5TC4A

Crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
292
Chain Sequence
EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohy
publication title Crystal Structure of the Emerging Cancer Target MTHFD2 in Complex with a Substrate-Based Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 292
sequence length 297
ec nomenclature ec 1.5.1.15: Methylenetetrahydrofolate dehydrogenase (NAD(+)).
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tc4A01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 5tc4A02
4ZRMA 4K9DA 3GUYA 4FDAA 1GZ3A 2G82A 3WIDA 4CMCA 2VHXA 3DXFA 4Q39A 4AFNA 1Y8RA 2FP4A 5TJHA 1E7MA 4D3FA 1DFHA 3DBHB 3FHLA 3WGZA 1E1LA 3W8DA 2AHRA 2VWGA 4ROSA 2EEZA 3MEQA 2AQKA 4EDFA 5EERA 3ZCXA 4WLEA 3H6KA 3I6IA 4KDEA 2VRCD 2JCXA 3JYOA 3PFWO 3I9KA 1YBAA 3ZV4A 3E48A 3JD1A 1RM5A 4XQ9A 5GY7A 3CMMA 5A9SB 4TKLA 4AG3A 3DBHA 3CMCO 4PLTA 5F3RA 3BYZA 4ALMA 1IB6A 3HZZA 2OO5A 1D7OA 3E6AA 3M6IA 3TOZA 4BV8A 1LSJA 3QSGA 1E7QA 1E7RA 1K6XA 2O7QA 2X0IA 4IMPA 4WKGA 4IS3A 5T67A 2UUPA 1PJBA 1WLYA 2JCYA 4OHUA 1TB4A 4PCVA 5A9SA 4TRNA 3LT0A 3VOSA 2QHXA 1D1TA 3QQPA 4X54A 3TPCA 1GDHA 3LT2A 2I76A 2VUUA 2YV1A 3OQ6A 1ZK2A 4PLWA 4GMGA 4JXKA 2HMVA 3DONA 2WEKA 3V1UA 1GYQA 4ZGWA 5L53A 4OGWA 4IDAA 4YPOA 2IODA 4G5HA 4GVXA 1A72A 4CMEA 3H5NA 1KEVA 1N2SA 3TFQA 5TX7A 1B0AA 3AUUA 4MKRA 2B36A 4MVJF 3MJSA 1VRWA 5CG1A 2V6MA 1M67A 2CVZA 3LSYA 3INTA 3JCZA 3ETDA 4YAGA 4PLGA 3FPLA 2HDHA 4NU5A 4CM7A 3RAJA 3L6DA 1V6AA 3GEMA 4AL4A 1NFRA 1EQUA 3F4LA 2ZTVA 3MJEA 4JN6B 4CQMB 2DTEA 2J3HA 2HRBA 5MGBA 1DC5A 4CMGA 3WG9A 3HN2A 4L75A 5TJ9A 1M6HA 4QTZA 5EN4A 3E82A 3OA2A 5IZCA 1YO6A 3L4SO 1YH3A 5FI3A 5T8KC 1QG6A 4FFMA 4BGVA 2GZ2A 4PG4A 1LNQA 4BHTA 2YY7A 4R41A 4UVDA 1OI7A 3DO5A 4YAEA 1EUDA 1Y6JA 2FOIA 5AXDA 1JU9A 1YONA 1E1NA 2JKVA 3AI2A 4R3WA 5U1PA 4EJ6A 3WQSB 4F3YA 1P3DA 3LYLA 4L8VA 2PZLA 5C3MA 1I8TA 3M2PA 1WXDA 2W2KB 2X5OA 2BFMA 2VYVA 4GGOA 5T6BA 4DC0A 1VLLA 3GC6A 2DU8A 3PEFA 3Q2IA 4XJTA 5IDYA 1LC0A 5GZ1A 4A73A 1WVGA 4UEOA 1GTMA 3RC2A 3GGOA 1KEWA 3RASA 4J7CA 3Q2KA 4LSMA 1VKOA 3HB4X 4GQAA 3ZI0A 2A94A 4ALNA 2W2KA 4JBGA 5ENDA 3E9MA 4PLFA 2EJVA 3ST7A 4XQEA 3GVCA 3W6ZA 4UVIA 5A1TA 3TL2A 2YHIB 2O50A 3ZV5A 4OKNA 1ZK1A 2C2YA 4PZEA 2NU9A 4RVFA 2CF5A 4W9NA 4IJKA 1LA2A 3AOEA 4AJKA 4RO0A 5EINA 1FXSA 1FDVA 5JBIA 5L4SA 4R16A 4HBGA 3OJFA 1NQAO 1SEVA 2HMSA 1LLDA 2GLXA 2BF7A 3JQGA 1NASA 1U4SA 3P2OA 1NTOA 2H6EA 4JNKA 3WOHA 3BHJA 2PY6A 4J90A 1QV7A 1Y7TA 2X5JO 1N9GB 1ZMTA 3S1LA 4XX0A 1AHIA 1LDNA 1YGYA 4HUJA 4Q3AA 1R0SA 3W8EA 2JFFA 1EK5A 2Q1UA 3ADPA 2VCYA 5B37A 2AE2A 2CMDA 4L4XA 1C1XB 1X1TA 4XIYA 3RVDA 1EBFA 1XQ1A 2ZATA 4NFSA 3JQDA 4EW6A 4IJWA 5DBIA 1JN0A 3H7AA 4OOFA 1IZ9A 3GNTA 1O0SA 3WQRA 3WWZA 1ZEJA 4E6PA 4GLOA 1I2ZA 3ROMA 1KVSA 5L40A 2X8LA 4MJLA 1K3TA 2VT2A 5KJ1A 4BS9A 1RM4A 3ZWVA 3RKRA 2EGHA 3ZWBA 3GLQA 1LTHR 5TSDA 1C1DB 4LISA 1Y81A 2P5YA 4KMSA 2C7GA 3LZ6A 4DYVA 1ZSVA 4RDHA 1B3RA 1UAGA 4PLCA 3VHRA 4BKRA 1FDUA 1ML3A 4OKIA 3TSCA 1SEPA 3ZWWA 3RBVA 4NK5A 3L07A 4Z9YA 4XYLA 3NT2A 5JC1A 2I3AA 1K6JA 1U28A 3JQ8A 1DHTA 2YZ7A 3U09A 3JQFA 2Z1MA 3NTQA 3EZYA 3HB5X 5JAIA 2QYSA 3BMQB 4IM7A 4RV9A 2Y67A 3DAPA 3ZNQA 3K92A 4CV3A 3C24A 4KP7A 4IDEA 4WGGA 4RZHA 4JGBA 1HYEA 1EZ4A 3H9QA 3OICA 2D5CA 1NWHA 1IHXA 4R9RA 4OIMA 1HE4A 1MGOA 1SAYA 3QJ5A 3U49A 2X23A 3QW2A 4DTIA 4NR0A 3PDUA 5L4LA 1A4UA 1WMAA 2AW5A 1EVZA 5JLAA 4FJ1A 4MOWA 4Z3KA 1T25A 2DUWA 1Y9AA 4BO0A 2XOXA 5U9CA 3BTVA 1JVSA 4ZQFA 4IIUA 1TT5B 5F1OA 2D1YA 4UVHA 5DNAA 5ITWA 2GRAA 2DBQA 1ZSYA 3D7LA 2BFPA 1EK6A 3I6QA 4BNZA 4J6FA 3S2EA 2PH3A 5HWSA 4BO3A 3D5TA 1GUZA 4CL8A 4EJMA 1UXIA 5A5EA 3UCEA 4AJEA 1TT5A 5EESA 1CF2O 2FMUA 5H82A 3ETEA 4B3HA 2VNSA 3K6JA 4W7HA 3GA0A 5A05A 3CZMA 4RCVA 3V1TC 1H0KA 2G5CA 3VZQA 4KTTE 3QVOA 5LCXA 4PG6A 4E3ZA 4BV9A 5JO0A 1BHSA 3EGOA 5JAZA 4OXKA 1H2HA 2PZKA 3A4VA 3P5SA 4HWKA 2R2GA 3WICA 3HDHA 1KYQA 1ONNA 3QWIA 4BNWA 4XWYA 2PTGA 4M89A 1VC2A 2CFCA 3ZU3A 2X9VA 2HSDA 4BNXA 1F17A 3RJ9A 1L1FA 4WLVA 3WGIA 2LDXA 2BI8A 2PK3A 1Q0LA 3QE3A 1NHGA 4RQTA 1HSZA 3WX0A 4BNGA 4CQMD 1PTJA 4NBRA 1VJ1A 5CEFA 4N18A 2OXIA 1XYGA 3B1FA 1EDOA 1GPJA 1ISIA 2ZB8A 3IP3A 3RIHA 3K9QO 1SBYA 4YT8A 1WDLA 3V8BA 4OSOA 3WDSA 3W8FA 3RFVA 3HHPA 2HLPA 1OBFO 4ZRNA 1GZ6A 1DAOA 3JQ6A 5FWNA 1NPDA 1DC6A 5JAQA 5BSFA 3OQ1A 2YV3A 3PJDA 4NZ9A 5KJ6A 1P0FA 4RPGA 2HK9A 1NFFA 3DOJA 4M49A 4W82A 2GR9A 2DVMA 3LC2O 1CIVA 2Y1GA 4AJIA 3RUIA 1O6ZA 3C3XA 4INAA 2B83A 3N58A 2QQ5A 4N54A 2DPGA 4TMFA 5HS4A 5IDQA 1VL6A 3C1AA 4FC6A 4GX0A 2AG8A 4P8RA 4AVYA 1N5DA 5JAMA 4IDDA 3UICA 3UAGA 3BTUA 3C1OA 5EPOA 4HFMA 4LVCA 4UVEA 4QO8A 1EDZA 3HWRA 3B6ZA 3FPCA 5ES3A 2J5RA 4YA6A 5BSGA 5K6AC 1ONOA 2RBEA 4PLYA 1DJQA 1YE3A 2GCGA 3C8MA 4F46A 4BVAA 2O3SA 1VL0A 1R37A 2C5EA 4LSWA 1ISJA 1ISFA 4AJ1A 2H5LA 3OETA 1N1EA 4Y67A 4YWJA 4J91A 3TWOA 5DZSA 3ANNA 5A5FA 3WQQA 2QIOA 5JCJA 2X0NA 3ADOA 1BRMA 1GYRA 3OJEA 2OP0A 3G49A 4E21A 5A9TA 3F6YA 1A4IA 4BOYA 2R00C 1BG6A 2J3KA 3TZQA 3B20A 3GAFA 2X9GA 4CM8B 3JQ9A 4QXMA 3WWYA 1G1AA 2I67A 4YVFA 2CD9A 4NDNE 4BNYA 2FN7A 3QIVA 3GZ4A 2FRDA 3DMTC 3DR3A 5EJ2A 4UUNA 4D3SA 5KKCA 2CUKA 3ZU2A 