5TC4A

Crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
292
Chain Sequence
EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Emerging Cancer Target MTHFD2 in Complex with a Substrate-Based Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohy
total genus 110
structure length 292
sequence length 297
ec nomenclature ec 1.5.1.15: Methylenetetrahydrofolate dehydrogenase (NAD(+)).
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tc4A01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 5tc4A02
1PTJA 4YRBA 1I10A 5ICMA 2JFFA 1ADFA 1NBOA 4M8SA 4PN3A 3AY6A 3P2YA 4J1SA 5F5NA 5ILGA 1AN9A 3S2FA 5HTOA 2V6FA 5G4LA 4J0FA 3N7UA 4A7PA 5JMWA 3DZBA 4WOKA 1ULUA 1YL5A 4D0SA 3WGIA 1U4OA 4N18A 4Y8VA 1GV0A 3A1NA 3ZNOA 1KEUA 1XGKA 2ZCVA 3DFZA 4R69A 5CP8A 4BO0A 5IDQA 4XQEA 5TNXA 2J6IA 3OBBA 3ZHXA 4UULA 1M2WA 2YQ5A 4CUKA 4D0RA 4E5PA 4BGUA 3FPCA 4XIJA 1GQ2A 5JAQA 3IDSA 1JA9A 3Q6IA 5CEFA 1C0KA 4FR5A 3RVDA 4DL9A 3I5MA 1EEHA 2P91A 4N7RA 1PJTA 2UUPA 1GD1O 3F1LA 1N2SA 2LDXA 5A9TA 1QXSA 1U3UA 1HE2A 3M1AA 3B6ZA 4BNXA 2VTDA 4NU6A 1U1IA 4DQXA 4G2NA 3ZGYA 4J4TA 2DTDA 4IJKA 5G0UA 1GV1A 3ANNA 1TVEA 5TJ9A 3M6IA 4DYDA 2CVQA 1PJ3A 4DBVO 2D3TA 3ENKA 4IDCA 5DDIP 3H6KA 3AOGA 3V1YA 1YKFA 1C0IA 2DLDA 4IPTA 3LLSA 5DBGA 4K6CA 2YQ4A 4PLVA 1B2LA 4PRLA 2EKPA 4LMRA 4W7IA 3BHJA 3NJ8A 2X1HA 4EUHA 2FN7A 3TJRA 3RC7A 2WJPA 1GEGA 4ITUA 4FC7A 3Q9UA 4J7XA 1K0UA 1C1XA 1DAOA 1F8FA 1GTMA 5G4KA 2E37A 4DMLA 2YW9A 4YT4A 4YXFA 1MXHA 1EE9A 2O7QA 1DFGA 3EZYA 2UAGA 3F6YA 4XR9A 1ISJA 5ES3A 5BR7A 2J3HA 1XSEA 2W8ZA 4CMIA 4J7CA 1HDYA 4JP3A 3CKYA 3PP8A 2DKNA 4OAQA 3WDSA 2CVOA 3OIGA 2NQTA 4K26A 7MDHA 1JAXA 1RYEA 2VHYA 2GCGA 5AXCA 4L4XA 4YQZA 4ZRMA 3U49A 5GZ1A 1ZEJA 4OOEA 5C7OO 2RIRA 4UREA 2DPHA 3GFGA 4JROA 2PKQP 1IY8A 3TPCA 3FTNA 1DFIA 1NQAO 4K6FA 3RC1A 1Q0HA 1R4NA 3GLQA 1IZ9A 2CDAA 3VTFA 3C7CB 5L45A 2XXBA 4IXTA 2EIHA 1J6UA 1WVGA 1NQTA 1GR0A 5DP2A 5H81A 2W98A 4WECA 9LDBA 2FR8A 2VZ0A 4WLEA 1ZMOA 2XAAA 5I8ZA 1XEAA 2YDXA 1TI7A 4CLOA 1MG5A 4UUPA 2BHLA 2UUOA 4R54A 5KJFA 4OHUA 1E77A 1U4SA 3CZRA 3UVEA 2WEKA 4XCVA 3VPFA 3WNVA 1UXJA 1R4MA 2NV6A 3RKUA 1LA2A 4P8RA 4S3MA 1RWBA 2ILTA 4PG7A 1UDBA 2Z1NA 1ONNA 4S1VA 3WTCA 4AICA 2NTNA 1PR9A 1ONPA 3C1OA 3GUYA 3OIDA 4OKNA 4R16A 4GKBA 1VSVA 3DAPA 3JQBA 3OQ6A 3JQDA 4E2ZA 3G0OA 1JW9B 2DBZA 1NQ5A 4IS3A 1VI2A 5T57A 4E2XA 1SB9A 4ZQGA 1TT7A 2WM3A 1E3LA 4IM7A 1X15A 3RI3A 2Y68A 3FNEA 2GN9A 2EGHA 3RFXA 4WNCA 5EJ2A 3GMDA 2I65A 3MWDB 2AG5A 2AW5A 2PD3A 4LSWA 1O8CA 2IYOA 4RPJA 5CG2A 2IZ0A 1HZJA 1DIRA 3H9UA 1LLUA 1E7MA 3FHLA 4BKPA 4A73A 2DTEA 4IZHA 1GYQA 4OM8A 4PZEA 4QTZA 1XA0A 1ZNQO 3GN1A 4GWKA 3F3SA 5G4KB 2Q1UA 2OMEA 1S7CA 2V7PA 1KY4A 2V6MA 3ULKA 5JAMA 3GOHA 1GL3A 1TB4A 5ITVA 4KWIA 2O4CA 4O59O 3I9JA 5T8KC 3OA0A 2YHIB 2HQ1A 4FJ0A 2H1SA 3QWBA 1HXHA 4GWGA 1P45A 3OJLA 4WLVA 2BRUA 4E21A 2FOIA 1C0LA 1U3WA 2WYVA 4U0KA 4J49A 3N74A 1BXKA 2GRAA 3AM5A 4WE3A 5EERA 3JQ8A 4FB5A 4L8VA 1ZEMA 4YT8A 3IKTA 4IMPA 2ZIZA 3ETEA 1LU9A 1IOLA 1ZK2A 3AY7A 1T1RA 1NASA 3DBVO 2HAEA 4U7WA 1QV6A 1K2WA 2B4RO 4G5HA 2PH3A 1PR3A 3PYMA 3JQFC 3PJEA 1R4NB 3WOHA 1R0LA 2FR0A 4BKOA 1E7QA 3OMLA 4B7XA 3DZKA 3S2EA 4DLBA 2J3IA 3LC7O 1NHGA 2PTGA 1O94A 3LC2O 3K9QO 2WTBA 3JQAA 4MO2A 4RO0A 3DBHB 1TA4A 2C0CA 1DRVA 1PJQA 4J2HA 4PVCA 3UFXA 4TZTA 3KO8A 5KTKA 4Z9XA 1QSGA 2VYND 4DLAA 3INTA 4CL8A 4FOSA 3I6QA 4Z6KA 3DHEA 1NPYA 5I8WA 1XHLA 2GO1A 4KQWA 4XKJA 4GMFA 4LCJA 2DBQA 2ZYDA 4HY3A 4A27A 5HS4A 3EVNA 1LSOA 3K30A 1NFRA 3JQ9C 1CEQA 3NJ4A 3E6AA 1HYGA 3DMTA 2Y0DA 4HX5A 3Q2IA 2B4TO 4MIYA 4HNGA 1E3EA 2FPPA 1ADGA 1MC5A 4H15A 1DJNA 5FFFA 4A26A 3BYZA 4BNMA 3WQSB 1PX0A 2PGDA 5IZCA 4LW8A 3L77A 5DT9A 4Z9YA 4LISA 3PJDA 4CMHA 3E9NA 2O2YA 3GDOA 3HQ4O 3T7CA 2VNAA 5L7YA 3AUAA 3WBBA 4DA9A 1CWUA 1FK8A 1X1TA 1UDCA 5I7EA 2BFPA 1PJBA 2C2XA 4M55A 3QP9A 3S55A 4BNNA 3ZNPA 1JU9A 2Q99A 2NM0A 3UAGA 2Y1EA 2CDBA 1WPQA 3BMQA 3PDUA 4D79A 4MPDA 1ZSVA 1PS0A 1HLPA 1ENYA 1Y8RB 1FDTA 1V3VA 3RAJA 2CUKA 4NBRA 2I9PA 5FI3A 5BSHA 4YJGB 1IL0A 3OETA 3EMKA 5HRUA 1LRLA 2Y1CA 1IPFA 1N7HA 2YZ7A 3SC6A 1ISMA 2NU8A 2NU6A 5H82A 4CJXA 2A92A 2VYVA 4ALKA 4DQVA 2VCYA 4C4OA 3HJAA 3VH3A 4CM7A 4ZJUA 1CYDA 1HDCA 3LSYA 4JLWA 1BDMA 1XU7A 2UDPA 3FRJA 4E4YA 4BV9A 2C2YA 4XRRA 4MKRA 4XD2A 3QJ5A 1QYWA 2ZYAA 4F6CA 5FI5A 3U9LA 4E5KA 1NHWA 1T2FA 3E82A 1DB3A 1NX6A 2FWMX 4G81A 4OSPA 1DC3A 2AG8A 4CV2A 2DM6A 2EERA 3BMNA 3D4NA 4FFPA 4I9NA 4W82A 3K92A 3T4EA 3DBLA 4Z0TA 1GPDG 1V3UA 4ALIA 3SXPA 3U4IA 1YQGA 3NGXA 4XYMA 3F4BA 4JJGA 3NEPX 4RPLA 4UUMA 3WGYA 2OORA 4RCVA 5B37A 1W8DA 3Q2KA 4QUKA 2QRKA 2B35A 2IXBA 2HK9A 4YT2A 2DC1A 1PGJA 4OL9A 1KVUA 4TVOA 5B4VA 4CUZA 5ENDA 1Y7TA 1NPTO 4PLPA 3GNQA 2HMTA 3ICCA 2FP4A 3P2OA 3ZDFA 1T2AA 1I5RA 5CG1A 3KUXA 3GGOA 3PQFA 3GNTA 4J3FA 3VOSA 1Y8QB 3I4CA 1J4AA 3OHSX 1XLTA 4R9SA 4PLYA 5C3MA 3AM3A 1GEEA 4K28A 1V6AA 4XYLA 4O1MA 1Q1NA 5FWNA 2BF7A 1M6WA 1UP4A 3FN4A 2VZ8A 4RL6A 3ZU5A 2NWQA 1MUUA 4QO7A 2J8ZA 5GZ3A 3A14A 1GPJA 1C14A 1MB4A 2WSBA 4L76A 4L9RA 3SVTA 3Q9NA 2O48X 1Q7GA 1QYVA 1DBVO 4CMGA 1YB1A 4BO3A 1BW9A 4YR9A 3GEMA 5U4QA 5I7FA 1KETA 4BGVA 4PG4A 4W99A 5GY7A 