3VISA

Crystal structure of cutinase est119 from thermobifida alba ahk119
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
261
Chain Sequence
QAANPYERGPNPTESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYTGTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAPNITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTLSDVEEYRSTCPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystal structure of cutinase Est119 from Thermobida alba AHK119 that can degrade modpolyethylene terephthalate at 1.76 A resolution.
doi rcsb
source organism Thermobifida alba
molecule tags Hydrolase
total genus 86
structure length 261
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12740 Chlorophyllase2 Chlorophyllase enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3visA00
2JGJA 4DMCA 1FFAA 4Y2QA 5KWJA 5ALEA 3AIKA 3WK4A 5EHQA 3QMVA 3HXKA 2QM0A 5DYTA 1PFQA 3VXKA 3R3UA 4EY7A 1CUXA 1VA4A 3BDIA 2G4LA 4JH0A 2WTNA 4RGYA 2QS9A 4PF1A 4B80A 5AH0A 2WHPA 3WQHA 4AQDA 2O2IA 4NMWA 5D3KA 3GZJA 1EDBA 1RYYA 1DINA 3C70A 4UBKA 1XZKA 2XUIA 4CG2A 1E8NA 5A7FA 4BRZA 3H17A 3N2ZB 3I2JA 2WFZA 3ZPXA 2XUAA 2Y1KA 4UBIA 5ALMA 4BE9A 4Y2JA 5CT5A 1ZICA 5T4EA 4H7HA 1U2EA 5ALGA 4FBLA 3DOHA 4DM7A 3MVEA 1TRHA 5LZ8A 1EXWA 2WG2A 4RPCA 3TEJA 3STWA 3FCXA 5AK6A 4X6YA 4AMZA 4N8EA 1B6GA 4RNCA 4C88A 3BWXA 3OOSA 1CUYA 1CEXA 3IULA 4L0CA 4HXFB 3FSGA 1XZDA 4INZA 4EUSA 1YA8A 2WHPB 3WWOA 4MEBA 1XRNA 3D5EA 1LGYA 1JMYA 4Q82A 3IA2A 3KWFA 3PE6A 2OGTA 3A2LA 3V9AA 4K6HA 1AGYA 4WDQA 3A70A 2VSQA 3WK5A 1X2EA 3T52A 1EA5A 2XQJA 1JKMA 5HFNA 1HL7A 4I19A 3C6YA 4J03A 5DYWA 5DYYA 4IH1A 3QMMA 4J0CA 2C4HA 1XRRA 3I6YA 4WFJA 3JYHA 1UKCA 4FNGA 3H18A 1XKLA 4UPDA 4QA9A 1XRPA 3MUNA 5AI5A 5K3FA 2WIKA 1T2NA 4K6KA 3DOIA 5AOAA 4CFSA 3IUQA 4CG3A 5AK4A 1AMNA 4Y2VA 4J0JA 2QUAA 5IVKA 2Y6UA 5AM4A 5AHXA 5FLKA 3ZV7A 1VLQA 3C8HA 1DWOA 1IZ7A 2ROQA 1EHYA 4BVLA 1PJAA 2C7BA 1T4MA 1C7JA 5ALIA 3CXUA 2BFNA 2XB6A 1BROA 1L7AA 2PSHA 1YAJA 3ZI7A 5I8PA 5LKRA 4LHEA 5DNVA 4FWBA 5AKKA 1R4ZA 2VT7A 5EIEA 4W1QA 3V48A 3F8SA 3LIIA 1R9NA 1GQRA 4BC1A 1GPKA 1QIMA 2PUJA 1QIFA 3E3AA 1G5FA 3HZOA 3D2CA 3ED1A 5LZ4A 2WTMA 1OCEA 5CH5A 5D7BA 4PV7A 4LXHA 1RWQA 2JGIA 3EIOA 5FP0A 1DT5A 5K3FB 3CN9A 4F5ZA 3PFBA 4C4ZA 3FLAA 4F60A 2Y6VA 4Y9SA 3I2IA 3DCNA 5AM5A 2HA5A 5CMLA 2ZSIA 3SK0A 5ALOA 5AKGA 1UK8A 4C89A 1JMKC 1FFDA 4JNCA 4K2AA 4RE6A 5AKJA 3ESDA 3HJUA 5K3DA 3QYJA 1YSCA 3D0KA 3WK8A 1ZD5A 5ALHA 2PU5A 5D6OA 3DDUA 4CG1A 1JU3A 1YR2A 5KWIA 5JAPA 2WG0A 4GXNA 5CW2A 3WJ2A 4OB6A 5BWBA 3FLEA 1QO7A 3UMJA 2JGLA 1C4XA 1UXOA 4J0GA 1XRMA 1LPPA 1R3DA 5FPPA 3R3VA 1M33A 1MT3A 1I6WA 1XZEA 3C6XA 5SYNA 3NWOA 3B5EA 3LS2A 4HRXA 1C7IA 4B85A 3VISA 1SCQA 3BDVA 4UFOA 3I28A 4MXDA 3WLAA 5IH7A 1KU0A 1VXOA 4BCDA 4J0KA 3W2TA 1P0PA 5JASA 2G5TA 4LYDA 1AZWA 1G42A 4A5SA 4BCBA 4DLNA 1ETHA 4XVCA 4Y2PA 1BCRA 3O4GA 3M3DA 1ZI6A 3EQ9A 4J0DA 4J3JA 2X8BA 2AJBA 2J4FA 1THGA 1L7QA 1LZKA 2RI6A 1IUPA 1TCBA 1E8MA 2QUBA 2Z8XA 3FCYA 2QMQA 2ES4A 2DSNA 3S8YA 1VZ3A 1WB5A 2QXUA 5SYMA 2DQZA 5HF5A 1BS9A 4TGLA 5AK3A 4FNMA 2C5FA 4BE4A 4AX4A 4MEAA 2QJWA 4Q3OA 2HA7A 1XQXA 4AZ0A 4C6HA 3BIXA 1H23A 1LBSA 2JGMA 4LXGA 3UUEA 5DTIA 4QDOA 1YB6A 4LKOA 3DKRA 5FXMA 3GROA 1WPXA 4ROTA 4U2EA 2XMRA 1XLVA 4BTLA 2GBFA 4C01A 7YASA 1VXRA 5C8XA 5JARA 1ZI8A 1GKLA 3I2HA 4OU4A 3BF7A 4KACA 1CQWA 2HADA 3IURA 3HRHA 4CCWA 3ZLUA 3Q8WA 2C0QA 1F0PA 2QRUA 4F0JA 3C5VA 5ISMA 3TGLA 5ALTA 1LPNA 1VKHA 4OD0A 4XJVA 5AK5A 4U2FA 4ARAA 1AURA 1P0QA 3I2KA 1XROA 5AI0A 2OAEA 5ALKA 1WM1A 3YASA 1CUSA 2I3ZA 3ANSA 5A62A 4EY4A 5DNUA 2DHCA 4I4CA 3SX4A 4UBMA 4WCVA 4B9EA 5BV7A 1TIBA 4UBLA 1CUHA 5JZ9A 1JJFA 3C45A 5IVIA 2AJLI 2XDWA 1GPNA 5JANA 1IUNA 3AUKA 5H3HA 1FFEA 4B0PA 1ZJ5A 4IHAA 4EBBA 1QIJA 4KRXA 5JD5A 3VKFA 4DSZA 3WL8A 4G5XA 1ZJ4A 3KDAA 3FYTA 1VA5A 3L1JA 4AO8A 3JW8A 3WL6A 1CVLA 4M0FA 2PSDA 1CUWA 1VZ2A 1MAHA 4UHBA 1QTIA 1XQWA 2VTVA 1ZD4A 5T4HA 3K6KA 3O9VA 5K3CA 4X90A 5HQ3A 1XZFA 1ZGBA 1KEZA 5AJHA 4JUIA 2XMCA 1OILA 4A16A 1WB4A 3V1MA 3M82A 4P9NA 5F4ZA 2PU7A 4RE5A 4ARBA 2CBGA 4C4XA 1AKNA 1LPSA 2O2HA 3AILA 2XUQA 2OAGA 3UUFA 1J07A 3G7NA 2CMFA 5LKAA 4KYVA 4H7KA 3D3NA 3WZMA 3I1IA 1MX1A 1UFOA 2W6CX 1B41A 4FBMA 3WWDA 3HSSA 4WY5A 1XQYA 1N5MA 3WA7A 3R3ZA 2JGKA 3M81A 4Y7DA 3VJKA 3ESAA 4ZV7A 5AP9A 3W9UA 4X85A 1CUVA 1E66A 2JIDA 5EIHA 3KOOA 2QT9A 3K9BA 5CT9A 1GKKA 4E46A 3HC7A 3LIPA 3STYA 1UOQA 1EB9A 4X93A 4D9JA 4JEIA 2GYWA 1U8EA 2YASA 1JJBA 5AM2A 2PM8A 1YAHA 5AM0A 1TCAA 1GZ7A 4DNPA 5HQ3B 2GBGA 1A88A 2JF0A 2JEYA 3HLKA 3MUOA 4KE9A 3C87A 3F96A 2OG1A 1TCCA 1XZHA 4G4JA 3C5WP 2WUEA 4G4GA 2ZJ7A 3R3WA 1Y37A 2HFJA 2V98A 1G66A 1HKHA 5EFZA 4X6UA 3IUJA 5I7UA 1QONA 4UBJA 3G9ZA 4B81A 4FKBA 4PNZA 5FPQA 1XKTA 4H77A 3V1NA 3I2GA 5DJ5A 2C0PA 5CXXA 4CIAA 5A71A 4Q3LA 5CXUA 3TJMA 1QIHA 3VJLA 1EINA 5LZ7A 2J4CA 1BU8A 2AJCA 3RARA 5LZ9A 3EQ8A 2ZJ6A 1SFRA 2UZ0A 3W9BA 3WA6A 1ODTC 2QKYA 2V97A 3C6ZA 1K6EA 1AUOA 2XUJA 3S2ZA 3IUNA 1MNQA 1YS2X 5J3JA 4WDRA 5E4TA 2GZSA 3A2NA 3NOXA 4GEGA 4OYLA 4BYMA 4TPKA 5JIBA 3O95A 1AQLA 5AICA 2QXTA 2ZYRA 4X95A 4LYEA 2WFLA 3H2IA 1ISPA 5C7YA 1SCKA 1HDEA 5AI4A 1JI3A 4UHFA 1EDDA 4LIPD 1QZ3A 1H2YA 4BP9A 