3DZJA 4IGFA 2ILTA 1WZEA 1XKQA 1KEUA 2CSUA 3MJTA 2E82A 4MVJM 3O26A 2GPTA 3GK3A 5KWEA 1SC6A 3NAQA 4ND1A 2PKQO 2PKQP 5EL0A 2AQ8A 3DDNA 2H9IA 2YFHA 1E3IA 4KUHA 1UXKA 2F1KA 3ZHZA 4DQVA 2WD7B 4LN1A 4PN3A 4MKZA 3EY4A 2DT5A 5B4TA 4J9VA 1U7TA 3D1LA 4FGWA 2B69A 4L74A 1R4MB 2NWQA 4OOEA 4BNKA 1LLCA 2VT3A 3V5NA 5A02A 5AXAA 5BSEA 1W73A 3ANLA 3JV7A 1U1IA 3VH4A 3GRPA 1KVRA 1SB9A 4B7UA 4JJFA 3H9EO 4HY3A 2VRCA 2ET6A 1KIFA 3KETA 2ZYGA 4PLPA 3VTFA 2FPIA 3CINA 3CUKA 2PGJA 4Y6SA 4LGVA 6ADHA 1FDWA 3GFGA 3ANMA 4WASA 1PIWA 3IL2A 4XB1A 4WCFC 4Z6KA 4MKXA 1ZXLA 3VZSA 1NBOA 3JYPA 3DZIA 2PD6A 4FPXA 4BO7A 2IZZA 3HG7A 4FFPA 1I3NA 4XRRA 1CRWG 2BGKA 2I66A 3T4XA 4GWGA 3HFSA 2UDPA 4R9SA 2VOJA 1DEHA 4DBVO 5AVOA 5JC8A 1MX3A 2I5PO 1UP7A 5JSFA 1KC3A 1NVMB 3AM5A 4RLHA 5CHEA 4J4HA 3FRJA 2FSVA 1I3LA 1IZ0A 1UP6A 5JMWA 4P4LA 1Z6ZA 1R6DA 4F6CA 4NHEA 3GN1A 2GGSA 3A28A 3NDJA 3RU7A 3RROA 4S3MA 3JD0A 2OP1A 4ESOA 3CE6A 3W6UA 3KYDA 3TDKA 1XG5A 1NHWA 1R12A 3PHIA 3AFMA 5DCWA 3ITDA 4Z0PA 3ZHYA 2IYOA 4UEKA 3AUSA 4XGNA 1FF9A 4XZ3A 4I9HA 1GADO 3PYMA 3R3SA 2DC1A 4R3NA 2C59A 1KETA 1LDYA 4QX6A 3UCFA 2O4UX 2D5AA 3IMFA 3VZPA 2NTNA 4JLWA 4PLZA 1XR3A 1YKFA 3IDSA 5THKA 1ZBQA 1Q7GA 3H5AA 4CLDA 1YJ8A 1JDJA 4FFOA 3GEGA 2D2IA 3U4CA 3ROPA 2BMAA 5JY6A 2QRKA 2WTBA 4MIOA 3KZVA 3DTYA 1YDEA 3O9ZA 4OM8A 5GZ3A 4MO2A 3ZWPA 2PKRA 5JMPA 5THQA 2D4AA 1I2CA 1T1RA 4J9UE 3Q0EA 3PIDA 3D64A 2ZCUA 5G0WA 1XWFA 4WCDA 1UDCA 3PYXA 1HE3A 2J5KA 1H93A 3N74A 1BTOA 1DJNA 4DL9A 3HUDA 1ZH8A 3H3JA 2P5UA 4DLAA 1NWCA 2JD2A 4E2YA 3I4CA 3JSAA 5BNFA 3IS3A 4I5DA 3RU9A 3GDOA 2GZ3A 5AXCA 1YBVA 4K6FA 3VH2A 4A10A 2AG5A 1YB4A 1E3EA 4U0JA 5K0ZA 2Q50A 3NV9A 4MVJE 4UAGA 1Z7EA 3HSKA 4R4JA 1PS0A 3EVTA 1I3KA 4CR6A 1Y5MA 4FBGA 2NVUB 3AUTA 1LRLA 1VPDA 5DOVA 4E0BA 5H83A 3CEAA 3OJLA 3DZKA 2WDZA 4B4VA 4ZVVA 4IXTA 1ZCJA 2UYYA 2TMGA 3X2FA 2WWRA 4CM4A 4I9UA 3ASUA 3QWFA 2E37A 4D45A 2QW8A 3OA0A 1EUCA 1L7EA 3GFBA 1P77A 2D0IA 3LDHA 4J3FA 2X1HA 1V3TA 4PLHA 4BNHA 2Y93A 1WDKA 2XF8A 4HV4A 3E9NA 1T26A 3FSRA 3DFUA 2RH8A 3GF4A 3H9JA 2EG9A 1O9BA 1UZLA 4XYMA 4A0SA 1FDSA 3DAFA 4YJFA 1I36A 2VTDA 5BQFA 1ADBA 1J49A 3LVFO 1PJ3A 4UUPA 4FSHA 1HETA 1ADGA 1ZKMA 2DKNA 4DUPA 1H6DA 3GZNB 1E7WA 2HQ1A 3E1KA 2C2XA 2HJRA 4IDBA 1GPDG 2C29D 3L6EA 4IMRA 4AJHA 1P31A 5B4UA 3GNSA 1HWYA 1LEHA 3FN4A 4PG5A 1T4BA 4NMHA 3VH1A 1VI2A 3OIDA 4O6VA 3WYEA 5C7IO 2H1SA 2GN4A 2NACA 3QA9A 4U6SA 3SBOA 2O48X 3G1TA 3GDGA 4FGSA 4RORA 1GCUA 1HYGA 4DIBA 5JS6A 1E6UA 3GZNA 1TEHA 5A3VA 3JQBC 3G0OA 2GN6A 4TKMA 1UR5A 4ND5A 3KO8A 5TRTA 3NDRA 1PEDA 1J4AA 1P1JA 1M75A 3KEQA 3M1AA 4JQCA 5JDCC 4TSKA 5CDUA 3K30A 3TZ6A 1NQ5A 1GQ2A 1PGPA 2GNAA 3PI7A 3IUPA 1KY4A 3GVPA 4UVGA 2CVQA 2Q49A 4BO2A 2J8ZA 2PD4A 4B3JA 1ZVMA 4K1LA 1TA4A 4J1TA 2VRBA 1AHHA 5JCXA 4ID9A 2HMTA 4OL9A 1QP8A 1SMKA 3AUAA 4B8ZA 3JYLA 1EE2A 1H6BA 1PR9A 2VHVA 5AQ1A 3QWHA 1LDMA 4E2XA 4ZN6A 3V2UA 1HYHA 4BGIA 1XU7A 3PHHA 3EYWA 4CUKA 2HMWA 2GDZA 4DVJA 3PPIA 4DGSA 1G0NA 2A35A 3BMNB 3MOIA 2UUOA 5KVVA 3K73O 1T2EA 2C20A 3L0DA 4NJOA 4E12A 4FJ2A 1HKUA 3FWZA 2YDXA 3FBGA 5JO9A 1ZNQO 1X0XA 3LC1O 3G3EA 1NVTA 3ZHBA 1LUAA 1AUPA 2IXAA 2CDAA 4YAJA 5IDXA 4RF5A 4YT5A 5CEEA 4YT4A 1O94A 2DTXA 3DZGA 2ZB7A 1IOLA 1N8KA 1WNTA 5G0SA 3VPFA 5B4VA 5CPBA 3UF0A 5B1YA 2DBVO 4BNTA 1PJLA 2X6TA 5KJCA 4CQLB 1V8BA 2X7HA 1PL7A 1ZK0A 2CF6A 3AU9A 4RDIA 3KVOA 3P2YA 3UOGA 4YT2A 2F00A 2FPGA 5HA5A 1X0VA 1YOVB 4FB5A 1U5AA 3FNGA 3PQDA 4NI5A 3NJ8A 1PL6A 2FZWA 3GDFA 1HEUA 2P68A 3OM9A 4ALKA 3BMOB 3FD8A 4BO6A 2GN9A 2Y68A 4CQLA 3RUEA 3BAZA 3JD4A 5L3ZA 1YBMA 4CQMA 1PL8A 5HM8A 5ILOA 1I30A 4TVOA 4MDHA 4D46A 5HBRA 1NP3A 4XA8A 1DPGA 4BQRA 4MVJP 4N5MA 1Y5RA 4CMEC 3GG2A 4D7AA 3DBRB 1M76A 4WECA 1LJ8A 4IY1A 3I9NA 1CETA 3BMOA 3OEWA 4EUHA 1ISGA 1TT7A 3T4EA 4A26A 4J7XA 4E33A 4D44A 2W90A 5ICSA 1F14A 2EJWA 3W1VA 1DRWA 5KTKA 1F06A 3HADA 4PRLA 4TWRA 4O5OA 4J0EA 3DBRA 1B2LA 2WYWA 2EHDA 1TXGA 4LK3A 1KS9A 3RCBA 4BNMA 1U2DA 4F6LA 2NQTA 3WXBA 3WFJA 2PR2A 3L6OO 4NFHA 4CM9D 3L4BA 4FOSA 4R5HA 4JP2A 2D3TA 1I24A 5IZCC 3CTMA 3KXDA 1JAYA 2IE0A 5TF4A 1T2AA 1DOHA 4ONEA 3B1KA 1HZZA 4N5LA 3BTSA 4NBWA 3U4DA 3FNHA 5TQVA 2C0CA 3NT4A 1O89A 5DT9A 2YHIA 2AQHA 2Q45A 1PZEA 4R1NA 1NAHA 4CM3A 3PGXA 2JJYA 4DIOA 2JD0A 2NADA 3NEPX 1GEGA 3V1YA 5L51A 1IHYA 4GWKA 4OO3A 1EVJA 3RFTA 3BIOA 3MCVA 4XGKA 5CG2A 4EZBA 4XJSA 3SC6A 3U0BA 4Y8VA 4RVGA 2PA3A 3NTRA 4R5MA 4IQ0A 2V65A 4MPDA 2WYVA 1N9GA 1F0YA 4BNLA 3F3SA 4DYDA 3D0OA 1NVGA 4R54A 1QYDA 3WR5A 2NTVA 4CLOB 4GX1A 2OBYA 3GVHA 4W9NC 1QYWA 3DZBA 5EIOA 1U9JA 2EKQA 1MG0A 3AOEC 4FOOA 2G0TA 4WLOA 1O5IA 4EYEA 1C1XA 3B70A 2ZK7A 4W6ZA 3N7UA 1P1HA 3BHIA 3UH1A 3KOUA 1DIRA 4R1TA 3OJ0A 2EV9A 3SLGA 1GL3A 4BMNA 1DRUA 1GAEO 5CDGA 4CLOA 2NNLD 3DB2A 1DSSG 2B0JA 4FR5A 4O63O 5G2OA 2IRWA 2VZ0A 1MXFA 3AWDA 3CIFA 3D4OA 3K96A 3PLNA 4RQUA 1HDZA 2UVDA 4TRMA 3H2ZA 1JW9B 2Y0CA 4ILKA 2E48A 4CM1A 1HE2A 4II3A 4PG7A 2PV7A 2Y1EA 1A27A 1A71A 1QR6A 5COBA 1UDAA 3O38A 4RL6A 2Q1SA 4D41A 1ARZA 2Y1CA 1ULSA 1C1DA 3ON5A 1IPFA 1HTBA 3W4IA 1BVUA 3PTZA 5IZ4A 2C07A 1IY8A 3TN7A 5DBGA 4E5NA 1NX6A 2B4TO 4E5MA 1J0XO 1T2CA 2EKPA 4Z0HO 5GZ6A 4PZDA 4GL4A 4WEQA 