5TC4A

Crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
292
Chain Sequence
EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohy
publication title Crystal Structure of the Emerging Cancer Target MTHFD2 in Complex with a Substrate-Based Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 110
structure length 292
sequence length 297
ec nomenclature ec 1.5.1.15: Methylenetetrahydrofolate dehydrogenase (NAD(+)).
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tc4A01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 5tc4A02
4GSLA 1FMCA 1LQUA 1ZK2A 1N7HA 4IS2A 4JBIA 4PVDA 2QYSA 5HS6A 1WWKA 4TRJA 2DC1A 1NQAO 3RASA 2AEJA 1V6AA 2X58A 3C7DB 4R1SA 1I3KA 3I9MA 4OMUA 5IDWA 5BQFA 4D45A 1NFQA 3AY7A 5IN4A 2A94A 5F3RA 4UUNA 3DBLB 2PGJA 3L6OO 3C7AA 3NJ8A 1DC4A 1SC6A 3TZQA 5L7TA 3ZNOA 1CYDA 2C29D 4K9DA 2JCXA 3DMTC 5KJ6A 2H9IA 2NNLD 2FSVA 1TT5B 4FOSA 2PH5A 5ENDA 4HFJA 4J1NA 4G2NA 4PZDA 4YT5A 4IGFA 1WAMA 1N9GB 1K6IA 3PXXA 4WLEA 5DP1A 2B4QA 4CLHA 1RM5A 1E92A 1NAHA 1DFIA 4WKGA 4XZ3A 3E6AA 1H6AA 5GMOA 1UZNA 3CH6A 3DC2A 2Y99A 5JAMA 2IXBA 3DHNA 4BNYA 2Z1MA 1U3UA 2H63A 2EEZA 1KVUA 2X5JO 4W9NC 2BFPA 2YZ7A 4CQMD 1ZK3A 4PG8A 2ZB8A 3OQ1A 3K2EA 3F4BA 3QVXA 3E8XA 5AXDA 2EWMA 2DBRA 2ET6A 4F6LA 1V8BA 4IDBA 4H3VA 4NR0A 4QXMA 5L51A 1JVBA 4NH4A 1GYQA 4HBGA 4A03A 3QW2A 4QO7A 3EC7A 3IQDB 3LK7A 4Q3NA 4IJVA 2Y66A 4KDEA 1E1MA 2G1UA 2ZATA 3QWAA 1HDOA 3KXDA 4J1QA 3IL2A 1HDZA 3D4PA 1E3SA 3HADA 1HE5A 3JQGB 3I6IA 1LSJA 1G1AA 4RPKA 5TSDA 3TRIA 3ETGA 5T6BA 4CQLA 3RROA 3OIFA 1D3AA 3ZWNA 4MKXA 3JCZA 3P19A 1HYGA 4B4VA 4Q9NA 3N74A 4YRAA 4XB2A 4NBTA 3E5MA 2G5CA 5LDGA 1CWUA 4JCOA 1ZK4A 1K0UA 2HMUA 3LT4A 4GX0A 4EZBA 4GWKA 3PEFA 4IDGA 3MJEA 4C7JA 4UREA 5KTKA 3RJ5A 5JXWA 1PL8A 1S7CA 3RUIA 3RUEA 1GD1O 4CV3A 5JCJA 4P8RA 4RVGA 4XYGA 1K3TA 1JQBA 4QQRA 4ESOA 1E3WB 3WJ7A 3OFSA 2HMWA 2WTBA 1X15A 3ZCXA 4BNFA 2FN7A 4CUKA 3K6JA 6LDHA 4N54A 5JCXA 4PGFA 3AFMA 5IFLA 4GVXA 3VH1A 1PJLA 1C1XA 4RDHA 3B1FA 4F46A 3PDJA 2FPPA 3INRA 3H9UA 3I23A 4ID9A 3HN7A 3DFZA 4R3NA 1IULA 4Z9XA 4CM8B 3RKRA 4E5KA 3DOJA 3KSDO 2ZYGA 5DN9A 4GGOA 3GG2A 5GZ3A 1WPQA 3KB6A 3VPSA 5F1KA 2GN9A 4UUOA 1Z73A 2P4HX 2PD4A 2YUTA 4O5OA 2ZTLA 3BTUA 3IKVA 1JLLA 2HSDA 3NT2A 3DTYA 2F00A 2VWHA 3V1TC 1ZO8A 1F14A 4CMHA 2WYUA 4E2WA 1JKFA 2Q1SA 4O63O 3JQ9C 3BTVA 1U3WA 1NAIA 4FGWA 3C1TA 4P4LA 3W8DA 4DBVO 4BO1A 3GZNB 1A71A 5HA5A 5JMWA 4ALJA 3GVHA 4CQMA 1M75A 3S2EA 1PZGA 3TPCA 1FJHA 3RC2A 2DLDA 5JBIA 3JQFC 4CMCA 4M49A 4NJMB 4KZPA 4RF3A 5A5EA 1HDRA 1MXFA 1I30A 4R1TA 2AQIA 2X0JA 1UXKA 3FTPA 3FSRA 4RVSA 1NP3A 2AQ8A 4P4NA 5AXBA 1NM5A 2E4AA 3GK3A 2AEMA 1ZMTA 3M1LA 3GT0A 4JQCA 4LVUA 3PYLA 1RYDA 5IN5A 2O48X 1LBEA 3KUXA 4EDFA 4R1UA 5A1TA 3GNQA 3NAQA 5KVQA 1JKJA 4UVGA 5IXSA 1V3TA 2CSUA 2NVUB 1VPDA 2O3TA 5U1PA 3WWZA 4CM4A 1QORA 1M66A 3PLRA 1O6ZA 1WW8A 1F0YA 4CL3A 4E12A 4DREA 1UP6A 4YJGA 5ICSA 5K9ZA 3UOGA 3RIHA 5KCZA 2O2SA 1X7HA 1A4UA 4R1NA 3DZBA 5ICMA 3TL2A 4I08A 5JO0A 1W73A 4WCDA 3G79A 1VL8A 3QWFA 4HNGA 5C3MA 3F1LA 4IDCA 4U6SA 4MVJF 1LDBA 4BO3A 3AW9A 3RC7A 2Q50A 3PFWO 5TGDA 2HK7A 2PFGA 2BGKA 3ASVA 1PIWA 3DBLA 2E48A 4E5YA 5BSGA 4ND1A 1UR5A 1SMKA 3GN1A 3PRJA 5EQFA 3HQ4O 3VVCA 4BQRA 2NQTA 5HWSA 5KKCA 5IG2A 3LDHA 2Q4BA 4ZU3A 4CM1A 1TT5A 2C2XA 4YA6A 5I7VA 3E82A 2VWGA 2VNSA 3LSYA 5CDSA 3DB2A 1N9GA 5A9RA 4GLLA 1O9BA 4BHTA 3BZUA 3LU1A 4XQGA 4BKRA 4RF2A 2DU8A 1X13A 2I3AA 4NZ9A 4IDEA 1UH5A 1Z7EA 4J9VA 4NJOA 4J6FA 3H2ZA 3KYDB 1HL3A 4URFA 4HKTA 2DBVO 3FD8A 5ILGA 4FC7A 3OA2A 2QG4A 1PR9A 1C3VA 3FF4A 2O3JA 2QHXA 2PZLA 3IP3A 3OP4A 4FPXA 4RQUA 2VHZA 1UXIA 3ZHXA 4DC1A 1KERA 1QYWA 1YRLA 3EZLA 2HU2A 3PVZA 2ZTVA 4Y6RA 4P22A 4GLOA 4XYMA 2Y0CA 1JAXA 4B4WA 4E5NA 4IIUA 3H8VA 4YRBA 1DLJA 4XYEA 4IMRA 5TJHA 4XDYA 2O3SA 5CP8A 4NIMA 2EKLA 1DSSG 5DULA 1LC0A 4B4UA 2G17A 2CDAA 3OJLA 3SEFA 1EFKA 2GASA 2RAFA 3TZHA 4HY3A 3BHJA 3RU9A 3JQGA 1CQJA 4XWYA 1VJ1A 1LQTA 4OQYA 1PR3A 4DGSA 2D59A 2D2IA 3E18A 4PLTA 4HUJA 1NWHA 1QG6A 1MLDA 1QMGA 3GZ4A 4AJLA 2WMDA 3LZ6A 1ARZA 3Q6IA 4PLPA 3RJ9A 1Q7GA 5HTOA 4TRNA 2IZZA 5KJ1A 1GZ4A 4RVHA 4ALKA 2VTEA 5ENVA 1J5PA 4RPLA 4C7KA 1ZK0A 2GCGA 3CZRA 3AI2A 3SJUA 1LJ8A 4XR9A 3RI3A 1DXYA 4WE3A 4GI2A 2VHXA 2VRCD 3VKVA 1X1EA 1E3WA 5EERA 2PGLA 4DQXA 4JK3A 1X7GA 2X4GA 1PZFA 1XSEA 3BXXA 2GD1O 4NU6A 3ROPA 5ITWA 1YL5A 5JLAA 1IZ9A 3TL3A 2EJVA 3H9QA 3U5TA 1A9YA 2J5QA 3ZGYA 1LRKA 1LSUA 2DKNA 3HDYA 4L0QA 4A5OA 3HG7A 4CMIB 4CM8A 4DIFA 1P31A 5F1PA 2JAPA 3A9WA 3OBBA 4DC0A 1B7GO 3D5TA 3DZIA 4XR4A 3S1LA 4CM9D 3TQHA 3O03A 1CQIA 3I9JA 2VHYA 3LT1A 1WDMA 3MJVA 3RQSA 2Y93A 1C14A 3AU8A 3H6KA 2FPGA 3ONFA 1T1SA 2O3UA 3SC4A 4IGEA 3IJPA 4UEJA 4IDDA 1BXKA 9LDBA 4FQ8A 3PWZA 3AI1A 3RWBA 3GZNA 3G0OA 4OKNA 4BVAA 4BGUA 4HXYA 5J23A 3UFXA 2HCTA 4CMBA 2Y1DA 3GN2A 3FWNA 4H16A 2ZYDA 2RIRA 4J49A 2JCYA 3Q3CA 1E5LA 4ZRNA 4CUJA 2YV2A 2Q49A 3EHEA 2HRZA 2C82A 1OBFO 1Y6JA 2FSSA 2YW9A 1Z7BA 4NJMA 2IZ1A 3DMYA 3NEPX 3BHMA 1A9ZA 1Q1NA 2Y67A 3ZI0A 4BIIA 3O26A 5EINA 3D64A 3IUPA 4MDHA 1ZNQO 1AE1A 1DFHA 1PS0A 2WE7A 1HDCA 1J4AA 2WD7B 1HLDA 1E7SA 4U6QA 8ADHA 4MOWA 2IEBA 1ADFA 4ZQHA 5JE8A 4M1QA 3JYLA 