3VISA

Crystal structure of cutinase est119 from thermobifida alba ahk119
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
261
Chain Sequence
QAANPYERGPNPTESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYTGTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAPNITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTLSDVEEYRSTCPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystal structure of cutinase Est119 from Thermobida alba AHK119 that can degrade modpolyethylene terephthalate at 1.76 A resolution.
doi rcsb
source organism Thermobifida alba
molecule tags Hydrolase
total genus 86
structure length 261
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12740 Chlorophyllase2 Chlorophyllase enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3visA00
2AJDA 3X3HA 4J0CA 1CUZA 2OGTA 1YB6A 3WWCA 3L1JA 3D0KA 3PI6A 2B4KA 3WA6A 4U2GA 3G0BA 1C7JA 2GYUA 1XZAA 5ALDA 4HXEB 4MQLA 1BU8A 1BRTA 2ZSIA 5ALTA 3PE6A 1CUVA 1XLUA 1C7IA 1OILA 3WKAA 2HA7A 1WM1A 4KE7A 5KBYA 5KWJA 4J03A 1MX9A 4BTVA 3WA7A 2WJ4A 1JU4A 5YASA 2XUGA 4QDZA 5K3FA 4CCYB 1TCBA 2WQZA 2GZSA 2WG0A 2WTNA 5DNVA 4C01A 2HFKA 3ZWQA 4UHDA 2OPHA 3PUIA 4PW0A 1OCEA 4IQ4A 1EDDA 4JYMA 5ALMA 1A88A 5AKZA 1HBJA 3L1HA 1Q0ZA 3WL7A 2AXEA 4C89A 4CG3A 5A62A 2XMGA 2WG1A 1CUJA 4ZXFA 3NUZA 5AI5A 4C4ZA 4FBLA 4U2CA 1VA5A 2BGNA 4G8CA 5JAOA 4B82A 3O9MA 1X2BA 2QUAA 1LBTA 4EZIA 4P92A 3KDAA 4KYVA 1CR6A 1XZHA 2XUIA 1VJ5A 3DOHA 3FWHA 1N8SA 4DMFA 3VVMA 3GROA 1IZ7A 1UKAA 1XZLA 3WK5A 1EDEA 3EQ8A 2C5FA 3PFCA 1E8MA 3AZOA 1CLEA 5JAHA 5CRIA 2PUHA 2GBIA 2Y2UA 1TAHA 2OGSA 1QO7A 5ALNA 2XMQA 3T4UA 1B6GA 4I4CA 4LYEA 4Q1VA 3ICWA 1W76A 5K3EA 5AOCA 3G02A 3TGLA 5AI0A 2QZPA 3U1TA 3WQHA 1G5FA 4F0JA 2BFNA 1H2YA 3NOXA 1P0QA 4X85A 3ZLUA 4WFJA 2PSJA 2R8BA 2WU4A 3LIIA 1CV2A 4BVLA 1YAJA 3PDCA 4G1FA 3STVA 4AXBA 1ORWA 3V1LA 3WKEA 3ED1A 3O4GA 4FKBA 3W04A 4MWSA 5CXUA 2RHWA 1USWA 3C5WP 1E66A 1F6WA 1W75A 1JKMA 2ZYHA 4PO3X 2PX6A 3VXKA 1N5RA 3WKBA 1ETHA 4KACA 2ZVDA 2XQJA 1O6FA 4NZZA 3M82A 3G7NA 2WIKA 1DWQA 1I6WA 3GZJA 4MXDA 1VZ2A 2WIJA 4A23A 5ALIA 1WOMA 3O95A 3I2HA 4OYYA 3R3UA 3HJUA 4NMWA 1P0PA 4GLBA 5BWBA 3H1BA 4EHBA 1DT5A 3AIKA 2VF2A 3FYUA 1YB7A 3WK9A 5LZ5A 4EA6A 1AGYA 1DQZA 3EF3A 3AZQA 4CIAA 3RARA 4X6YA 4BRZA 1NU8A 1MTZA 2FX5A 4B85A 4B6GA 2EEPA 1QFMA 4UHBA 1JI3A 2I78A 4LYDA 3CCCA 1KEZA 3WL5A 4S0XA 5A7GA 4KR0A 2C5GA 2HDWA 1BCRA 1UKBA 1YS2X 2OXEA 1P0IA 3G9UA 4OYLA 3H2JA 5FV4A 4HVTA 2LIPA 5CH3A 1CUWA 2AJBA 5A71A 2H1IA 1XLVA 3VJLA 5DWDA 4ETWA 4AMZA 4ZI5A 4Y2TA 1XZCA 5JATA 3I2FA 1AKNA 1VOTA 5HQ3A 5AM2A 5LP1A 5AIBA 5JD5A 5K3FB 2CUTA 2XUKA 1JJIA 3B5EA 2OCIA 4LXHA 4AZ3A 1W52X 4X92A 3CN9A 2ZJ7A 1QIIA 4FBMA 3QM1A 4XX1A 1QIEA 4FLMA 4G4JA 2H7CA 4Q34A 2JF0A 1DTEA 4KAAA 2WIFA 3O4JA 3DS8A 2ZYIA 3F8SA 5JARA 5T4BA 4AN0A 4Y2SA 4Y2YA 1VE6A 3E3AA 2C7BA 5ALGA 4AX4A 3G0CA 6YASA 1EVEA 4U2DA 1PV1A 1UZAA 5ALZA 2OCKA 4L0CA 4GWLA 4B80A 4EY8A 4XVCA 3QMWA 5AKHA 1PFQA 1UK8A 3AZPA 4GBGA 1QTIA 2XDWA 2HM7A 5FUMA 1SCKA 4UBNA 3I2IA 5FLKA 2G4LA 4QE3A 4J7AA 4EY5A 3BIWA 4HTAA 5JALA 1U2EA 4DM7A 4BTLA 3FOBA 4C4XA 2Z8XA 5AOBA 3H1AA 3HI4A 2JGEA 3D59A 2RHTA 5AOAA 5C8XA 2WUDA 3WK8A 5JIBA 1HLGA 1XKLA 2QJRA 5A7HA 1M33A 2IITA 5AK3A 2G5PA 4YASA 4J0HA 1U4NA 3NWOA 3MVEA 5H3HA 2C58A 5HFAA 5LZ8A 4OU5A 4YPVA 3AINA 2WTMA 2VJBA 5AO9A 4G4IA 3TEJA 3IURA 4BAUA 1TK3A 4H7EA 2HL6A 1P0MA 4UBLA 2DQZA 3G0GA 3BE8A 2J3QA 1EX9A 1YR2A 4WY5A 2VJCA 4QEKA 4HXFB 2ZYSA 1W6RA 4EUSA 4B7ZA 4DNQA 2WUGA 1THGA 3UUEA 2PU7A 1MNAA 4DNOA 5ALOA 1G66A 3AJAA 4QA9A 4QLAA 5LLSA 5AM1A 3G9TA 5AK6A 1EI9A 3C70A 2WM2A 3FVTA 1VA4A 2D5LA 5EIAA 4J0KA 2ONCA 4AQDA 3FNBA 1C4XA 5AM4A 1BN6A 1AZWA 2OG1A 3QMVA 2OLEA 5ALRA 1L7AA 4H7JA 3ILSA 3HABA 3QPCA 1WB4A 5DNWA 1Y7IA 3I2JA 5K3DA 5BOVA 4X6UA 5KREA 2D0DA 2BUCA 2VJDA 1XZJA 3ESAA 4KE9A 4A5SA 4DTCA 2OGZA 4IHAA 5CT5A 3LCRA 2YH2A 3E4DA 5EHXA 1MU0A 2XQIA 3HLKA 4X7BA 4BCCA 4H7IA 1RP1A 1QZ3A 1YA8A 4MJ3A 4QDTA 2XMSA 5HF6A 4L72A 3LLCA 1IUNA 2QXTA 2J3DA 5KWIA 2JGIA 4FLFA 1ZIYA 4U2EA 1HL7A 2ACKA 2HA3A 5AKYA 5LZ7A 3I6ZA 4FTWA 1GQSA 3DJYA 3V9AA 4BCBA 4E46A 1J06A 2WLSA 1N1MA 2PBLA 3I28A 3WLAA 4AB1A 2VA9A 2H9YA 1CFJA 1UK9A 4I3FA 2JGKA 4LXIA 3V1NA 4ARAA 2WFMA 1MAHA 2ECFA 2ZJ6A 2XUPA 3H2GA 2QRUA 5HQ3B 1CUYA 4W1PA 3JYHA 1CIJA 3FVRA 5DYYA 1LBSA 5D6OA 3Q8WA 4ZWNA 2WFLA 3PUHA 2Y6UA 1JFRA 4I19A 5T4EA 1ZGBA 1ODTC 5A7FA 3R3ZA 3C6YA 5CT9A 2VAVA 2XUFA 5ESRA 2V9ZA 3A6ZA 3A70A 5C8VA 5AKEA 1GQRA 4Y2UA 3GA7A 3BIXA 3FSGD 5C7YA 1NU6A 4GW3A 3V48A 1J2EA 3WK4A 3K2IA 3CXUA 1MPXA 3WYNA 4B0OA 1XKTA 4G9GA 5FRDA 2JBWA 5HF8A 2JGLA 4UHCA 3TRDA 2RIPA 2GBCA 4BB0A 2DHEA 3C6XA 3H17A 3P2MA 3U0VA 1GKKA 4RE6A 1VKHA 5ALKA 4E15A 3G8YA 4CCWA 4UFOA 3ZLTA 1QFSA 3CCBA 3HEAA 4X71A 3R41A 4INZA 5E4YA 3C8HA 3JWEA 1ZICA 3DYIA 5LZ9A 3R3VA 1CUXA 3V1KA 1LPSA 5AM5A 1WB6A 4U2FA 2PL5A 3E0XA 1CUFA 2V98A 3BDIA 1YSCA 4AN1A 1QONA 2JGMA 3OC0A 1H22A 1LGYA 3D5EA 4F5ZA 1AUOA 3AIOA 4H35A 2QVBA 3KWFA 3MGAA 3GUUA 1TIBA 4Y7DA 2IX9A 1DWOA 4QWMA 4OB6A 1A7UA 5AP9A 2OQVA 3SWWA 7YASA 4OPMA 2JGFA 5T4FA 4F21A 3WYDA 2VEOA 4P93A 1BROA 4BVKA 2O2GA 2XLBA 2PSFA 4IH9A 5DLPA 4W63A 5ALLA 