3RUAA 5JXWA 1O95A 3DAGA 9LDTA 5ER6A 2GO1A 2QZZA 3OF2A 3A06A 5FYDA 4H3VA 1N7GA 3CXRA 4Z9FA 3TZCA 1EUZA 3QRWA 4MVJD 3BMQA 3IKVA 3AY3A 4ZJUA 4JBIA 1Y1PA 3AY6A 1WZIA 4XGIA 1I5RA 3I9OA 2O3TA 4Q3NA 4ZQBA 1UAYA 1LX6A 3QVWA 5F5NA 2OORA 2VQ3A 1BDBA 2ZCVA 3PXXA 4JP3A 2I65A 3NGXA 1R66A 1P44A 1H5QA 5BNIA 4JIGA 3GPIA 4Y6PA 1QKIA 4C7JA 4L76A 4WOKA 4OXYA 1ULUA 3JQCA 3EMKA 4FFNA 3GY0A 2ZTUA 3L9WA 2V6GA 4RPKA 3D5QA 4N5NA 4YB8A 2B37A 4DPKA 1U3TA 3BMCB 3KHUA 4FS3A 3ZU4A 4YRAA 3AM3A 1PGNA 2VHWA 1U8XX 4BGEA 1E77A 3JQFC 3GT0A 1B14A 1GZ4A 4PFJA 4L0QA 4Y6RA 5BT9A 4CMAA 5IG2A 4CM6A 4XEHA 3OFSA 1W6UA 1DLIA 2P91A 4MP6A 3DC2A 4ZHSA 2EGGA 5KIAA 2ZQYA 4FCCA 4DXHA 1GQYA 2O3QA 4BO8A 1LQTA 4JJGA 3GQVA 4ND4A 3HN7A 1XIVA 1E6WA 3F1KA 3GRKA 1OZAA 4Y9DA 1IYZA 1BWSA 1OC2A 3PJEA 1KERA 5I7VA 1AE1A 3U62A 3IUSA 4BB5A 1E1KA 3O8QB 1H2BA 5KVCA 1VSVA 1HDOA 3VZRA 4WNIA 4GX2A 4NPCA 3PZRA 4XYEA 1E3SA 1BXZA 2VZ8A 4PZCA 1HDRA 4YTEA 3TNLA 2RAFA 1W8DA 4A7PA 5JDIA 2GN8A 4RF3A 1EMDA 1GUFA 4C7KA 4LRSB 1E6EA 4K28A 2R6JA 2RHRA 4XB2A 3PP8A 1X15A 2PZJA 4GAEA 2DBZA 2PGLA 4DA9A 4NIMA 3WTCA 2Q2WA 3PQEA 4BMSA 3TZHA 4FW8A 4M87A 1NAIA 3CSDA 4O1MA 3KSDO 4HKTA 2IZ0A 4ALLA 3R1IA 2O2SA 3PWZA 4XR4A 4B4UA 1LBEA 1LC3A 1SZJG 1WDMA 1U3VA 3ORFA 1PZFA 1MC5A 3ONEA 3IC5A 3LT4A 2VUTA 4BNIA 1LXCA 4WLNA 2EXXA 4DREA 5LDGA 2P9EA 1T4DA 3JYQA 3F4BA 3Q9NA 5DP2A 3WYCA 3RWBA 2BFAA 4EEXA 2VYND 4NBTA 1LSSA 3I9MA 4ND3A 4BQPA 1BVRA 3ZWYA 4CMKA 1DAPA 4NU6A 3BZUA 1GCOA 3GVIA 2ZTLA 4YJHB 4WK6A 1P9LA 4I8XA 4IZHA 2C5AA 3EDMA 2VHYA 4LMRA 3Q11A 4Q3EA 3PRJA 1JLLA 1ZMOA 4NQZA 3DZHA 3OIGA 5KCZA 3EK2A 1ZFNA 2YYYA 4YQYA 3WNQA 2OMEA 3WNVA 4AJ4A 4E2WA 1GYPA 1AXGA 4G65A 5DP1A 1YS4A 3PGJA 4BO1A 3LF2A 4HFNA 1R0LA 4NG5A 4PLVA 3V2GA 2DUUA 5JFOA 1LDBA 1CEQA 3INRA 2Q1WA 2QYTA 3TZKA 4BKQA 2FR8A 2DPHA 1HZJA 1H9AA 3IP1A 4O59O 1OAAA 2VZ9A 4BL5A 3I52A 4YQZA 4IQGA 2DFVA 1B3BA 4LCJA 3ZWOA 4C4OA 3HNPA 2OUIA 2Z95A 5COQA 4WCFB 4DLLA 4KDFA 4J1SA 4QSMA 1GFSA 4Q3DA 4XYGA 5JY1A 1NM5A 1V35A 3O03A 1TLTA 3OHSX 4CM8A 4GKVA 1N7HA 1E5LA 3EAGA 4P4NA 3GVXA 1NQOA 1BSVA 3HJAA 3FWNA 4O0LA 3UN1A 4DBZA 1T24A 3JQAD 7ADHA 3JQ7B 5L7TA 3C1TA 4JJIA 1V0JA 2H63A 1T2FA 3K2BA 1Z74A 4A03A 1LI4A 2JAPA 3ZWAA 4I5GA 4U8GA 5F1KA 3HQ4O 2WD7A 2NVBA 3KYCB 4GGPA 2HAEA 1OC4A 4GMFA 1E92A 3DL2A 4PGFA 1HXHA 4XRGA 1V9LA 3L9XA 2QZ9A 2LDBA 3JYNA 3R0IA 1R4MA 1VE9A 4UUMA 1HDYA 2EW8A 1SPXA 3JQ9C 1PR3A 4HADA 1EVYA 2HK7A 3GHYA 3VAZA 1ORRA 2ZKLA 4YRDA 3U4IA 3PWSA 3KYCA 3LT1A 4B3IA 5DOZA 1Q7BA 1LDGA 3D4PA 4QECA 4CUZA 1MP0A 5I9LA 3NTOA 3LU1A 2Y66A 3AI1A 5DULA 3M2TA 2I3GA 4FJ0A 2HRZA 4QFCA 4QQRA 1OMOA 2RHCA 1P45A 3FR8A 4GSKA 1NQTA 3ZWMA 1H6AA 1HDXA 1VM6A 4BNUA 2ZYAA 1D4FA 1MFPA 1FMCA 2VTEA 3F46A 4M54A 5I8ZA 5IN4A 3GG9A 1BXKA 4W7IA 1X14A 1K89A 2WE7A 4BGUA 1O8CA 4KQWA 1QRRA 1PWXA 2AEMA 1DC3A 4OMUA 4BB6A 1PWZA 4NJMB 1XU9A 4AJJA 1HSOA 3QVXA 4E13A 2ZJ0A 3SC4A 1B26A 1Y8QB 1QLJA 2A92A 4AICA 1FJHA 4DPLA 2O3UA 3KTDA 5FFFA 5I7FA 3UW3A 2ZB4A 1PJSA 2HKIA 4NJMA 5G4LA 1BW9B 1IE3A 3KUXA 1VKNA 3GNQA 4RJTA 2RIRA 3C7CB 2OFPA 4NBVA 4NFYA 2PD3A 2X0RA 3SXPA 1LDEA 1C0KA 3K2EA 3DHYA 4AJNA 4CLRB 3Q1LA 3STHA 4QT0A 5COAA 3KBOA 5KKAA 3OIFA 2OBNA 3H5RA 1EVIA 3H8VA 4XQGA 1RYDA 2EP7A 1IULA 4LRTB 1EE9A 3F1LA 2YFQA 4CLRA 1S6YA 1DBVO 1NR7A 1R16A 1MC4A 3HDQA 3W4KA 4R69A 1TVEA 2JFGA 5CDSA 4M8SA 1ID1A 3SLKA 2YUTA 2CDBA 1Z73A 2QG4A 4TVBA 3TFOA 4OSPA 4AJPA 5CP8A 4BMVA 1B7GO 4DMLA 3WGYA 3TL3A 1QYCA 4I08A 4B7XA 5L7WA 4Z9XA 4P22A 4NNJA 1T2DA 1EBUA 4CM9A 4IDGA 4D79A 4J7UA 4YDRA 2HMUA 2BKAA 3I83A 4JX8A 2J3IA 3WLEA 1B8UA 1SCUA 2I9PA 2NM0A 2O3RA 2X86A 4I5FA 1DDOA 5AXBA 1PQPA 2Y0DA 5T5QA 2BRUA 3WJ7A 4QEDA 2Q3EA 5F21A 3OBBA 8LDHA 4PG8A 3I9JA 3IOYA 1Q2XA 4TRJA 1XELA 3FCOA 1WWKA 1PS8A 2Z5LA 1ADCA 4P4GA 5CDTA 3CKYA 4CPDA 2NVUA 5HTOA 1N1GA 3KLPX 1ONPA 5C7OO 3JD2A 3PK0A 1K6IA 5F5LA 3Q3CA 5ICMA 3UCXA 4Z0TA 2NU8A 2DFDA 3GUCA 1CWUA 2SCUA 3PIIA 4W99A 3WSWA 4BNNA 5CDYA 3RBXA 3S55A 3ZW9A 4J1NA 3MWDB 3FI9A 2OGUA 3ONDA 2O23A 2WM3A 5FI5A 4J0FA 3ROQA 2YHUA 1KEPA 2PFGA 1HF3A 1Z75A 4BNJA 2NVWA 3DEYX 3LK7A 3FTNA 3I4FA 1W4ZA 4RVUA 5LDHA 1ENYA 3C7DB 3RC9A 3H9GA 1I32A 1DIGA 1R4NB 3H3FA 2GD1O 2BHLA 3OECA 4GBJA 1K5HA 3NT5A 5CAEA 5IDWA 5AYVA 1MXHA 3ZNOA 4CJXA 3IQDB 1XHLA 1ZK3A 3WSVA 1A9ZA 3ENKA 4RLSA 1MV8A 1Y8RB 3B1JA 3PHJA 1EQ2A 5DDIP 5A3JA 1NYTA 1R4NA 4HP8A 1Z82A 3IAHA 4U0KA 1N92A 3ETGA 1YWGO 5FEUA 3MWEB 1ZSNA 3KLMX 5I9NA 1ZUD1 3WYBA 2YQ4A 1LLUA 3K8ZA 2CY0A 4IIVA 5FF9A 3KEOA 5G0VA 1DB3A 1DXYA 2AE1A 1D3AA 1F8FA 3F5SA 1DFIA 5DBFA 3GMSA 2FSSA 1JWAB 4TRRA 1ZEMA 3G1UA 2CNBA 3I23A 2GF2A 4J2OA 4ZQHA 4MVJA 3RI3A 2VWPA 4IPTA 2Q4EA 5ADHA 4CR7A 3WS7A 2HUNA 3GOHA 3TRIA 5G4KB 4LMPA 3NRCA 2Y1FA 2JHFA 4R51A 5CEJA 3ZWXA 4H15A 3LF1A 4AJ2A 4FQ8A 3I1JA 2O7SA 4DC1A 3BTOA 4UUOA 4CR8A 2B4QA 4IINA 4CV1A 3JD3A 4HFRA 4NBUA 2OOSA 5T8KA 4QFDA 3JTMA 4HNGA 1J6UA 2WD8A 5G4KA 2BELA 3BMNA 4R01A 1YQGA 4KWIA 2J5QA 4ALIA 3WB9A 4XCVA 2W2LD 5TS3A 1QSGA 2B35A 1P1RA 3BHMA 1NFQA 2AA3A 3ABIA 4YJGB 1JQBA 2G1UA 3EVNA 4KTVE 5KJEA 3DZFA 1A9YA 2ZQZA 2FY8A 2WE8A 2YV2A 4W4TA 3WTBA 2J3JA 4WLFA 1XGKA 4K6CA 4YCAA 