2DVMA 2DTXA 4BV9A 1W0CA 3PIIA 1PQUA 2NVUA 2GPTA 1P1JA 5EPOA 2YV3A 2QX7A 4U8GA 3PWSA 2BH9A 1WP4A 3OETA 1YB4A 4EUFA 1B8VA 5DCWA 2PD3A 3I9LA 1BG6A 3O8QB 4LRSB 4MVJI 4GGPA 2R00A 1R66A 4J2HA 5ITVA 3BMOB 3DZFA 1NNUA 3V1YA 1GZ3A 1YB1A 4E6PA 4M8SA 3F1KA 1T2AA 5C7LO 5T64A 1E3JA 5AXAA 1N7GA 1PWZA 2HAEA 3WTCA 4JN6B 2VRCA 1E7MA 6ADHA 3VAZA 3WNVA 4HFMA 5KJEA 5TQVA 2AA3A 2AW5A 4HNHA 4EJ6A 3EMKA 1HSOA 1AGNA 1N92A 3WLFA 4AJ1A 1VC2A 4Q3AA 3ONEA 1W8DA 4R68A 4BS9A 2DFDA 5B37A 4PLGA 3LYLA 4JIGA 1LU9A 4OO3A 1DOHA 3CIFA 2HK8A 1HE3A 1O0SA 4FFNA 5GZ6A 3DZGA 1DC5A 2NU9A 1UZMA 4YB8A 1NTOA 3OQ6A 1H9BA 2O7SA 4E4YA 1EUZA 3KYDA 4CPDA 4ZQGA 4FJ1A 2JFHA 1Y7TA 3WGYA 2PGDA 2VYVD 2NQ8A 5IDXA 1GYPA 3I9OA 3CMCO 2TMDA 4CM9A 4EJMA 4GWGA 4UEKA 1T24A 4FN4A 2JKVA 4N5NA 2GNAA 4RLSA 3RUHA 2HLPA 4B4OA 5JAQA 5BNIA 3SJ7A 1T1RA 1GL3A 1ULUA 2UAGA 4RPHA 3MZ0A 1HXHA 1X7DA 4E5MA 2ZCVA 4JP2A 4NBRA 3RBXA 3GVIA 2C5AA 1QYVA 4IINA 2V65A 4UULA 2B35A 1IHYA 2VUSA 4D7AA 1HE2A 5JYEA 4QECA 2XF8A 2W2LA 2NM0A 4L4RA 3H5RA 1HYEA 1K2WA 3IC5A 5G2OA 2FZWA 4DMLA 2B69A 1HTBA 1MUUA 4I8XA 2NACA 1ISMA 1I24A 1L1FA 4RJTA 3ZW9A 1ONOA 1QRRA 2NTJA 4AJ4A 4CMJA 4EYEA 3ZU3A 1EK5A 1KBZA 5CDUA 1BGVA 2P9GA 1KIFA 1HZZA 3E48A 4WGGA 5F21A 4AJPA 4J4BA 3FCOA 5LDHA 3RCBA 1JW9B 4E5PA 1H94A 3ASUA 1KOLA 3H9GA 4OGWA 2C20A 4WNCA 4CLEA 4BV8A 1LA2A 4ZQBA 1N5DA 4CL8A 3ROMA 1HSZA 3HDJA 4FJ2A 4PG4A 5BSEA 1O89A 2BI8A 4TZTA 4JJIA 3WYCA 3KHUA 3HDQA 5K6AA 4GMFA 4B3IA 2WDZA 2A4KA 1YJQA 2DPGA 1C0PA 1FDWA 4AJOA 3DBRB 3H3JA 3GGPA 4OQZA 1IHXA 5C5IA 1VM6A 3MTJA 1WXDA 4QT0A 4R9SA 2Y1CA 1U5AA 2OORA 1OFGA 1T2DA 1YH3A 4DIOA 5EN4A 4EUEA 3L4BC 4L4SA 1DIGA 1PJCA 3JD3A 1EVJA 2BMAA 3H2SA 4B79A 1PZEA 1UDCA 2I65A 5CDGA 4CMIA 3AY6A 4G5HA 5A5FA 3QVTA 5JDCC 1EQUA 4A0SA 3WGIA 3LF1A 1DIHA 4PLWA 2ZKLA 2VYNA 3ADOA 3M2PA 4I5DA 4DA9A 1TT7A 4GH5A 1X0XA 1ZH8A 3IDSA 3QA9A 2NUAA 4BNJA 1P0CA 4UEOA 3PYXA 3NDIA 3RU7A 4RPGA 1RWBA 3FNEA 2J3HA 1ZJZA 2GDZA 3Q11A 1HF3A 1XGKA 3LT2A 2B37A 3W4JA 3WBFA 4RZHA 1NQOA 3CINA 3I1JA 3INGA 1PJ3A 4NI5A 1UXHA 4KDFA 1S6YA 3W1VA 1JTVA 4IQGA 4Y6SA 3TFQA 3B1JA 4BL5A 1P1FA 2ILTA 5COQA 1UAGA 4NQZA 1KC3A 3RUAA 4ALLA 5JS6A 3CPSA 1R0LA 1SZJG 2FWMX 4RGBA 1KEWA 4AJHA 1H6CA 3MWDB 5FWNA 1I3MA 2DBZA 4CR7A 1YQXA 3Q0EA 2VWQA 3PIDA 2VZ0A 2DTEA 4AVYA 3AUUA 4DYDA 1HDGO 4L9RA 2I5PO 3JV7A 5CEEA 2BRUA 4P38A 3QV1A 1Z82A 3DOCA 4BNNA 1PL6A 3K5PA 5H81A 1EEHA 3OIDA 1XYGA 3GDOA 1D8AA 4GMGA 3HB4X 4FGSA 3FNFA 4ILKA 1CDOA 2SCUA 4IQ8A 2B4TO 2PKQP 4CLDA 1KEVA 4RCVA 4Z9FA 1Q0LA 2PKRA 4OL9A 2OXIA 3RBZA 3O8QA 3ENNA 1H0KA 4MVJD 1ZZEA 3EY4A 3W8FA 1X14A 1ZEMA 2GN4A 4TSKA 1BHSA 3BMOA 3GC6A 4R51A 1H2HA 2PA3A 1DHRA 1UDAA 4CMEC 2BGLA 4BNZA 3N58A 4OOEA 5HS4A 3VH4A 4E13A 3V2HA 3VKUA 3RFTA 1EDZA 4Y9DA 3ON5A 5JO9A 5T57A 2UUPA 4WUVA 4NFSA 5A9SB 1O8CA 4GQAA 1ZSNA 2FR0A 1YJ8A 3DO5A 3PLNA 1ENOA 1NR1A 1KC1A 1QYDA 4OHUA 4PG6A 2AQHA 4F6CA 1GFSA 1QSGA 1ADGA 2YYYA 1LXCA 5IAAA 1WDKA 2NWQA 5JYDA 3U4DA 4YDRA 2GUGA 3UICA 5HBRA 4AJJA 4NFYA 4OXKA 5JNLA 2RBEA 3A28A 4Z0TA 5A3JA 2PV7A 3NT4A 1XQ6A 3FTNA 5T8KC 4N5LA 3VPGA 2UV8A 1YBVA 4R3WA 1RM4A 4I9UA 3BMCB 3AU9A 1GCOA 1DBVO 5L95A 2GERA 3WIEA 4BO2A 3PYMA 3RKUA 3D3EA 4D46A 1U1IA 1UP4A 5FFFA 3VH2A 4LW8A 4LGVA 2HJRA 1H93A 3S55A 3TDKA 3AUSA 1B14A 4D3DA 2HDHA 2V6BA 4K28A 5BNFA 3L07A 2FZEA 3E5RA 4W7IA 1XU7A 3P2OA 5MGBA 1C0KA 2E6UX 3W6ZA 1X0VA 1U2DA 5CHEA 4AJIA 4DQVA 1XU9A 3U4IA 1GQ2A 2Q99A 2JHFA 1L7DA 4WEOA 4J2OA 3FHLA 4BNMA 2E49A 1I36A 1PJSA 4J4TA 1XIVA 2E37A 1TI7A 1JN0A 4XGNA 4KWIA 1YWGO 5CG2A 2HQ1A 3CUKA 2WWRA 3GRKA 2NLOA 4GX1A 2CD9A 3QQPA 2JJYA 2EV9A 3FR8A 3W4IA 2VUUA 2PLAA 1BXGB 1WMAA 1E7QA 1A7KA 1GR0A 2Y0DA 3U4CA 3PPIA 3EYWA 4MO2A 9LDTA 3JQ6A 3Q2KA 2V7PA 2PNFA 3KV3O 3HB5X 4A2CA 3GR6A 3ZWCA 2H5LA 4AJEA 3HJAA 3TF5A 1H6DA 4YTEA 2YFQA 3SVTA 1SCUA 2PKQO 3W8EA 2EGHA 4XX0A 4D3FA 1XA0A 1I2CA 4XQ9A 3A14A 4KUHA 5KVCA 3BMQB 3TZKA 2IXAA 2C2YA 4E0BA 2JFGA 3GAZA 1SEVA 1ID1A 4YACA 3GEMA 2NVWA 1MP0A 3PHGA 1T4BA 2IEDA 3PJFA 4CM7A 1E1NA 4N5MA 4TVBA 3RUDA 1DIRA 3WLEA 1HETA 2ZB3A 1MG0A 5I8ZA 1YQGA 3GUYA 2ZYAA 1Q7CA 4TROA 1E1KA 2J5RA 2C7VA 4FFLA 2GSDA 2NU7A 2PK3A 4W6ZA 3WS7A 5CG1A 1D4FA 3U09A 3IP1A 1P9LA 5FI3A 3PTZA 1BSVA 5LC1A 5JFOA 5A04A 1JWAB 4BO8A 1H5QA 2OMEA 4BNXA 1AXEA 2ZQZA 2B4RO 4L4XA 4CMGA 1P45A 1KYQA 5L9AA 1O94A 1LSOA 1EDOA 2PZJA 1F8FA 1KS9A 5A06A 4CR6A 4ROSA 1TVEA 3S2FA 2WYWA 1T2EA 3JQ8B 2P91A 1LDEA 2EP7A 2I9PA 2J8ZA 5L7WA 4FR5A 3NTOA 3U49A 2QRLA 2D3TA 4FOOA 2OZPA 3F6YA 3RFXA 1NFRA 3GVPA 3L6EA 3ZWMA 4XIYA 2GRAA 3U3XA 2OP1A 4OSOA 3G17A 4TQGA 4KUEA 1PS8A 3NGLA 3JQBA 1Q0QA 1U3TA 3HHPA 3M1AA 3F47A 4IJKA 1B0AA 3V2GA 4GX2A 4ALMA 3PI7A 1EVZA 4L73A 2GYYA 5EJ2A 2EKPA 2X5OA 3KLPX 1QV7A 3R3SA 3PHIA 4IM7A 2CZCA 5F1OA 4B8ZA 3ICPA 4XRRA 1K6XA 3ST7A 3WGOA 3WBBA 1HRDA 2NVBA 1PS9A 2EW8A 3JYQA 4JJGA 3IOYA 1JKIA 1HDXA 2VHWA 3DZJA 1C0IA 3BYZA 1XLTA 4A26A 4G65A 4D43A 1EUDA 1GQQA 1YQDA 4Z6KA 3L9XA 1PJQA 4BKUA 5AXCA 1BDMA 3BIOA 2VZ8A 5ER6A 1U3VA 3L4BA 4AL4A 1SBYA 1TEHA 2P68A 1B3BA 5G4KB 5MDHA 4DYVA 3NTRA 4M87A 2WEKA 3AWDA 3UF0A 5JDCA 2HO5A 4Q3BA 1MG5A 2EERA 4YEDA 1KVSA 1I3LA 