3VISA

Crystal structure of cutinase est119 from thermobifida alba ahk119
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
261
Chain Sequence
b'QAANPYERGPNPTESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYTGTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAPNITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTLSDVEEYRSTCPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystal structure of cutinase Est119 from Thermobida alba AHK119 that can degrade modpolyethylene terephthalate at 1.76 A resolution.
doi rcsb
source organism Thermobifida alba
molecule tags Hydrolase
total genus 86
structure length 261
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12740 Chlorophyllase2 Chlorophyllase enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3visA00
4FBMA 1RWQA 1HL7A 4B0OA 4WY8A 1IUPA 1GXSA 2QM0A 1X70A 2C7BA 4BYMA 4LXGA 3BDIA 5LZ2A 4FOLA 4PW0A 5JARA 4Y2VA 3W9BA 4RE5A 4UHCA 2R11A 3I28A 3DOHA 4F60A 4BDSA 3IDAA 3WK8A 4X85A 2PPLA 3G0DA 3FYUB 3AILA 3ANSA 1VJ5A 3KD2A 4BZWA 5ISMA 2FJ0A 2WG1A 3FLAA 4DMKA 3WWDA 3A6ZA 2GBCA 1HPLA 1Q0RA 1YB7A 3ZLTA 1LNSA 4Q82A 1ZD4A 2ZJ6A 3I6ZA 3STXA 1EB8A 1XZMA 4UHBA 4AO7A 3C6ZA 3STWA 5JD6A 1CUHA 3WZLA 1GQSA 2H7XA 4H7HA 4FBLA 2EEPA 4E11A 2ZVDA 3FOBA 4YASA 5A2GA 2V96A 5EHQA 4G1FA 3PI6A 1XZJA 2YH2A 1MU0A 2CBGA 4DIUA 4TPKA 4L72A 1THTA 4J0JA 4Y9SA 3QPAA 5AKEA 1QTRA 1MX1A 3C5VA 2JEZA 4G4JA 3WJ1A 3G0BA 3G8YA 5FOQA 2C0QA 2OAEA 5AOBA 2QOEA 2QXUA 1MAHA 4ITVA 4C4YA 3N2ZB 4KR0A 1HBJA 4UBOA 3M82A 3VDXA 2VAXA 4OB8A 3WYNA 5DLPA 1UOOA 3WL5A 3ESAA 4CG1A 1CUBA 1TK3A 3PDCA 2PUJA 3BJMA 5AKXA 4BE9A 4FFWA 5LZ8A 2WUDA 1MN6A 2OXEA 1XKTA 5K3FB 4ETWA 3FLEA 2IITA 4YK7A 4QEKA 5ALJA 1A7UA 5AP9A 1TCAA 2BGRA 5EGNA 3WWPA 4HRXA 2RIPA 3RLIA 1W75A 1UKCA 4QDZA 2PL5A 5DNUA 1RYYA 4AO6A 3FVTA 4NMWA 2O2GA 1CPYA 1QIDA 2ONCA 3WJ2A 3V1NA 1A8SA 3B3QA 5DYYA 5DTIA 3D2BA 4ZV7A 2OCKA 3EQ9A 1K5PA 4IQ4A 1UK7A 3DQZA 5ALSA 4QLAA 4ZXFA 2XUKA 4BVKA 3LIIA 2WIJA 1U8EA 1SOMA 3W06A 2BKLA 2X76A 3U0VA 3D4LA 1UKAA 1XRMA 4Y2XA 3K9BA 4W1QA 1MNAA 3LIPA 4G9GA 3EIOA 1FFBA 1AKNA 2OLEA 2Q0XA 5T4EA 5FPQA 1XRQA 2HFKA 2Z5GA 4BRZA 1DT5A 4NVRA 2XMSA 4XVCA 5CXXA 1QJ4A 1E5TA 5ALHA 3STUA 3KXPA 2FX5A 2BJHA 1W4LA 1ZICA 3F8SA 3KWJA 4G4GA 2Z8XA 1ZD2P 3HJUA 4JH0A 2QR5A 4AMZA 1MAAA 1XROA 1XZGA 4FMPA 2J4CA 4J0DA 4X6XA 4U2FA 1BEEA 1AGYA 1E3QA 5E4TA 5K3EA 3O95A 2JGFA 3Q8WA 4HTAA 2HU7A 2JGLA 2HA5A 2QT9A 2PUHA 3V1LA 4KE6A 3H2GA 1R9NA 1VA5A 2CKMA 4KE7A 5DNWA 2C4HA 3OC0A 1SCKA 4AZ3A 3CN9A 4F5ZA 3MVEA 1XZBA 1BN7A 5LZ7A 5JD5A 5AIBA 2P8SA 1LPAB 4Y2QA 4O08A 2XMQA 3ZI7A 1GQRA 3AIOA 3LP5A 3LLCA 1LPMA 4B9AA 3CXUA 4DNOA 4MJ3A 2CEKA 3ZLUA 3G9ZA 5AI6A 1YCDA 4FLFA 1G42A 1KU0A 4W1RA 1XFDA 4FLEA 3C43A 3HABA 4LXHA 2GBGA 4XIIA 1JJFA 3KOOA 1GGVA 3EBLA 4H7JA 3BF7A 3ICWA 4MQLA 1JJIA 1AURA 5EFZA 4PO3X 5IVIA 5ALKA 2H7YA 3QYJA 4UHEA 1JJBA 2XUGA 1T4MA 1H23A 1M33A 4E46A 2WJ4A 4BAGA 1HDEA 5CT9A 4BVLA 2G63A 2GYVA 1T2NA 2V97A 5ALZA 1EVEA 3AFIA 4U2DA 3WA6A 5CH5A 3AIMA 3VJKA 1ZD3A 4JUIA 1JU4A 5AI0A 4X3CA 5LZ5A 1USWA 1VE6A 3FVRA 2GZSA 1B6GA 3I2HA 3DL7A 2Z3WA 4AMYA 3KSRA 4B6GA 3I2JA 4KRXA 4EZIA 5K3AA 2PSFA 3RM3A 4ARBA 4V2IA 1QIGA 1YA4A 3HLKA 1EDEA 5AM5A 5HFNA 1ZD5A 3QPDA 4OYLA 4J0KA 2VJDA 3HXKA 1AX9A 2RHWA 3H2KA 5JZSA 1DT3A 3DNMA 3FNBA 2XUDA 2OCGA 3H04A 4BCBA 2HFJA 2GZRA 4BVJA 3AZPA 2PM8A 2XLCA 4N5HX 4CIBA 2OCLA 3HEAA 2QRUA 2XUFA 4BRSA 2H1IA 3I6MA 5ALLA 2HL6A 2ZSIA 1XZEA 3WKEA 3SWWA 4M0MA 3UMJA 1XZDA 1QO9A 2HRQA 3BJRA 1TCCA 4BP9A 1AQLA 3BWXA 2AJDA 1EB9A 5AM4A 1SC9A 4EBBA 2DSNA 3O9VA 1MNQA 2RI6A 5JAPA 1Z68A 4OUKX 3O4GA 3FBWA 1OXMA 1H2YA 5DTJA 4GWLA 4P92A 2ECFA 1WB4A 4MXDA 3IVMA 4EA6A 3FCYA 3WKBA 3OTQA 1P0MA 4J0IA 2X8BA 4WFKA 1Q0ZA 5CT5A 5JAOA 4H7EA 3WWOA 4WJLA 5AI8A 5FLKA 1R3DA 1XRRA 5KWIA 4KJXA 3D5EA 1CUCA 5C81A 2XUPA 2HA3A 3VJMA 1QIIA 3C6YA 3O4IA 1JFRA 4KE8A 2K2QB 2WJ3A 3WKDA 2ORYA 4QLOA 3FYUC 4CCYA 1QIFA 5EIAA 2RGUA 1O6FA 1WCYA 2DQYA 2WFLA 4W1PA 3D2AA 3Q0TA 4UBLA 5C8XA 1LBTA 5EHZA 3V1MA 4RNCA 5ALUA 2B4KA 5FUMA 3EQ8A 1KEZA 3F98A 4X92A 4X90A 4H18A 3G02A 5EIEA 1XZAA 3G7NA 2LIPA 2ES4A 3IUJA 2HA2A 3PE6A 4Y2TA 4AXBA 2O2IA 3DS8A 4PSUA 4I3FA 2I78A 1UXOA 5EIHA 2XUOA 5AKGA 2OPHA 3DYVA 4UBMA 4UFNA 3QZUA 1U65A 1YSCA 1ZI8A 5KREA 2C5GA 1CUEA 4YX9A 2WIGA 1BEZA 1DU4A 2WM2A 2X5XA 5IVKA 2WU3A 5DYTA 4WY5A 7YASA 2WLSA 2XMZA 3SX4A 1LPNA 4BC0A 4H7IA 1JU3A 1IZ7A 1ZGBA 2VQ6A 5AKHA 1YB6A 1IZ8A 2W6CX 5AKIA 1ORWA 3RKSA 4HZGA 1EINA 1WB6A 4OSEA 5K3CA 5ALXA 4OCZA 2Y1KA 1CQZA 5AM2A 5ALMA 3TEJA 2EDCA 1VKHA 5AK3A 2B9VA 3ZPXA 3IIIA 5CT4A 4BAUA 1S8OA 2XMBA 3D7RA 1WPXA 1H2WA 5DYWA 3F9CA 2YYSA 4CG3A 3G9UA 4QA9A 2VSQA 4WFJA 1ZOIA 1YAJA 3STYA 2Z8ZA 5FDFA 4BATA 3A2MA 4X93A 3BXPA 1HKHA 1XQXA 3EQ7A 2DQZA 3GUUA 5JD4A 3PFCA 1X2EA 2JF0A 3PFBA 5I8PA 2DHEA 1XZCA 1U4NA 5LIPA 5T4BA 3V1KA 5I9IA 1JKMA 4Y2UA 3FLBA 4ZRDA 3ED1A 1VXRA 5HK9A 1PFQA 2I03A 4FDMA 4B83A 4H77A 3HACA 5AKJA 5IH7A 3PF8A 2VA9A 4A5SA 3HRHA 1XQYA 2ZSHA 4X71A 1DQYA 2Z3ZA 3M83A 4X91A 5ALPA 1G66A 1JMKC 1K8QA 3E1GA 1QFMA 3K6KA 2PKYX 4MYSA 4GI1A 5AK5A 2OAGA 1C7JA 3UUFA 2G5PA 1K4YA 4IH4A 3G0IA 5HKBA 3PICA 3JW8A 