5TC4A

Crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
292
Chain Sequence
EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Emerging Cancer Target MTHFD2 in Complex with a Substrate-Based Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohy
total genus 110
structure length 292
sequence length 297
ec nomenclature ec 1.5.1.15: Methylenetetrahydrofolate dehydrogenase (NAD(+)).
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tc4A01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 5tc4A02
1ENOA 4CV2A 1N5DA 2B83A 2GR9A 2G76A 2H6EA 3NDIA 1LDNA 4E4YA 3ZWPA 5I7SA 4D45A 3W6ZA 1UXGA 3PYLA 4OM8A 4YQYA 2WE7A 3M2PA 4P4GA 1CERA 5I7FA 4D43A 3K2EA 4BV9A 1GCUA 1RKXA 2H63A 5L9AA 2J3HA 3OA2A 1HXHA 4I9NA 5G0WA 2EGGA 3VVCA 4XB1A 2EKQA 2H5LA 3TJRA 3RJ5A 1G0OA 1ULUA 4L4RA 4OOFA 3NEPX 1P1RA 3JTMA 3ROKA 2RH4A 4CMCA 4XCVA 5CEEA 2D5CA 3IKVA 1LBEA 2GN4A 3PTZA 4FOSA 3JV7A 2PA3A 1J4AA 4JJIA 4UVEA 1YQDA 2HJSA 3C7DB 4AJ4A 2VOEA 5TGDA 4CR8A 5BSHA 1EK5A 2Q1UA 5ENDA 3MZ0A 4PG7A 3KLMX 2PKQP 2C2YA 4XDZA 2QRJA 3LF1A 4YJHA 4AJKA 4R1SA 4Y9DA 3DAPA 2O4UX 4W7HA 3ICCA 1OMOA 4BHTA 5CDSA 3WSVA 1Q1NA 3A06A 1N7GA 3W4JA 4CM3A 1H6AA 1H5QA 2NM0A 1GUZA 2OL4A 4UVHA 2QX7A 1LEHA 2WD7B 4U6QA 1Z7EA 3PWKA 3GOHA 3DBHB 4TZKA 3I9NA 3TSCA 3VC7A 3BMQB 2ZK7A 1LRJA 2NQ8A 4YT5A 4WKGA 3DFUA 1AN9A 4IPTA 4E13A 1E6UA 1QV7A 1FDVA 1QYXA 5EINA 1V3TA 1GYRA 1UAYA 2HU2A 5I7VA 5L4NA 2Q2QA 1DIHA 2RHRA 2VTDA 1LSOA 3HDYA 4MVJA 1P1HA 2OORA 4I9HA 3RKUA 3O38A 3M2TA 1L7EA 3BMOA 3H4VA 4IDEA 4K6FA 4C4OA 1JAYA 2IRWA 1BWSA 3DBVO 3JQCA 1LX6A 5TRTA 2V7PA 1PTJA 1WMBA 4Y6SA 5TC4A 1EFLA 5FFFA 4B79A 2HO5A 4XA8A 1O89A 1ONPA 1XDWA 2C59A 4GLOA 4OIMA 4LVUA 3UF0A 3FTPA 4KTVE 1MXHA 3QJ5A 4IDFA 2JD1A 1SPXA 2YYYA 4OAQA 1WZEA 2JFHA 4FN4A 4S1VA 1XQ1A 3DBRA 1LNQA 2TMGA 1GFSA 1KYQA 3G3EA 3JD3A 4YRBA 4C7JA 3H9UA 1E7QA 4IDDA 3KYBA 4NFHA 1U2GA 4ZHSA 2C7VA 3EAGA 3ZHZA 5T5QA 4CMIB 1MLDA 4RQTA 4DLBA 3GN2A 4ZRMA 3FNEA 3G79A 1V6AA 1TI7A 2WSBA 3M1LA 3ZWMA 4IY1A 1QSGA 2V6GA 2Y0CA 3UUWA 4IQGA 2GYYA 2B36A 3UCXA 3B1JA 3H5NA 3ZWBA 2I76A 1I2BA 5DF1A 1JWBB 4WCDA 1F8GA 1JVSA 4CR7A 4BNNA 4DC0A 4CM8B 5I8WA 1ZCJA 2AQHA 1SO8A 3C3XA 4EJ0A 1VJTA 1PGNA 3ZDFA 3ZNQA 4AICA 2IXAA 4YAIA 1DHTA 1ZNQO 2A9FA 2VRCA 1HWYA 1QG6A 3PK0A 4YVFA 1MC5A 4QX6A 5DP2A 1EBUA 4KUGA 1IHYA 1D1TA 2IZ1A 5EQDA 3GAFA 4QECA 3L77A 1V35A 1ZXLA 4K26A 3ZWCA 3BXXA 3GMDA 3ONDA 3SEFA 1UZLA 2RHCA 1LLUA 4RZHA 3TZCA 4CLDA 1JA9A 1JKIA 3E18A 2IZ0A 5L45A 3DHEA 3F5QA 3E9NA 1W0CA 3PFWO 3BTUA 5EL0A 3W8FA 4E2ZA 2BFPA 1DPGA 3AFMA 3LQFA 3E6AA 4GQAA 4WEOA 4FQ8A 2DPGA 2GSDA 3QVTA 3X2EA 1YS4A 1B14A 4I8XA 5COQA 4WLEA 4E6PA 2B5WA 5JCXA 3PJFA 2RCYA 1LUAA 1NPTO 1QYVA 5TS3A 2P9GA 3FNFA 4EJMA 3PEFA 1U3UA 2W90A 4D3DA 1GZ4A 4CM7A 4N5MA 1AGNA 1LRLA 2QW8A 1MX3A 1N7HA 5JPIA 4A26A 5B12A 2DTDA 4DPLA 1XA0A 4LCEA 1N92A 3KYDA 3DZJA 5TF4A 4E32A 1CWUA 3OF2A 4U6SA 2GN9A 1QORA 3CTMA 3EGOA 4OOEA 1E7SA 1BXKA 3RUEA 4JBHA 1QXSA 2CFCA 4BO0A 2XOXA 3GMSA 3KEOA 4OH1A 1DXYA 4F6CA 5FI5A 3BA1A 3S2FA 4FJ2A 4CV0A 4CJXA 4NDNE 4Q3BA 2VWQA 3TNLA 2GRAA 2HMTA 1LDGA 2DU8A 3KTDA 4J2OA 4Q39A 4XRRA 4RF2A 5DULA 2WM3A 5JC1A 3ZU3A 3HDQA 4A10A 4R16A 3GAZA 1EBFA 4PG4A 1HLDA 1NNUA 3ETEA 1PZFA 2W98A 4ZICA 4Z9FA 3KB6A 2Q99A 1WPQA 4M1QA 4CPDA 1W73A 5LDHA 4MVJG 3WICA 2ZYGA 1LA2A 4MIOA 3Q2KA 2J3JA 5G0UA 1KVQA 2ZB7A 2O3UA 2HLPA 2HRZA 1NXQA 5HRUA 3GDFA 4MKZA 1LI4A 2DUWA 1HRDA 1I8TA 2O23A 3PHLA 1H9BA 4RORA 5THQA 4DIOA 5HS6A 1P1JA 3I9KA 1U9JA 4CV1A 4EZBA 4DRYA 3K5PA 2P4HX 1HDGO 2FPGA 3AWDA 2YDYA 4A73A 2X9GA 4TRNA 1OOEA 4WOKA 4QUKA 1ULSA 1L1FA 2NU8A 4A27A 1ZSVA 1P0CA 4AJ2A 4CQLA 4A5OA 1HSOA 4FD3A 1RM5A 2PZMA 4OSPA 5DOVA 2YQ4A 3WMXA 3GNQA 1P33A 1ISHA 1ML3A 3ETDA 3IOYA 2V6BA 3LYLA 3PXXA 4Z9XA 3X2FA 4BO6A 3S55A 3UFXA 1X13A 1ISGA 3D4NA 4HFMA 2OHXA 4Q3AA 4E3ZA 5F1OA 2BRUA 4QT0A 3UKOA 3AM5A 3NTOA 3ZHXA 2HMVA 1SZJG 2DBQA 2JD2A 4NK5A 1X1EA 3OEYA 4OSOA 1U4OA 2O2YA 4KDFA 4FC7A 4XYGA 1HE3A 2PD3A 4ALMA 2VT2A 4R54A 1R4MB 2FHSA 3ZGYA 4IZIA 3VAZA 4ONEA 1GAEO 4DBVO 3BTOA 3NTQA 4GX0A 4CMBA 1PGQA 3MJSA 1SOWA 1O6ZA 3ZW9A 2Z1NA 4D3FA 4DPMA 2HQ1A 1E1MA 4O6VA 2AXQA 4BNWA 1LDMA 1SNYA 3H3JA 1GCOA 4NBWA 1G0NA 1LQUA 3S2IA 4J9VA 1XLTA 3LU1A 1I5RA 4DTIA 3E03A 1H0KA 4QQRA 4E5PA 1WZIA 2A35A 3E5MA 1CETA 4B4OA 4J4BA 3GZNB 5EN4A 2B37A 3BMCA 3EW7A 3AI1A 3COSA 1O9BA 4BNVA 4EEXA 4J43A 3IKTA 1ARZA 2O3SA 1JKJA 2Y0DA 1H6CA 3DFZA 3C1AA 4IQ8A 1X7GA 2JL1A 4G81A 2X0RA 3FF4A 4N7RA 3V2GA 3W8DA 3BMCB 3VZQA 5TIIA 4XKJA 2ZYDA 2X5OA 4TRJA 3IDSA 1I10A 2HUNA 3S2GA 2E6UX 4YT4A 1YE3A 2X0IA 2ZIZA 3ZHYA 2VWGA 1HTBA 4R3NA 2NVWA 1X7HA 3VTFA 2EW2A 2F00A 1BGVA 3RAJA 3V2UA 4JGBA 4JK3A 3V2HA 4DLAA 4NFYA 2G82A 5JSFA 5DN9A 5A9RA 5DCUA 2VHXA 1NHGA 2Y67A 4IZHA 1BXGB 2VRBA 2HCTA 3FR8A 3N74A 1IYZA 2UUPA 2O7QA 4YJDA 4EYEA 1YL7A 2WEKA 5FI3A 2QHXA 3JYOA 2IEDA 1NBOA 3ST7A 1YWGO 4D46A 5CP8A 4EUEA 4MVJP 3KBOA 1R12A 3JQGA 1KVSA 4HADA 4KP7A 4BNZA 1H6DA 2O3QA 4J2HA 4PLGA 4F45A 3ZWAA 3FI9A 2X86A 2A4KA 3MOIA 3NDJA 1P1FA 4TZTA 3VTZA 4U0JA 5KCZA 3ONFA 5DOZA 2QZZA 3NJ8A 4M8SA 4RVGA 3D5QA 1CQJA 6ADHA 1HF3A 2BMAA 