3C8MA 1M76A 3PJDA 3PZRA 1DRWA 1MFPA 4DLAA 1I33A 2Y0EA 1SO8A 4D0RA 3TJRA 1VRWA 4FW8A 3AI3A 4D44A 1JU9A 2O23A 3EW7A 3H9EO 5A9SA 1DLIA 1ORRA 3ZU5A 1PQPA 5COBA 1KETA 1SEPA 4LCJA 1E5QA 2G76A 3UGKA 4NK4A 1BDBA 4TWRA 1YS4A 3OICA 3H4VA 3NKLA 5KVSA 2AMFA 3AOEA 2X9VA 2Q45A 1F06A 4KOAA 1YXMA 3INTA 1OMOA 4DWVA 2Q1UA 2I6TA 1PTJA 4FCCA 4NBUA 3VPFA 2BFAA 4YT2A 2EIHA 5KJCA 1X1TA 4ZGWA 5A4DA 3KETA 1XELA 2AEFA 2VTDA 5BR7A 4IDFA 4IMPA 1R4NB 3Q9NA 3AM5A 3BMCA 1Q2XA 3HN2A 5KNLA 4LN1A 2I3GA 5L45A 3D1LA 1GADO 1KEPA 1T25A 3FN4A 1BW9B 4CODB 2RHCA 3NX4A 1Y1PA 2DT5A 1TB4A 4IQ0A 1YKFA 3DEYX 3LVFO 4ND2A 4BB6A 5IZCA 3LQFA 3O4RA 3DWFA 3FR7A 3NUGA 3ONDA 2O3QA 3CMMA 1KVRA 5DCUA 1BXZA 5COAA 3WIDA 4R9RA 3OJ0A 1N2SA 3WMWA 3M6IA 1ISHA 2FP4A 2YHIB 5JAIA 4HX5A 3K30A 1RPNA 2UYYA 3OSUA 1V9LA 2EHDA 2X0RA 3DQPA 4IUYA 3R1IA 1N1GA 4WPGA 5ER9A 3DTTA 3PHHA 1UXJA 3F3SA 3ETEA 4B3HA 3OMLA 3I9NA 1PEDA 2F1KA 2DFVA 5A3VA 1FXSA 3DMTA 4L76A 3WQQA 2Y1GA 1P77A 5TRTA 4YYZA 3JD1A 1XCBA 1R16A 3T7EA 4CMEA 4MIOA 4DL9A 1BXGA 1I32A 3Q9UA 3VDRA 5HM8A 2EJWA 3ETDA 4R69A 2IODA 1Y5RA 1HDYA 1WLYA 3GVXA 4ZQFA 2D8AA 1H2BA 2Q1TA 4Z0HO 1GAEO 1LLCA 1NFFA 3E9MA 4U0JA 4UVHA 4YQZA 1NX6A 3X2FA 1EFLA 4J7UA 4A10A 1YB5A 4W9NA 1P1RA 1QYXA 2X9NA 1OAAA 5GZ1A 1DIAA 2ZJ1A 3MJTA 4QEDA 5TS3A 3QLJA 1PJTA 3K2BA 2X22A 4NU5A 1VL6A 3BMQA 4BO6A 4J4HA 2LDBA 3WMXA 4M54A 1SNYA 4OXNA 4FJ0A 4YR9A 5F5LA 1DRVA 1VE9A 3CE6A 1E77A 4ND3A 5T8KA 5B4TA 1XR3A 3F5QA 3HSKA 2CVOA 1GU7A 2X6TA 3SXPA 3UVEA 2IZ0A 2V6MA 5G0TA 5CFZA 3VPXA 2O3RA 2JAHA 4LK3A 4DTIA 2BGMA 1K6JA 2C0CA 4ALIA 1T2CA 4MINA 3DAGA 4U5QA 4HP8A 3DAFA 2CF6A 1E3IA 2W98A 4IS3A 4BNVA 4BNIA 4CLXA 2PTGA 4ND4A 1GY8A 4I5GA 2J3JA 2X9GA 4MVJP 4UVDA 5EQDA 4R5MA 4PRKA 5KKAA 3GMSA 3JQ7B 3UCXA 3TNLA 5JC1A 1ZVMA 3JQ8A 4ZICA 7MDHA 2DUWA 5BSHA 1AHIA 4XRGA 4RZIA 3QJ5A 1P1IA 3DL2A 3ICCA 1YBAA 5H83A 1YONA 4YXFA 5KVVA 1I01A 3PGJA 1JAYA 3GFGA 3S8MA 3MWEB 5L4LA 2Z1NA 2VRBA 1EE9A 3NDJA 4GKBA 4OSPA 1SAYA 1NR7A 2JHGA 2NTVA 4ZD6A 4MP3A 1V0JA 4MIYA 1B8UA 1DB3A 1HT0A 2IE0A 3AOGA 4KP7A 3WICA 3DOOA 3GNTA 3VPHA 4XGIA 4NMHA 5TX7A 2D5CA 4O59O 3I52A 4PG7A 3U0BA 1PZHA 4JXKA 2J6IA 4YRDA 4LCEA 3EVTA 4R01A 1FK8A 5A03A 2GZ2A 2VCYA 4JROA 3UAGA 3VDQA 3WJAA 4KQWA 5DNAA 5L53A 1BTOA 1H6BA 5G4KA 2OHXA 2A9FA 4ITUA 5G0UA 1HZJA 3B70A 4IBOA 4IZIA 1A5ZA 2Q46A 2CF5A 1SB9A 3O9ZA 3VTZA 2P5YA 3AUAA 3VZPA 4OJNA 4Z9YA 3JQ9A 4TRMA 3I83A 4BNWA 1ZXLA 3WX0A 4F45A 3ZWOA 1OZAA 1WDLA 2ZQYA 3OM9A 1DAPA 4DPMA 2Y05A 2P9EA 4RF4A 4WK6A 4R16A 1Y9EA 3RFVA 3KLMX 4FBGA 4CM5A 1EQ2A 1NASA 3LT0A 1EZ4A 3VZRA 4EEZA 4JGBA 2DM6A 4OIMA 2JD1A 4WECA 3MJSA 4TVOA 3KSUA 1GQYA 5JPIA 4BO0A 3WGTA 3JQFA 2VZ9A 2GZ3A 4MVJE 5DZSA 1PGOA 5KWEA 4KUGA 4YJDA 3KZVA 3SLGA 2YQ4A 1DRUA 1PJ4A 3WGGA 3IJRA 2O50A 4E31A 5B12A 3GG9A 2DUUA 3E9QA 4HWKA 2HKIA 4WOKA 5JDIC 1R4NA 4S3MA 2ZTUA 1JWBB 4G81A 4GVLA 1F12A 1M2WA 3EUWA 3VZSA 1D1SA 3C85A 5I7FA 3DBHB 1BW9A 3ITKA 1PJBA 1P1KA 5HRUA 2GO1A 4BNKA 5JAZA 4YCAA 1R4MB 2HK9A 2WD8A 2X23A 3A1NA 3R3JA 4B7XA 4E2ZA 4B7UA 4BO7A 4ZA2A 2UVDA 4YQYA 3ZN2A 2BD0A 1QLJA 3OH8A 4LISA 4BO9A 1EMDA 4RVDA 2B0JA 3MCVA 4JX8A 1JA9A 3DFUA 4EBFA 3WGZA 2YDXA 2YHIA 4PVCA 2NU8A 3UUWA 3OHSX 3UH1A 4DPLA 3L4SO 3QSGA 4KMSA 2X0IA 3ZNNA 1VSUA 2X5KO 4TRRA 4C4OA 4DIBA 4UUMA 3FNGA 2EGGA 2BI7A 1MC4A 3I6QA 2OO5A 1ZK1A 4CMAA 1YVEI 4WLUA 2C54A 3G3EA 4NHEA 3R0IA 4GKVA 4EI2A 2YJZA 2AG8A 3A06A 3R6DA 2O7QA 4GAEA 2DQ4A 4IZHA 4WJZA 3JQDA 4I5EA 4K26A 5AQ1A 5TLSA 1NYTA 5DOZA 3L0DA 1XQ1A 3LC2O 2PZKA 2CFCA 1DPGA 3K31A 1ISGA 4OXYA 1UDBA 3LC1O 4M89A 1I10A 3OECA 3Q1LA 4TKMA 2W8ZA 4MVJG 1MX3A 3HNPA 4RO0A 4YAKA 1NPTO 1R15A 5JC8A 2XXBA 5ES3A 1MV8A 3EVNA 2YHUA 1ZIDA 3PQFA 5H82A 3VC7A 1XEAA 3S2IA 2UDPA 4BO5A 5I9LA 5L4SA 1XKQA 3DZHA 4L8VA 1VJTA 2PH3A 4GPD1 4R5HA 1J6UA 3NDRA 3WSWA 3KBOA 1LSSA 2VYVA 3DAPA 2ZJ0A 2QIOA 3OJFA 4N7RA 1ML3A 1XWFA 4E21A 3JQEA 3DDNA 4DRYA 3STHA 1RM3A 2OBNA 2OP0A 3KYBA 3BTOA 1GPJA 4IXTA 5TC4A 1Q7BA 1KEUA 4Z3KA 1GDHA 4XJSA 3W6UA 1P74A 1PGQA 1ZKMA 4WEQA 1YDEA 1V35A 1OI7A 2CNBA 3IAHA 3JQ7A 4K6FA 4AFNA 1VKOA 4KQXA 5G0VA 3X2EA 5EIOA 4XDZA 1E6UA 3GFBA 4LRTB 2Y68A 5DBFA 3WSVA 2WD7A 3D3WB 4IY1A 2NADA 2VWPA 5CPFA 3VZQA 4A73A 1GPDG 4U0KA 1ZXBA 2FOIA 3JD4A 4QTZA 1DJQA 3JD2A 4IIVA 1Y8RB 1E6WA 1NPYA 2BFOA 2P2SA 3K8ZA 3LF2A 7ADHA 4CMKA 5F5NA 3OQBA 1IB6A 4I1IA 3HFGA 4CV2A 4D41A 5A02A 2HMTA 1R0KA 2PR2A 1SPXA 3LLSA 2CVQA 1ZSVA 3EDMA 1W6UA 2Q3EA 2VT2A 3H5NA 3HZZA 1P44A 1NPDA 4BNLA 1XHLA 1E3EA 1DHTA 2W90A 4UVEA 1E7RA 2GGSA 3H3FA 3F5SA 5CDTA 4KWHA 3WYBA 3JYNA 2YDYA 1Q0HA 4NNJA 1L7EA 4I9HA 2O4CA 1PGNA 5TT0A 2EKQA 1I0ZA 3TSCA 1IOLA 3UN1A 1I5RA 2FY8A 5AOVA 1U9JA 3LLVA 3B6ZA 2BELA 3FRJA 1G6KA 3WGQA 2FR1A 3ZHYA 1YBMA 5KIAA 4Q3EA 4UAGA 1PX0A 1KVTA 3QWBA 5KJFA 5AVOA 3VH3A 2IDZA 3IUSA 3KOUA 4PLCA 4QSMA 4XYBA 4E30A 3D0OA 1LX6A 3K92A 5THQA 2CDCA 3COSA 2B5WA 3EZYA 4WOJA 2J3KA 2OGUA 1B2LA 4WLOA 1SOWA 3SX2A 4BNHA 1FDTA 1FF9A 2QRJA 1DDOA 4WCFC 1ZW1A 4YVFA 2P4QA 4CM6A 4HADA 2PWZA 1WZEA 4NK5A 4GBJA 3RVDA 1MGOA 1B16A 1U7HA 2I76A 4I5FA 2FPIA 2IYPA 4K1LA 3GVCA 1XDWA 2Z95A 1E7WA 1A7AA 4GL4A 5TT1A 1GCUA 3WDSA 1LUAA 