5TC4A

Crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
292
Chain Sequence
EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohy
publication title Crystal Structure of the Emerging Cancer Target MTHFD2 in Complex with a Substrate-Based Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 110
structure length 292
sequence length 297
ec nomenclature ec 1.5.1.15: Methylenetetrahydrofolate dehydrogenase (NAD(+)).
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tc4A01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 5tc4A02
1UDCA 2UYYA 5LDHA 2VHZA 1DIAA 2I9PA 3RC7A 4RQUA 3TOXA 3G49A 2V6BA 1NYTA 1MXHA 3NJ8A 4FJ1A 4LMRA 1HDGO 2Q1WA 2D5AA 3HHPA 3MJCA 4YT2A 4LRSB 4YAEA 2YHUA 4KOAA 4Y6SA 4FFMA 4CM6A 4BO6A 1ARZA 2IXBA 2NU7A 4LW8A 3NEPX 4CM8A 4JGBA 5I7FA 1KVRA 2BRUA 3AUUA 1X13A 2PKQO 3O8QA 5KJ1A 3FCOA 4WCFA 4XEHA 3ZW8A 1AGNA 1XELA 1B3BA 3NGLA 3KYCA 4RF2A 1I8TA 1U4OA 2RH4A 1ZCJA 2F1KA 2WTBA 3KYDA 3MTGA 2ZB8A 3E8XA 3P5SA 1HDYA 4E31A 1O94A 1DJQA 4I9NA 1UDBA 2AQHA 1U5AA 3AY6A 4MINA 2HAEA 4L9RA 1Q1NA 3PIIA 4AJ2A 4MVJA 3COSA 1ENZA 1EK5A 4RDHA 3FWZA 1Z82A 1R4NB 4N5LA 3U4DA 5CPFA 3DZGA 2GNAA 4OJNA 3OA2A 2PKRA 3O8QB 1CYDA 3GNSA 2IEDA 4WCFB 1LI4A 1UXJA 5BSEA 5DCUA 3KYCB 3SXPA 2E4AA 2Q2QA 2R6JA 3GDGA 3H4VA 3KYDB 4XYBA 2YJZA 1HF3A 5GZ1A 4URFA 1V0JA 3QQPA 1LNQA 4OIMA 3MJEA 4QSMA 2HQ1A 3LDHA 3AOGA 3GPDG 2HJSA 2IDZA 3UOGA 1P31A 1NFFA 4H15A 4DL9A 2R00C 4GX2A 2NU6A 3OIFA 4QT0A 5F1OA 1HSOA 2Q4EA 3U09A 3WTCA 3NKLA 4R1TA 3DZKA 5I8ZA 4I08A 3N58A 3Q9UA 1BGVA 3EDMA 5I9MA 2HMSA 1YRLA 4Y98A 1GY8A 2X0NA 4IQ0A 3WTBA 3K30A 4BNVA 4L4XA 3AU9A 3G1TA 1DO8A 3D4NA 4K9DA 3BXXA 3AUTA 3ON5A 3VHRA 3WGYA 3VH4A 3LVFO 3ZWYA 1P9LA 1V3TA 1N5DA 2JD2A 3W8EA 4JQCA 5C3MA 2I66A 1YDWA 1ZZEA 4WLUA 4YTEA 2HLPA 4M1QA 1PJQA 4PIVA 4BV8A 1RM3A 4YDRA 4BGVA 1NQTA 3KLPX 4WPGA 2Q50A 4D43A 2DBRA 2CF5A 5HTOA 4XGNA 1E3WA 2XOXA 3DONA 2OUIA 5U9CA 2J3HA 1U9JA 4FQ8A 2NVUA 1RPNA 2E82A 4WEOA 