3LHIA

Crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
231
structure length
231
Chain Sequence
b'MFVWHEYENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRSPIAFFNALSQKDLDWKNVGITLADERIVPTNHADSNTGLVREYLLKNKAAAAVWIPMVEDGKTETELHPDAVVDYALKHYKQPDVLILGMGNDGHTASIFPKAPQFQTAIDGSAGVALVHTTPVTAPHERISMTLDAIAHTGHVFLAIQGEEKKAVFDQAAQGENREYPISLVLNHQGVNCHVFYAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 6-phosphogluconolactonase
publication title Crystal structure of Putative 6-phosphogluconolactonase(YP_207848.1) from Neisseria gonorrhoeae FA 1090 at 1.33 A resolution
rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase
total genus 77
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhiA00
2O0MA 3KV1A 3ENQA 3NWPA 3IXQA 3LHIA 4TM8A 4GMKA 1O8BA 1LK7A 3HN6A 4TM7A 3CH7A 1LKZA 3OC6A 3BXGA 1CD5A 4L51A 3U7JA 1FQOA 4OQPA 1VL1A 1UJ4A 3L7OA 3E15A 2RI1A 1FSFA 3EB9A 3EFBA 5HJ5A 3CSSA 1HOTA 3ICOA 3KWMA 1Y89A 2J0EA 4L5JA 3HHEA 4L4ZA 4NMLA 4L5IA 1UJ5A 3NZEA 2BKVA 1UJ6A 2RI0A 4X84A 1DEAA 3BXHA 4L4YA 1FRZA 2R5FA 3E7FA 4M8LA 1HORA 1FS6A 4R9NA 4OQQA 4L50A 1PBTA 1KS2A 2GNPA 3UW1A 4GO1A 3BXFA 1M0SA 2OKGA 2WU1A 3LWDA 2W48A 4IO1A 1JT9A 3BXEA 4R7TA 1LK5A 1NE7A 2F8MA 2BKXA 3ENVA 1FS5A 1XTZA 3ENWA 3TX2A
chains in the Genus database with same CATH superfamily
4OH7A 1X2BA 4JSTA 5CHEA 3O8QB 3Q2OA 3RC1A 4BNTA 4PFSA 2CLMB 4MARA 2YXPX 1G3IA 1N9GB 3OM8A 4LSGA 4BV2A 1XVUA 3FI0A 3BDAA 1TF2A 2Q99A 2AZXA 1PVDA 3EXHA 3G0DA 4R8RA 4TKUA 3EVAA 1N6OA 4DRZA 2OZKA 5EE3A 5JROA 1LCIA 1NQUA 1RHMA 1T4MA 2JFXA 2RGNA 3KZNA 5CFLA 5IT0A 1WUHS 1YGYA 1V5WA 3RANA 4JJKA 2XXAA 1GG5A 1J0EA 4Q9HA 2GRJA 2HR1A 1NP3A 1BXGA 2OZLB 1PR2A 4A36A 3N7UA 3LUFA 1CUHA 3P45A 1VE7A 2P5SA 3Q15C 4IVQA 3KOOA 3EXIA 3M1AA 2EEZA 2GZDA 4FZRA 1ODIA 1QAMA 3H9GA 4LNHA 1F2VA 3H4MA 3SX2A 2ENWA 3UUFA 4EI7A 3NAGA 5L53A 3JQPA 2VXCA 4E09A 2RGGA 1PR9A 1EQUA 1EM8B 3WGNA 3U3XA 4ASUA 1XRMA 5C5CA 1VJ0A 2ZXFA 3MMZA 4Q6BA 1J8YF 2LV8A 3N70A 4LC1A 1WPQA 3FNFA 2WD9A 3QFSA 2ETXA 2ZE8A 2HBYA 3LPAA 1UINA 3IVCA 3MPUA 2HPZA 4MV0A 4PX3A 4KQJA 2I7DA 4FC7A 2HA0A 3VU8A 3A70A 4PHCA 5FPQA 1L4MA 1TFRA 2ZVQX 3DXFA 5HA5A 3RT7A 1E99A 1KP2A 1GTL1 1H6AA 3VBCA 4KIUA 2GTPA 4XJSA 1O8CA 4E1BA 1GGHA 3FJ1A 1OZFA 3LZ6A 4KO4S 5CXUA 3A4VA 3KB1A 1XZFA 2UZ3A 2IEBA 3H13A 3SHOA 1EFPB 1T8TA 2ZR8A 5HRCA 4LMRA 1XJQA 1YJXA 2AFRA 2B83A 3I39X 5KIAA 4IMRA 4EB6A 1G9TA 1N6KA 4L08A 2QX4A 3PIIA 3QE4A 2VDRB 1GEGA 1G42A 2IX9A 1U8XX 1VG1A 2ZYUX 3AGQA 1FY2A 4JWTA 5DZSA 5BO5A 4CMGA 4DC9A 2CXXA 2P8SA 2JCBA 4J1TC 3I9OA 3UJCA 4J6EA 4M7PA 4OOFA 4R81A 4YP1A 4DRYA 1COZA 4C2BA 1NL3A 2CXUA 1T2NA 3RIEA 2FPXA 3INGA 1Y6QA 4AYTA 4OI0A 3K70C 1SKYE 2YV5A 4FDVA 1FP2A 1QHHB 4KWCA 4RVHA 4UM7A 2PX3A 5D84A 3SFVA 4X6XA 4XGIA 5CR9A 4R71A 1U3GA 2BZSA 1XZ8A 5IVPA 5BYKA 1JAIA 1BJKA 4BJ1A 3DR3A 5DTMA 2ANCA 1SB8A 2IL1A 1UANA 1WUJS 2AT1A 2B1RA 1NW5A 1Y9AA 2RAUA 2V58A 2YWGA 1CNMA 1O94A 1D1PA 3I3SR 4PZ9A 2CNBA 2QYTA 1AU9A 3IBFA 1YB6A 1T9ZA 3UW1A 2WQ7A 1I3MA 2OMKA 3WLAA 3FOZA 2W6JD 4ND6A 1OUMA 1Z4OA 2D5BA 5BNFA 1GZUA 1YHYA 3QKRA 3RTBA 2FFJA 3BH7A 3GEEA 3PFNA 2QM7A 3C5CA 4JLSA 3SLKA 1JR6A 1WQ4A 4LE2A 4RF5A 2DPXA 4TMYA 2DSTA 3D6VA 1WDTA 2H8KA 3NTLA 4G6ZA 4A8JB 5HUHA 1X7YA 3UFXA 4R2HA 4L73A 4GP6A 5CMLA 2BBWA 2G63A 1YAJA 3RYIA 4EYOA 3ZX4A 4NBRA 1IJKA 2NO6A 1RWBA 3GEPA 1C2TA 1S9DA 4B2LA 2R86A 1SCUB 2V4UA 3KT0A 3LOPA 4LSZA 1RM3A 1TLLA 4Y2RA 5DOZA 3O26A 4C05A 6ABPA 1MIHA 1FDSA 1T3ZA 3KZ1E 3TQSA 4DJEC 3QX7A 1J39A 1QPBA 1HEUA 1ZK0A 1NBAA 5MGNA 2I1QA 3AEQA 4IHQA 3I32A 1NUPA 2ZIWB 2WFAA 3UJNA 1WXIA 2DB3A 3MCTA 4WK0B 3TGPA 5F33A 1W7AA 4TM7A 3PPVA 3CH7A 2REOA 2EWWA 5AHRA 4TKVB 4XJTA 3K0CC 3OE4A 1MDBA 2FZLA 4FD2A 3DFIA 4FYWA 2R3SA 2VTDA 3PJDA 3AF3A 4I50F 3AYXB 3K2IA 2NADA 5C1BA 2QBYB 1TRKA 2ZBVA 4YRLA 4E4YA 1Y3HA 5D1HA 4KACA 3HBAA 4QYSA 3SJ7A 4RZHA 4RK5A 4O4HB 1QFYA 5EZYF 1WMAA 1WXFA 5KVAA 3ELDA 5F52A 1U0JA 3N9IA 3P7MA 2VJBA 1PJQA 3MRSA 2DPHA 3T0GA 2MHCA 4C0BA 4QPNA 2WVJA 4N3BA 4PLZA 2PDAA 4KK3A 2XLCA 3LTEA 4KVZA 5DIZA 4JUCA 4KGVA 5C0OE 3GYBA 4UM9B 1IZYA 3U7IA 4Y6SA 3UJBA 4MI9A 5T5QA 1LPBB 2HJ9A 5HS4A 4IGFA 1P1JA 2AC2A 2PT5A 3NH6A 4QFMA 4HD8A 4J2HA 4LZLA 4CTJA 4WCFA 2OV3A 2I33A 3H9UA 4WN3A 1T2EA 5CDFA 1NUTA 4ZZIA 4MULA 1ZIDA 1N7GA 3OJXA 2PRJA 1E79A 1SFRA 2QLTA 5KZMB 2A1IA 4OBBA 2OHHA 4OHPA 5KNCD 4TMZA 2BN4A 1UFOA 3SFTA 5D01A 2YDXA 3ITKA 1IH8A 2GN8A 4KR9A 4HUQB 2PMDA 5ER9A 3RPEA 1OBFO 3IE1A 5B30A 1KC3A 1VKHA 3DB2A 2VSOA 4HK4A 3H1EA 1KFJB 3RUHA 4E5MA 1LC3A 1AZLA 1VE6A 1WCYA 1TEZA 1E64A 2EATA 1DRWA 4FM9A 1NASA 5A6SA 3GCWA 4ENPA 2CYCA 3V8PA 3A1DA 5IX8A 4NC9A 1TCVA 1U9YA 3O4RA 3IMFA 2H5LA 2X9QA 3CRQA 4AMBA 3K1AB 2CFCA 4S04A 2R00A 1NI4A 4TVBA 4C89A 3GA7A 4EQ6A 4RF4A 3OTOB 5C7IO 1GD1O 2ZTSA 4LPSA 3ASZA 4RA9A 3ZNNA 1GL3A 2B8WA 4ADSG 2E55A 4AG5A 5CVDA 3SDSA 1B1CA 3K30A 4NMHA 4ZTBA 4B3FX 1YVRA 5F78A 4B40A 4ER7A 2RGDA 3G68A 2QRJA 4XAQA 3VH3A 3DMRA 5DT2A 4EGJA 1U2GC 1N2CE 1XC7A 1ZMTA 2GKSA 1JJVA 2V74B 2AGVA 3BE6A 1Z5WA 3L43A 2FPGA 2YHAA 1FE8A 1OSNA 1J5XA 2CN1A 3EMBA 3JWEA 1CZOA 2I0FA 3H5RA 1MGOA 2VRBA 1DKNA 3DDWA 3N2LA 4HWGA 1GTZA 2FW8A 