3D0OA 3RC7A 4MP3A 4XQGA 4F3YA 3AU8A 4CLOA 2NV6A 2PY6A 2QYTA 3JQ7B 3O8QA 3WIDA 4H16A 1UUFA 1HT0A 1KY4A 1U3WA 3AI2A 3U49A 3GVIA 1QP8A 3ZNOA 4WE3A 4RO0A 1YKFA 3GZNA 1B2LA 2QYSA 5CG2A 3ENKA 1IUKA 3VH4A 5GZ3A 5ENVA 4PLCA 1JTVA 2AQKA 3L4SO 3WJAA 1ZUD1 4GGOA 1NTOA 4YPOA 2D8AA 3IIEA 1CJCA 2EKPA 3ZZNA 5T64A 1U8XX 3DL2A 3LK7A 4TRMA 3EC7A 1DBVO 1IE3A 4GGPA 4QO8A 1Q7CA 3OIGA 4RDIA 1GADO 3L6EA 4D44A 4XEHA 1ZKMA 2C54A 1Y6JA 1HDCA 5F21A 5GZ6A 1LDYA 2HK7A 2Q3EA 5CG1A 3ASVA 1ADCA 1I33A 3HADA 2PNFA 5KVCA 3ROPA 1F14A 4OYRA 2PZLA 3D3WB 3DR3A 4XYBA 2NTJA 5U4QA 1MA0A 4LK3A 3TDKA 1VSUA 1R6DA 4DMLA 1E6EA 4B4UA 4KOAA 1F17A 3F3SA 1YRLA 4BGVA 1C0IA 1K6IA 1WLYA 3KOUA 5TX7A 2XXJA 3OIDA 4IXWA 1PGPA 2OFPA 4YYZA 1JWAB 4RPLA 4ALLA 1HLPA 4M87A 4WJZA 3VPGA 3H9JA 2DPHA 1EQ2A 3JYLA 3ZWYA 4R1UA 4RGBA 3SXPA 1K89A 3CUKA 3KSZO 5IAAA 4M54A 4L4SA 3ADOA 4J90A 4JBIA 4L74A 4URFA 1MXFA 3ZHBA 3QSGA 1UAGA 4XIJA 4YQZA 4NJMB 1JLLA 2JD0A 3BAZA 2FR1A 4AJNA 1W8DA 3OMLA 4UREA 3EY4A 3G0OA 3TRIA 1GZ3A 4XD2A 4I08A 4BGIA 4CUJA 1NQOA 5L53A 4M86A 2WD7A 5AXAA 5HA5A 3A14A 3DOCA 3HSKA 4E2WA 3WBFA 1IY8A 3DBHA 1C0PA 1UXJA 1YJQA 4XYMA 4ZQGA 1D7OA 3GGOA 1I3MA 2J5KA 4D0RA 4HWKA 1RWBA 2BELA 3TZQA 1GQ2A 2EP7A 1NFRA 4QFDA 4NBTA 4MO2A 4BKPA 4I9UA 4GVXA 2OP0A 4P8RA 1Z75A 2B4RO 2VCYA 3AY6A 2A94A 3DHNA 4TRRA 5DCYA 1J0XO 4JQCA 1GEGA 2POQX 4II3A 3JQFC 3K92A 3KSDO 4EUHA 1M6WA 3H2ZA 5BR7A 1F12A 3OFSA 1T4DA 3KM0A 2YHIB 3EUWA 4RJTA 1HL3A 2JFFA 2GGSA 4FFNA 3AU9A 2FZWA 5TT0A 1LLQA 3OHSX 3WBBA 4IIVA 4R5MA 4QEDA 5HBRA 1A4UA 2HMWA 3KYDB 5ICMA 1YQXA 4QTZA 1C1DA 2HJRA 1T26A 2RAFA 4RZIA 4Q9NA 3DAFA 2XXBA 4IS2A 1AXEA 3W8EA 1Q2XA 2DM6A 3PJGA 3UICA 5L95A 1ENYA 3RQSA 4BNYA 2BFMA 4AJHA 4EBFA 3WDSA 3BTSA 3A4VA 3I4FA 2YHUA 2CVZA 2RH8A 3AUAA 1QR6A 3FBTA 5DBIA 2QRKA 4AJOA 3MEQA 1O8CA 3VH3A 3H6KA 2E48A 2NADA 2I99A 4LCJA 1IPEA 4XJSA 1P9LA 1PS0A 1ZEMA 5K9ZA 3I6IA 4IDAA 3D5TA 3K96A 2FWMX 4BGUA 3O9ZA 4IJKA 4L75A 1A5ZA 1GYPA 3QWAA 3WJ7A 3EDMA 3SJUA 3WGTA 1YL5A 3D3WA 1LJ8A 4BNKA 2NNLD 5A05A 4PLFA 4NNJA 4WLNA 3BMOB 4FGWA 2D0IA 1IB6A 4WCFC 4GMFA 1KC1A 1ZMTA 4W82A 2YJZA 1YONA 3ZV3A 5JAMA 4JP3A 3WWYA 4BB6A 1PS8A 1NHWA 1JN0A 5AXDA 5LC1A 5IG2A 3EK2A 1R0KA 1WXDA 2O4CA 2H1SA 3JQDA 4XQEA 3DZIA 4GKBA 5HS4A 3JD0A 1E5LA 5A9SA 2QZ9A 4EITA 3QE3A 3ADPA 3DQPA 2XPCA 4BKOA 1X14A 5AYVA 4EUFA 3ZN2A 4LGVA 3U09A 2OO5A 4OKNA 1FMCA 2Y1DA 1IZ9A 4FOOA 2GERA 4KTTE 2PLAA 3LT1A 3MWEB 4HNGA 3RBXA 3AJRA 2NWQA 3RASA 5A3JA 4KWHA 3O26A 3LZ6A 1SCUA 4YACA 2PKRA 5KNLA 1MUUA 3DTTA 2E82A 2BKAA 4IM7A 3JD2A 3H5AA 4WASA 1Z7BA 9LDBA 3VPFA 1QLJA 4HUJA 3KETA 2FR0A 4D3SA 4RCVA 2Q49A 1FXSA 3OJ0A 3MJTA 4OXNA 3W1VA 1C3VA 2FPIA 4DL9A 2D59A 3KV3O 2VUSA 3LT0A 1E3WA 4K9DA 5AXBA 3UCEA 4CL8A 5KVSA 2NTNA 4BKRA 5JCJA 1E3LA 2B0JA 4NQZA 4BGEA 4FFMA 1PGOA 1B15A 1RYEA 5KJCA 3WGHA 4FW8A 3WGQA 3ORFA 4FS3A 1G1AA 3VPXA 3OJFA 4CLRA 4Y98A 3IUSA 1ZEJA 4GX5A 4IJUA 3QWIA 4JJFA 3VHRA 4AJPA 3U5TA 4A2CA 4JP2A 3WYEA 1RJWA 3H65A 2ZTLA 3FPLA 1YB4A 1MFPA 1T25A 2QIOA 1PWXA 3JQ8B 4N54A 4BO4A 4NIMA 1U8FO 5G0SA 1BHSA 1K5HA 4YT2A 3B1FA 1YVEI 4ALKA 2X5JO 2DAPA 2WWRA 4WCFA 3MJ4A 5DDIP 4BNXA 3BTVA 3I5MA 3FHLA 3ULKA 4BO3A 3TFOA 1B8PA 1M67A 3IAHA 2OUIA 6LDHA 2ZQYA 3G49A 3ICPA 4CM9D 2Y66A 4CQLB 1M75A 1AHIA 3OP4A 2ZTUA 2Q4EA 5L3ZA 4MPDA 4GWGA 1H9AA 3RU9A 3DMYA 3I9LA 3ROMA 4ALNA 3UN1A 3I6QA 4ALIA 5HTOA 1V8BA 3V5NA 1EUZA 1CIVA 1FJHA 3GHHA 4B7UA 1UJMA 2PZJA 4WLVA 4BO7A 4OGWA 1D8AA 3L07A 3LC1O 3K30A 4ITUA 2DFDA 2CVQA 2ZCVA 2Q2VA 4IGEA 5IDQA 4XR4A 5L4LA 5KJFA 4PVDA 3DXFA 2AQIA 3PIDA 2G5CA 1E7RA 1EE2A 3VKVA 4O0LA 1F06A 4H3VA 4TVOA 4I5GA 4CM9A 1BVRA 3TOXA 2Z95A 1KVRA 1JW9B 4PRLA 3MJVA 1C0LA 3AOEA 4Z9YA 3JQAA 1R4MA 4BQRA 3NDRA 1A4IA 3GK3A 4CLOB 5I7EA 5H83A 1GPDG 5IDWA 2B4TO 4CMGA 2JAHA 2NVUA 3TZ6A 4HBGA 4E5YA 1R37A 3PGJA 3QVXA 4W4TA 5JDIC 4HX5A 5LDGA 1UDCA 5DT9A 1A9YA 2R00C 3TOZA 3TF5A 3GGPA 3D4OA 2PD4A 4KMSA 1XU7A 1MG0A 3PRJA 1PJ4A 1MG5A 1GD1O 1T2EA 3OH8A 3FD8A 4BNTA 5B4VA 3UCFA 3MOGA 1EMDA 2WTBA 4IS3A 4XWYA 1P1KA 3O4RA 3WB9A 2X0JA 1O5IA 4BO1A 3DZKA 1BW9A 2EG9A 1HE4A 4ALJA 3ANNA 3GR6A 1IZ0A 4L76A 5F1PA 1DRVA 1NFFA 2PTGA 4PFJA 3C7AA 5IJZA 3IS3A 4MJLA 4Y8VA 1PJSA 2O3RA 1PR3A 2IDZA 4PN3A 2WMDA 3H2SA 3AM4A 1UXHA 1B3RA 2YZ7A 4Y6PA 2WYUA 4CMEA 1SBYA 3FTNA 3JQ9C 5DCWA 4E2YA 4R51A 3RUDA 4FFLA 2O2SA 4E5KA 2VUUA 2OOSA 3PDUA 3W6UA 1JDJA 4IXTA 4BNMA 2P68A 2FSVA 2CNBA 3MCVA 3VZPA 2CF6A 2NQTA 1FDSA 3IUPA 4CMKA 1DOHA 1DC4A 1VI2A 4JJGA 2P9EA 2IODA 3ASUA 1UR5A 2R2GA 3F6YA 2O3TA 2CDAA 3GEMA 3IJPA 5C7LO 5JYDA 1SB8A 4MINA 4FIZA 4R68A 3IP1A 4Z3KA 2PKQO 3LT2A 4YR9A 1ZH8A 5A04A 1RM3A 2DTXA 3INGA 4BO9A 1XIVA 1NVMB 3K31A 5ER6A 1EE9A 4NU5A 3PGXA 4EW6A 4OL9A 3ZNNA 2VN8A 1ADFA 4CMIA 1PJCA 4GMGA 3ABIA 4DBZA 5TSDA 2NTVA 3D1LA 1U7HA 4IIUA 3RWBA 3R3SA 5ILOA 2GLXA 1NYTA 4LISA 3ZWOA 1MP0A 3O8QB 1CDOA 1LC0A 3I4CA 3OETA 4WPGA 3GEDA 2HAEA 3ZI0A 3GFGA 1R15A 2B5VA 3DMTA 1TT7A 3HB5X 3PWSA 4AJEA 3D4PA 4YRAA 1H2HA 1ZW1A 4EGFA 3ETGA 3JQ9A 2I67A 4OXKA 5TNXA 3C85A 3WFIA 2AQ8A 1LDBA 1UXIA 2FP4A 3M6IA 4RVSA 1H2BA 1NAIA 2P5UA 5IZCC 4CLHA 3JQGB 3GRKA 1DAOA 4YAGA 