5TC4A

Crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
292
Chain Sequence
b'EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohy
publication title Crystal Structure of the Emerging Cancer Target MTHFD2 in Complex with a Substrate-Based Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 110
structure length 292
sequence length 297
ec nomenclature ec 1.5.1.15: Methylenetetrahydrofolate dehydrogenase (NAD(+)).
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tc4A01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 5tc4A02
4NHEA 4YQYA 3OHSX 1MP0A 2OOSA 4IIUA 5A05A 4QFDA 5EL0A 4MVJA 2DBQA 1CF2O 3TZHA 1GZ3A 3GRPA 3AY3A 3PYLA 2HJSA 3NAQA 2GYYA 1X0VA 1C0KA 1U3UA 3FNFA 4MIEA 3OM9A 5FF9A 1ZZEA 2NACA 4B7CA 4L4SA 3CZRA 1E5QA 3QSGA 4D3DA 1QKIA 4FFNA 4J43A 5JCJD 4G2NA 4N54A 2ZTVA 3EAGA 3KXDA 4CMCA 4R9RA 1UDCA 2PLAA 4AICA 3N58A 4GSLA 4J1SA 2ZYDA 3W4KA 1E6EA 3ZH2A 1QV7A 1U7TA 1BVRA 3EUWA 1M6HA 4M49A 4CLDA 1GTMA 3RIHA 2VUTA 5C5IA 1AGNA 1IHYA 3TQHA 5IDWA 3QVTA 3C1OA 1B8VA 5K6AC 4JIGA 1YO6A 4R68A 3ROPA 4YJHB 2RH8A 4DMLA 5A06A 3MEQA 2GN8A 5B12A 2H1SA 4CR6A 4WECA 3ITKA 2VHYA 3VVBA 3E48A 3WGHA 1U3TA 2QIOA 3KSDO 5F21A 2B69A 4WCFC 1QYXA 3RJ9A 3LK7A 1PJCA 2VHVA 4XKJA 2DTDA 4E33A 1A4IA 1X7GA 2ZYAA 2AE1A 5L4NA 3WQSB 5CDYA 3TDKA 4JX8A 2GNAA 2YFHA 1XSEA 2VYNA 3QP9A 5AOVA 3VAZA 4PG6A 1TVEA 2I5PO 3TFOA 4J1TA 1FF9A 4ND5A 3K5PA 4GMFA 4J6FA 4GI2A 1BWSA 1V35A 1R0KA 3ENNA 4BNKA 4HX5A 1WZIA 3PP8A 1GL3A 4ROSA 4YVFA 1A4UA 3PWSA 4GL4A 3JQGB 5DP2A 3BIOA 3SJUA 3D1LA 3PTZA 2ZKLA 3HG7A 2P9EA 1GEEA 3DZJA 3WTBA 4DQUA 3MJSA 1FDVA 1VL6A 4TRNA 2FPIA 4O1MA 1KY5A 1FDSA 4UEKA 4DRYA 1AE1A 3GZ4A 4BNUA 1TB4A 3GGGA 1GY8A 1DIAA 5TNXA 4D45A 4EZBA 1YONA 2AEMA 1BXZA 1U28A 2HLPA 1LQTA 1NTOA 5JY1A 5G2OA 1VKOA 1CDOA 4FSHA 3O38A 2BFMA 4Q3DA 1QXSA 3G79A 1E3EA 3I9MA 2H9IA 2FZWA 4TROA 4RVHA 3DZKA 2HK8A 2NTJA 5HM8A 4H15A 2FR8A 4RVFA 1XCBA 2CDCA 3CXRA 1O9BA 4JP3A 1BXKA 2WSBA 4B4WA 3LT0A 2O50A 5ICSA 1IL0A 3BYZA 1DAPA 2D5CA 1IZ9A 2WEKA 1HETA 3B1JA 3H3JA 3PRJA 5T6BA 4MVJD 1P9LA 1IYZA 1PGPA 1XHLA 3WGQA 4XJTA 4CV1A 2D5AA 1LRKA 4WEOA 3GEDA 5CEJA 4FCCA 3VVCA 3PEFA 4JQCA 1NVGA 4UEJA 2J8ZA 1L1FA 3IUPA 3JV7A 5JYDA 4DPMA 3BHMA 1RYEA 3E8XA 5C3MA 3ZHYA 1SAYA 2PFGA 1DC4A 2B83A 3NX4A 2BMAA 1XU7A 1BRMA 3WWYA 1H9AA 2HJRA 4YRBA 2ZIZA 4TVBA 3WTCA 3K73O 1J6UA 1PJSA 2BH9A 4ALIA 4N5NA 1KEUA 2O2YA 3F4LA 1KVSA 5FYDA 4XYEA 5MDHA 5H81A 1GQQA 1O94A 2IE0A 3NT4A 4PLCA 1I10A 3I6QA 3BMNB 1HYEA 1T24A 3JQ6A 3QWAA 1LLUA 3GEMA 1H5QA 3NYWA 4RGBA 3PQFA 5F1OA 2X5OA 2XPCA 1G1AA 1NHWA 4A27A 4B7XA 1T2CA 2PH5A 1ML3A 1QV6A 4PZCA 2AE2A 4Y6RA 3B70A 3WX0A 3GFBA 5L4LA 3RUHA 3DONA 4PLPA 3LF1A 1HEUA 4KQXA 1NAHA 1NAIA 1P33A 3DOJA 4NBTA 2Z5LA 5CDSA 4WLUA 3PDJA 4RV9A 5JFOA 3LLSA 4AJHA 1EDOA 4CPDA 2VYND 4YJHA 5JPIA 1E1LA 3IIEA 1MFZA 2IXBA 3FF4A 2JL1A 3ZWBA 5L53A 1ZK4A 2X9NA 9LDBA 2DTXA 1I2ZA 2AQKA 1YL6A 3WYCA 1NQOA 4BNHA 1HE5A 3UXYA 1WZEA 2X6TA 3JYNA 3TOZA 4UVGA 4MJLA 1ISFA 1LU9A 2Y66A 3AM5A 4RVSA 2QYSA 3VZQA 3UVEA 2DFVA 3U0BA 1DHRA 1VJ0A 1F0YA 1DIGA 2YW9A 3ST7A 3V2GA 1K6XA 4IS3A 4XGIA 4NBRA 1Z7BA 4NBVA 1U7HA 4ZGWA 1CWUA 3LSYA 2NV6A 2YQ4A 2XXBA 4TRRA 3BAZA 1UH5A 3DFZA 4YAGA 3K31A 2C20A 2VRBA 3ZU2A 3MJ4A 5KIAA 4TRMA 4XQEA 5COQA 2R6JA 3JQBC 2HQ1A 1TT5B 1QSGA 3DWFA 4FBGA 3GMDA 3L6OO 4UUNA 2IDZA 2PZMA 1NPYA 3HE3A 1RKXA 1IHXA 1GU7A 1YRLA 2DBRA 1YOVB 3GR6A 3P2YA 5LDGA 1W8DA 2YJZA 3E82A 1P0FA 3TNLA 3DZHA 3G17A 4ZQFA 3I83A 4WGGA 2BLLA 4E2XA 1I0ZA 4X54A 1W0CA 3JD2A 3JD3A 4IDAA 1T2EA 2GF2A 4WNIA 2X0IA 5EINA 5ILGA 3RC1A 1U8XX 5DBFA 3GG2A 1AUPA 6LDHA 3H4VA 3RC7A 3ENKA 3ZNNA 4YAIA 2DLDA 5L7TA 3RFVA 1EUZA 5L9AA 3O9ZA 4L9RA 3E5MA 2R00C 4R3WA 1MXFA 2NU8A 4GVLA 1JAYA 4J7XA 5DBGA 3IS3A 2P9CA 2PY6A 4J91A 2UAGA 2YHIA 2HMVA 2YYYA 2WYUA 2RCYA 1MXHA 3FPCA 2GN4A 3JQEA 2OL4A 4R3NA 1Q0QA 3PK0A 5B1YA 1LEHA 4UREA 1ISIA 3OQ1A 3OSUA 3R3JA 4MP8A 1HDYA 2Y0EA 3ZWWA 2WD8A 5BSGA 3S2FA 5B37A 2Q49A 1H94A 1Q7CA 4AJNA 2QRLA 4LRTB 4GWGA 4ID9A 1PL7A 5TT0A 3VTFA 5TX7A 3BMNA 3GMSA 5AYVA 1EK5A 2HUNA 2NNLD 3MCVA 1GV1A 1U1IA 4FJ0A 3E1KA 2VCYA 1BW9B 2FPPA 1LSSA 4I08A 4O59O 4CMHA 1KC3A 2PZJA 3H9JA 4NNJA 4FFOA 3PHLA 5IAAA 2DC1A 4DUPA 3WB9A 4JJGA 3C7DB 5L95A 2X4GA 5TF4A 1Z75A 4DIOA 2EXXA 3AFNA 1CRWG 1HDCA 2X22A 5EPOA 3GF4A 3FNGA 3EZYA 3RQSA 2X9VA 5EESA 1LLCA 1AHIA 1I32A 4PVDA 1LI4A 1PGOA 1ULUA 2AQ8A 2WE7A 1U3VA 2PGDA 3FWNA 1EE2A 4XDZA 1QP8A 2Y1GA 1K3TA 3IP3A 1DO8A 3NDRA 4BUCA 4EGFA 2EJVA 3E9QA 3RD5A 4XEHA 3KSUA 3OIFA 4MVJI 1U8FO 1NR7A 4A10A 3RU7A 1ENZA 4J7UA 1DDOA 3ROKA 1K0UA 3ZDFA 2EWMA 5DZSA 4CLRB 3TN7A 1XQ6A 2Q2VA 1YQDA 3G0OA 1A7KA 1LDBA 2BRUA 4OAQA 3IJRA 4E5KA 3DZIA 4QO8A 3F9IA 4IINA 4BOYA 1KEVA 4IQ8A 4Z9FA 3FWZA 3ZWYA 1UP6A 4YPOA 4EI2A 2UDPA 1N8KA 1ONPA 3TJRA 1ISJA 2J3IA 3JQAD 2A9FA 3DDNA 5T67A 3S55A 2WD7B 4YT4A 3IKVA 3TFQA 4E31A 1P1JA 4L4XA 4NBWA 5JAQA 2D1YA 4N7RA 4Y98A 1MX3A 1MC5A 2JFGA 2W2KB 1GR0A 3VPSA 4CV2A 1BTOA 3RSHA 3PZRA 1KETA 1V6AA 2X23A 1UDBA 1YOVA 1HDGO 2Y1CA 1ADGA 1RM4A 1U4SA 3D64A 5G0VA 4BGIA 4XRGA 1XDWA 3ZV3A 3W4JA 2YDYA 4CM8B 4E3ZA 4N5LA 2I99A 1A71A 