3VISA

Crystal structure of cutinase est119 from thermobifida alba ahk119
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
261
Chain Sequence
QAANPYERGPNPTESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYTGTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAPNITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTLSDVEEYRSTCPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase
publication title Crystal structure of cutinase Est119 from Thermobida alba AHK119 that can degrade modpolyethylene terephthalate at 1.76 A resolution.
doi rcsb
source organism Thermobifida alba
total genus 86
structure length 261
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12740 Chlorophyllase2 Chlorophyllase enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3visA00
2QJRA 1W75A 4BAUA 4OYYA 5K3FA 3QBJA 4B6GA 3KOOA 3FCXA 4FNGA 3H2GA 1CUBA 4W1SA 3C6ZA 4L9AA 3IUQA 1W1IA 2P8SA 1UXOA 5AKXA 5HCUA 5CURA 1BS9A 3WKBA 4EY5A 2YXPX 3N0TA 4W1PA 1MX9A 3JWEA 4YASA 3K6KA 4PSCA 4Q1VA 4UHDA 4UBOA 2CJPA 5CH3A 5FKJA 1MNQA 1N5RA 1IUPA 1XRRA 4C01A 1F0NA 2PUJA 3KWJA 4UBMA 5DTJA 2WSLA 4FHZA 3HABA 1L7QA 4DNQA 5HK8A 3HXKA 2XUDA 4EBBA 5AK4A 5A2GA 2B20A 3DYVA 5AOAA 3WK8A 3KSRA 1X70A 4KE8A 1CFJA 1ZOIA 4MEBA 4JNCA 2DHCA 3EQ9A 4DYHA 4X00A 1Y37A 2XMBA 4C88A 5AOBA 3H2HA 2DCMA 4EA6A 3AJAA 3BDVA 2FUKA 2XMCA 3ILSA 1ODCA 2OCLA 3DDUA 2JF0A 1CUWA 2HHAA 3O0DA 5IVIA 4BC0A 1E5TA 2B61A 3DKRA 1XZBA 5AIAA 1QE3A 1QO9A 4AXBA 3KDAA 3FVRA 1VLQA 4X6YA 4ZV7A 3MUOA 4K6GA 1ODTC 2ZSIA 5ALLA 3E1GA 2FX5A 3NUZA 2QM0A 1C7IA 1MU0A 2ECFA 4KAFA 2Z8XA 1O6GA 4LHEA 4U2BA 5ALKA 5JIBA 2BUAA 5HZGA 3G8YA 4L72A 4X90A 3R0VA 4AMYA 2WHPA 4EY7A 4MQMA 1UK9A 4UHEA 1CUZA 1HLGA 2ZJ7A 1Q83A 3H04A 1W76A 1JJBA 5DLPA 4QDZA 2XMGA 5T4FA 4G4JA 1CUSA 1WHTA 3BWXA 3A70A 5C81A 2VJCA 5AJHA 1BCRA 4I4CA 5LZ7A 3H2KA 3HC7A 3I6YA 4Z49A 2RONA 1XLVA 1VE7A 3FLBA 4F5ZA 1TCBA 2OCKA 3BIWA 5D7BA 1XZHA 2C5GA 4OD0A 1K8QA 2JGJA 1QO7A 5ALIA 2QVBA 3D3NA 3ESAA 4BVLA 5AKJA 3V1LA 1DINA 2VSQA 1J1IA 5IVDA 3O4IA 4ZREA 1EK1A 5ALWA 3WMRA 1OILA 1ZI8A 2XT0A 1TIBA 4BE9A 2QUBA 5LZ4A 5AK5A 1UWCA 1GPKA 4Q3KA 1EB8A 1M33A 4E15A 1MPXA 1GZ7A 4DSAA 3UUFA 4G9GA 2WG0A 4OU5A 5FV4A 1VKHA 1ETHA 4UUQA 1XRNA 3ZPXA 1AX9A 4INZA 5D3ZA 3ZLUA 1ZJ4A 2H9YA 1CV2A 3DS8A 2YH2A 3HLKA 3O9VA 3LS2A 3IBTA 3A2MA 1MAAA 4AO6A 1P0PA 4MQLA 4P08A 1N1MA 1BN6A 2BUCA 4JEIA 5FP0A 5EHXA 3WJ1A 4UHBA 1SOMA 3I1YA 1UKAA 3IVMA 3JYHA 2WUFA 3O4GA 3QYJA 1A8QA 1A8SA 1UKCA 1CLEA 1GKKA 1W52X 4BDTA 3BDIA 1WB5A 1LPOA 5CT6A 3D59A 1YAHA 5E4JA 1P0MA 3G9ZA 1EDEA 1B41A 1QFSA 2BKLA 5K3DA 5AIBA 2OQIA 2O7RA 5K3EA 5JD5A 2QXTA 5ALJA 2WKWA 4N5IX 4F21A 3FSGD 4BZZA 4FFWA 3CCCA 4KE7A 2PBLA 3W9UA 5ALVA 3WI7A 3AZPA 4IO0A 5IVHA 4FLFA 2BJHA 2PSDA 3DLTA 4DNPA 1QFMA 3VXKA 2BFNA 5EIHA 1XZCA 1MTZA 3EIOA 5DTIA 4B84A 1SCIA 3WWCA 4G8CA 1E66A 1MAHA 3K9BA 4V2IA 3AIOA 4AB1A 1OCEA 3GFFA 4GXNA 2PU5A 5DNVA 4B0PA 2XUJA 5FOQA 1LBTA 2FJPA 4ETWA 3GBSA 2H7CA 4QDUA 1XFDA 3H17A 2EDAA 5HKAA 5HF5A 4AO8A 2QJWA 3QPDA 2XB6A 3TEJA 2WU3A 4MYDA 4UBIA 4M0EA 2QZPA 4BE4A 2WILA 4B82A 1AKNA 1RYYA 4Q3LA 1ZJ5A 1BE0A 3D2CA 1CUHA 1LNSA 3DNMA 1ZICA 4BCDA 4BVJA 1TK3A 2OXEA 4WY5A 4KRXA 2DFPA 5AM1A 3M3DA 3F98A 2V96A 1XLWA 3WWDA 1SFRA 2XUKA 4CCYB 2J3QA 1OXMA 1HBJA 1XKLA 3U1TA 4GHWA 2GBCA 2PX6A 5EIEA 3HACA 5EHZA 1BN7A 1QTRA 1CUUA 1K5PA 1XZIA 4GWLA 3F96A 1LPAB 3IUMA 3W2TA 4DTCA 2WFZA 3C87A 2HU7A 5FPQA 2Y1KA 3I2KA 3NOXA 1A88A 2HA6A 4LIPD 2I3DA 2ROQA 1D07A 2PSHA 1LPMA 4HXEB 2HL6A 2JGFA 1XZDA 2J3DA 1BEZA 1VA4A 1CRLA 2XUAA 5KWIA 1NU8A 5JZSA 1QGED 1CUJA 1QZ3A 4QLOA 2HA5A 4K2AA 3KWFA 4B7ZA 3STTA 5KWJA 4C87A 3OM8A 4H7KA 3L1HA 5IH7A 1CR6A 3LIIA 1E8DA 3D7RA 4MEAA 1CQZA 4N8SA 2PPLA 2WIKA 3NWOA 3VJKA 2CKMA 4QLAA 4FLEA 4KAAA 1CVLA 1Q0ZA 5JD6A 4GI1A 1K63A 3FYTA 3FNBA 1G66A 1G42A 4XX1A 1EVQA 3ANTA 1FFDA 3QM1A 2ONCA 2WJ4A 1ISPA 1EDDA 5A7HA 4H18A 2G5PA 4YX9A 1NX9A 5ALFA 3W06A 1R1DA 4BZWA 1VXOA 4HXFB 4MXDA 3CN7A 1GPLA 1CPYA 3G02A 4EHBA 3PUHA 4MYSA 5ALRA 4J0DA 3WWOA 1JFRA 7YASA 3WWEA 5FUMA 5FLKA 1BEEA 5ALQA 5K3AA 3HYSA 1CUEA 2XQJA 4Q82A 1QIKA 2ZVDA 3DYIA 3ED1A 1E89A 4DMCA 4ARAA 1Q84A 1THGA 4J0CA 5AKIA 3F67A 3ESDA 2Z5GA 1H22A 3V1KA 2G4LA 4KJXA 3C70A 1LPNA 1LPBB 4W63A 4BDSA 5AKGA 4P9NA 4ZWNA 4EZIA 1QTIA 1YA8A 4GLBA 4C4ZA 5AO9A 1QIFA 5ALPA 4H7JA 1XZEA 4C89A 4Y2UA 4DNOA 5LKAA 1R9MA 2QUAA 1GGVA 4H35A 1L7RA 1X2EA 3VKFA 2VT6A 4L3WA 3WA6A 3R3UA 3V9AA 1ZGCA 3ZLVA 1SCQA 4FBMA 1VZ2A 2NW6A 1QOZA 3M81A 4ZRDA 1ZD4A 4UHFA 5AHXA 2XUFA 1WCYA 4FWBA 2XMZA 3FCYA 4RE5A 3SC2A 2AJ8A 4WFIA 2HADA 2JGIA 4QDXA 4H7DA 4JYPA 2QMQA 1YSCA 2XE4A 3S8YA 4Y2QA 2PL5A 1KEZA 1QIMA 3STWA 2GBGA 4Y2RA 5AI8A 5IKXA 3AFIA 3STUA 5HK9A 2O2HA 2I78A 3WL8A 1VE6A 2WIGA 2VJBA 4B83A 4DM7A 1EHYA 2PKYX 2WIJA 1PJAA 4Y2PA 4CFSA 2JIDA 1CUIA 5CT4A 1DQZA 3F9CA 3I2GA 3PUIA 4QDOA 1R9NA 3DQZA 4BC1A 2JGMA 1CUDA 5CTAA 2XMSA 3VVMA 2R11A 4B80A 2H7XA 4Y2SA 1JT2A 2RHTA 4RPCA 3YASA 1J06A 2HRRA 4UHHA 2WLSA 3RARA 1XLUA 2XLCA 1ZGBA 2WUEA 3QPAA 5D3KA 3FAKA 2HA4A 1VXRA 3N2ZB 3WJ2A 1CUYA 5EHQA 4BRZA 5FDFA 1CQWA 5I8PA 2C4HA 4YK7A 5HF9A 4UBNA 5JALA 4J0GA 4WY8A 4H77A 2VAVA 