1FMCA 3ZN2A 4KMSA 2V6BA 5F1KA 3B1KA 1P1HA 2VHXA 4INAA 5B4TA 3NDJA 2B5VA 1M75A 2J5RA 2H63A 3PI7A 5FEUA 5JCXA 1ZW1A 2EKQA 4NJOA 4M54A 2PNFA 1CJCA 1ZIDA 1GUZA 2D8AA 4M87A 4MOWA 4O5OA 3WICA 5IDXA 5JMPA 3L6DA 4BO7A 4YTEA 4DYVA 5JW6A 1GQQA 4I5DA 4NI5A 3QLJA 5JSFA 3CXRA 1K6JA 4BQRA 4Q3BA 4DREA 4LCEA 3P7MA 2IE0A 5BNTA 1GZ3A 1Y6JA 2VHVA 4Z0PA 3U4HA 5GMOA 3RU9A 1O0SA 3ZV4A 4D41A 4IJWA 4EDFA 2OBNA 3L4SO 4PG5A 4TZKA 4R3NA 3VPSA 2NQ8A 3PLNA 2GD1O 2CY0A 4CMEC 2JD1A 1PS8A 1ULSA 2OXIA 4WOJA 3SX2A 4PLCA 2VWQA 1LLDA 2PKQO 4ZA2A 1IPEA 2JCXA 2WWRA 4MVJE 1KBZA 3WJAA 2BFOA 4AFNA 3HB4X 3IIEA 2QHXA 3IC5A 1ZUD1 5JPIA 3WIEA 2VWGA 3NAQA 4L4SA 1A9YA 2C5AA 5JO9A 3C7DB 4FD3A 4WEOA 4OKIA 4YJHA 1NPDA 1U8XX 2Y1FA 3HN2A 4B3JA 3GPIA 4ID9A 3O03A 3TWOA 3PQDA 4CLHA 4OSOA 1EQ2A 5JDCA 4PG6A 2IEBA 1QG6A 1LLCA 4EJ6A 1NVTA 3CMMA 3IOYA 4J1NA 5T64A 1VL8A 1QMGA 2G0TA 3GDGA 4MP8A 2Y66A 3E18A 4HKTA 5DN9A 1Y9AA 5IDWA 4R3WA 1E6WA 1YL7A 2WE7A 3UF0A 1IE3A 5A9SB 5JNLA 4A5OA 3L9WA 1IYZA 3F4LA 3PZBA 3UCXA 5EESA 2P4QA 1OFGA 5KOIA 4E6PA 3HADA 2X0JA 2I6TA 3NT5A 5KVVA 5L4NA 5AQ1A 1A7KA 3GDFA 3PLRA 1FDUA 1JVSA 1YOVA 4B7CA 1UP7A 4N5MA 1YDEA 2P5UA 4EYEA 2JAPA 5TGDA 3GK3A 1ID1A 3B70A 2W90A 2JFGA 2X5JO 2GSDA 2QRJA 1B8VA 2HK8A 2VUTA 1MX3A 3PPIA 3I9LA 1W6UA 1DIHA 1L7EA 4NQZA 4EW6A 2JHGA 3O8QA 2VNSA 4UEJA 3QA9A 2W2KA 1JQBA 4IDGA 4E32A 1B26A 1ENZA 3NTOA 4GX1A 3HN7A 4K1LA 4YAEA 4XB1A 3TQHA 2QZZA 3CUKA 3GN2A 4R5HA 2PZJA 3JYLA 2I67A 1ZO8A 4OYRA 4WCDA 1WDKA 2D5AA 1XQ1A 5H83A 3STHA 2DT5A 5TJHA 4AJNA 3GZNB 4BNHA 1P31A 1ZBQA 1U9JA 1Y8RA 4FBGA 1QYCA 1H9BA 3RQSA 1TEHA 4HP8A 3EDMA 1WP4A 5DNAA 3D4OA 1A4UA 3BMQB 1SC6A 4NHEA 3VH1A 3LC1O 1T25A 3OJ0A 1LSUA 3CPSA 1U3VA 1KERA 4TSKA 5I9MA 5BNFA 4PCVA 7ADHA 3WSWA 4MVJI 3LF2A 3LVFO 4NBUA 3BHIA 1E3WB 1BXZA 3WSVA 4NR0A 3ZWYA 1P0FA 3IAHA 4ROSA 4UEKA 4J9VA 2AEJA 3D5TA 2VQ3A 4JCOA 3AOEA 2HMVA 3FBTA 1YE3A 2P68A 2AEFA 1WXDA 3BTOA 3DAFA 3PFWO 4XGKA 1BSVA 1X14A 4YWJA 2JJYA 4UVHA 3VPXA 3IMFA 1E6EA 1HE3A 1T4DA 5FF9A 3X2EA 1B14A 1XG5A 4O0LA 4YT5A 5I7VA 2AQIA 2B69A 3SEFA 4CL3A 1PQUA 2QW8A 3K2BA 4WKGA 4RLSA 1ZK1A 5CHEA 3FBGA 2GR9A 1NFFA 4HWKA 1NAHA 4D42A 4MVJA 2TMGA 4YAGA 3JQ9A 3DBLB 5KJEA 1UXKA 1OOEA 3BAZA 3PYXA 1BGVA 4MJLA 4QO8A 3DHNA 1OC2A 4GAEA 4I5FA 4TKLA 2YV2A 3L4BA 3QWFA 1ORRA 5TX7A 1QLJA 2YV1A 4I8XA 1KC1A 4J9UE 5CDSA 2X4GA 1YJ8A 2JFHA 5DF1A 5KVCA 4ND5A 4WLUA 2Y99A 4UAGA 1BTOA 3LT4A 4OIMA 2Q4EA 3WFIA 2BFAA 5C5IA 8LDHA 4MVJD 2GUGA 1VKOA 3CIFA 3H5NA 4GKVA 3WGTA 4Y6PA 4D43A 3W6UA 1PJLA 2WYWA 4P4GA 4HXYA 4XYGA 5AXBA 4CLDA 4CUJA 5I9LA 3A4VA 1EUDA 3GR6A 1I2ZA 2O23A 3JQFA 3IUSA 3JQ7A 1MA0A 2RH8A 2Z1MA 3KVOA 1W4ZA 3QWIA 4KWHA 3W8DA 4HV4A 2CZCA 4WLNA 4FFNA 1OZAA 5C37A 1SOWA 4J7UA 4J4HA 1LJ8A 4J1QA 2X9VA 3RCBA 1LC0A 1A4IA 5IDYA 2VOJA 5AXAA 4BVAA 4R51A 2VRCA 2NADA 4I9UA 4MP3A 1R0SA 2UVDA 5KVSA 4ZGWA 1GYPA 1RM3A 4AJHA 4II2A 4Y6RA 5I7SA 4YJGA 3RBXA 4B4VA 4IDFA 3NTQA 1UXHA 5KIAA 5C7LO 3ZNQA 3K6JA 1HDOA 4KDFA 5DCYA 3PHLA 2GGSA 4D46A 4DQUA 3DTTA 3PHIA 3PZRA 2VTEA 3I1JA 1FDWA 1L1FA 2Y1OA 1B8UA 1XU9A 2ZK7A 3PWZA 4IDBA 4E33A 1I30A 3RD5A 1ARZA 1CQIA 4NFHA 4NDNE 2CVZA 4KUEA 1Y9EA 3NYWA 1B16A 1T2EA 5IN4A 5CPFA 4Q3DA 1QKIA 4E31A 2EW2A 2QRLA 1D1SA 4QFDA 4AJKA 3DOOA 3VZQA 1AUPA 4TMFA 4AVYA 1T2DA 3MEQA 2AQ8A 1ZMTA 3WNQA 1YXMA 2C82A 4ZQBA 1SBYA 3PVZA 3A9WA 1YBMA 1KVTA 1UXGA 4L75A 4MVJG 4UUNA 2EWMA 4LRSB 1SEVA 3TZHA 4W9NC 1K6XA 1U2DA 3HUDA 5JDIA 3L6EA 3F9IA 1EVIA 4I5GA 1F0YA 2PK3A 1HDZA 4NK5A 4OMUA 5FYDA 1NAIA 2F00A 5L51A 3KETA 3ONDA 3PDJA 4CR8A 1ADCA 4B8WA 3ZW8A 2VZ9A 4B79A 3KV3O 4EITA 4DXHA 2P9CA 1GUYA 4BO1A 4BV8A 5BQFA 1DO8A 4YJHB 1EE2A 3T4XA 4DIFA 1PIWA 3GA0A 4MIEA 2EW8A 1HKUA 2O2SA 3PXXA 3TSCA 4ZQEA 3V5NA 1GZ6A 1O9BA 4FCCA 1BG6A 1I3MA 4Q3EA 5DULA 3K31A 2VN8A 1BVUA 2P4HX 1WMAA 2ZB4A 3E8XA 3JQ8B 3FF4A 5IZCC 4F6LA 3I52A 3HDYA 4RPGA 2NU7A 2Q2VA 1GZ4A 1X7GA 3OICA 3P19A 4H3VA 4KTTE 1A71A 3VVCA 3EGOA 1CETA 1PL6A 2I5PO 3GAZA 3GH3A 2DUUA 4BKQA 3TFQA 2Q50A 5KJCA 4WGGA 2OP0A 1DOHA 4CM1A 4AJIA 4CODB 4DTIA 1F12A 3B1FA 3VZRA 4XDZA 3PIIA 3O9ZA 4NMHA 3W4IA 2EF1A 1D8AA 1WAMA 1LXCA 3EAGA 3KLPX 1EVZA 4J6FA 4XQCA 1PU2A 4CQMD 1I01A 4KUGA 3U5TA 1E3WA 1JVBA 1OBFO 4HNHA 3EC7A 3GG2A 3HWRA 4PIVA 2GN8A 4XQ9A 4B4UA 3H3FA 4ALLA 3ASUA 2PWZA 3DBRB 1ZJYA 3OQBA 3ZWWA 4FIZA 3ZWXA 1JKFA 4G65A 1QYDA 1NVMB 3GNSA 5L3ZA 1X0VA 4JP2A 4JXKA 5TC4A 1UZMA 4FFRA 2PR2A 2FRDA 5CPBA 5IZ4A 1QLHA 3PWKA 4XB2A 1DRUA 5JY1A 1ISIA 2IODA 3OEYA 1T2CA 3V1TC 3AI2A 3EHEA 4YRAA 4M86A 1ONOA 1GYRA 4ESOA 4DUPA 4TRJA 3AOEC 3ZWPA 4AJ4A 4AJLA 3NX4A 1K6IA 1MGOA 4GBJA 1RPNA 4FPXA 4BHTA 5JCJD 4TQGA 1NNUA 3KYBA 3QVWA 3RBVA 1VKNA 1HWYA 4CLRA 3W1VA 4H7PA 2NUAA 1P1KA 2PV7A 3WX0A 1W0CA 4RQTA 4XRGA 3H9QA 4FN4A 3W4KA 2BI8A 4BNIA 1V3TA 2A4KA 2G5CA 3F1KA 1E3JA 1Q2XA 4GLOA 1RM5A 4YAJA 1HEUA 3JQ6A 2YY7A 3SLKA 1Z75A 3FI9A 1FDSA 3KB6A 3OIFA 4E2YA 5F1OA 2G17A 2Q4BA 4IINA 4YCAA 1JWAB 1DJQA 3AW9A 3RFTA 2HK7A 4BGIA 4DMMA 3ANLA 3E03A 3MTJA 4MKXA 4BO5A 3DZJA 1RJWA 3VC7A 4CPDA 3Q0EA 4CR6A 3NT2A 1LQUA 1LDGA 2AE1A 2VYNA 2RBEA 3F5QA 1B3BA 3QE3A 3ZWCA 3H5RA 3MZ0A 1EFKA 3ETDA 