3PDJA 1NR7A 1DC6A 4DMMA 2Y1EA 1ZBQA 2ZJ0A 1BMDA 3EYWA 4J6FA 3OJEA 3OJLA 4DA9A 2W2LD 4XYEA 3L9XA 3CZRA 3QHAA 4U7WA 5A5EA 4J1NA 2X58A 1Z82A 1PQPA 1PX0A 3N7UA 4OQYA 3G1UA 2P9CA 2XAAA 4WECA 5ER9A 2YUTA 1SOVA 3AK4A 3W4KA 5C5IA 3RBVA 4IGFA 5FWNA 2ET6A 2X23A 3CH6A 3JQFA 2VZ9A 4DYDA 5I9LA 2Y1FA 3AY7A 3E1KA 1DIGA 3SLKA 3DEYX 4AL4A 5ICSA 4BNLA 1LU9A 4XDYA 1M66A 2RIRA 1BW9B 1Y9EA 2VYVD 2VHYA 1XYGA 2C07A 4WNIA 7ADHA 3ENNA 4FGSA 3BHMA 1EVIA 3DTYA 1P0FA 3I1JA 4ZU3A 1XQ6A 1ZSNA 1F0YA 4FSHA 3ONEA 4Z0HO 5COBA 1DJQA 1HDOA 2VHWA 4WCFB 3QWBA 4S3MA 1V3VA 2Q46A 2ZB8A 4HP8A 1B8UA 4PGFA 3U4DA 3VZRA 4II2A 4O59O 4TKLA 3DOJA 2DBVO 4CMEC 2OBYA 4F46A 5CDUA 4J9UE 5DP1A 1LDEA 3ANLA 3E9MA 1WWKA 2FN7A 3LT4A 3OECA 2VYND 1YBVA 4NJMA 3PQEA 1ADGA 1SAYA 1Z73A 1PIWA 3U9LA 1DHRA 2Y05A 5KKAA 2Y1GA 3VDQA 3OEWA 4CMAA 5IDXA 4MKXA 2DVMA 2JCVA 1Q0HA 3WR5A 3H9GA 3MTGA 3DBLA 1BXGA 3CSDA 3JD1A 3M1AA 2EWMA 2X4GA 4NZ9A 4ESOA 2AE2A 4KUHA 3PHJA 3VH2A 5C7OO 5JO9A 2BFAA 1W4ZA 4BV8A 1OFGA 1PL8A 1I0ZA 1N8KA 2PFGA 3STHA 5IZ4A 2ZJ1A 1LLDA 1SMKA 4U0KA 2YHIA 2Z5LA 3P2YA 1JQBA 3NV9A 1MV8A 1A27A 4E21A 3VKUA 4OO3A 2V6MA 4MP8A 3RFXA 1A7AA 4OHUA 5A06A 5KJ6A 4IDBA 1GL3A 1K6JA 4B3HA 2VQ3A 2NU7A 1X0XA 1XG5A 3NTRA 5K6AC 1X0VA 4E2XA 1R0LA 2AEFA 4DGSA 5H82A 4U5QA 5B1YA 1T1SA 1K2WA 1HYEA 3AUSA 1G6KA 1P3DA 2PGDA 2JCXA 2UUOA 3GLQA 4IMPA 2GASA 4AG3A 5JY6A 1O94A 1DSSG 1LRKA 1EVYA 2YV2A 4UUNA 4NFSA 2GDZA 5DZSA 1TB4A 2PGJA 1ZZEA 4FJ0A 5HWSA 3QWFA 4CLRB 4Q3DA 1DDOA 2OP1A 1F8FA 1KIFA 1R4NA 4IBOA 5TLSA 3ZCXA 3QA9A 3WSWA 3Q0EA 3INTA 1R0SA 2DKNA 1ZK4A 3NAQA 5G0TA 2OGUA 3F47A 1A9ZA 3RROA 4UEJA 3PLRA 3SBOA 3GVPA 4GL4A 4ZGWA 3F4LA 3HFGA 4K28A 3WGIA 2R00A 2C2XA 3P5SA 1C14A 2IE0A 4B8WA 1GU7A 3OSUA 3A1NA 4BS9A 2CUKA 3I9MA 3MJEA 1KEWA 1FDUA 1QKIA 3GF4A 5KKCA 3N58A 2HDHA 3LF2A 3WTCA 4R4JA 3NGXA 4J4HA 3ZWVA 4IUYA 1KOLA 2E49A 3P2OA 1PSDA 3NT5A 5G4KA 3GHYA 4OMUA 3F46A 4UAGA 1MB4A 1DC5A 4PG6A 1EUDA 4AFNA 1EK6A 1GUFA 1T2CA 4XR9A 3OICA 1GV0A 4ZVVA 3RBZA 4JNKA 3H7AA 3WGYA 3BZUA 2PK3A 2GZ3A 3SLGA 2RBEA 1TA4A 2GNAA 3OJOA 2EXXA 1PJLA 1PQWA 2R6JA 1KEPA 1L7DA 3GA0A 1VKOA 4HXYA 3BMQA 3GFBA 4D41A 4KQWA 3FPCA 5G2OA 3ZWNA 4BKUA 5DNAA 1E7YA 4RVDA 1UP6A 1I3NA 3INRA 2O7SA 1EFKA 4JROA 3C7CB 3QVWA 1ADBA 4NH4A 5BSFA 1S7CA 3UOGA 3T4XA 4ND5A 2X0NA 2O3JA 5JAQA 3QV1A 1ZJZA 4I5EA 3R3JA 3GEGA 1VL0A 1PJ2A 4K1LA 4FFRA 3AFNA 2AW5A 4YAJA 1PL6A 5CPFA 8LDHA 3NUGA 5IDYA 5JYEA 4CL3A 3E48A 5BNFA 1U1IA 5J23A 3IMFA 1LSSA 2GZ1A 1NWHA 2CDCA 4ZQFA 5JBIA 3GDOA 4OXYA 1YXMA 3PFFA 4J91A 3IJRA 3QLJA 2CDBA 4H15A 4BMNA 4CODB 4DXHA 4XZ3A 2AEJA 3GVXA 1E3SA 2FSSA 3ITDA 1GR0A 3LC2O 4OQZA 5A5FA 1NPDA 3HDHA 3DHYA 3GNTA 5MDHA 2CVOA 4QXMA 1R16A 4C7KA 4BNHA 1KY5A 5B4TA 2VOJA 2Y1CA 3KZVA 3DDNA 4CUZA 1NASA 2JHGA 2C29D 4J0EA 3WXBA 1I2ZA 3OQ6A 1GQQA 4YJFB 1BSVA 2J8ZA 4RV9A 3FR7A 1C1XA 3FSRA 4DIBA 3AW9A 1QYCA 1ZK0A 1TVEA 2YV1A 4RDHA 3GG9A 2EJWA 1UDAA 4RLSA 2C5AA 3K6JA 4MP6A 1ZFNA 5EESA 1PR9A 4LMPA 4LN1A 3FRJA 1I24A 1P74A 4XYLA 1ZJYA 2IYOA 3PHHA 3WQQA 4Y6RA 3B20A 4NMHA 4CQMB 3AUUA 4NPCA 1J5PA 2AMFA 4N5NA 4RPGA 3B6ZA 1NPYA 4LSWA 5TJHA 1CF2O 1VJ0A 3JQAB 3QQPA 1CYDA 3E82A 1M6HA 3JYNA 3SC6A 2AA3A 1EVJA 3UVEA 1QLHA 3V1YA 5ITWA 3ITKA 4E12A 4GBJA 1WAMA 3H9EO 1EUCA 1PWZA 1E1LA 5CDTA 4BUCA 1ZK1A 3U4HA 3WIEA 1CRWG 1GPJA 2YV3A 3KRTA 3PHGA 4ID9A 5JE8A 1HDRA 5CDYA 1GEEA 1OC4A 2BLLA 5CEFA 1PU2A 4FB5A 2OZPA 4I5FA 2DT5A 1N2SA 2EHDA 1ZXBA 3KHUA 4MOWA 3NT2A 1UP4A 3QY9A 3OQBA 4JN6B 1VC2A 2EGHA 4XRGA 2QRLA 4J4TA 5IF3A 2YDXA 3CINA 4YB8A 1UXKA 1GDHA 4PZCA 4B7CA 5JAIA 1Q7GA 2HMSA 2Y93A 3H5RA 2JCYA 3WYCA 3GG2A 3Q11A 2XF8A 5T57A 4CR6A 4BQPA 3PZBA 2DC1A 4AJLA 4PZDA 1Q0LA 1ZVMA 1YO6A 1N9GB 1TT5A 1BXZA 1T2FA 1OZAA 3WX0A 1DFGA 3GY0A 1U3VA 4DC1A 3PJEA 5G4LA 1TT5B 1YB5A 2G17A 3SJ7A 3S1LA 3KSUA 5JFOA 4E30A 2D1YA 3TWOA 5ITVA 2NVUB 1O95A 1E77A 1GQYA 2VHVA 4YEDA 1YBMA 1DAPA 4PLTA 5BSGA 5EMHA 4OJNA 3PQDA 4HY3A 4RPKA 4YJGA 4AVYA 1SB9A 2A92A 4UUOA 1WDMA 3HFSA 4E33A 5A4DA 3LLSA 4PRKA 3B1KA 5IN5A 4XGNA 5G0VA 2DQ4A 4R5HA 4UEOA 3CZMA 2DBRA 3MWDB 2EP5A 3HE3A 1P77A 3HJAA 4IINA 1OI7A 4DQXA 2EF1A 3OBBA 1DFIA 1LC3A 8ADHA 3IP3A 2I66A 3HG7A 3AI3A 1A72A 4L4XA 3FWNA 4JX8A 1PJBA 4UEKA 1XEAA 4PLHA 1HZJA 2HKIA 4EJ6A 2BI7A 1XELA 3LC7O 1ISIA 2HK8A 3OQ1A 4NU6A 5JAZA 5IXYA 5GZ1A 2G1UA 1Y7TA 4JLWA 3D7LA 3UHAA 3ON5A 1B16A 4DREA 4DQVA 2VTEA 1E3IA 2JAPA 2I65A 3RFVA 3RVDA 4CQMA 4TWRA 5CHEA 2FR8A 5JCJD 5JDCC 4M89A 1T2AA 4YJHB 5JO0A 1B7GO 3RI3A 3WNVA 5K6AA 1N1GA 1A71A 4L73A 3PYMA 1CEQA 4HNHA 1XCBA 1B26A 5F5LA 1Y9AA 3DB2A 1KEVA 4D7AA 5L4SA 1B0AA 5KJ1A 5EQFA 2YQ5A 2X8LA 3O03A 1E5QA 1DFHA 3F5SA 1XU9A 3HNPA 4KUEA 3VPSA 5AQ1A 4EEZA 5A1TA 1C1XB 1JU9A 4HFRA 1H6BA 1HEUA 1KC3A 4E0BA 5L51A 1U5CA 3GT0A 1Y8QB 1YJ8A 2VYVA 3AM3A 1S6YA 1LSUA 3QVOA 3IL2A 1Y8QA 2VRCD 3I9OA 4D42A 1EDZA 3G17A 1BTOA 2GN6A 1HDXA 2CD9A 3GUCA 3UW3A 4BO5A 3WMWA 5THKA 4B3IA 1EQUA 1QRRA 2VZ8A 2P5YA 3WOHA 4QFCA 1DIRA 3ANMA 4MVJI 2Y0EA 4W6ZA 4TROA 2W2KB 3ZU5A 1MFZA 2I5PO 1D3AA 2IZZA 4PLZA 5CAEA 2VYNA 5KWEA 1U7TA 5EPOA 1PJ3A 5EERA 4PG8A 5CFZA 1B3BA 3RD5A 3ZWWA 3RU7A 2CY0A 5TT1A 2Y68A 