3VISA

Crystal structure of cutinase est119 from thermobifida alba ahk119
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
261
Chain Sequence
QAANPYERGPNPTESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYTGTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAPNITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTLSDVEEYRSTCPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cutinase Est119 from Thermobida alba AHK119 that can degrade modpolyethylene terephthalate at 1.76 A resolution.
doi rcsb
source organism Thermobifida alba
molecule tags Hydrolase
molecule keywords Esterase
total genus 86
structure length 261
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12740 Chlorophyllase2 Chlorophyllase enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3visA00
2CBGA 4G5XA 2X5XA 4G8CA 3ED1A 3IULA 4W1PA 1U4NA 1CUUA 1XKLA 4B82A 4BCBA 2XMCA 1GPNA 1XRRA 4PSDA 2OQVA 1VE7A 1XZLA 2HRRA 1PJAA 2JIDA 5FP0A 2XQIA 4DSZA 2FX5A 4ARBA 3E0XA 2B4KA 1A88A 2JGKA 1IUOA 4BVJA 4MEAA 2K2QB 4Y2VA 1VE6A 4E14A 3BDVA 2HA0A 1AMNA 1NX9A 2WUDA 2RHWA 3GBSA 2XUJA 3G0DA 4OUKX 1VJ5A 5SYMA 2JGLA 1FFBA 3A2LA 3MUOA 3HXKA 1XQVA 2VQ6A 3G9ZA 1HL7A 3ZLTA 1USWA 2QT9A 3DQZA 3UUFA 3GA7A 1FFAA 2I03A 4OSEA 1CPYA 2AJ8A 2QS9A 4BDTA 2UZ0A 1XQXA 5BWCA 3RARA 2ZVDA 2EDAA 2QUBA 2C0QA 5ALDA 1JU4A 4GECA 5AK6A 1A8SA 4WFKA 5A71A 2FJ0A 4QDZA 1W52X 2WIDA 2JEZA 1ZGBA 4H7EA 4Y2SA 3WI7A 4KRXA 1CUGA 1T2NA 4GLBA 1BRTA 2PM8A 3AIKA 3W05A 5T4EA 5C8XA 5LYYA 2XQFA 4UHBA 4ZWNA 1P0MA 1QE3A 4J0KA 1EH5A 3IURA 3WMRA 2ONCA 3AIOA 1Q0RA 4QDOA 3I1YA 5CURA 3A6ZA 3Q8WA 1XZJA 2PSHA 4X92A 1GZ7A 5LIPA 3NGMA 4B0PA 2G63A 1BN7A 4AO8A 2OGZA 1A7UA 4FMPA 2OCGA 3VDXA 3FAKA 1C4XA 1E8MA 2XI4A 1MTZA 1R3DA 4YPVA 3LS2A 2O7RA 3G9TA 3D2AA 1EDDA 5K3EA 3IUNA 5A6VA 3F97A 4K6GA 1EI9A 1F0PA 2QKYA 3K2IA 3V1NA 2ZSIA 4S0XA 1XZEA 1CUAA 5ALPA 3ZV7A 4P9NA 3STYA 4ROTA 3DKKA 1QIIA 5ALGA 4MXDA 1TAHA 3G8YA 3SK0A 2PBLA 4LIPD 3Q0TA 4GWLA 4QNNA 5JZBA 5DTJA 1WHTA 4KE6A 5FLKA 2HFKA 4XJVA 2WUEA 3PUHA 4J0HA 2JGEA 2PUHA 3DOHA 4BZWA 4TPKA 3LLCA 4OYLA 3HYSA 4H18A 3C6XA 1THTA 3G0IA 2XMDA 3ESCA 4AB1A 4Y2JA 1MT3A 2ACEA 3I2FA 1E8DA 3KDAA 1XLUA 3C8HA 1DT3A 5HF9A 3N2ZB 4K5QA 5AICA 1B6GA 3LP5A 1G66A 5AP9A 5D3KA 1L7RA 1XZIA 5AOCA 4GW3A 5JAPA 4H7DA 5DWDA 5C81A 3WWCA 4BC0A 1W4LA 2WIJA 1EHYA 2R11A 1W75A 4ETWA 4Y2TA 4CI9A 3YASA 1QTRA 3FCYA 4QZVA 4YX9A 3R3UA 4P92A 3H2IA 3C5VA 3IUQA 5IVHA 3LCRA 3BXPA 3R3YA 1MNAA 2WIKA 4ZGBA 4C4XA 2CEKA 5AIBA 2ZYRA 2ZYIA 1ACLA 3L1IA 4X00A 3WZMA 4CIAA 3R0VA 4H77A 3OM8A 1S8OA 2YYSA 4AO7A 4B81A 1CUWA 5DNWA 3SX4A 3K9BA 2XUAA 1QIEA 3WZLA 4HVTA 5LZ2A 5DLPA 4AN1A 1IVYA 1T4MA 1IMJA 1DWQA 1XLVA 5AKYA 1TRHA 2GBFA 2VT7A 1YB7A 3CCCA 3GZJA 2RONA 2WFLA 3FOBA 4FLFA 4AN0A 3L1HA 1QIJA 1VKHA 2HHAA 3FVTA 4M0MA 1AKNA 3WWOA 3I28A 1CR6A 4MYDA 3H0CA 1IZ7A 5A7FA 1LPSA 1Q0ZA 4EZIA 2JGMA 4FFWA 1UKAA 3QPDA 3QM1A 1UK9A 4YASA 2HA4A 1BCRA 4P08A 2VJCA 4CFSA 2WLSA 3WWEA 5K3FB 5IKXA 2OAEA 3WL8A 5HQ3A 4OD0A 1QIMA 4U2GA 4UBKA 1KU6A 2WG0A 1HPLA 1UXOA 2GBGA 1L7QA 3PI6A 5ALRA 2DQYA 2H7YA 2DHDA 5AK4A 2DQZA 4F21A 3WKBA 4XVCA 1J2EA 3W06A 2RGUA 2XQGA 2G4LA 5LZ5A 5E4JA 1ZI6A 3CN7A 1LPPA 5LZ9A 2WUFA 3I2IA 1R1DA 1F6WA 2BUAA 4DIUA 4X94A 2H7CA 3C5WP 4EY5A 3C6YA 3HLKA 1N5RA 2PSJA 4AX4A 3I1IA 4EY7A 2QXUA 5CRIA 3R3ZA 1EDBA 2WFMA 3KOOA 4LXIA 4GEGA 4KACA 3AUKA 2HA5A 4AXBA 1K5PA 1EXWA 4JH0A 5ALXA 5BOVA 4ARAA 2EDCA 2Z8ZA 2O2IA 5IVIA 1QO9A 2H7XA 3WLAA 3D2BA 3WKEA 2QM0A 1ZJ5A 4UFOA 3BIWA 1HQDA 3QITA 4G1FA 1A8UA 3TJMA 4OYYA 4D9JA 1THGA 3WL5A 5A2GA 1CVLA 1XKTA 5KWIA 5K3FA 4X71A 4UPDA 3SC2A 3TRDA 4UBOA 4MEBA 4Q82A 3FSGA 1EX9A 1JJBA 5CT4A 3IBTA 5K3BA 3WK4A 1IUNA 3KWFA 2B9VA 3HEAA 4GBGA 5A62A 5JADA 1X2EA 1R50A 4NVRA 3AZQA 4A23A 4C6HA 4K6HA 4B7ZA 3STTA 4DGQA 1FFEA 1OCEA 5AI6A 2WTMA 2QR5A 4FTWA 1FJ2A 2WSLA 2B61A 1Y37A 3PICA 2XMRA 5AK3A 2IIVA 2C5FA 4F5ZA 1VZ3A 3D7RA 2HM7A 5JATA 1LGYA 1QO7A 3KD2A 4UHFA 2HU5A 3N0TA 3GFFA 2WHPB 4OB6A 1G5FA 5JD5A 3BF8A 3BF7A 3G9XA 1YAHA 4QWWA 3P2MA 1ACJA 1N5MA 4AMYA 4HXGA 3FSGD 1YASA 5AKEA 4TGLA 1GPKA 5EIAA 3E3AA 4H7HA 1MO2A 3IVMA 4Y2PA 3U0VA 1NU6A 1R9MA 4G9EA 1CV2A 2QOEA 4FNMA 3VJKA 5ALHA 4EB0A 1VXRA 2XUQA 3TGLA 2QXTA 1J07A 1U2EA 3HSSA 5YASA 3RM3A 4J0IA 4B6GA 4F60A 1XQYA 1EK1A 4BRZA 1DT5A 1CUXA 5JD4A 4Y2UA 4BE4A 1ISPA 5ALEA 4BYMA 1XRPA 5CT6A 1EB9A 2OQIA 1QZ3A 3FLEA 4DM7A 4PV7A 3H2KA 3IA2A 5JAUA 1SCQA 4UFPA 3W9UA 1BEEA 3NOXA 1Z68A 3G7NA 3V1KA 2XQJA 5JZ9A 3MVEA 5LKRA 2JBWA 1F8UA 1SCKA 3FNBA 3I2JA 2XMQA 3O4GA 1H2XA 1MNQA 1YS1X 1CIJA 5AI0A 5HKBA 2BUBA 5E2IA 1UFOA 1QIDA 2H9YA 3H1BA 5K3CA 2CB9A 3QBJA 2VAXA 1H22A 3FYTA 4DNQA 2BGRA 2I78A 4FBMA 3QZUA 1EA5A 4M0EA 3H2HA 3G0BA 2FJPA 4BP8A 4QLAA 1JFRA 3WIBA 4W1SA 3QH4A 1ZD5A 3O95A 4UBMA 3QMMA 4Y2YA 4U2BA 1VA5A 2WKWA 1XFDA 2BUCA 1J06A 2J3DA 5LLSA 2VTVA 1AUOA 3WK9A 1ODSA 2C0PA 1MX9A 1QIKA 2XUHA 3WL7A 1LNSA 4H7FA 4BB0A 4U2EA 3PDCA 1H2WA 1XRMA 2Y2UA 5JIBA 3AINA 5T4BA 4B85A 3QMWA 5EFZA 3E1GA 4EHBA 2PU7A 4N8SA 5HK8A 3IIIA 2CZQA 1UKCA 1ZD2P 4J0JA 3HRHA 3GROA 1AZWA 4K2AA 1CUHA 1CUFA 4W9RA 2Q0XA 1QIGA 2XUIA 4B83A 2AJLI 5DTIA 1E89A 1X2BA 4DNFA 