA 2D4HA 3S55A 1UQRA 4M9XA 4ODIA 3PRKE 2XMBA 3EOAI 1T8UA 1S1CA 2R6CA 1H4QA 5L4LA 2CLLB 2BRUC 4NMXB 3SBOA 3EVFA 1PJZA 1N4AA 1T9KA 3M3DA 2H57A 3QE9Y 2ZT7A 2H4ZA 3C87A 2DQSA 2PKWA 3HBFA 2BZ0A 3IHKA 2Q5HA 3UJ8A 1RBYA 1WDMA 4KUEA 2BEWB 3GLVA 3DMTC 2PVCA 2OBMA 1U8TA 2HA4A 2AXPA 4DMHA 5JR3A 2HR1A 1EZ1A 4EATA 1DBWA 5A4IS 3Q12A 1NP3A 2BF4A 2ERXA 4B6OA 5IXSA 1VIDA 5ENDA 1YZTA 2JIZD 3EVEA 2IHZA 4PNZA 4M1EA 5BUCA 3T61A 1RTTA 4HTFB 2GYUA 5FBVB 2I78A 3BAFA 2IP2A 2Z43A 4TKMA 3I5AA 3TE6A 2YWGA 3WHIA 3ZV4A 5B4TA 6LDHA 5HSGA 1YB5A 3ELYA 4PGGA 4W1QA 2NG1A 2QROA 2BGNA 1FFWA 1PD0A 3ANXA 3L0OA 2DHQA 3QEJA 1AGPA 4HAVA 4J0IA 4MAFA 3UK6A 4P4TA 1MDFA 1E2FA 4FHCA 5FADA 3UXHA 1WMBA 4JEMA 4W5QA 2AMVA 1VYTA 1SR8A 4ZOCA 4MW2A 2ZW9A 3T94A 2YTZA 4XIJA 4C01A 4OHYA 2A0YA 4TTRA 4D4IA 5A62A 3UJ7A 1Z0FA 3GQVA 5J43A 2AW5A 4IHJA 4WERA 4LJYA 3UTCA 1Z28A 2HLPA 3FTCA 3FWZA 5AD1A 1O0CA 2IWHA 3VHLB 2JRCA 2VEDA 4HBZA 5FTKA 5CDHA 2XYQA 3BRSA 1HKHA 1YZGA 4ZT3A 1XF1A 1PVVA 5JCJA 3ANTA 1T5LA 3JYQA 2JBWA 5DLQC 4F91B 5K4AA 4G9EA 1B0ZA 2BMAA 2YQZA 5AP9A 5IEBA 4MW9A 1S2IA 2VPIA 1Z8DA 3Q7RA 4G1MB 4R98A 3CE6A 2VH1A 2NZYA 3BGVA 3MWEB 5EJMA 2XTJA 4AIRA 4YAWA 4YRIA 3CLSD 3T9CA 1OA1A 5EHZA 3D6JA 3I04A 4N0PA 1CS4C 1V5EA 3IFSA 1Z7GA 1U3WA 4C4XA 1AN9A 1ZZGA 1M0SA 5FLEX 2H1IA 2QN9A 4K86A 2JHAA 4M4SA 5AW9A 1FBTA 2D2EA 5HCIA 2ZIXB 2VYCA 5BR7A 3JVEA 1SCJA 1ONOA 2XCUA 3GIDA 5A06A 2M9MA 2OE2A 2WDZA 3BHIA 3EF3A 4U00A 4Z54A 3TLXA 3VR1A 2XKKA 1N0UA 3ONEA 4MS4A 1SHJA 1WB5A 3WL4A 3EPLA 3MJCA 3TZBA 5ERXA 1YE8A 5JCOC 5KJEA 1A27A 5LN1A 1AHIA 1H2FA 1R16A 1PS9A 2G1UA 1WZNA 2IPMA 3N70A 3IA2A 2Z98A 1XEXB 3P4UA 4TUYB 2X6RA 3M1IA 1DEOA 1JMYA 2XI4A 3C15C 3EXIA 3MT8A 4MKRA 2OOSA 2P91A 3BJEA 3RUCA 2DOKA 3GUCA 1M6HA 1BMFA 3O0DA 1U80A 5IJ0A 4LWZA 2ZRJA 1L5HB 3AP3A 1L5LA 3IXQA 1KY5A 1G5PA 2PV7A 