2BFOA 1QMGA 3JQ8B 2ZK7A 4RVDA 4J90A 3GG9A 4F3YA 2B4TO 4LMRA 4OXNA 4M89A 4AJJA 1B3BA 4EW6A 1HE2A 4ZRMA 4NG5A 5L7WA 4O5OA 2EERA 1V8BA 5IZCC 3ONFA 4UUOA 1VM6A 2YQ5A 4AL4A 1MB4A 4IJUA 3TL2A 1VRWA 4LRSB 3ANNA 1BSVA 1DIRA 4XD2A 4CL3A 2X0RA 4Z9YA 3U49A 2BI8A 2X0NA 4R51A 2BHLA 1WMAA 2BGLA 4IDFA 4PG8A 3OMLA 4KP7A 2VNAA 1DLJA 1XQ1A 4MDHA 3E9NA 1WNTA 1XLTA 3RUEA 1ULSA 1AXEA 5IG2A 1MUUA 1DSSG 1DC6A 1N1GA 2V7PA 4Q3CA 1JTVA 2JAHA 5JC8A 3SJ7A 1JN0A 4CMKA 3L77A 1ZBQA 3ORFA 5C7IO 1W4ZA 5IDYA 4BNMA 4NJOA 2ZTUA 3DFUA 1VJTA 5J23A 4F6CA 4ZJUA 1EFKA 3Q2IA 3QA9A 2P5UA 1ISGA 1ZIDA 2QHXA 1TT7A 4K26A 4TRJA 5BT9A 5ADHA 4MO2A 2HMSA 2BI7A 3GHHA 4IZIA 3BTSA 1ZNQO 5B4TA 3GVCA 2JKVA 3GVXA 3RAJA 4CR8A 1DOHA 3OP4A 5FI5A 7ADHA 1R0LA 3TF5A 3MJTA 3O03A 1HKUA 3F6YA 1Y1PA 2H63A 1JKIA 2FY8A 4EBFA 1OC4A 1T2AA 1M6WA 2J3HA 1OBFO 2NWQA 1EUCA 4IDEA 3QQPA 5JCJA 4U0JA 1VSUA 4EITA 1QR6A 3VPFA 4XGKA 4J16A 3ICPA 2OBYA 1Z74A 2DFDA 1E3SA 2VZ8A 5JO9A 3H3FA 4D46A 1AHHA 5KKAA 4Z3DA 1D8AA 3HDQA 1D4FA 1I2BA 4R41A 3TPCA 3G1TA 3JYOA 4U8GA 1ZSVA 1PQWA 2JJYA 3AOGA 1IZ0A 3AOEC 1UZLA 1H0KA 4QEDA 4B3JA 3DB2A 1HWYA 5G0UA 1FDUA 1H6AA 3GFGA 5ITVA 1I36A 4CLRA 1JQBA 3ZWOA 3JD1A 1NQTA 2JD0A 5BSFA 3I9JA 4PRKA 4CL8A 5CG2A 3UW3A 1SEPA 4U7WA 4E12A 2O7QA 4P4NA 4EJ0A 3I9OA 3WFIA 4FW8A 4IM7A 1Y5MA 4JK3A 4MP3A 4PLYA 1KY4A 1U9JA 3A1NA 4MKRA 4OSPA 4D79A 1HT0A 3F1LA 3AUTA 3JTMA 4MIOA 4Z9XA 1JWBB 5LCXA 2PKRA 3UH1A 3NDJA 1HLPA 1VKNA 4CLEA 1HZJA 4R4JA 4PG4A 2DUUA 2W2KA 1NVTA 1NFFA 3D3EA 3GAZA 4ESOA 1YB4A 3ZWMA 4Q9NA 4W7IA 3RUDA 3DMTA 3O8QB 2CVZA 3KEQA 4M1QA 4LCJA 1IOLA 3HB4X 1HZZA 3I6IA 3ADOA 1QLJA 1NX6A 1SMKA 1ZJYA 3H7AA 1E1KA 3WQRA 4D7AA 4CUZA 4RZIA 4FOSA 1Y9AA 1LC3A 1OMOA 3TSCA 2Z1MA 4CUJA 1HXHA 2R2GA 4BO0A 2NQ8A 3JQ8A 1P1IA 5KCZA 1XWFA 5C7OO 2P68A 3BMCB 3RC2A 4MIYA 2HDHA 1YBMA 4CMAA 1D1SA 1LSOA 1ZK2A 3A4VA 3HUDA 3O4RA 4HNHA 4PIVA 3ANLA 4AJ2A 4NU6A 5ENDA 1YJ8A 3KBOA 1ONNA 3EC7A 5L4SA 3QWBA 5I7VA 2I65A 2Y1EA 3AK4A 3RCBA 4DA9A 2I6TA 3OA2A 3W4IA 2FR1A 3ASVA 5T57A 4YEDA 4BIIA 5JNLA 4P4LA 1B7GO 4KQWA 4BKPA 4XA8A 3M2PA 3T4EA 4OOFA 4P38A 3PDUA 1DIHA 1LDGA 4YTEA 3WJAA 4LW8A 1C3VA 2O3JA 1D3AA 5HA5A 2OO5A 5COBA 8LDHA 5TS3A 3PVZA 3GVHA 3PPIA 3EMKA 5U4QA 4FFLA 3AU9A 2HRZA 4DLLA 1P3DA 4BNXA 2Y05A 4RF2A 1R0SA 3I23A 2O48X 2GD1O 2J5QA 2PGJA 1X15A 1TLTA 5CEFA 2B36A 1JU9A 3RFTA 3OJEA 3LC7O 5THKA 4LCEA 2E6UX 3A28A 1S7CA 3QIVA 5IDXA 3UOGA 5ENVA 2GZ2A 3DO5A 1PL8A 3A06A 3C24A 2JHFA 3CH6A 4ND2A 4J9VA 4BO3A 3L6DA 1WDKA 3FN4A 1I30A 4CODB 3I9LA 4EEZA 5JDCA 1F8FA 3GEGA 3HDYA 2Y1OA 5DOZA 1U4OA 4BNYA 3TRIA 1YJQA 1QRRA 1E6WA 4AFNA 4TKLA 1HSOA 3WDSA 4YRAA 1ONOA 4R1UA 4BNGA 4GH5A 5JW6A 2JFHA 1IUKA 1I8TA 5LDHA 2NVWA 1HRDA 2E48A 3FCOA 3WIDA 1AXGA 3SVTA 2GPTA 2OUIA 1PWZA 1ZK3A 4TZTA 3RKRA 1RPNA 3WQQA 1WXDA 1P0CA 2CVOA 5A5EA 1PJQA 2EF1A 1E7YA 3ADPA 3BZUA 4P4GA 5AXBA 3NT2A 3RROA 5A9TA 3EGOA 4JNKA 5I8WA 4ITUA 3W8EA 1OI7A 4LK3A 4Z3KA 2O7SA 5CDUA 3ZZNA 3WBFA 4OM8A 2WTBA 5ER6A 2VYVD 1LDNA 1YBVA 3ZU4A 1ZSNA 5EIOA 1B14A 2DU8A 4XIJA 3GVPA 1XEAA 3AUSA 2Y68A 4AJKA 1A5ZA 1V0JA 4YA6A 3C3XA 2HAEA 4ALNA 4R69A 4YQZA 3JD0A 3DAGA 4URFA 1VL0A 3AM3A 3GGPA 4IS2A 3LZ6A 3RI3A 1PQPA 2O3QA 1KERA 1B2LA 2DBVO 4FGSA 4RO0A 3HN2A 5I7EA 3QW2A 3AM4A 2WM3A 4XYBA 2JAPA 2QRKA 4JXKA 5F3RA 4FS3A 2C54A 4R9SA 5CFZA 1CJCA 1HTBA 1HL3A 5EJ2A 2B37A 3WGZA 3OJ0A 3K2BA 4AJ1A 5IXSA 3MOIA 3GOHA 4CMGA 4EDFA 1GDHA 4CM3A 3VKUA 4ZU3A 1Q0HA 3JQAB 3GN1A 4H16A 3H2SA 3PWKA 3OA0A 5JMPA 1VI2A 1D7OA 4XYMA 3M6IA 1DIBA 3H8VA 3SXPA 3PHJA 1DJQA 3O8QA 3Q2KA 4IJKA 4GAEA 2CMDA 1I2CA 1NM5A 2HMTA 3DXFA 3H9QA 5GZ1A 2CSUA 5I9MA 1A27A 4UUMA 1OZAA 1VLLA 3TZ6A 3WNVA 4OL9A 5FEUA 5DP1A 1KYQA 3F4BA 1Q7BA 4J9UE 5F1PA 3BMCA 4EUFA 2PA3A 5AXCA 5CPFA 3CMMA 4ZICA 3UCXA 4BO1A 5CDTA 1GQYA 5DN9A 2XF8A 5KJCA 1CETA 1X1TA 4BNFA 1VSVA 1WDLA 1K5HA 1QYVA 4O0LA 2Z1NA 4PZDA 1ZXLA 4B4UA 5I9LA 4YWJA 2YHIB 3LC2O 1EFLA 1JVSA 2E82A 1KOLA 2RBEA 1E3IA 3ZU5A 3GLQA 4BVAA 4GX5A 1XA0A 2NVBA 1DAOA 1MA0A 3PWZA 4I5GA 3ZHXA 3PYXA 3NDIA 3ZWVA 5KJEA 4YDRA 3BTUA 2ZATA 3QRWA 3WICA 2CF6A 1LDYA 2D8AA 2GGSA 1V9LA 3JYLA 3BHIA 5TRTA 1HYHA 3ZV5A 1B8PA 4UVEA 5BQFA 1MG0A 3VZPA 3DZFA 2VRCA 3M2TA 3L4SO 3OICA 1YB5A 4YYZA 3GPIA 4E21A 1GADO 4IDBA 3FBTA 1P1FA 2PZLA 4CV3A 2WJPA 5TJ9A 4QTZA 1PX0A 1NNUA 2VHWA 4OKNA 2ET6A 1HDZA 4TMFA 1PSDA 1E7MA 4FR5A 4B7UA 1DLIA 2D2IA 5TGDA 1MLDA 1WWKA 3ZW8A 1YE3A 1ZJZA 1C1XB 2IEDA 1DFIA 4AJPA 4H3VA 4DTIA 2EIHA 4GSKA 4BO6A 2E37A 1FJHA 3DBHB 4DPLA 1RYDA 2FOIA 3INGA 4QFCA 1PS9A 2Q2QA 2G76A 1SB8A 2YV2A 2NU9A 4F46A 5JO0A 3MZ0A 2VZ0A 4YRDA 1MV8A 4RPKA 4IY1A 3FR8A 3JQ7B 3JCZA 3GH3A 4DLBA 2VN8A 1HE3A 2DPHA 1OFGA 4MVJG 3ON5A 3SLGA 3VPGA 3EY4A 4LSWA 3TL3A 3V1TC 1DJNA 4XQGA 2W8ZA 4PGFA 1NR1A 2PZKA 4HKTA 1PJ2A 3CEAA 4PLWA 1NYTA 4R1TA 5I7FA 2X1HA 3UN1A 3VH1A 2VWGA 3OETA 3UFXA 3WSVA 1WW8A 4BKRA 1ZVMA 2EP7A 2FRDA 3OEWA 4Y6PA 4ZN6A 4CQLB 2CDBA 2EGGA 3RU9A 4CQMA 4DBVO 5L40A 4R1SA 4W9NA 4BKUA 2W98A 2ZQZA 2GDZA 3W8DA 4NR0A 4OOEA 1UZMA 4IDGA 1BDBA 1VPDA 4RQUA 5DCYA 4PVCA 3QVSA 2Q4EA 2VTDA 4K6FA 1H6DA 3Q3CA 5F5NA 5G4LA 4YJGB 1YVEI 1PQUA 2O4CA 3KTDA 