4M1QA 4RF2A 4UVDA 5DZSA 3WR5A 5COQA 4D44A 3BHMA 4P4NA 4TRRA 1KVSA 4IY1A 2FZWA 2VOEA 4Q9NA 3WYCA 2ZYGA 4E5MA 5L7TA 1UXIA 2B37A 5JE8A 4BMVA 2RHCA 2BGLA 2ZCUA 3QRWA 5IXYA 1EFLA 2P5YA 3E5MA 3GY0A 2YV3A 5CDYA 1HTBA 2A94A 3SLGA 3E5RA 4R5MA 9LDTA 3VVBA 3RUEA 4AG3A 1N9GA 4BNJA 4ALJA 4BB5A 1E5QA 5DOVA 3U4CA 4GX5A 1P1FA 1E0DA 1U7TA 2NVUB 1VL0A 4X54A 1JWBB 3MJ4A 2PZKA 4Q39A 1Y5RA 4JGBA 4KOAA 3V2HA 3JQ7B 2Z95A 1LX6A 1MP0A 2O3TA 4XYBA 4XJTA 4ZHSA 1FXSA 5IAAA 5LDGA 1QRRA 3K2EA 4ND3A 3KZVA 4ALNA 3QHAA 4R1UA 2QYTA 3NKLA 3QV1A 6LDHA 1HDXA 2Q1TA 2BGMA 2NSDA 2YUTA 3S2GA 1PGNA 2QZ9A 3CINA 1UDAA 1X7HA 2GN4A 3ZWBA 1OMOA 4RQUA 1XKQA 3KEOA 4U8GA 3VAZA 3RUAA 3UCFA 5B12A 3TOXA 4OXYA 1UZNA 3TF5A 1U5CA 4PLTA 3DAGA 3F46A 3KM0A 2J5KA 1Z82A 2B36A 1PJCA 1R6DA 3E9MA 5DCUA 3LT2A 1HL3A 1PWXA 3G1UA 4NJMA 4CMBA 4XJSA 4DIBA 4J1TA 1EBUA 3QVXA 3RWBA 5JC1A 5L7WA 1AHHA 4TKMA 1AHIA 1SEPA 3BTUA 4IUYA 3S1LA 2IEDA 4HFMA 2F1KA 3GAFA 1U28A 3C24A 3GF4A 4PFJA 4BNUA 2QQ5A 1E1KA 3WXBA 4JBHA 3VH4A 3WMWA 2DBVO 5KKAA 2GZ3A 3L0DA 4XEHA 4DPMA 2RHRA 1QORA 3H9EO 1U2GA 4AL4A 1PWZA 1C0PA 5TLSA 4FC6A 4BNKA 3GZ4A 2X7HA 3BA1A 3DMYA 3EW7A 1K89A 1P3DA 2A9FA 4H16A 2ZQZA 3I23A 1E7WA 2D5CA 4TVBA 4BQPA 2GZ1A 1WDMA 2GASA 1PZGA 2H9IA 2W2LD 3EYWA 2EHDA 2YJZA 1DEHA 2X58A 4QX6A 2Q2QA 3DZIA 4CM3A 1UAGA 3T7EA 3WWZA 1J5PA 4RF3A 1ISHA 1MV8A 1N7GA 3JQEA 2NVBA 2YHUA 4JQCA 4NBWA 1X0XA 3KBOA 4R9RA 5J23A 1NVGA 3AFNA 3M1LA 4E2WA 4U6QA 2WE8A 1JKJA 5IG2A 1NP3A 1YDWA 1PS9A 1FDVA 1ZJZA 4NG5A 1H5QA 1H6AA 3WLFA 4AJOA 2YFHA 5A04A 3LK7A 2A35A 5TRTA 1LC3A 3AJRA 2OZPA 1XWFA 3ONFA 2J3JA 3KXDA 4P38A 5IN5A 3OSUA 4NFYA 4YVFA 2H5LA 1ENPA 1B7GO 1Z7EA 1B3RA 3ICPA 5JCJA 4BS9A 1H2HA 2HMUA 3K5PA 5A3VA 3WQQA 3FWNA 2FR1A 4WUVA 2P9EA 2WDZA 1YBAA 3UKOA 4D45A 3ON5A 2C59A 4Z9FA 4MVJH 3D1LA 3F47A 3GHHA 4CM9A 2FSVA 1E92A 1N9GB 3CSDA 3WJ7A 1SMKA 3H5AA 2O50A 1LRKA 1DC6A 3QVTA 2C7VA 4XGIA 4E0BA 3TNLA 2GERA 5L53A 1EVJA 1ML3A 3RC2A 2Y0EA 1HRDA 2R00A 2VHWA 1P0CA 4GSLA 4RV9A 2AQHA 5KJ6A 5LC1A 3SJ7A 1DIAA 2IRWA 2HDHA 4I08A 4RF5A 3WIDA 3BTSA 3O8QB 1EVYA 3WWYA 1Z7BA 4GQAA 1CRWG 3JQGB 1I8TA 2CF5A 2OL4A 4YA6A 1R0KA 5AOVA 2EP7A 3L07A 2GDZA 3G17A 3BTVA 4E13A 1LDNA 5B1YA 1DHTA 3GHYA 3PEFA 1D4FA 5MGBA 2NVWA 3FD8A 4XX0A 4IMRA 1EUZA 2BI7A 1CIVA 3A28A 3CH6A 1J0XO 3OEWA 3PGXA 3WGZA 3DXFA 5EINA 3OP4A 5MDHA 1EZ4A 3CE6A 1V0JA 3DQPA 4IJVA 1BMDA 1YGYA 4R68A 1H6CA 3ROKA 1ZFNA 3GPDG 1R12A 5K0ZA 3PWSA 3VDRA 1N5DA 2WMDA 5TSDA 4KTVE 5TT1A 3H8VA 4B4WA 1YRLA 1Q0LA 1HSOA 4WCFA 3MCVA 1OI7A 4CM8B 2I76A 3NUGA 1WLYA 2EGGA 1MC4A 4IJUA 3TZ6A 4TROA 2HMWA 4JBGA 3DC2A 4BL5A 1PGPA 4LVUA 3RJ9A 3GEDA 2X86A 1E6UA 1I3NA 2FPIA 3MOIA 5L95A 2JCYA 3IS3A 1DAPA 2Q1SA 3C8MA 4YACA 1DIGA 3ZV6A 3VH2A 4ZICA 1ZH8A 1JTVA 3I3OA 1K5HA 1GADO 2FZEA 2UV8A 4CM4A 1Z73A 2Y1GA 2Y0CA 2D0IA 1AXEA 1V9LA 5LDHA 1I2BA 2X8LA 2X0NA 4L4RA 1HDGO 2Y1DA 5I9NA 5U1PA 1P9LA 3WG9A 1PJ2A 5ER9A 2AQKA 5T5QA 1UP6A 2C20A 1LRJA 3AY3A 4NNJA 3DL2A 3L6OO 3U0BA 2BGKA 5IJZA 4CLXA 1FF9A 4BNTA 3R6DA 4RVSA 1DIBA 2QX7A 3D4PA 2JAHA 1ZXBA 3D64A 4QECA 1JDJA 3BMOA 2AHRA 1F8GA 4B8ZA 3MJTA 1PZFA 4EJMA 3GMSA 3CZMA 4WCFC 2O7SA 3GUCA 3GGGA 3FNGA 1KY5A 3K73O 2EV9A 3RIHA 1E7RA 1WMBA 4FS3A 1VSUA 3NV9A 4RVGA 2TMDA 2XF8A 1O5IA 2ZB3A 1SAYA 1YQDA 4RVDA 2B83A 3AFMA 4LVCA 4HFJA 1R15A 3D3EA 5G2OA 1ZXLA 4XR4A 4YAKA 3B1JA 4IXWA 1ZK4A 2CD9A 4U0JA 4AJ2A 5DBFA 2GYYA 1Q7CA 3KOUA 1L7DA 3LZ6A 1GCUA 1LNQA 2DVMA 3C3XA 3MOGA 3OFSA 2G76A 1Y81A 5F1PA 3EUWA 4QT0A 2X6TA 2VT3A 5IFLA 2HUNA 3P5SA 5EPOA 3GRKA 4RF4A 5COBA 1H2BA 2VWHA 3C1AA 2GLXA 3D5QA 3WB9A 1EUCA 1U8FO 1NWHA 1F17A 1LI4A 2E4AA 3D3WB 4NIMA 1WDLA 1P44A 1HZZA 1ZKMA 2HKIA 4A2CA 3UOGA 4CMJA 3LLVA 2X22A 3LF1A 3PK0A 1XQ6A 4IBOA 4J91A 4DRYA 5THQA 1EDOA 2E82A 2SCUA 5A5EA 1UZLA 3FTPA 3AU9A 4L73A 3KLMX 4BNZA 1H9AA 1SZJG 2DAPA 2CF6A 4UVEA 3I9OA 2XPCA 1RKXA 1G0NA 1LBEA 3TFOA 5HS6A 2DFDA 4WLOA 3PYLA 4HFNA 4LSMA 4M89A 3RFVA 5COAA 3TN7A 1H6BA 3ZHYA 2Y93A 3WYBA 1DPGA 4PVDA 4N5NA 5CEEA 2PGLA 2JD2A 3IP1A 2OHXA 2LDBA 3M2PA 4M49A 1EMDA 3QIVA 3AK4A 1RYDA 3JQGA 3WYEA 2ZJ1A 4ZD6A 2R6JA 4WPGA 3H65A 5K9ZA 5EQFA 3I83A 3PGJA 1NQOA 3MJEA 4CMAA 2HU2A 1ZK3A 3DHYA 3H9JA 3PRJA 4RPHA 2J3KA 5BSFA 1VM6A 5TF4A 4BNGA 3ABIA 2GN6A 2NLOA 4ND1A 1ADBA 3HSKA 2R2GA 3R1IA 1KEPA 3QWAA 1BRMA 5CDUA 2WD8A 4QFCA 3JQCA 4XIYA 3JTMA 3ASVA 4EI2A 4Z3KA 2Q45A 5JC8A 5K6AA 4FJ2A 4BO8A 3OF2A 3JD0A 1P1IA 2YFQA 1X13A 4QEDA 4FDAA 4IGFA 4CMIB 4FGWA 4CM8A 3HG7A 4UEOA 1UAYA 2NNLD 4XGNA 4MVJP 3RASA 2AXQA 4XQGA 5A02A 1EDZA 1LTHR 3V1UA 1I33A 1PSDA 1QR6A 3AI3A 1GCOA 3PHJA 5JYDA 1IULA 1KC3A 5CEJA 4CM4B 4BB6A 2VRCD 1SNYA 3KYDA 4NH4A 1MG0A 3I9MA 1I3LA 5T6BA 3WLEA 5EL0A 4NBTA 3MJVA 2BLLA 3BMCB 5EIOA 5BNIA 5JBIA 1KVRA 4N5LA 5T8KA 2GF2A 3MTGA 3ANMA 1Q7BA 4CQLA 4RVUA 1MFPA 1D7OA 5HBRA 2X0IA 4RORA 4L74A 1O6ZA 1PQPA 4IGEA 2Q1WA 4LK3A 2PLAA 3HZZA 4FQ8A 3QWHA 2RH4A 4XA8A 4AJEA 1C1XB 2X5OA 4RVFA 2H6EA 4WJZA 3TL2A 4UVIA 3C7AA 4EZBA 2E6UX 1TT5B 1IB6A 3N58A 1CERA 3OH8A 3O38A 5JFOA 1B8PA 2QG4A 1E1MA 3RUFA 1R4MB 4BO9A 2C54A 1ISFA 3HDHA 3RJ5A 5A9RA 4HUJA 3LQFA 1NYTA 4BNYA 3JQAB 3G3EA 2OOSA 