3LHIA

Crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
231
structure length
231
Chain Sequence
MFVWHEYENAAEAAQSLADAVADALQGALDEKGGAVLAVSGGRSPIAFFNALSQKDLDWKNVGITLADERIVPTNHADSNTGLVREYLLKNKAAAAVWIPMVEDGKTETELHPDAVVDYALKHYKQPDVLILGMGNDGHTASIFPKAPQFQTAIDGSAGVALVHTTPVTAPHERISMTLDAIAHTGHVFLAIQGEEKKAVFDQAAQGENREYPISLVLNHQGVNCHVFYAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 6-phosphogluconolactonase
publication title Crystal structure of Putative 6-phosphogluconolactonase(YP_207848.1) from Neisseria gonorrhoeae FA 1090 at 1.33 A resolution
rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase
total genus 77
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3lhiA00
1FRZA 4L51A 4R7TA 3CH7A 3E7FA 4GMKA 3ENWA 3TX2A 3BXGA 3OC6A 1KS2A 3UW1A 1M0SA 1XTZA 1NE7A 2RI1A 3U7JA 4OQPA 1FSFA 4TM7A 4IO1A 2R5FA 4R9NA 3EB9A 3NWPA 4L4ZA 4L50A 1PBTA 3CSSA 3BXFA 3ENVA 1UJ5A 4TM8A 1HORA 1FS6A 3NZEA 1LK7A 2BKVA 3HN6A 3HHEA 1O8BA 1FQOA 3L7OA 4M8LA 2F8MA 2W48A 4L4YA 4L5IA 2WU1A 2OKGA 1CD5A 4L5JA 4NMLA 3EFBA 1JT9A 1LK5A 1DEAA 3E15A 1Y89A 3LHIA 2J0EA 4OQQA 4X84A 1VL1A 1UJ6A 3LWDA 3KWMA 1LKZA 3KV1A 2RI0A 2BKXA 5HJ5A 3BXEA 4GO1A 3ICOA 1FS5A 1UJ4A 3BXHA 3ENQA 2GNPA 2O0MA 3IXQA 1HOTA
chains in the Genus database with same CATH superfamily
2ZJYA 4HV4A 1YQXA 3GJ4A 3A9UA 4GC9A 2HA0A 4OAOA 5IASA 3LCUA 2DFPA 2N0SA 4GECA 3AM3A 5D5HA 2G83A 3SICE 4P22A 3OOYA 3AHHA 2DKNA 1MW9X 3K71B 4CQMB 1YE8A 3NX4A 3NBYC 4HN2A 1Z4KA 1UAAA 4C6HA 2ZIVB 2PX4A 3HJRA 1EMDA 2PAFA 4XARA 4GOJA 5CD9A 2BMJA 1U7XA 2FEOA 3RFXA 4CM4B 1PCXA 4WOBA 4DCVA 6LDHA 1O87A 1RD4A 2D2FA 2FKAA 3TZHA 5LB4A 3CO5A 3AWDA 4HB0A 4BMVA 2VUTA 2FWNA 5KYUA 2YWBA 1BRMA 4J0KA 1POXA 4OSPA 3EGEA 1PT8A 3FTNA 4MKFA 4P8RA 2FFBA 1P44A 2HPZA 2ZREA 6REQA 4JQYA 4WERA 1E2MA 4BAUA 3P8ZA 4NEHB 3UJ7A 5HGJA 2C4WA 4R8RA 1Z33A 4W8OA 4BFXA 4F84A 2R7AA 4IVQA 4Q7EA 2UYHA 4RJ2A 4CM6A 3VJRA 1Y3CE 2YMPA 3WLIA 3WV5A 1EJBA 2A30A 1II9A 1ZD5A 2AUNA 2G3YA 3C3MA 4RPLA 1Q11A 4CFSA 2JJMA 4MZDA 3RV3A 1KO1A 3TQRA 3HKEA 3Q5DA 3BM5A 4KQ6A 1YVUA 1N6OA 2FXIA 3T61A 4UQPA 3FVTA 2GB4A 3A6ZA 5FORA 4FC7A 2DGDA 1OXTA 4QXMA 4K9QA 2GZAA 1F3OA 2NOAA 1E1QD 1L4KA 3EC1A 3MFYA 4Q1BA 4NOLA 2A7XA 1WSAA 4FI3C 3WYCA 2Z98A 4BZXA 1J21A 1FTGA 4FEEA 1XNRB 2FMKA 1VL6A 1WVGA 1X80B 5E8RA 5K7SA 3QFRA 1X9GA 4MHTA 2JFOA 1HFEL 1ORHA 2VT2A 4KQKA 1VCMA 1SB9A 1XZBA 5LB2A 5JWOA 2BEUB 3KQQA 1DXHA 2QM7A 4GKAA 3UENA 3VTZA 1WP9A 5GV7A 1Z6ZA 4G4SP 3R5KA 4QUBA 2WTBA 3FYUA 4OU5A 1T9CA 2REBA 5CVDA 2GAAA 2A88A 2QG6A 3MJCA 3MRXA 4DUGD 1E3JA 1QK5A 3OX3A 2QXTA 3A1UA 3RR2A 4LKRA 1PJSA 1ANKA 3EXEB 4TZTA 3BGIA 1I14A 1WQ4A 4TMXA 1OTXA 2ID8A 1HEIA 2V8OA 2WSSA 4B8ZA 4DFDA 3ZJUA 4FS8A 5K0ZA 3EMVA 3O47A 1SXHA 4YS6A 3WNDA 1UP6A 4KE9A 4R4JA 3OEWA 3PPXA 4EUKA 2XNCA 3VR6A 2BFMA 5C5IA 3FDZB 5CEEA 4ZO4A 1EWTA 5FI3A 2X1HA 1CEYA 2GFQA 5EJ2A 4CXMA 1KZ7B 1NSYA 3D3QA 4JVNA 3MTDA 4Q02A 5EWMB 4FW9A 2PUFA 2CB0A 2RSLA 1FIUA 1Y3IA 2HIAA 2ZSIA 4KODA 1AA6A 4AM8A 5HK9A 4NULA 2AGVA 3QEAZ 1UANA 4ZRNA 1U3TA 3SHWA 2SKCA 4LJSA 4LF8B 2DB3A 2GBLA 3GAMA 3MIZA 5D85A 1JAHA 1K7FB 1EAYA 2WJWA 1H4TA 2AOUB 2CL7X 2O2IA 4C6TB 1T0IA 2ZTHA 4LRYA 4YR7A 1DKPA 2BFOA 2J9GA 2PZEA 3ETLA 1JF8A 2J3MA 3EG5A 4X8HA 3SC3A 1ZUNB 1XVIA 2G70A 3ES9A 4HEQA 4KIUA 3ZX5A 4A4DA 4NU8X 4RVNA 4HK4A 5FWYB 4CLOB 2QUHA 1P33A 4H6XA 4LRQA 1TVEA 5EHZA 3C3AA 1JTFA 3WHKA 2VRCD 4LS3A 2EP8A 2NX2A 4HNHA 1GFIA 1YS4A 5EESA 1W29A 4M86A 3RS0A 1E7MA 3DMDA 1OPRA 2PGXA 1TJYA 4HH0A 3T9EA 2J7PD 5EE9A 4JT9A 1WV1A 5KNDA 3V42A 4N3BA 1N8NA 4XVRA 3DLBA 3OOWA 4XQGA 4DV0B 1BWRA 1NMQA 1TYBE 1E2EA 7YASA 2PLWA 1EDDA 4EPTA 3BICA 3RYCB 2QTCA 3AEKA 4RFSB 4AWAA 1O95A 1SBZA 1OAKA 2FXVA 2OAEA 2DC1A 2F55A 4NONA 2FPPB 3DDUA 4QLOA 2ZE5A 3AB3A 4FFLA 4KMOA 1B8NA 2VP5A 3NBXX 2X0JA 3FCUB 3P0FA 3PHCA 5IDYA 1U0OC 1NVVR 4ERXA 5AUNB 3NRJA 4CKCA 3RAEC 4TMZA 4QDTA 3K1ZA 4DIUA 1Y6GA 1NVBA 4F46A 1TCCA 1L5HB 4BVEA 2RONA 3E9ZA 4KQWA 5KOIA 1RYNA 3CS3A 5DHRA 4AJPA 3QX7A 4HLUA 2CLMB 4CLXA 2HN9A 3PD7A 4L9AA 4DDUA 2ZIXA 4R68A 1HFWA 4RMNA 3AOEC 4BC0A 4X44A 4A6PA 4PYIA 3KQOA 2NU9B 2E49A 1QYRA 3W6ZA 4LWOA 1OZHA 3RABA 4EEKA 1BDHA 2OHOA 4MV4A 3HB7A 5F5XA 4JLVA 5JHGB 2LKCA 4MS3B 3EEYA 1N5OX 1RM3A 4RM3A 4QHYA 3ZWQA 4CCWA 3F8TA 4NK4A 1E7WA 2HJHA 2QVCA 3UT5B 5BOSB 3UKOA 4F1KA 3GP8A 4BKUA 1QHFA 2CDAA 1JDBC 3TQTA 1GPNA 3NRCA 4QL3A 2MDTA 2D3WA 4J94A 3U0BA 4P93A 5MHTA 4U63A 2AF3C 4OFBA 4CLEA 4D4IA 4D92A 5KINB 3OQ1A 4OHKA 1G7CA 2R86A 2I2WA 2FETA 3BD8A 4LJKA 2ZIAA 3L4JA 1M0EA 3HXPA 3U7RA 5CDHA 1U7WA 2PUAA 5IZ4A 2BE9A 2YWCA 1Z15A 1KEVA 1MHTA 2Q5QA 1Z25A 3D5EA 5F73A 1BQ4A 1YSCA 3I6YA 4JSTA 1CIVA 3IALA 1W94A 3HFGA 3H97A 4LC9A 2XQKA 2X7XA 5AW1A 1XXHB 4O0LA 3S4YA 4BMSA 1ZAYA 2OHIA 3DWFA 2B5WA 3G2NA 5HJ5A 4Q00A 3S29A 4KE6A 2Z1NA 2GM3A 5FTNA 2CYCA 2QGFA 1CB7A 1ESMA 2ZYRA 2HBYA 4RHYA 5K0LA 4KDFA 3VVLA 3GAZA 5B7GA 2FCRA 3HVRA 2GXAA 3SQLA 3IAXA 3PQEA 2WU3A 3OOSA 4HNSA 1ADGA 1KI8A 1E64A 1MOZA 3HR7A 1VG9B 1JZSA 4ZMSA 2I99A 3F5QA 4L0QA 4N12A 4E5KA 3ENQA 1D1PA 2JJ1D 4QYTA 5EMLA 2J07A 5DM1A 4G5QA 4HEA6 3L0YA 2M6KA 5TR9A 2OY0A 4J9VA 1HT0A 1NQTA 1UR5A 2NXNA 