1YKFA 2DKNA 3RBVA 4XYLA 4OQZA 4NI5A 3LF2A 5TQVA 4BO9A 4ND4A 4K9DA 2VOEA 3KM0A 1HYGA 3X2EA 3JQAA 3JD4A 3WMXA 2Y1DA 5H82A 4E30A 3GAFA 1M66A 1OC2A 2PK3A 3OBBA 4HWKA 5A9SB 4OO3A 3VH4A 5JLAA 4NIMA 3W6ZA 4DXHA 2AG8A 4Q3EA 2C29D 4J49A 1XKQA 4MOWA 4PG5A 3B1KA 4RF5A 4BMSA 2ZJ1A 3KZVA 4YAEA 4EJMA 3BTOA 3VC7A 4F6LA 5IDQA 2YUTA 3KYCB 4ZQEA 1QORA 1GFSA 1J49A 1LDMA 3L4BA 3PJFA 1NPDA 4IMRA 4RPHA 4BS9A 4EUHA 1EBFA 3I4CA 1ZMOA 3DMTC 1HF3A 1YDEA 4YCAA 3WGOA 4NJMB 2CZCA 3GNQA 1KBZA 5BNTA 1PR9A 3UF0A 3FR7A 4L4RA 4UAGA 2VRCD 3GRKA 4IDCA 4DL9A 1DXYA 1QLHA 4IZHA 1Z82A 1KIFA 1UXJA 3V2UA 3VDRA 4BQPA 4IDDA 4UVHA 4E32A 3T7CA 2OP0A 3FPLA 3D3WB 5JSFA 2ZB8A 2PD3A 1U2GA 3HFGA 4NBUA 1ZCJA 4XZ3A 3WJ7A 3AW9A 4OHUA 2OHXA 3QVWA 4D44A 4YAKA 2V6GA 4YJDA 4MVJM 1EZ4A 1YDWA 4D0SA 5K0ZA 2J5RA 3NJ4A 4U5QA 4MVJE 1SCUA 3QVXA 4WUVA 1I3MA 3OECA 5IF3A 5EN4A 1DRVA 5BR7A 3V1UA 3GN2A 2YDXA 2HO5A 5K9ZA 2IEBA 3JQ9A 2GO1A 3CSDA 4YB8A 1ZK1A 1R37A 2JCYA 2VHZA 5EQFA 3GDGA 3NJ8A 4KDFA 4A73A 5A1TA 3VH3A 4RL6A 5K6AA 1LX6A 4MINA 4BHTA 1C1XA 3KRTA 3NTRA 3SX2A 2QRJA 2BF7A 3PI7A 2HK9A 3HWRA 3DBHA 1AN9A 3OQ6A 2LDXA 4A26A 2W2LD 3C1AA 3F3SA 3KUXA 1N7GA 4WCFA 4RJTA 1RJWA 3GQVA 1J0XO 1PU2A 2C07A 1PGNA 3JQ7A 3RBZA 2RAFA 3ZWPA 3CINA 1IY8A 4C7KA 1X7DA 1NBOA 1WAMA 4CQMD 3R3SA 2H6EA 3I1JA 5L3ZA 4K6CA 4ALJA 5JY6A 3HJAA 4KUHA 4RLHA 3HDJA 2H5LA 1FMCA 3NKLA 2VQ3A 1QYDA 5H83A 2I76A 2E4AA 4IQGA 5CAEA 2HCTA 5G0WA 3O26A 2BFPA 1UAGA 4HADA 2C7GA 2DAPA 3P5SA 3WWZA 3AWDA 3X2FA 4PLHA 1P1HA 2CD9A 4MVJF 4K1LA 3UAGA 4BB6A 4CQLA 1NHGA 4EYEA 1ZXBA 1LA2A 1T4BA 3MOGA 1N92A 5DT9A 3T7EA 1DFGA 2FR0A 2FPGA 3ZHBA 5A4DA 1LDEA 2EP5A 3W1VA 2D3TA 4NFSA 4AVYA 1LQUA 1IE3A 5JAIA 1LSUA 2BGKA 2C2XA 5FWNA 1PJBA 1VE9A 2ZYGA 1E77A 3LLVA 1E3WA 1G6KA 3ZV4A 1R4MB 4YJGA 2NSDA 3I4FA 2VWQA 4XJSA 2IYPA 3I9NA 4IBOA 3RUAA 3WGTA 3WGYA 4FFMA 3EZLA 3R6DA 3PIDA 2EEZA 1DRWA 4FPXA 2I3GA 4E2WA 1U5AA 1Y6JA 4JGBA 1SBYA 3FSRA 3L0DA 2WE8A 1GCOA 4II3A 4DVJA 5A9SA 1A72A 4J4TA 5HS6A 3HZZA 3B6ZA 2JD1A 3LT4A 5L7YA 4L0QA 2GZ3A 4LSMA 4BL5A 3KYCA 1XG5A 4D3FA 1MGOA 3AI2A 3IAHA 3TWOA 3G3EA 5CP8A 4CM9A 2CDAA 2NM0A 3P2OA 4FJ1A 3B20A 3WS7A 4J4HA 1E5LA 3K96A 4ND3A 1O8CA 5I8ZA 5DULA 1NFRA 4NJMA 3H5AA 3RUCA 1R6DA 3VTZA 2GASA 3IP1A 2C2YA 4BGEA 2C59A 4A2CA 1ZKMA 2FHSA 4I9UA 4M87A 2QG4A 2TMDA 1ZO8A 3D3WA 2J5KA 3V1YA 2V65A 3RC9A 3G49A 2D4AA 2X86A 1XYGA 4ILKA 1K6JA 4S1VA 3WYEA 3WIEA 2BKAA 4IUYA 2X0JA 4UULA 1DBVO 2AXQA 3DBRA 4J3FA 2Q99A 2X58A 3ZV6A 2VWHA 5U9CA 5KWEA 2CNBA 5BSHA 2YZ7A 3VKVA 1DFHA 1RM5A 5COAA 4BNJA 4FC7A 1DRUA 4I9HA 4QT0A 3KLPX 3S2GA 3IL2A 3IJPA 4DBZA 3AU8A 2Z95A 3LQFA 5T64A 1IPEA 3K8ZA 4HUJA 3VHRA 4RORA 1EQUA 3N7UA 5TIIA 1SC6A 1XGKA 1DC5A 4ZQBA 4BV9A 3GA0A 3CTMA 4I5DA 3DHNA 4M8SA 4QUKA 3ZWXA 5IZ4A 4D41A 1R15A 1A9YA 3JSAA 1QYCA 4E2ZA 4IMPA 5ES3A 3CKYA 2CY0A 1FDTA 2FSSA 2NTNA 3MWEB 4E13A 2Q1WA 2V6MA 4PN3A 5AQ1A 3ROMA 3FTNA 5G0SA 1YXMA 4N5MA 1KVQA 2X5KO 1UXKA 3GHYA 5EMHA 3JQFA 4WLEA 3KYBA 2B35A 4B4OA 4XB1A 1ISHA 4AJEA 4Z6KA 1NQ5A 3PJEA 4Q3NA 1C0LA 1CQIA 1PIWA 2A92A 2X9GA 3C7AA 4D42A 1H93A 1I3KA 1GUFA 4J7CA 4LN1A 4S3MA 3HB5X 4WLVA 3BMOB 5BSEA 1J4AA 1Y8RA 1NASA 3D4NA 1E1MA 1O95A 2VYVA 1V3UA 1B15A 4FN4A 5ER9A 5JBIA 3F1KA 3KETA 4NU5A 3RBXA 5A9RA 1VC2A 2C7VA 3BHJA 4FC6A 4RZHA 5KNLA 1WLYA 5DCUA 4TKMA 4RQTA 4Y6SA 4OJNA 2FZEA 1NP3A 4RVUA 4UVIA 5JC1A 1N2SA 4KOAA 3GGOA 1LXCA 1SOVA 3H5NA 3K92A 4XR4A 1WMBA 1B8UA 1JWAB 1O5IA 5KVCA 1FK8A 5JDIA 4XQCA 4HFRA 2ILTA 1R4MA 4KDEA 4WE3A 5THQA 1SO8A 5CDGA 3BTVA 3VZSA 1MFPA 4W9NC 1A9ZA 1UP7A 1TI7A 1P44A 4J2OA 3DHYA 3U4DA 4OYRA 1E7SA 3PGXA 3FNHA 4CM9D 2VUSA 4Q3BA 3IOYA 3FBGA 2GCGA 3I3OA 4OMUA 1YQGA 2ZCUA 3KYDB 1KVRA 4WK6A 2ZQYA 3CZMA 4LVUA 3GDOA 3KSZO 1YBAA 3SC4A 4MP6A 4PLVA 4XYGA 5IXYA 3OFSA 4PCVA 2IYOA 4AJLA 1P45A 4XRRA 4CMBA 1CIVA 2R00A 1ISMA 1JLLA 1P77A 1I33A 4DQXA 3HQ4O 5EERA 4L74A 4QXMA 4NZ9A 3PQEA 5TC4A 3R0IA 4QQRA 1NXQA 4P8RA 4W4TA 4PFJA 2A35A 1XIVA 2IZZA 2VZ9A 1M67A 3KEOA 2G0TA 4BMVA 1E7QA 3K2EA 2VTEA 5G0TA 1XU9A 4GGPA 4A03A 3ETEA 4ALLA 4E0BA 1ZW1A 3DMYA 2EV9A 1R12A 4Z0TA 4DIFA 5JAZA 2P4QA 4CMJA 1M2WA 5HTOA 4BNWA 3RKUA 3DBVO 3L4BC 4XWYA 2VUUA 2GUGA 2EKPA 5KOIA 4E6PA 1NWHA 4IPTA 1LRLA 5FFFA 2QW8A 3VPXA 1Q2XA 2DM6A 3AI1A 2YHUA 1R4NB 1TA4A 1ZEMA 3GVIA 3KO8A 3DOCA 2NVUB 1KEPA 2X5JO 3VOSA 2G82A 3U09A 3F5SA 2PTGA 1GV0A 2BFAA 5TT1A 4GVXA 4DLAA 1NFQA 2TMGA 3S2EA 3KV3O 3S2IA 2W4QA 3WYBA 3CIFA 2O4UX 3A14A 4D0RA 4R01A 4EJ6A 1YQXA 4R54A 1YH3A 3EVTA 2VT3A 5B4UA 4L8VA 5IJZA 2LDBA 3GDFA 4TSKA 4KWIA 4MVJH 1PZFA 3K9QO 4WJZA 4BQRA 3R1IA 1WP4A 4HBGA 3IMFA 1UR5A 3AI3A 3RUFA 4Z0HO 2J6IA 3RFXA 1E3JA 3VH2A 4CMIA 2UV8A 1TEHA 2AQHA 4W82A 2AEFA 3JQ9C 1WVGA 4JP2A 4RVGA 4P22A 5JYEA 2VT2A 4I5FA 2DQ4A 2X8LA 3HNPA 1U2DA 3D0OA 3AUUA 3RVDA 4ZQGA 3I5MA 1HE4A 1UZNA 5IN4A 3GNSA 2DVMA 3ZW9A 1Y9EA 4G65A 4Y8VA 2P4HX 1PJLA 1BHSA 1YB1A 4YACA 3ZGYA 1EVJA 3D5TA 2AHRA 4PLTA 5I9NA 1O89A 3H6KA 1ENOA 3U4CA 3PFWO 4B3IA 1Y8QB 5U1PA 3LC1O 4RF4A 2I66A 3H5RA 2DTEA 4GMGA 2OZPA 4BNNA 3QVOA 4L73A 4CQMB 2BD0A 4BB5A 1F12A 1W6UA 4KMSA 3BMOA 2Q4BA 3EHEA 3U4IA 3NV9A 2DUWA 5KTKA 1PEDA 