5K6AC 2XXJA 3Q3CA 1DLJA 1EQUA 4AJPA 3R3JA 5CFZA 4RDIA 1EBFA 4GH5A 3F5SA 4NZ9A 3W8FA 5IXSA 3FSRA 4DBZA 4ILKA 3E9QA 5KJ1A 3S8MA 4CQMB 1F14A 3ZV3A 4CLOB 3KEQA 1KEWA 4RZIA 2DFVA 1NWCA 2BD0A 1HDRA 3DDNA 4YRDA 1XIVA 1YONA 3DWFA 1YBVA 2DU8A 3FWZA 3I4FA 1G1AA 4TRMA 4W6ZA 5A06A 3PHHA 3COSA 2BELA 1AE1A 3ORFA 1VC2A 4QSMA 3PTZA 5HWSA 2EG9A 3E1KA 4CV1A 5U9CA 2CNBA 3AI1A 4QXMA 3FNHA 4D3SA 1YS4A 3CTMA 3JYPA 3ST7A 4LRTB 1ISGA 3RUCA 4HFRA 3ROQA 2UYYA 1PGOA 1DXYA 3LT0A 4IQ0A 4PLGA 3W8EA 5LCXA 2AEMA 4EUFA 2ZKLA 1QYXA 3Q11A 1HETA 2JKVA 1DC4A 3EK2A 2V6GA 3H2ZA 1VL6A 1SOVA 5T67A 5KCZA 5KKCA 3HDQA 1KEVA 3EY4A 4BO2A 1O89A 1YWGO 1DHRA 3JD1A 1H94A 3U4DA 4ZRNA 4IIUA 4AJ1A 1YB5A 4YJDA 2JHFA 2OUIA 3JQAD 1KS9A 1M76A 3FNFA 2ZJ0A 5KWEA 3PQEA 2PA3A 3B20A 3KSUA 2AMFA 3ADOA 4MDHA 3ZCXA 4R1SA 4GL4A 2BH9A 4Q3CA 3DBRA 4WASA 5JXWA 3JYQA 4KQXA 2JCVA 2HJRA 3GVHA 1JAYA 5BT9A 3DBHA 1FJHA 3UUWA 2YYYA 5F5LA 5TS3A 3ROPA 2PH5A 2OO5A 4IZIA 1A72A 1XYGA 2X9NA 3HHPA 4PRKA 4Y6SA 2D4AA 4YAIA 3HFGA 3GEGA 5EQDA 3NRCA 3I9KA 3RROA 2O3JA 3HFSA 3IKVA 4N54A 3ZI0A 5A3JA 4DC1A 5ENVA 5CAEA 5JY6A 2QYSA 3VKVA 3I6IA 5EN4A 1HT0A 4E30A 5DOZA 5AVOA 1WZEA 4IQGA 1LEHA 3S2IA 3VPGA 4JJFA 1E5LA 2B4QA 4GGOA 3AU8A 2X23A 3G79A 3DEYX 1BWSA 1JKIA 2C29D 4DGSA 5B4UA 2ZB7A 4WK6A 1UH5A 2BFMA 1B15A 2I66A 4FSHA 4BNWA 4F46A 1E7SA 4GMGA 4CM9D 4EGFA 3D0OA 2W4QA 3H7AA 4OOFA 1D1TA 3O4RA 4IDEA 4PZDA 3GVPA 4J90A 4EEZA 3RKRA 2WD7B 4XWYA 1Y8QA 3NTRA 5TT0A 4NU5A 4JJIA 1IHYA 2ZTMA 3DONA 4DWVA 3H4VA 4XDYA 3HDJA 1Z45A 4RPKA 3VZPA 1I24A 1XELA 4W4TA 3OQ1A 1LSSA 5ILOA 4C7JA 1P1RA 2D59A 2IZZA 2X9GA 4GVXA 1BXGA 3UN1A 1CDOA 2VHZA 1BW9B 1P74A 1H93A 4YQYA 2O4UX 2IXAA 4RLHA 3BMOB 2ZATA 3L9XA 1YL6A 3JD2A 4KDEA 2EEZA 1BHSA 4HBGA 4PGFA 3K96A 1VPDA 1VRWA 2OP1A 2DUWA 3V2GA 1G0OA 1LQTA 1TLTA 2VT2A 3JYNA 1AGNA 2I3GA 3DZFA 3OJOA 4Q3AA 3VTZA 4TWRA 5L4SA 2PD4A 3AM4A 4JBIA 4W9NA 2EXXA 1V35A 2PD6A 2IDZA 4PLFA 5JLAA 3KYCA 1IHXA 3DB2A 3GVCA 1X7DA 3LU1A 4F3YA 1H6DA 3UHAA 4BNFA 3ZHBA 5F3RA 3KYDB 3RUIA 3U62A 1GY8A 2IZ1A 3BXXA 4BUCA 4B3IA 5A4DA 5KNLA 3HNPA 4BNLA 2YDYA 3IUPA 2ZTLA 2O3UA 4ALMA 3VZSA 4E3ZA 1LDEA 1B0AA 4BIIA 2NACA 3AUTA 2JD0A 4R41A 2W2LA 3BZUA 1H0KA 4J43A 2EKLA 2HRZA 3I9NA 4ZU3A 2B5WA 1LDMA 1DRWA 1YB4A 2OBYA 5DBIA 5JYEA 4MIOA 3DZGA 2FPGA 4OJNA 1LDBA 4OXKA 4YJFA 4A03A 3ZWVA 2HCTA 1TT5A 3JD3A 4CMEA 3C1TA 5A5FA 1T4BA 2CDCA 3R3SA 2ET6A 3IJRA 3Q1LA 3ZH2A 1R37A 1YQXA 1GQYA 1VJ0A 1HE5A 1MLDA 1NXQA 4II3A 3BMNB 5G0SA 3SC4A 4CM6A 5TIIA 1E7YA 3PJGA 3MJCA 1SPXA 3E48A 4KUHA 4FGSA 3UICA 3WFJA 4R4JA 1HSZA 1MXFA 4XYEA 5G0TA 3ZV5A 4FW8A 3OA2A 1LLQA 2HSDA 3SBOA 3ZHZA 4OXNA 3WQRA 1TXGA 3RBZA 3RC9A 5CDTA 1LUAA 2P2SA 3K8ZA 3G1TA 2E48A 3UGKA 4DC0A 1T24A 4ZQHA 1GAEO 3WGOA 5JAZA 5JS6A 1HLDA 3W6ZA 2Q46A 4RVHA 4CQMA 1NTOA 2PFGA 4ZVVA 4LMPA 3OJEA 4MVJM 1WWKA 3ZWMA 3AUSA 1I2CA 2OFPA 3U09A 3GG9A 2NVUA 4OQZA 1UR5A 4CLEA 4EUEA 4BMSA 4IIVA 4W7HA 4CR7A 4CV3A 1CQJA 4CMKA 4OO3A 3JCZA 4E5YA 4P22A 4IDDA 1RM4A 4PG8A 2AA3A 3KSZO 3DOCA 3AUUA 3W4JA 1YJQA 3JV7A 1IUKA 1PL8A 1T26A 3CEAA 3ITDA 4FFMA 1VLLA 2Q3EA 3DFUA 2VWPA 3L4BC 1C1DA 3ZU4A 1U3TA 4I5EA 2JL1A 4EBFA 1BVRA 4DLLA 4DVJA 1M66A 2DPGA 2Z5LA 3KYCB 2C5EA 3D3WA 5ADHA 3BMCA 4JN6B 1YO6A 1SO8A 3A06A 1NM5A 4LN1A 2P9GA 1Z74A 4I9HA 1KVQA 2RAFA 3NDRA 1ZVMA 1DC5A 2CSUA 1ENOA 4OQYA 2PZLA 4ND4A 3KTDA 2EJVA 3WGHA 4J16A 2HJSA 3QY9A 4Z3DA 4JNKA 4YB8A 2PKRA 4J0EA 4PLZA 1N8KA 4D3DA 1KYQA 5AYVA 1WZIA 2FY8A 5CDGA 5BSGA 3QQPA 1PL7A 4YPOA 4IS2A 1BDBA 3H3JA 3ADPA 4ZQFA 1KIFA 1P1JA 5DP1A 4BOYA 1GFSA 2NU9A 3GRPA 1KOLA 1A7AA 4JK3A 1V8BA 2CFCA 1ZSNA 4PZCA 3OECA 1PEDA 3PJFA 4GPD1 4WEQA 4A10A 2BKAA 3QSGA 3ZWOA 1I36A 3GQVA 3NGLA 4F45A 2Y05A 3D7LA 4RZHA 1UJMA 3QW2A 5HA5A 3UXYA 2I99A 2DBRA 2R00C 3WTBA 1Y1PA 3C85A 3RUHA 2FSSA 3MWEB 1IZ0A 3KSDO 4GX2A 4URFA 3ZWAA 2O3QA 3V8BA 1PJ4A 1YOVB 2D2IA 1R16A 4J2OA 4BMNA 4YEDA 1M6HA 1Z6ZA 2EP5A 4IQ8A 3INRA 2J5QA 3DO5A 3DTYA 1CF2O 3OM9A 3H9GA 1P77A 4FJ1A 2GNAA 4BO4A 4K9DA 3FCOA 1J49A 2Q2WA 3RUDA 1SB8A 3QVOA 4IDAA 4J4BA 4AJJA 2VUUA 2G82A 4BNVA 3DOJA 1DFHA 1N1GA 1Y5MA 1T1SA 1JLLA 3X2FA 5A9SA 2DQ4A 2RCYA 2C07A 4UVGA 3ENNA 5HM8A 3AWDA 4R01A 2HO5A 5L4LA 1X1EA 2VRBA 4Y9DA 5G0WA 4CQLB 1JN0A 3JD4A 4MP6A 2DTXA 1GDHA 4LGVA 3GZNA 4EJ0A 1W73A 3ZU2A 1P33A 1YH3A 1PQWA 4JX8A 3VPHA 5F21A 3LYLA 2POQX 5IF3A 3R0IA 2D1YA 2Y67A 4Y98A 1DSSG 3GVXA 3ZZNA 3FR8A 2ZTVA 4ONEA 1A5ZA 3NT4A 4KP7A 1LSJA 1VJTA 1N1EA 3CMCO 3TZCA 3ETGA 5TQVA 2E49A 4E12A 4BKUA 2ZQYA 2W2KB 4BKRA 3QVSA 3GVIA 1E1NA 3ZNNA 4NK4A 1UUFA 4NPCA 2O3RA 1A27A 1EK5A 4GLLA 1HE4A 2HMSA 2O3SA 4BGEA 2WYUA 2IYPA 5EMHA 2HRBA 2C7GA 4BO6A 5L9AA 1C1DB 1VJ1A 1U5AA 1I3KA 1RM0A 1G6KA 1D3AA 3WS7A 2FHSA 3DR3A 5L40A 4OGWA 1WNTA 3ITKA 4Z0HO 1PJSA 2PGJA 2VYVD 1K3TA 3BIOA 1ZZEA 5DCWA 4NJMB 2BMAA 4QQRA 4R1NA 1F06A 3SJUA 4PLHA 4TRNA 4Y67A 1OAAA 2NTVA 3EZLA 4GX0A 3HB5X 4WLFA 3U3XA 8ADHA 3RSHA 2NTJA 3ROMA 1ZK0A 2X0RA 4Q3NA 4C7KA 2GZ2A 2VUSA 3KRTA 3INGA 4YDRA 3JYOA 3OJFA 1OC4A 1U7HA 3NDIA 2XOXA 3GFBA 4CM5A 1DLIA 3WGGA 1HYEA 4YJFB 2EJWA 5G0VA 4ZN6A 3TZKA 4GSKA 5JDIC 1S6YA 3WMXA 3WBFA 4WNIA 3VKUA 