2WSBA 4P38A 4YXFA 4GH5A 2IZ1A 1H6CA 5T64A 4XKJA 5CFZA 1UZMA 3FR7A 5I8WA 2PNFA 4OXNA 4N7RA 1UZNA 4YJGA 2VNAA 1RYEA 3G79A 3MTGA 3AW9A 3NX4A 1YOVA 1ZJZA 4K26A 2VUSA 3RQSA 3ZNPA 3PHGA 4J2HA 3NUGA 3RC1A 1ISMA 4CLEA 3AJRA 1RPNA 5L7YA 1SNYA 1U3WA 2Y1DA 5U4QA 2B5WA 4NK4A 2G76A 3NYWA 1YVEI 3E18A 2DAPA 1JVBA 3C85A 2HU2A 3HDYA 4HXYA 3T7CA 1DC4A 1IL0A 3LQFA 3DOCA 5B12A 2X9NA 4LW8A 3K5PA 1XLTA 1HL3A 2Q99A 3SJUA 5L95A 1CYDA 1HLPA 1RWBA 4XDZA 2P9CA 3V2HA 1ENOA 2X0JA 4JROA 5GMOA 4CM5A 3K31A 2BFOA 4IQ8A 1YL7A 4FIZA 4E4YA 1E1MA 3X2EA 4ZQEA 3GAZA 3RUHA 2BD0A 3GH3A 4CL3A 1P1FA 2VYNA 2YJZA 3VPHA 3HE3A 4D0SA 4E31A 3S2FA 2ZTMA 2FR0A 3RC7A 5IN5A 1X7HA 3JQGB 5A03A 2O3JA 1QORA 4B79A 1UP4A 3SEFA 2Y05A 5C7LO 5L45A 1BXGB 3ENNA 2I6TA 2QX7A 1DIBA 4ALJA 2EKLA 4PVCA 2HJSA 4RGBA 3KSUA 4TZKA 3NDIA 3PHLA 3UVEA 2V7PA 3QWAA 1U5CA 3I9LA 3S2GA 4I9NA 2GUGA 2NU6A 1IUKA 4M55A 1BXGA 4RPLA 3L4BC 3UHAA 5IF3A 2GASA 4R1SA 1MB4A 2NSDA 3RBZA 2OL4A 4LVUA 1UXHA 3CH6A 1YRLA 4CMHA 5MDHA 4L73A 1PJ4A 3GN2A 1LU9A 3ROKA 3ZV3A 1AXEA 2VWHA 3JQAB 3L77A 3CZRA 3QP9A 1HE5A 2POQX 3ZGYA 4BKPA 2VHZA 4MIYA 2BH9A 2PWZA 3RFXA 4DQUA 4HFJA 3ZDFA 1A7KA 4Y98A 4MP3A 5HRUA 4II2A 3DFZA 1ZJYA 5BR7A 2P4QA 3FNEA 1B8PA 3JQAA 4E30A 2DM6A 2QRLA 4EI2A 4WUVA 3P7MA 5T57A 1PGOA 2Y99A 4U5QA 1H9BA 4IDFA 3GPDG 2E49A 2A4KA 1G6KA 4L4RA 4BIIA 1FK8A 5TGDA 3QY9A 1R0KA 3A9WA 4MINA 2V6FA 4WNCA 1PJQA 3AK4A 1DIAA 3DQPA 3GR6A 3IJRA 4J43A 2JL1A 1RM3A 3JQ8B 4E32A 1BGVA 4WLUA 4DMMA 3FNFA 4DWVA 3D3WB 3NKLA 1P1IA 3PJGA 1I3MA 3A14A 1GEEA 4BO9A 1I0ZA 2HCTA 4YR9A 1B16A 1MA0A 1C14A 2GYYA 1JA9A 1KY5A 4HNHA 3MJ4A 1Y9EA 4CLXA 1E3WB 1XCBA 4DQXA 5KOIA 1YQDA 4U7WA 5AOVA 3DMYA 1PJTA 3EW7A 3D3WA 3F9IA 4B8WA 1Q1NA 7MDHA 5C5IA 3H9UA 3MJVA 1R15A 3F47A 2JAHA 3KYBA 4L9RA 4ZU3A 4B4WA 3WFIA 4YYZA 1P74A 1E0DA 3WGTA 4D3DA 1XQ6A 1EEHA 3KV3O 2XXBA 1E3WA 3LLSA 1EFLA 2QRJA 4PIVA 1ISHA 3H4VA 1E7YA 3G17A 4AJOA 4DPMA 1PGJA 3UFXA 3WMXA 1WW8A 4OQZA 4LCEA 4B4OA 1PSDA 1WP4A 3DBVO 2HK8A 1CDOA 1C0PA 3DBLB 4BKUA 2WJPA 2NLOA 4E5KA 2D8AA 1PZGA 4GLLA 3OMLA 2CDCA 1M66A 1PX0A 4IS2A 4YBZA 5DF1A 3CPSA 1XDWA 4IXWA 2V6BA 3PWKA 2XXJA 4WJZA 3A1NA 5ILGA 3DWFA 4ZD6A 3LLVA 1E3JA 2VOEA 3BMCA 4CV0A 1VL8A 2A9FA 3DBLA 4IZIA 4XDYA 5LC1A 4BO5A 1DIHA 3EC7A 1X13A 3TQHA 1UH5A 1W0CA 1ENZA 4J49A 4CUJA 1KC1A 4XYBA 2P2SA 3PFFA 5TC4A 3WLFA 4BNVA 4XD2A 1PZHA 4E2ZA 4RVDA 4Z3DA 5A9RA 3OSUA 1M2WA 1Q0HA 1JKFA 5I9MA 3H2SA 3INGA 4CLHA 4IUYA 1PU2A 4EUEA 3VVBA 2AXQA 3OEYA 1BDMA 1PQUA 3ZH2A 2PLAA 1QXSA 5G0TA 4CMBA 1H94A 2DQ4A 1I10A 1SB8A 3Q9UA 3BXXA 2O2YA 3RUCA 1E7SA 2ZYDA 3O8QA 3H65A 4FC7A 4KQXA 5ER9A 5L4NA 3GHHA 3IJPA 3RSHA 4L4SA 1C0IA 1RJWA 4CMIB 1VJ0A 1X7GA 4YAKA 4YRBA 3IKTA 2D59A 3QLJA 2J6IA 1A7AA 2EERA 3VVCA 1DO8A 3PYLA 4H7PA 5JPIA 5K6AA 1UDBA 5TNXA 3VPXA 3PZBA 1JAXA 2VYVD 1EFKA 3UGKA 3AM4A 3P19A 3KSZO 5F1PA 5KVSA 5I7EA 1ZW1A 1UJMA 4F45A 4KUEA 1YL6A 3E8XA 3WGGA 1PS9A 3ZWCA 5A04A 5IXSA 4CMIA 4DLBA 4R1UA 3ZU5A 3LC7O 4GKBA 4PRKA 2FHSA 2NTJA 5TT1A 2JD1A 1P0CA 3VTZA 3VC7A 3FBTA 4YEDA 1V3VA 3ZW8A 3F5QA 4EGFA 3UXYA 3Q6IA 2R00A 4ZICA 2B5VA 2Z1NA 4MVJG 5JDIC 3MJCA 1U2GA 2AEFA 1MFZA 3KM0A 3DMTA 3VKUA 3NGLA 3ULKA 2BI7A 4IBOA 1ZO8A 1DRVA 2FWMX 3QHAA 3DHEA 3U5TA 3EZLA 1V3UA 4ITUA 5KJFA 5EQDA 1ENPA 4XR9A 3OP4A 4URFA 4FFLA 5J23A 1K2WA 3QVTA 1GR0A 3U3XA 4YJHA 1TI7A 4OH1A 5A4DA 1PQWA 3WJAA 1RKXA 2ZJ1A 1HDGO 1UXJA 2BGLA 1JWBB 5JE8A 1J5PA 1L7DA 1WMBA 3MTJA 4WPGA 5ENVA 1U7HA 2CVOA 4D0RA 4M1QA 4A2CA 5TT0A 5JYEA 1GUYA 4J16A 2FR1A 2JHGA 5DN9A 4XIJA 3WGOA 2IEDA 4JBHA 3S8MA 1ADFA 1DHRA 4RZIA 4D43A 5JYDA 3BA1A 3PJFA 4OYRA 4FN4A 4I1IA 3VDRA 2I99A 3ASVA 5TIIA 5C37A 1I2BA 1C3VA 2NU7A 2BLLA 1QYVA 2EIHA 3U9LA 3VPSA 1YJQA 5K9ZA 3ZZNA 3S2IA 4EJ0A 1LSUA 2GSDA 4WCFA 1LRJA 2W98A 3WGQA 3D3EA 4H16A 3RUFA 1HT0A 3E03A 1JTVA 2WMDA 3ZN2A 5JNLA 1U8FO 4EUFA 3U4HA 2E6UX 2RCYA 3WIEA 2P9GA 2Q2VA 3JQ7A 3AFNA 1PJ2A 1SOVA 2W8ZA 2IDZA 1Q0QA 3SJ7A 1FDTA 2B4RO 2YQ5A 4JCOA 2UAGA 1PGQA 2PZMA 2C7VA 2X22A 3MZ0A 1GV1A 2X4GA 3AY7A 1D1SA 3IIEA 3MOGA 4B7CA 5IAAA 2W4QA 3E5RA 2Q4BA 4G81A 4RPHA 3OH8A 1OOEA 3ZV6A 6LDHA 1P1KA 4TZTA 4KWHA 2VWQA 2E4AA 2NV6A 1JKIA 1UUFA 3PLRA 1WPQA 4G2NA 5EQFA 2YW9A 4CMJA 4ND2A 1HDCA 1NXQA 1GQQA 1KVUA 4J1QA 3QV1A 4DRYA 1F8GA 5KNLA 1MUUA 4NH4A 3KB6A 4E5YA 1ZXBA 2ZB3A 4JK3A 1K0UA 5DCUA 4ZQGA 2GERA 2DLDA 1X1EA 2G17A 4Q9NA 3O4RA 2AEJA 5G0UA 5CPFA 3D4NA 3JQEA 1PJCA 4GX5A 4RF2A 4D42A 3OJOA 4Q3CA 1A5ZA 5DCYA 5IFLA 3DOOA 1NPTO 1Q7CA 1KVQA 4WE3A 3VKVA 2DBRA 5HS6A 3KYDB 2W2LA 3SVTA 4GI2A 1T1SA 1YDWA 4MVJI 4BUCA 4XQCA 1ZIDA 2XAAA 2X58A 4HX5A 4BKOA 1XSEA 3DTTA 3TJRA 2Y0EA 2WYUA 1X7DA 1Y8QA 3WBFA 3VDQA 3WBBA 4IJUA 1IPEA 3AI3A 4MIEA 3GEDA 1AN9A 4U6QA 1QLHA 3EUWA 2XPCA 1M6WA 5A06A 2UV8A 1XEAA 3PDJA 3E5MA 5ITVA 5I7SA 4KUGA 1LSOA 1XA0A 1ZZEA 2VN8A 1BW9A 4MP8A 5IXYA 1I01A 2RH4A 3PQFA 1QYXA 1CERA 2C54A 2PGDA 3WGHA 1LRKA 2EWMA 4CV2A 4UEJA 1YB1A 3AOGA 1Z7BA 1NR1A 4CODB 2FZEA 1KOLA 2Y1OA 4ZA2A 2DTDA 3DHNA 4FD3A 1YL5A 3T7EA 2Q1TA 2IYPA 3ITKA 4EITA 2AQIA 3ONFA 1OFGA 4RVSA 1Z45A 3RD5A 3UUWA 2BGMA 3KRTA 3ZHXA 1VSUA 3OQBA 4AJLA 1B8VA 4J4TA 4TROA 