3OZEA

Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
273
structure length
263
Chain Sequence
b'AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-methyl-5'-thioadenosine phosphorylase
publication title Crystal Structure of human 5'-deoxy-5'-methyladenosine phosphorylase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 263
sequence length 273
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozeA00
4WKNA 1RXUA 1RYZA 4X24A 4EB8A 4DARA 2HRDA 1V3QE 4JP5A 3OCCA 3O6VA 4R31A 3P0EA 1PK9A 1Z36A 1A9PA 3P0FA 1K27A 1RR6A 4MCHA 5F7OA 2ON6A 1ULBA 3KVYA 4DAOA 4TS9A 4DA8A 3INYA 2OXFA 3NM5A 1ODIA 4NSNA 2OC4A 4OGLA 5JPCA 1Z33A 3BGSA 3PNPA 3DDOA 3EUFA 3IOMA 1SQ6A 4LNAA 3C74A 3NBQA 2QTGA 1U1FA 4QARA 2HWUA 4G89A 4GLJA 1ODJA 3OZBA 1Y1RA 5F77A 1LVUA 1YQQA 4NS1A 3PHBE 4M3NA 1TCUA 4LDNA 4L5AA 1N3IA 1SD1A 4E1VA 1VHWA 3ENZA 1RXYA 1A69A 4TS3A 1A9QA 1U1DA 3D1VA 2I4TA 4DANA 1RSZA 3U40A 2B94A 1PW7A 1SD2A 1VHJA 4OF4A 3GB9A 3QPBA 3FWPA 4OY3A 1YRYE 2PGAA 3DPSA 2QDKA 4TTAA 3UAZA 4WKOA 4OEHA 4D98A 4JOSA 4D8YA 1RXCA 4OGKA 4M7WA 1ODKA 4DA6A 3MMSA 4DA0A 1ECPA 1PKEA 1TCVA 5B7PA 1U1GA 2RJ3A 5B7NA 5CYGA 1WTAA 1ULAA 1V48A 1PR4A 1YBFA 2ISCA 2AI1A 3BJEA 5B7GA 4F2WA 3LBAA 2Q7OE 1K9SA 5DK6A 1VFNA 1JPVA 1YR3A 3UAYA 4QASA 5F73A 4BMZA 4D9HA 3FUCA 4BMYA 2OC9A 1RFGE 4YO8A 1PR0A 4RJ2A 1Z34A 4NY1A 4DA7A 1OV6A 1ZOSA 4BMXA 4EARA 3E9RA 3KUKA 1PR6A 1NC1A 1Z35A 4GLFA 4WKCA 1JE1A 1PR5A 2OECA 4TTIA 2A0XA 3KHSA 1RXSA 1CB0A 4L5YA 4MARA 3PNSA 5F7XA 3FNQA 1Y1SA 4YMLA 4YJKA 3PHCA 1OVGA 4LKRA 3OZCA 1A9TA 4FFSA 4R2XA 1V41E 1LV8A 4TXLA 1JDTA 1B8OA 1JP7A 3IEXA 2I8AA 1XE3A 4GMHA 2QPLA 4L0MA 1M73E 1K3FA 1JDUA 4TXMA 4DAEA 4DABA 3OOEA 1OTYA 5C80A 3EUEA 1Z5PA 5K1ZA 3OPVA 3BSFA 4TYMA 4QEZA 1Y1QA 4KN5A 1OU4A 3DP9A 4P54A 4IP0A 1LX7A 1PR1A 3LA8A 1NW4A 3UT6A 3ODGA 1U1EA 5I3CA 3K8OE 4R2WA 5IU6A 1TD1A 1Z5NA 1VMKA 3DJFA 3KVVA 3NM6B 5KB3A 1JDZA 1Y6QA 1T0UA 4PNPA 1T8WA 4OJTA 4F3CA 4U2KA 4K6OA 4WKBA 3O4VA 5EPUA 1PF7E 1RCTE 3UAVA 1NC3A 5EFOA 1Z37A 5CCDA 1A9OA 1JDSA 4L5CA 4MCIA 1I80A 5CCEA 1Z38A 1YQUA 2XRFA 1PK7A 3T94A 3F8WA 4F2PA 3LGSA 4D8XA 1B8NA 4TXHA 4PR3A 1TGVA 3TL6A 5F78A 3E0QA 1PR2A 5B7QA 1RT9A 1JE0A 3BL6A 1PBNA 2QTTA 1T8RA 1SJ9A 3OZEA 3E9ZA 3OOHA 2A0YA 1A9RA 4F3KA 3FAZA 5ETJA 4BN0A 4G41A 1OUMA 2HN9A 1JYSA 5F7ZA 4H1TA 3EMVA 3GGSA 4M1EA 4F1WA 4TXNA 5F7JA 2AI2A 1Z5OA 3UAXA 2BSXA 5CYFA 1PWYE 3FB1A 4JWTA 4TTJA 2IQ5A 1V2HE 4GKAA 3KU4A 4QAQA 3SCZA 2P4SA 5FAKA 3OF3A 1V4NA 4TXJA 2AI3A 4I2VA 1JDVA 1T8YA 1A9SA 1Y1TA 3K8QA 5IFKA 4QFBA 1C3XA 1G2OA 3FOWA 1V45E 4WKPA 2QSUA 2A8YA 1TGYA 4YNBA 1FXUA 1OTXA 4LZWA 3UAWA 4QATA 5CXSA 1ZL2A 1ODLA 2AC7A 1T8SA 4ECEA 2GUWA 1CG6A 3EEIA 4LNHA 2H8GA 2HSWA 3OZDA 4G8JA 1U1CA 4D8VA 4L6IA 5F76A 2A0WA 1Y6RA 3KVRA 1QE5A 3DF9A 3ONVA 4UC0A 3MB8A 1Z39A 5EUBA 3NM4A 1Q1GA 5CXQA
chains in the Genus database with same CATH superfamily
3A1UA 1H3EA 3M33A 2QU7A 3QFRA 5TSDA 5ITZB 2O06A 2PJUA 1CU1A 1KQ3A 2D59A 4H6XA 2QI9F 4IXNA 4QTTB 1TMOA 4M86A 3VSAA 4AJPA 1MW8X 4ZCQA 2JKZA 3QKTA 4QUJA 2PQ0A 2LKDA 2HU5A 2ZIVB 4JP5A 3V9AA 4ZGBA 3K9NA 1P33A 4UXJA 5I48A 2GWRA 4W5QA 5KQGA 3FCOA 1L7OA 2QSYA 2YS7A 2YWGA 3KEFA 1LDNA 2J45A 3STXA 1XI2A 2XXAB 3AF1A 1URPA 4IWYA 2ORVA 1VBMA 2RIRA 1H2BA 3A2LA 1VI6A 2B3DA 1JG1A 4S24A 3V55A 5E8JA 2FWNA 1ZW1A 4EG7A 3AU9A 1SBNE 4P4LA 2I78A 2FSVC 2IS1A 4DIFA 2AJ8A 3UMFA 1LH0A 2PN1A 4B3MB 1KWGA 3MGGA 5A5GA 5E1OA 3WGUA 3A8TA 2YCLA 2AXQA 2ISSD 4REQB 1FQOA 1QAMA 1WP4A 2CYBA 1OX6A 3BB1A 1RAEA 1ZN8A 2O3UA 3T7DA 3TZLA 2BIFA 3ZLUA 2BHRA 3AV3A 3HKBA 2EX1A 4WY5A 4ENPA 4R2LA 1IK4A 2XQFA 4HAXA 1GQOA 4PRLA 2VF2A 4A8JA 4LZNA 3NBMA 1JR3E 3C45A 4JEIA 4CR7A 3CRZA 2AH5A 3GRPA 1NGSA 1V3VA 3AJAA 2ZJ4A 2MINA 4TL6A 4P5PA 5A02A 4QVKA 1GTSA 4P7FA 2PZFA 2QJOA 1RXIA 4P81A 3OJWA 5ALIA 5CIYA 3I9V1 3OAAA 1K8YB 2Z2ZA 4E09A 3RYFB 1DKMA 4D97A 2OBMA 2XUDA 3UHAA 1T9KA 2LZ0A 3LHKA 4J0QA 4RMNA 2Q9AA 1EE9A 1XZQA 2JHGA 3A6GA 5KQRA 3FI0A 3UMCA 2MTBA 2ZUTA 4ETNA 3ORYA 4BX2A 3BRSA 3AY7A 2Y66A 2GSDA 2UZ1A 4MW4A 5GONF 4V1CI 1TXGA 4NMHA 2Q6IA 4A82A 1PG5A 1TCBA 1BAPA 1TOAA 1PT6A 1VCMA 1YU9A 5HZKA 2Z1DA 3A9VA 3NBZC 4IJUA 4JJEA 3SNKA 2R65A 1P1KA 3LQ2A 4GYJA 3FIJA 4YALA 1L5HA 3U3JA 2KBEA 2AFHB 3ZCTA 3BULA 1DC4A 1WQ4A 3DB1A 3I6IA 1P3DA 4LDNA 4PLWA 1TA9A 4QGFA 1YJ5A 3ROFA 1A88A 3PQ6A 4CKEB 5IXYA 2IXFA 3ENZA 4GRAA 1M3SA 1CTQA 4IGFA 1FDVA 3K6SB 2BEUB 3R0XA 2ID4A 5FA6A 4W5NA 5K0CA 3DYBA 4E22A 3HRHA 3JZFA 4K9KA 4BO2A 4Y2SA 3S70A 1QJCA 1QONA 1EVIA 2ZBRA 4XJXA 4CLOB 4RABA 4PXSA 4ZI2A 6CHYA 3L7IA 5TPWA 4B09A 4JI6B 2ZI7A 1E1RD 1V16A 4U9HS 5GJVC 3IT3A 1CZRA 2RHDA 2IKQA 4IYRA 4CRWB 2G25A 1NVTA 3LKVA 4KBYA 1VHJA 3GCXA 4NZ9A 5LZ9A 5ERGB 5HOQA 4G8DA 3R5TA 2V59A 4GZMA 4JYBA 2A3NA 4MUNA 4MVJG 4GNRA 5IZ4A 3D8NA 3JQQA 3TLXA 1DEKA 2I8CA 1C8KA 1GGJA 2IUEA 3DS8A 4IUDS 2GKOA 3HXMA 2CMDA 3U7FB 2QDKA 4HQ0A 3FPAA 4U9IS 3EZLA 2IW1A 4RH3A 2YQZA 1GQ2A 3TRDA 1ZD5A 1MO6A 2BN4A 3VNBA 5K2MA 4TQAA 4CETA 3EX7C 3TL3A 3PXEA 3MBIA 5CLQA 4GLBA 2QI9C 1XKXA 1NOJA 4PAMA 2AUTA 4YJ3F 3RI3A 4XWAA 2AN9A 2BMFA 4DR1B 2RJNA 3IBFA 2II6A 4PLFA 3GT7A 