4X6XA 4UHEA 1WHSA 2WFLB 3MGAA 4AQDA 3DYIA 2PSEA 4OU4A 1N1MA 1LZKA 3VVMA 1RP1A 2PUJA 1PV1A 1LLFA 4KYVA 5SYNA 2BJHA 1JT2A 3GELA 5AM4A 2NW6A 4BTLA 4XIIA 5CT8A 1JKMA 3B12A 3IB3A 2OLEA 2XMSA 3NWOA 4K6KA 4EY4A 2Y2VA 4OPMA 1QOZA 1OXMA 4KE8A 4DSAA 1MPXA 2RI6A 4N8EA 3ICVA 2LIPA 4C4ZA 4MJ3A 2OGSA 4UBJA 1EINA 1XRLA 3HJUA 3WK6A 4Q3KA 5I7UA 3EIOA 5I9IA 3WKDA 2PKYX 4Y7DA 3I6MA 1N8SA 3H04A 5AHXA 3DEAA 3V1MA 5JAHA 1JMYA 1F0NA 2ACKA 4AZ0A 3QPCA 3E4DA 1QJ4A 1XZGA 5AKLA 3AZPA 5FUMA 4JNCA 3K6KA 1DWPA 5EIEA 1ETHA 3B3QA 2HL6A 1JMKC 3DL4A 1XZBA 2OXEA 2BGNA 2PL5A 6YASA 1ZICA 3C45A 2D0DA 5K3AA 1BROA 2W22A 4JUIA 1CQWA 1O6FA 4LYEA 3PF8A 3O9VA 4HAIA 2HIHA 5CXUA 5LZ8A 4U2CA 2VSQA 1BEZA 3AILA 5DNVA 3ESBA 1TCBA 1Y7HA 3FVRA 4WFJA 3G02A 1QFMA 3AZOA 5K5EA 3BJMA 1AC5A 3C43A 2QZPA 2XLCA 4L3WA 5CW2A 3HC7A 2IX9A 3D4LA 5FPQA 2AJDA 1QTIA 5D6OA 3IUJA 5ALVA 1MAHA 1EDEA 3WJ1A 4KR0A 4JEIA 4QDXA 1G42A 2G5TA 1WB4A 5JAOA 2JF0A 3EF3A 3AIMA 3G0CA 1CRLA 1XLWA 4CCWA 4CCYA 1LPOA 3SWWA 1BE0A 2OCKA 2GYUA 3DKRA 4JYPA 4X85A 1HKHA 4L0CA 1DQYA 5D7BA 2QVBA 5JD6A 4E11A 2ZJFA 5DJ5A 4LXGA 1HDEA 3CXUA 5FXMA 4BAZA 3T4UA 2HU8A 1ODTC 3WWDA 1LBTA 2HA7A 5DYWA 5CH5A 4Q3OA 1ZI9A 2GZRA 2EEPA 2J3QA 1W6RA 3C6ZA 4DLNA 1JJFA 4DMCA 1XZMA 3HABA 2QJWA 1CEXA 3F9CA 1GXSA 1H2ZA 4NZZA 5EGNA 1CQZA 5J3JA 4P93A 1DU4A 3WK8A 5LP1A 2DSNA 1XQWA 4PSCA 1VZ2A 3EQ8A 5AKHA 3BDIA 2PU5A 4Q05A 3LIIA 4C4YA 1MU0A 1O6GA 1LPAB 5AKZA 3U1TA 4DMHA 1EVQA 1CUEA 4I19A 4UFNA 1FFDA 3W2TA 5AO9A 2HRQA 1YCDA 2VAVA 4A16A 4OU5A 1UKBA 1K4YA 3WA7A 1SC9A 3HI4A 4BBZA 4C01A 1DWOA 5AI4A 3FBWA 2VJAA 1YB6A 2QJRA 3R3VA 1UK6A 4I4CA 4FLEA 2HADA 2ZJ6A 4NMWA 1BS9A 1ZIYA 2CMFA 1JU3A 3CN9A 4RE5A 4HXFB 5DNUA 2OGTA 4KAFA 1M33A 3JWEA 3KXPA 4U2DA 7YASA 4G9GA 5AKXA 4X91A 3BJRA 4XX1A 2WU3A 5BV7A 5F4ZA 1AX9A 1K8QA 1MX5A 4H0CA 3W04A 2WQZA 4OCZA 3WKAA 1IZ8A 1GQRA 4GDMA 3LIPA 4EY6A 4HRXA 1QIFA 3JW8A 2XUGA 1BN6A 5ALIA 4Y2XA 4MQMA 3D2CA 4J0GA 5KREA 2WUGA 1A8QA 4UHHA 2GBCA 2I3ZA 1QIHA 1WM1A 3O4IA 1GT6A 3H2GA 3H2JA 5LZ7A 4BP9A 1ZI8A 1EK2A 4ZREA 1XROA 2RIPA 3I2GA 4CG3A 3T52A 3DNMA 3F67A 5ALQA 4ZRDA 4CG1A 4DNPA 1CUSA 3EQ7A 2GBIA 2JGFA 4HRYA 2ROQA 3VJLA 4X6YA 3HACA 2B20A 2JEYA 1DX4A 4QWMA 5LZ4A 1UOQA 4BZZA 2CKMA 4H35A 1B41A 4E15A 1PFQA 1GPLA 4FWBA 5ALOA 1AGYA 1R9NA 1E5TA 3GUUA 2H1IA 1MN6A 2JGJA 2VJDA 1UZAA 2X76A 5T4HA 1KU0A 1MJ5A 4FOLA 4DMKA 2VJBA 1YR2A 4EBBA 2O2HA 3WYNA 4QDUA 2V96A 5CMLA 2VEOA 3DLTA 5ALSA 1E3QA 5CT5A 4EUSA 3WYDA 4WJLA 5AH0A 4W1RA 1ORVA 3R3XA 1C7JA 3V9AA 1AURA 3W9BA 2FUKA 5JYCA 3I6ZA 3H1AA 4GI1A 4FFVA 2BKLA 5AI5A 1XZCA 4V2IA 3MUNA 1QGED 4AZ3A 3BE8A 3QMVA 1Y7IA 3WL6A 4W63A 2I3DA 5K3DA 5ALFA 4X95A 1ZGCA 1ODCA 5C8VA 5FPPA 2WHPA 4BVKA 2GZSA 5A7HA 3ESAA 4CIBA 1R4ZA 3WKCA 3C70A 2PX6A 1P0IA 3VKFA 4FDMA 4J3JA 2AJBA 3M83A 5FRDA 4CCYB 4JYMA 1YA8A 4GHWA 2X8BA 2GYVA 4KE7A 3KWJA 4OB7A 1WCYA 5EI5A 1QONA 3FLBA 4IHAA 1U65A 4OB8A 5ALWA 2Z8XA 3OG9A 5KWJA 1R88A 1EVEA 1CFJA 4MYSA 1WB6A 2XUKA 4QDTA 2O2GA 4PNZA 4PW0A 2XMZA 1YA4A 2DFPA 5FOQA 1XZAA 4BAGA 1UK7A 2WG2A 3WK7A 4J0CA 4L72A 4HTAA 4G8BA 2XT0A 5E4YA 1VA4A 4WCVA 2ES4A 1CUYA 4WDRA 1XRNA 5EIHA 3ICWA 3OPMA 2Y6VA 2WHQA 1DX6A 2BCEA 5AI8A 3R40A 4PO3X 5ALKA 4DNOA 2OG1A 5AM1A 3RK4A 2AXEA 5AKJA 2XUFA 3STWA 4RGYA 2HA6A 4H7JA 2HFJA 2WTNA 4IH1A 4BVLA 3KSRA 3ANTA 5CBKA 2PPLA 5AJHA 1K6EA 4B9AA 2Z3ZA 5ISMA 1H2YA 4BATA 4MWTA 4DMFA 1BU8A 2Y1KA 5IVKA 5EHXA 2VA9A 4N5IX 5FV4A 3I2KA 1E8NA 3D5EA 4LHEA 5C7YA 5EHNA 1JJIA 4G8DA 3CCBA 4Y2QA 1XZDA 1TCAA 4WY5A 2ORYA 1VOTA 1ZD3A 3X3HA 2WM2A 4KE9A 3F98A 4C89A 4J7AA 2O7VA 2OPHA 4CG2A 3PE6A 4X6UA 5JZSA 5FDFA 4UHDA 2ECFA 4HS9A 3R3WA 4Q3LA 4WFIA 2XQKA 3R41A 4RPCA 4Y2RA 2HU7A 2XMGA 1AQLA 2C7BA 4FNGA 3WJ2A 3FCXA 3C6BA 1RYYA 3PFCA 3I6YA 3PUIA 5AM2A 1XZHA 3FYUA 4ZV9A 5IVDA 2J4FA 4ZXFA 4RNCA 4X97A 4UUQA 2ZSHA 1WOMA 2WJ4A 4DYHA 3IUMA 5HFNA 2Y6UA 1LPBB 3A70A 3I2HA 1WB5A 3F8SA 4B9EA 4B84A 2OCIA 4UBIA 1ZD4A 1G4HA 3PF9A 3STVA 1UOPA 3OURA 4KAAA 5E4TA 5HZGA 4KRYA 3TEJA 3M82A 1HLGA 2VATA 1UWCA 5IH7A 2GYWA 1X70A 2DHCA 2AJCA 3WIOA 2YASA 4Q1VA 1RWQA 2C58A 1UT6A 1W1IA 2WIFA 4FLMA 2YXPX 1NU8A 1CUCA 1MX1A 1SFRA 1OILA 1JI3A 1ZJ4A 4LYDA 3H17A 4Z49A 5LKAA 2VF2A 4AO6A 2V98A 2XE4A 4QEKA 5JASA 4AMZA 3FLAA 3ZLUA 3STXA 3OC0A 4ITVA 4TVKA 5HF6A 3BL8A 3D59A 4UHCA 1BCSA 2XUPA 3S8YA 2P8SA 4UBNA 4H7IA 2XMBA 4PQEA 5ALZA 5DYTA 3O0DA 3FYUC 2V97A 4M0FA 3VJMA 3WQHA 1KEZA 2C5GA 4X93A 3M3DA 3RLIA 2E3JA 3UUEA 3OTQA 4GXNA 4Q34A 1GKLA 2W6CX 4FBLA 5HF5A 4A5SA 1C7IA 4H7KA 1IUPA 5ALYA 3VISA 4N5HX 1GKKA 3DJYA 2G5PA 4WDQA 3UMJA 1FFCA 4BC1A 1P0PA 3PFBA 4IH9A 3NUZA 4G4JA 4IO0A 3L1JA 3G0GA 5AKKA 5CT9A 5JARA 3ZLVA 2WU4A 2WFZA 5HF8A 1WPXA 1CUVA 3EBLA 2BAGA 1I6WA 3D3NA 1SCIA 3WK5A 1ZIXA 5HKAA 3ILSA 1DINA 5AK5A 5ALUA 3B5EA 2C4HA 5JALA 4ZI5A 3D0KA 4UBLA 5T4FA 1UOOA 1TCCA 2WJ3A 2WILA 4IH4A 4B80A 5A7GA 2RHTA 3ESDA 1LBSA 1CUDA 4L9AA 3M81A 3O4JA 4B0OA 2XLBA 2VT6A 2XUOA 2ZYHA 2R8BA 3G9UA 2DHEA 3V1LA 3QYJA 1QLWA 3ANSA 4IQ4A 4O08A 2JGIA 2D5LA 5ALLA 4DTCA 4I3FA 4F0JA 5AKIA 5JANA 4BRSA 1HBJA 1EB8A 1GGVA 1VLQA 4PSUA 2XUDA 4BDSA 4BTVA 1K63A 1DQZA 1CUJA 2YH2A 3DS8A 3DOIA 4G4IA 1YAJA 1D07A 1CUBA 1CLEA 2OCLA 