2CUTA 5DNUA 2G63A 3TRDA 1IMJA 3WK7A 2WIDA 2HFJA 1UOPA 3C6YA 4J3JA 3PI6A 5F4ZA 5AKYA 1TQHA 3V1MA 3H2JA 1ODSA 2WFLA 4ROTA 2DQZA 2XUHA 4X97A 5T4BA 4DGQA 3FVTA 3RK4A 4G8DA 4B9AA 4QWWA 4CIBA 1FFAA 1O6FA 3G0GA 2ZYIA 5CMLA 3IUJA 2XUQA 3GZJA 2XMQA 3JW8A 1E8MA 2WUDA 3DKKA 5AKKA 1J07A 4Y2VA 1ZIYA 4H7IA 5AH0A 4Y2TA 4DSZA 3V48A 3WIOA 1AC5A 1KU0A 3ESBA 1UOQA 4H7HA 5AK3A 1KU6A 5HF8A 3HSSA 2OGZA 3FBWA 1TCCA 1JI3A 3WZLA 1J2EA 4X6UA 2OCGA 1MO2A 4GDMA 2PSJA 2RI6A 3AUKA 3LLCA 2ZYRA 3T4UA 1XZLA 3CCBA 5JZ9A 1CUAA 3TJMA 4XVCA 1Q0RA 2H7YA 2J4CA 2DSNA 4F0JA 4J0HA 4G8BA 1H2WA 5HQ3B 1HPLA 1EVEA 2VQ6A 2WJ6A 4GBGA 3AINA 1EK2A 3TGLA 3AIMA 5C8XA 1UOOA 4CCYA 4AQDA 5AK6A 4J03A 2FJ0A 4PW0A 4W1RA 4WCVA 3UMJA 4G4IA 3WK4A 4C4YA 1ZD2P 4FFVA 4ARBA 3K2IA 4EY8A 2OGTA 2O7VA 5LKRA 5H3HA 4UBKA 2VTVA 3C8HA 5CT8A 3FSGA 1IUOA 4OPMA 2I03A 5BWBA 1A7UA 4HXGA 1R50A 5ALMA 4AN1A 4J7AA 2HA0A 1USWA 1R88A 4ZI5A 1UK8A 1EB9A 5JZBA 1BROA 2HU5A 2GYUA 2JGKA 2OCIA 1WB4A 1I6WA 5LLSA 1H2XA 4U2FA 1GT6A 4BB0A 3STYA 5K3CA 1BRTA 4P92A 2ES4A 2HU8A 5A62A 1CUXA 4UFNA 2QTBA 3T52A 3DOHA 3WKEA 3IIIA 4WJLA 1T2NA 5ISMA 5BOVA 5ALXA 4PNZA 3I2HA 1Y7IA 2GBIA 1DX4A 1YB6A 3LIPA 4XWGA 2K2QB 4FBLA 3ZI7A 2GYVA 4CIAA 3AIKA 3HJUA 2V98A 1YR2A 2XUGA 2JBWA 3D2BA 5BV7A 1ZD3A 5D6OA 1ACLA 3IB3A 3WLAA 4S0XA 3PF8A 4CI9A 3ICVA 2AJCA 3DCNA 4W1QA 2DR0A 2DHEA 5YASA 1TRHA 5LZ9A 1K4YA 2Y2VA 1XRMA 3P2MA 5ALUA 2C5FA 4U2GA 5AM3A 4Q34A 1AUOA 3MUNA 4Y9SA 3I28A 4E46A 4BVKA 5JYCA 4K6HA 5A6VA 1MNAA 4JYMA 1Y7HA 3R41A 1UT6A 5E2IA 3WIBA 4CG1A 3BE8A 4KACA 4QZVA 1QIIA 1YS1X 1JJFA 3HI4A 4IH9A 4DMHA 1XQWA 1Z68A 3WKDA 5I7UA 2WHRA 3D5EA 5CBKA 3WK6A 4IQ4A 1XROA 4D9JA 1LGYA 3C43A 1AURA 5ALNA 4K5QA 1VJ5A 1YAJA 5LZ5A 3H1BA 2Y6VA 1DT5A 2GZRA 1W6RA 3BIXA 3S2ZA 3W04A 1DWOA 3I2JA 4TGLA 3BXPA 5SYNA 5JAUA 1SCKA 2WG1A 1U8EA 3HEAA 3KD2A 5ALYA 2X8BA 3C5VA 3C6XA 4BATA 4I19A 5AICA 1U4NA 4FLMA 1U2EA 4UBLA 5DYTA 3PFBA 5EFZA 3RLIA 1K6EA 1LZLA 2V97A 4TPKA 3VVLA 3ZWQA 4JUIA 4FOLA 1XZAA 1VOTA 4H7EA 3C8DA 3O4JA 3FYUC 1VA5A 3O4HA 2QKYA 5I9IA 2WM2A 4UHCA 4X85A 1ZI9A 5FRDA 1XZKA 1R3DA 2GZSA 3EQ7A 4N8DA 3WL6A 4N8EA 2ZJ6A 3QH4A 2JEZA 2C7BA 2QT9A 3DOIA 5AI5A 4KYVA 4DIUA 1CUGA 1XQVA 5J3JA 2QS9A 3WA7A 3LP5A 5AKZA 3C5WP 1EH5A 5CH5A 4QWMA 2X5XA 1GPNA 2CB9A 1JMYA 4MWSA 4A16A 1CUFA 4WFJA 1EX9A 2RHWA 4BP9A 4LYEA 4W9RA 2HIHA 4H7FA 1GXSA 1F8UA 3EQ8A 4EY4A 4QA9A 4ZV9A 1IZ8A 3WKAA 3X3HA 4RNCA 3D0KA 4HRXA 5JAPA 5ESRA 4OSEA 2BCEA 4PV7A 1RWQA 4X91A 5ALDA 4X95A 4KAJA 5CW2A 1MN6A 1LZKA 2WUGA 2QXUA 4ITVA 2DQYA 1CUVA 2OPHA 1G5FA 2O2GA 1XQXA 3AZQA 3MVEA 2AJLI 4OB7A 4B85A 2GYWA 5CXUA 3CXUA 4NZZA 1WOMA 2PM8A 1QJ4A 4LXGA 4C4XA 2ZSHA 1EI9A 4DLNA 5AP9A 3QVMA 4LXIA 4PSDA 4L0CA 1DT3A 3H18A 3I2FA 5EHNA 1DWQA 4LXHA 4HZGA 3EF3A 2BGNA 4GEGA 3FWHA 1E8NA 2GBFA 4FDMA 2CMFA 3G7NA 3STXA 4X92A 3C6BA 4E14A 3NGMA 1YA4A 5JARA 3WZMA 3AILA 3QPCA 3RKSA 1THTA 1P0QA 3B5EA 4Y7DA 1FFBA 2Y2UA 4FNMA 2WTNA 4RE6A 1XKTA 5HFNA 2OG1A 4X94A 4QEKA 4QE3A 2PUHA 4O08A 2Z3WA 3SWWA 3DL7A 4AX4A 1PV1A 2OLEA 2VATA 5HF6A 1FSSA 5HQ3A 2C58A 4FTWA 3G0IA 4X6XA 2Y6UA 3OURA 4QDTA 3IDAA 5FXMA 5LP1A 4XIIA 3O9MA 3Q0TA 4B81A 2XI4A 2XLBA 5ALZA 1ZD5A 4BTLA 3FYUB 5JAHA 3W9BA 4JH0A 1DU4A 2R8BA 5EIAA 1N8SA 1PFQA 1UK6A 2I3ZA 2IITA 1DWPA 1E3QA 4IHAA 2VJAA 1WM1A 5AKEA 1A8UA 4HRYA 3IA2A 5ALTA 3OC0A 2O2IA 3GROA 3QMVA 3GA7A 1YS2X 4UPDA 4IH4A 4XJVA 4J0KA 3RM3A 2IIVA 3C45A 3PICA 3R3ZA 2QRUA 5CT5A 1AMNA 1EA5A 3E0XA 3VDXA 3G0DA 3G0CA 2HA3A 5DYWA 4KR0A 4KE6A 5AM4A 1WHSA 3R3VA 5AOCA 3ZLTA 4U2EA 4EB0A 3SK0A 2YASA 4G5XA 4G9EA 5K3FB 4YPVA 3PE6A 3PF9A 3I6MA 4A5SA 2ACEA 3E3AA 1IZ7A 4F60A 3PFCA 3A6ZA 3VISA 1CEXA 4M0MA 3Q8WA 4B0OA 1QIDA 5C8ZA 3V1NA 2JGLA 4K6KA 5LYYA 3D2AA 4Y2YA 4OB8A 1ORWA 1MJ5A 2XUPA 3I1IA 1XRPA 1CIJA 5SYMA 2ZJFA 4TVKA 5FPPA 4AZ0A 4KRYA 2CBGA 4N5HX 3R3YA 3O95A 1R4ZA 2VJDA 2XQKA 3GUUA 1GQSA 3QZUA 4BYMA 5K5EA 2LIPA 3SX4A 4AMZA 1MX1A 1DQYA 3G0BA 3I6ZA 3L1IA 2CEKA 1ZI6A 3DJYA 2XUOA 4QNNA 4X3CA 3A2NA 1H2YA 1GQRA 3L1JA 3QMWA 4BAZA 4CCWA 5HFAA 1JJIA 2XDWA 1FFCA 1MT3A 2G5TA 1UFOA 5LZ8A 1YCDA 3CN9A 2UZ0A 3M82A 2QR5A 3HRHA 2HA7A 4UFOA 4MWTA 2RGUA 2CZQA 3H19A 4WFKA 2BGRA 1HKHA 4G4GA 1N5MA 5ALEA 1IUNA 3VJMA 3UUEA 5AM2A 1G4HA 3WWPA 4C6HA 5HKBA 6YASA 3FLEA 4HS9A 5LZ2A 3KXPA 3B3QA 2EDCA 4AN0A 2HA2A 3STVA 2WQZA 1YB7A 3DD5A 2WHPB 1FFEA 3DEAA 4NS4A 2ZYSA 2AJBA 2D0DA 5JANA 3ESCA 1NU6A 3H0CA 4MJ3A 1RP1A 5A7GA 3H1AA 3OOSA 1AGYA 4KE9A 2XQIA 1QLWA 1IVYA 1H23A 2JEYA 2IX9A 2PVSA 2WIFA 1UZAA 2VA9A 1JU4A 4FKBA 2WFLB 3F97A 5ALGA 2XUIA 3BF8A 5E4TA 5AM0A 3ANSA 3G9TA 1TCAA 5IVKA 2ACKA 2DHDA 1P0IA 1JMKC 4DMFA 5AI0A 1ZIXA 1BU8A 1HL7A 1CUCA 1WB6A 1ORVA 3WK5A 5AI4A 1HQDA 3R40A 1XZJA 5E4YA 3EBLA 1DX6A 1B6GA 2PU7A 5JASA 5AI9A 3BJRA 2AJDA 3WL5A 4Y2JA 1XZMA 4H0CA 4CG3A 5KREA 3PDCA 5JD4A 2OQVA 4NMWA 1S8OA 1H2ZA 3I2IA 3BL8A 1LPSA 2RIPA 4BCBA 2WJ3A 4X93A 1VZ3A 1TAHA 4UFPA 3BJMA 5CT9A 4HAIA 1QIHA 1AZWA 3R3WA 4PQEA 2H1IA 5DJ5A 5CRIA 4ZGBA 3ZV7A 4NVRA 1C4XA 5CXXA 5JADA 4BAGA 5AI6A 1XRLA 2B9VA 1EDBA 3BF7A 1QIEA 2HDWA 5JAOA 3GELA 2PSEA 4ZXFA 5AM5A 5A7FA 1F6WA 1QONA 2XQFA 2XMDA 5DWDA 2C0PA 2PSFA 4EY6A 1ACJA 3E4DA 2XQGA 2WHQA 5ALOA 