2FPPA 5IJZA 9LDBA 1P33A 1MG5A 4IDCA 1HRDA 3FTPA 3ICCA 3NJ4A 2X5KO 3UKOA 5L9AA 2P4HX 1KVTA 1JKJA 2TMDA 4IJVA 4GPD1 3EHEA 4BNFA 3HFGA 2YDYA 1QMGA 4GSLA 1LLQA 3VH3A 3VPGA 4RPJA 5BSHA 4Q3BA 4UULA 1E5QA 8ADHA 1UXGA 2EF1A 1CQIA 1WAMA 1U4OA 1YB5A 4EEZA 4TQGA 1DFGA 4GVLA 4A5OA 5TLSA 4IGEA 3COSA 1GU7A 3HDJA 2C82A 1GY8A 1F12A 1G0OA 2EP5A 2Q46A 4QUKA 4WOJA 5EMHA 4R68A 3PVZA 3TF5A 4OAQA 4YACA 2IEBA 3GGPA 4E5PA 1HLDA 3TOXA 1BMDA 3FF4A 4YAIA 4CM4B 1E3LA 1RM0A 3R6DA 3ZWNA 4M86A 1DLJA 1MLDA 5JW6A 2OHXA 4EBFA 2NQ8A 1KBZA 1GV0A 1SO8A 1CJCA 3WMWA 2IXBA 4FFRA 3W4JA 1B15A 4DIFA 2O4CA 3I5MA 1I33A 4BO4A 5KVQA 4YJDA 3M1LA 3JQBA 4RVHA 2CZCA 5H81A 4YJFB 3R3JA 1U3UA 3C7AA 5JCJD 2NUAA 1LQUA 4J4BA 1SOWA 4RF4A 1ZK4A 2HO5A 1C0LA 4MVJH 1S7CA 3RKUA 5JDCA 1NPYA 2Q2QA 1YQXA 4WEOA 2JFHA 3GGGA 1YXMA 1QV6A 3ICPA 4QO7A 2GZ1A 1NNUA 4OJNA 4A27A 5BNTA 4UREA 2AMFA 3GMDA 3ZNNA 2EW2A 4KZPA 3RJ5A 1VJTA 3QVSA 3RUDA 1D8AA 4I5EA 4OQYA 2PH5A 2OZPA 4S1VA 1GD1O 3SX2A 1AGNA 3QWBA 2JCVA 4PVDA 3AU8A 3E9QA 1CQJA 4KOAA 2ZIZA 3I3OA
chains in the Genus database with same CATH superfamily
1DQSA 1SHZA 3MNFA 3QEKA 2W4MA 2PYZA 3DVQX 4OIMA 2VHXA 4F8JA 5EJEA 4FHCA 2OHHA 3SBEA 2F3RA 1XZFA 4MQUA 4Q9AA 5FQNA 1AS3A 1JFFA 3BIJA 3CA8A 3OEHA 1JPNA 3PPYA 4ENWA 2QTZA 2QX4A 3CW8X 3ORHA 4UXIA 1N8NA 1T3GA 3PE4A 5HFAA 1E6MA 4G8JA 1QQAA 2LPMA 4LV8B 3NATA 2AHRA 2VWGA 1SQ5A 3AONB 1EDEA 1PK9A 3GCWA 2C9ZA 3MEQA 4I46A 4PC3A 5I5GA 2AOTB 1TQ8A 2V54A 5DH9A 2P9JA 3I6IA 5CVDA 4O33A 4OH7A 3QJGA 1IG0A 5GONB 3B2EA 3PQ8A 1MRSA 3I9KA 5IYZF 4WV3A 2YJGA 1AOXA 1Y7IA 3ASYA 4A8JC 2SNIE 5GY7A 1E99A 4TKLA 1K8QA 2Y1KA 3DBHA 3GUZA 4B44A 3LNTA 4M83A 3BYZA 1IB6A 1VG1A 1HL7A 3KE9A 5K8LA 1SVWA 4FMBB 3T3MB 4EF5A 2EF0A 4TM8A 1LSJA 1E7QA 3NHMA 2FFJA 4MJ3A 4TTPA 5FTKA 4LF7B 4V0NA 1FPMA 3IAS1 2RB4A 3F5FA 4N5HX 4OHUA 1SA0A 1WLYA 4NP6A 1TB4A 1KP2A 4PCVA 2DOKA 5A9SA 3TPCA 1D1TA 3WRVA 1CD5A 3FAKA 4WWHA 4IFEA 3FJ1A 5JHHB 2ZT6A 1GYQA 2FQWA 3LPMA 4IP0A 3T9EA 4JI4B 2HJVA 2IODA 3QEOA 2NMVA 2F9LA 4G5HA 1WNFA 2XB4A 1R0RE 1TJPB 4N8EA 5FYQA 4EG4A 2QLMA 3H5NA 1KEVA 4D9KA 4KR2A 1OXKB 2WJWA 4IOJA 3G23A 3TFQA 3I64A 3FB1A 1G5HA 3DOEA 1SQFA 3GRVA 4MKRA 2CYBA 1LW6E 3MJSA 4OHMA 2QEQA 2V6MA 5CG1A 3LSYA 1RWPA 4K7JA 1QHGA 3FAZA 3JCZA 2QL7A 1T34A 3G8AA 4Q03A 3L7YA 1WD7A 4KREA 4CM7A 1P80A 4QDJA 1Z7GA 3RVQA 3LLCA 3L6CA 3EGVA 3M4ZA 3N7TA 2BUBA 4RVOA 3NTLA 4W1SA 3D7KA 4C4AA 1EQUA 5JAPA 1TW2A 5DYYA 3K8QA 1CZUA 2WM2A 4U2BA 2HRBA 1EUDB 1SD5A 3RSGA 1P81A 4HAYA 3P9PA 3HL4A 3HXOA 5TJ9A 4BATA 5EN4A 3DQQA 3MWGA 1NUAA 3LRPA 4G1CA 1YO6A 3L4SO 1YH3A 3QKIA 1QG6A 2GCPA 4KMRA 4ZALA 2DEUA 3IEKA 4QA9A 5EP1A 3C98A 4BGVA 1LNQA 4P34A 4R41A 4IZOA 4YAEA 1P3Y1 5FOUA 3HUEA 1YONA 2I4OA 4UZEA 1SKAA 4R0VA 4ZCMA 5B3KA 1KJYA 5U1PA 3LYLA 1GTVA 1EAYA 3C45A 5T6BA 1HT1E 1QIDA 1XZIA 4E7PA 1VLLA 1FBNA 4XJTA 5ELLA 1R0YA 2O2GA 4DEYA 3L5KA 3D7NA 1W76A 3KAQA 1P2TA 1QHNA 1Z38A 2ECKA 1GTMA 3RC2A 3SCZA 4RHEA 3GGOA 2QN7A 1TU4A 4DS3A 1O6GA 3RASA 3W90A 4LSMA 3HR8A 3DNFA 1N6NA 3G9UA 4EFLA 5JWRA 3HEBA 3IAEA 3LY7A 4JBGA 4JBXA 4U5XA 2ZJAA 3LE8A 3CNLA 3TSOA 2JFXA 1SXJE 4TKUB 1M6VB 4WKBA 4GLJA 1S89A 4XQEA 5HIJA 3L82B 2IVZA 2ZRCA 4X8MA 1V4BA 5A1TA 4US2R 1I2DA 3L1JA 3A1CA 3QOXA 2ESRA 4OKNA 3X44A 5BUQA 4LF8B 1KY3A 1SKYE 3QQ5A 3BGIA 4IJKA 4B81A 1KFEB 2F6RA 2GEJA 1PNVA 5DRTA 5DHTA 3EASA 4RKYA 4AJKA 5M34A 1J1IA 1KZYC 2E4UA 1UT8A 3OFJA 1PUIA 1KAEA 1LBIA 1XEXA 3N2NA 1FDVA 3N2ZB 1CJUC 3VPAA 2O7NA 4PZYA 1I6KA 4NOMA 1X9IA 2GO7A 5LB2A 4EHDA 3Q4GA 4GUDA 4RSHA 1CUJA 5L8VA 1B8OA 4ENRA 5IKXA 1TUIA 1NASA 2QAGB 3KJFA 1JEJA 4TV8B 3RQIA 1FXWF 4ZCIA 1YR2A 2XADA 1XLTC 2ZJ5A 3R23A 2WUEA 2XOKA 1JQDA 1N9GB 1UFOA 1UKYA 4G1FA 5H4GA 4F38A 2TRSB 3S1LA 2XT0A 3GUHA 5KUTA 1LDNA 4A23A 2OWEA 4GHWA 4D26A 4R83A 3W8EA 4OHXA 1H69A 2KLHA 3IODA 3P9RA 1SXIA 4EY3A 4F93B 1SUFA 3LS2A 4JUBA 3WQHA 1EK2A 3RODA 1SCKA 1TAQA 3KQMA 2BLNA 3VJKA 1HNZB 5B37A 4H3KB 2WDPA 5E7QA 2NP6A 2Q4RA 4YMSA 5DHQA 3IXMA 2Q62A 1X1TA 4GBGA 3MUOA 1P2DA 4XIYA 1V8PA 4N5IX 2ZATA 2J9FA 4X45A 4D9IA 3JQDA 3SJAA 4IJWA 1T0HB 1N6RA 2GPNA 2ZBGA 4EW6A 1M7GA 4RSRA 2ZRKA 4OOFA 3O1IC 3CWQA 3WWZA 2O5CA 1ZEJA 4F1JA 3ND5A 4NYMR 5ESWA 1I2ZA 1PFVA 4N65A 3D6JA 3ROMA 3UBTA 1W4BA 1OU0A 1E59A 5ALGA 4UTPA 1TEZA 4W7SA 2X8LA 5L40A 2VT2A 4CG1A 1XVUA 2IQIA 4XI9A 4LJ5A 3P4XA 4NAHA 1KY2A 2ZAMA 1ZNXA 3F5MA 3O8NA 3PPVA 4O4JB 4AM8A 4BZWA 1EYZA 4AKIA 1RXEA 2X2OA 1YUMA 3GLQA 3ZU6A 1ODLA 5HUJA 4YRFA 3RREA 4C4PA 4UHHA 1PZNA 4Q9DA 5IHXA 3TFWA 1K1EA 1ZSVA 2IHTA 3HVHA 3N0TA 2D5IA 2Z9DA 4X1OA 1B3RA 2XDQB 3OE1A 3ZW7A 3VHRA 1VHJA 2XUKA 3ANSA 2R6AA 3EEYA 4FYJA 2AKYA 5EKXA 3RRFA 3UENA 3NIGB 3ZWWA 2ETXA 2BY4A 4U2EA 5EE0A 4FKMA 1FSFA 1E61A 1K6JA 1UBGA 1GP2A 1Y48E 1LPOA 3NYQA 3FNRA 4UOEA 1RRFA 2YZ7A 3E0XA 3U09A 2XVAA 3DE6X 3T8YA 3LVBA 4KDRA 3HB5X 3GRCA 3QPCA 2DMRA 4PICA 4RV9A 2Y67A 1DBQA 2CYCA 3K92A 4CV3A 3LTNC 1QKKA 3RIGA 5KPJA 2ID4A 3C24A 5GIPE 1L4HA 4DUYB 1QYRA 5KAMA 1YOBA 4JGBA 1HYEA 3LC0A 2XCLA 2J31A 3MF4A 1VJDA 1L8LA 2GMWA 2COKA 3EXHC 4D4IA 2ZSAA 1IHXA 3A4NA 3CLVA 1Q91A 1SAYA 3F7TA 1E3MA 3BB4A 3QOWA 1Z33A 4DEVA 3PDUA 4M1MA 