3M81A 3H2HA 4DSAA 4GBGA 2AJBA 4NS4A 4QZVA 4D9JA 1WPRA 1R9MA 3QMVA 1Y37A 2FUKA 2XUAA 3WL8A 5JZ9A 4B9EA 4KRYA 4KEAA 3QMWA 3BDVA 2WHQA 1DTEA 4B82A 5ALIA 1O6GA 3AJAA 2XQIA 2HU8A 3IURA 4PF1A 3W9UA 3HSSA 4LKOA 1MTZA 1BN6A 2QJRA 2NW6A 1JT2A 3DLTA 1UZAA 4UBNA 1BCSA 3GA7A 3DJYA 3O4HA 4TGLA 5ALTA 5AOCA 3R3UA 3WK9A 1EHYA 4AQDA 4KE9A 1XZKA 1H2XA 2PX6A 4X7BA 3C6XA 4F0JA 2WSLA 3EF3A 1QIMA 1EDDA 5C8VA 1J2EA 5E4JA 5IVHA 4F21A 1N5MA 2VTVA 3OURA 1MPXA 4XJVA 1Q84A 4NZZA 2AXEA 2OGTA 3D2CA 4DGQA 1YS2X 4MQMA 1FFAA 1FFCA 2AJLI 4J0GA 1CUYA 4ZV9A 2Y6UA 1CUIA 4Q1VA 4YPVA 4OYYA 1UT6A 1N8SA 1BE0A 1ODTC 1YAHA 3VKFA 3AUKA 1QIHA 3CCCA 3VJLA 3F96A 3FYUA 2WKWA 4A16A 4G9EA 5CMLA 4PQEA 5CT6A 2V98A 2J3DA 4K2AA 2V9ZA 2WFZA 1YS1X 4W9RA 1KU6A 4EY7A 4PSCA 5ALNA 4BB0A 3TGLA 5IKXA 2BUAA 2H9YA 5ALEA 4DYHA 1LPBB 1CVLA 5SYNA 1VZ3A 5AKYA 1XRLA 4FKBA 1UK8A 1FJ2A 3WL7A 4MYDA 4U2EA 4QDTA 1VZ2A 4MWTA 3A2NA 3TRDA 4WDQA 2QS9A 2XQKA 4JEIA 1YR2A 1CEXA 4GEGA 2QZPA 5T4FA 3D3NA 3BL8A 3WZMA 1XQWA 5HQ3A 4QNNA 1CUSA 1QE3A 1TKRA 4P93A 4PNZA 3FSGD 4HXGA 5F4ZA 3AIKA 3TJMA 1E8MA 1P0IA 4OU4A 4J3JA 1H2ZA 2JGIA 1W1IA 3FAKA 1UK9A 5FPPA 5HZGA 3BF8A 3GFFA 1LPSA 5T4HA 1W6RA 1LZKA 2WFLB 1F8UA 2I3DA 1K63A 3H19A 2XE4A 5K3FA 1EXWA 4N8EA 1DQZA 1MX9A 4QWMA 1EVQA 3WIOA 4ROTA 2BFNA 2VAVA 2RHTA 2JGKA 4QE3A 3H17A 5AIAA 4RPCA 4DNFA 1R50A 4DM7A 1H22A 3E3AA 5K3DA 2JGMA 3WK4A 1MJ5A 1L7AA 1F0PA 1TIBA 1ETHA 3D0KA 3PUHA 2HM7A 1DWOA 4H0CA 5EHNA 3C5WP 1WHTA 3UUEA 3W2TA 2ROQA 3F67A 4W63A 2ZYSA 4AN0A 4UBKA 2GYWA 3OM8A 2ZJFA 3ILSA 4C89A 4RE6A 2RAUA 2YXPX 1WB5A 2RONA 5CT8A 1QIEA 1XZLA 2QJWA 4GLBA 2G5TA 3V48A 1B41A 4C4ZA 5J3JA 1ISPA 4I19A 2XMDA 4GXNA 4FHZA 4PSDA 5HK8A 4UHHA 2PBLA 2HA6A 2VJAA 1XZHA 5AICA 2HIHA 5JALA 4L9AA 3I2GA 4DMFA 3QBJA 4G5XA 2O7VA 2JEYA 3IB3A 4EY8A 3W05A 3LS2A 6YASA 3V9AA 5LLSA 2AJCA 3CN7A 3D59A 1LPOA 3S8YA 4IO0A 4ZWNA 4BCCA 1ZJ4A 5AKKA 4KAJA 3WI7A 2WIDA 5AO9A 5ALDA 5BOVA 4HXFB 4JYMA 4Q05A 2WQZA 4FNGA 2XDWA 3I1YA 2OGZA 5A71A 4XWGA 1PV1A 5I7UA 1BRTA 4J7AA 1ACLA 3HI4A 1E8NA 3QITA 3WKAA 1LGYA 1XZIA 2DR0A 3G9TA 4X6YA 4CIAA 3T4UA 2QMQA 4WFIA 3WKCA 1R88A 4U2BA 3C8HA 4Y2YA 5AM3A 3HC7A 3A70A 2VT6A 1QTIA 4KYVA 5ALOA 1CIJA 4OB7A 4MEAA 4G8DA 1XRPA 1ODCA 4UPDA 1XKLA 4EB0A 2ACEA 1F6WA 4P9NA 3NGMA 2BCEA 4JYPA 2CZQA 2XMGA 3OPMA 4CCWA 3QPCA 1U2EA 5JASA 4DLNA 3OG9A 1MT3A 2OQVA 1UWCA 4BDTA 1GPKA 2BAGA 4KAAA 3HZOA 4L3WA 4CFSA 4K6KA 5JANA 5AM1A 5AJHA 4AX4A 1ZIXA 3I2KA 2CB9A 4FLMA 1CUAA 1UOPA 5C7YA 2EDAA 4ZREA 3ZWQA 1WOMA 4J03A 4I4CA 1EK2A 2Y6VA 3CCBA 1AUOA 2DHCA 3VVLA 3X3HA 1GZ7A 5D7BA 5JIBA 2HDWA 4K6HA 2VEOA 3C87A 2JGEA 1TQHA 1VA4A 1IUOA 4B84A 5JATA 3RARA 2VATA 1OILA 5A7GA 2WG2A 4K5QA 2J4FA 1C7IA 3KWFA 1LZLA 4C87A 4M0EA 2IIVA 1W52X 4Y2JA 3ANTA 2WHRA 4AO8A 5LZ4A 4S0XA 2PSDA 2ZYIA 3BIXA 4E14A 5SYMA 1FFDA 4N8SA 4A23A 2GBFA 4PV7A 4EHBA 5LYYA 2WUEA 3IBTA 5ESRA 3DOIA 1FSSA 3H1AA 4FFVA 5JAUA 1CUFA 1A8QA 5HF9A 4EY4A 1Y7IA 5CRIA 2WHPA 3G0CA 1EH5A 1CUUA 1CFJA 4H7DA 2XUJA 1CUXA 3PF9A 1QFSA 1LPPA 3R40A 2BGNA 1ZGCA 5ALFA 1ACJA 1EK1A 2D5LA 1GPLA 3C45A 4N5IX 5AKLA 5KBYA 4UBJA 2VF2A 4UHDA 4BTLA 1L7RA 2DFPA 1JMYA 2C0PA 4MWSA 4ARAA 2XQGA 2G4LA 3QM1A 4EUSA 4C88A 4QDOA 5E2IA 5HKAA 1MO2A 4DMCA 3K2IA 5EI5A 2XT0A 2JIDA 1QLWA 4ZGBA 1CLEA 3I6YA 4AN1A 4W1SA 4B7ZA 2HADA 1QGED 5CBKA 2JBWA 4DTCA 2DCMA 1VXOA 3FWHA 3SK0A 1F0NA 1CUJA 5AM0A 1UKBA 2Y2UA 4OB6A 4BC1A 3WWCA 5CXUA 5FP0A 1BS9A 5LKRA 3DKRA 5K5EA 1XZFA 1EDBA 3VISA 2QUBA 1P0QA 5HQ3B 3ICVA 5HFAA 4J0CA 1VOTA 4HS9A 1JI3A 1EA5A 2QXTA 3GBSA 4HAIA 2HA7A 2HA0A 1THGA 4DNQA 1D07A 4CI9A 2WJ6A 4IHAA 3I2IA 2Y2VA 1XLUA 5AI5A 5DNVA 4XX1A 1CV2A 3L1IA 2XI4A 5CW2A 2OCIA 3H2IA 4GDMA 4Y7DA 3WK5A 1WM1A 1Q83A 1Y7HA 4HXEB 3IULA 4Y2SA 1CUVA 1SCQA 1BU8A 4UFPA 4GHWA 1LLFA 1CQWA 2W22A 1NU6A 1ZI6A 3WIBA 2UZ0A 4LXIA 2O2HA 2WU4A 2GYUA 3WMRA 3KDAA 4ZI5A 1VLQA 2FJPA 2PSHA 1G4HA 1XQVA 2XMCA 5LKAA 5A6VA 3I1IA 1QIJA 3JYHA 4WDRA 5D3KA 5A62A 3H2JA 1A8UA 1ORVA 2XUQA 5ALVA 2DHDA 1NX9A 4M0FA 5ALWA 3HYSA 3H18A 2BUCA 3NUZA 3R3YA 3MGAA 1XRNA 4BP8A 4Q3KA 1VE7A 2XB6A 3AZQA 3GELA 2HA4A 4AZ0A 4LYDA 3H0CA 3RK4A 1N1MA 3STTA 1DX4A 1HQDA 3QVMA 1GT6A 4H7KA 2IX9A 2O7RA 2ZYHA 4B85A 3DD5A 4LYEA 5AH0A 2HRRA 2ACKA 4X97A 3R3VA 4C01A 3SC2A 4IH1A 5E4YA 4X00A 4UFOA 2WFMA 4DNPA 3WWEA 3S2ZA 2XMRA 5ALYA 3R0VA 5AK4A 5JZBA 5FRDA 3BIWA 1AMNA 3IUMA 4N8DA 1DINA 1AC5A 5HF5A 2BUBA 2YASA 1BCRA 4OPMA 3WQHA 4K6GA 2I3ZA 5FV4A 4UBIA 1DX6A 3W04A 3DKKA 2WUFA 3C6BA 1K6EA 5A7FA 2XUIA 4Y2PA 1TRHA 2C5FA 3MUNA 1E66A 4LHEA 4WCVA 1UOQA 4L0CA 2R8BA 2E3JA 3P2MA 5BV7A 4CCYB 3R3ZA 1CUDA 3T52A 2WUGA 3FCXA 4P08A 4KAFA 3H1BA 1J07A 4H35A 2HHAA 5A7HA 5H3HA 5BWCA 4RGYA 1WHSA 5JAHA 1QONA 1CRLA 4B0PA 4C6HA 1OCEA 5DJ5A 1LBSA 4J0HA 3E0XA 2J3QA 4CG2A 3NWOA 5AI9A 2JGJA 3ZV7A 4FNMA 3L1JA 1XLVA 3LCRA 4IH9A 2WTMA 1J06A 5K3BA 1ZI9A 1CUZA 4EY5A 2OQIA 1HLGA 1QO7A 4AB1A 2GBIA 1C4XA 3MUOA 5LZ9A 3WL6A 4G8CA 1GKKA 5CURA 4JNCA 4BE4A 1ODSA 5D3ZA 1G5FA 3ESCA 2B61A 5AI4A 4B80A 1PJAA 2WIKA 3O0DA 3N0TA 4QDXA 5ALGA 3ZLVA 3ESDA 5ALRA 1E8DA 3JWEA 2H7CA 1BROA 1R4ZA 3IUNA 4Q34A 2ZJ7A 3DCNA 3WYDA 1YA8A 1R1DA 4INZA 2WTNA 2XQJA 4KACA 4FTWA 3IA2A 