4RGBA 3VDQA 4GI2A 1GU7A 4EEXA 4DPKA 4O6VA 4XZ3A 3MJSA 3UW3A 3G49A 1Q0QA 4FFLA 4O63O 1O95A 2ZTUA 1LDYA 4MKZA 3TL3A 4RJTA 4OH1A 5BSEA 1BXGB 4KZPA 1ZSYA 4GGPA 1VE9A 4B4OA 2AE2A 5AXDA 4D3FA 4D7AA 3ONEA 1R66A 4I1IA 5ITWA 1A9ZA 4DPLA 4P4LA 1QP8A 4B3HA 2PZMA 5THKA 1SCUA 2B0JA 1WW8A 4JIGA 4HADA 2ZB8A 3TOZA 1M67A 1MFZA 5A1TA 1YVEI 4U5QA 2PY6A 3JQBC 4E5NA 3M2TA 4GVLA 6ADHA 1PGQA 3KHUA 1HYHA 5JDCC 4YYZA 5C7IO 3O26A 1DDOA 2I3AA 4U6SA 3HE3A 1ZCJA 2GPTA 3VHRA 3DMTC 3DZHA 1C3VA 5ER6A 3TDKA 5ICSA 5JAIA 4L0QA 3IL2A 4FFOA 4ND2A 5A05A 3GGPA 3LDHA 3H2SA 3PHGA 3IQDB 4FOOA 1XCBA 3FPLA 3GC6A 2QIOA 4R1TA 1GUFA 4RDHA 2HLPA 3JSAA 1AXGA 4CV0A 3IJPA 2OGUA 2Q49A 3WGQA 2FMUA 3ZW9A 2CMDA 1EK6A 1E3IA 2YHIA 3RU7A 1I32A 3ZWNA 1NR1A 3UH1A 3PFFA 3ZU3A 4B7UA 3IP3A 4MVJF 3TRIA 3PIDA 2WD7A 1NR7A 1E1LA 3FR7A 2G1UA 3GT0A 1XR3A 4PLWA 1NFQA 4NFSA 4CLRB 1E3SA 1QV7A 5A03A 1N92A 5KVQA 3V2UA 4WCFB 4CMCA 1HF3A 4NBVA 5GZ6A 3UCEA 3LT1A 4MINA 2V65A 5JO0A 4YBZA 3EVTA 1PZHA 4DIOA 4A0SA 3TZQA 4UUOA 1PZEA 1XDWA 1I0ZA 2X5KO
chains in the Genus database with same CATH superfamily
4M1YA 4A9AA 1EVKA 1PTJA 3R0XA 1GFIA 4NF2A 4Z4EA 4RJKA 3TQQA 2JFFA 1ADFA 4M8SA 2PUGA 3LVRE 5AT1A 3HYSA 4F9EA 3KEFA 1AQJA 4G1MB 1QRAA 4X0EA 1M8KA 3C4VA 3NGMA 4PC1A 1PLJA 1ZNWA 4EH1A 3DO6A 4XWOA 2V6FA 2OENG 4TL6A 2H1OA 5G4LA 5AVYA 4CG1A 1RAHA 4OGKA 1R8XA 3N7UA 621PA 5E1OA 4UASA 2ZULA 4A7PA 5HKOA 3DZBA 3U48A 2HJGA 1YL5A 4LI3X 4D0SA 5M5BA 3CQ9A 3WAGA 3I45A 1IZ8A 1QPGA 4G9BA 2V7XA 3A1NA 3KT6A 4Y8VA 4RHUA 1QWSA 3ZNOA 1KEUA 2HOQA 5CP8A 1I6LA 3WWOA 3EXIA 4MLPA 1M0SA 2SKEA 1QHHB 1JI3A 2OZLA 1MTZA 2P75A 3MRTA 4UHBA 3VOAA 4C0JA 2CLFB 1V1JA 2YQ5A 2QR3A 3LFHA 1X86B 4TYQA 1GWNA 4QVKA 3ZH9B 1JA9A 3UOAB 1WXIA 3H4TA 3ZDBA 1L1RA 1EEHA 3I5MA 3N2LA 4YBRA 5ELXA 4AZ3A 3NHSA 4URVR 2JA2A 5KOHA 4N7RA 3HXOA 1JECA 2FEOA 4ZDIA 2V3CC 4YREA 1SKQA 1JEOA 1AO3A 1RQ2A 4JLBA 3R24A 1IWOA 3EC2A 3LPAA 3NAMA 4LYJA 4M1KA 4S2EA 1WETA 1U3UA 1KGDA 1CK4A 3B6ZA 3HBNA 2VTDA 3M1AA 4M9RA 3UGTA 1U8CB 3V7YA 3VYUB 2VNJA 3SYKA 4G2NA 3ZGYA 3JZMA 4GLJA 5KYWB 2HA0A 5ALOA 4CGYA 5JADA 3BKWA 5ALZA 4DXAA 4JA2A 2ZJAA 5J1TB 3O0DA 1C50A 4UU0A 3FXAA 3L6CA 2QLMA 1E18A 4TX1A 1SVLA 3MTQA 1YHZA 4AI6A 3N86A 5BR1A 4A4DA 2OAP1 3VNVA 3C6MA 3FHTA 3ZGOA 4IDCA 1PSWA 3VSBA 1QFYA 5K5EA 5KEIA 4C2BA 1P8AA 4PZ9A 4HC4A 4QGHA 3SR3A 4GOLD 2J0VA 3S2SA 3UATA 3BEDA 4GXQA 4EO9A 4JR2A 4LGYA 1KE1A 3KQLA 1QZXA 4P34A 1CQIB 1F6BA 4PAGA 1TQHA 2Q5EA 4IGIA 4LMRA 5DMHA 3BHJA 3NJ8A 2X1HA 2HIAA 1B0PA 3TJRA 2H2GA 1IVNA 1IEXA 1P19A 2IHVA 4FC7A 2CFRA 3KHKA 3V8PA 1WMDA 3RRYA 1ZI8A 2I2DA 2ONYA 4ARSA 2QUKA 2XQJA 8GPBA 4MS3A 3PHBE 4RE6A 4PZEA 2REBA 2X40A 2WG0A 4HRAA 4ZARA 2R1VB 3H97A 4C4AA 1BQ4A 1TTQB 4HVAA 3JVIA 2O05A 1HDYA 1MQAA 3CKYA 3HBFA 1DOAA 3PBKA 4Q4JB 3EEIA 4FKZA 4C4PA 4UW9A 2QM8A 3HXPA 3RG8A 1Z7WA 4UU7A 3PRKE 4PANA 3DVRX 3A70A 3HKBB 1C2TA 2R6AA 2R7NA 1AZLA 5FPHA 1RKBA 2DWUA 3GFOA 3HO6A 2E7ZA 4QUAA 3C3CA 2RIRA 4M1ZA 5BUZA 2ENUA 5AI6A 1D2RA 2DPHA 2AVNA 2TMKA 1NBHA 3AKCA 1NR5A 3R0ZA 3LNTA 3ZXSA 4PC7A 1IZ9A 4B6PA 2EQ5A 4G5YA 3VTFA 2O8CB 4GOKA 2MU1A 1JEJA 3N2GA 5ARDA 2XXBA 3QI2A 5FWDA 2Q6VA 2EIHA 1UIRA 4UJ5A 5H16A 3SYMA 1NQTA 3HVUA 5JWRA 3C5VA 1JR3D 2W98A 1E3DA 3NHKA 1ZZGA 4ISCA 4WECA 4CEHA 5DIFA 2R5NA 4JI2B 3T9AA 2FWAA 4DBLE 2PUDA 4CLOA 5CVEA 4KXXA 4POOA 3KELA 1LX7A 3NCHA 1R10A 3EIQA 2TMYA 1W87A 2K2WA 4OHUA 4BFZA 5L3VA 1W36B 2AR7A 4KO1S 4C6HA 3ONVA 2C42A 4LXQA 3WNVA 4A92A 1Z06A 5K0NA 4S3MA 4NDZA 4PG7A 3JWPA 5CGQB 3SR0A 3NKVA 2XUKA 1ONNA 1CS0B 4S1VA 1XFAA 4RPCA 4AICA 4IWXA 3TBHA 3L05A 4EYSA 5C8ZA 3WMRA 3IUNA 4ZAVA 5SZHB 2NXJA 3OIDA 5E38A 5CA0B 3HNRA 1KQ3A 2F17A 4EG6A 4JB3A 3H05A 3NG1A 3JQBA 3OQ6A 1HL7A 3LQQA 4P83A 1NQ5A 1DG9A 2FUKA 1XN1A 3GJTA 4JJ4A 1G21E 4EFMA 5JXGA 1SRQA 2BSAA 3N8NA 5HE8A 2OXTA 3PCRB 4PNPA 1CNMA 5ERGB 2GN9A 3UMVA 3UTCA 4I6EA 3RVJA 3GLFA 3RFXA 1OD6A 4YCNA 5EJ2A 2I65A 4GOXA 1WVIA 3AF4A 2AG5A 4MO9A 2BUBA 2JRLA 1BX1A 1SXJE 1XYYA 3IURA 5LZ8A 3ODPA 1DJMA 1WKBA 1NT2A 1O8CA 5FL7A 3B1YA 5CG2A 3L1UA 3B5JA 1JAIA 4D74A 1T5BA 2GVDC 1E7MA 3NM5A 1XQWA 3PQ7A 1JDSA 4TXNA 1P2TA 3CUTA 3WKCA 4NCKA 2Z3ZA 2NSJA 2FW8A 4QTZA 4OM8A 4N5IX 4ZWNA 1GT91 3ZHOA 5CFMA 4UMEA 2LD4A 5LYJB 2E0IA 4A8JA 3F3SA 3JAWB 1SVIA 3EGWA 4IGKA 5G4KB 2Q1UA 3HFJA 1E94E 1EGHA 3A7DA 1BZYA 2JATA 3DTVA 3KD2A 5GQSA 3ULKA 2V6MA 4BDTA 5JAMA 2ZJ6A 1E8NA 2PSHA 2PX8A 2IS4A 2VEOA 1JI0A 4HN4B 2ZSIA 3AR7A 2IH2A 2IGTA 3ED1A 2QM3A 3U37A 2HQ1A 2M1XA 4X8LA 1ZA2A 4MV5A 1OPXA 4EYKA 1MQSA 3OJLA 2ZREA 2BRUA 3O8OA 2FOIA 2HJ9A 3C3BA 1C0LA 1U3WA 2GCIA 5CX1B 5IF9A 4J49A 2HF7A 1X1SA 1BXKA 1L2TA 1SQ0A 2GRAA 3DF9A 1M7BA 3P2IA 3M8KA 3RRMA 1N1MA 5EWMB 1GRRA 1V41E 4L8VA 4MCIA 5B6IA 3IKTA 1Y9DA 1RPTA 2H1WA 3CX3A 3B1WA 2H51A 1NATA 1X2BA 1F2UA 1IZZA 2FWPA 4D96A 1P9OA 1CDZA 2DKFA 2PXXA 3DBVO 3MELA 3RFUA 2E18A 5J1SB 1Z0SA 2NZWA 1K2WA 1MAUA 1VSQA 3RG2A 4YLYA 4QXQA 5AIBA 9ATCA 1TCBA 1L3IA 3JQFC 3LM8A 2PSFA 1R4NB 3OCYA 4OUKX 4ON9A 2AGVA 3ESDA 4GBMA 3V7FA 4A16A 3B1XA 4NXNB 3R3HA 1M34A 3WYGA 2V9CA 1PHRA 5E7JA 1XLVA 3QEMB 4U7HA 2IHJA 1R9GA 5LYYA 4AD8A 1O2DA 1O94A 3UAWA 