1A4UA 1WMAA 2UYOA 1WUHS 1F2TA 4FJ1A 2PX2A 3UUEA 4DC9A 3MB5A 4JI7B 1Y9AA 1Q44A 4KYIB 4HRVA 1USIA 3BTVA 4BZPA 4ZQFA 4YRNA 4X44A 5F1OA 1DT3A 2XUHA 2ZRMA 4KQJA 4TT3D 4UE6A 1XZDA 3DO6A 3MYYA 4L07A 1ZSYA 4XFKA 4EA6A 3RS7A 3T3GA 2FVXA 1UFKA 4OFZA 3I6QA 1PSZA 4H1HA 3SHQA 4BNZA 1M6NA 4QOSA 3HV0A 3LX4A 5HWSA 4TN1A 5ALQA 4LI3X 4YO8A 4X94A 1Q0SA 4NE7A 1CJKC 1UIRA 4DV0B 2WABA 5A5EA 1Y80A 3L2OB 1A5TA 1QMPA 3O94A 1KP3A 4PEVA 1O94D 4AJEA 5JZBA 2BEUB 5ENZA 3QMPA 3EFOB 4HMPA 1TT5A 5EESA 1CF2O 5LQCA 2UXCB 1FZTA 1KI4A 4MS3B 2VNSA 1NV9A 1XO1A 4TQUS 3SNHA 4G0WA 4KMMA 4YYEA 4HVAA 3LHKA 4G5YA 2JDIA 4MROA 4Q4JA 3OWXA 3QVOA 4KW7A 5LCXA 4F4FA 1NI4B 3U2QA 3WLPA 2X5NA 1DNPA 3E3NA 4OUDB 3WK6A 5A1JA 2AFRA 1LLFA 1XT6A 3FYCA 4FSDA 4MA5A 4Q00A 3AUKA 2OFFA 4QG3A 1M0EA 1J7JA 2PL9A 1H2HA 3P5SA 2F67A 3LM8A 4HUQB 4KX5A 1SC1A 4NTZA 2PTGA 4M89A 2CFCA 5JJBA 2ZVDA 4BNXA 2DPXA 1QAMA 3F67A 3RJ9A 3VO2A 3ZX4A 2PK3A 3K6SB 1GIAA 5A3QA 3A6JA 5FBRB 1YNOA 1NHGA 3DP9A 3A6GA 1S2LA 4URWR 5GOTA 5CEFA 1RHQA 2HBRA 2NSJA 2J0UB 2QVYX 2WJIA 1XYGA 3B1FA 4OI0A 2AOVA 1GPKA 1ISIA 1JEAA 3RIHA 5JQWA 3FHCB 4F06A 5KYKA 1WDLA 4TSRA 4N3BA 1U3DA 3FTCA 4BQFA 1KQGA 3W8FA 4GMXA 3LQYA 3HHPA 2HLPA 4X61A 1CS0A 1E64A 3B3FA 1X9GA 4JMLA 4ZRNA 2O8EA 1M2VB 4D9MA 1TYZA 2F9MA 3JRWA 2PZGA 3LCVB 2QI9F 3O8LA 4AP9A 1DC6A 4DT1A 1RWQA 1C3OA 5BSFA 2ADFA 2WWFA 1R2QA 1XMVA 4IKPA 3W6OA 4ZKDA 3UJAA 3PJDA 3SZOA 5BWNA 3BCUA 5LP1A 4RGVA 2R8OA 4RPGA 4O8CA 1A04A 5ESXA 3VI4B 2GZDA 1XP5A 3FZNA 2GR9A 3Q6NA 2P9ZA 2Y1GA 1IIRA 2Q7XA 3CO0S 3P1JA 3LQ2A 2ERYA 2Y0PA 4ZVNA 2B83A 2OHOA 4X0EA 1FLNA 3GRUA 4YRPA 1U0BB 3O1JC 1VL6A 4ISBA 1A95A 1VG0B 1GARA 2AG8A 2WQZA 3V8NA 2DXIA 1N5DA 3MMZA 5I7AA 3V4PB 1G18A 1LH0A 2DUNA 2JHCA 1PK7A 3KFLA 4Y7CA 3NKVA 3UICA 4I55B 4ZV7A 4NC9A 3SZUA 1JQEA 2PXXA 4CF4A 1G64A 3C0KA 4HI0E 1DL5A 5BV1A 5DASA 1DKOA 2GVNA 2HA7A 3LQKA 3C1UA 3CY6A 1EDZA 4QO8A 5K6TA 5KYUB 2M1ZA 4GW3A 4GRIA 1DE0A 4M2LA 3EXEB 1WXEA 3KKEA 1KDPA 2MMCA 3SKXA 3TOVA 2RBEA 4NENA 1YZKA 3I6ZA 1NJ2A 3KXIA 1J25A 5CVCA 2ZEJA 2O3SA 4WZAB 1UDWA 3TMYA 1KK2A 4KB5A 2HLNA 1M34B 2C5EA 2B8JA 2ZXUA 1ISJA 1BD4A 1XRJA 2R25B 1ISFA 3MTDA 4HZUB 4Q1VA 4RDXA 4LXHA 1Y7HA 3SE7A 4F3NA 2PKCA 1N1EA 4GXQA 4RV4A 4YWJA 1MCZA 1N0WA 5A5FA 1M2KA 2JBWA 5ALJA 5JCJA 5HZKA 3SF0A 5K0FA 3FM9A 3FMVA 3R7BA 5JXGA 2GDJA 4OXRA 3ZIDA 1TF2A 3DUFA 1BRMA 1GYRA 5BWBA 2FF7A 2MSLA 2OP0A 3I28A 1KGDA 1G8PA 1P2UA 1RXIA 1E79D 3MSXA 3F6YA 3LK6A 2X14A 3QU7A 4XASA 3V1KA 2DWOA 3C7TA 1ZICA 3PUHA 4OHRA 1L4YA 5AKLA 2PS0A 2X9GA 1QS0A 3IUEA 4GG1A 4QXMA 4C5CA 1JJFA 1N1MA 1Z0FA 2CFRA 4YVFA 3RSLA 4NEQA 3I5YA 3EA5A 3QIVA 3BERA 4HZIA 1VG8A 1R4ZA 1PLLA 2V96A 2YZ2A 3A3KA 3MN1A 5EJ2A 3ZS8A 4CKEB 4D3SA 1X1CA 5KKCA 1NMEA 1LB1B 3PNMA 4ODIA 4KXFB 3RG2A 3DZJA 1MQAA 2JJ1D 3D4LA 1W44A 2J87A 3MJTA 1BJRE 1II0A 2E82A 4Q9LA 4WNAB 4KIUA 4KYUA 1NYLA 2WAAA 1SC6A 3NAQA 5AKIA 3UA3A 2PKQO 3FPSA 4DXAA 2ON6A 3GCDA 3PQ6A 2PSSA 2YFHA 4MEBA 2PIDA 2WD7B 2C4VA 4EHAA 3T7JA 4FLEA 1H4TA 1SVLA 1ZA1A 1T1JA 3AESB 4MYSA 4O2BF 2I2XB 2D13A 5EZYF 2G9VA 3EY4A 4CRWB 3HU5A 1U7TA 3WO1A 3D1LA 1DWPA 3FMPB 4OOEA 4BNKA 1X1AA 4J16C 3R7NA 4L0DA 5EMMA 5A02A 4CZ2A 1JDBC 1S2DA 5BSEA 2IDJA 2BIFA 4OA5A 5A2QA 3K0SA 1US8A 1FSZA 3GRPA 4S35A 5B36A 5FAXA 2QR3A 1KVRA 1XTJA 2XCOA 4LDZA 1SXJD 1Z08A 2JGEA 2BOVA 1NXTA 2HRRA 2XB8A 3TXYA 3IIJA 1T8SA 3QYJA 5EHIA 2VRCA 1O95D 1AO3A 1T4CA 3P2IA 3KETA 2FPIA 3DD1A 4RJJA 3CINA 3CUKA 4UU7A 2PGJA 4HGRA 5HDQA 4FCWA 4LXIA 3JQRA 2C00A 3GFGA 3P0IA 2FN3A 3Q7QA 4J0DA 4QUJA 4JYAB 4BFSA 5AKZA 5HOEA 2Z56A 3BRSA 4YRGA 1IATA 3VZSA 2RGBA 3DZIA 3ZX5A 1CVLA 2EBUA 4JSYA 4BO7A 1H3EA 3AJEA 1II9A 2IZZA 3HG7A 1GSOA 1I3NA 3IIIA 2P2CA 4RA9A 4XRRA 4S0XA 3WYFA 4FX5A 4PTLA 2I66A 4K6GA 3T4XA 4GWGA 2JIZA 4R98A 1CR2A 1JEYB 1VJCA 2PL5A 5JC8A 4A15A 4DBVO 3B1YA 2YMLA 1XXHB 4G85A 2Q6TA 2ID9A 2GRJA 1E2QA 4EMBA 2JLXA 2GZHA 3AM5A 1KYIA 2W6QA 5SZJA 2ASVA 3GPBA 3OTIA 4J4HA 1JU4A 4D8XA 3FRJA 1ZG3A 2XH8A 1I3LA 3AH8A 1VPTA 3URMA 4O29A 3BOSA 2ENWA 2GGSA 4NBLA 3NDJA 4ZTBA 5G3YA 3RROA 5J58A 4TQ9A 3SC3A 1SXQA 4QWMA 3USZA 1J5EB 3CE6A 3PQ7A 4UQLA 3WYCA 4MS4A 3HR4A 3PHIA 5DU2A 5DCWA 4F5ZA 4HOYA 2JEOA 4UEKA 4HDNA 4NBNA 4LF5B 4ZYTA 4CHTA 1F3LA 1XYVA 4FOLA 4NV0A 1KAOA 1SUEA 4AUNA 1IM8A 4DCJA 3FUUA 1LTKA 1GADO 2QDXA 2VBGA 4QARA 4MJ7A 5AJXA 2C59A 1TTQB 1VYTA 1LDYA 1CHDA 3DMNA 2WM9B 4HGQA 4V03A 4HWTA 4L5IA 3UATA 3IMFA 4CT4B 3HPRA 1PT5A 5CA1B 2DQYA 1VLZA 1XF1A 4TLLB 1KQNA 1CYEA 4QUIA 4O4IB 5IX8A 4PLZA 1XR3A 1YKFA 1RRKA 2G0AA 1ZBQA 2BFCA 2J85A 2XMQA 1NW8A 1P91A 2L69A 3I4LA 1JDJA 5HIMA 2D2IA 1SHJA 3U4CA 3ROPA 2BMAA 1YQEA 2QRKA 5KOYA 2WTBA 3KU4A 4MIOA 3KZVA 2D4HA 5BSRA 4CI0B 1I9CA 3O9ZA 4UFPA 3I2HA 4OM8A 4MO2A 5DWVA 3ZWPA 1V37A 2OSVA 3BRWD 3GBPA 3PKZA 1BWPA 4HVCA 4DVGA 1EWRA 1TC1A 4W8GA 4LNUA 3MT9A 1XZJA 4A0RA 2FUEA 1PR2A 1QVWA 4EF4A 1ZX1A 5BXYA 4JLBA 1XWFA 4WCDA 5H80A 2C31A 1IY2A 2PPLA 3MCZA 5F64A 1HE3A 1RXWA 1WL8A 2QTHA 3F78A 3WVNA 4F96A 1YVPA 1W85A 1X6VA 5DNDA 1OAOA 3M6XA 1H93A 3DNMA 3EOZA 1CUCA 3N74A 5JAOA 4DL9A 1V7CA 4YLGA 5F73A 4IJQA 3ZGLA 1ZH8A 1FW8A 2ZBUA 5IJWA 4AF7A 4O3FA 