3KXPA 1JU4A 1D07A 3U0VA 4MWTA 1EK2A 4DTCA 1MNAA 4QDTA 1TQHA 4B82A 1ODSA 2CUTA 4KE7A 4M0EA 2YYSA 1NU8A 1VE6A 1ODCA 1X70A 4Q3KA 3DL7A 2DCMA 1DWQA 5JATA 1QLWA 4J0HA 1ZI9A 1LPMA 2Z5GA 3BJRA 1CUIA 2Q0XA 3MGAA 3PUIA 2BAGA 2WUDA 4EZIA 2XUKA 3D59A 4FOLA 1IVYA 5JZSA 1F0NA 2GYVA 2VJDA 2BJHA 3VDXA 1MX9A 1VE7A 5LP1A 2I3DA 3WK6A 1DQZA 3G0GA 1W75A 4FHZA 3E1GA 2WFLB 1XQVA 4OPMA 2Y2UA 4P92A 3GELA 2XUPA 2WJ4A 3WIOA 1Q0ZA 4HRYA 4NVRA 1XZMA 4A23A 4AN0A 3K2IA 4DMFA 4JYPA 1ZIXA 1XZLA 1UKBA 2RHWA 2J3QA 4UHHA 5AKZA 3CCBA 4L9AA 4ZREA 2NW6A 3HABA 1S8OA 4BC0A 1XZJA 3QZUA 1CUBA 1QTRA 5ALZA 4UHDA 3O4IA 4X97A 5CH3A 1K8QA 4AO6A 4DSAA 4FMPA 2VT6A 1XLWA 1ZGCA 3PDCA 1E89A 2BCEA 3OG9A 4V2IA 2WU3A 4B0OA 1WOMA 2WIGA 3QPDA 2ZJFA 1CUFA 3STTA 4K5QA 4S0XA 2CJPA 5LIPA 4BRSA 5ESRA 2AJ8A 4QZVA 3WIBA 1LBTA 2G63A 4B9AA 3AIOA 5FRDA 3WKCA 3OM8A 1UK7A 4Z49A 4X6XA 3V1KA 2Y2VA 2H7YA 4F21A 5HCUA 4U2GA 4H18A 5LLSA 2PKYX 3RK4A 1EVQA 2OGZA 6YASA 1DQYA 4BZZA 4BP8A 3QVMA 4ITVA 3WMRA 4YPVA 1YA4A 2ONCA 3D4LA 1OXMA 3WKDA 5AKYA 1GQSA 3P2MA 4X3CA 1GT6A 4GHWA 1NU6A 4OSEA 4QDZA 1YCDA 3IVMA 3T4UA 2K2QB 1DTEA 4Y2SA 2XI4A 4FDMA 1ZD3A 2JGFA 3DD5A 5KREA 5AKLA 2IX9A 3QPAA 2GYUA 2QVBA 1HPLA 1R1DA 3L1IA 3G0BA 4QE3A 1DWPA 4PSCA 4QNNA 4G9GA 5AOBA 4BZWA 2C5GA 5HK8A 4KAAA 5DTJA 1DX4A 3EF3A 1WCYA 4EB0A 4UHEA 4DYHA 5CT8A 4Q1VA 4W1RA 3WKAA 4XIIA 1LPBB 1P0MA 4H7JA 4H7FA 1YB7A 3BIWA 3A2MA 1G4HA 3IB3A 2RAUA 1H2ZA 2BKLA 3SC2A 3V1LA 5LYYA 2G5PA 3FOBA 4UFPA 5AKIA 2XQFA 3O9MA 2XMQA 3G9XA 3FVRA 5HKAA 1Q84A 5E2IA 4GECA 1EI9A 1Y7IA 1IMJA 2HA0A 3SWWA 5AIAA 3I1YA 2GZRA 3HACA 5FKJA 3G8YA 2ORYA 3H1BA 4P93A 4N5HX 1W4LA 4EA6A 3I2FA 1TK3A 2B61A 4BVKA 2WIFA 3N0TA 4FLFA 2WJ3A 5HF6A 3Q0TA 5E4JA 2B9VA 3H0CA 4W9RA 1BE0A 3FWHA 3R3XA 4EY6A 3ANTA 1A8QA 5CT6A 2OCGA 2HL6A 4YK7A 1LPOA 4KE8A 3AFIA 2HA6A 1WHSA 2GBCA 2WU4A 1QIKA 1BN7A 2J3DA 1QOZA 3KSRA 2XUHA 1BEZA 2C58A 2ZSHA 2HRRA 3LCRA 3H04A 4XWGA 4MQMA 3G9TA 3JWEA 2AXEA 4BTVA 1CUZA 2ZVDA 1MN6A 2HA2A 1CUGA 2QZPA 4I3FA 2VAXA 3FYUA 5T4FA 1YASA 1K63A 3CN7A 2OCIA 1DX6A 3AZPA 4DNQA 1TKRA 4KE6A 5ALJA 4X00A 4W1PA 1H2XA 4E15A 1XZCA 4BDSA 5EHNA 3BL8A 3KWJA 4E14A 5BWCA 1GGVA 4B83A 1CPYA 3DS8A 1CUDA 4CCYA 1ACLA 1SOMA 4IQ4A 2HU8A 4OB8A 1AX9A 1U65A 2OGSA 2VJAA 3VVMA 5JD4A 4NS4A 4M0MA 3QMWA 1HLGA 2AJDA 2CB9A 3L1HA 4L72A 2RONA 4K6GA 4PSUA 3IBTA 4C4YA 2O7RA 5ALQA 5ALSA 2WHQA 3W04A 3WYDA 1BRTA 2BGNA 2X76A 4JYMA 3QITA 3ZLVA 1CFJA 1FSSA 2OQVA 4QEKA 4ZXFA 1AC5A 1X2BA 2IIVA 2WM2A 1WB6A 3FYUB 5ALLA 3QPCA 1Y7HA 3PI6A 4ZRDA 1CUCA 2RHTA 2PBLA 1A8UA 1QIDA 1MO2A 1NX9A 4PQEA 1R50A 4AMYA 5IVDA 2V9ZA 2XE4A 4GWLA 4UFNA 2VJBA 3DEAA 4GW3A 1N1MA 4H0CA 2HHAA 4CCYB 4QDUA 1WPRA 1ACJA 2XMGA 3D2BA 4GBGA 2XMBA 1EK1A 3ICWA 5DWDA 5JYCA 3D2AA 4BCCA 2ECFA 1EH5A 1FFBA 5D3ZA 2I78A 1JFRA 1N8SA 4DNFA 4WJLA 3ZLTA 3F67A 2Z3ZA 1HBJA 3AJAA 2WUFA 1H22A 3LP5A 3H2KA 1XZIA 1CLEA 5E4YA 1MTZA 1MAAA 5CTAA 1UK6A 5JAOA 4DMKA 2RIPA 1BCSA 3AZQA 4MJ3A 3AIMA 5JD6A 1USWA 2XQIA 2QR5A 5ALXA 4OU5A 3DNMA 1VOTA 2B4KA 1A7UA 2XUGA 5HKBA 1RP1A 1U4NA 4QWMA 3STXA 1H2WA 2ACKA 2GBIA 4KR0A 3BJMA 2HU5A 3C43A 1PV1A 5ALNA 4WY8A 2HDWA 1MU0A 4QLAA 2PSJA 2OCKA 1W52X 4BAGA 5IVHA 3BF8A 3ESBA 5CH8A 3KD2A 5AO9A 1CQZA 2VQ6A 2O2GA 3O4JA 2WJ6A 3HYSA 3G9UA 5ALVA 5K3EA 3WK9A 2WSLA 4ZV9A 1UT6A 5JAUA 2HFKA 1VJ5A 3GUUA 5I9IA 1CUUA 4FFWA 2WQZA 1O6FA 2WLSA 2VAVA 1FJ2A 3OTQA 4WFKA 1GXSA 3NGMA 3GFFA 5ALWA 5JALA 4GDMA 4Y2RA 4YX9A 2FJPA 2WHRA 5HFAA 3DLTA 2WG1A 3F9CA 5HZGA 5AKEA 2PVSA 2PL5A 4GI1A 1J06A 1XZAA 4BVJA 2HIHA 1R88A 2XUDA 4GLBA 3IUMA 1QGED 5DNWA 4MWSA 3DQZA 1Z68A 5CRIA 1EDEA 3B12A 1CUEA 2Z3WA 3WWCA 3WKEA 4MQLA 5A6VA 2R8BA 1E8DA 2ACEA 2XMSA 5DLPA 5C8ZA 3R3YA 1TAHA 2PPLA 4BAUA 4U2BA 2W22A 3H2GA 1HQDA 3FSGD 1CIJA 3LLCA 5AI8A 5HK9A 2OLEA 4QDXA 4YASA 1YS1X 4U2CA 4HXGA 4CI9A 3IDAA 5AKHA 3DYVA 2VF2A 2XT0A 2WUGA 3WYNA 1J2EA 1ZOIA 1CR6A 1XZGA 2FUKA 3AZOA 1XFDA 4QWWA 5ALRA 2D0DA 3PUHA 4Y2UA 4BAZA 3ESCA 1ZIYA 1E5TA 4X7BA 2PSEA 4MYSA 1LZLA 5LZ2A 1SC9A 4TVKA 1XLUA 1ZD2P 4G1FA 2X5XA 3PICA 3DKKA 1CUAA 5EHXA 2R11A 2XUOA 5IKXA 1W6RA 1LNSA 1P0IA 2VATA 5EIAA 3H2JA 2PSFA 2XLBA 4OCZA 2XMZA 3X3HA 2PUHA 5FDFA 4CIBA 1W1IA 2XUFA 4BATA 3DL4A 4ZGBA 2OXEA 4OYYA 4W63A 1K4YA 2DHDA 2BUAA 3ICVA 2E3JA 5JAHA 2JBWA 1XZBA 2EDCA 3RM3A 4DMHA 2YXPX 1JJIA 2HM7A 4FLMA 3D7RA 3OC0A 5JZBA 2BUCA 4ZI5A 2H7CA 2DHEA 3FVTA 5HF9A 2LIPA 4IH9A 2I03A 3F98A 2DQYA 1UKAA 3G02A 1UZAA 3G0IA 4X71A 1QIIA 2XMDA 4G4IA 5FUMA 4MYDA 3BE8A 3VJMA 2XQKA 4DIUA 4KAJA 4UHCA 4HVTA 5A7GA 4EHBA 2P8SA 2D5LA 5ALFA 2BGRA 1DU4A 3STUA 1UOPA 5EHZA 4ETWA 3GBSA 1Q0RA 1QO9A 4WFIA 3FAKA 5LZ5A 5KBYA 5BOVA 2VEOA 4B7ZA 4N8SA 3QH4A 3EQ7A 4J0IA 3EBLA 4X91A 2HA4A 1QJ4A 4Y2YA 4P08A 1UWCA 2CEKA 4OUKX 2Z8ZA 2XLCA 4KAFA 2CKMA 1R9MA 4E11A 3W06A 5HF8A 2V96A 4X94A 4EY5A 3WZLA 1EVEA 2WFMA 2H7XA 3RKSA 4N8DA 3F97A 3B3QA 5YASA 1F6WA 2WILA 1IZ8A 1UK9A 4UBOA 5AI6A 5AOCA 4J7AA 1IUOA 2FJ0A 1THTA 3R0VA 1KU6A 4X92A 3WWPA 3WWEA 1BEEA 5FOQA 4AB1A 1MJ5A 1N5RA 3DJYA 1BN6A 5C8VA 2VA9A 4OB7A 3HEAA 1ORVA 2QOEA 3DYIA 3PF9A 3PF8A 1O6GA 4L3WA 4FLEA 1QFSA 1QIGA 4G8BA 4H7DA 4AXBA 3OURA 2EDAA 2IITA 3O0DA 5EGNA 3R40A 2H9YA 3H19A 