3LHIA

Crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
231
structure length
231
Chain Sequence
MFVWHEYENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRSPIAFFNALSQKDLDWKNVGITLADERIVPTNHADSNTGLVREYLLKNKAAAAVWIPMVEDGKTETELHPDAVVDYALKHYKQPDVLILGMGNDGHTASIFPKAPQFQTAIDGSAGVALVHTTPVTAPHERISMTLDAIAHTGHVFLAIQGEEKKAVFDQAAQGENREYPISLVLNHQGVNCHVFYAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative 6-phosphogluconolactonase
publication title Crystal structure of Putative 6-phosphogluconolactonase(YP_207848.1) from Neisseria gonorrhoeae FA 1090 at 1.33 A resolution
rcsb
source organism Neisseria gonorrhoeae
total genus 77
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhiA00
2OKGA 4L50A 5HJ5A 3ENQA 3EFBA 1KS2A 1FS6A 3KV1A 3E7FA 3LHIA 4L4ZA 3EB9A 4TM7A 1XTZA 4IO1A 1FQOA 3BXEA 1M0SA 4GO1A 3U7JA 1CD5A 1UJ6A 3CSSA 2J0EA 1UJ5A 2O0MA 3OC6A 2R5FA 2RI1A 1FS5A 3BXHA 3HN6A 1VL1A 3BXFA 2W48A 4L4YA 1JT9A 3KWMA 3ICOA 4R7TA 3LWDA 1DEAA 2GNPA 1LKZA 1PBTA 3UW1A 3ENWA 4NMLA 4L5JA 3TX2A 3CH7A 4TM8A 4L5IA 1HORA 2RI0A 2F8MA 3NZEA 4X84A 3E15A 3BXGA 3NWPA 2WU1A 4OQQA 3IXQA 1NE7A 4OQPA 3ENVA 4L51A 1LK5A 1FSFA 1LK7A 2BKVA 3L7OA 3HHEA 2BKXA 1HOTA 1UJ4A 4R9NA 1FRZA 4M8LA 1Y89A 1O8BA 4GMKA
chains in the Genus database with same CATH superfamily
2OILA 1I6WA 2R7LA 4RVDA 2Z6QA 3AVQA 1JJBA 4MICA 2QUJA 3Q7IA 4RHUA 3TBKA 1Y98A 3QLVA 4LJYA 4OAOA 3WK5A 5IT4A 2ODEA 4KVFA 2ZS7A 2NXCA 1U9ZA 2M2IA 3BPSA 5B58T 2WSSD 1L9XA 4RKFA 4UQPA 5AT1A 3HK2A 4TZ6A 1GU1A 1FTQA 2NU7B 3D4BA 4HZIA 3O2JA 3EH1A 2QJWA 4S1PA 3TI9A 1FCJA 4DCUA 1W9HA 4Z99A 2ECPA 2ID8A 4J94A 3I3SR 2W70A 4Z7NB 1PSDA 5M29A 3NEJA 2ISSD 1O0BA 2LZ0A 5IH7A 3ODPA 1MP0A 2DU8A 1ADCA 1H2YA 2GPYA 2XKAA 3GD7A 1SCDA 5I45A 1KNQA 4F4DA 1ONOA 3AY3A 3LC2O 3ZWWA 2ZWVA 3QI2A 5I7FA 1PFUA 2DR2A 4TZKA 2GERA 4H27A 1UAYA 3GFBA 3TTTA 1PJ2A 1N2GA 5DXAA 2RGRA 5B1EA 2KLBA 5D6NA 4C0LA 3HYNA 2GN8A 2FR0A 4CMGA 5HF5A 4H6PA 4YXWD 5KNCD 1YC5A 2GZ1A 3DWFA 3EA5A 1C0KA 1SVMA 2IXEA 3AWDA 3LA8A 1W88A 1Z6PA 5KINB 2CMKA 3R75A 3ADDA 1F4LA 4JI4B 2PRSA 2W0MA 1Y3CE 4YN3A 2BP7A 1EUZA 4LFAB 1T6BY 4KIWA 3RI3A 2HYIC 4OHBA 1ILEA 4ND7A 1ZFNA 4M60A 4X54A 3NVDA 4ZJZA 1IDOA 3KOMA 4BO9A 1OLSA 2DKFA 6CHYA 1XEFA 4GWLA 4KDEA 5TLSA 1I2BA 2IOFK 5LMUB 1KEZA 5HF6A 3AK4A 3GUYA 4CKBB 3KB2A 3MCAA 1TFRA 3QEAZ 3CJQA 5IJ9B 2BFDB 3H5TA 1YZKA 4HQ0A 1EK2A 4Z49A 1C8KA 3DVSX 3G0DA 4M9CA 4TVKA 1FTGA 1PL7A 1Y1TA 4RESA 4WW0A 4YJ3F 3SSMA 1DWOA 1LPOA 3CNHA 3LDUA 5TQJA 1CS0A 3NOQA 3DLCA 1Q92A 1E89A 4UUPA 4P8RA 4ZT7A 4L8LA 4D8UA 4OATA 2AC4A 4ARZA 5CA0A 5IHXA 1HORA 2ODTX 3L49A 1IL0A 3QE0A 4KH1A 4C88A 1VKNA 3OM8A 4M1ZA 4MITA 4QAQA 4YJDA 4YMWA 1GL7A 1VA5A 1LBSA 1OWLA 2H51A 4HDRB 3OQPA 4FOTA 3E15A 3OQJA 2PXAA 2IDZA 3OZTA 4U6SA 5DYWA 5FLKA 2DPGA 3ZCRA 2HU5A 2R6AA 4QYIB 4IQ8A 3FHOA 2CVPA 5KUTA 2A9PA 2ZR0A 4LJAA 4ZRMA 3BRSA 2VWPA 3BN3A 2Z30A 5ADWA 5CBKA 1OH6A 1E4EB 3OM1A 3CZ4A 5FBQB 1LDNA 4K26A 1V16A 4MAAA 1P2GA 4RSHA 3SF8B 5KNDD 1U6JA 2R79A 5E1BA 1G1MA 4QU5A 1XTUA 4TTPA 4F3KA 1ZD3A 2QS9A 4CR8A 3CNLA 1JHQA 4BQFA 5CFOA 1ESMA 2BKXA 2HMAA 4J0FA 5KYKA 1X2BA 3JXEA 1WHTA 3EFEA 3FPCA 4KCGA 5H80A 2VQFB 2GJAA 4GQIA 1FSGA 1RLOA 3A9WA 3EJWA 1BDBA 2XDQB 2Y1WA 4IDEA 1H6DA 2AN1A 3BSWA 3W9SA 3ZD9A 1ZPDA 1P77A 2NNLD 1UT5A 3NCTA 4FFDA 1JJ7A 2HHAA 5DTQA 2IIQA 3TX6A 2D1TA 2JFOA 2FXVA 1R9JA 2VDMB 4WN9A 4BNIA 5GONA 4NG5A 5ITZB 3MM4A 4KJXA 3UC9A 4GM1A 2JAPA 1ZR4A 1TC2A 5ALXA 3VVLA 5LWHA 1X38A 5IDWA 4DXDA 4MGZR 1VFPA 4ZXPA 3SXPA 1PNRA 1XZQA 5BQ5A 1KGSA 3EW7A 2QLLA 3F46A 4O2BA 1G3RA 2O0JA 2VP2A 5ALKA 3W6UA 5AHXA 4YUYA 1MC1A 2HSJA 3GYGA 3L4EA 2VHTA 5AKJA 2HCRA 1JJAA 2JLYA 3CLHA 4Z9AA 3JY6A 4FSDA 5LUAA 2MSEB 4HH0A 5TPWA 5HNKA 1ISRA 4DSAA 2IS4A 4V0OA 2XYRA 1SIBE 4D9NA 3EMDA 4ENRA 2QVCA 8OHMA 2A9VA 5HIKA 3UAWA 3LQ2A 3EPKA 4E5UA 4Y2QA 1JT2A 2D3TA 3HWX1 4HAWA 2OCPA 4UZSA 1KSFX 1ZH2A 1PHPA 2YC2C 1NV8A 2YX1A 2PZMA 1VSUA 2OK8A 2OVFA 3LUPA 5JQGA 2H2WA 2ZETA 3CINA 1ZIYA 3OJWA 4EARA 1IN5A 2QORA 2Y1FA 1WULS 2ZR8A 5LOVA 3OIFA 2EJTA 1CUYA 3QELA 1FRFS 2PX4A 5LPNA 3I4LA 4X41A 1P0IA 2W2VA 3P9NA 4W7IA 3X1YA 3AUUA 5IPFA 2QTWB 2XBMA 1JIJA 1T2CA 3WHIA 1UINA 4BJ6A 4JWKA 2UYHA 3MQFA 2MINB 1J25A 3A6DA 3M89A 5JR3A 1UBRS 2D2EA 2P69A 3EMKA 5CTAA 1IVYA 4HNVA 3DZKA 4IR7A 1GZVA 1AGPA 2YHUA 1Y3FE 3OWHA 3PNLA 3JVDA 5HM8A 2VNSA 1K66A 4U7GA 4EH1A 4ZCTA 5HRCA 3IUNA 1NOJA 4L6IA 4WJLA 1Q1NA 2DKOA 2ZVQX 3NHAA 2VRNA 5FOTA 2BHLA 4D42A 1YR6A 1JQ3A 4W1QA 3ED5A 1D5CA 3S1AA 5EL0A 3DFFA 4IYJA 5CFMA 2JGKA 1L1EA 2OHVA 221PA 4A2CA 4HVCA 4QUIA 4JYAB 3NHJA 3SN6A 1XLWA 3HKCB 3DYIA 3ZKAA 1OH5A 1RPTA 3HC7A 1USWA 2XMDA 3EUEA 4W9NC 4F1WA 2MU1A 2YHSA 4A5OA 3MEQA 4ZZ3A 3SHOA 2XKBA 2Y1OA 3WL8A 5CVEA 3FGOA 1JE0A 2CYCA 3B78A 2GBLC 4BLOA 1KIMA 5IM5A 2PGAA 4YB8A 4E31A 3QWAA 1BHJA 2GVZC 3U6KA 4NEHB 4LGYA 5EAIA 3PXUA 3SY8A 2IZ1A 3C3BA 3MWFA 1O03A 4RFSB 5LA6A 3RWMB 2WT8A 4QUAA 4RVCA 4KRFA 3UWKA 1OZFA 3HFSA 3TZEA 5DLEA 1UDAA 2BF7A 4TT8A 1PKXA 3VAAA 4C4OA 2GAJA 1V11A 5FXMA 3O31A 3RUCA 4Q3DA 3DAGA 3RTCA 2V6JA 2JFXA 1PKEA 3MMXA 3AR7A 4JX9A 2DFNA 4JBGA 4V02A 4UTZA 1UMDA 1NXOA 3QPWA 1X9IA 3AGPA 