5C37A 1BRMA 4FSHA 1CERA 1WMBA 4M86A 3DBHA 3QIVA 1NVTA 4O6VA 3DXFA 3F4LA 5KOIA 3K73O 2D4AA 1SB8A 1W4ZA 3GDGA 1R4MA 3KYCB 4JBGA 4E3ZA 5BSFA 1E7YA 2V6GA 3KSZO 1HLPA 4BB5A 2HJSA 1A72A 4MJLA 1ZEJA 1U4SA 4J91A 4R4JA 1QKIA 2CUKA 3AFNA 1CIVA 3ZWWA 3GPIA 2H6EA 4Q39A 3UHAA 3KEQA 4ALNA 4UVIA 4GSKA 1KY5A 1EBFA 3I4CA 4LMRA 5IDQA 3ZZNA 4NBWA 4IJWA 2VT3A 3HDHA 1FDSA 3VTFA 3GLQA 5JMPA 1Y5MA 2NV6A 5CEFA 4B7CA 1I3NA 3MOIA 4BKOA 1DFGA 2J5KA 3I5MA 4PN3A 4ONEA 3PHLA 3CXRA 5L7YA 3U62A 1YL7A 3MJCA 3DBRA 4CV1A 1CJCA 4MVJA 1P1HA 1AUPA 3PP8A 2GZ1A 4BUCA 2FHSA 4J90A 4MKZA 1U5CA 1PU2A 4PLZA 2JD2A 2NSDA 3CEAA 5DT9A 1LTHR 3FWZA 3ANNA 3HWRA 3OA0A 1P0FA 4YJHB 4ZJUA 3WB9A 4PG5A 4D3SA 2B5VA 3DHEA 2R00C 3CTMA 3OJOA 2DTDA 4WCFB 1YE3A 2D1YA 1P33A 1YGYA 1EUCA 2BLLA 1HWYA 5IF3A 1ISJA 2A35A 4PZEA 1CF2O 4H7PA 1J49A 1ISIA 1B3RA 4L75A 4XJTA 5IZCC 1PQWA 4DLBA 4EITA 1BMDA 3TOXA 4BKPA 4TMFA 5JDIA 4E2XA 4RVUA 3BA1A 1YL6A 4ZHSA 1N1EA 4PIVA 1I2BA 1WZIA 4YWJA 4IJUA 2H1SA 1Y9AA 1G0OA 4QFCA 4EW6A 2J3IA 3P2YA 2I67A 1NQ5A 4MP6A 3FI9A 4KTTE 5B1YA 3D4OA 5B4UA 3GRPA 4D0SA 2E82A 3DONA 4OM8A 4BNUA 1MC5A 3PDUA 3GUCA 4OKIA 4XKJA 3QVWA 2CVZA 2P9CA 4PRLA 2I99A 1MB4A 3KO8A 1D1TA 4J7CA 1LDNA 1R37A 2CMDA 3EGOA 2C59A 3GEGA 5DF1A 1TA4A 5JSFA 2YV1A 4FIZA 1LLDA 3OEYA 3C24A 3D3WA 4BKQA 1BVRA 1B15A 2XPCA 3RC1A 3JYPA 5EESA 3ZWBA 2BF7A 1OC2A 4R54A 1Y8RA 3GF4A 5DBGA 3E03A 3PWKA 3WFJA 1Z74A 5TNXA 2VOJA 2A92A 3GEDA 2X0NA 1GUYA 1ONPA 1C1DB 4J3FA 4CLRB 2Y1OA 4JNKA 5CEJA 2GF2A 4IDAA 3T7CA 3AM4A 4II3A 3L6DA 2W2KB 4FD3A 2Y1FA 3FPCA 4GX5A 4W82A 3VVBA 4CLOB 4JLWA 2JFFA 1QXSA 4PLVA 1LC3A 3QHAA 1EE2A 2VN8A 2WJPA 2GN6A 1B8PA 3GGGA 1OOEA 3ZV4A 2RCYA 4EJ0A 1PSDA 4AG3A 1U28A 3K9QO 4YAIA 3QWIA 3FNHA 3PFFA 5T5QA 2ZK7A 3PZBA 5EL0A 3PK0A 5IJZA 4YAGA 2G0TA 2Q1WA 2PY6A 5I8WA 1IY8A 3MOGA 3B20A 4PFJA 2GN8A 1UAYA 4UUPA 4O1MA 1FDUA 2VNAA 1T2FA 4J0EA 4NG5A 4XB1A 4MKRA 1PL7A 1CEQA 1Y81A 2FMUA 5K6AC 3PJEA 4DQUA 1LEHA 1B26A 1J0XO 3Q2IA 3WOHA 2CDBA 3GMDA 1M6WA 3C1AA 4I9NA 4E33A 4P4GA 3AM3A 3OJEA 1O5IA 1ENYA 5I7SA 1AXGA 3ZWXA 1K89A 3WR5A 2X86A 3WG9A 3WWYA 4AJKA 4TKLA 1CETA 1NWCA 3TFOA 1DIBA 2ZCUA 2IRWA 4RVFA 3MTGA 3ADPA 2PZMA 1IZ0A 4K6CA 4J16A 2X8LA 3ZV5A 4RPJA 4S1VA 1K5HA 4DLLA 1GEGA 3OEWA 4N18A 1NVGA 1ENZA 1NBOA 2I66A 3CSDA 3DR3A 3NRCA 4Y6PA 4BNGA 1O95A 1YOVB 2YFHA 3H7AA 3ENKA 1KVQA 1LRJA 3JD0A 5L4NA 2NTNA 2FRDA 3WQRA 2DBQA 4XEHA 4D42A 1XG5A 4BMNA 2EXXA 3KYCA 2QZZA 4XCVA 3WNQA 3IIEA 4BGVA 3QVOA 4XQCA 4PZCA 1U8XX 4LSMA 3GDFA 2R6JA 1ONNA 4MVJM 1ZFNA 3W4KA 5THKA 2Q4EA 1Z75A 3RSHA 3N7UA 4YBZA 4FB5A 4W7HA 3U9LA 1DJNA 1F8GA 3JSAA 1ZUD1 2D5AA 5FYDA 5ILOA 3HE3A 3KM0A 2QQ5A 2DAPA 2EG9A 5DOVA 3BMNB 5DCYA 5BT9A 2Y1EA 4XQEA 3T4EA 1IE3A 3V2UA 3F9IA 1VLLA 4J1SA 3GNSA 3G1UA 3PGXA 5TJ9A 4WLVA 3M2TA 4II2A 4B3JA 3BAZA 2OBYA 3MJ4A 4W4TA 3ITDA 1IPFA 2C5EA 1PJ2A 1ZSYA 2Q2WA 1H9AA 2VOEA 3L9WA 3QY9A 4XD2A 1I8TA 1UXGA 4HFNA 4PLHA 2V6FA 3I9KA 3ZU4A 2R2GA 1LLQA 1JVSA 3WXBA 4R41A 3ZH2A 2ZTMA 4L74A 3GOHA 2OL4A 2O4UX 4E2YA 4OAQA 1V3VA 1VKNA 2WYVA 4YJHA 5FI5A 4NPCA 2QW8A 2VQ3A 3FBGA 5B4VA 3IKTA 1UP7A 2EF1A 4Y8VA 3ANLA 1RYEA 3QVSA 4WCFA 1HKUA 4IPTA 5BNTA 2XAAA 2AQKA 2BHLA 4BMVA 1GV0A 1UUFA 1TLTA 3RUCA 1A27A 3ZU2A 4BGEA 4BMSA 1E6EA 2HRBA 2TMGA 4OOFA 1MFZA 4JJFA 3B1KA 4FFOA 2VHVA 5DP2A 4KTVE 1Z45A 2AE1A 3AY3A 4BO4A 3SLKA 3BTSA 1QYCA 3TOZA 3PHJA 1EVYA 1PGPA 2UUOA 4PLYA 5FEUA 1T4DA 2AE2A 1U8FO 3JQAB 4J7XA 3CZMA 3EAGA 3P7MA 3QP9A 3H65A 3ZHZA 4RQTA 4A7PA 2CY0A 4J9UE 4FFRA 1DC6A 3PJGA 4J0FA 1GYRA 1ADCA 5IDYA 4QO8A 4Z3DA 1AHHA 1G0NA 4AJ2A 3WYEA 4YPOA 1UJMA 4RF5A 1R12A 2W2LD 1IL0A 5FF9A 1R0SA 5I9NA 2Q2QA 4MVJH 3G49A 4RORA 4MPDA 1DC3A 1NXQA 5C7OO 1U2GA 3SC6A 3ZNQA 1LI4A 2XXJA 4MP8A 3OIGA 4ZVVA 3P5SA 3WTBA 1QLHA 1WNTA 2OUIA 4F3YA 3ZWAA 3ROKA 4YJFB 2IYOA 1IYZA 1NHWA 4IXWA 1DEHA 1LDGA 1Y8QB 1RKXA 1ZMOA 1VSVA 3NJ4A 4AJNA 2OFPA 1EBUA 1FDVA 1VJ0A 1QR6A 3RC9A 4EUHA 1N8KA 4WLFA 3UKOA 3TZCA 1C1DA 4CLRA 5LCXA 5CPBA 2PD6A 4H15A 4DUPA 1VL0A 4NDNE 4YT8A 2W2KA 4DXHA 4CR8A 2X1HA 3V1UA 4CLOA 1DAOA 4HFRA 1ADBA 4B8WA 1UZLA 5T67A 1LDYA 1ULSA 2WM3A 3SBOA 2FR8A 5G4LA 3TWOA 4Q3DA 3NT5A 1E1LA 3ZWPA 1T26A 1R6DA 4W99A 3V8BA 4XYLA 3ZHBA 1AN9A 1GEEA 3NV9A 3UXYA 2GR9A 1ZCJA 4XGKA 3GQVA 3BHIA 3CKYA 1NQTA 3H5AA 1ZJYA 2VYND 1LLUA 5G0SA 1GUFA 2JL1A 1IPEA 4DVJA 2EW2A 4RV9A 4CV0A 2VUTA 1E0DA 1EVIA 3GY0A 3ZWVA 4A27A 2C7GA 2OOSA 4DMMA 3HUDA 3JQAD 2HMVA 4XA8A 3GPDG 1M67A 5TIIA 2Q2VA 4AICA 3S2GA 3F46A 1V3UA 2EP5A 4E32A 5DBIA 2NU6A 3ANMA 2AHRA 4Y98A 1IUKA 3ZNPA 5IZ4A 4JP3A 4ZN6A 2WSBA 4QUKA 4RLHA 4YAJA 3KVOA 3AJRA 3O38A 3WFIA 1GZ6A 5A9TA 1SOVA 4BOYA 5U4QA 1YOVA 3RAJA 4FS3A 2ZIZA 2JCVA 4CJXA 3GHYA 3ZWYA 3IS3A 1PGJA 3JTMA 2WE8A 4WNIA 1HEUA 3NYWA 1NHGA 2B83A 4BGIA 3AK4A 4WLNA 1GUZA 5K0ZA 1EK6A 1CRWG 3OF2A 3ORFA 2JD0A 3KTDA 4DPKA 4PLFA 3KRTA 4CQLB 3EK2A 1M6HA 1Z6ZA 5C7IO 4EGFA 3V5NA 3NTQA 1GV1A 2BFMA 4CUZA 1NVMB 5I9MA 1I2ZA 1ZBQA 3L77A 1HYHA 2POQX 2QRKA 5ADHA 3I4FA 2P5UA 3C7CB 4LSWA 3VHRA 5L40A 3WQSB 4J43A 1YDWA 5JY1A 3DHYA 4OH1A 3RUFA 5CDYA 2W4QA 3BMNA 5DDIP 2HMSA 2O2YA 1A4IA 2DPHA 3I3OA 5G0WA 3ULKA 4M55A 