5CTAA 1FFEA 2QUAA 1IVYA 1ZIYA 4X6UA 2VJBA 4UHFA 1CR6A 1RP1A 3R41A 1YASA 3OOSA 2CJPA 1QZ3A 2PSEA 1J1IA 2PU7A 4Z49A 4U2CA 5AKZA 3PUIA 5D6OA 3C8DA 3F97A 3VXKA 1DWPA 5HF6A 3WK6A 4EY6A 3NOXA 1IMJA 2WIFA 4BCDA 2VJCA 2HU5A 1AZWA 1TCBA 3AZOA 2WG0A 1QIKA 2WHPB 1GKLA 3C70A 3O9MA 1NU8A 3GZJA 4G8BA 3R3WA 2PSJA 4Q3LA 3AINA 4H7FA 2CUTA 3DL4A 4MEBA 3O4JA 5CH8A 1E89A 2OG1A 4BAZA 1UK6A 4BTVA 4C4XA 5JADA 4BBZA 2PU5A 3DYIA 4OU5A 3GROA 2WILA 4HVTA 2PVSA 4BZZA 1XLWA 1GPNA 3BE8A 3ESBA 3IUQA 5AHXA 3U1TA 4QDUA 3VVMA 1A88A 4G4IA 1EX9A 2C58A 5BWBA 5FXMA 1DWQA 3G9XA 3WK7A 1MX5A 5CH3A 4GECA 1ZJ5A 1UFOA 3A2LA 1IUNA 5FKJA 1QOZA 5LP1A 1W76A 4DSZA 1X2BA 2AJ8A 5HCUA 4DMHA 2QTBA 3L1HA 3QMMA 1L7QA 2D0DA 5AOAA 4U2GA 1SCIA 4Y2RA 4FWBA 2QVBA 5DWDA 2XLBA 4B81A 3FSGA 5AK6A 1I6WA 3R3XA 1EI9A 4HRYA 3G0GA 5HF8A 2QKYA 5C8ZA 1SFRA 4X94A 2CMFA 5EHXA 2XUHA 4UUQA 4OD0A 1N5RA 1P0PA 5YASA 3DEAA 3M3DA 3B5EA 4X95A 3WLAA 5KWJA 3STVA 3DDUA 5IVDA 3B12A 2ZYRA 4QWWA 2XQFA 4LIPD 4E15A 1CUWA 3WA7A 3YASA 1CUGA 3E4DA 4GW3A 4TVKA 3FYTA 4Q3OA 5ALQA 5JYCA 2OGSA 3QH4A 1TAHA 2B20A 2VT7A 3I2FA
chains in the Genus database with same CATH superfamily
1ZA2A 1FYFA 3HJRA 4FBMA 4AAYA 3P8ZA 1XCLA 1HL7A 1YBVA 3A9UA 3R5HA 2NZVG 2FSPA 1TYDE 2OAP1 3AEZA 3A31A 3LC2O 1LC3A 3MJTA 4WY8A 5AHOA 2Q45A 2VPZA 3FGPA 3LBIA 2A86A 1KAQA 1HK7A 5C7LO 2MR6A 1X70A 1ZGHA 2IUSA 1Y89A 3GT3A 4N40A 1IHYA 4MS1B 5SZIA 3EG9B 5HBRA 1TPYA 3RPEA 4BYMA 1T3HA 3KIPA 2QAIA 2HUNA 1P7CA 3OUZA 1G0OA 1JAXA 1P18A 1VQ1A 3KKLA 1OXXK 4JJ7A 3NZEA 4LTMA 1QCDA 4PW0A 5JARA 2Q1YA 3QXCA 4K40A 4KL8S 4Z1MA 2ATVA 2YJ4A 4D9NA 2C2YA 4ENUA 2BR5A 3I28A 4DR4B 1LD3A 4HCJA 4LWZA 1ZSVA 2HEIA 1QHHA 1I7PA 4FSXA 4KKXB 3S2YA 1X7ZB 3ZCRA 4F60A 3PGLA 2WWWA 4X85A 3AF3A 2WSSD 4G0VA 1N6KA 3GQBA 5BNWA 1XMVA 2WUWE 1TZKA 2P2NA 5A5EA 4KH0A 1K3FA 1HNNA 1R5JA 5JG7A 3AILA 2QGNA 4MUEA 2X9QA 3CEAA 4OMDA 4R68A 2EJUA 3TUJC 2IIPA 5JS2A 4C30A 4NQZA 1VJ5A 3OFSA 2OV4A 4B7UA 4BZWA 5ISMA 2FJ0A 4EO4A 4ZAZA 3L9WA 3FLAA 4KWEA 2X4GA 4HNQA 1JPVA 4RY2A 4NH0A 5DEIA 1BS1A 4YJGA 3U26A 1SCNE 4O4LB 4B4VA 4Z54A 5A9SA 2QV0A 3GLRA 1S0UA 1YB7A 3LKDA 3LNCA 2OB2A 4YRQA 2OFFA 1C8LA 3L05A 4XAQA 2OYRA 4AZ0B 1BX3A 2RGNA 4A1FA 1HG0A 2O8CB 5J59A 2PXXA 1EB8A 4CRWB 2W6NA 3DWFA 3JD2A 2YIDA 4S1TA 4BLSA 1XZMA 3T99A 2WAXA 3LHKA 4KXNA 3ONEA 4UHBA 5BV2P 1A9XA 4OEHA 1DG9A 1V0JA 4QU5A 1U0FA 2FFHA 3GXOA 5TMEA 1PJZA 5F51A 2ZS7A 3THYB 1GQSA 1OX4B 3SSNA 1E59A 1DO8A 2HHCA 3V00A 1P1CA 1XP8A 2AF4C 3QPUA 1VHDA 4U0KA 5FO1A 3RUEA 4RULA 2FWPA 2WU1A 4L0MA 1QQTA 4QOFA 3RRFA 3TE6A 1WQ1R 3GLQA 1MA0A 2I4LA 3E23A 3I4LA 5CNJA 1R5NA 3QFCA 3FOBA 4P3OA 4ZYZA 5A2GA 2E21A 3FCUB 3RS0A 4E5KA 1QRRA 1ILEA 2IVFA 5EHQA 1CQPA 2QI9C 4BFXA 1MH9A 4ND6A 3PI6A 3QWFA 2AFHB 3UHJA 3WGOA 3KQKA 2FH5B 2P7IA 1PU2A 1N2CA 1LXCA 2ICAA 2ZZNA 2FW6A 4DDKA 1RAIA 3JVEA 4IINA 5CCXA 2CBGA 2CE7A 3D02A 3C3YA 3HBNA 3FF1A 3U56A 2Z98A 4MUGA 4E32A 5HR5A 3GLHB 1IY2A 1QCCA 3QUCA 4BKOA 1FS6A 1F4VA 4Y9SA 2R7NA 4I81A 4L4RA 5AKEA 1TQ4A 1QTRA 1MVLA 1AIPA 2EL9A 3JQ7A 2D4AA 3P5BA 2B0JA 1PKEA 3LI2A 5CVCA 4C6TB 2ZP1A 4G4JA 1MT0A 1OPXA 3MS2A 3WJ1A 1KARA 3FI9A 3LK7A 4H1UA 2PYIA 3G8YA 3LXRA 3AJDA 4O02B 4K9NA 5FOQA 4B3TB 3OP4A 1H94A 3N75A 1YIDA 4RACA 3VA7A 4TQUS 3RAJA 3ZWXA 5AOBA 1XMIA 1Z33A 2QOEA 3QVLA 5ED0A 1L5KA 1Z16A 5L6LB 5AYVA 4KDEA 4AJNA 1MAHA 3OJCA 1ZFNA 1B73A 4I66A 4L85A 2H4YA 1X7HA 4UBOA 1E9CA 4GOXA 2QUJA 3H7AA 3OC6A 3OLYA 5FR2A 2HT6A 2GDZA 2H2HA 2WM8A 3WGHA 2C2WA 2Z8YM 4BFSA 4BX2A 5JI3E 2EZ4A 4MRAA 1XA0A 3CZPA 1WJGA 1CUBA 1TK3A 5CPFA 1SZCA 1AK9A 4O4HA 1B6SA 4EG4A 2FPSA 4O8CA 2RG7A 3K1AB 4WTOA 4EMUA 4P58A 4U7JA 4WUVA 1ZVJA 1YZ3A 2OFOA 3DMDA 2XH8A 1B6TA 3QLEA 1ABBA 3ZQ6A 1MN6A 4IDOA 3I8OA 2PSSA 3CLTC 3T7JA 3SZUA 1QOPB 4D3DA 3EAQA 3QPVA 1DCFA 1IMOA 1Q7RA 2V6MA 5K3FB 5CEJA 5BSKA 3UM9A 3Q87B 1EX7A 2ZUVA 3I73A 2IITA 3W77A 5CFOA 3L8YA 1V1RA 1NG9A 3G85A 2ZREA 3A27A 1LSSA 5LOVF 1A7UA 2OGWA 5AP9A 3ADOA 5ECYA 4E5MA 1D7OA 1B26A 4P7BA 1QH1A 3CLHA 5M34A 4O2AF 5DM60 4P38A 1U7TA 2H4JA 1FNSA 1YK1A 3ECSA 4CMBA 1DBIA 1GP2A 1VBFA 3S8MA 3FETA 2VK1A 2W00A 1D1SA 1Q91A 1PYGA 3WO1A 4B48A 3RLIA 1J0DA 5KJ1A 2WWXA 4MJ7A 4MQ6A 5J5CA 2IXFA 3IIJA 3QEBZ 5JH7A 3MELA 1HKUA 3BTSA 1I36A 1RRPA 4QD3A 5DNUA 4MB2A 6ABPA 4BV3A 3S99A 3GN2A 3IAM6 3HNRA 4NMWA 3JASB 3P9SA 4UDOA 1Y6RA 4RHYA 4AWAA 1CPYA 1JDZA 1QIDA 2YS6A 4H4CA 5BR7A 2XTZA 1YJXA 4LA4A 1LUAA 2P11A 5F5NA 4Q1AA 4MVCA 2VWQA 4U7TB 3AB3A 3FY4A 3LRPA 3SHWA 1ULSA 1E79A 3C7KA 3ROEA 4M46A 3D2BA 3TZLA 4DLZA 1YRLA 4UUMA 4DCCA 3HP1A 3FRJA 4G67A 3WHLA 1Q0SA 4AUNA 4BOYA 4HWKA 1NE7A 1UK7A 3BCRA 3DQZA 4KG7A 4YT5A 1L5HB 4XWKA 3NTVA 4U3JB 1H2EA 4BYGA 3C97A 2VBFA 2KX7A 4RFVA 3V2UA 1FZQA 2WIJA 3M89A 3DLPX 2B92A 5FBWB 3F4KA 4PRZA 3H42B 2GBPA 3IDOA 1VKOA 4YJ3A 3DDHA 2XHZA 2XTNA 3MTIA 5TSDA 3P1JA 1Z5ZA 2PRJA 4WZBB 1EE9A 3DLHA 4KGVA 2L18A 4MICA 3CW2A 4ACAA 2V74B 2CLLB 3K9BA 2EKDA 4DSUA 4JSTA 3O7MA 1CNFA 4R9NA 4W1QA 2Z1DA 3AUXA 4E33A 1T5DX 3CRRA 3H5TA 3LE8A 1XXLA 2C8VA 2I2BA 3BRWD 4JI4B 3L82B 3LQFA 1D1PA 4C9BA 1GA4A 1R6TA 3C3PA 3LW8A 4FZVA 1Q1QA 5T4EA 3AEXA 5LA6B 2VDWA 5TT1A 2X13A 4RVDA 3TRIA 1C29B 4CM8B 4J6FA 1RJGA 