2YWBA 3Q7TA 4FINA 3OG9A 2XDQA 1UZAA 2QZPA 3PWTA 1JLHA 3R5FA 4BLQA 1NBHA 2EKBA 3VR4H 4YRBA 5CDUA 2LZ0A 1NY5A 4E2FA 4RQTA 2ECKA 2DHDA 3ASYA 3CUUA 3HVRA 2GEKA 2CLOB 1GPH1 4PWZA 2OC9A 1BVUA 1CZRA 1N4AA 1N1DA 3UGJA 2HCBA 2PJUA 5G1NA 2HDWA 3AVOA 3VMMA 4I9FA 2GYWA 4MW7A 5JWHA 4AIIA 2Y1GA 4WKPA 1KMQA 2WTXA 1QJ4A 1K7SN 1P75A 3A4NA 1Z39A 2VJQA 3JATA 2B34A 2HF7A 1OI4A 3ELWA 3HCNA 2Y68A 3NHZA 3RO7A 2C5SA 4JXJA 3ZNOA 3N2NA 4D99A 3Q2KA 1OWLA 2NQ2C 3EUAA 4IPTA 1NI3A 4LYGA 3UJ6A 4B82A 3O90A 1GZ7A 4EKEA 4XQGA 4FI3F 4QSMA 4PONA 1T35A 1QIJA 3OLVA 4NX2A 5LZ4A 3H11B 3DCJA 1FDWA 3PBKA 4PAQA 4KN8A 3PQDA 3S55A 1FW8A 1DQZA 1W88A 3E70C 4KXUA 4Q02A 4HV4A 4MUBA 1BTOA 4O8CA 1AKUA 3VPFA 2QTFA 1BOOA 3P32A 2YL2A 4MQFB 4RFVA 2OMEA 2YN0A 4N5NA 4IAOA 1F20A 4R0VA 2IXEA 3DEHA 3DNMA 3CR7A 3MJCA 1L7OA 4A0HA 2VHJA 4M60A 2OXTA 5H3LA 3ZK7A 1GSOA 3NEJA 2GEFA 5FHQA 1DUVG 3EPLA 3FOFC 1I94B 1CR1A 1UMDB 1GA6A 2A30A 3GVIA 2O07A 3I01M 1GJRA 1D2MA 1S3SA 1U3TA 3OH8A 4L5YA 3TTTA 1E7WA 4CF7A 5FFFA 3UUGA 4DS3A 1YRHA 2GX6A 3TXYA 3KCNA 4KFRA 5KMGB 4YT5A 1C50A 2Z58A 3GUHA 3NXSA 4MKFA 2XPCA 2WWIA 4TS4A 1IY0A 3LDUA 3SAJA 1W0KD 3IT0A 5LB4A 4DLUA 3SMVA 1GR1A 3HV0A 5LYYA 4ND8B 1IOZA 3VZSA 2PR7A 4MDYA 1U2TA 2VAWA 3RF7A 1JTEA 3WGHA 1Z68A 5TXGA 4DSTA 2ZZNA 1M5RA 2G1AA 3WFJA 2DF8A 3AF2A 3TI9A 2AOUB 2COEA 1I7NA 4A6DA 2NXNA 5EG5A 1OAOA 5EI5A 3TKYA 5IJ0B 4BN5A 2B2NA 4HAYA 3NHLA 3PJGA 4MW1A 4HDNB 1S9HA 2XD9A 4EO9A 1SHLA 3ZEAA 1NVTA 1M8KA 2L17A 1R37A 5DEOA 5K1ZA 4I36A 1YS9A 1WX1A 4EMBA 2DUMA 1KJYA 3GRZA 3CFYA 5LMUB 1FP1D 1XWWA 3ACBA 6LDHA 3DO6A 4REQA 2A58A 1G63A 3LWBA 3BGWA 1CQJA 2FPPB 2G9QA 1N7JA 2FY8A 2WHRA 3A2NA 4PN3A 3HFSA 2EZTA 5H68A 1LDYA 1JAYA 2P78A 4N12A 1JMKC 4UNSA 1Z62A 3EZ6A 4KMRA 1ODJA 1KNXA 3WQQA 4KAFA 4O4IB 4Q3CA 4MUKA 5IK2D 2NU7A 4EAAA 2L42A 1P6QA 2C5BA 4DV1B 3R5SA 1D0SA 3TDNA 5A5FA 5C8ZA 3G13A 1EMDA 3AI2A 4R2LA 5FYQA 2O8BB 1B1AA 4QG7A 3VO2A 2WJAA 4YJFA 4DIMA 3LRXA 5TEWA 4XQ9A 2K87A 3HJCA 5KAPA 2WMYA 1C9NA 2WYVA 2AQKA 1A88A 3TVYA 4R8SA 2NSHA 2OQVA 3H3FA 2Y6VA 3KOWA 4BB0A 5KYKA 1JSLA 1ZD4A 2A1UA 3AILA 4IIJA 3CMMA 2HQBA 5CDYA 4C4RA 1DS6A 2ZITA 5D7NA 1L5HA 1JEAA 1KA9H 1R3UA 1U4NA 1YNOA 4CG1A 3N8GA 4JEUA 3IBTA 4ZK2A 1JG3A 1IBRA 2H63A 2VHCA 4EL0A 1JDBC 2C9BA 1WF3A 2WR8A 2B1GA 3LE8A 5EJAA 2AFHE 2UXCB 1Z0UA 2X41A 3E03A 5CDHA 4ZV7A 1NP7A 2EP5A 3I83A 3NM5A 4HQFA 4B8YA 2MMGA 2AKYA 3LBAA 4PIPA 4WK4B 4W82A 1Y1SA 3TRHA 1PO7A 1PT7A 2C4TA 2HJVA 4Z4QA 2H9YA 1FYVA 2A67A 5HKOA 5A06A 3OM1A 3OTQA 2JCYA 2WWGA 3GJZA 4LOKA 1FTQA 3KZMA 4POAA 3WQRA 2GFHA 2FG5A 3OSUA 4FYPA 4Y67A 5C18A 3W3AA 4J49A 3VR2A 1DRKA 5KQRA 1S2MA 1T29A 2XB9A 1T4BA 3OC0A 4PSVA 4AUMA 4CV3A 5G0VA 4MYTA 5CCDA 3W0LB 4MR8B 4IHJA 2YFQA 3O3MB 1Y33E 2Q1XA 3K92A 3IUMA 2HXYA 3PGXA 2UVQA 4B6RA 1QJCA 2ECQA 2Y9MB 1VJDA 4NMXB 3DQZA 3GLIE 4DLKA 5IJWA 2ZYAA 1I80A 1D9XA 3KB6A 1H2HA 2IPXA 2YWFA 2HDNB 4PGMA 2EBHX 2NTNA 5EHZA 4I3FA 1CUXA 3UIEA 1IOLA 1HK7A 1PNQA 5BV0A 5F7XA 4MP8A 3C14C 4RK4A 4WOKA 4RHUA 3MGGA 5A5GA 3SQXA 2VTVA 2R8RA 3B1FA 3GH3A 3I9KA 1U8YA 3ROXA 4KW7A 4QDTA 4Z5XA 3U3JA 3SZMA 3G2JA 4QPDA 1L3BA 3ML1A 2O59A 3O75A 2J9FA 5KYGA 3O8OB 3VFDA 1D2GA 2VUUA 4NCXA 1M67A 2P9ZA 2ON6A 4KX3A 4MVYA 4PNPA 3GQVA 4L74A 1XELA 4P2BA 1U0EA 2I6TA 3NEPX 2G7ZA 3QPCA 4YRMA 4OJNA 2FR1A 4PGAA 3JVEA 1HL7A 1L5RA 4BXOB 2WZQA 1K6MA 1ZSVA 1DEOA 1EWYA 1QIKA 3H9JA 3RS9A 4TMWA 1H2XA 3CNQS 3BTVA 4KR2A 2K7FA 2EW2A 2JFHA 1QP0A 5FF9A 5GAJA 1Z3CA 3GZTB 4J0HA 4EW2A 2YYZA 3Q7SA 1SHKA 4MR9B 4YMVA 2Q45A 4R05A 3T1NA 1G8JA 3UV6A 3E5NA 4M1TA 3TUZC 1OYOA 3OP1A 4GOKA 3VR6D 1XDZA 2VA9A 4IIGA 3GGDA 4BFCA 4BNJA 4BCDA 3TTSA 5CDSA 2B21A 3QK7A 2GILA 2QTNA 1FDOA 3KJFA 4J0QA 4F3RA 3VGJA 4KGDA 1JT9A 2D00A 4H3HB 5AT1A 3ZHSA 3DP7A 3PVSA 2JRLA 2JRCA 2BM0A 1OI3A 1O96B 3QLVA 1JU9A 5I3ZA 4BP3A 5K6RA 1D6JA 3QFHA 2JG3A 3IVAA 1A9XA 1PJRA 3R4CA 5B3AA 3S2EA 2VT3A 5AM2A 4E46A 2H9AA 3MJFA 4DMCA 1HYHA 3K6KA 2O0MA 1QM5A 3GZNB 3KJEA 3FDFA 4NHOA 3TZQA 1YR1A 2FRVA 1ABBA 1LDMA 2GJAA 1ESEA 3NBQA 1WHSA 4GRAA 3KYIB 4MVWA 4ZT3A 1DKUA 2DLNA 2X7XA 4DWVA 1JRLA 5JLJA 2DE0X 1DTWB 2P65A 3UHPA 1DKQA 2J41A 4FGWA 2VPQA 4YCMA 6ADHA 2XKJE 3C3EA 4N0PA 3VO9A 4U7FA 3ABOB 2F9MA 3ESRA 3WSTA 1T5IA 1R9MA 2H06A 4PIMA 3DZGA 1E6MA 1RP1A 1YKFA 1WUYA 4F5ZA 3GFQA 4B7ZA 4DY4A 1C3OB 4D3XA 3U7JA 3HUUA 3DT6A 3INTA 3JD1A 5K8IA 5DM0A 3RYFB 2GAOA 1T8PA 1Y5RA 4TTAA 4UVEA 4QU5A 1X1AA 1V3UA 3G2HA 3HEMA 1A04A 4E5YA 2AJCA 3HJRA 1XTKA 3I6IA 3BB1A 2ZT8A 1AO3A 3FWZA 5ED0A 5LZ5A 1GKUB 4BZXA 4E32A 3W6NA 2QROA 1QUFA 1B16A 3UUWA 4D9GA 5BQFA 1V16B 3K5PA 2J59A 2RHLA 1YRYE 1V3TA 2NSYA 4G5OA 1XPJA 3HM2A 4MDHA 1D07A 5HS6A 3H04A 2XT0A 3NP9A 2TMYA 3AONB 3BMCB 5FCDA 3D31A 4C14A 2AW3A 4PX5A 2OHOA 2HV9A 4JEHA 3VR1A 1Q50A 1BROA 2QAGA 4GMHA 4PO9A 4RZUA 3BFVA 4MCIA 1YACA 1U1FA 3KFVA 2UZIR 4OYRA 1EE1A 5DBOA 3WL3A 1GNPA 1M2OA 3DZFA 4CIXA 4PQEA 3RJ5A 1R3DA 3TTVA 3EEOA 4Y2TA 1A9QA 5G3ZA 3QUQA 1EWKA 3EGWA 4RD6A 1P1RA 5ECWA 5CAEA 1J5EB 3A9TA 4M54A 1T6YA 5ICFA 5GM2A 1T0JB 3QFRA 2XCRB 1GN8A 4QQFA 5KTOA 4JLUA 3UCEA 1YB2A 2CLCX 1ZPDA 1EG2A 4HTFA 4ZI5A 3LOUA 1PFVA 3CWZA 4RK7A 3TZEA 3WDKA 2P2GA 5K0JA 4UJ5A 4AXXA 