5AVWA 4RXMA 3TCXB 5BYAA 1K3TA 3FSGD 1C9DB 2ADMA 4QC2A 4IJ6A 3T12A 5HMLA 5J47A 4UATA 1XQWA 2P6MA 3SE7A 3T38A 4UTRA 1ZRHA 4JHLA 1DBVO 2I71A 3QVTA 2B1IA 2JIPA 5ECDA 1YO6A 3D8SA 5KTNA 3ZN2A 3LBIA 1Z0IA 3BIFA 4QJ4A 1BW9B 4A2PA 1EFUA 2CFSA 1JILA 3BWBA 3KJHA 5JQWA 4IOLA 5IAGA 3ILVA 4DL9A 1FNDA 4N3NA 2PTHA 2DWOA 2FUG6 1NP6A 3KOZA 3GFOA 4HWRA 1AB6A 4QFDA 4TM7A 2BZ0A 4V03A 1DWQA 1BGXT 3DQPA 4QECA 4KQWA 3EG9A 3KYJB 2IYNA 3PRYA 3CWQA 5J2UB 2FGKA 3ZH9B 1HY3A 2ABWA 2HBZA 3IVXA 4G2TA 4GGOA 4AJ1A 4OUDB 1LX7A 4AMVA 1ZAYA 1VI6A 1H5UA 2HNAA 3MOSA 3BTUA 3IUQA 4KFUA 3HJNA 3GIDA 2J9FA 3BCHA 5DNWA 1W36B 3L7MA 3L6CA 4IS3A 2C3PA 2AVNA 2Z83A 3GJ7A 1GCOA 2FLVA 3PJFA 3RS5A 5JCPA 3PNYA 1IVNA 4NLLA 1CG6A 3WGUA 2PKQP 2YWEA 5TE9A 3WJAA 2TRSB 3VHXA 2PH1A 3LUAA 2R44A 2AYYA 2QRZA 3ESQA 3BXFA 3WC4A 1UXOA 3GCXA 4QOSA 2IYFA 4HH3C 4EVSA 3NLLA 5ICEA 3TKAA 3LMKA 1T25A 2VFAA 4IGFA 5CXUA 3SGLA 3ET5A 4GXTA 1UFKA 2I3BA 4QYXA 1Y5LA 1RI2A 3MRSA 2YN4A 3PFGA 2DJ5A 4DABA 2NTVA 2JPDA 4YV1A 3S5JA 1V9LA 1RI5A 1GUAA 5HOEA 1Z7EA 2WYUA 3OSUA 1KEEB 3CISA 4D46A 4ZMBA 1SZJG 4P5EA 1ZQ9A 1H4QA 3VVBA 4E30A 3K8QA 4DB2A 1EEHA 5DM1A 3MOGA 4C4RA 2GZAA 4LOAA 1KO5A 3BJIC 2QPAA 2R6HA 3D8NA 4Q39A 4ZVRA 3R7AA 4RNDB 4L5IA 5B3LA 2WC1A 2PK3A 2FG5A 2FUKA 5A3SA 1F5NA 8AT1A 3LNTA 1C3OA 1E2BA 1IFXA 3H17A 2HFKA 3OPVA 3KLOA 5AM3A 1D5WA 1I36A 3CSUA 3IE2A 4OB7A 1A3CA 1E3DA 2AFIE 1O6BA 4FE7A 5L53A 2NO1A 4Z2YA 4BOYA 1RYZA 2PSJA 2QK4A 3EY4A 5ER9A 2FVYA 1N6NA 1KL7A 1WXXA 1KZ7B 4TYQA 5DWDA 4QSHA 1VXRA 3OZ7A 4GS5A 5KQMA 3TG2A 3MJ4A 3TQSA 4HLCA 4YI5A 1PJ8A 3K5WA 4IIJF 4CTMA 2R47A 1LI5A 4W5WA 5BWCA 1J8FA 2VK8A 3JQDA 3DZGA 5ES3A 4C2TA 2HPAA 1E2LA 2PGIA 4C4YA 1IHYA 1FP7A 1TTPB 1YI8A 2VYNA 4K8RB 4B3JA 1RM3A 3NC4A 2UYOA 4JYBA 3DE7X 2SKCA 3HP4A 3R6WA 4M6WA 5NLLA 3D6FA 3GUHA 3I9JA 1T1EA 3K1JA 5H3LA 3QIAA 4DIOA 1DXOA 1JJVA 5A1JA 1SD1A 2HDHA 3T06B 3G7SA 3PFHA 5E4FA 4B6GA 1WCV1 2X0DA 1PT8A 1DKQA 3C6ZA 1B15A 2GEBA 2CCJA 3ANSA 4H4DA 4ABYA 5JY6A 1NJ8A 3CH4B 2ZI3A 4H4EA 2DY1A 4S0ZA 3X1ZA 1VLJA 3SEFA 1XNRB 4RAOA 1FJ2A 2V7VA 4KLAA 3KE9A 1T5IA 1ZMXA 4MZXA 1GZUA 2C9YA 3ADOA 3TEJA 2HJHA 1J24A 3RC3A 3V8QA 4D0RA 1IZYA 1HZZC 1H42A 5HX7A 4DB4A 4INJA 3D7MA 4YRDA 2HF8A 3VR4A 5JMOA 4XM2A 3H9QA 3VO1A 2CNBA 1BNCA 3KETA 5IC6A 1T6ZA 3HBAA 2H2HA 1HURA 4IYRA 3QVXA 5U4QA 5KOJB 3AF6A 4LMPA 4LJRA 5IT9A 3DTVB 3IKMB 1R9MA 1PNTA 2P6UA 4RIHA 3OFND 4W5OA 1TL7C 4HNAB 4EAAA 1VHLA 4KO2S 3ICWA 4Q1FA 2WKRA 4TL8A 2BGGA 1L4GA 4BX8A 1Q0UA 2C42A 2OHJA 2A6PA 2PXXA 3NRBA 3GU3A 1ZK4A 4FC6A 4G5XA 4PLVA 1U63A 2BUCA 4XLZA 3BMQA 3GJSA 5F3RA 4BMDA 1SKYE 3OE5A 3UV6A 3NFRA 4AZ0A 3A9CA 4DR2B 2C5SA 4A8HA 5E95A 2RHLA 3DULA 3DV0B 3KT3A 3HJAA 1FVHA 2C2OA 3UWDA 3EG5A 4N39A 4YAFA 2GILA 3S70A 4FQ7A 1UC8A 1K08A 4OHMA 2ATXA 3A6EA 2Y76A 2J7PD 5LB2A 2HWWA 5GGYA 3O6VA 2D5BA 3JQFA 2WM2A 1VI5A 3IXLA 5EE9A 1A5SB 1V8BA 4KPGA 1MC5A 4Z0HO 1QH1B 2J48A 4YVFA 1NM5A 4NCHA 3VR6D 5JUWA 1C2YA 5FR1A 1M75A 2WG2A 2QSJA 1ZVJA 4UCXA 4BFVA 2VDPB 4Q4LA 4RLFA 3HM9A 1R5NA 1XVUA 1T5SA 3E9RA 4B73A 5EP1A 3TQOA 2PY6A 2I34A 1YRAA 3TIIA 2FN8A 2C2HA 4Y2VA 1I7LA 3QJGA 1RYDA 3AP2A 2B35A 3VYSB 2IU4A 3PQ5A 2BDUA 2WJGA 2QQGA 1P4AA 2NIPA 4TLDA 1N3BA 3G0BA 4ZVTA 2DHCA 3IP5A 3QIVA 2X8JA 1R27A 4MV0A 3PXXA 4LVOA 3CRQA 3JX9A 4NCNA 4MHTA 2QW8A 2I0FA 3WP0A 1ITZA 2BVNA 4YT4A 2QG4A 4GKBA 2GX6A 2C9DA 1LDBA 1DGQA 4CKWA 2G8LA 5JDCA 1AXEA 2WSIA 1FP6A 1R7RA 3ZGYA 3I39X 4OHRA 4I19A 1DC6A 1YB5A 2NVUA 3D0QA 3V7NA 1SBQA 1DELA 2DFLA 2WSLA 1FYDA 1MNQA 1K89A 3D7NA 1L7VC 3PBKA 1YBMA 1AURA 2J3HA 2ZVDA 3FPEA 3IQZA 2FWBA 4EA6A 5IUJC 5JHHB 1HG0A 3KJIA 4PC2A 5JJ5A 3HXOA 2YY5A 3DLHA 1UPTA 2FUEA 3QUSA 3I9V1 1XQ9A 4YJ2B 4LSMA 3TCKA 1SBTA 4UVHA 3L0CA 3ZDXB 4ZIRA 4P7GA 1Y89A 4H7IA 4IHKA 1KVRA 2BW0A 3LBAA 4X63A 4G24A 5F52A 2H4WA 4C6RA 1R6BX 1EJ0A 3EQ6A 4RZQA 5DU2A 5C1PA 1SCUB 4O4LF 5BV8A 1N2IA 1S6YA 2X4DA 4JITA 2CSXA 3M8KA 4KU4A 2ZBVA 3VR3D 4HYEA 1BVUA 4JB3A 4HRVA 5B2ZA 3HJRA 3F6YA 5FNVA 4MR9A 1J2JA 2TECE 1T8UA 4JELA 1V8ZA 4JYCA 4OL0A 1HLPA 1NC3A 1FLAA 4ROTA 3QU9A 5AK5A 5ALPA 3EB9A 4INZA 2HXSA 5FIUA 1B00A 5C18A 3RT7A 4ZZ1A 3FOZA 2B4QA 4ZCPA 3A4YA 3GZNB 5IAKA 1W0JA 2X5KO 4DV1B 2HHJA 2P9FA 3GJZA 4XI9A 2RIPA 4KPFC 5EGSA 2NV6A 5KJFA 1LZKA 1PZEA 2A5LA 2QRJA 4F12A 3GDFA 4MS1A 3AVTA 3NC1C 4EEXA 2EZ9A 1II0A 1ML3A 3IPAA 3OO1A 5KVVA 3WWDA 2HV9A 3T94A 3FCEA 3H8JA 5A6SB 1SOAA 5BR7A 2DLCX 1XLUA 1KZ1A 1JZQA 5CT4A 5M04A 3T54A 1XP8A 3TLKA 4TV9F 1NPYA 1OY1A 4L76A 3AUAA 4Q7MB 4RL6A 5MN4A 3O03A 2RBKA 2XMBA 4IFBA 4YCJA 5E7MA 4DXHA 3QX3A 3VO2A 4NYIR 4CNBA 1M34A 1CT9A 1O94D 1A27A 1FTWA 3DLPX 1LJLA 1XRLA 5EHNA 1G291 3EGDB 3QXJA 1M0TA 2IH5A 3IDFA 1DV2A 2ONKA 2NVBA 2J1LA 1XRJA 2E4UA 2GRAA 4PC6A 2XTJA 4BVHA 4RW0A 1CQJB 3QZUA 3TKYA 1NX6A 5JO9A 1OXVA 1Z39A 2WFZA 1J09A 1E2JA 2PHZA 3ICOA 3CV3A 4MJXA 1KORA 2JCXA 3OLWA 4S1OA 2IYAA 3H99A 5EJIA 5FD8A 1U3FA 3KKMA 4L5BA 4LRWA 4C22A 1FMCA 1EZZA 5DYGA 2PRJA 3AJ9A 3RCBA 1WKVA 2Q2WA 1N2SA 1O95D 4EELA 4Y6PA 5E0OA 3FWKA 5HKAA 2OSBA 1W47A 3UHPA 4ZVLA 3ADCA 3RVOA 4ED9A 3W5HA 3S2SA 3DLAA 2PYIA 1RHKA 3O3MB 5CCXA 2V7XA 3TF5A 4OCZA 3GR6A 4G4JA 1FP4A 3A25A 4H15A 2ZRQA 3OY7A 