4UVIA 4IKOA 3SQDA 3TPFA 3L6CA 4ZMSA 3G5AA 2BRUC 1OLOA 3OX1A 3CONA 3MMSA 3G2NA 2XB4A 4HGOA 3HXPA 2EW8A 3IMEA 5LMUB 1WVMA 3GU3A 1Z8HA 2FP4B 2VK4A 4KI7A 3ZBPA 1R1DA 4QQFA 3K6RA 1SVIA 2FETA 4K9QA 4BP3A 4ZZ0A 3SQLA 1TEHA 1GPMA 1U1GA 4G1EB 4F0JA 2ET6A 3H0CA 5F3RA 2PXHA 5H8WA 2QBYB 1P2UA 2ZSDA 3DOEA 1M74A 3GDHA 3GH1A 4K6KA 8ABPA 4Q00A 4WZBA 1UWCA 1DBQA 1Z4LA 1EJ6A 2QMYA 3R7WA 2VRNA 3SD7A 4BO5A 4D9JA 1P9LA 4A3SA 2K6GA 4YUWA 3M9XA 1EDEA 1ZU4A 3HCPA 3QF4A 3WB0A 2GS9A 3NR2A 2D5CA 3A7DA 2UZ0A 4HBZA 3K6JA 4B76A 4R3NA 3ZTWA 2UXDB 2XEDA 3I39X 3OQBA 2V9PA 3GD7A 2QTMA 3JWIA 3UW3A 4TZTA 2NMVA 1TYZA 1U8ZA 3QPWA 5CPBA 1T8PA 3I2YX 1FJGB 1WXDA 3BCSA 4J0GA 2HIMA 4A6PA 3BIWA 4QOIA 3V8VA 4E70A 1UZAA 5I8ZA 1ZO8A 4CUJA 5FWXB 2QLNA 4HPXB 4OHWA 4AUNA 1P2DA 1U63A 2B7LA 1BWRA 3VSBA 2OK7A 3AT1A 4QFDA 1FE8A 1KERA 1RLOA 1M8KA 3KWMA 1C1DB 2ZBGA 3N6XA 3SK0A 3TTVA 3ZBTA 1SKAA 2O0MA 3K20A 3P97A 1J2TA 1DPFA 4I0WB 1V39A 2VAMA 3K8YA 4K6GA 1YRAA 3TNYA 5L7TA 5AVQA 1EFPB 1SXHA 2P35A 4N5LA 2GFHA 4RGBA 4XSHA 3O3CA 5C53B 2QX8A 1ZISA 1ULSA 2XCLA 2B25A 2XMRA 1QZZA 3OX3A 3AHEA 5T57A 1ONOA 5C80A 4TZ6A 3UW1A 1D2CA 4GLFA 4J4BA 1RC8A 3MTIA 1G6OA 3KHSA 3A1VA 3KOZA 2Z4RA 1Q19A 2GK7A 2O4UX 3V1LA 3VH3A 1XMQB 1O1YA 3ZLVA 1GY8A 2RG1A 1ZD1A 4PWYA 3S7TA 3U49A 3E48A 3J81A 2RFLA 3B1FA 4B48A 3LBHA 4PZPA 2XIQA 3FGNA 2H51A 3HUUA 3FDIA 1QQ6A 4YQYA 1OZAA 1D5WA 4Q18A 1DI0A 1GTG1 1XXLA 1YBAA 3F6EX 2O2JA 3DVAA 3M1LA 2J5RA 3LQQA 4PU0A 4JAVC 3AZOA 3NTLA 3BFXA 2FWJA 4DDWA 4B3FX 1P1RA 2GXSA 1ZK0A 5KNBH 3CZAA 4NYIR 2OESA 2JFHA 1B0AA 5I9BA 2H2AA 5D3MA 4WN3A 1V41E 2MSCB 1A2KC 4BCDA 2GKSA 2QRQA 1SRRA 2VTVA 3KQSA 2VRBA 2VA9A 3CN7A 2H48A 2QSJA 3SYKA 4GDFA 3TSYA 1TA4A 2ONZA 5KVVA 1FLVA 3GGOA 5DNWA 5A0TA 2X3FA 2DR2A 1NU8A 1G8JA 1SVWA 4QXRA 2E4AA 2O0LA 1CHNA 1Y6FA 4YMSA 1OTHA 1K98A 3D59A 2I34A 2PXAA 2OYCA 3V80A 4ETWA 1YI8A 2JGFA 1A95A 4BLRA 3LXXA 2AXEA 1V37A 5IM5A 1Q6YA 3B5JA 3UK1A 3UYKA 4NNOA 5DK4A 4Y1RA 3W5BA 1IQPA 4IL5A 3L6DA 2JIOA 2CUKA 2KLHA 4RMIA 4EGQA 1XD2A 2WD7A 4HZUA 4ENUA 2BFPA 2FJ0A 2Q50A 2FPKA 2R7AA 2VJYA 2R5NA 3KZOA 3H9UA 2WJYA 4BIIA 3JWEA 3CNLA 3ICQB 2Q4EA 4UUNA 1OU4A 1GNLA 1UL1X 1UXGA 3DDSA 1HURA 1TF2A 1U7TA 2JATA 4IP0A 5DBHX 4AUEA 4YWJA 4DLWA 3Q8KA 3A9RA 3RFUA 4I8IA 4DRZA 1BGWA 4MR9A 3ETCA 1QCCA 1A76A 1D8TA 3IRVA 3LKZA 5FI1B 2SKEA 1SIUA 4JIGA 4DG5A 2AD5A 4E88A 4DA9A 2WF6A 2QRVB 2NUAA 4KAXA 3EWIA 2CEAA 4XD2A 3CF2A 4B3JA 1J5PA 2NXWA 4Q1CA 1W36B 1NBWB 1VMKA 2R7MA 2FZVA 2G9ZA 3LRTA 1VG9B 3CEPB 1LLQA 2L82A 5DFAA 3S2IA 2ZJ2A 3V8PA 1PYOA 5FAXA 4C4PA 1W5SA 1A8PA 1HLFA 3ZJVA 5JRZA 4K2HA 5IAAA 2AEJA 5KI6A 1YKSA 2GPBA 3BHMA 2GRJA 3T7CA 3LCMA 3TK1A 1X8JA 4GPIB 4DC0A 1CUEA 5IAOA 1N92A 1WW8A 4ZV9A 3T3DA 1KK2A 1C80A 3MTJA 4F9TA 3KV3O 3IALA 3AR3A 4NP6A 1V6CA 4KBGA 4KIGA 5AUNB 1B23P 1NU6A 1NI4A 3PHJA 2F3UA 1BROA 1CRLA 1FP2A 2WWYA 6Q21A 1Z2CA 3PL1A 4UU1A 1ZC3A 2IY8A 1G5HA 2JGLA 1FYEA 2X42A 2Y8EA 3LVFO 121PA 1N77A 3DMNA 2AN4A 1P9RA 3TNFA 4FN4A 1PJQA 2H1FA 1VP9A 1A9OA 4IUBS 4OYYA 1HOXA 3O3MB 1KC1A 2EGHA 2WI8A 4YDQA 2GZAA 1EK2A 1ZC4A 4R9RA 4RTOA 4O1MA 3QVUA 1BSVA 1GU0A 4R2HA 5FWYB 3RYCA 1FYVA 2J0UA 2XRFA 2PLFA 5E4FA 2A9PA 3O2NA 2EHJA 2WA1A 4LKOA 2FPPA 3DOCA 1JIIA 4OU4A 1QG6A 1DKNA 2HW8A 1YSCA 1VGVA 3JD0A 4O5OA 3PFKA 2VTBB 1LTHR 1XU4A 2W2PA 3N53A 3KLNA 2I99A 4IQ8A 3O8LA 3MCUA 3TFWA 5IKXA 4OKSA 5C5IA 1FFAA 1QGZA 2H4FA 3P1JA 4JX9A 4UPVA 4BMDA 5TMPA 4LJRA 3FAKA 4TMKA 4PZLA 4QNMA 3E3AA 3MF4A 4XWTA 3JD1A 5FBVB 1EKXA 1NVFA 2ZTHA 2EF1A 3EY4A 1O0SA 4IDDA 5KPDA 1ORWA 1ZIYA 1W59A 3TFOA 3C1OA 2X2EA 4HYYA 3VU1A 2QRKA 2D5BA 4MZXA 3U7EB 2F3PA 2IC5A 3AVVA 4BECA 1BYIA 1EIZA 3OZEA 2M6SA 1HI9A 5JLJA 4EUHA 3AUSA 1LS1A 4WESA 2CF6A 1R8QA 4YIHA 4TVBA 3BAFA 3L1IA 3FAZA 1OHHD 4Q4AA 3NGLA 2P9JA 3D7RA 2PMFA 4MRSA 4REMA 3ZEAA 3I9JA 3JVVA 4K9DA 4KMOA 4EGCB 4B47A 3D43A 2IXBA 3NAZA 4QUEA 3MTAA 1LXCA 2G71A 2YHSA 3KYCB 2BGUA 3MIZA 1YMUA 3PSHA 4W7IA 5SYMA 3WX0A 2FEKA 4I66A 4ERNA 2ZREA 5LLDA 2PZMA 1TPYA 4NARA 2OCPA 2FWIA 2Q6OA 3X1ZA 1NFRA 3MWJA 1GOTA 3O8QB 3WV5A 3IAFA 1F8FA 2QX9A 5MN6A 1UFVA 2AI2A 2FLWA 4N5NA 2N42A 3VR2D 4JWTA 1ZESA 4X60A 4X8LA 3M49A 1QRSA 2CHFA 3HDJA 1E2EA 1KVQA 1MVLA 3HP1A 3ESCA 4IEIA 2YV3A 5AVJA 3EIXA 2NYVA 4GICA 4PRYA 3IKLA 3TJRA 3PWSA 3U3RA 3GCZA 4YRNA 1AKVA 2BFEB 2AI3A 4XDZA 1G5RA 1LBSA 4I3GA 3JQEA 4MVJA 2XCRB 4YREA 4DR2B 3AFGA 2IEDA 3ROZA 3N8NA 2PKQO 3RAGA 4B32A 2O5EA 3LBYA 4DJDC 4FYXA 3E9CA 2D3TA 4QFBA 3VYVA 2NVBA 2O2DA 2CXUA 3N2LA 2R6FA 3ASUA 1WV0A 1B0UA 4YMIA 5AI4A 2VNSA 2XA9A 5BT8A 4EFDA 5HCNA 3PQFA 4R1SA 3JAWA 3W5VA 1CUBA 4QU0A 3U1TA 4B82A 1QKIA 1G8MA 1P81A 4JZKA 4RA6A 4M1ZA 5H02A 3HB0A 1CY1A 2ZRBA 2XY4A 4YTEA 1FXUA 2J3LA 2GILA 3HACA 1VLJA 3K30A 1YS9A 1Z2PX 2Z8XA 3HPRA 5J2TB 3HY4A 2VUTA 3RANA 4U2FA 3U9SA 3JRWA 1QCZA 1Z07A 2A35A 1WKVA 1MO3A 1NRXA 1LBQA 2BKVA 2H29A 4QDXA 1Z6TA 3KTOA 1C7IA 4GE3A 4IS2A 4WERA 5YASA 4JI0B 1VCIA 5HJ7A 3BOSA 1G4AE 2FDCA 2AFHE 2Z9DA 1Q1QA 2UZ4A 1QSGA 3IODA 2HYDA 2ZBPA 4Q16A 4UE3S 4GRIA 5CBKA 5B2FA 3RFVA 1PZMA 3L5KA 1M2WA 2X2FA 4G8JA 1NLYA 3VTZA 4YPOA 2ODNA 4D1YA 3NH9A 1SZPA 4D3FA 