4QOEA 3LUJA 3NHPA 3BF7A 1T5SA 1XZPA 2COKA 3UKOA 3THYB 1QAQA 2VNJA 1K86A 2ZRPA 4A8HA 1QDEA 4XLZA 4JX8A 3FNQA 1A2KC 1IVNA 1R10A 5DX8A 4WBNF 2FSIA 3ZCSA 2B7LA 4OHYA 4ENWA 5BN4A 4IWNA 4GNRA 4K87A 2I4RA 3ZWAA 3OCXA 3M7IA 3W5AA 4B7AA 4S1NA 2O2SA 4MB2A 1U8UA 4C2TA 4FGLA 3M6AA 4YO8A 2VOJA 2H2DA 1U0LA 1T9DA 3OKAA 1GL9B 2RGWA 3P0IA 4RA6A 1ACMA 1QQ5A 1GGNA 3ZBQA 4Q4AB 3Q8WA 3DZDA 4GPIB 4LSMA 3QI2A 4IEFB 3ODPA 4Q4JB 1Y6JA 4V0OA 2FLVA 5AHOA 1F3OA 1O0SA 1E5DA 3VU9A 2BMEA 1KMMA 4QTUB 1GY8A 2C5AA 4HEA1 4DA6A 5IXSA 2ZTVA 3GPBA 4IY1A 5KYUB 1RIFA 1F6WA 2NT4A 3MSXA 4MPJA 2QQ5A 3EZNA 4G67A 1BFUA 2J9XB 3GG2A 1HZJA 4FKMA 4G26A 1TUIA 3FDJA 5IAJA 1NR7A 2GTHA 4ER0A 4CJXA 1WBBA 2VSXA 4PVCA 3REOA 2GTIA 5IN5A 3EAGA 3ILHA 2ZT7A 2C0QA 4LEIA 4RLSA 3VKWA 5FL3A 3VPCA 1USKA 4C0JA 3GP8A 1G98A 4WFIA 3S44A 5HOEA 3ESZA 4HWTA 1P0PA 5BN1A 5EXSA 3R9IA 2R6JA 3RGGA 1XFAA 2GBLA 4CM5A 4MO9A 1TMYA 1VRVA 5DGHA 2EX4A 2QUHA 1II0A 4Q00A 2CK3D 2JAUA 5KYYA 4Q7JB 1KDPA 1MVLA 1PJ3A 4RD1A 5TR9A 3UCFA 5CB0A 3C3AA 5AJWA 3TE7A 1B74A 5I7SA 2A6PA 2BMVA 2GBFA 3Q7IA 4PYNA 3RABA 1JDVA 3W2HA 3DTNA 2C97A 3KKNA 2PIDA 4BATA 3LM8A 2JIMA 2V54A 2WE8A 3IPYA 1HFJA 3HA7A 3B1KA 2V8BA 3ZZ0A 2IU6A 2E21A 2NO7A 2VHTA 2QA5A 4Z4HA 2F62A 2AF4C 5JD3A 3DDHA 3UWSA 1G55A 3STHA 4Z0TA 1NN5A 1WUKS 3JQBA 1SUWA 5FNVA 1XRQA 5HCIA 3ZZUA 4K2HA 1SA0A 2B9VA 4JEMA 4NJMA 1QGOA 2XKBA 2M6SA 4B3MB 3ENNA 2G1PA 2DWUA 4CETA 3R09A 1UXKA 1YDMA 1ZK4A 2H0QA 3CQ9A 3CURA 3HCCA 3LA8A 4FUQA 1C3JA 4KO2S 4MPPA 1RW4A 2WHPB 3ZD6A 1S4MA 4EJSC 5L45A 3LKVA 2WAXA 4X44A 2QRGA 5BMOA 2CL5A 1GGJA 3D6NB 2ZXUA 1C30B 3ILXA 4W5RA 3MS2A 1YZQA 4FIDA 1R8YA 2NV0A 1QZ3A 2PZAA 3B51X 3SC3A 1SD1A 5EERA 3RNOA 3FTEA 1O6BA 2ET6A 1ZBDA 2H4ZA 3NB0A 3ZQUA 4BNIA 4DDTA 1ZI9A 1DUIA 1CP2A 2J8ZA 1JLLB 2HIMA 2JAWA 4BVHA 4C7XA 4BGDA 3CZAA 2FJUA 3OQIA 3RHSA 5DM1A 1QFJA 2A1TS 3SKVA 4C4AA 3N5CA 3NORA 4ZCTA 3ZX5A 2BHTA 2FR8C 4RBNA 1YMUA 3SHQA 3R4VA 1I30A 2OEPA 4JJ8A 1VKRA 1M8JA 2LE0A 4KK4A 2QMEA 1LWNA 2AEJA 2H4WA 4B47A 5JDIA 1BHSA 2W6NA 3B20A 4ZFNA 4DBLC 1Z6PA 1JFFB 2QP4A 3I28A 1EA7A 5HQJA 1PGQA 2D7JA 3KB8A 3VUFA 1D1SA 2ZE6A 5A7FA 2HMYB 1T1JA 1LVGA 2ERCA 3HZHA 4FFVA 5B12A 4GUDA 2RGUA 2QTVA 1VFPA 3BE5A 4MV6A 3QVOA 1ELOA 2VXOA 1PK9A 4RK0A 5F2OA 1SKQA 5D87A 1P18A 4LW8A 2CNNA 3ZZMA 2XZPA 1QHYA 4QUIA 4C6HA 5ALGA 3WS7A 2CDBA 4YJGA 3NNSA 2HBZA 3V7YA 4Y1GA 1UK6A 4LS3A 4L3OA 3E2PA 1G66A 4TKLA 2CWWA 2H7VA 2I6SA 2CUNA 3RBZA 2YHIB 4LRUA 1XDSA 3QOYA 1X77A 3NKVA 3SSAA 4YUAA 1JFRA 1TDJA 3AFGA 1CRQA 3HHPA 4BUCA 5EEGA 3KOUA 4BP9A 1XQ6A 1XZNA 2IUEA 2IUYA 2IVZA 3WP0A 4GKJB 1COWA 1TZ2A 2QRLA 2MINB 1W8DA 1QVWA 2BOVA 4KXLA 5EXEA 3WISA 4CWAA 1X1DA 1KEKA 5EIXA 3N3AC 3D2AA 5B53A 2OA0A 1G20E 1E9SA 2JIPA 3AFOA 1SG6A 2YFHA 3DHNA 3IBYA 1D2HA 4M9XA 5FUBA 3TBFA 4ZOAA 1PWEA 1IM5A 4DLWA 1WETA 3BT7A 1LV8A 2J9YB 1YBFA 4M88A 5EHXA 4AY4A 5IUNC 5E6UA 3AR3A 1NFQA 4KE6A 2RCNA 4Q9JA 4W9RA 3PC8C 4DNPA 5DTJA 1P6XA 3WIVA 1N5JA 3I6QA 1MCZA 2XZOA 4LJSA 1GXSB 5KNCH 4LDZA 1PZNA 1C7ZA 3D7MA 2X5KO 1XZQA 2IDKA 2XKAA 3K8YA 3P2MA 4OLAA 1IE3A 2C4NA 1JEQA 3KZCA 1E9CA 3AQIA 4I7EA 4RSRA 5IM4F 4N9WA 2Z95A 4Q3NA 2ZXEA 1D2AA 1CJVC 4A8PA 3LUDA 2WILA 5CXQA 2GUGA 1X80B 2L69A 3ITDA 3KK0A 3PCXA 2YCLA 2WBLC 1GYQA 4ETIA 4MLPA 4Z9AA 4YIHA 2UU9B 3GOQA 2WLSA 3NAQA 3TAHA 4NFYA 3DLBA 3ZCTA 4LTNA 2B7BA 4IXWA 5A5EA 3BRWD 4DGSA 2FB9A 1DXHA 1VLJA 2WSMA 1MB9A 4UDNA 1EM6A 5D6OA 2WWVD 5JWRA 3SM9A 2PUBA 1RZVA 3MQ4A 1C1YA 3HDVA 1QK5A 5HWSA 4D92A 1ZS9A 1WO8A 3RVDA 2W2NA 3LGAA 2EL7A 4FCTA 4TWZA 5DW3A 4LZAA 4YDHB 4KQHA 3TG8A 5LKRA 3BCHA 4KXFB 3S1AA 2K4MA 4BEWA 4I8XA 1FBNA 4N49A 2JVIA 4P58A 4DQ0A 3P71T 1GPBA 2XE7A 3FPFA 2CNDA 2ID7A 2ZAGA 3H16A 1TZJA 3KOXA 3WGUA 4JR0A 1FDVA 2OYSA 2WJHA 4JI1B 1E94E 1QH1B 3GP3A 3WTCA 3LQ1A 4LJLA 4LMAA 4EI9A 4PM4A 5HUJA 4OG2A 1Z6XA 1NKVA 1BGXT 1XDBA 4XD7A 5TEVA 3ZKWA 1CDEA 2XGOA 3QF4A 5KYNA 1I1HA 3S68A 1IMOA 5DNDA 3Q3EA 4Z54A 1N78A 4L7QA 3G49A 3OZGA 4QHTA 2ODTX 1UIMA 4YMWA 2EDCA 5BV8A 1NJ8A 4XX0A 3C45A 2EG9A 3L6OO 1RRVA 1ZEMA 1FP4B 1UJNA 3EC1A 1MTOA 2QOEA 4MINA 5EQTA 2YX1A 4ZVNA 2Y1XA 2VHQA 2PS1A 2YFYA 4H1WA 2OE2A 2DBVO 1NN3A 1QO7A 2CHUA 3AZPA 6Q21A 1GUZA 3CTPA 1F8YA 2OO5C 5LFAA 4QUAA 1XD8A 4UTPA 3C6KA 2YHUA 4DQLA 5L3ZA 4PZZA 4LWZA 1DIBA 3I34X 3UXMA 2NZJA 1X8JA 3NCTA 4V02A 2XMSA 1T6NA 5DBEX 5KB3A 4LBZA 4AZ3A 1O97C 1L7DA 5AJZA 2M1XA 2P68A 1Q57A 4NE2A 1I51A 4G0UA 4UAJA 3PGMA 4FLFA 2DCMA 4OU5A 5K3SA 1K6JA 2FCAA 3NATA 4JK3A 2GAFA 4AMGA 2J31A 3AEUB 4KFTA 1SVOA 2ZJ4A 3RH0A 3U48A 4BNNA 1K8ZB 3BN3A 3LJKA 1H9CA 2I4TA 3W5HA 3K2EA 1O77A 5FYDA 4KREA 1K92A 1SUIA 4FEAA 5TJHA 2G1JA 4EPYA 5CFRA 1JDJA 5I51A 3DV2A 1FYDA 4MPDA 3ZXUB 2OHIA 3GQBB 3K6RA 2WMNB 1QQ6A 4O2BA 3GRAA 1HSOA 3INYA 2OD7A 1WHTB 3NBMA 5MN6A 5TRTA 4A91A 1GPNA 4S12A 3WHKA 2JHCA 2XTAA 4RTPA 5FAKA 5IVKA 5ICSA 1H2ZA 1ORTA 2ZI6A 3QX9A 4UHJA 5DASA 3B9BA 4NK4A 5DYNA 1DJPA 3N6RA 4IXTA 5EP3A 1YI0A 3I64A 3VC1A 4MHTA 4HX9A 2C7BA 4UHFA 4KXMA 3K9GA 1U7PA 4D6PA 1QX4A 2H4YA 2CZCA 1O0BA 5LD2B 5JAQA 3CUKA 4QUBA 4BB6A 1JJAA 3PQ6A 1U1EA 1WDLA 3PQ4A 5LQMA 4CKCA 2H7XA 1GITA 1XKTA 2JIBA 4AKTA 3GPIA 5BUQA 3HU5A 3NLLA 4NDZA 1UP7A 1IXKA 