3BHJA 3CKYA 3QIVA 1XWFA 1EEHA 3H9QA 4BNFA 5BQFA 1V9LA 4LVCA 2O48X 3FNGA 2W4QA 3QP9A 4WLUA 5KTKA 2FRDA 4R01A 4CM4A 4DWVA 1OAAA 3CEAA 1R66A 3JQBC 3WQSB 4CV3A 3WFJA 1DIAA 5TQVA 4FR5A 3PLNA 4BVAA 1NP3A 2X22A 4QSMA 3ZNPA 1E1KA 1EDOA 3JCZA 1D1SA 3AUTA 3L4BC 3NT4A 3K9QO 2HMUA 1ONOA 5IN4A 3CIFA 1ZK3A 4E5MA 4UVIA 2FMUA 4EI2A 2BGKA 1NQ5A 4WLOA 5JC8A 5JMWA 1WMAA 4IDCA 4D79A 2NU9A 3LLVA 3FWZA 1XSEA 4H7PA 3BMNA 5K0ZA 4TKMA 4A7PA 2VWPA 1I2CA 4DVJA 1FDWA 2X7HA 4YTEA 1HYGA 1U3TA 1GY8A 3PPIA 4GVLA 5F5NA 2DUUA 1JKFA 1IOLA 3I23A 4O5OA 4Q3NA 1DJNA 1V0JA 3VDRA 2PH5A 2WJPA 2UAGA 3VVBA 3GVHA 1KEUA 1U4SA 2D2IA 4JXKA 4B7XA 3SC4A 1HSZA 1PQUA 4PLVA 2WYVA 4HKTA 2EIHA 3F1LA 2VZ0A 3C1OA 3NX4A 1YDEA 4TQGA 2Q1WA 5T8KA 3FNHA 4PLYA 4RF5A 3KEQA 4UULA 1WVGA 4J16A 1SEVA 3TZKA 5I9NA 3RUCA 4YJFA 2IXBA 3GQVA 5AVOA 4MDHA 3GRPA 3U62A 4HFJA 1HZZA 3R0IA 2F1KA 1AE1A 3AOGA 3IQDB 3BYZA 1Y81A 4PZEA 4P22A 1GV1A 3I3OA 4ND4A 2C20A 3NGLA 4CM1A 2UYYA 1X7DA 1TXGA 3F4BA 1IPFA 2ZCUA 3GGGA 4KWIA 4I5DA 2D4AA 3K2BA 3FBGA 5T67A 3U4CA 3L6DA 4RVFA 2VHZA 3HZZA 1YH3A 5BNIA 4L8VA 3EVNA 3ZU2A 2JHFA 1E1NA 5L7WA 1E7MA 3WG9A 5B4UA 2DLDA 3CPSA 1TEHA 4FFPA 1VE9A 4PG5A 5EIOA 4BNJA 4CMHA 5CDGA 3PIIA 1GYQA 1QYWA 2WE8A 5A02A 5JY1A 1P1IA 3PWZA 1PJQA 3ROQA 4R41A 4X54A 3UH1A 3Q9UA 3DZGA 4J7UA 2HRBA 2EKLA 3VPHA 1NWCA 2JKVA 4NBUA 1K0UA 3DZFA 3WGGA 1ZMOA 3PYXA 4PCVA 4M49A 1LTHR 4HFNA 4YAEA 2GO1A 2P2SA 4XB2A 1T1RA 4TMFA 5GY7A 3LDHA 1VRWA 3JQ8A 2UV8A 4R69A 1UH5A 4OKIA 4CMJA 4WGGA 1VLLA 3HHPA 1WNTA 1KVTA 3VH1A 1I36A 3PQFA 1OC2A 4WOJA 3ZV5A 4GX2A 1UZMA 4GWKA 4RF3A 1IULA 1E7WA 3MTJA 2GUGA 1C0KA 2W2LA 3FCOA 5DBGA 1GZ6A 2GF2A 2G0TA 2PR2A 3CMCO 3AOEC 4FDAA 1FDTA 4RLHA 3T4EA 1HE2A 3I52A 3WLEA 5FYDA 3BIOA 4GAEA 4P4LA 3C1TA 1H94A 4FJ1A 5HM8A 1VJ1A 2C0CA 2B4QA 5AOVA 1Z45A 3HQ4O 3P7MA 2J5QA 1HYHA 4P4NA 4XQ9A 1UDBA 3W4IA 3E9QA 4AJJA 1Y8RA 5IZCA 1YB1A 3GNSA 3D3EA 3TL3A 4AJ1A 1ISMA 1XR3A 2BH9A 3EVTA 3JQ6A 2V6FA 4INAA 4NK4A 3WQRA 2Q4BA 1NX6A 4ZQHA 4PVCA 1DRUA 4EDFA 1HE5A 4B4WA 1DIBA 2CF5A 4W99A 4G65A 4W9NC 1AUPA 2J6IA 2H9IA 1IHXA 2SCUA 2NLOA 4ZD6A 3RSHA 2J3IA 2NVBA 1X1TA 1BDMA 1MGOA 5CEJA 1T4BA 3G1TA 4DUPA 2PGLA 4BMVA 2BGLA 4CLEA 2UVDA 3LSYA 3F1KA 4BNIA 3UAGA 2ZQZA 4RF4A 3RIHA 1D4FA 1QV6A 4BB5A 4GSLA 4KQXA 1YOVA 1PZEA 1IL0A 4IJVA 4NG5A 4UVGA 3U3XA 3EZLA 2UDPA 5IXSA 2AEMA 2WD8A 3NKLA 3WWZA 3F9IA 4O63O 4RQUA 1DO8A 3VOSA 3SVTA 3E5RA 4BNGA 4QO7A 3S2EA 5JDIA 3Q2IA 5C7IO 2YY7A 2BGMA 2VWHA 3A28A 1LXCA 1TLTA 1YDWA 2TMDA 7MDHA 2VNSA 3B70A 4R3WA 1NFQA 3U0BA 2AG8A 2E4AA 3GDGA 4CQMD 3HWRA 1BVUA 2X6TA 3WGOA 1KS9A 1KERA 1YGYA 4CM4B 3ZV4A 4Z0TA 4BKQA 3NJ4A 2GN8A 3JQ7A 1DLJA 3KYCA 1LLCA 4W9NA 4R1TA 3DBRB 1WDKA 5I8ZA 1UP7A 1VM6A 4J3FA 3EHEA 4XGKA 4WNCA 1YL6A 4J0FA 3JQEA 2ILTA 5H81A 4WLFA 1ID1A 4E5NA 2HSDA 1E3JA 4PLWA 1V3UA 5T8KC 4J1TA 2C7GA 2WDZA 1J49A 3Q1LA 4NR0A 5COAA 2QQ5A 1PZGA 5JS6A 3PI7A 2OBNA 4B3JA 2ZYAA 3GC6A 4ZJUA 1VPDA 2GD1O 2FPPA 1CQIA 1Y1PA 4J49A 1QYDA 3DBLB 4BL5A 3U4IA 1RM4A 5T6BA 4MVJF 2X9VA 3AY3A 4F6LA 5L40A 3DC2A 4GI2A 1NQTA 3SX2A 5GMOA 3JYPA 3RCBA 4R9SA 4B4VA 5IFLA 4MVJE 3GPIA 1C1DB 2I3AA 4YDRA 4ND2A 3TN7A 1M2WA 2I3GA 3C24A 1Z6ZA 3HN2A 1ONNA 3KUXA 4HV4A 4NBVA 5A9TA 3NYWA 4XJTA 4ZQBA 4AJIA 2YFQA 1J6UA 1Y5RA 2Q2WA 4UUMA 3K73O 5JNLA 1E6WA 3R6DA 5ES3A 5KOIA 1Y8RB 2Y1OA 1P44A 3DOOA 3Q9NA 1BG6A 1EVZA 2X9NA 4YWJA 4B8ZA 4PLPA 5F3RA 2BFOA 1VSVA 1GUYA 1T24A 2NACA 1M76A 1T2DA 1XKQA 3V1UA 3Q6IA 3JQBA 3V1TC 3KYCB 3A9WA 2X5KO 4LRSB 4U8GA 2PWZA 5KVQA 1E0DA 2AG5A 3P19A 4N5LA 3TFQA 4RVUA 3PZRA 2B69A 4XX0A 2WYWA 3TQHA 3L6OO 4BMSA 4KDEA 1QMGA 2C82A 4P38A 2GCGA 1HDZA 1PZHA 4G5HA 2VUTA 1PS9A 1KVUA 1YQGA 1ENZA 1PGJA 1X15A 2YW9A 4PIVA 1LSJA 4LW8A 5KVVA 1RYDA 3KVOA 4ZN6A 1I01A 4TVBA 2DTEA 3QRWA 3GZ4A 3RJ9A 2JFGA 4DQUA 4D0SA 4RL6A 2B35A 3HB4X 5DBFA 1P31A 3EMKA 2Q1SA 5LCXA 4IJWA 1NAHA 2PH3A 1PL7A 4NBRA 2EJVA 4MIYA 1WW8A 1MC4A 4FCCA 2Q50A 4CLXA 1U28A 1XGKA 4Z0PA 2OXIA 1U5AA 2FOIA 4MVJD 2ZTMA 4ND3A 4YJGB 4UUPA 4J1QA 4YCAA 3MJCA 3RC9A 2GPTA 3ZV6A 4DIFA 5BSEA 1HDYA 3DO5A 3PJDA 4FPXA 5U9CA 3ZH2A 1I32A 3CE6A 3I9JA 3JYQA 3T7CA 1OBFO 3CMMA 2W8ZA 5JLAA 5BT9A 2YFHA 1NR1A 1ZSYA 4WUVA 4K6CA 1I3KA 3TL2A 2W2KA 3T7EA 1DRWA 4GKVA 4RVHA 2OMEA 3WNQA 3C8MA 2FY8A 1RM0A 4XIYA 1UZNA 2VT3A 3JSAA 5JDCA 2JJYA 1VKNA 1DEHA 2QG4A 2BHLA 3I83A 4RPHA 4BOYA 1AHHA 4IMRA 3RUFA 4BNUA 1RPNA 2Y99A 3HDJA 3L0DA 1WP4A 2AHRA 4ROSA 1HKUA 2ZATA 3BMNB 3LVFO 3Q3CA 2EV9A 4GPD1 2CMDA 3RC1A 2NSDA 4NHEA 5BNTA 1K6XA 1VL6A 3KLPX 1U2DA 2ZB4A 1A7KA 4TSKA 3V8BA 4Q3EA 2HK9A 3DZHA 1E3EA 5ADHA 2DBZA 4YBZA 4ZQEA 1W6UA 4E31A 3IC5A 9LDTA 3FN4A 1ZK2A 3GN1A 5C37A 4N18A 1NVTA 3DONA 4LMRA 4BO8A 3ZW8A 4LSMA 4GX1A 3VZSA 1E92A 4JCOA 4J7CA 4WEQA 4J7XA 1AXGA 3D64A 4DYVA 1Q0QA 2D5AA 4NI5A 4GLLA 4ZRNA 2PZKA 2E37A 2FZEA 3H8VA 4MIEA 1SC6A 1JAXA 4YAKA 5I9MA 4XQCA 3JD4A 1ISJA 3RUIA 5L7YA 5F1KA 4O1MA 4Y67A 3WS7A 4YT8A 2IYPA 3TPCA 3UXYA 4ND1A 5FF9A 1O0SA 1KBZA 1B8VA 3QW2A 1ISFA 2I9PA 4R1NA 4GSKA 3UGKA 4DPKA 4J1SA 3WGZA 4CM8A 1Z74A 5TJ9A 3TZHA 2IEBA 2ZB3A 4M55A 5A03A 3ZWXA 4IDGA 4XGIA 4RPJA 4L9RA 1H93A 4FC6A 4CM6A 