5F1KA 4ZAYA 3EIHA 4MW2A 1OSNA 1G3IA 4AY3A 2WAXA 2GA8A 1IPHA 3HY6A 3LUPA 1A7AA 1HG0A 3NM4A 1FZQA 1O9HA 4FIZA 4NYMR 4QD3A 4XGRA 3J81k 3L1VA 3LHDA 2GHQA 1C4WA 3PUKA 5MGBA 1ZCAA 1RMTA 4PEVA 3NOQA 3JQ8B 1TUGA 1XTVA 1VI5A 4N39A 5HBRA 4DMRA 2PGNA 2Y1DA 3ZQKA 4YJHB 4MWTA 1C0IA 2GAJA 5KDOA 5J4HA 4FNMA 4NG4A 4Q93A 1ZIDA 1NBHA 2JCGA 5C7OO 3W06A 4BZXA 1UBOS 1T9DA 1VLHA 1TLLA 5C32A 5HF6A 1CUUA 3P0EA 2QUJA 4IEEA 1JHDA 1NUTA 1ZJ5A 1NKVA 1CXZA 4I1UA 2HREA 2YYAA 3LZ6A 1QRDA 3VMFA 5K99A 1H8HA 5D84A 8ADHA 5CURA 1GG9A 2OUKA 4PSUA 3VKGA 2CEKA 5CFNA 2CVZA 1OD6A 3DV0A 3IQGX 1GPNA 3CZ5A 2PH5A 2PIDA 3L1UA 2BH9A 1AX9A 3GEMA 3CLUD 4IV0A 4J76A 4A2PA 2V74B 4WJKB 1XKLA 2GN6A 3BD7A 1JB9A 2YWEA 4Q1VA 4RMHA 2WAMA 5B1YA 2BGGA 1XBTA 4TS9A 4X5OA 1C3OA 4P38A 4TM7A 2C92A 1FLAA 5CTJA 3ESDA 3FYTA 1JPUA 2CLEB 4P6VF 4L78A 2IYPA 3BGWA 2I1WA 3SOPA 4EHFA 2RGCA 3H9CA 4L8YA 3NC4A 4YEDA 4ZU6X 4DCGA 4NPAA 3R5XA 4YRBA 3LT2A 2BR4A 3GJ6A 4DSAA 1RYBA 4UE2A 1B2LA 1QMPA 4W8HA 2ZOSA 2VPIA 1OB2A 1DINA 2OUIA 2OV4A 2IBSA 3EVAA 4C5AA 2HA6A 1I4LD 1C29B 5DBFA 4MQUA 4DXAA 4TRJA 2D13A 1YR1A 3G9QA 5BOSA 4QFMA 1Z4IA 3EZ7A 5KSPA 4CLXA 2FMUA 5KBYA 1QC5A 4U5XA 1WSBA 4F3NA 4YUZA 4JSYA 1BYUA 4EY7A 2AFVA 4TYYA 1CVRA 2R8BA 1GL6A 4YQEA 3DDWA 4CIBA 4E5UA 3RKUA 1B0ZA 3HABA 1YBHA 3NAMA 2B98A 2DY0A 2VL7A 4GMFA 1F12A 3A27A 2IYTA 3MAGA 1SU8A 3WK8A 5DT2A 3ZHQA 4EHBA 3TRJA 2NZVG 5E1DA 1K7YA 3L0ZA 1KFKB 3WNDA 1C0EA 2ECQA 4PPFA 4UXIA 2B6NA 3MC1A 4BZWA 3ANXA 1L7QA 2RK3A 4IRMA 2RHJA 1L9KA 2ZJAA 3I37X 3Q11A 2JS7A 4C2UA 5IZCC 4CMKA 1DKRA 3DCIA 3QEOA 3DC2A 3H2SA 4FBGA 4L5AA 5JCJD 3RKSA 2WM3A 1QDUA 3H0KA 3R9WA 4KVFA 1XZJA 1K68A 1X15A 1MJHA 1R6AA 1RXYA 2XMQA 5FNVB 1N3BA 2MSEB 3M6UA 5HQJA 4B17A 5JYBA 1YJQA 5A1TA 4MROA 1MHPA 3C8UA 5TT1A 4C0HA 1A9QA 1PJBA 2ID9A 2B8EA 2C59A 2R6JA 5C5DA 5GP1A 2I4TA 3GCWA 1RJGA 4XE5A 4NWIA 4FZJA 3SZRA 4A0HA 2Z3WA 5K0BA 1CS4C 1EG7A 1JWLA 1LSOA 4O08A 4FOOA 2UVQA 4FOTA 5IN5A 4E51A 5BV0A 1OWPA 5JRJA 1XMSA 4F06A 3SLKA 4AJIA 5KQLA 4GMKA 4AZTA 3P45A 2UYCA 1MN6A 3HL4A 1J06A 1WNFA 3CNBA 3NYIA 3O0DA 1MQAA 4WK2B 3F73A 1I13A 4QA9A 5AVTA 1R0YA 1ZQ1A 1TJPB 2A9VA 2QU8A 1R0SA 5CJ2A 2ZM6B 3E5MA 4LE2A 1YCGA 4WCVA 2GFIA 5KMGA 4OQQA 2NVOA 4RL4A 3D4BA 4HATA 4KRYA 4DEXA 3NB0A 5C8DA 2ZFUA 3GEGA 3AETB 1S2LA 3IDAA 4IO1A 2V6JA 1CS0B 1K0FA 2FI1A 3KKOA 3MCZA 3QXGA 4UHBA 4F8YA 1GPYA 5LA6B 2QZSA 1HZZA 2ORYA 4XUEA 5J47A 1RKUA 4ZRMA 4CLRA 3FROA 3CUUA 3DZIA 2F1RA 4QWWA 3T9AA 3FCYA 3C7TA 3IAAA 3SHTA 3KOYA 2O8DA 1ENPA 2Z98A 4IJMA 3IT0A 4ISBA 4WXYB 3WIUA 4RQBA 4HNSA 2PL5A 1A5SB 1DKLA 2MSNA 3S1AA 1E3DA 3WXBA 3VDXA 5AW4A 3FHTA 3ORSA 1OFGA 3ISJA 3S28A 1UEJA 1XD8A 1R5JA 1GTJ1 1PSZA 1EU1A 2G67A 3DL2A 1Q74A 1X9GA 3G1UA 3NUGA 3UMYA 3DVRX 5JBNA 2ST1A 2A78A 3C5VA 3R1IA 1UJ2A 4NC9A 5EIBC 4TT8A 1ZRHA 1YZKA 4H3VA 1D8AA 1PLLA 1VTKA 1CHDA 1YFZA 3BJEA 4J2HA 2W5UA 1CBUA 1N7GA 4ZICA 1QGUA 1ZK1A 2YL2A 3HJFA 2PX5A 4KUGA 4F2WA 1QLJA 1DLJA 1G64A 1T1IA 1T4GA 1EQUA 1ELOA 4RPIA 3TD6A 4UNPA 4DRYA 3T41A 4QXQA 5LMCA 2F9FA 2LV8A 2ZSAA 2I71A 1EVZA 3WQRA 5LD2C 3BMOB 1U8YA 5DTRA 3V4RA 4X66B 3KAPA 1CY6A 4AYTA 4EG5A 5F1OA 2B69A 1M6VA 2I87A 1AGXA 4UUQA 4WY2A 3PFCA 1PNTA 4YI5A 4OYHA 2QL7A 4EPTA 4EZBA 5IKMA 3CWQA 3U19A 4A15A 1MO4A 3N9IA 1FPMA 2B3TA 2ZWAA 3KD2A 3Q3EA 2XF8A 5C4GB 1DMSA 1TUBA 3UHPA 1QRUA 3C41J 3F5MA 1D4FA 1OYOA 4KH1A 3CPSA 2MOKA 4MNTA 1A97A 2V7PA 3PD7A 4RKRA 3NRBA 5JANA 4XGNA 1H66A 1HZJA 2HA7A 4N3BA 4HGYA 2O59A 1OV6A 2CVOA 2P2GA 4BKRA 3P94A 3HKBB 2YV2A 4QO7A 1XZEA 2REQA 2YZNA 1XLVA 1SKYB 4A8JB 4Y6PA 5E95A 4C08A 1VBNA 1VKOA 5KWJA 4PXYA 2V3CC 1XJQA 2BL4A 2Z3ZA 3M5CA 4G81A 4HWGA 4RY0A 1IN6A 3WGKA 2MINB 4L6CA 3HYRA 4KB5A 2PFSA 4I1YA 4JBIA 4XSVA 1ZI8A 3ZZTA 4ARUA 3E5RA 4QT0A 4DV3B 5F35A 1E99A 3MRSA 4LYEA 2BT4A 4RW0A 3EFOA 1BGVA 1F17A 1JQLB 4DJFC 3WGTA 5A5FA 2VZLA 4UASA 2GCGA 4QDOA 3JQ7A 5KYYA 5DHUA 2ECKA 3FMGA 3TQOA 1N6NA 3P9KA 3ZE7A 2BZSA 2ZTMA 3FVTA 4H1UA 4OJYA 2UZ1B 1MABA 3BQMB 4IX1A 1XYYA 3IH5A 3ESXA 3OE4A 3JSXA 3RWOA 421PA 5ALTA 3JRXA 5ALEA 4EYEA 4LRQA 2HWXA 4R5HA 4X7RA 4P32A 2XGJA 2I6QA 1JILA 1WMAA 1G7TA 1Z08A 2CHVA 2Q0QA 1L5HB 2QR2A 3OOYA 4GVLA 1XSEA 3FUXA 4JJFA 4LKRA 4CM9A 2C2MA 3BX1A 4HRYA 4DV6B 1U2TA 3AKZA 3IEMA 1WIWA 4R1UA 4EOGA 1O97D 2AN1A 2POQX 3S4YA 3INRA 1A9TA 1F8UA 3KWJA 3P20A 3SS7X 1YVEI 3G3EA 1XQVA 5D1HA 4G0UA 1QB7A 2G0NA 4FYPA 1FSSA 5FL7D 3SHVA 2EFJA 3CLRD 2GSWA 4NH0A 5IK2D 3PHGA 4RETA 1YUMA 1YMVA 3H6KA 2HY7A 3U81A 3F3SA 5D51S 1A4RA 4M7OA 2NVWA 5BUSA 4I5GA 4JLDA 4L0MA 4YJ2F 5TPWB 3O95A 3I28A 4W1QA 1V16B 1FK8A 2H7XA 2I7DA 3F71A 4PCVA 1G55A 3U4QA 1XAGA 3CEAA 3CF0A 3MTGA 2HMVA 3C3PA 3IQHX 3UMSA 5FUMA 2H18A 5ECWA 4EO7A 4LYDA 2GPTA 2PNJA 2ZRHA 1DAKA 4P5DA 1T9GS 5IAGA 4B44A 1ST2A 1GTMA 2YZMA 3H8SA 4L15A 4PBRA 1DBRA 2I7TA 2PKWA 3FY4A 3MXOA 3N1UA 1YGYA 2J7PD 1PQPA 3PX2A 4WNAA 4INJA 4UHFA 1RWNA 3PGLA 4BX3A 2VSOA 2HJRA 1GAXA 2O20A 4R2JA 3LGAA 5A4DA 4E5PA 4EJFA 3PNYA 2XWPA 2ZW9A 2W2KA 4GYYA 3VR1A 3O8RA 4HVTA 5A05A 1RVDA 1MT0A 2IQIA 1BU8A 1A5TA 2J3HA 1ZDMA 3ZD8A 4DC9A 4NBSA 3AJEA 2XWSA 3KPUA 2BTEA 3LUDA 1LDYA 3LT0A 3RS8A 5K6AA 5JR3A 