4Z4IA 1AY0A 1QM5A 1NWCA 3PGMA 4DZRA 2XUGA 3NHBA 4DMHA 5ITSA 4MR8B 1OFUA 2ZT7A 2Y9PB 1YRQA 1PZMA 3KCNA 5CM8B 1PYDA 2ZR0A 5EE3A 5BNFA 4ARVA 4F92B 4JT9A 2Q3DA 4MV9A 3GDOA 2Q0XA 1M5RA 4PZLA 4N39A 2OQ2A 3C3EA 4Z99A 1ZL2A 2AG5A 4U8HA 2P9QA 2ZE6A 2WPDA 1HQYE 2QR5A 4HAUA 4A10A 1XWWA 1HX7A 1EFTA 1RQLA 3KX2A 4R4JA 2NNWB 3MLAA 1PFKA 1WABA 4URZR 2GCEA 4XJXA 2VHJA 5KNDA 3AJDA 4G1MB 5AIBA 1F60A 2H1OA 1D9ZA 3AUTA 2H1LA 4KHZA 2O07A 5DHAA 5AHOA 1ULZA 1WD5A 2AF3C 5DOVA 5H83A 3VR3A 1IUNA 4BECA 2WDZA 2C5BA 5JJ5A 3EXIA 2Q3FA 2QNIA 4ZVVA 4IWNA 3LL4A 2WNSA 3NQ41 4IXTA 4CDGA 4WXYB 2TMGA 4S0ZA 2EATA 1ODSA 4MW1A 4MKHA 5CB4A 5BV8A 3KVRA 3NWOA 4K9QA 4Z1OA 1JXQA 1P77A 2D0IA 4NABA 1HR0B 1IJBA 1GUBA 2R79A 1EFPA 2Y93A 3GWZA 2XF8A 4V38A 4GOJA 3SQMA 5MN5A 1T26A 3DFUA 4YIKA 3S2SA 2RH8A 2XGGA 5HGJA 4ZHQF 4XLTA 4HEA1 3H9JA 4IHQA 1O08A 4KPEC 1UZLA 1P1BA 3IAAA 4JBLA 4YJFA 1I36A 2XB9A 3IA7A 5JS1A 2QSUA 3LVFO 4QGBA 1J09A 1JAZA 1FFGA 1KMHB 1HNWB 2BWJA 2WT4A 2V7QD 2WG0A 1M74A 3O21A 1CLUA 3K70D 4X6UA 2MSKA 3GZNB 2E3JA 5EIXA 3E1KA 4LJ8A 2HJRA 2OPBA 3CVOA 5EE5B 3L6EA 3H8SA 3HCPA 1E2MA 5KPDA 1YU6A 4EEKA 1LFAA 4OI1A 6Q21A 2J30A 1RDFA 4OPMA 1B00A 1VI2A 4GMDA 3VH1A 2WF7A 5HKOA 4O6VA 4ASUA 3JQPA 7YASA 2PQ2A 2NACA 1A7JA 3GLUA 3H87A 1I4OA 2Q6LA 2O48X 3GDGA 5FA8A 4ME6A 1CDZA 3SBOA 4DXDA 3ZDCA 5T41A 5JS6A 4Z0NA 3LYUA 1KR5A 4HB0A 4I81A 4D8UA 3BZBA 1SVSA 5A3VA 2BBOA 1GPYA 1KJ8A 1QANA 2VZEA 1DKLA 2J6CA 3ICWA 4GE0A 1UR5A 2GAOA 2GK7A 3HA2A 4L8WB 3KO8A 1HE1C 5MN6A 2GYUA 2DYKA 3B6MA 1NI3A 4H7KA 1PEDA 3S1AA 1P1JA 1M75A 1TZKA 1ZP6A 3MHPA 1HURA 1Z6PA 1FVFA 1JT9A 1NZJA 1QR2A 2AX3A 3EGXB 1B2RA 1XMSA 2YHBA 3C5HA 2P9HA 2B25A 3F9CA 4MV7A 1MORA 2J41A 3ED5A 1KAGA 2IUEA 2D2FA 4A4DA 1K8ZB 1NQ5A 1GQ2A 3AEKA 2GNAA 3O91A 4WINA 4MWBA 4O3MA 1ND5A 4CN9A 2C9DA 2PUBA 3MJRA 2H06A 3K2IA 5HM6A 2CVQA 2Q49A 3RADC 3RYCB 3CCBA 1TTTA 3O0DA 4TS3A 3VZDA 2AOWA 1BCSA 2HW8A 1YE8A 1WS6A 2FLVA 5JBNA 3JZFA 1YQTA 2O2DA 2AOTA 1AHHA 3OC6A 5AW3A 4F21A 5JPDA 3OTGA 1HUQA 5EJ5A 1TCBA 2OXRA 3DTVB 4EJSB 5KDOA 3NBUA 1I2MA 3AUAA 4CIDA 4RSGA 5D00A 4LOIA 1WKCA 2WILA 5AQ1A 4B73A 3HFJA 1LDMA 1XMPA 3V2UA 4AKHA 4BGIA 3JXEA 2V9ZA 4D3YA 3EYWA 2A57A 4ENUA 2HMWA 1QFSA 3LCUA 2C96A 1X2BA 1TUGA 3A4YA 3IAFA 1OREA 4G6ZA 1TGYA 4N47A 4UTVA 2G6TA 1CZLA 2UUOA 1CR1A 5FP0A 1T2EA 5KVVA 3F8TA 1P0QA 4FJ2A 4FP9A 1HKUA 3FBGA 1YS7A 5EJMA 3RHTA 1GCGA 3OE7A 2GXAA 5E4FA 3A4TA 4QGHA 5TGTA 2IYRA 2RHTA 1CBUA 1P61B 2IP2A 4H77A 1IM5A 4YT4A 5A0FA 3KPJA 4EX7A 4KGDA 3K9GA 3KOXA 4YMGA 2HBZA 2QRHA 2XMSA 4BFTA 2HNBA 4Q7QA 1QOZA 3L40A 1BDHA 1N8KA 1KQFA 5DO9A 2X6TA 4U7GA 1FS5A 4W5QA 4HWRA 4L4ZA 5E38A 3E3LA 3VOBA 3FMGA 2VDMB 2X7HA 1FP6A 1PL7A 2CF6A 3P2YA 3BWXA 3I01M 3BQ9A 5DGTA 1J0AA 4U2CA 3UK2A 3ZHQA 1M2NA 4JL5A 1G7CA 1W30A 3FNGA 4MKIA 4NI5A 1NW9B 1SXHA 1NJFA 3RTGA 1CY2A 2P68A 1AKUA 3FD8A 2GN9A 1GRCA 3KJNA 5DYIA 3UWMA 1TVKA 3BAZA 4N3AA 3Q2OA 4QTUB 3SS8A 3WKDA 4B6RA 4BX0A 5ILOA 5K45A 2EJBA 1Q1ZA 3COZA 1XMIA 5TEWA 2X7XA 2W48A 4MDHA 2JFZA 3RRYA 3W5SA 4YUVA 4XA8A 4Z49A 4MTCA 4X65B 4OB8A 2A5YB 4BQRA 3IILA 4DJAA 2IKQA 3ZKWA 3DBRB 1XCPA 1PAUA 5ALZA 4JIMA 4WECA 4JI3B 3EIOA 3GCGA 2GAFA 3D81A 1YB7A 3HVRA 4P08A 1NZDA 2AFHE 1D2HA 3EPKA 4GEKA 4OYLA 1HFWA 5ICSA 1F14A 2ZVJA 4I6GA 3HWX1 1X1DA 4JFAA 2BFEB 2NX2A 3HI4A 2PGIA 3G0IA 1CRPA 3NGMA 4N5DA 3PSHA 4TWRA 4NSNA 4WSOA 2JFUA 4DV2B 5AM4A 9GPBA 1B2LA 2J45A 1JLHA 1VFPA 2CLHB 2JHAA 2O06A 1IY9A 2RONA 1TXGA 3Q3JB 3ZCSA 3UPUA 3RCBA 1JQ3A 1O97C 4BN4A 3ZQ4A 2XQVA 4RTNA 4DV5B 2MR6A 2X3YA 3RF7A 4HUTA 1V39A 2PR2A 4CM9D 1GPUA 1U9IC 3NRBA 4R5HA 4G4GA 3GLHE 4QHYA 1I24A 1N5RA 3CTMA 1QCZA 4FQ7A 1GO2A 3FMIA 1T2AA 1HZZA 2AZMA 4BQOA 4M38A 1MDBA 1BVHA 2FAXA 5KQPA 1R8YA 1OD6A 3BGOS 3L7JA 1M6VA 2ZJZA 1O89A 1DOZA 2QD1A 3PV0A 1PWYE 1RLMA 1HG0A 2PEZA 4HLUA 3TKLA 1PZEA 5LJIA 4R1NA 2YHAA 4NYIQ 3LWNA 1E96A 1NAHA 3ECAA 5BQ3A 3K5IA 2XSZD 2BZ1A 1L6RA 2CFSA 3MRSA 2JD0A 3I09A 3IOMA 2ZYUX 2MYNA 3IVMA 2HDOA 1SUAA 5KNCA 1GEGA 5F2EA 1IHYA 2Z8YM 4FEEA 3QIAA 1EVJA 4KI0A 3U13A 1NXPA 4F4IA 5CG2A 4ZEWA 4Y6LA 4X6LA 4ZAYA 4US1R 1NSTA 3FNIA 2Z9BA 4DA6A 1KSFX 3IULA 5CLQA 1HNXB 5HFNA 3ODGA 1MX5A 2CL0X 2P2ZA 4TKVB 4Y8VA 3ETNA 4TV8A 4IQ0A 1DARA 3ND8A 4LXQA 4DLUA 1OR8A 4JLSA 4B83A 3OEED 1N9GA 2J3LA 4HNRA 5HIKA 3K9WA 2BKVA 2ZBRA 2A8YA 4BX8A 3D0OA 3I0NA 4DYDA 4FGLA 4AYTA 1OASA 3CLRC 5FA6A 3I32A 1GUAA 4PZ9A 2B6HA 3PGA1 1XPJA 4JY7A 3GVHA 3LHDA 4K6HA 3MUFA 4LUCA 2QIPA 1U9JA 1N57A 2GF0A 3AOEC 2G0TA 3GIWA 3JAWA 4FOOA 5EZ5A 1C7RA 5DXJA 4WN9A 2VRNA 5B2ZA 4D9EA 4K3UA 2HA3A 4LZWA 4W6ZA 3KL4A 1P1HA 3N7UA 3FROA 1P6QA 3SLGA 3OJ0A 1M1YB 3D1JA 3UTCA 1Z5ZA 4C0XA 5EZQA 2HJ9A 1SHTX 1DSSG 2HFJA 2TMKA 2WTNA 2VZ0A 4IJ5A 3AWDA 1UZUA 3PLNA 2XR1A 3H2ZA 2QVZX 4CM1A 4KH0A 2J08A 3ADKA 5CVUA 1OB5A 3RRBA 4RJKA 1EWYA 2QV7A 3A8TA 1QR6A 3A4MA 3QYFA 2D62A 4I8IA 3O38A 3QEBZ 1BEZA 2Y1CA 2FG7C 5E9AA 4TZ6A 1C30B 2QAGC 1XRNA 4ZZ0A 1V45E 3R9IA 1HTBA 3SQXA 3EF3A 2EC5A 2P1RA 2W93A 4O2LA 3PTZA 4F9EA 5CB0A 1N8TA 3D6UA 4ZYUA 3TB4A 2XDQA 5FLEX 3ZXXA 2FPMA 2Z8XA 3I8SA 1U2PA 2EKPA 2BMEA 2B1QA 1XYYA 3R75A 3HJFA 2F3PA 4R2KA 1FNSA 3DAGA 