2WIJA 2O7VA 4HZGA 4BDTA 2H1IA 3FNBA 3QBJA 2DR0A 1CV2A 1Q83A 2QTBA 3AINA 2YH2A 1CUJA 4KRYA 2BUBA 3C8DA 1QE3A 2ZYHA 3I6MA 3PFCA 3RLIA 4AN1A 5FV4A 4HS9A 1W76A 5AI9A 2JGEA 5AM3A 1E3QA 4H35A 3BXPA 5EI5A 1EB8A 4PO3X 3STVA 4DNOA 3FYUC 3QM1A 3TRDA 3WI7A 4KEAA 4AO7A 3O4HA 1CRLA 4N5IX 3R41A 1MX5A 2DFPA 2QJRA 3M83A 3HI4A 4LXIA 1QIEA 5AIBA 2JEZA 2WKWA 2XQGA 4UUQA 4Y2XA 3C6BA 2RGUA 2FX5A 2CZQA 3NUZA 5T4BA 1K5PA 3WKBA 3FLBA 1J1IA 3OPMA 3G0DA 5CBKA 2PX6A 1LPAB 4FTWA 4Q34A 5ALUA 4NZZA 5C81A 1UOOA 4PW0A 4IH4A 3ILSA 3VVLA 4U2DA 1DT3A 4KJXA 1QFMA 2OPHA 5A7HA 5AKXA 4DGQA 1LLFA 5ALPA 1JT2A 1MPXA 1WHTA 3E4DA 4HTAA 5K5EA 2HU7A 4HXEB 1ORWA 2B20A 4G8CA 4BBZA 2HRQA 1F8UA 5JADA 4B6GA 2VJCA 3A6ZA 3E0XA 3ZWQA 4Q05A 5AM1A 5ALYA 4G9EA 4FFVA 4O08A 3H1AA 3GA7A 4C87A 2OCLA 3FBWA 1FFCA 1GPLA 3CCCA 4W1SA 2WIDA 3H2HA 4BB0A 4H7EA 3IIIA 4PSDA 3WL5A 4UBNA 3WJ1A 2EEPA 2ZYSA 1XRLA 1A8SA 4AZ3A 4QLOA 4ZWNA 4G8DA 5K3AA 2ZYIA 1SCIA 3W05A 3I6ZA 4HAIA 4B84A 4XX1A 4EY8A 3WK7A 5A2GA 4Y2TA 1EX9A 4H7IA 5CURA 3G0CA 3U1TA 1XRQA 2HA3A 2OQIA 5K3BA 5CT4A 3WL7A 1L7RA 5ALDA 4IO0A
chains in the Genus database with same CATH superfamily
2JGJA 1VSUA 5HRUA 1AKVA 4IIBA 3SFZA 3MHPA 4EW2A 2G9VA 4Y2QA 3AHDA 4ZVNA 3AIKA 3G2HA 3HXKA 3TQCA 3WYEA 2BGMA 2QM0A 3EGWA 5BN3B 2EJTA 2AW3A 1JE0A 2PJUA 2GVNA 2B7LA 3ND9A 2J0QA 1AQUA 3VXKA 1PFKA 1YC5A 2PBRA 5TDHA 1JQ5A 5K0FA 3AU9A 1B6SA 4KQWA 4XYGA 4IDFA 1ZQ9A 3U4MA 5C53B 3OQOA 1OFHA 4TKZA 1XP8A 4P0QB 2BHNA 2VBGA 4C7XA 5BQ3A 5EERA 4JH0A 2VP0A 4GP9A 4F38A 1I6MA 2H11A 1UM9A 3S1AA 4CN9A 3JQGB 3O3MB 1TLFA 5CK4A 1NQAO 1W4AA 4UDOA 3BMQA 4AQDA 5CB4F 5CM2Z 1OI4A 2OM2A 5C1BA 5DP2A 4GI2A 3T9FA 2R96A 5D3KA 3GLFE 2YMMA 3PGJA 3QFHA 3GDHA 2BCJQ 5BSFA 2F62A 2F3TA 3N2GA 1Q92A 1ZW6A 3EGOA 1XZKA 2XUIA 3G68A 3I1JA 4OMFG 2FN9A 4JJ8A 3RABA 1RD4A 4I4TA 4E32A 3H17A 4NBKA 1UXGA 5L9AA 4FJ2A 4GO1A 4D4GA 1N9GB 2PPVA 1Z63A 3H3JA 5D87A 5L3ZA 3T3MB 3MJHA 5JMOA 1Y1QA 5ALMA 3OLZA 1M3SA 3IKTA 1IM2A 4U7PB 2XITA 1JKIA 3H2YA 5F98A 1TNDA 4RUKA 4RY9A 4L4YA 4YMVA 1N33B 3N39C 4TTQA 4ZEWA 4C7JA 4EKIA 3PHHA 4RL4A 1KF0A 4EKYA 4YMWA 3CXRA 5T4EA 1VL6A 2FPGA 2L19A 4D8VA 3NKFA 3EHEA 2GA9A 5EE1A 3DDHA 5BUCA 1ZJJA 2O8VA 3I6BA 1A71A 4ACAA 1ELOA 1KGSA 2Y0DA 4IRXA 3ZWXA 4ZARA 3OLQA 3R7WB 4DLXA 1P7PA 2JLAA 4FBLA 1BQ4A 1I1NA 2WYUA 2R3SA 1U4OA 3HG7A 3MQFA 4FD2A 1HE5A 5FBKA 3TINA 3OZAA 2AOUA 4LRTB 3AWDA 4RF5A 1JMVA 3SLGA 3ZVRA 2FZLA 3R3SA 4N7JA 1BXGB 1D8TA 4LHZA 3STWA 4JVNA 1WOYA 2W2VA 2QMZA 2M6KA 2ZUUA 4KDCA 1TFRA 4MV4A 4MP3A 3WDKA 3SJUA 1PT6A 1VBFA 2IZOA 2VEDA 1IDN1 3UCEA 1B1AA 2I2FA 4FZ3A 5AJZA 2EW2A 4PY2A 3CNNA 2RHDA 4RNCA 2Y68A 4F8JA 4O2AB 1CUYA 1E6KA 3IVGA 2VC2B 3DW3X 1PJZA 3KZMA 2ZR0A 1AQNA 1T2DA 2Z1NA 4Y8VA 2I2CA 3N59A 1RXVA 2LWIA 4JEHA 3VQTA 4L0QA 4ILKA 4RDCA 4WESA 2GPNA 4ZCIA 4E1BA 1EXVA 1ENZA 4D9GA 1H1LA 5EKSA 5IUJC 3SE7A 1P17A 3I23A 4INZA 1GFZA 1M83A 2WHPB 3BWMA 2R8EA 3DOEA 2OZVA 1T0HB 1Z8HA 4RIFA 3V6LA 2Y3IA 3LUPA 3MUFA 4MA5A 5GJWC 4MITA 2OV4A 5BYKA 5JMWA 2IEAA 3N28A 4ZGGA 1YHNA 3QE3A 2R6JA 4JJGA 3GNSA 3P52A 4R5HA 3T8YA 5KS2A 4KFRA 4MMXB 2BI4A 1KYQA 1J9EA 2DWQA 1Y0BA 4II7A 3TDNA 1BFKA 1KDPA 2UYGA 1VCHA 1YZLA 2JLRA 1F60A 3SEZA 3TD6A 5I3CA 3UPUA 3S6JA 2QE7A 1PO7A 4K6HA 2V1UA 2UZ1A 4I3HA 3KB6A 2OD2A 5FA8A 3QUTA 3CLUD 3ESZA 4TN1A 3U3RA 1XAJA 4QLBA 2ZRDA 2QRKA 3OPYI 4XOIA 2V7UA 2IY8A 2YCBA 2C4KA 3ADKA 3QU7A 4MROA 5DX8A 1RQRA 3LDAA 4BGIA 5BRJA 3ELDA 3E5HA 3PNBA 4HAZA 5FNVB 4EHJA 2N42A 1VMAA 3ZR4B 2CDRA 1UODA 5IN5A 1XELA 1GNTA 4RV5A 3L8YA 4DRXB 3CF2A 2FEOA 3GZ4A 5DYYA 2H17A 2BHTA 2XHZA 4IH1A 3GGJA 2C4HA 1WMFA 3PCTA 1XRRA 1MZPA 1BFUA 1URPA 3NT2A 4UVEA 4WFJA 2W4QA 1PJQA 3BM5A 1V11B 4BV8A 1Y7PA 3DZBA 3OZRA 4PRYA 5KJ1A 4ZYZA 2QUJA 3KE9A 4FMCF 1P2VA 3A11A 2Z2XA 4R98A 4C7MA 2EZTA 4ENUA 3M33A 4HMQA 2XQVA 2XVAA 2QK4A 3PPWA 1E4EA 1KH1A 1TEHA 3MUNA 4R2WA 1W8DA 4Q9IA 2WIKA 1MV5A 5HEKA 1TA9A 1XPUA 1FDIA 1I8TA 2OM6A 3B3FA 3RVBA 2VDKB 3UFXA 1MJHA 1QAQA 1E7MA 4TUYB 4IKPA 2WAMA 2X19A 3F5FA 2X9LA 3U3OA 2V5AA 1OHHD 4G01B 2B4TO 4HZUA 4RXTA 3W7VA 1Z07A 3KTFA 4K9QA 1KEWA 5TVKA 1PDOA 4PNEA 3RQSA 1F2UA 1NF8A 4Y2VA 4J0JA 4N0PA 5JSHA 4DB4A 1PLKA 5LUAA 3HSYA 2VTBA 1A9XB 2ODQA 4XD7A 5JXIA 2QUAA 3CSDA 4H27A 4GMHA 4LCBA 4O25A 1A4XA 3ACDA 4HWPA 1UJNA 2NU6A 2W00A 4RAOA 2DLNA 3C8HA 4ENPA 3ZDBA 1OFUA 1I94B 4L8WB 1J2RA 1X7ZB 2EP7A 1NMZA 1TO1E 3HP1A 3NAQA 4KP7A 2YIDA 4LJLA 3HDQA 4XPIB 3V8RA 4E0BA 1YE5A 4MKGA 2W6ZA 2OBBA 1I7LA 1JR6A 1AQJA 3I9FA 4DV0B 2FW8A 4HOYA 5B2ZA 4F12A 5F77A 5BQFA 3C2QA 5ALIA 5BSGA 2J85A 2ZJ5A 4QFBA 2PX0A 2B4YA 4IPTA 4IICA 1KE2A 1YT5A 13PKA 2HLHA 3RBXA 3VVCA 2PXHA 2BLNA 2H57A 2RBEA 1L7AA 2XYRA 2YRFA 3BCHA 3IAFA 2PSHA 1QH1A 4BVHA 1GVNB 1V7CA 3SX0A 5I8PA 1YBVA 5ES3A 1IN5A 3OQIA 5TB5A 2BFAA 5JCXA 1T36A 4FWBA 1JQBA 1R4ZA 2KYRA 2N47A 3Q0EA 1OTYA 1C7RA 3QE9Y 4G26A 1KDOA 1Y7TA 2DC1A 4OHVA 3E9YA 1AK9A 2JAXA 3F8SA 3LQFA 1U0TA 2PT6A 2Z9DA 3UC5A 2V74B 3AERB 1NSFA 4DG9A 1EVYA 4MGKR 4EBFA 4FGJA 4YP9A 1VDMA 1R9NA 3O31A 4BC1A 3FYCA 2PUJA 4IMRA 5FPHA 4WT7A 5AW9A 3TH5A 1V4BA 3DCJA 4IEIA 5C8YB 3VPFA 3DYBA 1JL3A 5DDIP 3C15C 1QIFA 3E3AA 3R44A 2XZLA 1GG8A 5JH7B 1XIVA 