4BZWA 1VHDA 4P22A 4XX1A 1T3GA 2QN7A 2OGUA 3IAEA 4JCOA 3WMWA 2QJRA 4BLUA 4N6OA 4YR9A 1USIA 3N5KA 4HMQA 3T5BA 5C4MA 1T43A 5K51A 3ZH2A 1QYWA 3SS8A 5L3SB 1HH4A 1G8PA 3DMGA 4TZ6A 2WIBA 4KPUA 4RHYA 4EPRA 4DARA 5SZHB 4BKUA 1S3IA 4S0ZA 2R751 2Z43A 4X24A 5KTNA 4N7JA 1FMFA 2G6TA 5IDQA 4S1OA 3U3MA 4WZBE 2WJZB 1L5KA 2XVMA 1NPDA 1IQUA 2ZJOA 2ZVPX 1L7QA 3DE4X 3O0TA 2XW6A 4RZ2A 2AG6A 3TRJA 5JS6A 2JGAA 2QRMA 1NLUA 5KTRA 2V4MA 2O2GA 2NX2A 2PS3A 4Q03A 1Z88A 1EJ2A 1RP7A 1WUTA 2C2WA 1JZSA 1Y34E 2RGXA 2XGSA 3GC6A 3IQFA 3LVRE 3N2KB 2PGLA 3OOJA 4K6OA 1PBTA 3SICE 3WYGA 1CEXA 3MTEA 4BJ3A 4Q3EA 1GM5A 2RK4A 1B93A 3MOIA 3LAWA 3TZHA 3IHTA 2AN4A 4MUGA 1WTCA 1G2IA 2V7PA 3PVCA 3TJMA 2XOEA 1HV8A 4GEKA 5C52B 1X86B 4R68A 2VK2A 1ONSA 3T99A 6YASA 5IDVA 5IU6A 1DBWA 1BU5A 2AD5A 3LWDA 5KJ6A 1II8A 3SVTA 1PJLA 1B2LA 3FNRA 3MMXA 2D2FA 3RJZA 2WK1A 5HZMA 3U31A 4EHIA 1WBDA 1KEVA 1YTUA 4DRXA 3DCNA 3VPAA 1MTZA 1VG9B 4ILEA 1AMNA 2UUPA 4YBZA 3OEWA 2YYSA 4LOJA 3BGIA 4K9QA 3K0SA 2CCJA 4N01A 2QLFA 2RKWA 3NO4A 1C4OA 4C43A 4IIHA 4ZYXA 3T6KA 5AOCA 3D3NA 1R0SA 1CK4A 1RYMA 2QTLA 3SXJA 1E2MA 4E2XA 1KYZA 2DG2A 3IP7A 1YIDA 4JB2A 1HNZB 1BH6A 3RU2A 3O38A 5MF6A 2KPOA 1K08A 3HVKA 1F60A 3ORRA 3TQRA 3KFXA 4R2WA 1YC5A 4IH1A 4QRHA 4ZOEA 1NONA 2R6ZA 2F4VB 2NU6B 3E7PA 4DQUA 2ZBEA 4HFMA 1OH5A 1U3DA 3W5SA 5JCPA 1RPNA 4BFUA 5HJEA 2PGIA 1JFLA 4L51A 3ZV5A 1UDBA 2EX0A 1ZHFA 4F97A 1CNEA 1X94A 1G4HA 1KRWA 1DX9A 4ZJPA 2I4OA 5BNIA 1JJIA 1VHTA 4FMBB 4IIJF 4N54A 3ZV7A 1PI3A 2ASEA 3STWA 1E1QA 5ALLA 4WKOA 4BQEA 2QTWB 3ZHBA 1GFSA 4P7FA 4D4IA 5F4BA 1B8OA 1RM5A 5DIFA 4F6CA 2VSQA 4NICA 2NP7A 4XI9A 3JX9A 1XZAA 3KPYA 4KIFA 1PX0A 4MA4A 1NJGA 4PHHA 1CU1A 3WYBA 1RM4A 1OA1A 4JLKA 2IEZA 4Q6WA 4EPXA 3GA0A 1ESZA 4OA8A 4AW9A 3HO6A 3BRQA 4I99A 2C3YA 4TV9A 3HWRA 1SK8A 4P3XA 1PG0A 3OIDA 1C8BA 3URMA 5FA8A 3KVRA 4EGSA 1OVMA 2B4YA 3EVBA 4EHJA 3L05A 4MYUA 3CM0A 4ZZ2A 2BR4A 2FSSA 3BD9A 3FGZA 3NXKA 3BFPA 3A6JA 3I6MA 4RVSA 1FXUA 2O5EA 1PZXA 5C1IA 1TFUA 1X92A 3EJWA 1L7XA 2ARKA 2Y66A 3O0DA 3KKQA 5DWDA 3VR6H 4RVGA 4Y0AA 3AY6A 2W0MA 2QIPA 2WU0A 2ZJZA 3F3SA 1QIHA 1T6XA 1DAPA 1R7RA 1ZMBA 2OGZA 2QPTA 2Q0HA 2H2WA 2WU8A 3GLVA 4G4IA 1V8BA 4P3OA 4OHFA 4QODA 4ZEMA 4WLUA 1OH8A 2DFPA 3H0KA 4A2CA 2YH2A 3O4IA 4GSKA 3DB1A 1QANA 3WIUA 4M8LA 4TTRA 4EEXA 5F21A 1ZL0A 4QTXA 3AXSA 5E8JA 3SSNA 3T06B 4NENA 4Z4EA 3VRHA 2YXLA 3I1FA 3RREA 1EBUA 3SEQA 3CXUA 1RSZA 5G4KB 1GGMA 1TMOA 3RG2A 4ZI7A 4JLDA 4X64B 2FPRA 4JBXA 4M76B 3KLPX 3IAXA 2W37A 1K5HA 2WC1A 3MFYA 5T4FA 3UNXA 3GDFA 2V55B 3VDNB 2NYUA 4YP7A 3SR4A 2IH2A 1FLAA 3ZE7A 1Q83A 1UC5B 4DLLA 1NVVR 3D3JA 2BD0A 4ESEA 3ESBA 1UQRA 1DBVO 5GOZA 5A4DA 4ESVA 4OMCA 4F5YA 3P2EA 4GBGA 2J7PD 4HWOA 2P11A 3WYFA 4KWIA 1L5ZA 1KMHA 4OHBA 3LD9A 2OFOA 4Q47A 1QRDA 3ZZTA 4D45A 4I5DA 3TSYA 4M99A 3NHJA 2FZEA 3PVZA 1H1TA 1SXJA 5I48A 3NUQA 1C29B 2JLZA 5CXSA 1US8B 2R11A 3O4GA 3VYRB 4MQMA 1PKXA 1ZA1A 5HTOA 4N48A 4HDQB 2CMFA 1U5BA 2J0UA 1MG0A 1XF1A 2IYVA 4NNOA 4MCJA 4X41A 2I76A 5FLYA 5TQ2A 4WOBA 4FYKA 8MHTA 1Z6YA 1IXRC 3S99A 3RTCA 2GJ4A 2ICAA 2O8NA 3JRWA 4GQIA 2QRQA 1NW3A 4URUR 5LVAA 1YS1X 4ZI2A 2YVAA 3F5DA 4G1CA 3OFVA 2G06A 3PWKA 3MM4A 1GWNA 4BAGA 5CDFE 3EY9A 3QKSA 4S2EA 1U9JA 2J46A 2A88A 3STYA 4DMKA 2QG9A 4I4IA 2XRYA 1U4SA 3KQHA 2FMHA 4OEHA 2R7MA 3P96A 1Z5NA 1MNQA 1O95A 1U2DA 4C1NA 3ANMA 3N53A 4W9NC 3E35A 3IVMA 4Y2UA 1TX4B 1HRDA 1UBCA 1UOPA 2C4MA 5ARDA 5JI3E 3WZMA 2V6IA 1GPWB 4M38A 2YZGA 2X4GA 5EJIA 1IVSA 4LY6A 3AR9A 4PZDA 4Z3OA 3OCUA 2RH5A 2NO1A 2V7EA 1QK4A 2ST1A 3A4LA 1EXDA 4PG4A 1LBTA 5KDDA 1GOTA 1Q0UA 3EQ2A 3FOCA 2AOTA 2QP9X 3WK6A 1CUSA 4BQOA 4BIMA 1TM7E 2A8YA 3X1JA 2HYIC 2C77A 4GD3Q 1M7HA 3AR2A 3HHEA 4K9KA 2XT9A 3IQDB 3ND7A 1RVV1 2BP7B 4EQZA 1OYYA 2XGMA 4U7TB 4B3XA 2OZLA 1H0KA 1WDMA 2WABA 4RV9A 3VZCA 3KS9A 3FWPA 3LYLA 4CL0A 5I4KA 2XVYA 4H3VA 2G9VA 2W43A 2WF8A 3R6WA 2OECA 2G72A 4PQRA 2ZJYA 2E1RA 3MYYA 4KSCA 3MWJA 4RHXA 1YOVB 3RVNA 3UJ9A 4HNGA 2IDZA 3EY4A 3KSAC 2QN9A 3NDRA 1E6CA 3ETHA 4CE6A 4Y2GA 2P0AA 1O5IA 1YZTA 2WJYA 3QUTA 4L4YA 5ESRA 4S1TA 4F06A 1KIMA 1K8RA 2EP7A 1VG0B 3LC2O 4N3CA 2FEKA 4KIWA 5CGZA 4G1FA 1CY8A 5F76A 1F2UB 3RV4A 4DR6B 4XDHA 3P52A 1T9KA 3JQQA 4WW0A 3AF5A 4Q16A 2QM8A 3K16A 4U9HS 3SYMA 1JIKA 4DWJA 3KEMA 4H2DA 4OXYA 1ZNWA 3IILA 3ZHUA 3CT4A 4C4SA 1H2BA 3VKHA 1VKOA 5CA0A 4OOEA 3WLIA 4UPDA 1F4PA 3AETA 2YY5A 4OI1A 5AVUA 2WU1A 1L8AA 5DYYA 4MRSA 1Q1GA 1SUAA 2PZMA 5KTMA 2P90A 2VN8A 4EELA 2BGTA 4B5LA 1CQIB 4BVJA 3KLBA 4BYMA 4PG8A 2KB0A 1ILEA 5KC8A 2O2DA 5JCOC 2C4KA 2PSJA 3PE6A 2CXNA 1JILA 1JE0A 1U94A 2DUJA 2JFOA 2NXCA 2VT2A 3A14A 1E1NA 5NLLA 3ZXSA 2EFHB 4ZVSA 4Z6KA 1LPNA 2PV0A 5F9MA 5A3RA 3OZ7A 3EPRA 5I9LA 1UZUA 1EWVA 1GZ6A 5AMXA 1NQXA 2X5NA 1QHHA 5EMJA 4URVR 4JLAA 4DMGA 4KU4A 1EFVB 1L5NA 1G2PA 2ZYTX 2ZG6A 3P9RA 3KEQA 3BX1A 4DLSA 4LVNA 4WEQA 2WWTA 2XT6A 5JSZA 2LRHA 1U0BB 4R1UA 3CKKA 5FR2A 1B23P 2Q9UA 4U39A 1HQKA 5FULA 5AKGA 1M74A 3G59A 5BRNA 2HQ1A 2CL6X 3TOCA 2ETVA 4LSWA 4KYTA 2A57A 2OD2A 1B00A 1HDOA 3KT8A 1TCAA 3L4KA 3PLRA 4CU5A 3HA3A 3VYTB 3L4BC 4IHKA 3ZCQA 3EIXA 2IP4A 4A7PA 4WJLA 1S4QA 3SF8B 3HBJA 3CRNA 2NZYA 5TQ0B 4QWWA 4TSKA 1M54A 4RFSB 2O7RA 3G8BA 