3K9QO 2DHEA 5JNRA 5IYZA 1LBHA 1ILEA 5DYGA 3UFXA 4TZTA 3KO8A 2IPLA 2ODAA 1MAWA 4IUDS 1GUDA 1KYZA 1E3TA 2CLIB 3KCQA 3MSCA 2BR5A 4RY8A 2I6FA 1P3JA 5IRCD 1SBCA 3C14C 1L3CA 1DG3A 3I6QA 1YUBA 4FOSA 4BMDA 1JSLA 4AK9A 1JALA 1XJWA 5FJJA 4J2TA 1XHLA 2NQ2C 2GFQA 4A27A 3NVMB 2O8DB 2ZZMA 5FUXA 2WIJA 3OE7A 4QNRA 3M6WA 1KEEA 1XALA 2P9BA 5AW9A 1EUQA 1NFRA 4N48A 1CB7A 2UZAA 2DFKB 5AH0A 2J07A 1XMSA 5ALDA 1WULS 2IEGA 1P2BA 5ED4A 1HYGA 4HZGA 3VM6A 2ABWA 1FYEA 2B4TO 1JKJB 2WM9B 3F8TA 3K2IA 1LF5A 1DX9A 4G89A 4H15A 5FFFA 4BNMA 1CUVA 3BYZA 3CNBA 3WQSB 3H8SA 3T0GA 2BPOA 4IHJB 4RMJA 2Q4TA 1A76A 2DOKA 4KKXB 4E6EA 2FNAA 3D2LA 3C3MA 4LXGA 4JI8B 4OHWA 3DMPA 2O2YA 3VU0A 1GOTA 1I4OA 2X5NA 1RE1A 1CWUA 1ECLA 1X1TA 2HC9A 2L69A 5T4BA 5C53B 4AQ7A 2WHYA 3QEAZ 1SVNA 3CNHA 4M55A 2BMWA 4RWEA 3O8CA 2XKKA 3ENQA 3WIBA 4HXFB 4BNNA 3VYWA 3UAGA 3QPAA 2AYZA 2CDBA 4LY3A 4WFQA 1KI7A 3AV3A 1X8XA 3HL4A 2W2OA 4NX2A 1MC8A 4MPDA 4PGAA 1PS0A 3LHIA 5AVQA 4K2AA 1Y8RB 2VKTA 1TO2E 1L9XA 4K6GA 3DCYA 1NKSA 3C4JA 1XEWY 1FBTA 1BWQA 5FI3A 1TO6A 1VHWA 5BSHA 3OETA 3O93A 1IPFA 5TPWB 1E20A 2YZ7A 1VE6A 1UJCA 2B3DA 2NU6A 5H82A 4QKQA 1Z56C 2VYVA 4DQVA 2LKDA 4JI6B 4C4OA 1KPIA 2C2OA 3EVFA 5GM2A 4CM7A 3RARA 3OCJA 3NPMA 5BW8A 1WV0A 3FHJA 1ACMA 4X6LA 1ZH0A 4DA8A 4WT7A 4B2IA 1KDOA 2GEJA 2UDPA 2O1WA 3FRJA 3JW8A 3L7IA 4S1NA 4EYOA 2C2YA 4XRRA 3VR2D 3R9XB 3O8RA 5LA6F 5AIAA 4RIEA 1QYWA 1TCUA 2O8EA 4F6CA 1JLSA 4KO8A 2XLBA 4BNHA 2QM7A 3E82A 4OSPA 3U1TA 1EX9A 5F1YA 1P4SA 5TGTA 4ZJPA 1OA0A 5AVRA 2V0GA 4FFPA 4LYEA 5JD6A 3L93A 1XEWX 1H4VB 3ZLVA 5AW2A 1EHYA 3BM5A 2GN0A 1BCSA 2XWBF 3SXPA 3ZUGA 2Q28A 5LD2C 2FETA 2AK3A 4XX0B 1PI3A 4G0NA 3L04A 5EHIA 5KWIA 2PL9A 1DJPA 4RPLA 4UUMA 4HEQA 5DK6A 2OORA 4L5AA 4OQPA 4RCVA 4H6VA 4QRHA 5CW2A 4D6YA 3RSFA 5B55A 2ZAMA 1USUA 4ZVRA 1FSGA 5DWVA 2DC1A 4L6AA 5HPYB 2ZRDA 2XE7A 5HF8A 5B4VA 1PR2A 4CUZA 1NPTO 5M34A 3OFKA 3IP8A 3GNQA 3ZOZA 3H3XA 3N76A 2O7VA 4JMPA 3T99A 4JC4A 3NHLA 1YACA 1XQVA 1Z4PX 3UYLA 1GTJ1 1A8QA 3DKKA 1P75A 1UC9A 4B71A 2QT9A 1O0BA 3F74A 1BOFA 4N39A 4UFNA 3O1IC 4QTUB 2YMMA 3DMHA 4MGIR 4Y0AA 5DBEX 5J40A 1V26A 2K6GA 1Y8QB 3K72B 1J4AA 2DERA 1XLTA 1PFGA 3RAEC 1GL6A 1AUVA 3B53X 3R5TA 3OQMA 4ENQA 3ML1A 4MI9A 1S2GA 3KR9A 4HH3C 1L5KA 3AM3A 2XNKA 1N3BA 4FZ3A 3EQ8A 3KKLA 4K28A 3RRBA 4D0NA 4GE3A 1W36D 4MUNA 1J8QA 1EXMA 2WIBA 1M6WA 2A6PA 4TYWA 2PUJA 2G9QA 3NBYC 4B3FX 4Z0NA 5IJXA 5GZ3A 2J8ZA 4ER5A 3A14A 5HKAA 2AKEA 1GPJA 4EF4A 4KG7A 3IGFA 4L76A 1P73A 2OVFA 2QAGA 3OZEA 5ETJA 4YAUA 1DBVO 4OSEA 1PDVA 1CQJB 1YB1A 4BPBA 1R0RE 4BTLA 1E9AA 2CHEA 3M3PA 2A0FA 3MC1A 2VC2B 4NSNA 5U4QA 3RS7A 4W99A 4BGVA 1I94B 1ZRSA 4DJ5X 3BFXA 1YKGA 3AR6A 3K6KA 5F1KA 4CKCA 2AT1A 2PUHA 2QXYA 1LWOA 1BEEA 2RBKA 4FI3F 1P1HA 5LBTA 4BWFB 5B4TA 1Y5NA 3NDJA 3OUZA 3PNQA 2Q3JA 4ARZB 1JG4A 2WIFA 4M54A 2PNFA 4JI0B 3KP1A 3ZQUA 5G02A 5JMPA 3L6DA 4BO7A 3N2KB 5IC4A 3ZJ5A 1E5XA 1FFAA 4NI5A 1LCIA 5TQ2A 2FLVA 5AHRA 1OWNA 1X8KA 1YHNA 4DLZA 4G1EB 1T8SA 2QMQA 4DREA 3P9PA 4CIBA 3CZ4A 2O2JA 4FX2A 4CKBA 3GH1A 2YHBA 2LGJA 4DG5A 1PBNA 1Y6JA 2VHVA 3OZFA 5SYNA 4EYGA 4Z0PA 4OJYA 3WLPA 1RRCA 1FOEB 1J5EB 5JH7B 4EKGA 5AJTA 2JH3A 1WTCA 4RX1A 2B98A 1LTKA 1L1QA 4D9MA 2GD1O 2CY0A 2VDOB 3FMOB 4CMEC 2QIPA 3VSCA 1WVMA 2FCAA 3EZGA 2WM2A 3FLAA 4KLNA 3O90A 4PLCA 4ZA2A 3ESCA 1FIUA 4MVJE 3OOEA 3F7NA 1CUCA 2G83A 4JFAA 4TYMA 3IIEA 2QHXA 3IC5A 4NYIR 4F4JA 2IYAA 4RZQA 3H17A 1V37A 3WIEA 4NXMB 2HWYA 2Z57A 4RK7A 2XVMA 2HHCA 4ZI3A 2PG3A 4G1CA 4B4DA 4QLOA 3B3QA 3EDOA 1W4RA 3C7DB 5HIKA 4U2DA 1ZNXA 2W2QA 2BFEB 1QOPB 4FDUA 2YYZA 4HO1X 4YJHA 3WLTA 1AS3A 2W4IA 1U8XX 2AWNA 5CLJA 2Y1FA 3HN2A 1V8DA 2JJQA 4QA9A 1NX9A 3O03A 3TWOA 4QBTA 4CLHA 3MXOA 4TMXA 3AHEA 4NEQA 1LLCA 1YZ3A 2FPSA 3OPMA 1YJXA 4FS8A 4EJ6A 4HF7A 5B64A 4KE8A 2QD2A 5AI9A 4GZLA 2YJNA 4MP8A 1NY6A 2PO7A 3S1AB 2QLNA 5IDWA 2ZWAA 2FEPA 1T6BY 1RYBA 3IBSA 2OFFA 2W6CX 1GA1A 4M8IA 1W47A 4B85A 1X77A 3ABZA 1IE3A 2WJ6A 3EXFA 1W4CA 4A5OA 3E9CA 1QFZA 3F4LA 4DCOA 1KMMA 5DM70 4OHPA 3JRNA 5SY4A 2P4QA 2PLNA 3T7KA 5LQJA 2HQBA 2QRMA 3AHFA 3ESZA 5KX5B 1Z38A 4RTRA 1DXOA 4BZZA 4WY2A 5IT4A 4P92A 3QF4B 3GDFA 4B7CA 4CCWA 3OLXA 4GP7A 1UP7A 3CTPA 4N5MA 4X9XA 4LJAA 1V1RA 1CUFA 2J7PD 2HHJA 5H9VA 4ENRA 1ID1A 2F1IA 2W90A 4LE2A 1BD3A 3SWWA 4ZT2A 2FZ5A 3TW8A 1NW8A 2HW8A 3EIFA 1AV7A 1WUJS 3GL9A 1B8VA 4G25A 1MX3A 1IQUA 1W6UA 4Y0NA 2OO3A 2NMVA 4IXMA 2H31A 1WE2A 1L7EA 3O1HB 4JQYA 4EW6A 2D1FA 2ECPA 2JHGA 4LHVA 4TPKA 2O8BB 2PWAA 4FKBA 5D3MB 2W2KA 4D8UA 4AKEA 5L3RA 1JQBA 1Q7TA 2NZXA 4GX1A 3DR5A 3HN7A 3R09A 3TTWA 3WK8A 1XKTA 4JR0A 4XB1A 1SUAA 4G8CA 5IP5A 4DSZA 1DUSA 1E2EA 2GPJA 4GWLA 3UB2A 4MJ7A 4ZO7A 3ZVKA 5CYPA 1VIYA 1WBDA 3GN2A 1NI4B 2KWIA 3EOZA 2PUBA 1G7RA 5EWJB 2YBEA 3GLIA 2XOEA 2YR0A 1WDKA 1M34E 2BKUA 5CCBA 2DT5A 3CLKA 3BD8A 2VPQA 3P71T 1P31A 2EZ4A 2XBLA 4P4TA 1Y8RA 3NOQA 4LX0A 4F21A 1QYCA 1Y3HA 2RI0A 1A95A 2ZYSA 1H9BA 4GPIB 3RK1A 1S4QA 1TEHA 4HP8A 2JIPA 4EYQA 3D4OA 2FPLA 2YXLA 3BMQB 3Q87B 4PHHA 3LC1O 4PS1A 4ZT5A 3W0LB 5BUQA 5KPJA 3OJ0A 4C0HA 1LSUA 4NICA 3RREA 3VNUA 1TZKA 2Y1LA 3HBLA 2X2FA 4ZI5A 4AX4A 4BVEA 5C1BA 4DV5B 1EDEA 4UTZA 2XKAA 1JHOA 