2V9ZA 1DTEA 2RAUA 4BCDA 2CUTA 3OOSA 5AM5A 2ZYSA 4X7BA 4XWGA 1XZFA 5CTAA 1WPRA 3DCNA 3S2ZA 1ZOIA 5AI9A 3H19A 2OAGA 5CH3A 5EHQA 5HK9A 1YSCA 1Q83A 1XRQA 3DDUA 1SOMA 5AIAA 5H3HA 4EA6A 4BAUA 3DYVA 1VXOA 5I8PA 3FYUB 3ZI7A 2QRUA 1E66A 4J03A 1CUIA 4RE6A 1TIBA 4EY8A 3DD5A 5HFAA 5AKGA 1LPMA 5CH8A 3AFIA 2DCMA 5ALJA 5AOAA 3ZPXA 4W1QA 2WG1A 3HZOA 5ALMA 3O4HA 4LXHA 3QVMA 4NS4A 3BWXA 3FWHA 2QTBA 3WA6A 1TKRA 1W76A 4C87A 2Z5GA 1U8EA 1QFSA 4X3CA 4QE3A 2CJPA 1UK8A 2QUAA 3H18A 5EHZA 4KAJA 1ORWA 2WIGA 5BWBA 4BCCA 4FKBA 1LZLA 3C87A 2BFNA 1P0QA 3WWPA 2HA2A 5AM3A 2HA3A 3ZWQA 1Q84A 5D3ZA 2PSFA 4MWSA 3A2NA 4KEAA 1J1IA 3EQ9A 1GQSA 4QLOA 2Z3WA 4U2FA 4YK7A 4PF1A 1L7AA 5HCUA 1FSSA 5AOBA 4FHZA 4KJXA 4BE9A 4J0DA 3IDAA 1MAAA 1CUZA 1YS2X 3F96A 3A2MA 4INZA 5KBYA 4WY8A 4LKOA 2XB6A 5CXXA 2XDWA 5ESRA 1TK3A 4X90A 5AM0A 2HDWA 4HZGA 3AJAA 2PSDA 2J4CA 3BIXA 3O9MA 1H23A 5C8ZA 1LPNA 4QA9A 4Y9SA 3DL7A 3C8DA 2WJ6A 5HQ3B 2WHRA 4C88A 3VVLA 4MQLA 4G4GA 3RKSA 1TQHA 4ZV7A 2ZJ7A 3JYHA 1XZKA 3QPAA 5ALNA 4HXEB 2DR0A 2QMQA 4N8DA 2IITA 2PVSA 4E46A 5FKJA 3STUA 5DYYA 3V48A 3VXKA 5ALTA
chains in the Genus database with same CATH superfamily
1ZL2A 4FFNA 1E92A 5JWOA 1AGPA 4JSTA 5E6RB 1U4OA 3LCMA 4KNWA 3QY0A 4MW0A 2WR8A 4FFPA 3BMQA 2ODWA 4G5XA 3MG9A 4PLYA 4DV5B 4JLNA 4G8CA 4JB3A 3MRSA 4Q3EA 2I6SA 4YRSA 1M1NB 1SUSA 4L4RA 3VPDA 1JSCA 2I71A 4UTRA 1GADO 3CZRA 3DEZA 1N2CA 3QJGA 3PDIA 5LJIA 1C7RA 2OQVA 2GNPA 1DIHA 3C7KA 5JG7A 1M5UA 1AM4D 4A03A 1VE7A 1E7RA 4NONA 2V6FA 1EUCA 2B3DA 4F38A 2X8JA 4ZA2A 4Q9KA 5IC4A 1J9EA 2JIDA 2OGUA 3KPJA 4WIAA 3R8XA 5BR7A 4DSZA 1T5DX 3S6JA 3IIJA 4TZ6A 1MABA 1ABEA 3ZHRA 3F47A 4IIDA 4EMBA 2B4KA 4ASUA 2ZTMA 4U7GA 1T43A 2CJFA 2P62A 4LDRA 2D1YA 3AXSA 3RK1A 3TZKA 4DLZA 4F4UA 1A88A 1IG0A 3B7WA 4RS4A 5BV0A 4ZALA 3MSXA 5H9VA 2EF0A 2SBTA 2AX4A 1U0GA 2OCDA 3EE6A 3LSTA 2BFBA 4D45A 2AFIA 1GY8A 1VE6A 1U7OA 2IZ1A 4BVBA 2BSAA 4FYJA 3LPNA 2G07A 2JFUA 1JAZA 2HA0A 3B3FA 3OJXA 1IEQA 4MHSA 4JXJA 3JTMA 1UMBB 4ND6A 4M8SA 2JIBA 2RHWA 5AVQA 1FQOA 4NBVA 5KNBA 1TLLA 2PUTA 5DBEX 4B7UA 4WZZA 4DDTA 1Z63A 1QYDA 2SICE 3BWMA 1C8VB 3TGPA 4OUKX 3NRCA 1VJ5A 5SYMA 3RFVA 1A4RA 2R6CA 1TJ3A 1RNLA 5I7FA 3T5BA 3DHNA 2HY7A 3HXKA 3QUSA 3WAJA 4O59O 1IULA 2REBA 3KQYA 3NRJA 3WSVA 3VKHA 1XQVA 1EBUA 1QAQA 3G9ZA 4J16C 2ZM6B 3I9V1 4B34A 5KOYA 4WBNA 1EP9A 2DT8A 3DQZA 1EE1A 1LBEA 4NAVA 1EKXA 1LBHA 3LHIA 5GOZA 4I6EA 1C29B 4BDTA 2QS9A 1G6HA 2PH7A 2PLWA 3GPIA 3LCCA 4I1OA 4YNBA 2LR0A 3ZNNA 1ODLA 1XXHA 2FQXA 1TK9A 2BPOA 1TA4A 2X9LA 2ZVPX 4KBGA 2QUBA 2QK4A 4O1IA 5AW5A 4LZZA 5ALDA 4JI3B 4F1WA 4WBNB 1PG2A 2OHHA 1QFJA 2IP4A 2QN3A 4RY2A 1KI7A 2QUJA 4B40A 1AKRA 1LDNA 4UMDA 3I6IA 1K7CA 2JHPA 2X2PA 4MV1A 5E9JA 3IPLA 2P2LA 2X0EA 3VSCA 1Z7YA 5IKMA 4N9WA 4DMRA 3G5MA 3NM6B 4G1UC 2C7PA 4E4RA 2EZTA 2JEZA 3BQNB 1WV1A 2MIIA 4JI4B 3PJDA 4Y2SA 1S2DA 2HMUA 1H0SA 4HAYA 3FROA 1C0KA 3D7MA 4Q24A 4ZYXA 4LF6B 2C4MA 3DE6X 1JH9A 5G2OA 1LF0A 2PM8A 1SKBA 1ZJZA 1FMTA 2EAUA 3AVQA 3AIKA 1QOQB 4K1XA 4RHTA 3L0SA 4I2NA 5LYYA 2PZ8A 4EKIA 4U6QA 3VR6D 2C88A 2RKWA 4CLDA 1IVNA 1UWLA 1TM3E 4M22A 4JJKA 3JQ6A 4CI0B 1HMPA 1FYDA 1VCHA 3ED5A 3ROMA 3PJRA 3BXHA 3BWDD 4ZWNA 4Q7MB 4MCAA 3TF5A 3ASZA 2FSHA 1S1CA 3KRTA 5C31A 5JH7A 1XNQB 4Z9XA 1Q21A 4QX6A 5HS6A 5IPFA 2ONCA 2P65A 5DTEA 1Z4PX 4A2WA 1C2YA 3TZHA 621PA 4B48A 4CM8A 1URPA 3PWTA 1L6IA 1KJZA 1ZEJA 2WE8A 2X5JO 1OFUA 1JXQA 2FGJA 3B89A 3MJVA 3ZCPA 1E3DA 2E4YA 2REQA 3O0TA 1UKVY 1ZIPA 4R1MA 3E48A 4PLWA 5KJFA 1ONSA 2A8YA 2I1LA 4X61A 5JT1A 4X92A 2HEGA 4TL8A 4ALMA 3B1JA 2G63A 1P1RA 3RC7A 1IIBA 3CJTA 1ZH4A 3HDHA 3JYOA 1BKSB 3MLEA 3ND7A 4QJBA 2RGAA 4TMWA 4RJTA 3VC7A 4GPAA 4I5DA 1W85B 3OO1A 5ITZA 3ELBA 5K8JB 2XTZA 1JLHA 1YKGA 4EG1A 4YRAA 4G0MA 4KO2S 1WXQA 4J1QA 5HIMA 2LCIA 1TL7C 5CVTA 3QTLA 3G9TA 1BDBA 1YQUA 2P3LA 3IQIX 3OY7A 3TLKA 2EQAA 2CFCA 1IY0A 3G2PA 2IS6A 3I92A 5I7SA 2NSJA 3ZY5A 4M37A 2G28A 1Z8FA 3IUNA 1KH1A 3C3WA 1EFPB 1RJWA 4JQCA 4HI0E 1J97A 4R9SA 3W5VA 1W4BA 2VHEA 2HV9A 3AWDA 3A1WA 3CLVA 4CTJA 3BTSA 4EECA 2BVNA 3K2IA 1KWKA 2GEKA 4RH3A 3CM0A 4X9XA 5C1PA 2V65A 1Z13A 2APJA 3I62A 1K5HA 4IS2A 4NBLA 3PDJA 2I29A 1A50B 4UREA 5ALPA 4WRRA 5EWMB 1E9EA 3STYA 4PFSA 2AOWA 3LHSA 1P77A 1QIIA 1SHZA 1V7PC 3D2LA 2LBPA 3KZOA 5TPWB 5IZCC 3G8YA 1R8QA 3AX6A 1Q57A 4Z4IA 1ECFA 1TFRA 4FOTA 2ACWA 3E3OA 2DH5A 1D4ZA 2HXSA 2BOVA 4GWLA 3WB9A 4AJEA 1ZO8A 4CM7A 1XN1A 1DUSA 1TLFA 2AHOA 2J59A 3BZUA 3VHRA 1IUKA 2IODA 1IB6A 3IAFA 4GMHA 5DGCA 1QG6A 3TZQA 4HMOA 3V3TA 3UHPA 3ES9A 4D57A 4P7BA 1VHQA 4CMKA 2FW9A 1N57A 2TRSB 4PSAA 1E5LA 5DHPA 1X19A 3EUWA 1W46A 3QA9A 5KAMA 2VJPA 4DSOA 3DOHA 3GBPA 4EFDA 2L18A 4G26A 4R1OA 2WF6A 2EC5A 3GOQA 4RIGA 4OX9Y 3HYSA 1WDMA 3K6RA 4H18A 2VKQA 2W2LD 4RAQA 4ZVUA 4OQPA 1WP9A 1CR0A 1EJ2A 1FTWA 3KSAC 3M4NA 3Q5DA 3VX4A 2OGWA 3D8BA 4Y2JA 5TQ2B 2V55B 4H0FA 1KTIA 4M7PA 2JBHA 4K28A 3HYRA 3MNFA 4EGCB 5BOSA 3WFIA 4LJLA 4MQ6A 4DR5B 1G5RA 1J0CA 1XLUA 3C8HA 4PSVA 5A05A 4AKTA 2Q9BA 4AJKA 1QQ6A 4JLSA 2HLNA 4RKYA 5F33A 3I5XA 5F1KA 5AICA 1B6GA 2CWDA 2PLAA 4XWWA 2WJJA 3SJZA 2O8DB 2QZ9A 1PD0A 5AJVB 2AEJA 1C8LA 5AP9A 3I73A 5ICCA 4Z3OA 4I1VA 3LI2A 1OU4A 8AT1A 3PNSA 4HQFA 3LUJA 