2B6NA 3M82A 5KTSA 4JIGA 3RC7A 5JNSA 3R7NA 3DOCA 4NZYA 2P0AA 3A1TA 3ABQB 3LJKA 4BVFA 2V6FA 1T2EA 1YUNA 2E85A 5B7QA 1M9NA 1G5RA 1R74A 3T1TA 1V2HE 4XCXA 3JR7A 4XAQA 2ICAA 5AKEA 3RAJA 5BSMA 3V1TC 2IKQA 5TIIA 3MBOA 2P40A 4E5PA 4PYKA 4WOCA 1F2TA 1KPGA 4Q05A 4FUTA 3UMFA 4W1QA 1MV8A 4EI7A 3VSCA 4WHMA 1FTQA 1U2DC 1PTKA 2DWCA 1W0KD 1TM4E 2JCGA 3N86A 3QZUA 4FFMA 2VYQA 3D6NB 1VM6A 3IKJA 1OY1A 5DLYA 4M1ZA 1DKLA 4OFZA 5FHRA 5K5EA 4RO0A 4GEGA 1CVRA 4IDOA 5DIZA 4CQJA 4KQXA 3H6KA 5CFNA 4E08A 5LUAA 1QYDA 2X7HA 3K4QA 3RYIB 3GOQA 4HTAA 4CR7A 2IZ0A 3OU6A 4JT2A 3ZW9A 3FTEA 3D8TA 1PZMA 2B99A 2OORA 3M33A 5JAQA 1GGFA 3Q7EA 3SAJA 3QU5A 4GBMA 1B8VA 4GQBA 4Q3NA 1G3IA 2DMRA 5DM0A 3WLSA 2DBZA 3PVCA 1VKZA 5KTOA 4JLJA 3QFCA 5IC6A 2NUPA 3IDQA 2DXIA 1JIQA 2QTTA 1J8FA 2OCBA 3M6VA 1IG0A 4TWAA 3AESA 3INGA 1GOTA 1NY5A 4HG2A 1MOSA 2L42A 4EA6A 3SIWA 2HRQA 1E4VA 1C1DB 1DOZA 1QYCA 1N5DA 1R9GA 3MJDA 1VJCA 1LPMA 4J03A 4PAWA 1KJWA 1XVLA 4Y2SA 4QBIA 3ZU4A 1EFAA 4KFUA 2JCYA 3WYFA 1QCZA 5DWVA 3TAXA 4LJ7A 5C8XA 4B3FX 1YCDA 4RTRA 5I7WA 2COKA 3BQMB 3TDKA 1SCDA 2XYPA 4Z4CA 3B20A 4OH7A 4D3DA 2IQ5A 1JNXX 5JCOA 5L40A 1GPJA 4S1NA 2YMQA 3H2YA 4C9BA 4G1BA 2ZJOA 1EXMA 3ASYA 5AKHA 5EXDA 1AURA 1LB1B 4N0EA 2OCPA 5I8ZA 2YVUA 4AKEA 1VFPA 3QPBA 4Z0TA 2C2XA 4ILKA 4KWEA 5K4AA 4J0FA 2CSUA 3BL6A 3F3SA 3C7AA 2AFHA 3GZJA 2OBNA 4BRSA 1DUVG 5EJ6A 5DTJA 4QDUA 3OVMA 4A8HA 2FKNA 4LRTB 3ILVA 1AHHA 4MR8B 5DU2A 1M7HA 4PPYA 3IV7A 5AW7A 1VSQA 5JFGA 1RW4A 3E82A 4J0QA 4JJ4A 5EWLB 3O95A 4HL6A 1ZI9A 1X9HA 4BO2A 1QYXA 3T4PA 4GI3A 1LRJA 4V3CA 3NHMA 2ZTSA 2VCHA 4O4JF 4US1R 5H59A 3UC9A 1JU4A 3VHLB 1OBVA 2GN2A 2XNDA 3WP1B 3USES 3KEQA 5GIPE 3E7WA 3O9VA 4X24A 3ZCTA 2QRNA 2C3UA 2Q6IA 3N7AA 2WTNA 2BGLA 3GMSA 2PD6A 4QDJA 2QRMA 2AFHE 3I5XA 3HVKA 1KJ9A 4HBGA 3EGWA 4CM5A 1UBNA 3WAGA 3MINB 1A7AA 1ZJJA 3HEMA 4S1PA 3WB2A 1NYQA 1VIDA 2UVDA 1C7JA 1QDUA 3NJ4A 3QWIA 4MVWA 5G40A 5CDGA 1HDEA 1EBFA 1U5AA 1KSJA 2ZJ5A 4P4LA 4Y6RA 3MN1A 4C88A 4A16A 3T94A 1M1YB 1GZVA 1O57A 4RJJA 4PHTA 4OHBA 3VPXA 1ZW1A 1FLNA 4IQFA 3MM4A 3PXBA 1HT1E 2FFRA 3CMCO 5FUYA 5JJBA 1QPGA 5FOWA 3WAKA 5JT1A 3NXKA 3H1PA 1Y5IA 2GAOA 2DWUA 4OQEA 3SXJA 3VJLA 4DLLA 2WM3A 4WXRA 4K9DA 1LBQA 1CUEA 1L7AA 4JBYA 1ISMA 2H7VA 5HE8A 1GZHB 3BBPA 4I1SA 5CPBA 1NDUA 1W5BA 2QZ4A 3CH7A 3FUXA 4D9JA 3A04A 2QMUA 1CY1A 3L7MA 5B5SA 1UMKA 2PZMA 2ZFUA 3IT2A 4CMKA 4U6SA 3M5DA 3FM9A 4D5EA 1JI0A 2CEKA 4MSUA 2EKPA 1NQVA 1YTUA 1CEEA 1IL0A 1Z2OX 2NO9A 2FG6C 2GTIA 3B6KA 5JCPA 1E79A 3DBHA 5P8WA 2PL1A 3IEMA 3VOSA 2FR0A 1V2GA 2VNAA 3U7JA 3PX3A 5D51S 1J97A 3O21A 2FLKA 2LDBA 4ZXFA 3HJAA 4I9GA 1XLTC 1CDOA 1V8PA 2JGKA 3MMPA 4KO2S 1T3HA 5JXGA 2GETA 2J48A 3MOIA 1E2LA 1RYHA 1N0IA 2OXFA 3AR7A 1ULHA 1O03A 4WCFB 1E0AA 2WK1A 4C4SA 3ICQB 2IYZA 5F4BA 2IKSA 2W6QA 3IUBA 3PYLA 5BUZA 3HBMA 4YV2A 1T10A 4FMCF 3ENZA 2DVMA 3JQBA 2OFPA 3IQXA 4MV1A 4D5GA 8OHMA 16PKA 5I9LA 1GPDG 3H87A 4OHXA 3ZH9B 5ENDA 1GITA 1AY0A 2MYPA 1ICEA 2YRFA 3SNHA 1JLRA 1NJ8A 1TIPA 1XNGA 1JLSA 3KD2A 3Q7SA 3VI3B 4AIIA 2BGWA 2UUAB 3OKPA 1X42A 1YUMA 4ZAYA 4BGEA 4LSMA 4IH9A 2IU6A 2RBGA 4MKHA 1SQFA 2C0QA 4D3SA 4QDZA 4OUDB 1Z82A 5JCJD 3B7GA 5GZ6A 2OXEA 2IZZA 2VNKA 1Q7CA 3AF5A 2FLVA 2QE6A 2WNIA 4IL5A 4PQYA 3SJAA 2F62A 3VC7A 4ZIRA 4B3RB 1W47A 1Q83A 1V5GA 3K0HA 1JQBA 1Y3DE 2YC4C 4C1NA 4D56A 2EGUA 1KJQA 4DYHA 4F3NA 1PLJA 5JAIA 5MF6A 4B33A 4B73A 5IWCA 5BNZA 2E5WA 3H5AA 2XMRA 4HFRA 1G59A 4E7OA 2XZLA 1GRCA 3ZDAA 4F2PA 1HNZB 3BEOA 1UBLS 1I9GA 1PJ8A 2J0EA 1NN3A 2IYTA 3OCVA 4U9HS 2GSWA 1JHDA 5HIJA 3KJXA 4HDCA 3AWIA 2HYIC 3WVNA 2P4QA 4RLQA 4RSRA 2WVHA 3CEMA 3WXBA 2FQWA 2I4RA 2PJZA 3QKWA 5B1EA 2VWQA 1EYZA 3TRDA 4JODA 3STVA 1F1BA 4A8TA 1EDZA 3IKLA 3JYOA 4UBNA 3LT0A 1YKGA 4YJ2F 3C3CA 4I8DA 5ALZA 2I34A 3ZHYA 4RMJA 3MT9A 3G82C 4O4LB 4YTEA 2ZIWB 3U0VA 2VP6A 1NVKA 3G9TA 5FV4A 1D2MA 3VH3A 2CBZA 2CVZA 2XQFA 4Q4JB 3GUUA 3ESXA 1NXXA 1XVAA 5FBZA 4AULA 4JWTA 3LBHA 2AI3A 4CM1A 2W2MA 1LWNA 1ZMTA 4P92A 4TKVB 3IEVA 1NI4B 1QO0D 1F6DA 4Q03A 5A62A 3KKMA 1YJ5A 2IVFA 3HWSA 2PG3A 1PZFA 1FDTA 3QMWA 2WTUA 1SUAA 4DY4A 1SHLA 2WT8A 1U28A 3LOQA 2WV7A 4JI4B 1UDBA 2GWRA 4GM1A 2X3FA 1YIAA 4RGBA 1GPYA 1HRDA 3FPLA 3UC5A 3T0IA 1ZP6A 3LKDA 2RGAA 4QFMA 5EP4A 4BP9A 4FZJA 5JV5A 2VDUE 3F9CA 1TZKA 3HA7A 3O9MA 2Q3DA 3P2OA 3UANA 3V3TA 1T6NA 4C08A 1IQPA 4X95A 4CFYA 3GLFB 1W0JA 3CJRA 5HPYB 2ZZMA 4FSDA 3GNTA 5HILA 3RK1A 2BLLA 2P6UA 1ZONA 3I6MA 4LDAA 3NHWA 5IHPA 1MENA 3EIFA 5EMJA 4EGAA 2NT4A 7GPBA 4EVSA 1US8A 4JP1A 5HIIA 2XCSB 2CLFB 3GJXC 3M6UA 2JH3A 4JC4A 1SQ0A 4MUIA 1WHSA 3LT5A 3G0GA 3KL2A 2P77A 3TM4A 4GQAA 4E2WA 2OBYA 5A5FA 2WTXA 3KJEA 2W98A 1O0CA 3O26A 2ORVA 4QAJA 4ENPA 3GG9A 3HUUA 5KAMA 2GEDA 3KSMA 4G3XA 3IIEA 3H0CA 3W6OA 4CMBA 5DM70 4WMLA 4P4NA 4H7KA 4RABA 4MUJA 3RUCA 1RXSA 2XLBA 4H77A 3UK0A 3W5IA 3T3EA 3V2HA 2GN9A 3OZTA 4ZREA 1KJYA 1GNVA 1OWPA 2B7LA 2ZRDA 2GN1A 3BERA 3FYCA 1HYBA 1OLUB 2PMKA 5DW0A 2Z6AA 4BJ6A 5F3WB 2R8OA 3ERCA 3E5MA 1IXKA 1AGRA 1MC5A 1G21A 5E9QA 1UDRA 2HR1A 3ETNA 3JX9A 4PBSA 3RLFA 1UFKA 4EO9A 2FW9A 1OXBB 2X22A 2BV3A 1W6UA 4RKWA 1LZKA 5C4GB 3PNSA 5GJVC 3WISA 1PQ4A 1VA5A 1EQUA 4V0SA 3FPFA 2XYVA 3WOHA 1XEXB 3EW9A 3IDOA 