4RK7A 3BJEA 3ZS8A 2RBGA 5HK9A 4DCGA 3FRHA 1GQSA 4B6RA 1SQ6A 2YTZA 3U4CA 1SCBA 2PEYA 5K2MA 4ZK6A 2DT8A 3C5HA 1GNTA 3LUHA 4FGUA 3TW8A 2NO4A 3BK2A 5K99A 4HDNB 4P7BA 1LQ2A 2VP4A 3UUEA 4I4TB 4YV0A 2DETA 4NCIA 1TUBB 1U11A 3A1VA 3AQ4A 3K96A 3EX7C 1ECFA 3EWNA 4IIYA 2YDXA 5AJUA 3THWA 3EFOA 2PFSA 2NADA 3A27A 4LF5B 5HGJA 1DU4A 1P81A 2LIVA 2R6FA 1U2RA 3ILYA 1PUIA 1YZQA 1VKOA 1GGEA 4JU8A 1IHUA 2ZVPX 1A2KC 1YGPA 1AQ6A 2J5QA 1R6XA 5GJVC 5HJ2A 3PQ6A 1ZOSA 2W58A 1F38A 1UKYA 4WKPA 3OBIA 4R1LA 1Z63A 2G5GX 2GD2A 1FFYA 1E9AA 5AKEA 3E8MA 2BEKA 1QXSA 4U6QA 1QGYA 4IZOA 3PHJA 4G86A 4D9FA 3S2GA 2ZZNA 3VZDA 1AXGA 1Q6YA 1RXCA 3OWXA 2HRQA 4GG1A 5DI3B 2PJZA 4JXJA 5BNIA 4QT0A 3PEYA 1O5IA 5JLAA 2ZE5A 1RMTA 2AMLA 3PP8A 2WVGA 3OD5A 1MX3A 2GEKA 4LGCA 3QUAA 1U94A 2OE2A 4WH0A 4YUXA 4L08A 3SHTA 2CUNA 5A5VA 3P19A 3OF2A 4FS3A 1TUGA 5EQJB 3L7AA 4YI3A 3ZK9A 2VAXA 1GU7A 1K4YA 5HIIA 4O3FA 2DPLA 2OB1A 4CIYA 1IY9A 4FW9A 3AWIA 1HTTA 1WR8A 4RMIA 4D3DA 3CB4A 4CF7A 2X9NA 1NUTA 1CE8B 4N9WA 1NF3A 2GPBA 3QQPA 4NJOA 4OHZA 2ZYGA 4GOKA 3IFSA 3SP1A 1Z34A 3JWPA 3MK31 1RRPA 3RGWS 4II3A 1J49A 4JLMA 2G1KA 1CZKA 2BKUA 3QFCA 3WY9A 1JKXA 4RSMA 4D25A 1H8HD 5F2OA 4W6ZA 3HBFA 4FZVA 4FEEA 4NBVA 2X6QA 4CKYA 1QONA 3HSYA 2EP7A 4Q3KA 4TTRA 1H0HA 4AS1A 1DBIA 1UJ6A 2H1WA 3PJGA 3ZKWB 1P73A 2AG6A 2E89A 2QL7A 4RYDA 3FCSB 3AI3A 3TLGB 1WB9A 3NVAA 2JAHA 2WI8A 3Q40A 5D6OA 5FBVB 2FYTA 4R9UC 1T9ZA 5ITWA 1GA6A 2NXEA 4DLUA 5FA6A 1WM1A 2R66A 3G9QA 4US0R 3EIUA 3K2BA 5ED0A 2MCFA 2IXFA 5CJJA 3BWVA 3TLZA 1ZH6A 1UFVA 1CY0A 4RK5A 2IYPA 4E11A 1XAIA 2PLFA 3GB9A 3PQ7A 2OQVA 1W2HA 4C6TA 2EBWA 4O8CA 4G01B 2CEAA 1E7MA 1HM5A 3IBYA 4S35A 4CF3A 1Z0UA 3EVTA 4CKZA 2IEBA 2NO0A 3CUTA 3MCZA 2AW3A 1JX6A 3UXMA 4AO8A 4BMZA 2I6GA 1SVLA 5G0WA 1V5GA 5KCZA 1FDUA 4W5RA 5DYTA 3BKXA 3H9GA 5DNEA 4ZWNA 3BIXA 3JAWA 1SBYA 3R24A 5LZ7A 1KZ9A 2NXJA 5KO2A 4FYPA 3R3YA 4KIGA 1BVRA 2CC2A 5JC8A 2FVXA 3MCTA 3V1UA 2G09A 1AUXA 1TJ5A 2LGJA 3RDPA 5FPYA 3P9QA 1FYXA 3PDIB 4N0PA 4P3YA 3ZV3A 1Z4QA 4CV0A 3DLTA 4PBSA 3WNZA 4BAUA 3TDNA 1E3SA 3DDOA 1M6WA 2CKMA 1JQJC 2E1RA 1LPAB 1I4DD 4A92A 3FWHA 5LUBA 5LQNA 1RYFA 3WA7A 2OP1A 3WRYC 2XUPA 5AW3A 5H7XA 1KZGB 4ND8B 5COQA 4ZANA 4JC0A 2X2OA 3EW9A 2CZCA 3PQDA 3MJRA 4KK4A 5KHAA 4C0HA 4DV2B 1MDBA 5EZ5A 4LNUA 1GZHB 2ZIZA 4KN9S 4C0QC 3HUDA 4OFXA 2ZIXA 1AQJA 1UC4B 3EVBA 1U4NA 3IKLA 3W05A 2G70A 4Y6OA 1DC4A 1PZXA 2PMCA 3STVA 4MVJI 1UZNA 1IMOA 4UNPA 4L0QA 5LBIA 1QVAA 2VTVA 4XX1A 2NQ8A 1OZGA 1Y7HA 5JS2A 3VH3A 1JMVA 4B5KA 4YMUA 1FLVA 3GLHA 4XIIA 3LHSA 1TZCA 1ZNQO 3WA6A 4DWJA 1WBJB 3PEFA 1IZ7A 1FYWA 2DOKA 1KYZA 5EPOA 3IE0A 4PZPA 4B2IA 1R0WA 4FJ1A 4L50A 4FMCB 5DKFA 2QR3A 3V2IA 3RYCA 3M6IA 2HMWA 4U7FA 1NRWA 3ECSA 3OZVA 3PC7A 5C35A 2WIKA 4G1BA 3IMFA 4NAHA 3QTTA 2QL9A 4PSVA 3R0QA 4FDUA 2P77A 2XV1A 1SEVA 1HQYE 3WRWA 3NHLA 4ZYUA 3AVYA 1BE1A 1LS6A 2PM8A 4UAUA 1NVUQ 5EXEA 2W22A 4BLTA 1CUBA 3L92A 1HDYA 2JGFA 2PH3A 3LPNA 1SXJC 4LC9A 4AZ3A 2I4IA 1TAUA 1TC1A 1PJLA 3K0AB 1J99A 2ST1A 2YMQA 3TRDA 1NQTA 4JUFA 4DRYA 3I4FA 1T9HA 3LQKA 5CLQA 4BY9E 1VIVA 5C8YB 2WJWA 3H7IA 1S4MA 1EXDA 1GAQA 1VLHA 4PLGA 4ZO4A 1GQQA 2TS1A 4A82A 1BWQA 2B3TA 3DCJA 4RQUA 5AKGA 4OPMA 2YR0A 1U3TA 3L8HA 5LZ9A 1PK7A 1ZRMA 3CO0S 5E3JA 3I6MA 2F8SA 1QUEA 1JAHA 1W9MA 2QRVB 3FYSA 5IKXA 3CVXA 1C4OA 3L7NA 3Q1KA 4NZZA 4L78A 3BT7A 2VHYA 1HRDA 3GMSA 3W5SA 3HXLA 3IS3A 1I0IA 1CRQA 4KTVE 4ZA2A 4D9BA 3VC2A 3JD2A 1UP7A 1XCJA 5FUQA 3ITEA 3BWXA 2PSHA 1ZOIA 2DJIA 4RWZA 3F4BA 4L4RA 4QZVA 2OV6A 2XUGA 4HQNA 5DSTA 5EWMA 1VHQA 1HG1A 2KX7A 4B44A 5MF6A 1I51A 3LCVB 2VRCA 4J3NA 5C2JB 4CMHA 1VBMA 4LXXA 2V74B 2D0PB 4RY9A 1VG9B 1GPH1 1U0LA 2NZYA 3WK6A 4KXUA 4PR3A 4PYRA 1NW7A 4TMKA 4ATNA 5K6AC 4FFOA 1UOEA 1YAJA 5JSKA 1RXWA 3KT0A 1JEOA 2GRUA 1FRVA 2RGCA 1L3BA 3NNSA 5B57C 5H9VA 5F7JA 2G5CA 2PUEA 1NMQA 4LA4A 3RWBA 4TMZA 1YDMA 1Y8QA 1GPAA 4CVNA 4BKUA 5EJ2A 1QKKA 1RE0A 3KO8A 3M6XA 2WBLC 4N49A 1NQUA 2G25A 3BRWA 3OJEA 3CZ5A 5K45A 1E6LA 1JSLA 5I47A 4CLDA 4TX1A 1N77A 4BUJA 2HA3A 4U2BA 3DVAB 2Q62A 3IXQA 3P2OA 3OP4A 1ICIA 3KJNA 4D96A 1Y4SA 5DHAA 3UTCA 1WRBA 3DOJA 4BN5A 3A4TA 1KDTA 4MPJA 4CQMB 1M6NA 4WK6A 2GMWA 3UEOA 1LBEA 1Q7CA 4C2UA 1DXHA 3L4JA 3IP6A 3QEJA 1Q3KA 2R00A 2WV7A 3DOFA 3QY9A 1KBOA 3AHDA 4LY3A 1TKBA 4R1PA 4HCJA 2NTJA 5BQXA 2H9IA 5H8WA 3JQ8A 1GV1A 3A05A 4P3NA 4PNHA 3OZAA 3PYXA 1ID8A 4EG1A 1ZW6A 5E8RA 5DCWA 2NUAA 3WIUA 1E4OA 3D3QA 1C3LA 2EFHB 3O2SB 2TMGA 1H6CA 3HU2A 3VKVA 5I7AA 2ZXEA 3IVRA 2WVJA 4B7XA 3JD4A 3BXPA 4EVIA 4DDMA 4WXHA 3AU9A 2QOEA 1VKZA 4MYHA 4ZQFA 1LSJA 4LF4B 1VYVA 2FEXA 3JQAB 3D8BA 4H17A 2DM6A 4REOA 2GJKA 3GDHA 1YS2X 4CM8B 3ZY6A 3ROTA 4YIKA 1LH0A 3KP1A 2LV8A 1T1GA 1IXZA 3NCHA 4HBZA 1OWNA 4K9SA 4JVNA 2OV1A 1GPUA 1J0EA 3T1OA 1M0EA 5DPMA 2HW8A 4RHFA 1RU3A 1T4BA 3NM4A 1N5RA 4YRSA 2QM7A 1P2TA 3DE1X 3MTIA 4I8DA 4S1WA 2JW5A 1Z6QA 2ERCA 4TL7A 5EESA 4ZARA 4E4YA 1AV6A 2QX6A 1JKFA 2RHMA 3DZJA 2VL7A 2IKQA 5JJLA 1XCPA 2Y1DA 1X0XA 1BA3A 2XE8A 3OPYI 2PGXA 4MCHA 1FU7A 4CMJA 4DT1A 3KYBA 1H0SA 1A9OA 3K1AA 3KU1A 1G42A 1ZN8A 2ZJ8A 4LE1A 2GCOA 4ER5A 9MHTA 1XUOA 4WGGA 4ZI5A 3O2NA 1D4OA 4GLJA 2Z3WA 5JXHA 3WL5A 5BV2P 1KI4A 1USKA 3JQEA 1OHHA 5EIBD 