3RS2A 4DJDC 1KI8A 3EZ2A 4QRHA 5LA6A 4NJMB 1W96A 3BXGA 4D4GA 2AJTA 4ZQBA 3ICPA 2ZDGA 1T3TA 3MGCA 3K5IA 2Q4RA 3CPHA 4RVDA 5DWDA 3WGLA 4BC0A 2JLVA 3SU8A 3HB0A 3FYCA 3EDMA 4LC9A 1GEEA 3C41J 4Q7QA 3ZQUA 4ETWA 1YB2A 1AGXA 2V58A 2QE6A 1TU4A 3OJEA 4CI9A 4DCSA 4BVGA 2EXXA 5K8LA 4LF9B 4DQKA 2GN8A 4QZVA 4AC9A 4DMMA 2QI9C 3N8KA 5C7IO 2ZBVA 3GJXC 4FFBA 1L8AA 1WA5A 3GEMA 2CD9A 3R6TA 3WHIA 4AWXA 3HCDA 1KH3A 2XVMA 1OYWA 3HBNA 4LA4A 8LDHA 3EGXB 3B78A 4NV0A 2VNJA 2FK7A 4V0RA 5JQGB 1CJBA 2JFQA 1BW9B 1L0BA 1W4ZA 3B85A 4ZGBA 1TKAA 2EGUA 2O3UA 3STHA 3H4TA 4C4XA 3ZE1B 2ZYRA 4KQIA 3QLJA 4NCNA 1JKFA 1TT7A 4XFDA 3BB3A 2AXQA 4XYEA 3FDFA 1BWSA 2RMKA 1L5MA 3CEAA 1QH1B 3CRNA 4OQNA 4HUJA 3WZMA 4O4HF 2X41A 1UM9B 4PEVA 3PPYA 1NRXA 4ARVA 1CUWA 2HQSA 1Q92A 1L5ZA 5HCNA 4XVRA 3N5CA 1FOEB 1LBIA 5HZMA 2XUAA 3V1UA 1P2UA 1TYDE 2Q3JA 1MEJA 2VDNB 4ND1A 7AT1A 3BGDA 4ZAYA 4H2DA 3CUSA 4RGBA 1PNQA 1IMJA 3FUVA 2BTEA 2JDIA 1JSZA 1XLVA 1FMLA 3GLIA 2JLAA 2GBFA 4RZXA 1CZKA 2NO7A 1PGNA 4KVFA 5CHEA 2CF6A 1SVOA 1Z0UA 2I0FA 1S2OA 4H3KB 1YDHA 5C1IA 1RWOA 1S96A 5FBKA 1P5HA 2GB4A 3CCCA 5LC1A 2C4NA 4J29A 4PPFA 4WA8A 3MZ0A 5FLXA 3G8BA 3FOBA 3Q1LA 2VDOB 1PTJA 3KTAB 3PKJA 4IGEA 3L1HA 4JC0A 1TM7E 1PAUA 3TQQA 4RTMA 2NACA 4CCAA 5LUBA 2HHAA 1UMCB 3CUTA 3RYFB 3KR1A 1OB2A 1AKNA 3RSZA 1GZSA 2QGNA 1O77A 1VTKA 4BNDB 5JJIA 1WEHA 4M21A 3ZWKA 4Z9YA 3HDQA 1I7QB 5L3ZA 4MCIA 1GL3A 5A7FA 3SM3A 1R5NA 3H11A 4YAIA 1K3FA 4IQGA 1M6EX 4FFWA 3QPDA 1P8JA 4WOJA 5CLQA 2QRVB 4A73A 1E63A 2DPHA 1UK9A 2Q8PA 4OMUA 4TTPA 3NTVA 5FF9A 2OBLA 4I55F 1IXYA 3F6SA 1M2EA 3QNUA 2BBTA 1KAQA 4RH1A 4YRJA 5E4FA 1O54A 2REOA 5FUQA 1VCOA 4K9QA 3WGIA 1ZK3A 3F3MA 1ISMA 2WV9A 5K3FB 4WBXC 2DPXA 4RA9A 1P9NA 4U1RA 4AF7A 1NKSA 3A6EA 3I8XA 3WL8A 1J8FA 2LW7A 3NI2A 4EPWA 5JYDA 1P9LA 1XU9A 1KBOA 2DCUA 2NU8B 3A6DA 4ZKDA 4U2GA 4UBKA 3BA1A 1KU6A 3IT1A 4RA6A 4U4AA 4RTKA 3I42A 2GTPA 2WTXA 4MQFA 2D59A 1MDBA 3P0HA 3TR6A 1YQ9A 3K0EA 2QAJA 5KINB 3T0FA 3IESA 1QH0A 3HR7A 1C9KA 3ENKA 4MKFA 5LBUA 4LJ7A 1O96B 3K15A 4JEMA 4BFXA 4E2FA 2IYAA 3IAXA 3NHYA 2I8LA 2ZRPA 4HYQA 2V3CC 4IDPA 5ALRA 4GZLA 4KR2A 1EG7A 2H7YA 1C9YA 4DBVO 1FFGA 1PJ2A 2ASEA 1GNPA 5AK4A 3KTOA 1VG8A 2PUVA 3UHOA 3VPFA 4D74A 5K0CA 4H15A 4X24A 3FD8A 4QLBA 2DQZA 3KQQA 3VKVA 2AK3A 4OXYA 4BKUA 4IFEA 4GYJA 2W2OA 1S2LA 1UM9A 4G0YA 4LWQA 3MPOA 1VYHA 3A1TA 3W0LB 3GDOA 3ILVA 4CQLA 3GFRA 5E4JA 2Q3CA 4HDRA 3R3JA 4DA9A 4L8YA 3P9PA 4DDWA 5JS6A 3CN7A 5H70A 3PJGA 3P2EA 2C9OA 4LHXA 3N6XA 1IAQA 2O8EB 2LGJA 4WK0B 4ZO8A 4RY9A 5F2OA 4DIUA 3L7OA 3JQFA 3PFKA 4V2UA 1EJ6A 1YQXA 2IUFA 3GU3A 1GG8A 1U2RA 1JI0A 1PQPA 2IYRA 2IVFA 3C6YA 4KQCA 4NEHB 2FG5A 2PSJA 1UP6A 1G3UA 1PK9A 2VRCD 5IUJC 4FFBB 4QKQA 3RSGA 2QXUA 5CITA 1NZJA 4N54A 4R0MA 1F8YA 4B4WA 1GHTA 4H3HB 4JOBA 4LHZA 3W1WA 1OJLA 3EFEA 3P32A 4H0NA 3I30X 2EFYA 1M6HA 1WU8A 3L0IB 4JDUA 4LXIA 4YHHB 3V7FA 2HA5A 2ZRGA 2OCXA 4N01A 1JDPA 3JWJA 5JVDF 1RZRA 1NJ1A 3UKJA 2QG6A 3I1FA 1NMEA 2BM8A 2JW5A 4LKRA 3SKVA 3PE4A 4Y30A 2CZCA 1P9OA 4D0RA 4QT0A 3KQWA 1E2GA 4B09A 1YRAA 2O2IA 4NNOA 3MGBA 3VHXB 1KYXA 4AG5A 1U5BA 2JASA 5IMSA 5KVCA 1GTG1 4HLUA 1AOXA 4HDSB 3D2BA 1Z8NA 3BFJA 3FMIA 5DI3B 5LP6C 1DEOA 2FPOA 4P4LA 4BFLA 5KC8A 3L92A 1R6AA 1LS1A 1Y89A 3O94A 3BIWA 4RFVA 1K4MA 2JKVA 1A2OA 5EJ7A 3EODA 5D3QA 5CB4F 3NPMA 3PXEA 4FGSA 4JLKA 4Z8YA 4D9JA 5I48A 3QXGA 2YWFA 4I1RA 4KIFA 4AKGA 4ZYUA 5A2GA 5KTSA 3CLHA 5KWIA 2YZNA 4X71A 4UPDA 4II2A 1BKYA 1B8PA 2OORC 2ISQA 5DN6A 3TRDA 4YH1A 1JJVA 3FSGA 4YYEA 1EX9A 4MLCA 3ONEA 3IUEA 5EYPA 2XYHA 3G5UA 1I1HA 1I3LA 4HKTA 5EJEA 4BPRA 5A02A 3T3PB 2C61A 5K3BA 2MSNA 1ZJJA 2JVKA 3U09A 1IUNA 4J1TC 1WCV1 2BM9A 3E9DA 2Z2IA 4DA8A 3RKUA 3ISTA 2Q49A 3OCJA 4HG2A 1GCOA 3B2NA 2ZRLA 4B47A 1T29A 3PA6A 4C6HA 1XVTA 2EJCA 1CQPA 1LNZA 3SZGA 4D99A 4KR6A 1T25A 3PLNA 1Q5PA 3AFMA 5LUAA 3HS3A 1FFEA 4AXXA 1OCEA 2HV8A 2BGIA 2YHBA 3ANNA 4FMCF 4ZOLB 2QR5A 3GLKA 3E1KA 3M0EA 4KX5A 1QDUA 5EY5B 2NO0A 1HSZA 3IVAA 4I1PA 3D9QX 4KNYA 3CNNA 2KX7A 2WMNB 3AV0B 4QFCA 3P4YA 4HQ0A 1GPMA 3ZI0A 4JNKA 5JR3A 4IDCA 1BHSA 2HXYA 4KR9A 1KEEA 4B6QA 4PYOA 1OTXA 3BN3A 5JATA 3S7TA 2JHFA 2QTRA 4G5RA 1LGYA 1BMQA 1A5SB 1J5XA 4R9RA 4NBKA 2RC5A 1N2GA 3PPVA 4BB9A 2HU5A 3ABSB 2K5UA 2BY4A 3AB8A 3Q3EA 2C5SA 3EEBA 1XZNA 3H8SA 3LBAA 4OB6A 5EIOA 4A8JA 4OXQA 1E69A 4EHJA 5K0LA 1VDZA 3C1OA 1JIUA 3EVEA 1OKKA 2IYWA 3DTTA 3MJ4A 2LWIA 3QA3E 4W99A 3RO7A 2VUSA 1XMIA 1KDPA 3BF8A 4RVCA 1NVGA 2Q5IA 3P2MA 3V4OA 2IHZA 4HXGA 1STOA 4HGOA 5CAEB 5PNTA 3FSGD 2FOIA 4HEHA 1YASA 1KFEB 4TYMA 5FI0B 1PLKA 1IATA 4DMUB 1GL7A 3NX4A 2W93A 5DISB 3QFTA 1E7WA 2LVBA 1O94D 4ZU3A 4H7HA 2ID4A 3C8MA 4RDIA 5G1OA 4B3SB 2QXYA 1ZESA 3GT3A 1M0EA 3IVMA 4Y2PA 4LCJA 2IU4A 3GCXA 3ROEA 1R9MA 3NBKA 1JYSA 2WINI 3FUUA 3JQ9C 4IIJB 4RADA 1JSRA 2CHEA 2R8EA 3L9XA 5EP3A 5TEVA 2YJ4A 2GEUA 4FHFA 1G8SA 4RWEA 4ZAGA 3DM5A 2D1QA 3FN4A 5ALHA 2WA1A 2XUQA 2R48A 4D8VA 1IRXA 2OC9A 3TGLA 2QXTA 3CMMA 2GEBA 1OH7A 1NN1A 1U2EA 1Z0AA 3SOPA 3ITNA 2ET6A 3U13A 1P1KA 3FPJA 4B4KA 2Y8EA 4YJ3B 1Z4LA 2HPVA 5JNSA 1U2TA 5AVWA 1EUZA 2J3KA 2YQ4A 2PLNA 4G9BA 4G86A 4B6GA 4IG4A 3FDXA 1YZTA 5DPMA 5MGNA 1U3UA 1XF1A 2A33A 3SP1A 4YXWA 3CB2A 1XTKA 4DIFA 1ATIA 