5KYXA 1JECA 2C4UA 1HM5A 1A9SA 1UKEA 4XVHA 1DT3A 5CUQA 3WMFA 1KYXA 2UZAA 4PHHA 3DBOB 5HE9A 3WR5A 2WYVA 2JEOA 1Z6XA 3LA8A 4LGVA 2FQYA 4IZ6A 4OSEA 1I2BA 2V7VA 4UDXX 1E98A 2FNAA 2VYVD 4WA7A 1VB5A 4B6FA 3KUKA 2P3LA 1K8QA 3MTJA 2AN4A 2WV9A 2CXNA 2ZJAA 4LXYA 3DVSX 5CTJA 1I4LD 3UB4A 1JSZA 4IUDS 2IUFA 1G21E 1OYWA 2ZTVA 4J4BA 3TUIC 1BFUA 3E18A 2CWDA 3V8BA 2FEMA 2Q3HA 3DEIA 4EW3A 2IUUA 3Q7TA 4RV5A 1DQSA 1Y8RB 3WWZA 4LRSB 3TRHA 1XCJA 3ODGA 1G20A 1U0GA 3K0EA 4EYOA 5CCXA 1H23A 1F60A 1T4CB 1SBNE 1CE8A 2A0XA 1UMBA 1WHTB 2A1UB 2FPOA 2YHBA 3KV1A 3L8CA 2CFTA 4HDSB 4LQ4A 2QZZA 3ZH2A 3SHOA 1LLUA 3C6MA 5MN6A 4OQYA 1DDGA 3I04A 3ZY4A 4JLKA 1CEXA 2G9RA 3CNQS 4XTCS 2OCAA 4RTKA 1C9EA 4YCBA 4AECA 1F8XA 4H0CA 1ZXBA 3L8YA 2A9FA 4PGAA 3WGYA 1XWWA 3VBEA 4DIBA 1AZSC 1L7QA 1QLJA 5TPZA 3RTCA 3W9UA 2C7VA 3SDSA 2VDLB 2GPTA 4EHFA 5JAUA 1CZOA 3NHPA 4GPAA 1Z62A 1YRBA 1E66A 4DGQA 1SBIA 2ZETA 4X93A 5C3UA 2OZLA 3DFMA 1ZD8A 4N82A 4XYGA 3NYRA 4EA8A 1Q1NA 3T1QA 3PNLA 1PFYA 2C1XA 2H92A 4E5SA 1A82A 3F7OA 3CRVA 3L43A 3ND6A 4L51A 2ZRCA 5FPSA 5BUCA 6CHYA 1WB9A 1JH9A 3WRYA 2REXB 2P9YA 1VKRA 4RULA 1TB4A 3M5CA 1CIJA 1MGPA 2XD9A 4IMJB 1QE5A 2XWJI 3BE6A 2PUTA 3Q87B 4FJ1A 1ZVKA 4BLTA 3P7MA 1OOEA 4GWLA 3WLEA 1T5TA 4ALKA 5JEDA 3PQ7A 1CZKA 1CZNA 1NWHA 2PKQP 3FVVA 3KHKA 2ASVA 3JCZA 4Z54A 2P1DA 5JVDF 3ICVA 1OZGA 3DUFB 4XCVA 5K6TA 4LHWA 1CVIA 1KH3A 3BJRA 3M34A 4KV9A 2C4HA 1EVKA 4CV1A 1NP7A 3D81A 2RK3A 3QVJA 4P80A 1OILA 2ZS7A 2NXJA 3B38A 3E3LA 1QVVA 1QANA 3CWZA 3MGGA 5M5BA 4URZR 2OV8A 1EP2B 4Z1OA 2IEDA 4P58A 3PC8A 3TQSA 1CZHA 4BNFA 2PIAA 3QUTA 3IUNA 4RKYA 2POCA 2B8WA 4KX3A 1SD1A 3B60A 3EVZA 4EJ0A 4F6LA 1NQAO 1L5LA 1C8KA 1G42A 1HE3A 1UWKA 1TFRA 2JLBA 2OHGA 3EUWA 4X3PA 3NC4A 4YP6A 1PZNA 3VZBA 5TEVA 4A6DA 4RD3A 3DLHA 2O7VA 4I4TA 4ZO6A 4CEIA 4CCYB 3I6ZA 4IIJB 2YYYA 1NIJA 3OQ6A 4ER3A 5K8LA 2B37A 3ONFA 3TK1A 1IE3A 4P2BA 3SYMA 2QZPA 4Y0NA 5ALEA 4RTMA 2PT9A 4TYNA 3L6DA 4O2BF 1TIBA 2FFQA 3IBCA 1KO8A 1P80A 3PFNA 4LBZA 3WLQA 4EELA 4QM6A 4MVCA 2MOKA 3TVTA 1IZZA 1KO7A 1U7ZA 4HFJA 4JX9A 4NV0A 1WUTA 4PYLA 5K09A 2I9PA 1E9DA 5H83A 1E9RA 5BV2P 3I61A 5DMHA 2IP2A 1V9LA 3IQEA 5ED0A 4ZARA 4FNAA 3ED5A 3RBVA 4BBJA 4DRXA 4R1NA 1LF0A 1QQAA 3EEIA 3L0BA 1YVPA 2EEPA 3AOGA 3OF5A 1F5NA 2GCPA 2JANA 4HQ6A 2AG1A 5KJFA 3R0IA 1E9VA 1GUAA 3I9OA 5JQGA 5B30A 1Z9BA 4HGRA 5DB4A 5IX8A 1O0BA 4MYTA 2ZBRA 3PUVA 3PGKA 1VPDA 1PYGA 4XQEA 3CWCA 2XNSA 2AJTA 2BI8A 1J25A 2W9XA 1UIMA 3ABOB 4MV6A 1JG4A 5CD1A 2UYGA 3BQNB 3TTXA 3GFPA 1NUTA 3BRCA 3H2GA 3RCBA 2OGTA 2J7KA 3PENA 4RHTA 2AUTA 4R0VA 4JI1B 4B3BA 3HJHA 5B7NA 5SY9A 3R7BA 4G0UA 3RIEA 4CI0B 3E27A 4C7KA 3I9KA 4J1QA 3V2IA 3DVRX 4F1WA 4FHGA 1QF6A 1DBIA 1FTSA 1RPNA 1ZLXA 1NKVA 2X8LA 3CKMA 3RYFB 1LNZA 4CT5A 4N3GA 3MMXA 4WY2A 5JLJA 4YMSA 4KR2A 2XVMA 1VGRA 2CE2X 2G88A 1AQIA 2ZE7A 3DE7X 3JASA 3RSSA 4C89A 2TMKA 2NYRA 3ASVA 1GU7A 1ZK2A 4EECA 1Z28A 4FGJA 2B82A 4HAUA 4Q7KA 4BN4A 1RI2A 2AEFA 3FWZA 4C7XA 4RX1A 4DLRA 1PDWA 1M0TA 1P45A 1XTJA 3UMCA 5I7VA 5AVQA 4H31A 1V7ZA 3REFA 2P9HA 1WULS 1T9AA 4JB3A 1CRPA 3QKSB 1NTRA 1RS0A 4EKDA 2OWDA 3BWDD 1RYYA 1NG1A 1D4AA 3E8XA 4BPBA 3LF1A 2GO7A 1KS9A 3H1EA 4U3JA 3THRA 3UAVA 3PPYA 2WKRA 4I3GA 1Z63A 2I22A 4NAVA 3KYDA 5KDDA 3L6RA 2NUTA 3QYAA 4OIFA 4YRZA 1FEZA 2H63A 1LW6E 3NT4A 3UA3A 1P77A 2WPDA 4LZZA 3LLVA 1ULBA 3FR8A 1JEEA 2VYFA 1XWFA 4F1JA 5JAOA 1YI8A 2E5LB 3T7CA 5DNUA 1E3IA 4NQZA 2IDJA 4FM9A 3PJRA 2ODTX 2PCLA 3HSYA 3UUFA 1ZH0A 3TIFA 2PFKA 3EFEA 4IEIA 4LY0A 3VU9B 3ZDBA 2FZLA 2YWDA 4RADA 3TLYA 2YUIA 3NASA 2GDZA 4BDSA 3QFHA 5DYNA 3KAQA 4NBLA 5BMVB 4DCSA 1SR8A 3NIBA 1FS6A 2WUGA 1NQ5A 4WUTA 2G4CA 2WYIA 3L6UA 3F3YA 3DA8A 4GGPA 4XE5A 4XSHA 3VDQA 1IOZA 3CB2A 3RUIA 2Z4RA 3OT4A 4Z51A 1VMKA 3TBHA 1CUIA 2PZKA 4QAQA 1K6EA 4Q47A 4OL9A 5SYNA 3VNAA 3U61B 1VCHA 5KOJB 1MX3A 3KJZA 3L0ZA 1Z4LA 5GV8A 3JD0A 1VI2A 1WV0A 3O8LA 3LOUA 1IJBA 1E61A 1ZJYA 4OK3A 5GGXA 3RFVA 2FPIB 2UUPA 2D13A 2SCUA 3I5MA 2WM8A 4RYDA 4NG5A 1R16A 1O4VA 2QSJA 4U6QA 3RVQA 3FOZA 1BQEA 3O90A 4L5JA 1CQIB 1DG3A 3KZ1E 3BVPA 4M99A 4ZQGA 4I5IA 1S6YA 1RLJA 2EJCA 2R2AA 3WYAA 1JDNA 1Y89A 2XYRA 5AJWA 1FVHA 4NPHA 2X13A 4FI3F 2J0UA 4B44A 5E6SA 5IUNC 2IYXA 2JIZA 4PRLA 1I6KA 1Z6YA 2O9JA 2LGJA 3D6FA 3PUJA 3ZCUA 2FZEA 5C7OO 2DEUA 4J8PA 4FT4A 4JSYA 1GVHA 1WKVA 1XN1A 2AHRA 4CR8A 4O3MA 4C4ZA 4A27A 4BNKA 2AK3A 3WWYA 1ZUIA 2R1VB 5EIEA 4YRJA 3D6JA 2ZTLA 1YACA 1SQ5A 1JT2A 2VZ0A 1XTTA 4LWQA 2VIIA 3AB7A 4BP1A 4CQLB 2VXOA 4QWMA 4Y2TA 1JDVA 3KEOA 5AIAA 3AHEA 1BCSB 3G0BA 3KEMA 4PPGA 2AYXA 1H2FA 1U3DA 2BGKA 1D4ZA 3NTLA 3W5SA 4EZEA 2GHQA 3QEJA 3K0SA 2I4OA 5LA6B 1H6CA 5LLTA 1KMQA 2QL7A 3ETDA 3MQ4A 2M6RA 2PZAA 4D82A 2PLFA 4C3ZA 1Z22A 1E2HA 1DFHA 3OQPA 2ZIUB 2BMAA 3I6IA 5IYZB 2FWRA 1PSDA 2OFXA 3O8OA 2PZGA 4XVQA 3T1HB 1ZN8A 2YYSA 1U1CA 1EFPA 5IF3A 4K6HA 3C8UA 4C0BA 5GJBA 2AMJA 1CFZA 2OMEA 3BMOB 1UXHA 2VT6A 2JHCA 4J16C 5THQA 4NMWA 4CM8B 2A92A 3N87A 1KNQA 2A2ZA 4GYWA 4JLPA 1EK5A 4RVSA 5EIBD 4H17A 4CKYA 3FHTA 1NT4A 2CMGA 2I1LA 1Y42X 4QJ4A 3O0DA 3NJRA 4V0RA 2Y3IA 2GD1O 1AOXA 2X0DA 4C5BA 2J3EA 3L40A 1V16A 4B3HA 3IKTA 1P1FA 1E7RA 1CKEA 1MV5A 121PA 3IJRA 4WECA 3ST7A 3UCXA 1NASA 3C7KA 