3RB8A 5E4TA 5K8IA 3E48A 4JOCA 2PL1A 3N6RA 1AGXA 5IASA 2QRHA 2CL5A 1SIUA 4M3NA 2NSDA 5F2NA 1IN8A 1Y9JA 3V7YA 1G20E 2C83A 3KV3O 2YY6A 4GIBA 4BO3A 1K5DA 3GCWA 3RS0A 1X7HA 3P0JA 4QHTA 4EUSA 3MCUA 2P1ZA 2W2LA 1XN1A 1OUMA 4G63A 2B1QA 4IIHA 5J3JA 1BS1A 4F71A 3OQBA 5IHPA 5LDGA 4BO8A 5TEWA 4PFKA 1NIJA 4E94A 2I4OA 2E5WA 4TTIA 5DGTA 1W49A 1Z83A 3KOWA 2IP4A 4L5JA 1LI4A 3ZU6A 4OXRA 3O4GA 1D1SA 4IDHA 2CKDA 4BVJA 1R5JA 4GZMA 5EQDA 1KI7A 2JEYA 2QTRA 3PKJA 3M7IA 1PE0A 4L2IA 1UP6A 4GXRA 2CVQA 3EIXA 5ILGA 1Q2XA 4NK4A 3ETGA 3OSZA 1Q2UA 4TRRA 3H5VA 3KXIA 3ZLUA 2IXBA 4CM9D 4E5VA 3MNFA 4CEHB 1XDGA 4A23A 1Z07A 1P7ZA 5LP6C 4ND6A 2XWQA 2Q3HA 3PEUA 4J7UA 2WOOA 1WMSA 3DE6X 4L3OA 4E22A 3NP9A 3PENA 5JRZA 6AT1A 1SBHA 1H3NA 1YIOA 2P6NA 4QTUB 2FQYA 5C9ZA 4YC7A 3NYRA 2VTDA 1M2NA 2NX2A 3OUTA 2X2FA 5FHRA 4B33A 4CIAA 2I91A 1SB9A 3FGPA 3EZ7A 1IULA 3RSFA 3W5UA 2O8FB 3H0EA 1E2KA 2A1UA 4J1NA 5A4FS 1QVRA 3SOZA 3T9DA 3JQPA 3VH4A 2HEGA 1MV5A 3DZ8A 2XUFA 4O2AF 1L4HA 4R8MA 5JEEA 5L6LB 4KSYA 4HGOA 4Y7CA 4ZU1X 3L9WA 1ADGA 4K9OA 4RBNA 2W2NA 2VDWB 4ZREA 5UKDA 2C4MA 2WE8A 3JARA 3NHSA 2OXIA 2IOYA 2DQYA 3LS2A 5IFKA 4UXJA 1URPA 3T3MB 3HCDA 3ZDZB 4DLNA 4DC0A 1WHTB 4BEBA 4LPKA 4OF4A 5B4TA 2XDYA 4UULA 5AKKA 4OO3A 4ZCLA 1AQNA 5DHTA 3VZBA 1RWBA 1W75A 3T1YB 5EE1A 3DWEX 4Q21A 5JBQA 2ZJ0A 1VL6A 2WJJA 4CMKA 5B6IA 2X1HA 2ZJFA 5C1IA 4DR7B 5JJIA 1F8XA 2YZ2A 3DTVD 2R751 3EXAA 4M9RA 1TJ3A 4JVLA 3B52X 3ZGVA 2P79A 5J1SB 2RG7A 2EG9A 3IEXA 4PZEA 5IVDA 4MUGA 4O2BB 1J23A 3FUUA 1N6HA 5BSMA 4DWWA 3OX2A 3O21A 3R3JA 2V3CC 4MEAA 2Q1XA 4BFSA 1GFSA 4AJJA 3LOPA 3LYLA 1H4VB 5KKAA 3SEZA 3DE5X 1T3ZA 2HCTA 1IHXA 3MOIA 4YYEA 1LB1B 3OE7D 4FQ8A 4UREA 5TPWB 5I8ZA 1AN0A 3OA2A 1ESCA 1ZONA 3N2LA 4MWGA 3KL2A 4PZ0A 1ZS9A 2JD1A 2Q1TA 2YOFA 3DKVA 3UJ8A 3UOGA 4KZPA 3W5CA 4TWZA 1AE1A 5EC8A 1IN1A 4V0MA 4DQDA 1WEHA 5E2IA 3K4HA 4HMQA 4KYUA 5JQGB 2WPDA 3B9QA 4U02A 5IMBA 1BU5A 1H2HA 1ZW1A 2ACWA 2BJVA 2IPLA 1J0BA 3P4XA 2NLOA 3QPAA 4DBZA 5LZ2A 4X8HA 1MAHA 4HXFB 3FNEA 4YMGA 1BKYA 1CIJA 3U7IA 3AHCA 3FCCA 2A3NA 1GCUA 1SQ5A 4TMFA 5KWIA 1CZNA 2FETA 3B53X 4LFBB 2WJ3A 1E9CA 1RTTA 4RQBA 1XNHA 4D5EA 1E2EA 1YR7A 4LYGA 1O08A 5J4KA 3U7QA 3NFYA 1WCXA 3B36A 5JU6A 1YL7A 3FTDA 3L6UA 3ORQA 4N5LA 1ZCFA 4E1VA 1PL6A 1UPCA 3I92A 1YS6A 1TEZA 1Z74A 3S40A 3S1AB 1KIFA 1P1HA 2Q3FA 4JMPA 4QGSA 3EVCA 3OQVA 5KX5A 1XNQB 1CKEA 1A9ZA 5HUQA 1X1AA 5FA5A 5KZMB 4HZGA 4C89A 5I7UA 3ZGXA 2H7YA 3YASA 1MGPA 4X6UA 3TRIA 4AFNA 1NNEA 1F0YA 3BFJA 3DS8A 4GGPA 4CTNA 2HWUA 4WSOA 2QD5A 3FKQA 4AZVA 1XWWA 2FWMX 1H4SA 3PFIA 1SKMA 2JDID 4WACA 5IK2D 3THXA 3ITDA 3W34A 3TMKA 4GNKA 4LJ8A 1TFUA 4KR9A 1PFYA 4N40A 2FKNA 1EK6A 1IRIA 4Z54A 1VL8A 5MGNA 3AUJB 4O1MA 1UJ4A 1P31A 4P08A 5JYEA 3ZVNA 1QP0A 1ZMRA 4NI5A 1JVSA 1W4ZA 4AN0A 3AZPA 3OZIA 1C1YA 2I8CA 4GNRA 3SIRA 4BVGA 3QK7A 1CNEA 1G3UA 4I5GA 4EGQA 3D8RA 2VPXA 4PW0A 3VKGA 2INGX 4OGGA 4V0NA 1N5DA 4CTKA 4J91A 4B8ZA 1E0DA 2GBLA 3NTOA 5BOSA 2R6R1 1XEXB 1XKLA 4N5MA 5I9MA 2VPYA 3GZ4A 1HEYA 1CUCA 3AFIA 1Z3CA 4I99A 1VG1A 3HU5A 2XH8A 4ZVNA 1BJKA 1OU0A 2VPQA 5BSRA 6PFKA 2DB3A 3CW2A 1CVIA 2V9CA 1OLUA 3TZ6A 3WO0A 3BFVA 3OCWA 3ZUPA 1WV0A 4OFWA 3WSVA 1QUFA 1NUSA 2JGRA 3ZNOA 1N5IA 4GLBA 4GP6A 2GHTA 3SJZA 1ODIA 3HB4X 3AEYA 5T5QA 1QK4A 3A3YA 5G41A 4D8YA 2ZK7A 4LYFA 4XVQA 5GM1A 1J2RA 4Z3DA 5J2TA 1JG2A 1TK3A 5HF8A 3EG9B 1VL0A 4P80A 1TGVA 3QVSA 3SI7A 2HF9A 3FNRA 4QG3A 3VX3A 3NP7A 2VZLA 2DTEA 5A3RA 2FQQA 3Q7PA 2QTMA 2ZIUB 2A0YA 2E87A 2PIDA 3KOOA 1J1UA 3IJPA 4BBZA 4PG5A 1QCDA 3AG5A 2J9FB 1LCIA 1YKGA 4QEDA 2O5RA 3EH2A 3JRWA 4DJAA 2BGIA 1OFHA 3L01A 5EUMA 3Q87B 5BSWA 1EP2B 4G67A 4M8KA 1NXWA 4RS3A 5IDXA 2TMYA 3O4JA 4GKAA 1RFGE 1FFXB 4GKKB 1P1CA 4Z1MA 1BD3A 1TMYA 1ZO8A 3PNSA 4FDVA 1YONA 1BGVA 3H5AA 2JZOA 4QJBA 2OQIA 1OYYA 1XV5A 3GA7A 4R3NA 1H2EA 3SZ3A 3COPA 1QFSA 3E2PA 3VR5D 2VXBA 2F9LA 3FJOA 2V5UA 2OD7A 5KNCH 2QPTA 2WJIA 4L16A 4E14A 4AZSA 3G0CA 1GRCA 2XUJA 4EGCB 5BQ3A 4PHGA 1FDVA 5HYVA 1V95A 4QL3A 1C0EA 1D04A 1P17A 3GJ8A 2HNBA 1O8CA 1ZI9A 3OAAD 2JS7A 4H0FA 2GPNA 4ZVMA 2ZAOA 3IBCA 4BJ5A 1MO4A 3DTTA 1QYXA 2E4WA 4EF4A 1J9GA 4LE2A 4EB3A 1ENYA 2DWCA 1RWPA 2HL6A 1UBKS 4V0SA 1A88A 5E4JA 2BYTA 1Y3BE 2AG0A 4UTPA 4EJSC 3VQTA 1C3OB 1TQ6A 5C1BA 5C1OA 5K5EA 3F8TA 4HDAA 3ND7A 1KU6A 5DMHA 3GPBA 2NO5A 4Q02A 2YYYA 4XWTA 2REQA 3STUA 1YTUA 1E2DA 4AF7A 3JWGA 1U1CA 4ZALA 4DREA 2HA6A 5CFNA 2OA0A 1CWUA 3A6HA 5C81A 2NO9A 1YIDA 5LD2B 3RIEA 4KRXA 4JNCA 4GXNA 5HUHA 1PL0A 5AVSA 1JRLA 2AJLI 1ORHA 1L5SA 1X7YA 4E3ZA 5H9WA 1FFBA 3S2IA 4P7FA 1BJTA 3DM9B 3WLLA 2J4DA 5HWSA 3E9DA 1I32A 1T6YA 4I66A 1TYZA 3WYCA 5DBGA 2PZFA 3ANMA 5BMOA 2YJZA 4WNAA 3GQVA 2GD0A 3LT2A 3EBLA 4QTYA 4M6WB 1A9RA 3E05A 1ZD5A 1U2EA 3EXG1 5DYNA 3VJLA 2ZAMA 2WFLB 3NBUA 5B6PA 3PUXA 2JJ1A 5KNDH 5BNTA 2RJ3A 2Y92A 3I52A 3SC2A 2VPTA 3RARA 5AESA 2Y1KA 1Q77A 4EKIA 5I4CA 3R74A 2RFLA 4P54A 1IU9A 5EQTA 3ZY5A 1IEVA 4FWIB 3TTUA 3UT5A 4G0WA 1XHEA 4AY2A 3WQSB 4AN4A 2BEJA 2IYXA 2NSYA 1XT6A 1ZGGA 2ZTHA 2OFOA 4KVAA 4RK4A 2X6TA 4QO7A 4RJIA 3KEMA 2GBCA 2I7VA 5IU6A 2OV4A 4CLHA 3VAZA 4HNTA 1SWVA 3DBIA 2BE9A 2VP5A 4WERA 1L4FA 1RCUA 1UBCA 1UKVY 2XNDD 4M7WA 4X6LA 3CF2A 1U1IA 2Z6AA 