4B9EA 4BRSA 2HFKA 3HZOA 3D4LA 2W6CX 4LYDA 3LCRA 1LPPA 5K3BA 3OG9A 4WDQA 1WPXA 2XMRA 2OGSA 4AZ3A 2BUBA 5EI5A 5JATA 4OU4A 3QITA 3FOBA 4OB6A 2Z3ZA 2ZYHA 5T4HA 2VF2A 3WKCA 4EUSA 3G9XA 4PO3X 5LIPA 1XZGA 5A71A 1HDEA 2W22A 3A2LA 1LLFA 1U65A 5BWCA 2D5LA 2X76A 3ICWA 4LKOA 5DNWA 1AQLA 4M0FA 1UKBA 1TKRA 4OUKX 5AKLA 1EXWA 5C8VA 4DMKA 1F0PA 4KEAA 4X71A 3WQHA 3WK9A 2J4FA 3W05A 1JU3A 1MX5A 3WYDA 2JGEA 4HVTA 1FJ2A 4CG2A 1GKLA 1X2BA 3AZOA 4DNFA 3H2IA 3FLAA 5ALSA 2HM7A 1YASA 2V9ZA 4GECA 4PSUA 2VEOA 2OAEA 2VT7A 1SC9A 2YYSA 1XRQA 5C7YA 2WG2A 3VJLA 2WU4A 1L7AA 3MGAA 5T4EA 4IH1A 3R3XA 3WYNA 2RAUA 3U0VA 1UK7A 4OYLA 3IUNA 4E11A 3IULA 4I3FA 3QMMA 2C0QA 3B12A 4Q3OA 3G9UA 1W4LA 2B4KA 1WPRA 3FYUA 4A23A 4BBZA 4UBJA 4BP8A 1EINA 2VAXA 4FMPA 4J0JA 4BTVA 4WDRA 4U2DA 2ORYA 4BCCA 2Z8ZA 5AKHA 5DYYA 4OCZA 3IURA 3M83A 1BCSA 4G1FA 5ALHA 2WTMA 2AXEA 4J0IA 1XQYA 4HTAA 3WL7A 2WFMA 5KBYA 1DTEA 2Q0XA 1QIJA 2BAGA 4Q05A 1XZFA 4PF1A 4U2CA 4RGYA 1LBSA 1JKMA 5EGNA 4Y2XA 4X7BA 2E3JA 2OAGA 4AO7A 3F8SA 4P93A 1QIGA 3OPMA 3DL4A 3OTQA 2EEPA 1T4MA 5CH8A 4GW3A 2QOEA 1C7JA 2HRQA
chains in the Genus database with same CATH superfamily
1AV7A 3QVXA 4JVOA 4NWIA 4QU0A 2QJRA 3OLXA 1RBYA 2OCPA 3JQ8B 4OGGA 5DLDA 1W75A 5HEKA 3R77A 1IJBA 4L8WB 3MIZA 5K3FA 5L3SB 2MIIA 4C4PA 2BJWA 3JWHA 3RRMA 2JH3A 2NU8A 1VCIA 4NH0A 3L79A 4KXUA 4B6GA 1DXQA 4MINA 2YHUA 2Y66A 1DUSA 1L6IA 4FNGA 1YS6A 2CL7X 5LU8A 1K27A 2NYVA 4W1SA 1T2EA 4YRQA 4N3AA 4QO7A 1XDUA 3QU7A 2F3TA 2F43B 1W1IA 1TEXA 4RVUA 1SQFA 1SXJA 4PC2A 3AJDA 1YFJA 1JF8A 4KVGA 3O93A 1OY1A 1WNFA 4OA5A 5AKXA 1CZUA 4RFSB 3IJPA 5HCUA 4B32A 3LY7A 1KJWA 5ESXA 3FTPA 2YJ6A 3B1ZA 1BS9A 3WKBA 1NVVQ 3TIVA 3UHPA 5BVHB 1JI0A 1G8KA 4Y1GA 4Z4QA 3ND6A 3HUFA 1TGYA 1KSGA 3OAAA 1EVYA 1MJHA 1PSZA 1R0LA 1CD5A 3NCTA 4KB5A 3MAAC 3I32A 4Q1VA 5KX5A 4UHDA 1UBFA 2QL6A 3SFZA 4OH1A 1JE0A 3Q2IA 4JL8A 5D51S 2CJPA 4PINA 3P27A 5CH3A 5FKJA 2WWFA 5IH3A 1I10A 3MS2A 1WSAA 3K1YA 3HCAA 4FZRA 1E3JA 4BLQA 4DLUA 4GD3Q 4TYPA 3LF2A 3WR5A 1NTOA 1GV0A 2WWIA 4MLPA 3H5LA 2G9VA 2A5YB 2VDOB 3G8BA 1XRRA 4JBLA 1CQPA 3ELYA 3A7DA 3IOBA 4CM8A 2A57A 3MINA 4HZUA 4TTQA 4BUZA 4CN9A 2PUJA 4B3IA 3UOAB 3I5UA 4BEBA 1GZVA 1PUIA 4X3OA 4HWPA 1Y3IA 3HXKA 3DM9B 2AYXA 4L0DA 2QPLA 2B1JA 4N6GA 4Y98A 5TQ2B 2BKUA 4R2HA 5JPIA 5KSPA 5HTKA 5JH7F 2MSLA 1Z6QA 3A28A 1BX0A 2DFKB 2Q8NA 3P4XA 3N9IA 1X39A 3KSRA 4CE6A 2H1VA 4MWGA 3WYBA 4YUAA 2O8BA 4MS4A 3I64A 4FWIB 4QXAA 3TZ6A 3CBGA 4TMVA 2RBGA 4JNCA 4KVFA 4RVGA 3VDRA 4CRWB 4MVJM 1CJCA 1MVLA 1H0HA 3PYMA 1F4LA 4RGQA 2CLFB 4JLVA 1HSZA 3HBFA 3KWLA 3ZE9A 4C88A 2E6KA 4BN4A 2C4NA 4DHWA 1Y9DA 2F2TA 3H2BA 4PIVA 5AOBA 2HHLA 2IKSA 2VJOA 3AEKB 3SHOA 2FUKA 5BRAA 5GMOA 2XMCA 3D3KA 3JCZA 1XKXA 3MELA 4ENUA 5AUNB 5IK2D 1ZMTA 2YCLA 4QBKA 1QE5A 3EGXB 4ALMA 4YT4A 4ZTUB 1Q7EA 3G68A 2HHAA 2I6FA 3IQFA 2VFAA 4I5EA 5IVIA 4RZXA 3RB8A 4CKEB 5LP6A 5EXTA 1JDBB 3DKRA 1I2ZA 1XZBA 2QU7A 4GL4A 4IUCS 4LRYA 2R79A 4NE2A 4FYKA 4M55A 3MUFA 4X0EA 4Q48A 4BZXA 1YB2A 1ZONA 2FG5A 4A7PA 2QWXA 1WU7A 1FU8A 2P90A 3TLYA 3WRYC 1EGAA 2XSZD 4XR4A 4X6YA 2Q4DA 3RE1A 2B78A 3GXBA 3QK7A 4JK3A 4ZV7A 5KJCA 2V3VA 1PG2A 4WZAA 5ALLA 3N8DA 2IQIA 1ATZA 5B58C 1VM6A 1XUOA 4GZ6A 4C2TA 1IEWA 3BFKA 1VRCA 2FX5A 4LJLA 1S1CA 3ZDBA 3ZV6A 1C7IA 1GXSB 1P2SA 3A6EA 1WXHA 2Z8XA 4RZUA 3UK2A 1HUQA 2IYYA 3S2SA 4LHEA 2PX0A 1FTQA 3QY0A 1ESZA 1Z73A 2Q8QA 3DFMA 5JIBA 4CEIB 3KZCA 3HCOA 4A4DA 1I5OA 3V4OA 1OTYA 4L72A 3CBQA 2FQQA 4YONB 1ISJA 1H2FA 1LS6A 2FX2A 2QM8A 3LVFO 1T2FA 3QXJA 4F38A 4PYRA 4PHHA 2SNIE 3QFHA 4ND8B 1CRWG 3STHA 2IYFA 2I29A 4FYPA 2A6PA 4IIVA 1T8RA 3T3OA 1RI5A 1AMOA 1M6VB 2FR8A 2EKLA 4AJJA 1R5NA 1HLGA 3O8DA 1CJMA 2PT9A 2PNJA 1SVLA 1JHYA 1PJ8A 2WZQA 1Z17A 2ZJ7A 3IMKA 2B82A 3N2NA 2QW0X 3N05A 1GQOA 2EFGA 1VKZA 2VHZA 5AXDA 3WRYA 4EKYA 4PZ9A 5J2UA 1AS3A 2IGTA 2P6PA 1Q1ZA 4EKGA 2CLKB 1Z6GA 3DEZA 2XMGA 2G5GX 3WGOA 2IYZA 1ZUNA 4L0MA 1WUTA 3LYLA 4E09A 1XAIA 4IJUA 3KPWA 4IHJF 2C2XA 2R1VB 1H2EA 3DO5A 3M8KA 4IIFA 4UAGA 1A4IA 3KYCA 5E0OA 3JARB 5K8UA 2QIPA 3QRWA 1ZC4A 1AN0A 2IVFA 4I55A 5B4VA 4I1VA 4LMPA 4DLBA 4X1IA 2GOYA 5AT1A 5F3RA 2G1KA 5C81A 5TVKA 4IJ5A 1XDWA 1JLKA 3EDQA 5AJHA 5E9QA 3RIGA 1Y89A 2VDJA 2W2KB 1SHUX 3FGZA 3Q7EA 2IYVA 4Z49A 2O8CA 2RONA 1KYYA 4Q3DA 2GF9A 1FXSA 4NOMA 1RAFA 3IVAA 1WW2A 3BIWA 1Z15A 2C78A 1EJ0A 4BO5A 3BXOA 4RF3A 1P7VA 3H86A 3R0ZA 2OOKA 5D7BA 4ZQEA 3B1FA 5B1DA 3LCVB 1Y8RB 2PYDA 2YVAA 1J2JA 5AJVB 3DDOA 2YQZA 3LCUA 2QW1A 2E9SA 5E6UA 4NQZA 4L16A 1IY8A 1H0RA 4K40A 2X6QA 2O5CA 3GYGA 2FFHA 1QO7A 1K86A 2PGOA 4M2LA 4NBWA 1TNDA 1N6HA 3BCUA 3BE5A 3AO0B 3T9AA 5AUPB 4RD2A 3QUSA 3HJFA 2O8DA 1AN9A 1LBQA 4R9NA 3VX4A 1D6SA 2BFMA 4QVIA 1X7XA 4WOJA 5KYUA 4G4SP 3GDFA 3V1LA 3KP1A 1J1IA 1K8YB 3CW9A 3GLHE 5CJJA 3TOVA 2XCUA 1GM5A 4KLRA 2WV7A 5ALWA 3ZWYA 4R8MA 2ATXA 4EEZA 3WHPA 1B14A 1LQTA 1OILA 1L5NA 5KCZA 4RZSA 2JKZA 1XAJA 4C7OB 4QYXA 3ZVLA 4BE9A 1CS4C 5HIAA 3QEMB 1M2VA 3VDQA 3Q5EA 3B3JA 1WBBA 2RCNA 3ETCA 1E77A 3ZZ1A 3WGVA 3AH8A 3OX3A 3ABOB 1SUPA 5AVSA 1FU4A 3NNNA 4GVPA 1I6KA 3QKSB 1RZRA 4PAQA 3BORA 2Y05A 2VDWA 1FPQA 3H0KA 3OLZA 3BMOA 5F1OA 2CC2A 1C1DB 2D13A 3GDGA 1U94A 3LZ6A 3OOEA 4YRZA 5IFLA 