1GV0A 2C2YA 2AHRA 1HDOA 4CQMA 3MJVA 2NM0A 3GGOA 3DBRA 1KS9A 3ST7A 2IYPA 2POQX 1FDUA 3C1TA 2RH8A 3L9XA 4IJUA 3CZRA 2OXIA 1NTOA 4RZIA 3MJ4A 1E3WB 2DBZA 3GMDA 4OOFA 4FFRA 4ND1A 4ROSA 1AXGA 1QLHA 5EINA 1EVYA 4BO9A 5L53A 1ZEJA 4PZDA 1GUFA 2NTNA 3BMQB 3HDYA 4XRRA 1VI2A 1Z45A 4IUYA 1JKJA 8LDHA 2Y0CA 1GUZA 3CXRA 4JIGA 3QWBA 1T25A 4CQMB 4CV3A 3WS7A 1YO6A 3DBRB 3CKYA 1PEDA 4CM9D 4PLFA 1BWSA 2EGGA 1KIFA 2PY6A 4JXKA 5EQDA 2EXXA 2O4UX 2TMDA 2DTXA 5A05A 4NPCA 1ZK1A 4ZN6A 4JROA 2CDBA 4NG5A 3I3OA 2O3UA 2NTVA 2FZEA 3O9ZA 1TI7A 4YRDA 4QO8A 3UGKA 4CR8A 4JBIA 5B4UA 1TVEA 4PLPA 5CG1A 3RD5A 5IZ4A 1NAIA 3ZWXA 1RM5A 3BMNA 4CV0A 3AM5A 2J3IA 4ZD6A 2X58A 5KIAA 4B3JA 5B1YA 1WDKA 1Y6JA 3V1TC 1NR7A 4Z9XA 1ZFNA 6ADHA 2YY7A 1CEQA 1HL3A 2QZZA 3OEYA 1YONA 1I36A 1ZXLA 1PS9A 1EE9A 3Q6IA 4DMMA 3OM9A 2PGDA 1PU2A 3NTRA 4BO3A 2NACA 3VPSA 1Q7BA 4YXFA 1LSUA 3QWFA 3DXFA 4Q3NA 1WW8A 2BGLA 3FPLA 1H0KA 4EEZA 4NK4A 4Q9NA 4KDFA 1LEHA 4PCVA 1DC5A 4ZJUA 3W4KA 3QE3A 3QJ5A 4XYLA 1PGQA 3I9OA 3QLJA 4WUVA 2PD3A 3HE3A 4E2XA 3BA1A 1FMCA 3NAQA 5F5NA 3RC2A 1WLYA 5MGBA 3AI3A 3WIEA 1KVQA 4ZU3A 2ZTMA 3AY3A 3H9JA 4YA6A 4EZBA 4NR0A 4GQAA 1P77A 1EE2A 5KVQA 1ORRA 5AYVA 4KZPA 4XQ9A 5HA5A 1UZNA 4MVJG 2VUUA 3GA0A 3T4EA 3V1UA 3AWDA 5K9ZA 2I3AA 3K2EA 3N7UA 3PQDA 4DLBA 2DU8A 1LDNA 4RZHA 3GG9A 4D41A 3NTOA 3AOEC 4M86A 1K6IA 4AJ4A 2H5LA 1ENPA 3DZFA 3NDIA 4ALNA 4YRAA 5KVVA 5L4NA 1HE4A 1WAMA 4L74A 5T64A 1QYCA 2YUTA 2O4CA 4BL5A 4XR4A 1K3TA 1N2SA 2EKPA 2IEBA 2Y05A 2HKIA 5KKAA 1B14A 3PWZA 1YH3A 1PR9A 1X7GA 2GSDA 3WQQA 4HFRA 5CEEA 4ALLA 5DBFA 4RVDA 3OIDA 1ML3A 3GUCA 2OP1A 4BNIA 1RWBA 4CQMD 3IQDB 2V7PA 4D44A 3FNEA 4HWKA 4R54A 1U2DA 2VRCA 4N7RA 5CDUA 3LT0A 4TRMA 2EEZA 4HP8A 4ZRMA 1S7CA 3F1KA 5CP8A 5I9NA 1V3VA 1E3IA 1LXCA 2O3SA 2DBQA 2OBNA 5COBA 5TGDA 2IZ1A 1SPXA 2Z5LA 3QWAA 3E03A 3JYPA 5G0TA 2BH9A 4XIYA 2GN4A 2W2LA 4INAA 5A03A 1MG5A 3WGZA 3KTDA 3U5TA 1NQAO 4ZQBA 1R4MA 3PLNA 4RVUA 3PFFA 5T8KC 3RJ9A 5B4TA 3V1YA 