1NQAO 4FFOA 3GUYA 4KZPA 4UVDA 1YOVB 2P91A 3WLFA 4YRDA 1DB3A 3HN7A 2X1HA 3PVZA 1VL8A 4MKRA 1ENPA 4BO2A 2LDXA 2V65A 3RC2A 1YBAA 5FEUA 4ZA2A 2AE1A 3OIFA 5JMPA 3RUAA 1I30A 1ZIDA 3DWFA 1I3LA 3OA0A 4A0SA 5KIAA 1WDLA 4I1IA 5G4KB 2ZKLA 1E3WB 3OM9A 4CM5A 3RUHA 1N1EA 4Q3CA 1GTMA 4A03A 5L7TA 2BD0A 2ZTVA 1Q7BA 3HUDA 2BI8A 1XHLA 5A3VA 1N9GA 1SEPA 3DAGA 3L4BA 1K3TA 4FBGA 3QWHA 5AXCA 5KJEA 5CPBA 1FF9A 3L9WA 3RKRA 1ZO8A 2DFVA 3PP8A 1JVBA 4Z6KA 1BDBA 2C5EA 2NU6A 2J3KA 4GH5A 4YA6A 3S8MA 3E8XA 1LQTA 2CSUA 1BRMA 3K8ZA 4NJOA 2VNAA 2D3TA 1KETA 4MVJM 3KXDA 4ILKA 5JW6A 1R4NB 1DLIA 5A9SB 2Q1TA 4G2NA 4W7IA 4JBGA 2BF7A 4IQ0A 3CXRA 1P45A 3GVCA 4JIGA 4YXFA 3RFTA 4LRTB 5MGBA 2Q45A 2GZ2A 4Z3DA 4WK6A 3NRCA 5JXWA 1NM5A 3DMTC 1NVGA 3ZU4A 4DLLA 3H3FA 4L0QA 1FK8A 1ORRA 4MVJH 3QVSA 4CUKA 1PEDA 2CZCA 2O50A 3GPDG 4BIIA 2I6TA 3BHIA 2PV7A 3GH3A 2J5RA 5EJ2A 3WTBA 3JQAD 3R1IA 2EEZA 1DC3A 1HETA 5ILGA 2NUAA 2P4QA 3DZBA 5B37A 5C3MA 3WYBA 2LDBA 2Z1MA 3PHIA 3EZYA 3KO8A 1Y5MA 2PD6A 5U1PA 2EERA 4R9RA 1PJTA 1EZ4A 2EW8A
chains in the Genus database with same CATH superfamily
3GLHA 5FNZA 3V8NA 1EHIA 1K88A 3IVGA 4KJZA 3RK4A 2ANCA 4OBWA 2GR9A 4EH1A 1OH5A 1OROA 2P1DA 1LDNA 5DKFA 4OHWA 5IBPA 3MFYA 3KQPA 5I7SA 1WX1A 5IWAB 1UXGA 2Q3LA 3BJIC 3ET4A 3EG9A 2HRDA 2PRKA 4YQYA 2WE7A 3T9FA 1HKHA 3HCPA 2SKCA 1G8SA 4P4GA 3VU0A 3RYHB 3X3HA 3BXEA 1FQWA 1MJGM 1N2BA 1DE0A 1RAAA 3BS4A 4BV9A 3KZMA 3ZEAA 4KPFC 5L9AA 4HQ0A 1Z37A 4I9NA 3VVCA 5G0WA 4P58A 3NI2A 3OHPA 1GN9A 5KAMA 4PHFA 4XB1A 2H5LA 5HF8A 3UQZA 4JEHA 3MOSA 2DZDA 1OIVA 4GFDA 3VR0A 1RQXA 1EFHA 4OOFA 4WZZA 2CFIA 1P1RA 3KG2A 1RZ3A 3PUHA 4XCVA 5HF9A 1EVLA 2D5CA 4OEHA 4JLUA 4XFDA 4A9AA 1YVPA 4ZU1X 5KYVA 1LBEA 1RFLA 1UIRA 2DSNA 2I8AA 1AS0A 1XTIA 2GEFA 2R1TA 3DEJA 4UTNA 4R40A 5EXDA 1M8FA 1J4AA 2XTMA 4MR8B 1EI9A 4W9MC 3C7DB 1JEEA 1LPPA 1ZQ1A 3F6EX 4AJ4A 4EOGA 2NOAA 2OXRA 2ZROA 1JJAA 3L04A 3MZ0A 3QXGA 4JIMA 4PG7A 5D01A 3RYIB 4DCGA 3CNBA 1KE1A 5IASA 2P3SA 2QRJA 1FNCA 1XNRB 3CF4G 4GQBA 3OIUA 1XQVA 3I2HA 2O4UX 1L4HA 2H4HA 3HA3A 1SUBA 1VDZA 2O6HA 2OSBA 3X44A 4BFWA 2NZ8A 5E6RB 3DJYA 5C52B 1QJ4A 2J3QA 2EARA 3P4UA 4J3JA 1U3FA 3O0TA 3PBKA 1DKPA 2E1RA 4KIJA 2NM0A 3HABA 3PQ4A 4UVHA 1U0OC 5FNVF 4MLCA 3KKNA 1HZZC 3DDSA 4L8FA 1VHQA 2IYQA 5F12A 2YINC 1SPBS 3HZRA 3COWA 5JCZA 1RYFA 3I9NA 3I39X 2I7VA 4YMVA 3T95A 3TNYA 1Z12A 2EP8A 3U7IA 4MDEA 4XSVA 3DD5A 1RZUA 5CVJA 4NU8X 1QV7A 2AVNA 2RI0A 2ZYUX 1CHNA 1J0DA 1V3TA 2HU2A 2QF7A 4KQKA 4FLFA 1MRNA 4MRPA 2Q0XA 3OPYB 3SXUA 4C06A 3HDYA 3ZY4A 1W48A 3N5KA 1P1HA 3E53A 4ZXFA 3ESYA 3PD0A 4INOA 4D9KA 2EQ5A 2DY1A 3FROA 3M2TA 4LJ9A 1VDMA 4P82A 3TLMA 5I3CA 1H4QA 4K6FA 4C4OA 2XADA 3NTUA 4U7JA 1VLMA 3DCYA 1FUIA 1KORA 3GLTA 1L7MA 3KB1A 3G0CA 1IEWA 1LX6A 3TYXA 4BP1A 2WNSA 2GH1A 2QXTA 4ZCLA 2ILVA 1PYDA 2XE8A 4PEVA 1D2RA 3E61A 2PQ2A 1T1EA 5EVCA 4TN1A 1A1VA 2HO5A 4UQOA 1RJ9B 3F7OA 3OJCA 1X94A 2A3NA 4WZBB 3BIFA 3UMMA 4XA8A 2IYTA 1XDWA 2C59A 2EKDA 3K35A 4WXYB 3HEAA 4LVUA 1R6TA 2QMHA 4EG3A 4HL6A 13PKA 1L8AA 1RADA 221PA 1VMIA 2CJYA 3OMXA 3QJ5A 4GR5A 4RHEA 5KI6A 2JFPA 3G0IA 1SPXA 4MYUA 2PUAA 2QUAA 1VHWA 5DCLA 3HVJA 2OCPA 3DBRA 4QVKA 5IULC 1XZDA 3OEHA 1D6JA 2ANBA 2WJ4A 2ZIWB 4MRVA 3HO1A 1T6NA 2FX3A 3KUDA 1Z38A 4C7JA 2RCNA 1FY2A 2RGBA 3HCNA 2Q9BA 3EDOA 1BE6A 4G1BA 4RY9A 3ZE0B 1U2GA 2OYSA 2RJ3A 2C7VA 4NX2A 4WOCA 1CEYA 2R7MA 1MLDA 4BV3A 2ZS8A 4YV0A 4RTKA 1HNNA 3HM2A 3V3KA 5I5EA 4L7QA 2OGSA 3GN2A 4ZRMA 5LXTF 3FNEA 4BJHB 5JSYA 1UZAA 2O2ZA 2Z2YA 1WXWA 4OFZA 1SVNA 4XM1A 4FGZA 1NV8A 4DA4A 2QRMA 4BBAA 4IY1A 3V6LA 2QTGA 2XXAB 1U7WA 4WDRA 4WOBA 4IQGA 3UUWA 3MYRA 4D98A 1VKHA 2D1FA 4W1SA 1XMOB 1I2BA 4CR7A 1JWBB 1F8GA 1ODKA 4BNNA 1EA7A 3Q3HA 1OIWA 1TMKA 3QLTA 4HTAA 2NXNA 5I8WA 3NVKI 2H65A 3C3XA 3L43A 4HDRA 4EJ0A 2RFLA 2GWRA 2QA5A 2QN1A 4PY2A 3STWA 4EA8A 1IJFA 1VJTA 2O2GA 5DBEX 4EG8A 1T5HX 4L4UA 4DR7B 4KGVA 4IZOA 3V7WA 1MQSA 2A9FA 2R6GA 2VRCA 1HWYA 4PR0A 4EKNB 4TMZA 4F3KA 4N41A 5JXIA 3ENZA 4G4IA 4PRZA 4QX6A 1T0IA 4PAQA 4YVFA 1CW2B 1MEJA 5DP2A 1N2OA 4KUGA 2X7JA 4G07A 3H1TA 5GJCA 2IZ1A 1XX6A 2Q7OE 1U0TA 3G5TA 3M6LA 1EYZA 1QX4A 4PAWA 5FBWB 3O8RA 3OTIA 1E9EA 3BXXA 2FZCA 3CUTA 4AKSA 3TXXA 4F06A 5FUWA 4XX1A 2JIZA 4IUDS 4ER3A 5KKNB 1W36B 1J20A 3RREA 1Y1TA 4DV2B 3EXEB 4A2QA 2DB3A 3E18A 5DM1A 2QP4A 4W6QA 2O8NA 3EEIA 3EXIA 4EGJA 1II8B 1JHDA 3W8FA 3IX7A 1BXRA 4HZUB 4GXNA 4PO9A 3I4LA 5BQXA 3L2OB 3RT1A 3I8SA 4B82A 1NI4A 5B5SA 4FZRA 3M6FA 4IO1A 5IC5A 2ASEA 4ODIA 2VIIA 3FMPB 1DBIA 1C30A 2B5WA 3HGMA 2EYQA 4L3VA 3FMGA 1LUAA 1NPTO 1SA0A 2P9GA 3BVPA 2GCIA 5GJVC 3W2GA 3BSSA 2A3RA 4XARA 1GPMA 1AGNA 5JPIA 1MX3A 2Q6VA 4NDAA 2WK1A 5E4YA 5TF4A 4WVLA 3WVNA 2F62A 1H8HD 1PZNA 4FFBA 3M49A 3N2IA 2P67A 1N7IA 3EGOA 4N12A 4HAXA 3U48A 2DLCX 3EVGA 4KNYA 4GG1A 2O8CA 2HCFA 4B1FA 1SU4A 2ASVA 3GMSA 3BERA 4AMBA 1DXYA 3KQNA 2ZUVA 4DG9A 5DLYA 2QV7A 2EBHX 4OYLA 4CJXA 3OLXA 1FZQA 3L8ZA 1VCNA 1UT8A 4KLZA 3C3MA 2GRAA 4ES6A 1X80A 1K27A 4OBEA 4QDJA 5DULA 2PX5A 1E4OA 1DDIA 3H2GA 3V97A 1NF3A 3OQVA 5DI3A 3ZU3A 2VBGA 2QN2A 1G5FA 1HLDA 1NNUA 2V55B 3LUPA 1TX4B 5FTKA 4JI7B 4GU5A 4MDFA 2W98A 3V1MA 3QG5A 3V46A 