3JQBC 3QE3A 3ZV6A 5JY6A 3LC7O 4U7WA 3H9JA 4OYRA 2RHRA 4DBZA 4O0LA 5L3ZA 2YQ5A 4YAEA 3UCFA 3MEQA 1D7OA 3D7LA 3UCEA 8LDHA 5GY7A 3E9NA 3C1OA 1C1XB 1QV6A 3JQCA 3RBVA 3AUTA 1LNQA 4FDAA 3QWHA 4BNTA 2QYTA 3GHHA 5EMHA 3FBTA 2C07A 3WGHA 4MIEA 4FC6A 5A05A 3PQEA 4CM3A 1GTMA 1BVUA 1WVGA 3DBVO 4LVCA 2HUNA 2D0IA 1LRLA 4FFPA 1LDMA 3KEOA 1U7TA 1ISFA 5IXYA 5I7EA 4ND5A 1OC4A 3T4XA 1TXGA 1MXHA 3GGOA 3G1TA 2ZB7A 3PQDA 4ZRMA 4D79A 4YT4A 2X7HA 3TZ6A 1ENPA 2GLXA 3TN7A 4INAA 4BQPA 4HV4A 2YY7A 5U9CA 3GA0A 3ROQA 1RM0A 3C3XA 4NFHA 4J1TA 2B36A 3VOSA 2BKAA 3RD5A 4CQMB 3U4HA 5TF4A 4NBVA 3DZKA 4EEXA 3UW3A 3JQAA 3ZW8A 1HE4A 5AYVA 2QZ9A 4PCVA 3A4VA 2AXQA 3D4NA 3AOEC 3NGXA 1DO8A 2RH8A 4Y67A 5JW6A 2LDXA 4ZQEA 3E1KA 4Z0PA 4LMPA 4WASA 2RH4A 2XOXA 2ZB4A 3HFSA 1F17A 4RL6A 4XIJA 3ABIA 1RJWA 4QFDA 4QX6A 1BWSA 1U4OA 3D5QA 1QP8A 3ZDFA 1VI2A 3GH3A 2AG5A 1C0LA 4JBHA 1JDJA 3IMFA 4CM4B 3FPLA 4TZKA 2G82A 3GAFA 4FFMA 3QRWA 4YJGB 1MA0A 5JCJD 4Q3CA 5CAEA 3JYOA 1E3LA 4YJFA 4X54A 3K96A 1P3DA 4RDIA 1Y8QA 1PWXA 1KY4A 3ZV3A 2Z5LA 1YO6A
chains in the Genus database with same CATH superfamily
1LQUA 2IYLD 3ESCA 1N7HA 4GGMX 4PVDA 2QYSA 5HKLA 3PPWA 3WLOA 4TRJA 4XJVA 2DC1A 1FS6A 1NQAO 2AEJA 3TI9A 4DSNA 3BCSA 2X58A 1I3KA 3I9MA 4OMUA 1EP2B 5IKEA 3PXAA 5BWNA 2DETA 5DGCA 3T5DA 3U1VA 2Q2NA 3WKAA 2ID7A 2PGXA 2PGJA 1SC6A 3P9KA 1QVAA 5ESDA 5JS8A 2DJIA 2ZYVX 3D4LA 1UC9A 4KCGA 4K9DA 4P7JA 3WYNA 4ZAGA 1GNQA 5HPYB 4MQ5A 2H9IA 4LJ5A 3JW8A 1CF4A 2BGNA 2IYSA 1P7ZA 4GOKA 1UMKA 4G2NA 4UBMA 1OAOA 4YH1A 4IGFA 1DCMA 1WAMA 3E7FA 3I01M 4R8SA 3PXXA 1DQSA 1IH8A 2B4QA 3PQCA 1RM5A 3FMOB 3LRXA 3A4TA 4CLHA 4EZEA 1DFIA 1U1FA 4M98A 5IT0A 3IKLA 2I3DA 4REQA 2Y6UA 3H1GA 3QVUA 2PANA 4WK4B 4F96A 5B7QA 1JA0A 3ZE1B 4HF7A 3RU2A 5JAMA 1E9RA 4BNYA 2IPXA 1ZM4A 1IEWA 1KVUA 1X8XA 1XD2B 3QXCA 3T3PB 1ZITA 3KXLA 2XWJI 5AW5A 3VHQA 4FSDA 4PG8A 1B6SA 3QVGB 1NJ8A 3HM9A 2O7RA 3S8EA 3F4BA 2WTEA 5H9VA 4TYNA 4CG3A 3DFIA 2FXVA 1N2IA 3O8OB 3QVXA 4HDAA 1QHHA 3ABOB 1VE3A 4B0PA 3PA8A 2EWMA 5K4GA 2Q3DA 2GF0A 3SOPA 1V8BA 2AFIB 4QYTA 5CTAA 3F7MA 4NR0A 4QXMA 4UEWA 3EPLA 1L8OA 7GPBA 2IZOA 4B4DA 1ZS9A 1VLHA 1G2QA 4WBNA 1K08A 1Q84A 2QPTA 3BRWD 4JB3A 4OUDB 1FC0A 1Z2PX 4QO7A 1J70A 2CXQA 1SUIA 5P8WA 3L93A 3Q98A 1AQJA 3W5CA 2EX4A 4KDEA 1SHZA 4Y9UA 4KFCA 1O2DA 3JZIA 3O21A 3KXDA 1OLUB 1A98A 3MLEA 4DY4A 4EA7A 2NW6A 3D4PA 1N2OA 4PFKA 1HE5A 3JQGB 3EXAA 1LSJA 3TJMA 3UO8B 1RAAA 1NA5A 4YAFA 4Z1MD 5DNUA 5TSDA 1OH5A 2PZBA 4DR5B 5ERGB 2V03A 2QD3A 3FXAA 5JECA 1B1CA 4JJ4A 4B3SB 4PINA 2VPXA 2AT1A 4LOHA 2L19A 3BSFA 4FFBA 4PZZA 5E1OA 3M3DA 4A8JB 3QLTA 3HFRA 4Q7QA 1JFTA 2O5VA 4BNDB 2WLSA 4LJAA 1WXHA 4GR9A 4Q7KA 3W2TA 4M3NA 3JVVA 4JL6A 2ODQA 1I6KA 1IN4A 3CIOA 4AZ3B 4YO7A 3KZKA 4IDGA 3THWB 3LUGA 1Z5NA 1CC1S 3KXKA 3NOXA 3AUFA 4RJKA 3R7DA 3UIEA 5KTKA 5JXWA 2GJKA 2EYQA 4CV3A 3TM4A 2O1EA 4XYGA 4GFDA 4FDUA 5JZ9A 121PA 1S01A 4HT3B 2JJMA 3FOBA 3JWHA 4B35A 2H1RA 5HQJA 1JSXA 1QO7A 4QFBA 2YOGA 4N54A 4M88A 1E2DA 2RI0A 5F4BA 4OX9Y 2O52A 2PTHA 3SOZA 3VH1A 5JIBA 4B6SA 2E21A 4DRZA 4AZSA 1PJLA 4EKIA 2DWPA 4HWTA 5BN3B 5K4AA 4KXMA 5F2NA 1GTG1 1YVUA 4QOGA 1JKMA 2BFNA 1SIOA 3KVRA 3DFZA 4R3NA 2HSGA 1YJBA 2OC4A 2PXHA 3NHSA 4Z9XA 3H87A 4CRWB 3QZUA 1Q0UA 3PGMA 4HZUB 5BYBA 1T6ZA 2ZYGA 5C81A 3A1FA 2OBBA 1GNVA 3I9V6 3TBFA 3G1WA 2IHYA 2FW0A 4KGXA 5K3FB 4L27A 3KB6A 4TWBA 4XLZA 3SYKA 3AIIA 4C43A 1NZJA 2Y92A 4UUOA 2PD4A 2P4HX 2TMYA 2ZTLA 2HCJB 3FETA 3IKVA 3W8RA 2FZVA 2HSDA 5CT5A 3DTYA 5FUVA 4OMCA 4YRPA 3WKDA 4W5QA 1KQNA 4NCJA 3ROGA 3V1TC 4JOSA 4QOEA 3RGGA 1G3RA 3T7KA 2BDTA 2R6GA 3THYA 4RTMA 1JKFA 2OHIA 5IPFA 1PD0A 4MSUA 3WSTA 1F8XA 1PT6A 4XGRA 5EMLA 1J0CA 3DT8A 1NAIA 4KODA 3W8DA 1DEXA 2EW1A 3O1JC 1WXQA 2EJCA 3SYLA 4NCHA 5HA5A 3KFLA 2GAJA 4BWVA 5JMWA 4Q1EA 2BYTA 1E89A 3GQBA 4CQMA 1M75A 1U6JA 4BEJA 2NXCA 2AG6A 5EKXA 3PEYA 4P7FA 3RT9A 1PZGA 3DD1A 3P9NA 5DHTA 3TPCA 3T5AA 5CIYA 3V8MA 2VJYA 1MGPA 3EIUA 1BE8A 1GSOA 4RYLA 4YONB 2OPHA 3ROTA 5JBIA 1IZZA 1Q1GA 2A5YB 3GBSA 4L72A 4FONA 4KZPA 1Q11A 3RM3A 1B4DA 1I30A 4NFLA 3NBMA 1JXAA 1UXKA 3FTPA 4KAJA 4E5SA 1XD8A 5AXBA 2XH8A 3ESBA 1F8UA 4ZVPA 4LWOA 5AVVA 1IXZA 3GT0A 1MRSA 2DMRA 4PAMA 4RIEA 2XCSB 4CGZA 3LFTA 4LS3A 3UUEA 5CK5A 2MSKA 4COKA 5KKNB 1RYHA 3B3GA 3GNQA 3NAQA 4KMMA 3RB8A 4CNQA 4X64B 4TUYA 2G8LA 1THMA 4TTSA 3BWYA 1QORA 3N2KB 2H5JA 3KE9A 4AC9A 4QYSA 2AJCA 4E12A 1FFAA 1DZIA 2IUTA 2B78A 4BTLA 4JOBA 4Q4LA 3ADDA 1X7HA 1A4UA 4R1NA 2XRZA 3CNBA 1A9PA 1RWKA 1ZD5A 2O2EA 5FHQA 3TL2A 2YJ3A 1T35A 4DLXA 3LQ2A 1XPJA 3U60B 1S9HA 5YASA 5JZVA 1L5NA 5C3MA 3F1LA 4OU4A 2NZ8A 2ODBA 2ZJAA 3D4BA 4U6SA 1Z5GA 1H9CA 2HLDA 4Q4JA 2Z43A 1W85A 4NULA 2YJ6A 3PFWO 1KYZA 3ECAA 1QPZA 2GAFA 4MJXA 1J8MF 1L7AA 1MEJA 5ABPA 1CUUA 4FHEA 1CIPA 2H07A 1VP9A 1ZD4A 4KN6A 4DIMA 2GQ0A 1TQDA 2FW6A 2FWRA 2QUBA 5D01A 2VDNB 3FZQA 6NULA 3L04A 3HKDA 1JJBA 3HDVA 1Z22A 2OG1A 2G40A 3VVCA 3PRJA 1BMQA 1QFMA 2NQTA 2YN4A 1CZRA 4L9SA 3E70C 2CB0A 3FTCA 3OZVA 2DHDA 3IUJA 3LDHA 3M3HA 5E4JA 4YA6A 1L7MA 1YI0A 4EW1A 3E82A 4TYWA 4ZO7A 3ICOA 2RGGA 3LUHA 2ETVA 3H04A 3ZI7A 3DB2A 1N9GA 4XUDA 1Z29A 5AK5A 4YV1A 5CDSA 3H5OA 3TIGA 