1GGVA 1XQVA 2YASA 3GBSA 4Y2PA 1DU4A 4Y2VA 4RGYA 3VKFA 1DWPA 1R3DA 5CT8A 5K5EA 3G0DA 4ROTA 4H7HA 5CT6A 2XI4A 3H2KA 1QGED 1B41A 2GBFA 2CKMA 4M0EA 1CUDA 3DEAA 5ALUA 1GKLA 4BCDA 5HKBA 1K6EA 4B81A 3IUNA 5T4HA 4EB0A 3LIPA 5HZGA 3WL6A 3PICA 4P08A 4OCZA 2WIGA 2ES4A 1JMYA 2XB6A 5K3AA 4B9AA 1UOQA 1ZD4A 1BCSA 2WHQA 2CEKA 3DKRA 4DNPA 3W06A 3MUOA 3STXA 3VISA 5JZSA 2C0PA 1IUOA 3VJKA 2FUKA 5ALSA 3R0VA 4WCVA 1ZI8A 2ORYA 1Z68A 4GI1A 1K8QA 2JIDA 2CB9A 1CQWA 3AIMA 4X97A 2CJPA 4H0CA 4DMKA 4O08A 1KU0A 5AI8A 4BZWA 4DYHA 5AKLA 1H2ZA 3QVMA 3ESDA 5ALVA 2HFJA 4Q3LA 2WSLA 4CG2A 1EB8A 2XMRA 3FLBA 5A2GA 4DNFA 3ESCA 1CUSA 4AO6A 5LIPA 3I2KA 5J3JA 1UWCA 3PF8A 4JH0A 4KJXA 1F8UA 2OCGA 3DDUA 4FFWA 4IH4A 2DQYA 5SYMA 1TRHA 3W05A 1FFDA 5K3BA 4G8BA 5EHQA 4ZV7A 2Y2VA 1BN7A 4E11A 3FYUC 2ZJFA 4LIPD 5AICA 2J4FA 2DHDA 1D07A 3BXPA 2Y1KA 4HAIA 3WZLA 3VDXA 1WPXA 5IVDA 1CQZA 3B12A 1XZKA 2E3JA 5JASA 4OB8A 5ALPA 5ALXA 3WMRA 4MWTA 3D4LA 4Y9SA 4L9AA 4ZGBA 4PSCA 1R9NA 3O0DA 2ZYRA 5AKIA 4X91A 4M0FA 3A2MA 1GPLA 2HA6A 4WY8A 5ALQA 4IH1A 2G63A 1EA5A 3WWPA 1CUCA 1CUUA 1CUGA 4JNCA 4J0DA 3QBJA 4KAFA 2V97A 4UBJA 2JEYA 5FPQA 2BGRA 1XRNA 4DIUA 5CH8A 2WHPA 3BF7A 2VQ6A 3C87A 2HA4A 3N0TA 1XLWA 3YASA 4BZZA 2OQIA 4FLEA 1K63A 2XLCA 4H18A 3RM3A 4UBIA 1WHSA 1F0PA 1IUPA 4QDXA 2XUJA 4BAZA 4OU4A 5D3ZA 1LPOA 4FHZA 4E14A 3WL8A 5F4ZA 1GPNA 3C5VA 2RAUA 3WI7A 3FCYA 1ZI9A 2O7RA 2BUAA 2XUDA 3OPMA 1EK2A 1H2WA 1ODSA 2XMBA 4HS9A 3KD2A 4EBBA 2WFZA 1W4LA 4B84A 4OB7A 2QMQA 2XMCA 3O4HA 4XWGA 4Y2QA 3W9BA 2DSNA 2VT7A 1VZ3A 1ZOIA 4PNZA 1QIJA 2HA5A 5IVIA 3QITA 3H04A 1ZJ5A 1UT6A 4WFKA 2BAGA 4FOLA 5EI5A 4Z49A 1SCQA 4UPDA 5ALWA 3S8YA 1LNSA 1UK6A 5AI6A 5FXMA 2XUOA 1SC9A 1XZMA 2VT6A 2K2QB 3IA2A 1K4YA 1ODCA 5LYYA 2B61A 2QJWA 3V1MA 4BRSA 4U2BA 3G0IA 4D9JA 4BAGA 3C6ZA 2YYSA 5ALEA 4PSDA 3AUKA 4W1QA 4W9RA 4C87A 2WJ3A 5HF5A 3WKCA 3ZPXA 1H23A 4WJLA 4Y2JA 1XRPA 1XQXA 2WUFA 4KE6A 5AM3A 1R4ZA 5CURA 1LLFA 5AK5A 1XZIA 4DSAA 4FNMA 5JZBA 4N8DA 1GXSA 1MN6A 1WHTA 5AKKA 2Z5GA 1QIKA 4G4GA 4KE8A 4X93A 4BC0A 4J0GA 3F67A 3FYUB 4YK7A 1F0NA 2PM8A 2B20A 1CVLA 4K2AA 2GBGA 4H7DA 3F96A 1MAAA 1QO9A 1WPRA 2EDAA 3A2NA 1JMKC 4Q05A 5IH7A 2VJAA 3IDAA 4H7KA 1BS9A 3G9ZA 5JZ9A 1AMNA 2HADA 3W2TA 5AH0A 1MX1A 1ZD5A 3HZOA 4X94A 2BUBA 1XFDA 2QS9A 3WWOA 1XZBA 2QM0A 4MEBA 2QTBA 3IIIA 2CMFA 3BL8A 3IBTA 4FNGA 5JD6A 3W9UA 4BP8A 1QIHA 4JEIA 1Q84A 3H0CA 1RYYA 4Q82A 2GYVA 3DYVA 3RKSA 1ZD2P 3KXPA 5I8PA 4X3CA 3HC7A 2QT9A 1L7RA 3QPDA 2UZ0A 2HRRA 5AI4A 2HU7A 3H18A 2DCMA 1ORVA 1QLWA 3BF8A 4GEGA 4EY7A 2BCEA 1U65A 4HXGA 3M3DA 3EQ9A 3C6BA 1QTRA 4G8DA 2XQFA 1EHYA 4BDSA 1QE3A 3D3NA 4OUKX 1WB5A 3KOOA 3ANSA 2EDCA 1J1IA 4QLOA 3FLEA 1UKCA 1OXMA 5ALHA 4CG1A 4G5XA 1NX9A 3DCNA 2CZQA 1G42A 3B3QA 4PSUA 3FLAA 3AILA 3R3XA 1HKHA 2JEZA 4DSZA 2WU3A 1ACLA 1FFBA 4DLNA 5ALFA 4QWWA 5DTIA 1W1IA 1AC5A 2BKLA 1FFAA 1PJAA 4P9NA 2YXPX 5C8ZA 4RNCA 4JUIA 3O4IA 3DL7A 5EHNA 4Q3OA 4J3JA 3HXKA 1XRMA 2DHCA 3WIOA 1CEXA 3IUJA 4WFIA 4HZGA 1HPLA 3OM8A 1BEZA 4GHWA 2HRQA 1CUEA 3GFFA 3LP5A 4K5QA 1DX4A 1XRRA 3Q0TA 5AKJA 4OSEA 5LKRA 2X76A 5E4TA 3K9BA 3BJMA 2H7YA 3ANTA 4B83A 3WWDA 4N5IX 5BV7A 3A2LA 3H19A 4UHFA 3ZLVA 4ZRDA 2PKYX 3WIBA 1EH5A 2RI6A 4TPKA 1FSSA 1ZGCA 3TJMA 2WIDA 3PFBA 5CTAA 2XMDA 4LXGA 1N5MA 3WJ1A 1E8NA 1GPKA 3HRHA 3WJ2A 5CT4A 4KAJA 4UUQA 5FDFA 4UHEA 1T2NA 1XZEA 4V2IA 3QH4A 2VTVA 2PUJA 1MNQA 3WZMA 5EGNA 5AJHA 3KWJA 2OCLA 4BE4A 3K6KA 4NS4A 3FYTA 3D2CA 3R3WA 4FDMA 5A6VA 3D7RA 1R9MA 1Q83A 3QZUA 2DR0A 3I6YA 5HF9A 3FBWA 4K6HA 4N5HX 3EIOA 3DL4A 5CW2A 1E3QA 4DMCA 5ALJA 3JW8A 1O6GA 5HCUA 2Z3WA 5C81A 5IVHA 1H2XA 1UK7A 5EFZA 4PF1A 1VXRA 3IVMA 5AIAA 1A8QA 1DINA 2GYWA 3OURA 1QIGA 1TCAA 2FJ0A 3FAKA 5E2IA 5EHZA 1VE7A 5JD4A 3UMJA 1E89A 1RWQA 4UBKA 5JYCA 4X95A 2XE4A 4QDUA 2JGJA 1T4MA 1HDEA 3L1IA 1YA4A 2ROQA 2B9VA 4WDRA 2BJHA 3G9XA 5BWCA 2X5XA 3IB3A 2W6CX 2R11A 3E1GA 2Z3ZA 4F60A 4DMHA 5HKAA 1E8DA 1EK1A 5DYWA 5FPPA 5SYNA 3DNMA 5CBKA 3OOSA 1ACJA 2HHAA 1R88A 1LZLA 2WG2A 3ESBA 2RONA 5ALYA 4FFVA 3F9CA 1UOOA 1MJ5A 2O2IA 4G9EA 3QYJA 2WFLB 3DLTA 1CUIA 1SFRA 2HA2A 4LHEA 3FSGA 2QKYA 2WHRA 3STWA 3I1IA 5DJ5A 3ZV7A 2V96A 4PQEA 3VJMA 4CIBA 4W1SA 5AKXA 1DT3A 3STYA 1THTA 2QOEA 3BJRA 1JJBA 1MX5A 3M81A 2WILA 3QMMA 1ZD3A 3SC2A 4IO0A 1YASA 2OAEA 3DD5A 5JADA 1EB9A 1LPNA 2ZSHA 2Q0XA 1UOPA 1JJFA 3CN7A 2O2HA 4A16A 4C4YA 1CUHA 1KU6A 4BBZA 4EY4A 1LPPA 2H7XA 3DKKA 1TCCA 2CBGA 4X6XA 3EBLA 5AHXA 1ZI6A 2X8BA 5D7BA 4N8EA 1A8SA 1LPAB 3EQ7A 4BATA 2VSQA 5CH5A 1K5PA 4LKOA 1JT2A 1QOZA 4N8SA 4UBOA 3STTA 4B0PA 2XUHA 3KSRA 3LS2A 4RPCA 1YAHA 2WUEA 1QIMA 3D2AA 5DNUA 2AJ8A 3IUMA 1QIDA 4AO7A 4CFSA 1XQWA 2IIVA 4GXNA 4AMYA 1EXWA 1Y7HA 5I9IA 4ZV9A 4J0IA 2QUBA 4BVJA 4BP9A 4J0JA 4EY6A 2HU8A 3T52A 4GDMA 5LKAA 2FJPA 3H2IA 4B9EA 5IVKA 2XQKA 1TKRA 3VVLA 2HIHA 3I1YA 2VATA 1SOMA 2Z8ZA 4X00A 2PSHA 1VXOA 1IMJA 4XIIA 4PV7A 1IZ8A 4HRXA 5E4JA 1GZ7A 2WJ6A 4HRYA 4MEAA 1XRQA 5DTJA 3SX4A 4GECA 1ISPA 1ZIXA 2I3ZA 4M0MA 5AM0A 3WK6A 4BYMA 5JAUA 4UFPA 3I6MA 1XROA 3DQZA 1AQLA 2AJCA 4WDQA 4QNNA 4JYPA 5AI9A 3IUQA 3WKDA 2I3DA 1XZFA 1X70A 4UFNA 1CUBA 4MQMA 2XUQA 3HSSA 1UFOA 4CCYA 2PU5A 3BWXA 3WK7A 4Y2XA 1MO2A 3DOIA 4RE5A 4TVKA 4UBMA 