2YV3A 2FWMX 3ETDA 3JYQA 1RM0A 1YS4A 4FDAA 2GERA 2HKIA 3QWFA 3INTA 4NMHA 1EDZA 1MG5A 3UUWA 4R16A 1V3TA 2J3KA 4HV4A 1LSJA 4II2A 1J5PA 3NTQA 2YV1A 1F06A 1UDAA 3EK2A 4NFHA 2AMFA 1C0IA 2P9GA 4L76A 3WXBA 4WCDA 5A02A 2Y1FA 5F5LA 2WMDA 4WNCA 2ZB4A 1E6UA 4DIBA 4JROA 3UCEA 3PJDA 3IUSA 3ZCXA 1N5DA 1YL7A 3PHGA 4HFJA 1PL6A 2GR9A 1HDRA 2PD4A 1QG6A 4AJ4A 3WLFA 4IQ0A 4LVCA 1JA9A 1O0SA 1GUZA 2FN7A 3KYDA 3EYWA 4FOOA 1GZ4A 3GY0A 2XAAA 2I9PA 4A7PA 4GWKA 4E5YA 5B4VA 4H7PA 4K28A 5IZCA 4HXYA 4YBZA 4FJ2A 2O3SA 3ZWNA 4INAA 2Q1TA 4ZD6A 4OQYA 4IJVA 1XR3A 3OF2A 3FD8A 4I5EA 4DQVA 1OAAA 3ZU3A 5EQDA 3D7LA 5HS4A 3MTJA 4WLFA 3EDMA 1EVIA 1TXGA 1N1EA 2I3AA 5CPBA 1KS9A 2RHCA 2B5WA 2PR2A 3QE3A 3VPHA 4BNIA 4E5NA 1YWGO 3FRJA 4CLOA 2VWPA 2Y0DA 5DNAA 4YR9A 1Y5RA 3C85A 3W6UA 4CUKA 4MVJP 2E49A 4OIMA 2OFPA 1I01A 2HRBA 3COSA 3AFMA 4FIZA 4JBIA 2Q50A 3U4HA 1SOWA 1T4DA 2UYYA 3KVOA 5GMOA 3UHAA 2CF5A 1E7WA 2UVDA 3E18A 3PHIA 1F8GA 4KWHA 3UCFA 4DC0A 1BG6A 4U0KA 5DBIA 1CYDA 1R4NA 2NVUA 3C8MA 1V3VA 1S6YA 3IKTA 1CQJA 1GYQA 3PYMA 2JD2A 1T1SA 2Y67A 3PLNA 1DPGA 1SZJG 4E4YA 1PGQA 4WPGA 4OXYA 4D43A 1Y81A 4I9NA 4PRLA 4O63O 1LNQA 3Q9UA 3HN7A 2NU7A 3NTOA 1HLDA 5CHEA 4BO2A 1UJMA 3MTGA 5BNFA 5AVOA 2QQ5A 4CM1A 4OSOA 1BXGB 2G17A 2OBNA 4XR9A 4EUEA 3OIGA 4NQZA 3ETGA 4WCFB 1ZFNA 2IRWA 4O6VA 1EVYA 5HBRA 4NH4A 1B0AA 1X0XA 2FMUA 3ZNOA 1L7DA 2YY7A 4ALMA 4B8ZA 2Q46A 1JAXA 3I52A 7MDHA 4W7HA 3INRA 3IQDB 3E5RA 1F14A 1O6ZA 4F45A 2WDZA 2NU6A 2PWZA 2OXIA 1HDOA 3VZRA 3AOEA 3CE6A 3DAPA 3H2ZA 3JQDA 3TOXA 1GD1O 3H9EO 2O3UA 1Q0LA 4BMNA 1UAYA 4R5MA 4YT5A 3B1FA 4LGVA 4OKIA 2W2LA 1LLQA 3N74A 1MC4A 3GUYA 4FFPA 3U3XA 2NADA 1M75A 1Y8QA 5C7LO 3RUIA 4GX0A 3CUKA 4NDNE 4G5HA 4IGFA 1ZMTA 4DGSA 2RH4A 5JMWA 1B26A 2RIRA 3OJFA 4I1IA 5ILOA 3WGIA 4ALKA 2BGMA 1PS0A 3UKOA 2C5AA 4DREA 2D0IA 1ENPA 4NPCA 4TZKA 4BNZA 3JQFC 5KJ1A 1VJ1A 3DZGA 3SBOA 3LU1A 4PLZA 3M1LA 4YT8A 3PZBA 6ADHA 1E3WB 3WLEA 4WASA 2F00A 3Q0EA 3ZNPA 1E0DA 2ZTMA 2EHDA 1DC3A 2J3JA 2VHXA 1PZGA 3F47A 4QSMA 3JQGA 3NT5A 4MPDA 4QO7A 4KTTE 3ZWCA 2Y99A 3PIIA 1UUFA 5JE8A 3Q9NA 1X7HA 3C7CB 4CM5A 1GYPA 2CFCA 4DPKA 1ZUD1 1GUYA 2GZ1A 4XDYA 3TZCA 3GK3A 4JBHA 1B16A 5T8KA 2POQX 3HADA 3GNTA 3HDHA 4YJFB 2NLOA 3L9WA 3T4XA 4ZRNA 3NEPX 5KJ6A 3H9UA 5JDIC 3AY6A 3TZQA 4PG7A 3WG9A 4BKOA 4CMEA 1WDMA 2IZ0A 1LRJA 3GPDG 4R1NA 4RLSA 1T1RA 4B79A 4M86A 2FP4A 4WOJA 4BO4A 2EGHA 3I9KA 4UUPA 3L9XA 1JKJA 1LBEA 3HFSA 2ZCVA 4UVDA 8ADHA 4RPLA 4HFNA 5KJFA 4GX2A 2NTVA 1EQ2A 4IXTA 1P1RA 4JJIA 1HDXA 4U6QA 2HMWA 2ZJ0A 3F46A 3NGXA 4FFRA 4BGVA 2QZ9A 1E92A 2WYWA 2HSDA 3PFFA 4ZVVA 4AJOA 2Q3EA 5A03A 2I67A 4GQAA 4TQGA 2AA3A 3HSKA 1PJ3A 4NK5A 5MGBA 4ONEA 1P74A 3DHEA 4J1NA 3E9MA 2W90A 1FXSA 5JCXA 2O3RA 3DBRB 3U62A 5JS6A 4BO7A 2JCVA 2PGLA 3JYPA 1CERA 1W73A 1EE9A 4KZPA 5G4KB 3E03A 4C4OA 3QV1A 1EVZA 1H9BA 3CPSA 3V8BA 1C1DB 1Q1NA 2O3TA 3BMQB 3CMCO 4QX6A 4TWRA 1LC0A 2NQTA 2WYVA 5T5QA 1N9GB 4Q3AA 4RPJA 3QWIA 2GN9A 2ZB7A 4EEXA 5JXWA 1H2HA 4GGOA 2P5YA 2V6FA 1R66A 4FQ8A 1I24A 1BXGA 1GZ6A 1D1TA 1EK6A 1T26A 2B5VA 4GKBA 5C37A 3DZBA 3K30A 2B4QA 2PV7A 1H6CA 1I5RA 3Q6IA 3AY7A 4PLFA 4M55A 5JDCC 4BV8A 2HK7A 2AEJA 3H9GA 4WOKA 5GZ6A 1PZEA 1SEVA 3IDSA 2C5EA 5KVVA 1Z6ZA 4OXKA 3WBBA 1LTHR 1K89A 2PD6A 1VL8A 4Z0PA 4CM4B 4IXWA 3DC2A 5AXDA 3DQPA 2QX7A 1PGJA 2EG9A 1Y8RB 1JDJA 1PZHA 2AQIA 4GLLA 1EBUA 3DR3A 3FTPA 2X7HA 2DPGA 3GZNB 1H6BA 5KKCA 3C1TA 4JLWA 4C7JA 3M1AA 2YFQA 3ANMA 1X1EA 3GUCA 1I3NA 1P31A 3LVFO 1CEQA 4GKVA 4XB2A 3V5NA 3WMWA 4CR7A 1IPFA 1C14A 5F1KA 2CVQA 1YGYA 2WWRA 4LISA 4RCVA 5ITWA 2F1KA 4WLNA 3AUAA 3Q1LA 4FD3A 1P1KA 2EW2A 2O23A 3MJVA 3FNEA 1L7EA 3LYLA 4RDIA 4YT2A 1SB9A 3ITDA 4GLOA 2NUAA 3UGKA 2HU2A 4ND1A 4DWVA 5JAMA 1PTJA 2P2SA 4NK4A 1DB3A 2Q45A 3ZI0A 1ZSYA 1RWBA 2SCUA 1M76A 5BNIA 3V2HA 4BNVA 4RF3A 2D59A 5HRUA 5TSDA 1YL5A 4BNLA 1TT5A 1ZK0A 1BDMA 4J0FA 4XCVA 4YJFA 1UXIA 1ORRA 3WOHA 3PLRA 2Q1UA 2Q1SA 3ONDA 1N7HA 3D5QA 4PZEA 5HWSA 1X14A 4B8WA 4CM7A 3DBLB 4HY3A 3DTTA 1NVMB 3RJ5A 4YXFA 2Y0CA 2RHRA 3GT0A 4M54A 1NQAO 4MKZA 5FI3A 5KVQA 9LDTA 1Y7TA 2IODA 1B3RA 1PJ4A 1KC1A 3K6JA 1JKFA 3OIDA 1Z73A 3PQDA 2VNSA 5A04A 3SC6A 3RWBA 1BGVA 4N18A 4CM6A 3QWHA 3U5TA 3P7MA 4JJFA 3ASUA 5L51A 2QZZA 2C0CA 4AJIA 3KB6A 3ZWAA 1ADCA 1LJ8A 2GRAA 3ZHZA 5DCWA 3SEFA 5A5FA 1GYRA 2DT5A 2IXAA 4JN6B 3DAFA 4AG3A 3RASA 4KUGA 2PKQP 2C82A 2G1UA 5DDIP 3L07A 1K6IA 4RPGA 4JBGA 3AJRA 1GCUA 3QHAA 3DL2A 4A5OA 4XQ9A 2PNFA 4CV0A 2FSVA 4W6ZA 4J4BA 4ZHSA 1NWCA 1K2WA 3P19A 3ZN2A 5G4KA 2Y93A 2PKQO 3S8MA 4GBJA 3STHA 4MKXA 3NGLA 1UXHA 1BMDA 1GQ2A 1C1DA 4WEQA 2OORA 3WSWA 2A94A 1QYWA 2V6BA 2GN6A 5CG1A 3BMQA 1EEHA 4BGUA 3UICA 1SPXA 3ZNQA 1ADBA 2OP1A 1OOEA 1N9GA 3EW7A 3VDQA 1X13A 3KOUA 5CEEA 1KEWA 4NFYA 4J0EA 1WPQA 2JHGA 4HFMA 3D4OA 3BA1A 3TZKA 2XOXA 1T2FA 3FHLA 4CMIB 4Y67A 1G0OA 1UXGA 2IZ1A 3QLJA 4GPD1 1ZH8A 1PWXA 2JCXA 4XX0A 3QJ5A 1BW9A 5KVSA 1G0NA 3MJEA 2CUKA 3DOOA 3LDHA 4DC1A 4GX1A 1NPTO 1UP4A 4D3SA 4E5PA 3PXXA 3E6AA 2HMUA 1IULA 3PGJA 3H65A 1RM3A 4KUEA 3WFJA 3KHUA 4HNGA 1ID1A 3DEYX 4FB5A 2EW8A 4WLOA 4BO8A 1U3WA 1DHTA 3ONEA 5L45A 1E3LA 2GSDA 4CM4A 1LUAA 3WNQA 5IFLA 3F5QA 3S1LA 1PR3A 