1JLKA 4M9ZA 4P33A 3S4YA 4GPEA 4GBED 1DKPA 4BHTA 4BXOA 5BWLA 2PU7A 1JG1A 3MWJA 4XQGA 4BKRA 2NU9B 1O96B 2DU8A 3PICA 3TGLA 1FUUA 4UHDA 4NJOA 3VR6A 3H2ZA 1LK0A 3CLSC 3JZDA 3ULKA 4Z4HA 3C3KA 1R64A 3F3KA 2DBVO 3FD8A 2Q41A 5B7NA 3BH6A 3EC1A 1J5EB 1A69A 1U0RA 2YUIA 3OA2A 4FC7A 4UJ5A 3KNZA 1BQEA 4QDUA 5FV4A 1PR9A 2UZ0A 1JDBC 2O3JA 2QHXA 5DW3A 1ZRSA 2YFYA 3WO0A 5AR1A 5BSRA 1FFWA 3FYUA 4ZCSA 4HDNA 1H1LA 1BGWA 3EZLA 2HU2A 3PVZA 5KHLB 3RG2A 1KI7A 4C0LA 1ILEA 1L8LA 1OWMA 2PVSA 3AEXA 4B4WA 2ZIXB 1ODIA 4PU0A 3RNLA 4JFRA 3RJMA 2X0DA 1G8KA 4RETA 3A7DA 4HVCA 1SXPA 4PZ9A 3OM8A 4CF4A 1DSSG 4DV7B 2HQSA 5HDQA 3D43A 1JIVA 5HMMA 4DSOA 1Z6TA 2GHRA 2CW5A 1PJRA 2XUPA 3ENVA 1EFKA 3C6YA 3LE8A 3OZTA 4JJ6A 1CS0B 2WU4A 1RWOA 3CM0A 4Q82A 2R1UA 1YB7A 2VIIA 2W00A 3DKPA 2YMPA 5H4HA 4N76A 1P2UA 1G7RA 2QDKA 4YCSA 3O84A 1TKBA 2D59A 1H2YA 4HUJA 5KWVA 1NWHA 3WGKA 1C9DB 4PTYA 1W5BA 4AJLA 1AGPA 3RJ9A 3RK1A 1TTPB 4AUNA 1A4RA 1H2ZA 1ZN7A 2IT1A 3CT6A 5K0EA 1UK7A 3VU9B 2IZZA 1J20A 1UODA 1GZ4A 3P9PA 4RVHA 4H77A 1S5PA 1GWNA 3O47A 2IU4A 4K87A 2BRUC 4PWZA 4C7KA 2GCGA 4HNAB 3RYCA 2YH2A 2G9VA 4W6QA 4XR9A 4BZXA 3GROA 1RHUA 1MAWA 3HXKA 3TQCA 1X1EA 4OH7A 4Q7LA 2XUJA 1WUTA 1UDRA 1ZH0A 2PGLA 4KK4A 2CLOB 3DUWA 1X7GA 2CHUA 4JK3A 4Y2PA 3SKXA 5EJ7A 2DKOA 5ELXA 2V7BA 1QGDA 2FMFA 4GEKA 4LRXA 1COWD 4IGIA 4C06A 2C5GA 3VHLB 1QWSA 3FH0A 2K7ZA 3PCRB 3QBVA 1IZ9A 4O33A 3EFOA 16PKA 5K09A 2WJVA 4ZMBA 3E7PA 1WABA 4KI0A 1UAAA 3DEJA 5KTRA 1ID8A 1LSUA 5DN6A 3T5TA 2BFWA 2HIMA 2WJZB 3S7TA 4CMIB 3D8UA 1UBNA 1XMPA 4CM8A 2C77A 2PE5A 3ZDAA 5JALA 5JMTA 1XWIA 3A0RB 2WAMA 4HSEA 3O0TA 3BE4A 5HZMA 1B7GO 3D5TA 5TMBA 4BLRA 3OHMA 1L5VA 1TTTA 2M98A 3S1LA 3S28A 2QQGA 3KVNA 4CM9D 1GAXA 1CQIA 2GKGA 3BF7A 4J7AA 2VHYA 4Q4HB 1KARA 2I55A 1PRYA 2QW1A 3MJVA 5JATA 2ZSIA 3E5HA 3QVLA 4D8XA 1SVOA 1AQUA 1W93A 1U99A 1XTTA 1C14A 2VJCA 2W93A 2Y93A 4H7EA 3J80A 3ONFA 3KJIA 3NU1A 4L8LA 2PHZA 4NYMR 3EFBA 2F1HA 3UJPA 3BIXA 3NORA 4ZV7A 1Y3HA 5ELLA 1AA6A 3U7EB 1BXKA 2GPWA 3N2IA 5EZ6B 3U44B 1GLGA 1A1VA 4FQ8A 3PWZA 3AI1A 4Y2JA 4TVSA 4OKNA 4N3NA 5EQJB 5C4GB 1ZL2A 2CYBA 3P0EA 4YP9A 3WL6A 4CMBA 4A91A 1V16B 3R7FA 4Z51A 2JIQA 1YR2A 2WIFA 4XQ0A 1W0KD 2P78A 4J0GA 4ARVA 1Z4LA 1XZEA 1KPGA 2WVHA 2QN9A 2WZDA 3TSYA 1WBBA 1JRLA 4XTCS 5EI5A 1IVSA 1Y6JA 2FSSA 4NCNA 3WIBA 1NKTA 2JLWA 1X8JA 2BIFA 2C2BA 2PBRA 2IZ1A 2YY6A 3HU5A 3PF9A 4JUAA 3ZJTA 3U7FB 3GWGA 1Q1NA 3ZI0A 4UC0A 1Y8ZA 2X41A 1JECA 1V2GA 5E6RA 1ZNQO 1G9SA 3VGPA 5DYGA 4QBKA 3UYKA 2CXRA 1DKQA 4LV6A 8ADHA 1E7SA 5LBIA 1R8XA 4BCDA 3RHTA 3BQ9A 2EP8A 4MGEA 1RYMA 5EY5B 3K9FC 1T5IA 4NVRA 3X44A 5DYTA 1P1JA 4DWOA 3GEBA 5FNVF 1T0IA 1HORA 4GQIA 1IBCA 1X8KA 1X6VA 3PWSA 4R8KA 2BH9A 4W63A 2B0CA 3OETA 4YAWA 2RHOA 2SCUB 1I80A 3ABQB 1B8VA 1TFRA 4EEKA 4RADA 3UPTA 1XV5A 2JCSA 2A1UB 2AYZA 5DCWA 5TR9A 3QHPA 2V59A 3CCCA 4M2LA 3OLVA 5FL7D 3TMAA 5AHRA 5KX5A 3E9DA 4I36A 1W44A 4IDPA 4B3FX 4CCWA 2UYQA 2BISA 3ED5A 4ZEVA 2XA9A 1R4AA 4M8SA 1C8LA 4O4LF 4CI0B 4AY2A 3P45A 1WX1A 1T2AA 3MA0A 3MCTA 5C7LO 1P2GA 1GM5A 4EDHA 1TVKA 2DZDA 2HADA 2XUKA 2BI4A 2HAEA 4TMYA 1LB1B 5E9WA 6ADHA 4OM7A 2DLNA 1QP4A 3PNVA 3PUYA 3VAZA 1T36A 4QVKA 5HKAA 1OX5A 1OVGA 4JT9A 1N77A 5KJEA 1O8BA 1QG4A 2GA8A 1GGNA 2WIKA 4EJ6A 3E2PA 3KYJB 4X5OA 5AKGA 2ZBRA 4AJ1A 1VC2A 4ND8A 2BH2A 4HG2A 2I22A 2OZLA 3H5WA 3LYHA 2DFDA 3NI2A 3VUFA 1PFQA 5FTWA 5C2JB 3LYLA 2BE9A 5HFNA 4RTNA 1D5CA 2RKOA 2QMZA 5P21A 2HK8A 2OV4A 1HE3A 1O0SA 1Y48E 4FFNA 2FW1A 3NFRA 3DZGA 4UHFA 3TX2A 2ZUFA 2IY9A 2YXEA 3N28A 3R9IA 2CL6X 1PJ8A 1ZESA 1T13A 2JRCA 3SR4A 1VE6A 3HLKA 1GRVA 2V7QA 3JU3A 3D7NA 2JVIA 3OQ6A 1H9BA 4EFMA 4AO7A 3KYDA 4E4YA 2JGEA 2RHMA 4FJ1A 3WGYA 3MCWA 2PGDA 3K9NA 2OILA 1C3JA 1YZYA 2G4VA 5DLQC 4BVLA 4NYJR 2TMDA 3P4UA 4HX9A 2H52A 1XALA 1YVRA 4PN7A 4B6FA 3IFSA 4HWGA 1RBMA 1YR7A 5D3KA 1DT5A 4KOEC 4FP9A 3AKDA 3PF8A 3GI1A 1UJ6A 5B57C 2OGWA 4NE7A 5D5PA 4B4OA 4KX3A 1DOAA 4IGAA 1M74A 1SGWA 4RPHA 5TS2A 1TYCA 4IH1A 3QFFA 3DL0A 4E5MA 3DO6A 1DWUA 3HCPA 2ZCVA 2IS1A 2DWQA 3UXMA 2QENA 1CDDA 4G5YA 1GA1A 2FFHA 1XEXA 5IHPA 3WHKA 2DEUA 2HT6A 3WWDA 1U2RA 4G9BA 2GN0A 4XD7A 2ZI6A 3TRFA 2IYEA 2VUSA 3K4QA 1W36D 3GGDA 2A7XA 1FU8A 4FX2A 1EA5A 1PUXA 3OZXA 1HYEA 4ERNA 4F91B 1QHEA 5BSMA 1UK6A 4B7ZA 2FZWA 3JR7A 2OG2A 5KCMA 1MUUA 1N2EA 3E7WA 4JBLA 4JY7A 4KBYA 4V3BA 5FLXA 1TQ8A 1EB8A 3ASZA 5IM4A 2PBFA 1Z63A 4CMJA 2NIPA 3WRVA 1SUDA 2AMVA 2ISQA 1HZZA 2GETA 1H8HA 2QR2A 5EKTA 3HGQA 5F21A 1J7KA 2CKDA 3FCOA 3RCBA 4E5PA 1R6TA 4UATA 2I1VB 3ASUA 3LYAA 3NALA 5K2OA 3KOWA 1KFKB 3OC6A 4BV8A 4QM7A 1UANA 5LD2B 1X7YA 2YMLA 4R2HA 3UM9A 3A6FA 3ROMA 1HSZA 1L3IA 2XSZA 1ODCA 3LHFA 3VYTB 4PG4A 3GLFB 3HBMA 3HC7A 1O89A 4QPJC 2J08A 4JJIA 3KHUA 2Q7OE 3B36A 4GMFA 5ADWA 3ZXIA 1SXJD 5CITA 1ZC3A 1WHSB 2A88A 2DPGA 1B74A 1L5FA 9GPBA 3CNNA 3DBRB 4EUNA 3GGPA 4YUYA 1TZKA 4E4TA 1VM6A 5LOVF 3MTJA 2EDAA 1WXDA 2P9HA 3L06A 4LWPA 2ODEA 4QT0A 4YWHA 1FNMA 4D9JA 2CUZA 2Y1CA 1U5AA 2BMDA 2ZJYA 3TG8A 2RHLA 3KQMA 3LRTA 4RGQA 1KO7A 2OZVA 3L4BC 3RFUA 5BT8A 4XPIB 2Q6LA 3FOEC 1VTKA 4QC2A 4GBMA 3GP8A 4NXNB 5J4LA 5BUCA 1XHFA 2WWWA 4LXGA 4JYZA 4R2MA 4B79A 1NBWB 1PZEA 2OO3A 4GBGA 