2KLHA

Nmr structure of rcl in complex with gmp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
b'MRRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQALNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLVEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords c-Myc-responsive protein Rcl
molecule tags Hydrolase
source organism Rattus norvegicus
publication title Structural characterization of the mammalian deoxynucleotide N-hydrolase Rcl and its stabilizing interactions with two inhibitors
pubmed doi rcsb
total genus 35
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2klhA00
3O8NA 2IZ6A 2IZ5A 1PFKA 4JENA 1S2IA 4U1RA 3BQ9A 3HNOA 1T35A 3O8OA 4A3SA 3U39A 1F8YA 4MEJA 1ZXXA 4I7EA 4I36A 5AJTA 3O8OB 1WEHA 4I4IA 3SBXA 3OPYB 2F2TA 4KXNA 1F8XA 1WEKA 2HIGA 2NX2A 3F5MA 5ITSA 2KLHA 4JEMA 3IMKA 1YDHA 4LJRA 4JELA 4PFKA 4HX9A 3OPYA 6PFKA 4P5EA 4RH3A 5AJUA 2PFKA 3EHDA 1S2GA 2F64A 4FYHA 2A33A 3GH1A 3O8LA 4NPAA 2KHZA 4KXMA 4MCJA 3QUAA 4FYKA 3PFKA 4LJLA 4KXLA 1S2DA 2A0KA 1S2LA 4FYIA 4P5DA 1RCUA 3MAJA 2F67A 2PMBA 1KZHA 4WL0A 2F62A 2Q4DA 4OHBA 4OHRA 2F48A 4LJKA 3K2QA 1MTOA 2Q4OA 2IZ7A 1S3FA 3UQZA
chains in the Genus database with same CATH superfamily
2EFEB 2GB4A 5GV7A 3BFJA 3U60B 4LWPA 3WRXA 4HYQA 2BRUC 3ZD9A 2ZB8A 1DBIA 4JS0A 4YH1A 3DD5A 1XNJA 1UFKA 1PI3A 2NAFA 3DVLA 1SQFA 4YVFA 4B3FX 4ACBA 3QLJA 4NRDA 1PVOA 3ZHYA 3L02A 3AEXA 3BQMB 1MD9A 4U39A 1AB6A 2FE1A 4B40A 3SQWA 1ADBA 3ADKA 3TBFA 1BJKA 2E1PA 1QZUA 4ONEA 3FOWA 2M32A 1PT6A 2GCEA 3FPSA 4LXGA 1SU8A 3U2QA 2RGBA 3BMOA 2RDMA 1TNDA 2G09A 3BIOA 3IRVA 3QPCA 1Z82A 4R3NA 1CJMA 4OL0A 4XUDA 4EW2A 2G40A 5KNCH 2EIHA 2ORED 4PAWA 1DC4A 4KSCA 3SLGA 4PZDA 5JI3E 2BR4A 1NF8A 2W6QA 3G2PA 2HTEA 4IRXA 4KYUA 3EODA 3TMYA 2IUYA 4RF3A 4F5ZA 1U4NA 5K3BA 3RLIA 5HS6A 4RKWA 5HZGA 3HDTA 1FYFA 2VJOA 3NM5A 2YYZA 3FDZB 2Q7XA 1RHMA 3PC7A 4NBTA 5CCBA 3TH5A 1UBSB 2VDKB 2VK8A 1SWWA 1Q7GA 3EC7A 1UOQA 2AT1A 5DX1A 5F5LA 1AG9A 1P2TA 3H11B 1MG5A 1WXDA 5KZMB 4X5OA 3UH0A 4FGJA 1CIPA 4JYPA 4FZ3A 2P9EA 1AZLA 121PA 1H8HA 1RFLA 3LYHA 4W7HA 3H5WA 3L40A 2G67A 4HQRA 1NL3A 3G0GA 1IDN1 5HF8A 5K3DA 4F5WA 5HNKA 4IVQA 1KBQA 4FKMA 3ASYA 4N5DA 1DCKA 5MGNA 5EKUA 4ZARA 3SYKA 4A8JB 5J58A 4CTMA 1WZCA 3A6GA 1JYSA 3F78A 2QN7A 1HDIA 1QHYA 2PX8A 4D4HA 2V1XA 4FEGA 4B7AA 3V1UA 1UPAA 3CG0A 3I09A 4KE7A 5JWOA 3LL4A 3CF2A 4AWAA 1EUQA 1L4EA 2ZFUA 4AX4A 5FQOA 2JHAA 2R1VB 3AFOA 2C7QA 3QHQA 2N9UA 3UN1A 4IGIA 5HFAA 5GJWC 2YXLA 1G63A 4U7JA 4EQ6B 1EWRA 4GW3A 2JFFA 1PDOA 4BIMA 1JXOA 1XQXA 4ZYTA 5TXGA 4J1TC 3TQHA 2A9KA 4IRUB 3I12A 2YXEA 1QHFA 1D9XA 2CVHA 4OXXA 5HQ3A 1DDGA 1JLSA 1GKIA 1SKBA 1L4KA 1HM5A 1UXIA 1U7HA 3DLAA 3P32A 1K5GA 4J1TA 3RIYA 4AJOA 4DR5B 3GJ3A 1Q7CA 4URVR 3UOWA 4BNTA 3LTNC 1DQRA 6YASA 2G25A 3PZBA 4JV5B 1KDYA 1T5HX 2IZZA 1IHUA 3SMVA 2ZB3A 3NBQA 1NNEA 3E61A 4TKVA 3DLTA 5LD2B 2X1VA 1B76A 4OSOA 5EN4A 4BGDA 3ZJ5A 2WU3A 4F1KA 3F6SA 1IRIA 3NHPA 1N3LA 3DO6A 3MWDA 3DEIA 3GP8A 4FZVA 2E48A 2FP3A 1JPNA 4KP7A 3A6FA 3IQZA 1L9KA 1A8IA 3CKLA 2ZWMA 1Z47A 2B34A 2IP1A 2VHEA 3AFNA 1SVNA 4KNVA 2OZLA 3ICCA 4FFWA 1TM5E 1YFJA 1MTOA 3WBKA 2GCPA 3U13A 4DEVA 4DJDC 1H4VB 2ZI3A 5AW7A 5JQWA 3HY6A 4YRPA 5DX0A 5KINB 3GHYA 4DANA 4YDRA 3GGPA 4EA9A 3KYDB 2OQVA 3TCNA 1KQNA 1RM4A 2OENG 2PUVA 1JA1A 3CLHA 2VYND 3O31A 5CVDA 3FKSD 4YBZA 3N0RA 4I0WB 2Y4OA 3B7WA 4TSFA 4E14A 2Z2YA 5JWRA 1A4XA 3CUTA 5D1NA 4G4GA 3GLGB 1CUUA 2W2LA 1ML3A 1TVCA 3IEIA 3R7NA 4NEGA 1KYYA 2YC4C 4BJ1A 2Q62A 4D99A 1D1SA 4YCSA 5TF4A 3R2JA 4UBOA 3SZGA 3OOJA 4Q3CA 5DTMA 3UJNA 1IZ8A 1JKJA 1PWYE 1WE2A 2B5OA 2V0NA 2ZT8A 3CURA 5FQNA 5IEJA 1T9CA 1N4DA 5KJFA 5HFNA 1ZFNA 2R5NA 3GRUA 3IQWA 3OJCA 4MJXA 4HSGA 4K6GA 4ENQA 5GV8A 4W9NA 1KY4A 3GLKA 4LSGA 2JCXA 4HDKA 2Q3HA 1W8DA 4J7AA 1E2MA 1YDWA 2FGKA 5A9SB 2W58A 5IXYA 1H4TA 3NBUA 2PN1A 3CZ5A 4F46A 3WSTA 1YRBA 2VOEA 3C1AA 3O5AA 4HEJA 1PR0A 5KSYA 1HV8A 4HAZA 4H60A 4XGQA 4EH1A 1GHTA 1JG4A 2ZT5A 1J56A 1ILEA 4DAEA 2ORIA 2Z2XA 1VMIA 1PHPA 3HBJA 2QN6A 1QRTA 3K5HA 3T61A 4E5DA 1OH8A 4ZIRB 4XX1A 1PWEA 4HMPA 3PQ2A 2JGDA 4QBHA 4XOIA 1AK9A 3D4NA 4BATA 1U1IA 1R88A 4DMUB 1SUWA 2AJCA 1SVUA 2CJYA 2DPMA 2GK3A 1CP3A 1UZLA 3EXIA 3GGOA 3IO5A 5DYNA 5IF3A 4MYHA 4ZQEA 3AR4A 2IH5A 3S8EA 5JBIA 1W4CA 4N9WA 2WWRA 4P80A 5IC6A 4MDEA 1BSVA 4KGDA 4RANA 1L8LA 4I55F 4C20A 4Y2VA 4I9NA 1IJKA 1JL3A 2OBLA 5THXA 3A4YA 1RWVA 2AEEA 1EEHA 3PNSA 4R2KA 1PE0A 3RHFA 1V7ZA 1G1AA 4IAOA 3IOMA 2PU5A 2J85A 2O23A 4NFYA 2BDUA 3B2NA 3TIIA 1XTIA 4MRPA 1G0OA 1XD9A 3TZLA 1YR3A 1W85B 1NV9A 4H1WA 2XT9A 4TVBA 3HE3A 3VPSA 3RLFA 5KPJA 1KTIA 2WB2A 1EJ2A 4J1SA 1USVA 2W6ZA 3DFKA 3E5HA 1PSZA 4AT1A 4BO9A 2IUEA 4G5GA 4H08A 5T6BA 4RFSA 4EARA 2ZXUA 1XG5A 3GDWA 4Z8YA 5E4TA 1VL5A 3E8SA 4BP9A 1Y33E 2UYYA 1Z13A 2CFRA 1MB9A 3ICOA 3KJXA 3SZRA 1JR6A 5LNK1 2Z8XA 4Z2YA 1ZRSA 1U3TA 2EKZA 3KZKA 4H4CA 3NHMA 2PGAA 3KSUA 1MX3A 3PPVA 1WR8A 4HSEA 3SSMA 4DQDA 1RQNA 4P4LA 4FCVA 4TTAA 1MUUA 3Q2OA 3SE0A 3NBZC 2YMLA 3BL5A 3OEYA 4PO3X 4ZJYA 2Q5HA 3W4KA 2WHEA 4B3BA 1XV5A 3AUFA 3RUDA 1YB2A 3GC6A 1W34A 1S0UA 2OZLB 4AY2A 3FGOA 1KQOA 1SVLA 4PRKA 2NUAA 5K4HA 3OCXA 1U8XX 1XD2A 