2AK2A 2BFFA 1W49A 3DO8A 4YRNA 2H1WA 1OLOA 1SIWA 2GF9A 4MGYR 1YFJA 1TZCA 3ZD8A 1SCUA 4A8TA 2AR0A 2ZS9A 3GBPA 3ONWA 4AO6A 4X71A 5DEIA 3OO1A 4RJLA 2Z1MA 3GARA 3I4FA 4ZV9A 3TQCA 1ORIA 1SBNE 1W2WB 2PXCA 4LTDA 1XSEA 4MUJA 4OIFA 4DA7A 1GAJA 2ECFA 2HPAA 2LUOA 5BSWA 4FHDA 2EFCB 5EWLA 5LQCA 3MSCA 4AUEA 1F5SA 1A7UA 2AYZA 1BKYA 1TM4E 1VYUA 2I2WA 2IY9A 1SQSA 1JEDA 2H2FA 2Z6VA 4LZNA 4TRRA 3JZDA 5DNAA 3V4VB 2FNAA 1KETA 2AQHA 1ETHA 5DPMA 1E3DA 1G0NA 2P9GA 2XYQA 3ESYA 1JXAA 3HLTA 1EWRA 3ITNA 4H1VA 4JBGA 4JFAA 4MJ3A 5DWQA 3TVTA 3TSOA 4HGPA 5HSGA 2B5WA 4R7GA 5AW2A 2QV0A 4JI3B 2GCPA 2BFBA 1H2FA 1UBUS 3MG9A 2XDYA 3KT6A 1R88A 4F4IA 2JANA 2VJNA 1YVEI 3FETA 2RK6A 3FGNA 1F0PA 3MWFA 2ZIAA 1ECFA 2J4DA 1XTSA 5EWMA 1VL0A 3HKCB 4A10A 1P2DA 2DC1A 4GFDA 3TZCA 4ER6A 2PH1A 1YI1A 4ROTA 2EFGA 4GOXA 1SIUA 3AL0C 1JG7A 3MB5A 2HMVA 5HCUA 1GG8A 4ARVA 4IX9A 1UR5A 3D0OA 3KAJA 1YZYA 5BYJA 1JJBA 4BFZA 1QQTA 2R2GA 2HW8A 4MSUA 1MRNA 3UJAA 4URYR 3WBKA 1W47A 1ZUNA 2WJJA 4MCAA 3O1LA 4TXJA 4BFXA 2HJWA 2C9ZA 3TJZA 3SVLA 4KUHA 2R85A 1B8UA 1A3CA 2ZR7A 4CMIA 2CXOA 1O2DA 1PQYA 2YBEA 4A27A 1J1IA 1KR5A 1TKRA 1O7JA 3FFAA 3U7EB 2REXB 3PYMA 3W2TA 3FNBA 3ZDXB 4KV7A 5A04A 1PUIA 3S8MA 3WGLA 4TXNA 1WL8A 1DX6A 1R4NA 2JD2A 4IIBA 4QT0A 2XF8A 4RCVA 1NG1A 2BEUB 3E5RA 3IIMA 4Q7MB 3CLUC 1EFRD 1VSVA 2K2WA 4H6XA 2CW5A 4YJ2F 1V2HE 1K8QA 1LLQA 3FHTA 3WC4A 3F2IA 1Y5MA 3QU2A 4A26A 1LI5A 1NXSA 4N1AA 1CHNA 1E2NA 3S2ZA 4HRAA 5LOVA 2V0NA 2DH6A 4JYZA 1HLPA 4KIGA 4RVUA 1JEYB 4P7GA 3ZLBA 3ZVLA 3EG9A 3LT5A 2P79A 3M89A 1X1QA 1Z6QA 3FYUC 3PXEA 4F92B 1YQGA 3OPMA 1ZNXA 3R0ZA 4PLVA 1KOGA 3EZLA 1F2TB 3DZCA 4MUIA 3VSCA 3PGA1 4INPA 4BFLA 5UKDA 2QPAA 1ZRNA 4PYIA 4BNXA 2Q0SA 1NYLA 1GUAA 1JQJC 1OXKB 3CF2A 2XH8A 4ZVVA 4TT3A 1XJWA 5IH7A 3QE3A 5DBIA 3FF4A 1U3FA 4L9AA 4FXPA 1MOSA 2RHCA 2VDLB 2PX6A 4YROA 3UXHA 1G38A 4MRMA 5CEEA 4H0NA 4QBIA 3HLYA 2QL9A 4QDOA 5J5VA 1NVVQ 3RKSA 3TI7A 5DHPA 1G21B 2EVWX 2X40A 4YLYA 1ACJA 4NCKA 3SDZA 4XWYA 3D64A 1X70A 3UCXA 1OFUX 1JZQA 2KW5A 4YRSA 4BCCA 1CUWA 3PDJA 4R01A 1MZPA 1KBQA 1JHUA 2AVDA 4JT2A 3W1WA 1X39A 3W8DA 4EW3A 4QYMA 4AVYA 5F1PA 5IDWA 2I6UA 4BKMA 4BNDB 3T3NA 1C7FA 4MUFA 3IUYA 4N6GA 4QU9A 3HCBA 2HJRA 1T9HA 3ED5A 2AF3C 2WG0A 5TB5A 2Z56A 2REBA 2CBZA 4PC6A 4PFJA 4B9AA 4U7DA 2V45A 2ZIGA 3Q8XB 3A6GA 1ML4A 2P6UA 3B5JA 5DCUA 421PA 3RAEC 3B36A 5DNUA 3EQ6A 3IPAA 1A8UA 1BU8A 2HLNA 4FTWA 3NEYA 4PX9A 1CRWG 1VRCA 3I6YA 3TMKA 3IAAA 3PP8A 4Q9LA 1J4AA 2ZTMA 4ETMA 1SVIA 4ZOCA 3F67A 1ZESA 1WW2A 3W9SA 1GL6A 2HMWA 2DR0A 2IP1A 2ZT6A 4O3MA 3WBBA 2CV0A 1MXHA 2ZI4A 2E4UA 5DULA 3TOVA 1EVQA 3L7JA 3G0HA 4LBYA 3JR7A 1N2ZA 3KOYA 4OA5A 3S4YA 1IXSB 2GSDA 3SXUB 1DOAA 3T61A 4LNUA 1VIMA 3CUWA 4NH0A 5IBCA 1YTLA 2HHJA 1XAGA 1Z0JA 5C1DA 5KMGA 2E4XA 1USGA 1JALA 1Z22A 2GHRA 2J67A 2AHOA 1I9CA 3E1KA 1EDBA 4MR7B 2H2HA 2R7AA 3OJWA 1FU7A 2PGOA 4EX6A 4EUEA 5CFPA 5LP1A 1GP2A 1ODTC 1SU8A 3PWZA 3HRHA 5KSPA 3WNQA 3A1FA 5LDGA 4G0QA 4BVBA 3O21A 1RM0A 1UMBB 2AE2A 3E61A 3ZIUA 4A5OA 3CLRC 4BMDA 4BX3A 1VLHA 5JADA 4LJ6A 5CEFA 4DG5A 4RUKA 2JEZA 1OX6A 4WUVA 5JBNA 1XKQA 2J07A 2H16A 2O0KA 3HKBA 1HNNA 2YOGA 2ZSBA 1P31A 2G5GX 2RDMA 4RSGA 5IFKA 3DBHB 2RI6A 4ALMA 1IQ0A 1DIAA 3DV0A 4O1HA 5LXTB 4IIYA 1K68A 3PUWA 5JYEA 3MWEB 4LF9B 3FUTA 1LLCA 1TJ5A 1XKXA 2BM1A 2FF7A 1AS2A 2FPKA 2XWBF 3W9UA 5DBHX 4NBKA 4QXQA 4D0NA 5BP7A 5JI2E 2JLXA 3PQ2A 3UAYA 1ONOA 2ID8A 3CTMA 5K3BA 4PTZA 5NULA 3PI6A 3Q3HA 1E89A 3ONDA 4XR9A 3WQSB 2W2LD 1XD2A 4EZEA 3WGMA 3C6MA 1T8YA 3HU1A 4Z4FA 1F0NA 4ARZA 1RLJA 2Q5LA 2B35A 2R47A 1C1XB 1ZK2A 4PC7A 4PCUA 1ZGAA 1JKMA 4H7JA 2JFUA 1GQ2A 1VGQA 2ZFUA 3ZU3A 1VLZA 3RVQA 5LP6C 3M5PA 1K06A 3NM4A 1AKTA 2GA9A 2WIGA 4KE9A 3WK4A 4LY9A 3WNZA 3KVOA 2ZRQA 1E7QA 1DQSA 4ARUA 2I55A 3V8BA 3KV3O 3B1ZA 2EGGA 3THWA 2IHUA 4EBFA 4NQRA 3MF4A 1R6TA 1GGKA 3WWOA 1FMTA 4LFCB 3MJHA 1ZHHA 1LXCA 1L7PA 3KXDA 4ZVLA 1V8FA 3TGWA 1FFDA 2RGAA 1Y3AA 2W22A 4J43A 4R3NA 4F12A 5CXXA 5EP1A 2NUAB 1FBTA 1SZJG 2BEJA 4JC5A 4PZ0A 2IXTA 4KE8A 3ZV6A 2DCUA 4YXWA 2QTCA 4YRKA 4JJGA 2DQZA 4F7WA 2HSZA 1W9MA 3H5AA 1DC7A 1QMGA 2GEUA 4PIVA 1Y89A 4NMMA 1ZOLA 3EGXA 1JKFA 4K86A 1T1GA 5MGBA 2FDCA 3EGVA 4BCBA 3IOYA 2B1IA 2Y0DA 5FLXA 1E9AA 1W4BA 4P34A 1TVEA 1KYXA 3F4BA 3DP9A 2AS0A 3AR4A 3F5SA 5FADA 5K0NA 3MJSA 2P40A 3HTXA 2J5RA 4CR8A 5F7ZA 1XTTA 1DWOA 2D7CA 3DAOA 3IP9A 2RE8A 4YPOA 3LQ2A 3EVTA 1N2EA 4I5EA 2RI0A 1NT4A 5JZVA 1MV8A 2BBOA 4EF6A 1GPMA 1ZN7A 2PX0A 1E62A 3KETA 3EG5A 4PHGA 4CIDA 2C2XA 4I08A 1XRLA 5I9TA 2PWBA 4Z1MD 1E98A 1EFDN 3BBPA 4LXUA 4MR8A 1M2VA 1CZKA 3TLXA 2DETA 1NKTA 2ZWMA 5TIIA 2V98A 2W6PA 4LDQA 4DJAA 2CLLB 4QNNA 4DNOA 2Z2JA 1C4WA 2BUCA 4Q93A 1PGOA 1V47A 4TYPA 3ADPA 3AESB 3DVSX 2UZ1A 3TLCA 4NE9A 1DLIA 1BXRB 2Q1TA 4YA6A 1MOPA 3ZDZB 1W0CA 1ZJ5A 4WGGA 3GEDA 4JVMA 2DHRA 3CZ4A 1SWWA 1XVTA 1UF9A 1G4AE 1ZYUA 2ERXA 3SG0A 3TQIA 2CF6A 3NUGA 5JRDS 1RTKA 4NFLA 2X7HA 3D0RA 3SS7X 3ZWWA 2I71A 3KSDO 1UDWA 1X14A 4MV8A 1E0DA 3ZV3A 4A2QA 1HT2E 1Q7GA 2J3HA 3T5MA 3EODA 4OFXA 5IYZA 5A3SA 1FU8A 3LPCA 5DSTA 2NPFA 1SC1A 4HAZA 4HJRA 2WYIA 2BUBA 5CLGA 1AKMA 5KQGA 3JPWA 3B82A 3O8OA 1DFHA 4Y7DA 4PLFA 4P7JA 3UTCA 1PR5A 1SY7A 2I2FA 3X3HA 2P35A 