5ESDA 3RVRA 2QZZA 2P4UA 2DR3A 2D3WA 3GOQA 2QMOA 3A06A 5LDDC 1M0SA 2B2NA 3KOOA 1LNZA 3WB1A 3KQUA 1Z39A 3CLTC 2EFGA 2AG1A 2IHNA 1O2DA 1NY6A 3R8FA 3FGPA 2ACKA 2D1TA 5EHQA 2B20A 4PCAA 4FILA 1IDN1 4II7A 3I9OA 2O3TA 3UFXB 1V16B 3WP0A 2EWVA 4DNFA 3VSCA 3QVWA 2VQ3A 2ZCVA 2Q5LA 1GGKA 5BV2P 1SUIA 2JS7A 1P44A 1QHSA 1RP1A 1L5KA 1P4SA 2W2XA 2JAUA 1KYWA 1Z7YA 2C8JA 1QKIA 2FPKA 2R2AA 3L7CA 4GR4A 2ZSJA 4JIGA 1ULUA 4L76A 4OXYA 4QOHA 3WL6A 1HDIA 4CEHA 2TMYA 3GY0A 1J00A 4JQOA 2ZTUA 4B7AA 1E5DA 2FMXA 3OIYA 4YK7A 2JLWA 4DPKA 1U3TA 3KHUA 4YN3A 1VQ1A 4Z9AA 2W6NA 1NVKA 1U8XX 1W88B 2I4NA 4C03A 4ED9A 4EGCB 4MSUA 4BJ6A 1B14A 1XE3A 3MGAA 4F2PA 1I7PA 1H2ZA 4BNDB 4QU5A 5BT9A 5SV2A 3VKWA 1H2FA 4BMPB 4CMAA 1GRVA 2XWQA 4Q7MB 4XPIA 4ESHA 5IG2A 2JGLA 1SCIA 5FUWA 5KKNB 3K20A 4Q82A 2P91A 5K20A 4MP6A 4D97A 2PJUA 1ZD2P 2DECA 3E1GA 1JWLA 1QIGA 1RFLA 4UMEA 2BEUA 2ZQYA 5KIAA 3ZIAD 3U1VA 4DC0A 1GQYA 4DXHA 4L8YA 1LQTA 4BYGA 2DETA 1Q92A 3GQVA 3DPUA 1P75A 1JHRA 3HN7A 4Q5IA 1E6WA 4CVNA 4CGZA 3GRKA 1WA5A 1IYZA 4AWXA 4I1RA 4ACBA 1NI4A 4G0OA 4OUDA 1TJ4A 4X20B 2QTLA 3EVFA 2VHTA 4XQ0A 5D84A 3T38A 2VAMA 5LU8A 1H2BA 3L8ZA 5C5CA 3VUFA 2QRGA 4PHGA 4C3VA 2PL3A 5AVTA 4N4AA 3I5XA 4BXOA 3O31A 4WNIA 1IK4A 1Y1TA 5H0IA 3V8MA 5LD2B 3E05A 3TNLA 1LBHA 2GN8A 2IPXA 4RF3A 5CX1B 4C7KA 2YYZA 4RLQA 3RSFA 4J3JA 5TV2A 4R2LA 4IR7A 2PL1A 4K6MA 4XB2A 2JIQA 5LZ4A 4OLBA 2GHRA 2V59A 4NQRA 4ETNA 3QI2A 1PR0A 1RW4A 4LBWA 2PZJA 4I6EA 2UUCB 4OQ4A 3CW2A 1JDVA 4G86A 4HQLA 3WTCA 3B7WA 4BMSA 1KI2A 1H9CA 3SDSA 5LLSA 3U5TA 4GC9A 5FPTA 3K15A 3R1IA 4EHKA 4UUQA 1N2IA 2R66A 5JAUA 1M2EA 2HPZA 1EWTA 1LBEA 2OGSA 1SZJG 3AIOA 4RGQA 2ATCA 3ORFA 1MC5A 3CJTA 4G0XA 1V5GA 1ZGGA 4X3PA 1RPZA 1B42A 2VUTA 3H1FA 3T7RA 1I94B 4WLNA 1ZC4A 3L49A 3N5CA 4I99A 1PT8A 2Q2NA 3S1SA 1GVNB 1W4AA 5BWOA 1EI9A 5LDGA 1OB2A 3TSAA 2JFBA 1J06A 1NKTA 1MAWA 4UNPA 5AUNB 5KREA 3F4BA 3Q9NA 4QM7A 5K4GA 2BFAA 1DCTA 2ONJA 1NQWA 1JLLB 1JPVA 4NBTA 3EEQA 1GPAA 4GLBA 3AIIA 4ND3A 5JVDB 4FQ5A 2PBZA 1RRPA 1ZD4A 4UU8A 1ZYUA 1L5HA 3STXA 1OX5A 4URXR 5TMPA 4I55A 3DO8A 1WIWA 2ZTLA 2JFYA 3LYAA 3X1ZA 3QXXA 5C8DA 2WVGA 2HDWA 3ZK7A 4I8XA 3B52X 4X60A 3LFHA 3EDMA 3FYHA 4M1YA 5KYUA 2EZTA 3Q12A 2IXEA 4Q16A 1ZMOA 2LNDA 10MHA 1JXAA 1H2EA 1NT4A 1KJ9A 1ZFNA 1PDWA 3EXEA 4N0DA 4O2BB 4LYGA 2CEAA 5D01A 1O8BA 1JDZA 3LV8A 4G65A 3UJ6A 4QBFA 1XLVA 3ZOZA 3LF2A 5A4JA 3V2GA 4WZAA 2DUUA 3MWLA 2OMKA 2PRZA 1LDBA 3HRHA 3KXPA 1Q22A 5CW2A 1CEQA 3VVMA 1RJEA 4RM3A 1M34A 4PTZA 2GA9A 2QYTA 4HZUA 2VP4A 3B3AA 1OXVA 1H9AA 4ZO9A 3KKMA 4D1YA 4XUCA 4IKEA 4N7MA 4YPVA 1IXRC 3FCSB 2I1LA 3ACBA 4B7UA 2W7TA 2VPPA 1XBTA 1I7NA 5E9WA 4LF9B 4K2HA 4LHVA 5HKLA 2XZDA 5CW1A 4YQZA 1B3BA 2QK4A 4LCJA 2NU7B 3K8OE 1FP4B 2IS4A 2JIBA 2HZBA 4QSMA 1GFSA 3BB3A 4XYGA 1L3BA 4F72A 3JPYA 3F3MA 1DBIA 1XZQA 3CRQA 3O03A 3OHSX 3WRXC 4CIXA 2BHSA 1UJBA 4RTKA 1JAIA 3GVXA 1NQOA 1BSVA 5A3SA 3FWNA 3NOXA 4O0LA 3JQAD 2JLBA 3F2VA 2G71A 5BMVF 7ADHA 4N3CA 2XGOA 3ZKAA 2AZXA 3BIXA 1V0JA 2VCHA 2H63A 3O47A 1YS1X 1T2FA 3HRIA 3SX4A 2BFFB 1ZW6A 2I80A 5H3LA 5JZ9A 1N33B 4WNAA 5TPZD 5ECGC 4DM4A 3V6MA 3TCNA 3VRHA 2C5FA 3H7IA 4ZP1A 5ALLA 4A03A 4PFJA 2JAPA 2MTBA 5GPBA 5IT5A 1P19A 1W0JA 4I5GA 1ZN9A 3ZWAA 2Q3BA 4U8GA 2FHPA 5F1KA 5FIUA 2GWHA 2WD7A 2YWRA 1Y6FA 1IH8A 2HAEA 3AESA 4WBSA 1PR5A 4GMFA 4NXNB 1E92A 2VATA 3D02A 4KXUA 1K7XB 2QY9A 3LI2A 1U9CA 4HD8A 2LDBA 2W37A 3EIUA 3R0IA 1VE9A 1ORWA 2IELA 1EVYA 2HK7A 3GHYA 4L3OA 2RHOA 4MQLA 1QGYA 1FFCA 1KEZA 2PSHA 1N7IA 4RD4A 3UJPA 3KQOA 4YRDA 5B1SA 1T5SA 5CH3A 5C3UA 2X3FA 3UJCA 5K0TA 1S01A 4KNVA 2EEPA 2AF4C 4BZXA 4MW0A 4K8RB 1C7QA 4IIDA 5G40A 2I2BA 4CUZA 4XDHA 1STOA 1X3SA 3EPPA 4HAXA 4HQKA 1HPLA 1VLMA 3FTEA 4TXMA 3SYLA 2HO4A 1V26A 2XUAA 1TD9A 1OMOA 3CGWA 1NN0A 3H83A 3HCCA 4R8VA 4NG4A 4EA7A 1NQTA 3V9PA 4E51A 3TVTA 5KYYA 2FZGA 1AS0A 4BNUA 1VKRA 3UQYS 2AG0A 1CB7A 3NYIA 4FVTA 3K70B 3CNQS 2VI5A 3CNEA 1KZ6A 1YZFA 3FB4A 3NJRA 3QXHA 4FFVA 5IM4A 4TX1A 1U63A 4OI4A 1U0GA 2QLNA 2WE7A 1F9EA 1ULHA 3B53X 1JNXX 2QPAA 2AEMA 1PWXA 2VKQA 1W35A 4HNAB 4CIWA 1JEYA 5HTKA 2L42A 2FVYA 2ZDGA 1XXHA 4MV3A 1QFXA 1SM4A 2WU4A 4JP1A 3HU1A 1Y8QB 1DG9A 1QLJA 2A92A 4AICA 2I4MA 3P9IA 1FJHA 2JLZA 1TQDA 4XD7D 3HSSA 3IAUA 4D9HA 5LB4A 4DPLA 2VPXA 1U6IA 1G8KA 5FFFA 1LS6A 1B0ZA 2H48A 1K86A 2BMDA 3CQ9A 3HYTA 4F71A 3K09A 3AUFA 3VNSA 3UW3A 3CX7A 3HJHA 2CJFA 3WWEA 1KIMA 2DFPA 4QBIA 4Q1EA 3KOWA 4RJTA 2RIRA 2I7CA 2VNHA 4NBVA 3AKDA 3WAGA 1M0WA 2R60A 3QTLA 1RRMA 1X8JA 2HY7A 4OUKX 4QUHA 4LV5B 2XOEA 5C8ZA 5K0CA 3X1WA 3U4MA 1ODFA 2BDUA 5KNDH 3A1WA 3C87A 3IA2A 3CF4G 4PSAA 2VSNA 4CKBA 4WBXC 1PFUA 2DZDA 3PUVA 2RBGA 1Y4AE 5FWDA 2ZAGA 4OX9B 1ST2A 4F7WA 3A6HA 3SEZA 1G2OA 2B2CA 1L7MA 1JR3E 3QUSA 4I3FA 1E94E 2MR5A 1E3QA 1DBVO 2VDUE 5AVKA 1VIVA 3NALA 3UAWA 2BFWA 3RIEA 4UHBA 1JFVA 1ID1A 3H5IA 5EP4A 3HCOA 2YUTA 3CZ5A 3CU5A 1P72A 1Z73A 4CKWB 3ZJTA 2J3DA 1EFAA 4JR2A 4EGSA 4DMLA 2D1FA 2HB6A 3AW8A 1YCHA 3GP5A 2VO1A 3EEOA 2PUGA 4BFUA 4G01B 4ZHQB 1TK2A 4OHYA 4P22A 1JJAA 1T2DA 1EBUA 3TEFA 3V46A 1HMYA 1QHHB 3JAMA 2P7HA 5EQJB 4DCVA 2BKAA 3I83A 2J3IA 4LDNA 4X1KA 2HXGA 3VYTB 4A0QA 1CE8B 2OXCA 4M36A