1VLLA 1KY5A 4WLNA 4OXKA 3RQSA 2FHSA 5DF1A 3H9QA 1NWCA 2EF1A 4E4YA 3M2TA 4CM4A 3WYCA 1YS4A 2H1SA 2W4QA 1U3WA 4IZIA 2CUKA 4NBRA 5BT9A 6LDHA 3BTSA 1G0OA 3DAPA 1CQIA 1ZK4A 3D4OA 1E1LA 3FTPA 2BGKA 3IL2A 4E33A 3I9NA 1Y5MA 3AJRA 1F14A 1SBYA 4NFYA 3IP3A 1M76A 4BMVA 5IFLA 3OBBA 5KJFA 4IJKA 4GLOA 2OP0A 4TRJA 2NU9A 5MDHA 4CV2A 4BO0A 1R4MB 1I33A 2ZJ0A 1M2WA 4XR9A 3E1KA 3SEFA 1YOVA 5IN4A 1PL6A 4OQYA 5EQFA 1Y81A 4B4VA 2BLLA 1I5RA 4R9SA 1LDGA 3JD0A 4K6CA 4WKGA 2GDZA 2VWQA 2GASA 3RUFA 2JD1A 4DGSA 2Q2VA 3AK4A 1P74A 3FRJA 3IMFA 4J1NA 4LK3A 3R0IA 1BHSA 1PJBA 4NMHA 5IDQA 4TRRA 2A9FA 5K6AC 3FNHA 3H6KA 4U0JA 1BG6A 1HYEA 1WNTA 4CL3A 5A1TA 1R0LA 3H7AA 4WLOA 4OAQA 1GZ3A 1C1XA 3WG9A 4BO1A 1IHXA 2CDAA 2X5OA 1F17A 4B7UA 4EJ0A 4M8SA 1VSUA 5TJHA 2HO5A 3B1KA 4IY1A 3IKVA 4ONEA 4WJZA 1SOWA 2V6MA 3E82A 3DO5A 4RF3A 3G17A 3LSYA 1R0SA 3G0OA 4GKVA 4IJVA 1I3NA 3C24A 3WBFA 4CPDA 2FPGA 3WQSB 5G0SA 2B0JA 2PKQP 2D0IA 3A06A 4LVCA 3RU9A 1C1XB 3KEOA 3MWDB 4K1LA 4FR5A 5IN5A 2E6UX 1Y9EA 4D3FA 1O9BA 4KP7A 3DBLA 4GX0A 3RU7A 1E7WA 3INGA 3QWHA 4NU6A 1B15A 5LCXA 4B8WA 4DLAA 1F06A 3JQFC 3PYXA 5G0UA 5JC8A 1HLPA 1NHWA 1G1AA 3GK3A 3ETEA 4MVJF 3OP4A 5JPIA 4JN6B 4LCEA 4A26A 1VE9A 4XKJA 1X0VA 2WE7A 3ZV5A 2VYVA 4J9UE 4UVEA 3STHA 1R37A 4BNKA 3P7MA 2GUGA 3RUIA 1NP3A 1K89A 4EUHA 4IDFA 1DRVA 2OMEA 3MOIA 4R3WA 4GKBA 1X15A 4I5EA 4XQEA 5G4LA 2X8LA 2DLDA 4RQTA 1SEVA 2QX7A 3DDNA 4Q3AA 1X14A 1NAHA 2AQKA 4OXYA 4IM7A 5F1KA 4RVHA 5EERA 3IS3A 4R5MA 3K73O 5C7OO 3HWRA 1UZMA 1BXZA 2WYVA 3QVWA 4F45A 1JLLA 1HWYA 4CMAA 1M6HA 5H82A 5F3RA 4P38A 4BKPA 3GRKA 3JQBC 3AUAA 2WD7A 3R3JA 3WMXA 1FDTA 3FPCA 3ZWAA 4YB8A 5ILGA 4HFJA 1P0CA 4R1UA 1U3VA 1T2AA 5I7SA 4L4SA 3RBVA 2JL1A 2C5AA 4CR7A 4OH1A 2WSBA 4J49A 3F5SA 4NBWA 1F8GA 5DNAA 1KERA 3DZJA 3LK7A 4ITUA 5A4DA 1A71A 3WLFA 4O6VA 3IOYA 1U2GA 2WD7B 2P4HX 1UAGA 2C82A 4E5YA 2O3TA 1DOHA 1MFZA 3ZI0A 1FF9A 3IDSA 1QLJA 3WIDA 3ONEA 1JDJA 2Y1CA 5ITWA 3ZN2A 4EUEA 1ZMOA 1UXHA 5THKA 5DP2A 