4LSWA 2EERA 5B4VA 1SZJG 3HJCA 5G0TA 1CUXA 1JAIA 3EG9A 4HQOA 2AXNA 1MFZA 3PTAA 3MILA 3DLPX 2OCPA 8ADHA 2FUCA 5FPSA 1P4HA 2ZCJA 4BE4A 4LV5B 5KNCD 1J7JA 3SEZA 4OI2A 4I99A 1KGDA 4FSDA 3TSCA 5IXSA 3WLFA 4MDEA 1L5NA 4G8JA 2VHJA 5CT6A 1TC1A 4Z6KA 1EB9A 2IPMA 3PQFA 4LQLA 3KDSE 1C9DB 2B4QA 5FEUA 4NYIR 1QZ3A 1XCGB 3F4LA 1MR3F 3GLVA 5GONF 3WWZA 2BDEA 3ILXA 4DRXA 2CNNA 2AN4A 1G38A 1G20B 1Z0DA 3UNXA 5HOQA 1M75A 2O0JA 4AJOA 4BUCA 1VG9B 3FPEA 4FU0A 3LBIA 4C5AA 2EV9A 1M34B 3F9IA 2QP4A 4I4TA 4NJOA 2CW5A 1CJSA 1M2VB 4A0SA 2ZI4A 2XA1A 4OEHA 3LXMA 5E3IA 4L1KA 4G85A 4NNJA 1Q0LA 5JZ9A 2JBWA 1L1FA 4B84A 3N8NA 1SCKA 2W4MA 2YN2A 4N76A 1TJ5A 3FNBA 2ZW9A 1Z25A 3O4GA 2Y1DA 1Y5LA 3M1YA 3S2YA 2OECA 1EA7A 3D54D 1K92A 4HB3A 4C3VA 1PNOA 1CWUA 3O8LA 4PRZA 1M0TA 1UJ4A 1TVKA 3TKLA 1Q6ZA 5FBHA 4X0EA 3W3AA 1M74A 4LISA 5D1NA 3GA5A 4EB3A 2VRBA 4DR4B 4WCFB 5E2IA 4ENTA 5DB4A 3BK1A 3H1BA 3LECA 1T1IA 1DGQA 4YCNA 2XD4A 3V80A 2VAXA 3L8DA 4JBHA 3HP4A 1BMDA 3U7QA 3K0FB 1H8EA 1PZNA 5IDQA 3DEFA 3WHPA 4ZJUA 4QU0A 1KEVA 1P6QA 3NDIA 3QZUA 1EA5A 1TKCA 1Y5RA 4FDLA 3BL6A 3DNPA 3QEOA 5AVZA 3O6VA 2A2ZA 3SKXA 4LYGA 4C2UA 4QUEA 4PTZA 4WK6A 4PZ9A 4C0XA 3QU5A 3NCHA 4QNMA 4UE2A 1AO0A 3OOYA 4UU0A 4E5VA 1PD1A 1JFRA 2RAPA 2QRKA 4I9GA 1HO3A 4PAWA 4XA8A 4HP8A 3OFKA 5TGZA 2OHGA 1CDZA 2JVJA 1Y33E 2UZ1A 3G89A 5EUCA 3DE7X 3SQXA 3O3MB 4W1SA 1LCIA 1ZD5A 3COVA 3JPYA 4RKFA 3ZBPA 3LQ1A 2D7CA 1YU6A 3QP9A 4KWTA 1WUIS 3BXFA 1R0LA 1Z7GA 3GUZA 4HQLA 4JBXA 4YP9A 3TI7A 1XTSA 1NE2A 3IP9A 3Q3CA 2JFPA 4MQ5A 5F1YA 1RBZA 2CXRA 3P4UA 4FEEA 2O3RA 4LC1A 4ZCLA 5I9MA 3JCZA 2WKWA 4JLWA 3DOUA 3OU6A 4GKAA 4O33A 5TSDA 3TOZA 3AGQA 3F0TA 1UT8A 2PVCA 4IIVA 5TE9A 2W4IA 3RRFA 3U31A 3W5SA 3OTOB 4RTRA 4WHMA 2XZTA 1XNGA 2GUWA 2VJKA 1J06A 3LDGA 4I0WB 3F7OA 4JB0A 2VTVA 3D6MA 3S2FA 3S7ZA 3RG8A 1Q7TA 4CM9D 4B5LA 3DE5X 5BVGA 1UQRA 1GZVA 2QRJA 3TSZA 1V1MB 3GR6A 4V1CB 3PHHA 4K9LA 4H60A 2WAOA 4P22A 4X8LA 1R6BX 3G6WA 5EAIA 4KYUA 3EXFA 3FBGA 3RRYA 3WGVA 3U4QB 2ZTVA 1DFGA 2GPYA 1DJOA 2Q4DA 2UVDA 3JQGB 5K6AC 3RR2A 1OGYA 1KVRA 1M2OB 1E0DA 4HVCA 5CFMA 1QK3A 4R9UC 3ZZUA 2QUIA 2AGVA 4AWAA 1KDTA 1T34A 3FDZB 3BWYA 3G2NA 1QDEA 2BGMA 2IXGA 3NTXA 3DSRA 3T7AA 1D2EA 4JK3A 3QE4A 4H16A 4ZOAA 3NHZA 4PPQA 3VPCA 5JLJA 3ABZA 3ECSA 5HQJA 2UV8A 2QDXA 2GLTA 4NZNA 3AINA 3Q98A 3K0BA 3AI3A 4EVIA 2O5CA 1IHOA 2QR2A 2PU7A 1P2SA 4MV9A 4B46A 3GFSA 4GC9A 4GGOA 3CWCA 3M9LA 4B4VA 4R8LA 1J8DA 5F78A 2HC9A 3LK7A 1CJTC 3UPUA 1YS7A 2RC6A 2NADA 4OJTA 1E2UA 4EYSA 1QHGA 2IUYA 3AESB 1P5ZB 4O1HA 5I4IA 3Q3HA 2I7DA 4F6RA 4ZI3A 1Y7PA 2IZZA 4RLFA 1F9AA 2CVOA 1YE3A 1KS2A 2ZANA 4M1WA 3HR4A 1DJNA 4XSVA 2HWUA 1CUFA 4W9RA 4ZQGA 4JI6B 5L6LB 4MI1A 4JZYA 4PHCA 3C3PA 4URVR 3AUSA 4MB6A 1WXDA 3QKIA 4QQNA 3S2EA 1JLLB 4B6OA 2H08A 2QLNA 2C3MA 3E7XA 3TW8B 4QAJA 1ZLYA 2GAOA 5DTIA 3KETA 2IK8A 4LNHA 4PICA 4QYIB 4G1EB 4JUFA 4WMLA 1UADA 2ASVA 2YNMC 3F3KA 5DHFA 1ODFA 1UEJA 2QLTA 5D5HA 4XLLA 4UHEA 2Z4RA 3UGTA 3QU2A 3UMMA 3SHOA 3PR2B 1RZVA 3NVKI 2BEWB 1GGEA 2QD2A 4TSKA 2V1UA 3LCVB 2J6IA 5C4GB 2PTGA 4YO7A 4QARA 4JJZA 1N3LA 1SBZA 4NRDA 2AQHA 4JOQA 3FVVA 2PUJA 3HHPA 4YRRA 2QTLA 1NBIA 3M5DA 4B6RA 4CU2A 4BLSA 2C57A 1H2FA 3UV6A 3VC1A 5J2UF 5EINA 1PJBA 1RQPA 2NW6A 2ZTHA 1EDOA 1VE9A 1LWNA 1W5EA 2FRVA 3GEGA 4LPKA 4BTLA 1SVUA 2YJ5A 2Q7DA 5HPYB 1TJNA 3RV4A 1AG9A 3B12A 2LKCA 3Q8MA 2DP4E 2OEPA 4GUAA 2B5OA 1OAOA 3LL7A 1L5GB 5EJ6A 1F0KA 1AS0A 2E7ZA 5DXFA 5LXTB 1A82A 3IB3A 3K9HA 1WLSA 2ZBFA 1E6WA 2JHAA 2XMSA 1S2MA 1BC5A 4RF5A 3NHBA 3WMFA 1ZBDA 4KGXA 5IULC 3NGXA 3H9QA 3W5HA 4DDHA 2P4SA 3U3MA 3GEDA 2W2LA 4REOA 1AQUA 2P3QA 2YICA 5FO0A 1Z37A 2YWEA 4LMPA 2Y2VA 3U37A 1E18A 3OC6A 4YT5A 5I5GA 4Q18A 4LDJA 2ZEJA 1OXMA 2QRZA 2L82A 2ZATA 3D4OA 4Q1FA 2YN4A 3A7DA 5DMXA 1ZMRA 1JHDA 5AMXA 4DCVA 5B36A 3ADBA 3T9CA 4DSAA 2IS4A 2DUUA 3OPVA 1E9CA 2GK7A 3ZQJA 2GXUA 1Y1TA 1X1EA 3GEBA 2NU9B 4US2R 4M9XA 2LIPA 2RAFA 1WP4A 4HATA 3EHDA 4MJ3A 1JQAA 2OV8A 2AZDA 5KZMB 4S1OA 4EB6A 4O4HB 3UOWA 1DG3A 2Q50A 4UBJA 1IY8A 5E2BA 4QHYA 1XRLA 1YACA 2YR0A 5GZ6A 4LZAA 1UPBA 3VH1A 2HPZA 3N8GA 4PIPA 2GTIA 5TT1A 4MAAA 1ZR2A 3IEVA 3ADCA 4HWSA 1WCIB 4WZAB 1A2QA 1UQTA 5LA6B 2Z58A 4OSOA 2PKYX 3AYXB 2PH5A 4JR0A 4YAOA 4BN0A 5A5FA 1CNFA 5JRDS 3E58A 4GZ6A 4RF3A 1XLTC 4BJ6A 1N9KA 3SSAA 4F4JA 5HIJA 1ZXBA 5HJ2A 3DEAA 1Z33A 5B6PA 1RI4A 1UPCA 4TL6A 3M5WA 3IA7A 2FI1A 3S8MA 3V1MA 5JAHA 1OBHA 1F0NA 4YJFA 2ACKA 4XEHA 1ULSA 3HCPA 4AZ0A 2OXFA 4FQ5A 4BLVA 2I2AA 2QLFA 3AC0A 4MS3B 1H8HA 2QQGA 3DO6A 1Y7LA 1BX0A 4M0DA 4WADA 5FUMA 1E32A 8GPBA 3K6KA 3AF4A 4HX9A 2R87A 5HOEA 1JEQA 3AEQA 1DJLA 4KXYA 2VSFA 2JRLA 4HNVA 1XZBA 2IDJA 2OXEA 6YASA 2ZS9A 3ZBUA 1LRKA 3DHYA 2PV0A 2JFVA 3A06A 1ZICA 3N2LA 3OJFA 3OQIA 3PWKA 4KI0A 1FTYA 4MJLA 2IBMA 3U4HA 4DJ5X 5JCOC 4KMRA 5DBGA 4M2LA 2QNBA 4CEJA 2G70A 2W22A 5DXAA 1EXDA 4LYEA 1FU8A 3R7AA 3PUYA 2O23A 1WNFA 2I8CA 3CNQS 13PKA 4JLMA 4MVJF 4TV8F 5CXUA 3UJ3X 2JFWA 2OPBA 2X6QA 3DXXA 4UEOA 2NXEA 4UTOA 5CB0A 3OCUA 3H11B 1LDBA 2VSQA 1K7FB 3HWSA 1WXHA 3GGOA 1JDZA 2VQSA 4R8RA 5E3HA 1W2GA 4ZC8A 2JIZA 2H8GA 1Y7HA 3ESBA 3TIIA 4V1CI 5ESXA 2DMRA 1XTQA 2FB9A 2QSJA 3G02A 3OAAA 1ZD9A 1C81A 2IA5A 4O4JB 5T57A 1E5QA 