4XIYA 4WKGA 4ZQHA 4Y9DA 4J2HA 1XELA 3ABIA 5TJHA 4YAJA 4J1QA 3OJOA 1R16A 1LLDA 2JFFA 3GZNA 1HSZA 1KVTA 2EKQA 2O2SA 4BNTA 3SLKA 4BO5A 2B4RO 4IGEA 4E2YA 5TLSA 4B3HA 3NRCA 4B4VA 3JQBA 5GY7A 4L75A 4U6SA 4A0SA 4G81A 3IC5A 2ZB3A 1GPJA 4QECA 1GAEO 1I3LA 3OH8A 4OGWA 5A3VA 4BKQA 2A4KA 4W99A 3U9LA 1E7RA 3EVNA 2XXJA 2UUPA 2PH3A 2QYTA 3QY9A 5AXAA 1C0PA 4Q39A 3WGGA 1EMDA 2OGUA 4JCOA 1Q7GA 2B0JA 1GEGA 5A3JA 2GLXA 3HHPA 1A7AA 1T2DA 4CJXA 2WD7A 1KVUA 1EUDA 3MJCA 4IJWA 2OMEA 4HP8A 3OJLA 3W8FA 4DYVA 4DYDA 1GPDG 1H2BA 2Q2WA 3DTYA 1Z45A 3NUGA 5DF1A 3KLMX 4UEOA 1JVBA 4PLGA 2DBZA 3ICCA 1T25A 3ROQA 2UUOA 1ADFA 4XGNA 4DMMA 3DBLA 4TVOA 3OQBA 4OH1A 5GZ3A 1PS8A 2ZTLA 5IN5A 2BELA 4LMPA 1ARZA 3LT1A 5ICMA 4RDHA 4CM8A 3JQCA 1E1NA 4IIVA 2EJWA 1DEHA 1JW9B 2P91A 3LT2A 4I8XA 2G5CA 4FGWA 5T8KC 3G1UA 3L6EA 1PJTA 2AW5A 3BXXA 5DOVA 4CLOB 3MWDB 4CLXA 3D4PA 3FI9A 2EKLA 3GC6A 1IB6A 4R5HA 3WR5A 5I7SA 1BVUA 4KTVE 3OEYA 1ZEJA 1F17A 4CMEC 4E5MA 5LC1A 4CLHA 3A9WA 4ZA2A 1Z7EA 2VOJA 3PHHA 3Q11A 1U5CA 1ENYA 3ULKA 1SNYA 1FDWA 2AG5A 3PJGA
chains in the Genus database with same CATH superfamily
1RXWA 1OA0A 4NHEA 2PMKA 3EH2A 3OHSX 1X8KA 1CVIA 1MP0A 3PEVA 5EL0A 1YB6A 2XCOA 1CRQA 2WABA 3EWSA 3FPEA 4N8EA 1TCUA 5IDVA 5DWVA 4TXHA 2NZXA 2HJSA 2IGBA 2NU7B 2P2CA 3CH5A 3NFYA 3NAQA 3PYLA 2GYYA 4K6GA 2PUVA 3E58A 4PNPA 4WGFA 4V0QA 4XUEA 2PH7A 3U7JA 4AMBA 3OM9A 3E7PA 4EG7A 2BFCA 1KZYC 2C96A 4OMFG 3TEFA 4BHTA 2NZ2A 2N1BA 4RESA 3FA2A 3NHFA 4KOEC 4WY2A 2J3DA 2BIFA 3G7NA 5DGXA 2QS9A 2Y1WA 3KT3A 2FF7A 1XZDA 4DKXA 1IATA 1QKIA 1WZCA 2XIJA 3WLIA 1ETHA 5JVDF 1VGVA 2PBRA 2R4QA 2A8YA 1M5RA 3KXDA 5BN1A 4MI1A 1UDCA 2PLAA 3HNOA 4N5HX 4AICA 4RY2A 4GSLA 2VP3A 3TUJC 2JAXA 3ZH2A 5K0FA 1D04A 1XAJA 4M49A 3EXG2 5D87A 1LK5A 1CKEA 3V3TA 2VUTA 1VBMA 4G5XA 2G4VA 5FJIA 3ZYZA 1KWGA 1Z2AA 3MBOA 3OWHA 4KPUB 4JIGA 4R68A 4EG8A 2V3VA 1R0BA 2PR7A 3MEQA 5A06A 5B12A 2XDAA 2E5FA 4QRHA 2ANBA 3IUMA 3VVBA 1QTNA 3WGHA 4MVCA 4OBXA 1U9ZA 4AG6A 4F4UA 2MMCA 2QUAA 4FQ5A 4YRKA 2FN9A 1DWOA 4O4HB 2YASA 4FHZA 4MUAA 1K6EA 5DI9A 5ES4B 1E5TA 4X92A 4E33A 4EFLA 4MYSA 1X7GA 2GM9A 5L4NA 2ZAMA 2WINI 2CCGA 4LXTA 4X6UA 4JX8A 1ZGJA 3TNYA 1L4MA 1QFZA 1W0KA 3VAZA 4AMZA 4ZI5A 4PG6A 5FTMA 5KNDH 1N5RA 3O31A 3JATB 2AC4A 3ND7A 1DKMA 3ZTYA 4AUEA 1FF9A 1X7WB 5CA0A 2X2EA 3ZZTA 4GMFA 3T9EA 4HX5A 5H5JA 3AFOA 4ROSA 1H2FA 2P6UA 1GCAA 3R5HA 4ZI3A 2JARA 3SJUA 1EVLA 3D1LA 4MLDA 3RLFA 4A15A 1OF1A 5AVKA 2Q3HA 1QU2A 2GA8A 3DZJA 2BTEA 3WTBA 4DQUA 3MJSA 1XRLA 2YH2A 3HCCA 4CKWB 1CUEA 5CW2A 4HVCA 4L4ZA 1AK1A 3S70A 1SBIA 3CVOA 1AQNA 3O1HB 3L84A 1FW6A 2WPDD 4DRYA 1C1HA 2NO0A 1OWOA 1TB4A 2JGNA 3MWFA 4LI0A 2AMJA 5DYTA 4D4MA 3P5BA 1GY8A 1DIAA 7MHTA 2WAOA 1JHZA 3EVEA 4D45A 4X3CA 4OP1A 3RVQA 2XNCA 3VSBA 2JIOA 1A76A 1D6JA 2AEMA 4ZVOA 2ONYA 2ZR7A 5TF0A 3X43A 1KP9A 4RZQA 1NTOA 4IVPA 4NBKA 3SNKA 3ZK9A 1X7YB 5G2OA 3ZQJA 5JY1A 2WT4A 1S4QA 1PQYA 4FSHA 3L41A 3H0CA 4W5OA 2FZWA 3LGAA 4UXHA 3OTHA 1V1JA 4RVHA 4TROA 1Y8AA 2BW0A 3PNMA 3FGOA 4LGMA 3VR4A 1RLJA 4JVNA 3VKHA 3RNOA 5ED4A 2FR8A 3AEUA 4G56A 2QXTA 2QL6A 3O82A 3DL7A 4L3OA 1V45E 1PFYA 4YJ3A 5JJCA 2VLBA 3LT0A 2O50A 2C0PA 1Y3CE 1PEYA 2C61A 4FLFA 3RTEA 3GP5A 5F2NA 1Q0TA 2ZJ6A 2WEKA 2GAOA 3ELDA 3IBYA 1A8SA 3EJ6A 4EB0A 3ROGA 2R86A 2YOFA 4MVJD 1J8DA 2ZRKA 4LBWA 1IYZA 4Q15A 5FBQB 1BX0A 1R8YA 2C9ZA 4CV1A 2VP6A 5FX2A 3LO5A 3R0ZA 4WEOA 2XTAA 1E2IA 3HK2A 1XTIA 3VVCA 3CX8A 4CEHB 5EFZA 3MC1A 3ROFA 1TCAA 2J8ZA 1XMIA 1N6KA 3EQ9A 4P34A 1L1FA 4D9KA 4K9LA 4DG9A 3IUPA 3R23A 4EP1A 1TIBA 3E8XA 3TVDA 3RTDA 3ZXSA 4MUHA 1YFJA 4A0HA 2VVTA 2VNJA 2PFGA 3RADC 4P4SA 2BMAA 5DNEA 5B64A 1TTTA 1SQSA 4CI0B 3PEYA 4YRBA 1WW2A 3NVKI 4TVBA 3WTCA 3KQPA 4AZWA 5AW6A 1J6UA 3C39A 3ZLBA 3I09A 1AURA 1PNTA 1FSFA 1KEUA 1LI5A 1UJBA 1KVSA 2SKDA 2W0MA 5AJVB 5F51A 5FYDA 2YZGA 4XWTA 5DH9A 3T9CA 3I6QA 1PZMA 1WKVA 1T24A 2WUEA 3ABZA 4NYIQ 3JQ6A 3IDQA 2G4CA 3NYWA 4JI0B 2I22A 1J7JA 1NN0A 2X5OA 4C01A 2XPCA 2ZXUA 4ND8B 4KR6A 4A27A 2VYQA 1KZ7B 1SKYB 4HCJA 4C05A 4M0FA 1T2CA 2PH5A 5IJAA 1QZXA 2D00A 1NZDA 5K0ZA 1HMPA 3HCDA 4GT1A 4HHEA 4Y6RA 3WX0A 5BN3B 4RK1A 3WRXA 2FDXA 5L4LA 3RUHA 5HIIA 4RK6A 4JX9A 4RM3A 2H1FA 5AVXA 3DONA 4G5RA 3OEHA 4KI7A 2CMFA 1NAIA 1XZJA 5CDSA 1G2IA 1TFUA 3UUGA 1LK0A 3Q41A 3NTLA 4NEQA 4ASUD 5EJAA 4LJSA 4RTQA 4AUNA 4ZCMA 4AJHA 1EDOA 2J48A 2LUOA 4KPUA 4EPWA 2BYTA 3P97A 1AKRA 1SXJD 3WMGA 1E2DA 4GP9A 5JISA 1U0RA 2FEXA 2GCEA 3IIEA 4NONA 2IXBA 4ZVRA 5B58T 4B09A 5JCPA 1NI5A 3D81A 3A11A 3ZWBA 1VIYA 4ETWA 2X9NA 4DZTA 5LP6A 1P81A 1IU9A 3CNNA 1EVEA 2PL1A 3D3NA 2HSEA 2AQKA 1X2BA 1YL6A 1YV9A 3CUTA 4O4HA 2QVGA 2QRPA 3WYCA 2AX3A 3N8HA 4Q1VA 4UHDA 4Q4JB 5E4TA 2QVZX 3SY8A 3TIGA 3PLAE 2FETA 2YCLA 3JYNA 4AN0A 4UVGA 4YV0A 1CQXA 1LU9A 1EJ6A 2BFFB 4KRXA 3AM5A 4Z4CA 4RVSA 4CUKA 3D6HA 4DVGA 1YF3A 2Y92A 1CR0A 1JKMA 2HHHB 4D9GA 3IMGA 1EGQA 3JATA 5HDQA 5F98A 1DHRA 3G8BA 2YL2A 5E3JA 4ZXPA 3D3JA 2VF4X 4WFKA 2Q8PA 4LOAA 3FCEA 3QNWA 3UV3A 1UBGA 3ZTTA 2GMWA 2NUAB 4XPZA 5KQRA 1A9TA 5LL6P 4O2BB 4RVCA 1CWUA 3WFZA 2ZVJA 3A3PA 1YU6A 1HE8B 3O4GA 4FNMA 4EX7A 5EY5B 1E60A 4CKWA 1Q50A 2VJAA 2F2TA 4OBBA 1GFIA 2C20A 5DGCA 