1ZGAA 3BHIA 4IL5A 4NBUA 1R6VA 5CDFE 2UXCB 1G8PA 4O4JA 4RY0A 3VYSB 5DRYA 3GFQA 1OH5A 1Q7RA 2WYIA 5DMXA 1F6WA 3QBJA 3SCZA 2GMWA 2AEJA 2VQ3A 1N2XA 2VDVE 3MHPA 3ZV7A 2OV3A 4PPYA 3FBTA 1YE3A 2AEFA 2P68A 2XD9A 3BTOA 3PFWO 1BSVA 3QPUA 3RM3A 4YWJA 2DQYA 5BQ5A 5AOCA 2IUFA 4F96A 4JLAA 3F7OA 2FJ0A 2X14A 1T4DA 2WYOA 2BR3A 5D8DA 2H8KA 1XG5A 4CCYA 1R0XA 1FU4A 2AQIA 3A11A 3PE4A 4MJXA 2BUCA 2B69A 4UXHA 2CJYA 3K2BA 3NRBA 4RLSA 2AD1A 4JLJA 5FTMA 1ZK1A 1ZXXA 2AJDA 3KEGA 4UTVA 5JWOA 1KKUA 2Q0XA 3FBGA 3FVTA 4N40A 4IIHA 5G53C 1CY2A 5F9HA 4FLEA 4NBLA 1K8XB 2W2XA 3CEPB 3GWGA 4MVJA 4P36A 2XR1A 5REQB 4PAQA 3K15A 5AJWA 2BFNA 3ZQJA 4ECEA 1KGSA 1I7LA 2F1JA 4H3KB 1F0KA 3NTUA 4DCGA 1OOEA 4CKXA 3K4QA 1MX1A 3K9GA 1M1UA 3TOSA 3W2GA 3E15A 3TG8A 1PW5A 3L4BA 5G41A 4B17A 4AAYA 1KEZA 3G7UA 3SFZA 2F3UA 1G98A 1YJ8A 5CDSA 5EMMA 5JRDS 1SFRA 5KBYA 3C3DA 4X63A 5AJVB 4NS4A 2DPXA 3TLJA 1I1NA 4BLQA 1C7FA 1R6BX 3BWMA 3EIEA 3PXEA 3I0ZA 5DSZA 2YN0A 1R8YA 2XZLA 4IIDA 2B7BA 2AIRA 5C5IA 5ALXA 4DILA 4L4ZA 3WNBA 4QUJA 3VOTA 4GKVA 2ZIXA 2BGWA 4FGZA 3SIWA 1A7JA 1PJLA 2WYWA 4FTWA 5EXSA 2ZQ5A 4TXMA 5BURA 4S24A 2HRRA 5AXBA 4Z4HA 1M7HA 3SEQA 4EFKA 4F1JA 2FQYA 3A4VA 1GNTA 4HJXA 1EUDA 4M0DA 3GR6A 4O25A 1GTSA 4EQ6A 3BGSA 4NONA 1F1JA 4L5IA 1VYTA 2QTAA 4DR3B 1TC1A 2GBGA 4BUZA 3OI7A 1Y1RA 3M9XA 4S12A 1GPWB 2WFLA 4G8JA 4OB7A 2H07A 5FL3A 2CZCA 4N6NA 1OKKD 2Q4OA 4FFNA 1OZAA 1KAMA 1SOWA 2OHGA 2VHTA 1U81A 4KE9A 3SHQA 1DCFA 5IVIA 1E5TA 2X9VA 5ALFA 5L3SB 3KPVA 1K08A 2RKBA 4KLAA 2E1RA 4CI0B 5GOTA 3RANA 4U39A 5GGYA 1R0SA 4P5DA 1RM3A 3KR0A 1C9NA 4UD6A 4YMGA 5CYGA 3RBXA 2RDMA 3OE1A 4RHCA 1HNXB 3ND8A 2PEYA 4B4VA 1RQXA 2EDCA 1KE2A 2J4CA 1IIRA 2BGJA 1LK0A 2VI5A 1OI4A 2Z6UA 4MYSA 4KDFA 3HO1A 3HCDA 5KHLB 3TLGA 2UXDB 4V0MA 2X7XA 2GGSA 3CO0S 1UJ2A 3CRMA 4O3FA 1L7RA 3JR7A 2JLZA 3PHIA 1L5MA 1XXHB 4D56A 2ZJZA 1B8UA 4CT4B 4IDBA 4LPKA 1QQ5A 2F4NA 4HEJA 3RD5A 5B57C 5EKDA 1G16A 1Z4QA 3A4YA 4EFLA 4KUEA 4OP2A 721PA 2GD2A 2FMIA 2IKSA 4EVQA 5KAPA 2GYWA 3E7XA 5IN4A 1TW3A 4RK0A 3REOA 2HBQA 4CNQA 4DUZB 4Q3DA 1D2NA 1FS4A 1U7WA 1D1SA 3GPBA 4QFDA 5B1EA 2EOAA 2JLBA 1UPXA 3NBUA 4KZKA 1T2DA 3FZYA 1KSFX 4JHLA 3S40A 2RAPA 3SJAA 1JZQA 3IB3A 3OX2A 1W59A 1KVTA 1YBMA 4PW0A 3UV3A 5ESRA 1E59A 1OB5A 1NIPA 4MVJG 3A2KA 2EEPA 2QTVA 1EYZA 2FSVC 3LCVB 1K6XA 1RAEA 1U2DA 2PV0A 3HUDA 1CRPA 3OAAD 4MV9A 3L6EA 4AN0A 1EVIA 1H0HA 1R9MA 1TCAA 1I80A 2CKMA 2PH7A 3QXJA 5KB3A 1G5PA 2XUOA 3TQRA 4ID3A 3AERA 4DWWA 1RMYA 1GTRA 1EJBA 2AOXA 4MUBA 4URHA 3H42B 4ENUA 1J25A 3PFBA 4LK2A 2IHNA 1X8JA 4CDGA 3CRW1 5CNJA 2EJTA 4EITA 1C8VB 3FAKA 3KHTA 1R7RA 4YRGA 1I2DA 1M7GA 4BO1A 4YROA 1E6KA 5LZ2A 3OZGA 4W5WA 1EE2A 2H17A 3NALA 3QGMA 1ESZA 5E6RA 4MIEA 1MRSA 3OHMA 3ZS9A 1HKUA 1PFVA 1KJJA 2IHTA 2KS6A 2OD7A 4INJA 3TSCA 4QUGA 1FS6A 3OY2A 3EH2A 1KOJA 1ZPDA 3IT3A 3ZDRA 5BN3A 3CA8A 1O9BA 4FCCA 4P35A 1I3MA 2JGKA 2ZWMA 3U9SA 1BVUA 4UM7A 2IP2A 1KP3A 2IYFA 5JCZA 3H8JA 3WL8A 3M1YA 4KMOA 2XUIA 5IZCC 4D9JA 3UV7A 5GIPE 4D9NA 4JT8A 5KSZA 1JIKA 4FXOA 5LWHA 2NU7A 2Q2VA 1X7GA 3RIEA 1IEVA 1NP7A 1A71A 2CJXA 3TD9A 2AX4A 3TZEA 2XB4A 2QPTA 1YIDA 2I5PO 4V2UA 1YZYA 2DUUA 2WJHA 4XPZA 1C7EA 4WNAB 4WGGA 3T3HA 1DKRA 1FFHA 3INNA 4CM1A 4DTIA 3RADC 2XE8A 1CS0A 3U7EB 3OTGA 3VZRA 1H5NA 5HP4A 1ZH2A 2RK3A 1TMGE 4JGIA 2CB9A 4NMHA 1HNWB 1KK0A 3THRA 4LECA 2EF1A 1QE5A 2V1UA 3KLPX 3FCAA 4XQCA 1EVZA 3IRUA 4YV0A 4F4DA 1BQEA 1FY2A 3LS2A 1I01A 1ZGZA 3CN9A 1H2XA 1ZLYA 2QXUA 3BJRA 2AOTB 3LUJA 5EZYB 3EC7A 3GG2A 4B4UA 4PIVA 4WACA 2AX3A 3QKSB 5DXFA 4BNDA 4FWTA 3WRXC 1MOQA 3L06A 2XCQA 2PXHA 1KMHA 1LK7A 4M4SA 1JQDA 2PWZA 3E05A 1BO6A 2P7IA 2WKPA 5C9ZA 2NIPA 3DBRB 3VUFA 4BB0A 3OQBA 4GE0A 5AVZA 3EH1A 1C7ZA 4I50A 4KMRA 2VPPA 1QYDA 4HG2A 1SC9A 2HDNB 2JASA 3IB6A 3D6AA 1X0VA 3MCUA 3UO8B 5TC4A 5A5VA 2PANA 3WB0A 3KE9A 5CA0A 4L57A 2QNIA 2GVZC 2C2GA 2Y92A 3RWOA 1CUHA 2BY4A 2XA9A 4MMYB 5KTNA 1F38A 4TYPA 3DLIA 4V0LA 3F96A 2IODA 2WVJA 4QYWA 1V1MA 3EHEA 3UXEA 4YRAA 2R8EA 2XTMA 4R2MA 4F86A 1AQYA 1AUXA 1QTIA 2GPNA 2XVZA 3EC1A 4EG5A 2XCTB 4R1QA 2JBHA 3AOEC 3MIIA 4HXEB 4AJLA 3NX4A 3UT6A 1K6IA 1MGOA 2QQ0A 2QRNA 3RBVA 1NNUA 3G0BA 4AZTA 1F8YA 4R0MA 1VKNA 3LY5A 3RLIA 3V3KA 3QVGB 4ZI2A 4H7PA 1XMVA 4LF5B 1CIJA 1GXSB 2NUTB 4Q03A 4F5WA 2B7LA 2F8TA 3W4KA 3FWHA 2BI8A 4IR7A 3RWMB 4BNIA 3DV0A 1V3TA 5JMOA 5LQCA 2HI0A 2ODQA 1E3JA 1TUEA 3F1KA 3JASB 3C39A 2XADA 5DX1A 2IOHA 4GI5A 1EM8A 3NXSA 4UCXA 2QLJA 4GLOA 1RM5A 1E58A 3P9RA 2YY7A 4FE7A 2GJKA 1Z75A 3SLKA 5LPNA 4Z99A 1T5IA 3K5WA 2KMLA 2B9VA 2Z04A 4L4YA 3L4JA 2ZANA 2F9FA 2FMKA 4EFDA 4YRSA 1A8PA 2G17A 1CY7A 4IINA 4KXMA 3KUKA 3MB8A 2CVFA 4IJ6A 4FYHA 3PD0A 1HTWA 1X7YB 1ORHA 3RFTA 2A0WA 2PHZA 2W83A 4ML3A 1KYXA 1E5DA 2K4MA 3Q0EA 2VA8A 3VC7A 3LUDA 5K3AA 1B6TA 2AE1A 2VYNA 2RBEA 4JBXA 2H4WA 1YUMA 4O1IA 1SBTA 1XK7A 3PI6A 1O94C 4RF2A 3M33A 3HVIA 2XSZA 3L7BA 4M1QA 5DZSA 5E4JA 1OBVA 3OESA 4UMDA 1M72A 2JIZA 2XT6A 3WR5A 5KNBD 1GRQA 3OF3A 5COQA 2VPZA 1ESCA 3MINB 4Q9NA 2GZMA 1CFZA 2ZYGA 2HEIA 5EWLB 4OHYA 1UXIA 3UC9A 1WV1A 3TTSA 2P11A 2RHCA 5AJYA 5IXYA 2ATEA 1Z26A 1YZLA 2P5YA 3GY0A 5AMXA 5I6DA 3QKIA 2YV3A 5CDYA 1HTBA 