3KVRA 1NVMB 1RQPA 3D1VA 1K3FA 4JLJA 5AHKA 4WOBA 5ALVA 5KOIA 3D0QA 2ZIFA 4HOYA 4LVCA 3GIDA 3OIVA 4PYMA 4BMSA 2PG3A 1D2NA 3F4LA 1Q11A 1Z45A 1XJWA 3MRSA 3C8DA 2IZ5A 3R7LA 1HTWA 1NNSA 1W29A 4WZBB 3ZDXB 2AFIE 2EWWA 2DWUA 1YNOA 3OETA 4KQWA 4E2XA 3BHJA 1OZHA 4ZRMA 3IELA 2GN8A 2OG1A 2VYFA 3VR6D 3AJ8A 4G5SA 3VKGA 2I7CA 1QQ5A 1QGDA 3J81A 4GPD1 1GDHA 4EFDA 3JVVA 1M2KA 4FT2A 2O50A 5HGJA 3SZMA 2HF2A 1QTRA 3WRYC 2HMYB 4FTWA 4WPGA 2P2SA 2OFFA 1DZ3A 3SVZA 3AT1A 1PHRA 1PR1A 4KTTE 1NJ8A 4XYMA 1FJXA 2H1OA 1Q3HA 4ZI3A 5KQPA 2EEPA 1E5LA 4QJ3A 3A9WA 1KRXA 2O2EA 4JJ8A 4JOCA 3LWBA 2WB4A 4NONA 4P38A 4JJ6A 3O3NB 4E7PA 5I8PA 1EESA 3ZU4A 1P5JA 2UZ1A 1OH7A 4QOHA 1GRRA 5GADl 1DO8A 3GPLA 1LW6E 1Y4ZA 4HZUB 3RIXA 3VU9A 1G3QA 4E46A 4MUIA 5JCOC 3O4GA 3ZGYA 3GUZA 2IYAA 2CXTA 3ZHOA 2FKNA 1EFDN 1R0CA 1SUFA 2Q21A 2ZIXA 4FINA 4H6XA 3F67A 3CNLA 4GP6A 1W8IA 2EF1A 4TLEA 4M0DA 1VJCA 2BZGA 3E5MA 3EB9A 2WOJA 4JJIA 1BW9B 3BPSA 3S1AB 5JDIC 3RAFC 1LD3A 4A2PA 2VRNA 1ZUNA 3D1LA 3HU3A 1SKYB 4GMGA 3PF8A 4HX9A 4MS1B 4AMVA 4BBAA 4I1PA 3P2EA 4FMDB 2HK6A 4KCGA 4DW8A 2BGUA 4MW2A 4XR9A 4F3TA 4Z8XA 1AGYA 5ALDA 4B87A 3KG2A 2E85A 1QHGA 4FNOA 1PFGA 4RVFA 4CV3A 3K1AB 4NFHA 3UUFA 3FPJA 3KAJA 2G1KA 4EBFA 4DB4A 4K9QA 1ZIYA 1BYIA 1YVUA 2B7CA 4MWEA 5A4DA 2CY0A 3AVXA 4ZO7A 1GD1O 3P9PA 2PSSA 2HMWA 2EIXA 1QRDA 2Z9DA 1GJRA 1XAIA 4OM8A 4YT2A 4RA6B 5L53A 3BXEA 3GLVA 2ZLBA 2BGNA 2HRCA 2QTHA 4MJ3A 3OQIB 2IITA 1GZSA 3VR4H 3GJ5A 3GLGE 1EIWA 5JY6A 2K5UA 2RGGA 3RFCA 4MVWA 5G3ZA 1J0EA 1NVWQ 1PUJA 2OSVA 3PE4A 4BQRA 4CLHA 5I7FA 2FR1A 2PX5A 4DA7A 2Q27A 3WB0A 2QTFA 2YZKA 3PS9A 1YE5A 3NEYA 5JR3A 4LXHA 1H3NA 3CBQA 1ZK0A 2B4KA 4IYJA 3VPAA 5KNCD 1ZJZA 3ZYZA 5F73A 4EG3A 4QEKA 4LBYA 2YFHA 3EUWA 1MQ9A 2VWQA 3FCSB 3JQBC 3MJHA 1I80A 2ID8A 1GG8A 1ZU5A 3M6UA 4YEDA 4CM8B 2QE6A 3F6BX 5LZ8A 2CDRA 4KO4S 4GSKA 3HWWA 3WV5A 4F9TA 2ROQA 4KN9S 5DSZA 3WK6A 1TT5A 2VDWB 2X2FA 2G6TA 3ESAA 1GLNA 3VI3B 5C1OA 4OA8A 4NJMA 3DDUA 4ZGBA 5KQMA 4J16A 2Q9AA 4GKAA 3B48A 1QK4A 4X1IA 1TZCA 3T5BA 1BDHA 4IIFA 4RIGA 4TS4A 3F46A 2FOXA 3ROTA 2OP0A 5IM4F 1Q84A 4UPVA 3T5TA 2D2IA 3D2CA 2QVBA 4LZAA 3KQMA 3TUZC 1KA9H 2XBLA 2D62A 3GBPA 1UT6A 2DQ4A 2P7HA 3UCFA 4J7XA 3A9RA 4X97A 3W3ZB 3KOMA 1MKYA 1BEUB 1QOQB 3BIWA 3ETNA 3MOGA 3RCBA 3VJMA 3HA5A 1XZHA 4S2UA 5EIOA 3W8NA 2QXTA 2RGEA 3L06A 5AVUA 3Q41A 1Z38A 2DPYA 1X7YB 2W98A 3GUCA 4LUCA 4X8HA 1T0JB 5FBRB 2WOOA 4G4IA 3N0WA 4ZQCB 1V71A 3N2ZB 3WIEA 2JF0A 3C3AA 4RETA 2WVHA 3ZCQA 2CL6X 1BD3A 1WEHA 2QAIA 3FTDA 3QU7A 4MINA 4MUAA 3RI3A 3FRIA 1FFCA 1KYQA 1NVTA 3V4RA 1NXOA 5WRFA 3LGSA 1HWYA 1YACA 3R7WA 3BGOS 3INGA 2VK4A 2ST1A 3SIXA 5AKLA 5AW1A 3RPEA 3DNFA 5LXTF 1N7JA 4UM9B 3HZRA 4ZCMA 4JP1A 3OJOA 2X42A 4B8YA 1E62A 4P3YA 2R7MA 2XB9A 4W63A 2O8BB 3IAFA 3GV0A 3GT3A 1AX9A 1L5HB 2D1YA 5IBQA 5LDDC 3PUXA 1GSIA 1G8MA 1F8UA 1NU6A 2QF7A 4FYXA 3HXQA 1L5QA 1TAHA 2Q6TA 3BREA 2HO5A 4M3NA 1Z5GA 2YY5A 4C04A 3SF8A 4BEVA 1FFHA 2EX1A 2Z6VA 3WJ2A 1JIKA 1YUMA 3PITA 1GNVA 1HE2A 2GMWA 3SHQA 3ZZTA 5KOHB 3EZ9A 1Z2EA 9LDTA 4LG1A 3ER9A 3DEKA 3BCSA 3U1BA 4MLCA 2HQSA 1ZD2P 1TQDA 5IEBA 2MSKA 2W70A 1U04A 4BFCA 3LT5A 4WKNA 1JEJA 4JYMA 1WXXA 2WIAA 1JHZA 4N6NA 1O3YA 4FCTA 2RHCA 1AUVA 3CCBA 4IV8A 4U7FA 3EVFA 4IZHA 3SJUA 2QOEA 1G8AA 2XA9A 5T41A 4BUJA 4C7MA 4GKBA 4B2IA 3NVKI 2DMRA 3L07A 4ZXPA 2IY8A 4NZPA 1O7JA 2CYAA 2FPPB 3NCTA 3EFOA 1S2DA 4NAUA 3WK5A 3C5WP 3RTAA 1ZVKA 3GPDG 3W5CA 3AHIA 5DIZA 4B6EA 1DCTA 2PZLA 4FYYA 3EEYA 4BB9A 4X44A 3IEVA 2NAPA 5EZYF 3VOTA 3T1HB 5A02A 4WXYB 4ZTUB 2KS6A 2KPOA 3BWVA 2FEPA 3S99A 5EXEA 5EPEA 3I04A 3LKBA 2XIQA 1WCV1 1J0CA 1QRAA 2VBIA 4EVIA 3GZNA 1E1MA 1GUAA 3QJ5A 4XGKA 1D4FA 5H0IA 2ZU0C 1VDZA 3A3OA 3DF7A 1RAGA 3I8SA 3BMCA 3NHAA 3ND8A 3OE5A 2G82A 4CLOB 1B42A 3MCTA 4BZPA 1ORIA 3BB3A 1D6SA 3K15A 3KSMA 3UMYA 2BH2A 1FE8A 4KYIB 1II8B 1U9IA 4WNCA 3MEQA 3CUUA 3GRCA 1GUZA 4BVHA 1H2YA 3TRJA 1XSEA 4JZKA 2FRDC 4GDMA 3ZIUA 5ITWA 3NWJA 3C6BA 3NKFA 4NBSA 1QH8B 1U9IC 3M81A 3ZJVA 4Q66C 4CCYB 3AW8A 3QE2A 1OZFA 3D81A 3OI7A 1PGPA 2OCXA 1A4UA 3OLQA 3W2TA 1ZITA 2Q0SA 3UTCA 3DLIA 1EBFA 2WUDA 3J7AC 4DV7B 1Z34A 2EXXA 5CHEA 1FS4A 1MA3A 1YT5A 2Z3ZA 1X2EA 3PEFA 3M70A 3QVSA 3VKWA 3VO1A 5L45A 2HIHA 3T41A 4BFSA 3QY0A 5HW0A 4ESOA 2HLHA 4D4MA 2OORC 4BKOA 3O8CA 2JLSA 3IOYA 2G28A 2Q3CA 3GAMA 4IQFA 1E1RA 2Y05A 3PDWA 2QTRA 4WA7A 3NBKA 4PIVA 3ZDFA 2QRUA 3PHJA 2OFWA 5CK4A 4LYAA 4BJ5A 1N2GA 2AXPA 1PK9A 3IR7A 3V4LA 1UIMA 1NR7A 1RPAA 3ONNA 4LJ7A 5EL0A 4LF7B 1BS2A 5FPTA 5HQJA 3SU8A 2EGUA 4YMGA 3LFUA 2C77A 2ZJ4A 1XRJA 3PTAA 1ZNXA 3H19A 1X14A 5DMXA 2B4RO 3W2GA 1JSCA 1Y3FE 3ACCA 1JHUA 2HQ1A 1EM8A 1SD2A 2XOXA 3IV9A 3QXGA 1U8FO 3G02A 3V8VA 3WL6A 4MVJD 1ZISA 1BQEA 3FUWA 4GE0A 1F8XA 4N8SA 4BTVA 3FFWA 3B1ZA 3N5KA 5JAUA 4E0BA 1R6DA 4J4TA 1KARA 5F9MA 4FYPA 4AG5A 1SELA 2BMVA 1Q0ZA 1VLZA 5FO1A 3K71B 1JE1A 1WLSA 3CF0A 1V95A 1HG1A 4OSEA 4TZ0A 3AF0A 1J00A 1HNXB 4OMDA 3SJ7A 2O8DA 4J0CA 2A0FA 1ZK2A 3E3MA 2BF7A 3MTEA 1Z5NA 3HCEA 5D5HA 1FFEA 4JBGA 4PXYA 5HJEA 3LOUA 4GI5A 2DR2A 1XDSA 3RU7A 4M86A 1KEVA 2HFJA 4UE6A 2ZRMA 4W5HA 1E6CA 3DLCA 3KDPA 4NX2A 4EL0A 2UZIR 1M0TA 1USKA 5A1TA 3MN1A 4Z0NA 5F51A 1EWYA 