5EP1A 2YIMA 5CDGA 2B21A 2W2XA 4G5HA 4OB7A 4MV9A 5A5FA 4AKIA 3KKQA 3CEJA 2GS9A 2XIJA 4A0SA 4IILA 1CYEA 4YECA 3FROA 3TMYA 1POXA 3H2IA 4PLWA 4JI1B 1UBTS 3H2YA 1FP7A 2VYNA 3P32A 4DIUA 5DNEA 4DA9A 1TT7A 1ZGBA 1ZH8A 1AD2A 3QA9A 3RNOA 1JTEA 1NF9A 3N05A 4UEOA 1ZM3A 2XKJE 2QTTA 3ABRB 4F5WA 5JISA 1FMJA 1RWBA 5DISB 1M1UA 2XYHA 4QTUB 4WKBA 1AKYA 2DOKA 2J3HA 4KXLA 4X41A 2QTHA 2JZOA 3T1VA 3LT2A 2OD7A 3ZE0B 1T1JA 1TF5A 4E51A 3BWVA 3GUVA 3WBFA 4GKAA 5LLSA 5EHNA 1TK2A 3R7SA 1BX1A 3QELA 4N5IX 3INGA 4Z8XA 1ES9A 1LJUA 1PJ3A 2BP7B 3TYXA 5BY2A 5AHWA 1UXHA 4MUXA 1IUOA 1KDYA 3M4XA 2W9XA 4N8SA 2O8BA 1VG0B 1VXOA 2AG0A 3KJHA 4IQGA 1F6BA 2JHPA 3P2MA 2HFJA 5CW1A 3EH2A 2JATA 2KE5A 1C8KA 5COQA 4GC9A 1E62A 3T99A 3THSA 4BL5A 2QNIA 4F56A 5JYBA 4RD0A 3BWCA 1IK4A 1VI6A 3AESB 4ALLA 3BH0A 2V1UA 3KWFA 4JXJA 4RGBA 2I78A 4J16C 3JAWA 1H6CA 3OPQA 1G2IA 1QE5A 1H4VB 4J6EA 4M99A 4OIFA 2DBZA 1GVHA 3KR2A 4TL9A 1Z6PA 4X3PA 1QQTA 1YMVA 2BY4A 3E9EA 1PNOA 1BC5A 3PIDA 4QUJA 3DS8A 4RS4A 4DY6A 3JV7A 2CWDA 4KMRA 4BV3A 2BRUA 4W1QA 2CJWA 3LDAA 5AK4A 4E03A 4ZANA 4F9TA 1YIAA 3RK0A 3TW8A 3WA7A 4DYHA 3EPJA 1L7BA 1QVWA 2F1OA 3OIDA 3AVQA 5DJ5A 4OCZA 1DQNA 2ZSDA 1P75A 1G19A 3GDOA 4DQ0A 1O77A 1JHOA 3F6EX 3HB4X 2PLRA 5TMPA 2IUUA 3U81A 1K4MA 2NV2B 4ILKA 5JAHA 1CDOA 1EIZA 2P2ZA 1KEVA 3P1JA 4QD3A 4CLDA 4P4SA 5LLTA 1M2KA 4Z9FA 3SI7A 1Q0LA 2PKRA 3HKBB 1B23P 1U2TA 2WSSD 1E63A 3O8QA 2FFRA 2R5FA 4I1PA 5HZHA 3NDPA 3KR0A 4TTRA 2IY7A 3OPVA 2XMBA 3EGEA 1H66A 3GC6A 4YCMA 1M34A 2BUBA 2Q9AA 5LP1A 1ULHA 2X6RA 2XVMA 4LDQA 3UMYA 1DWPA 1S96A 4HUQB 3U9TA 5EYPB 3TNYA 3QPBA 4D9IA 1UDAA 3IPLA 3CF6R 3DMHA 3N76A 2GK7A 3IBYA 4L0CA 4UOQA 3QW4B 1Z37A 4E13A 3V2HA 1T8PA 2G88A 3GLHE 1M2OA 2FU5C 4K2HA 2J0SA 3G2LA 2REQB 3GFTA 3CLTC 4I3GA 5KYUB 2UUPA 5LA6A 1W46A 1DJPA 1WU7A 4YV7A 1SUBA 4UPVA 3HCAA 2O8DA 1VBNA 3BMXA 3IURA 4ZHQF 1QH0A 2X3FA 1QSGA 1ADGA 4ZZ2A 1AU9A 2VQDA 3WKEA 5AW0A 1WDKA 4AP9A 4G09A 1XLWA 2NWQA 2WWXA 1N0UA 2BGJA 1URPA 2GUGA 5AKYA 1KKLA 1VOTA 1NJ6A 4LPSA 1RKVA 4AJJA 3P0IA 3HDTA 5C5CA 3DL7A 2AOUA 2HHCA 1QOZA 5CT4A 3UMVA 1PG5A 1XQ6A 5IBPA 3B7WA 4N5LA 1T3GA 3QXSA 3VPGA 2UV8A 4BQFA 1ORWA 3HEBA 3K1AB 4ZI7B 2Z57A 1E9BA 3KWJA 5IVDA 1B41A 2FRXA 3AU9A 1GUAA 2JI4A 3IHTA 3LPMA 4OFWA 1GCOA 3SQDA 3NBQA 2FE1A 3RKUA 1SIUA 3D3EA 3LHSA 4OI4A 4QDTA 4FZ5A 4C1NA 1U1IA 5LIPA 4JVSB 3VH2A 2ZI5A 4ZARA 4LGVA 2RBKA 1H93A 3NNNA 4PY2A 1Q5PA 1XOIA 4CU2A 1N5IA 2ZRQA 4FNGA 4JVOA 2XCRB 3ZOZA 1Q3HA 1VG1A 1XZBA 3O2JA 4QGSA 3KKKA 4O4HF 4TSRA 5BQXA 5KYGA 2CLHB 3F8WA 4H27A 5E0KB 2ZVDA 1NLFA 2CCGA 4PTZA 1GQ2A 4C2UA 2JHFA 3N2GB 2YY5A 4J2OA 1OXKB 1U1EA 3EPRA 3GLHB 2QB5A 4U8HA 3TEFA 5E4TA 4I2NA 2Q3FA 3Q7TA 3I37X 5K03A 2R9VA 3G9UA 2XTJA 2VNKA 3SG0A 4LY0A 3VNSA 3KPJA 4C0WA 3TR5A 3U48A 3FYCA 5IKOA 4WN9A 2ARKA 2XDAA 5ERYA 5CG2A 2HQ1A 1EFRA 2XTMA 2ZANA 1Y3CE 5DGIA 5B2FA 2OAGA 3V80A 2EV9A 3B1ZA 4I1UA 3V4VB 4BB0A 1RWPA 1LI7A 2PLAA 4S04A 1BXGB 1FBTA 1RRGA 1A5BB 1P5FA 2DP4E 3GIWA 3H8SA 3QE4A 3C5HA 5DHUA 1ZRHA 2N9UA 1TL7C 3FLBA 4K9RA 1ORHA 4L15A 2NX2A 4W1SA 3STWA 3B53X 3DNPA 2NO0A 1NVVR 2F4NA 3EJ6A 3GRAA 4NBKA 4UZEA 1FUYB 2Q6IA 3PC8A 3ZDXB 3ER8A 1NXOA 2WFLA 1J8QA 4ISCA 2Z4RA 2H5LA 4GT1A 4IFEA 4TTJA 5DT2A 5KQLA 2PCLA 1F48A 1X8LA 2YFQA 5ELMA 3LIPA 3W8EA 3OQIA 2EGHA 1XXLA 4XX0A 3U37A 4D3FA 1XA0A 1OTHA 3A14A 1B8NA 1JL3A 4XQ9A 4F8JA 1ZGAA 3L43A 5KVCA 4O4LB 3F96A 1AURA 3K5IA 4HK4A 3EULA 3H9BA 2W83A 3CG4A 4DLYA 1DP4A 5F33A 3K70B 1MP0A 4I4IA 4L3VA 4G1FA 4LXYA 1KI2A 1E1NA 3L5OA 1WUYA 3UTCA 5ITZA 2RAUA 3RUDA 3WLEA 1MVLA 3C15C 1VECA 1IOVA 4JIMA 5DM1A 2Y71A 4YMIA 2FR8C 5I8ZA 5IH3A 3V1KA 3OWOA 1Q7CA 3ANXA 3U7JA 3PXCX 4KC0A 2W8BB 4KDRA 4XWKA 2VJOA 5JXHA 4J03A 2GSDA 5H80A 2XJ4A 4MJ3A 5EJEA 1D4FA 1OIWA 5HJ2A 2HCFA 2HA6A 2Z04A 1BSVA 2ZBEA 3B78A 3PHBE 5CFQA 3K71B 3AEUA 3QLVA 2XUOA 1JWAB 4V1CI 3G5UA 1TJYA 2R5WA 4BO8A 2OMEA 3CZAA 1RACA 3KOXA 1I9GA 4BNXA 4HPJB 3O90A 2ZQZA 1REQB 3TIVA 5E8RA 4L4XA 2CNWD 3SMVA 2B34A 3U4GA 5JRDS 5D84A 4WBNF 5L9AA 1FYWA 1LSOA 2WSMA 3GMIA 1F8FA 4HNSA 4P86A 4DWWA 5A06A 3EIWA 1EM8B 2H4XA 1EP1B 1ELOA 4H6PA 5AVZA 1OWOA 2XVAA 2P91A 5FO0A 4D9CA 3E3NA 4F04A 2J8ZA 2VH2A 2Y2VA 3QNWA 5TPWA 2FLVA 4RA9A 4FOOA 1QX4A 3DD5A 2X8BA 1AC5A 3U7QB 4L6AA 3PXBA 1WLSA 2TS1A 4RHTA 3C8ZA 1NBMD 1WCIB 4DMUB 2W71A 4C89A 5K8JB 1VKRA 3MWDA 3NGLA 1OX4B 3TDNA 3JQBA 5FL3A 4B5LA 2X1LA 3QFHA 4O1HA 3V2GA 3F47A 1NT2A 1B0AA 4IJKA 4FKMA 4GX2A 3ZE6A 4TV8A 3ZVRA 4JVNA 4ALMA 4ECAA 5K4HA 2F48A 2ST1A 3ES9A 1QGUA 1R74A 2ZIGA 4L73A 5EJ2A 3SE0A 3DO8A 1VJRA 4QQNA 4MLDA 2PUBA 1T3HA 1H8ED 2PUEA 2PBZA 2FMIA 3WJ1A 3ST7A 1QC5A 1NVKA 5CCXA 2DJ5A 1FDRA 1FJXA 1HRDA 2FSUA 1EIWA 2ECQA 2NVBA 4DR2B 4YJ2A 3EXEB 1OV6A 3IIMA 3W7BA 4CDGA 3IOYA 1JKIA 1HDXA 5J3JA 1LNZA 3KSRA 1C0IA 2WT8A 2FN8A 3BYZA 3LBYA 4OQ4A 5H9WA 2UVPB 4GZLA 3F7TA 4KW7A 5ER6A 3L4BA 1VPTA 4BFXA 4K05A 1RXWA 2JIZA 1PN3A 3PPYA 2A3RA 2BJHA 2I8LA 1CZOA 1XPRA 1VPEA 1YHZA 1C5KA 2X77A 4L76A 4D4JA 4I6EA 5MDHA 2BOVA 2XODA 4QELA 4DYVA 3NTRA 1B0UA 2FB9A 4MKFA 5ESRA 4KR9A 3TLGA 5IT4A 4YEDA 1MBZA 5IVHA 1QB8A 3ET5A 3GFPA 4URHA 5FV7A 1KVSA 1I3LA 2FPXA 2I34A 4BWYA 