3H1GA 3V42A 1U11A 4IDNA 1XRSB 3IUNA 4MGKR 3TB6A 3LYAA 2CVOA 2IGBA 3UJHA 3J80A 1CY2A 4RVDA 4ZEWA 2NTVA 3E84A 1FL9A 1NI5A 2OG2A 3DL4A 3IP5A 2ZJ2A 3NWPA 4Y1EA 3ZQKA 4DUGA 1PR3A 4EHKA 1TF5A 1ABEA 2YNMD 3A2LA 4OXXA 5C53B 3M81A 3NBKA 1RLIA 1M2WA 1WU7A 4MH0R 4R8KA 4LVOA 4AMVA 2VHEA 4IFTA 4D1YA 1KZ9A 3SJUA 1QYCA 5DCYA 4EEZA 2FPMA 1POWA 2OCPA 3FG9A 4KRGA 1W5FA 1JECA 2FPOA 4GBMA 2FRDA 4XWAA 3AINA 2ID9A 1DQYA 4QVIA 3OICA 4G0XA 4WY8A 4ZQCB 1XEXB 2WPNA 3GJTA 3BB3A 2G28A 4RKQA 1NXTA 1MUUA 4UE3S 4X94A 5FX2A 2BHLA 3U0VA 3QU5A 4CLDA 4DR7B 1CEYA 1CR2A 3IS3A 4PRYA 1XE3A 2QTBA 3OY7A 3PDIA 4B8ZA 4EUKA 1J7JA 1E1MA 1EXMA 3G6KA 4WLOA 2PD3A 2JGJA 1INLA 3D6UA 4IZ6A 4GKKB 3BGSA 4QQNA 5C1OA 3NIFB 3MRXA 1MG5A 2B4RO 4GIBA 1HT0A 4IIEA 4JUFA 5K8JB 4X85A 4BGEA 2ALJA 4GZMA 3CJRA 5IAGA 4LDRA 3V9AA 4NWIA 2IV3A 3TFWA 5CCXA 2JVJA 4PLHA 1YZ3A 3FOBA 3I2IA 1RDFA 3VTKA 5JVDF 5K0EA 2PZ8A 3HJUA 2ZAOA 3HUFA 3UK0A 4XDZA 2GH1A 2AX3A 4F6RB 1UWKA 2OQ2A 4AJHA 2H51A 1IC6A 2AOXA 4XGQA 1T0HB 3V32A 2GO7A 1PV2A 1Q3TA 1LZLA 2C7QA 1Z35A 1Y1LA 4X63A 2WKPA 3N2GA 3A1UA 3U3DA 4WXEA 1Y42X 3IAHA 3SHFA 4XYBA 4QASA 3W8NA 1QV9A 1HDCA 4JVOA 2XTNA 4W5JA 5TPWB 4H4DA 2ES4A 1XDWA 1XTVA 3TW8B 1T0BA 4XQ0A 5KKCA 2I54A 3HE3A 3VX4A 4IO0A 2Y71A 2IW3A 2XCLA 3WADA 1QRTA 4BDTA 4AROA 2J4CA 1N0VC 4IVPA 7REQA 4A15A 1GLNA 2IWHA 2J0SA 4G37A 1E1CA 2F4NA 3C3CA 4UBMA 1JG1A 4Y2XA 1H0SA 1PG5A 3T3MB 1MIOA 1ZUWA 5B2FA 1POXA 5C7OO 1SG9A 2CF5A 3DEZA 3T9AA 1K7XB 1JFTA 4JBWA 1RI3A 3NTQA 5LA6A 4FMDF 4BLWA 3GFBA 3E58A 4U7PB 5AVWA 1YA6A 1L1RA 5HKLA 4WZAB 3EDMA 1YDEA 2EEPA 3SHVA 2D1RA 2WM2A 2IGTA 4JGBA 1KK1A 4FJ0A 4RH0A 3IUPA 2LIVA 3IDFA 2B1QA 2OT3B 5ESDA 4QREA 4V24A 4PC1A 1OH7A 1NQWA 1Q22A 2P9HA 3BZUA 4IV5A 5JAPA 1DOZA 2MT9A 2J5QA 1U1GA 2WVGA 5IVDA 2MYUA 2OSBA 2HA3A 1RWVA 3NI2A 3L9WA 2ZUEA 3GJ0A 4J1TA 1GNLA 4M8NE 4TMXA 5SY4A 1P2TA 3OLYA 1OAKA 3LOQA 4RLFA 4QUJA 3R5XA 1CY0A 3JTEA 5AVJA 4YPVA 1FNBA 2R2AA 3ZZNA 4ZKDA 4N0EA 4YC7A 3EIUA 3W1EA 3HI4A 3EF3A 1N8KA 2NW6A 1XFDA 1E0AA 3Q7QA 4K81B 2CLIB 3HBNA 2Q1UA 3DAFA 1CG6A 3GFTA 3MCWA 2ZI9A 1I0IA 1PR1A 3O2NA 2HO5A 2IUSA 4CKEB 3VC2A 4EKYA 1U0HC 1HR0B 2YJ5A 5AOAA 2H0AA 1NBIA 2HDOA 2ZAIA 4J76A 3QEKA 3PXDA 1GQRA 4PR3A 2GAJA 3C1TA 2ZDQA 4MV5A 2LBPA 2I62A 2OBNA 3ANTA 4KG7A 1EGHA 4B85A 3QIVA 1ZLYA 4K8RB 4CL3A 3H5OA 4UEJA 4Y2HA 3FW1A 1ICIA 1U7DA 1Y80A 3EPPA 3KKOA 1BE6A 4G5SA 4UPVA 2HRZA 1Y1RA 3WFZA 2B78A 1XX6A 4M0CA 4N5HX 2IDMA 3EHDA 1BS9A 2QSZA 3OKCA 2DFNA 3VNVA 4RPHA 4ZQIA 2XUAA 3H99A 3O1JC 2VQDA 3FBTA 3SJZA 3BIWA 2C9MA 1YDHA 2EZ8A 2G9RA 3DVRX 4MWGA 1V1RA 2EL9A 2WJPA 2KWIA 4PO3X 3UPTA 1H0HA 5HEKA 4RFLA 4QOJA 3M4YA 1GG2A 2ZLBA 1QORA 4FYMA 4WK6A 4WESA 2P3QA 4XCXA 5DTEA 2CMGA 1NBWB 2J1LA 3DC2A 4OJQA 1JJ7A 4EVSA 5G0SA 3O1HB 1D4ZA 3T3IA 1QIFA 3LC0A 2ZPAA 4AF7A 2IIQA 2CXPA 2P27A 3ANSA 3G2KA 1YI8A 1EJ0A 1CLEA 3R44A 2AJTA 2C7GA 3B48A 3K0CA 4K6KA 4RIHA 4CW7A 5IF3A 1GQSA 3Q0TA 4B1FA 4D56A 4RPGA 3BMOA 4D9FA 1L7MA 4AAYA 1TGYA 2VL7A 4H59A 1L1FA 2Z5GA 3I58A 5EMHA 2KHZA 4AL4A 4QDUA 1SUDA 3JYPA 1U3UA 3KUDA 1I4EB 4F2PA 3VISA 1VKJA 1K1EA 3SEAA 2UYQA 3U2QA 3PK0A 5LPNA 2AQ8A 3C3YA 4GPD1 2NUBA 3O03A 4ZAGA 4GT1A 1ZU5A 4I4CA 4LBVA 1Y6RA 3IX7A 4OHMA 1P19A 4X84A 1RXUA 4QT4A 3IAM6 4U1RA 7MDHA 4NR0A 1V41E 4FFMA 1FW6A 2CFOA 4F5EA 1MAWA 1MT3A 4RY9A 2PZGA 2EZ4A 2PWZA 5ALVA 1PJSA 2G07A 2Q3BA 1XP5A 5TJ9A 3CX6A 2BEVB 2P1RA 3TK1A 2O52A 4F71A 4PCLA 3GOHA 3MIIA 4LRTB 4BNUA 1PW7A 3MPOA 5FO1A 1KHHA 3EDQA 4IL5A 3QTLA 1C2YA 2WFZA 4KBYA 4M6WA 2BEWA 1MJGM 4N76A 2VWPA 3NEAA 2BFEA 1ICEA 1NAHA 4BO7A 4UVHA 4G84A 4IIFA 2CLSA 3K8QA 3V3TA 3MLBA 4KSBA 4B79A 4FFBA 2ZWOA 3FCAA 4M83A 3UJ3X 5HQTA 2NVOA 5A3QA 4BU1A 5KVSA 2PT7A 2XUFA 1OIXA 1ZU4A 1ZX1A 3H7IA 5EOVA 4GKAA 3ECAA 5KOJA 1NXVA 2O2JA 4WA8A 3E3AA 1XK6A 2F90A 3NHBA 2AZDA 2XMBA 3V8EA 5LUAA 2JLWA 1XTZA 4NDAA 1TVMA 5FI3A 5FPTA 1W36D 1J42A 2IV2X 3TUIC 3F7TA 2CHQA 1TJ3A 2Q62A 5I01A 1VDZA 3D2BA 2PUTA 3QEMB 2N47A 2A3NA 3QHAA 1HE2A 3S5JA 4FK8A 2D06A 2YINC 2ZVJA 3LHIA 1LI4A 3L0OA 4I6GA 2XUDA 3CNBA 3IPXA 4L5CA 4N0MA 4F4DA 3NHYA 1U2GA 1OWNA 1QAOA 4UC0A 3LUBA 4YRDA 5BORA 4F3TA 4LWOA 3GDHA 4CZ2A 3FSEA 1P7ZA 4L9RA 1RD4A 2V6GA 1A4IA 3N0RA 1DQPA 1DBRA 5IKOA 3Q40A 4HSEA 2A0XA 1T4CB 3AH8A 4QLOA 1X9GA 1KKMA 2X9LA 3FVWA 1V4NA 1H1LA 5IVIA 4U2BA 2EJTA 3AW9A 6PFKA 3G79A 1S8OA 1GTVA 4FONA 3AHDA 3Q5EA 3K5WA 1G3RA 4QJ3A 3PIRA 1YRLA 1Q12A 1Q3HA 4BVFA 2TRSB 1AH2A 3PL5A 3WR5A 1E2IA 3A3KA 1C3LA 1HE4A 5BY2A 2FQYA 4MHSA 1UBNA 5JMWA 1AV6A 2WMOB 5CJJA 1VYTA 3U16A 2VDKB 4XWOA 5BWCA 3KL2A 4HR7A 4U5QA 2R7NA 2J33A 5J2TB 3DBRB 3HKDB 3TW4A 4UAUA 3O94A 3TZKA 3LQKA 5IG2A 3O7WA 1XCLA 4YAOA 1IU9A 2HF2A 3AFIA 2O2ZA 4DNXA 1WZEA 2F43A 4E3WA 1G291 5G40A 4D41A 2CXTA 4EJ6A 5BW8A 3PDCA 4IH9A 2ZWIA 4M9SA 1OXBB 1P77A 3GLQA 1ONPA 3NRCA 4G2NA 4QQRA 1ZH4A 5F5NA 1RZRD 3KUCA 4KAXA 2Y1WA 3KU1A 1R9NA 1AB6A 1GU7A 3A1VA 3N86A 4BTVA 5IUJC 4QUHA 4NZYA 4JUAA 5FPHA 3ZEIA 1GXSA 1YL7A 5DGTA 3GROA 3URKA 1KE1A 3QZUA 4DUYB 2DUNA 5DK4A 2BGUA 4PO1A 5AVQA 1KYTA 1PDOA 1UK9A 2V7QD 2Q9CA 2X8BA 3L7MA 1AGXA 1Q91A 3DEKA 1USVA 1W76A 5ALKA 1CF4A 1JW9B 2MSWA 1FVHA 2QUZA 1P8JA 3K6SB 1JHQA 4R2MA 