1ECBA 1M1NA 4ZCQA 5AYVA 2HWWA 4MKZA 2AKEA 2EKQA 1B3BA 5EHIA 5HJ5A 1HDOA 1B26A 2ZCJA 2VH5R 5B64A 1U28C 3GY0A 2XDAA 2XR1A 2JZOA 1WMBA 4W8OA 3SLKA 3D7MA 4DLUA 1UDCA 3MSXA 2QUZA 4I6EA 4U2GA 5AW8A 3RVOA 3TPFA 1Z88A 3WMRA 2IXGA 2JJYA 4CQMA 3CVYA 3HYSA 5BR4A 4JB8A 5DM60 1HOXA 2ZTHA 1SHKA 2PKQO 3GEBA 3NYQA 4QEZA 3AH8A 3MSCA 4AP9A 4POOA 1TEHA 3B9QA 5JCOA 3E4CA 2BPOA 3O92A 5KX5F 2QN1A 2QGNA 4BFZA 2O8FA 2FWBA 5GWXA 3R8XA 1EM6A 3TGWA 1VG1A 5K0GA 5FEUA 5DGHA 2VJDA 3OFKA 5HCUA 3PNPA 5HKOA 2C59A 4L02A 4MQ6A 1PSWA 1Y8RA 2B20A 4F06A 3Q3CA 1W44A 5JYCA 4PZEA 1EVIA 1LLCA 3BORA 5G0UA 4D8XA 4D9BA 4TV9F 5AD1A 1WXEA 2YJ3A 3B7GA 5KNDH 5EIAA 2LGJA 2V9ZA 2PPLA 1QC5B 4FE7A 3LO5A 4Z4CA 3TAUA 4MGZR 1ZN2A 5KYGA 1QQTA 4KVAA 3CPSA 3H9QA 3SHOA 1LDGA 1WXGA 1WD5A 3CHYA 1DCFA 3MFYA 5AHRA 5AW3A 2I22A 4CM4B 4ICIA 5AM3A 1AQUA 2CMDA 2YJNA 3I5AA 5CLHA 1JLLB 2B7LA 2XRMA 3BWBA 4V0SA 4NDZA 1R0WA 1QPGA 4JMLA 3DEFA 4M1EA 2VDLB 3BE5A 1JH8A 4I5FA 2QK4A 4R31A 4ZIRA 4H7DA 2VUIB 3ZLTA 2ZJBA 2W6JA 3FVWA 4AZ0B 2ZM5A 1RXEA 5DK6A 4JUFA 5B55A 5ILQA 4KZPA 2FJPA 3H5OA 1QIHA 1IY0A 3RUHA 4I19A 3SDSA 4PGFA 1LLQA 4XEHA 3ZDCA 1OZGA 1TJYA 3K3PA 2QXUA 4R7GA 4C2TA 1CRQA 1AXEA 2JCVA 4F2DA 2FLKA 4BXOA 4XE5A 1ZHOA 2PD4A 1JQEA 3Q2KA 4O5AA 3OMLA 3FZEA 3RRBA 1S8FA 3P2IA 3AM4A 4BX2A 4E12A 4EKIA 1N8KA 3B1VA 1Q16A 4P35A 4P4SB 4M0EA 4YMHA 1JAXA 3COJA 2JJ8A 3EBLA 1UM9A 4L1KA 2F8MA 2F1IA 1TVEA 1WDKA 1AOXA 5G41A 1W19A 1NQXA 4NNJA 4ZP1A 3VBEA 3WHKA 1NFFA 1NX6A 2GR9A 2CBGA 4YECA 3VR0A 2JIZA 4D9KA 1R6XA 2R6FA 5JJLA 4OYRA 1WV1A 4F5YA 4ZTZB 5TPZA 1RXWA 1E1DA 1LZLA 1N5MA 3O1IC 1TX4B 4W6ZA 3QMMA 3R20A 1US8B 4EFKA 1H0KA 3G49A 4YJFB 1GU7A 4TTSA 4NBUA 1MRZA 5A71A 1KI2A 4LE0A 1Z17A 3HN6A 4TROA 1RYHA 3LFTA 1OXKB 4YRBA 2WJWA 1SBTA 3DB2A 5E6RB 3V7WA 1UBMS 4B45A 2PFGA 1WW2A 3BE4A 2WUGA 1U3GA 1XFDA 1J0AA 2B61A 2HU5A 2GVNA 3ER6A 4KE9A 4PYQA 4KU4A 3V80A 4GL2A 5JCJA 3GF4A 3L92A 2GDJA 3TB6A 2JPDA 5ARCA 2EV9A 3PLNA 2ZT7A 4WN3A 3KVOA 1Z7GA 3W6PA 2IH4A 1XD8A 2JFZA 2ZTVA 4BN0A 3KUXA 2SCUB 4Q7QA 4X41A 4EPTA 3AEUB 3QX8A 3LL7A 3ZNQA 2A2ZA 1BVHA 1EUZA 1EFPB 2QB5A 4BVFA 4CM1A 2GFQA 1PZEA 4K5QA 4ZEOA 1T4CB 4DC9A 1UDRA 1DAKA 1XPJA 1D03A 4HDSB 4L85A 4LMRA 3IQDB 5IHPA 1JUDA 4FE3A 2JRLA 3F6PA 5AM0A 1XWIA 4GAEA 2PJZA 2R6GA 3G13A 3LTEA 1UQUA 3AV0B 1ZBQA 3FPEA 4YIKA 5DNUA 3VVBA 3GFTA 4IKOA 1VBFA 4MV8A 2DUNA 3VUEA 1I2ZA 4KO3S 2WABA 1NQTA 1ZYUA 3ENWA 1ZIPA 3EUFA 4FFVA 2HEGA 3VZDA 1EVLA 5C1DA 1J9ZA 3C3DA 2XWJI 3LUKA 4G09A 3TD2A 1LSUA 3B6EA 2WV9A 1JQLB 3WLRA 3BIFA 1KOGA 1BKDR 4JI0B 1I01A 4D0RA 1V7PC 3ONWA 2Y1LA 1IWPB 3QRWA 3UAGA 3HNRA 2OK8A 1VBNA 3GNLA 1CR1A 1NRWA 4KG7A 1GPUA 4PVDA 3SC6A 4QOJA 4A5SA 4HUTA 2BE7A 1U8AA 5TRTA 3A3KA 4EELA 1ADGA 1RYMA 2HSEA 5FP0A 4PPYA 4UULA 2FPGA 2IU3A 3G8CA 2GI4A 3O47A 4G5XA 1XQVA 2PGOA 5IN5A 2LCQA 4CT4B 5LDHA 2OBXA 3WLFA 3GPIA 4ENPA 4IDOA 1WPRA 3ZWOA 1UKBA 3A2KA 4BO7A 1RAEA 3HTXA 1W4LA 2P9JA 3LRXA 4CIAA 1YDMA 1FNBA 1PJLA 1OREA 2FPLA 3DHVA 3KLPX 4DPLA 721PA 5ARDA 4I8XA 2BGTA 4X60A 4Y2RA 5EE1A 4O0LA 2YJ6A 2UZAA 3PUHA 2CE7A 4KQHA 1BCRB 2C2XA 1W49A 4FIZA 4Q3LA 3OQHA 1H6BA 1DC8A 4Q12A 6ABPA 2UZ3A 2WHPA 3OTHA 4GKVA 3PRJA 4OHOA 2J59A 1DRJA 1IEVA 3M9WA 4IH4A 5BOSB 5FFNA 1JDTA 1ECJA 1F20A 1QYDA 1UT5A 1TT7A 1ZO8A 2HJSA 2IYEA 1X8KA 3D2LA 3F9RA 3KFXA 2R4UA 4LWOA 4URFA 3STUA 3DDHA 1G3RA 1HXHA 2HNBA 1YBAA 2IL1A 1M10A 1R74A 1Q1BA 2OO5C 3GA5A 3R3JA 4NWIA 5H83A 3LCUA 3LLVA 4K81B 2C96A 4ZAVA 4QLOA 2DCMA 1I3MA 1GV0A 2Y1FA 3T9CA 4UEJA 1EKXA 1E9EA 3MF4A 4B09A 1U80A 3IMKA 3TOXA 2C7OA 3OECA 3D3KA 2JLUA 1TYAE 5CPFA 3TK1A 5KTMA 1C0IA 1FMLA 4K1LA 3D64A 1CNFA 2YZ2A 2H06A 2CUNA 3HL0A 1QR2A 1ENZA 4JK3A 3OEHD 3WZLA 3EQ9A 2OSBA 3OFND 1T5TA 1M2OA 1HPLA 4E5MA 2ZXEA 2ZUUA 4NG5A 4YMSA 1E4VA 2R68A 1IK4A 3M1IA 4Q16A 1KS9A 4K8OA 2PRJA 3SOPA 4E1AA 4EKYA 5ADHA 4CDNA 1VIMA 2HV8A 2WA2A 3KE8A 4MWGA 3BD8A 4XW2A 3SXPA 3VH4A 3FBGA 3A14A 1FJGB 4EF5A 2OD2A 5AICA 1VL1A 2F1JA 5JNTA 1GNQA 2FOLA 4OMCA 2HT1A 2VTEA 4G8JA 5CLLA 4WLOA 2UU9B 2GUGA 4YXWD 5L3RA 2SECE 2A9PA 4P5DA 1XKLA 1SCKA 2KM1A 3SC2A 1R6UA 1RWNA 1J1UA 2FWRA 3FBTA 4K40A 4LOIA 2GESA 4UU8A 5EYPB 5T8KC 4DBLE 4H1HA 2AW5A 1LZKA 4DV4B 2WHYA 2ZKIA 4TVKA 3R74A 2IRWA 1ZXBA 1ONBA 2HDWA 1DOHA 1GFWA 3OZAA 5U9CA 4N5IX 2VBCA 1ZKMA 1E2QA 2Z8ZA 4HEA1 3E4DA 1ZESA 4GM1A 2OGTA 2QMOA 4K87A 2LXNA 5BQFA 3AKZA 1ODTC 1Y8QB 2J9XB 1H42A 2I66A 4TKUA 5A0VA 3OE4A 2QSZA 1YZHA 5T6MA 3X2FA 4CGZA 5L7YA 2E5LB 2CLSA 4R9SA 4B31A 1FFXA 3RVQA 1YJCA 1MJFA 3WIUA 1PJRA 2BTQA 5F21A 2X0EA 5KSOA 3GCGA 1FTQA 2NNWB 2VDJA 5CNKA 3RJ5A 1QX3A 1KK0A 4AY5A 5EJ5A 2VO1A 5I7AA 4QDUA 1V16B 1KZ7B 3RT1A 1MC1A 4XUCA 2H00A 3HNOA 3Q5GA 4DBZA 5GTDA 2AFIB 1SUCA 4JJZA 1R4NB 4YUXA 4DWOA 4ZKDA 3ZW7A 3FW1A 3VR1A 3I6IA 4J07A 4CPDA 2JHCA 1CQJB 1C0PA 2AYXA 2BH9A 3H3JA 4HRAA 3RSLA 1QU2A 2GZ3A 4L74A 1CY0A 1RWWA 4LIPD 4Q9IA 2BHSA 3OCJA 4R6WA 4QJIA 1RNLA 1KKLA 1FNDA 1JSRA 2EBHX 4H0FA 3X1DA 3H1BA 1Y5RA 4BLRA 1D8TA 1LLFA 1H5NA 3PDCA 2BAGA 5REQA 2IUUA 1F6DA 2GYUA 5B1SA 1H2EA 4QXRA 1IZ9A 4LHYA 4YCMA 2J5QA 2BKEA 4CL0A 4O2AA 1YZFA 3N9IA 4AJKA 4XYLA 4R41A 3JQ8B 1UDBA 1V96A 3NH9A 4LZZA 4XX0A 5J43A 