1CZKA 2YBEA 4EJ2A 2R8YA 3KYJB 1CK4A 2V6BA 4R40A 3HZOA 1U3UA 4ZC8A 1VMKA 4H4DA 3HKBA 1E62A 4D3ZA 3WL4A 1E99A 2A2ZA 2IU3A 1YOVA 2XJ4A 2YCLA 2JGIA 4G1CA 5FP0A 5IKPA 2MDTA 3IA7A 3TRIA 2HZBA 2ID4A 1UFQA 2FVXA 5G02A 4C4ZA 3FLAA 1KFJB 3CH7A 1IY1A 1GV0A 3I9JA 2EEZA 1UT5A 1G8MA 2Z95A 2Y6VA 1NLFA 1BDMA 3GW8A 1Z83A 4YDRA 3WB9A 1G20A 5GVSA 1KRWA 3ST7A 4OTZA 4Q0MA 4UU0A 1ONPA 1IWOA 2PJDA 3I2IA 4RVNA 5GMOA 1T1RA 3IKJA 1JYSA 2GD2A 2VRNA 3DR5A 1NQXA 1EEHA 1T8TA 2AG6A 5CMLA 5ER9A 3BMCA 4ND4A 5ALOA 3SK0A 4D96A 1UC4B 4AI6A 4IX9A 1GDDA 2PVPA 1WA5A 4JIMA 4KBYA 1U4SA 3O5AA 3DTNA 5T67A 4CKBA 4BO6A 1MRZA 3OF3A 2H2AA 3G2JA 4JNCA 4EARA 4IDDA 3O4RA 4UNRA 1II9A 3RIMA 4N5LA 4FXOA 4XUDA 3DDCA 3S7TA 1KI3A 3WGMA 1W46A 1C7QA 2UKDA 1VECA 4LBZA 2A94A 2HAEA 4M0LA 5I5EA 3O8RA 1RWKA 3ZWYA 1UXIA 4IXNA 4YGXB 5IM4A 4PG6A 1Q57A 1HYHA 3BULA 3DDUA 3H86A 3EQ2A 1WDTA 2PKEA 4WBSA 1QO0D 2XRMA 1KYWA 3D5QA 4CR8A 4ZJZA 1EWRA 4RJJA 4A10A 4BZWA 4RTKA 1YQDA 2YFHA 3GLRA 1SQGA 3A7DA 2R8RA 4U8GA 4KX3A 3JVDA 2DTEA 1NVDA 3TAHA 4D8TA 2NO5A 4JHXA 4MKZA 2RGXA 3EW7A 4DLBA 5FL7D 1SXJE 4NHEA 1T35A 3PFGA 3RAGA 1D4ZA 4DZZA 1GTZA 2HGZA 2I1WA 3GAAA 1H0HA 3SQDA 2OFWA 2Z08A 1HEIA 1NASA 3L8MA 4J0GA 1LJUA 1LPPA 3LO5A 3HJCA 2B0JA 4F91B 5I9LA 4BJ5A 1HLFA 2H4FA 3ZWMA 5IAKA 1E7RA 2NT4A 4EFKA 4KGDA 1GTMA 4GKJB 5G4KB 1JEYA 1M33A 3PA6A 3ZXUB 1I6WA 1LY1A 3I04M 4HB0A 1ANKA 1XZEA 1JF8A 1QQ7A 1BMDA 2IP1A 2Z2YA 3GRAA 4YDHB 3R75A 1RJDA 3AY3A 4IP0A 4XYMA 3UJBA 4YLYA 1WV0A 2DQSA 5CM9C 1TC2A 5DOVA 4DIDA 1U7ZA 3VJRA 1GKIA 2V7VA 2ZBPA 2WWIA 4L4UA 3G8CA 1C7IA 4B85A 2OAP1 4DG5A 3VPBA 4R01A 3EMDA 3QWIA 2QB5A 2ECKA 3VISA 1P2DA 2K4MA 3JASA 1XWIA 2WSIA 1LBIA 4MKFA 4BJ6A 4D0LB 5KOYA 1RC1A 3CISA 3IBSA 2VWQA 4UTRA 4DMUB 3LUKA 2BFDA 3DAYA 1C4KA 1SC6A 2WWHA 1VXOA 5TF0A 1YONA 1IJBA 1OX4A 2H8KA 3W3AA 4X7MA 3O7MA 2NXJA 4CEHB 1O54A 1W9MA 1OXKB 2P9EA 3E7XA 3HGTA 1C3JA 3LHIA 3N0RA 3REFA 2HSWA 5J2UF 5B4UA 1T4GA 3C3MA 3E8MA 2POQX 2SNIE 4GRDA 4URHA 1S02A 3PUWA 3MS2A 5FTNA 5FULA 3OQNA 4RIEA 4HUTA 3TKLA 2C2GA 3LUGA 3L7CA 1TKAA 2LV8A 1GZSA 3FJOA 1FX0A 3KCNA 4OFZA 4CM7A 2P7HA 1L5QA 4YCSA 5IXYA 3IDZA 2GKGA 5JQGA 2ZB4A 3FWZA 3O4GA 4MRVA 4YCJA 2YXBA 4LRXA 3RHFA 3ILHA 2VJLA 4UMEA 5C8DA 3LVBA 2F43B 2BGUA 4B8WA 3JRNA 4L7VA 1JR2A 2AJBA 1T43A 1LZKA 4K2HA 2L18A 3W9YA 4AIRA 4Q4CA 2VUIB 1J7KA 3A1WA 3IDSA 2QUBA 5CAEA 3KQLA 4J9UE 2G70A 1P5RA 4RFVA 2JFHA 1T5BA 2P4EA 2QMQA 2YFYA 3PI7A 4XFJA 5EP3A 5GM1A 4BFXA 1DRVA 2NAPA 5DT9A 1F8FA 1KBQA 1WB5A 4NDAA 3Q3JB 5H7XA 3VU0A 3ORHA 4DYVA 3HB4X 3B51X 1NJGA 1TQ8A 4DDHA 2NG1A 4JUDX 3LGXA 1QP8A 3VYWA 4BB9A 3G2QA 4FNMA 2GZ3A 4DR6B 1NBMD 2C5FA 1QKKA 1DC4A 1U3DA 1QRAA 2A7QA 4BL5A 4CKWB 1FTGA 3RS3A 3I9LA 5CNIA 1XEWY 5LNK1 3TUIC 1B6TA 1GOTA 1N9ZA 2K7ZA 3MINA 2IUYA 4ZIRA 4AY6A 2AF3C 4Q3OA 1KMHA 4ODIA 1D04A 1DAHA 4WKCA 3DTVD 4UTXA 1ZJWA 5JROA 2ERCA 3BIXA 4I4LA 4LNUB 2GM4A 2BELA 2Q5IA 3RHSA 4MKXA 3K3PA 2NUAB 1PEYA 4F1WA 3TD2A 4LKOA 2DRIA 3DKRA 1ATZA 2KS6A 4UASA 4UM9D 4Z6KA 3PC8A 3NH6A 3AQ4A 1OZFA 4OI4A 1QKIA 3I6QA 1IBKB 4BO9A 3BILA 3UHPA 1G291 3W5CA 2QENA 3CJTA 4MIEA 4EEZA 1Y6GA 3NMUF 1PT5A 1G55A 4RX1A 2GBFA 4ISCA 4N49A 5JPIA 3QEMB 1KMCA 1PZNA 2XZDA 4TKLA 1GFWA 3RKRA 3TECE 5DGDA 3FVVA 5D01A 4LBVA 1Q1QA 1IY8A 4OU4A 2EGHA 3D8UA 1CQWA 4CLRB 5L7YA 3A9TA 2WMDA 4FGWA 1UBJS 2HADA 3IURA 4D0GA 1CY4A 3BIFA 3FOWA 5HCNA 2WTXA 5IF3A 4LFBB 2I6SA 1ZH4A 4WNAA 1L4KA 2R25B 1EA7A 1YD7A 1ECCA 1ZGJA 2R84A 1RI2A 4Q02A 3GEMA 1HDIA 4FXPA 1TKBA 4G0ZA 3RUAA 3E53A 3ZWKA 1A1VA 1KFEB 4BMXA 1G21B 4XJVA 3K0FA 3SX2A 4ARAA 1R0CA 1RQ2A 4J1QA 1VLJA 3SKXA 4ZKEA 2G04A 4ZU1X 3T7DA 3TXAA 1E2QA 1UBLS 4GF5A 5EWMB 4BO7A 1J0CA 5JVDB 2R5WA 1FZQA 3O94A 5E9QA 1SKUA 5EVCA 1K8XB 1X9IA 2YVQA 4MIYA 2GSDA 2P41A 5T6BA 3YASA 1JE1A 5A62A 4B79A 5AUPB 4RWZA 1H2BA 4CL3A 5K0CA 1NN5A 4EY4A 5AXBA 4B2PA 5I7OA 4F06A 2DHCA 4Q5IA 1NONA 3DMHA 3UAXA 4EPYA 3B7GA 3RK1A 4CEIB 2G80A 5A3VA 3PGVA 4PYIA 2V6GA 3BXFA 2HNBA 2VUHB 3AVOA 5H68A 4AT1A 5BV7A 5EEHA 1V1MA 4A2CA 3GLFA 1XP5A 4NEGA 1LX7A 2X8AA 3OWXA 2ZAIA 3BK7A 2YZ7A 3UMSA 1FQWA 1L1RA 3E82A 4IILA 3AESA 2C9YA 3D6NB 2JI7A 1FVFA 2CCGA 4AZ0B 3EXIB 2WSSD 1FIUA 2JAUA 2AJLI 1KZYC 1MQSA 2O4UX 2UZ3A 3JX9A 3L4SO 5KCMA 1T2EA 4Z4CA 2EJWA 3NOOA 5HIJA 2J0UB 1FYVA 1R5BA 1W48A 3ZE7A 1N2SA 3AUKA 3KQTA 3DF7A 2BH2A 5CW1A 1FFEA 4C3VA 1RLOA 1X80A 1PNTA 2IYFA 4FOOA 3SMVA 4EBBA 4KRXA 3UWMA 3MEQA 5D7NA 3MOGA 2LKDA 1VIAA 3OZEA 5G3YA 4M7OA 2GX6A 4S1WA 1I0ZA 1YMQA 4J2HA 1G7SA 1I2BA 1L7VC 3DWGA 4JP3A 2XA2A 4O2BF 1J42A 4C2BA 1E4VA 1FLDA 2YVAA 3OLWA 2WYHA 4I55F 1P2SA 4MUBA 3CLSD 3ZGXA 1QGZA 3G5LA 2X15A 5REQA 3RC7A 1QHNA 1RJFA 3F3YA 1NQVA 4OM8A 5BVHA 1DUSA 1M2NA 3G3EA 4UOQA 3AF5A 1VJDA 2IXEA 4M0FA 4KKVA 4S1NA 4WINA 1TZMA 1VL2A 3C8MA 3TLGA 4XX0B 3LLUA 3DOUA 4KK3A 4PLVA 4EFDA 4LQLA 2ETXA 1LA2A 2AHOA 4YECA 1SOVA 1DBWA 1V7QA 4I5FA 1P75A 1NAHA 1WEHA 2UZAA 4CF5A 4CYMA 1RAHA 3TZKA 2FE1A 2R85A 3U49A 4HJXA 2L42A 3WQQA 2VTVA 1DG1G 2WT4A 3FUXA 1G8YA 1D9ZA 5A0VA 4HNHA 2ZWPA 5T4HA 5IUNC 5K4HA 1TX4B 5BV8A 4C7BA 5A03A 4AJPA 1ZGBA 4KMOA 5DPMA 1Y81A 3FMIA 3G2KA 2Q3FA 5F7JA 4YRFA 2F64A 3ENQA 4KOAA 3UY4A 4E4TA 4GI5A 2C77A 