3GAMA 3D81A 4YIKA 1P62B 4TYWA 1RVV1 2B1QA 3O8OA 4O2RA 3TQQA 3G2QA 4CPDA 3NVAA 2RGXA 3GMIA 5EA2A 1GGEA 3NWPA 3M6UA 3G8AA 4FUQA 4MVJG 2KJQA 1PT9A 2AJBA 1LZKA 1SG6A 2XVAA 3Q2KA 1MB2A 1WF6A 2OR3A 4P33A 2PS0A 1U98A 3FTFA 1HQDA 5EKTA 5KCMA 1R2QA 2HRZA 2WHRA 2ZVQX 3SN6A 3OURA 3UTDA 4BBZA 3GDFA 2DWPA 1QUEA 2WJAA 2ZZKA 4G23A 5G1OA 5JT1A 3EZ9A 4NV0A 1LI4A 1J42A 2PFSA 3LIPA 4OMCA 1BCSB 3BB1A 3HGQA 3N0XA 1V4BA 1P91A 1T0UA 2EATA 3W9SA 1AN0A 4G0UA 4DY4A 4MDYA 4CIYA 1NMXA 2Q2NA 2RGWA 1P1JA 3I9KA 3MMPA 2JK1A 3RJZA 4QWWA 3LP5A 3K5PA 1PTKA 4FE4A 1A8QA 1D6SA 1TVKA 4QG3A 1XJCA 1D5WA 1QQ5A 2YWHA 1OOEA 3W5AA 1YOBA 4WOKA 4ND8B 4F2GA 5LQJA 4QUKA 5GONB 1AZLA 3NBKA 1ZSVA 3GD5A 4DJTA 1NJ5A 1XQ9A 1ZOOA 2RHJA 1NT2A 4FD3A 4MUGA 1D4ZA 1RM5A 2PZMA 1YZNA 5DOVA 2FZLA 2YQ4A 3VX4A 1X8XA 2WFLA 3WMXA 3ETDA 1KK1A 2G28A 2OV2A 3I6BA 3LYLA 4F8JA 3UFXA 1ZN9A 1JHZA 4KKXB 4XFKA 1XO1A 4YWHA 4E3ZA 5CM8B 3CF2A 5LZ9A 3UKOA 5G41A 2HM7A 1UPXA 3AM5A 2QRVA 3W2EA 4AY6A 1WW2A 1X1EA 3EJ6A 4OSOA 1FB5A 4PNPA 1MW9X 4C43A 1U4OA 2MYUA 1DMRA 2O2YA 3HKDA 3L0PA 5FI0B 1UKZA 1RWOA 4B3FX 4CTOA 1HR0B 2PD3A 4YP6A 4ALMA 3BWVA 3ECSA 1T5DX 1VKRA 3IODA 3TIVA 2XLCA 4N82A 2L2QA 1E2IA 1QYIA 2GCOB 2WD9A 4ZK2A 1I5EA 1GL7A 2Q3BA 2VP0A 3F6BX 4IZIA 4NE2A 3GP8A 4DC9A 3FOFC 1JAHA 2ZSAA 1GAEO 3FBWA 1W5EA 2QTMA 1OWMA 3BTOA 3II6X 1ODFA 5LB2A 2ONJA 1UBLS 1P72A 1JLMA 1NRXA 3VC3A 5E0OA 4CMBA 2A59A 1NMYA 1TK3A 1O6ZA 1VP3A 1A77A 1DADA 1P3Y1 1IQ0A 1CQIB 1Q44A 1QIJA 4OYYA 4D3FA 4F2WA 4DLZA 4JT4A 1H4SA 4H1TA 1XLWA 1J0EA 1H5UA 1XEWY 3H3JA 1GCOA 3NTLA 1QVAA 4NBWA 4Q9JA 3VZCA 5GVSA 3U60B 1MKYA 2BHRA 1P18A 3KQKA 2BEUA 3ZS8A 2PU7A 4DTIA 2CCKA 3PE6A 2ROQA 4HDNB 4IIYA 3S8EA 3KVRA 3TSOA 4F5DA 2WKPA 1RYMA 3OPQA 1WZIA 5H80A 5K0TA 3HCFA 4MW6A 3SKVA 1M10A 2ZSFA 4PX3A 3GZNB 3SX4A 5FHQA 4WESA 5C1PA 3F49S 2PX0A 4NCKA 3IKTA 3MLBA 2HT1A 4AO6A 2O3SA 4ZVTA 2P6OA 1EXWA 3B3AA 4RIIA 3G0HA 3O1IC 2REQA 3P32A 1H6CA 1ZCAA 4IQ8A 1USVA 2Y4OA 5AK5A 3FF4A 1CF9A 3PFGA 2VT6A 4FEYA 1I4OA 3PSHA 5CXUA 3IDSA 4HS4A 3KHTA 2L0XA 3HR7A 1JBKA 1JEJA 3AYZB 2H2GA 5ALMA 2E6UX 4C3VA 4EG5A 4MHTA 2QMEA 2X0IA 4C0BA 1IHDA 3ZHYA 4ZREA 1PVVA 1F4LA 2YVKA 3REFA 5F3DA 3E27A 1V5IA 1GNVA 1RBYA 2O2DA 3A9RA 3SYNA 3L7AA 3RAJA 3V2UA 2IBTA 4JK3A 2F48A 3PR3A 1BMQA 4AJ9A 4JXZA 1U0FA 3CN9A 2C4WA 2C5BA 3ITEA 3WB0A 4L8LA 3UAOA 1NHGA 2Y67A 1YZHA 4MUAA 5EC8A 1MB0A 2VRBA 1YB7A 3T4PA 2C9OA 1TYBE 4V0OA 1MOQA 1U8YA 1JT2A 3FR8A 1IYZA 2E89A 4KGZA 4EYEA 3HKCB 4DSOA 1YL7A 2WUFA 2QHXA 2I03A 2C99A 3MINB 1O9HA 4DCCA 4HYEA 4URYR 1ZCFA 1B0PA 1KVSA 4HADA 4KP7A 5B7QA 1C9MA 4OXQA 3KZNA 3NHUA 1EG2A 4J2HA 2R8ZA 4J0JA 5K6TA 5LQCA 3ZWAA 5LDDC 4AF8A 4IH4A 3MOIA 2A4KA 2HA0A 3NDJA 3KXLA 3T0IA 5KCZA 2VL7A 1C3EA 3H5WA 4KODA 1T1IA 2QZZA 1N1DA 2HH9A 1KZ6A 1UPTA 2YXLA 5ECDA 2ZE5A 3D5QA 4XGQA 1HF3A 3EWNA 1SRQA 2D7CA 3D0OA 3DP7A 3R7LA 5F2OA 3K0BA 4F3NA 2BJWA 3NW9A 5BURA 1SKQA 4EHJA 3B8EA 3S99A 3O8QA 3WIDA 1U0RA 2IOHA 3DKKA 1AVTA 3KJGA 3DDCA 3PS9A 3TO5A 2IF0A 1E0JA 1Z34A 3V8VA 1IC6A 2AOTA 3DE3X 2Z04A 1NXXA 4U8HA 5D1NA 2AI3A 4GPEA 3U49A 4AMUA 1UBKS 3CZ9A 4CEHA 1B2LA 2QYSA 3O4HA 2GEKA 1XZKA 1WXFA 4Q1DA 4CEJB 1ETHA 1MHTA 4KIWA 2B2NA 4DMHA 2C8KA 2IQIA 4QXQA 1WDWB 3NKFA 3F7NA 3CXUA 5JXHA 3FZQA 4YPOA 1ZQ9A 3ZKAA 2D8AA 3IIEA 4KN9S 4OUDA 1OWLA 2NU9B 4NS4A 2IFTA 1FLDA 1SHUX 1Z16A 4HEQA 5T64A 4BJ3A 1MO2A 3KKQA 1H0SA 1Q1GA 1G8GA 5FOWA 2VEDA 3IHKA 3PHBE 4TXHA 3GIDA 4QO8A 3GFOA 1T5IA 3UEOA 5HQ3A 1WOYA 1PBNA 2CVFA 5F64A 1NMEA 3BFXA 4W1PA 5EIFA 2FR8C 2WVJA 3UUEA 4AZWA 2HXYA 1IBSA 3DO6A 3LGSA 1R9NA 3KKOA 5IBQA 5IVPA 3A6LA 3PFBA 4Y2GA 1PR0A 3Q6MA 5F21A 1UMCB 2IU4A 5GZ6A 4AWAA 5EHIA 2Q3EA 3MBKA 4OXRA 5ALTA 3ASVA 1ADCA 1I33A 3IUEA 4KR2A 2VJQA 2PNFA 5KVCA 3ROPA 2J3EA 1F14A 2G04A 1BQ3A 1N6RA 2PZLA 1KAQA 3D3WB 3FKSA 2QX4A 1KPIA 1RQRA 4MS3B 5BMVF 1FMJA 3CUYA 3UAZA 5KVAA 2WG0A 3MCAA 4K9KA 2OFFA 1YI1A 5I7AA 1GCGA 2H2FA 1J8VA 1O95C 4EPTA 4P6VF 4PS0A 3OFNA 1SQ6A 2CLDX 4UBKA 3TGWA 1R10A 2O57A 5JAUA 4ASUA 3AY0A 3WRXC 3VSDA 1GSOA 1SXHA 4ENTA 1XDZA 2XXJA 1UKCA 3OIDA 4FYIA 2HR1A 1P9OA 1UBSB 1CS0B 4TUYA 3TXAA 2I7XA 1ST3A 2RGGA 2TS1A 2V5AA 4M87A 1W4CA 3AVPA 3JW8A 2XWPA 3CGGA 1EQ2A 4EYOA 4AXBA 1IMOA 1UBNA 2HQOA 4JKOA 1K89A 4QDZA 2BYTA 1KJ8A 2I6XA 2J6CA 2P2ZA 2JHPA 3ZU6A 2RHBA 5IWCA 2IXTA 4ZHQB 5K0FA 1P2TA 3N8NA 2PRZA 1BWRA 4Z9BA 3RC8A 3ZHBA 4EELA 3ER6A 5GAJA 2ISQA 4NJMB 1JLLA 2JD0A 1Z17A 2QMQA 3OFND 3BAZA 1KI4A 3DMFA 3NATA 3U3MA 4A0RA 4UREA 4KFRA 3FAKA 3AX6A 2AW3A 2V7BA 4M86A 3VHXA 2RGDA 5HA5A 3O90A 4KW7A 3OKPA 1EK2A 1COWA 1DBRA 4WKCA 1UXJA 1JYSA 3FCEA 3TTYA 3CRNA 4A8JC 4C0LA 1I3MA 3WRVA 4KXUA 1RMYA 2W5UA 2BDUA 4YXWD 4IRUB 4GW3A 5AOCA 3RIXA 4Z99A 2RI6A 1NFRA 1XYYA 3I2YX 4QFDA 1ZWLA 4NBTA 2QTLA 1U2EA 2VPYA 3NNSA 4J94A 5EPEA 1XTVA 4F8YA 3SVLA 4I9UA 5DM70 4L78A 4Y6QA 3SK0A 4ZEVA 3AHHA 1YRYE 2OWEA 2HI0A 2VCYA 5G3YA 5DGCA 4HWTA 3P1JA 2WTNA 1JU3A 4I36A 4JQCA 2V0GA 5KU7A 3JQFC 3KSDO 4EUHA 5BR7A 1OVGA 3RAPR 4GDFA 1BHO1 1KQPA 4IFTA 1JP7A 2PVSA 4ARVA 3OC0A 1XEFA 1E3TA 4URWR 3EUWA 2GGSA 2J59A 5JARA 4OBBA 4KN6A 2FZWA 5TT0A 4F04A 1LLQA 4Y0NA 5LNK6 2HWXA 3VDMA 