4BE9A 5FKJA 2C4HA 5HK8A 2P8SA 1SCIA 1WCYA 5LZ2A 5I7UA 1FFCA 1EVQA 2RGUA 2AJLI 5ISMA 1CRLA 4K6KA 2XQGA 1DX6A 4UHHA 2XUAA 5IKXA 1XQYA 1AURA 4H77A 3RK4A 4YX9A 4Q3KA 2QXUA 3I2GA 4QDOA 1XZGA 5HK9A 4TGLA 5EIHA 5JAPA 4QZVA 3HACA 1MT3A 3AFIA 2HU5A 1S8OA 5FOQA 3MUNA 2VAXA 4AZ0A 4MYDA 1A8UA 1GT6A 2PVSA 2XT0A 1QJ4A 5CMLA 1TQHA 1X2EA 2DFPA 3RLIA 1ZJ4A 1AX9A 2HA0A 2O7VA 3F97A 4CI9A 4BC1A 4MYSA 1G4HA 5FP0A 1XRLA 1CUAA 5LZ4A 4ITVA 2OAGA 3M83A 4KRXA 3H2HA 2J4CA 4FMPA 4KRYA 4C6HA 2W22A 5AKGA 3GELA 4Y2RA 4C88A 4NVRA 3N2ZB 3WWEA 1QIFA 1UXOA 2XMZA 3D2BA 3BDVA 1Q0RA 2GZRA 1E5TA 3F98A 3OTQA 2ACEA 4FWBA 4L3WA 3C45A 3HYSA 4X90A 3STUA 2G5TA 1U8EA 1L7QA 4ARBA 1BEEA 4BDTA 1HQDA 3ICVA 2WKWA 1XZDA 1BE0A 1CPYA 1VLQA 1JU3A 1R1DA 4W1RA 2QR5A 1FFEA 2Y6VA 1YS1X 4XJVA 5D3KA 5JANA 1J07A 1R50A 2PPLA 5DYTA 2C0QA 4AO8A 4KEAA 3R40A 1DQYA 1YCDA 2PSDA 3S2ZA 5K3CA 1LZKA 1IVYA 3R3YA 3ZI7A 1LPMA 3PF9A 4H7FA 4DGQA 3IULA 1FJ2A 3UUFA 5HFNA 3OG9A 4K6GA 2PSEA 4OD0A 2WHPB 3C43A 3O9VA 1EINA 3C8DA 3FCXA 5AK4A 2I03A 1LPBB 3NGMA 1EDBA 4ZREA 5CXXA 3SK0A 1Y37A 5EIEA 3QPAA 2NW6A
chains in the Genus database with same CATH superfamily
1H6DA 3MMPA 4ZT5A 3IP3A 2A86A 4TN5A 3RAGA 1YK1A 1QHEA 3IHLA 1K27A 2JI6A 2F3RA 2OGTA 2WWGA 4YBRA 1MORA 4DE5A 4M86A 1U8YA 3VO9A 1DAIA 4QD3A 2WPDD 2WVJA 2PO7A 1TO6A 5EVCA 2I5PO 3CLRC 3D0KA 4GM0A 3CU5A 4ZU1X 3UHPA 1G1AA 1BD4A 3FNIA 1UPUA 1A2OA 4FGUA 4U2GA 1PJZA 2C4MA 2YICA 3JZFA 4LDNA 3BD6A 3LUAA 1C7JA 1LBQA 1SBTA 4RKFA 2GYUA 3Q5EA 3UPUA 3GGJA 4E5KA 2XDQB 3GA0A 4S1VA 1HR0B 5CB4A 3SZMA 4C0LA 4G23A 5JS6A 3LWDA 3ZK8A 4ZZ3A 4EPVA 2D7DA 4MQLA 1OF1A 3ROPA 2BDTA 1ZGHA 3ITDA 3PRJA 3W3AA 4KNVA 1BRTA 1XRJA 1WXIA 1NVVQ 2FOXA 4IHJA 4M83A 1MH1A 2XTAA 3DBHB 4CTKA 1JA0A 3RREA 5JFGA 2DFNA 5KOHA 2B8EA 2PG3A 2HA7A 3L01A 3QXSA 1KBQA 1V95A 2LVBA 1JZQA 1XTIA 4F1JA 3FOZA 2LKCA 1MX9A 3TSZA 3FDXA 2WJ4A 3B1KA 4BNIA 3GC6A 4JLKA 4RKYA 1ZN7A 3FNGA 3WA7A 1JU4A 2OVFA 4RD6A 4BQNA 2PKQO 5HG0A 4M6WA 5K3FA 3ZG6A 4IJMA 4CCYB 3L8EA 3HU5A 4RV5A 1GAWA 2JLYA 3N2IA 5I7VA 2O0HA 4RTRA 3GOQA 5DGHA 3DULA 3ADDA 5ADWA 3MWEB 4C03A 2K6GA 2WTNA 3LLUA 4MMXB 3U1VA 5DNVA 3X2EA 2A1TR 1NL3A 2B99A 2GJKA 4I9HA 1UBMS 4AKTA 4FIDA 4CMEC 2C88A 4JK3A 2OPHA 4XWKA 1D5CA 2BCJQ 3TOXA 1QRSA 1ID8A 1TQDA 2E55A 4RZXA 3WDKA 2R4UA 1Q21A 3KAQA 4GBMA 3P9XA 1D2NA 2O9JA 2WSYB 2B5WA 2P79A 4MW7A 3AUUA 4QBTA 5DCLA 1IDN1 1RTKA 1Y80A 1QDEA 3R1IA 1Z06A 4WZ6A 1EDDA 4HLNA 1FYEA 4JYMA 3OQJA 4XUCA 4EP1A 1DAHA 4Y1EA 4RYLA 1KTVA 4HO1X 2YRXA 3QYPA 4MW9A 5AKZA 4I4NA 1BHSA 1K89A 2AXEA 1Q3KA 3WL7A 3OPYI 2AB0A 4O5OA 2CVQA 4C89A 3F8WA 2JLRA 2DPMA 3A1VA 2VZ8A 5AHKA 4CG3A 2XMGA 4DDHA 2WG1A 1CUJA 4BMYA 1U2SA 3NUZA 3I34X 1J56A 2YZ2A 3SC3A 4U2CA 4IIUA 3UK0A 2ORWA 3EZ2A 4L76A 2ATVA 1O4WA 4YR9A 4BY9E 2B21A 1UBKS 4NXNB 4I9UA 1X2BA 2JKVA 1L5HB 2LDBA 3IOEA 1T3SA 1YO6A 4KMSA 3T38A 2C2GA 1Z62A 4YRTA 4AUEA 1LBTA 3NTVA 2J45A 3QE0A 4M1YA 4EZIA 2GN8A 4KYVA 2X1MA 4Q01A 5HCIA 1H85A 1UJ5A 1KJJA 1E2FA 1CR6A 4NDAA 4RIGA 3R7BA 3SYRA 2IYTA 3IVCA 1XXHB 4FKMA 3IPAA 2X0KA 3ZEIA 2I4OA 1N8SA 2OBMA 3AHDA 3L7YA 1KQPA 2Y1WA 1Z3IX 1XTZA 3DVAB 1ZW6A 3FGOA 4FQ8A 4PHCA 1G9TA 2FR8A 3OECA 3FOAA 1KI8A 4OHXA 1UKAA 2FW6A 4KSCA 1OBCA 1PZXA 1JR4A 1J7JA 2R4TA 2WA2A 3IPYA 4UEOA 1TU0A 2C42A 4U39A 5DN9A 4O4HA 4ZRMA 3WK5A 5KNCH 4KTTE 1JVBA 1V1RB 5E7JA 4RIEA 1NI5A 4ZC8A 4DHEA 5IZCC 1XTTA 3Q88A 3WHKA 1YQQA 1GUYA 4CQLB 3DTVB 4NU0A 1FFYA 1KERA 3H8SA 3HJBA 5EESA 5AW2A 5DGXA 4RF5A 2XWBF 3GFOA 3VR6D 1SU7A 3OFKA 5FTNA 4MV7A 5C8YF 4UZSA 1IONA 2JVJA 2YMQA 3T7KA 1VL6A 2R6HA 1KFCB 1SGWA 3OQOA 3AJDA 2E6UX 3OF2A 1NW9B 1YIOA 4NYIR 2R6CA 1P72A 1TUEA 5DB4A 1PR2A 1WVGA 2W2MA 2IU3A 3FH0A 1JR3A 4M98A 4PINA 1WO8A 2J32A 2VDWA 2W58A 2ZSJA 3AV3A 1E2NA 2H00A 5ITWA 1RZRA 1XMPA 4KXUA 4P5PA 3HRKA 2AMVA 5ERYA 3I6IA 4RZIA 4V39A 3IQHX 5JVDB 4I4CA 4D9MA 1UFVA 2E1PA 2YR0A 3GVCA 4FONA 4B3FX 5KWEA 4JV5B 3ICWA 3VX4A 4BB5A 1ZN2A 3C3JA 3E70C 1FE8A 5JNRA 2GEDA 3HMKA 4XD2A 2WDZA 4LVUA 2LUOA 4NU8X 3TGLA 4WWHA 2HTEA 4BO7A 4Q16A 3LBNA 2Q2QA 5IC5A 3K4HA 3U1TA 2GBLA 3WQHA 5CK5A 3FD8A 1I3NA 1G8SA 1H2YA 1V7ZA 3G89A 4R1OA 3ZK7A 5HUQA 4IMPA 1YI1A 1FJGB 1KC3A 1KRHA 3JZDA 4IEFB 4P5DA 1BQ3A 1P0QA 3GJ3A 4MZDA 4NPCA 1A5ZA 4V02A 4X85A 4E70A 3WHIA 4QQ8A 4CKXA 4YA6A 1WP4A 4FOTA 3RDPA 2E4ZA 2FETA 4OQQA 2OK8A 1X7XB 5KAMA 2Q62A 1TVEA 3WMXA 3LIIA 5LUAA 1COZA 3UJBA 1FLNA 2EKBA 3OZ7A 4MRRA 1YAJA 3PIIA 1TO1E 3PXCX 2QE7A 4G1FA 4BO8A 1P1BA 3AGQA 1GNVA 4AXBA 2ZAGA 2CXQA 3P9NA 3V1LA 3AHEA 1M6EX 2HWYA 3DG9A 1R64A 1U3TA 3RU7A 2ASVA 3L6UA 3WKEA 4DBLE 5JY6A 3AL0C 4IOMA 5DX0A 1UFQA 1QVAA 1EXVA 3CVXA 1CERA 1W5AA 4ALJA 2OM2A 1F2VA 1F0YA 1YGYA 4OQFA 5NULA 3RC9A 3WBKA 3O1HB 3EB9A 4JJFA 1M2WA 4CZ2A 3G68A 3C5WP 2CCJA 1E66A 5EXDA 1JYEA 3K9GA 1LBHA 2JFNA 3LOUA 4PO3X 3A6KA 5TMBA 3GLTA 1M2VB 1DCMA 2PX6A 2RGGA 3X1DA 1N5RA 2R2AA 2AI2A 3B1FA 3CS3A 3LGAA 3WKBA 1J2YA 2ZJYA 1KEEB 2J1LA 5FA8A 1ETHA 3O8QB 2HEIA 2P6UA 4HDSB 4KACA 2Y0BA 3CO0S 3CPHA 4TKVB 3LCVB 4YONB 2VPYA 1N57A 5ES4B 3ZD7A 1KAOA 3M82A 3G7NA 4O3FA 2ONZA 2IEIA 4N48A 1WXWA 5B5SA 1NT4A 2FW9A 2JHAA 3Q0IA 1DWQA 4JLOA 5ERXA 3W2GA 4ACAA 3AUYA 4ZEWA 3R9XA 