3WFZA 4QJ3A 1JEYB 2FN7A 5TS3A 3MPUA 4Z7OB 3UYLA 1G5HA 3CMCO 4NVRA 5KYTA 3ENWA 2EFHB 4LRYA 2HYDA 2R66A 1R74A 2R7AA 2XRZA 1KEPA 3QVTA 3KXPA 4RK7A 4HDCA 3SDSA 2XEDA 4R8VA 3S81A 3L4JA 1YJ8A 3EGCA 3UXHA 1U6KA 3RU3A 4E5DA 4E7OA 4HT3B 3F74A 1C4WA 3KWJA 1JILA 2Y0EA 4GUAA 5F7OA 3KHKA 1VJGA 4P33A 1AQIA 2BDUA 2Z8XA 2XSZA 4RXMA 2HZ7A 1UXGA 1OAOA 1X1CA 1A4UA 4AMZA 3ZDAA 2OT3B 4B2LA 1XZGA 3I04M 4JUAA 4M1MA 1DL5A 3VR6D 2CB0A 4J0DA 3DOJA 4U2FA 1WPQA 3CE6A 5ER6A 3KALA 2G8LA 3DTVD 1WUKS 1C4KA 1P4AA 5B3JC 2A3NA 3MB5A 3H86A 4OKIA 1W36D 2BMWA 4V0MA 2GLXA 2Q4TA 3Q8WA 2BIFA 4GOJA 3ZZ1A 4ZGGA 1RR6A 1I3LA 5LSAA 1T9GS 1RXIA 3OTWA 1P2GA 2GNPA 4P4UA 4YTEA 4D81A 2F59A 2QRPA 3WB0A 9GPBA 2OO3A 2W6IA 1HLDA 4K6FA 4Z3OA 3PFGA 1CETA 4ZGWA 3MJHA 2Q5LA 1XDGA 5F12A 2PUCA 2DHRA 2MSEB 2A9FA 4CPDA 4HWPA 4C4SA 3H9CA 4D4HA 1RJ9A 2WP0A 5CAEB 4ZVOA 3DCJA 4IUBS 3SSOA 4CR8A 5HUJA 1JN0A 3KSUA 4KNWA 2D06A 4NCKA 3FPGA 1XD2B 2JFWA 1WNTA 3QKRA 5K7SA 5LZ7A 5JD5A 1J0EA 4Y2QA 1VL1A 2WPDD 3CUKA 1G8PA 3LO8A 1GRQA 4LSZA 4IIJF 5CVJA 5T67A 1MC4A 3PRYA 4QJIA 3HRKA 2VJPA 4ZC1A 3C7TA 2AX4A 2YXNA 3OVMA 3AIOA 4CEJB 4WZZA 3VV3A 1VSQA 4B46A 5I7WA 5JAZA 1KR2A 4DNOA 4Z1OA 1QVRA 3D3WB 2CEKA 4LMRA 4RA6A 4TMKA 3G9ZA 2CDBA 3U44A 1ZVMA 4OKNA 1I32A 4XM1A 1B42A 4L76A 3O38A 4JC5A 4EMSA 3AKZA 3A0RB 2EHDA 3GPLA 5TF4A 3D6VA 1KU0A 4TKMA 1XSEA 3USZA 4J7UA 5BWNA 2PKQP 5EE0A 3DTVB 2R2GA 4HNGA 2V4MA 3R3SA 2IYFA 3E7DA 4NP6A 3I72A 4Q4AB 2Q5IA 1W36B 3ZDBA 3BH6A 3UCEA 4YQFA 4P0TA 2DMRA 1LDNA 1UBOS 1R10A 4Q03A 3KXDA 4XIIA 4OL0A 3O73A 2A4KA 3B2QA 2PZMA 3ZXYA 1LV7A 3KFVA 1U5BA 2VPQA 5A5FA 2R3SA 2J0QA 4ZANA 3CF4A 5K3SA 4EJSC 1U6IA 4DA9A 2XB2A 3NEPX 1KI6A 4ZO4A 4DZRA 5LMNB 1G8YA 2I55A 2IHBA 5AJVB 3JZDA 4QGHA 5SV2A 3QYJA 1JJBA 4GI7A 1VI2A 2I8LA 3N0XA 3VHQA 1O1YA 2GN8A 2XUGA 3SF0A 2XOKA 1GTJ1 1LDMA 1M33A 1Z4IA 4IDDA 4KXLA 2WJ4A 1PNOA 3PHJA 1BNCA 3OOYA 2C3OA 4D9KA 3C48A 4LOLA 3R7WB 3L8GA 4OJTA 4YDHB 2IZ1A 5CT9A 5FJJA 3KLPX 4B76A 1V3QE 4BVLA 3AVOA 5FBHA 1B3BA 2GYVA 3OJOA 4YAOA 3ZKWB 3EF0A 1T2NA 4XQ9A 5ALZA 3R6WA 1E4VA 1BQEA 2J0VA 4ZA2A 1DO0A 1EVEA 2L82A 2VEDA 3WA6A 2YHUA 4CMEA 2O0LA 3AX6A 1G3MA 1JAZA 4M9RA 4BV2A 1G2PA 5CX1A 2AN5A 2GA8A 3JWHA 1XWIA 3TS1A 2VAWA 3R5TA 3KKZA 4BJ5A 2VQSA 1TYBE 1VGRA 2F3TA 2H4XA 2JLZA 1USWA 2D8MA 2O0KA 3NJRA 3HV2A 4PAGA 1VE6A 3AEQA 4ZI7A 1ADYA 1B6GA 1CJMA 3DL7A 2QX7A 1R8XA 3DZBA 4FHEA 4TKLA 3RYHB 3GN1A 3T12A 3HCNA 4DSNA 1JSLA 2PMKA 4DCOA 4BQPA 1I7SB 2DR3A 4EZIA 4G1CA 3BXZA 3HB9A 1Q7GA 3HYCA 3CIFA 4R41A 1QV9A 4ARBA 3SZRA 1R0KA 3GLVA 4V2IA 1T0PA 2G72A 3FZYA 2GCIA 1D2RA 2MYPA 1YA4A 3OWXA 4G24A 5CDHA 1EDEA 1PI3A 1AK2A 5HS4A 5HFNA 4NCJA 3K6SA 1K0UA 2P9ZA 5SY6A 3JTMA 1N7HA 2XWBF 2B21A 2WDPA 2RBEA 4UHKA 2IUUA 5AW2A 4E0BA 4PCAA 4TM7A 4EECA 3AF5A 4INPA 1CD5A 3NEJA 4QHTA 2JAUA 3BSWA 5AW5A 3WOVA 3SHVA 1XCPA 1TUIA 4RCVA 3MGGA 5TRTA 3USES 4CF3A 4OHBA 3L0CA 3ZOZA 1I30A 1U11A 3DP9A 3E18A 2LIVA 3IUSA 5L3VA 3NVDA 4JBXA 2P2GA 1P2BA 1Q95A 2ZRCA 3NORA 4YRFA 3DNMA 1H8HA 3VU1A 4UARA 1KORA 2BEUA 4BLUA 1M34A 3CEMA 3FNBA 3PR2B 3DBLB 4WGGA 1GXSB 4Q3AA 5JMWA 1WBBA 1QVWA 4YMUA 4C0XA 3UMRA 3BHJA 4BCBA 4WRRA 2EC5A 1GO2A 4C0JA 1W59A 4LY0A 4B09A 4PXAA 2VKQA 3OICA 2PM8A 2I2CA 2WD7A 1X8LA 1P5FA 2AMJA 4EGCB 2I6TA 1VG0B 2BHRA 4L3VA 4QIHA 1B8VA 1Z2CA 3GIWA 2ADMA 4HYEA 4DC1A 4R3WA 2JB9A 3FZQA 3VTZA 1GTZA 5B1IA 1RQ7A 3PQ5A 2UUCB 2Y1WA 4KWCA 4KFSA 4O2BA 4YJKA 5ALLA 2HL6A 3N0VA 1OIVA 5HM8A 1PL0A 1GSOA 2WSYB 4PZ0A 3GO4A 5DI9A 2VT7A 4I9HA 4ZZ1A 4KGDA 1RAAA 4PZPA 5CDTA 1QO9A 2HRQA 3JXEA 3QX7A 4LCEA 3RRBA 4BP9A 2QMEA 1JR3E 4G6ZA 2NAFA 3N7AA 4DQKA 3TLMA 1ANKA 5DN6D 2B25A 1A5TA 1EB9A 1XDZA 5EIWA 2R6AA 2O57A 4Q7EA 1J39A 1JTVA 2P78A 3BMOB 5AM4A 4EBBA 3HU3A 2NU6A 1MNQA 4RHTA 1GILA 1Z68A 1T35A 1P2DA 4BVFA 1AB6A 1XRJA 4CLOA 4KODA 4TOIA 1H69A 3HYTA 4KR7A 5CIYA 1DBQA 3IT3A 3AOEC 4FCCA 3TLCA 3UG6A 3EMBA 3Q6NA 4FE7A 4MDFA 1V95A 2JIZD 1JHAA 4LJ9A 5ADHA 5GGYA 4FNAA 3HFJA 3FCYA 1EIWA 3CZ4A 3LF1A 4KN8A 1YQXA 1TW3A 1W46A 2GK7A 1SQGA 1KSHA 1G60A 3IHLA 3IAUA 4I9GA 4JC4A 3DEJA 1USVA 4Q18A 2VIIA 3FPEA 1JPNA 4LSWA 2HNKA 4J0IA 3S70A 5CFNA 1CYEA 1GYPA 5EJGA 1I4OA 3ROMA 1N0WA 1Y8QA 1QHGA 4WEOA 4D4GA 4LF8B 1EQUA 4EYEA 2W6QA 3WWOA 1TU3A 2KQUA 2DH6A 1FBTA 2Y1CA 1R3DA 2YFQA 3EZ9A 1M6HA 2DETA 5A5DA 2VCEA 4YACA 3OLCX 3NWPA 2OBMA 4KJXA 5JCPA 2YW2A 5I01A 4B5KA 1CZOA 4EABA 5IJ0B 1JHXA 4NAHA 5K0FA 3R0IA 3I1FA 2UZ1A 1VLVA 3ONFA 3HVRA 2P2ZA 4JP8A 4ZCPA 4M1ZA 9LDBA 4BEJA 3C6YA 2H48A 4LF4B 5ICGA 3O4IA 2WV9A 4LGYA 1G8FA 2WJ3A 2IV3A 1DUVG 2P0AA 2R4UA 1AUPA 4H6PA 5A3VA 1OXKB 4EW6A 5IDXA 1KP3A 4O63O 3SLGA 3K1YA 5WRFA 3WNQA 3RCBA 1M6NA 2RGUA 3S2GA 4PG5A 4E03A 4WERA 4KIFA 4RWEA 1HDOA 1O6FA 4EI9A 1ZJJA 3P2JA 4W1PA 4Z4IA 1JA9A 3ABSB 1GU7A 3JQDA 4O5AA 4XGIA 2WMOB 3TMKA 2ZTHA 1ZD1A 3BSSA 1VIDA 4I1VA 5F7JA 3VDMA 1RXCA 2Z9CA 1RJEA 2OP1A 3LLVA 3GPCA 4UBLA 1L3CA 5C8XA 6AT1A 2PXAA 2NG1A 8OHMA 1EBUA 5DASA 3UPDA 2GN9A 2C4WA 4TX1A 4JBWA 4HQOA 4TSFA 3E3NA 3VDQA 3BD8A 1LI4A 3IP5A 2DSTA 4PZUA 3UB3A 1E3WA 3F98A 4X92A 3ZNNA 2JASA 3NFYA 1AV7A 3DNFA 5BUZA 3RI3A 1H4TA 4MV1A 1JI0A 1U8UA 1QE5A 3AESB 4YUAA 4AMVA 3OUUA 3BCHA 2PZGA 1YK0A 