5CEFA 3UN1A 5DBIA 3I9MA 3AM3A 4U0KA 1OI7A 3CIFA 2X0RA 3H5NA 3LU1A 4MOWA 5T57A 4FIZA 2EG9A 2P5YA 3HFSA 1VJ1A 5I9LA 3JV7A 4O59O 2EERA 5BNFA 5K0ZA 4GAEA 1H9AA 5DCYA 1ONNA 1HDCA 3H9EO 2OGUA 4R1NA 4MVJE 4QUKA 2VRBA 3NTQA 4GH5A 4LISA 1ZW1A 3WJAA 4JP2A 1MX3A 4BMNA 1L7EA 4XYGA 3RFVA 3LC1O 3GDOA 2RAFA 1ADGA 2BGMA 3MOGA 1QYWA 2P9CA 1LLCA 2YZ7A 3E5MA 2Y66A 1R0KA 2TMGA 2C59A 2W2KA 3GGPA 3RBXA 3ITKA 4CL8A 3W4IA 1P33A 2IRWA 4LN1A 4WCFC 3PHHA 1R12A 2BI8A 3L6DA 3CMCO 3WWZA 4XB1A 1OAAA 1BVRA 3W4JA 3S2GA 1C3VA 5KVSA 1BW9A 3EMKA 1XHLA 4FS3A 1FXSA 3ZU2A 1GQ2A 2JCYA 3C1OA 1ID1A 4BNMA 2EGHA 3D7LA 1UXGA 5A5FA 1LRKA 1GU7A 1A27A 1KOLA 1DIRA 2AG8A 1NFRA 3GOHA 5TF4A 4J43A 4J1SA 1O0SA 1PZFA 4HNGA 2W2KB 4XX0A 3KYBA 3UUWA 3KXDA 1NWHA 3A9WA 1T1SA 4J9VA 1I3KA 4M49A 1QXSA 4J0EA 5HBRA 4AJPA 4IDBA 1DFGA 1BW9B 3FI9A 4O5OA 1O6ZA 1I2ZA 1XWFA 2Q2WA 3FBTA 2GERA 3PDJA 1N7GA 2QIOA 2ZYDA 3ABIA 4E5NA 3BHMA 3GZNA 1UP6A 4IDAA 4NK5A 1JWAB 1O89A 1YXMA 3WLEA 2GN6A 3BTVA 3ZV6A 1PJ4A 1J49A 3TZCA 2X9VA 2ZB4A 3P2YA 3GNQA 3PHLA 3Q0EA 3WBBA 1WMAA 3M1AA 4MP6A 4PG6A 5COQA 4BKQA 2AQ8A 2YQ5A 4IDEA 3MZ0A 5KJCA 2OOSA 3N74A 4E6PA 5IAAA 2X4GA 4CLEA 3KZVA 1TB4A 3GMSA 2C0CA 1N9GA 5ENDA 5IDXA 3KUXA 2GF2A 5L4SA 1ZJZA 3L4SO 4YAGA 3DEYX 3AI1A 3EAGA 4OGWA 4GWGA 4OL9A 2O3JA 3GZNB 5A9TA 3RC1A 2DFDA 3A14A 4E3ZA 4AJOA 5I7EA 4S3MA 5BSGA 1CRWG 1YE3A 3F1LA 3U3XA 4MVJM 3NX4A 4CODB 5JAIA 1JWBB 5JDCA 5JNLA 1PZEA 4RGBA 1DDOA 1LSJA 2PA3A 2X22A 3DFUA 1DIGA 1TA4A 1N9GB 4P4NA 2E48A 1OOEA 1Y9AA 1MB4A 1EQ2A 1R4NA 3OHSX 4CM9A 2UAGA 1PJTA 3PQFA 4ZQEA 1XEAA 3JQ9C 4F6LA 5DP1A 4YRBA 4OO3A 4W9NA 1MC4A 1D1TA 3K31A 4A10A 2NVWA 3ULKA 5L7YA 4N18A 1MA0A 4WNIA 1L7DA 3H9UA 4JK3A 3JQAA 1LC0A 5JCJD 2EKLA 2YDYA 4NH4A 5IXSA 4RVSA 4MVJH 3AU8A 1P45A 4IPTA 5FF9A 3RJ5A 2X9NA 5THQA 3GVCA 4RPLA 1GQYA 1PWXA 4ZRNA 4EUFA 2X7HA 2Z1MA 1EBFA 4IGEA 4D46A 2JCVA 2FP4A 4R5HA 1WDLA 3ADOA 3GAZA 4NHEA 5KJEA 2CVOA 2GCGA 4BOYA 4F46A 1C0IA 4DA9A 2DKNA 