1GKYA 3QFSA 1BGVA 4M46A 5GM1A 1J5EB 3TE7A 1HH4A 3AIIA 1YZLA 3TDNA 2JK0A 1Z73A 3C70A 2C59A 3OFJA 5LDGA 4ABTA 1MZPA 3UAZA 3BK2A 3O3NB 3GFVA 4TTSA 3QW4B 5DRYA 4NE2A 3TH5A 2Q4EA 5DOVA 1S8NA 3ZKWB 2R0QC 4GOXA 4OGWA 2OXTA 3COJA 4YCNA 1FUEA 4HRXA 2IPXA 4H4EA 5HIKA 2M6LA 1YBMA 4URWR 5LD2B 3UYLA 3SF8B 1T3TA 3GPCA 3B1KA 3KOOA 3E58A 3I9V6 3KP1A 4LVUA 1DAGA 3U4GA 3JYQA 3K5WA 1V41E 1P4HA 4X1OA 4TOIA 1GCIA 1S3GA 3VR1A 4AZ0B 4BV2A 4D96A 2EL7A 3L18A 1R0LA 3SQWA 4TN5A 1ZSYA 3G2PA 4GSKA 4YJHB 4PNEA 1TF2A 1XCOA 4NOMA 1XZLA 3ZDDA 3L0CA 3HA5A 4TT3D 2FZCA 5FNZA 4RGQA 4S12A 3RNOA 4CL0A 1TUIA 1V47A 4M1WA 3ILXA 4ND5A 3TXYA 3UO8B 4XPIB 2HV9A 4BNUA 2J6HA 2GUGA 1FY2A 1ZMRA 2DH5A 3MS2A 1W0CA 2RGRA 2YUTA 4EY4A 3NUZA 1VLHA 2O6LA 3WGNA 2W6JA 5FV7A 3BRQA 3LC2O 1AN9A 5K0EA 1AV6A 3K70D 3QEMB 4C5AA 2IHUA 1DIGA 1GQRA 4FTWA 4LOJA 1YTLA 4URUR 2X42A 5KTYA 4Z4QA 2Q4DA 3FFBA 5LLSA 3TINA 2FWIA 3GA7A 2W37A 3GQBB 1XLWA 3PC4A 2FU5C 4OI4A 3R9KA 3OZIA 1ISFA 2IT1A 2D4HA 1LK0A 3DG9A 3MPUA 3U37A 2QX9A 3X1MA 2NPIA 1SG0A 4AN0A 2PSDA 2JFXA 1H0SA 4LGCA 1VJ0A 3DSRA 1NJ1A 4U7GA 4C3OB 3BFVA 4DARA 3CUWA 4I0WB 5AW0A 1FW6A 3AVUA 3ZV5A 2XZTA 2QAGA 1CRQA 4JNKA 2X7JA 3ABSB 3ZBUA 3TSWA 2QX8A 4BB0A 3N7UA 4FHDA 3WGOA 4UNSA 1DAKA 5CDYA 2IJGX 2NQ8A 4FONA 4U7HA 1QP0A 1D7OA 3OEEA 4QSHA 5KWEA 3H9JA 3OMWA 5EZSA 2K7FA 3AVQA 3ESDA 5E4YA 4R54A 4TPKA 4QPPA 4R1MA 4ZCLA 9LDBA 3Q12A 2M6SA 3SYNA 1V25A 4YRLA 2W2KA 4AUKA 4EKIA 5JJCA 4UHKA 3GDFA 1ZQ9A 2HCJB 3FROA 1IH8A 5A5EA 1RHJA 3A1VA 1R8SA 4V24A 3GPDG 2IDZA 2JK1A 4LYGA 3EFOA 4REQA 3OX4A 1FRNA 1LPNA 3BDVA 5FUWA 3QPWA 3CUYA 5AKGA 1M34A 1NF8A 1Z4JA 5AJTA 3ONNA 4F12A 5E6RA 1L9KA 3K6SB 3D7RA 1E92A 3OF2A 5TRTA 3KAPA 2HX1A 4ZCIA 5JY1A 3UMBA 1RRGA 3HV2A 1E2NA 3DQQA 3TLXA 1OXMA 1LLDA 2DQYA 3GLUA 1PX2A 3VNSA 1EBUA 2R6DA 1X0XA 1GA4A 4HX5A 1Z6AA 3K6RA 1QC5B 4JYMA 4FMPA 2LVBA 2C00A 3JD3A 4C7OB 2GXUA 3KTFA 1TVCA 2G1KA 2ZIFA 3QU2A 1VPVA 4HJXA 4INAA 1U3FA 4L02A 2IF2A 3JQRA 2O8BA 3U9LA 2H4JA 1KY2A 1WXFA 2AC2A 3P2IA 1M34E 2OHVA 3K9LA 1P2FA 1QS0B 2NIPA 1KJJA 3GGJA 4PV7A 2OMKA 1K9VF 1OXUA 2B20A 2NQTA 2OV3A 1E3WA 1NC3A 1VSBA 3B9PA 3OZAA 4H35A 4HTFB 5A6SA 3GLHB 3A9CA 2RC5A 3IIIA 3LGXA 3QVKA 4PLHA 1PL8A 4QPNA 4LXHA 5G0TA 5GGYA 4CFZA 3CUTA 4FDAA 4R05A 4IGAA 1SULA 1Y3FE 4JB8A 3Q7IA 2HDOA 4QVIA 3EQZA 3INYA 3JQCA 1K7EB 3ML1A 3WGZA 1H0RA 1QIFA 3ANLA 2CWWA 1M2VB 1P8AA 4YP5A 1XHFA 3A2LA 2QX7A 2FMTA 3THOA 3SS7X 1I4OA 4OOFA 5G0VA 2ZBGA 4A92A 4BWGA 2AFIA 2Z6UA 1UPTA 3OJXA 4P0TA 3RSGA 3II6X 1D9XA 1S1CA 3ZW8A 3RS8A 5EQJB 3TOZA 2RMKA 1ZGJA 3O3OB 5KDLA 1L2TA 4JASB 4CLRA 3MTEA 2V3VA 4LDQA 1U8UA 1XZJA 4CEJB 4A8JB 4G07A 2HQSA 1M6WA 2RH9B 3D6VA 4A8JC 4NC9A 2DUWA 1RC0A 3FTCA 1H4SA 1BA2A 1WKBA 3EIOA 4GKVA 3OZXA 3U3JA 1V11B 5CB4A 1J9EA 2C8LA 1MU0A 2KS6A 4X1KA 1UKVY 3BXOA 1ZVMA 2BHLA 4PSDA 1G60A 2J6BA 3HNRA 2OO5C 4FYXA 4TQ9A 2YINC 4C30A 5CIQA 1Z0UA 2NO7A 4DNOA 1X8XA 3JQ9C 2AFIE 4KLZA 4AJJA 2YN2A 3OCYA 2QPAA 5KKNB 1T8RA 1X38A 3TVYA 2C92A 3VOAA 5BQXA 3JZIA 4P81A 1SO8A 2L0XA 4F72A 2FR8A 4O2AF 4H27A 2R6FA 2VDRB 2F1JA 3AVPA 1YDEA 3QPCA 4LXGA 3SKXA 1SIWA 3GLIA 3DOEA 4B79A 1Q74A 3IPLA 2WMOB 1YMQA 2ZAIA 3ZGXA 4Z4FA 3J7TA 2ORYA 2KM1A 2HJWA 4NOKA 4PFSA 4GMDA 3L4BA 1L5YA 5A9TA 5C18A 4I99A 2CHFA 3MW8A 4JHXA 4KLNA 1ICIA 1MJNA 3ZVKA 1CS0B 2C4VA 1P3Y1 4BQIA 2ISQA 1PSWA 4UTPA 4NQRA 3U4QB 1E3DA 2QN9A 2XUIA 2KW5A 1CUHA 4OJMX 4GP7A 3KU4A 1PR3A 3IDFA 4R1UA 3K0KA 2PS0A 1AKYA 2O4CA 4G9GA 1DXOA 3N39C 4LW8A 4LG1A 2VO1A 1U9YA 3RE1A 3NHFA 3U7QA 4NYJQ 4UUMA 3GLIE 1TYZA 2XUGA 5HDQA 1T2VA 3S2IA 4MR7A 1YBHA 3EA4A 2H9YA 4C43A 3QNWA 1NJSA 2CLDX 4MLZA 3EXHA 3K8OE 1PQWA 2V0GA 3D0OA 2J9XB 3HLKA 1DDIA 1QOQB 1NR7A 5HUJA 3OWOA 2UVQA 3ENNA 3H2KA 4BJHB 4BN5A 2XB9A 4KI7A 4Y1EA 4DA7A 2BTEA 2UZ0A 1MVOA 4OKIA 5EJGA 4X64B 4UUOA 3EAGA 3QX9A 2VTKA 2WWXA 4KLRA 1K2VN 2PGAA 3IQDB 4W6ZA 4P7FA 4L5YA 5HFJA 4KPEC 3COYA 3OE7A 1U0LA 2FZ4A 3TZLA 3S2YA 5TPZD 4Q34A 2DUNA 2NSJA 1XA0A 2C1ZA 3RTBA 2ZRFA 2GUWA 5E9WA 3FZEA 2ZU6A 5FWXA 4DMFA 2JW5A 1X0VA 2XMBA 4MMYB 3R6DA 2I62A 3ABRB 4MVJP 3KYCA 4FCWA 4PF1A 4XI9A 2OYRA 5CLGA 4BFUA 4D79A 4YPFA 4OPMA 3R7LA 3ETHA 3FE2A 4K2HA 1OAOA 4YO7A 1A9QA 4DDKA 3ZXYA 3NUGA 1E6MA 4U2DA 1GFWA 4TXJA 2P5YA 4M36A 4R16A 1Z6QA 2GS9A 2IBTA 1QBGA 3OZBA 4DR6B 2BFEB 5IAEA 1Z5UA 4IFEA 1JFSA 1TZJA 4E70A 1DZ3A 2MSNA 4ZZ2A 2WA1A 1HPLA 1T36B 3GU3A 2H1FA 5JMOA 1EWRA 4MHSA 4EY6A 5LPNA 3QH4A 1PWEA 3JYHA 4NESA 4MCJA 2HK9A 4S35A 5AKLA 2GSDA 5FB3A 5DSZA 4E07A 4IX1A 3TVDA 3UK2A 5AVSA 1ILEA 2FZKA 3IQGX 3WQBA 5IMSA 4TXLA 2GRUA 4LGMA 4GI2A 4B3DA 1LPOA 2ORED 4FIDA 2X6RA 3I0NA 4KU4A 2WE7A 1KQOA 4G1MB 5CX1A 1DWUA 4M0DA 1T34A 1ZOSA 5TS2A 1H85A 2ZKIA 2FPMA 2CXPA 1TQHA 1M8JA 2P79A 1HZZA 2NADA 2PWYA 3FJ1A 3HSSA 3IP1A 3M4JA 4ZAGA 3W06A 3AKZA 3FYTA 3THXB 3PPWA 1QMGA 2HK7A 1CQXA 1U0FA 2BTQB 3GH1A 3T5MA 5HUQA 1GPWB 2YCLA 1DOAA 4GOND 3NOVA 1NJFA 3N8DA 2O2GA 4AURA 3BCHA 3R7WA 2JH8A 3QLUA 4IS2A 5CFLA 5I7RA 4QT4A 2ZTMA 3EIWA 3MBKA 3TQOA 4HOYA 4TZ0A 3BB1A 5JD6A 1X8KA 2WAMA 1C3XA 3DL0A 3H1GA 3H5LA 3V4PB 5J3JA 2F9LA 2EW2A 5DTRA 2GFHA 1E1DA 5CM9C 4GGMX 1UH5A 4F4DA 1OTHA 2YJ5A 5IPFA 2HIGA 2JIMA 