2DWOA 2RG7A 2C4KA 4RK1A 4TXLA 4TLMB 5DKFA 5C51B 4RMGA 1VKHA 2DLNA 2VBGA 3SAJA 4LXUA 2QSZA 3CF6R 3EUFA 3NC0C 4OG2A 1XRNA 5CX1B 1ADGA 3U40A 1QCYA 2ZATA 4CKCB 2M6LA 1ZUD1 5BPHA 5I47A 2P9HA 5JU6A 4QUIA 4I3HA 4L22A 4HQNA 4NESA 4RXTA 1P7WA 1YJ5A 2H9YA 3DS8A 1UPFA 2WJGA 3PD0A 1AHPA 4W9MC 3F4BA 1B73A 2IPAB 4Z51A 2CK3D 2GN9A 4RD6A 2WJVA 2DWCA 2XA9A 2IH5A 2IPMA 3A2MA 3LLVA 3GZNB 2WPNA 4QD3A 5G40A 2P4UA 2WD7B 3PR2B 4MW4A 2HYDA 4AO6A 4LE1A 1Q1BA 4MQLA 4RV9A 3KE9A 2ZRMA 5FR1A 3P0IA 3B38A 3N0XA 3W5CA 2RH5A 3PUKA 4YJ2A 1LSOA 3OESA 4JEIA 3EOBI 4BLVA 4TKUA 4WLOA 5FP0A 1T4CA 2V0NA 1PQWA 5BYKA 3ENZA 4AJ2A 1B8OA 4UHBA 2QL9A 4R1TA 4ZVSA 5KNDH 1UKAA 2VNSA 2QB5A 3NP7A 1J0DA 1Q0TA 2ZBEA 1CP3A 1MEJA 5E38A 4IILA 1LDGA 4PY2A 1G5IA 2YIJA 1XTTA 1KVUA 3JD2A 4KFRA 4DZTA 1A8QA 3O8QA 4QPZA 2ZUUA 3U4QA 4XYGA 1PX2A 4Z7NB 1W52X 4PZYA 4E94A 1CEQA 1O6CA 4HCJA 5D85A 4LBWA 4FZ3A 1HF3A 2IW1A 3BL5A 4OXQA 2CFCA 2OYCA 2B1IA 2P9EA 5DEIA 2PX4A 2QU8A 5EIBD 5C46F 1FDVA 1WS6A 3B3AA 3OZXA 1U2ZA 3PGJA 5CFMA 2I1LA 1P0MA 1NDUA 2YZ2A 5DNAA 3RS3A 1RRPA 2HLNA 4JGIA 2NU7A 4QC2A 5E7JA 2BRUA 4BWGA 1K7YA 3RHTA 5EWJA 5D01A 2C5LA 2XB2A 1E9EA 2DTXA 4JP2A 2MSNA 3PQCA 1GNTA 4QVKA 2C3UA 1MBZA 1I7SB 2EZTA 2YOGA 5NLLA 1K4MA 3EGIA 1PQPA 1ZLYA 2GPWA 1JB9A 1YJCA 2OQIA 3BJEA 5LBUA 4BGIA 3DBLB 4FMCF 4O02B 4Q4LA 3AB7A 1DAIA 1ZBDA 5JS7A 1GGEA 2WKWA 5LA6F 2IE0A 2AD1A 1VMEA 3BEDA 3AHIA 3NALA 3FDFA 4NULA 3TG8A 4ES6A 3AC0A 1EUDB 3D3EA 1DG9A 1E9BA 1J33A 1B16A 1L7XA 1TMGE 2PBLA 3R1IA 1NKTA 4I81A 3UJPA 3S2IA 5ALVA 3RAJA 4DE5A 2G1JA 2ZRIA 1GZ5A 4FE3A 4BNDB 1NXPA 4KPYA 1PUJA 1YBAA 3WBFA 4MHTA 2DBRA 3K2EA 3PQ2A 2C9OA 4E33A 1OFHA 2BY4A 3DLTA 4GQAA 3UC5A 4YJFA 4JKYA 1RSZA 1DP4A 2ZJYA 4I36A 1UBKS 5AD1A 5GJVC 2YVKA 1UZMA 2ISCA 2P2NA 3UT0A 3DBHB 2R86A 5GTDA 2Z1DA 3MJRA 3MCWA 1JXAA 2WVGA 4I4IA 1HEIA 1YKGA 1K7EB 3EIOA 3GO4A 4FHGA 1HOXA 1T1IA 2Y99A 4DEYA 3OSUA 2W70A 4MAMA 4YMHA 2EJVA 3TF5A 4XXHA 3H42B 3K9BA 4IFBA 1WLSA 4QQRA 2YV2A 6AT1A 1S2DA 3HA2A 4ZHSA 3GFFA 4D6PA 3EGCA 3VA7A 5M04A 3DGEC 4ZO4A 3ST7A 5F7OA 1TJYA 2Y0BA 1TDJA 3M1YA 5M3BA 2RGNA 1PRYA 3MC1A 2XUJA 3TWOA 5FUBA 1HE8B 4U0JA 3X1XA 1CEEA 1NVEA 5G0UA 4DMMA 1OC2A 4C29A 2H06A 1QKIA 2H7CA 4LJ6A 4O8CA 3NRJA 4QDUA 4ZRNA 4KO3S 1SMKA 5F5NA 3VTAA 4QYTA 4F6LA 2PYZA 3AF4A 3Q2OA 4M86A 1HYHA 4TQAA 2VUTA 4IDNA 3ZLBA 2VUIB 5JSZB 3BHIA 4G25A 3QWFA 1A9QA 4MJLA 2FW1A 5HF5A 2E4AA 2XB6A 2VKQA 3NBZC 3LQKA 4I8DA 4P3PA 2Q6OA 2XCLA 1U3CA 3BE4A 3HVUA 3KFVA 3R0JA 2JBHA 4M0EA 1DO8A 3TINA 3GHYA 1XSEA 3FMOB 3GLHB 3NEPX 4GR9A 4IVQA 1NPTO 1HGXA 1ZJ5A 2VQEB 1BE0A 1LEHA 1ORTA 2EKZA 1QDUA 2WVHA 4JUCA 4U6SA 3S4YA 1TQ2A 3D2CA 1CUHA 1HM5A 4HFMA 5CA0F 3KT0A 3WMGA 2P2LA 3IP8A 1UFRA 4P53A 4BCDA 2R0QC 1YD7A 2RGYA 5FO0A 2OXEA 2C96A 4WY5A 4O2BB 4C5AA 2OA0A 1HG0A 1BVRA 3B60A 3NWJA 5AM1A 4DLXA 2I2CA 4PC7A 4BGEA 3D64A 1LRJA 2JI8A 2VK8A 4LHZA 4QICA 3VAAA 4EFMA 3ZCTA 3CZRA 5IDYA 3BULA 3NT5A 3PQDA 5CNKA 3QKUA 4IFTA 4EW3A 5C1OA 4BLRA 1D0SA 1XKLA 2AW5A 2O9JA 3KOWA 4MSUA 4TKVB 2FPKA 1C0IA 4G56A 5BQPA 4ER5A 1T5DX 2B37A 3TD6A 4RIEA 2BN4A 2VQDA 3HACA 3MQFA 3TCNA 2AN1A 3NB0A 3LWNA 5EIEA 1YB1A 5EHZA 1E7QA 3AOGA 2EG9A 2J09A 1W4ZA 1D6NA 2QF7A 1IWPB 1UFKA 2FMIA 1BMQA 1FQJA 2WT8A 1PWHA 3NC4A 3UJ3X 2Q0QA 521PA 1MGOA 2FGKA 2IHKA 2NNLD 1D1SA 4IKOA 2I67A 5CFZA 1W581 2IX3A 1DEXA 3IIEA 4OF4A 4JDPA 2HR1A 3SHTA 5P8WA 4YJKA 1TECE 4NV0A 2BFAA 3W2TA 3GVPA 2WFZA 3N8HA 4ZT2A 3HY6A 2H5IA 3J80A 2HLDA 5HS6A 3CIOA 1CZLA 3LX8A 1JL3A 3A36A 4HI0E 3DMFA 4HPWA 4MO9A 5EZYB 1EK6A 4E07A 2JVIA 1X7WB 4JVSB 4B4OA 2IOQA 2I3DA 1ZK4A 4BVBA 3AI3A 3R3JA 1VFNA 2HBZA 3UPTA 1LK5A 3R09A 3USES 5CLJA 3IBSA 3THWB 4EEXA 3I5AA 4MUMA 4PYKA 4BVFA 1SXGA 2F9LA 4BMOB 3UN1A 5K4AA 5L3SA 4ZOBA 1DARA 1NHGA 4LDQA 5LQJA 3DKVA 1H5UA 2FDRA 2Q3LA 2XXBA 5EZQA 2ZYVX 2C2WA 3OIYA 1BW9B 1CRLA 2XUAA 3ADPA 1EDZA 1NU8A 2GTHA 1TYAE 3QTLA 4EHHA 5JZSA 1C7FA 2CFOA 1M7GA 1JIKA 1R66A 2F43A 2V4ZA 3CLHA 4B7ZA 3W34A 4C20A 4ZCIA 4JY7A 1AVTA 2O52A 1M2KA 3STTA 4DR2B 3ER8A 3DDCA 2VNKA 1D2HA 5FNVA 1BKSB 4RE6A 3I5YA 3CX7A 1XMPA 2CMHA 2W0MA 1D2EA 2Z57A 2PN1A 4L50A 2OORC 2R8PA 3ZZ0A 1MG0A 2AHOA 4L74A 1NW3A 1E5QA 1AUPA 4ZCTA 5BVHA 2P2DA 1FBTA 1YV9A 1E1RD 1E8DA 3E3LA 3AR7A 1EWYA 1KAOA 4JITA 4PZEA 4YPFA 3ZBTA 3N0VA 4BWFB 6ABPA 2HCBA 1J9GA 1IHXA 2OT3B 5EJAA 3DBVO 1HRKA 2ZRJA 5TARA 5HOQA 3FFTA 3TFQA 2PZJA 1KHTA 3K4HA 5IM4A 1MPTA 2BGIA 1S1MA 2Z43A 4QUAA 1DKMA 4K6CA 3S27A 4IP0A 3CX4A 4D81A 4JLNA 3O2NA 1E9CA 1BH2A 4Z0NA 2KS6A 3D0QA 3V1YA 2PKCA 1BMFA 2DERA 1DJQA 3KELA 3GEPA 5DYIA 5BURA 1KFEB 3PNVA 4WVFA 2J3JA 2H1RA 3PSHA 4ZQGA 4A6PA 2C7RA 5ILGA 4MW7A 1EUQA 4DUYB 1JDBC 1MB3A 3E5RA 4GC9A 1PVVA 2PGNA 4WVLA 1E3DA 1FS5A 1NF8A 4WBNF 2AW3A 4BYGA 4ZZ0A 3PUVA 4IRMA 2GWRA 4F46A 1QG6A 3AWDA 3V4SA 4YR7A 2ONCA 3TQQA 3UK7A 1M1YE 3WMFA 1HYQA 4CV0A 4XD7D 4H3VA 1EDDA 4A2PA 5LUAA 1WXIA 5A7HA 1W73A 2VKTA 3WE7A 2N1MA 5IZCC 1MFPA 2Z2YA 5JNVA 2E37A 4XASA 4OGFA 1VCOA 4HYEA 2FWMX 3KQMA 1Y4ZA 3Q9LA 4JT2A 2WF5A 2DBQA 4R41A 3A9UA 4YX9A 1NX9A 2I8CA 5EERA 1JHDA 4BZWA 3AKZA 1VXOA 3VPAA 3ZKAA 3KDPA 2YWXA 3AY7A 1S8NA 5IBPA 1OASA 1A4XA 4UXJA 2BHNA 2QPAA 2JANA 3PUHA 4RVSA 