2BFDB 1CJSA 5FDFA 3ADBA 4HATA 2ZRNA 4B6JA 3ZDAA 1A4UA 1RKQA 2R62A 3KYDB 1C1DA 3O4IA 1PNOA 2C61A 1J2JA 4V2UA 4JKYA 2CBXA 1T26A 4M99A 3FNBA 5KSYA 4KJXA 3E1SA 1WTAA 5DYWA 1Q19A 1U7UA 2FH5B 2XXBA 2FEWB 2A4MA 1P5ZB 4L1KA 2JLUA 2DM6A 2OENG 1YZGA 3UICA 1BDIA 5L95A 2JHAA 4BNYA 3A32A 3L0ZA 4YCSA 5B58C 1QONA 3O84A 3UUGA 3BF8A 1AZTA 1LCIA 3EISA 2PMFA 1L4LA 4IXMA 4MRRA 3FIUA 4DJFC 5CA1B 2QNRA 2GPBA 2QD2A 3CCBA 3FH0A 4OGGA 5AW6A 1O8CA 4G8CA 2F90A 1RWNA 2E48A 2QL7A 3JASB 3JARB 4ZCRA 9ATCA 1IPEA 4Q66C 1PS0A 2GZRA 4AZ0B 4M1OA 3PKJA 1EFVB 3CEJA 3I6IA 3T1YB 3H5TA 2FNAA 2CLFB 1AT1A 1RXSA 2DH5A 2CUTA 3IHTA 4RFSA 2Q07A 4ACAA 4BGUA 3H87A 3O9ZA 1KSJA 4IJKA 2C4NA 1FFEA 4HGNA 1J2EA 1JNXX 3SE7A 1K3FA 4ZCQA 1MAWA 4BNKA 2Q7XA 4G5XA 4K6GA 4PLFA 3ZR4B 5I7WA 2A57A 4FGWA 4PO8A 1Z0JA 2D0IA 4XAQA 3K6RA 2YXNA 3EGWA 4AF6A 1BVYF 2FF7A 2JA2A 3UKJA 4A4DA 2YJZA 5FUMA 1YONA 3ADDA 2TYSB 3S1SA 1NOJA 4LSGA 3SYKA 1LVUA 3WWYA 2HQRA 5ALXA 5B2EA 3OU2A 3I62A 1PS8A 3U4QB 5AXDA 5AI4A 2BBSA 1P8AA 3H1EA 3SJZA 1Z8FA 4URUR 3FOAA 3PITA 4OAPA 2H1SA 1V5EA 5DFAA 5K3OA 1FCJA 4MQFB 3VYRB 4DVGA 4GKBA 4BE7B 2VDQB 1HGXA 4MVWA 2PXHA 1NKTA 5A9SA 4GPBA 2QZ9A 3ZK9A 3QE3A 4MR7B 3EEQA 3ADPA 4RDXA 1L5SA 3MSXA 5EJ4A 1GG5A 2XPCA 2BR5A 3RF7A 5AYVA 4JYAB 3M70A 2HA3A 4I1PA 3ZN2A 3IMGA 2OKCA 3HVKA 3THWB 4KBFA 4MO9A 1ESMA 4OKNA 1FMCA 3LBIA 3VR6H 1I6WA 1UBMS 2O05A 4S04A 2POCA 4IIBA 3K3PA 1YJCA 2ZWOA 3RBXA 1R64A 1KMHB 4KQMA 3MJSA 3OLZA 3RASA 2AKAB 5A3JA 4KWHA 4YACA 3LZ6A 5KNLA 2ID9A 1D6MA 5E2IA 2XUIA 2YN2A 2IYUA 3DTTA 1KZ4A 2BKAA 3R7WB 2YIVX 4CIWA 5JZ9A 2RD2A 3PPXA 1OI3A 9LDBA 1BDHA 2CHVA 1T6YA 2WMNB 3VYWA 4CTJA 3KETA 2UZ1A 4D3SA 4WNYA 3L8GA 4AI6A 4QQFA 1VLQA 5HNKA 1I6LA 1NN5A 2Q49A 1FXSA 3BXHA 3FPGA 4FMDF 2GI4A 3EF1A 4Y2SA 4KGXA 4YGYA 5DSZA 2WVGA 3RS3A 1P2SA 2GHIA 4EWLA 2FPIA 4GT1A 2D59A 2H08A 4DL9A 4UPEA 3T61A 1CX9B 1WW3A 4P0QB 1EFRD 2OCIA 2CXQA 3GFQA 3T1QA 3LY7A 4K9DA 2XZTA 4F9TA 2PIDA 2NTNA 4BKRA 1E1CB 1OGIA 2G72A 1AQIA 4G25A 1E3LA 1G21A 1VYHA 1SVLA 3WLQA 1PGOA 3OOYA 2G1KA 3BD8A 3JR3A 4ZWNA 3WGHA 3AEQB 4NULA 3D6UA 4WUTA 5IHXA 5AW9A 1JJVA 1G1AA 1V25A 3VPXA 4ICIA 1JKXA 4IJUA 3UJPA 5M04A 4MLZA 4PBTA 3VHRA 4A2CA 4DIMA 2WTXA 2ATIA 4TV9A 1SVIA 1W49A 1XCOA 2VQFB 4S0XA 1RHQA 4N54A 5F33A 1I9GA 1U8FO 3JU3A 1BHSA 1K5HA 1ZOPA 2VP4A 3FJOA 3BH6A 4ALKA 5T4EA 1AGXA 2GK6A 5DDIP 3BTVA 1Y6ZA 5DN6A 2AK3A 5BWOA 2JLWA 4JEUA 4Y1RA 4LBVA 3TFOA 1AOXA 1A5SB 5EP2A 1ZVKA 2CLCX 3U7GA 1XZGA 3IAHA 3PIRA 3AR2A 4CFZA 5IJXA 6LDHA 4BBPA 3EXHB 4MWZA 5BORA 5AUPB 2AZDA 2PO7A 3ICPA 4CM9D 1T1GA 2G9RA 2PT6A 4B7ZA 3TIFA 2DR2A 1AHIA 2Z0MA 3OP4A 2ZTUA 4RZ3A 2HWUA 2QGNA 2XKAA 3AJ9A 2VG8A 3HPQA 5EP1A 4NCAA 4ENUA 4UE2A 3OOEA 3OE5A 1JG7A 3K9BA 3RU9A 3DMYA 3I9LA 2H48A 5LQAA 4ALNA 1XHFA 4ALIA 3GCXA 1YJBA 2J9GA 2P9FA 3RVLA 2BMFA 5H4HA 1FJHA 3GHHA 4BO7A 4NQRA 2YWDA 3L07A 3LC1O 4BCCA 3UJ7A 5FO1A 4BLWA 5H68A 1CUDA 3AB3A 3KQQA 4FQ7A 2FFJA 3I8OA 3VSBA 5L4LA 1T9GS 2X9LA 3DXFA 1SUDA 1UOOA 2P2CA 4RFLA 1EE2A 1R5JA 2CJWB 5TE9A 3VKVA 1Z3IX 3E15A 2XWBF 4KAAA 1GQFA 3L7IA 4KPUA 1T9DA 1W75A 4M1EA 3TOXA 1Y3IA 1P4HA 2GT1A 3DE5X 1RLIA 1XVTA 4QRHA 3S70A 1BWPA 1P1BA 5A62A 3MJVA 3BGVA 2QT9A 3SIPA 2Z58A 2HD4A 3B89A 2YRXA 2OZLA 4GM4A 4O2BF 4TN5A 2RG1A 1G3UA 4H60A 1AV6A 1JGTA 4BWFB 3O2NA 2QTCA 1A9OA 2B4TO 3CRRA 2NVUA 3KDPA 5EHGA 1NR5A 1TVMA 3TZ6A 3LVBA 2FP4B 4M8LA 4AKEA 2ZITA 3CF4A 4HX5A 5LDGA 4JT2A 2V1XA 3S8YA 4MW1A 1IN7A 2BKUA 2R00C 4MNTA 4BMYA 5BNZA 1WEKA 3KEFA 1K97A 4OI2A 3OJWA 1M2VB 2MMGA 2XD9A 4YMLA 1V2HE 3WRWA 1SXIA 3WLJA 4ROTA 1MG5A 1GD1O 1JEOA 4QC2A 3TFWA 4RTNA 1XZPA 2D2FA 3ZV7A 3FPAA 1YRWA 5B4VA 3QUBA 3UCFA 1ECFA 2GSWA 4IS3A 2IWHA 2I6UA 1PUJA 1P1KA 1ABEA 2BBWA 3HKCA 3JSXA 3KQSA 3O4RA 1EBBA 1QOPB 2H0QA 7MHTA 2R8PA 4MWOA 1N33B 3N28A 1UOEA 3TTXA 3DZKA 2H9YA 2AZMA 5JRDS 3ED1A 5JZOA 1T36A 2XD4A 3ANNA 5AUOB 1CDZA 4M3NA 1OASA 3EXG2 3UJ6A 1IZ0A 2FDXA 3E5NA 1DRVA 3IO5A 3RDPA 3C7AA 5IJZA 1C29B 5JD4A 2NV0A 3D3NA 2P6NA 1D8TA 1UMBA 1ESCA 2O3RA 4PN3A 2J0UA 5HZKA 1MX9A 3H2SA 2IVFA 3WK5A 5KNCH 1UXHA 1KDPA 1QNLA 1HLGA 4Y6PA 1ECCA 2ZXUA 4ZC8A 5EQTA 4OQFA 5EJIA 1V43A 3RUDA 5KQRA 3DCIA 4JJZA 4F84A 5KNBD 3PEUA 2C84A 3M6VA 3TNJA 1YR1A 1DAMA 3W6UA 1AO3A 2W6JD 2WZQA 3H1FA 2LKCA 2P68A 2CNBA 1IM8A 2AHOA 4P3YA 1FDSA 3IUPA 4CMKA 1U1EA 1DOHA 1L4FA 3OPXA 4QXRA 1AQUA 1DC4A 2X15A 4BXOB 3I04M 4US2R 1JIXA 2PT9A 1DKUA 3OO0A 1MOZA 3ASUA 2BTQA 3BGSA 3CNEA 2YBEA 4JB3A 4X1YA 5EJMA 3SR3A 3V7NA 3OCWA 3EZXA 2FJPA 5FUVA 1JE1A 5DXFA 3RG2A 4B6OA 4ATNA 2O7NA 2QE6A 4QGBA 3IP1A 4G4JA 5GADl 1T6XA 3PNSA 1NSTA 2A9VA 1QMPA 2FFAA 2WHQA 4D6PA 1RM3A 3JPYA 1C2TA 2C9DA 3INGA 5A04A 1VL1A 2AZXA 4WKNA 4LQ4A 5A3QA 1NVMB 1QOQB 2J6HA 3K31A 1NU6A 3QU9A 3EEOA 1PG2A 2OQIA 4MGHA 4XD7D 4CGYA 2FUNB 2VN8A 3ZNNA 1X2BA 4L7VA 1WR8A 4DR6B 2CE2X 4Y2YA 2C5FA 3U2QA 3ABIA 3D2LA 3LUFA 4ZAVA 5T7BA 4I7EA 2MSWA 2NTVA 3L3BA 1E8DA 2G77B 2F6RA 3K53A 3I30X 4KV7A 4MHSA 1YI8A 1QKKA 1NYTA 2IOQA 2PT7A 2VSYA 3W79A 1PZXA 2DQZA 2XMRA 3SJBA 4AN0A 1C7IA 1TCBA 1BGWA 1DCFA 3ESRA 3O8QB 3OETA 4QJ3A 2O14A 3O8CA 4JVSB 2XB4A 2YIDA 3GFGA 2GBFA 2B5VA 3DMTA 