1IU9A 3SDZA 3SG0A 4RBNA 2JPDA 3PDUA 4F3TA 4QJ3A 2SBTA 1R5OA 3O8QA 4JB2A 1HLGA 2DR2A 1O89A 1ZVQA 1KY4A 4FOPA 1YZVA 4O2RA 1NBHA 1NIPA 3LQYA 1K7CA 4OG2A 4JUFA 2C5FA 3DTYA 3OQNA 3GNLA 3ZIAA 4OI2A 1F8FA 3JVUA 5D3MB 5LN1A 4ETMA 1QIKA 1SKQA 1W4AA 1Z06A 1NVUQ 3KPYA 4ENRA 2ZZNA 1MB2A 1EU1A 2XRFA 5T3YA 5FL7A 1G8KA 1NW4A 4KQCA 1KBQA 1IXSB 2YL2A 3GT7A 1RIIA 3HWWA 3K9NA 2A78A 2DFDA 3KJFA 4TKUB 5CP8A 1M1ZA 2H11A 3U1VA 3ZVRA 1RZ3A 5EJ9A 3DW3X 2CEAA 4LNAA 2MSLA 2L69A 4FSXA 1JQKA 4N0MA 3VOBA 3FZNA 4L16A 4MYCA 3SOZA 5JD4A 2VFAA 4GDFA 3O4JA 1NVTA 4FFBB 3PPVA 4KFTA 5BSEA 1FX0B 4NH0A 1FU7A 1YQUA 1NW3A 1GAWA 5FBLB 1HQCA 4YCMA 3ZIUA 3NV9A 4G2NA 3B9RA 3B3GA 3O5AA 2A4MA 4L4ZA 3U3KA 5DK6A 4DMLA 4DW8A 2ZIGA 2ZJFA 3ANYB 1BKSB 4TV8B 1JG2A 3Q6MA 1WEKA 4IYRA 1ZO8A 2JJ2A 3TXXA 3DBRB 4DSZA 4XQ0A 1LPBB 1EZ1A 2GILA 1BJRE 4G0YA 3DULA 3Q15C 4BU0A 3JATB 2DU8A 1U8ZA 3BFKA 5AHXA 5IDWA 3ZGNA 2G1JA 1LCIA 4C6SA 3P2MA 3L6CA 3G7SA 4MW9A 1EDOA 3ELYA 1M8FA 2FSSA 2WF7A 5FOVA 5F1YA 4QYIB 2BSXA 2R60A 1N5KA 1U80A 5HK8A 1WB4A 1YBAA 4QGSA 4BZPA 4GLOA 3F6SA 3DT9A 2VDNB 4GZ5A 1SEVA 4NZNA 5EVJA 1WCV1 1ESZA 1H5QA 3MJHA 4M9QA 4N03A 3MJ4A 1PD1A 1C14A 2RE8A 3ZWPA 4EB8A 4D57A 4BY9E 1O5IA 4RK1A 2PN1A 2BFWA 3QTBA 4KPGA 3QHAA 4GW3A 1IVSA 4I2NA 3KQLA 4WQMA 2WQZA 1C9KA 2I71A 2A59A 3OQBA 4MGIR 1DU4A 4HEJA 5I3ZA 1GSIA 1IEWA 2COEA 1V6SA 1I0IA 4Q66C 3U4HA 1M5RA 4LJ8A 4O4HF 3IBYA 4U7WA 2B21A 4PQEA 1QUEA 3KJIA 4YMGA 5JI3E 2DWOA 3QPDA 3QSYA 4KO4S 2FFJA 2ZR9A 1I4WA 5JNTA 2YHUA 4M83A 4MWCA 4PXYA 4C06A 4YCLA 4JDPA 4PPFA 4WKNA 1ORRA 2AXEA 2IZ7A 2D1SA 6Q21A 3SC2B 4RIEA 1Z56C 2HCTA 3MC1A 2C5GA 2ZAMA 3MMSA 4NCNA 4R1SA 1OTYA 3FH0A 1Y82A 3IQZA 4OBBA 5AHKA 2GAJA 2IYPA 2OP1A 3WLPA 4AY2A 3FSGA 4DM7A 2G40A 2JFPA 3PCTA 1TKRA 3I2KA 5BN3A 1JEYA 1XZAA 4XFDA 3TOXA 2G17A 1CS4C 2AE2A 4P3YA 1E2BA 2R66A 3CFYA 3QKRB 2XTNA 3PF8A 4U7TB 5TQ2A 3ZWAA 1GRRA 3FUUA 1VE6A 1Z4IA 2XVXA 3I9MA 4U9IS 4RTNA 3QUBA 2C7PA 3E9RA 5BUQA 4UDNA 5REQA 3U4MA 2A0YA 1M7BA 4AYWA 5K3OA 3AEUB 4NS1A 2QUZA 1H9AA 2O2JA 3BGOS 3MWJA 1U5CA 2A0FA 3MMZA 2O1EA 1T9HA 3Q8WA 5H16A 3ZCVA 4BMDA 2G5PA 2LDXA 2O2SA 1YOBA 4I36A 4NZMA 3C39A 3AM4A 2PVPA 4ZVPA 1SVKA 2NZ2A 4KHZA 4EJFA 3OQIA 4RA6B 3QQ5A 2OCXA 4IIUA 5T4HA 2A5YB 3VR4H 3OLVA 3T3NA 2OAGA 4NEGA 4DR2B 2I6FA 5LBTA 1HURA 1ZN7A 1H05A 3DXYA 2BPOA 4PZDA 1XD8A 2NU8A 2WTEA 1VYVA 4CEHB 1KZYC 3H18A 3ZCXA 5AUOB 1CLEA 4UTOA 5K03A 1JNYA 2UAGA 3LQFA 4F4UA 3H1BA 1MOPA 1TVKA 1PR0A 3AJ9A 1YE3A 4ILEA 1BTOA 1AZWA 3DHVA 1O58A 3ZCQA 4P82A 4CVNA 4LZLA 1NOIA 2P9JA 1SELA 2AWNA 2F17A 2VAVA 2VCYA 4FOLA 4FYVA 5TS3A 4BIIA 1C7RA 4LC1A 4R9NA 1K9SA 4WLVA 2ZJ6A 5CJPA 2OCLA 1M5UA 1CDZA 1UC4B 2OC4A 3HP1A 4I3HA 2Q27A 4DSAA 5JCXA 1JHQA 4D4HA 4F3KA 3PUIA 2V58A 2YCBA 3HXQA 3C4JA 3C6XA 4DGSA 1TO2E 5CRIA 2BM9A 2WF8A 3BS4A 4ZEVA 2HT1A 3EDQA 1UM9B 1E1CB 4L0CA 3P2JA 1H2HA 2BHRA 3MILA 3N5CA 4ZMBA 2WWVD 2PLRA 2NAPA 3NWEA 1Z34A 2FRXA 4BMNA 4DIFA 1ZD3A 2O0LA 4EK9A 4KAFA 1RI4A 2W2NA 1DIHA 1UDWA 5A0FA 4RTOA 2XB2A 2Z0MA 1V6CA 1PW5A 5K4GA 2X8WA 1TX4B 5ES4B 3P27A 2FW6A 5BR4A 3C8ZA 3G6KA 3L8FA 1F2UA 4FDVA 1T3SA 2HXYA 1UKBA 4YCAA 2I2AA 3QPAA 4J7CA 3ZZMA 1P17A 2YN4A 1AKRA 2XGOA 2BI7A 4WDQA 1RJGA 3D59A 3LLSA 4GBGA 4GM4A 1YJXA 2V03A 2XZPA 1D07A 4F21A 4YPOA 5KU1A 3NM6B 4IQ0A 5KC9A 4X90A 3X2EA 1E99A 1ZBQA 1GGNA 1CQJA 3PQ6A 4QYMA 4S05A 4YGXB 3R9WA 1R6XA 4IKOA 3QXJA 3ND8A 4LYDA 4XRRA 4ENTA 4US2R 5KYGA 2E18A 4IRUB 5JZBA 2WJ6A 4MIKA 5L8VA 2IEYA 3MHPA 4TQAA 1CYDA 1HL7A 3C43A 4O1IA 5H82A 3Q7RA 3RTEA 3ZBQA 1DIOB 3C85A 1CU1A 2JIPA 3S8MA 3T5AA 3WGIA 2UUCB 3ZQ4A 2BHTA 4DQ0A 2QRHA 5THKA 1BGWA 4WNIA 3TJZA 5ICGA 3CT6A 3DM5A 2AN1A 1DFIA 1IXYA 4HHEA 3NEPX 1YQTA 4QRIA 4UNQA 1T9ZA 3WL4A 4EFKA 3T3DA 3BHIA 2PGIA 5CNJA 2RHLA 3I04M 1BCRA 1VPLA 1NRJB 1B43A 2V4MA 3BL8A 3JQFA 2WJVA 4HR7A 3HR4A 1OI2A 2FG7C 3IA2A 1QMPA 4RD4A 1K89A 3WLJA 3ADOA 3QITA 4N5NA 4CL8A 1X15A 1QFSA 1SCNE 2GJSA 3O4IA 4PHFA 1OWOA 3QVLA 4LA4A 5MFPA 2WWWA 2GD6A 4QE3A 3DTNA 2HMSA 4DNQA 4V39A 1L7MA 1L5ZA 2J0VA 1VSVA 2J8ZA 4I9HA 1JB9A 2WTAA 1DIRA 2G0AA 2O07A 4HLDA 4AKSA 2N9UA 3LO5A 4F9TA 5HM8A 2E6KA 5D5PA 1NBAA 4H08A 5TQ0A 5DPMA 1QRTA 1QP4A 1MEEA 1Y1QA 4OGFA 4P3NA 4WTOA 4H4DA 4NFLA 2O0KA 1NVVQ 4N39A 5D7BA 4UHDA 3FYUC 2XITA 1UM8A 1KQPA 1Y63A 2P3SA 2Y77A 2ZRGA 3FBWA 3OC6A 1ODLA 4K26A 4W63A 5DT2A 2O1SA 1ZSNA 3KVVA 5CLQA 1EFLA 1KK1A 3QYJA 4B4DA 2PEYA 2V9ZA 2JZOA 3OIFA 1GAQA 2LCIA 3A11A 3EGDA 2MSKA 3OCWA 1LI5A 2IS1A 2FUEA 3AI2A 4D8TA 2B98A 2SHKA 3HP7A 1GL3A 3HS3A 1ISGA 1U9IC 5T8KC 4G67A 3ZD7A 3K1TA 1QYIA 4LJ5A 2WHEA 2XB4A 2VSOA 3FKJA 1X2EA 1C3JA 3B52X 4OHCA 1TRKA 2XA1A 4P3KA 2FMXA 3RFFA 3S3TA 1Y9JA 3TNDA 1R9NA 1UJ5A 4QODA 2SNIE 3U4IA 4MMZB 4EITA 3I0ZA 4HQ0A 4TTPA 4WASA 3O4GA 4MVJF 3GDOA 3WIBA 3ZTYA 5LOVF 1YFJA 2P90A 3TSCA 1Q6ZA 5DHUA 4C14A 4KN5A 1E0JA 2XNJA 5CG1A 1C7ZA 3FTFA 4RXMA 3KUUA 4R6WA 2BZ0A 3DEZA 2ZT7A 2JLVA 5FWNA 1YHZA 4M0EA 2IPOA 4NL4H 2Q45A 1FVXA 1DSSG 3RANA 1W96A 1S7CA 1IRIA 4AX4A 3QXSA 4BX0A 3RSLA 4TXMA 5JWRA 3OQHA 4GX2A 4J1NA 4ZODA 721PA 2XCLA 1B26A 2XCQA 4Q24A 5FA6A 5CVVA 1CHNA 2EJTA 2O20A 3DAPA 4EDFA 1K5GA 1VDZA 1U7TA 1T8PA 4GWKA 3EAFA 4QQ8A 