6GPBA 4KN5A 5K2OA 1J23A 3DBRB 1AM4D 4R6WA 4II3A 5EYPA 5ALIA 5FI5A 1Z2DA 3FFTA 1WOMA 3H0KA 1KS2A 1TJPB 5KNLA 1VHWA 5F64A 1FC0A 5FHQA 4F4JA 1NQTA 3EARA 4LZWA 1X0VA 4N7JA 4MMZB 4NMWA 4BQFA 5HVNA 2WP8J 2XYQA 3GR6A 3BL5A 4EGCB 1QQ6A 4LOLA 3MWDB 1MO6A 2VF2A 4OFZA 1ODLA 3FYUA 2Q1TA 4DV2B 4O2RA 1NG9A 2DX7A 2PS3A 3WOHA 2JCVA 1VMIA 5EKDA 5LD2C 5LZ5A 3AYZB 1RWXA 4EA6A 2RCNA 2JJYA 5K0JA 1AQJA 1DQZA 3K1YA 3A1TA 3NIGB 3OHSX 3O2SB 3PVSA 2X0FA 4JGGA 4F5YA 3R9IA 4JYCA 1GPWB 3L7LA 3MTJA 4N54A 5K0ZA 2QQGA 2JFQA 4KL8S 1Q7TA 4BMDA 1T1SA 5DRYA 2YTZA 3RARA 1J8MF 1RNLA 1EHCA 1F2UA 4FE7A 1T0IA 1MTZA 1Z0SA 3D7LA 1L8QA 2FX5A 4DRXB 2FN4A 5LYJA 3AVWA 3DFMA 3MTEA 1M2OB 1BJTA 2EEPA 2IJGX 4A1FA 2RD2A 2CLLB 3OJOA 1Y42X 5F9FA 5EMNA 3CGWA 3AQ4A 4DB2A 4QPPA 3VSDA 3GIWA 2ZRPA 3PX3A 4Z9BA 2OHHA 2I78A 2IP2A 3UIEA 5LP6F 3W8FA 2P62A 3D64A 1G7TA 5ELMA 1EFVB 3OPVA 1V8PA 2PE5A 2AE1A 2G25A 3K70D 5L4LA 5IM4A 4N0MA 3F4KA 5A7GA 4E5DA 3VPBA 2ZB4A 4V1CI 1GP2A 3KQQA 2C5GA 4FSHA 2Y0CA 1VLHA 2ONYA 2V74B 5BRAA 1Y6FA 3OI7A 1H65A 1SM4A 3ZY2A 2OXEA 3RK1A 3I12A 1WV0A 4IYRA 4N1AA 4X1KB 4IQGA 1YF3A 3KV1A 4TXHA 2YWXA 2AEFA 2QBYA 4IOJA 4OYLA 2VQFB 4G1UC 3NEYA 1O94D 1U7HA 1K6IA 4P3YA 2FEXA 5JCJD 4MLZA 1UOEA 4OXKA 5FD8A 4YXWA 4B4UA 2AJBA 5F7XA 5JFTA 2P9TA 3MERA 5A71A 4MJ7A 1PG5A 3F47A 4DCPA 1G64A 2WVHA 5K8IA 2GD2A 1Y81A 2GFHA 2PAAA 2XBLA 2EFEB 1OFTA 4M22A 4NCNA 2F90A 2VO1A 1PT8A 4Y2TA 5KZMB 3I2FA 3DKPA 3SLKA 3WLQA 2FQQA 4EHLA 4HFRA 2IH4A 1JB9A 1NC1A 3TL2A 2CXSA 3FUCA 3LHKA 4PPFA 1L7BA 5DN6A 3EXIB 3TZHA 5HQ3A 1V7CA 1MIOA 4EB6A 2CUTA 4HCJA 3SC4A 2ZYTX 2I9PA 4OLFA 4DMGA 1IXRC 1W52X 2NUAB 3WAGA 5C1DA 5JPCA 2BMEA 2PZFA 4X92A 2C2MA 2CBZA 1OFIA 1F48A 2PZBA 2X6TA 5IAAA 3OZGA 3UZUA 2UUPA 3CN9A 1ML4A 1NJ1A 5SY6A 3S2YA 4QYXA 1XZ8A 1IEXA 3CM0A 1NYLA 4QVIA 5LQJA 2HHCA 4Q21A 3ANMA 3KKNA 3RWBA 2GBPA 1YONA 3ACDA 4K9MA 3CRZA 3ZV3A 5B3LA 4KAAA 4QM7A 1OY1A 4REQB 2A4MA 3DS8A 1W87A 3I0ZA 4F2WA 2A0WA 3GFRA 5JARA 4KYIB 4AN0A 1J99A 4L3VA 3V42A 1E9CA 1MFZA 2PT5A 3AF3A 2GCOB 3EGIA 3LT0A 4MYUA 2DEUA 3MHTA 2GZAA 3BORA 4AL4A 3UK2A 3UXYA 3IP9A 4RVSA 2C7BA 4BLWA 2HW8A 1RRMA 6YASA 5FWXA 1LSJA 1OW3B 2PIAA 4GXTA 5BYKA 5K6AC 1QCZA 2QJOA 3LX8A 2WF9A 3LL4A 4U2DA 1G5HA 3TAUA 2ZAOA 4TSFA 2Z2YA 2WA1A 2FE1A 5HYVA 5FOUA 2PV0A 4QQFA 2PV7A 1K75A 3IT0A 4H1HA 3VHXA 3M4ZA 4LZOA 4BO5A 1KY5A 1M1NB 3D7SA 5EZYF 1PFQA 2WBLC 1JHZA 1GZ4A 3ZDDA 1SVMA 5EXSA 1ID1A 3HXTA 3GK3A 1HEIA 1UK8A 2Q5LA 3AZPA 2NUPA 1SWWA 3ZXUB 1KRXA 1ZZEA 3C7AA 1DHRA 3A27A 1QTIA 2GLTA 2N46A 5KJEA 4EL0A 2HM7A 4MYRA 1JDJA 1SCKA 5L6LB 4MCJA 2GM5A 1Y0BA 3B6JA 1Z82A 4CEJA 1NXQA 2HYDA 4QE3A 2EHJA 2YNMC 4Y98A 4YMSA 5TPWA 1LDGA 1NI3A 2A4KA 4JC5A 1NJGA 4J7AA 4EY5A 2Z0MA 1EWQA 1MH9A 1CKEA 3T5TA 3U81A 1BSVA 2QNBA 1P3JA 3DE1X 1Z08A 4K26A 3FDZA 3ILXA 4FK8A 5AOBA 2J9ZB 3U3KA 1U8CB 3HI4A 4E2XA 2V4UA 5HWSA 4MUXA 1EX7A 1PSDA 1J39A 1X9IA 1ZN8A 3GZ4A 2C2WA 5D2CA 2B7LA 2C9CA 3EVCA 1FNCA 3E53A 4HX5A 4PWZA 3QX3A 1HLGA 1WMAA 5LWQA 4QGGA 3TSCA 5AJYA 1DIOB 1XKLA 2H63A 2ZYAA 2QJRA 1JXMA 1P5HA 2KM1A 1DFHA 1O7JA 3HNRA 5K0BA 3ZI0A 5F1KA 1M33A 3PJRA 2Q1WA 3ZHRA 1NUHA 3IQFA 4ARSA 1QWSA 2G5PA 2DFTA 2H31A 4DIBA 4OHMA 1GSIA 3GJRA 1CRZA 5TARA 4FJ2A 1L9XA 4AJIA 3Q87B 2QDXA 2Q1UA 1D04A 3ETLA 5TQ2A 3AVPA 1XB2A 1LRKA 1E9RA 3KB1A 5H3HA 3QMPA 1KAQA 1T8SA 521PA 5HFAA 2FV8A 1M8GA 4NLLA 1AKTA 4I4TB 2IBTA 4BX0A 3VKWA 4MRMB 4KHPB 3FNQA 1M5TA 2A1UA 3VO8A 1GU0A 3CO5A 3NAQA 5PNTA 1I7SB 4NOLA 3V4OA 4XIYA 1KPIA 5E1BA 3TBFA 4EGAA 2NZJA 1QP4A 3VU9A 2XX3A 1YFZA 4N9QA 3T5AA 5AO9A 5BUZA 5LXTB 1OASA 2DP4E 2I6SA 3TEJA 4EW3A 2EEZA 2CVZA 4FDUA 1TU4A 3T3DA 2Y9MB 4F38A 4O1IA 1M0EA 3OKCA 1B6SA 2HL6A 3Q98A 4R1PA 4MPPA 1YACA 2FG7C 4UBLA 2ZI9A 3WIEA 1FS6A 3G0GA 3A1SA 2FVXA 3SLRA 3QLVC 3KSAC 1UPTA 2J3QA 2JJ1D 3IBGA 3QY0A 3F8TA 4KQ1A 1LLUA 1YR2A 2C5EA 1QYDA 2NAFA 4MV3A 3FX2A 3PVCA 4XIFA 2AFHA 3JRNA 1KK3A 4WJZA 4C14A 1SBIA 4WY5A 3OTOB 1THZA 3VH2A 2VP4A 4NCIA 1YB1A 4QEKA 3LQRA 5IANA 1G6KA 3SJCA 1E92A 2O57A 1SKMA 2R25B 1SD5A 1W6RA 4JKOA 5E0OA 4QYTA 1CLUA 1IXKA 2HU2A 2Z1MA 3SG0A 3V8NA 4ZCQA 3T3NA 4D9GA 4BO9A 5J1TB 2NV6A 3LKVA 4RFVA 3MTIA 4KUEA 4O4IB 3RUPA 1XVVA 2Q4BA 3T5GA 2IOQA 2ZRJA 3S4YA 2KW5A 4OQYA 5ALOA 4XPIB 1RCTE 1BXRA 1G66A 1E94E 4JITA 5LD2B 4ENSA 2JLCA 4MS3B 5F98A 2DSTA 3INTA 4PFJA 2SECE 4QLAA 4D9EA 4CMKA 2XZOA 1EZ4A 2HPHA 1SB9A 3G9TA 4AI6A 4UE3S 5KPDA 2O1SA 4FN4A 2YRFA 1BS1A 3HR8A 1NN1A 3AETB 4Q3EA 4LWOA 1XC7A 5JV5A 4IF4A 3BVPA 3VOSA 1OT5A 1R4MB 4HI0E 1J09A 5LDHA 3B6IA 2D5LA 1AS3A 3WHPA 3KZKA 5EIAA 2UVPA 3RG2A 4XOIA 3SBXA 4A27A 4X1IA 2BMJA 3SBEA 1R6AA 1ELOA 1Z5NA 3ZQJA 1W2HA 2A30A 2WWVD 4EHKA 2B92A 2HO5A 1VLJA 4DIMA 4FI3F 2HAEA 2WJAA 4AQDA 2R5WA 1PGNA 1ZAYA 1GAXA 2VDOB 4PYJA 1ZR4A 3U4DA 2NO9A 5ENDA 2I2AA 1RP7A 2LDXA 3L04A 1Y1LA 1J2TA 4QOFA 4PCLA 1WNFA 4TV9B 1PD0A 2OG1A 1YHZA 3RYHB 3HP4A 5ALRA 3V4PB 2P5UA 4S1NA 1V16B 4F46A 4XGRA 4PZ0A 1PE0A 1YVUA 4KO2S 1XNQB 4KZPA 5DNWA 2CNOA 1JFFA 1XXLA 3MJTA 1VL8A 5K3DA 5B2FA 4X6UA 2GMWA 1EFRD 4LA4A 2QSUA 2GK7A 2V4ZA 3OFSA 4CMBA 1PKEA 1NQAO 2UAGA 3EG9B 3ZN2A 2V7UA 3P5BA 3PDJA 3LQ1A 4HDNA 1V5IA 2J07A 4OGKA 4GWKA 4A5SA 1N6IA 1T2VA 