3UTDA 4CKXA 1TM3E 1A69A 3T9BA 4Q4CA 2NO6A 3H13A 1YZNA 3ZEAA 3IGFA 4L9SA 2EZUA 1XR3A 4BEJA 3SHFA 4A8PA 3HFJA 5BR8B 5DT9A 2BPOA 4MP3A 3IAS1 3PNBA 3BMQB 1GJRA 1U3WA 4NP6A 2HMVA 2MHCA 1ENZA 1GHTA 4N5DA 3CKYA 3G8CA 3DQQA 1KOJA 2QTGA 2VHEA 3QBVA 4FXPA 2C9ZA 3W7AA 4GECA 4LY9A 3WV5A 3I6QA 2LW7A 2QWXA 5JYCA 3ESAA 3ZBQA 1BRMA 1GQ2A 1DJOA 3HP1A 4ETIA 4A0FA 3LKVA 4ISBA 1J33A 5TDHA 5J2UF 4Y1RB 4Y2PA 2BGNA 4Z4IA 1DEAA 1HDGO 1RQNA 2DTDA 1DADA 4G25A 5ALFA 4QOEA 1D2NA 4H35A 3VPGA 5U9CA 1QS0B 3GUUA 1US8B 1QAMA 1LBIA 1LXCA 1R4MB 1WLYA 4L28A 4GX0A 1QIKA 2ATVA 4B40A 3U48A 2BFOA 4RLQA 2UYYA 1SAYA 1RLJA 4BWFB 4Q1VA 4RK6A 1XK6A 4G1CA 1OAOC 3HU3A 4BP1A 1GGVA 3IUYA 3U4QA 2VJDA 1T36A 2AUTA 3BSSA 5AW8A 1OH7A 4DC9A 3W4KA 2HMYB 4BNJA 3PX3A 4K3UA 4RX1A 5CCDA 4ZP1A 5JZ9A 2PSSA 2NUBA 2BJHA 1N6KA 3OIWA 1L4YA 1YKFA 1VZ2A 2PBZA 2X8JB 1ORRA 3LDFA 4DWOA 4C4XA 3NBMA 1RMQA 1U7TA 3DVQX 1FBTA 2JFFA 1K9SA 4REMA 1TJNA 3SDSA 5H3HA 4FFSA 4DJJA 2DXIA 2JIZA 2NTNA 2C4HA 2JI6A 5BNWA 4DNOA 1ABEA 5K0LA 2QDKA 2VTBA 1RXVA 3CUWA 4M46A 1DIGA 2CE2X 5KC9A 1M2WA 2BBWA 5G1NA 1I2MA 2XEXA 5ETJA 3ZWYA 4F5YA 1AG9A 1OBHA 1XDUA 2WUFA 4B46A 5D84A 2B6HA 1RC8A 4MMZB 1YD7A 4H7DA 3RG2A 2GYYA 3CEJA 1J9ZA 2V7QA 1QP8A 4BNHA 1JG7A 1ZUNB 2G71A 4RM3A 2CV2A 5BN3A 1YHZA 2JKZA 4L0MA 3QU2A 8ATCA 1UZMA 5IKOA 4N47A 3BMNA 1I2DA 2AX4A 3JQBC 1DRVA 1PGPA 2JKYA 4C06A 2F8TA 3RBVA 3T6KA 1E6KA 2AS0A 2Q3JA 3KR1A 5EPEA 2JLUA 2I8LA 2QJRA 2B69A 3PGMA 2PEZA 1YDWA 3BD6A 4CNQA 5EPUA 1ZN2A 5C3UA 5JS7A 3N87A 3G3EA 1J2UA 2F43A 5AKLA 1NLMA 1X42A 1DJQA 2FPSA 2R25B 5CFLA 4JUCA 4WY5A 5CVTA 3E6AA 4IAOA 4XD7D 1EQUA 1DDIA 1S1MA 4NY1A 1VJTA 5DHUA 3R3SA 1R2QA 2ZXFA 3UWOA 3EF3A 1ORVA 4Y0AA 1BCSA 1U1EA 3TD6A 3Q0EA 9ABPA 5EWLB 3ZWOA 1OIVA 1CB0A 5KJCA 1HV8A 1ZJZA 1MRNA 1TZKA 3G2JA 2JA2A 3A3KA 1DMRA 2E55A 4JLDA 4J16C 4MS1B 3O90A 2XZDA 1G98A 3FZEA 3ETNA 1R0SA 4LN1A 3NHUA 3RJMA 5KSWB 1J7KA 3CW8X 1F48A 3MUFA 1DEHA 4QBHA 2W8BA 4J6EA 1K97A 2X1LA 4QOJA 1B8PA 4U0KA 1XTSA 4GMGA 3VPXA 4RF5A 3CZPA 4F3CA 5IAOA 4MV1A 4ZGWA 2KS6A 1N0VC 3BAFA 3IUMA 5FWYA 1RWXA 1M34B 1RWMA 4AF8A 2I80A 3IA7A 2YBEA 2R8OA 4ZQBA 5ER6A 2EQAA 1G5PA 2UVDA 4R6XA 4NCXA 4OV6B 2NU9A 2QUIA 2QVBA 2YZ7A 1EP9A 1N3LA 1LDYA 1ZVQA 3H1TA 3F78A 3VNBA 3WGTA 3LUBA 1GQRA 3D81A 1Q16A 3N8IA 3Q3VA 2VQSA 4JD5A 4JHXA 4ESVA 1T2EA 2ON6A 1WA5A 3DEKA 1KYVA 2VJKA 2D00A 3DFUA 4HQRA 4WHMA 3U7EB 5IABA 3ZE6A 4YT2A 4IMRA 3HPQA 1TF7A 1V0JA 4MVJM 1SWWA 2XNKA 3MTJA 1QRAA 4KR3A 1QKIA 3AUYA 1E2QA 1XTPA 1WZUA 2VXOA 3NZEA 3I32A 1UADA 2H1SA 3RFFA 5HG0A 1AGNA 1E2GA 3WYFA 1MFZA 1R50A 3MTEA 5LYYA 4AY5A 1G8HA 2PWYA 3GQBB 4PTYA 1A4XA 4ZT2A 4CQMD 3BMXA 5EEGA 2JVKA 5TPZD 1O94C 4IOMA 3T7IA 3QXHA 4I4LA 4K6MA 1Y8ZA 3ETJA 4ZK2A 1NJ5A 3UK2A 1F2VA 3G5TA 4EBBA 1YJ8A 1EEXB 1TA0A 1XG5A 1BHO1 2R8PA 3TW8B 4YRAA 1YJ5A 2W93A 3H1AA 4TWIA 4XGKA 2HF2A 2FSGA 3OJXA 1I4OA 5AW5A 5A03A 5IUNC 4U2CA 3FYUC 3I1FA 1QRDA 4FI3F 1GPWB 5CVDA 2OFFA 4QPJC 2I7CA 2XW6A 2LRHA 4NBKA 5CU7A 1Y3HA 2QYSA 4D99A 5JNSA 1F0KA 3IVCA 3ICEA 1V1JA 1B8UA 1H1DA 2D1RA 4BB6A 4F5WA 3NDRA 2HWYA 5KPJA 4I9UA 1IZZA 3ZQJA 3VNVA 4Y6RA 3WLNA 1NLFA 3KAQA 4HFMA 2W6JD 2H1LA 5ARDA 3JQAD 4JQYA 4Y1EA 2X5XA 3I9OA 5BN1A 3QHQA 1J90A 3QU5A 1BN7A 2AC2A 2PMKA 4BC1A 3R7NA 1PFWA 2AHOA 3RVLA 4JH0A 5FLXA 4UHEA 2Q8PA 3WFZA 3ULKA 2IUTA 5T57A 4EY3A 2ONZA 2ZT7A 3D2LA 3AIKA 1NNSA 2ZJZA 2Q6LA 4HDSA 4HF7A 1JTFA 3R7FA 3UC5A 1BKDR 1XD8A 3PG5A 5CFZA 3KKKA 1E62A 4ETNA 2PX3A 1NUUA 3GRPA 2XNHA 1ESZA 1RD4A 4NPCA 4J8PA 4RPHA 4UBIA 1RAAA 2PX2A 4R2IA 5GV7A 3CONA 3NH9A 5BORA 2FJPA 1E96A 1NXQA 3RANA 5FJJA 4QXPA 2UVPB 4UBMA 4WLOA 4YJ2F 1W34A 3BXEA 4CIWA 1UK6A 2VRWA 1QH0A 5FUXA 4YV7A 2PV0A 1GGMA 1UIRA 5JECA 5JAPA 5TIIA 2MYPA 3FE2A 4KYTA 5CA1F 1EI9A 2XT6A 4BX0A 4ARIA 1E1LA 1JR2A 2JAQA 2WA1A 4WDQA 1ZA1A 4E07A 3OMWA 1RT9A 2I2BA 4YCLA 3AY6A 2RI1A 2BGRA 3EARA 5AKXA 3W3AD 4RL4A 2H06A 1XVAA 2C20A 2E85A 5F64A 4KO8A 3CF6R 4AP6A 3LDAA 4E08A 3S81A 1WL8A 5GJBA 2WILA 3DHWC 2JHAA 3BA1A 4IP0A 4LC0A 4QBKA 4IRMA 3PFWO 1KK0A 4RFLA 5AJXA 4HWGA 2QX8A 3CSDA 3FGNA 3C24A 2AOTA 3MCVA 3OLXA 1N2EA 5AM1A 4V1CI 4Y2TA 4B45A 1A9QA 3DFKA 2QY9A 2ZBPA 3EGVA 4CCWA 4PC3A 3GG2A 1KEKA 4KVGA 3RRBA 1IQRA 4IM7A 3KQNA 5D1NA 2I54A 1BMFA 2BE7A 4AU1A 1XQ6A 1GEEA 2SCUB 3FWYA 1GLGA 3AXSA 2J3QA 1PJSA 2JJ2A 1KQOA 4ACBA 1TM2A 1OB5A 9GPBA 4QDTA 3JVVA 4F9FA 2WWYA 1EJ6A 4TM8A 1YR3A 2J4CA 1CHNA 3MRXA 5KYWA 3LWZA 3KYCA 4NCAA 1Y0BA 2ZBQA 1FE8A 1MU0A 3KRTA 3FROA 4G0XA 3HGMA 4MRSA 1Z5WA 1N0UA 2C82A 4YQEA 3OI7A 4BO4A 2VVTA 1G5HA 4RA6B 1PNVA 3V8BA 4ARBA 1E77A 1R4ZA 4Q5IA 4EGAA 4PHFA 2FWPA 2V0GA 4KXQA 2PT7A 1SOMA 3VR6H 3PQCA 1I9CA 2P4QA 2C97A 5T4FA 4UFNA 3TR6A 1E58A 4PZ9A 4JLKA 4RWEA 5T41A 5TNXA 4QD3A 3MLEA 3NT4A 3SJ7A 1YFKA 2RAUA 3CEHA 3ABIA 1JDTA 1CFZA 2WEKA 3MHPA 3SX2A 3FTEA 2Y1GA 2AN9A 1SOVA 4DPMA 2QMZA 5F35A 2XBLA 3B1KA 4G5SA 5CDTA 1CIPA 5MFPA 1RWWA 1DLJA 3ZZ1A 2D0IA 3IBGA 1G3IA 3MC1A 4M99A 4C4ZA 1D2MA 2BDEA 2PKCA 2XADA 3G5MA 3BEDA 3PKZA 4UEOA 5JHGB 3TG8A 2QENA 2E2WA 1UBNA 4JA2A 4KIUA 4R9NA 4DCMA 5KWVA 1UWKA 2NZ8A 4UHCA 2J6HA 1XXHB 4HC4A 4QLAA 2VNAA 1GITA 1C7JA 2LVBA 2Q5HA 2WZCA 4IMIB 3M6WA 