1PR3A 3FTNA 2LDBA 2VNAA 2JFGA 3DZIA 4FB5A 4FFPA 2HMWA 4FOOA 4BO5A 4GBJA 2OO5A 1P1KA 3JQAB 4R68A 1PJSA 4DRYA 5TX7A 3WGTA 1JN0A 4O0LA 1ISFA 3RFTA 3QW2A 1U8FO 2OFPA 1DBVO 2EJVA 4U6SA 3DB2A 1DLJA 3OSUA 5L45A 1IZ9A 1M75A 4Q3DA 3OJEA 4J1TA 2V65A 4E32A 4EDFA 4B4OA 2D3TA 1T4DA 2OHXA 4D7AA 1MXFA 2ZJ1A 1N92A 4MKXA 1NHGA 3PJDA 2H9IA 3HDJA 4MVJP 1JA9A 5DT9A 1ONOA 3D64A 3L4BA 4BNJA 1EQUA 2C20A 1RM4A 2Q46A 2Q4BA 3RUEA 1JTVA 4CLRA 5JS6A 1PIWA 3B1FA 3GR6A 4FOSA 4OMUA 4RPJA 2VTDA 2NQTA 1LJ8A 4JBHA 4B8ZA 1KETA 4FDAA 2NLOA 4NI5A 1HZZA 5BR7A 5HWSA 2OZPA 4PLTA 4DVJA 3KSUA 4YBZA 3ZNPA 3PHGA 3FHLA 4PVCA 1KEWA 1OFGA 2VOJA 1EDOA 3EUWA 4XDZA 4D42A 3O38A 1H6BA 5B12A 1DHRA 2CNBA 1YBVA 2O23A 4II2A 3NDJA 4U6QA 4CLRB 4CMKA 4E5MA 3G3EA 3CEAA 3BMQA 4KTVE 2RCYA 1HEUA 4UUOA 4BS9A 1E7QA 2P5UA 1WMBA 3Q1LA 5EIOA 3LZ6A 4XD2A 4YJGA 2J3JA 4BO4A 3ANNA 1E1KA 1P1RA 2PD6A 3ZV3A 4C4OA 3VPXA 4MP3A 1JKFA 1ZO8A 4AICA 4AG3A 1QV6A 3F9IA 3O03A 1NFQA 3EZLA 4JJFA 5KNLA 5EL0A 3PHIA 2RHCA 5CG2A 1I24A 2HSDA 4IGFA 2BKAA 4CM3A 2GN9A 4YJFB 4B7XA 1E3JA 1R15A 3WQRA 5A02A 2FR8A 1CIVA 1X1TA 4RV9A 2ZTLA 2UDPA 5F5LA 3ZHYA 2CDCA 2VTEA 3WGOA 5JE8A 4W7IA 1XYGA 5JBIA 4G2NA 3TZKA 5CDTA 5IG2A 2VHXA 3B20A 5CHEA 5JYEA 2VOEA 4OKNA 4CUKA 4DTIA 3SVTA 4YJGB 1YVEI 3WSWA 3I23A 1DXYA 3MWEB 1ISMA 4PVDA 4DIOA 2HDHA 3JD2A 4OOEA 3E9MA 2CY0A 4MIEA 3IJRA 4B3IA 3OF2A 4KUEA 3ZU3A 2HU2A 3JQAD 3RUAA 4PLHA 3OECA 8ADHA 5ILOA 4BO8A 3B6ZA 2QYTA 3OQ6A 3PFWO 1DHTA 2Q49A 1DC3A 2I3GA 5TQVA 1VKOA 5FEUA 1VM6A 2HRBA 1WPQA 3D0OA 3V8BA 2IODA 4PFJA 1R6DA 3H5AA 2PFGA 1G0NA 3ENNA 4JP3A 3EYWA 4L75A 3PPIA 4DLLA 3LYLA 3GY0A 3CMMA 3EY4A 3WICA 1YB1A 4MP8A 1PX0A 3ETDA 2EHDA 1IL0A 1B3RA 1B26A 3TL3A 1NQOA 4BO2A 4RF5A 4GVXA 2BMAA 1AUPA 2ZK7A 4BNTA 4PG4A 4QQRA 4MDHA 3RC9A 1X7HA 3I83A 4DQVA 3U4CA 3B1JA 2BELA 1Z74A 2G5CA 1SOVA 3F47A 4UULA 2PZJA 1SCUA 3E9QA 3QY9A 1EVJA 3UCEA 1JVSA 2C5EA 2WD8A 4W4TA 3PDUA 4BVAA 1F0YA 2AMFA 4WASA 3INTA 3OJLA 2EV9A 