3PKJA 3QEKA 2E4XA 2HBYA 1XX6A 2Z4TA 3IO3A 1C3XA 1NW8A 2GCEA 1UIRA 1MT0A 1T9GS 4KH0A 3P7MA 3AEKA 3JQ7A 5FQNA 2WSBA 3OWXA 4G01B 1VSQA 3WWOA 2YHIA 4QT4A 1ZN7A 1J8VA 1WEKA 1QR6A 1ZGAA 3EGXA 2PMFA 4FGWA 2NXWA 3B2EA 4IWYA 4EG8A 2QL7A 1QRDA 3TMAA 2F8SA 1G2OA 3ZCXA 4CKEA 3MJCA 5FLKA 5BN3B 4HJRA 1FNCA 3N0WA 2WF8A 3AB8A 4U5QA 3ZWXA 5I8WA 5K3AA 2IYTA 1DBRA 4L73A 2VRWA 4E3ZA 1AU9A 2PX8A 3NVAA 2A59A 4YO8A 2BI8A 3H9GA 3DYIA 1E2UA 4JV5B 3ED1A 1HORA 2Q62A 1RQGA 4RMIA 3JZAA 3ETGA 3HPQA 4BFCA 3EY9A 4B3DA 2NZUG 2FQWA 4Y6SA 4LOKA 4WKOA 5EZ5A 4ZJZA 1IJEA 5CLFA 4J0CA 3Q98A 1W5FA 5C1DA 3T5TA 2II6A 4D4JA 5BWOA 1LI5A 2PK3A 4HNTA 1WY5A 1HFKA 1YCHA 2H9IA 4W5RA 4URHA 4FWTA 4CEIA 3OM1A 3AOEC 3NBYC 3C70A 4XPIB 3BGOS 1LPNA 5BN5B 3OJWA 2FEOA 3UCFA 3DZDA 4JCOA 2JAHA 4ZCQA 4BLUA 2YC4C 3PFWO 4E1BA 3MTEA 2WINI 1RBQA 1MR3F 1SHTX 1Y6RA 3AFNA 3KE8A 4INPA 5BW8A 2LRHA 3X1DA 3B2NA 4ND8A 3NBKA 4UNIA 4KQGA 3U3RA 3NONA 1RKXA 2GXQA 3W3AD 2VA8A 1YA8A 3RJ5A 4PSKA 3OE1A 4GLBA 1YS4A 1ML4A 4ZT4A 1C8LA 1HDOA 1M6VA 2A9VA 4CM6A 3S3TA 4X8HA 3WLPA 1F5NA 4JIGA 2EF1A 3OZGA 4RDHA 2RE8A 3IXMA 3OPVA 3HUDA 2FRXA 1BRMA 5B53A 4PGFA 2JG3A 2HWWA 1TFRA 3DZIA 3GEEA 4Y2UA 5A6SB 1R8QA 3P9PA 4DNOA 4HAZA 1R9MA 2DXIA 2QT1A 2H92A 2DF8A 1GGVA 1IY1A 1L7RA 2R1VA 4LHXA 4GR5A 1NDQA 2QN6A 3FETA 3JARA 5FL7A 2W6NA 1Z4OA 3LAWA 3TUJC 3VAZA 2ECPA 1GPJA 4FI3F 2PDAA 2R62A 4LN1A 4RHFA 4XFDA 5GINE 4FHCA 2R6FA 3M5PA 3WA6A 2NZJA 2QD5A 3R3UA 3ZLVA 1ZGCA 2YZNA 2J5XA 1SCQA 4FBMA 1ENYA 3RUEA 1QOZA 2W2KA 5JSHA 1MC8A 5ERXA 5U9CA 1YK1A 3AM5A 3NHSA 1P7PA 2ZAIA 2CD7A 3TQRA 4KGZA 2CMKA 5IYZB 3FCYA 4RE5A 4U9IS 1ORRA 3U7GA 1KY2A 4B2IA 1AZLA 2YFQA 1ZH4A 1PQYA 2Q2NA 3FOWA 4CT0A 4DWJA 2JGIA 3AERB 3DL2A 4FMDB 4H3HB 2AI2A 4Q19A 4EEKA 5JW6A 1J90A 1G2PA 4HUQA 1ZA2A 1NN3A 4JYPA 4FD3A 2I2AA 2AKEA 3IV7A 3M0EA 1HT1E 1L5WA 4ZAGA 1SVWA 2PKQO 1HE5A 1LC3A 4FDVA 3S8YA 2RHRA 2JI9A 2XIJA 3T8YA 5JOQA 4M53A 1KEZA 3WQQA 2CD9A 3UXMA 3ZUGA 3O82A 1OYOA 3L43A 1JV2B 2PO5A 1TVKA 5AMXA 1QQ5A 3W1VA 1DCKA 1F3OA 3Q5GA 2YNMC 1U0SY 4DCMA 4MYUA 1V25A 5HK9A 5KJ1A 1FDWA 4JX9A 3S6JA 1ABFA 4MCIA 1B0UA 3QEMA 3OQ1A 1RQPA 1VE6A 3VRHA 2JRCA 2WIGA 4BJHB 2PKQP 2WJPA 2Y1LA 3OZFA 3L4BC 1JTFA 1ISIA 4Q9JA 2BJVA 2JIMA 1TU3A 2AXNA 2CUKA 3QKSA 4AKTA 2UUPA 4P4TA 1WD7A 4M83A 3GJQA 3M49A 4MVJE 4N0DA 4LOHA 4CFSA 3HH8A 1KI8A 2JIDA 1OV6A 1YI8A 3SFVA 1I3OA 3SSNA 5CT4A 2LR0A 1DQZA 1M1YB 4NH4A 4S1TA 3RYIB 4QDOA 5GOZA 3G85A 5CX1A 2VUSA 4CKCA 4PE5B 4BKOA 2OE2A 1BA2A 2AQHA 3F71A 5EQDA 2XMSA 3UCXA 5DWVA 5K20A 4ECAA 2R11A 4H2DA 1PR2A 2A5FA 4FT4A 2H7XA 4LGYA 3LCCA 5J2TF 4B80A 4AX8A 3QUBA 1S2GA 5COBA 3WAJA 1ILWA 1DIBA 3NHAA 3O2SB 4PR0A 3EXG1 5FNZA 5KDLA 3UMRA 2G28A 3WOVA 2JVKA 3BSWA 3N87A 3GZNA 5H8WA 2YNMA 3SJ7A 1M8PA 2EZUA 2JJ1A 3CZPA 3IUBA 4HYTA 1ECFA 2ZWPA 4B3BA 5BSFA 3I05A 5EKTA 2GLXA 1TTQB 2G5CA 3VPHA 5IMSA 3EE6A 1VPLA 2X3YA 1U4OA 2COUA 5GPBA 3QPAA 2EBWA 3FAKA 4KUGA 5CB6A 3T4XA 3ZG6A 4XWKA 1JALA 1R8YA 3WJ2A 4BRZA 1B2LA 3L4BA 2MINB 5CP8A 3OTGA 5FPTA 2WTEA 1Z2PX 3OCXA 1Y5LA 4YK7A 2XE8A 5HF9A 1M54A 4MUNA 4N65A 2YXEA 1SPXA 3NH9A 2W6PA 4ITRC 1Z0ZA 1Q2XA 5JALA 4E5MA 1EVJA 4J0GA 5AW4A 4HADA 4GGPA 4CFZA 2J0QA 4FB4A 1C3LA 4H60A 4LMAA 2CUTA 1WUIS 5DNUA 1XG5A 4AUNA 4CFYA 1TU4A 1T5SA 5L45A 3FTCA 2Y0PA 1JUDA 2G06A 3HRIA 2G63A 3IQEA 1OU0A 1RPZA 4INAA 4BOYA 3DBRB 1ZIOA 2WPDA 2YW9A 1ZJWA 4Q3AA 3VPDA 3M4JA 3A1FA 2VYVD 3H6GA 4FXPA 4RIGA 3K3PA 4LGCA 4WUVA 4FBGA 4OHXA 1F0KA 3LC1O 4A27A 1DC5A 4IJMA 4PIPA 3GFPA 1G1AA 1XJ5A 4IYRA 5EP4A 1Q0HA 2PGLA 5EQTA 2OK7A 2IHUA 3TEFA 1PVOA 2R8EA 1X6VA 4RHEA 3BIOA 3UV7A 1TJ3A 3H2JA 3EGEA 4H6WA 1ODSA 1O8CA 2GZHA 2OFXA 1OYVA 5DU2A 4M0UA 1GRNA 4ROTA 3DBLA 5BSUA 3ZDXB 5CB4B 2UU9B 4EO9A 5E1DA 9MHTA 1D2NA 1DO2A 1UPCA 3FVTA 4Q4DA 5K2OA 4G8DA 4CTMA 1EUDA 2CY0A 3GFSA 4TLBA 5FT9A 4D3XA 2H11A 1K8XB 1OLUB 2F1OA 4MRRA 4O8ZA 2PR2A 1HT3A 4BS9A 2CNDA 1A69A 1IN5A 1ZVMA 2QRLA 3ZNQA 1WF3A 2ZYIA 2JFHA 2FSVA 2I6UA 4JEUA 4LWQA 4YB8A 1ZR4A 2X9VA 3L8CA 4MYRA 3WDMA 2WUDA 3DKKA 3B48A 5BSGA 4FT2A 5EEHA 5DNCA 4G85A 3MFYA 1Q92A 3ZVRA 5IJAA 4E22A 3VH4A 4Y2VA 5FD8A 4OHMA 2CHVA 3MNFA 3S2GA 3ROZA 1Y4SA 4BJ6A 2RHJA 3HJBA 4GS5A 5IDQA 3JRNA 5AH0A 5CK4A 4N9QA 1E58A 3JASB 4J6FA 4F4HA 2E1RA 1GQ2A 1N5LA 3BWYA 1TQDA 5KKNB 1KU0A 4M88A 4QGGA 2PCLA 4PHTA 4H7HA 1A82A 1CULC 2R1ZA 4G41A 4XB1A 1X38A 3AJ8A 4HX5A 3ZXSA 4QM6A 1MJGA 2H1WA 1SVSA 4FW8A 2GF2A 1FSPA 2R2AA 4H15A 4MQEB 1R6BX 1CC1S 1Z4QA 2C84A 3A05A 3EA5A 3ETJA 4H3SA 1KOLA 1JI3A 2Q2VA 4HEQA 2BCGY 3ZW9A 1FY2A 3PPXA 1BHQ1 1DVRA 4CV3A 3PQ6A 3IPRA 4CTOA 2A5LA 4R05A 5IP5A 3U3JA 1KK3A 1PS8A 2PAAA 5ESDA 2HF9A 2ZAOA 1Z35A 2CDNA 2FQ1A 3EXHC 2ZYRA 3SBDA 1LSUA 4DDVA 2YS6A 1Y3FE 1XZLA 1LW7A 2NO1A 2O05A 5D87A 5HG0A 2C9MA 1G64A 5FWDA 3LZCA 4ER7A 1CUAA 5CIWA 1AXEA 1ULBA 1KY5A 1ADCA 2W5UA 2DBVO 4Y2GA 5FADA 4I08A 3TJMA 4LZLA 3WTCA 1YUNA 4PXSA 4XTCS 4D44A 3GD5A 1Q0RA 2H7YA 4UHJA 3JVUA 1RM3A 2DSNA 3GLHA 4EJFA 3I62A 5FOTA 3AJEA 1ZY2A 2BF4A 3KLOA 3DFFA 4HBGA 4DCTA 1E3SA 1VJRA 4JC4A 1GADO 3DTVA 4RZ3A 5A3RA 2BFDB 5ED4A 2JASA 5FO1A 5EXXA 4NLLA 4BO8A 1OSNA 3HTXA 1J97A 3AL3A 1PR4A 1WULS 2CXRA 5B3JA 3A2KA 4G2TA 4UOQA 5DN9A 5FEUA 