2G72A 1DKMA 2FEPA 1O4WA 2Q2QA 3VBEA 2C3YA 4ZICA 2IBTA 4FFVA 1WZ2A 4I4TF 4GDFA 1Z4NA 2DBRA 3O0TA 4JJ6A 3EEQA 1EFKA 4UUBA 1Y1PA 1WMDA 1KR2A 4UNIA 2K4MA 2EW8A 1JQEA 2ZRGA 4QBIA 1KNXA 3ERCA 1SUDA 4RELA 3NPMA 5CITA 3PDJA 3K8OE 3L0ZA 2NSJA 4RORA 1MZVA 4L15A 3L1JA 2QTBA 4GYWA 3PNKA 4X1IA 2O2JA 1AMOA 2FFRA 3GH1A 4PG4A 1CQWA 2IZ6A 2QE6A 5HQJA 5SY6A 1HBJA 3LGAA 4A6XA 3RUDA 4N1AA 3BH6A 2F3RA 1N4AA 4UU0A 3GLIE 2D1FA 3HKBA 3GVXA 2J9RA 3KB8A 5FL7A 3RUIA 4X20B 4I7EA 5A9RA 1EZ1A 4N5NA 4RK0A 3UK6A 5L3SB 1MB9A 5H70A 5F3DA 3TB6A 1X39A 2XXBA 3F3KA 3S68A 5HEKA 1UXIA 2O0MA 3NHYA 2ARKA 4FDLA 2OM2A 3JZDA 4IVNA 1FL9A 4BVAA 2ADFA 2GZHA 4U0JA 3UKDA 1DARA 1PS9A 1RHRA 2BGLA 2HQ1A 2NG1A 3UXYA 3P71T 3U9SA 4HMOA 5B55A 2GAAA 2GEDA 3COSA 4UVEA 1ES9A 1T26A 2CNKA 3NR2A 3JD1A 5JZSA 4JR2A 3KWMA 3NHRA 2OZLA 2J3DA 1SZCA 1SXJA 3VYWA 4B3CA 2XB2A 4RU1A 5DLQC 3E1KA 1EX6A 4Y8VA 1YS4A 2ZPTX 1LTKA 5F78A 5ENDA 2A5GA 4JP2A 4MWDA 3SLKA 2I4NA 4QXQA 4TLLB 1NF2A 2L17A 1B6SA 1G17A 3G9TA 3MGGA 2WJVA 1VRCA 2HU2A 1V41E 2VF5X 4S3MA 2HV8A 2BZSA 2P27A 3B48A 4I14A 4INOA 1U80A 1ZMOA 2AJBA 4JBHA 5AI4A 3NX4A 3SHWA 1JIVA 2QYOA 5BW5A 2HCFA 4CKEB 1W4AA 2ZSJA 2QLJA 4DR1B 1MQ8B 1O6GA 2WMNB 4YX9A 4KKVA 2Y99A 1OB2A 5BN5A 5FWAA 2I2FA 4YJHA 3M82A 3R5SA 3EYWA 2EF0A 4WL0A 5CX1B 4F6LA 1RRCA 1E79A 1H66A 1XRMA 1E1MA 2G88A 3HM2A 1FQKA 1VJ1A 1NZJA 3B2QA 4W63A 4PIVA 1YS7A 1JSRA 3ETCA 1SURA 3H1EA 4NENB 4Q4AA 4AJKA 4ZCIA 2GVDC 3CX7A 3G5UA 5F4BA 1RAEA 5A9SA 1F06A 3RM3A 5CAEA 3GUVA 3NM5A 2XDWA 3ZHUA 4BHTA 3WDLA 1U1GA 2ZP1A 5FKJA 4EF6A 5KNBA 3CKMA 1XZBA 4PIPA 4RD6A 4RPIA 1HNZB 2YYZA 4ID9A 1RXEA 2E3JA 1F8GA 4PR0A 3N05A 4EHAA 4OHFA 1J20A 1E5TA 2D1QA 4JLNA 1PJ4A 5K6AA 3IAAA 4X7PA 3H4IA 3SYNA 1GM5A 2DAPA 3T7EA 2P2GA 1X1BA 2XGSA 5CB4F 2BC9A 2ZYDA 1RP7A 4FFWA 2DFTA 4QBGB 3TPZA 4BYMA 3LPAA 4GE0A 1V1RA 5T3UA 2NUAB 3R8XA 4CDRA 4CI9A 1OILA 2O8DB 1WW2A 2QVGA 4TYYA 3JR3A 3QLTA 2YWJA 4DIEA 5T7BA 1I6MA 1VMIA 1I7QB 4PAWA 2IXTA 1AOXA 3PI6A 5LU8A 5EMKA 4QPZA 3T0GA 1Z45A 1RZRD 2FZVA 3QYJA 1WQ1R 4KUEA 4FHEA 4KITB 2YQ5A 3DZHA 3EQ8A 5AVVA 3PUWA 3PHGA 3E61A 5DX0A 4IIJA 5M5BA 1PVDA 2KLHA 3B1ZA 4MUBA 1Y7PA 1MPTA 4FD3A 1SU6A 2X9VA 1KSGA 2PZKA 3RUHA 4Q9DA 4GZ5A 1HYHA 3CX8A 4FC7A 3AJDA 1QF9A 3FPBA 2HKIA 3I2GA 5GAJA 2D5AA 4PVCA 4YCCA 1PV1A 5JH7B 1ORDA 3P9ZA 3RU7A 2L18A 3BDAA 3IT1A 5EYPB 4D4LA 1TMKA 3UUGA 1KQGA 4WFKA 1KMHA 2YFQA 1SM4A 4LRTB 4F9TA 2QD3A 4NFYA 4RHEA 4U2EA 3SSNA 2H4JA 5ARBA 3WS7A 3JCZA 1WDWB 2IHKA 3K1AB 4OMCA 1NNLA 4IIDA 2GCOB 1E1NA 5DTJA 3MJSA 4S1TA 1DQNA 5CDFA 1KI6A 1F20A 4PHTA 4MV9A 4TV8B 1PCXA 4BRZA 3PX7A 1NPTO 1Y9AA 2JGDA 1RKQA 2H08A 2QZJA 2VZ0A 4H31A 1QBKC 2YY7A 1GRNA 3K70B 3WGOA 3QMPA 5BV1A 3OPXA 3JASA 2EBHX 4H7KA 2JFPA 1L4EA 3B6MA 2H57A 1XLTC 3UHOA 4CV3A 2B37A 2X2PA 3KPVA 1JEQA 4GP9A 2PJRA 2QR2A 2IVZA 2XR1A 3TAUA 1WU8A 3D54D 4GRAA 2OOKA 5JDIC 1B0ZA 1GPYA 2C59A 2WTNA 5CLHA 3W78A 3S8EA 1MJGA 2CFRA 2JH3A 1DJPA 4J4TA 4QNMA 4R81A 3GO4A 3RVRA 1W36C 1O97D 3OJLA 3WTBA 4LRYA 3T15A 3JYHA 2OBYA 3ZE9A 2V45A 2WHQA 1F14A 2NOAA 1T5DX 3HB0A 2ZM6B 1L8AA 2SKDA 4PGHA 4NBUA 3HKEA 4U7PB 4KWCA 2E49A 3H11B 3KKLA 3S1SA 1BE6A 2BM0A 3LX4A 3RR2A 3L7BA 3HKDB 1KYXA 4X97A 3R5HA 1MEEA 2C84A 3MIZA 3U9LA 1HL7A 4I9NA 4MS3A 3LYHA 5EIBC 3V4FA 3WGJA 1CUWA 1U2SA 2YRXA 4MUJA 5JE8A 3WNDA 2BN4A 5C7OO 2W90A 3K8YA 7GPBA 1OWOA 5ELXA 1DOZA 4HB2A 2WSSA 2R96A 1FFSA 4UDXX 1AKRA 2JFGA 3PFFA 3KE8A 1QZXA 4EMTA 1PEAA 3ISJA 4Q1BA 4WECA 2DX7A 1V8OA 2SBTA 5E6SA 3LBNA 2VYVD 1ICEA 4F8EA 4MPDA 4E2ZA 4KLCA 3ESXA 1GUZA 5CK5A 2AZXA 2P4UA 2C3MA 2I8AA 2G6BA 3DR3A 5DYIA 1C41A 4XWOA 3VKHA 5K3FA 3QPUA 5BVHA 1NKSA 1U0NA 1X8JA 3QEBZ 2VPWA 3IEKA 4BVFA 4XVCA 4YNBA 3X2FA 3C8MA 3UAZA 4PX5A 1RWNA 4CTOA 1IXYA 4FUQA 2QRLA 4A16A 3QVGB 1KAEA 4YXWA 1VPTA 5KNCA 3DGFC 4Y30A 1HE5A 3ZW9A 5HFAA 4LQ4A 3V9PA 4D4KA 1QIHA 4YGYA 1OPRA 1JXOA 1MR3F 4HR7A 3IRUA 2FMKA 2ZRJA 2GFIA 2XCQA 3CVYA 3DDZX 3DFZA 3H9JA 1NSFA 2PFGA 3P0EA 3H8VA 5DK6A 1LVUA 4KQEA 5DSXA 3T7RA 2AFHE 2SECE 1R88A 1G7RA 3N2KA 4DBVO 5HQ3B 1XU9A 3B1XA 4CLRB 1YB7A 2Q5IA 3VOTA 1JLHA 2PS1A 4IKEA 2NYAA 4LHZA 5T6BA 1JNXX 3U81A 3EZGA 3EIOA 3RAPR 3ELBA 3PC3A 1NXTA 2XMSA 1G6KA 4P36A 1TIBA 1WCIB 4N6GA 5GQSA 3JR7A 1NBWB 4XIYA 3TSAA 5EJ4A 4ALJA 1JI0A 4N01A 2OCXA 3UBTA 2J0EA 5L3QB 2QP9X 2OHHA 2HLPA 3QLUC 4KB5A 3BF8A 4QYWA 1DJNA 2CUTA 5AO9A 2Q4RA 5KQGA 3PXDA 1MXHA 5LQMA 1MZPA 1LPPA 2AOWA 1RBZA 1AH2A 4MS4A 4YTEA 3RK1A 4JGBA 1XKTA 2BMFA 5I4IA 2A5DA 1NV9A 2NYRA 2EARA 3DXZA 3QKSA 3PL1A 3IEVA 3FUXA 3ZVLA 4BFYA 2GBFA 1J2YA 3H4VA 5J59A 3OOEA 4HVAA 5PGMA 4YMHA 1IATA 3T4PA 1I4WA 3ELDA 4CHGA 2A3RA 3DJFA 5EKUA 2JGLA 2W4IA 1E2NA 2NXWA 4FN5A 1ADJA 4UQLA 1UC9A 2X15A 2Q5QA 3EBOA 4MR7B 3GLTA 3AUFA 1GKKA 5KNDA 2WMDA 3GAZA 3SQNA 4U2FA 1N7HA 2R4QA 3F5QA 3JRNA 5FBKA 3HDGA 1B6GA 3WBBA 2ATCA 1Z9BA 3I83A 3H5IA 2EYUA 1SBZA 3ENWA 5CDYA 2NP7A 2BZGA 2HK7A 1RQPA 2O2XA 4Y3UA 1RNLA 3OFVA 3CCBA 4RK1A 5I9IA 1YQEA 1SHJA 2H1VA 2PS3A 2YHBA 1LSSA 4MSUA 1MH1A 4ZAFA 3S29A 3RIHA 1YMUA 3AERB 4CEIA 2ZUDA 4TV9A 1BMTA 3SFTA 1L7RA 4YYZA 4ZQEA 4GOMD 4YS6A 3VHQA 3P8ZA 1Z16A 2KI5A 1Z36A 3JU3A 4GUAA 4YPFA 5IARA 2HLHA 1XL0A 3GBVA 