4YT4A 1ZC3A 4O4LA 1T9DA 1UKZA 4B7UA 1O4VA 4ID3A 4N49A 4WJKB 5JTTA 1FIUA 3ZHSA 1DEHA 4B09A 4URVR 1R6XA 1AD2A 1DBIA 2YC2C 4Y2GA 4PEVA 2Q3DA 2CXXA 3IQDB 4MKGA 4OQDA 4B48A 4N3GA 5C46F 3PKIA 3RFTA 4ZMSA 1Q1ZA 2CY0A 4LRUA 3TEFA 2FEKA 2ZS7A 16PKA 3F3SA 1FFWA 1QZ3A 1YA8A 1P2SA 2YV3A 4GI3A 4OH7A 2NZWA 3GCDA 4P82A 3RABA 4NOMA 1JQDA 1IZ0A 3B36A 3ND7A 1RWKA 5DMXA 3SC2B 4F04A 1O58A 1FUYB 4AAYA 3LLVA 2VJMA 2J3DA 2JGIA 4W8GA 4KK3A 4U2EA 1B43A 5REQA 2QTVA 2C2KA 1EBUA 1HL7A 2PUGA 1C8BA 5DGTA 4CTNA 5KO2A 3D7MA 1BAPA 5AFSA 3CE6A 4ZCSA 1J06A 3GJYA 1I3LA 2Z4SA 1ZRMA 4CXMA 1XCMA 4FFLA 1AGNA 1H4VB 3E18A 4RF4A 2ZROA 4DKJA 1SVOA 3GPIA 5L4NA 2RH5A 2QU8A 2OKCA 4J7CA 4UM7A 2BH2A 1TM2A 3Q7RA 1RKBA 2ODNA 3GQBA 2CHEA 4OMDA 2A9VA 4FYMA 4OQ4A 3QA9A 4FN5A 3ZBTA 1FXWF 3FOFC 3THXA 1QF6A 4GRIA 1EUQA 1U9JA 3GBVA 3N8NA 2WFMA 5CGQB 2XR1A 1AXRA 1GA6A 2D7JA 2ECFA 2XUPA 5HHTA 3ZDAA 1OBOA 3BCUA 1YRHA 1I32A 4KPGA 1O6ZA 1FW8A 1DUIA 5AUQA 1RIIA 4AQYB 5HCNA 3DR5A 3IAFA 3E23A 2R62A 2YJTD 3GJ4A 3OZEA 5D87A 5D6OA 3HPRA 3LPLA 4RPJA 4Y1RA 4EIWA 2OQRA 3IAAA 3MB8A 4TV8B 2EJCA 3BGSA 4RTLA 2GI4A 3EVTA 1F3LA 4FSXA 1Z74A 4CT0A 2FHSA 2WFLA 4FCTA 1SQSA 3KU4A 4EW1A 1QCYA 2A0XA 5F2KA 4CM8A 2YJGA 2OP0A 3A14A 4IVNA 4MGEA 2ID8A 4HQNA 4Q66C 1U2PA 2Q5HA 3KWLA 3PGMA 5MN4A 1Z5OA 4DLAA 1ZZGA 4ZAZA 4RIFA 3ONWA 4DM3A 2UXCB 2AG1A 4AP9A 2I87A 2YHSA 5A7FA 4UQOA 3VV2A 1H2EA 5KQRA 1N9ZA 1S3IA 3R3ZA 3R8CA 1OZ0A 3R6DA 4B4DA 2G9QA 2P2NA 3I9NA 3K92A 5EPOA 3THWA 1GZVA 3D2LA 3IDZA 2OHGA 3CQ9A 4BWVA 1GPMA 4EQ6B 5ITVA 5BURA 2C7GA 4LJ9A 1KGSA 4OKSA 5K8CA 3EIUA 1E32A 4Y2UA 3HGMA 4ZYTA 5K45A 2HSJA 3BIXA 4JJAA 1HORA 1EVIA 2G5GX 3V48A 2GCNA 4IZIA 4NOKA 1RR6A 1NVVR 3B78A 1M2HA 4RHTA 4ZZIA 1ZL2A 5A3RA 1R4AA 4TVSA 4EYSA 4D9CA 3WK4A 2QLMA 2ESRA 3DAGA 2BBOA 3WYNA 2ZRKA 4YT2A 1C7EA 3IE2A 3M9WA 3QWIA 3DEYX 1UH5A 1ULBA 4RQBA 5FRDA 5AXAA 4A7PA 1USVA 3HDVA 1PW7A 1BE8A 1O0CA 2C61A 3WO0A 2VYFA 1NQXA 2QD1A 3MRVA 3LCCA 1N5JA 1U9IA 1X1AA 2ZR0A 4MR7A 1E9FA 5THKA 4ADSG 4PG5A 3NVKI 2H1HA 3HCCA 2XVMA 3C2QA 1YNOA 3UAZA 5KVSA 1WF6A 3OCXA 4XDGA 5AWFC 1OWMA 4NTZA 3TK1A 2RIPA 3JYPA 4F5WA 1QGAA 4BWFB 2GBCA 3FI9A 1G63A 1WBJB 4GPIB 4BMOB 3WAKA 3ER8A 4AJHA 4IIGA 1AKMA 4M9SA 5EJAA 4RE6A 3WFZA 2EFCB 4E15A 3TW8A 4CCWA 1QAMA 4UFOA 5KTRA 2WAOA 1ZCJA 5F76A 3JRXA 1SVUA 3HCNA 5KDOA 2C4TA 4J0EA 2PGLA 4P83A 4CQMB 5AW9A 1UXJA 3N2GA 4XR4A 2JLBA 2A9JA 4C2AA 3URMA 5LP6A 3ZYZA 5DMHA 3T5MA 1QVWA 5C37A 1TRKA 2QN1A 3BK1A 5J4YA 2FZLA 1IDOA 5E4YA 1V9SA 2ISCA 3F1LA 2M98A 1MOZA 2P9BA 1OWPA 4Q3AA 4DA9A 3FTDA 4NEQA 1E2UA 1ZICA 2KJQA 3EWIA 2B0CA 1GZHB 3FXAA 2R47A 3HLTA 1N92A 3P0JA 3PJDA 4UTNA 4KVFA 5EHIA 3OQHA 4W8HA 4TYWA 1KH1A 3NBXX 2K7FA 4TTAA 1ZCBA 3M2PA 5AM5A 3VC3A 5G53C 5AVVA 4U2FA 1P9RA 1A8HA 2V98A 2VYQA 1NMSA 3FOWA 3N59A 2Q0QA 3NXSA 1EUDB 2A5DA 4EK9A 3AEKB 2PKCA 3K30A 2GEKA 1G21B 4IMJB 4BQRA 3QW4B 1LGYA 3F3KA 4I50B 4L15A 1Z6XA 5C1IA 3RTCA 4D57A 5CFLA 5E7MA 4DZZA 1KDYA 3RVSA 2NU6A 1TGYA 3MGAA 3KYCB 5U1PA 4NG5A 2WE8A 2W2KA 2PO5A 1B93A 3KVNA 4KN8A 4EELA 1R4NB 3B5JA 4QFCA 4KXVA 3G8CA 3GFBA 2IUYA 4FC6A 4R3UC 1NI4A 3BXEA 1BD3A 5AP9A 2O20A 4M4SA 4N65A 3FPFA 4ZO6A 2OQVA 3BWDD 1POWA 4DLRA 3DMRA 3SWWA 4CTJA 2Z1NA 3VNVA 3COSA 4LK3A 2P65A 3NB0A 2JGFA 4EVRA 3LZCA 7REQA 3KQYA 4Q12A 4ER7A 4ENWA 1B3RA 1NLUA 1TW3A 4D45A 3BFXA 4II7A 4CV0A 5JVDF 3WYDA 1JQ3A 3R9KA 4LRTB 2VEOA 2GN9A 1DPFA 3FVWA 3JZAA 4XWOA 4OHYA 3O2NA 4QUDA 5AJVB 3IEKA 4G0XA 1W44A 4G67A 4RK5A 4RL6A 1YZLA 2FEPA 4ZVQA 3VMMA 3CTPA 2DLNA 1SUPA 4P53A 2DFKB 2Y4OA 1RHRA 4Z1MA 4ZK6A 5HQTA 1UBHS 2W2NA 3OPYA 4DXAA 1UBUS 3O8CA 4PZLA 1EG7A 1Z8FA 1F12A 1LDMA 4HBGA 4IGEA 1Z6QA 1OVMA 1IJFA 5L3ZA 3U48A 4RVCA 4BKQA 4BVHA 3PLNA 2D6FA 1HX7A 3GBSA 3CNEA 3HLYA 4I7EA 1KDTA 3Q3EA 4KQKA 5CM9C 2BT4A 2H2FA 4PWYA 4F6LA 3ZWOA 5DW0A 3EIFA 2ZE5A 1UBEA 2H5JA 2V6BA 1NKTA 2RGYA 2IXGA 3C85A 3FBGA 3MJSA 4ZAYA 5BVHA 5JISA 1M2KA 1EM8A 1R0XA 2CXHA 1P5RA 2H4YA 4ZEOA 4WZAA 2QVLA 5K5EA 5EZYA 3RUDA 3WQBA 5LXTA 4ROTA 3UMYA 1ZH8A 1OLUB 5CLGA 3H2KA 2D13A 1QH1B 3GEIA 3K0SA 3U3ZA 5CDYA 1I14A 2X0JA 1Z33A 2AZ4A 3FNEA 1GA4A 2CKMA 2ZIFA 3OFJA 4MQEA 4ZALA 2QRNA 5FFMA 5FULA 3MQ4A 4C6TA 4BJ6A 1LW6E 1FNNA 2F8MA 5ALUA 1WW8A 5J4VA 5EKXA 3N8IA 4HBZA 1DJPA 2FJUA 1I4WA 2G06A 3JWHA 3OX4A 3PUVA 3WLKX 4B8WA 4BCDA 5HKBA 1NXSA 1OWOA 1YUNA 4K1LA 4QUHA 1XX6A 4Z51A 1H8HA 5TPZD 3AI3A 1W0KD 3LIPA 4L4UA 2OCDA 1J0EA 4AIRA 4FHCA 4OCZA 1U3WA 5JI2E 3OZDA 3D1VA 1DADA 3A1WA 3VNBA 3WGVA 4GKAA 3ZOKA 3IEPA 1RAFA 2OHOA 4OHVA 2ZATA 3ZHCA 5K3AA 1EE2A 4ZYZA 4ZEXA 2I34A 3PX7A 2ZQZA 1ZD4A 4DAOA 3QG1A 1JWBB 2R6JA 4XW2A 3EPPA 3X1ZA 5J4HA 2CV0A 4KR3A 1J1ZA 3EE6A 2QR2A 3PTLA 1OGJA 2GYYA 5DLEA 3TFOA 2C82A 3A37A 1JA9A 1LJLA 1Q19A 3Q8XB 1JVNA 4RAQA 1L7XA 2KHZA 4HDCA 2FSVC 2Z9BA 4EGJA 3LG2A 2QM3A 4XE5A 3QPWA 5JZSA 3NWBA 3L8CA 2E4UA 1X39A 5L4SA 5EG5A 2C0PA 1IUOA 1X3LA 2ICAA 3E58A 3PDIB 4R8SA 4URUR 1OFVA 3T99A 3PD0A 3GG2A 2OT3B 3TIIA 2FUKA 2AE2A 4FYPA 2JLVA 5KNBA 2C2YA 3ZV4A 2ORYA 1E1QD 4V3CA 5K1ZA 1AJEA 3P1JA 2MSLA 1II9A 4V0OA 2X8LA 1Z68A 3OY2A 4JS0A 4IIYA 1L7DA 4AF6A 3W8EA 5K01A 1Z63A 4GC5A 4XWWA 2BFCB 4BXOA 4HK4A 1PBNA 4Q48A 3KB8A 1IULA 2MHCA 