1QFMA 2A94A 1JF8A 4AZ0B 9ABPA 4NBKA 2Z2JA 2QE6A 4AG3A 4D82A 2XB9A 3OFNA 4AN4A 1F3LA 2ID8A 4ZI7B 5DOVA 3U4CA 2QT0A 2ZJ2A 1P1FA 2QRZA 1LNZA 2A14A 4NYJR 1YF3A 4B6OA 1JR3A 3E4DA 4MXDA 1U0SY 2V4ZA 1ZNZA 2Z95A 2QG6A 2UZ1B 4FT4A 3DYBA 4ZQIA 4JMLA 3WLMA 1W5FA 2Z5GA 1NURA 3QX8A 1LF0A 3P96A 4N0DA 3K2EA 4ALNA 2O07A 1GNPA 3KZVA 3LUKA 3Q2OA 3R5SA 4YP0A 3QV1A 4ZZ3A 1RKUA 1D4OA 1ZESA 4D8XA 5LQRA 2DQSA 1OR8A 3K6RA 1IG0A 5AUQA 2BGMA 4G0OA 4NYMR 4X71A 4NP6A 3TIFA 1GFWA 4ETWA 4R40A 2QZ9A 5EUCA 3S2GA 4Q1BA 4RQUA 4Z4GA 1M2HA 3DLAA 4IRMA 3HM9A 1E5VA 3VAZA 3RUAA 4DTCA 4JNCA 2NUPB 4K9PA 5DBHX 3UCFA 5B12A 3LCUA 4LRUA 1XK6A 5SY6A 2G7ZA 3GLFB 3R7WA 1L8XA 3RW9A 3F46A 2IP4A 3Q6MA 2QU8A 3SI7A 4C0QC 5LLSA 1BKSB 2B36A 4BQOA 1A50B 1Z4OA 2AXNA 3M6AA 5TPWA 4P0QB 1SKYE 3GARA 1L4UA 3RTBA 1PWXA 1GSIA 4ND7A 1NDUA 4NJMA 2YJ3A 4XJSA 2B2NA 2PNJA 2RSLA 4CMBA 2X4DA 4ETMA 5JC1A 2H3EA 2RH5A 5LQNA 4HGRA 1L4HA 3EY9A 3OTOB 3OCUA 3S1LA 1DTSA 1CYEA 1T1EA 3Q5DA 3OEEA 2F1KA 4HFMA 3SQXA 1CY1A 1U28A 4HGOA 4DLRA 2QQ5A 4W8HA 2ANBA 4L78A 3EDYA 3OIVA 2GZ3A 5KKAA 4GZ3A 5DLEA 4DPMA 3GDHA 3PVSA 1OFIA 4AL4A 5AESA 2PCJA 1PV2A 4RK1A 2QP4A 1E1DA 4DF3A 5AWFC 4UDYX 3GRVA 2FKNA 2YW2A 4FC6A 1O57A 4HD8A 1FP4B 1BDJA 2NOAA 3JATB 2XZDA 4MWGA 4NE9A 3O8OB 3RSSA 3UB4A 1K89A 3G8YA 4H16A 4LCBA 4GSYA 2ZJ3A 3F6PA 2C4KA 4I1OA 3ZZMA 3ZEAA 3I23A 5T41A 2ZAIA 3VTKA 2SECE 2R8PA 2BIFA 4BFTA 4CEHB 1IM5A 1G55A 2XDWA 3EOBI 5EPUA 4ZVOA 3TD6A 1O97C 1U28C 5KYNA 4N3NA 5TV2A 5K20A 3EYWA 3L18A 2Q9BA 4H0NA 4JI1B 2R0QC 3OTHA 4QJ3A 3D31A 3B1VA 1YS2X 4QX6A 3ZIUA 4CM3A 4BLOA 1UAGA 5LFAA 3WWZA 4TVSA 1IXRC 2EIXA 1N7GA 2XDQB 2I4RA 2OCPA 4N4AA 5HRCA 1RYNA 1I1OA 4P82A 3E0XA 1Z8NA 4TLMB 3D2AA 5AUOB 1X0XA 5E1BA 4P3NA 4JS0A 3KBOA 4R9RA 1UFVA 2P1DA 3H4MA 4HXGA 3AFNA 4EW1A 2R8ZA 2JLUA 4LF4B 2O5VA 5IG2A 4U7PB 3SQLA 4YHHB 1UJNA 3PNYA 1RJFA 3HA3A 4DUGA 2DFTA 3IR5A 4F8EA 1DQPA 2P9JA 4RADA 2I6GA 3AR8A 4GRDA 2R85A 1FDVA 3PKIA 1SCDA 2UVPB 4GW3A 3AJDA 1NJSA 1H6AA 4H6PA 3ADKA 3FVVA 2YFHA 5HKKA 3P94A 3MXTA 1NMZA 3N8DA 2OZPA 3HBMA 4MV0A 4X91A 2MSEB 3KXDA 1FRNA 2CLMB 4RCYA 3OSUA 5JJCA 4YVFA 1IMOA 1EFPB 2RKOA 1TVKB 4OLFA 3CBGA 1Z7EA 3DV9A 3OZWA 1ZU5A 1GZ7A 1TVMA 5E2BA 1ITZA 1QH8B 3DL4A 4DLUA 4XUEA 1ZYUA 4ZEVA 5A3VA 5HZGA 2A9PA 4TWAA 1E89A 2FN9A 3C87A 1DKNA 1HDIA 2P9EA 1X1CA 3LA8A 5CLQA 2CXSA 2WDZA 2OFOA 4NKRA 4AURA 2AI2A 5F2KA 3UTDA 3SN6A 2C59A 3FSGD 1ZGGA 4W8OA 1W0JA 1OSNA 3D1LA 3KPUA 2RI1A 2FSVA 3I1IA 2XCUA 4FEYA 1N9GB 3WJ7A 1A82A 1SU4A 3JQPA 4BV3A 3GRZA 4D26A 2O50A 3UFXB 1LRKA 1DC6A 3QVTA 1Y5IA 2C7VA 3BPSA 4XGIA 4E5VA 4RA9B 3RABA 2GERA 5L53A 1ML3A 2XAUA 2P90A 1A5SB 4IQFA 3RC2A 1EWVA 4M83A 4GRIA 2CWDA 4XWWA 3KQHA 1D6JA 4GSLA 2P4EA 1QONA 2YXEA 3O8NA 2H0QA 2B0CA 4MYTA 3DAOA 5BPHA 1SXQA 2CV2A 4I08A 4RF5A 1SHZA 3RYIB 4JT9A 3WIDA 2WJJA 2NP7A 1AKVA 3MLAA 3U0VA 4BEJA 2J7PA 1G18A 1CRWG 5A4FS 4QBHA 2AJ8A 3JQGB 3AJEA 4MMXB 4LG1A 2C4HA 3BD9A 3N6VA 1FFXA 5B6JA 2I91A 4KQIA 3DUFB 1SU6A 2WNIA 5TE9A 4LKOA 2K2QB 2RHJA 3X1ZA 1XTZA 1DHTA 3GHYA 1GNVA 3KU1A 4ITVA 4LQCA 4E13A 1G59A 3M6UA 1B1CA 2RAUA 5TQ0A 1T0PA 1Z0ZA 2JH8A 3FD8A 5EPEA 2OTCA 5LKRA 3EGVA 1EUZA 2BI7A 3C3WA 1NI3A 4G9GA 3HP7A 4QGFA 3PGXA 3WGZA 1CR6A 4GT1A 4WBNF 1V4VA 2H3HA 3ILXA 5EEHA 3B3FA 3CE6A 1N4DA 1N0IA 3DQPA 1A4XA 3G5LA 3A8TA 4W1PA 4EJ2A 3NW9A 3PQ8A 1YGYA 3UAZA 1VJGA 1PNRA 1BWPA 5K0ZA 1R12A 1N5DA 1TKRA 2C9YA 3I2FA 1QCYA 4GBGA 2FVXA 2IPXA 4B4WA 3F78A 2FSGA 3OFND 3RC3A 1BFUA 4WY5A 2GF9A 2ZIUB 2I76A 3IE1A 1KL7A 3PFNA 3EN0A 4JBGA 5C4IA 3DZDA 1T8UA 3FCXA 2WFAA 4S2UA 1L8AA 4B6SA 2DF8A 1A0OA 2X86A 4FBLA 3R7DA 4ZT7A 3MOIA 2WHEA 3IS3A 3ORHA 3C8MA 4C0AC 2C4MA 1ODJA 1S7GA 2ZAOA 3CPJB 3VH2A 4ZICA 2QLTA 4PBSA 2YZGA 2FZEA 1NVVR 5F7ZA 1T3TA 1Z73A 2FWNA 4FYKA 2QTMA 4U7JA 5GGXA 4N7MA 3EWSA 2VIIA 4COKA 5AW3A 3OIUA 3BX1A 4X84A 3MJHA 4IMIB 4EQZA 2E87A 3KC2A 4MGHA 2ONJA 1TOAA 2EJCA 1EDDA 3RSLA 3SKVA 3WG9A 1NVFA 4EUSA 4Y2JA 4G97A 2WIGA 5F73A 5T5QA 2R97A 2C20A 5G3YA 3ZK8A 1AU9A 3VVLA 4Y6GB 4YY3B 2XUJA 3A3OA 4QBGB 3U0BA 2BGKA 4GMKA 4UFOA 4KLZA 5TQ2B 4B2PA 1YCHA 1OX4A 4BNTA 4RVSA 1EHCA 1NBME 2ORVA 2QX7A 3LO8A 1P0QA 4I1RA 4MV8A 3UK1A 4QUHA 4BBJA 2ZWVA 4CFSA 1N5RA 4YMIA 1FLNA 3LBIA 3O9MA 4WCFC 2O7SA 1CUGA 4H77A 1OAKA 3AF3A 2WUVA 2GCNA 5I48A 4KIUA 3W05A 2FPUA 2ZBGA 5JSYA 3ZCRA 1VE5A 2BDUA 4BMCA 3GRYA 3U7IA 1A9PA 2XF8A 3EOAI 2B83A 3AFMA 3FTFA 3AESA 4RD6A 2Z08A 1XRSB 3CUVA 1P9NA 1ZD8A 4RHTA 5EP2A 2BM1A 1RW4A 3D3EA 1OBOA 1XMXA 3H2BA 4DQDA 3UAYA 1X92A 1ZK4A 4YAKA 2EARA 3SHWA 4PO3X 1Q7CA 4UARA 2BWJA 3LMKA 4K9KA 2JLWA 4YMUA 3IELA 4FOLA 4QEZA 4BCCA 3KKNA 3MCAA 1TO1E 2VHCA 4LWOA 1UIMA 1D2CA 5A4AA 3LZ6A 3MOGA 4QAJA 2OHOA 1ZR2A 3U6KA 3EUWA 3EFOA 1YUNA 1QKJA 3NVKI 1H2BA 3C1AA 4E1VA 3R9XA 1OWLA 3I62A 3BH6A 1XEXA 1Y1QA 3THYB 3AFGA 3WB9A 1JHRA 3T7JA 1RPJA 1U8FO 1Q1EA 3W5DA 1H8ED 1NWHA 1LI4A 3RFFA 1C3OB 3W06A 1WQ4A 2FZLA 5TMBA 2C1XA 4I1YA 1W76A 3MGKA 3UOGA 4CMJA 1UKZA 5ESDA 4IBOA 3LF1A 1JLKA 3PK0A 1GTL1 1JPVA 4QC2A 4ZOLF 1E69A 2WJ4A 4RMGA 2E82A 3V4VB 5K8TA 5K03A 1MJ5A 3GCZA 1U7DA 3LBAA 2QW1A 2Q3LA 4NENB 4C1BA 1H9AA 1SZJG 1RXYA 2VP0A 5JS1A