3K8YA 3Q3GE 2XOKA 3ZCVA 5JQGF 1U5BA 4IXDA 2FE4A 2OVBA 2VDKB 4AMGA 5EEHA 3J7AC 5DM60 3HMQA 2ZBGA 2G25A 3L0YA 2DQKA 1E2LA 2FGJA 4Y2RA 3U9SA 3U56A 1KP3A 2JIDA 2AQ8A 3HN6A 2P0YA 4U7PB 1UXIA 5EE9A 5KHAA 3ZCRA 1DZ3A 3CVJA 3UFXB 2VKQA 5JSHA 5C2JB 3IV9A 3HNOA 4DWWA 3MF4A 1FRQA 5ANRB 4Z5XA 5IZCC 4HVAA 3GRKA 2RAPA 5BNTA 1MRZA 1E2GA 3QIAA 3NUQA 4JGGA 3PUXA 4BU1A 1NR7A 5KC9A 3HWX1 2ZKIA 4KYIB 5LP6A 4C5AA 5DNUA 2ZJ0A 3EYWA 2HCBA 3B5EA 4ZJZA 2I4IA 2ZEJA 4LI0A 5HIIA 4U7WA 2V4MA 3DWGA 1RD4A 2X0DA 5HMMA 4RKWA 3WZLA 5A71A 4U7FA 3VXKA 3SC2B 2A9PA 3ZKWB 3OZAA 4PR3A 4BFCA 1WB6A 2HHLA 3WLLA 1SVSA 1TD9A 2WM2A 4MAAA 4O4JB 2IYNA 1SOVA 5ER9A 3RVPA 1Z4PX 1AHNA 5C5IA 1ANKA 2KW5A 3W4KA 2FN8A 1CZHA 3I34X 4IGFA 1W2WB 2NUBA 5FWNA 4BDTA 2DOKA 3THSA 2GTPA 2E0IA 4TTQA 3RFFA 2XMBA 3FTEA 1U9CA 3BZWA 4L22A 4F1JA 1PT5A 2Q28A 3BH0A 1GLVA 3ZUPA 5I9LA 2I6QA 2IQ5A 5ADWA 1FSPA 1DIGA 3KBBA 3PC2A 3SLKA 4NHOA 4R2WA 4AL4A 3RTCA 4BNLA 1M66A 3RSOA 3FKQA 2BC9A 3C6BA 2NQ2C 4Q4HB 1T91A 1XYGA 4JCCA 4KIGA 2C07A 1GTVA 1WOMA 2X9QA 3BHMA 3CNLA 3EAQA 1P0FA 2ZBFA 5T41A 3T3MB 2WVHA 1ZSNA 4FSHA 3ZXSA 1DWOA 1JWLA 2VHWA 2OZKA 3PVSA 4NY1A 3K6SA 5IEBA 2ZB8A 3VZRA 4PGFA 3C1UA 4KR6A 4D26A 3KPWA 2JGFA 2JH3A 4QM6A 3DOJA 4CF7A 1MAAA 1THGA 1YRAA 4J9UE 5JH7F 3CW9A 4HN9A 1WWKA 1UFQA 1J39A 3KVNA 1Z5GA 4Q3OA 2VSFA 1WXEA 3OIWA 4Z1MA 3SQLA 2Y9PB 4L07A 4FFBB 1Q6ZA 1X9HA 3G8BA 3NIFB 1PIWA 1BJKA 2E4VA 3U17A 1DHRA 3U9LA 5DM0A 4FXPA 5B3AA 3A0UA 1EGQA 3AF3A 3PXAA 5E4FA 5A6SB 1E2KA 5H9VA 2R1VA 4CMAA 4YHBA 1UC8A 1V1MA 2JCVA 1SXPA 3TIIA 1Q0HA 3WR5A 1I2AA 1JSXA 2GBIA 5JMTA 5A6SA 3M1AA 1BXGA 3JD1A 3LZCA 2X4GA 2IHZA 1XBTA 2YX1A 3IAXA 3O3NB 1Z8NA 2BFAA 1TTTA 4BV8A 4MS1B 1PL8A 3QX3A 4YRNA 1EJ6A 3LW8A 4KC0A 3OZUA 1O6FA 4BCDA 3BA6A 1O58A 3UT6A 1MO6A 3VSCA 5IZ4A 3E9YA 1BE8A 4U0KA 5IVHA 3OUZA 1JQBA 4FT2A 2OK7A 4RGQA 5EYPB 4WWHA 5TMBA 2OVFA 3Q3IA 1YTLA 2PX8A 4HWOA 4BU0A 2WB2A 1OILA 2G63A 3OWHA 4M7RA 2C3OA 4OO3A 4A1OA 1JDPA 4QLAA 3RV4A 3GJ5A 5A06A 1A7AA 1NW6A 5KJ6A 1DUVG 1ZH0A 1HV8A 1K6JA 4FLMA 4KQ1A 4ANFA 1WZUA 3FUVA 4UBLA 3LWZA 3JZAA 3CR7A 4M83A 4JBYA 4MW9A 4OKSA 2GLUA 1NYLA 4MCJA 4DGSA 1AK9A 3ILHA 2EZ9A 2ZYSA 1N1MA 1K2WA 2VBFA 3F6RA 4FHFA 5EJAA 5TVGA 3TCKA 4EG4A 4EYGA 1XLVA 1PD1A 3MRSA 3ZE7A 4D9HA 4H7HA 4GOMD 4RKEA 1IAVA 1XKTA 2I6FA 2EFYA 4IMPA 1VHLA 2QU7A 2QVCA 5C34B 5DSTA 4AG3A 2XTJA 5FA8A 3NS7A 4BRSA 1ICEA 1K9VF 1DSSG 4J16C 3QELB 2ZSBA 1BA3A 4Q1FA 1LWNA 5FPYA 4TVKA 1LRKA 1N0VC 4QOIA 4QZVA 4UQLA 3ZH9B 2YV2A 4LF7B 3KXPA 5EZYF 5KMGB 2WKQA 3I73A 2ZYTX 2A6PA 1QDEA 2M9MA 1G4HA 1SVKA 5KYYA 4FDUA 3AMVA 3UW1A 2BFNA 4Z7OB 2OP1A 3IBYA 2XECA 2XMDA 2NSLA 3B3GA 3G8CA 1LLFA 1KMQA 2YZGA 1G20A 3ZGLA 4CKEA 1Q0TA 4MV9A 2QRZA 1ZK4A 2VNJA 3NAQA 4MGZR 3UV3A 4LZJA 4ZI7A 3BWBA 4HNSA 2XT6A 5K4AA 2IUUA 2DPXA 3LQ2A 1OXUA 3PLRA 2FLVA 3GVPA 4GL4A 2E21A 4AX8A 2PDAA 5A2GA 3KALA 3PFCA 3VTKA 3OM0A 3TZLA 3WWCA 4ZC1A 2YOFA 2YQZA 4QYWA 4Z2YA 2R00A 2C2XA 3L8EA 4PHTA 2NO4A 2ZP1A 4ZVMA 3VNBA 4B8WA 2ZWMA 3WKEA 3WNDA 4C4TA 5F9HA 3D7RA 4JITA 3Q5EA 1R0BA 1PR1A 1XAIA 1FDUA 2RONA 3GF4A 3PPVA 3HJHA 1L3CA 3A1VA 1NKSA 1X1SA 3N58A 2K5UA 1N0IA 3LF2A 4KXXA 3WTCA 5C5DA 4R4JA 3ZBQA 1E9RA 4XEUA 4ZAXA 1BHQ1 2ZUBA 4IUYA 1SKUA 2I3DA 1J2TA 1UPAA 3FDXA 1A8SA 1XK6A 5ESRA 4MGYR 4MWBA 2XYQA 3F46A 4OMUA 2O06A 3R7FA 3U3RA 3W1WA 4EFLA 3NDBB 4IMIB 2AWOA 2BM1A 1KZ9A 4N3AA 4XQ0A 3U13A 4DE5A 2H8GA 1EK6A 2XH8A 3Q85A 3IUQA 4ZRDA 1P81A 1JG4A 1VYUA 5D3QA 3HB0A 4L8YA 5KYWA 1GV0A 4XJXA 2PX4A 4RTSA 4X64B 5AK4A 1GTG1 2IITA 2DT8A 3PE3A 1K4YA 1WBJB 4IVRA 4DIUA 1E61A 3SLGA 1DS6A 3CO5A 1DXQA 1RXIA 3Q6NA 2EXXA 3U1VA 5LOVA 1DQNA 3HR8A 4N0QA 3M5DA 4S1OA 2XXAA 3DHWC 3ND5A 2A88A 2D06A 1V7CA 3GFBA 4UM8B 1E59A 3CF6R 3U7JA 1DTEA 3AZOA 3FOCA 4MR9A 5G2OA 4BKUA 3RM3A 4X1KA 1L9KA 1E7YA 1M73E 4G1EB 2IYLD 4KO2S 3VI3B 1GPH1 1ZNWA 4DNOA 4OMFG 4BPRA 4PHCA 2JVKA 5TEWA 4PNEA 2O7SA 2YICA 2J4DA 3K0AB 4RWZA 1J1ZA 2AJLI 1S7CA 3CSUA 3QX9A 4WD3A 5JLJA 3L4KA 3BQ9A 1II9A 4DDWA 1ZD8A 4HLUC 1TF5A 1WD7A 3T12A 3Q0IA 1WE2A 4KYUA 5E1DA 3K0AA 4YAJA 4R9UC 1PL6A 2NU6B 4F12A 1N0WA 8LDHA 5HRCA 5GIOE 3FSGA 4C03A 2YV5A 2ERYA 2P3QA 4PX5A 4XXHA 2QXUA 4C4XA 2P2GA 1LSSA 1QLWA 5J23A 2H5EA 4HOYA 5CTJA 1OKKA 4ZQFA 4U02A 2WWHA 3D6MA 3GPBA 4JC0A 5IVDA 5JAOA 4ZDIA 1T0HB 3GDOA 1QQAA 4OJTA 1BX1A 4OXYA 3TD9A 1WJGA 1U2TA 3E1GA 4MRAA 1M5UA 2B6HA 4H15A 2Z8XA 3TSYA 2XUKA 3BPSA 4TV9B 5NULA 2R7LA 1U6JA 2CDNA 2FSPA 4FMDB 2ZTHA 2FSSA 1OTYA 4CKXA 2QAGC 2GZDA 5J4LA 1FTQA 1GR0A 1AUOA 3AF0A 3LC2O 4Q1BA 4N3GA 3R75A 2MJLA 5LVAA 3T7SA 2EL7A 1Q7RA 3DHYA 3F78A 3GNTA 4ZO7A 2YS7A 2MMCA 4G8JA 2OHIA 4QXMA 5K6RA 2JLAA 5B4TA 1L4KA 1NASA 3P96A 4J0EA 1CZOA 1GQQA 1VCMA 4YXWA 1UFRA 5K8LA 2IBSA 1NUTA 4RV9A 4K0KB 3A1EA 3KAKA 3BN3A 2YV1A 4RDHA 2I1WA 1XWWA 4NBNA 1PLKA 3GG9A 2EJWA 4O4IB 3Q41A 6REQB 4RTMA 2H1RA 3EGDA 4UHBA 3ZTTA 3AEXA 4CDNA 3NM5A 2Y1LA 3ITNA 1FBTA 2VVTA 3BXGA 2P4UA 1PR9A 1BIFA 1CY1A 3KB8A 3MT9A 4LMPA 4P31A 2Q3CA 2XBMA 3EMVA 1I24A 4XYLA 2OQ2A 1J00A 1ZJYA 4JAVC 2D1SA 3OESA 3PDWA 1QC5B 4CQMB 2NPIA 3L1IA 5ALQA 2AMFA 3D8NA 3ZGZA 3W5VA 5IKEA 4RPGA 1L3IA 1OHHD 2Q5JA