4DFDA 2D2FA 1U2SA 1GOTA 1P4JA 1W4AA 1WHTB 3C7KA 3F5MA 3HQ4O 3TNFA 3VNBA 4AD8A 5MF6A 2E55A 2X5KO 2YINC 1NVEA 3ND5A 4GZ5A 2VDMB 4TTTS 5LIPA 1QK5A 2EKBA 1KQ3A 1PRYA 4FUQA 3KB2A 3F9CA 3FTEA 2X1LA 1Q0RA 2RH8A 1RABA 4RM2A 4M1OA 4FLMA 1NXSA 3KJIA 7REQB 4JROA 3PGVA 1RU3A 5IKEA 1S7CA 3W4IA 2I4OA 2YMMA 2GBIA 5CT6A 2QTVB 3GT0A 4E4RA 1MNAA 2W6PA 3B1XA 3UWDA 1E0AA 1UWLA 2AG1A 2X4IA 2H48A 3EHDA 5CW1A 4B8ZA 2YIDA 1TL7C 1V7QA 4NHEA 4B47A 3ZXUB 3C6XA 3BA1A 4JBHA 1HOTA 4KLNA 5FBHA 1XTVA 2NXEA 2O3UA 1D5CA 2PS9A 5EZ6B 3AP1A 3QHPA 3TSCA 5IPFA 4K9NA 3E9YA 1BNCA 3EZGA 4X91A 3L77A 1NYRA 3ADOA 3EF0A 3GAFA 4DTIA 1XIVA 3E22A 4U9UA 2B99A 4MCHA 2B82A 4R0VA 3BDVA 3FBWA 5JRJA 3CC8A 2VJMA 3KAQA 3LXRA 5K2OA 4QDTA 4IJMA 1BO6A 4HZIA 3D8TA 3MUOA 4YRZA 4R8MA 4C88A 2QA5A 2WYHA 4GSLA 3RYHB 1ZVVA 1FQJA 2OILA 1LVHA 1YWGO 4ISBA 5K3SA 2K7ZA 2FDCA 1TQ4A 3EH2A 3VYTB 1K6EA 1HLFA 2B3TA 3ZR4B 1E6EA 2PL1A 4NYIQ 1LVUA 1OLXA 4ZODA 4ZT7A 2YHIA 2PT6A 3LPLA 4JC8A 4L3OA 4YIHA 1H2HA 3WA7A 3AJDA 3A27A 3EIEA 4N03A 2Z5GA 4RKQA 1GTRA 2I2FA 3IV6A 3NC4A 4URYR 5CJPA 4A03A 3HJNA 4G24A 3WMEA 1K7XB 5FPHA 2ZZMA 1SOAA 2OESA 5F76A 1MJGA 2WUEA 5KOYA 1HLGA 2A94A 3C70A 4BL5A 1G8YA 3DHEA 3QK7A 4P86A 4YCAA 5A6SB 5CBPA 5KX5A 2VTBB 3HCWA 2G17A 3NDRA 1YTUA 4LFCB 4COOA 3IT2A 5JV5A 4PSKA 1ISHA 1XEFA 1RBMA 2GILA 1UP6A 2QAGC 3OZ7A 1DPFA 2DGDA 5TS3A 3LDUA 2UXDB 1V2HE 3H75A 1G98A 4MUJA 3EZXA 4REOA 3T52A 1GLVA 1D6NA 3RFVA 1JE0A 1NF3A 3FMFA 3RJ9A 3WDKA 1ZH6A 4BWVA 5GZ1A 4YJKA 3QX3A 1O9HA 1NXPA 5EFOA 1GRNA 3CNEA 1OFHA 2DPGA 2YH2A 3NWOA 1IWOA 4OKSA 4QTXA 4YUZA 1AA6A 3EEFA 2V8OA 3RSQA 1MB4A 2OK7A 3IESA 4B7UA 1FPQA 2VN8A 4EHIA 4E2WA 4IOKA 2PVSA 1XEWY 4G1FA 4DXDA 4WXHA 3THXB 3HG7A 2WJ4A 1AVTA 3T7CA 4CF7A 2XQKA 1QGOA 3O8OB 3LBYA 4X6LA 3DO8A 3RK0A 3PJDA 1D09A 3WMWA 4B9EA 4ZYYA 1P1KA 5C32A 4N3NA 5KWJA 3KLOA 3MS4A 3ILHA 4O4HF 1T13A 2GBPA 5CIYA 1OA0A 3WGYA 2EJTA 4A2QA 2VA8A 4C1NA 3PQ4A 4E88A 5IT4A 1G18A 1SXJD 3LMKA 1T5SA 1GARA 3QXXA 4Q4JB 3O4FA 5FIUA 4A4DA 1R9JA 3H1FA 1HT2E 2IEBA 4BVAA 3DPUA 2Y68A 3FI0A 5EKSA 3GGGA 4JELA 1U8ZA 2AE2A 3HKDA 3ZNPA 3ITKA 3I9MA 3HR7A 4EO9A 3CO5A 2X9LA 1J24A 3EZ2A 3H84A 3DLHA 3TVTA 1ZNWA 3MD0A 1YFKA 4CHGA 4BV2A 4F2PA 2P3QA 1VHDA 2GLUA 3LQKA 2X0DA 1OWLA 2BP7B 2CWWA 1QHHA 1RHQA 2J1LA 1S2GA 1B8PA 4FONA 1QZ3A 3VJLA 5JMOA 2C3OA 3SYMA 4IDNA 4EQZA 4OREX 4BMXA 4PO8A 1YJBA 4MLZA 5HIMA 2PUGA 3QWIA 1WXQA 1OPXA 4KI0A 4C5CA 1T3HA 4Z4FA 3QH4A 4YLEA 1KJIA 1TMOA 3B5JA 3KKOA 1H65A 1WCIB 3F6YA 2JH9A 3P9CA 4IUDS 4Y3UA 3RUEA 2CSXA 4OQZA 1NXWA 1ORWA 1Q74A 4UJ3A 5COAA 5EPOA 1SCNE 4MGKR 4BDSA 4DLKA 1VE3A 2QZZA 3ABSB 4G0ZA 3VZPA 1YS2X 3EGDB 1G60A 4XGIA 2F67A 3QENA 1PQPA 3LPMA 4OHCA 1XZCA 2PNJA 4M6WA 2A9JA 3M6VA 5I7EA 2A14A 1XMIA 2ORWA 5AK4A 3SWWA 3P9KA 1B3RA 1OCEA 3IAM1 4XJXA 5D84A 2IHNA 5F5XA 5ERXA 2ES4A 4INPA 4DCJA 3HVUA 2CLLB 3QEMB 4MGHA 5H1YA 5AKZA 5FA8A 3TM4A 4C0KA 4CMAA 4D3DA 5AM2A 2CXNA 1E2GA 3LOPA 4J0JA 2NVBA 1QH9A 3FGNA 4JLPA 2GRUA 1FZTA 3VJRA 3WY9A 3ZJYA 2QD3A 2XCLA 5FWNA 3KJHA 2PX2A 3L0IB 3N5CA 2P8JA 2BDEA 4EY8A 2V98A 3AB7A 4RESA 1EFVB 3VAAA 3KCQA 1KDRA 2GBGA 4YJ2A 5A1JA 5HF6A 3DM5A 2Z1DA 2C57A 4XXHA 5IX8A 1M0EA 1Z63A 2OCPA 2OVFA 3IPRA 3IP5A 1KP2A 2NU9A 1Q0HA 2W2OA 3P9NA 3RGWS 1BXZA 2G9VA 3CLSD 3OURA 5KMGA 2IYQA 2QM8A 1NC1A 3PXCX 4M4SA 3KETA 4CLRB 1QS0B 4MGEA 1H3EA 3FA2A 2R5FA 1IMJA 1T4DA 3S28A 1AO3A 1I3KA 4FKZA 4KQ1A 5J63A 1GZ6A 2VBGA 2Y0DA 2YFYA 4LV8B 2WJJA 4R1TA 4TZTA 3WGHA 2C2HA 3Q7PA 4FMCB 1QIDA 5FL7A 4BB6A 3GLIB 2NO0A 2ZYRA 3KD3A 4MR9A 1F7UA 2GKGA 1H05A 4DDKA 3EX7C 4BS9A 3ZDEA 2C31A 4E2YA 3LZ6A 2CF6A 5P8WA 4BZWA 1U8CB 2I0FA 3DF9A 4QYMA 1EP3B 3B1FA 4F6LA 1GPJA 3QSYA 1QTQA 1W2WB 3RC9A 3LUPA 3UG6A 3U56A 4EMTA 1IHPA 1RWQA 1T3ZA 2VRCD 5AIAA 1OKKD 1FDVA 5I01A 4M1MA 3RFXA 3Q6MA 5LP6C 2QY9A 1DQNA 1ZH0A 3RADC 1KC1A 1I2CA 1PZFA 3D2AA 4KAJA 1JHAA 2Q41A 4KAFA 3Q7IA 4ENUA 1Q57A 1HYHA 1IJBA 3AKEA 2FEKA 3LCJA 4MPJA 4B4VA 4URXR 3QFFA 4TN1A 2VSFA 1G20A 1KIAA 4ARIA 3AR8A 1C1XB 4XASA 3ZN2A 4RX1A 3EVNA 1IN7A 2IA5A 2QENA 3HY3A 1WNFA 1E3EA 1Z74A 5IC4A 2QDXA 1W7AA 3M6FA 5BPHA 3R1IA 2EARA 4KC0A 4L9WA 4Z9YA 2EVWX 3EDQA 4X20B 1CUBA 4HLUC 2P0EA 2WKWA 4Q1FA 3R7DA 3GLIA 4P83A 4EG1A 1HLDA 3I9FA 4HQ6A 1JZSA 4P4NA 1QIIA 4R3UC 1DEXA 1USUA 3IVMA 5AI8A 2CV1A 1CRWG 3ER8A 4X8LA 4HVAA 5E6SA 1YOVA 4C01A 4DLBA 2NSLA 3DEJA 4NU8X 1CTQA 1IBRA 1SBHA 2RFLA 4FK8A 2AXQA 3AKYA 4TTPA 5ESRA 3EUAA 3L3BA 2UKDA 3LJKA 3C8MA 5DRYA 4FYIA 1LB1B 4N5NA 2ZAOA 3ROXA 5L6MB 2JBAA 1T26A 2RIPA 1X7XB 3VR3D 1V5FA 3D9QX 4RK0A 3COPA 1O2DA 3DBHA 2E2WA 4LYFA 4MWBA 4OV6B 5IBPA 4NCHA 3RVRA 4BFLA 5CVJA 2R00C 4H77A 3HO8A 4J1QA 2NM0A 5JH7B 4G56A 2VBFA 3WFJA 3AF4A 1L1EA 4L4XA 2XUAA 5E4YA 1V4VA 3K32A 4EW1A 5K05A 1MU0A 3DE0X 3QNMA 4N5HX 1PJBA 3LUCA 4IV0A 5K2MA 4KR2A 1A9ZA 1QJCA 4HEQA 1XZNA 4KVGA 2QTGA 4XB2A 1QBKC 4R2XA 2NVOA 3OSZA 4P33A 1DHRA 2PUHA 1AS0A 2RHRA 3UOAB 4BFWA 3DFMA 1L5SA 5AI0A 4GX0A 3V4PB 3VOAA 1QHSA 5H70A 1KEPA 3E7PA 4FC7A 4INAA 1CLEA 1XXLA 2IYFA 3WLMA 1A71A 2F1RA 3JQBA 3HWSA 1N4AA 3UIEA 1MJGM 3KSBC 2XVZA 1V1MB 2HHLA 3BXOA 1QNLA 4K3VA 3PX2A 4FDVA 3SHWA 5K8TA 1BDIA 2Z4TA 