3QI2A 3MFQA 4A3SA 5BSUA 4H1TA 1IIBA 2JFHA 2VT7A 3ZJVA 5JJ5A 1OI3A 5IAGA 3FDIA 4AMGA 2AR0A 1WP4A 2CLCX 4QXOA 5BRJA 4UM8B 4MQ6A 3N74A 4BNXA 5TLSA 5A71A 2ET6A 2WFZA 5BYKA 3KL4A 1KZGB 3PBKA 3G2JA 1A5AB 1H2RS 2OCDA 1WCIA 2QLTA 4PR3A 1B76A 2AXNA 1CF9A 3AY0A 3M2TA 4NJMA 4WV3A 3AVXA 2AW3A 1N3LA 4PRKA 3KG2A 1BEUB 4YV0A 3DXZA 3ZN2A 2AK2A 5JTUA 4EBBA 3RSQA 1NF2A 3W8DA 1G9TA 2Q3BA 2H2AA 1XJQA 3MBIA 5DI9A 2JDIA 4JMLA 2Z08A 3PQFA 3LECA 2OT3B 1Y1TA 3PQ4A 2I2DA 2JARA 3IAFA 2HOQA 4C76A 3E53A 1H1TA 3JAWB 4U2GA 3U49A 3EARA 4DR1B 1YQ9A 1CNMA 2QRVA 4KJXA 4IVRA 1RAEA 4URHA 1Y3HA 2P6RA 1VLZA 2UZIR 3GR6A 3HBAA 2WZQA 1KXZA 3S2ZA 1PWHA 4L7VA 4LJLA 1G41A 1PJZA 2V55B 1MHPA 4JS0A 3EH1A 2AH5A 4QYWA 1QFJA 2HD4A 5F21A 1DEXA 3L9XA 2PNJA 3AQIA 3X1XA 5TMPA 4MR9B 4ITRC 3C3DA 3R0QA 2O0MA 2CBGA 1E3TA 2IUTA 2P4UA 1T9GR 2HHHB 3VYTB 1W52X 2FSFA 5DK4A 1D8AA 4FIZA 4RH3A 2V6JA 3BMNA 1DV2A 3AIOA 2QP9X 3TUZC 1ULAA 5I9SA 3T54A 1KA9H 4X20A 2N46A 2ADMA 4D0GA 3D54D 4NARA 4B47A 3DP7A 3ZDZB 3BXGA 1FL9A 1UIRA 1Z75A 3QBEA 4FGLA 4R2IA 1EIZA 4UM7A 1A77A 3HJCA 1WUHS 3QOXA 2QB5A 4K28A 3LSYA 3ICEA 2OK8A 1P1KA 4XLLA 5DN6A 2EVWX 2GN8A 3EWIA 5AXDA 3R2JA 4B6RA 3NWBA 2Y4OA 4E5YA 4H7FA 1RZRA 5HMMA 3KXLA 5D6OA 3UYKA 5LCXA 1VMDA 4Q9JA 5BN4A 2WF5A 2ZAOA 3KU1A 5CA1F 1N77A 4RHCA 5FRDA 3T9CA 2FN3A 4FOOA 3LQQA 5ERYA 2DOKA 3F6RA 4DMHA 1XDDA 3JPYA 2G4LA 4BXOA 5I9IA 1D1SA 3EVGA 5BSGA 4Q9DA 1N75A 1N8SA 3FDXA 4OF4A 1CY6A 3T7EA 3MWYW 4KBGA 1T15A 2Y99A 1DDOA 2JGFA 4HXEB 3MOGA 1VPEA 1ZRSA 2BFNA 2OV4A 1Q17A 1OA1A 2J32A 3F78A 3SY8A 3WYGA 3M3HA 3KTAB 3HO8A 3ZDXB 2C4TA 3VKHA 2PUJA 5K6AA 4KWCA 1IEXA 3CXRA 5JS6A 4OGGA 4X0EA 3GO4A 5AM1A 5GVRA 2YNMA 2H1VA 3P4XA 3PJGA 3G5MA 3KZNA 2WMDA 1U2EA 4KNWA 1I94B 4N76A 3PDIA 4MRNA 2H16A 4N54A 4CWAA 3HUEA 4JJIA 5BW6B 3TXAA 4ODIA 1EA7A 5F7ZA 3VPGA 4EBFA 2Q2NA 2QYHA 4CMHA 4N5DA 3F49S 1XQ9A 2B4TO 3PNVA 4KFSA 3T3PB 3W04A 4EPXA 1ZD1A 1MVLA 3AR9A 4D9IA 1S2GA 2Q6KA 2UYYA 1NTOA 4BKPA 2CNLA 1T8UA 3PUWA 2VJPA 1Q44A 1EFRD 5IXYA 2QZ9A 3EGXB 4ZYXA 1OFUA 4MVXA 4KPYA 1KMMA 4E2FA 5EHQA 2AUMA 3H1TA 4LWPA 1ONPA 3DTVA 4AMVA 1KOGA 3D7SA 3COZA 1ESNA 3GGSA 3O94A 4PAQA 4IHJF 4DYDA 3PIDA 5I4KA 5IJ9A 5LZ8A 5KVSA 5IM4F 4QUEA 4UAUA 3TMAA 3HJTA 3OIYA 3NAGA 2QG4A 2QMYA 3IMKA 4TYYA 2QPOA 1FU4A 2BF7A 2X4GA 5ALKA 2BRUC 2GHRA 1VCOA 2C9BA 3KOZA 1D04A 2Z5VA 3ORYA 2YTZA 2UZ1B 4TVKA 4WH0A 1NP6A 4DMRA 1CW2B 5H3LA 1I5EA 4G0QA 4LSZA 4H0FA 5A4FS 2JKZA 4YEDA 4WY8A 5JOQA 3NT5A 3NU1A 5AJUA 3GGOA 3DZKA 2EP7A 3FCEA 3ZWKA 4TLAA 2FSUA 2NXWA 2D1YA 4TVBA 2OPHA 1NY6A 1UJ4A 2OGWA 3KLNA 3LC7O 4XVUA 5J2UA 4F4FA 1XYGA 2YFHA 2R9VA 3MIIA 4NMMA 3VDMA 1D0SA 2YQ5A 3W2TA 4MCHA 1WDLA 3UGQA 4XDGA 3Q8MA 3TN7A 4EM6A 2F1HA 3IHLA 3E3NA 3T5BA 2BR3A 5M3BA 3MT8A 1G38A 1CRZA 2QM8A 4LZNA 1R4MA 2I1QA 5KC8A 2EWMA 5EINA 3P26A 4W5NA 3T35A 5JFTA 2OKCA 2LE0A 1N6RA 2WSIA 5H9VA 3D02A 2E6UX 3PGMA 1A4RA 1RJ9B 2Q0XA 2P11A 4OUKX 2IUYA 3R6WA 4IQ8A 4J7UA 4DANA 4XPZA 2JNWA 2VYNA 1VECA 1E6KA 2C2KA 1VTKA 1I3OA 2OXCA 4MI6A 4R8VA 1KSGA 1L5OA 2BMWA 2UV8A 3WO1A 1HLFA 1OC2A 1NLZA 3FLBA 3TQHA 3IDSA 2DSTA 2E82A 5F1KA 3D43A 3HACA 1DARA 3ZD6A 1G8YA 4MW5A 4N9WA 5AHRA 3AUFA 2BGNA 5A4KA 3P9PA 4YRBA 3ND7A 1WXXA 3A4VA 3EH2A 3KSRA 4AY3A 3AR8A 3MQ2A 4EFLA 4YRKA 1HF3A 2YN0A 1KDVA 3ELWA 3FB4A 5BP7A 5HM6A 2D1RA 2FQXA 3C6QA 3P9XA 1DIAA 5JASA 1N6HA 3GT3A 2V96A 2R8RA 1SG9A 3EVDA 5CYPA 3CZAA 4YMVA 1IZ8A 3CZMA 1YV9A 4L4XA 4YY3B 2K2WA 4LJAA 1Y6JA 3CRNA 5A3VA 3ZVNA 3DOHA 2O54A 3RTDA 3L0PA 1VMAA 2ERCA 2YZ2A 3OPYA 1BS2A 1YOVB 5JLAA 1N6IA 2DBVO 4DA6A 4MGEA 5AM3A 5JYBA 2QT1A 1OVMA 4OJYA 4HDOB 1SHJA 3FD8A 4RV4A 3FUVA 3BULA 3T9FA 5T6BA 5KS2A 2X58A 5ALNA 3P94A 1KBZA 2HMYB 3MT0A 4JR2A 3AV3A 3RROA 1FDOA 3WGLA 3K8QA 2RG1A 1W75A 3FGOA 5EP2A 5L95A 3ZD9A 1K8RA 1SUCA 5BVHB 2ODEA 2Q41A 2PO7A 3HCWA 4FEYA 1YR7A 3IVAA 2GAIA 2JJ2D 3N2YA 5HXAA 3NDIA 1PVDA 2IEIA 1BN7A 4P4SB 2BFDB 1B4DA 2VH2A 3DLTA 3GJYA 1FSZA 1NZDA 3EZ7A 1TOAA 1CUFA 3S1LA 3EG9B 3OTQA 4RIFA 1E8NA 1V1JA 3TECE 4HYTA 3IEXA 2R8ZA 1U8AA 4R2LA 2CK3D 4HGQA 1E8DA 4IVNA 5GM2A 2HJGA 2NVOA 3M9XA 4IXTA 3A1NA 4B85A 1NVXQ 3ET4A 4OQ4A 2XDQA 4BVLA 3AM5A 2I33A 5C34B 2BKXA 3DKVA 3CRZA 4WSOA 4WESB 1P4AA 1T0PA 4DJDC 5KYNA 4XB1A 3QI7A 3BFXA 2R96A 4M0PA 1S89A 4MW7A 1X7WA 1GEGA 3TNLA 3URKA 1JHVA 4LPSA 1VHWA 2XT6A 3P5BA 4QOFA 4ZDJA 4GKJB 3GEBA 1J90A 1BJKA 4MRPA 2P9FA 1U0SY 1JLLB 3MCTA 2GARA 2Q5EA 2PNFA 5HHTA 4RPHA 2RGXA 4ARBA 4IAOA 1X7XA 2RH4A 1SOVA 2QRUA 1U0JA 3GJZA 3LP6A 4PNHA 2IU0A 4RK4A 3V1NA 2VF2A 3T41A 5KJ1A 4RHXA 2HLPA 2EKZA 3PGXA 2PKRA 1T2NA 1SBCA 1J0BA 3F3MA 4GH5A 5BNFA 5C7YA 1HBJA 4UQOA 4S1VA 5J9FA 2VSQA 4XWYA 4JYAB 1ZX1A 1RI3A 1V0JA 4Q1AA 3EXIB 4FD2A 4QGFA 2NYVA 1SKUA 5IULC 3W3AA 3UJ9A 3HFSA 3IRUA 4PS0A 3EY4A 3V97A 1ZMBA 3I9FA 1NL3A 2G63A 2WD7A 3KR2A 3NWJA 2QN7A 3A05A 5ERGB 4E4RA 4EB6B 2BCEA 4ZHQF 4KQMA 4M60A 1TQ2A 1O08A 5INTA 2Q4BA 1IIRA 1BW9B 3RUDA 5CBPA 4ONEA 1H4QA 3OUTA 4D6XA 1DG9A 4PC6A 4A82A 3R3VA 1L6RA 1QK4A 2C3MA 2OB2A 3NPMA 4UNRA 5I01A 4DV6B 3QTTA 4JXKA 1QTIA 1J8MF 2C95A 2FN9A 2GERA 4YXWA 4WD3A 2OA0A 2I87A 4LY3A 3MUOA 5F7JA 2HSZA 2C96A 3C3KA 3M1IA 3N2ZB 4L50A 1PBTA 2QX4A 