4O2BA 4ZOLB 4PZ0A 4YCAA 5CVDA 5T7BA 1SKQA 2AWOA 4L27A 2IW3A 3AIMA 1XR3A 3PJGA 4NABA 1SQSA 5B1EA 2OV2A 1EU1A 1UOOA 3F5MA 2BTEA 4AQDA 4GUDA 1CSEE 1N0HA 2GK3A 1PUXA 2V6GA 1U7XA 2Q4BA 1VJCA 4H08A 4KUHA 5BOSA 3SVTA 3CTPA 1JDNA 5DVZA 3UY4A 4GXQA 2GN8A 3DLPX 4PW0A 5AK6A 3UUWA 5L3QA 3MTQA 1DSSG 5HCNA 5B7QA 1QAMA 3O83A 4WCVA 4Y0AA 3F6PA 2H0QA 1ZNYA 5IF9A 5IXJA 3AIIA 1P77A 2BM0A 2R1TB 3LT1A 1DI0A 1JDPA 1S7CA 3KD3A 4M1ZA 4HDMB 1HZZC 3W2EA 4UDYX 1FSGA 1KKLA 2PQMA 1AKTA 3CJTA 4WINA 4ARBA 4EY8A 4MUFA 5KU7A 2A35A 5FPKA 2C94A 1NG9A 1E2HA 5TY0A 4UE6A 4O1MA 3BIJA 1EFPB 5ADVA 2KWIA 4AG3A 2VTVA 721PA 5BRJA 1I7DA 3C8HA 5CT8A 4PLHA 3WMXA 3ZIAD 4B4UA 2WQ6A 2QG6A 3DV0B 2CYCA 2V7WA 3DOCA 4HWTA 5EZYA 2WLTA 4LE2A 4QTZA 4OPMA 2I03A 3TXXA 4YCMA 1X7WA 2VCYA 5DISB 1R50A 5ALMA 4AN1A 1L8QA 3ILHA 4RK5A 1P45A 1N9GB 4J7AA 1DBQA 1USWA 3IGFA 1V9LA 1W5BA 2WAMA 4Q5IA 4EHIA 3THWA 2X7XA 1EB9A 3T7CA 1K1EA 5D86A 4XFJA 5CBPB 4IINA 4AKIA 5IHXA 2WM3A 1K0UA 4IUYA 4WLUA 5LDGA 2QTHA 5IANA 5E8RA 3GJ0A 1L8OA 1RHQA 3DB1A 3ILYA 4JD5A 4EP1A 5B7PA 1AKVA 2CXQA 4B8YA 3HM2A 1RJGA 3TLXA 1E1KA 5MHTA 2CCKA 2ZB2A 1H2XA 1ZOSA 1NURA 1ODJA 2WAXA 1L8XA 5LDHA 4F6CA 2QUJA 2BLNA 3JQQA 1C0LA 4BB9A 4ZOEA 4TXNA 2ODTX 2R4UA 3WRVA 1KGSA 3ER6A 1WMDA 4IDDA 4PXYA 1QUEA 4IOKA 1T34A 5HE9A 1FUUA 3ZH9B 2P9ZA 4ITUA 3M34A 4F5YA 4DV4B 4AUMA 1WSBA 2XF8A 4IQFA 4AJIA 4KQKA 1JS1X 1B3BA 4M98A 1E92A 2QTBA 3PUJA 2V5VA 3CF0A 3ZCRA 1XJCA 5AHKA 4FM9A 1V8DA 2ZBRA 2GPAA 4MAFA 3UAXA 4A2QA 1TA4A 4HV4A 3IIIA 3PNQA 3FF4A 1W2GA 3HQ4O 4O4HF 1T2NA 4UREA 5M34A 1LLCA 4DDMA 1KDRA 2RGWA 2JLQA 5K0FA 4BVGA 2DOKA 2G7MC 1UBCA 2SICE 5AVYA 4V0LA 5DHRA 1L8AA 2WTAA 4IFIA 4MWOA 3GWGA 2ZB3A 1BOFA 2ZSUA 1EK5A 3TLEA 1AH2A 1Z4IA 3RSHA 3QTTA 5KNCH 2Y1DA 2YS7A 4TKLA 1ZD8A 5JVDB 3V6MA 1EWRA 4DY4A 1KO7A 3A1SA 2AFIE 4FDTA 3I8XA 4J29A 2Y3IA 2JEOA 1IIRA 4Q1AA 3ZE2B 4F96A 4KI0A 1NQWA 1K4KA 1PI3A 4BNLA 3W2IA 1B15A 2XUGA 4UEKA 4IRXA 5DI3A 3PHHA 1D2CA 1F17A 3AV0B 1COWD 1N2OA 2DPYA 1W7AA 1CKEA 3DLBA 1RKUA 1ZXXA 1ZD3A 1C1HA 5D6OA 4UCQA 2D0OB 5GZ1A 1IG3A 4NZPA 2YWEA 1C4WA 1IY0A 5ILQA 4WH0A 1KDPA 3NIBA 3PXCX 1Z8FA 2F64A 4JOCA 2PGAA 3A14A 3PF8A 5DRTA 3WLAA 4AZ0B 1Q7TA 2XB4A 5K09A 4M49A 1EKXA 1GUYA 3NATA 4FCCA 3RT7A 8AT1A 2TMGA 1RAAA 5YASA 1ECLA 2ZUVA 1JN0A 2RHGB 3DG9A 4WZZA 5DCLA 3R76A 1E1CB 3FROA 1GDDA 1RC0A 1J4AA 2CNWD 2FETA 3LWZA 3QVTA 3MN1A 4X60A 1VHWA 1B93A 2ORVA 2J9FB 1S5PA 3MM4A 4AYTA 2OHOA 4PX9A 4O4LF 4I1OA 4R31A 1J6UA 4MGKR 4BLTA 4RTPA 2B8JA 1SEPA 3RVKA 2C5FA 3Q3IA 5GONB 2DQKA 2IYPA 4Q39A 1U2SA 2V7TA 4EO7A 3ADOA 4KQ9A 1A2QA 3D81A 1Z4PX 4OL9A 3F5FA 3IUYA 3VFDA 2R96A 2IXTA 3FCAA 1K97A 2PAFA 4FOTA 1YZTA 4IKPA 3X1JA 3AF2A 5L9AA 3DWEX 3O38A 4EYQA 5A6VA 1PZNA 1SVKA 3KAPA 5HJ5A 3CVVA 1OTXA 3LUPA 4OBEA 1YDEA 2YIMA 4JYMA 4HVLA 4NPCA 1N25A 2X2OA 4X20B 2PE5A 2HN9A 4KR2A 4BO2A 2I3AA 3Q1LA 4XPIA 3H13A 1FYVA 1N7HA 4WXHA 1SU6A 1SU8A 1UKZA 2IZ0A 1EVLA 3FM9A 3HBNA 1WZUA 3OZRA 1JNXX 3BE8A 4PVDA 4ZQHA 3WIBA 3ZDQA 1QP4A 3IAM1 5HMLA 1OFGA 3ANXA 1QIIA 4YCCA 5KTRA 1YS1X 4J1NA 1B42A 1RLTA 3L05A 3K0FB 1OGJA 1PKXA 4RABA 3IXLA 7MDHA 4ABTA 4JWKA 3O8LA 1IUKA 1XQWA 1NC1A 1ZPDA 1G7SA 1Z68A 2PZMA 3KSZO 3WGZA 4F2DA 5GADl 3MJFA 4Q7KA 4V0ME 3D5EA 3KOYA 5CBKA 2IOYA 2OO3A 3EVZA 1P60A 2H18A 4D9JA 1LDNA 3RK1A 3C43A 1XVIA 1CY7A 4LGMA 2ZIEA 3ND5A 1P17A 1NFRA 1ONBA 1H2RS 1JLMA 4CR6A 4K5QA 2G9RA 3ABSB 5A6SA 2YJGA 1V6SA 1UEXC 1VJ5A 3EMBA 4R8KA 4RPIA 1EQUA 5CHEA 2E48A 4KQ6A 1GTL1 3I9MA 3ZGOA 4C6TB 4ZDIA 3WYCA 2GZRA 1DGQA 1KI2A 2IFTA 3Q3JB 2M1XA 1G7CA 2GM9A 2YINC 2WZDA 3O2JA 1NA5A 1U99A 4O4IB 4UEQA 5CPFA 3S2ZA 3U6BA 3I9V6 2XRMA 4HWOA 3HVKA 1P81A 4GX2A 3W04A 4B09A 2W6IA 4EARA 3TZLA 5LLTA 3ANMA 4QOJA 4OEHA 3RVLA 2W4QA 1CY6A 2RGXA 4ESHA 3ADBA 3PGKA 1SCBA 2R4TA 4RGVA 3PXDA 1SCKA 2H1CA 3VTZA 2IIPA 1K6IA 2B83A 3TB6A 5HR5A 1XK6A 3KD2A 3PUZA 4WZBB 3CKKA 4B7AA 1G4UR 5IYZA 3CRNA 1D8TA 5LQSA 3QW4B 4IWNA 1ZXBA 2Q3CA 3AERA 4PLVA 3T7IA 2Y93A 3U3XA 1SOWA 5CM9C 3OF2A 3OHMA 1NYLA 3RANA 4WV3A 2X86A 3H83A 2BMJA 2DRIA 2WNHA 3T4PA 3ZWNA 2AX3A 4E1VA 3HWWA 1P6QA 2W48A 4QM7A 2JLVA 1LZLA 2V97A 3BB1A 4TPKA 3SJCA 2PIAA 3ZWQA 2AJTA 4DA8A 4TS1A 4DUPA 4HKTA 3BAZA 4YUYA 1GT91 1D7OA 5K51A 5LQCA 2ODPA 5GVRA 2GXAA 1XZAA 3ZDAA 4QBIA 4A6DA 3EYAA 4WLFA 3DC2A 4CDMA 3O4JA 1ZRHA 3COZA 3ZJ5A 4DRYA 4EG5A 1NVTA 4EVSA 5BQFA 4HX2A 1UPXA 4D4HA 1DEKA 3LVRE 4G37A 5EUQB 4Z86A 5CIQA 3AVVA 1PJ4A 5J5CA 3RRZA 3TE6A 4B6JA 4LF9B 4RTRA 3FCCA 1R4NB 1ZI9A 3CX8A 5FWYB 1H3EA 2QLNA 5FRDA 4Y67A 2FUNB 1P9OA 2DT5A 3K6SA 2NX2A 4KQIA 3JSAA 3ZY4A 3GBPA 4FNAA 4XTRA 2QN8A 4KR3A 2JFXA 4Q01A 1XTIA 2P30A 2C7BA 4I3GA 3UTDA 4HB2A 3LUGA 2C29D 2YMQA 5KAPA 1M1YA 1PZMA 1QRTA 3H97A 4ZOAA 3RYIA 1PT7A 1XIVA 2HV9A 3INTA 4N7JA 3HR8A 1T0IA 4US1R 2BIFA 3ZZNA 2VR1A 5J3JA 3IEMA 1HTWA 2QS9A 2DFLA 1IZYA 1YQ9A 1H3NA 3CEJA 1A1VA 1M6WA 2G0TA 3KQUA 2O7SA 2RGBA 4ZZ1A 5AKZA 1EH5A 5CH5A 1G8HA 5I9BA 1WPQA 1VL8A 3OFNA 1AUXA 1RLIA 3COPA 4I9HA 2XNKA 3T5MA 3TGWA 3UJAA 3ORSA 3S8MA 1F2VA 4D6YA 4EA7A 2I54A 3DPUA 1QOQB 2DFVA 3DQQA 3OPYI 4U5XA 4WUTA 4URFA 4WCFA 1U9JA 1DBVO 2AVNA 1KVTA 4PTLA 3MIIA 1XQ6A 2RD2A 3KFLA 1ACMA 4LDJA 4WFJA 