3SS8A 3CM0A 4ZYVA 3WSVA 3ZDXB 2AVNA 4RS3A 1O6ZA 2Z57A 3MBIA 3JQ8B 4HWPA 1I33A 1DJLA 4YC7A 5JFGA 1TGYA 3M33A 4WSOA 4ZU1X 3JVDA 1A5SB 2D5BA 3I39X 4WOPA 5LB4A 1AURA 2FZ5A 1N6HA 4HVTA 1G20A 1XTSA 3OEHD 2NPIA 4HI0E 1Y1SA 1UK6A 3MYYA 1WCV1 2HSZA 1DUIA 2G1JA 2Q2NA 4JENA 5EIWA 3QPBA 3BRCA 2CXOA 2FWRA 2O8EB 2NYAA 1OI4A 3RVLA 4N7MA 5BSWA 3WLLA 5J2UF 1WKVA 2CL7X 5IJ9B 4MEJA 1BHO1 1CE8B 2GK4A 3TMYA 1TZMA 5IK2D 1ZD2P 3EA4A 4DCMA 5A4KA 4R1OA 3X44A 2OLKA 1RQPA 3PC4A 1YRYE 1EBFA 5B53A 1RRCA 4WT7A 1YQQA 2QSJA 4FDMA 1JW9B 2WFLA 5T8KC 4BZZA 5LP1A 1ZR2A 4LI3X 4K87A 16PKA 1GFSA 1EIWA 2GXUA 1TGVA 2ODTX 1IJEA 3KHUA 3FMVA 4IIHA 4QBGB 1IN4A 2P6PA 2V65A 2VK2A 4WN3A 1HLFA 5HTKA 3U5TA 2YVLA 4Y0AA 3N3AC 2I4LA 4I4LA 2XNSA 4RY9A 3PFCA 4Y7DA 3NUZA 4JI8B 1X1CA 5DFAA 221PA 4AZWA 1VKRA 3VU9A 5EIFA 2IEGA 5AM0A 4OHFA 3TQTA 3ZCPA 4HC4A 4QYWA 1OX4B 3K30A 3G1WA 3OO1A 3OX4A 1ISRA 2LKDA 3DEIA 3N0RA 3OJFA 4M1MA 3ZR4B 4H60A 2BEKA 5AKKA 3AOGA 1X8JA 3O31A 5J3JA 3H1FA 1F9AA 2NUPB 1QK5A 3IE2A 3LDGA 3PNOA 4K9LA 3JQBC 1T2DA 5SICE 2CDNA 4EHJA 3PEUA 3R3JA 2NQTA 3JZIA 3KSZO 4MQFB 1HF3A 3W1EA 4YFYA 3ERCA 1FB5A 3W2GA 3KZNA 4BFSA 1R6UA 3TWOA 4F9FA 4R7TA 1R2QA 1DX4A 3C5CA 4JBHA 2CUZA 4FOPA 5T64A 1Z0UA 2JRLA 5I4IA 3IELA 4XX1A 4CKCA 1PGQA 1QCDA 1HLDA 3AEYA 3QBDA 3Q7TA 1NA5A 3ZZ0A 1BX3A 2ZSHA 1G2OA 4D3FA 2ETVA 1JV2B 2C7OA 2CJPA 2VPXA 3D3NA 4QT0A 1W5TA 5D87A 3WJ7A 4KQIA 4Q24A 3UK7A 3LT5A 1GD1O 5SV2A 3T7IA 3CR3C 4GSYA 2H65A 3TIIA 5IANA 3UVEA 1HURA 3OX1A 3PNBA 3OP1A 3PX3A 4DV6B 3ZVMA 4GWGA 3NIWA 5IVDA 1F4PA 1C1XB 3DONA 4WK0B 1Q3HA 1ODCA 2GRJA 2XY4A 4GLJA 3QVKA 4OIMA 4D45A 3G9ZA 3H2HA 1GGNA 3F6RA 5LBIA 4DV4B 3AEKA 1KR5A 1WKCA 1VE6A 1IY8A 2IU3A 3PCTA 2HQ1A 2IC5A 2X0JA 3C1TA 4JITA 2WJZB 3K0CC 4DLYA 4F1WA 1TKBA 2C2MA 1IAVA 2HMWA 5CPFA 1KDOA 1TFRA 3LI2A 4UDXX 4J91A 5E6RB