4ALJA 4XYMA 5A9RA 1GCOA 1LLQA 5JXWA 2Q45A 4HFNA 1E92A 4WK6A 3PWSA 3GFGA 3BMCB 3Q2KA 4DUPA 4BQPA 2O50A 4IBOA 1GTMA 1DFIA 4GSKA 2NVBA 1YQXA 1B0AA 2HK8A 5DZSA 2VZ8A 1CERA 4DPMA 1BDBA 4QXMA 4J7UA 2Q3EA 3KEQA 1B8VA 3WGHA 3S2EA 4ZVVA 1H93A 4BGUA 4XRGA 4W7HA 4KQWA 3VAZA 2BFMA 3AFMA 1EK6A 1P1JA 2IE0A 4IINA 4YT4A 2PGJA 3GHHA 3DL2A 1XSEA 2GRAA 3GFBA 5EPOA 2GN8A 1FDSA 2JHGA 2ZQZA 3L9WA 4KTTE 1ZBQA 1PGNA 3VKUA 3VKVA 1XCBA 4BNWA 3RWBA 4KWHA 1CWUA 1IHYA 4WLFA 3O4RA 3NT4A 5C7LO 3P2OA 3ZWBA 4ID9A 5ICMA 1IULA 1QV7A 4CMEA 5T6BA 1GV1A 1NNUA 3H3JA 3QA9A 4ILKA 4PZEA 2RBEA 1D7OA 3DOCA 4N54A 3DHYA 4CMCA 4MKRA 3ASUA 4D45A 4J4BA 4YYZA 5CDYA 2DT5A 1GFSA 4ZQHA 3R3SA 2J8ZA 3FF4A 4GX1A 1Q0QA 5FI5A 2QZ9A 5CDSA 2DC1A 3DZBA 3KHUA 2C07A 3VDQA 3NJ4A 3DR3A 4YPOA 2LDXA 2I67A 3UF0A 3WSVA 3RFXA 3ZWOA 1XQ1A 4DC1A 3GH3A 1LA2A 4LSMA 4S1VA 3H2SA 3QRWA 1FK8A 1TEHA 5FFFA 1E3SA 3X2EA 3KB6A 1OC4A 3C85A 4K6FA 1XA0A 1P44A 1PSDA 4ND4A 3R6DA 1HDRA 3TOZA 1VRWA 1GAEO 4AJEA 3IJPA 4O1MA 1KEVA 3DQPA 3IP1A 1K6XA 1OC2A 4ZQGA 5JMPA 1WWKA 3DMTA 1GQQA 3GNTA 2DTEA 4UVGA 2AEJA 2EP7A 4I1IA 3MCVA 4DQXA 1ENOA 1KBZA 2AQIA 1HE3A 3H3FA 1HYHA 3GRPA 3F3SA 2HK9A 3WGGA 1LDYA 2WE8A 3L6OO 1E1MA 4WOKA 2OORA 4MIYA 3L0DA 4A03A 2DFVA 3S2FA 2UUOA 2DPGA 3PZBA 3I6QA 1UP4A 1I01A 4Y8VA 2JAHA 2DVMA 4PG8A 3PJGA 1D1SA 4OSPA 4XJSA 5DBGA 3QVOA 4RL6A 5EMHA 4GX5A 3I9LA 3ZNNA 1GZ6A 4PGFA 2X5JO 1D4FA 3PYMA 2E37A 1H2HA 1AN9A 3DTYA 4AJJA 1T26A 4ALMA 4J16A 1YJQA 3BHJA 4IS3A 1BDMA 3ZH2A 3BTOA 1DIBA 1BMDA 1B7GO 2FPIA 2X0IA 1KC3A 4J2OA 4M54A 4R16A 5H83A 2FY8A 5U4QA 1NBOA 1AHHA 2P2SA 1ISGA 2HK7A 2DTDA 2JAPA 4F3YA 1JAYA 3ENKA 3TWOA 1WZEA 2PTGA 4YT5A 4QEDA 4AL4A 5L51A 3CE6A 4BNNA 3AOEA 2W90A 3VC7A 1DRUA 4BNXA 3ONFA 3GLQA 3AW9A 4II3A 1Z7BA 3GVIA 1NM5A 1ZUD1 2JHFA 4M89A 4MPDA 1GPJA 2ZYGA 3TF5A 2O2YA 2NUAA 4G81A 4Z3DA 4CMIA 2BHLA 1X1EA 1XU9A 2O7QA 1UZLA 1A5ZA 2AW5A 2Q1UA 3DBHA 3OJOA 3I9JA 5JDIA 1Q7GA 1JAXA 4FN4A 2NTJA 1GZ4A 3PK0A 3VH3A 