3NEYA 3G9QA 3GEGA 3QYPA 4EW3A 2GMWA 4E21A 1KJWA 1TW2A 4RVHA 2AWNA 3IP5A 1PTJC 4A16A 1KS2A 2R7NA 4KO8A 5KNLA 1WB4A 1GA4A 5I4KA 1S96A 2QP3A 3G2IA 3M82A 4NATA 4P9NA 5A2QA 2DWOA 1ZC3A 2PU7A 5F4ZA 4CIDA 1JFFB 2PEZA 5IBRA 1AKNA 1LPSA 5EUQB 3F3SA 3AILA 5T8KA 2VLIA 1RLMA 1DAPA 1KK3A 2A35A 4N7MA 3VPAA 1J07A 4FKMA 4COKA 2I66A 3DWEX 4AYWA 4TX1A 3OH8A 3QKSB 5BT8A 1KKMA 1Z13A 1T4CB 2BD0A 2V65A 2V4UA 3RT1A 2WHXA 2X7HA 3QFFA 4Q24A 5DM4A 1BQEA 1J1UA 3I1IA 4EUNA 4H3SA 3TAUA 4YVFA 4F6CA 1B41A 4NZPA 1WBBA 3WWDA 3ND6A 4GZLA 2Z09A 4R05A 1TIPA 3HSSA 4IDBA 4YDSA 1H6AA 2AE2A 1G6KA 4WY5A 3O8LA 5C1DA 1US8A 2I65A 3GFBA 4HEJA 4K9KA 1VJRA 1I7QB 2HNKA 4BN4A 5HRCA 1DCTA 4PC7A 1E1CA 1EIZA 1KQFA 1JDUA 3TVTA 3ZY6A 4B3FX 4WBNA 2P91A 2QGFA 4P3YA 4BS9A 5LDDC 1KVUA 3FPAA 1H6BA 1GN9A 3OTGA 4ZEXA 4UTPA 2Y77A 3GDFA 3IRVA 3CMMA 4FYMA 1ADGA 3SI7A 4DR1B 2W7TA 2H3EA 4JIGA 2FFQA 5CT9A 4YRJA 1V4NA 4RTLA 1UADA 1SCAA 1OH5A 3H75A 1J0EA 2FUEA 1JXAA 3LIPA 3CF0A 1G8JA 1UOQA 3N8GA 4G86A 221PA 4KITB 2OAQ1 1E3DA 4MV9A 3EHDA 1I5RA 1L8XA 1X7XB 3P4XA 1AS2A 3AG5A 3ODPA 1USKA 3HCAA 4OLJA 2D2FA 2X3FA 1L7NA 5B4VA 1U8EA 3CLUC 2HOQA 3WGVA 1KHTA 5ARBA 1RU3A 3G1UA 3LVRE 1YAHA 2IYSA 4W8GA 2XWBF 4DSTA 5AM0A 2YV1A 2OQ2A 2RK6A 5JSFA 2VCHA 3O75A 1MC4A 1AXRA 3KUDA 5HQ3B 2NN3C 2PMEA 5FPSA 5IJ0B 3TPCA 5HJ5A 4DLVA 1NATA 3MT9A 3WO1A 3B8HA 2BGIA 4MQEB 2AQKA 4NCNA 3ZTYA 3AVUA 5EXDA 2OG1A 1TCCA 1NAIA 3TNLA 1RYHA 2QRGA 9LDTA 1JNXX 4LK3A 3M5DA 3VSEA 4BNWA 2A5JA 2GRAA 3B89A 3H2ZA 4FFNA 1EFUA 4GP6A 4WNCA 4BQPA 4U63A 2GEUA 2QX4A 4PR3A 1A4RA 1CT9A 1QZTA 3VHRA 3C8ZA 1L6IA 4DOMA 2OHVA 2ZJ7A 2BV3A 3H7AA 3R3WA 1Z33A 2J3HA 4UDNA 4ZCSA 4DCGA 2BISA 3KQUA 2BMJA 1JEEA 3AHCA 1GNLA 3Q40A 4NU8X 3BL5A 4KQEA 3LA6A 1ZUD1 4WA8A 5JCOC 1HKHA 1SZCA 3L0CA 1KK1A 1WLYA 1V16A 5EFZA 2ZULA 5K20A 1ZGGA 3HE3A 3RTEA 4BIMA 1Z0SA 4OLFA 1XAHA 3EEQA 1YJAA 3O90A 1D2MA 1U9IC 1T2FA 2O14A 4M89A 4DJJA 2AKEA 3LZ6A 5BNFA 1WU7A 4XDGA 3RVMA 2OHFA 1PEDA 1E3SA 1T2VA 2BCGY 3OEYA 2AN1A 4PNZA 3A4NA 1EVIA 2GEBA 3GHYA 2A9RA 4L78A 3RROA 3FOEC 3T1HB 1XPRA 2WF7A 5B53A 3MJDA 4M53A 1TAGA 3TZCA 4B6OA 1XCLA 3I2GA 3G49A 1TVKB 1L8AA 2C78A 4HWKA 5CXXA 4CIWA 2J7PD 2OWDA 4NZYA 3G6KA 3QFCA 2OCDA 2E37A 2IFTA 1WZIA 2MR5A 4B3XA 1PKXA 2YWCA 3A1FA 3KEGA 2WSYB 1BG6A 1P81A 3CWCA 4Q3NA 5DSXA 5CD1A 3SKYA 1LSJA 3QUAA 1MQ9A 3GCGA 4OI1A 1I7SB 5I9BA 3PC4A 3VH3A 5L53A 1QVWA 1JB9A 1PQ4A 2FZ5A 4L50A 2P6UA 2Y92A 3WR5A 5KYXA 1RYFA 1UPFA 3IQHX 5LZ7A 5JCPA 3KLPX 4HPXB 4N82A 5GQSA 1S9DA 1JDBB 1PZGA 1V4VA 2Q2WA 1U2DA 3QLUC 1FMFA 3RARA 1MB3A 2AFIB 4MLPA 3OUZA 1OA1A 3OY7A 4ZAYA 5SZHB 1YC2A 3ADPA 2FPLA 1A9QA 2FSVA 1KVQA 3EIEA 1RCTE 3NHRA 3KSMA 4HNAA 2QD1A 2UZ0A 3W9SA 3QSGA 4IS2A 2ID7A 4TTSA 4WH0A 3IV9A 4X41A 2FUNB 5EZYB 5KKAA 3WA6A 2HIMA 2GETA 4WEOA 3A6DA 4E70A 1JBKA 4HN9A 1O5TA 4ZMSA 3GGOA 1B16A 3AQIA 5CPBA 3GYGA 1J09A 1C7FA 1WQ4A 2RHBA 3D8NA 3CUTA 3MD0A 1XTZA 5EIWA 2GN9A 4MPTA 4YCAA 4EKEA 3GK3A 3AF3A 5F9FA 3AM1A 3QWHA 4DV1B 2MCFA 4PNHA 4E51A 4JJKA 1AUOA 2XUJA 5GTDA 5KKCA 4D9BA 1UMKA 2PD3A 1GG2A 3II6X 1Y3BE 5EFOA 4B3TB 2A5LA 4PIVA 4XM1A 3VR2A 2NO4A 4IZOA 3HVUA 4C9BA 5J3JA 3O2QB 4PZDA 3WFIA 3FM9A 1ADFA 2IYXA 3HP4A 4PXAA 3ZX5A 5KOJB 3DFKA 3OE4A 3OIFA 4FYVA 4GEGA 2WVGA 4FZVA 2C00A 3LA8A 5AHKA 1EM8A 5DISB 2A3NA 4PXYA 3AO0B 4ZT2A 1Q95A 4EA9A 1SC4A 1KJQA 2RD2A 1DXQA 2W11A 1O03A 1UP7A 2RJ3A 4NCJA 1IBRA 4TPKA 2Q1TA 3U56A 3IOEA 4OJKA 4AJ1A 2G40A 2QTNA 3R0XA 4R8VA 5F7ZA 4BWYA 2P2SA 3HADA 4OFWA 4ZGWA 4GVXA 1ISMA 3FF1A 3FHTA 2G28A 1SH7A 2GESA 3K0SA 3PGMA 2DFLA 1ZN9A 3IP6A 1M0TA 2V45A 4MYTA 3T3DA 1KOJA 1XALA 3SBOA 1SXJA 1ZUIA 2YVKA 1RT9A 3RSCA 4WCFA 4QXOA 3A3NA 1XRSB 3EGXA 3T94A 1HUQA 3JQQA 1PSWA 3BE6A 3K09C 1GT91 4LYFA 1JP7A 1YR3A 3CT6A 4S1PA 1SCKA 4XFDA 2IWHA 1GGMA 3NYWA 4KHZA 1HDEA 4EOGA 1JI3A 1DSSG 1U8FO 1IDOA 5JBNA 4TT3A 3WJ7A 2COUA 5FORA 5CFNA 3X1XA 4IKOA 1IY9A 4MUHA 3WNBA 2VI5A 3MRSA 4PO8A 1QDLB 3KL4A 3KXPA 4GZMA 1F7UA 1JU4A 3D02A 4RJLA 3HL4A 3SYNA 1RXEA 3CF4A 4I9FA 4MWTA 4N40A 4DTCA 4NBTA 4R2JA 3CYFA 2C9MA 3D3EA 5KQPA 1TQHA 3TLZA 2J3JA 2ZBEA 3I5YA 4B82A 4TYWA 1L5ZA 3FDIA 1PHRA 5IANA 1HE1C 1A2OA 3L6DA 1NU8A 4HX9A 2AVNA 1BXKA 5JRZA 1L4YA 4P31A 3UJAA 1NC1A 1NWCA 2JB9A 1F4LA 4HB3A 4UD6A 3FW1A 1YGPA 1ZXXA 2BBSA 4BN5A 1DG9A 3CR7A 4ND8B 4HPJB 2DCMA 4PBRA 3BGWA 4MS3B 4XDYA 3ENZA 4EM6A 5UKDA 3N2NA 4GMXA 3NNNA 4D4IA 4J0HA 4OHWA 5JBIA 3F47A 3DLPX 1USGA 1ZI9A 4KW7A 1X39A 4YRZA 2JIZA 3F6EX 3LRTA 3VKUA 1ZG3A 2Q0XA 1ID1A 2IYEA 3RG8A 3PUIA 1NTRA 3CBGA 3X1WA 2MWMA 2P5SA 3A3KA 1L7OA 5E7MA 1TTHA 1XXHE 3L43A 2BWJA 1YQGA 2AW5A 5THKA 3UW1A 1OX6A 4EZIA 4E08A 3FHJA 3GDGA 3T9EA 3KUUA 4QASA 3TW8A 1R2QA 2QG4A 3HVJA 5GADl 5DYNA 3QX9A 2GM5A 5D00A 3RRFA 5KNCD 3RTBA 5JZSA 2F1JA 2FZCA 4UEWA 5KWVA 3A1DA 1QGDA 1F0NA 1E0DA 3IIEA 1XYGA 4MZDA 4TXJA 2G36A 5HKKD 4MV1A 1VQ1A 1OH8A 1CSEE 2V55B 1MT0A 4BNDB 1J8YF 1R8JA 1I80A 2BJHA 3CUWA 3K1JA 4GPD1 4RO0A 4BXOA 2Q45A 1AN9A 1N0VC 4RZHA 4B7CA 1VE7A 3OFKA 3T0GA 5LP1A 1G3MA 2PZKA 3GYBA 3T3IA 1DQZA 3A6KA 1M6VB 3G0GA 4JSYA 3V34A 1Z4OA 2RHHA 3ZV5A 1E5VA 1TU0A 3F6PA 1HYGA 4GR4A 1D2HA 1PL8A 1SPXA 4OPMA 2Y2UA 1DOZA 3TQIA 2B78A 4PONA 2LE0A 