4JEUA 2PL1A 5C5CA 4Q4CA 3D3WA 3DHVA 1T3HA 3HN2A 3PNLA 2LR0A 1G8AA 4R9SA 5IG2A 5LDHA 1NQXA 4QZVA 3I61A 4FW8A 3F5FA 2Y77A 3NM6B 3RIGA 2EJCA 3DFMA 1SKMA 2JFYA 1CY0A 2D2FA 4M87A 4BLQA 1YTUA 2ZS9A 2VTDA 1T3LA 1WZEA 3EVNA 3KLBA 4IUYA 1DX9A 4KSYA 1JEEA 2OHJA 2NZWA 3R23A 4F3CA 1RZVA 2M98A 3N0VA 4A4DA 1ECJA 5KTTA 1IH8A 1SIWA 1IYZA 1JU4A 2OP1A 4K6OA 3AP3A 4WZBB 2QN1A 3O9MA 3OEED 4TWZA 3R7WB 1J09A 2OV1A 1VA4A 2J3JA 4J4TA 3C3AA 3G2JA 1SN7A 4O4LA 2O3JA 2Q5IA 3D6MA 3SEAA 1QV6A 3QF4B 4WOKA 4Z0HO 1ZM7A 3BE8A 3P2MA 4E5YA 3VO8A 3WGNA 2WIBA 3MS4A 4R2IA 3HK2A 1HLDA 1EFHA 1PJ2A 5B1EA 3UM9A 2X0RA 5FUBA 2FRVA 5G0WA 3QK7A 3FFWA 4LI0A 2AZMA 1ZAKA 2B1QA 2R8XA 3AVOA 1PP4A 2YV4A 3G8BA 1Q6ZA 5KREA 4B9AA 3KZ1E 1Y9JA 1TQHA 2WNSA 1XNJA 2I22A 2XRYA 3AF5A 5LZ7A 4YUAA 3Q8WA 3BHNA 4V0ME 4TQ9A 1WD7A 3TQCA 3WLSA 1WF3A 1GZ6A 1PK7A 4G67A 4HADA 2AOXA 5AK4A 1DB3A 4ZQFA 1J0XO 2RCYA 4LC9A 3RC2A 3WL4A 3C85A 1U7UA 1WEKA 2XJ4A 4HNQA 4L8VA 1ZD4A 4NLLA 5JZSA 3EDMA 2XDYA 3FFBA 4EKDA 1AB6A 4N4AA 3EC7A 3OTHA 4URVR 2IOYA 1GLGA 1NMQA 4N49A 1YS2X 2AG6A 2VCHA 3GWGA 4RMJA 1U9ZA 2BWJA 2Q9UA 1VB5A 4IJ5A 4YJFA 3TI9A 4Z53A 1G8SA 4C78A 1HPLA 1J70A 1TKBA 3KT8A 1KJNA 4B5KA 2GH1A 4MVJH 2PH7A 3SY8A 1TK2A 4ENRA 2QTNA 1T8RA 5A3QA 3N5CA 3ZVRA 2CF5A 2OZEA 4YRJA 5T7BA 3CA8A 4XM1A 1EUCA 3IAS1 2DWUA 3B6ZA 2E5FA 1X0VA 2QG6A 3D5TA 3SU8A 1N2ZA 1PGQA 2JH8A 4R98A 4ZYUA 2YWDA 1DJOA 2J87A 1NPDA 3GCDA 4EYSA 5LP6A 2WC1A 2O0JA 5EHXA 4QT4A 2HIHA 5BVHA 5FTLA 3SXUA 1DAEA 1B26A 4HNAA 3DVAB 3JV7A 2X41A 3B82A 2AOVA 4H35A 4TVOA 4FGJA 4R68A 5J5VA 4CTNA 1U2DA 5JWRA 2JFUA 2X3UA 3TD9A 3A9WA 2QX4A 3EMKA 1Z4JA 2X86A 4M9CA 3V7FA 1FZTA 1MC4A 3CYFA 5D3MB 2A3RA 3CHYA 4ZKDA 2Z6VA 3PS9A 4Z7OB 4M21A 4INOA 3CX8A 5FBKA 5FLXA 3ILHA 1Z0DA 3GZJA 3RNLA 5GM2A 3H42B 4NAUA 4EG0A 2P9BA 4WH0A 1DSSG 1WKBA 2WMDA 1TK3A 3DNPA 1PTJA 1TZ2A 4CLEA 4RSRA 3AGQA 3R7FA 4JBNA 4F7DA 1F3OA 2BFBA 3O4RA 3HV0A 4Q9HA 5AK5A 4C3ZA 1OLUA 2HEIA 2JGDA 3CLSD 4A10A 1P73A 1LF5A 1YFLA 1VMAA 4NV0A 4Y1RB 1XZIA 5FTMA 3HCEA 3M82A 1TE2A 1XD2B 1BTOA 1Y4UA 2WD7B 2YYSA 1QHGA 2Z9CA 3A2MA 3FFAA 4HZUB 4V02A 4ARVA 4DDKA 4B8YA 5TMEA 4PLHA 5JH7A 1GDHA 4I1SA 3K8ZA 2PR7A 1FDIA 1UOPA 2KJQA 2UYOA 1GZSA 3QLJA 3WK9A 4C4TA 1P19A 2ATCA 3AHCA 1EM6A 2CE7A 3G8YA 1VBKA 3DL4A 4FDLA 1MZPA 1GRQA 4EL5A 5BVGA 2HEGA 1E2UA 4MR9B 3NEJA 4LJ6A 1N57A 3U3MA 2RB5A 3P5BA 5EE0A 1Y9DA 2QR3A 2J3IA 1TFRA 4J0DA 2NUAB 3UOGA 3GAZA 2XNDD 1T24A 1YL7A 1F9EA 3VKVA 4D2IA 1AMOA 1G5QA 3L8ZA 3G0IA 5FEUA 3EEIA 4H0FA 1CJSA 4QQ8A 4LNHA 1J1IA 5D87A 3B7PA 2AKEA 4ODIA 3EZ9A 5IW8A 1SXGA 2H1HA 3LZDA 4BLWA 2DGDA 1YZTA 1MG5A 3CW9A 1PFKA 5J4VA 1Y6RA 5I9SA 4V0SA 1PG2A 3CNNA 3P9PA 4D9NA 3PP8A 3CISA 2VQ3A 1H4TA 1RZRA 1TZKA 2H2FA 4MYSA 1NI4B 4AKSA 3DZCA 4DIUA 2WAYA 3HV2A 3O8OA 2HDHA 4EUSA 4RYLA 4OTZA 4BNUA 5BSUA 2YZ2A 3G49A 2VZ8A 1K6XA 2R25B 3BRWD 5INTA 1W34A 5HF9A 4RSHA 5LQSA 1CRQA 4KE8A 1QU2A 2FR1A 4GBGA 3VYTB 1Q7TA 2FP3A 3AP2A 1O5TA 3S29A 4DBLE 1FFDA 4EHNA 3M4ZA 1HNWB 2GHRA 4MEJA 2RC5A 5FWDA 3VKWA 4PW0A 1Y4SA 1TYAE 4R31A 4YA6A 3KQPA 1IRXA 4PAOA 2JFNA 4FMCB 4JK3A 4W7HA 4WOBA 3RYCB 2DLCX 2J0UB 2PMEA 3VFDA 1QF6A 2VDNB 2FPSA 4WFIA 4MPJA 2FPPB 1EDZA 1YRBA 2CXNA 2ZI5A 2J3MA 4XCXA 2DBVO 4OHOA 1T5DX 1EK6A 2C95A 2UYGA 1YR2A 3PJEA 1Q11A 1UBTS 3UJBA 2P90A 5JZMA 1FQWA 3E7PA 2P67A 1UDRA 1BX1A 3PHLA 1WXXA 2A0KA 2FXIA 4HPWA 3HLKA 5DU2A 2OOSA 1YTLA 1QDEA 1KAEA 1KI1A 2FZ4A 2IXGA 1XKTA 4LDAA 4D3DA 5L4NA 2BC9A 2OHGA 4AJ1A 4AWAA 3PT5A 3GJZA 4QDJA 5CNJA 1C7QA 4DCUA 3K0CC 3GYBA 3NM5A 3WMGA 4BEBA 4WUVA 4L16A 2OORC 4GOMD 1N6RA 3AJDA 2J08A 3QY0A 4RL6A 3L0IB 1G6HA 3FM9A 2LD4A 4RENA 4U2CA 4WCFA 1RQRA 1GR1A 3SLGA 2A9QA 3JTEA 1C8VB 1KEPA 2KS6A 3VR2A 3K0BA 5BR7A 3VPHA 3WBKA 2RKBA 4WESB 3R3WA 4PYMA 1SCKA 2QK4A 4F9FA 1RAFA 2MSLA 4IIDA 3VJRA 3L82B 3P9CA 4Q4AB 4WVLA 2PXCA 4OJNA 3V4FA 4WINA 3WWCA 2GXAA 3VKFA 1SQ6A 4OMDA 1WMSA 3LPNA 1VIAA 1RXWA 3K96A 1IOWA 3L4EA 3SSNA 3OQNA 4AJ9A 2DLDA 3HMQA 4LE1A 4GKKB 3S2SA 2IVZA 4ALIA 3BN3A 1GPH1 3FUVA 4LHEA 5TQJA 4JR1A 3SYTA 3F1KA 1NR5A 1VGQA 4TTQA 4EI7A 4K6HA 4L3WA 2CLOB 2GYYA 2IOFK 3EXG2 4BB0A 5K8IA 3U7GA 2Z1NA 4EW3A 1O9GA 3OMXA 5EHQA 2YJ5A 1RKBA 3R9KA 2HSGA 4EFLA 4K5QA 5AHXA 2EERA 2WT4A 3VH2A 5CDGA 4MV0A 1PSDA 2AJCA 2DFTA 1I9CA 1BS2A 3R41A 5A71A 1O7JA 4KV7A 4CI9A 7ABPA 5JYDA 2R6CA 4C4ZA 4DR5B 2HYIC 3HHPA 3IAM6 4K9SA 4M6WA 1RKQA 2VNKA 4NU8X 3O31A 3B36A 1RXVA 3S2EA 3T1QA 5LJIA 2IH4A 4MA0A 4JNCA 4EMBA 3W8FA 3F8SA 3UTDA 3VPBA 2DT8A 1BHSA 3GNLA 1SH7A 1SKYE 3MQFA 4PAWA 3WO0A 4A91A 4E07A 3K4PA 4FNOA 4FUQA 2ONJA 3VBEA 3TUZC 4X7PA 2CNOA 4MCAA 1ZGHA 3D1VA 1A96A 3WHKA 1JJVA 3R6LA 1WXGA 1X8KA 1IXRC 4KQ1A 2Y0BA 4M1KA 4MV1A 3HADA 1ABBA 2QD4A 4C6RA 1CUFA 1CEQA 1RSZA 2H07A 4LJLA 2B94A 2G9NA 1R4AA 3JAWB 4E5SA 3SR3A 2IHVA 1Y8CA 4RA6B 1NP7A 3GRZA 5HOEA 2JAQA 4UTRA 3HL0A 4M89A 5THXA 3ULKA 4B43A 2VCEA 5DH9A 5TQVA 4IO0A 3ADCA 1OFVA 4N3NA 4B45A 1ZLXA 1VPWA 3AKYA 2V7XA 3OC0A 1ISRA 3FR8A 4HQ6A 1THMA 4PNHA 4QG7A 3WBJA 3HO6A 3I1IA 1N5KA 1PFUA 2FE4A 4HMQA 3BXEA 5C0OE 4EFMA 2W6ZA 2CZCA 3RE1A 1GPAA 4D8UA 4F2DA 2WY2D 1E6EA 1E9AA 1Y37A 4OXYA 