3ICPA 3IPYA 3ZDDA 2WD8A 1YQUA 3HV0A 3K8ZA 3P4UA 2L2QA 5E1MA 4TSKA 5KYWA 1PNRA 4HDNA 4TYWA 2A58A 3TIGA 4KK3A 1KJYA 1Z6AA 1Z6TA 3THXA 1H4SA 1YB7A 2KYRA 2Z4SA 1XRSB 3AHFA 4DF3A 3FHTA 2G7ZA 4B85A 4DSZA 1MC5A 1L4MA 1TC2A 1K7EB 1Y37A 1RQXA 3G9UA 3EQ7A 4NE7A 4ZVSA 3T7IA 1SXJB 1HEYA 1ZLXA 4F6RA 1RXSA 3K09C 3ETLA 3CUKA 1A9TA 4MUGA 4RUKA 5DHAA 5EY5B 1FF9A 4DE5A 1K08A 3A9VA 5JBQA 1IN1A 2GZSA 2HLPA 4HTFA 1HMPA 1II0A 4LWQA 1G64A 4NF2A 2X86A 3VPHA 1RWBA 2HDOA 2BUAA 4FS3A 4AZ3A 1KMHA 4R83A 3VPCA 2FVXA 5AKJA 2R8PA 1K27A 1DAPA 3HHPA 5C8YA 1VB3A 1NSTA 4JUAA 1RTTA 2QLBA 1OWOA 3K4PA 4G3XA 1X1RA 4RENA 4YQZA 5BSRA 3SBOA 1FTYA 2HXSA 3EG9B 2I33A 1RWMA 2VAVA 3IH5A 4NJOA 2O0JA 1JRLA 2AL7A 1CHDA 2GEKA 2ZBQA 1H0HA 3CPHA 4OHUA 5CGQB 4ZZ0A 5HSGA 5KNDA 1W47A 3PHIA 3RSZA 4HGRA 3HUTA 1NLMA 1OOEA 3T7JA 5LUAA 2QL6A 2JCGA 3I4FA 4HF7A 4OMUA 3O8RA 1LC3A 2D0PB 2Y0CA 3C7DB 4G0QA 3L4BC 4TT3A 3GFQA 4KPFC 2QLNA 3LZCA 5LJLA 2WSSD 1GN8A 5ALKA 3EQ6A 4NE2A 2OP1A 3DOJA 4PXSA 3O1LA 2AKYA 4B3JA 1L7RA 4H0CA 4JQYA 1XROA 3HL4A 4C0QC 4DQLA 1VRWA 5FA6A 2OOSA 4ZC8A 3AETB 5BN1A 5LP6B 3B13B 2GKOA 1B0AA 1RMTA 3W9UA 5LYJF 3ZKWA 3SYRA 4UVGA 3WP1B 4R2LA 2X5OA 3ABZA 3AUUA 2O8CB 4MVCA 4N54A 4YAJA 2GHRA 5A05A 5EHZA 1W35A 3K72B 5AW4A 1XZPA 5DTIA 2FJ0A 2O8VA 2OEPA 3FETA 3OZIA 4HVTA 2NSHA 3R3YA 2YHBA 2C00A 3OHPA 3HUFA 1G3UA 1GTVA 1VYTA 1W5FA 1Z8HA 2OCBA 3WKBA 4K28A 4MI9A 1NNUA 1NTOA 1XTRA 2R25B 3LCMA 3E9QA 1KAOA 2OGUA 3LUBA 1L5YA 1KJQA 1VL6A 3LV8A 4MVJP 5CH8A 1C1YA 1V47A 4HNAA 5IH3A 4BWGA 1PWHA 2JANA 5JALA 4DUGA 2ZB7A 4G6ZA 3B1JA 3TI7A 2W0MA 3ZU3A 1LS1A 1KJ8A 1Q17A 4Y98A 1ZD4A 4BV3A 3FN4A 4RMJA 2GGSA 3KJEA 1Z2AA 1KMCA 4KAAA 3A10A 1DWOA 3HFSA 3JZDA 5I7UA 3WTCA 5FPSA 2EP8A 1CJCA 3AR9A 2E4YA 2ID4A 4HGPA 4BMYA 4QUBA 1BFKA 3FDIA 2PMDA 3NOXA 2IV2X 4F3KA 3AUSA 3FPFA 1N9GB 2VNSA 2XQIA 5ECWA 4MPTA 2QUAA 2L18A 4AKTA 4LZJA 1WHSB 4GIBA 1KC3A 3ULKA 4A15A 2UVPA 2GAJA 1BDMA 3F6CA 4Y67A 3THOA 3TLCA 3NQ41 4ZVQA 3ZW8A 1KPIA 1XCBA 3FSGD 5FAXA 3KWFA 5JPCA 2O59A 1RAHA 2WSIA 3QW4B 3VR4A 3WHLA 1ZG3A 1AUOA 2HAEA 5AO9A 3VA7A 2QL7A 1ZS9A 4OBEA 2JEOA 2XMCA 4OK5A 5UKDA 1BGVA 3E7WA 1T8TA 3HMKA 3WMXA 1TVKA 5D5QA 1W36C 3KQHA 2FW9A 4Y9SA 1PQUA 1QZXA 3TF5A 3A70A 1BZYA 4YV0A 2GTIA 4PTYA 3IQEA 3KTFA 3BL6A 2B83A 2OV6A 2FSUA 1EWQA 1B8UA 2QJFA 1VRVA 2OC4A 3IVXA 1TQ6A 4PLFA 4LJAA 3B9BA 4MW6A 4F4CA 4OATA 1KVRA 2NP6A 1N5KA 2RHGB 1NI4A 4M8SA 4CW7A 1DC5A 1TZJA 3V9PA 4CR7A 4QOIA 3KZNA 3WYNA 1JDPA 1KEEB 5CX1A 4CM5A 3S29A 5EERA 2FG7C 2WJPA 3HRHA 4AJ2A 1I94B 1ULBA 2KLHA 4NS4A 2Z2ZA 3LPAA 4YRLA 3RVDA 3MS2A 4UVIA 4DMHA 4DM3A 3I01A 1AN0A 1TM3E 1SIOA 2WRZA 4CCAA 4LJRA 1JDJA 3CLTC 1SD5A 1WHTA 3G8AA 2DJ5A 3T3OA 2PZ8A 3DNPA 3Q6IA 4BO1A 3MJSA 2GZRA 2CJFA 2BFOA 3U48A 1Q1GA 3QA9A 1E4YA 4A6EA 2HSWA 1ZDMA 2R8EA 4ZO8A 1OLUA 4BMOB 5FLEX 2IHKA 1A95A 5REQB 1HTBA 4CM9D 3S8MA 2EFDB 1E0KA 2PNFA 4AAYA 4GLBA 4HHEA 4JEUA 1USGA 1GKYA 4ZVTA 3MQ4A 4LYJA 3LIPA 3B3FA 3DS8A 3D6VA 4XLTA 3HADA 1QHIA 1OTHA 2PSHA 4KPYA 2PWYA 2X6RA 5IP5A 4LF6B 2OECA 5JNWA 1XEXB 2YYAA 3VYWA 3P8ZA 4QATA 4KQ6A 1G66A 4KIFA 1Z0KA 4HDCA 3RTDA 2OTCA 2G9QA 3INYA 1WULS 1GFIA 4D4IA 2JFNA 3ZKWB 1YD7A 4E1VA 4AURA 1VSBA 4S0XA 1MT3A 4JD5A 1EG2A 1TJ3A 2Q0XA 3TTSA 4RXMA 4MAFA 1KKUA 2NWQA 4DZZA 3PRYA 3BVPA 2PGXA 3MMPA 5E9AA 1UEJA 4K8RB 1SC6A 1QOZA 4D96A 4PR0A 4G0UA 1Y8QA 3AB3A 4XPZA 5EP4A 3ZE7A 1Z26A 4M89A 4LVNA 2K7FA 5T5QA 1DG9A 1WABA 2R96A 2FMTA 4IQ0A 4ZOLF 2IEGA 4HGNA 4U7GA 4I3GA 1VIYA 2C82A 4RSMA 1R00A 4HLUA 2HF9A 2IUFA 2H7CA 2FG6C 2ZZNA 3G7NA 4J2TA 5DBOA 1P8AA 2Y1CA 4Q3DA 2EW2A 2W90A 3WYDA 1O6BA 4PG6A 1KI1A 2IQ5A 2VDNB 3BRWD 2AXNA 3KKPA 2QX6A 2HMUA 3C85A 1PVDA 5FNZA 1JFFB 3PDJA 2PSDA 3SZ3A 6CHYA 3NYWA 3GW8A 1KAQA 5HF5A 5F1PA 2D1QA 5K3EA 3B8EA 3EW7A 3QPWA 1DKMA 1Y6QA 2J6IA 4JI2B 3D7RA 1XFAA 1XQYA 4A3SA 1C7FA 3U31A 4AYWA 2O2IA 3VGPA 2IEIA 2F4NA 1DEAA 2B30A 1C3OB 3EEBA 1MV8A 3K0EA 5CB4F 1M1ZA 1LW7A 4ZFNA 1V5GA 2OL4A 4XVUA 4UCFA 4QQNA 4RKFA 4X92A 1VZ2A 5KQLA 1F8YA 3C8UA 3UV3A 3FYTA 2H29A 2Q0QA 1TPYA 1YCGA 3C6MA 1KI6A 3RYIB 2IBTA 3PEVA 3R0XA 3GEMA 2YZMA 3HN7A 4EUHA 3WJ1A 4RS4A 4PYRA 3U49A 4IJVA 3BE6A 4C21A 4D8YA 1OTYA 1IXZA 1R37A 2JGIA 1BS9A 1A8QA 1GN9A 3LF2A 4YTEA 4HEA6 1D7AA 2EKLA 4Q15A 1KIMA 1C1HA 4QU8A 3ZBTA 2PKEA 2BFWA 4Q6WA 1CQIA 3E0XA 1CWUA 4LCEA 4L3VA 3I73A 2QIOA 5DNEA 5LWHA 3TLJA 4OGGA 3OE7A 3NONA 2FW7A 3DMYA 2JB9A 3LYUA 4FIDA 3SYNA 4D3SA 1MDBA 3A0UA 4I08A 3JSXA 2VT6A 2NN3C 1M2GA 4RMNA 1G3IA 1TKBA 2CFOA 4MUMA 4K1XA 4YQFA 1I3LA 3NPMA 1MVOA 1WU8A 5FBQB 1JDNA 3KHSA 4QUGA 1NVFA 3JATB 2Q8QA 5ULLA 3IUMA 2XCQA 3NFRA 2C2YA 1UKAA 3V1KA 4AS3A 3B9PA 1HLPA 2BFNA 3KDSE 3RWBA 2EOAA 3L9XA 1EAMA 2CXRA 2X0KA 5DO9A 4WNAA 3STTA 4DSNA 2O2CA 1OQAA 3W04A 4WESB 4XJVA 4DNOA 4UMEA 4FYMA 4R2WA 5ECYA 3CLRC 3C3KA 4MW7A 1XK6A 4DM7A 4RDCA 1A7JA 4RAQA 5BV1A 2GPNA 2AJLI 3VZBA 3I1IA 3ZHQA 5HUQA 3ROZA 3BC1A 1XUOA 3I6MA 3ZDRA 1OGIA 1T4CA 3C3PA 4QG3A 1LU9A 4OK3A 1N2CE 4LOAA 4TN5A 2E18A 1C3EA 3PUIA 1RLIA 3BB1A 1XQ1A 2V7GA 2NTJA 3MAJA 3NPAA 5G53C 4NZOA 2PTGA 2Q3EA 3L7DA 2BFCB 4OCZA 1WPQA 2HWXA 1Z25A 1THZA 1GGKA 1Z16A 4XQ9A 2BHRA 5FUQA 1I7DA 