4NCAA 5LB2A 1C29B 4OLJA 1PL7A 1V71A 1ZVKA 4HMOA 4HY3A 2G1PA 4P3NA 4D1YA 1SVMA 4JXJA 2P2SA 2FLVA 3QXCA 4N48A 3TTTA 3WKAA 1IWBB 2QL5A 4NE7A 3SU8A 5IULC 1ZX1A 4A03A 1VP3A 3F6EX 3EEIA 5JH7B 4Z1MD 5JAPA 3HYTA 3NTXA 2WEKA 3HU5A 4ND6A 1S02A 3G7UA 3D02A 1CDOA 1DV2A 5A5DA 4II7A 1RWQA 3P9CA 4X91A 5ALDA 2J30A 4KQHA 4M38A 3L40A 3HZHA 4X95A 3ZOZA 4XB6B 2X4LA 5CW2A 2PEZA 2FMFA 4XR9A 5ENDA 2AD5A 1GJRA 1LZKA 2O4UX 3DBRA 2QXUA 4B73A 3FHCB 1G5FA 3CLRC 4AJNA 4OJYA 1T4DA 2HGZA 3MB5A 4P3YA 4D0LB 4OMFG 4R7ZA 5JE8A 5DNYB 4Z4IA 1EUZA 3U60B 4JOBA 2AJLI 4TLCA 1B8UA 3RODA 3OT4A 4OB7A 3UV6A 3VV2A 2JK0A 4LYFA 2H29A 3NM6B 4R98A 2Q5FA 3CXUA 4NZZA 4B74A 4RWEA 4OLBA 1WZ2A 1CS0B 3GEBA 3GJRA 4GWGA 2H4XA 3IILA 3V55A 1QJ4A 3EMDA 3FCSB 3GB9A 5FYDA 4NS1A 5CB4A 2ZSHA 4KX3A 4OK3A 4UDOA 1PZFA 2QXYA 4HDRB 3TECE 1OWPA 3H6HA 2H2DA 2HWKA 4TQUS 3TH5A 1V7QA 1VL0A 1SBQA 3FE2A 3QBVA 2BBTA 2ZLBA 2WVJA 1C81A 3CU5A 3I9JA 2A14A 2I2WA 2ZZNA 3GNSA 4KPUA 2NXEA 1OLUA 3C5EA 2OV3A 1F8YA 1A7JA 3DUFA 4JLOA 3I2FA 1L7NA 4XUDA 3GLSA 2IK8A 1AK2A 2P40A 4G0NA 4LXHA 3OU6A 5C8YF 1PZHA 3ZIDA 4PZPA 5K0GA 2I4IA 3OKPA 3R7NA 3DZFA 3IDSA 3BWDD 3IT0A 3WGIA 1P4GA 2G88A 2J41A 1V7PC 1OD6A 2OFPA 1BS2A 4Z4EA 3OETA 3HB4X 2R8RA 2PJUA 4E32A 1Q3TA 3EFHA 4NZNA 3JASA 1J7JA 4IGEA 4DDTA 1KK1A 3PC8A 2PUCA 2ZJ8A 4L08A 3G7NA 2HMTA 3P0RA 1SC6A 4X92A 3L02A 2F1JA 1GLVA 3M89A 5K99A 4CMIB 3VNUA 2G3YA 3RKSA 1THTA 1F9AA 2I6SA 4MQEA 4G63A 5MGBA 4Y7DA 1Q0PA 3B51X 4JELA 4QXQA 4B6SA 2JLBA 1GPH1 3KQNA 4J07A 4FNMA 4IV0A 4BVAA 3AMVA 2XAAA 1W4AA 2JLCA 1P44A 2OBYA 3DXFA 2AXPA 3PVSA 4JSTA 1RIFA 3ENWA 3OIUA 1QWOA 4KXNA 2OG1A 4BKRA 4X94A 2ZRCA 3EZXA 3N1UA 4IQGA 4EW6A 3QLUA 1F5SA 1OKKA 3CMMA 3ZV4A 4LF4B 1XRSB 2F48A 1D7AA 5JZVA 1T1SA 2UYHA 3B85A 2QYHA 1YDHA 3C7TA 3SWWA 3H2ZA 1RRKA 1SXJD 4ND3A 3DL7A 4LYGA 1O0BA 1NXQA 1VIVA 2HUNA 2OV4A 4LPKA 1PV1A 3ND8A 2FVXA 3L77A 2GJAA 1IN6A 4R4JA 2QA5A 1FXWA 1EGVB 2W43A 3NWPA 2VNJA 2H1LA 3U7EB 4U3JB 4AFNA 4C0JA 1ZWLA 2BFDA 4DMGA 1AJEA 4S1OA 3LUHA 2JVJA 1HV8A 2QTGA 3IQIX 4HXYA 5JLAA 2C2ZA 1BTOA 1V1RB 3G0IA 4TVBA 2V0GA 3OAAD 5GP1A 621PA 4U00A 4KQ2A 3D4NA 1M7BA 4K86A 4X6XA 1U5BB 3SS9X 1NVMB 5HP4A 1E2DA 1WUHS 1GL3A 4ZOLA 3AM4A 3RBVA 1NF9A 4AZVA 1YBHA 2Z8YM 2UYOA 4PAOA 4MVJA 1Z8HA 3L7BA 3VTKA 3O9MA 4Q9IA 3S2UA 4YJ3F 4NZOA 13PKA 4W5HA 5DTEA 4BNFA 4DV5B 2FX3A 5CJPA 3H4IA 4YRAA 2XLBA 2DUWA 4O59O 4DOMA 2RGGA 3RRBA 3MXTA 4H4EA 2GEKA 4R40A 3VSEA 2VXBA 2VG8A 1D6MA 2R1TA 2NTJA 2FOXA 3PDUA 3W5AA 1KSFX 1VL1A 5EHGA 4HDMA 4PYMA 4B3CA 5J58A 5FOVA 3GPBA 1EZ1A 1PFQA 3PQ7A 2ONJA 1L7BA 5DGIA 4EFNA 1YO6A 221PA 3K1AA 4HDQB 4UATA 4GM4A 5B1YA 3UJ6A 4A8PA 1EFPA 3ITDA 4A2WA 4JP5A 3WG9A 3PNYA 4IHAA 3OZEA 2VJAA 3DV0A 1IBRA 5LPNA 1L4BA 4FSHA 5BV1A 2NIPA 4MHSA 1F7VA 1EP3B 1GVHA 2FV8A 4LYJA 3MWDB 4MVWA 1WM1A 4O2RA 5BMVA 1QP7A 1WBJB 1SN7A 1C7ZA 5LD2B 1N9GA 1A8UA 1MEOA 2D7CA 5AKEA 1EGQA 3NGXA 5CDYA 4L1KA 5KOHB 3KKMA 2O2IA 4J8PA 2CNLA 3E81A 2ZWMA 4WXMA 3WDSA 2QMZA 1M74A 1C5KA 2XADA 3GROA 3GX1A 3V4PB 2ZRPA 4FX5A 5CBPA 3RWBA 4UPDA 4J0KA 2IT1A 3I0ZA 5INTA 1U81A 2IIVA 3C45A 3NKFA 5KB3A 2I66A 1E1NA 2CF5A 4B6FA 2ZXUA 4JXKA 1HWYA 1WZEA 2G6TA 2C2OA 4MMYB 2XNJA 1ZRNA 2HA3A 4UMDA 4A92A 4KSBA 1ESNA 4JLDA 4RY2A 2VNAA 3AVOA 2JHFA 5EYPB 2HK7A 3FPHA 5HZHA 3ASZA 4ECEA 1ZJ6A 2EW8A 1CLUA 3O47A 3PNKA 3AUXA 2Y9MB 1A5AB 3DT9A 3PLRA 3H1EA 3MAGA 3R3VA 5AOCA 1W96A 1Z08A 5J1TB 2Y1FA 1RI2A 3E22B 3FPBA 3MTJA 4K0RA 3SK0A 3DOEA 3OX2A 4ZGWA 1AHNA 1MFZA 2BL4A 1OXKB 1M1NB 3TR5A 4B7UA 2N75A 3LGXA 1JLLB 2FPGB 3KQPA 1SC4A 3PT5A 2ACEA 3KSUA 4RTMA 3TAUA 2XNDA 4YT5A 3H5OA 4F60A 4W7HA 1CZHA 3F4KA 4J9UE 1E0JA 1KFJB 2FPIA 3EVFA 3VSDA 1HDCA 5FJIA 4C0WA 3QWBA 1BEUB 2I1VB 3Q8WA 3NBUA 3V3KA 1H1DA 1PU2A 3FDIA 4A6EA 2DLDA 3O03A 1BMTA 1WUYA 2ZBUA 1XNHA 3GLGB 2QMHA 3S40A 5K0ZA 2XKJE 2D2VA 5CCBA 1FP4B 3Q7RA 3R6LA 2M9MA 1U3FA 4CMKA 1J2RA 3M9WA 5JVDA 2YFHA 5JY1A 3GEIA 3P19A 2JGLA 3QYFA 1PHRA 4TTSA 3R8XA 3ITEA 2BM1A 2DHRA 4LNUB 4BZPA 3NHFA 4ESVA 2R48A 4RSHA 4YI3A 2WWYA 1CJBA 3AUUA 5CEFA 4PLPA 2JJYA 2NVWA 1R6XA 2EL9A 1MJ5A 1QG0A 1UDBA 2XUPA 1P1BA 3HL4A 2X2PA 4GX0A 1E2LA 2FMUA 2NTNA 4FFBA 1FZQA 4JB2A 3VOAA 3R0IA 2ZKIA 1CK4A 1GZ6A 2EFJA 4JI3B 1RXYA 2RG1A 4BO9A 4PCAA 2QV7A 4TVKA 1O95C 2AWNA 4AZ0A 4HG2A 2CBGA 4J0FA 1ZK2A 3OA2A 3MK31 4FMCB 4M7OA 3TL3A 1U3UA 2YWGA 1H9AA 3OZCA 5LA6B 3GT4A 5B37A 2QX4A 3O95A 4I5GA 4P36A 1E1CA 3O21A 4YI5A 4C03A 1GQSA 2V9CA 3U3OA 4BX9A 3PZBA 1ONNA 5ADHA 4AMZA 4I2NA 1UBGA 2F3PA 2VCHA 1II9A 1MX1A 2ILVA 2QZZA 1WY7A 3DSRA 1EA7A 1P74A 1Q5PA 3G0BA 3ML1A 4OBXA 4RW0A 1XMXA 4ZVQA 1O5IA 5GONA 4NJMB 1DEHA 3PTLA 4P3XA 2HRDA 1ZI6A 2HRZA 1E3IA 2ODAA 1A50B 3GOQA 3ABQB 5B58T 3ROMA 4DA7A 3LNCA 3BCRA 1KJJA 1TC1A 4I1IA 1K9SA 4GOJA 4EYOA 4G6ZA 5TC4A 3FKQA 2EWVA 2HAEA 2WHXA 2W4IA 3AU9A 4LRTB 1G8AA 1VMAA 2FRDA 2P6OA 2XDWA 3SM9A 1J5XA 3T35A 2R47A 1MT3A 3G2QA 4RPGA 4X20A 2G5TA 2GPJA 3DE5X 1EE2A 1Y3CE 3MJ4A 1YCDA 2EFDB 1QZXA 2X9LA 3O4VA 4G1UC 4QELA 5ER9A 4E5VA 5F9MA 5FWXB 1VIAA 5IXSA 3I34X 2QR5A 4QUEA 1UM9B 3O3CA 2WM9B 3ECAA 1UJMA 2ZREA 3JD4A 4PGMA 1FX1A 2QTAA 4QOSA 5I7VA 2XYGA 4EK9A 3QTBA 5KOYA 3K0FA 4DJAA 4MQUA 2AE1A 2H2WA 