1W8IA 4XFJA 4BP1A 2PBLA 5FOVA 3HR7A 1ADYA 3NEYA 1GDTA 3IVGA 4S35A 1V71A 1Z88A 3FUWA 1O87A 4MHOA 2HBYA 4PC1A 2GAOA 2I6TA 1XNHA 2YWBA 4MI6A 3RGGA 3THWA 3GFGA 4H1WA 1LEHA 2YDYA 4DJJA 1WY7A 3IR7A 1V8ZA 1X3SA 4BCCA 3QBJA 1KFJB 1PFYA 2IYUA 5G1OA 3A1CA 2P2DA 5AUQA 1NPYA 1SMKA 1U3CA 3TIIA 3RSZA 1MJNA 2ZT6A 3R7DA 4CIVA 1HYEA 1U28C 5EE3A 1XZLA 1YBFA 1JGTA 1UKYA 2AI1A 1VYVA 2FXVA 5DMHA 4CLHA 3MJEA 4E3WA 3AYZB 4GXNA 1YKGA 4DHWA 2PUDA 3EQ9A 3WP1B 1SQGA 4PIPA 3BWCA 5AVOA 1I7DA 4JP3A 5BMOA 1N8TA 4D92A 1U4OA 2AQHA 3LLMA 4DR6B 1WOMA 1FYWA 1Z2DA 2WF7A 5KC9A 2UV8A 4ABTA 1K9SA 1JWAB 1LNZA 3H2ZA 2E82A 2XTAA 3Q8LA 1OFHA 2G80A 2IP2A 4Q1AA 3U62A 3DV0B 1JQ5A 1VLVA 3LIIA 3KFXA 5DYYA 1KZ6A 2VP9A 3L49A 4MKFA 4QYTA 4YXWA 4LRXA 4M0CA 4J7XA 3ER8A 2Q8PA 3W9UA 3T8YA 1T1JA 1I3CA 1PL7A 5ES4B 5I9LA 1Z4QA 1C3OB 1BEZA 2WTXA 1L5GB 1KK3A 3TLZA 4B6JA 8OHMA 3M3PA 4HD8A 2MDTA 4QM7A 3FPBA 3KB8A 4N7JA 3UG7A 2FY8A 2C2ZA 1XYVA 2IZ7A 3KHTA 5D5QA 5JZVA 2YJNA 2H06A 3Q10A 1Y3FE 2FGKA 2KSQA 2ZYWX 3GI1A 1ZOSA 4A6EA 3ILSA 1NASA 2FKNA 3DVQX 4LC1A 1FSPA 4NOJA 3GVHA 4IUCS 2G0AA 1E62A 3TCKA 4F46A 1OBOA 3JX9A 4DQDA 2CMGA 3MOSA 4WZBE 3DQZA 2NGRA 4F3RA 3AUAA 4DLAA 1YONA 3SIXA 5EJ9A 2QT0A 1Z0UA 2GF2A 4GM0A 2AEFA 5FOWA 1J5EB 5BOSB 1MAHA 2R6GA 3UT0A 4OMUA 1QC5B 5DM1A 1GTL1 2CCJA 5JCJA 3HO8A 2NXCA 4B6EA 2R1VA 1CETA 1W36C 3JWHA 5TT0A 3RRFA 3UNXA 3BUSA 3L79A 3LWBA 4FCTA 3MLEA 1G8KA 2IPAB 3S2ZA 3MYYA 1I7QB 1L0BA 3BT7A 5FDFA 3M4NA 3BL5A 3DBVO 2HHHB 2VDVE 1JPNA 3BTSA 5IJAA 1QCYA 5D5PA 4ZU1X 3X2EA 1QHXA 4ZOLA 3RJMA 9LDBA 3ASZA 2M6RA 3C3YA 5EJ8A 1SFRA 2UU9B 4PZ0A 4P7KA 1KQGA 3WYCA 1MX5A 3WRYC 1JH9A 1FFGA 1HE5A 1H2RS 1ZVMA 4MO2A 1KMQA 4ZU3A 3UT5A 3RU2A 4BBAA 4BYGA 1U9IC 4AWBA 4PGFA 4YAKA 4B4VA 1N36B 2PMWB 3UJ3X 5J2TF 4ZIRB 2AB0A 2CZQA 1ZGAA 1TJNA 2EJVA 3B3AA 1EFVA 1UIRA 3QUTA 4G8CA 4N0QA 1JEQA 2XVAA 3ESYA 2R1TA 1L4EA 1N9GA 1YK1A 3IHWA 3NWBA 4N3GA 1Y9EA 4BVEA 1IBKB 4PG7A 1G3UA 1QH1B 4IRUB 3TW0A 2JIQA 1LX6A 4P92A 3QU5A 3HFRA 5AM3A 3BH7A 2GF9A 4G5YA 3NYRA 3RVPA 2FG5A 2EP8A 1E2QA 2BFFA 1XAJA 2FPIA 3HDYA 5CNKA 4CFYA 3C4JA 4HAUA 4ILKA 3HCWA 1TA0A 1TX4B 2Q6LA 1ZUWA 1OLSA 3B3GA 3HGMA 4WKGA 3G5LA 2ERYA 4QYSA 3T0FA 2MMGA 2WZBA 5DIFA 3VR6D 4DABA 6ABPA 4N0MA 2VF5X 1UJBA 1A9XA 1DL5A 2N46A 3FOBA 3FNHA 3JQDA 5K1ZA 3RLFA 1WSAA 1V6AA 3H11A 4R2KA 1QOQB 3U44A 3G82C 2YQ5A 2ZB7A 1OI3A 2EWWA 3CUVA 1IZ8A 2HXYA 4YGYA 1X80A 3VHRA 5KMGB 2WKQA 1AO0A 3BDIA 4Y2HA 4ENTA 4Y7DA 4FKMA 3QFTA 4X1IA 4HGQA 4JU8A 3RIYA 2AZDA 2C0PA 4PO9A 4FNGA 3DKKA 5DYWA 4BU0A 1W0JD 2J5KA 1J56A 1MEEA 1Q0ZA 5THQA 4F97A 1SKQA 3EYWA 3GGGA 4ZOEA 4GIBA 2YHUA 5E0OA 4CLRB 4TZ0A 1A77A 5DW0A 3A70A 2VJLA 2O8DB 1P4AA 4LHZA 4QBHA 1A8HA 1Z7EA 1Z5VA 5JDCC 1NHWA 1KOLA 2E18A 4RQAA 3GD5A 1CYDA 2ES4A 3LQFA 3S1AB 3DDZX 3V42A 2BEVA 2ZI4A 4BLTA 1ACMA 3AFHA 3PUVA 1QO7A 3L7BA 4KQ9A 1RWWA 3V2GA 3RM3A 3WGVA 1IIBA 4FGZA 2QYHA 3LM8A 3WC4A 1LK5A 2O1SA 3WQHA 1COZA 2ZJFA 3IAHA 4RA9A 2NZYA 3W4JA 4TMTA 5AXBA 4FQ8A 3RDPA 4EPXA 2IL1A 2QKYA 1RBMA 3AL3A 1XZDA 4MMXB 4NTZA 2W83A 5L3QB 1OWMA 1P75A 2HXSA 2WSBA 3QUAA 1QGUB 3B1WA 3KELA 3U0VA 4BXOA 1JG2A 3EYAA 1PF7E 1I1OA 4PV7A 3V2HA 1WVGA 5IKPA 2AJLI 4EY8A 4JP8A 5EFOA 3N5KA 2I29A 2V7WA 3JAMA 1GGMA 4MVJM 1QIDA 3DLBA 1S2MA 4HXEB 1M6VB 1Q3TA 1W49A 2CCGA 2YN2A 5A06A 3MOIA 3JQFC 3HEAA 4X8OA 1GSIA 4EHKA 2JFXA 1WAMA 2R62A 2VJBA 3AR2A 1JEJA 3G8CA 5B4VA 2O2CA 2PS1A 5EKSA 1TUBB 4BNVA 3IJPA 3NTOA 3EQ6A 1Z22A 4MJLA 2OA0A 5U4XA 1J2UA 1Y7TA 1XK6A 5K05A 3OBIA 1QYCA 1IOLA 3A1WA 4W5JA 4DSZA 2P5SA 2O57A 4R84A 4RPCA 5AUOB 4TT3A 1HV8A 2HJSA 3I0NA 3OA0A 4X61A 3TL6A 4GR9A 1CZKA 5LMZA 1YACA 3A3OA 3OH8A 5GMOA 2REQB 3JYOA 3WXMA 3H1BA 3GBVA 2DWQA 4PF1A 5IC4A 1KIMA 1VKHA 4AF8A 4LAFA 5D86A 5AXAA 1MB9A 5IXSA 2WWVD 4EB6A 4ASUD 2FYTA 1PCXA 1YB5A 2HSEA 4QGHA 5FNVF 5T8KA 1DQRA 1C9EA 3PL5A 3SIWA 3U4AA 3OOHA 1L5RA 2QYOA 2XTMA 4KQMA 3EFOB 5EY5B 2FWAA 4WJZA 5FL7A 1JVSA 1X1EA 3ESZA 4K6FA 1VGRA 4P4UA 4PQEA 1K6MA 4BWGA 5LNK6 3JQ7B 4K1XA 4OOEA 2K5UA 3ZGXA 4DMLA 5I4BA 2G9RA 4Q7MB 3UFXA 5I3ZA 2ZRNA 4M1YA 1KZHA 2NZXA 1MABB 2XD4A 4MP8A 1U7ZA 3BWVA 3QOXA 1LLUA 2A59A 3H6HA 4GPD1 1AH2A 1EBUA 1RM5A 1Y3AA 4ZTZB 4F04A 5HGJA 1KIFA 4M1EA 1G4UR 2H17A 1SBHA 1OFUX 5C2JB 1DELA 4TXNA 3OKAA 4Z7QB 5JYCA 3W1EA 4ZTUB 2Q7DA 5FLYA 3R3ZA 1BJKA 1G0NA 3QUSA 3ZE8A 4BO7A 5CYFA 4DLYA 4UNQA 5JS8A 2IYQA 4XQEA 1QE0A 3MGAA 5CAEA 1JG6A 3NDIA 2J4FA 3L8YA 3VDRA 4NK4A 4S1OA 4ZI7A 1YHYA 1AQNA 5ILOA 2WNHA 1S2NA 4EPYA 2DHRA 5AM4A 1JNXX 1SCAA 4OP1A 5LA6F 1ONPA 1EWKA 4JA2A 4XSGA 4AW9A 1H6CA 4DJ5X 5B3LA 2WUDA 2HL6A 3DE1X 3NOXA 1HE3A 4RX1A 3U4QB 4LC0A 3DL0A 4OLHA 1Y4AE 2EJTA 2DHCA 3I3OA 1I3LA 1UAYA 1XEWY 5EE1A 4Y6LA 4U6QA 1DADA 4QYMA 1ZIOA 2HZBA 5B2ZA 3TB6A 3ZS9A 3JYLA 2DQYA 1UDCA 2FWPA 2ZIWB 5JMTA 4WNAB 3R20A 4W99A 2DM6A 2PM8A 4HDAA 1M2HA 2JBAA 1KXZA 2B30A 4XYLA 4MTLA 1FIUA 3HU2A 3OLWA 5M34A 5AQEA 2W2KB 1ZEMA 3ENWA 3I6MA 5B55A 3MRTA 4HGRA 3G9UA 1Q0RA 4FKZA 2ZRAA 3H83A 3C6YA 1WDKA 3OEEA 2AA3A 1F60A 1M1YA 1OTXA 1BE1A 1NX6A 2ZRPA 4MUXA 4HCJA 5C8YA 2PAFA 2ZT5A 4U5QA 4WZ6A 3GLFA 2JIMA 1OQAA 2ZJYA 3D3WB 4FOSA 3IXQA 1BDHA 