3DEHA 2GAFA 4OHOA 4XGRA 5KYGA 2H1WA 2PPLA 3KQSA 1RKUA 1P5ZB 5COQA 1YZKA 4MQBA 2HQ1A 4LY0A 4YHBA 4U6NA 3A9SA 1QSGA 1RLTA 3LHDA 2W6CX 4CDRA 4UUNA 2IDZA 4ENWA 3JW8A 2R85A 2WFMA 1C4WA 3P2YA 3GR6A 3TRDA 2WHRA 1UFQA 1Q95A 4BMPB 2IYVA 3D6UA 3C3BA 3DZHA 2IDKA 1T29A 1I7NA 1X7YA 2J09A 4ZZ2A 3M4NA 3OOSA 1SCQA 3A58B 4MUYA 1DCTA 2CV1A 1QE3A 4WGGA 2BLLA 4E2XA 2FPLA 1ZAYA 3S44A 3IQWA 3PGVA 1RQRA 4AZ3B 1U8XX 3I6BA 3K6RA 2O2GA 3VXKA 1X80B 4ID3A 2CYBA 1NBHA 2HIMA 2IA5A 1W96A 2NPOA 3ZJ5A 1AUPA 3TINA 1XQXA 2WG2A 3HO6A 5JZOA 3ZNNA 5EOVA 2DLDA 5L7TA 4NOJA 1LPPA 1UBTS 2Q5CA 3RFVA 1NTRA 2V4MA 4MW6A 2PWAA 1BGWA 2GM3A 3LA8A 1N6OA 3OM1A 3QXXA 4GKJB 2XIQA 2J33A 2RGUA 2PPVA 1MXFA 1OXBB 5BT8A 1V9SA 2R4TA 2BCJQ 2FQYA 3AFGA 4GVLA 1JAYA 2G09A 3RJTA 3U7EB 1C8VB 4CCWA 1CNFA 2CHUA 2BHTA 3BG5A 4HQOA 3BJMA 4BMZA 3V8NA 4ZFNA 3LDFA 4CEHA 3FB1A 2UAGA 2QI9C 3DGEC 3SHWA 5D7NA 1RXCA 2I8CA 3C1UA 3C70A 1IN6A 2W6ZA 4J75A 2GN4A 4LBVA 4AM8A 1SC9A 1P4RA 1DAFA 3H6GA 5IVKA 1QGDA 4EBBA 2RD2A 2VP2A 1B74A 5B1YA 4LK2A 4I46A 2NPIA 1KO8A 2GVDC 4PPFA 4LFCB 3R3JA 4F5WA 5FUXA 1X1CA 4MYUA 3BFKA 4MP8A 5LA6A 4L50A 3TGWA 3ZWWA 2O2CA 1SVMA 1QAMA 2JGMA 4FHCA 2NVOA 4LDQA 4KFUA 2WTUA 1MW8X 2R1ZA 1JA1A 3SQOA 4I3FA 5TT0A 1N5MA 2ISQA 3HCPA 3FOAA 2MTBA 1PUXA 3T35A 3TTTA 1ZRHA 3EPHA 3GMSA 5F7ZA 4FYXA 3ZBTA 3MCVA 1TECE 1UOPA 2VQSA 2ECFA 4FJ0A 5HCUA 3IXMA 2CGEA 1Y4DE 1FOEB 2DWCA 1L5YA 2VCYA 4GOLD 5JJLA 1AV7A 4NPAA 2WSMA 2LIPA 1NSFA 1SVKA 1ZCAA 3HV2A 4DUPA 5AW3A 1Z35A 5BN3A 5IAAA 1DXOA 1JSXA 2FOXA 2JJ8A 1Z75A 1B8OA 2IFTA 1C8BA 3LW7A 1HDCA 4JC0A 1SKBA 4DDUA 4MKHA 5GWXA 2FKNA 5CXQA 3B6IA 1NV9A 1KZHA 1L8AA 2QI9F 3DD1A 1P3Y1 1LLCA 4E5VA 3SHQA 1AHIA 4UPVA 4ZCSA 4HDMB 1I32A 4PVDA 3AEQB 1F2TB 1ULUA 3FWNA 1SWWA 1QP8A 1Z08A 3N8IA 1IJBA 3DMGA 1DO8A 2V7VA 4OB8A 4BUCA 4XEHA 3KSUA 4EA7A 4EHBA 2UUCB 4MVJI 5EE1A 3O1JC 1AQYA 1U8FO 2ZUFA 1X42A 3WDMA 4Q4JA 1ENZA 3RU7A 5AJTA 2AX4A 5KTSA 3ROKA 1OA1A 1MJHA 1QZZA 2E85A 3ZDFA 2BFFA 3R6LA 2HU7A 1HM5A 1PD1A 1GU0A 4ZO6A 2RJNA 1KE2A 5JZBA 2Q2VA 5E3HA 1YQDA 2P6PA 1I1HA 3H4TA 2QDKA 5ED0A 4L4YA 3A2LA 1ZUNB 4G5OA 3LL7A 1GGKA 4BOYA 4KQMA 1C9KA 1T5BA 4B48A 2HJGA 1E2PA 4CRWB 2RG7A 4FFVA 1UEXC 2QSYA 3ZWYA 1UP6A 4GR5A 2IUYA 2UDPA 3OCZA 4EI2A 4I1PA 3VI3B 5AVVA 3FZQA 4GFDA 4LYFA 3JQAD 5BP7A 2A0UA 4WESA 3SOZA 2A9FA 1TEVA 5EZ5A 2RHLA 1J2RA 3DDNA 3IOEA 3K20A 2COUA 3PXDA 3Q8XB 2WD7B 1OYOA 1YA8A 4K8OA 4KMMA 3ZYCA 5F4ZA 4AZTA 4E31A 4EHKA 2CV0A 4O3FA 3EA0A 3HXKA 3COYA 4J1TC 1OPXA 1RYZA 2Q8NA 4GUDA 4RX1A 3I5XA 2IHNA 3I0MA 2Q4DA 3KB2A 3UA4A 4CV2A 1A0OA 1S8NA 4ZYYA 1JDTA 4E5UA 5LLDA 3L8GA 3DNMA 1QANA 5I9TA 4IDHA 1IY1A 1TQ8A 4XIIA 1UDBA 1HDIA 5KNBH 2D1QA 4QVGA 3VC2A 4YPVA 4BGIA 4X95A 1IY9A 1CJMA 3G5LA 3W4JA 3RQIA 2I2CA 4U39A 1G7SA 4X65B 4N5LA 2A9OA 2CMHA 3W3AD 3H04A 4MRNA 2AKYA 1KJYA 5C1IA 3GG9A 1U81A 4AZ3A 4F3YA 1X3SA 4LMRA 5CGQB 3NQ41 4OXNA 5JADA 4MNTA 4BE4A 4HD8A 2KSQA 4EW6A 3BIXA 3W9BA 2PT6A 4E51A 4NG5A 1SQ5A 4IG9A 3B89A 4O5OA 3QKSA 5D6NA 1J20A 1VHTA 5FPPA 2EERA 2VJMA 1JEYB 2PLFA 2VL7A 4BLSA 2JIZD 4AL4A 1U9IA 3KR1A 4ER5A 4FHDA 2JPDA 2CVFA 1POWA 1DIRA 1CHDA 5BR1A 1ZWKA 2O06A 5KYWA 5HP4A 10MHA 1RWXA 4MYDA 2IEYA 1LLFA 3B1XA 3QFFA 1K88A 2BLNA 1WXHA 3Q40A 1XQWA 2IIBA 1U90A 1QG2A 4X97A 1UK9A 1PN3A 2WICA 2VNAA 1XQ1A 1P4JA 2HRRA 2ZULA 4MDHA 1WNTA 5AI9A 1IBLB 5H7XA 3GP3A 2IXFA 1KHTA 1NP6A 2FXVA 2O7VA 3DT9A 5IG2A 5JI2E 1QWOA 1YZLA 2GBFA 4JSTA 1N1GA 3P2IA 4Q3CA 5JR3A 1RWKA 4RSHA 5JC8A 2FNAA 2D62A 3V6LA 2DMRA 3WLQA 3ZGOA 1KFCB 4TTSA 3AI7A 4BNMA 2WJIA 3RO7A 4F91B 2ZTUA 3ONVA 3R5JA 1NU8A 3CEMA 2JFZA 1VJTA 4FYPA 2WY2D 5DYNA 1ZIDA 3GDHA 4WSOA 3QVUA 4TRJA 3T7JA 1N2CA 3NAMA 3UV6A 3AVQA 3W5VA 4D0LB 3PS9A 5AK4A 2YWHA 2HMSA 4IZIA 2XMGA 3TLYA 1SN7A 1ZNQO 2UKDA 3KQKA 3GVCA 3I9V6 3E9EA 3R3YA 1T8UA 2JKVA 4ZK6A 4D4GA 2AZ4A 3P9RA 1DOHA 5AVWA 4QNNA 4LXIA 3S2UA 3TF5A 3MJTA 4MV9A 3ZDDA 1KDYA 4M38A 2ZU6A 5G41A 1SKQA 4CTJA 4ZV9A 2O8BB 2WUFA 3QJYA 1IVYA 1F0NA 3AV3A 3QQPA 1HFEL 2HV9A 2IYZA 4IDEA 4JFRA 5JCJA 1JQKA 4QLOA 1Q6ZA 1KI3A 1DS6A 4KV7A 3VPFA 4XGKA 4J16A 2QX4A 2WWVD 1A8IA 3HN6A 4HDMA 4LNUA 1YTUA 5CUQA 1F2TA 4DLNA 1RQNA 5EIAA 3E9DA 4M83A 1W2HA 4LE0A 2RHMA 1XQVA 4HPXB 4Z4HA 1D8AA 3HDQA 2ZUTA 3VUEA 3TPCA 3ZTWA 3G1TA 3FETA 3I0ZA 1T1EA 2AR7A 1ZSVA 2JJYA 2GYWA 1NMQA 3S99A 4CKCA 1JH9A 2G40A 1UZLA 2EFGA 1O0CA 1SUBA 4B3JA 4WN3A 3RHFA 5EUQB 1EDDA 2CHEA 3CUEF 2YFYA 3DV0B 4YAUA 4ZZ0A 5ITVA 4X7PA 5ALEA 1Q20A 2EYUA 3ZWOA 1NQTA 2JD0A 4GDFA 4I19A 3LT5A 2VSQA 4C04A 5CG2A 2FPIB 2GI4A 4D8VA 4E12A 5HK9A 4ZDKA 2LR0A 2QU8A 2P8SA 3F9RA 4HUQB 1R4AA 3BJIC 2RI6A 3E23A 4PC2A 3C7KA 1WF6A 4PYQA 5ITZB 2VI5A 1A5TA 2DPMA 3SDSA 5AW1A 4MP3A 5ICCA 4PLYA 1DRJA 1EFRD 1U9JA 4MTLA 1D2HA 1HT0A 4Z9XA 1OIXA 1FVHA 1OIWA 1E79D 1XALA 1OXTA 1VIDA 4EIWA 1VMEA 3DT6A 3WI7A 1A2OA 4PG4A 4R4JA 5M3BA 3URKA 1NFFA 2OSVA 1D2NA 3EFHA 3R5FA 4CKEB 5BR8B 1YB4A 1W30A 3BCRA 4P33A 5JHHB 3ZD6A 3KZNA 3HJGA 3RBAA 4I36A 2FJUA 3DMTA 2XRFA 3UHPA 1F0KA 2O9JA 3ADOA 1VLQA 1MW9X 2EJBA 4M9RA 9ATCA 2I3ZA 1SMKA 1VMIA 3H7AA 4JLBA 4ZODA 3VC3A 3WQRA 1C7ZA 4PE5B 3FCUB 1XPJA 3BJZA 3LBYA 3PF8A 1PWYE 