5CFQA 2IDKA 3O1JC 5KWSA 2QYTA 3N7TA 2VBFA 1CR2A 1P1RA 2BGRA 4JLAA 4G4GA 2POQX 4G89A 4M1EA 4O5OA 1N5MA 2ZVJA 2DM6A 3M70A 4ROSA 4XVQA 3VJMA 4DVGA 2W8ZA 4TQGA 3UUEA 4D02A 2OMEA 1W2WB 1JHAA 2FE4A 4IIYA 2IU6A 2NN3C 1QBKC 4L02A 3O8RA 1G4HA 2DB3A 1N1GA 2VTKA 3FHJA 4HGNA 4ARIA 2GUGA 4L85A 5GV8A 4OHZA 3GJZA 5FYQA 2PL1A 4RAQA 4FIZA 4C30A 1KO8A 2BSXA 3KXPA 3B3QA 2VZ0A 4C6TA 1N2JA 2QQ5A 1A9YA 4M22A 3U3KA 3C3YA 3STVA 3ZK9A 5L3RA 3UW1A 3WRWA 5C7LO 5CA0B 1LV7A 1UL1X 2ADMA 2XMPA 1ZH8A 2DWPA 2J0VA 3M6XA 4ZU6X 2BTQA 1A9PA 1U0EA 3WLFA 4E21A 4L78A 4TV8F 1RLMA 1ZYUA 2AJBA 1VCMA 1N0WA 1ZN8A 3OLCX 5A9RA 3EEFA 3BZUA 5EJ8A 1V0JA 5A7GA 2HHJA 1JIVA 2VHWA 2I6QA 4CM5A 5DCYA 1ESMA 4LS3A 4UAVA 1CX9B 4D3DA 1YT5A 4V0RA 4U7WA 1QR2A 3QJGA 3ZC3A 2WIFA 1FFSA 3FB4A 2ZP1A 1IJFA 3UAGA 2TMDA 5C80A 2I7DA 2DWQA 3QWIA 3EW9A 4UVIA 1WHTB 3K0AB 3IIKA 1AS0A 1NN5A 2TMYA 5ALGA 2DE0X 4S35A 3G9TA 5C3MA 1TCAA 1BFKA 3DDNA 4N01A 4RM2A 4IOLA 1K6MA 2DHDA 1JMKC 3M4XA 3D8SA 1IY2A 3RC2A 1ZIXA 4D9HA 1OWMA 4N76A 1Z6XA 1BD4A 1YOBA 3M1AA 5B12A 1BU8A 3L06A 1LNZA 4B3GA 1KNXA 4UM9B 1JG1A 4JSRA 4AJOA 1OBHA 1B8VA 3K94A 3MJHA 1TI7A 2YYZA 4L9RA 4Q1EA 4Y1RA 2HW8A 4NCBA 3U1VA 3ZWVA 1LVHA 1O6ZA 4QEDA 3QP9A 3VSBA 4V2UA 3VO8A 1CQXA 1W88B 5JS6A 1PT6A 1CETA 4RXUA 3E9CA 2BT4A 5DM2A 5E4YA 3EBLA 1B6GA 2JPDA 1IU9A 2B35A 1FZTA 4NBSA 2ONYA 4OLHA 5DLEA 2OO5A 1ISHA 1PDOA 4KPFC 2JGAA 1XZMA 4O63O 3OIVA 5SYAA 1K5GA 2YXLA 1I9CA 3RAPR 4C1NA 2F9MA 2E6UX 3PB3A 5K0CA 1PJ2A 5GZ3A 1F3LA 3L8GA 1WXGA 2AFIA 2FPSA 1F12A 4PYIA 1PLLA 3GRCA 3RHSA 3TE7A 2OQVA 1HK7A 2I2BA 3TMYA 3B1YA 3FI9A 3TZKA 4KU4A 5HPYB 3HB1A 1XDDA 4HK4A 4P5EA 5EY5B 3LUFA 5JMTA 2Q21A 3NNSA 5L95A 3I1JA 2DETA 5KU1A 3I58A 3TYXA 1XVTA 1RYNA 3WV4A 1KIFA 4E5YA 4EJ6A 3FJOA 1FTSA 5FWAA 3P52A 1M0SA 5PGMA 1OREA 1RJ9A 3U44B 2EX1A 4DCSA 2YICA 3VYSB 3EX7C 2O8EA 1REQB 2K6GA 2TSYB 1AZWA 2YWHA 4RM3A 1ZESA 2H1IA 1DUVG 1YF3A 1XWWA 3LSTA 5CRIA 3KL2A 4NCHA 2ZUWA 1Z22A 5CXXA 2B5OA 4HVAA 3SI7A 4CTKA 5BPFA 4TRNA 1H6CA 4F97A 5IEJA 3BA6A 1MD9A 5AI6A 2W6OA 2NTYC 1EDBA 3KVRA 5MFPA 2OBLA 3THYB 2P3SA 4UAUA 1ZRMA 4CM4B 1JAYA 1ZQ9A 4YIKA 1KA9H 2DWUA 1PCXA 4AAYA 3PHLA 2A2ZA 5JAOA 2VDVE 4S0ZA 3MBKA 2E18A 2MU1A 5A7FA 4OKNA 1OVGA 1YZNA 3G5UA 2CUNA 5BNTA 5JH7A 2DPGA 2LGJA 3KQQA 3L4SO 4NJEB 2EZ9A 4LRSB 3WAGA 3UICA 5DWDA 2PSFA 5FUVA 3PVZA 4K1LA 3RTEA 3D6VA 1YVRA 4DAEA 1CEYA 1ACJA 3JQRA 2XQGA 1MMFB 3NAMA 1N8KA 1DDOA 4BRSA 1MX3A 1YWGO 1KORA 1SG6A 2HFKA 3HZOA 4AYWA 4HNQA 2NAFA 1VECA 3C14C 1ULUA 5JSUA 3SX0A 2RI0A 3A25A 3E48A 4BMXA 3DO6A 2FWJA 1EFAA 3CWZA 1LPPA 3UXHA 3K5HA 3QVJA 4BP1A 1CS0A 4HAOA 4X5OA 4RZIA 1DC8A 2G40A 2Y0CA 2XMRA 4D97A 3S2FA 2ZRAA 1UJ6A 2V54A 3HCDA 3HSYA 4GT1A 5EI5A 1GWNA 2VHQA 4HDRA 4OU4A 2NPOA 3QPVA 2OZPA 3W90A 1E7RA 3QITA 2H1FA 4U02A 1N6LA 1Y9AA 4OP2A 1QC5A 1NUUA 4G5YA 5EMKA 1RWOA 4MVXA 4FCVA 4EUSA 2W7TA 2KW5A 4K81B 5K01A 1D2GA 4OQ4A 1QQAA 2BWJA 1C2TA 1PIWA 5IKEA 3MCAA 4YREA 1DL5A 3G9XA 1U2GC 1MC1A 2CV2A 2EWMA 1XVVA 3IP7A 2VTBB 1GNPA 3FUVA 4LOIA 3T9CA 1U65A 2LUOA 1VG8A 1Z5UA 4AKGA 3OCCA 3UG6A 1PL8A 2PH5A 4KSCA 4U7DA 2W42A 3ZHBA 3JVDA 1AQLA 1OWLA 4M0FA 1UKBA 4II2A 2PX2A 4QFBA 5F7XA 1KH1A 3O7WA 5HIKA 4ZMSA 1KS9A 1Z36A 2PBRA 3W7VA 4DMKA 1N5OX 3PVCA 2H1HA 3L01A 2AG0A 4X71A 5A06A 3Q72A 1VI2A 4EO4A 2HLDD 3UMFA 4P38A 2QP3A 2QAIA 4NMXB 4CMIA 3GRVA 3BJZA 2D2IA 4S04A 5CW1A 1QCDA 4WSOA 4XLLA 3CQ9A 3OOHA 3SQMA 5H4GA 3EXAA 1AF7A 2IYNA 4CG2A 3QXHA 5F7JA 4DBVO 1Z3IX 4DLLA 1DHRA 3EIUA 1N2ZA 3H2IA 1ZHHA 3M6FA 5ALSA 4KXYA 5JNSA 2IUUA 4K05A 4RYLA 1E32A 1GTZA 1QHIA 2J8ZA 5ESRA 2HU2A 4GECA 1WCIB 4PSUA 2JD2A 1EWKA 4DDHA 5A5EA 4OBBA 1RMQA 3BOSA 4YUXA 2OAEA 1G8YA 3K0EA 1E18A 1U2GA 3OBIA 5FTNA 2YYSA 1KVQA 3EMVA 4Q1DA 4WA7A 1WXDA 2WG2A 3KUDA 4IHJA 1WXQA 5LC1A 4DGSA 3IODA 1W0CA 1KIMA 2WU4A 1L7AA 2XA1A 3MS4A 1NQ5A 5EE9A 2IYWA 1B8PA 4YLEA 3T12A 4B34A 6ADHA 3IAS1 2C99A 1ECBA 3ZHZA 3QNMA 1YONA 5THKA 3HXPA 4U3JA 3UW3A 1NNI1 1E7YA 3DNFA 4IH1A 4OOEA 3TTVA 2VJPA 4BU1A 3WB0A 2WMDA 5I9TA 3IQZA 5CXSA 4UTPA 1ZK3A 3V8PA 3BRQA 4L7VA 1YNOA 2MWMA 3MCZA 1YIDA 1NUQA 3IUNA 1U5BA 2YVLA 3LBYA 2PFSA 2VPQA 3U2QA 4F5DA 5DTQA 1LLUA 4K9OA 3IP5A 1JAHA 1N3YA 1YDMA 2GERA 3OEWA 1DKQA 4Q3OA 4RK4A 4TWJA 2I7VA 5EE5B 3WXBA 1GA4A 3U16A 3L0IB 4WX2B 4JAVC 3KB6A 1GFIA 2HOQA 4MPDA 2B4KA 2EBHX 1BMFD 4A0HA 1R5BA 2R6ZA 4Z2YA 4A23A 4FGKA 4U7JA 3CLTD 4WOCA 1XTKA 1AOXA 1YBFA 1X1RA 4UBJA 5FHQA 1LI7A 1U0LA 2HF8A 4K6MA 4DIMA 1W5TA 3MJTA 2YMPA 4J0JA 2RCYA 5CM2Z 4FW9A 2ZSFA 5F5XA 2IP2A 2AYZA 2WE7A 4MDHA 1FSZA 4I66A 2ORYA 4OAQA 2CLSA 5J63A 3ZNPA 4AUEA 3R5SA 3OLQA 5LOVF 3OHPA 1AXRA 2I55A 1V3UA 4RJJA 4YQEA 3EVAA 1IOZA 2IEZA 5JQWA 3CCFA 4G1FA 2W8BB 3AG6A 4J3NA 1QDEA 4HNSA 3FOCA 1W4CA 2NVUB 4CKWB 1OX6A 1JBEA 3MWDA 3OLYA 2WFMA 2CKDA 2XE7A 2FVYA 1J2YA 1HYBA 4LSZA 4XSHA 4EL0A 1WMAA 3VR3A 2WB4A 2ORED 4RLHA 1W0JA 1TT7A 2BAGA 3IAHA 3IELA 4YRFA 4Q05A 1H2AS 2D4HA 2IP4A 3DKIA 1EFVB 1P9NA 1XZFA 2QAJA 4PF1A 1OPXA 3N28A 3RU9A 3EEQA 1EJBA 3HADA 3JWJA 4MQ6A 3HDTA 1RM0A 1MJNA 2EATA 3GF4A 1JG7A 4ZPJA 4C14A 4CVNA 1RRMA 2GVNA 3I9NA 4W99A 4JJAA 4IG9A 3I12A 4L8GA 4H17A 4IDBA 5JCZA 4GBED 1QIGA 4H0FA 4BFUA 3PPIA