3I52A 2WJ4A 1Q0ZA 2BGLA 1BX1A 3D7NA 3HB9A 2G4VA 4O4HF 4WXHA 1RI5A 1TA4A 4P58A 4AU1A 5CCXA 2DBVO 3VNAA 4MPPA 5FCDA 4DMFA 4JQCA 3BFKA 4M36A 4OKNA 1HTBA 4LOKA 3CNLA 2J3QA 3GLSA 3SXPA 3ACBA 2Q62A 1DI0A 2QTCA 3O3OB 4DV2B 3KQWA 5IP5A 3T7SA 4MQ4A 1ZO8A 2DPLA 3GBVA 5FR2A 3HABA 5CHYA 2JANA 4X61A 5EPUA 3ZIDA 1XZJA 4OXIA 3GQVA 1AOXA 3OKPA 1I6LA 1K0UA 2AYZA 4WGFA 5ALZA 1S3GA 3VYUB 4RY0A 2IYQA 3WFJA 2ZJ2A 4QULA 4IWXA 4LZJA 4CTNA 2HPHA 2FHPA 4UHDA 1U0BB 3SE0A 1DARA 1QBGA 5CH3A 3W2GA 4ZI2A 1FFXA 3QG1A 4BU0A 1BZYA 3BSWA 3LKVA 4AO6A 2B25A 4D9NA 2YXDA 1E69A 2Z1DA 3MWKA 3ZVNA 3M9LA 1QHXA 1FP6A 3UB2A 4ND3A 3RCBA 3URKA 5CLIA 4DM4A 4ARSA 4NX2A 1EQ2A 4Q9HA 4XOUA 4X45A 3NU1A 4JLUA 5E7JA 1ZGCA 4JAVC 5JAIA 2HYIC 1E1DA 3PPXA 4BMYA 3I34X 3NBXX 3STHA 3A37A 2XRFA 1E89A 1DHTA 4RACA 3TQTA 1ORTA 1YQUA 2YVUA 4M87A 2BBTA 3RSOA 1UXJA 2WU1A 3HBJA 2K7FA 4NDNE 2PG3A 4M60A 3NC1C 2QYOA 1WOMA 4YV2A 2WIGA 3RFXA 1NP6A 4KVFA 1NVGA 2ZJFA 2KHZA 2EP8A 4B6PA 3STTA 2CK3D 5CB6A 1WMSA 1S8AA 1L4NA 1YDEA 4HDOB 3O1LA 5FOTA 5LQSA 2A4MA 4E31A 5A4DA 4INPA 2XAAA 1GL6A 3OE7D 4IF6A 4C4SA 4DVGA 1B0AA 3OX3A 3TMAA 4UVHA 3FWYA 4QZVA 1LBTA 1KOFA 1DAIA 2G63A 5AFSA 4MUEA 3AIOA 3WOHA 2OORC 1FUKA 1PLLA 3KAPA 2PMFA 4J0EA 4W8OA 5BNIA 3ECAA 1ZN8A 1ADYA 1BGVA 2EAUA 3A6EA 1MQ8B 1WB9A 4YCMA 1P44A 2J3MA 3AVWA 4GSYA 4EAAA 5F1OA 3V1KA 3LF2A 3S2UA 5CJPA 5CVJA 4F21A 1UP4A 5JJ5A 4ONEA 5HCUA 4CWAA 2PH5A 2KSQA 3VA7A 1MIOA 4UD2A 1X77A 2RGYA 1F06A 2J9YB 2J5QA 1PGJA 2O0MA 2G71A 2P62A 1BNCA 3ISTA 4MA4A 3NNSA 2OO5A 2OZLA 3WLQA 3RK4A 1XYVA 4N76A 1PJSA 1MABA 2Q1SA 3BWCA 2REQB 2TMYA 4V03A 2HUNA 1EWYA 3RRZA 1RW4A 1JT9A 3HJBA 4BZZA 4E5DA 5A6SB 1NUQA 2OXRA 3ASUA 2ZUTA 3B82A 4I50A 4BMSA 5BV2P 5K0EA 1N2IA 1M2OB 4MLZA 1C1DA 3P2JA 4CMCA 3JALB 2BE7A 1SKMA 3IVCA 2I7DA 2Q46A 2LCIA 2ZWMA 1U3VA 3ID6C 3FDZA 4COOA 5EJ7A 1NJ6A 2R1VB 3V8EA 1GTRA 1SEPA 5FBWB 3ADOA 3VFDA 2GHRA 4BNIA 1OXMA 4HGRA 2PR7A 3WKDA 3RGWS 3AETB 3ZIAA 5I01A 3IQIX 4XYEA 3WGIA 1Y4ZA 4N6GA 4RHYA 4UUNA 1GQSA 3PHCA 4I66A 5T5QA 4E1AA 3PFNA 4X3CA 2PIAA 3FMPB 4DCVA 2A9OA 3M2PA 3RVQA 3TOVA 2AK2A 4M1KA 5D6NA 3VU9B 4MAMA 4OSEA 7MDHA 2A9KA 3DL0A 3RDPA 2K2QB 2QG6A 3ILXA 3EBPA 2QZ9A 4KBFA 2B92A 2E89A 2R86A 3L07A 5FD8A 5J9FA 1JDVA 5KSOA 2ZKIA 2HV9A 4HC4A 1M2FA 1VHQA 2XGGA 3K15A 1SWWA 4UZSA 5JUWA 4NPHA 1IEXA 2R65A 3JYOA 5IHXA 1EE9A 1U6IA 2OHGA 5G1PA 1W8IA 4JVLA 4MVYA 2HSEA 3O7WA 3SSOA 5DHSA 2GYUA 5LMCA 2ZOSA 2Y1DA 3QKWA 1RPAA 3QHQA 3N2YA 4RY2A 2H63A 3MJSA 2PUDA 1NQUA 1S8FA 1EE2A 3JQBA 1X92A 3ZGNA 1NSTA 4D99A 3L1IA 1L5OA 2X14A 3SYLA 5I9NA 1ZR2A 1DWPA 3EMBA 1IOLA 5AOBA 4OMDA 1VYTA 4YB8A 1Z4KA 2QMYA 1NNSA 3TCNA 4MNTA 1EGQA 5KHLB 3TEMA 4G09A 3DOCA 4EB0A 3O2SB 3TUZC 3FHCB 4KPUA 1Y1KE 3WMWA 4CQMA 5FLXA 3EIFA 4W1RA 9ABPA 3GJTA 3WKAA 3VH2A 1QZZA 2FWRA 4NBWA 3VHXA 2RHCA 2ZYGA 2ZVQX 3JCZA 1P0MA 1IHPA 4H7JA 4H7FA 4WOCA 2BHRA 5CYPA 3CGGA 3C48A 3UZUA 4ZTZB 4IGKA 3S1SA 4QOGA 3UUWA 4LVNA 1REQB 2HRBA 4DLRA 3F9RA 1K89A 1W2HA 3Q9SA 3PZBA 3T9DA 5JWOA 4JI0B 3IVRA 4IJKA 1OFGA 4Q4HB 5U4XA 4UFPA 2BEJA 3JRXA 3DFFA 1PR5A 4W7SA 5FHRA 4CBVA 2NZ2A 3DJFA 4OA8A 5IABA 4YA6A 2WU0A 4B1FA 1NDUA 4IIXA 1X15A 2F90A 4YBZA 1G1AA 2BFEA 2QVYX 1XD2B 4UARA 4J1NA 3ELUA 4ZO6A 5H81A 5HKAA 1PYGA 4FEAA 5LMZA 1A9PA 1FSZA 1U8YA 4I6GA 1FBNA 4JI4B 4IYJA 3B60A 1HA3A 1OKKA 2D1QA 3WICA 3VNBA 3GY0A 3I1YA 3PDIA 2WJHA 5FKJA 1WXXA 1DQNA 1RACA 3G8YA 2E2WA 2RBKA 1HE2A 2B7BA 3NVAA 4ZQEA 5E7IA 1DQPA 1EG2A 4W9NA 5CX1A 2OCXA 5E6RB 1Z4MA 4JYCA 1H8HD 1X42A 1B2RA 3DAGA 4GX2A 4NV1A 2N0SA 1TTPB 3EWNA 1MO4A 1T3SA 3N0TA 3R9XB 1CNFA 1VDZA 2HBZA 4IHJF 1FP4A 4K1LA 4FLFA 4JUFA 1NMYA 3WXMA 2D3WA 1E2LA 3HBMA 5JCZA 1HZZA 3C4VA 4Y1GA 4ZQCB 4CVNA 1ISFA 4YRCA 5EGSA 3MPUA 3AMVA 5IT9A 2QGNA 1ZHHA 3GG9A 1RIIA 1R0ZA 3FWHA 4Q3BA 4BNLA 5DI3A 3RU2A 2I1QA 1X7YA 4G1VA 2BR4A 1UBKS 2QHXA 2QLLA 4PYKA 2F1OA 2BM8A 3UJ9A 5DO9A 1NG1A 2UXCB 5HE9A 1CC1S 1A76A 2I76A 1BVUA 1OA0A 1ZNZA 2HL6A 2OCGA 3M6XA 2QW1A 3OOYA 4BX9A 3AFIA 3KVRA 2GPAA 3IMFA 2ATVA 1QIKA 1BN7A 1WVGA 2R6DA 3KOYA 2O20A 1DJLA 3PE3A 4FU0A 1NI3A 2PAAA 1QOZA 3GFRA 3KSRA 1Q3KA 4J29A 3CLRD 2XUHA 1KZ1A 1RPNA 2NZUG 3NIBA 4KUEA 2F3UA 4YRDA 5T57A 3LCRA 3U7JA 3U9LA 2X8LA 2HMUA 3CLKA 1HG1A 1N2CB 1I5EA 2R8XA 4REQA 1R4MA 5B3KA 2C9OA 3ZU5A 1NULA 4EF6A 2IHKA 5CX4A 3WGGA 5CCBA 1KVRA 4BTVA 4QM7A 1NUAA 2GFQA 3RHTA 3TZQA 3JD4A 3QRWA 5C4IA 2NYAA 3LUHA 1KMMA 4G07A 3J7TA 3B7PA 1Z2OX 3UAOA 1WP9A 2FFBA 2Q1UA 5EE5B 4C07A 3FYUA 3M5WA 1IQ0A 3T5CA 1EFRA 3T1QA 3ZHOA 3KKEA 1N5KA 3VVBA 3WLLA 4N1AA 5IT5A 4O63O 2XPCA 3DNPA 1T34A 3LRXA 3ICQB 1JI0A 4OHKA 2AG0A 1YZFA 1JIVA 1WTCA 3N2EA 4JSTA 4FQ5A 1DS6A 2I91A 2VAPA 5GONB 1SKYB 1YR9A 2QLTA 1HRDA 2DPYA 2J30A 2YHUA 3Q88A 4RHTA 4ZYXA 4E15A 1FUEA 1S6YA 4N3AA 1V7ZA 2RGDA 1TF2A 1Q74A 2VP2A 3GRVA 3NC4A 1V35A 3VR6D 3PDWA 4F7DA 1JWLA 4MW9A 2CXSA 3JQ7A 3PQ5A 4FFSA 1JIXA 4FR2A 2C99A 3FUTA 4LTNA 4BLQA 5BWCA 4OP2A 4Z5XA 5JYEA 1OI3A 2CUNA 3KYDB 3ONNA 1Z2DA 1V6CA 3DGEC 4KQIA 1PQUA 2W83A 3PHLA 1IAVA 2W6QA 4OQFA 5EY5B 5FQOA 2ZUFA 2PSSA 4NYIQ 4UUMA 5EA2A 1EVKA 3R8CA 4CXMA 1KRXA 4HDMA 1CQJB 2AOTB 2AQIA 4OB8A 4Y0AA 2HBYA 3S2SA 3N8DA 5B6IA 1V1RA 3ABRB 