3HCNA 1ZHFA 3L92A 4BFCA 3JATB 1U8XX 3K0FA 3ZLBA 2AC7A 2A0UA 3HYTA 1AKRA 4QPJC 4CR6A 5C35A 1BS1A 3JZAA 2DETA 5E4TA 3E81A 3WLLA 1SBCA 5BV2P 3LCVB 1ZK3A 2X6TA 3LL4A 4Q47A 4GXRA 4CPDA 4F84A 4FILA 4PLCA 3QKWA 1P4HA 2R8ZA 4L6IA 4KL8S 1FBTA 3ZVNA 3ZDYB 2A0WA 3QJ5A 1FUEA 5GIOE 3IUYA 4RV5A 3ADOA 3ONVA 4TUYA 1RRFA 3AF4A 1HMYA 1KHHA 4N9WA 1TQDA 4L02A 1FVOA 1JJ7A 4O4LB 2W6CX 2FPWA 2I2AA 4PR0A 1Y5RA 4D0NA 1A5BB 4LVOA 3TPCA 1Q84A 4DRXA 4IGKA 1R10A 4I99A 2YTZA 4TROA 4BJ1A 4O0LA 5DX1A 4CM6A 1P5FA 4L27A 1X7ZA 4J1NA 1ZUNA 1RYZA 4C30A 4DMKA 5BW8A 3SVTA 2ODAA 2IDZA 5G40A 3PX7A 1T34A 2AT1A 3COYA 4PHHA 3L8CA 1DIGA 3C2QA 1T15A 3ZE9A 3FBGA 1FDWA 1FQKA 2JVKA 5K3FA 3SOZA 4A9AA 1VKJA 4S3MA 4YMVA 1X7GA 3QLEA 3KDSE 1CUHA 1E89A 3TQQA 3BHJA 2WSSD 5NLLA 4GI3A 4AN4A 2P41A 4HI0E 2F55A 4R1LA 1NNSA 4CQMD 1V35A 3HJAA 4FZVA 1Y3CE 1MJ5A 4LFCB 1CUSA 1Z0IA 4ATNA 5EIWA 4FM9A 5AK6A 4AJOA 3HGTA 4BMSA 1MAAA 3F5DA 2Q4TA 1QVWA 4YJFB 5AOAA 2G88A 1IG3A 4Q1EA 5DIZA 4Y2JA 4NX2A 4LHWA 1WZIA 2HHJA 3ZHZA 5EE9A 5L9AA 2CDNA 1A98A 2J0SA 3F6CA 3FYUA 4G4JA 5MGNA 2QWXA 3HVHA 3M7IA 3SLRA 1RU3A 4XLTA 4RM2A 1EUCB 1KI4A 2YJ6A 3PNPA 4RZ2A 2ZRMA 2NN3C 4RZHA 1NE7A 2NWQA 4J0HA 2EKPA 4MV4A 1EB8A 4PFJA 3SS8A 1HMPA 1CDEA 1H05A 1Y9ZA 4NFHA 3U3OA 2AW3A 3O75A 5F21A 1GUDA 1FJHA 3MT0A 3VR5H 3ZQJA 5A4FS 3SVZA 4BP8A 3NDBB 2BBSA 2YUTA 3IOMA 4PAGA 5LP6B 4H0CA 3ED1A 1T4BA 3SX4A 1O2DA 5KJFA 5BVHB 1QV7A 4ZT7A 1F20A 3SXUB 3U5ZB 4DB2A 3CZMA 4HNAB 5I9IA 2BDUA 2OAEA 2XOEA 1RPNA 2IYZA 4GZLA 4G9GA 4ZVPA 5LOVA 2Y0DA 3OIGA 5BR8B 1Z12A 1DDGA 1EXMA 2V98A 3MM4A 4DCTA 4YAUA 3HWSA 1Y1RA 2OK8A 3TR5A 2FUNB 2R6DA 2X2PA 4LTDA 4XKJA 1GLVA 1Y6ZA 3Q2OA 5HFJA 4HWRA 2IWHA 1II8A 3MJDA 3U48A 4LRYA 2C5BA 3WWZA 4KO3S 3KALA 3KC2A 5CLIA 4EA7A 1Y7HA 3IUQA 2JJ8A 1YQQA 1S8FA 1XTIA 2Q3BA 2VZ0A 2NTEA 3DD1A 3KE8A 4L57A 4TN5A 1CRPA 4RSMA 4RY2A 1K1EA 5A5DA 2JW5A 1XRQA 5T4EA 2G1AA 3N2KA 4M9ZA 3UC9A 3QI7A 5F98A 1P5ZB 3T7RA 2NOAA 3V00A 1N2CB 5TMDA 3T3NA 4EAQA 1OGIA 4FGKA 1T9CA 2BFBB 4K86A 2ZULA 3ZXYA 4D79A 4AP6A 1OLUB 2BAGA 1KFEB 2ASEA 1K9VF 2JGDB 1GDDA 2XNDA 3GA0A 4GKBA 4OG2A 3T54A 3A6PC 2P68A 3KJGA 4R6WA 2KB0A 1XR3A 2WSYB 2VDPB 5CDSA 3B51X 4AMZA 2XV1A 2B1RA 2CBZA 1R9MA 2P4EA 3G0BA 3ICWA 3OCVA 1G5TA 3JQAA 3ZWWA 1AV7A 2NX2A 3PUXA 5JH7B 2V0NA 5AIAA 4ZXPA 1E1YA 2ACVA 4QQRA 1OC4A 4OBWA 4H18A 4HMPA 4UHJA 5BVGB 1M1ZA 1FMJA 1DRWA 2D0OB 2ZWPA 5DLQC 5AM0A 3U7HB 2CSXA 4UMFA 1XLTA 2XCUA 2HJ9A 2YYYA 5T4FA 2GCNA 2YMLA 5DYGA 1P72A 1ZMBA 1NIJA 2EV9A 3QMMA 1W93A 3PGA1 3FTCA 3QE0A 2WQ6A 4WNCA 1KYWA 5BSWA 3ASYA 1UZUA 2XSZD 4QOJA 2IDMA 4LGVA 4Q9JA 3D7KA 4GR4A 4JWKA 3ROMA 4Q1DA 3ZDXB 4A5SA 1HKUA 2ABWA 3RVLA 1H5QA 4A8JC 3EUAA 1L4GA 2R751 1SBTA 1YZ3A 1XZHA 3GNTA 3MWFA 4CIXA 3X1YA 1PLJA 4ZOBA 3HFSA 3T9DA 3HCFA 3FVWA 1IPFA 1ZW6A 3HI6A 3AEQA 4DA6A 2P4QA 3S6JA 3LBFA 3OX2A 2JCXA 3DZ8A 3E9YA 1W4LA 3EXG1 1QYVA 3OE7D 4YT5A 4CHTA 4L0DA 3SGLA 3BSWA 3CURA 2FN3A 3C48A 3H4IA 2Z95A 3O8OB 1MP0A 4A0FA 1VSVA 5B7PA 1ULHA 5ARCA 2GBIA 4IOKA 5A6VA 1N5JA 3U7RA 5J2UA 3E70C 4LYGA 1T9GR 1SHLA 2GR9A 1F5SA 2ZIZA 1ULAA 4ZT2A 5ES3A 1U8UA 2EWMA 1HRDA 2ZTUA 3KEOA 5J1SB 1MOSA 2B35A 3KPWA 4RDIA 2GYUA 3CV3A 4CMIA 4OXKA 2ZYUX 1VE6A 3RRMA 3ECCA 2ONCA 5DM2A 1YS4A 4OH7A 1KSJA 4K9RA 1Y4DE 2WEKA 4H15A 2LCIA 4NPCA 4PQYA 1K4KA 1Q1AA 3DPIA 5JO0A 4LOJA 1TMKA 2PLNA 3LOPA 4UW9A 3LE8A 5BSRA 4B3GA 1NRIA 4YJDA 5IT9A 2A86A 3KJZA 3B5IA 4MWZA 3BFKA 1JAIA 3ACBA 4K87A 2REBA 3CXRA 5H1YA 1JTFA 3TZBA 2QN6A 4HYEA 1FS6A 1G18A 4QNRA 2RAPA 4KDCA 3PTLA 4EHHA 4A0SA 1N2XA 1BRTA 4AG5A 4E94A 3I32A 4NE9A 4F6RA 1DUSA 1UEXC 1E2PA 1ILWA 3NHLA 1C50A 2HPZA 2B82A 4NZYA 1GZUA 4H77A 3K9FC 3PR2B 4OHFA 4Z6KA 4PX2A 4NY1A 1WUYA 1EWVA 5B4UA 4JKYA 4WCFB 4BMXA 4AO8A 5GIPE 3ED5A 3MERA 4PTYA 5DHFA 4OUKX 3G2MA 2VYND 1T6BY 3MAAC 2GLUA 3NP9A 3TMAA 1YJXA 1YFJA 2ECOA 1CR0A 2ZK7A 2Q5EA 3GAAA 4IIGA 4TVKA 3ZU2A 4PGAA 1NVUQ 4II7A 4UFNA 2X0NA 2XUAA 4G0OA 4II3A 1I6KA 1HLPA 2Y27A 1Z82A 1KDOA 2H1LA 4CIWA 1S89A 4E4YA 4UREA 5PNTA 3CUSA 2ZSBA 5HIJA 2JLYA 4MSUA 2NQ2C 1NG9A 4ZCSA 2O23A 1M33A 1XN4A 4CTMA 5TIIA 4ZO4A 1S9HA 2WLTA 4NENA 3SDBA 3GVXA 4RK0A 4GOOD 5BN3B 2JA2A 3WOVA 3ACDA 1UQTA 3H75A 2VHTA 1DV2A 1ZONA 3B53X 4AWXA 3QTTA 3OZGA 5DJ5A 3D2LA 4JGGA 5G1NA 2JLUA 1DUIA 2IEIA 3G9XA 3Q9NA 4Y1EA 1EYZA 4GOLD 2D2IA 4BX9A 5A4AA 1FVHA 2H08A 1LI4A 2PJZA 2WHYA 3WGLA 1IC6A 8MHTA 4Y8VA 3N2ZB 3QUBA 2ODPA 3JQGA 4HFRA 2IS6A 1MB0A 3K0EA 2QXTA 4BGIA 1SURA 3IXLA 4J94A 5GQSA 5KKAA 2ZJ8A 4XWYA 2J3QA 1RAGA 2QAGA 4R8RA 5BW4A 3MQ4A 5AKJA 1H0HA 3SZLA 5BWLA 4G0WA 4MJ7A 3WNQA 2COKA 4TWIA 2GERA 1VJDA 3FOCA 2Y4OA 4UFOA 3G2LA 2YOHA 5CVCA 3OJFA 3M81A 4TSKA 2IGBA 1OZ0A 4FSHA 3LWNA 2B4AA 4N9QA 1H85A 1GCOA 3SZOA 3ZZ1A 1G9TA 3D6AA 4KXMA 3QNWA 3P52A 1PL8A 4CW7A 4ZYVA 1DO2A 2PWBA 4UAJA 2GJ9A 1WXQA 2WB4A 4G8BA 521PA 2Z4TA 3RIHA 3D7LA 5T4HA 4F9GA 5CDFE 3M6XA 4EHJA 1KAOA 1RABA 3B7GA 4L74A 3FTEA 3ZU4A 3BG5A 3ODGA 3OIFA 3IOEA 4KXYA 1TKCA 5GJCA 4E14A 4BJ6A 1WZNA 2QW8A 1KHTA 2HMYB 4U0KA 5JT1A 3E1KA 2VP6A 1Y8AA 1UBLS 2MYPA 4FMCF 2POCA 3JQCA 1QDLB 1A04A 4CQNA 4TWAA 3H0EA 4DPMA 4RQUA 3PUZA 4XYGA 