3K2BA 2PR2A 1ADFA 3PZRA 1ZMTA 5TS3A 3EHEA 4AJ1A 4RORA 1HXHA 2VNSA 3A4VA 1EVIA 3ROMA 4XDYA 4UEJA 1K2WA 1QYXA 4G65A 1J4AA 3EW7A 1ZH8A 2I99A 4PLGA 4WEQA 2YV1A 4LCJA 4RPHA 4UEOA 3W8DA 1PJ3A 4CMIB 1GCUA 1YL5A 2WYWA 1LRLA 3Q3CA 2P91A 3S55A 1U7HA 3VZPA 4CM7A 5IF3A 2G76A 3KLMX 5B4VA 3DBHB 1ZSVA 3D1LA 4C7JA 1KEPA 3ROKA 2PWZA 1F12A 2UUPA 1JU9A 2NNLD 1NPDA 1PTJA 3OIGA 3NT2A 3PGXA 2R2GA 4BNUA 1LQUA 4BNFA 4PN3A 4LMPA 1XIVA 3ZU5A 3RKRA 4IQGA 1TT7A 1IYZA 3E48A 3K6JA 4JJIA 3TJRA 4GLLA 1EUZA 2QQ5A 1YWGO 5KCZA 1DC6A 5CEJA 2PZLA 1YDEA 3CPSA 3DTTA 2GZ1A 5JY1A 1Z7EA 1HSZA 4UVIA 2V6FA 2JCXA 3RKUA 2GZ2A 3OMLA 3BIOA 2Q1SA 3F46A 4FBGA 3JYQA 4J90A 1YL7A 3RUHA 1HKUA 4OQZA 4R1SA 4Q3CA 3PQEA 1DAOA 1XGKA 3C7CB 3T4XA 4DYDA 3GN2A 3I4CA 4P4GA 2PZKA 2HCTA 4NFSA 3H9GA 4E0BA 4AVYA 1RM0A 2CSUA 1A72A 3OJFA 3PIDA 4CR6A 3UKOA 3EK2A 3GT0A 4WECA 3JQGA 1T2FA 3O26A 3HN2A 1MUUA 1I0ZA 1IUKA 3D4PA 3ZWVA 4CV1A 1W0CA 3ZCXA 3AY7A 4KUGA 5GY7A 3LC2O 1ISJA 4WOJA 4IJWA 3VTZA 3UCXA 3R1IA 2WEKA 5IZCA 1VL6A 2Y1GA 3CZMA 3NYWA 3UICA 2BFPA 4RCVA 2G17A 2XAAA 4CMGA 1Q0HA 2YHIA 3ZNQA 5KOIA 4ND3A 1C0PA 1DSSG 2WWRA 5HM8A 4NNJA 2BFOA 1AXEA 4HKTA 3UW3A 3ZZNA 2FR1A 4RO0A 1HZJA 1UP7A 3GUYA 3JQGB 3P19A 1N1GA 4A5OA 9LDBA 1D8AA 3CINA 2HJRA 5JCJA 1D3AA 3I4FA 4EBFA 1I10A 1NVMB 3ZU4A 2CD9A 3DBVO 2YW9A 2Q99A 5JDCC 2VN8A 3PRJA 3PXXA 3JQ8B 4TZTA 1CQJA 2D1YA 1SB8A 4JLWA 4AJKA 2YHIB 2DQ4A 3JQ6A 4UVHA 5DOZA 3PTZA 4FC7A 3MTJA 4GPD1 2EW8A 3VPGA 1PQUA 4ND5A 5L3ZA 4BIIA 4F6CA 3RAJA 3K5PA 1LDMA 3HDQA 3WMWA 4W9NC 3FWNA 2OBYA 2O3QA 1CDOA 5L4LA 4BQRA 4XQCA 1SO8A 4L76A 1YQGA 1HLDA 2WYUA 3JCZA 3WYBA 1KYQA 3DMYA 1F8FA 2AEMA 2VYND 3JQCA 4ZQFA 1GUYA 4Z9YA 2UV8A 1PGJA 1U7TA 1W6UA 2D5CA 3F4BA 1KVSA 2Y0EA 4DIBA 3EGOA 2WM3A 3A28A 3GQVA 3E6AA 5DULA 1GR0A 4B3HA 1LBEA 1WVGA 3FD8A 4CM1A 1Y5RA 4FFOA 2JKVA 1IPFA 3ADPA 4Z9FA 2H6EA 2Y1FA 1E7MA 3LLSA 2Q1TA 1S6YA 4PLVA 4YWJA 4YJHA 3V2HA 3NGXA 5TT1A 3RVDA 1LLDA 1SZJG 1SAYA 3WDSA 3KBOA 