4X0EA 5E7JA 1FS6A 1FTWA 2PKYX 2XE6A 1RACA 4LXGA 4NNJA 3W6OA 1MABB 3LY8A 4MIEA 5FP0A 2D1SA 2C94A 4RTLA 4UU1A 1MJ5A 2A9KA 4XQEA 4M1EA 3ANNA 1SC3A 1HETA 1YJ8A 2W6JA 1PP4A 1T0IA 2ADMA 2VJKA 3MWDB 4UXIA 4C6RA 5FLKA 1O97D 1HEYA 3BXFA 4WXRA 4UBOA 1GTG1 1SVSA 3EC2A 4WOCA 5E9QA 1WBJB 2LWIA 1SD2A 4GBJA 2Y3IA 3LUCA 2C58A 4J8PA 4TLBA 1FRVA 4TN1A 3Q0IA 4EY4A 3VZBA 5TT0A 3SIWA 1E7MA 1H3EA 3VKGA 3DPIA 1Q0PA 3TPCA 1QOPB 2QF7A 2XNDA 1IIRA 4B34A 4D42A 3D6JA 1G6HA 5T57A 2QLBA 1IM2A 1X8XA 4OL0A 4M1MA 4GQAA 2JZNA 4JLWA 2QRVA 3QKUA 5D3QA 3QX3A 4G65A 4GXRA 2FSFA 1AQJA 3C43A 3VZDA 1QH1A 1M2HA 3BD8A 1IQRA 1GAWA 3IYLW 4PS0A 1SBHA 1KI6B 5LXTF 3U3ZA 3I62A 4IGIA 4BJ6A 3AF1A 3ZI7A 1PZMA 4BNKA 1S6YA 5ALFA 1GPDG 4ZVUA 4KPFC 1NZFA 2BZ1A 2VJOA 2GN6A 2XYHA 3D5EA 5AKLA 5IDYA 4B3CA 3QQ5A 5H7XA 4B3DA 4QYWA 4RMNA 4IZHA 3BOSA 3C6ZA 1Y1TA 2F9FA 4NCHA 3CF6R 5IMBA 1BHJA 1NV9A 3GLHA 4RQUA 5FQNA 3UY4A 4C07A 1O0CA 1M0TA 2HO4A 1IN8A 4E5DA 4HYEA 1CD5A 2VR1A 4H6PA 5KNLA 4A0SA 4RJTA 5FOVA 3BXZA 1OKKA 1YUMA 5EFOA 5J2UA 4IDCA 3L04A 3PC6A 3SZ3A 3KQLA 1VI5A 1WZCA 2B9EA 1M66A 2NU9A 4CFYA 2ZE5A 4DABA 2H17A 3E15A 3TQFA 4RS3A 3KYJB 1U0NA 4L7VA 4RK1A 3S40A 3PR2B 3QGMA 4PPNA 4MZDA 4PAGA 5MHTA 2V7GA 1F9EA 1C0LA 2PMKA 2FHPA 4ES6A 3AOEC 2FI1A 2MSKA 3H7AA 4QZVA 2I65A 2O7QA 2ZU6A 3D1VA 3G1WA 3MUFA 3JQGB 3ME5A 3O4HA 4QRDA 5DSZA 3TTUA 4D98A 4CEIB 1TAUA 1DSSG 4L02A 3I0MA 3WGJA 5FBRB 4B6QA 2G5TA 2OV4A 4UDXX 3D5TA 1A1SA 3FUWA 3AW8A 4C06A 1O57A 2B0JA 4MUMA 2W8BB 3O3NB 5D1NA 3KKKA 3LF2A 3D7SA 3LDHA 2ORVA 3OHMA 3QLEA 4PCVA 2OXIA 3V1TC 5KDLA 1UEXC 1RJGA 4EBBA 4L5JA 3IA7A 4G41A 4UTXA 1FQJA 3OETA 2VF7A 3L8GA 4L8VA 3VJMA 5J40A 1M5UA 2Z9DA 1V1JA 2O1SA 4NF2A 2WU4A 1WB9A 3EUFA 2O6HA 5BQOA 3RVRA 4U4AA 1SBCA 2HGSA 2X3FA 2ZB8A 3FRHA 3HL0A 1Q1QA 5FTWA 3DEIA 3Q6MA 2W4QA 4REOA 2ZJ1A 4AMUA 4C7BA 4MKXA 1BSVA 2ODPA 5K3CA 4UTRA 1UPUA 2GWRA 1AT1A 1Z5PA 1P62B 1M0WA 3N28A 4OBEA 5ECDA 3JAMA 1LBIA 1G8GA 4BOYA 4AY2A 1RHUA 1BRMA 2JIRA 3TECE 2YHSA 1JAXA 4YHBA 1OI7A 3TQQA 2XYRA 4OQNA 3RFUA 2X4LA 3E3LA 1MXFA 4KPGA 2XQVA 1L5VA 5HIKA 1KTVA 2B2CA 4H15A 4TRMA 4W9MC 1U0RA 4CCSA 4JU9A 3PPIA 1BEEA 1G6KA 1SXJE 3PX2A 2VHWA 3LNCA 1FP6A 2PSHA 4IDEA 4EB0A 1QRRA 2VO1A 2O23A 3W6UA 2LKDA 1N0WA 4IGEA 4BBZA 1ID8A 4OFZA 5IW8A 1SBYA 1VG8A 3TLJA 1LQ2A 3RHTA 3EOBI 2I29A 3C0KA 4OXKA 1KDVA 5JOQA 3QW2A 1BCRB 5TARA 3MLAA 4U7HA 1PX2A 3G2LA 4R8LA 1RJFA 4JJFA 4Q1FA 5KVVA 1ISRA 2W9XA 1K88A 4R0NA 3VPBA 3QE9Y 1IB6A 1K6IA 1ECJA 4DV6B 3IV7A 5BXYA 3N0TA 4KNYA 1JT2A 3UWOA 4YUYA 3GJ4A 3B53X 3U40A 3AM5A 1EFCA 1LTHR 1U7HA 4OJYA 1OB2A 1GCUA 5AI9A 2IUUA 1GEEA 5JJ5A 3IB6A 4MQ5A 1QIMA 5K05A 3MINA 4C3VA 1MHTA 3QMVA 3FMPB 3MWKA 3RIYA 2CMKA 1OI2A 1IPHA 4FE7A 2XUHA 3RUEA 3JV7A 4KPYA 2XAUA 1ZGGA 3B3GA 4Q24A 3LYHA 2IXFA 2V7TA 4C0LA 1SEVA 3L92A 4DPMA 4PYRA 3Q3CA 1GRVA 3JZAA 1KU6A 1C0EA 3SX0A 3GMDA 1S7GA 4L9SA 1J0BA 2WD8A 4DSOA 4IDPA 1IZ8A 2AJ8A 2C7RA 3CHYA 2G0AA 2QL6A 3EXG2 2CC2A 4D2IA 2P41A 2Z3WA 3GAMA 3COSA 1E5VA 2NACA 2V5VA 1E32A 3N0WA 3T9FA 5EUCA 4ZMBA 3OUUA 2GI4A 4NI5A 2NPOA 4OHXA 4UCWA 1HNXB 1H1DA 4RD3A 4LFBB 4H27A 2VHVA 4IJ5A 3QLVC 1MDFA 2R68A 4B87A 3WLQA 4NCBA 4ARCA 1KKLA 1DT3A 2Z2XA 3OZXA 2UYCA 4IZIA 2VRCD 2XHEA 2QHXA 3ETLA 2BFPA 1FS4A 2WEKA 4ZT5A 3RK0A 1UPTA 4FYVA 2D0OB 2I1LA 5ALDA 4CEHA 3PHJA 4MW4A 3FLBA 4OH1A 1G5QA 1Y9EA 3E81A 3QVGB 4JLMA 1RABA 1EX9A 4OHRA 4FEEA 1QZZA 4CIYA 3UUEA 3ZOKA 4BFSA 1QRUA 1A2QA 5MDHA 3EARA 4N7RA 3CS3A 3BSYA 4XKJA 4HFNA 4C7MA 1DCTA 4L4SA 3OZFA 3PQFA 3RVOA 1OTXA 1DMSA 3UEOA 1VLMA 4OSEA 3QE2A 4TQAA 3NR2A 4FDUA 1CUUA 1OXTA 1Y7PA 2BUAA 3PJFA 1J5PA 2BRUC 3DONA 4ZANA 1Z06A 3GJ6A 3H2BA 5SY9A 1VLLA 3KQKA 1YF3A 3KNZA 5LZ2A 2HCTA 5JG7A 1G3MA 3R7WB 4PX2A 1CY6A 2FQXA 1NVKA 5L95A 4F0JA 2WAAA 3BIJA 3RDPA 3DEYX 1A8IA 4KSYA 2I4MA 2JGEA 2OBXA 4QGGA 4MQEB 2IYUA 1E2JA 4R3WA 2IU0A 2BW0A 3CSUA 1B6TA 2VYCA 3IURA 4NAVA 3R40A 3NC0C 2DWPA 3RI3A 3QY0A 3WBFA 4OJKA 1UJMA 2PMEA 4AJNA 5HZHA 1ZW6A 4R40A 1UC9A 1Y3FE 3STUA 5JYCA 1VMIA 5CT9A 1WOMA 5DYGA 3ONNA 3FPAA 1ZW1A 1OAAA 1WLYA 3OAAA 3TDKA 4YREA 5EN4A 1AQIA 1AUOA 4CM7A 4ZC1A 5JJCA 2GHTA 3WGTA 2QUJA 4HXGA 1RYBA 4DA0A 3AR7A 3TR6A 3VXKA 4GOND 3FGPA 5D8DA 1IK6A 2V6FA 3JRNA 5F5LA 5FORA 5JHHB 3LPDA 4P84A 2A4MA 2DU8A 2PO5A 2NZXA 3GH1A 4HDSB 2R7LA 4U2KA 1LY1A 3RLIA 3PENA 2W90A 1N2XA 4GLJA 1J25A 3OPYB 4WZZA 3KDAA 3LP6A 3PLNA 4IJ6A 2VJMB 4LGCA 3FSGD 4QPZA 1ZIXA 1DZIA 3I9V1 1Q19A 1UFRA 1IN6A 3KDPA 4HXFB 3QUAA 4R8VA 1EGQA 3HKEB 3PFIA 4TKMA 1MJFA 3PQCA 4Z2YA 1Z0IA 4B6OA 4DV5B 5HXAA 3A31A 1H5NA 1UXOA 2JLAA 2LGJA 3C7TA 3R8XA 4AN4A 3EPJA 1M1YA 1Z74A 1PFWA 3KQVA 4B35A 5EXXA 4LX0A 4NAUA 5IYZF 1PZFA 3CVVA 2BPOA 1K3TA 1JFSA 4BL5A 3QELA 5A4FS 3A04A 1HTBA 2AJDA 1FF9A 2PK3A 3FRIA 1AHHA 1Z0SA 2QRHA 1KZ1A 1RQLA 3K0AB 5EIHA 2GZMA 4E31A 4X6UA 4EY7A 1BJTA 4OQDA 5FWXB 3G82C 3AM3A 2QLMA 3ZCXA 4CF6A 1GA4A 5IKPA 3G9QA 3VPSA 3A1WA 3GLGB 4S24A 3TBHA 1EUDB 5JZOA 2O54A 1QIIA 1V1MB 3CCFA 1LPOA 1NAIA 3TCKA 1O89A 2H00A 3K0FA 3MQ2A 5CPBA 5LB2A 4AJLA 4BIIA 5IT4A 1EUQA 4I4NA 4Y7CA 3W6ZA 3PUYA 3Q5DA 1CEEA 2JGDA 4H16A 4KH0A 1EGAA 2QN2A 3T12A 4NBLA 1Q44A 2GN9A 1A76A 3LW8A 4WOPA 5CHYA 