3G02A 5EIEA 1BYIA 1EHCA 3PC8A 4BX8A 2CNWD 2R2AA 4NYMQ 2ZCJA 2LIPA 4ZYLA 4AKSA 2ES4A 5L4LA 4KW7A 3PNOA 4UQPA 3PE6A 1QRTA 4QULA 2GHQA 3GA5A 4BO0A 3LPMA 2ET6A 2R00A 2ZXEA 2QQGA 3NHSA 1E3TA 3R9IA 2YZMA 3DC2A 3RREA 3F0TA 2O2IA 3K16A 2OZKA 3A3NA 2I34A 1LA2A 4PHTA 1PZFA 1Z2DA 3HVIA 1QS0A 2JK0A 3K0AB 3A3KA 4ARCA 1ODIA 4HEHA 4RNDB 2I78A 2PGXA 2JJMA 3PYXA 3UUWA 3QF7A 1LVGA 2WM3A 3PE3A 4LN1A 1A5SB 4LMPA 4AC9A 2BFBB 3EX7C 5B53A 5CJPA 2WFAA 1ZYUA 2PV7A 2AT1A 3H8VA 1KAGA 2ADOA 4L74A 4CDGA 4ZTUB 1N9GB 1YC2A 3AL2A 4UFNA 3WLKX 3ADBA 2WT8A 3LZCA 3QZUA 3TJRA 1YSCA 3DGEC 4A82A 3K9FC 1CUEA 4BX9A 4ALJA 3HHEA 1U1FA 1BEZA 1W4RA 4J0FA 4TWAA 5GMOA 2WM2A 3TQTA 5J4VA 2JLVA 4OQ4A 1K66A 1XU7A 2GCOB 1T6XA 1G5QA 3LBYA 1RAEA 2P62A 3IAS6 3JQGB 1MOZA 1Y3DE 4G5YA 4Z0PA 2V7EA 1FUUA 3UK1A 3M33A 1SG9A 3DP7A 1W8IA 4G37A 3TUIC 5EXXA 2FE1A 4EW2A 1F6DA 4N5LA 2GEJA 4GZ6A 5L95A 3CNHA 1DTSA 2OZEA 3FCSB 4IX9A 4LMBA 4LZOA 4RJJA 3DAPA 3DDSA 3IR7A 2H2GA 4DJTA 5JW6A 3RTGA 2HD4A 2GBLC 1N6HA 3AL3A 4ZQHA 4RU1A 5ARCA 1SOWA 1GD1O 1Z25A 1FFXB 1ISMA 2CVZA 3M6AA 3MUEA 2B94A 3EIXA 3KB8A 3FNFA 5AKIA 3RKSA 3OFND 3AV3A 3ZH2A 3ZWMA 1QAMA 1NLYA 3VNUA 5B4UA 2GB4A 4WUTA 2IUTA 4RTLA 2C2XA 2H2AA 3RSFA 2X4LA 3H84A 1ZRSA 1M2KA 2Y1KA 1XAHA 3UOWA 4F5YA 1PG2A 1IOZA 1BWSA 3M6IA 2EDCA 1SOUA 3QLVA 4FMDB 3TEJA 7GPBA 4PLFA 4EENA 2C9OA 3COJA 2ZJ5A 3GDOA 4I6EA 4CBVA 3OF5A 4L4XA 1ICEA 5ELXA 1SXJE 1S8OA 4DLWA 1K92A 4BWYA 3F7TA 3D7RA 2P79A 1LDEA 1WPXA 5EEHA 1H2WA 5LQDA 1W96A 5DYWA 1DJMA 1NXXA 1C7QA 1HEIA 1I1NA 2XBMA 4HDQB 2W8ZA 4F4HA 2VSQA 4YRMA 3EPKA 2ONKA 1DC6A 3RKUA 4LYHA 5DHQA 2P4SA 1YAJA 2C4UA 1WUJS 4UU8A 2HT1A 4O6VA 3BXPA 3EQ7A 5JD4A 4AYTA 1L7MA 1WVMA 3UV6A 3NHZA 4MYUA 5B55A 1X2EA 2Y1EA 5A05A 3U39A 2AEJA 1LEHA 4XQ0A 4KO4S 3DV2A 2RHJA 4U2KA 4JKOA 5C8YF 2A1UB 1U0RA 4PO8A 2ZK7A 3LX6A 2Z5LA 2EW8A 4Q24A 5CVTA 4XFDA 4JLAA 5JE8A 3RFCA 4DPKA 1RXEA 1YZQA 4NMMA 5B7PA 5T4BA 2B8EA 3DOFA 1L4HA 3ZK8A 2AYYA 4YBZA 2Q4DA 2C2KA 1TLFA 2ZRMA 5ULLA 4PTLA 3V4LA 1GR1A 1N6RA 2QQ5A 2FSVC 2X6TA 4NZPA 4EPWA 1J9ZA 3ZWDA 4QGFA 4OG2A 2I03A 2VNIA 1N5LA 3F3SA 4S1NA 4CM4B 5A03A 3F1KA 1JL3A 4QJBA 1Z26A 2W6JA 2YFYA 3V4ZA 5BQOA 1DC7A 1C50A 3FNHA 4IZOA 5FWXA 5M04A 1Z3IX 2NO5A 3CNQS 4FYVA 2WJPA 3O3NB 3ZD9A 4GKJB 2CCJA 4QPNA 4EFKA 2GNAA 3E5NA 3T1QA 5JFTA 1GY8A 1U4SA 3P0FA 2WUVA 4ZALA 5BVGA 3EZGA 5ALPA 5ICSA 2OLKA 3F6RA 4P4SB 4FZJA 2FMFA 1JS1X 1YZUA 2PAAA 1E18A 4KYIB 2ATCA 5BSRA 2PQ6A 3IMGA 2CT8A 3PEYA 2R8RA 3IP9A 2GUGA 2K4MA 3K0FB 1KY5A 3KTAA 4LYYA 5SZHB 2GTHA 4GI1A 3KCQA 2UKDA 1E20A 2EARA 5AK5A 3T5GA 3WO0A 3V3KA 4AZ3B 1YF3A 4HUQA 2Z6VA 4GSKA 4ILKA 4OHZA 1FFHA 4KQFA 1CDOA 2G5PA 4NULA 3UUFA 3CUEF 2A9RA 2V55B 1IN7A 1BJRE 4GXTA 1H0HA 5T64A 2ZWIA 3NNNA 4PGAA 5ILOA 3S40A 4IIJA 5HKKD 4HP8A 1HEUA 1Y7PA 5P21A 4EG6A 3BTUA 5FOVA 2ZJOA 3GJ5A 3M81A 3PICA 4JNKA 4W9NC 3U9LA 3X2SA 2WD9A 1E0JA 4WHMA 4NAUA 4IO1A 4QQNA 3K5HA 3TOSA 2FPKA 2RH8A 4CEIA 1BWQA 3TX2A 1IHUA 1S6YA 3KXKA 2F8TA 3I62A 1Y5IA 3NYIA 1SJ9A 1NKVA 5BVGB 1UPUA 5C53B 1HZJA 1TF2A 2W2QA 2WRZA 3OJEA 4MUMA 2FOIA 5JLJA 2IEBA 2XUAA 4CQMA 1D0IA 1PCXA 3WXMA 3WL8A 3RJ5A 3DDWA 4AM8A 4F4DA 5JZ9A 4A6DA 3HKEA 121PA 2PCJA 5KYNA 3L06A 1OVGA 1ZCZA 2BFPA 4HGPA 4IMPA 4NFYA 4BJ6A 1KYWA 3QMWA 2J9YB 1GU1A 2QP3A 1DTEA 3JR7A 3P4UA 2COUA 3NKLA 4D3SA 3NR2A 4B82A 2YCLA 2CVFA 3A4IA 1GV1A 2R8YA 1NMZA 2XQIA 1QDLB 2HU8A 3OKAA 4EKNB 3U7HB 4AKTA 3TOCA 1PT7A 3EGVA 3HDHA 4BN4A 1RLOA 4PF1A 1X0VA 3MM4A 2HCTA 4B3SB 1NVWQ 1NATA 5FPKA 1YD7A 3PZBA 5I9SA 5LNK1 2YZKA 4NCNA 1D0VA 3TI9A 4BLRA 1I1QB 1BN6A 2QJRA 3MN1A 4LXTA 4LWOA 1OMOA 3WBKA 1QCZA 3GR6A 4ALNA 4RJLA 1CS0A 1YQDA 2QYSA 1KH2A 2VQ3A 2WF5A 1ZEJA 5JJBA 1CF4A 1OA0A 4HG2A 3I34X 2FX2A 3G1WA 3P0IA 3KOYA 2GWRA 2JI9A 2IP4A 3PQDA 4WN9B 1SVUA 4YMGA 4TGLA 3MMSA 5ALTA 5HPYB 4UTNA 2WWGA 3U7QB 1VL8A 2ZTUA 2JHGA 4JKIA 4G1EB 4Q19A 3SLRA 2G40A 3WK9A 4L75A 1EHYA 3BDAA 1Z3CA 5KSPA 3OIWA 4AWBA 4MPTA 4RZ3A 4LYAA 3SC6A 4RZIA 1GKIA 2NYUA 1NT4A 3KU1A 4J2HA 2I22A 3HSKA 4WCFB 1YGPA 5JXWA 2ZS9A 4PR3A 3WTBA 5EWLA 2J9XB 3LYHA 1MVOA 4HDMB 4F0JA 1U80A 2WSLA 4QG7A 1QIMA 1EDDA 3R6DA 3OCJA 3U31A 5C8VA 2D7CA 5C46F 5CLGA 3SE0A 1U8XX 2YZNA 4QT0A 4FYXA 4XDZA 5E4JA 5A5GA 1TEZA 1T8YA 2DRIA 3QA9A 4Q3BA 2WLTA 4M36A 5EXEA 1X80B 1ZQ1A 4F21A 1QFJA 2LZ0A 1UFQA 2HWXA 2VTVA 5JC1A 4RTJA 1JLRA 1OV4A 4GWKA 4XJVA 4AKIA 2AI3A 1FLDA 4MUJA 5F7ZA 4PLCA 1JHYA 2OGTA 1ZMBA 4M9CA 4WA8A 4XDGA 3RFFA 1PDVA 4L02A 2AJLI 1AY0A 4K9RA 4AROA 4CHTA 5CITA 2B36A 1XTUA 5IAGA 2IH4A 1P45A 1Z45A 1DIHA 2IDJA 2UUPA 3W5UA 5J4KA 3LPDA 1S4QA 3LNTA 5DXJA 4DOMA 1PUIA 3ITEA 2E4XA 3B9RA 1RTTA 1SIWA 4MVYA 3VTKA 1PFUA 4ZV9A 1K7YA 1AA9A 3A6DA 2ZZKA 1WBJB 2PX5A 4GF5A 4IS2A 4MHTA 2KMLA 4R51A 4E5UA 1RIIA 1I80A 5JDCC 3RTDA 3N2KB 1GAJA 1U63A 1PS0A 4D3FA 3QKIA 3VDRA 1FW8A 3IRUA 3A1DA 3NEAA 4LRTB 3CA8A 3N2IA 4LRSB 5K4AA 3VSEA 1C9MA 1NKSA 3KZMA 1OHHA 4CWAA 1OZFA 3TK1A 1CYDA 2A9QA 1UXJA 3AEKA 3Q7RA 1JFLA 1KBQA 1Z47A 3TLKA 5GJVC 2PK3A 2PGAA 2PQ2A 2LUOA 2QTMA 3FYUA 3PE4A 1IH8A 1Z34A 2WKWA 4DV0B 2IYOA 4A16A 3VYSB 2Y8EA 1QGUA 1Z88A 4PQEA 2RGYA 3SFZA 3L4KA 5I5GA 4GEKA 1YT5A 3VHXA 1N33B 4D25A 1PJQA 3O8OB 3E35A 