1QK5A 1MFPA 2IHKA 2XUGA 1PEYA 4KXXA 3D8TA 3TJRA 1D0VA 1KMHB 3ZVKA 4D44A 3H9EO 3ACCA 4JYBA 1DLIA 2G04A 4JKOA 4EQ6A 5CVCA 3RYFB 1CB0A 3ZU5A 4PC2A 1ZYUA 2QTRA 1FP1D 3MSXA 3NCHA 5DTJA 1QAQA 5FT9A 3KJNA 1QHFA 3UJHA 1PR6A 1SEPA 4Z9BA 4UNRA 2V98A 4LV5B 3UT6A 4YDQA 4X65B 4NK4A 3BUSA 1HG1A 3NHZA 4TWRA 2O5EA 3LI2A 4KN5A 5KYWB 2ZT6A 2VDQB 3IERA 2E7ZA 3AOEA 4CVNA 2WWGA 1G18A 2HBZA 2X9VA 1G17A 3MWLA 4I81A 1QO0D 1PR4A 4H2DA 3UANA 2FV8A 1C7IA 1KJWA 1VCMA 4DWVA 2BHTA 1H1TA 4HNQA 4FCCA 3IRUA 1RWXA 2Y6VA 4LBWA 5KJCA 1X1TA 4I4CA 5A4DA 3B38A 4OHVA 4YN3A 1QGYA 2WSLA 1ECPA 4HAVA 1UFQA 4IMPA 3RT7A 1R4NB 3FGOA 5E8JA 3Q9NA 3BMCA 2FK7A 3IPRA 2AS0A 2I3GA 3UOAB 5CBPA 1IBKB 1Y3BE 1KEPA 1T25A 3FN4A 1RAIA 2J7PA 3B3JA 1YZVA 4PIMA 4UFOA 1GO2A 5H3CA 4LJKA 2G1JA 2R3SA 4K9SA 3VO8A 2E4YA 3U4MA 2VTBA 1VGRA 4ND2A 4BB6A 4CFSA 4EK9A 4XDHA 4LZAA 5AJUA 1P39A 3LQFA 3GLVA 3FR7A 3ONDA 4UDYX 1Q12A 1YS9A 4QDOA 1JI3A 3Q8WA 5C8YA 1E18A 4R9RA 3FPGA 3OJ0A 1N2SA 4KYVA 3WMWA 4AJHA 1MABA 3C8DA 4Z3OA 1ISHA 2FP4A 5JAIA 3TVDA 1U6KA 2PUTA 1P60A 4HRAA 4QKQA 1V9LA 2X0RA 1UOOA 4IUYA 1T0HB 2PRYA 4PM4A 1DWQA 1M2VB 5AOBA 1R7RA 3F3SA 1R3UA 1G8AA 3ETEA 4B3HA 5A4MS 1WOMA 1AA9A 3CUYA 4KIUA 1RNLA 1PEDA 2F1KA 3WQQA 3DMTA 4ZCRA 2Y1GA 4KQ1A 1NYQA 3UC9A 1AMOA 4MIOA 4K1XA 4ON9A 1PV1A 1I32A 2AF3C 3C48A 1CZUA 1HYBA 1O4WA 5HM8A 1ZN9A 3ETDA 4K9NA 4R69A 5AKHA 3JASB 3WB0A 2RGYA 4H1HA 2IYUA 2ZVQX 2O57A 3SIRA 2VHUA 1ZGCA 3NP7A 1EWKA 3OLXA 1HTTA 5DRTA 5E38A 1X38A 2F6RA 4Z0HO 3GT4A 2NNWB 2N46A 4YMUA 3KQQA 4AECA 3X2FA 1EFLA 1GZDA 2R47A 3QKSB 4IVPA 4AN4A 4FU0A 1P1RA 2VG8A 1V11B 1GL9B 1QYXA 1Z56C 2D0PB 1OAAA 2BR4A 2LKCA 4L2IB 5FD8A 3ZG6A 4CDMA 2ZJ1A 3MJTA 1L7OA 1VPLA 5B3KA 4HXGA 1OH8A 1PJTA 1II9A 1SC3A 1ZUHA 4NU5A 3GDHA 3BMQA 3MRXA 2LIPA 1KFBB 3ZLVA 4DS3A 3DDSA 3BGVA 4UUAA 4DSTA 6CHYA 1EUQA 1U0BB 3DVAA 4U2BA 1QH8B 2C31A 3DV0B 2W4MA 3F6BX 1JLHA 2I6SA 2SNIE 1OGYA 2HN9A 3CE6A 1EJ6A 3IT3A 5BQOA 5B4TA 3F5QA 2FQXA 2PH1A 1F2TA 2CVOA 2HSEA 1GU7A 3EIEA 2X6TA 3R6GA 3L0IB 4UBIA 3VR0A 1F1JA 1G291 2NO6A 3OIVA 1D5WA 3HFJA 1QFJA 4MWDA 4R2XA 3RS9A 3ZE7A 1JV2B 3S44A 4B3BA 5IBQA 2WPDD 4UBNA 4DQKA 5I8PA 2PX3A 4GRIA 4ALIA 1XBTA 4IFIA 2VHCA 4QGBA 5EWJB 2PKEA 4DR1B 3DAGA 4BKUA 2IPAB 1E9EA 4BEWA 2Y3IA 4U5QA 3UV3A 4RV4A 3D8BA 2YVAA 3C2QA 2CF6A 2PKWA 3NHAA 4IS3A 4XIFA 4BNVA 4BNIA 2OWEA 2F55A 1FL9A 4ARZA 2PTGA 1V5FA 3EPKA 2J3JA 2FX3A 1V4NA 4HYEA 5JHHB 1NN0A 4R5MA 4QODA 4C87A 2FN3A 5J43A 4B09A 1TZ2A 3NUZA 4ZWNA 1G60A 3TNLA 1ZVMA 3JQ8A 4NDAA 4OHKA 3AF0A 4JLPA 4DG8A 2NZUG 2GN2A 3ETLA 3IB3A 3IMEA 5A7FA 4LYYA 3GCWA 5FWXB 2CLFB 1JAHA 1V1JA 1A5TA 2FEWB 1M2EA 2GCPA 1PQYA 3HI4A 3WGLA 5KVVA 3ET4A 3P9QA 4IKPA 3S8MA 3EEQA 1TKCA 4DMRA 3PUKA 4HAZA 3DFMA 2VRBA 2WYHA 3V46A 4A2QA 2QVBA 1G5RA 1HQKA 2H1WA 1SAYA 4N8DA 3MAJA 1QF7A 5KNDD 5AVTA 3X1MA 3TX6A 2PN1A 1B8UA 1DB3A 1SXIA 4JZKA 2IYWA 2J32A 1D6NA 5AP9A 1EYZA 2P67A 5MFPA 1AUQA 3BFPA 3ZI4A 3GNTA 2WJJA 3M89A 3CF4A 3FGZA 4QBFA 1J06A 5EHQA 2W7TA 3OFVA 5G4KB 2D5CA 4R05A 3U0BA 1QF9A 5TMDA 4JXKA 5EVCA 1CUBA 2QRVB 2K5UA 4QNMA 3BZBA 3CZ4A 2XI4A 3EVTA 1FK8A 2A6PA 2PJDA 2I62A 2Q6KA 2PLWA 2XVXA 4JROA 5H4GA 3IXQA 1CUGA 4JLUA 2OV6A 1UPXA 2WG0A 4MRMB 3VDQA 4ZCIA 1QU2A 4KQWA 1JMVA 2EZTA 3HCOA 2XT6A 1H6BA 3R0ZA 3LXUX 4YS6A 1E6MA 1E0KA 2A9FA 2OHXA 3S7ZA 1Q19A 4IBOA 2DERA 1TYDE 1H2EA 2OB1A 5DH9A 2IIQA 3N53A 2ETXA 2Q46A 1COWA 3LW7A 3ZW7A 3I62A 2ZKIA 3R75A 1Z4OA 4YUZA 5EWLB 4H7IA 1J22A 4OJNA 2G9NA 5FH9A 2R2AA 1T3TA 1PI3A 1OZAA 1WDLA 3FPSA 1X94A 4Z8YA 4QDXA 4BYMA 4DPMA 1P73A 2P9EA 3OCUA 5DXJA 2QJOA 4WK6A 5EP4A 2E55A 1ZVJA 1Y9EA 3BXEA 1GPNA 1CRQA 4FBGA 4FHFA 1SCKA 4Q03A 4CM5A 4HQ6A 2YVQA 3LT0A 4HDOB 4YQEA 3TQTA 4EENA 4JGBA 1PKEA 4EW3A 4DEYA 4F5YA 1GQYA 1NT4A 2NZWA 4G4SO 5JPIA 3JQFA 3BIFA 2JLRA 2HPAA 4C5AA 4O4IA 4MVJE 2KX7A 4QWWA 5J4HA 1PGOA 1YQQA 2HJ9A 3CBGA 3OCXA 4KUGA 5JNWA 2Y0PA 1NNSA 2IIVA 4PHFA 1M8PA 1UQUA 3UJDA 4NE9A 3SNKA 3HHEA 1JG7A 1PJ4A 2OXRA 4KYTA 2O50A 1O6BA 4RQAA 3KLBA 3AJDA 4F3NA 2EFJA 3Q41A 4IIGA 4LXIA 5B12A 2FPIB 3K9LA 4MI6A 2WWHA 1T1GA 2PGIA 3KB8A 3T3NA 1L4YA 4R2IA 5JDIC 4S3MA 5FLEX 2GK3A 1EVEA 2F67A 4GVLA 4LJSA 4RSRA 1KWGA 1F12A 3M3PA 4G0QA 1Z47A 4PIPA 3CONA 5CFRA 5I7FA 1J21A 3DBHB 1BW9A 3N86A 2VLIA 5J4KA 3ZVMA 1H4SA 1PJBA 2MDTA 4V1CA 2XWPA 3TRHA 4KLRA 1QCZA 1QR2A 5E9AA 4BNKA 5JAZA 4DV3B 2R96A 3ZGZA 1R4MB 2X23A 3C3MA 4FE7A 1C41A 4B7UA 4BO7A 1T5DX 2UVDA 4YQYA 1R18A 2ZU0C 3EXHC 4A23A 7YASA 4B32A 1U0HC 3TKAA 1T1EA 3L7AA 1EMDA 2FUKA 3EDQA 1TK3A 4RVDA 2IXFA 2ONYA 2XGSA 2J0UA 3AR3A 1FLVA 3MCVA 2X9LA 4GKKB 1CUSA 1JA9A 4O2LA 4PYJA 3BDAA 3U40A 2R6AA 2B7BA 4GZ5A 1KDOA 3IDFA 3PUHA 3L4SO 2OQVA 1O9GA 4KLNA 2QRPA 4TRRA 1AHPA 3H1TA 3PFCA 1KK0A 2EGGA 4ZCPA 3UMJA 4EUKA 1EDEA 2F2TA 2O8CA 4BN5A 1BHO1 5CVVA 5J2UA 2BI7A 3WE7A 1E2EA 1NM5C 4F2WA 2OLKA 3I6QA 5BN4B 3MTBA 3CURA 2W42A 1XROA 2B99A 1J2JA 1SUCA 2B4YA 3MELA 4IOJA 4MK4A 4WLUA 3V1NA 3FCEA 1T8TA 2K4MA 1IPHA 1QVRA 5F35A 4AIRA 1KYVA 3B9RA 4Q66C 3R0IA 4JLNA 4XI9A 5FL7A 3HYNA 2JIMA 1MPTA 3R40A 5DM2A 2PU5A 4Q1VA 4EI2A 3OIUA 1NY5A 4V24A 3R6DA 4EY4A 3NIGB 3WXMA 1PZNA 1Q50A 3HA7A