1SCUB 3AEZA 1CQWA 4M2LA 1J2UA 4R2KA 4UUPA 4X97A 4B4VA 3D8HA 4F3KA 1WD7A 3LC1O 4ZYVA 1EZZA 4RSHA 3O7WA 4RYDA 3SM3A 4O08A 4EI8A 3HQ4O 2IU6A 1ZD1A 4G5RA 5IJWA 4IOKA 5FBLB 4BZWA 3UHAA 4DYHA 3KFLA 3WIVA 2BGUA 1J0BA 2EARA 2JCBA 3TPZA 4QHYA 1XGKA 3RWMB 1BDIA 1VJ0A 3AT1A 5ALVA 4XI9A 3CLTD 4EKYA 1E2EA 4JZKA 2GARA 4WOJA 2GKOA 3RKRA 1RBZA 3E61A 2H57A 5M29A 1RZ3A 2R84A 2ODPA 2X4GA 2OGWA 5DHUA 2VT3A 2FEMA 4WCFC 2XMRA 1SXQA 1RQRA 3QKRA 2F4NA 4AO6A 4LV6A 5LIPA 3VYUB 1ZCFA 4NARA 2RE8A 1E3WA 1M2JA 5F2EA 4COOA 3TR6A 3GU3A 2QZ9A 2AJTA 3GZNB 2FW0A 3QFRA 1KMIY 2FFQA 5DLQC 3SEQA 3AF4A 3GWZA 4NEHB 4CQJA 4Z4QA 4KJXA 1X9HA 1F8UA 2OCGA 2QV0A 1T3HA 4YRRA 4OI4A 4GLOA 4G0PA 1CETA 1TPYA 3LCUA 5HX7A 3Q9SA 3LO5A 4M1KA 1K6JA 5TB5A 5SYMA 5BW8A 3WB0A 3W05A 1M2EA 3OEEA 4L4XA 3G59A 2DFLA 3DMFA 4TM7A 3TDKA 4EX7A 5AHRA 2EC5A 5EHQA 3NVMB 4HX2A 4H1WA 3IUYA 3JPWA 4CKCA 3PPXA 1L4GA 1MAVA 2YCBA 5F7JA 1Z38A 1U2DC 4LIPD 1PGPA 4P38A 3RAPR 4W6QA 3QNWA 1IIBA 3LKDA 4UJ3A 5AICA 4F9GA 5JBNA 1ULAA 5CAEB 3BWCA 1GCGA 1NFQA 1GYPA 3VDXA 1W1UA 1WPXA 1PEKE 2GVDC 1MW8X 2ZPTX 3FG9A 4D26A 1CQZA 1T36B 1WU7A 2BWJA 1A9YA 3B12A 4BN0A 4D6PA 3ZJUA 2QUJA 3L6BA 3KNZA 3C1TA 4LJ7A 5D3QA 3CA8A 3GAMA 2HNKA 4GRAA 4NBWA 3L0BA 2VP5A 3EFBA 2LIVA 3K2EA 5E8JA 3KPVA 5TRTA 3DVSX 3T7IA 1Z26A 4CODB 4J9UE 1EHIA 4NV3A 4ZGBA 5CLFA 4JXZA 2IP1A 3QENA 2ZYRA 4D42A 5KKCA 2WNSA 4D9FA 1U0FA 3NNDA 1LTKA 1NUTA 4PLZA 1TK9A 3A6FA 2AKEA 3GLIB 3Q40A 1P44A 4NK4A 4OM8A 1R15A 3MOIA 1VL1A 1Y9EA 4IH1A 5FORA 1EA5A 3QE3A 3L49A 1C8VB 3CLHA 4D4KA 3OOWA 1CUCA 3VPXA 1DIBA 2PAFA 4RCYA 2QB5A 4K0RA 3ZR4B 2JFZA 2QMUA 1GTG1 2IOYA 4HDRA 4QL3A 4IIXA 3GGCA 4FFMA 1HDCA 2RGNC 4HVCA 3LDUA 4V1CA 4UASA 4KAFA 4YWHA 3ER6A 4ZODA 4G8JA 2JEYA 1MXFA 2O23A 1TJ5A 2BGRA 3OZBA 1PJ2A 1U5AA 2HMTA 4Z0NA 4R2IA 1E1YA 5CH8A 1D8TA 3I09A 3LYHA 4DB4A 2VQ6A 2HA4A 3MJHA 5FQNA 3V1YA 4DA8A 1KO4A 1LDBA 1NP7A 3DFZA 1SKYE 1XLWA 3YASA 1O95C 2V6GA 3FKQA 3HUDA 2OFFA 1OGIA 1B7GO 2IVZA 1LVUA 1J22A 1TU3A 2F1JA 2LR0A 3HDTA 5LN1A 1FXWA 4A0RA 3KEGA 3U56A 1AS2A 1DIAA 3PTZA 4RD2A 1KQFA 1XR3A 1S2GA 3RM3A 2RKWA 4FHEA 4UBIA 2AN5A 3IE0A 1HOXA 4PYOA 4ETIA 1DHTA 1WHSA 3CXRA 4GIBA 4B4KA 3HSKA 4KQ6A 4BBPA 3CW8X 2HLDD 4DA6A 1D2RA 4QDXA 4C0HA 1AY0A 4AX8A 2D2XA 3QX8A 2CXPA 4U00A 1LPOA 4A6XA 1ZHOA 4QLBA 1E98A 1CJUC 4FUQA 1DTWB 4E14A 4K1XA 4NEGA 5CDTA 4QVKA 3C5VA 3NHFA 4KITB 2R5FA 3FCYA 3HO8A 1XJCA 3E22B 5AVSA 4NFSA 4JUAA 2IZOA 2OHJA 4HQFA 5H9VA 1UEJA 3VH4A 2H1RA 1QV7A 3ZE9A 1USIA 4V1CB 2AOXA 2E4YA 2G82A 1PFKA 2Z2ZA 3A10A 4ND8B 3ISJA 2WFZA 4I4TF 3UY4A 2UVDA 2V03A 4B84A 2OYRA 2AVNA 4JZYA 3FOCA 5BQ3A 2KBFA 2R1ZA 2ZRHA 3R24A 4WASA 1EUCA 3C4JA 1LSOA 3O4HA 3WNZA 3RS4A 2V0CA 3KHSA 2PX0A 3R8XA 3UICA 3HJTA 4XWGA 4Y2QA 3FN4A 4OA8A 1Y4UA 5LXTF 2OXFA 4JWTA 3W5VA 3W9BA 2E0IA 1RQPA 2WYVA 4OGFA 4YI5A 2VT7A 2X6QA 3BRSA 2C9ZA 1ENZA 1VZ3A 3LDAA 1ZOIA 4O2BB 3SJZA 2ZBPA 3W5SA 3BZUA 1WZNA 3P71T 2ZUVA 1JDNA 1Y1TA 3VVBA 3EGOA 4D9KA 2HA5A 1BHQ1 1ZXLA 4FGWA 4HNUA 5MGNA 2CMGA 1M0TA 1BRMA 3LKZA 5IVIA 1NVFA 3FKSA 1B73A 3WLNA 5CB8A 1QANA 3QU9A 3MWEA 4D4HA 2ZWIA 1TT7A 3PXUA 4IX1A 4GPZA 4XFDA 5BSRA 2ZVQX 2VDKB 1SZJG 2QD5A 1UT6A 2WF8A 4RFLA 1N5IA 9LDBA 1ZA1A 2CDRA 2P11A 3CEHA 3PRYA 1LK7A 4KUHA 1J0DA 4C3ZA 2ZT5A 2QQEA 2BSAA 3NHBA 3DZCA 2RGBA 4A8JC 2FNAA 2O5RA 4M9RA 3L4BC 4O4IF 5F78A 4JI0B 1GLNA 1DUVG 1UK6A 3K1ZA 3PQEA 3ZGVA 2V7XA 5FIUA 1KZ6A 3CWQA 3BAZA 4YWJA 2D3WA 2VHJA 3I9V1 1XTUA 4WY2A 3AY3A 1XZMA 4HZUB 3IERA 4RQUA 1M8KA 2V6JA 4OXRA 3TF5A 2NUBA 1L5RA 3FYHA 4LZJA 2REQB 1CJVC 4MR8B 4XLLA 1DAFA 1GM5A 3PPYA 2XNDA 4PG4A 5LYYA 1WDLA 3HY4A 2B4RO 4NG4A 2LBPA 1VDZA 3OD5A 1FA9A 3H99A 2LPMA 5AD1A 1R0RE 3ZTYA 4Q9JA 1YR8A 2ZRQA 2WHYA 4RX1A 4PSDA 4FUTA 4OJTA 3ZIAA 1G2IA 1SOVA 1XXHA 3E2PA 4W1QA 1ZRSA 5CDSA 1RKVA 2CHUA 1EESA 4Y1FA 1WDWB 3IVRA 4RA9A 3K71B 4C87A 3KJZA 2WJ3A 3JYNA 4CR6A 4TV9F 2EJTA 3EDOA 1CB0A 3W3ZB 4Y2JA 1RJ9B 4WCFB 1CJCA 3ZCRA 4L07A 1XRPA 4IBOA 1XQXA 3ROEA 1V4NA 1CJTC 1V1RA 4FQ7A 1OI2A 2EFGA 4FYJA 4JBGA 3QJ5A 3TB6A 4F3YA 4YUWA 5AM3A 1NRIA 4PICA 4BU1A 1R16A 4CQLA 4RTPA 1R4ZA 1GPDG 5A4AA 3KCQA 5EIWA 1ATIA 2B25A 3RUCA 3EK2A 4M8IA 3TTSA 1XZIA 2TMGA 5KNDA 1MRNA 1GR0A 1TA9A 4BFYA 4WBNB 4U63A 4TYYA 4Y6OA 1KA9H 2VP3A 1SXJD 1Q5PA 3NNSA 1MKYA 4GU5A 5TF0A 5JROA 1S4QA 3PYMA 3TLMA 2GHRA 3JYQA 3DE3X 1JUDA 1E20A 1T8WA 4GEKA 4N8DA 4BMNA 3EMBA 1HC7A 5IJ0A 1XCLA 3O4FA 3ES9A 1VHLA 1QIKA 4KE8A 3K5HA 1X1DA 1FTGA 1W30A 2PZEA 2H1SA 4U8GA 4BMCA 5DBHX 1UDWA 1P4RA 4R05A 4QG3A 4R8VA 1F0NA 2PM8A 2VCHA 5ED0A 2ANCA 4D41A 2HN9A 3K1AB 2EW2A 2GBGA 3OF3A 4F97A 4PRZA 1H05A 2ET6A 1RJFA 3TQRA 3F96A 2W6MA 2BD0A 3JR3A 3K09C 1MAAA 1NVTA 2V5AA 2F4VB 2V6FA 2ENUA 4LF9B 1ECCA 4GF5A 5B58C 1M1YA 1E5VA 1WPRA 3ZBQA 1ISGA 2C92A 1Y3AA 1J2JA 1NX6A 2I65A 5EEHA 1J0CA 3ILYA 3PHLA 1JMKC 1G59A 3OTGA 5IH7A 4PNPA 1U3CA 1X7XA 5B36A 5BSHA 2B5VA 2OV6A 1U6JA 2BJVA 2W8BB 3BCSA 2C03A 2I4RA 1BDBA 5KTYA 4M0PA 1AMNA 1GU1A 2HADA 5KI6A 4D8UA 3W2TA 1MX1A 3UK6A 1X7ZB 1ZD5A 1JR2A 1KJZA 4YMGA 2PD6A 4MWDA 1XFDA 2VBIA 3FPLA 5LB4A 1UMDB 1VCHA 2ZITA 4E2ZA 1ST3A 1CU1A 4LVOA 1BCRB 2QM0A 4CCYA 2HT1A 1PK8A 3FCOA 1NN0A 5FUBA 3T1HB 1SQFA 