5EXDA 2BM1A 1HDZA 3AERB 3FZNA 4H2DA 5C8ZA 1Z3IX 3EWSA 4UD6A 1CYEA 4U5XA 1C9DB 4ZDJA 2FQWA 3EZFA 4AJEA 1YMVA 1NURA 2XGJA 1RRGA 4O63O 3UKOA 5KU1A 4RJIA 3QEAZ 1U8UA 2PLNA 5GONB 1TGVA 2V7EA 1Z2NX 3DW3X 3QLUC 4GGOA 3UMJA 2A9QA 1NN1A 3ETDA 2O0LA 5LBTA 4FDLA 5F1KA 3K9WA 5FD8A 1KO8A 1DKPA 2H2IA 4JASB 4QU9A 5LQUA 4FZ5A 2MSEB 3JQRA 4G5OA 5EP3A 1R5JA 4YRAA 5AVVA 2DTEA 2PMCA 2X1MA 8ATCA 1A1VA 1WETA 3ICQB 3ZHBA 4A73A 1O8CA 2C7PA 1LH0A 4GI3A 1LC0A 1ZWKA 3DP7A 3UVEA 4CETA 1E3JA 1N92A 4G5HA 2AJBA 4BP8A 3S7TA 4CFZA 4E3ZA 4II7A 3VNUA 4BIIA 2HA4A 3ZXSA 4II3A 5F52A 1J9EA 1RJ9A 2BBSA 5BSMA 3KT8A 1NLYA 3U5ZB 4B3TB 3ZY4A 2Q8NA 3N7AA 4WOKA 4MW9A 1BN6A 2G1UA 3WK4A 1T1IA 4ZHSA 3IEKA 4JX8A 2QI9C 3GJ0A 4DIKA 3RQSA 3L1KA 1ZSNA 2I9PA 2ZIAA 1U0JA 1XXHA 1T9DA 1FRFS 1MX1A 1SA0A 4IHJF 5DB4A 4DLXA 2QUKA 4KH1A 4CLRA 3D5QA 4PX3A 3MCUA 3V2GA 3LP5A 1WVIA 3EQ2A 2XWSA 5LA6F 2CFSA 4HH0A 1RBYA 2RC5A 5DI9A 5KCZA 1NM5C 2BKLA 2ZI5A 3PT9A 4Y2JA 3SQNA 4N5LA 1UBCA 5JSQA 3H2YA 4LOLA 1YR6A 2I2BA 1LI5A 2FW8A 1D4AA 1UPCA 2HD4A 3K0BA 2FHPA 3EC2A 4PWZA 4BC0A 3AL0C 1E1CB 1YDHA 2ZRDA 3H9BA 1DAEA 4RADA 2PYDA 3CWCA 4AFNA 2FPOA 1YB6A 3I30X 1TQ2A 1KE1A 1IN6A 4NVRA 3I9NA 3BWDD 4FR5A 2G72A 2YRWA 4KMOA 1UXHA 1G8PA 1W0KD 2O3TA 2PM8A 1Y7PA 4P4SA 2NZVG 4Z0TA 1E3DA 1IOWA 2JAWA 4O1IA 1M8FA 2ANCA 5CX4A 2P9HA 1QFJA 4G9BA 2HTFA 4Q4DA 4FYVA 2ZAYA 5ALHA 3RU3A 5DLDA 3IDQA 8OHMA 1PNTA 1AZWA 1JG3A 2Z6AA 3HDJA 4EHBA 2G4VA 3FR7A 1J2TA 3GVPA 5JS8A 3Q8KA 2J31A 5BW8A 5AJZA 5AQEA 3AOEA 1K2WA 1XU9A 3CZ9A 2KI5A 1CFZA 3L5OA 4HQNA 4UZFA 4RBNA 5MN6A 3GEHA 3ICEA 2GAAA 1IBKB 2A5GA 4Q6BA 4Z51A 1SK8A 5IARA 1A5ZA 2PJRA 1QQBA 2O5VA 3N05A 2Z4RA 4B6GA 2C99A 2NT3A 4FFLA 5J3JA 3U3KA 3WHPA 1SGWA 2H5IA 3CZRA 4OPMA 1N75A 1KS2A 2W4QA 4TOIA 3FZGA 2O54A 1A5SB 2O3SA 2EW1A 2GFHA 4MYSA 5DN9A 4BE4A 4QM7A 1NY5A 1E99A 2HXYA 3C6QA 4KX5A 3M3DA 2ZDGA 4E6PA 5IJWA 3GEEA 2YJ4A 4LSWA 1X8JA 1NN0A 1RYFA 1D4OA 2JI7A 3MD9A 4NECA 2BYTA 4QYSA 3TS1A 1OAKA 2AUTA 2CMKA 2P79A 4XR4A 4J2HA 2H0AA 3RFUA 1NWHA 5CDHA 4Q9NA 3CW2A 1YJAA 5HEKA 4IEIA 3QA3E 5ILGA 4NU6A 3UW1A 1E8MA 3KZMA 2QX9A 4GLFA 4ZMSA 3W2HA 1FX0B 4U0JA 4ZCSA 3ZW9A 1SHTX 2CUTA 5JNVA 2HU2A 2AEJA 1ZWLA 3ROGA 5J4KA 1L5KA 2O8DB 3W5VA 2PX3A 1ITZA 1AGPA 4IIUA 4F9FA 1CUWA 3ZCRA 1XU7A 4KXQA 3PFBA 3IJRA 4UMDA 1HA3A 4AN1A 4EI8A 3QZUA 1F2VA 1GFZA 2WWFA 3DW1X 2ZRCA 4MMZB 2Q9UA 3Q7TA 3FB4A 2PZKA 4DGQA 4B2LA 4EIWA 4O3MA 3FNFA 3LLSA 1DU4A 4HXYA 1BVYF 2FA9A 2VQDA 2XUKA 4RU1A 2Z3VA 2UZ4A 5AVRA 1ULAA 4V2UA 2GBLC 2JJ2D 2HI0A 2I6QA 1BFDA 2PH1A 1NAHA 1MGOA 3ASZA 4X90A 1LBEA 1CY6A 4RZIA 3FTQA 2EFJA 4S04A 4EUEA 3FJOA 4M7RA 3S2IA 2B8NA 4QHSA 3S2YA 2FSFA 4I36A 1ISPA 1E0SA 2RSLA 3ANTA 2FFRA 4PFQA 4KN8A 4AM8A 2GN9A 4NP6A 1L4BA 1N6HA 4NMWA 5D3QA 4C1BA 4CKBA 5AK0A 5LUBA 2F6RA 4JJ4A 3IDZA 3EXFA 4E21A 5KDOA 3IUJA 3LRTA 3TNDA 4GOKA 1S5PA 5D6OA 3ZE6A 2OWDA 3HKCB 4JEMA 3GCWA 4NOJA 1H8ED 5DM0A 3E3NA 1Z7EA 2R87A 4LN1A 3EXG2 2HT6A 2OV2A 5DCLA 3KIPA 1FB5A 4XLZA 4KWEA 2AUNA 3D59A 2ZTMA 2MINB 1CHNA 3TLKA 1SXQA 2VQFB 3HP1A 4C03A 3QKSB 4ZEVA 5AM5A 4EBBA 5CEEA 3OY2A 4O8ZA 1W30A 3FDZA 3LK7A 1CC1S 1GCOA 1P2DA 1K8QA 3E5NA 3OQPA 3P0HA 3H4TA 1YE8A 5HRCA 3L1IA 4S1VA 4HWRA 4D98A 2Z5VA 4UEOA 1F0PA 2DSTA 1NW5A 1PJSA 1ISJA 4N82A 4R2HA 5DCYA 5CDFE 4DR3B 2DLCX 2CC2A 3A1TA 2V7TA 4Y6PA 3OKFA 3HUUA 3T7SA 3GDFA 3PWSA 2H1HA 1NQ5A 3PFKA 4O4IA 4HLNA 4Z9BA 5FPYA 4KXLA 3RAEC 1GZHB 1E2JA 3OPVA 3QMPA 1ZKDA 1JKFA 2QEQA 2C07A 5NULA 2D5BA 3UA4A 4MVJM 1PZXA 4BTEA 3D4LA 3EGEA 1OXUA 1Q1EA 1UXKA 5H5JA 5BVHA 3QOXA 2QQFA 1KFBB 1IOLA 1X7DA 2MSNA 4JBWA 4KN6A 5JI2E 5E6UB 8ABPA 2REBA 2WTEA 1S8OA 1Q1NA 1SU6A 1V6AA 2EG5A 3C6KA 2POCA 4N39A 3TNYA 5MN4A 4CT5A 1S01A 3CFYA 2V8BA 1U7PA 2Y0PA 2CZGA 2WIFA 5KYYB 2Q9CA 3E82A 5LQDA 3S44A 1U99A 3ZZ1A 3JW8A 5CT5A 2F9MA 4KI7A 5FLXA 1S2NA 4DCNA 2V9PA 5FDFA 3MJDA 4CVNA 4A10A 4ALLA 4BLVA 3TPZA 1ISGA 5KQSA 5H16A 7REQA 1RHUA 3NH6A 2YXDA 3QWFA 3KQVA 1L5HA 3LH5A 3PC4A 4G63A 4J4BA 3ESZA 4A6PA 4ZT2A 3MOIA 5FYDA 1QV6A 2VSQA 3L6DA 2PXHA 3CKKA 3IOCA 3AUJB 1PZMA 2TMYA 3I4LA 5F4ZA 5B3JA 1YU9A 3C6YA 3AVVA 1USIA 1L9XA 2UUAB 3UT5A 1U81A 2XZPA 2FWAA 1HMYA 3F47A 4PINA 4OK6A 2V7UA 3GDGA 4WQMA 2X8JA 3CPEA 3VO9A 2RCYA 3D6FA 3MGBA 1VDMA 3EWIA 2WMOB 3L6OO 4LSZA 3DE6X 3LLMA 3D6TB 4WN9B 3C74A 9ABPA 2XW6A 1JALA 1WBBA 3SVTA 3VNAA 3FMGA 1HFEL 3VHQA 3THWA 3MCAA 4G5QA 5EUCA 4Y2TA 4L5JA 2VHZA 3NHBA 1DIAA 4OHMA 1UQRA 1NUAA 2WJIA 4NFSA 4NK5A 1BCSB 4BCDA 4WUTA 3ZI0A 3HLKA 3MWEB 4IOMA 4Z5XA 3DMGA 1E7QA 3T3EA 2GN4A 1P19A 3GEGA 1V3QE 3MRVA 1BVUA 4B3CA 1NDUA 4AI6A 3PCTA 3TECE 1TK3A 3F4KA 4ZRDA 1IEQA 4ZJZA 3EZLA 1HSZA 4E5SA 3CTPA 3IC5A 2DBRA 3HCFA 4G0PA 3U81A 3G2KA 4Q1CA 5BY2A 1I9CA 1FNSA 2X76A 1LPSA 3AM3A 3QGMA 2P90A 1C9YA 1SWVA 4AK9A 2H4HA 3KU4A 1V11A 4KDFA 4DZTA 4PNEA 1XN1A 1HNNA 2PUJA 2W4MA 1W5EA 4BO8A 5BURA 5AM4A 4JVOA 5DWQA 4NI5A 5FWAA 1MTZA 1G5QA 5DTEA 1Z15A 3G82C 2B25A 3M4XA 3MWEA 2X8LA 4RFLA 3UWOA 2ZSAA 4FMCF 2BTOA 4QU5A 1V5IA 3SDBA 1G8JA 5IUNC 2PV0A 2JA1A 1W94A 4KDRA 2WNIA 4LPKA 2H5JA 3NVAA 3Q7EA 5JCPA 3U7HB 1FP4B 1X1DA 3DZJA 1FFBA 3OC6A 4EEZA 1ECCA 4Z3KA 5A2QA 4FN4A 1IBCA 