3OTWA 4F60A 3RSGA 5DNAA 2C2XA 1KOGA 2V4MA 3HSKA 1K8XB 3FI9A 3THWB 2OAP1 3I45A 2OAQ1 4JKOA 2AMVA 4AJJA 2P6OA 4PO3X 1Z4KA 3ROKA 3UK0A 1D1QA 1SVMA 1NBMD 3NQ41 1TFUA 1RBZA 2VJQA 2JFVA 5KSZA 2B2NA 3MGBA 2H2GA 3NHZA 4QX6A 2JJQA 4BWVA 1VHLA 4KJXA 4URFA 1DX6A 5FTNA 2OWDA 2W6MA 4LBVA 5EQFA 3VKHA 4ADSG 3EXAA 1SVKA 1XF1A 2XR1A 4N18A 2FUKA 4N1AA 3OLYA 3EISA 3MINA 2NG1A 4QGSA 3WR5A 4ISCA 4MQFA 1MTOA 4B31A 1TZMA 4RHFA 4K0RA 3E4CA 5JXJA 1G7CA 1XCJA 1P9OA 2X4GA 1WHSA 3NVDA 4CLDA 2CV1A 1I80A 1J2JA 1UMBA 3GUVA 1GTRA 1QHHA 1K5GA 5DRYA 2P91A 1WCV1 2O0KA 2H4YA 1P0QA 3E15A 4QYXA 3UHOA 2YOFA 1SC9A 3S8EA 3GP5A 2YJTD 3L18A 2CLCX 2PD4A 3QMWA 1E5XA 1JHQA 3OWXA 1GEEA 4B7ZA 2JIPA 3PNOA 4F2PA 2AKYA 3V3TA 2FJPA 3VSDA 4RSGA 2NV6A 5IBRA 3H5RA 4DTCA 2Q21A 1CEEA 2MR5A 3CCFA 2OXRA 1KK0A 1JFFA 5HQTA 3NTQA 1FNSA 1KOJA 1UOOA 2G9UA 1V1RA 1XUOA 3C70A 1HSOA 1YE5A 5HM6A 3Q7RA 1KZ9A 1UP7A 1M7GA 2VYQA 2IPOA 1E61A 1XVAA 1SHKA 1RQNA 1PV4A 5AVKA 4D44A 3VAYA 1HE2A 1WABA 4L51A 4U8HA 3TXYA 2DWPA 4EEXA 1ZH4A 2ZTSA 4QAJA 4Z9YA 4AF7A 4DIOA 4HEA1 4MVJF 2Z6AA 1P77A 4OHRA 1XPJA 4HDNA 3KWFA 4UUMA 1ARZA 1EVQA 2R1VB 1PWEA 4JVNA 4RWZA 4JI1B 4EUNA 4D41A 4H7JA 3FSRA 2WD8A 3H1FA 1DE0A 1BRMA 1I3NA 1LPOA 5FPYA 4LDQA 1WCXA 3KKLA 3NHSA 4KGDA 1XZPA 4MW6A 1XTRA 1RWKA 4EMTA 3RTDA 1CR1A 4EKGA 3GIDA 4BUJA 1E77A 3LD9A 4ZOLB 4IWNA 3I9KA 1N2OA 1NG1A 4QDUA 1WD5A 2XYPA 3MD0A 4K6CA 5FOXA 3O47A 5LYJA 1KXJA 2AWOA 4GYKA 3UT5B 1CSEE 1O5OA 3EMVA 3GGSA 3GJ3A 4IJ6A 2ZSIA 1WZUA 4GQBA 3LRXA 3LTNC 1HFWA 3DAYA 1M2NA 3KXKA 4JBYA 2OCYC 1FMFA 1FVFA 4B34A 4YV2A 3UMRA 1EFVB 1S3GA 2RDMA 1LDMA 1JEQB 3PC6A 3QOYA 2R1TB 2F8TA 1N9GB 4JL8A 2Y76A 5MFZA 1V2HE 5F3DA 1NJ2A 4UHHA 2IYVA 3ZWXA 3UPDA 2CKDA 2I4OA 2UZ3A 1P1JA 3NUQA 4DYHA 4L0QA 5KNCD 4HS9A 2E4VA 3LDFA 3UEOA 4LRWA 4YRGA 2W90A 2FPIB 2EFEB 5AJWA 4Q3DA 4IH9A 4M83A 4KR0A 3HFGA 1B41A 3J7TA 4ECAA 4LBWA 3GZNA 1OLSB 3BKXA 1FYDA 4WGGA 3ZZNA 4F4UA 5JMWA 1SHTX 4UD6A 1A9SA 1A2BA 2HUNA 3T12A 3HYCA 1A9XB 1G38A 1TO1E 1OXUA 2V0CA 5FBZA 1Q16A 1G2OA 2P6UA 1YDFA 2VPPA 3AW8A 3EXHA 3KLPX 3SF8A 3CM0A 3WDLA 5ALYA 3N2IA 2DTXA 1MORA 5AK0A 4ZCIA 5KOIA 3H11B 4AP9A 1TYEB 3U44B 4PVDA 3R6TA 2IEBA 1CP3A 3CZ9A 3P2JA 5CVUA 3TM4A 1SC6A 4QVGA 5HK8A 4RELA 1ZSNA 2JEYA 3LY9A 4X1IB 3LRPA 4CQJA 3IUJA 2Q3LA 3DDNA 4GBMA 5CX1A 2R1ZA 2VHYA 3WL6A 3RU9A 1KVTA 3LS2A 4LZWA 2YHAA 2ZPTX 2D5IA 4G1CA 5D3QA 5CFRA 3LI2A 3LLSA 1Z13A 4XZ3A 3DEHA 4JCCA 3RVNA 5IVKA 3LW7A 4TMVA 2V7UA 2NYUA 5ED4A 3L6BA 3SBOA 4D3ZA 3VAAA 2IPXA 2ID8A 2QTAA 2BEVB 1UM8A 2CDRA 3PQCA 1KETA 1M72A 1E4YA 3O26A 1N2CE 1U1CA 3FHCB 4EAAA 2VS1A 1GQSA 4DDVA 4X3CA 1YNSA 4C2AA 4RA9B 1R50A 1IEVA 4WL0A 4HAOA 4TKLA 4L50A 3X44A 2WQ7A 3FTFA 1KC3A 2ZIXA 1G20A 2HPHA 2HF7A 3IP1A 5KNLA 4BXOB 4MITA 2GEBA 3NVMB 5DX0A 3TDMA 4BLOA 2PFKA 4RK6A 3B78A 3NHYA 4B2LA 3HCDA 3RQSA 3HSYA 1KJ9A 2GM9A 4HGZA 5LL6P 1YO6A 3PEYA 3IV7A 1W2GA 2IYOA 1GGFA 1ZJJA 3D3NA 3EPJA 1E32A 1OH8A 1WVIA 4UTVA 1BMDA 5JWOA 2AJTA 2ZYIA 3GJ5A 3WLOA 4MIKA 3UMGA 5L45A 1IMJA 2EJUA 4ASUA 3SKYA 3L0DA 5EJMA 1WRBA 5TX7A 3FN4A 4FDUA 4WQMA 1KEEA 2QP9X 5BYJA 1L6IA 4XIIA 1H0KA 4Z54A 1ESDA 2FN4A 1NVBA 3EXEA 4PG8A 1ZRNA 2TYSB 4B3XA 3W2IA 4MVXA 1W5FA 4FYIA 4HQOA 4PHCA 2WKPA 3A3KA 1EG2A 5HIMA 1X42A 5F7OA 1UM9A 2YXEA 3ZHRA 2Y68A 3BYZA 4DR4B 1JKIA 1C1YA 2QN8A 4I9FA 3KVYA 4DCNA 2PDAA 3ZGOA 3SE0A 1J7JA 1F14A 1VYHA 2JLRA 2OXFA 5BQ3A 3BIFA 1Z4MA 5I01A 3LCJA 2H1WA 1P0FA 3DXZA 2Y2UA 3WRXA 5BXQC 2L18A 2D7DA 1P2VA 2VHUA 3DTNA 4OGLA 4EB6B 4M0KA 2X4DA 1H93A 3DEKA 1P3JA 4GRDA 5HZGA 1NVWQ 5WRFA 3TINA 4Z2AA 5J5CA 3CR8A 4QXMA 4XJTA 3WQQA 3A3YA 1FUIA 4CM4A 1W94A 2H7CA 3WTCA 1KYZA 1BXGA 1E9SA 2BFOA 1KVUA 2G8LA 3Q5EA 3DSRA 3UFXB 2IT1A 2PE5A 5BUZA 3JYQA 2CDCA 4HR7A 2CNKA 3GAFA 3KVOA 3NTUA 3STWA 1CVIA 3LPAA 5JJBA 1BA2A 1LK0A 3PJGA 3MWLA 2IS4A 4MV9A 1YA8A 3KLMX 4RPJA 1DU4A 5D8DA 4EL0A 5K01A 4ZDJA 4KKXB 1TT7A 3PFWO 4BO3A 1KY4A 5KYVA 3VOTA 1LBHA 1ODJA 5L7WA 4X65B 1EH5A 3ZGVA 4PHFA 1QANA 1RYHA 5H9WA 2QRLA 4UBKA 3QKSA 1CZNA 4WIAA 5KAMA 1DC8A 3T9EA 3JVDA 3USZA 3AZQA 3WA6A 4JBLA 3MT9A 3GH3A 4HAIA 4TTVA 2HLHA 5CAEB 3C6MA 4O0MA 2DZDA 3PHBE 1XQWA 2OPBA 2QORA 4U7JA 4ZI7B 2F4VB 2VP4A 3GZ4A 3S1LA 2RGWA 2IPLA 2K87A 4G09A 2OHOA 1TF7A 4QTZA 3TOVA 3GARA 4M9UA 4UHCA 1FYXA 4K26A 2EG5A 4GC9A 5K0TA 2X9QA 2YFKA 5G1PA 2EZ4A 3SSOA 3VX4A 1UK9A 5LQNA 2C96A 5EHNA 3M6MD 1GSAA 3OFND 2KBFA 2HK6A 1LJUA 3THRA 2FOXA 2HC9A 1EDBA 1F0PA 3ETDA 3L9WA 3O8NA 3PQ4A 3EPHA 1K5HA 4BNTA 2IE8A 4NOLA 4BFZA 4RORA 1L1QA 1KZ1A 4TS1A 1I2CA 1P6QA 2IP1A 2JBAB 3FCXA 1RBQA 1ZD9A 2AG0A 5BRJA 2F90A 3TZCA 5I7FA 2ZE5A 3RR2A 3F8TA 4WGFA 2AJDA 4FC6A 3EEFA 2VUUA 5BSGA 1CIPA 3WLTA 1H9AA 3CGGA 3PJRA 1M1YB 2GLXA 2KQUA 2X9NA 4B4WA 4ER3A 5AESA 5C8YB 3EDQA 3ZGZA 1PVOA 4BRUA 3GLFB 5E6UA 1Y8QA 4UMEA 1P60A 4G4SP 3KYJB 1B8PA 1T2AA 2P9ZA 3N76A 4I5DA 4KMSA 4XIYA 1VPVA 4L8GA 3K0FB 1KE2A 3UUGA 3MWEA 3IUPA 5B53A 4DJEC 5JXHA 3A6LA 4W8OA 2X8BA 1GKIA 1US8A 3KAKA 2BMJA 3EH2A 4B1FA 2JGIA 3VNUA 4ZHQA 3KB2A 3HDHA 3KL4A 3KSUA 4Q4JA 4DIEA 2ZAMA 4PLTA 3M4XA 3RC9A 1RWXA 5FF9A 4TUYB 1T5LA 4EHLA 1BHO1 1QB8A 4EQZA 2UUAB 