4XDZA 3FUVA 3VO9A 5AW2A 3K32A 4X0EA 3FI0A 4IMPA 2Y66A 4FD2A 2FPWA 4G4SO 4XARA 3WGGA 2WVHA 3TFQA 1I1OA 2DMRA 3K35A 3LLUA 1QIDA 4M0UA 1ORWA 3GGOA 5KTKA 5CXXA 4QEZA 1I3LA 4CMEA 2PFKA 4TZTA 1AT1A 1FSFA 2OOSA 2PPVA 4LZAA 2FGJA 3B1JA 4JBXA 3EZXA 3UAYA 1S01A 2JNWA 3GT0A 4LOHA 3FFAA 4F11A 1BRTA 3MYYA 4IW3B 3NORA 4S1NA 4WK2B 2I87A 1NW3A 5DDIP 3BXOA 1JHRA 1RM5A 3AR6A 3N8NA 5LQDA 3MELA 4IVPA 4PEVA 1C8LA 3H2YA 1E1CB 2E4ZA 1T6NA 4OXNA 3TO5A 4US2R 5EIOA 3W04A 5I01A 3I0MA 3ZCQA 3FDIA 2ZCUA 4H1TA 5F33A 3E58A 4TXHA 2OBXA 3OLZA 1JAIA 3F97A 3DBHB 4HLUC 3RC2A 1NJ6A 3D8UA 2R62A 1RKXA 3GFPA 4FZ5A 5ALYA 1Q19A 4ZCSA 4F4JA 5L7TA 1WQ4A 2QGNA 4PHCA 2PCJA 1L5FA 5HRUA 1U3GA 1I7PA 3ZU4A 1F2TA 3GWGA 4K6OA 1Z56C 4MLPA 4U3JA 2O6LA 5D00A 1BX3A 4WXPA 5E1OA 5KB3A 5ADHA 4P0PB 1VLMA 1XZCA 2CHVA 3KU4A 4M9ZA 4HV4A 1T5LA 2OGWA 2XWPA 3UZUA 4B80A 1BZYA 4KOAA 4CLOA 3U7JA 2WKPA 2RB4A 2OEPA 4ETWA 4BNGA 2QG6A 1CD5A 4JL5A 4DOMA 1XMOB 4EY8A 1DINA 1M2KA 2B7LA 5CNJA 2PWBA 3VOBA 2ZT5A 4GWGA 4FFBB 4HWKA 2JAUA 4EJ2A 1YZGA 2Q5LA 1AO0A 5F1PA 2J3LA 4P53A 1WY7A 3GCDA 3IDSA 3PLAE 2ZIWB 3BEOA 1JZTA 2YZNA 5KWEA 2CN1A 5FPKA 1SVIA 1OASA 3Q0IA 4HDOB 2OYSA 5B58C 3ZHRA 4A26A 3L5OA 1HRKA 2DH5A 2QUKA 2ZWPA 5HDQA 1DWPA 3KQKA 3D3JA 3QG5A 1W46A 1Y9EA 3QKTA 4HDKB 4YJGB 1LS1A 4B32A 4GWKA 4J1SA 4WV3A 2X40A 4DLLA 2ZB7A 2Q3LA 4FEAA 3TQIA 1EVIA 2FK7A 3DTYA 3ED1A 4ZVPA 4B3DA 1CERA 5CDSA 4IY1A 1M33A 3LO8A 1QH8A 2XZLA 3I23A 3RYIB 2DUWA 3KTDA 2DQZA 3NXSA 4ZEMA 2YICA 1CUSA 2BI4A 1SXQA 4JEHA 1H22A 2GKOA 2YW9A 4FMDB 2BH2A 4MQEB 2GEVA 1SA0A 3E5HA 1KEUA 3JQGA 3MJDA 4YJFB 3GEMA 3MT7A 2HRBA 1B73A 2QB5A 5REQB 4G0VA 2Z4SA 1Q7TA 3K6JA 3R7WB 3FSGA 2WY2D 5ICCA 2I99A 1AKNA 4FLMA 1B6RA 4LRUA 1SKAA 5LCXA 1FP1D 2A58A 1CUDA 1JFRA 3WAKA 2ZIVB 3C6XA 3UQZA 4KPUB 3B5JA 4Q3CA 4RTLA 3ONDA 4MI1A 3MIIA 3T7CA 5K6RA 2XGMA 4EDHA 1PW7A 1RWVA 1TVKB 3IC5A 1ISJA 5AVZA 1FC0A 3ZCTA 3BUSA 3TNYA 3IAM6 3I2YX 4IF4A 1S9DA 2J9XB 3PXGA 3CNBA 1YCDA 4RPLA 2HO4A 1QKJA 3M4ZA 3OUUA 1P9LA 1R0BA 4GR4A 2XOKD 4KXVA 5E7QA 3KVVA 2QMHA 4K03A 3EQ2A 5D7BA 4AG3A 2YHIB 3HGQA 2P3LA 3RYTC 4BP9A 3C8HA 2RD2A 2D1YA 2PUHA 3JALB 3OHPA 1TTHA 2DFVA 1RI4A 2REQB 3REOA 3LYUA 3ZOZA 4Z9YA 1Q15A 4Z9BA 4EA9A 2IYTA 4F5EA 5JS6A 3ABOB 4UKDA 4HAIA 1CUHA 4IXMA 3QXSA 2JRLA 5CM8B 3O75A 4TRNA 3IVAA 4MW6A 1JXQA 2COEA 2Q4DA 5F2KA 3VJRA 2CDNA 2ECQA 1L5HB 3LVBA 2ZUUA 3UAOA 3RJTA 4UHBA 1RVV1 3MWDA 4FGJA 1IXRC 3GPLA 3LP8A 1LLFA 1ZDMA 1EUYA 1S2GA 2BEWA 1M2VA 1RIFA 3FZYA 2ORYA 1ORTA 3R9WA 2XAUA 3IJRA 4OI0A 3N58A 2CLDX 2J4FA 1HDRA 4MQMA 3UHAA 3Q3CA 3QBTA 3F73A 1YOBA 2P2YA 3LU1A 2X0NA 2VDLB 4F4UA 2X4GA 2IPNA 1CDDA 2X5OA 1GFWA 2ZAIA 1FYVA 4O4IB 3SC2B 4Z7QB 5MN5A 1CEEA 5DCUA 1XWFA 2C4NA 3CRNA 3MMNA 4WBNB 3UT5B 4JY7A 4BNMA 4ZHQB 1YBAA 4ZOLA 4NYMR 4GQBA 5AJTA 1K0UA 2IT1A 4E5YA 3JATB 4F3YA 1X1DA 1JI3A 2GEFA 4HYQA 2QIOA 1YCHA 3AO0B 3KDSE 4XVRA 3HUEA 3N28A 4PANA 5CT8A 1RWOA 1XKXA 1M67A 3K7EA 1PSZA 3D43A 3CS3A 3FMVA 1CJBA 3ER6A 3GFVA 3IX7A 3CSSA 3KHKA 3HL0A 4E7PA 3AIOA 3Q0TA 4C05A 4DEVA 5FUYA 4F38A 3ZW7A 3LM8A 2VJMA 1KR5A 1PG0A 4IV8A 3D5TA 1Z0KA 4AP9A 1T9AA 2B61A 1Y5RA 4EG6A 4BNXA 4G5YA 4B31A 3THOA 4DBLC 3NBXX 4C08A 5CYOA 2OUKA 4MAFA 1DE0A 2YWCA 4JFRA 3AR3A 3U40A 2C8JA 2XVAA 1JEAA 1A77A 3L82B 3QKRB 2XUHA 3NQ41 5LBTA 2IHUA 3ZWBA 4KPYA 3D1JA 3V3KA 1EWQA 3IT2A 4M0FA 2A0XA 2EHDA 4WD3A 1KO8A 1Y1QA 5LZ5A 2O7RA 3O84A 4OIMA 1YDHA 1LF5A 2YJGA 5SICE 1Z62A 1K7XB 5G1PA 3G5LA 1UM9B 4YQFA 2QXUA 1C5KA 2CLFB 1NI4A 4EUHA 4NQRA 4I1IA 4DV5B 2QD2A 2PNFA 1K3FA 1XJ5A 1NVXQ 4FB4A 2AB0A 4YUVA 2O8CB 1LDGA 2H0AA 5CEFA 5K0NA 1R6DA 1SHUX 2OLJA 4AS2A 2NPOA 4J0EA 5E3IA 2JCSA 4Y1GA 3FLBA 1KI1A 3ILHA 3L02A 5CH5A 3I2HA 4A1OA 3AP1A 3UJNA 1MG5A 2P4EA 3USCS 1EDEA 4IXWA 3R7SA 1DI0A 1RHUA 2CB9A 4JXKA 4DLKA 2FFAA 3LHDA 5F1YA 5FUVA 2X4IA 1FFCA 4IG4A 4DIBA 4KEAA 2RCNA 4Z9XA 5AW0A 3IALA 4Y9DA 4YAEA 4DMUB 4EA7A 2O5CA 5FBZA 2UVQA 3D8HA 2Q45A 3RC9A 2XWBF 3HB1A 3ZS9A 4AY4A 1YZ3A 3G82C 4MQFB 2FPKA 2IKSA 3IQIX 3WTCA 5TGZA 1CUUA 4OXYA 1WETA 3FR7A 1G8JA 4HNSA 3F49S 4F4CA 1SN7A 1XTQA 4MXDA 4QYMA 4WEQA 3HDQA 3TLBA 4UNSA 4XX0B 1W4CA 2IELA 4DR5B 2BFBA 4LQLA 4WCFA 1EBUA 4PO1A 4NKRA 3OFNA 4MTLA 3ME5A 3SNHA 5K03A 1BDJA 5F9MA 3KPUA 1CDEA 4PNZA 2PUBA 3G8BA 4FGLA 2DEUA 4OKSA 5IDVA 1P33A 1BQEA 3N7AA 1WSDA 4OFZA 3RSQA 3WXBA 3NKLA 4XIFA 4QWMA 4ZGBA 2YV1A 5B4VA 3KELA 3GUCA 1OAOA 1THZA 3F3MA 4MV4A 4A3SA 3DAHA 4IL5A 3Q5GA 4EZIA 2IHJA 4LTNA 3ZDRA 2G7ZA 4QDXA 1E7WA 2R6CA 1AF7A 4CJXA 4NYIQ 4LSZA 2AE1A 5C8XA 2FHPA 2QQ5A 2F90A 4WBXC 1YZVA 3FIJA 3GJXC 1OV6A 4Q37A 4EFLA 3I6IA 2K87A 1BAPA 2J7PA 2BLLA 3Q2IA 3WL7A 4CM5A 3PCXA 4U9HS 1EDDA 4BMNA 1Q3HA 4PV7A 3L07A 3A1TA 3NHWA 3ZJYA 4BRWA 3HCBA 4ENWA 2L2QA 4MKRA 1A9XB 3VTFA 2EJCA 2CJXA 5EMJA 3UVEA 3R0IA 1ULUA 1ISMA 1WO8A 1EUCB 2C3OA 2IXGA 3D6AA 3F7MA 3QPDA 4KWIA 5JAOA 4MW9A 4N3BA 3BMCB 1JU3A 1UBEA 4ZQHA 2IJGX 4D0LB 1UKCA 4OA5A 3BZBA 3DTNA 3E82A 5GADl 2BGWA 1T8TA 1XF1A 1X94A 2C2WA 1BCSB 1E5DA 4XJVA 4AJ2A 4EOGA 3IERA 1OJLA 4B3FX 1QZ3A 2Z08A 4YAIA 4I3GA 4K88A 4GOXA 5ALIA 1OX4A 1P2UA 2B8JA 2Q4EA 4PFSA 1QGZA 1X1SA 4G8CA 1J8DA 1VL1A 3JQBA 5JNWA 3GLFE 3QXXA 2PKYX 