2CUKA 3Q5GA 5FEMA 3ETJA 2CNWD 3FZEA 1P5HA 2F3QA 2Q1WA 3AHHA 1V4VA 3GLFB 4XD2A 4H7PA 4N5DA 2HUPA 2HQRA 4L5AA 2DTEA 2ZR0A 1L7EA 2HU7A 1T8SA 4GG1A 4XTRA 4TWRA 1U28C 1T36A 2CDNA 4LE1A 4UNIA 5FWAA 3WO1A 2GBLC 3ZHXA 4E5UA 3X1DA 2RG7A 4BRWA 2KI5A 1JIJA 4Z9YA 1DVRA 1JLSA 5JAIA 4DEVA 4R51A 4P4TA 1O03A 1YZHA 3ZVRA 5K3EA 5JJBA 1IATA 4M1QA 2YVQA 1BGWA 3TR5A 1FB5A 1L8OA 2D3TA 2SKCA 3IEIA 2P6OA 1Q84A 2QDKA 3RIMA 1H85A 4KBGA 5F9HA 4J0DA 4X1YA 2UXDB 1T34A 1JSRA 5TNXA 3ZBTA 2P1ZA 2VDOB 1NDHA 3JZIA 5FUWA 4YWHA 2YZ2A 2F17A 4ZMRA 1N5OX 2A78A 1A2BA 1I1QB 3N59A 3PDWA 2YZNA 4O3FA 1BEUB 2IS4A 5C3UA 2IYOA 1TLFA 3GN2A 3EE6A 4FGZA 4J3NA 4QBFA 1XMJA 4EG5A 1G4UR 4GOOD 1H66A 4PGGA 5EE1A 2IYRA 3OEYA 2SKEA 3H5TA 2IPMA 1OC2A 4H18A 4OMDA 4LI3X 1E3WB 1MOQA 4UEOA 1VCHA 3A1TA 5C34B 3UJ7A 4CKBB 1HQYE 1T2FA 2FPWA 2HFJA 3AVQA 3KSZO 2FP4B 4EDFA 4HNUA 4GLOA 4Q34A 3UT6A 5H4HA 1MB0A 4JHLA 2BP7A 5B58C 1JDPA 2BSAA 4O2AA 4MV1A 4PXSA 3WGKA 2AKAB 1TE2A 2O1WA 3T4EA 4KIJA 2UZ0A 3L0IB 3KJNA 3OOHA 1DARA 1G3QA 3TW6A 4RQAA 2GAIA 2F8LA 1GKLA 3FBGA 4YRRA 2FR8A 4PANA 3KEGA 3OWXA 1CTQA 3O84A 4GLBA 3SI7A 1YOVA 1LQUA 3B6IA 3HJBA 4W6QA 1B0AA 2JIZD 5ETJA 3DZKA 5LA6F 3I12A 4EMSA 1WPXA 1T5LA 5B1EA 3JASB 2I2BA 1WEHA 2W6IA 2O05A 1N5RA 1KQNA 3UMGA 5DRTA 4O2RA 2LDXA 3HDQA 3N2YA 5SYMA 3VNAA 1GRCA 5EPOA 5A4AA 1M5TA 2VP3A 3EXG1 3PNKA 3KL4A 4RV4A 3ROZA 2XX3A 1NX6A 4DLBA 2H4XA 5BPFA 2X0NA 4PFQA 4YRGA 3HN6A 4JLPA 5KJCA 5JSUA 1NDQA 4NZOA 2PPLA 2D8AA 1ATZA 3FRJA 4HB3A 1THZA 2EJVA 3LGSA 4KRFA 2ZB3A 4YCAA 3ZW9A 5AUPB 1WCIA 2J3EA 3ZHVA 2JF0A 3DJYA 2LP4Y 2X6RA 4RIIA 3H5IA 4O1MA 4DLRA 1ZJYA 3EIWA 4DUZB 1U5AA 1M0EA 1CETA 1VLVA 1AN9A 2H29A 4N47A 1RI5A 2ZRKA 5D2CA 1D5CA 4C4TA 2D3WA 1NMSA 2HSJA 5LBUA 4TPKA 1WZNA 2Q5CA 1IULA 2OLEA 1DRVA 2EF0A 3U3OA 4ACBA 2G1KA 4HCJA 2XCOA 4W5OA 4UEKA 5BMVA 5CA1A 4AJ1A 5HJ5A 2WY2D 3U4CA 1CS0A 1FSZA 2A5LA 5C81A 5JV5A 3NS7A 4WAUA 1HOTA 3G88A 4Q1CA 3RWMB 2ZRAA 4JL8A 3BVPA 1WNFA 2B5VA 4HQOA 1EFHA 1M1NA 4OXRA 3GNSA 3FWKA 3AI1A 4ALJA 2VJYA 1NF8A 1CWUA 2B8NA 4ANFA 3PC8A 5ICEA 1Z6TA 3OU7A 1MC4A 4L6CA 1P17A 1T1EA 2Y4OA 3NTUA 4AUNA 3QVTA 4DDMA 3EZGA 1ENOA 1TYBE 1N1EA 1HYEA 1FOEB 2ENUA 3A58B 1KQPA 1KZ7B 3GBVA 4LF7B 3O5AA 1LX6A 1HG1A 2NO5A 2YIDA 4INZA 4KTVE 3OT4A 5AVYA 1NUHA 1VTKA 2QDXA 3SF8A 5JIBA 3OCJA 3WO0A 2PX2A 1UKBA 3C3KA 3RWBA 3SMQA 2ZUTA 2ZQYA 2QP3A 3I76A 3QPDA 1YOBA 4LYAA 4M37A 3USZA 3ZTYA 2FWMX 1NVEA 2O1EA 4YVFA 3ORSA 5FBKA 3H5NA 4ZYZA 3GLRA 2N75A 3Q6NA 2RSLA 5B6IA 1Z0DA 4XIJA 2FQQA 1PHRA 3Q85A 3A11A 3T4XA 3NMUF 3G5LA 5E95A 4BDSA 3W7VA 1FLDA 1Z15A 2I34A 4C4PA 1XYVA 4G8BA 3VC3A 1E2HA 2ZJAA 2H08A 1PJ8A 1UPXA 3KQNA 4HLUC 1Q0SA 4JB0A 1Y4UA 2WD7B 3IP8A 3U4QA 2CMDA 3HB1A 3TNJA 5C2JB 2JHAA 4BKPA 5CM8B 5DK6A 3KXKA 1NNLA 1B14A 3QKIA 3E9MA 1RMTA 1IJEA 1KQOA 5DVZA 3LHKA 3FWYA 1ISSA 1K2WA 1SBTA 2HPHA 2LTAA 3HADA 3IERA 3O91A 4Z99A 3SSOA 4F2HA 1CEQA 4IUCS 4W7SA 5ES3A 5BRAA 1KVRA 4FFOA 2QVZX 3K1YA 4EJSB 4HUTA 4JYPA 2MR6A 3DTYA 1E1RA 5IANA 1OVGA 5K0GA 1HDEA 4F11A 5ALHA 3DTVD 4JC8A 3PQ5A 2SCUA 4J1SA 4C5BA 2YMMA 2IYFA 3R0QA 2DECA 3EULA 3UAGA 4HLDA 4DBVO 5A6VA 1Y98A 4DNQA 3BL5A 2CT8A 3UWPA 3ABRB 1KI9A 2CK3A 3C8ZA 1JQDA 4DM7A 1NMZA 3O8LA 3P0RA 1CB7A 5F98A 1PL7A 4E7PA 3SXPA 4F4CA 3KFLA 3LP8A 4GXQA 4RD2A 4ZOQI 5BVGB 4CEJB 2CVQA 1U0OC 1X0XA 1I3CA 3C15C 3CVOA 2VG8A 1TUBA 3IIEA 1XROA 4H7EA 2C2MA 3OIYA 3RB8A 2HADA 2WZBA 1IHYA 1AMUA 5KTYA 4HQLA 3HDYA 4KDEA 1UWVA 2I22A 2JH9A 4KNVA 4TL6A 4PXYA 1E60A 4R1TA 3MJ4A 4CBVA 3EUWA 2XCUA 1QFMA 5GOTA 2G82A 4P3YA 1ZK3A 5EWJA 4YJHA 4NLLA 4CI9A 4IR7A 4YRFA 1I3LA 2X0RA 2ZIXB 5C80A 1PSDA 2ZM5A 1NF9A 4KVAA 3ESDA 1MX9A 1XJ5A 4IDGA 3D4LA 3P4XA 4CT4B 4XFJA 2HDHA 4OHVA 5LOVF 1ZZEA 4RKFA 1TPYA 3CNOA 4FX5A 5CB4B 2BYTA 1YHNA 5AESA 2V6MA 4N40A 5K4AA 2HSGA 3U5ZB 1F9AA 2JBAA 5DO9A 3TAUA 2X42A 2X19A 4IRUB 1BWSA 1EA5A 1RAGA 1F51E 1JDSA 3DLPX 3V2UA 1HGXA 3LMKA 5CFZA 1OJ7A 2WHQA 2YYYA 4MS3B 4G9BA 1XCGB 3RYCA 3TFOA 2XUPA 3CONA 1F2TA 1NVAA 1M8GA 3CNEA 1YB5A 1AGNA 5E2IA 4D0RA 3KQQA 2ONYA 4MQUA 4UBJA 4AJKA 4LIPD 3LFHA 1QGDA 1ETUA 3JD2A 1G6OA 1I7DA 1ZVMA 2XNHA 3ABIA 2Q27A 2BKAA 3LY5A 4WK2B 4HDCA 1T5TA 5AW6A 4GL4A 3SZOA 1Y4SA 4LQCA 4QX6A 5FBZA 2QG6A 1L4NA 3TIGA 4DYVA 1JH9A 1QTQA 1QVVA 3GMTA 4L0DA 2FWNA 3K32A 4KDCA 1W36B 3DJFA 3K94A 1TC2A 3VA7A 3LIIA 2E2WA 3KTAA 3QE0A 2VNAA 4PBRA 3A27A 3WJ1A 3FNEA 4I81A 1Z83A 1Z2CA 2BLLA 2IHYA 2DRIA 1T5DX 4CF3A 3MHTA 1G60A 1X7ZA 4V38A 5DCWA 3H2SA 3LT0A 2BF4A 3HJNA 1NF3A 4L3WA 1NQAO 1T25A 1T4GA 3C39A 5I7WA 2VP2A 4Z9XA 1ECPA 1ADCA 1V11B 4DG8A 3RG8A 3HA5A 1E3QA 3EEIA 4JBIA 1OLXA 3ED1A 1KIAA 3VU3A 4ARIA 1LC0A 4J1QA 3NQ41 3LK7A 1MQ9A 4UTOA 1XF9A 1J2EA 1JIUA 3OIVA 4CM1A 4LF4B 1SKYB 1EHCA 2BGLA 2NTYC 3V34A 3VZPA 3ANYB 5CURA 5B3KA 1DCKA 5LQAA 1H8ED 1XXHA 1AHNA 1A5TA 2FSGA 3DMPA 5CYPA 2PWPA 5CM9C 2PX5A 3WSWA 4BX8A 5CLLA 4RTNA 3FWNA 3BKXA 1AUVA 2WKSA 4MCHA 3WTBA 2XMZA 3T1QA 2BFCA 3PNQA 5EVCA 5DRYA 4BJHB 3ES9A 2YIMA 3D3QA 5DV9A 3ENVA 4GOLD 5AUOB 5CIWA 2ATCA 2NPIA 2J5XA 1PGNA 2W6ZA 3B6JA 1AIPA 1S8FA 1ZN9A 4HXYA 1SQ5A 4H3KB 3QEOA 2AN1A 2ZJ7A 4PYKA 5F77A 5TMBA 4DW8A 4F5WA 2X7JA 5K0TA 3NJ4A 4P1ZA 4X6LA