1IOZA 3UV6A 1AZTA 4FGUA 3DCJA 2WV9A 1P0MA 4RHYA 4FEGA 2EU8A 2C1ZA 3OEWA 5AJVB 1JXOA 3EPLA 4JBWA 5IARA 4FX2A 4HZIA 3CCCA 3QLUA 1LQTA 3RTGA 3DEFA 4DRXB 3LVBA 4EBBA 4DM3A 2RJ3A 1JW9B 3KQWA 2BPOA 3KR2A 3PFHA 3TVYA 4J4HA 2NSDA 1X7ZB 1PR4A 2VC2B 1ZUNB 2PX3A 1J5XA 1SR8A 2ISCA 2WSMA 3IS3A 4G2NA 4ZI5A 4TMWA 3H2BA 2XCTB 1WY5A 3EH1A 2XCIA 1QTIA 2IELA 4MJXA 2CJWA 2GZSA 2JD0A 2P0YA 3RJ5A 1Y33E 4I4NA 4JXJA 4UXHA 4A26A 1C0PA 4RKYA 1B14A 4RGVA 3PEFA 1A5AB 4X64B 2AYYA 3CW8X 1VKRA 4QBKA 4ESVA 2QW0X 2GEJA 5K3FB 4N0DA 3LF1A 5AI5A 5FBRB 2PGOA 3BFVA 1JIVA 1KPHA 3EDRA 1A9YA 1Z6YA 2HU8A 3NWPA 4QASA 4OQMA 2A5DA 4IKPA 4C03A 1K3UB 2OY0A 4U0JA 4BMZA 1H9CA 4QG3A 4URZR 4DNPA 2XBLA 1UC9A 2OC9A 3ZW8A 5J5AA 3C3MA 4CEJB 5EIHA 3C97A 6REQA 1QPGA 1A2OA 1PHRA 1QGDA 1RM3A 3LUCA 3RYTC 2NZJA 3FYUB 4JI4B 1R5NA 3QHQA 3ZDFA 2OAGA 4E12A 1TJ5A 2B7BA 1Z4NA 3B9PA 3BQ9A 4UVEA 3EGIA 5BSTA 5E9WA 2ACEA 5FLEX 4WEOA 3COSA 3EDYA 2QV7A 4LTMA 3FJ1A 1T2UA 1MJFA 5H81A 3V1YA 4XVCA 3FOFC 4W7SA 5LM3A 2CL0X 5TNXA 1XTJA 4TTSA 4BLVA 2OECA 5ESDA 2ZUEA 2NVUA 1COWA 3F2IA 4BFUA 1HZZC 1SXJA 3LT5A 1XEWX 4FSDA 2WE7A 4N6GA 3ZEIA 5JAQA 3DF7A 2Z5VA 1ZZGA 5AVYA 1BJTA 1CY8A 1ZXXA 4L5YA 1Q50A 3PUJA 5E6SA 4MARA 4Y9RA 2Z3VA 2FOLA 4MYCA 5LOVB 2JL1A 4RMGA 1WW2A 4KR9A 2G72A 3DT8A 3MT8A 1EK0A 4NYJR 1EUDA 1VOTA 4I4TA 3UVEA 2C3MA 3G0CA 4RJJA 1KEKA 3ABSB 1HTWA 5IVDA 4LCBA 4E1AA 1RCUA 5F7XA 3UJ8A 2JVJA 1NW3A 1II8B 5COAA 4YJKA 3FMVA 3PHCA 1UF9A 4LXGA 3X1XA 2Q1UA 3HKCA 3MB5A 4RPGA 3D02A 2PRZA 1AXRA 2YFHA 2Z8YM 2TSYB 1LNQA 2A5JA 3PGXA 3UB3A 3UKDA 3N2KB 1V96A 2VJCA 2ZIUB 4CBVA 4MW5A 3M6IA 2KLBA 4TXLA 3QV1A 2DBZA 1JIJA 5A62A 3B1VA 2NO7A 3TJMA 2F1IA 2XSZA 4G3XA 1JFVA 2W2NA 5EP2A 5I9MA 3GUUA 4HNGA 1DT5A 3OD1A 1RZ3A 2HI0A 3GJ8A 5EXXA 4URXR 4XVUA 1EMDA 2QPLA 5DDIP 4MV6A 2HCFA 1GLNA 3L06A 1H1LA 2Q5CA 2Y1WA 3JQAB 4FYYA 3AMVA 3HXKA 3H9EO 3CUYA 4AROA 2C31A 1FEZA 1C1HA 2JBWA 2WD9A 1E2DA 2XGSA 1GU1A 1SVNA 3W3AA 2ORIA 4HBGA 3TEFA 821PA 4O4LF 1PV1A 3HYSA 3ZOKA 3ZUPA 3LXUX 2OV2A 1T0HB 1WHTA 2QQEA 4TLCA 4HX5A 2QZZA 1G41A 4L5IA 4X6LA 2B5WA 1E66A 3A9TA 1X87A 3G59A 3QVJA 1NLUA 2GEKA 3RKRA 1F0NA 4JA0A 3I58A 3O92A 4QIHA 8LDHA 2XUGA 1L5YA 2XHZA 4FVTA 3NRJA 3WOHA 3I9OA 3OSZA 5I3CA 5BMVA 2I7VA 3X43A 5E9JA 1DCFA 2QTVA 4FCCA 5IU6A 4KZKA 4D3SA 5A0VA 1NF2A 2QM7A 4DKJA 4ZOAA 3AEQB 3F46A 2BLNA 5ECYA 5FJIA 1LWOA 2LIVA 1J25A 4HZGA 2EBUA 5DSZA 2XW6A 4RVUA 3K3PA 3PQ8A 3REFA 2C57A 5AT1A 5BRAA 1Y8ZA 4FXOA 3OCZA 1ORVA 4LZOA 4PGGA 1I1HA 1J0BA 1BDJA 1PNOA 3HDQA 5FP0A 5LYYA 4QJ3A 1RS0A 1SUPA 2V45A 5G0SA 5J2UB 4AG6A 4YLGA 2X7JA 5C4MA 3E0XA 1R74A 5LQMA 3LQKA 2V6GA 2FFAA 4GX1A 5A04A 2JI8A 4Y1GA 4CMIB 1BWPA 4RD0A 3R7SA 3HMKA 3WMRA 2WTNA 4R51A 1XTQA 4P7GA 1IJFA 1QIGA 3RNOA 4WW0A 1G3RA 2FPGA 1RCTE 2FN8A 2WPNA 4MPDA 5F9FA 3CTMA 1PZHA 3CS3A 1PFWA 4FYHA 1KFCB 2C7PA 1LLFA 3MBKA 3PDCA 3PXAA 1T0BA 5TEVA 3NIGB 4XIJA 3TI7A 3VR3A 1R6BX 4WXMA 2VYNA 3SJBA 2OV3A 5ALHA 1DCKA 3EE6A 1JTVA 1GADO 2DP4E 2HLNA 2RGXA 3K15A 1JHUA 4JQSA 4Q1FA 4IF6A 3I9V6 2ZB8A 1L4YA 4B33A 4TN1A 5LP6F 2UYHA 4MYRA 2HK9A 1Z38A 3V4SA 3VR0A 1W36D 3BWEA 1VQ1A 5K0LA 2W6JA 3RS3A 1VKZA 3C6XA 2XH8A 3P8ZA 2BDTA 3FDZA 2ARKA 3L7MA 3CX3A 3QSYA 3AK4A 3NCTA 1EGMB 2F3TA 3KDAA 2DXIA 1AG9A 1OPRA 2CHGA 3D4IA 4X1KA 1VYUA 1HE4A 3R5JA 2ZDQA 4RTLA 4IPTA 3IAXA 5ALOA 5BSFA 1DJNA 2PV0A 3S2UA 5KNDA 1PT9A 5JY1A 1WXIA 4M1OA 4YCJA 5KJ1A 1LB1B 3PKIA 3VVBA 3GXOA 3GLUA 4B35A 2D5AA 1X9IA 4NBTA 3EZ6A 2P9CA 4FCVA 1OZGA 4B7XA 1JE0A 1GAQA 3LUJA 3NAQA 4ZO8A 4CF7A 1NPTO 2VK2A 5AW3A 5GAJA 4X54A 3A2NA 5K6AC 4RXTA 1ECBA 2FPLA 4TMXA 1SAYA 3AOEA 3CQ9A 5FTKA 5P8WA 2VH1A 3TJZA 4E5MA 5L40A 1F8XA 3EBOA 1I14A 1KO7A 2HFJA 5TQ0A 1W581 1BU5A 5CFZA 1NV8A 1V9LA 3ZKWA 4IDBA 3ONFA 2IF0A 2FUG1 4QE3A 4W4TA 3GEIA 5I8WA 4OXXA 5ETJA 3HEMA 1RHKA 2PQMA 4FC7A 1IHOA 3WNCA 1KY2A 1Q1BA 4LF6B 5JH7F 2JLZA 4NENB 2CK3D 4JYPA 2JLWA 1XDWA 3SXPA 3A3NA 3IJ5A 1TYCA 5EZ6B 4PZDA 4AJKA 4C1NA 1CCWA 2RHHA 3V4LA 4EHAA 4Z1MD 4Y6RA 3W8NA 1U90A 2ACKA 4RF4A 4XD7D 2XQJA 2ZJ5A 3UWDA 3WAKA 4RH0A 3G0GA 1OAOA 1Z7GA 2OHIA 5EP3A 1ZUHA 1EZ1A 2HLPA 1FTSA 1R0ZA 3GUZA 3P26A 2VSYA 2BGTA 1ZL0A 2GDZA 2IHBA 3GQBA 4H1HA 4OFWA 2O3SA 4WOJA 4M7PA 2WJ4A 3Q0TA 4UHKA 3CF4G 2JHPA 4DBVO 4YPVA 4R71A 2ZKIA 3JQGB 4RIHA 4NAHA 3SCZA 3A6KA 2XUPA 3KZNA 4L08A 1J9GA 1K3TA 1MC5A 2ZAOA 4KYIB 4OJKA 3RVRA 3VO1A 4MPRA 2QAGB 1L8XA 3R77A 3K94A 3H4MA 5KWVA 5F4ZA 3NIBA 2Z08A 1I10A 1X7HA 2PLRA 4NJMA 1GR0A 2HSDA 4IBOA 4JODA 5FBLB 3UAGA 5M2QA 4UU8A 2H9AA 2A9JA 2WG0A 5A7GA 4YUVA 4DWOA 5CFLA 1C3EA 4KDRA 3QNUA 4LHYA 3UUFA 1IXZA 1NN1A 4LMBA 4MB6A 4DUYB 1VHDA 1IG0A 4DMMA 5JMOA 2FHSA 4HUQA 2YIMA 1ZIPA 5CP8A 3SC2A 1M1NA 4GKJB 3VYWA 3GLIA 2EQAA 3EMDA 1RIIA 1NBMA 3FZGA 1NI5A 3H2IA 4Q03A 5C46F 4CDMA 2QMOA 1ZA1A 2ETVA 2R6ZA 1VL5A 1AC5A 2H5LA 1G8FA 1KEZA 2OYRA 4AP5A 5JD3A 5MN4A 4O2BA 4MYHA 1BMTA 1R00A 5CXSA 3RUAA 1XJ5A 3DHYA 2V4ZA 1YB1A 1E60A 4C3OB 3QVGA 4IIJA 4P7BA 3TE6A 2A9FA 1JKFA 1YD7A 2IYRA 3OZXA 4GQIA 4KN8A 2HO5A 1WZCA 5D6NA 3KDPA 4ZEOA 4BJ3A 4ZDKA 3NLLA 2W0MA 2ZATA 1LNSA 4Q4HA 1ZK4A 3ZCSA 3LYUA 2V96A 1CQZA 5LP6C 1VRWA 1JUDA