1SUDA 3EGOA 3FCOA 3PP8A 4FMBB 1XEWX 4HMQA 3MGKA 5AOAA 3U9SA 4O1HA 4RH0A 5ETJA 1J8YF 3DZKA 3K05A 3UFBA 1VTKA 3RBAA 2A88A 2CBXA 4M22A 3NX4A 2OHVA 2RCNA 1ZZGA 3A1CA 4NCIA 4LTNA 5F5NA 3E23A 1Z37A 2BMDA 4MV3A 3RWMB 4A0FA 5BWLA 1E5TA 5BV7A 1KIFA 1PNOA 3KVNA 1JI0A 1NUSA 2G9ZA 3QE0A 4MYRA 4OH1A 4RE5A 3ZI7A 4IJ6A 3FG9A 4MA4A 3KKZA 4LV6A 4QU0A 5C0OE 2FLWA 3A1FA 4NJMB 4OHRA 2HCTA 3ZCTA 3ONFA 4QVKA 5KDDA 2P27A 2PGLA 2ILVA 3K1AA 3ZBQA 3IT1A 5EIWA 1I7NA 3ND7A 2I76A 2O2SA 4IFTA 5BYAA 2D74A 2EZ8A 3AZQA 2XCUA 2QVYX 3T1YB 4LYEA 2WBLC 3A7EA 1TMKA 1N3BA 3ES9A 1I5EA 4XA8A 4C3UA 3PDIA 3Q5EA 4YPFA 3BCUA 5LBIA 4I4LA 4CE6A 2YS6A 1KKMA 1YBVA 1MENA 1PYOA 3OM0A 4L7QA 2OXFA 3CN7A 1EUCA 1NOJA 3VKFA 3WKAA 1JH9A 4UTXA 3K0KA 4CMEC 2EX0A 2JD2A 3NBXX 2DFLA 2EKDA 2H6EA 4G25A 3WAJA 2X4LA 3L6EA 3N6XA 5E1OA 5H3LA 4PZYA 2P35A 3DAHA 3PC6A 1CEXA 3S55A 1NV8A 4C4PA 5IVIA 3IIIA 4BNMA 3WNCA 1ELOA 1YB5A 3BWXA 1KY5A 3R41A 4CKCA 3DWGA 4D9CA 2TMKA 2NXCA 3QVTA 1JG7A 3L7OA 2F3PA 1VLVA 2ZSFA 4LBWA 5LMCA 1HZZC 4WBNF 4UHFA 3TRHA 1DTWB 2DFVA 4LY3A 3WX0A 3VKUA 2O6HA 2Y1XA 2ZBRA 3IPAA 3OZXA 2WP8J 2ZAGA 1EX6A 4RMHA 4UBJA 5LQSA 2ZSUA 1M7GA 1SC4A 3DT9A 1YE3A 4GC5A 2LPMA 4FQ5A 1YQGA 3EBPA 4ITVA 1ICIA 1Z08A 3KSAC 3D6HA 2QROA 2XOKD 2J0UA 3DJFA 2GN1A 3OAAA 2Q5FA 1CRLA 1WAMA 1OBCA 4HH1A 4ZYLA 3NW9A 4I2NA 1G5TA 1Z0AA 2WWHA 1TF2A 3AF5A 2BJVA 1ZUNB 4M1TA 4XUEA 3RB8A 1KMQA 5KHOC 4OSPA 5IAJA 2YJTD 5IULC 3ECAA 4XSVA 2WU0A 4IF6A 1XDZA 1RADA 2CBZA 3GFPA 3FNQA 2ADMA 3K0AA 3WK7A 3OH8A 1QV7A 4QRIA 4EAAA 3OO1A 2FMXA 4LC1A 2VPYA 3LUDA 2H4ZA 3VC7A 3WVNA 4N3CA 1D2HA 3ZGOA 1K6MA 3WOVA 1ZD3A 2HU7A 3LUAA 1P4HA 4TM8A 3V48A 1CUXA 2G9RA 2IIBA 3EHEA 4A6DA 1HUQA 1D07A 4M38A 3E58A 4ZVOA 1QFYA 5DKFA 2PAFA 1VL0A 1FXUA 2AOXA 3SFZA 4D92A 4GRAA 2ZR8A 3KALA 1E63A 2I6XA 4CV0A 3QBDA 4EZEA 5LQCA 2GEVA 3MWJA 2BV3A 4IHJB 4QL3A 4D45A 2XVYA 4D3XA 1X3LA 2IDJA 4B17A 3NNSA 2D3WA 5K5EA 2IHTA 1EJ6A 2OBMA 4QLBA 1QO0D 4JEHA 2DUWA 1MXHA 5IKXA 5MFPA 1CBUA 1MHTA 2FZ5A 2I3BA 4H18A 5LSAA 1SG6A 2HBZA 1H69A 5EAIA 1L4GA 3PQ5A 5HUHA 1CUZA 3E27A 4B0OA 4YRRA 1OZAA 1XKTA 3OX3A 1JSZA 2YQ4A 3FKQA 3ET5A 3OSUA 3T3MB 3K0FB 4F91B 4DOMA 3GP5A 1W85A 2GBCA 3M6LA 3CH4B 3U7EB 5I9IA 3EVBA 2HLDD 3IMFA 4OHBA 4S05A 4BN4A 4XSGA 2X9VA 1Y81A 5CR9A 3E70C 2Z56A 4NDAA 5KBYA 3ED5A 4G67A 4GI1A 4HYEA 4U4AA 5FYQA 4PRLA 3R0JA 2YW9A 1RI1A 4AUMA 5D1HA 3VC1A 3GHHA 5CA0F 2C5SA 1PK7A 3VTFA 1Z6XA 4NATA 4QPCA 5DEOA 2P67A 1MC8A 2XBMA 1AKYA 4PCUA 1VE7A 4QHYA 1H2ZA 3WQHA 4L9AA 4M87A 2ZR0A 1TCVA 3UGKA 1PFKA 1NBEA 4LZNA 3UJ7A 2P6RA 4WCFC 3CXUA 3K35A 3R0IA 4TRRA 5LN1A 1F2UA 3HBAA 1MABA 1S4QA 2PH3A 3BQ9A 1J7KA 1UFOA 2R7AA 4IH9A 1JIUA 1CUFA 1Z0FA 1MFZA 1U8YA 2J9FB 4FNGA 4CKWA 5JAHA 3CX3A 5HQTA 1GTG1 2WDPA 1JNYA 1Y80A 1NJ2A 1PJ2A 3M6WA 1ZK4A 3IE0A 3O7WA 1NX9A 4RHFA 5A9SA 1O54A 1TCBA 2EP7A 5JMTA 1FJHA 1S1MA 2GN0A 5HMMA 4BNYA 1OR8A 1UWVA 5DW3A 2M6LA 2JBWA 4A92A 2HK9A 4AWXA 2XCOA 5TY0A 2YXNA 4B8WA 3UWPA 1ST2A 2W6IA 4HVLA 4MI6A 2EERA 1A2QA 4P54A 1J99A 4GMXA 1U0FA 1XZMA 2OE2A 4IG9A 4XGRA 3AR2A 1U0TA 2AI2A 1A04A 2VP4A 2R5WA 4EHAA 4F84A 1M75A 5JASA 2C04A 4R8VA 5GZ6A 1W9HA 2YQ5A 3USES 3EXG1 3WGZA 3IUQA 3QVKA 2FZWA 2LW7A 2VYCA 4R2IA 2M6SA 3PCXA 3B5EA 5A7GA 2BEUB 2DFDA 2WMDA 2BVNA 3DHWC 5AW6A 4B34A 4Y9TA 2Q6VA 3QFHA 4XVCA 3FDXA 5ALUA 3BGWA 5AW2A 1IHDA 1Y42X 2E6KA 4JOSA 4ENWA 4A0RA 5AJXA 1PZHA 1HO3A 4BFVA 1P75A 4TPKA 4GPIB 1T0HB 2YJ5A 4GBED 1UADA 4HDKB 1DWUA 9GPBA 2EQ5A 5C35A 1GPMA 1WB4A 1F2TA 5EG5A 1IY2A 2I3DA 5BSKA 5HPYB 5IDYA 1SO8A 1UKVY 3TL3A 4AJIA 3E5RA 4TKVB 2R7KA 4JQCA 5CFPA 4GYWA 4YAUA 4OQDA 4G85A 1C2TA 1UPXA 2FVYA 2Q4EA 1W46A 2RARA 2BY4A 4X0EA 5FTJA 3S0JA 1U0LA 2P9ZA 2Z2IA 4A7PA 1T8SA 4ZU1X 4CDMA 3PXGA 3NZEA 3ZIAA 2JHPA 3A6KA 4OX9Y 2HJ9A 1L5GB 3CF6R 4IP0A 1V5WA 4MH0R 4XTCS 3LWNA 2RGUA 5FL7D 2ZJ1A 4UATA 1PZGA 1CG6A 4AJHA 1PT8A 4UTPA 1TFRA 3RASA 1R0LA 1G7SA 1NYLA 2WKPA 5EJFA 3ZZNA 1OGYA 4DT1B 1IZYA 1X1TA 1UFRA 2QN8A 7MDHA 1EZ4A 2ZIEA 1CS4C 1O9GA 4Q9LA 4FFDA 4M9QA 2OLJA 4PZLA 4TX1A 1C80A 3ZXYA 1K6JA 3NWEA 4C3VA 5BT9A 3COYA 4YCLA 1BMQA 2W48A 4Y0VA 3WGTA 2ZE7A 3K6SA 3RS5A 3OT1B 1LX6A 3R75A 4WCVA 4HGYA 4BGVA 2FEWB 3RUPA 1RDFA 4ND5A 2GAIA 3R4CA 1YMQA 3ND9A 3PNQA 4TV9B 3BBLA 4K0KB 3K0AB 5CFOA 3K7EA 1JHYA 1D2RA 4AZVA 2G36A 3I3SR 4NSNA 1SRRA 3KLBA 1YAHA 2ZJ0A 3GRRA 3OG9A 1O97D 4FWBA 4OLFA 2WVAA 1G6HA 4PYLA 4IMRA 1FDWA 1HGXA 4FHFA 4ALJA 1Y1SA 3QJGA 4PW0A 3HJGA 4E2ZA 2IPNA 1O4VA 1ISFA 5JSKA 3ZV6A 1WKCA 4LQDA 3STVA 4J7UA 1MPTA 3G9QA 1K63A 2IP2A 2POQX 2PBFA 1J06A 3UAVA 1H2FA 2E3JA 1AK1A 4KDEA 4S1WA 1EE2A 2GM5A 4HQFA 5JD5A 1M72A 1KI3A 3TFWA 4BGIA 3GDOA 4GP7A 5AHXA 1O97C 1RQ2A 1DKNA 3DPSA 3PD7A 1ORDA 4PCLA 3DMFA 4N3GA 2V7QA 1JQAA 2P5UA 4F2HA 3N8GA 3WGGA 1T8WA 3B70A 5TPZD 4QDKA 1EX9A 3G0OA 4G8BA 4X7PA 3ZGXA 4RF2A 4UNPA 4OJTA 1XQWA 2I54A 4Y6GB 4ZZ2A 1E7SA 3T1TA 4RVNA 1VLQA 3O0DA 4FKBA 2PZFA 4TWRA 1YIAA 4M36A 5EINA 3WBFA 1KJ9A 1YASA 2HPHA 2OO5A 2V7VA 3FPCA 4URHA 3WICA 1MW8X 2H1VA 1IQPA 1FXWF 2AJDA 3H11A 4N0QA 4MWSA 3VTKA 2X0IA 3UXYA 1E66A 1P7WA 2CL5A 1NVVQ 3BEOA 5DX8A 3DOFA 1ZI8A 3KL2A 3N6RA 1CULC 2ZBEA 4OI1A 5JQGB 3KZOA 