1F2TB 4G0OA 4N12A 2BF7A 4QSMA 4FYHA 5K5EA 2H1WA 3HXQA 1C8BA 1LDGA 2VZ8A 3I04M 3KKQA 4FR5A 4JEHA 5TPWA 3SSNA 4KIJA 3ZGNA 1J49A 2W98A 5CW2A 3HDGA 5LB2A 3HTXA 3C1TA 5JWRA 3KQMA 1LK7A 3D4LA 5I7OA 3OPXA 3K16A 2POCA 2X58A 3QUAA 2DR2A 8ATCA 2CE2X 2GNAA 4D9MA 2JAOA 1H85A 4WKBA 3PLAE 3ASVA 3GGPA 3RJ9A 4P81A 3P0RA 2H4XA 3ONVA 4TZTA 1MAHA 1ZCFA 1RKXA 4N5DA 1WO8A 4P6VF 1J70A 1I6MA 2HK9A 1WDKA 2VAMA 3DMDA 4U7WA 3JSAA 2ZRBA 3QIAA 4FILA 1TO1E 2V7GA 2Q27A 4W7HA 2HN9A 4ZJZA 1DZIA 3L4BA 1N2SA 1PWXA 1PRYA 2CL5A 3ZWXA 4BGEA 3MFYA 4YCCA 1K06A 1RHQA 1ZGGA 3B6EA 2P75A 3FNFA 4DYVA 4UTNA 1ZS9A 2JHCA 4YN3A 1SHLA 4I1YA 1WSBA 4UVEA 2NGRA 3Q7PA 4O5OA 3AIMA 4O25A 1X86B 3PPIA 5HP4A 2ZRIA 2RGGA 4XDGA 5CPBA 4QXMA 3KQHA 1XLWA 2OD2A 4CCYA 5KTTA 3PVZA 3T1TA 2NUBA 1BE0A 1HE1C 2EZ4A 4BRUA 1ZN8A 5FOTA 1GGHA 4IDGA 521PA 3V4PB 3ZE0B 1FFYA 3AOGA 4MWEA 2JLQA 1NQ5A 2YY6A 3G9QA 1RCFA 1R0WA 4D25A 2GYUA 3B20A 4GOKA 4PYQA 4NCIA 5KYGA 3DKRA 4X85A 4B2PA 2B5WA 3QSGA 4ITUA 1G7SA 1HKHA 3ETJA 5HE8A 3W2FA 2C2GA 3OFSA 4I50F 5JBIA 3L77A 5D7BA 4CV3A 1V45E 3N2IA 3UN1A 2NVOA 4EHKA 5JD6A 3V2UA 1MQ8B 2J3EA 4JP8A 5F98A 4LXGA 1Q7GA 4URZR 2F1RA 1TM1E 1VDMA 2ORED 2YFYA 3JQFC 3Q3VA 1RBMA 5MN4A 4P53A 4Q4DA 1ODTC 4Z7QB 4M7OA 3D02A 3ZQ6A 3IOMA 4BNMA 5KYXB 1QHSA 3COJA 1S9DA 3MCUA 4F46A 5BVGB 2H18A 3I64A 1B76A 3PD0A 4E6PA 5IJ9B 4CKZA 4CTNA 1S7CA 2EFCB 3QOXA 3USZA 3K20A 2GZRA 1L4KA 1L7NA 1MVOA 2EEPA 4JYZA 3M3HA 1M1YB 1W6RA 1Y63A 3OIUA 3BCHA 1H3FA 1Q6YA 3NBXX 1P62B 2BFFA 3TX2A 1XZMA 5EKDA 1S8AA 2EOAA 3HABA 4GMXA 2QJWA 3TNYA 1CEXA 1E20A 2G04A 1T9GS 4U7PB 5FTKA 1QB8A 1ZHFA 2FSUA 2JNWA 1U8AA 2OYCA 5EGNA 5K2OA 1G21A 1OXVA 2RG7A 4AMVA 1YNSA 4JI5B 3NAQA 1RAEA 1DU4A 1SY7A 3MOGA 4CMIA 5IYZF 3MHPA 3WK8A 4EKYA 5IU6A 4KC0A 4KQEA 1AGNA 1ZLXA 2EL9A 2AKYA 2OL4A 1E1MA 1YC5A 4C6RA 4HLUC 2YIJA 3VBEA 2OO5A 3BDIA 3QLTA 4K6OA 4TSFD 5FI5A 4QGSA 1DLIA 5IAJA 1Q3HA 3PPXA 3W8RA 4CZ2A 3DKIA 1O6GA 4FJ2A 4QUKA 2W2MA 1PR5A 1CIPA 1XQ1A 1TZKA 3HG7A 1M2JA 3LPLA 2C8KA 4WKNA 4OMCA 4CV2A 4DMHA 1YFZA 2ATXA 4EARA 1TGVA 3DHWC 4FMDF 5THXA 3GP3A 2W6PA 4U7FA 1N2CE 2YKGA 1W0CA 2MTBA 2IZOA 2Y0BA 2F3RA 4OQEA 2BBWA 4R2LA 5P21A 1YCDA 2OA0A 4MWGA 1TVCA 4IIEA 4D2IA 1QVAA 1C7ZA 4OA5A 2GKSA 1XDZA 1VLMA 3CU5A 3NJ4A 4WNIA 4PG4A 4YB8A 1SC9A 3L7YA 4XYGA 1R6UA 1IVSA 3MB5A 3I61A 2YIVX 4UKDA 3MTIA 1E1QA 1I94B 2NTYC 1NQWA 3FBWA 2QTZA 3FCAA 1VMAA 3WMGA 3VFDA 1SG9A 1CCWA 1NI4B 1R0ZA 2P4HX 4TYPA 4V24A 5CP8A 5A4AA 2VN8A 5DM1A 4AUEA 1ZVMA 3W2EA 4ZO4A 1N36B 5HCIA 5LOVA 4NXMB 1KI6B 2FEOA 5DRYA 1U5AA 2QPAA 1GKUB 1BS9A 3FAZA 1II9A 1U7TA 3NNSA 5BT9A 4BNJA 5HRUA 5CYGA 4AS1A 1FVFA 3E03A 1JU3A 3CN9A 5AHWA 4RE5A 1V5WA 4MS1B 3WBKA 2C4KA 2Q5HA 1L4UA 1EUCB 3GH1A 3IT2A 3EUAA 2QL6A 3K0CC 4NE2A 1XPUA 2Q9CA 2W6MA 3GQVA 821PA 3ET5A 1UC5B 3ET4A 3KXPA 4HWRA 4NI5A 2Q21A 1C80A 2PGDA 4U2DA 2DECA 3RC9A 2H1FA 3PSAA 3V1TC 4UVDA 1DBRA 4QU9A 4FB5A 3KQUA 5L9AA 4X91A 2Z56A 4EW2A 1KARA 2GJAA 3TPCA 2WU3A 3LT5A 3UAZA 2PUWA 1G8KA 1P7VA 3N75A 4NTZA 5G3ZA 2EWMA 4HC4A 1ICIA 1MX5A 1YR8A 4OP3A 1I1QB 4OI4A 4C7XA 2R96A 5CCXA 4OCZA 1D4AA 2H0AA 1GQRA 5LWQA 1T0HB 1DO2A 3GGSA 4QYWA 2A59A 2C9DA 5L7YA 4AJLA 1DWUA 2PBFA 2DKOA 4DZZA 2DB3A 1BH6A 4KVZA 3CNBA 1P5JA 1AN9A 1QIFA 4HRXA 2Q1UA 3RHSA 2I4MA 4JHXA 1BN6A 4GD3Q 3NBZC 2H8KA 4MV6A 1H1TA 2NPFA 1XC7A 2QMZA 4H17A 4CM8B 2H11A 1QF7A 2I6QA 3I01M 3PITA 1D6MA 2J1LA 3KPUA 3RT7A 5ALIA 3EF1A 3CLTC 1A9RA 1AS3A 4HTFA 2PJRA 5EWLA 4CDNA 2NVWA 3FOWA 4HDQB 4LBWA 4Y2XA 4B3MB 3CBQA 4PIVA 4J0GA 2OO5C 4PLGA 2B1RA 4P4UA 4YQFA 1V7QA 2WUGA 3VYRB 7REQA 4M6WA 4MX8A 1OH5A 3QUTA 1XMPA 2I3ZA 1WM1A 3ABQB 1K6MA 1W48A 3DVRX 3O4IA 3AGPA 3T4XA 5JISA 5JNLA 1GT6A 3JRNA 5CD1A 1NJ5A 5LQUA 4H1UA 5LZ7A 3I4LA 1EK2A 1IXKA 1JXOA 5AXBA 1BXRA 1XROA 3K0FA 3BTVA 3I2GA 3NGLA 3NHPA 2WJVA 4CG3A 4RPGA 4M87A 3DNMA 4JFRA 4KIUA 1MW8X 2WHYA 1COWA 1N6NA 2Y0CA 4ESEA 5ALQA 3QI2A 3N8HA 2VTBB 1WZIA 2IYUA 4EH1A 2XW6A 1QZUA 1IBKB 4ZVRA 4DNPA 1RIIA 2JAWA 4XCXA 1E1NA 2PN1A 3GRRA 4NMXB 2JVIA 2X4LA 3EQ7A 2GBIA 3GJ3A 4GPEA 1OFGA 4RL6A 3VJLA 3WY9A 1PJ8A 2AF4C 2NYAA 5BV2P 3KZ1E 3SQOA 3UHJA 2ZBRA 1P9WA 4MULA 4X3PA 1SXJB 2ONKA 1I36A 3OIFA 1DX4A 1D2MA 3ORFA 4KYTA 5BV8A 3PL5A 5LZ4A 3PJEA 3GMSA 2BKAA 2PANA 2QAIA 4OL9A 3P9NA 1JIIA 1M2WA 1U7ZA 4BZZA 3MCAA 2WDZA 4XGIA 1G6KA 2NV0A 3K6JA 5JU6A 3LYLA 1Y48E 4JP3A 2I2FA 4H31A 4WCFC 4KXFB 3LQRA 4UD2A 3LGSA 1U7XA 3P97A 3LF2A 3X2EA 3U0BA 3ZW8A 1RMYA 4HD8A 4E2XA 3NUQA 4EG0A 1E7QA 2WNIA 3F5SA 1VE1A 5EPUA 1XPOA 1K98A 3Q7QA 1O1YA 3LWZA 4WSOA 3GLFE 5IK2D 3FUCA 1B3BA 1ORIA 4Q7LA 5IWCA 4FE7A 1HMYA 3AG5A 4RV5A 4HLDA 2H1IA 4ZOCA 5LQNA 2JGJA 4MKZA 2R9VA 2MYTA 3M9WA 3FYDA 1IOVA 3QVXA 3VHXA 3DMGA 3I0MA 2P2CA 3JQBC 1I10A 3EDCA 1NJGA 3WTBA 5GIOE 2C9MA 3C15C 3BGWA 3WLNA 4H08A 1J2RA 2DSTA 2X9QA 4G0XA 4J0FA 4OREX 3ZZNA 4RGVA 2YW9A 4R69A 3PQ6A 5L3QB 5ED4A 3UWKA 1NG1A 1YS9A 3QVSA 4KXWA 4YACA 3G68A 3MRXA 3RT9A 1CS0A 3PQEA 3GJ0A 2OBFA 4QDUA 3TQCA 2LNDA 1VE5A 2Q3LA 1JVBA 2JK0A 3EZ9A 1O58A 2IPAB 3LPMA 4XB1A 1I6LA 3VU3A 3ZHZA 4EPXA 3DLTA 4MVJI 1TTHA 4GWKA 2EX0A 2FXVA 3TQOA 4JSRA 4NSNA 2C94A 4LDPA 5AH0A 5HBGA 2WHEA 2CLFB 3KSZO 4TV9F 3DE1X 4RTJA 