4HDAA 1LC3A 1OMOA 1V8ZA 2Z1MA 4KZKA 4AKSA 4CUJA 3C5EA 5AK6A 3MGKA 1OXKB 3N76A 4BE9A 5KCZA 4MIYA 1HK7A 1U99A 2O0MA 2GD0A 3A4VA 4FN5A 3H84A 4G84A 3SIRA 3ZXIA 2ZRPA 4PIVA 2XUJA 1WD7A 3QVLA 4NU6A 5ENDA 4R0VA 1T3ZA 4G07A 1E0JA 1ONNA 3IIJA 4Z7QB 3PL5A 5L4SA 1L7PA 1RP1A 2P9YA 1KMCA 4YRPA 4EHAA 4OHPA 2I65A 1HV8A 5TQJA 2VYFA 3R7NA 2XYRA 4MR7B 3TAHA 1IC6A 3AK4A 4ZVTA 3RCBA 1ZD8A 2AT1A 3DV9A 4IH4A 2YWFA 2I6TA 2VDKB 2PE5A 5F3WB 3ASVA 4L22A 4EABA 2D13A 2XGOA 4EY6A 3ZE8A 4BVFA 3LKZA 3GLGB 2OAP1 2VH2A 1FSPA 2FMXA 1JBQA 2Y4NA 1E8DA 1F2UB 1DIHA 1V5FA 2ORVA 3WJAA 4ZZ1A 1D3AA 3LUAA 2OO5A 5COBA 3WIUA 5TS3A 3EDCA 1VCHA 1EVQA 3PVZA 1T9BA 2GCOA 3EGXB 3GVHA 3EMKA 1THZA 2PCLA 2GAJA 3OURA 1B6RA 1WCV1 3AU9A 3AZQA 4R40A 4CFZA 4DLLA 4GLJA 1KH2A 2IHVA 2XUIA 2QQGA 1GNPA 2GD1O 3C8DA 2K6GA 1X15A 1ZD9A 2RGYA 3AJ8A 3BIFA 3KUDA 4DV4B 2B36A 4O1IA 2V98A 3IVXA 4LX0A 5BWMA 4LCEA 4ZCQA 1Z2EA 4LYGA 1NKTA 3MLBA 3QIVA 4D9FA 4EG4A 2GZ2A 1PL8A 2JF0A 2GX6A 3D6FA 3DCYA 4QGBA 3JRXA 3HBAA 3R7WB 4ND2A 3WGLA 1XE3A 1ZKDA 1E98A 3U3MA 4EEZA 5JDCA 3ROTA 4ZARA 3WGVA 4N1AA 1LFAA 1CY1A 1NJ8A 1XI2A 1JQLB 2Y1OA 3HDYA 2BBWA 1QRRA 3AR6A 3T1NA 1HMYA 1RI2A 3AIOA 3WDSA 1TZJA 4YP9A 3TCKA 1XA4A 2YOHA 2KLBA 4EO7A 1ZJWA 3WWPA 2A9JA 4DRZA 4GH5A 3WK5A 3K4QA 1UWKA 3LTEA 3NASA 2NVWA 1SKYE 2E48A 2PAAA 3FCOA 1AXGA 1OXUA 4B9EA 5B53A 3LY9A 1NUSA 3RKRA 2O8BA 2P62A 2CVOA 1CJSA 4C0KA 2FPXA 3HB7A 2YXLA 2PUFA 3RROA 5A9TA 4BV2A 2W6MA 3EGOA 4JNKA 4JLSA 1ZZGA 4Z5XA 2IEZA 5A5GA 1OI7A 4LK3A 1DWPA 2E4VA 4RTLA 5C5EA 4HDCA 3QLUA 4Z3KA 5KPDA 3ZE6A 2QMQA 3ZZNA 1AKTA 5EJMA 2W8BA 4OM8A 3ZU4A 1YBVA 4KBFA 1DQPA 3L7IA 1O77A 2DU8A 4XIJA 2ZSKA 1G9XA 1QOPB 3QF4B 1SZPA 1T3TA 3MTIA 4RABA 5BUQA 1L7OA 4YA6A 3QFRA 2A57A 3ETCA 5L8VA 4Y1RA 3GJ8A 4TXMA 2OZEA 3DAGA 1EVKA 1LZLA 4BAZA 1G5HA 1U65A 1VCMA 1NDQA 2I4RA 3KYJB 3I62A 5LB4A 3LXMA 3MGCA 2O3QA 2RJOA 2BTQB 2ODEA 1B2LA 4TLEA 1G59A 1K7CA 3H2BA 1EWTA 1PV2A 4FGSA 3HRHA 2X2FA 3LDGA 3TNDA 5LU8A 3PRHA 1OX4B 4LTMA 4HUQA 4JXKA 4F2GA 5F3RA 1IXZA 1VE6A 4U9UA 1VI5A 3VU0A 1FLVA 2R8BA 4K40A 5K8UA 5CFZA 2IZ5A 1HL3A 3EGDB 2B37A 2B5OA 3OJ0A 3ZE2B 5A0FA 3CQ9A 4P5PA 3SVZA 3C3DA 1IEXA 4I4CA 2M2IA 2IIPA 2ZVDA 1F6DA 4QPDA 2BRUC 2QIPA 3VKUA 1SPBS 2W2OA 4PC3A 4URHA 4WKCA 5ICFA 3FWYA 4JB3A 1CUXA 2VPWA 4C7XA 2NYRA 1RHJA 4H16A 3ZHRA 4CKEA 3FJYA 5BRNA 1QGZA 1D7OA 3M6IA 1Z5UA 3LPAA 4QXOA 1ODJA 1ZJJA 3SXPA 3OWXA 3PHJA 4DEXA 4GAEA 1IQ0A 2AXEA 2HMTA 4FNGA 4F3TA 2X77A 2CSUA 4D56A 1NMZA 2EYQA 1Z63A 1OZAA 2CHFA 1VL1A 3JU3A 1NLUA 3WNVA 2BKLA 4OL9A 2RAPA 6CHYA 1Q7BA 1W4BA 3FDFA 2ON6A 5F1PA 4F3RA 2AIRA 2N46A 3DA8A 3KOXA 5AXCA 1JPJA 2VDUE 3LY5A 2OK7A 4PCUA 3UCXA 4BO1A 3C3WA 1IMOA 4M9XA 4NICA 3EA4A 3PRYA 4OHKA 4BNFA 1X1TA 4ZZ3A 3NVAA 1JR3A 1ZIOA 2QPLA 2RGBA 2JBAB 1U7WA 2PVCA 5FWYB 3EZ9A 1P9RA 4B3FX 1KOJA 5ALLA 3WYNA 1NVUQ 2Q9AA 2QTWB 2V7QD 4YWJA 5SZIA 1JYSA 1SXIA 1FJ2A 1P5RA 2IHTA 2OGWA 1H2RS 3GLQA 1IN8A 2NVBA 2JFWA 2J3QA 3G2NA 4GX5A 1DAOA 3PPXA 5A0TA 1QS0A 3UJBA 4AG5A 4DJDC 1MDFA 5JD6A 3GLGA 1OLXB 1CNEA 3M5DA 3MCAA 2EW1A 5KJEA 3HXMA 2AXPA 3BTUA 2P6RA 1CXZA 1CUHA 3WICA 4AIIA 4BX2A 1H4VB 4HAIA 2KQUA 2ZJZA 4CDNA 5H1YA 1L4LA 1TM7E 3GXBA 3QYAA 4QPNA 4UEQA 4IR7A 3JYHA 3L49A 4M1WA 3BOSA 3EGXA 3LOQA 1CVLA 3QKIA 5TRTA 3RVKA 2Q27A 4X20B 3KIPA 2OGTA 3C3MA 1XNHA 1YR2A 3RS5A 5K2OA 2QTAA 4DHEA 3L4SO 4Z7JA 3QF7A 3UWDA 1ZD5A 4FXOA 3R5SA 1GLVA 3GPIA 4MO9A 1DI0A 3EIWA 4YYZA 4E21A 5JS1A 2HDWA 4IDBA 5KNCH 4BC0A 1JPNA 5EE0A 3C48A 1OYVA 2PZLA 4D5GA 2DUMA 3RUPA 3WK6A 1GRVA 4QTZA 5K3SA 4C0AC 4F9TA 2VHWA 5EHQA 2FSVC 4RPIA 3I2IA 2ET6A 1YU9A 2JA1A 3GZTB 1MAUA 4IIXA 3R7WA 2JJ1D 1C3OB 4N03A 4M9CA 1X94A 3ZJTA 5J40A 1H1DA 1SWVA 1EM6A 1GZ5A 3ZW8A 4ZJPA 4HEHA 1SK9A 1F3LA 3K9NA 2JGAA 2ILVA 4V03A 4WACA 3GPCA 2EIHA 1N2CE 4KFTA 4GSKA 4E07A 4IIJA 1JYEA 1Z8NA 1SB8A 4D8TA 3UBTA 4PBTA 4F46A 3MMPA 1U0EA 3W79A 1ZOSA 1XP8A 4RPKA 3EG5A 1RSZA 3IEIA 3OZCA 3EZNA 3JQ7B 2OKGA 3KQOA 1YB7A 4FYWA 3RSZA 3T99A 3WL6A 4DLBA 4GXTA 3HI6A 4YCNA 2WVHA 3ON5A 4HDOB 5H16A 1W48A 2Q29A 2ES4A 2I8AA 3A26A 1Q5PA 3EY4A 4Q1CA 3V1TC 5U4XA 4XQGA 2IW3A 4QHSA 5C1OA 1N2JA 2PZKA 4G1BA 4Z9BA 4PLWA 3NUZA 3LX5A 3PFBA 3P4XA 2R87A 3VH1A 3HUUA 1M1XB 1OGJA 2VWGA 2MMGA 1KO5A 2VTBB 4BKRA 3ZDCA 4YGXB 1I1OA 1OJLA 1ZESA 2ZT6A 3OX3A 1PNRA 2FRDA 1ZL2A 3IUEA 5I4BA 4P98A 3RR2A 4Z8YA 1TAHA 2ZSEA 5BQOA 4IOMA 3V4ZA 2Q6OA 5AI6A 4EOGA 2ZQ5A 1A3CA 3OO1A 1XEWY 3Q0IA 3K1AB 4DBVO 1GP2A 4KQEA 4DJEC 5LQCA 3W8DA 2BTQA 4OOEA 1UZMA 4IGAA 2IK8A 2W9XA 5SICE 3V7UA 3MTEA 1H0RA 1Y1LA 3SZ3A 1VYUA 3IAUA 1OX4A 1QF7A 3NKVA 3HCRA 3OI7A 4DXDA 4YAWA 1H1TA 2PXHA 2VTDA 3QVGB 1H6DA 3ECSA 3NANA 4IQFA 5F5NA 3UW1A 1DAEA 4WH0A 5F52A 1QIDA 3GCWA 1JF8A 3OX4A 3NOOA 4LJ5A 3EGDA 4EHFA 2QTHA 3A3NA 4TSFA 3UTCA 2QYHA 3EEOA 3CVJA 5CCXA 1JSZA 4OQZA 4G0UA 2QPOA 3PE6A 3HNRA 2JJ2D 4G37A 4BO9A 4K9DA 2VOEA 4HS4A 1T35A 3EFOA 4H3HB 3V55A 2C7BA 2VSXA 4K9QA 5J5VA 2WJGA 2ZBUA 1WF3A 2J6BA 4E30A 1Y42X 4TGLA 5K4AA 5A1JA 1OC2A 1RAFA 1QDUA 3OBBA 3KDSE 4HWKA 1E0AA 3ICQB 4V2UA 4NIMA 1C81A 5JLAA 1SCNE 1VE7A 4DXHA 3C6QA 1KH1A 4C4AA 2QUZA 3PBKA 2A88A 1XAHA 1SUSA 1T9GR 1Z7WA 