2VFAA 1I4WA 3L04A 4GLOA 3T5GA 1ESZA 2NLOA 1GCIA 1GGVA 1P3DA 2X9NA 3LT4A 4M46A 3QWHA 5EZ5A 4CRWB 2ENWA 4JUBA 1JECA 3TGLA 2O0HA 5IYZF 5I8ZA 3OJ0A 4HQ0A 5KVAA 3GFSA 5D6NA 3NVMB 5FV4A 2OG2A 2R6ZA 3F6RA 4BFTA 5CXQA 4EB3A 4QLAA 5K6AA 3HSSA 1DEHA 2QRZA 4RKEA 1MF7A 5JLJA 1SCAA 1VHLA 1DRWA 1P62B 3F71A 4L2IB 5TARA 2NIPA 3FDFA 4OQPA 4GX2A 3S6JA 2I3ZA 2ZGVA 1JPJA 3BTOA 3P0FA 4ROTA 4DDTA 4B2YA 2OD9A 1ZUD1 2HOQA 3AXSA 5AXAA 1JS1X 2H92A 3PGMA 2G5GX 2EZUA 3E3OA 3JTMA 3T9FA 4AECA 1CJTC 3AXTA 3KPVA 4LA4A 5M34A 2MSWA 4KQKA 1Y8AA 1JIQA 4U02A 1MO4A 2EFCB 3UXHA 4J0QA 4OHVA 4E3WA 2HC9A 2BHNA 1L7EA 4TMVA 3MUFA 5FADA 1TAUA 1T6BY 1U0SY 3I01M 3VGJA 5IWCA 1QF6A 1CDOA 1GEGA 3HU5A 4PBTA 3NXKA 4Q1BA 4H7PA 4TKLA 4ZYVA 4TL9A 5C7LO 4TYQA 5FJJA 1YDFA 5JVDA 3F73A 3DBIA 1E8DA 4FHGA 2I2XB 3U4GA 5I4KA 2O8BA 5DK4A 4B3DA 1JIIA 2DCUA 2YOGA 4EPRA 3MHTA 2IWRA 3ZS8A 1QBGA 4UAJA 1JHQA 1LK5A 1MC4A 4QDXA 4L76A 2IVZA 1GPYA 1XBTA 4Q9KA 3E1KA 3RSGA 1Y34E 3GNTA 2P11A 5H3CA 3RYTC 5HRUA 4BV8A 5CPBA 2IZ1A 1P2UA 2X9GA 3L7LA 2YBDA 2PS3A 1G9SA 1G7TA 2WF7A 4IGFA 4ZI7A 4FNMA 3TQIA 1OMOA 3NUZA 4B2PA 1HH4A 4TV8A 5DHSA 4RFVA 5DNAA 2BFDA 2BLNA 4ZXFA 5I6DA 3IX7A 2R11A 3V1YA 4TTQA 1EVKA 1MOSA 1TD1A 3LDAA 3FMVA 5IABA 2VNAA 1FDTA 1QLHA 2WP0A 3PICA 3GUUA 3QITA 4G86A 4XB6B 1OE0A 4Y30A 4CI9A 4FOOA 4NPCA 5AUOB 5BW5A 3CRRA 3OLCX 1B41A 5FPPA 1OB5A 2YIMA 1J5XA 3FUUA 4DMKA 3W78A 2JGFA 1IATA 3B8HA 1S3GA 3NOVA 4HKTA 4KDCA 3VAZA 5FBVB 3HZOA 4ZI7B 1WY7A 3FNRA 5E3HA 1E1NA 3S27A 1P2GA 1ZM3A 4I9FA 4GEGA 4WI1A 1D6JA 1P2SA 3DTVD 5DIFA 5I9SA 2XZOA 1I6MA 1YHNA 3FVVA 2B4TO 1Y3AA 2WC1A 4IDAA 4YAIA 1J33A 3HPQA 3UV7A 4C4AA 1XLWA 5AOCA 1P0FA 4PSUA 1G19A 3QXCA 4UUOA 3DA8A 3N8DA 5IYZB 1VZ3A 3WV4A 5KNBA 3B1YA 4YY3B 2AHOA 3G2JA 3USCS 4JGIA 5JVDB 3SS7X 4Q9DA 1NW9B 2BKAA 2C7RA 5HVNA 1SR8A 4MO2A 5BNIA 2IKQA 1KWGA 4OY3A 1TECE 1GPH1 2ZWIA 2PJDA 4MS4A 1XNHA 2OA0A 3OLZA 1BCSA 1NXQA 4I1OA 5CLIA 3IIJA 2ZI9A 3H0CA 4WA8A 4CKXA 5HKAA 3GRFA 2IU4A 5EKXA 2VSNA 3S1LA 5A9TA 3TRKA 1P18A 5A3JA 3UICA 1R27A 2QKYA 2EX4A 5ESXA 4V0LA 2RBKA 3NIWA 4O2RA 5HKBA 2RGNC 4OFXA 5L4LA 1OI4A 1SCQA 2AX3A 1E3IA 5FXMA 2QD2A 5ARBA 5DXAA 4LDRA 2QMHA 5FKJA 1WF3A 2ZB4A 4YJ2F 1KOJA 5JAMA 1L7OA 3NEAA 3CUVA 2ZQZA 4IJWA 3QE3A 4GDFA 4IGAA 3IVAA 3QX9A 1C5KA 1UKEA 4B6SA 1WW8A 1N9GA 1XTJA 1CUCA 2JIBA 4RD6A 5EGSA 4BQOA 1EE1A 3OO0A 4RACA 2PEZA 5AK6A 1QLWA 4H1TA 4IVNA 3MBOA 4BQNA 1NBME 4X84A 5DU2A 4KQ9A 1DAMA 4ROSA 2B98A 2FUCA 3GFFA 4BNXA 1M8JA 5TSDA 3A7DA 3DGFC 5DNYB 1ATZA 3O7MA 1CFJA 3AGQA 5FI5A 5EFZA 2UYOA 1Z83A 2GEBA 1CUSA 1YRYE 1TW3A 2ZBUA 3IFSA 3HB9A 2VNIA 3GRYA 3LKZA 5A4IS 5I8WA 9MHTA 2A1TS 4PICA 4QA9A 2OAQ1 4X6XA 4WSOA 3GLQA 4B79A 1N5DA 4DQKA 4DA9A 1P73A 2WHQA 4JIGA 2W37A 2IOQA 3ABOB 2E4XA 5ES4B 1ID8A 3HEMA 4WOPA 3S1AA 3DKVA 1SULA 4WX2B 3FLBA 1JVNA 1C4KA 1II9A 1KZGB 1RLOA 2IXDA 5E6UA 4ZZ3A 5L8VA 4RK5A 2R48A 5ECDA 4D7AA 1H9AA 2FPUA 3H5VA 5CVEA 1ZCFA 4EOGA 4LJ5A 4DQ0A 3QKTA 2DBVO 3FM9A 3I8XA 1T1RA 3AB8A 2AV6A 3OBBA 4IIVA 4QARA 4YDQA 2BHTA 4CM9A 3GELA 5G0VA 2KE5A 5LZ7A 2UZ1B 1QGUA 3EQ8A 4FDAA 4PLPA 3MBIA 1LSJA 1IZZA 4KVFA 1W4RA 2ECFA 1WZEA 4BVEA 2WV7A 2BBTA 5C51B 2WTUA 1P7YA 1P5HA 4ZCPA 2X23A 2XUGA 2XUHA 3AGPA 4Q4HB 3FJYA 1SZPA 3L8YA 2VAPA 1ZEMA 3E48A 1UAGA 1VSQA 2A59A 1Z0IA 3IHWA 3L1UA 1ZIXA 1SXJE 4V39A 5K4GA 3OX1A 4TL6A 4XPIA 1X80A 2YL2A 3CPJB 3UH1A 3HGQA 1O5OA 3QKSA 1D4ZA 1K5DA 5DISB 5DM4A 2BFAA 5H02A 1TU3A 2BCEA 3OPXA 3ZJ4A 2ZTUA 4KXNA 1VKOA 4MVJG 5KTTA 2CL7X 4ED9A 1OZ0A 1AK2A 3HYCA 1L7AA 2O2GA 4BNKA 4EZBA 1DQZA 4NENA 1SURA 4YQEA 3RBXA 4MV4A 5DLPA 4BEWA 5AOBA 4ARBA 2AWOA 4H1UA 5LQNA 4QBKA 4AW9A 3GRPA 1FX0A 2CD7A 5K3CA 3CEJA 2J6BA 3NJ8A 5TDHA 1IJEA 4OQNA 4YWHA 4AQ7A 2NUAB 1KGDA 4QQ8A 4MARA 1GAQA 5FRDA 2YBEA 2Y99A 1JJ7A 4CBVA 3PHBE 1E6KA 4XQEA 2XCIA 2B8TA 1Q0UA 1ZGGA 3HJRA 3ZG6A 2QM0A 4ZCIA 3VH1A 2H7XA 3GLHE 1I1HA 1VPEA 4MW1A 3M2TA 5C34B 3UOGA 1DT3A 1VFNA 1GYQA 3HU1A 3OD5A 3LBFA 4US1R 4MKXA 2HN9A 5KNDD 3K70D 2GZHA 4FYKA 4HDNB 1P0PA 3ZTYA 4F86A 1DWQA 4ZO9A 1GUFA 1W2HA 2DLDA 3NALA 4FLFA 4IIDA 3THRA 4E94A 2ODEA 3ZDYB 3A1SA 2QYHA 1JWLA 5BSGA 3HK2A 5LDGA 2IHVA 1WUIS 2DWCA 3QVWA 2Y1WA 3HCCA 2UYHA 4FLEA 4YJHA 1JDBB 4H7EA 5HHTA 4PX9A 5JH7F 3A2MA 1L4HA 3TEMA 3NM4A 4B46A 5FHRA 1E7MA 2GZ2A 3GU3A 3MQFA 3CSSA 1JLKA 3FUVA 3ND6A 4R4JA 5D3ZA 4AJNA 2YNMC 3C5HA 3IHKA 3DYIA 2WJAA 4N18A 3KXLA 3LF1A 2LBPA 1BRTA 1EAYA 2XXJA 5DNCA 1ZC4A 2AF3C 2B1JA 4ZCRA 2XE8A 2M9MA 3IUEA 4LYHA 5K0LA 1R4MA 4D56A 2YFQA 5BUQA 2R00A 4A82A 4LYGA 2WWGA 2Z6QA 1UBGA 2UV8A 5K4AA 5JH7A 1D0VA 1GPAA 2B94A 5IAOA 4PLHA 1Y8ZA 4GNKA 3K30A 4B74A 2OAEA 2OYSA 3KS9A 4PSCA 4EB6B 1TAGA 1ID1A 1ZR2A 1LSSA 2GPYA 2WFMA 1KOFA 2GM3A 2P7IA 3AUKA 4V0QA 2IU0A 3NTXA 4XIFA 2FFQA 3W77A 4HNTA 1N6IA 4PGGA 5K8JB 3GR6A 3KV1A 4HN2A 3FNBA 3TDNA 1KVSA 1YZ3A 4B0PA 4AKGA 1Z0JA 5BWMA 2MDTA 1F5SA 4CN8A 2G5PA 4MULA 1V35A 2HMSA 5IDXA 3PXUA 2XECA 1XXHB 4IOLA 4CKYA 1CUGA 1TKAA 4ETNA 1SK9A 2ARKA 2BMFA 2ZR7A 1A9RA 2CJPA 3DJYA 1I4TD 2QZJA 4YRJA 3WK9A 2DFNA 1RMYA 2JL1A 2XOEA 4MO9A 1ZH2A 2RHHA 1JWAB 4JT4A 2O7NA 2VPWA 3HVIA 5BYKA 4MS3B 4HAIA 3H87A 5CG2A 1B6RA 1GSOA