1X86B 1XD9A 2FOLA 4U7PB 2X58A 1PS8A 5JTUA 1PV2A 3AR2A 2V98A 1JXQA 4PX3A 1MLDA 3PQ7A 4R2MA 5CDFE 2JVJA 5JQGA 3II6X 2C5AA 3E6AA 3PJFA 4KI7A 5GQSA 3U7JA 2ZU6A 3J7TA 1NNLA 4ZZ3A 2O3SA 1CSEE 1JQDA 1BDIA 5E3HA 3AI3A 2JCBA 3CW8X 2SECE 1RFLA 1EUZA 5CFMA 5DSXA 1C9JA 2AF3C 3MWLA 5IKXA 5BWLA 4MKZA 1TM7E 1NMYA 1GGHA 2EX4A 2PMFA 2BUAA 2CHVA 2QVXX 3Q8MA 2C7OA 2H9YA 5DTEA 2BEVA 4YA6A 4YJ2A 4HSEA 1N8KA 1S3IA 3EDMA 1QUEA 5ECGC 1XN4A 2CLKB 4JA2A 3FIUA 3FVVA 3OZUA 4JITA 5E7IA 4FKBA 5B6PA 4LGMA 1E69A 3R75A 4C29A 2TMGA 3K9CA 4QUDA 5FTLA 1HL3A 3PXUA 3ZD6A 1Q3HA 2J6CA 1JHOA 2JK1A 5K05A 4AY2A 3ROZA 1NLFA 3MAGA 1KVTA 4MYDA 4K6OA 2JIQA 3GGDA 3LVBA 1E63A 3A2NA 5IXSA 1XU9A 5IYZB 1NI3A 1CEYA 3ZVRA 2IYWA 3RTCA 2CXHA 4BXOA 3B7GA 1S2GA 3E53A 3ONDA 1VJRA 5KYYA 5FAKA 4RHCA 1RE1A 3K9GA 3QHQA 1R9GA 1XNQB 1LSOA 1EFCA 2PBRA 3QV1A 1YR2A 4LI0A 4OXXA 4TQGA 4L6AA 2ARKA 3TSOA 1Y6FA 4HX2A 2RCNA 4ND7A 3W5BA 3CO0S 2BEWA 3FUWA 2VZ8A 3LP8A 3RSLA 2HPAA 2W58A 5JSYA 4BIIA 1T9CA 5B7NA 1IBSA 5FBVB 1PR3A 3FNEA 1VI5A 3LY8A 1QE3A 5AHWA 1VPLA 4MHOA 2R6ZA 3KUKA 4H6XA 4P93A 5DXFA 1ZXLA 1QG4A 4OQFA 3WLHA 1T34A 4TUYA 4FB5A 3IMEA 2X9GA 2XODA 2WTBA 4KZPA 2FI1A 4GOKA 1V7CA 1FXWF 1SXJD 2I99A 2MU1A 3GAMA 3GGOA 2FWJA 2ZQZA 4EWLA 2GPJA 3IESA 3BFXA 1NUAA 5C5IA 3EC2A 3T9BA 1E8MA 2G1AA 4BKQA 3DFUA 4B3CA 1P0IA 3IHTA 3W5DA 1P0CA 1W1IA 4LBYA 1W8DA 2YICA 3FAKA 2BD0A 1J22A 1UK9A 2DUJA 2VHQA 1FJXA 4LAFA 3THWA 1SVLA 3E61A 4JGIA 3BB4A 1VDZA 1G17A 4GWGA 5HIMA 5T4HA 2F8MA 4E88A 2D00A 4JBGA 1DEHA 1LZKA 2F9MA 3KLNA 4L3OA 1I4WA 1VBKA 4GGPA 2EIHA 1GU0A 1XAIA 2GVNA 3ILVA 4OUDB 1SQFA 4PLYA 1ABEA 3OZGA 3Q0IA 2WAMA 4FYJA 4YS6A 1K63A 2D1RA 4OHWA 4QG3A 1X7XB 1GLGA 1B8NA 2E4UA 3AKDA 5BRNA 1OGYA 1XK6A 3O21A 3EYAA 2M6RA 4X3PA 3WBJA 1A7JA 2P6UA 2X5NA 1C80A 3T7TA 5I4KA 1KP9A 2ZT7A 3WIOA 4TXNA 5CDSA 4ROTA 1E1CB 2OECA 2XYVA 4WKCA 4E3WA 2BFNA 5CJ2A 2EFCB 5F1OA 4NENA 2KJQA 2BP7B 1N8TA 3VI3B 4TV8B 4L0QA 1Z5OA 4N3CA 3QYAA 1Z6PA 1UP6A 4OMCA 1FDSA 3TNDA 4YRLA 5FBKA 2MOKA 2E55A 4QHYA 2QSUA 2JGKA 3K9NA 3QENA 5KTPA 3S7TA 3N2YA 4DCGA 1R50A 3AEUB 1E2BA 1Y3IA 2ZBVA 3A1SA 4C7OB 3M6VA 2X8AA 4NJEA 4JXKA 1SXJB 4UTXA 1J97A 3AF0A 4ZCQA 4UM9D 3T38A 1QQ5A 1JJVA 3IAM1 1MJ5A 4IDBA 1L7AA 4UD2A 4DXAA 5K0EA 3V8VA 1KF0A 2HRBA 5A4AA 4URZR 4BNYA 1PJ3A 2PL3A 4DLUA 4P0QB 1P6UA 2HM7A 1DWOA 1V8FA 1D5CA 1CZRA 1Q5PA 4MV3A 2CNKA 2Z3VA 1IHXA 1NBHA 1W29A 4R2XA 3RJMA 3KFLA 5GVSA 1QBGA 4DLYA 3W2TA 4BWGA 1ISHA 1E2UA 5KQPA 3AI2A 1XJCA 3GHYA 1UMKA 1NI4B 2Q3LA 2AC2A 4KU4A 4I4IA 4K9KA 4UBKA 2VP6A 1UADA 3A25A 3HXOA 2PZFA 3GYGA 4ASUA 4H9GA 3HLTA 1I4TD 4JS0A 1P4SA 2Y99A 5E4FA 3WADA 4RE6A 1FSFA 2QN6A 3PEVA 2RAUA 4YY3B 1PFKA 1G2IA 3H5OA 1MIOB 1WB5A 1K97A 2H31A 4QUHA 4XWAA 3WYEA 3TNFA 1MBZA 2D3WA 1JVSA 2PD4A 1K4KA 3FFXA 1QR6A 3SSMA 4LISA 2QJWA 5IK2A 4FB4A 5KSYA 2CC2A 4KPYA 3FDXA 3L0PA 3S5UA 5EMNA 4JB3A 4DKJA 1EFPA 4MLZA 2C07A 2WDZA 4G01B 1I5RA 3CUTA 1Q22A 2XMDA 5G1NA 2PEZA 4HAUA 3DJFA 5CCBA 4HPWA 2WWFA 3HA2A 3FDZA 3QFFA 4JZKA 3L8EA 4UHHA 3MSXA 3KBBA 2W9XA 2XJ4A 1GDHA 1R8QA 5AICA 4UM9B 5DX1A 4L9AA 1KKLA 4O4LF 4BIMA 1OC4A 5BMVF 1WEHA 3C5HA 1UDBA 4M7PA 2O5CA 1I4LD 3OIFA 3T9DA 2IU6A 2P9FA 3L4BC 1ZOLA 1UBCA 2Z5VA 4RPHA 4YCSA 3N3AC 3P96A 4GBED 2JCGA 2ZRBA 3RLFA 4KHZA 1EFVA 1UBNA 4WAUA 3IGFA 2VJOA 4DBZA 4MK4A 4DJJA 1QV6A 4YECA 3P9RA 4V24A 4CETA 1YVDA 1T8PA 2HEGA 2JPDA 2JZOA 3G2NA 3DA8A 3LKBA 4N49A 4E31A 3UAVA 5CG1A 721PA 3DR3A 4M0PA 1QAQA 4DA4A 1N5OX 3RYFA 3JQ9A 4HDKA 4IDAA 2AJCA 3CN7A 3TI7A 5EUCA 1H9AA 2GD0A 3NDPA 4IV8A 3S8YA 3TSAA 4ZWNA 3D8RA 1GM5A 2IW1A 4BCCA 2GKSA 3MINB 3G0OA 3MWEB 4MAMA 2QSYA 2JL1A 2NYRA 3KVYA 2W48A 3OZ7A 3PSAA 3R7AA 2RHGB 8AT1A 3NM4A 2CLEB 3AXSA 4KAJA 2IHNA 4EPRA 3SAJA 1L4KA 1RWMA 2GARA 2IGTA 3FZGA 4AFNA 2AB0A 4R2HA 1Y8RB 3E5MA 5ALDA 3LQ2A 5BOVA 1L3BA 4HXFB 3KR2A 4HWRA 3N8HA 4YNBA 2PWPA 2HF9A 2XDWA 2I4IA 2C82A 1YGYA 3DV0A 2C5BA 3T6KA 4F2GA 1TA9A 5H9VA 3U40A 1J5XA 1RYZA 2CYAA 4WBNB 1PV1A 3AHGA 1GTSA 1SBCA 1KJNA 1MOSA 2JLQA 2FEKA 3LUCA 2RGWA 1N5DA 1CVRA 2V8BA 3HI4A 3LGAA 1NZDA 1YMQA 2IE0A 1UDXA 3BZUA 3L7LA 4G5QA 4WKBA 4RC9A 5DMHA 4NWIA 2O07A 1F60A 5D01A 4QYIB 1S8AA 3CO5A 3PXCX 4AF8A 4RF4A 1LGYA 2W90A 3OPYB 4Y67A 3G9TA 3S28A 3ZNPA 4JB2A 1JHZA 4X6YA 1TM3E 1PSDA 3GRAA 4IVQA 4MRSA 4RABA 3C3XA 1MB9A 2PR7A 1M2WA 2BSAA 3ETGA 2B1QA 3KQMA 4FT4A 2QMQA 2P6NA 4LNAA 3RVBA 5DNAA 4RGBA 4EW3A 1SBTA 2IJGX 2PGJA 2X8LA 4WFIA 2JIPA 1R88A 1N25A 5HGJA 5EZYB 4A4DA 3H9JA 4ZO8A 4GU5A 4XARA 3IVCA 1QTIA 3U60B 1JEOA 4OB7A 3HR4A 4RETA 2WOJA 3LA6A 4WINA 2R1VA 1XRPA 3J81A 1IYZA 1A95A 1X1QA 2NVBA 3M2TA 5BR4A 2Q9CA 1IBCA 3AO0B 4KNVA 1MO5A 2CYCA 3H6GA 4LRQA 4UPDA 5FNVF 2J30A 4BGUA 4IJ6A 3THXA 3BKXA 4GM0A 1YBAA 4JCOA 3U4QA 4D9EA 1JVBA 2QY9A 2QTTA 4DQLA 1ECLA 4ETNA 4MP3A 1KO4A 2GR9A 1JR2A 5EMKA 3ZYCA 1GZ3A 4P9NA 5HUHA 5LQCA 3G8CA 1MO3A 2IBTA 2GWHA 1O6CA 1KBOA 1C5KA 5EHGA 2CZQA 4ZOLF 3RTEA 2VRBA 3DC7A 4Q66C 4CMIA 5KOYA 1ZNQO 3MS4A 3TGPA 4QU0A 3QF4B 4A0QA 1GHTA 2YHBA 1YI8A 4IDNA 2LPMA 1P33A 4LTNA 5JASA 4DLNA 5FPYA 4S3MA 2VSOA 2OQVA 1UWCA 3I9LA 2Z83A 2AVDA 4HFRA 3RIXA 1GPKA 1TJ5A 2BAGA 4NYIQ 3PIDA 3UFBA 3HZOA 1SKQA 5FULA 4CFSA 2HPVA 