1C7JA 1HLDA 4GQAA 2BKXA 3WBBA 3W9BA 2AOUA 1Z4QA 4COKA 2IOFA 2EW1A 5JYCA 1JHOA 5HKKD 4Z5XA 3ZD6A 3H1AA 3IDZA 4PTYA 4E2YA 1JFTA 3JAMA 5CXQA 5KJEA 4B4UA 3UT5A 1T5HX 2JJ1D 1CY1A 5IC5A 4NENB 4WPGA 4OBEA 4GFDA 1T4CA 3GAAA 1UKYA 3ABIA 4PS1A 4V2IA 3MUNA 4G5YA 1QGED 2P2ZA 5EXSA 4AZ3A 4YMUA 3ZEAA 3KAKA 4BMCA 3QMVA 2RHRA 2WV7A 1PFKA 4LY9A 1KQNA 1J0EA 2I3DA 2J5XA 2P11A 3WZ2A 2I9KA 4TKLA 1Y81A 2TMYA 3QEKA 4X95A 2UUCB 3HNRA 1OBFO 5KTNA 1ODCA 4MGIR 4F85A 3KFVA 3BD6A 3D8SA 5IAEA 4BVKA 1VMKA 3I4FA 3P0IA 2CYBA 4XUEA 3O2NA 3KU1A 1GAWA 2NZUG 4NJEA 3MLAA 5LDHA 3DZCA 4L78A 3ZUGA 3KEFA 3IQEA 3UH0A 2YWJA 3HBJA 1N7GA 4A6EA 3C70A 1A4IA 2PX6A 3EXG2 1GILA 3DFUA 3VKFA 4FDMA 3O8QB 5JI3E 3QPWA 4J3JA 4J43A 3AFNA 4TLLB 2AJBA 3ZV6A 1GQ2A 3LGAA 3IDSA 1IHYA 2C4UA 3QW4B 3KALA 3QXXA 5FRDA 1BGWA 2CDAA 5H4GA 2FDRA 1HGXA 1MD9A 1ISJA 3P2KA 3B6ZA 5E7IA 4XTRA 4D98A 2AB0A 5FL3A 1M2KA 4PAMA 2VTKA 1UBHS 5EJFA 1E94E 3HA5A 3I53A 3TRKA 1TD1A 4KE7A 2D5BA 3KV1A 2OZLA 2D06A 4OMFG 4WLEA 4YFYA 3H0KA 1KEUA 5I7WA 1JHAA 4WEOA 5GZ3A 2ZZMA 1QONA 4N48A 5EG5A 1SVMA 4L5JA 2VJMB 1UJMA 2XT9A 1OE0A 1CE8A 1BTOA 3GRYA 4C20A 2AUMA 4LCBA 4EJ2A 2P9ZA 3HGTA 1YD7A 4NOMA 3REOA 5B7PA 3QSYA 3CA8A 1PIWA 1YZ3A 2KQUA 4BS9A 2Z8XA 3J7TA 4CPDA 2HIMA 1UZMA 4F4HA 2WT4A 1WSAA 4YMSA 1ULTA 4GBED 5UKDA 2RB4A 3V8EA 3T1YB 1I24A 3HVUA 1U63A 4MYSA 3SBOA 1HLFA 3T9EA 4QDTA 2CDCA 4IRUB 4MV5A 2X2OA 2EL7A 4OHXA 4MS4A 4OYRA 2IBSA 1DL5A 3TJZA 4FDUA 1YA4A 1YZLA 2KE5A 2XRYA 4HDNA 1PR6A 1RYNA 1VSVA 2DFPA 1NGSA 3ROKA 3GDWA 3VX3A 5FOQA 2ANCA 2PKXA 3KVYA 4DZRA 5JQWA 4L4UA 1WUKS 3NTRA 2OYRA 5C53B 2J3IA 5IBPA 1UJNA 1E3WB 1YGPA 4U3JB 4BAGA 1K6XA 3BXZA 3W7BA 3W1EA 1V1RB 1GGMA 4L72A 4HTAA 4ZZ1A 1DBIA 1HKUA 2GCGA 1ML4A 4ZHQA 2PEZA 2HH9A 3MUEA 2XT6A 5DI3A 2R6AA 2NAPA 2QRLA 4HDSA 4D3ZA 1W29A 1XRNA 2IHKA 4WDRA 3AL2A 4V0QA 1QQBA 3DEYX 3KFLA 5EIHA 1U8ZA 3KOMA 3AVOA 4FYKA 5DHSA 3PYXA 5HIIA 2Y6VA 5JNUA 2I2WA 3EC2A 1KDZA 4EG5A 2N46A 2QR3A 4DIKA 3M4JA 1SIBE 4MR9A 2ZIXB 5IM4A 2F9MA 4PYMA 4GMGA 1CKEA 4I36A 5K7SA 1PBTA 3GD7A 2E4WA 4P3PA 4PO3X 5ALKA 3SHVA 1WLYA 1TQ8A 4M36A 2BR3A 4ESOA 3GCDA 3A8TA 4TRMA 2R8RA 3ANXA 1CZHA 2H0RA 4B45A 4JGBA 5AKJA 3UENA 5IFKA 4PVCA 2FMKA 1QZXA 4CEHB 2C42A 3K1JA 3KK0A 3STWA 2SCUB 3TS1A 2D1RA 3EMDA 4XGRA 2CVHA 1B6TA 2KLHA 1SMKA 3K9NA 4X7RA 1X1DA 3LYHA 1NX6A 4BNVA 3DUWA 2RGYA 3FMVA 3RBZA 4B5KA 3CX3A 1N7IA 3O4VA 1Q0QA 3JZFA 3NEYA 3N3BC 4CL8A 2Q2OA 3A6GA 2XBMA 3OE4A 2CJXA 4TS9A 1K6EA 1SKUA 2BRUA 1AQ6A 1IXSB 5B3JA 4L4SA 2NSLA 2W6JD 2WHXA 4N7MA 1WD7A 4X1OA 3ELYA 4FZ3A 2Y3IA 3GJSA 5DSXA 3U7GA 3R9WA 1S9HA 3R5XA 1A9XB 4CV1A 4DMFA 4QPDA 1PS8A 1CRQA 1Y4UA 2FMIA 1QUFA 2VAWA 1SRQA 4AFNA 3GOHA 5TEWA 3BQMB 4HWPA 5LMUB 1JKXA 1MIOB 1AHIA 1ZRMA 3I83A 4Z99A 4Z0PA 3RUHA 3U80A 3U3XA 2NTVA 2CLSA 5ENVA 2BMDA 2PD6A 3M70A 4EB6B 5K0SA 3HJGA 2J3MA 2WNHA 3MJRA 4BO5A 4OI1A 2WWYA 4IFTA 2WTAA 3O84A 2J9RA 3CZCA 3ZWVA 2PS3A 3U9TA 3FPGA 1VCMA 3OX1A 2OSBA 5HW0A 2CB0A 2H63A 2A5FA 4MVJA 2WPDD 1TCAA 1D9ZA 3JD0A 4WY5A 3MTBA 3UB3A 5BR8B 4YA6A 1P19A 2RK4A 5KSPA 1CERA 1NXWA 2VYVD 1OI7A 4LDQA 3SIXA 1FZTA 4MUNA 3WLOA 1LLCA 3TDKA 4RW0A 1FX0A 2BGWA 1JH8A 2WM2A 2PZLA 4C89A 4OQQA 3I5YA 3L0DA 4XIJA 2A6PA 2OAP1 2MSKA 2QZJA 2XOKA 3M1IA 4M53A 1C4KA 2ZETA 1C1HA 4GMDA 4X1IA 4AUNA 3JVUA 1TT5B 1U0FA 5ECWA 4EMUA 1DLJA 3PS9A 4HS9A 3H7IA 4KCGA 4KO1S 1Z17A 3PQ2A 2J0UA 4Q3LA 4WFIA 1WS6A 3USES 4F11A 1KOGA 3H2SA 1AKEA 4KV9A 1JDNA 4RMJA 3ZQKA 3WADA 5C7OO 5HILA 3GLIE 1SN7A 1EIWA 2AG6A 1FX1A 1PLJA 1Z45A 3ITKA 3T7DA 2YXBA 4C14A 2CCGA 4IF4A 5EXTA 1SQ0A 3NC0C 1RYYA 3LC2O 3MQFA 4IZOA 3LQ4A 1P4JA 1KAOA 3P19A 5EP2A 1F2DA 2H4ZA 3A4VA 4W9NC 2Q6OA 4ZXFA 3SJBA 4ZHQB 1I4EB 4UUQA 4F72A 1IN7A 5L3SA 4WINA 4RMGA 4D3FA 4EZEA 4MW7A 4WZBE 4K3VA 1A9QA 1D2AA 2P6UA 4ARZB 3B7GA 3KTAA 3ZHCA 3GARA 2XHEA 4JBLA 1KJWA 1OFTA 2BEWA 3PNYA 3UAVA 4B2IA 1LPBB 2JBAA 2UYYA 2J6BA 2W6OA 4K81B 5IARA 1M1XB 1ZD1A 2QU7A 3A70A 4B9EA 4DUGD 2VYFA 3U9SA 4EUNA 1G2IA 1KAGA 4UBIA 1PYGA 1S2NA 4CETA 2P9CA 2Y76A 4HRVA 1O4WA 3RVSA 1KRWA 2WICA 1UOPA 3O7MA 1L7MA 2OO7A 2RGXA 3BRCA 3Q6MA 4C2AA 2LPMA 1KZ9A 5HZGA 5CB8A 4KWIA 4IQFA 3M82A 1JA1A 1NJ2A 4CM4A 4N3AA 3EVCA 1HLGA 4B1FA 1FFXA 3ZHXA 2LDBA 2W8ZA 2ZYWX 1J99A 1E9RA 4R2MA 5I8ZA 2ZYVX 5AJWA 3TXAA 1N1EA 5EQJB 5KSWB 4J1TA 4JT9A 5B58T 4TRJA 5T8KC 3THSA 3WIOA 2YASA 3CH6A 1G3QA 4Q1VA 2ABWA 4RUKA 2DR3A 4DCTA 4IIUA 2Q0SA 4LZNA 4FLMA 4P34A 2YJ6A 1C9JA 4Z3KA 2CDBA 4URXR 3N9IA 3AVYA 3UHAA 3IJRA 2PZEA 1MPTA 1LLDA 1RWXA 3BD7A 1K3UB 5ECDA 1Z0ZA 3CVUA 2HSGA 1OILA 1T36B 3HM9A 2WKRA 4KKXB 421PA 1GNTA 4LYDA 3O03A 2BC9A 3D5TA 4P7KA 1EHCA 2OHVA 5CIQA 5J2UB 3UVEA 2JL1A 3AJRA 4UPEA 4EI7A 2P77A 3F71A 5CX1A 5E7QA 4Z49A 2A3NA 3R5JA 3CVVA 5CNKA 5SZHB 1X7ZA 4EI9A 4D6XA 3RNLA 4QIHA 3LUFA 1PZHA 3DZBA 3QX9A 5SZJA 5GMOA 3TW4A 4HAWA 3IYLW 1YHNA 1YS4A 2CHUA 4GPZA 4AO6A 2V98A 5LJLA 2CJWA 2XCQA 2XE4A 1A04A 3IR7A 3GJ8A 4GYWA 3FLAA 3UW1A 3KHTA 1ISIA 3PIRA 3ITDA 1KO4A 4J2OA 3STXA 2C99A 3ZDQA 3VR2A 2ZWIA 1S89A 2OM2A 4JBWA 4R01A 1TA0A 4Z9AA 1GCUA 4BNHA 5FBLB 3K71B 8MHTA 3TVTA 4C08A 1HYBA 1B16A 1JPNA 2D2IA 2B1QA 4UBNA 3RS7A 1FP1D 2H2GA 2ZIAA 4LBZA 4XUGB 4Y0AA 4BASA 