4ED9A 4GOOD 3TKYA 4R0MA 1TKCA 3HO1A 1A82A 1ZIPA 1O97C 3WK8A 3EVFA 1NKSA 1UIMA 2UXCB 2C77A 1KZ4A 1LDMA 3KEGA 3RAGA 3IE1A 3Q98A 4IX1A 2YXPX 4KLCA 2JAWA 4TKVB 1YIDA 5TGZA 1IOWA 1J99A 2HWKA 3E7FA 4UDXX 1KBZA 3FROA 4QAJA 5BNTA 1KAOA 5IVHA 4Z53A 1VCOA 4XM0A 3FPFA 5I01A 2P2LA 3V8VA 3LXXA 4WBXC 1NN5A 4CWAA 3O3OB 4K6OA 5EWLB 4ARZB 2ORIA 4OF4A 1XTKA 1XF1A 3IPCA 5HOEA 4B71A 1BNCA 1OLXA 3D3WB 4CIXA 4IH1A 5HQ3B 1CSEE 1A2BA 1R9NA 2VNHA 1W93A 3BWBA 3TB4A 2CLIB 4AS3A 1ZCJA 2JH3A 1IONA 1F3OA 4R9UC 3CNLA 1J1IA 4KX3A 5FL7D 4OHUA 1VDZA 4P58A 1KAQA 3QVWA 1WTAA 2RGNA 4MS1B 3LRXA 2V6GA 4UPEA 4YJDA 4G85A 4MVJM 5AHXA 1YDWA 2GM5A 4X20A 4U5QA 4E1BA 2XB2A 4LXQA 1M0SA 1I3MA 4LZPA 4E88A 3LI2A 5A4FS 4C7VA 5KC8A 3DMNA 3NIDB 3LX6A 3M9LA 4ZAWA 1UADA 5EN4A 5BR7A 4RTPA 4OCZA 3GN2A 3FTCA 3TGPA 2AG6A 4ZOLF 2IEBA 3ANYB 3KJZA 2GO1A 3CSDA 1YZNA 4KE7A 2YWJA 1R37A 4HLCA 1X1BA 4RETA 5E0KB 1SCAA 2ZE8A 4ND7A 2VHZA 3DLAA 5EQFA 1C3OA 4QM7A 3ADCA 2VDOB 2YX1A 4KDFA 3C3KA 3FTDA 4RADA 5U1PA 3TLAA 4A73A 4HB2A 3DKIA 3P8ZA 4U00A 3R7BA 1Z3CA 3Q8MA 3ITEA 1JZTA 3NTRA 1I4EB 4G5YA 4KXYA 1QCCA 4XPIB 4TYWA 1KRWA 2HK9A 1Z6QA 4N01A 1N6HA 1AN9A 2AWOA 2ZSUA 4OMCA 4A26A 5DSXA 3QMPA 4EYKA 3KUXA 5DGIA 1HG0A 1KDRA 3KKNA 1J0XO 3SX4A 2BONA 2C07A 3JQ7A 2PGNA 2RAFA 3S29A 5IULC 2CZQA 2IKSA 1X7DA 4C22A 1WAMA 2AD5A 2OAGA 4CQMD 1Y98A 4IHJF 5HF8A 4MKIA 5MFPA 2VJYA 3GLTA 5FP0A 2O2EA 2O2DA 3NAZA 1GLGA 5CM8B 4JR1A 1FSGA 1KP2A 1YB2A 1SULA 4BWGA 1CQIB 1YR1A 2QN3A 4K6CA 4AO7A 4PC6A 3CLRD 3PCRB 4QL3A 3HJAA 1UBCA 4RWEA 2QRZA 3HDJA 3HXTA 1T91A 2FG7C 3HY3A 2OPHA 2ZJ5A 3NKLA 4AMYA 2VTBA 1YR9A 3RE1A 1BZYA 3M33A 4EI8A 2D0PB 1L4NA 4YP6A 3UMCA 2IOFK 2H17A 2R5WA 4HADA 4CCSA 1YR6A 3AXTA 3IAXA 5P8WA 4ZTUB 4LNAA 1P1HA 1KEEA 3FSGA 1CJKC 3QNMA 1WA5A 1NHGA 2BUBA 1ZXBA 1T4BA 1S8FA 1G3MA 1N3LA 1N92A 3K1AA 4KBYA 4YK7A 2VO1A 3F8TA 2FPGA 3X44A 1MAWA 1A97A 2AG0A 1TW3A 1LDEA 4AUKA 3W1VA 4EDHA 4XASA 1OQAA 2D3TA 4GOMD 2Z2IA 5THQA 2PUAA 1NY5A 1JIVA 5JAIA 1IE3A 3SF0A 4RH0A 2B82A 5AKYA 4YRIA 1FFDA 1PJBA 1VE9A 5F1YA 1FYXA 4P7KA 3D2LA 3QVGA 3B53X 1R4MB 3E27A 4YRJA 3ME5A 3RG8A 3I4FA 1C8LA 1FJGB 2C5SA 2VWQA 5DYIA 2DLCX 2YVQA 1DMRA 3B1VA 4IBOA 2XMSA 3WGTA 4FFMA 1HA3A 2VQFB 1PAUA 3IEUA 3R6DA 3PIDA 5EXSA 1KQOA 1DRWA 1FP4B 1Y6ZA 3FVTA 2I3GA 4FPXA 4X8HA 1L4BA 1L7BA 3ZCQA 2J0UA 1NW9B 3R3WA 3JPWA 4RLFA 1JR6A 3L0DA 3LPLA 5GJWC 3MWYW 5E1DA 2XCUA 1JLSA 1TNDA 3I34X 4X6YA 3AEYA 4J4TA 1RXUA 2P11A 3I0NA 1NV8A 3B6ZA 1YDHA 1M72A 1OFTA 2JD1A 3A4NA 4L0QA 4Q16A 1XBTA 3S2ZA 2GZ3A 1AKVA 2FYTA 1NRJB 4LSMA 2N42A 4WKOA 4HQLA 1UT5A 1JLLB 4PR3A 5K8TA 3KR0A 5CTAA 1MGOA 3AI2A 1U28C 4MV6A 1KZ1A 1ZD3A 3TWOA 2RGCA 1TD9A 5TDHA 4QUEA 3RVLA 1QCYA 2IPAB 1XNRB 1ZS9A 4H3KB 3WS7A 3L0IB 5G1NA 4YMTA 4DAEA 4MITA 1Y9DA 1VHJA 3EH1A 3K96A 4O4LF 1N0HA 1LWNA 3ZU6A 5CB6A 2AXNA 1N6PA 2CFOA 3HGQA 4TKVA 2W2PA 3H5AA 5CH8A 4B6RA 4YRSA 1UJCA 3KOYA 4L5YA 1NKVA 5B7QA 1GFWA 4CTNA 2PKCA 3OJCA 4N0QA 2HF9A 1M2NA 1Y80A 3B5IA 2GASA 2XUZA 3G02A 3TLMA 2A59A 3LECA 2QZ4A 4TLDA 4BLVA 2C2HA 4YXWD 3SJZA 4M1KA 1JR3E 2PO5A 1NVEA 4Y2HA 3W1EA 4F2DA 1N2BA 5EWLA 2FHSA 3AESB 4ARZA 4KC0A 5KTOA 2GVNA 4LF4B 3VR5H 3CZPA 4LKOA 1T9GS 1P2SA 3D3WA 5FFNA 3AHJA 5HQ3A 2GAAA 4D81A 3S81A 3C16C 3FZEA 3BX1A 2CCKA 4NYIR 2H85A 3V1YA 4OUKX 3GLGE 3IR5A 4QTXA 4HNAB 3VSCA 4D9EA 5JNSA 1YI0A 2BKAA 3VPAA 5C9ZA 2LIVA 4M9QA 4UULA 1WB6A 3A4MA 2O1EA 3JSXA 4KODA 3TIVA 5KWEA 3H0EA 5ALDA 2REXB 1NNI1 4LPKA 3SYKA 3VKVA 2H1OA 5COAA 1RM5A 1N7JA 1DKNA 4P32A 4XJXA 5KQGA 4PPQA 3I9FA 3L06A 2HIHA 3ML1A 4QT0A 2OXCA 3S2GA 1AZLA 1XVTA 2H5IA 2RHJA 2PSHA 3AU8A 2PS9A 3CNEA 2PXCA 4OFZA 2Z95A 3LQFA 1FNCA 1LBSA 2FJ0A 5T6MA 5LBTA 3HWWA 4RKEA 5BSVA 1EQUA 2D2XA 4AMVA 1XGKA 3GA0A 3KQVA 2OCXA 3BA6A 1NUQA 2JDID 2I33A 4QUKA 3VR3D 4D41A 1R15A 1T6XA 4BFTA 2FX5A 5IZ4A 5KU7A 2PJRA 1M54A 1RLIA 4QODA 4FCVA 3JQPA 1N6LA 3CKYA 4H6XA 1Y0BA 1FDTA 4LXXA 4UUQA 5EUMA 4BQNA 2NTNA 3MWEB 2EP8A 3EF3A 1V71A 4AJ2A 2BDTA 1KQNA 4PN3A 5E9JA 4KNYA 4IL5A 1K92A 4NBNA 1JE0A 3FTNA 3H0KA 5G0SA 1FDRA 1SJ9A 1UXKA 4H6PA 3N5KA 2VDRB 4M1TA 3VPDA 1OX6A 1HEYA 1G64A 2B35A 1FNSA 3LQ2A 4B4OA 1LBQA 3PUXA 1DG3A 2PX6A 4Q3NA 4RJKA 1CQIA 1RLMA 5DLEA 1CS4C 3C7AA 1EHIA 1G2QA 1RAHA 2H1HA 5JPCA 4D42A 2IYLD 2NSJA 1I3KA 1GUFA 3DE1X 3HB5X 4UXIA 1J4AA 5EG5A 2WM9B 5BMVB 2YNMA 1TYBE 1J21A 5DHSA 3R76A 2FQQA 1H8HA 2OR3A 1T6YA 3D4NA 3O9VA 4Y6LA 4DHWA 5IVIA 1NVBA 2ZS7A 3EDOA 1A9SA 1CE8B 1B15A 1QZUA 4TSRA 5ER9A 4NU8X 1OXSC 3E9YA 1QJ4A 2IPMA 3F1KA 3OJXA 4MULA 3UAYA 2AGVA 5A9RA 2HYIC 2A9RA 2NUTB 2TYSB 2XCLA 4IGKA 5DCUA 2P6MA 4TYQA 1UK7A 2FN8A 4RVUA 4RFVA 3A4YA 3QH4A 4BMCA 1TQDA 4HEQA 4JJ7A 5DISB 1SOVA 4B43A 5JFTA 2EFJA 4W9MC 1B8UA 1OXMA 2VUHB 1N2HA 1O5IA 2WWIA 4MQMA 3LCJA 5JDIA 1Z5GA 2HF8A 1R4MA 4NMWA 3UV7A 3NDBB 4HJRA 4PYRA 1JKXA 4FEYA 5D7BA 1SO8A 4U2CA 1H0SA 1E94E 2JGKA 5HUJA 5KQSA 3DHYA 1WSAA 2F67A 2VF7A 4OYRA 3PGXA 3BE8A 1FP4A 1PD0A 1E18A 2B0CA 2VUSA 4PV7A 4YMWA 3E2MA 2GCGA 4UOZA 5JWRA 4X66B 4KQ6A 2ZCUA 4LOLA 5HIMA 3GIWA 3IXQA 3KYDB 2AR0A 3D59A 4O4JB 3RGWS 3RK0A 4OREX 5TMPA 2H2IA 4B6GA 3GDOA 1XKTA 1NVFA 3FVQA 2WF7A 2OXRA