5I8WA 5ITVA 3HCNA 2IEYA 2IW3A 3WRYA 2BIFA 2VNJA 1VHLA 2OO7A 2R5FA 3H8JA 1ULAA 3T4XA 4RA6B 3AF1A 4WPGA 2XOEA 4YMIA 2BSQA 1U2RA 4TV9B 4BUZA 5ADVA 1L7EA 4HH0A 4LZOA 3MCTA 2QRNA 1J00A 1CU1A 1Z5NA 2UUPA 1HE4A 2WNSA 1HLGA 1QH0A 4U3JA 5EE3A 4ECEA 3JPYA 1QB8A 4QRIA 4TM8A 2AXPA 4KQFA 4TTIA 8LDHA 2K2WA 2RONA 2W70A 2JDID 3KR1A 5LYJA 5A3QA 1G64A 2AR9A 2B36A 4BNZA 4GICA 3UTCA 1VHTA 2AMLA 4HSEA 3VTKA 2GCNA 2VCYA 3I4FA 3IBTA 4DC9A 1I30A 1FYFA 1M72A 5LQAA 4HDAA 1T8SA 2GCOB 3OAAA 4KQ1A 1BMTA 3UK7A 1R74A 3WYDA 4XLTA 1ADCA 5EE0A 4J07A 4LY6A 4NLLA 2X40A 4KNVA 3BK1A 4WASA 1Z56C 3FGOA 1KP3A 2AJTA 5TXGA 1FSSA 3M4YA 3MXTA 4QEKA 4OLBA 1AC5A 4RDHA 2NACA 3NV7A 5C51B 3HH8A 1NNEA 2H1OA 1EUDB 5EMNA 5ENZA 1S3FA 2NTNA 4ZRDA 1CUCA 4MRNA 2PNJA 1XO1A 2EFDB 1RM5A 2JAOA 7GPBA 5KYNA 4J7XA 1R6DA 1ZM7A 2D8MA 2FEXA 2VL7A 2JBHA 4JB8A 1C4OA 3QLEA 4OHFA 2Z5LA 1Z28A 1MO2A 1NX9A 3WISA 1KYIA 2X3YA 4ENTA 4QTXA 4DC1A 1VGVA 2XWSA 3LC7O 3AEKB 5GIPE 4REMA 4O4LB 1C0LA 1GZHB 3AGPA 5GJBA 3JWHA 3OSZA 3U4QB 3DQQA 4PIPA 4US1R 3FYHA 3ITDA 3RGGA 4AMYA 3WAJA 4RTSA 3ZZNA 1QGUA 3F9IA 1V9LA 3VGPA 4W82A 5IS2A 3C3YA 4ND6A 1OAKA 3L0YA 4R8RA 1G8FA 1AB5A 4BB5A 2D00A 1QGAA 2GJ9A 2V03A 3L7LA 3NHYA 3KSAC 3SS9X 1RKQA 2BHLA 2HCFA 3A6HA 2BRUA 4M9QA 5KQGA 3PYLA 3M9XA 4BASA 2V4MA 1TK9A 4CF7A 3N58A 1QFYA 1G41A 3JY6A 3KHTA 2REOA 5H1YA 3OPYB 1ZIPA 2NSDA 2AYYA 2I55A 2Q3CA 1NUPA 4HGZA 1F51E 2DE0X 4IZ6A 3ZHVA 4CKCA 4UTOA 4GVPA 3UB3A 5DOZA 4BFZA 2DFTA 1JIJA 1P60A 4NFLA 4OQYA 3ZNPA 3LC0A 2FEAA 3K16A 1ZC4A 1PR0A 1G60A 2JLBA 5IAGA 5DWDA 5FWNA 5KOHB 1JAYA 1RJWA 2N9UA 4FDVA 1AGRA 5A9TA 1EBUA 1XXHA 2Y0PA 1X8JA 3MB5A 3MTGA 4MVJD 2ECFA 3UIEA 4BCCA 3DFMA 3KPWA 5D3ZA 3HB7A 2BFBA 2CLLB 5C5EA 5BN4A 2D7CA 4I0WB 2PKXA 4LHXA 4A0HA 5C5CA 5J1SB 2AHRA 4JXJA 1Z18A 2PH1A 3MIIA 2EFHB 1HBJA 1ZHFA 3HB1A 4JLVA 1UDRA 2EJCA 1I4TD 4JOBA 2OHJA 4C04A 3TPFA 6CHYA 1C8KA 2WUFA 1ESMA 2O2ZA 3E81A 3FPSA 4S35A 4BBAA 4BNUA 2OXCA 3VZQA 3SMQA 4A03A 5BRAA 2JFZA 4GQIA 2FMTA 1E94E 2TSYB 5E4YA 9LDBA 1TAQA 1QHGA 5DW3A 5CTAA 3SBEA 2VNSA 2IX3A 2BFFB 1YZYA 2EFCB 3NETA 1BCSA 1FS6A 1E4YA 2D5BA 3PC6A 3Q7SA 4JC0A 4LN1A 4MW1A 1KY3A 1QH8B 4WZBE 3S5JA 4D3FA 3AXTA 4Z3KA 5JD6A 1JZSA 1PJRA 4JA0A 2DM6A 4JCOA 5KTRA 1T5OA 4LZZA 3L8ZA 1F20A 1EFLA 2B4KA 5EP4A 1A7UA 4QJ5A 2XUGA 2FAXA 4MR9A 3EC1A 3K9LA 4GNKA 3I9V6 1CNMA 2ACKA 5IXJA 1S7CA 5JRJA 1ENYA 4KO4S 3MCVA 5L3QB 4KMSA 5THQA 4P22A 1I7DA 4PM4A 2YHIB 2DEUA 3C43A 4OOEA 1SZPA 5A05A 1ZQ1A 4V1CA 2W4MA 3HDJA 3IUBA 4RMGA 2QQ0A 5ALNA 4ABYA 3T4PA 1HT0A 1MU0A 5KU7A 4YAGA 3QQ5A 2PSJA 3W6ZA 4LGMA 3HYRA 1DAFA 3RC3A 3S29A 2B98A 5BMVB 2CV1A 1AIPA 1UDBA 2EQ5A 2QRLA 3C6MA 3I12A 1LI4A 1N6PA 2HPAA 3U48A 2C2MA 1UT8A 3AHEA 4IQ8A 1P1RA 3K7EA 5J2TA 2QAGC 3CLHA 3M1YA 3WB0A 2Q0SA 5HBRA 2OCPA 3ROGA 1E5LA 1QR2A 4IZHA 2O2GA 3SLKA 2WINI 4OHUA 4MX8A 1NMQA 1YJ8A 1JG4A 2WJ6A 2Z2IA 3HYSA 4BNFA 5ALVA 5G41A 5K3EA 3I3OA 3H6HA 5FPKA 1T9ZA 2PZAA 3PYXA 2BTEA 2ZIFA 4Q21A 4RS4A 5JAUA 3RVKA 3ZZMA 1NXPA 2BFCB 1U8ZA 2FZEA 2IYRA 4TS4A 2PLAA 4F5DA 1FXWF 5I9IA 3UAVA 2PQMA 3W4IA 2HWUA 4YPOA 2LD4A 5CA1F 4A8JB 3E3LA 1XCJA 3PE4A 5GV8A 2B6HA 1LNZA 1LVUA 1O77A 2O7NA 1PL7A 4FGLA 2KE5A 4LZPA 4QGBA 1JS1X 3OTQA 4TV8B 2EJBA 1JXMA 1YK0A 2HK8A 5I9TA 1BOFA 3EZLA 2G72A 3NGMA 5DLEA 2CV2A 3O9ZA 3IPCA 4L0DA 1P19A 1E2NA 3TZ6A 2JGRA 2BTQB 2V5VA 3LHFA 2Z6AA 4L07A 2NSYA 4PZCA 2FJPA 1OY1A 3BH6A 3GJYA 4D4JA 2ZIWB 3T6KA 2RJNA 1GSOA 2H2FA 3ZCTA 4EPWA 4N3CA 3X1KA 1CZOA 5JCJA 2COEA 2IBMA 2ZDGA 3FH0A 1GUZA 1EFKA 3AFOA 3DMRA 3GL9A 3O91A 4Y1EA 4LCJA 2OYRA 3TQOA 3OC6A 1SQ5A 5HUJA 3KJHA 4IW3B 4YRTA 2GB4A 1HDZA 4JLWA 2B2CA 1PW5A 4BFTA 1A4IA 1MTOA 4BVBA 3WAKA 5AUNB 4QGAA 4TSFD 4GLBA 1UPBA 3B1JA 4QUKA 4NICA 1V8PA 4QRDA 2EFYA 4TQGA 3U13A 1QGED 1VTKA 2O0KA 5DNWA 2KPOA 2YTZA 4KDRA 4OQMA 5JXJA 3GGGA 2AV6A 1C3XA 3AR6A 2A3RA 1QVVA 1VPWA 1L5WA 1OF1A 2Q99A 5HKOA 3ROFA 4XM2A 2VF7A 3BQMB 3B12A 4NBLA 3WADA 5EG5A 1Y98A 3PQEA 4NV3A 3EY4A 2OVBA 1U8UA 4CKEB 4D74A 2R8BA 1DGQA 4HYYA 1FNMA 4CIXA 1E8DA 3F7NA 5AUQA 2DTDA 5FAXA 2DYKA 1HT1E 2P9CA 4WOJA 4YCLA 3A6GA 2E49A 5E6SB 2QQ5A 3KXIA 2FF7A 1ZU4A 3FIUA 4H0NA 1CY7A 4BAUA 5L4NA 2FPUA 5B7PA 5F1PA 1AA6A 1ZUHA 2CHVA 5EIFA 2W22A 4YLEA 1ZVQA 4GC5A 4B34A 1EE1A 1AM4D 3LLCA 1THZA 4O1IA 3FNHA 4QDXA 2MSWA 4Z2AA 4GX0A 3OE1A 4B35A 1SAYA 3O2NA 3ZBTA 3IDAA 2C7GA 1UBSB 3NONA 4GGMX 4HAUA 1JR3D 3QVUA 5DNAA 4L75A 5EYPA 4ZAXA 2VAWA 1U0GA 4EGAA 4WECA 1XZGA 4YRLA 2IUTA 1XFDA 3JAKB 1G7RA 3NAMA 3W8RA 4YUVA 1STOA 5EIOA 3M9WA 3DE7X 3GOQA 1DRKA 2YWDA 3UT0A 2Q5FA 4PLHA 4C76A 4EG4A 4LOIA 2W5UA 5AW4A 3IHWA 3JZDA 5GOZA 4KLCA 3HA3A 1B8PA 4YP1A 4DQLA 2YKGA 4ENRA 1EZ1A 4ZO8A 1AU9A 1I9CA 1BXRA 1LZLA 1RVDA 5LZ2A 3PSHA 2PLRA 5DHRA 4JP8A 2QIOA 1JXOA 4LVUA 3WYGA 1ZK0A 3P2KA 2G08A 4IV8A 3HKEA 4XLLA 3D6MA 1RQ7A 1U1EA 2F4NA 1RXSA 2X2OA 4OXQA 5CCDA 4GZ3A 3WLMA 2BGWA 3CQ9A 4P7BA 1KYVA 4EABA 3ER8A 4C5BA 2HTFA 4Y30A 1RTTA 3PIIA 1NXQA 3GVPA 5MN6A 1UQUA 5G0SA 4LDRA 1HWYA 3HKCA 1P0IA 1T6BY 1FRFS 3LPNA 5EJIA 1ODKA 4PZYA 4HVLA 1MHPA 1TO2E 2PS0A 3IEPA 2ZWVA 4L9SA 1ZLYA 3N87A 3TZLA 3A27A 1TCVA 1YBAA 2NLOA 4RJ2A 3ZV3A 1JHZA 1VI2A 1DG3A 3OTIA 4OO3A 4QXAA 