2B7LA 3PC6A 1OJ7A 3O0DA 3RVBA 3WS7A 3FYUC 2V97A 4M0FA 4Y18A 2ON6A 5BWLA 1G64A 2QZ4A 2ZIVB 1RQRA 4IMIB 4HUTA 4DWWA 4YJ2A 4CKCB 4N39A 2NZ2A 3B6MA 2E55A 3KOYA 1PI3A 4X93A 3M3DA 3RLIA 4OJNA 1CQXA 3UG6A 4X5OA 1D5WA 2ZIGA 3LVQE 2YRFA 4FCVA 3JD4A 3FHLA 5B6IA 4XYBA 1HY3A 1RPNA 2L19A 3DT6A 4MKHA 1AH2A 4J49A 4C30A 3KJFA 2BELA 5J5CA 2M9MA 4BJ1A 1Q16A 4QVKA 3W5JA 5BN1A 2ZT7A 3HB7A 3QF4A 2C20A 5FUWA 1ML3A 1CY7A 4HS4A 4NDZA 3RS5A 4BYGA 4ECEA 1KC3A 2ZJ2A 2O2CA 3FCCA 4HNSA 4ZZ0A 1GXSB 1KK0A 5ICSA 3A3YA 1Q7BA 4IDNA 4K9SA 3C3DA 4TTAA 2TECE 3FIJA 4NNPA 3DJYA 3S2GA 2G5PA 3D4PA 4F1JA 2W42A 4DAEA 5CYOA 3IMEA 1LFAA 2RJ3A 3OZBA 4OH1A 3UPDA 5HHTA 1FFCA 2RE8A 2GKOA 5DO9A 2Z9CA 2V7EA 1P0PA 2VBIA 2H2IA 2YUIA 1G5IA 1IK6A 1NVXQ 1U2PA 1OKKD 1H8HD 3VR4H 5H3CA 1W93A 1GSHA 1OT5A 4J4TA 2X4DA 1G2PA 3I04A 2RHOA 4NU5A 3L1JA 1RJ9B 1T5TA 2O8CB 5L51A 4ZYVA 5AKKA 5CDTA 4ZCMA 5LNK1 4EW6A 4L22A 5FLEX 4ZC1A 4RDCA 2AMJA 5I7AA 3NVDA 2M1XA 5TT0A 3Q4GA 3DA8A 4CL3A 3KFXA 2DC1A 1O9HA 2FSPA 3D1JA 3L4JA 1NYRA 5B37A 1TO6A 2I3AA 1NW3A 2X77A 3AP3A 4FX5A 5CM9C 1I6WA 3C0KA 1U02A 3G1UA 4KUHA 3ILSA 2QRNA 2O7NA 3QOYA 5C8DA 3F7TA 3QVUA 3B36A 2D2FA 2C4HA 1ZOOA 2Q5JA 2NU7B 1U8TA 4LMAA 5JALA 5KNBH 3DT9A 3D0KA 1OTHA 4IDDA 1ULUA 2CLCX 4DG9A 4OBXA 3G8CA 3A1FA 3CEMA 3NDJA 1NLZA 4GH5A 2Q6IA 4ZVVA 3D6VA 4NICA 1B8VA 4OKSA 1HUQA 1JR3A 5BR1A 3QOWA 1GCGA 1KMHA 3EDRA 3UH1A 1RAHA 1LBSA 1Y5MA 2QYTA 3L8FA 4L9AA 4Q9DA 3Q7SA 1K9SA 5DCUA 2QTFA 2I2DA 3EAQA 4NR0A 1WZ2A 1HE4A 2CHGA 3M4YA 4E4YA 4GE0A 4LJAA 2ZYHA 4JLOA 3ZY3A 1OU0A 2AR0A 4HJRA 4OGFA 2R8BA 3BHMA 4F4IA 1A96A 2DHEA 1OV4A 3SFTA 3NM5A 3EJ6A 4IX9A 1FTQA 4F71A 4R8MA 2HYDA 1DS6A 1PVDA 4G2TA 4MSUA 4TYYA 1VL8A 3BMNA 4Q4HB 1Q1AA 4LUCA 2AOTA 5C37A 2VSOA 2ZBDA 1WU7A 4IQ4A 4LJ8A 3RC1A 1I30A 4B44A 1NLMA 2HCRA 3UK7A 2AQ8A 3N0WA 2P2SA 2EHDA 2C9BA 4KLRA 5D8DA 2Y68A 3L82B 3IEKA 2EW8A 3RW9A 5KJ6A 5HTOA 4AP6A 2JGIA 4KQKA 5EMKA 3ZBQA 2BHSA 5ALLA 4DTCA 4I3FA 4F0JA 2RHGB 1SBYA 2P4QA 1SCBA 1EK5A 2XDAA 3AKDA 3FSJX 3LO8A 4RL4A 2KWIA 2VUHB 1VLQA 1ZK1A 1WULS 3ETEA 1PDWA 4HSEA 1NI4A 5FNVF 1JE0A 1F12A 1LJ8A 3ZJTA 5I3ZA 1KGSA 3PEFA 2WD8A 1YXMA 3HK2A 3OCZA 4BL5A 2ZAYA 3PEUA 3WYGA 2V5VA 1U8FO 4Q7KA 3ZWNA 1SCAA 4DANA 4A5OA 4D81A 1CF2O 4E32A 5BQXA 2W11A 2FHPA 5CNJA 4RHCA 2ZRDA 1OH8A 2PX5A 1FJXA 3VV2A 3Q0IA 2E37A 2OKGA 3LUBA 5IYZB 5AUNB 1D07A 2HLHA 5JD3A 3G0HA 3D7NA 3F49S 1NKVA 3BIOA 4JA2A 1CUBA 2G36A 1U9IA 2EARA 3SDSA 2EVWX 2VUIB 5ETJA 4URUR 1XR3A 2BHLA 1CFZA 1DTEA 2G06A 2I7VA 4Q4AB 2RAUA 4P7FA 5LOVF 2NPIA 5LQSA 1K27A 1TU3A 1ECPA 2JD0A 4IZHA 4FGJA 1H05A 4BCDA 2GK3A 4ES6A 5KTKA 2HLDA 2FZ4A 1Y8CA 2W48A 5AM5A 5E9AA 2GCEA 2ZSEA 4KNVA 1ZU5A 4XWGA 1SEPA 2HQBA 5AJTA 2VJNA 3S2ZA 1H9CA 3H19A 2JZOA 3BFKA 4YDHB 1EDZA 2VP6A 5HK9A 3DV0B 4MCHA 2MDTA 5AIAA 3EIUA 4OQ4A 4EA6A 1YKFA 2DFKB 1FU4A 1KBQA 1L5KA 3LOPA 5GONB 3FYUB 1BA2A 3S2IA 4GI2A 1RMQA 3K53A 4S1NA 5BYBA 1M1YA 4OXRA 2ZREA 2AIRA 4KTVE 1IYZA 3U3DA 5DULA 3JQAA 3I23A 1E66A 4N6GA 2P30A 3WTCA 1C3JA 1AKWA 4N03A 2ZSBA 3OLVA 4V0NA 1U31A 3DD5A 5LN1A 2HDHA 3EGWA 1H9AA 4JJIA 3OU2A 5JROA 3O1IC 3S5JA 1DG9A 4I2VA 5IAOA 3W77A 3MGKA 1QG4A 3JYQA 4EW1A 4IFBA 5HRAA 2XYRA 5LQRA 5ALJA 3THWA 2YQ5A 4V0KA 4EJFA 2OXRA 1BAPA 4KQHA 4G07A 1X77A 2GJ8A 3MJCA 1T8TA 1M2NA 2J3HA 1XCOA 1YH3A 2H57A 3LSYA 3LGXA 4HH1A 4TLMB 4LXHA 5BR4A 3NB0A 4BEVA 1G1AA 1NXQA 2AFRA 3BWXA 3LT1A 1W8IA 3UC9A 2CSXA 1F8XA 3UMCA 2Z5GA 4GVLA 3O74A 1SBNE 3LJKA 1GDDA 1DRJA 1NRWA 1T5OA 2IOFK 4JOCA 5I5EA 3O3OB 2MR6A 4QE3A 4X3CA 3UMBA 3DLAA 3EMBA 3NHUA 2FPWA 1J1UA 4I8DA 2QUAA 1R8YA 2IV3A 1DTWA 4G5SA 3KE8A 1Q1BA 5JWHA 5EHZA 2KMLA 3JYNA 1EP1B 4UCXA 1ORWA 2WIGA 3MMSA 5BWBA 2H1CA 3B1YA 4MUKA 5H7XA 1NVWQ 3EEOA 4NYMR 3TM4A 3QVVA 2FR8A 4WTOA 1QV9A 4BCCA 4FKBA 4W6ZA 1P0QA 4TV9A 3WWPA 4OM7A 2HA2A 3A28A 2YHIA 3PC7A 4XOIA 2OYSA 3U60B 1VE3A 2CYAA 4JGGA 3GGCA 3ZWQA 3AW9A 1QFYA 1D7AA 2DBQA 5DT2A 4X6LA 3ZHYA 4TLAA 3OZFA 3AO0B 4QUGA 5I4KA 2F2TA 2QX9A 1YUNA 4ZO6A 1IBCA 2VUUA 3HKBB 1FSFA 1B6SA 4BQOA 3I9KA 1TUBB 5EMMA 4JQOA 1X7ZB 4K1LA 4D42A 1S7GA 2PWZA 4MQ4A 3W7VA 4MQFB 1GQSA 2RGEA 2O06A 4QLOA 2IP2A 4NCJA 1JG3A 1U0LA 2A1UA 4Q7EA 5AW7A 3QX8A 4EY3A 4LY0A 5HCUA 3AL3A 5KNDH 1K3TA 2AV6A 4FSHA 1KMQA 5CK4A 4FHZA 3TOSA 4CLXA 4E5YA 4J0DA 2FP4A 2FKAA 4HQ6A 4TV8B 2CFOA 5DIFA 1H6DA 4X62B 5FL7A 1WCXA 1FIUA 2QQ5A 2O8FB 3VRHA 3PGA1 5C80A 1A76A 3A2MA 3MD9A 3UK1A 5KBYA 1WXEA 2RBKA 2XD9A 4MUYA 2VHWA 5LQDA 1TYZA 5LL6P 2QJOA 1SXJA 1UL1X 2BH9A 5COAA 2XB6A 2YXNA 5CXXA 5J1SB 2PV7A 4LOIA 1GFSA 1NT4A 5ESRA 4AY6A 2ZYUX 4WI1A 3KUUA 4J75A 4Z0HO 4ENWA 2DLCX 3GGDA 5ITWA 1W9HA 1JU9A 2HDWA 3WLRA 2GWHA 1E59A 3QVTA 4Q4JB 9LDBA 3DAYA 1SU8A 1VJ0A 1XPRA 4XUCA 2P40A 1ODIA 3O9MA 1BNCA 2DUNA 3RVNA 1KZYC 1O6BA 2C98A 4Y1RA 4OQMA 4M54A 4OQDA 4YLYA 1Y7TA 2BFWA 5ILGA 1Y4AE 4RHYA 1JFLA 1BDJA 2V7VA 5KYWB 1NA5A 3QVJA 3BIJA 5REQB 1CRWG 5JC8A 1X9GA 3FWZA 5EIFA 1KSHA 2GI4A 3KLOA 1ZIOA 1MJGA 2HR1A 4EFMA 3VH4A 2H0QA 2AI1A 2IH5A 3M6MD 3Q8LA 1N5KA 2BONA 4CV0A 2OB2A 3TLEA 1BVRA 1KR2A 1GCIA 2VR1A 3IR5A 1JKJA 2QUHA 1II0A 2NUTB 4LOJA 4FNOA 2R86A 5HWSA 1DAIA 1NAHA 4UUMA 1CF9A 1NBAA 2QTGA 1UDXA 3I6QA 6AT1A 4RORA