1SG6A 3K0AB 3L8GA 1IUKA 4EI2A 2B7BA 4BMCA 1KAGA 4QBTA 4YLGA 5AVKA 1ILWA 1EQ2A 1I10A 4II2A 2VXCA 2HUNA 1NBEA 5ETJA 5LZ2A 1Q1ZA 4GX0A 5J2TF 1J8DA 4ZI7B 2GKOA 4U8HA 5TSDA 1THTA 3ZNOA 4CQMA 3QWAA 2FHPA 1PYOA 1TUBA 4GQIA 4HGPA 1PFWA 4EZBA 3N2LA 2JA2A 4H59A 4I4IA 4IOJA 3M3DA 5K8UA 3RUFA 4CM4A 3AX6A 4ID9A 3JY6A 3L0DA 2OQRA 4J0IA 1TMOA 1T8YA 3T1VA 4DKXA 1IRXA 3RRNA 5IAAA 2XUHA 3CGGA 4B2PA 3ZWNA 1Y7LA 4B3JA 2GESA 5IDQA 2EHDA 1OBOA 4NKRA 1ZI6A 3LCJA 4GPZA 5E3IA 1HEUA 5FBQB 4ZU3A 2JS7A 3P9CA 5FO0A 5A1JA 2YOFA 5JYDA 3HU2A 2HPVA 4IGIA 1YGYA 2QD3A 4MK4A 2I8CA 3TJRA 1JEQB 2XKJE 4IJMA 4G86A 4BKRA 3VDRA 3IH5A 4MMXB 2FSPA 4E7PA 4X7RA 1NHGA 1IMJA 1CUWA 3DWGA 3WX0A 5CLFA 1KP9A 2QR3A 1AO3A 1I7PA 2EV9A 4X7MA 4G0PA 4YRDA 2CZCA 2UYCA 2P2CA 1PT5A 2XRMA 1O94D 3IELA 2IH4A 3EXG1 1MIOA 2WHQA 3WWEA 1OMOA 4BQEA 4YB8A 5JMTA 1JA9A 3PQ5A 3N0TA 3W4KA 3LY7A 1UKYA 2F1RA 2Z8ZA 3HCFA 3NC1C 3Q6IA 4LDRA 4YNBA 4ED9A 3A6KA 4R1LA 4UVDA 3FNEA 5C35A 3LLMA 4LF6B 1Q57A 4I1RA 3INNA 3A06A 2YJTD 3WZLA 3GJTA 2JAQA 3QJ5A 4LYEA 2YVKA 1F4LA 1FDUA 1W44A 2PM8A 3K5PA 1IXZA 2ERXA 2WYOA 1VMEA 3JSAA 3TQIA 5DCUA 4LUCA 1AT1A 3NT2A 4P32A 5IG2A 1SBTA 2Y9MB 3E7DA 2XMZA 2Z58A 2WWYA 1YAHA 1HOXA 2E55A 3LH5A 3REQB 2UXDB 3PX7A 1R0BA 1RWNA 3IEPA 3GCDA 4PCUA 2ALJA 3D3KA 3DCNA 3B70A 4R31A 4AP5A 1SIOA 4EMTA 4NWIA 3H5VA 3MWFA 3F90A 3B3JA 3R44A 3EXEA 1U4SA 5AYVA 3N3AC 5AW6A 2VHXA 3G0DA 4DWWA 3PK0A 1F6BA 3OLQA 1V5WA 5JWHA 4JI5B 4EEXA 3VO9A 3HDHA 1K4YA 3OZVA 5CEFA 1FVFA 2V5VA 5U4QA 4RS3A 1JPVA 3V8EA 1YO6A 3VZPA 4UM9B 2P69A 3OLXA 3BUSA 5JHHB 1KZ1A 1L7VC 1R3UA 2ZSKA 2W2LA 4KDEA 3P0RA 5EWMA 4QICA 3MXOA 3VR5D 4YWHA 3T7SA 2NTNA 1IOWA 3TZ6A 4AMYA 1JH8A 2B2CA 4Q4LA 2J5XA 2PH7A 3TM5A 1DLJA 2JKVA 2MYTA 4LMBA 3ANMA 1NU8A 2AOUA 3FMOB 4QPCA 5SZKB 4C6TA 1X7YA 1XU9A 1IQ0A 1D5WA 3QLTA 2VATA 3DYVA 4ZAXA 1H1LB 8ATCA 3IBFA 4H16A 1E9BA 1GRVA 3M6IA 1JQJC 2ADFA 2GK3A 3I2FA 5TT0A 3A4YA 4DY6A 4TLLB 4UARA 3D1JA 3FFXA 4R2JA 1IZ0A 4UAVA 5FWYA 5WRFA 5TVKA 1ZJ5A 1EK0A 4IFTA 3ZW7A 4GUAA 2H4WA 4BRUA 3M3PA 3AJDA 3GHHA 5E1MA 4G63A 4IIEA 4PFKA 4EJMA 3FZGA 4JJ7A 4EOGA 4R1QA 2H2FA 5EUBA 2C2YA 3E2MA 4CV0A 3KB6A 5TX7A 1Q0LA 4O4IF 4DR7B 1G4AE 1ZHHA 5LZ7A 1G8SA 4IG9A 3TQFA 2IE0A 3GOHA 4XIFA 2Q5JA 3RSCA 3IOYA 3W78A 3RYCA 2RD2A 1G5FA 2EKQA 2O48X 1QNFA 2YXNA 4RFSA 4F2WA 5BSVA 2FPGA 3AF0A 2NP6A 1P9RA 3Q2IA 1FLAA 1ISPA 2CVOA 4BRZA 2F90A 5KWJA 1J8QA 1C7EA 4ASUD 5KYWA 1OH8A 4L4YA 1TW3A 2IH5A 3TB4A 2FPPA 4WAUA 2F9FA 1NA5A 3JARA 4TQGA 4P2GA 4DUPA 4LV6A 4KXVA 1F17A 1BQ3A 3DMTC 1NLUA 3S6JA 1I7QB 2DECA 4UU7A 1ECFA 2Y0DA 3DJFA 4KQGA 5G0WA 1L5HA 1XU4A 2JG3A 3AKCA 2A5JA 4Z3KA 3R76A 3WIEA 2B25A 1GG2A 1EFHA 1YFKA 3AOEA 4Q9NA 5FBVB 6YASA 1WCYA 2GPJA 2ZR8A 4WZAA 2FV8A 4B9EA 2ZEJA 3FWPA 4QUAA 3W7VA 4ESVA 2NU9A 5DRTA 3KUCA 4QVGA 4BVKA 1ZH4A 5C5CA 9GPBA 1LF5A 2CYBA 4RZ3A 1JXAA 3TW4A 4WI1A 4TS3A 4MS3A 4AJLA 5K0FA 1KKMA 3I53A 4IXNA 2HRBA 2V7TA 4XUEA 3RBAA 4UCWA 2RH8A 4MKXA 1OX6A 2G06A 1RLOA 3VO1A 1KL7A 2B78A 2C58A 2NLOA 1PEKE 2X2OA 1Q7RA 1P2UA 1C4WA 1DWOA 2Y92A 4MQUA 3I4LA 3UWMA 4WN3A 1P18A 1N5LA 2Q6LA 1U99A 1QV7A 3FWKA 4WZAE 5KNBA 5LXTF 3GX1A 4BO9A 4EG3A 1U2GC 4U00A 5IBQA 5JATA 3OD1A 1G8PA 3PWSA 4G0WA 4OBWA 2H31A 2GYWA 1ZYUA 2HY7A 2JGDB 3IAS1 3QP9A 4KYTA 1L5RA 2QTFA 4F11A 1QWSA 2ZLBA 4FWTA 3E23A 3I64A 1CB0A 1TJNA 1Z4OA 1EAMA 5TF4A 4FZ3A 2HNKA 5AKIA 1N7JA 1BXRB 2ID7A 2YR0A 1Z2EA 1GUZA 1NE7A 1RE1A 1RWWA 2CHQA 1QIHA 5B6IA 4QWWA 2F3SA 3N75A 2GNAA 2WD8A 3OE5A 2ONCA 2VHVA 4FOSA 2WR8A 3DHNA 3PNKA 3QLVA 4MUKA 1XAGA 5LZ9A 4GPTA 2QAJA 5ESDA 1RXYA 2ZJ8A 3B9BA 3KOUA 4KN6A 3LKBA 4ZU6X 4YT8A 5AUPB 1P5JA 1TZCA 3MWKA 1W581 2H9IA 4ZGGA 2PYZA 1M2EA 2PWAA 2FSGA 1ZUHA 4JEHA 2WUVA 1I9CA 4R0NA 1S9DA 1PT7A 2ZRPA 3TDMA 2JFZA 3RNLA 1ZKMA 4D41A 3S70A 4J43A 1R8JA 4WGFA 4ZOLB 1JMVA 4EY5A 3D8UA 4GYJA 5JNWA 4MYUA 3ET5A 4JENA 1Z18A 1V3VA 3KBBA 3VHXA 1TZMA 2I7XA 2HLDA 2O0JA 1U2DA 2J3QA 1P7CA 2P3QA 2X4IA 1QZ3A 3KQPA 2CHUA 2HZBA 1P74A 2CXTA 2YHSA 5SZIA 3T7DA 4NXNB 5TPWB 2VPPA 1GXSB 5A0TA 3OQMA 4C0XA 1XZPA 4KRFA 1BE6A 5G4KB 5DN6D 3ZVMA 1ORDA 4IIVA 4PTZA 2MIIA 2D54A 1RZRD 3FPCA 2H29A 3HXTA 1IM5A 3RYIA 4ER7A 2BONA 3U40A 5DI3B 2DF8A 4MUEA 4ND3A 5ALYA 1QB7A 2LW7A 4JEIA 4KP7A 2VT3A 4F93B 1IULA 3S2UA 1GTSA 1A04A 1C9MA 2GEBA 4QU8A 3VZQA 4ZCQA 2QRQA 2WDZA 3KE8A 1ZHFA 2O50A 5IJ0B 1P19A 2EAUA 3U60B 3H2HA 1T5BA 3BJZA 5EUQB 3V34A 4IF4A 2O8DB 1FQWA 2FSIA 5JU6A 1PGNA 3IHKA 3AGQA 1DKOA 3UPTA 3EZYA 4KSCA 2CUZA 2ZJBA 4B4WA 4ZU1X 1GZDA 4IIGA 2JI8A 3IAHA 4YP1A 1IN7A 4MUMA 1W85B 4WOJA 1N57A 1U11A 5J4KA 1R64A 2ORIA 2ZQZA 3CLTD 2YNMD 1IY2A 1RE0A 3OWHA 4XR9A 2NU7B 1VIMA 3VPFA 4B34A 3KQWA 3NG1A 3L6OO 5LYJB 2HBRA 3F8WA 2O59A 2X23A 2EXXA 4RELA 5D6NA 5E1BA 3WLMA 4EHDA 3GNQA 3V2GA 1U9CA 2H1WA 1W1IA 2GTHA 4O2AA 3OTWA 3QVWA 1GQ2A 3AY7A 4N18A 4BNWA 4CYMA 2KSQA 3HYNA 2ZYAA 1QHSA 3PHBE 1ZC4A 4PLCA 5F51A 2ZPTX 1IPHA 5GINE 3HKDB 5HBRA 4HN4B 4BZWA 4Y2PA 3WFIA 4W9RA 4DZTA 2H5JA 1J06A 1FW8A 2V7QA 3OHSX 4MR8A 3WMWA 3H5WA 3C3BA 5JXIA 4MDYA 2FQQA 4Z9YA 3RVMA 4CIDA 3OOEA 3LMKA 4WKCA 4XQ9A 1VI5A 3DGFC 3M4XA 2WSMA 1YS9A 4GR9A 5KAPA 2V3WA 5DNEA 5AVWA 1GLNA 3LSTA 