4RKWA 4UE6A 1W4RA 2E5FA 2AC4A 4XDZA 1FLVA 4L95C 4NYIR 4ZCTA 2LCQA 2QQFA 4OYYA 3AVYA 1SD5A 1FXUA 1FQJA 2XIQA 4QC2A 5CDSA 1HDYA 2DHDA 3WGUA 2PMDA 4WIAA 2IDKA 3ILVA 1GLGA 3CX3A 1ULUA 1X8XA 2NWQA 2QM3A 1NUTA 1XE3A 2I9PA 2QSJA 3ETLA 4UEQA 5E6UA 2EDCA 4ZCPA 4V02A 1GTG1 1EDOA 3QYFA 4M4SA 2NMVA 2CF6A 3GFGA 1JW9B 4OK6A 1UBNA 4EDHA 2CJFA 3LQRA 2HDHA 1DADA 2ZLBA 4F4FA 2YXLA 5C4MA 1DMSA 4MS4A 3OC0A 5JZBA 3NEPX 3AK4A 2RE8A 3GA0A 5CLLA 2VZ9A 1JECA 1KQGA 1DEKA 4HNRA 5TF4A 1R6BX 2YMQA 4IFIA 3LX6A 2XGJA 5F9MA 2FI1A 2ID8A 2P9BA 4LJ9A 2H4HA 4BNHA 5IFKA 1MUUA 2J08A 1UKAA 1YZHA 1KAQA 4NYMR 1YZ3A 5EVJA 1DBPA 3G02A 1NVTA 4DFDA 5CVEA 4D97A 4IDEA 1KJNA 2RBGA 2BP7A 4F85A 4AJIA 2XMDA 3EODA 2UYYA 2O6LA 2PKWA 1CZRA 3B53X 4QTZA 3WHIA 1KYYA 3ZDFA 5FUMA 2FPIB 1Z5ZA 2DFNA 2QA5A 3BE8A 1CJVC 3H7IA 3WSTA 4CM5A 1KJIA 4KN5A 1G3UA 4MS1B 1KEVA 3ANNA 1ZOOA 4EYGA 3L7AA 3EFEA 1XMSA 4YV0A 1I32A 3LM8A 4CM8A 2ECOA 1M1XB 4YJ3B 1YHZA 2ZXFA 1JB1A 3A4YA 2FDRA 2VHUA 1WABA 4KIUA 3TLEA 1L5MA 4EHBA 3Q8LA 1FP1D 1ZD1A 1AQIA 1XHLA 4TLDA 2ZYWX 2BGRA 4DL9A 4A0SA 1LI7A 3STUA 4DJEC 1MC8A 1UOPA 2ZYVX 2ICAA 4ETWA 4AUKA 3A04A 1L5FA 1USIA 4US0R 1FW6A 4JLDA 3EYAA 1ISSA 2NT3A 3I0NA 4HK4A 4OHOA 3TLXA 4CF6A 4GMGA 1ZK3A 2XCQA 2MHCA 3SQMA 4KR2A 1I2CA 2GI4A 2QN1A 4YI3A 2AG1A 3NWJA 4LWQA 1RZRD 4BLSA 2WA2A 3N8KA 3P9SA 3NVKI 5DLQC 1LB1B 1YL7A 1TLTA 4LDQA 5BOVA 3NP7A 4E30A 1IRIA 3VH1A 4ZQHA 2VEOA 5I47A 5DI9A 1IC6A 9MHTA 1GAEO 2HTEA 4Y6PA 2D2VA 1BKYA 1O95D 4M0CA 4B7ZA 3IMKA 2CL0X 2OB1A 3QPWA 1YHYA 3EBLA 4RTPA 2Q2OA 2ZJ8A 4DWOA 4LOJA 4N01A 3TSZA 3V3KA 2Z8ZA 4LPKA 3ABQB 1YRBA 3L4BC 4UNQA 5LMNB 4FKZA 3D4PA 4YGYA 1OT5A 1U7OA 2QAJA 4TWRA 1TYCA 4YO7A 2CKMA 3SQOA 5BR1A 1GQ2A 1AO3A 1R9MA 2YWEA 1KL7A 3QELA 3OJOA 4KFUA 1U7WA 2Q8NA 1M5UA 1W96A 1YQTA 2LPMA 1K98A 1RAIA 1XTJA 2QSYA 3VTAA 2V96A 4X94A 4DGSA 1W5EA 5J58A 2H7XA 3OU2A 1XG5A 4N8DA 2FK8A 1Q1ZA 3B3QA 1ZNQO 2P69A 4F4CA 1M54A 2REBA 2GEFA 4MUFA 3RTAA 4B44A 4MV0A 3AR4A 5EJFA 3SDZA 1UK9A 4UBOA 8OHMA 2FRDC 2SKEA 2PY6A 5IK2A 4CODB 4JS0A 4EFNA 1G8GA 1IUOA 5DWQA 1JAXA 3AEQA 4ZMRA 2YDXA 1THTA 3BSYA 4O5AA 1XV5A 3H5LA 4H1TA 4X92A 5FPTA 2WBLC 5JS7A 4XB6B 2R44A 3WWEA 2VWPA 3KLNA 3OLYA 3PCRB 4KWCA 1SXIA 5FOQA 1Y6FA 3U7RA 4FZJA 3OQ1A 2WPDA 5A5GA 3ZLJA 4CPDA 3TK1A 1Q7BA 1OGJA 3BRQA 3D7MA 4CMEC 2OVFA 1JKXA 1QBKC 3OIDA 4HWGA 4HY3A 3K0CC 3JQAB 3PQ6A 3ROTA 3UK1A 2F6RA 3DJYA 1ZH6A 3JATA 5DHUA 3GLTA 2HIAA 1LLUA 2BVNA 2G3YA 1AUXA 1OXSC 2A33A 3F7OA 2WHEA 1N5OX 2AD5A 2P9GA 4M9UA 1ZDMA 1R0YA 2NSLA 2Y0EA 1JFLA 3BDAA 3OLXA 5A4KA 5TT0A 1HQYE 5B2FA 4MZXA 5CA0F 2AOVA 4CL8A 4RQBA 3MCWA 5K6AC 3G59A 5TVGA 4Z51A 1H66A 1JQ3A 1O3YA 1ORVA 4NWIA 1F4VA 2BDTA 4P3KA 2J5BA 2QOEA 3IQFA 5FBVB 3KSBC 3PF8A 4U8HA 1VGQA 1H2RS 1Z6AA 3AM5A 3GNTA 2X0JA 1KPGA 1C29B 2O05A 1Q7TA 3P0FA 4FLEA 4YV7A 1N3YA 1QFSA 2C97A 3B9RA 4G6ZA 4G8BA 3ER9A 3LOUA 4BNXA 1E2UA 2G8LA 2QX8A 3AP3A 3UWSA 3PX7A 3IQDB 1DAOA 2B99A 3UNXA 2V7QD 1LH0A 2FDXA 3EGDB 3EXHC 2J9GA 3OURA 3O0DA 5D5HA 5EGNA 3ZU2A 3R40A 3SXUA 1NC3A 2H9YA 1IPHA 1KEKA 5KSYA 4MV7A 3SEAA 4BDTA 2D54A 2IKSA 3KVOA 1QU3A 3TEFA 2QL7A 2NUTA 3DE0X 1FUYB 4OHCA 3LCVB 1O89A 4DSOA 3W3AD 1LTKA 3QBJA 4LHVA 4P5EA 4UNPA 1SUSA 2DR0A 4A6XA 4EQZA 4JJ4A 1YI1A 4M9ZA 3K1AB 1S2LA 1R6UA 3K8QA 3AINA 3R4CA 4QFCA 4KPYA 4NBVA 1XDSA 3LBNA 4ZK6A 2OBYA 3HO8A 1I4OA 4C4OA 1CUJA 3HSKA 5IHPA 1J2JA 2NZVG 2BUBA 4F4UA 1QE3A 2IEBA 3I6MA 4JI6B 3T7EA 2QBYA 4FMBB 1IULA 3PXEA 4W5HA 1KI8A 2YYAA 1GGEA 1PLJA 4AM8A 3KQKA 2XXAB 3MF4A 5AM3A 1RNLA 1XVIA 3OM9A 4MQUA 1G2IA 2IYVA 4XWKA 5DM70 1VL8A 4FCWA 2X0KA 4BV9A 1JHMA 5FTLA 2ZPAA 3D8TA 4HDQB 1EB8A 5EI5A 1NBME 3GPDG 3QUSA 4L2IB 3CA8A 5TR9A 1PD1A 2EIHA 2JAWA 2YMPA 4I36A 1SOUA 1GUBA 2ZTVA 1QM5A 3JWJA 1CR0A 3TRDA 8AT1A 2E0IA 5BWNA 4ASUA 3B5IA 3QBDA 3U4DA 4CU5A 4ETNA 4XRRA 2Z6QA 2BSAA 2B21A 2NYVA 4HYEA 4P38A 1BWPA 4GXTA 3LUJA 5F2NA 2VPZA 4Q4JA 4GYKA 3LXMA 1R27A 1UZNA 2E5WA 3M83A 4I9UA 2C4VA 3HI4A 4ILEA 4LXIA 1ZSVA 1RI1A 2SICE 3KVNA 4G9BA 2H2WA 5CIQA 2NU8A 2B94A 2WKWA 3W8EA 2XQGA 4B6FA 4UUQA 5FF9A 4Y2XA 5M5BA 3IBFA 1QSGA 3Q4GA 4ZCLA 5TQ0A 2GPJA 1XHFA 4JWKA 4CF4A 1XN4A 3BREA 2JLCA 4OGWA 4K8RB 1A2BA 3ZGLA 1PZEA 2H2HA 3WOVA 3WKBA 1Q0PA 4B43A 4JUAA 1QHHA 2DSTA 2G67A 3IP7A 3VKHA 1HORA 5G0TA 3NTVA 2Q3DA 3OEEA 3G0DA 2H51A 2ZT7A 4G0XA 5ALUA 3SG0A 3NJRA 3QFTA 4NZZA 1ZKDA 3PEYA 4WZBA 3VVLA 4E5KA 2DKOA 3D6HA 2HREA 1FK8A 3I5AA 2DKFA 2IHVA 2ZBUA 4OK5A 1W581 1E1YA 3RC1A 1CJBA 3KJFA 4TOIA 3ZUPA 4DY6A 3LHSA 4O59O 3INYA 4NCIA 2H1WA 3SD7A 5FOWA 4TTAA 4HTAA 3IXQA 1GPUA 4L7QA 2B20A 2HHLA 2P2GA 1KYTA 4G8CA 1T3HA 2I62A 2PH3A 3WGJA 5BOSA 5EZ6B 4CV3A 4B6GA 4QVIA 1A50B 1PEAA 3L02A 5FOSA 3RRNA 1R16A 3ILYA 1SCNE 1ZRHA 4Q05A 3QLTA 4MVJF 1B3BA 3RANA 3VAAA 5AM1A 1QYDA 4G9EA 1Z5UA 3QVLA 3PITA 4FFVA 3L0IB 4FYIA 4BLVA 1KO8A 2CMKA 2Q6IA 2QRVA 2WZBA 2FSHA 3FAZA 1MKYA 4CIVA 4MOWA 5DTMA 4B31A 4QUJA 4C87A 3FBWA 1KAOA 2I7TA 1GR1A 4EJ6A 3CCCA 3FG9A 1GAQA 3BORA 3E7FA 3N0VA 3KZOA 2P5YA 1B3RA 1ISIA 4C7VA 4PSDA 3BTVA 3LOQA 2XJ9A 1GAWA 1UMDA 2FQYA 3NT4A 3VU3A 3WJ1A 4E5PA 1M2WA 4N7RA 4Z54A 1X1QA 1E2KA 1A72A 3HEBA 3SJBA 4MW2A 1XRLA 1KH3A 1MD9A 2FX3A 4AZ3A