1GLVA 4K6KA 3U4HA 2EGGA 3GEIA 5JANA 1EVZA 1Y98A 3FPFA 5AM1A 1G8SA 3MWDA 3UC5A 3CH6A 1ZIXA 1A96A 1M7BA 3I2KA 3IEMA 1R0CA 5KX5F 2AK3A 1ADBA 3FTQA 1UOPA 3BILA 1Z4NA 3FW1A 1TADA 2AR0A 3B7WA 3EZ2A 3MJEA 3AONB 4JQOA 2FW0A 4D8WA 4ESOA 4UMFA 3DZHA 4WCDA 2VJLA 3SX0A 2C94A 3ZWQA 3QXGA 2FMUA 4J03A 1G5RA 1G2OA 2EWMA 2IKSA 3IQEA 4UEKA 5DXAA 2Y27A 5LJIA 2Y6VA 3WR5A 3FSEA 5HDQA 5BQFA 5JV5A 1OSNA 1DKPA 5ESDA 1OQAA 2EVWX 3L8CA 5EJ2A 4FCTA 5CBPA 3HU5A 3VU9B 4NYJR 4JYAB 2AN1A 4S1OA 2DOKA 4RS4A 1FVFA 1YOBA 1MIHA 2HDWA 5F4BA 4RQBA 3KR0A 3V34A 3U49A 2AQIA 2VEOA 1LBIA 3TCKA 2GCNA 2X4IA 3W3ZB 1Q19A 2JGEA 2EW2A 1B4DA 1L4BA 2FEAA 1DPGA 1VA4A 3LBNA 4AS2A 1N2BA 3OZEA 2PS9A 4HYYA 2ZWPA 2FQQA 1A3CA 3UG7A 4D8VA 2KB0A 1JZSA 1R16A 3EZXA 5IWCA 3ZU6A 2VATA 3RU7A 1OILA 3D0RA 2YV3A 2ORIA 2WG2A 4K5QA 4AZWA 5K8LA 2I2WA 5FR1A 4BNDA 1FNDA 3SXUA 4D44A 1Z6QA 4BO7A 3BA1A 3QUQA 1L7PA 4ZJUA 1IXSB 1RRVA 2AXQA 1T5OA 2VH5R 2YN4A 1PR4A 4FYMA 3ZD8A 2HCFA 5ED4A 3O75A 1KHHA 2XYPA 1SKYE 4Y2JA 4PYJA 3ZWCA 4YUXA 4WZ6A 1OX6A 3F1LA 3GCZA 4UAUA 1DDIA 1BKSB 1OF1A 1T2FA 1TTQB 2H07A 2PSDA 3SYTA 3RT9A 5E9QA 3I5AA 3PCXA 4O1IA 3VR4H 4G0UA 2VZ0A 2PZLA 3B13B 1OZ0A 4BL5A 1FFDA 2IELA 3EFBA 2GJAA 2XWQA 5LP6B 4LJ7A 2IYRA 3JQBC 3P19A 3GEMA 2GBFA 3VR4D 2VPWA 5LYYA 4EHBA 3N3BC 4I2NA 2YKGA 1INLA 1KYXA 4IMJB 3IBTA 4EB6A 1QB7A 4KB5A 2Y3IA 3DOIA 3NT2A 4K9MA 1E32A 1H1LB 4PC2A 3FOZA 1BO6A 2GZ3A 4QREA 3AY7A 2HDHA 3ZBTA 3PUZA 4GOMD 8ATCA 4RY8A 2CFRA 5JAUA 2ZRLA 3AR4A 4FX2A 1QQ6A 4QOSA 5CNKA 4CM6A 5AUOB 5I7EA 2JLWA 4YRIA 4ZYVA 3IQHX 1FSZA 1ZA1A 3H9GA 1JA0A 1MG0A 3EGDB 3P0RA 4FE4A 3SZLA 1NW9B 3KPWA 4XWWA 1W19A 2FUCA 3PGXA 1D8AA 3U6BA 5JTTA 2YBDA 4GE0A 2JFHA 3GJ4A 4GLLA 1VP9A 1ZBQA 3K2BA 16PKA 1II8B 1OYWA 1Q20A 1U3TA 3ELDA 1H1DA 2NUPB 3PF9A 3ROXA 3RS2A 3LX4A 1LPPA 3ME5A 3PNKA 3R40A 4QXAA 4LDZA 4YAIA 5ALFA 3DWEX 4OBXA 1EK1A 5EP1A 2WZBA 4KLCA 5L51A 4QAQA 1TA4A 2CLCX 3C45A 1TZMA 2I4RA 5TQJA 1E4OA 2DC1A 1J8QA 5KBYA 3L41A 4D1YA 1FRFS 4QBTA 2FPPA 2XV1A 2VUHB 3M0EA 1XX6A 1CRPA 3LA8A 1TZBA 3LOQA 4FGKA 1NLMA 4KUHA 4UNQA 4MRMA 3G88A 5AXCA 4DKXA 4ARAA 2XQGA 2G4LA 3L8HA 2IW3A 2BKXA 4GR9A 3PKZA 3TG8A 2CLHB 1TCUA 3WB2A 4ZCIA 1V8BA 3C7DB 3CB2A 4QDOA 2X2FA 4OXQA 5E2IA 1GPUA 4C07A 1UJCA 4YDRA 1R9JA 3UKDA 5MGBA 1PT9A 1MO2A 1EA7A 2GEDA 1G41A 1OBOA 3SCZA 3RBZA 4BRUA 4XVUA 1PW7A 2VDUE 3ZJUA 1Q6ZA 3K2IA 2H1HA 2JIDA 2XT0A 5MN5A 3AF4A 1UP7A 5DF1A 1UEXC 1E5DA 4M0CA 3WJAA 1W5EA 1D04A 1W73A 2HJSA 2ZE5A 3M3HA 4W1SA 4QDJA 1M1YE 1R64A 2AFIE 4A0HA 2FFAA 4XIFA 1U0TA 4NL4H 1U2ZA 2B4RO 2JBWA 3CLKA 5G02A 5JY1A 4JB8A 4HWSA 4GPD1 1Y9AA 4ZN6A 2SCUA 3E05A 5KCZA 4DIOA 1CUJA 1Y8AA 3KEOA 1UKBA 2PR2A 1JIVA 3GJ0A 4RSMA 2OMEA 4X0EA 1VHQA 2X5OA 1COWD 4B44A 1OE0A 3EVBA 3QW2A 2OLJA 3P26A 5A0VA 4N5MA 1TCVA 1Z2OX 1E4EB 3PD1A 5FP0A 2E5LB 4BBJA 5DNYB 5H4HA 2WU0A 1U3VA 5T3YA 2IHKA 3Q3EA 3AHDA 2VYCA 1FP2A 4RHXA 2FG5A 5EJ6A 2AXNA 5BR1A 1XZFA 3T7AA 3CVOA 1LJUA 2RHDA 1P0QA 1RMYA 3ICVA 1YDWA 4XWTA 3TW0A 5HQ3B 2D0IA 2BFCA 3BZBA 3DLBA 1MA3A 2B1GA 1VOTA 1T3ZA 4HS9A 2YJZA 1JI3A 4RYLA 3RVRA 4JUCA 4Q7QA 4ZYUA 5AESA 3JAMA 1KZ7B 2V0NA 4KH1A 1L5RA 1XEXA 3IDQA 1JG1A 1OT5A 2MR5A 2J0UA 3LQYA 3ICQB 1O95A 3CJTA 1EM6A 5EYPA 1Z2NX 2Z57A 4N0MA 4ARZA 2PTHA 3CUSA 1W0JD 5BPFA 1Z5WA 4HAIA 2QNIA 2QRVA 1TECE 1ZL0A 2ZJ1A 1QGZA 4CKWA 1RWNA 3OJWA 4LRUA 4MW4A 4PBRA 5B36A 1THGA 4XOIA 2XX3A 1R7RA 1D07A 2BHSA 2BMVA 3PDWA 1QZTA 1YBFA 2WJ6A 3JX9A 3PVZA 3QFRA 2GJ8A 4BJ1A 4AY5A 3B48A 4PVDA 2HSJA 4RKEA 4NQRA 4ZQCB 3VHLB 1A27A 2VZ9A 4B31A 4QBFA 4C2UA 4N39A 3H7IA 5DNVA 4XX1A 5F1YA 1CZKA 2XI4A 2NACA 4RJKA 5NLLA 1NW3A 1PTJA 2QN2A 3KDPA 3R44A 2HQRA 3QHAA 2DEUA 1NRXA 1SD5A 3TWOA 2A0UA 3ER8A 1Q83A 3JALA 1UAGA 4PLTA 3IO5A 2WWTA 5IMBA 3T1NA 2OOSA 3H16A 2ZUFA 1Y7HA 3EEFA 2HJGA 3JARA 3DSRA 4HXEB 3BM5A 3OZRA 4TL6A 2HC9A 4Y2SA 1T2VA 1V8ZA 1QK5A 2JFNA 2A7XA 1YDFA 3E8XA 3L4EA 2QTHA 4PX5A 2O8BA 4D9MA 1BU8A 3CLRC 2FWIA 5IZCA 3DPIA 5D51S 1LLFA 3UHOA 4RPKA 3UH0A 1RZ3A 2R6JA 2V9CA 2VWHA 4OHRA 2XYGA 1SB8A 3CRNA 3F6EX 2YJNA 1SZDA 4WBSA 2I1VB 2V6BA 2WB2A 3C24A 2FR8A 3ASVA 2REQB 3EPJA 1UPFA 2IF0A 2YRXA 5DSTA 4HLUA 3FHJA 5H5JA 1TFUA 4PLWA 2Q3EA 3HR7A 3GF4A 1S4MA 2YOGA 3D54D 5KNCH 1TUEA 4HQ6A 2OUIA 4YWJA 3IQGX 1ONBA 3D5QA 3IO3A 1ESEA 4GPBA 4DSOA 5L7YA 1HC7A 4GAEA 3L7JA 3AIIA 2E37A 3D81A 3WYCA 5JYEA 5KNCD 1W5SA 1BQ4A 2M98A 1K68A 4MS1A 1FK8A 2GM5A 3CISA 5HE8A 3LP6A 5TXGA 3I1IA 3T4UA 4KQJA 4DLXA 1QIJA 3H2ZA 4GXQA 5CD9A 3JYHA 4X60A 2IUEA 2PKWA 1QG0A 4TTAA 1NSFA 1W88B 5CR9A 2FPOA 4JQYA 3H2JA 4YMWA 1IHOA 2VDVE 5LB2A 3U7RA 2PKCA 4GSYA 3HKBB 4W6ZA 1GNSA 3B51X 2CW5A 2I7VA 1D9XA 3A3YA 2VLIA 4RTMA 3TNYA 1ZMOA 1NX9A 3L18A 3TRFA 4BNJA 3LY9A 3RS4A 2IRWA 1K08A 4EUKA 4M0FA 2ZAGA 5BV0A 1A8IA 1V8DA 3HCEA 3VNVA 1ESZA 1EBFA 3H18A 1ULHA 4HOYA 3UK6A 3MGAA 1MEJA 1RACA 5EG5A 4ZI3A 1JYSA 1XRNA 1IXYA 4BKRA 3EVGA 1O54A 1L8OA 3O90A 4DIDA 3TUZC 1XRSB 2D2FA 2XB6A 4O4LA 2CYBA 2EFYA 3QPWA 4L0DA 1E99A 3T0FA 3X1KA 5IKMA 3R8FA 4TKZA 4FGWA 4AZ0A 3RK4A 1M6WA 1N1MA 2Y92A 1SBIA 4TT3A 2WICA 5F98A 3QSGA 5PNTA 3M6MD 3G49A 1H3FA 4WXMA 1YKFA 3TM4A 2PTGA 5I3ZA 3NNDA 4G9BA 4N9WA 4I99A 3NXKA 4J0EA 2O7RA 