1NBEA 4XCXA 1X15A 4FDTA 4FYWA 2ZYRA 3H1PA 5CDFE 3SLGA 4P84A 5JCZA 1T29A 5HKKA 2V6GA 4CUJA 3E0QA 4GDMA 2W8BB 1E7QA 3MJVA 4KN5A 2B4TO 2WD7A 1EDZA 4F2WA 3NNDA 4PBRA 2Y71A 3NGXA 3Q2KA 5HZGA 5KTOA 2W42A 2WIDA 3LUFA 4G0ZA 1Z17A 1ZD1A 4BU0A 4DV7B 4ZXFA 5LYJF 1M6VA 1YT5A 1XIVA 5DULA 3MFYA 5LWQA 4DQXA 1RBQA 5JAIA 4BX9A 4UTXA 5I8PA 1F60A 3Q9UA 3V1KA 5JJKA 1FS4A 4R1TA 1IZ0A 4UJ5A 1M8GA 1S8AA 1L5OA 4X1KA 2O3SA 1OVMA 2RK6A 5MN6A 5F23A 4W8GA 5CB6A 1QDEA 4XASA 5FWNA 3C1OA 2Q3CA 1EXMA 3FDXA 1ZK3A 2POQX 3O8OA 5LBUA 4MRRA 1U8XX 1CZRA 2B8TA 3M6UA 1A7KA 2OV8A 3KJFA 2P9CA 4PYMA 5I9BA 1FLNA 1GKIA 3PR3A 4JDPA 3VR3A 2XUOA 3L6RA 5K3AA 1GEGA 1NDUA 5TQ2A 1YS9A 1R4AA 1JHAA 3VR5H 2QTVB 2E48A 3WLHA 3R4VA 5KVAA 2CHUA 2G9QA 1GVHA 3D6JA 4MWOA 4PAGA 1N9KA 1TZJA 2G4LA 3CTPA 1DAIA 1CF4A 2EFEB 2CHEA 4PONA 5C51B 1GYRA 2H07A 1UWVA 1D4FA 1NVKA 1Z8FA 3L05A 3BHNA 2JIQA 4QNRA 4X5OA 3VX4A 4FOOA 1TXGA 3U3RA 1L3CA 2DBQA 2PKRA 4ZI7A 3PT5A 1WWKA 1CF9A 1ZX1A 4J1QA 3UMVA 1Z2CA 3HADA 1KY3A 4AZWA 3I04A 3O82A 3KQTA 4IF6A 4U8GA 5BT9A 4B71A 3C97A 2HJSA 2MSWA 5JRDS 1WABA 2D8MA 2JGEA 3IPYA 4MKZA 3OTGA 1PWHA 2XE6A 4YJ3B 2IQIA 4WZAA 2NZVG 1G4HA 4KXWA 4RLSA 5FB3A 3JD0A 4M76B 5D2CA 1QOQB 1VE3A 3SQLA 5JWHA 1YUNA 4P5DA 1DAHA 1O94A 1ELOA 2AT1A 3R5FA 4GOJA 4IHAA 1T3LA 1XPJA 5E9QA 4ZYZA 1C7IA 4B3SB 3I28A 3UWSA 1OTYA 2YWFA 4TN5A 1LSUA 1G21E 1CJSA 2O2EA 1XZIA 4ZV9A 2BCEA 2I7XA 4MLZA 1JFSA 1YS1X 1Q0LA 3MERA 1CRZA 5DN6D 4MIEA 3TCNA 1EX9A 2JEZA 1LLUA 2ID9A 1MKYA 2VEDA 2X9QA 4MR8B 4O2AA 2PRZA 4XVHA 4PYKA 4RF2A 4N0EA 5JD6A 4Z4GA 1COWD 2IBMA 1Z7BA 1DKRA 3RWOA 2Q7DA 1OQAA 1OR8A 5TARA 2G36A 4F04A 1XVIA 4YP6A 1ODKA 1OTXA 3ND9A 1WHSA 4JQOA 3AI2A 4EA8A 4O02B 1Y4UA 1HQKA 3DBRA 3ZHYA 2VBCA 1HE1C 4AKEA 1USIA 3SIXA 1VLQA 3AL2A 1AZWA 1SOUA 5FWXB 1KEWA 2OCIA 2B30A 1TLFA 3K94A 5D85A 4DHEA 1GL9B 3DDSA 4LK3A 3B7GA 3UJ9A 4Y67A 3Q2OA 3C7DB 3K70D 2OKCA 4EO7A 5LSAA 1FXWF 2OPBA 1Z28A 4XDHA 3RE1A 2J45A 3S2EA 1ZJ6A 2PUVA 4UCQA 4NZPA 3P9RA 4BE9A 1PR9A 5FULA 4JT2A 4R2LA 2IP1A 1BEUB 3IIKA 5A1TA 2GD1O 5I7VA 5EIFA 4I81A 1M8JA 1UEIA 3FHLA 2A94A 3NGLA 2FZGA 2HJVA 1N1GA 2RSLA 4MVJE 3CXRA 2PAFA 4AXXA 1DO0A 3R23A 4D8WA 2MJLA 2JFUA 1V7CA 2B5VA 1M2GA 1U7WA 3I8OA 4J0GA 5TMBA 3UCXA 3F7OA 1AQUA 1P5RA 2GFHA 3H1BA 5FI0B 4ZRNA 3U09A 4ENQA 1Q1EA 4MJ3A 5K0CA 4FEYA 5F21A 2QT1A 2XGGA 1HSOA 4MHSA 3DCYA 5FTJA 4HFNA 4UM9B 1R5BA 3LIPA 2M6LA 5I4BA 1U90A 2AJDA 4MARA 4O1IA 4GKJB 3I9KA 5AHOA 3ONEA 2GPAA 4OQQA 3DMNA 3KJGA 3VKFA 5BXQC 2NU7A 1I7NA 2HMTA 1JG6A 3EC2A 3M5DA 1YQ9A 2ZBDA 1B3RA 4H77A 3ZE1B 3KWLA 1P1FA 5CVVA 1RQ7A 1O5OA 3LX8A 4S12A 1J5XA 4GI2A 3EZFA 2O5VA 5T67A 2LKDA 1RDFA 2YVUA 3CA8A 3OKPA 4PGFA 3UJDA 5KVCA 3ZJTA 3NH6A 1QJCA 2J3MA 3CRMA 1KY4A 1U7ZA 1RM4A 2WM9B 2XKJE 1Y3IA 4EHNA 4AD8A 4G41A 2DYKA 1IEWA 1QSGA 4LX8A 3WB1A 2IPOA 5EHIA 3ZY2A 2QU8A 1OFUX 3BBLA 2FFJA 3OZUA 1M7HA 2PU7A 1HPLA 3O1IC 5DIZA 4F96A 1BXRB 2IW3A 3HR7A 3VU0A 1H8HA 3NBZC 5KSYA 4FK8A 4EEKA 2AKYA 1Z2NX 1GA4A 3IOMA 2Y8EA 2UZ3A 1K9VF 1Y37A 3OEED 2GRJA 1B16A 1SEPA 4LCEA 1S3SA 2V6MA 4CHTA 5LQSA 2PR2A 1L6RA 1Z37A 3SC6A 1AHPA 1QO0D 5BV7A 5IXYA 4QTXA 4II2A 1RQXA 4NU6A 3LRTA 2HQRA 4WWHA 1NMSA 1ACLA 1XTZA 2GM5A 3MF4A 3NC0C 1LRLA 4OI4A 2QI9F 3TTYA 1K7CA 3MZ0A 2DGDA 3UXEA 1H6AA 3A10A 2GH1A 1BQ4A 3CM0A 3DD5A 4CKBA 2OYCA 1VFNA 4MV5A 3GJ6A 4J07A 2W6ZA 4MEJA 4BV2A 1L7EA 2BFDA 2P4HX 2UUCB 2C9MA 3EUFA 4D74A 4HS4A 3HCEA 3HVHA 1OMOA 5LJIA 1UPAA 1L8QA 2FCAA 1BYIA 2IPMA 1N2CA 3A2MA 4ZZ2A 5J5CA 4C6SA 3NT2A 4IS2A 3EIFA 5CIWA 3HWWA 4OB6A 5HTKA 5AJHA 1DAEA 3CURA 4HDRA 3WVNA 4QARA 5DO9A 2XCSB 2B8WA 3SS8A 4KFRA 3FCOA 4QXAA 2ECOA 4QYIA 1JALA 4ILEA 2QJFA 4HSEA 2UUAB 3QV1A 1NMEA 3DP9A 3URKA 3ZXUB 1GCAA 2CF6A 1SC6A 3RTAA 1KJZA 4HPJB 5AVOA 4P4TA 1P0QA 2XMGA 3FYHA 3KQYA 5H3CA 1XZGA 2W2XA 4ZO8A 4TS1A 2FMXA 3SF8A 1LLCA 1QYRA 4DRXA 2QRKA 1Q1QA 2ENUA 2JLSA 2VT7A 1SBIA 3EVGA 1CHDA 3H6HA 3OLCX 1AKTA 4INPA 4KQ6A 3VJKA 3VSCA 4BVEA 2A30A 1RJGA 2IK8A 1X77A 1CVRA 2PE5A 1Q1GA 2YW2A 4KUHA 3GOQA 1REQA 4DJFC 4MVJH 1XTTA 4IZ6A 2XVXA 1E5VA 4QODA 1E60A 5I8WA 2HZBA 3CPJB 4URZR 1P72A 2XDQA 3PFCA 3PSHA 2O5EA 4B35A 3HA5A 5EUCA 2GCGA 1S5PA 2ZJ6A 4WCVA 3X1XA 3BCSA 4COKA 2D0DA 4BQEA 3PHHA 3TGPA 4OXIA 5P21A 4F2GA 3O8CA 2RONA 1ZNYA 1MOQA 3BHJA 3EEBA 4GPBA 3AF1A 1GFIA 1Z5NA 2AF4C 2PVCA 4O1HA 2V7EA 4OYYA 5C7LO 2PGDA 2H85A 5ITZA 1JW9B 2O14A 2PSDA 2RJNA 4JIGA 1XYYA 3BAZA 3EVEA 1ZVVA 1X3SA 2QZPA 3OZDA 3P2JA 1WW3A 1OBOA 2O7NA 1LNSA 5TQ0B 2XQFA 3HVJA 4XB2A 3ROKA 1QV9A 3R5XA 5ALUA 3AR2A 3JPYA 1WUKS 5IC5A 1QYWA 1O2DA 2BFFB 4J2HA 2ZUBA 3BJZA 1IUPA 1C7EA 3EHDA 4YWJA 2X13A 2X4LA 4GW3A 1Z35A 4AMGA 3QW2A 5EXDA 1IB6A 3EVNA 2ZJOA 2PIAA 3KKPA 1BS9A 2DERA 4PX2A 1GYQA 1GUFA 1XRPA 4TSRA 3J7TA 4KL8S 1SQGA 1OZAA 3QE3A 3Q3HA 4DGQA 2YWGA 2CLSA 2I4MA 3RVMA 2IF0A 3GFGA 2WHPB 1MLDA 1QZZA 2JK0A 1WXWA 2QRPA 1JMYA 3CUSA 4RV5A 4XZ3A 1I33A 4EX6A 1NMXA 2ZIGA 1J5PA 1G20B 1LQTA 1Y33E 1NG1A 1VIYA 2GETA 4REQB 5ALQA 3C5WP 2ZBGA 4NJEB 1AS3A 3NTUA 1UFOA 1EU1A 3F3YA 4R2MA 1C7FA 2ZSFA 2LE0A 3UGTA 5FV4A 3CLUC 1QE5A 1TW3A 1F8FA 1QJ4A 1SVWA 1YRBA 1QNFA 2MINA 3PDWA 1DT5A 3GVCA 4OKIA 5TXGA 4OX9B 3PXBA 5J4YA