1EFPB 2CMFA 3GX1A 4DDVA 1IU9A 1VI6A 1L3IA 2AEEA 2W6ZA 3F4BA 2CNBA 4ISCA 5BMVB 4W82A 3B6MA 3KSBC 3QOWA 1M2VA 4FNGA 4TV8F 3OLXA 3DNPA 3T3EA 1QNFA 3R6TA 1TYCA 5HJ5A 3AUTA 3OM9A 3VDQA 4ALIA 4ZO9A 4JBYA 4JEIA 2ZB3A 2V7GA 3T4XA 1YQGA 2IEYA 5AVWA 4PQFA 2I62A 4GX2A 1PF7E 1BA3A 3RSGA 1IIRA 5E2AA 5HIIA 3DYVA 3QBEA 3IAS1 1XWIA 1ZD2P 3LT1A 4M55A 3U7EB 4REMA 2B0JA 4DUGA 3QW2A 3IR6A 1IY9A 4N5LA 1G291 3DWFA 3EBOA 2IIQA 1HTBA 4CLEA 4AZ3B 2UZ0A 3D4NA 3CUKA 3DBRA 3FPKA 4DYDA 1XDUA 1I6LA 4RJJA 2HKIA 2QNIA 2WZQA 4FYYA 4YCDA 1JI0A 4PGFA 3WBBA 2BC9A 2G80A 1T2AA 1YUBA 3PD1A 1QLWA 4GEGA 3TW4A 4F4DA 5M04A 1WB9A 2BKXA 4DCTA 1YZHA 1U65A 1GGJA 1QHSA 1JEJA 2PSSA 4JOSA 3RVLA 3ZWVA 1LX7A 1YTUA 3K31A 5JC8A 2WB4A 1QE3A 5BSGA 3GZTB 2QTWB 2VZEA 3D3NA 3FMVA 4ZOBA 5BQ5A 2PKWA 4OUKX 3SEFA 4A92A 3MWDA 1RAAA 1E0AA 1BC5A 3A3KA 1KYVA 1YULA 2PBFA 3DF9A 3TAXA 1KR5A 3LHIA 1KZ4A 1JDTA 3LP6A 3FHTA 1TPZA 4G4SP 5ULLA 1OX5A 3GRUA 5HKKA 3UAXA 4F06A 1L2TA 2YIMA 4WUVA 3W0LB 4EAAA 4HUQB 1NX9A 5A4FS 1UWLA 2HX1A 1YJQA 2ZJBA 3QVSA 4G07A 3I04A 4UM8B 3KO8A 4UQPA 1T5IA 3EVZA 4XUDA 3AF6A 5JYBA 2WWYA 2JS7A 2EVWX 3IQGX 4X7RA 1TZKA 1SCBA 2GNOA 1FP7A 3AHHA 4UM5A 5TQ2B 3VHRA 4DRXA 3KJEA 4ZN6A 1QG0A 1QORA 4Q1FA 4CIWA 3R7AA 3TQCA 1E3DA 1Q14A 1NWCA 1ZHHA 3S40A 4DWVA 2ADMA 3LHSA 3GLUA 4Q7EA 4WI1A 4XWTA 4JUFA 1J49A 5FO1A 5JNVA 1D1PA 1UDXA 2VZ0A 1L7OA 1CRQA 4CKYA 3R7DA 1ZNWA 2L17A 2FSFA 3V1TC 1PQ4A 2JEZA 1EM6A 1L4LA 3SCZA 2DUUA 4X7MA 5HMLA 2XKKA 3LXRA 1VL2A 4TKUB 3NI2A 2XB2A 3ZDYB 5EWMB 4D3XA 2J87A 3AKDA 1E7YA 3BXOA 1FFBA 2WYIA 4S1OA 4HD8A 2Q8NA 4DLNA 1YT5A 4QNMA 4ZO8A 1YB5A 3OKPA 4X1KA 5J5CA 1XF9A 4NESA 1NFRA 4E88A 4HNQA 4QWWA 2CZGA 2QRPA 3BSFA 3RYIA 1JQBA 2VHQA 2VQSA 3O3NB 4U4AA 1C0EA 2JK1A 2QIOA 3ELUA 1MJNA 2QLTA 4A8JB 1AC5A 1B16A 3B70A 3FRIA 3P4XA 4KC0A 3VR6H 1BXZA 1CE8B 1PJAA 4LSZA 4OL9A 4KPUB 4P9NA 2IHZA 2PMFA 3RF6A 1NF9A 4DLWA 5IPFA 3CVWA 2JIOA 2IWHA 4DY6A 4DN6A 4F92B 1KFEB 4I50F 1H4SA 3UT0A 4YT8A 3QUQA 4J3JA 3AU8A 3JAMA 3HXKA 2ZI3A 1E99A 1U98A 4PS1A 3KVVA 2CL6X 3P9KA 5DP1A 1GQYA 1UT5A 2CBXA 3UAOA 4DR3B 1OXVA 2HBZA 3IUJA 4MPDA 4UTXA 2FW1A 2OBFA 2CHFA 3U7IA 1HPLA 3QSYA 2ZRGA 2GR9A 4LZNA 4NNJA 4B46A 4FDLA 1BEZA 4EGQA 2PR7A 5ESWA 1UF9A 4MH0R 3TX2A 4LNHA 2BJWA 2A88A 2R00A 2C5LA 2QTZA 2VWHA 3DLCA 2XW6A 1DX4A 1LY1A 1MCZA 3V8VA 1Y8CA 3EWSA 1T9KA 2PS0A 1E6EA 2NUTB 3JQGB 1YI0A 4MPTA 1G8GA 1Z2AA 2CJYA 5G4KA 3S55A 4A5OA 4OVKA 5GOZA 2VYCA 2EJUA 4HGRA 2A0FA 4FD3A 1ZWKA 2BSXA 2ARKA 4WACA 1Z2NX 4MIKA 3LWZA 3HUFA 3ZQKA 4C29A 4CMAA 2YCLA 2CFTA 4DG5A 5CXQA 1EYZA 3ZJ5A 1Y3BE 4JSTA 4ZAGA 2XAUA 3ANTA 4HTFA 1KEUA 4HQRA 2O4UX 2E4AA 5TMDA 4J49A 4MQ5A 4PNEA 3AUXA 1KYQA 3VPAA 2ZUBA 1G55A 4ALNA 4R2XA 2BKEA 4OYHA 5E1MA 4NNOA 4OQXA 1KL7A 1U7TA 5E7IA 4TLCA 3A2LA 1X86B 2PZKA 8OHMA 1OGYA 1T9GS 4M21A 2UXDB 2QY9A 1HDIA 1KO5A 1U99A 4UHFA 5DV9A 3MS7A 4ZRDA 4UTPA 2PKYX 5G1OA 4JR2A 1GZUA 2YBDA 3JQQA 3NPAA 4U7GA 1LX6A 1Q0TA 1P5ZB 3C41J 2OYSA 5D01A 5EJFA 3TRKA 3N05A 5JWOA 3VJRA 3TJMA 1X1EA 3AHCA 5H02A 1FDWA 3A05A 1P4HA 3PFBA 5GAJA 5IU6A 1UAAA 2BZ0A 2Q6TA 1UBOS 2J33A 2UZ3A 2XMDA 4LXGA 1WWKA 4WD3A 3WJ2A 1GPKA 3AFGA 3HRHA 5KINB 4EYGA 5FDFA 4JBXA 4UHEA 1XP5A 2G36A 4RJTA 5LFAA 3S8EA 2Z30A 4PFQA 1EBBA 1HZJA 2Y1DA 4MP8A 5LVAA 2H1VA 3IJPA 4C7VA 4B2PA 1N2GA 1I4EB 4ISBA 5EGNA 3WZMA 3JARA 4GS5A 1TTQB 3P4YA 1QAOA 4KLZA 2WYWA 4D80A 3PT9A 1U5BA 3AVOA 4KI7A 4LXXA 3IQWA 1D2HA 4GE0A 4NY1A 3QYFA 4ZIRB 3UJ9A 1IOVA 3JVEA 2V55B 2YJ4A 5EE5B 3TOCA 1LQUA 1LRJA 2AN4A 3D2CA 3ONNA 1IQUA 2W6PA 1DDIA 3ITNA 2XTZA 5DHPA 1GXSB 4HN4B 3QZUA 5DHAA 5DSTA 2GPYA 2D4AA 4GVXA 1WSWA 4M53A 1YKSA 1JR6A 4LPSA 2QSJA 1PN3A 3DL4A 4HYTA 4PAQA 2EL9A 3LUCA 1T0UA 1Z4LA 1NSTA 1V7PC 2VYVA 3C3WA 3L6DA 4H59A 5F9MA 1UDBA 3H4TA 3FWKA 4C30A 3EAGA 1O6GA 1T6ZA 2GM3A 5F5LA 1FLDA 4M88A 1ZUHA 3ZCSA 3GLSA 1MHPA 1EWVA 5DM0A 3OU2A 1H2XA 4MRMA 4W5HA 3BD7A 1H66A 2CDCA 5DBGA 5EFZA 1IB6A 3PHHA 5FNZA 2C2OA 4FZ5A 3BRWD 4G01B 1W93A 2YJ6A 3IVMA 4ZYXA 2IS1A 5JXIA 3A06A 3PG5A 2GTHA 1V5GA 1FDUA 1WKCA 2YXBA 1TJNA 3AI1A 3NTLA 3OURA 4B3SB 1QIGA 3B7PA 3FZGA 2H2WA 3NDRA 5F23A 1O5OA 3VR3A 1LV7A 2FSGA 3IGFA 1QF7A 3UAYA 1BH6A 2RBEA 3OPQA 3H5OA 4TSKA 5E2IA 3ZHXA 2BFDA 3H2ZA 3LSYA 1BIFA 1CF9A 3IP1A 3LX5A 2EW1A 4YECA 2QMEA 3OP4A 1RWQA 3AUSA 1CQIB 1MV5A 1SCNE 4UBKA 2DQSA 5JYCA 3KXKA 4MKHA 2XE4A 4K6FA 2B83A 3IV6A 4J3FA 3BKWA 1HDEA 2NXNA 4WHMA 2I4MA 3CH6A 4MUMA 2ATIA 2B9VA 4EHDA 1N2EA 3GI1A 4FYXA 5BWCA 3CZAA 4POAA 2R11A 2FFAA 2YS7A 1RQXA 5IWCA 3UAWA 1FS5A 4D0GA 2R0QC 1DB3A 1Q0SA 4DSNA 4F60A 1ISRA 3ORYA 1EIWA 4DMHA 2IU4A 5C9ZA 3VPFA 1GNRA 1I6KA 3S5UA 3L7IA 5HDQA 1W581 2A1TS 1YCFA 2CFRA 4FOPA 2GN0A 4JLDA 5KDDA 1W8IA 3HZRA 5SYNA 1M3SA 1PKXA 4R31A 1NV9A 2HPAA 1AKWA 2UV8A 2J0UB 3D8UA 3DNMA 4MA4A 4MS3A 4PC1A 4BFCA 1MW9X 5CBKA 1XIVA 3L43A 4B3MB 4ND4A 1R6BX 2UUBB 3KS9A 1ACJA 2ZSDA 2VK1A 4GSYA 1EJ6A 5SZJA 1R88A 4DCUA 3GCXA 1LZLA 3U62A 3KZVA 2A1IA 3OIDA 4LI0A 3AETA 4BLOA 3I61A 4FFSA 1H69A 1EJ0A 3HWSA 4GP6A 1FRZA 3ROTA 3BFVA 3C5EA 1UOOA 1V1MB 3Q0EA 2O2IA 1PT9A 4X61A 5A3QA 2VBCA 1DCFA 3ZE0B 4G9EA 1V8BA 1QRRA 3THSA 2B5OA 5K51A 1YQDA 2H5LA 1SFRA 1M5RA 3C1AA 2GT1A 