5FPKA 1B0ZA 2BIFA 2J09A 1XMIA 1W88A 2B4RO 2P4HX 3SYRA 3QVTA 4NCHA 1B0PA 4CIVA 3VX4A 2A5DA 3E3OA 1DJPA 2HRDA 4PTYA 1X7ZA 4CBVA 2WUWE 1FFAA 3AR6A 3MINA 1U8YA 2ETXA 2BFPA 3BZUA 1FP6A 3QVGA 1HL3A 2IXTA 3O31A 4FEAA 1M1YA 3VGPA 3TFOA 2PPLA 1BWSA 1K4KA 4Z99A 4Y9RA 4B8YA 4P3OA 3CRRA 4XUCA 1RMTA 3OFSA 5FP0A 4CTKA 2XQIA 4PANA 5CFZA 1ESEA 1M2GA 2D1TA 1DFGA 2WWHA 4MRVA 2WUDA 4DJTA 1N8TA 2R47A 3NFYA 4YECA 1VJ5A 1GUFA 1NQUA 4LHYA 3MK31 3RJTA 5CB0A 5CT5A 1VJ1A 1OXKB 3J81k 3HCOA 4KRYA 3JQ7A 4C0JA 4N3CA 4BZZA 1QIIA 1N5IA 2RBKA 1IOLA 2HK6A 2XBUA 3N07A 4IP0A 2ZI9A 3LP5A 2AG5A 4BVJA 1Q2UA 3K0FB 5HJEA 4CG0A 1CF4A 4I1YA 3G8AA 1XNQB 4XD2A 4R1PA 1SCIA 1MXFA 3G6WA 3BWCA 3MCAA 3NAZA 1U31A 1XLTA 4FNMA 4ZI2A 2O8FB 4KMRA 1R5JA 3OPQA 1MP0A 3PHHA 4QQRA 5C5EA 2FPSA 1O96B 2EHJA 4RZUA 1DO0A 2Z8XA 4AKHA 4B6SA 3RC1A 2WAOA 4JN6B 2IF0A 4PG4A 1ZMOA 1DQYA 3LK7A 2Q5FA 5I45A 3AJRA 1M72A 2G67A 1Z26A 4J4TA 4JXXA 2NSYA 2VP3A 1NXQA 3ZLUA 4RK6A 3T5PA 2VTBB 1MO5A 4UAGA 4DWOA 4NFYA 1GSAA 3A9RA 1ZSVA 3TAUA 1E2FA 5SZHB 1PWYE 2FSHA 3U7HB 2D0DA 3HJNA 4KGZA 3SQDA 1N78A 4YFYA 1VL1A 1P2GA 1YBFA 1VKHA 2B4QA 3KWMA 3VYRB 2OBLA 1KI2A 2W4QA 3OIDA 1S8FA 5BQPA 4OUDA 4HYEA 4R9UC 3G5AA 4FN4A 4Z8YA 3Q6NA 2VZEA 3P9SA 3W3ZB 1ECGA 3PSAA 4ZI5A 1OH6A 3G7UA 2QIOA 2O8CA 3TD2A 4HWTA 4TROA 3VR6H 4MYDA 4OXIA 1T8SA 4AJ2A 4OSOA 1EFCA 4WJKB 5DHSA 5EP1A 1YRQA 1ZIYA 1UT6A 3O8CA 1OWNA 2W6MA 1WY7A 3IP6A 3ZCPA 4LF4B 5ITVA 2ZE6A 4L8LA 2J08A 2E4XA 4FGUA 1JKMA 3FNBA 4PC2A 2VQSA 5HUHA 1LDEA 3UHFA 5KOYA 4MEBA 5CNMA 1XJ0A 2DUUA 2PUGA 2GPYA 3OPYI 4R3NA 2ODBA 3RVRA 5TV2A 2XY4A 3P9ZA 1T4BA 1T1IA 5EHGA 3C3JA 4NS4A 2QP3A 5L4LA 1M8KA 2GNOA 4G01B 2DY1A 1ONNA 2OEPA 2WFAA 3R8FA 4AF8A 1QJ4A 3T9DA 3UXMA 4QEDA 4ZJPA 1M10A 1HNNA 1YDGA 3RQSA 1HGXA 2XWSA 5KNCA 2EP5A 3NIFB 2QTBA 3KM0A 4WINA 1WNTA 5KNDH 3GWGA 4D0NA 1XRNA 4EQ6B 3ZU2A 4Q4JA 1T1EA 4H6WA 3V55A 3V9AA 5DKFA 1COWA 3JZFA 3I2JA 2GX6A 3LCRA 3O93A 4JHLA 3W90A 3WE7A 3AVWA 4JI7B 4TKVA 3BT7A 3DVQX 1NI4A 3I76A 1WW3A 1UXIA 1L8XA 2CJXA 3I5AA 1BMFA 3DDWA 2O2YA 3AFMA 4OREX 3EWNA 4WFQA 1NULA 2ZRJA 3JQ6A 4XLTA 5J4VA 3L7YA 4HAXA 2CBXA 3F0TA 4LTDA 3IHWA 5C8YB 4OHMA 2QT9A 1N32B 1UPXA 3AY6A 3CNNA 1ELOA 3RS9A 2D5AA 1KTIA 3HNPA 1FNSA 4P3XA 4YUAA 4JLOA 1YVDA 3RU7A 1I01A 4UFNA 2G25A 3FHLA 4LYAA 4J49A 4EG6A 1M2JA 4GOOD 1YNOA 2H0AA 4NCJA 1ULSA 2DHRA 4NK5A 3KQKA 2HUPA 2BCJQ 4RVUA 2PU7A 5IH3A 3GLFA 4NZPA 1KZ4A 3MWDB 4CKBB 1GTG1 2Q0SA 2RKOA 1KETA 3KB2A 2PGLA 4W6QA 1ZHOA 3CVUA 2HA5A 2ZI5A 4L5AA 1P39A 3HSKA 4F2DA 1VRVA 5AI6A 1QQ6A 1S01A 1Z68A 3DQZA 4RD6A 1O8BA 1OZ0A 1JDPA 3B5IA 5J40A 1PD0A 3BWVA 5I47A 2MMCA 2Z09A 1EWVA 4G41A 3WA7A 1U3WA 1FSGA 4BV9A 3AILA 1VBMA 1E3MA 1K98A 2H7YA 4L5IA 5A4IS 3JRWA 3JZMA 2F3TA 4S0XA 4D3ZA 3IS3A 2IYLD 2NO5A 2WU1A 2PSHA 3D1LA 4ZV4A 5JAPA 2HW8A 1CZRA 1MJGA 3NHJA 4OHUA 4JA0A 1TYAE 1ZOIA 4RH1A 1TCAA 3MSXA 4YASA 2XLCA 3GLFE 3P0JA 2ZWVA 1XRRA 5EXSA 5DDIP 2QL9A 5LWQA 3K30A 2GO1A 2AVNA 3U5ZB 3D4NA 1XTIA 4ZT5A 4JJFA 4YRPA 2VDQB 5FLKA 4AQYB 3EIXA 1XQVA 2JD2A 3IR6A 4IDFA 2CXHA 4EJ2A 3WKCA 4ZCRA 1M73E 4BFSA 1SUFA 2GMWA 5LYYA 4BU1A 4PW0A 3CA8A 5ITSA 3TG8A 4PG7A 2BUAA 1XEXA 1R00A 3E0XA 3JQ8A 2ZTUA 3UJBA 3MG9A 2PUBA 1KVUA 5HKKA 4AK9A 4AQ7A 1DKMA 3ROEA 1A2BA 5ICSA 1FP2A 4HZUB 1I6MA 4K9MA 4BJ3A 4Q4HB 2QNRA 2QZSA 1MRSA 5DBOA 3V4SA 4X71A 5I51A 4B81A 2F43A 3K35A 1KMHB 3LQ1A 2CT8A 1BDBA 4K0KB 4O33A 4TV9B 4DCTA 2IIVA 4QA9A 4BVHA 4M76B 1WNFA 1GZUA 2AI1A 2QTNA 2VUSA 3IESA 3K2QA 1PEYA 1XAJA 2FCAA 5EKDA 1RADA 3G2OA 2OLJA 4L9WA 4JGIA 1E2IA 2TMGA 3QWBA 3AHDA 4J29A 4JKOA 3VPHA 1ZIDA 3LE8A 2J9RA 2BUCA 4HDSA 2ENWA 2MWMA 1NN5A 3BWEA 3I0MA 4PHCA 4UREA 5FBHA 2Q29A 1M6VB 5EZQA 4BKOA 4DC0A 4JBHA 2GPWA 3ZNNA 3HM9A 2FJPA 2EKBA 4P35A 4RV9A 5AK6A 2OO3A 1R4ZA 1GG9A 1IN4A 2B9EA 2NNWB 3ILSA 5EG5A 5ICEA 2R6R1 5LQJA 5JH7F 3A14A 4GPD1 4K88A 1M0SA 1G1AA 3B1ZA 3O8DA 4WT7A 2ZCVA 2AZXA 3EGOA 2A0UA 2XA9A 4R83A 2GRAA 3CR7A 4F4HA 2FR8C 1EE2A 3WL6A 3OKFA 4WIAA 5CA0B 1ID8A 4PSAA 1H9BA 4TUYB 3HBLA 3VAYA 1C3LA 1GPUA 1GNTA 4RGVA 2M1XA 1W2WB 1ODSA 3I45A 1I51A 2XE6A 5EHXA 2XSZD 1I4EB 5B12A 2FRDC 2WC1A 1I36A 3BB3A 4BGVA 4W7IA 5A3RA 3RKRA 4CKWA 1NYLA 1OGIA 1KKLA 1V6AA 3LZCA 4F91B 3ZPXA 1BE0A 4J07A 5BNWA 4MUAA 3OTIA 2BF4A 4C29A 3QU9A 3TG2A 1SQSA 1KFKB 3IE0A 5AVJA 4I6GA 3L93A 4DNXA 4E5MA 2ACEA 2WT9A 4BMYA 4B48A 1GNPA 4XOIA 3CW2A 4IJ5A 4DMMA 1N3IA 1U6KA 2GFIA 3VSAA 1NRXA 4E1BA 1J2RA 1OX4B 4HJRA 4D8WA 3A2NA 3MSCA 2G08A 1OBCA 2D2EA 2YV1A 1TD1A 5AOBA 2W2LD 3BL5A 1N1MA 1VRWA 2EOAA 3ICWA 3DUFA 2OM6A 1C1YA 4KZPA 4CL2A 2WA2A 2LV8A 1S9HA 5LZ5A 4TWBA 6AT1A 1QGAA 3OWXA 5IC4A 1RNLA 2ZSEA 2YWRA 4UJ3A 2B35A 4ND2A 1T24A 1M1NA 5A9RA 1TQDA 4YP7A 1XD2B 2HGZA 5BMOA 4MYSA 4BLUA 3TEMA 4E5VA 1R37A 3CISA 3A9TA 2DPGA 1EM8A 3D4LA 5AKXA 2W5UA 1BEEA 1RVV1 5DTIA 4J4HA 1JS1X 1BFKA 1ZXXA 1EIWA 1XLUA 3AEQB 4AT1A 2EDAA 1C7QA 2I29A 4JB0A 3OP4A 2EFGA 2X5KO 3ZXSA 2BOVA 5FJJA 2CKDA 2I6QA 1YF3A 2R6HA 3NATA 3NOOA 2VP9A 4WN9B 1UK7A 3TLKA 4ESHA 4ZCPA 1XZEA 4EIWA 3KVRA 4MUFA 4Q4AB 3GJRA 1R88A 1A8IA 3NDJA 1JXOA 4D45A 5CJ2A 3K2IA 1N25A 1D6MA 3P20A 2HV8A 3VVBA 1WBJB 3U56A 1U6JA 1SJ9A 1SPBS 4Z0HO 2J9YB