3EGIA 3WP0A 1U4OA 3RIEA 3TTYA 4O1MA 3WGQA 4YUVA 4HZUB 2LXNA 5H59A 1YZYA 2XECA 1TIKA 4Q37A 3WNZA 5C32A 1NQWA 1OX4A 2J5RA 2MHCA 1TQ2A 2PO7A 2PZJA 4CL0A 3TLBA 2Q8NA 1FA9A 4KUGA 1J9EA 1L7BA 1TTHA 4HNHA 3AR6A 4UJ3A 4XOUA 1CZUA 3ZWPA 4KP7A 5U9CA 4BEBA 1PFGA 2WFMA 3GZNB 3REQA 3GPBA 1CU1A 3I53A 4OFXA 3QEAZ 1XYGA 2ZUSA 2J0SA 1R5BA 1XVUA 1E64A 2BC9A 2HF7A 3LT0A 4S12A 5JCOC 5ALYA 2ZB4A 3UWKA 3IEIA 4FQ7A 1P9NA 3E7WA 4F84A 1MV8A 1TEVA 2HXGA 3UAWA 1Z15A 1E3LA 1KDPA 1IN8A 1C9DB 3FTPA 3GLHA 1FX1A 1Z6GA 2CMHA 5FRDA 3BIWA 5AXAA 1AMNA 1C3JA 2JLUA 3QLUA 2QMUA 1Q2UA 3Q1LA 3X1MA 1KGSA 2BUBA 4C6TA 1W9MA 3AMVA 3TPZA 2XKBA 1HURA 4PZZA 3CURA 1Y7LA 2I3ZA 3F9RA 2GUWA 2ZRAA 3IP8A 1RHUA 1QRDA 3OPXA 4Y1RA 2WC1A 4OBWA 5AHRA 3ZXUB 2FXVA 1GPMA 3AI1A 1BMFD 1I3MA 1P44A 1ZM4A 2NM0A 5DI3B 5DX8A 1P60A 1HLPA 3TXXA 3RUCA 3SJZA 3U48A 4TRMA 3G5UA 4MITA 1K6EA 3R0JA 4L7QA 1K7XB 2QJOA 3HWRA 1F2UB 3MGKA 5E1BA 3N28A 1NVVR 1VJCA 2C5FA 2GTPA 3MUNA 5GAJA 4YR9A 4N0EA 1FDUA 1ZH4A 3E03A 1URPA 1Z82A 4XVRA 3RADC 2R5NA 3HO8A 3K1JA 1G0NA 1DAOA 2DKNA 4GG1A 4L0CA 1TPZA 1BU5A 2R8BA 4MTCA 4YJHB 5CP8A 5EA2A 3WXBA 2H52A 1OBHA 5E1OA 4B6JA 2EU8A 1GWNA 1GGJA 4XLZA 2HBZA 2BDTA 3KT8A 4ND8B 4UNPA 1JQBA 1UJ6A 2W2XA 4CE6A 2ASVA 3K1AA 4M7WA 4QGSA 7ABPA 2WUGA 2C7VA 3IV6A 1LWOA 4P08A 1MRZA 1BA2A 3D31A 5FNVA 4MW2A 2I62A 5DTMA 4DV4B 5CHEA 1QZUA 3OO1A 2PKEA 3H1BA 4FN4A 1BJKA 2RMKA 2Q07A 2HHAA 2F67A 2OP0A 4TL8A 5BWCA 3WRVA 2FGJA 1HSOA 2WZQA 3AU8A 4BPBA 3DGFC 4C6HA 2DFDA 4FDTA 4ZOLA 2AZDA 4YHHB 3TL2A 5F3WB 4ZQGA 2J3LA 1T9HA 3SOPA 3Q3GE 3RAPR 3SJBA 2ID9A 1LSJA 1JHDA 1D1TA 1RHKA 4RCYA 3ZDRA 4NBLA 3PXXA 1BH6A 3T3HA 5L40A 1TT5B 1XAGA 5DP1A 3R20A 2ZI3A 1IY8A 4ZHQF 2ON6A 5EOVA 1E7RA 4B6OA 1N3LA 1XNJA 3FKSD 1SB9A 4M9XA 4YT2A 4ABYA 1RZRD 1DWUA 2CLDX 1RYFA 2ZITA 3ZV7A 3ETEA 3GNTA 1ZGGA 4B45A 4FNMA 4D9FA 3C1AA 5KX5A 2WTMA 3Q15C 2ZSFA 4LDQA 4YV7A 5I45A 2GDJA 3BULA 3VSAA 4ACBA 2DHQA 1PO7A 2CLIB 1J8YF 1NY6A 3KP1A 4IZ6A 4NOMA 3JASA 3B60A 4NV0A 4R8KA 4PPNA 4EZEA 5I9MA 3K8QA 4MA4A 4DTIA 1V7QA 4IWYA 2E4YA 3O4FA 4XJXA 5KNDA 2QZZA 1HLGA 2F9FA 5BVHB 4NZ9A 1EEXB 1NF3A 1ZRNA 1JHVA 3NNSA 5C35A 5J4YA 5LZ9A 4G8CA 4MP6A 1CS4C 5CFZA 2EFGA 5LIRA 1KSJA 5CURA 2W42A 2G3YA 3BE5A 1WXQA 2JJQA 1ODSA 4Y1EA 3T4XA 1G5FA 1NZJA 2REXB 4DQ0A 2OOKA 2BBSA 3LDFA 4QPCA 1MAUA 4YI3A 5I9BA 2WMYA 4OMFG 4B80A 1K9SA 2W5UA 2CV2A 1L5HA 1Z75A 2IODA 3M6UA 3JR3A 2IUYA 4LX8A 5CLIA 4YN3A 1QANA 1J0CA 3TLGA 3X1ZA 2HH9A 1O2DA 4BJ3A 5ITWA 4BMDA 2ZSEA 1DUSA 3O0DA 5F1PA 1U2QA 4C06A 2D5IA 4PFQA 5JNVA 3KHSA 1AQUA 2A3RA 2ZT6A 3ESDA 3FGNA 4MZXA 4V39A 5ALRA 3FG9A 3RS8A 3TZBA 3DAOA 3VU8A 4AU1A 1T0JB 2WWHA 4WZBA 1BROA 2OD7A 2NQTA 1P9WA 1KHTA 1AS2A 4LE0A 3FBTA 3KPVA 3N5KA 5EZ6B 4IHJF 3TSYA 2P4UA 2HMYB 3A6LA 3BEOA 1DZ3A 4UTZA 4MQUA 2E48A 2CHQA 4LQDA 5DHSA 3WYDA 1EGQA 4INZA 2XQJA 2W7TA 1ODKA 3GU3A 4FTWA 5HJEA 2HMTA 2OVBA 2Q3DA 2DB3A 4FYYA 2QUAA 4HMPA 4EYKA 1XHLA 1IVYA 3CF4G 1IJKA 3D3JA 1H8ED 1ONOA 1U1CA 1SVIA 1ZIYA 1P4GA 2A9JA 2VJBA 3GARA 5CVEA 5FL7D 1JEYA 5TE9A 3VPCA 2ZB2A 1YASA 2NVOA 3OOSA 1P9LA 1S2OA 2CJPA 1QZ3A 2AFIB 1U2TA 2PSEA 3BHMA 3DDZX 3A1VA 2PU7A 2RI1A 3DZIA 3TPFA 4ZIRB 1SXHA 4M8SA 4YJFA 5JXHA 5BRAA 5A06A 5D6OA 3RS9A 1AGNA 2EJTA 2ZKLA 3VXKA 3R7LA 5SZJA 3LLSA 2DLDA 4DR3B 1TU4A 4FNOA 1DWPA 1XD8A 3DFFA 4NPCA 1ZVQA 3GVCA 1AKTA 2WJYA 3NOXA 1DEAA 1KK1A 1S5PA 3OTIA 8MHTA 5U1PA 3WZ2A 1YE8A 1N6IA 3OT5A 2VJCA 4BCDA 1XFAA 1H0KA 2HU5A 3QBEA 4UU0A 4YMHA 1UBFA 1XEFA 4DCVA 3T3NA 3ZGZA 1QHNA 2SNIE 3FH0A 4JOCA 4K3UA 2OV2A 2CNDA 2WHPB 1L7VC 4Z7NB 3HCDA 4ZT7A 5JUWA 1T6YA 1ZGAA 3EWAA 2P5SA 5TNXA 4ETIA 3GZJA 4URVR 4EJSB 3IXLA 3VMMA 4NLLA 3V1YA 3R3WA 2XT9A 4HB2A 1GGNA 1TMGE 3RSHA 3AINA 3MCWA 4RK1A 5IANA 4EVQA 5JNUA 2ERYA 5FTWA 3JU3A 2PKRA 3BRWA 3I9JA 2CUTA 4LWPA 2XB4A 1VBMA 2GRAA 1A9YA 2B4YA 1IJEA 3HVUA 1FTYA 1TT7A 2XVYA 2XNDA 1RS0A 4G97A 5BY2A 3Q0EA 5EWJA 4DCPA 5CAEA 1UK6A 3KEGA 1U2PA 2EBHX 1VJTA 3UEOA 1KS2A 1P17A 4QDKA 1A1VA 1VMDA 2DFLA 4E5VA 5GIPE 4C4XA 1YZVA 1GDDA 4OGLA 2NVWA 1GTG1 1MC8A 1XD2A 2DX7A 3IC5A 4MLDA 4XYGA 4L15A 2FF7A 1G18A 5CA1B 3NBXX 1FPMA 1WVIA 5HDBB 4JV5B 1MUUA 4OU5A 3GOQA 2WJAA 3T7KA 4CEJA 4MULA 2EKPA 1G5PA 3N76A 1RWBA 4WQMA 5DCWA 3JPWA 3TR5A 3D3WA 3GFBA 3VUEA 5IT9A 1V11B 4HVTA 3RAEC 1Z35A 3OA2A 4MW9A 3NETA 4BLOA 3N1UA 4BNVA 3A8TA 4BZZA 5KTMA 4RMGA 4AJLA 1ZH2A 3R6GA 1IRXA 3VR6A 4KPUA 2BJVA 4LW8A 3UXMA 2ECOA 3ESRA 1GPNA 5FTMA 3CXRA 2IYXA 3L0OA 2ERCA 3LXMA 3DTVA 4E1AA 4QDUA 4LCJA 2H7VA 3VVMA 4Q4AA 2OCDA 4N3AA 4AT1A 4FIZA 1RJWA 1GNRA 2HO5A 5M2QA 5BWBA 5C5EA 1U2SA 3ZS9A 4B34A 3UJHA 1E9BA 4YIKA 4MPDA 1Z5NA 3NM5A 3PGJA 1ZAKA 3LD9A 1G21B 4IIUA 3H5AA 3LSTA 4UTVA 1P3Y1 1RP7A 4I4TF 4XYBA 2ZQ5A 4Y2GA 4IOKA 3IAAA 3ZVNA 1RRCA 2Z4TA 3B52X 4BNTA 1LF0A 1NQXA 4EHFA 3IR5A 1NJ6A 2VQEB 4PRKA 1IN6A 4U6NA 4DSZA 3GNQA 2Q4OA 3E81A 2OKGA 3QYFA 4I2VA 1OAOC 1ORHA 2HDNB 2Y9PB 4DJ5X 2QLBA 3KJXA 2OSBA 3N2NA 4KIJA 5K0LA 5HCUA 1EEHA 2C96A 1OLSB 5E3JA 5FEMA 2EV9A 4DMHA 2R9VA 1UJBA 3DMGA 1P2UA 5HJ2A 2DUNA 3DXFA 5EE5B 2B2CA 3ZKWA 4DJEC 5K0ZA 1XB2A 4B6EA 1TO6A 2J41A 4DABA 1NW6A 3ZTWA 5MF6A 5GJBA 1Q7EA 5DH9A 3DMYA 2ZYVX 3PHCA 3HB1A 4RZUA