4LHEA 3EIQA 4BBAA 2C96A 4JL6A 2GO7A 4RNDB 3DHNA 1N7IA 1QWOA 1XALA 2WMDA 2Y0DA 1ZU5A 2E85A 1W5EA 2OV2A 5IJZA 1GPAA 4MS1A 4MVJD 4DIOA 2WY2D 1XJWA 1K5DA 1OTYA 4DSUA 3HO6A 4B35A 2YQ4A 3FSJX 4PQEA 2CE7A 3EG9A 4FR5A 3HCRA 4M1SA 5CVJA 5DEOA 5I45A 3IMEA 3L0IB 5EUMA 1L3BA 3SPXA 4PCUA 5ILGA 3VJMA 1QTNA 3B38A 1GQ2A 2IZ1A 1PR6A 1IQ0A 2SICE 3RJZA 4W1SA 4BNJA 1CR4A 1VPEA 2HXGA 2X9GA 3RHFA 1RHJA 3S5JA 1OX4B 1ZUNB 1R0WA 2HOQA 3R7WB 3VU0A 2A67A 4XUGB 3OJCA 1P77A 1OT3A 1DXYA 4R2JA 2UKDA 1GUBA 1OIXA 4YMVA 4D8TA 4EEZA 4LRWA 1CDEA 4OHKA 1PR9A 1YU6A 4W6ZA 3DA8A 4E08A 2WILA 4EY3A 1ZD3A 3SC2A 2BDUA 3UJHA 3WADA 2BOVA 2FEAA 3DD5A 2ZSHA 4LE0A 5AXDA 1RYDA 5IRCD 1JJFA 2H9AA 3OZRA 2R6AA 3KPUA 5IMSA 3OT4A 4C4YA 5KVAA 2Q29A 2Q2OA 1S8NA 1KMMA 3W5UA 5B37A 1LWOA 3UJ6A 3KT3A 5HS6A 4YGYA 4BBZA 4ESVA 2C7OA 5H8WA 1F6DA 4EZEA 1V37A 3QLJA 1LPPA 3ZHZA 2H2GA 2O8FB 2CXRA 1ADYA 1UXGA 2Y0EA 1RM4A 1VFNA 3ZUPA 1NJSA 2X5NA 3KV3O 1LTHR 3EBLA 5JZMA 4MJLA 1UAGA 1MMFB 5KIAA 2B8TA 1W48A 2QRQA 4N8EA 5DTEA 3VOTA 3HL0A 1YS4A 3OE1A 1LPAB 4G0QA 3GV0A 2HJSA 3RVOA 1SUCA 4BNGA 3QXCA 1Q0PA 2V7QD 2VSQA 3TKYA 4L5AA 1NN5A 1PHRA 1WVIA 4EUKA 1F2DA 2A78A 3PWSA 1NSFA 5AVYA 4KSBA 1PUXA 3NHMA 4OQZA 4AU1A 4P31A 3ICQB 3RV3A 2JLSA 2C59A 2QRMA 4M99A 1JB1A 2FKNA 2IY8A 3KKQA 3PPVA 3OF5A 4R1SA 4C0JA 1UQUA 5K6AA 3AF1A 1R0KA 4FP9A 3NGLA 3O82A 2BP7A 2OMKA 1JAXA 2P6NA 2PRZA 5EPEA 1YAHA 3IR5A 1QIMA 3D2AA 3DE0X 5LCXA 3TD9A 3KYBA 1KP9A 4N3CA 2AJ8A 1J9ZA 4AO7A 4CFSA 4DYVA 3EXEA 4TV8A 5FOSA 1SUAA 2KMLA 3SICE 3VR5D 1EXWA 4G84A 4IFIA 5GV8A 4XYEA 3FHOA 3BKXA 3T61A 1MF7A 4IDNA 4YUZA 5IDYA 5DM60 5J1SB 4I1YA 4UAUA 3WDSA 1NRWA 1OFUX 4PY2A 3R76A 4GDMA 4W9NC 1LB1B 4YJ2F 1U0JA 5LKAA 1M7GA 3G2LA 2VHEA 3LUGA 3PNQA 1H1LB 1TKRA 2XQKA 3VVLA 3W4KA 1GPJA 3QWBA 1HRKA 2VHYA 1VIVA 1E5LA 5JDIC 2VATA 2QT1A 1Y89A 4IZ6A 1RHKA 4TTRA 4FXOA 2RHDA 2ZXFA 5AMXA 1IK6A 5FCDA 3W6PA 4EQ6A 4CF7A 5KHLB 4MB2A 2YS6A 1W4BA 2HWKA 3EUFA 3PEWA 1IY8A 4DMMA 4EKIA 1IMJA 4XIIA 4PSKA 3ROKA 4I36A 4C4SA 1PQWA 4OMCA 3C7KA 2XE6A 4HRXA 4C78A 1GGNA 4L0QA 3DZ8A 1XRQA 1XVLA 4JQSA 1A4RA 5CG2A 4GECA 1Y8RA 3F4LA 5AM0A 5JAUA 5AXBA 2EZ9A 4X1YB 1GYQA 1X1BA 1HDGO 2O3JA 1U0EA 3IT3A 3V1UA 3I6MA 1XROA 5C3UA 5CLHA 1O96B 1DKMA 1JDSA 3AKEA 3G5MA 4Q1DA 3GN2A 2GVNA 1AE1A 2VIIA 1B76A 2AJCA 2ZUTA 4ZCLA 3QVVA 2C8JA 4HDMB 2RB4A 4C0SA 4Y18A 3LYLA 2YXDA 3I37X 4Y6PA 4G24A 4M7OA 5JAZA 4UATA 1JHMA 1L7VC 2BM1A 2WT8A 3N7TA 4JELA 5L51A 2GLUA 2N75A 3H4VA 3IYLW 1RXIA 1WZIA 3MQFA 1GU7A 4IINA 3S2EA 3ZXXA 5BSVA 1BKYA 2VPXA 2WTBA 3DQQA 2QTHA 1W36D 4MQMA 3UO8B 1QRTA 1UFOA 2TMDA 2PU5A 1CY0A 1ILWA 5DSZA 4HNSA 3D4IA 4ZAVA 3IE1A 2DWOA 4Y2XA 4RD0A 3NJ8A 1K2VN 4TWZA 1VHTA 2GDZA 4CQMA 5D3MB 5HGJA 1OOEA 1HH4A 2QWXA 3PT5A 4QTTB 5GONB 1XPRA 4LF8B 2AXPA 3QLVA 3ZVKA 4PLPA 1NYQA 2IYQA 4UBMA 4YRCA 3UCXA 3WNVA 2FX2A 1YHNA 5JNSA 3A4LA 4MB6A 3UC5A 1G2PA 2J5BA 2LWIA 5C5DA 2X2FA 3TW6A 2P8SA 4GRDA 1K06A 1SCIA 4MUAA 4XGQA 5EIFA 3KR1A 3RVQA 1B0ZA 4DWJA 3TTYA 3TLGB 5I7UA 2AMLA 1ZH0A 1FFCA 5K0NA 1KJYA 4KXNA 4BNLA 2FTKE 2PZAA 2WT9A 2ZXEA 1OAKA 3LBAA 4AD8A 1DKQA 4ZD6A 5DBOA 4IDAA 5FPYA 2PL1A 1NBMD 1Z7BA 1Z56C 4I1RA 2QVYX 3L77A 3O38A 3JRWA 4K6KA 4F7WA 2Q0SA 3ZGZA 3I92A 5LMUB 3AVUA 3VI3B 3ZWKA 4UW9A 1F6BA 5KNCA 2QLBA 1L4NA 2JA1A 1G21A 1WUYA 1NN3A 1R0BA 1GSAA 4I50A 5IKXA 2Q4RA 1XUOA 2WHXA 5FLEX 1ZUIA 2FRDA 5GZ6A 1LNQA 1AURA 1CZUA 1E4VA 4H77A 3RK4A 1RRCA 4NZYA 4CDMA 4J2HA 1UANA 1Z0JA 3RASA 4WBNF 3EEBA 4OHFA 1H4TA 4IX9A 5LQAA 4TGLA 4OQPA 3DVRX 5JAPA 4MULA 2H8GA 2PA0A 3ZY6A 3HACA 3W6NA 2GSWA 5CDFA 2ZJ1A 2QTRA 4DRYA 5GGXA 2B2XA 1Z39A 3IUEA 4IZHA 2XJ4A 4AZ0A 1I6MA 5A3SA 4MQFB 1I1NA 1JQKA 1MB0A 2JH8A 2LV8A 3GFVA 1ARZA 3D6VA 2AYYA 3U49A 1GT6A 2XT0A 5EMHA 3ULKA 1IUKA 2QUIA 1B1CA 2CNWA 3EIHA 5JBQA 1YUMA 1BKDR 1TQHA 3RPEA 1JSCA 3T7SA 1L4BA 3H1TA 3N2KA 4JOQA 3X44A 3SHVA 3OKAA 1D9XA 2AFIE 3N74A 3H42B 4D92A 3FB1A 3GEHA 3MUFA 3KEOA 1PX0A 1SHUX 4XTRA 4TKZA 3F97A 4ZU6X 3KUXA 4MYSA 5BY2A 3S99A 1P7ZA 3NC1C 1MQ8B 4N0EA 5AK0A 3BBLA 4UPEA 3KE8A 4D2IA 2IEGA 1YQXA 1W59A 4J1TC 4L50A 1ZJWA 1QGOA 4Y67A 2F9FA 3UAGA 4GP9A 5FTJA 2YJ3A 1CUAA 2GXUA 1WTAA 2ADFA 2XXJA 1NUSA 1E6UA 3Q2IA 4ITVA 4KDRA 5C8DA 1OLUA 1SO8A 1TUBB 1Z4OA 3I3OA 3H2HA 4M0KA 4WUTA 5GGYA 5G1PA 1OLSB 3QJGA 5FWDA 4WNAB 3H8JA 5B53A 4E6PA 4LXUA 1VPLA 1GKYA 2BE7A 1ZMRA 2YN2A 3IHWA 4X5OA 4J8PA 4FC7A 1PFUA 4Y2RA 3C6KA 4WMLA 3COWA 1PW5A 5K0FA 4NVRA 3RF7A 2EXXA 3Q6NA 3F73A 1FK8A 3EJWA 5BMVF 4BLTA 3D8TA 1QIFA 1VYUA 3KUCA 1UXOA 2JL1A 3EISA 4HZIA 3W1WA 3U19A 2O8DB 4Q7MB 4G9BA 1NLZA 2KI5A 2P2SA 1XN1A 3SX2A 1YQEA 2B1IA 2H6EA 4Z9AA 2QD3A 4WXHA 5GM1A 1WXGA 5JMPA 2V0NA 5KWVA 3DW3X 1DBWA 1MA3A 3NRBA 4XPZA 4M1MA 4YO8A 3JZIA 4L3WA 4B76A 1GDTA 3A7EA 2IHJA 3C45A 3NFRA 3MT7A 3ONEA 3KQNA 3E8XA 5CB0A 1IOWA 4A8HA 2G5TA 2V7PA 2ODAA 1QG4A 1BW9A 3MN1A 2E18A 3LGSA 3P5SA 5CM8B 5E3IA 4AZSA 4BDTA 1DOAA 2MSNA 2WWRA 3QUAA 1HQDA 2QSYA 4OIMA 4RM3A 2QY6A 1FF9A 1XZDA 1W88A 2VF8A 2V8BA 5HEKA 3WP0A 3S27A 4ITUA 3A6PC 1PJRA 3W5CA 3K70C 3ZH2A 4RPLA 1YQ9A 4ZI2A 2O3SA 3IRVA 1I0IA 1W5TA 3OHMA 3MC1A 3V2IA 2FOLA 4BNXA 2PANA 5D3KA 5JANA 1C9DB 1LI7A 3R3HA 1R50A 4RZUA 3FY4A