4OKIA 4Z3KA 3C1AA 3KOUA 4HX5A 2Y0DA 3DAGA 2G0TA 2C2XA 1EBUA 2HRZA 1O95A 3FBGA 4EEXA 5CDGA 1IY8A 2HMVA 4OXNA 1CJCA 3PYLA 3AUSA 3D3WA 2DAPA 2I76A 3ONDA 1H9BA 2VWHA 1U3UA 3RASA 4HADA 1K6JA 3JTMA 1U28A 3IIEA 3L4BC 4N5NA 2H63A 3IC5A 2QRKA 1ZK0A 4E2YA 4DQUA 1H6CA 4R4JA 1WDMA 4YJHB 3LQFA 1QORA 3CTMA 3HB5X 2VZ0A 2Z95A 2O48X 4O63O 3PEFA 2O7SA 4K26A 4Q3BA 4FGWA 1M66A 4BGIA 3JD1A 4ND2A 2QW8A 4IDDA 3ROQA 3D3WB 3I6IA 4J6FA 4Y67A 4BHTA 1FDWA 1NXQA 4GWKA 5I7VA 4PLWA 1HDZA 4FJ0A 4J2HA 3UH1A 3SLKA 5JAZA 1C0LA 2B37A 2PH3A 4XYEA 1E3EA 4BNHA 5TC4A 4NJMA 1BXGA 3OH8A 3U4HA 5L95A 3HB4X 2YQ4A 4UUNA 4YACA 3VH2A 1LDEA 2CVZA 3ZWCA 1P3DA 4UUPA 3TZ6A 3E5RA 1T2CA 4KUHA 1R66A 3FR8A 3JQDA 3I5MA 1X0XA 2GZ3A 4IIUA 3RSHA 2V6GA 4BNZA 4BUCA 4XA8A 1L1FA 4EGFA 3HJAA 5FI3A 4BKOA 3GAFA 4FSHA 4HUJA 3GF4A 2CFCA 4E5PA 2ZKLA 5AXAA 4NJMB 4WNCA 1YBAA 2X5KO 1BXGB 3ZWWA 2B83A 4AJNA 1CETA 2VCYA 1LSSA 5T67A 4R41A 4E2WA 1SB9A 4CLDA 1BTOA 5CFZA 2Z1NA 1EDZA 1DC4A 3TN7A 2JJYA 4BB6A 1UXIA 1SC6A 4PLYA 1DPGA 1EEHA 1P1IA 4XWYA 1NPTO 3WJ7A 4PG7A 1W8DA 3HNPA 1I32A 2VUSA 2AE1A 1LUAA 2X23A 1NQ5A 1VKNA 1XG5A 4NFHA 4U7WA 3FNGA 3OA0A 5HRUA 1YJ8A 4U5QA 3JD4A 5G2OA 2C29D 3TZHA 2YYYA 4YQYA 1V8BA 4B4WA 4CM8B 1B8UA 5AXDA 3GVHA 1NX6A 1XDWA 3VZSA 3ICPA 2YFQA 5C5IA 5EN4A 1W4ZA 3I9KA 2YV3A 2J3KA 1K5HA 1LC3A 1G6KA 2NU8A 2JD0A 1U8XX 1GL3A 2YV2A 1ISHA 2AG5A 3ZDFA 5CPBA 4RF4A 2VWPA 3LT2A 4XZ3A 3TPCA 5KJ6A 5L9AA 5EJ2A 2B4RO 4FC6A 2CF6A 5BNIA 4DMLA 3BYZA 3DAFA 2Y1DA 4C7KA 4UUMA 1W73A 4J7XA 4KDEA 2D59A 2NWQA 3H65A 3U4IA 1YB5A 5G0WA 3V5NA 2B5WA 1GEEA 3H5RA 3QVTA 2NSDA 2Y1OA 4YR9A 1ISIA 2Y1EA 2Y99A 4QECA 4J4HA 2P4QA 4EI2A 5DCWA 2VWGA 3VTFA 5TLSA 1ZKMA 3K9QO 3UFXA 1X7DA 2JFHA 4RLHA 1HE2A 4YJFA 2FOIA 3KETA 4LSWA 1UR5A 1YGYA 2EJWA 4RDIA 3OJ0A 5IDYA 1EUDA 5C7IO 3SLGA 3VVCA 1TXGA 3ETGA 1QRRA 1GYRA 4GGPA 3LF2A 1LX6A 4M87A 4BGEA 2EWMA 1EMDA 3OICA 1U3TA 4D0RA 4Q3EA 4PLZA 4E12A 5GZ6A 3WB9A 1OMOA 3DZHA 3VZRA 2FN7A 5AQ1A 3DOOA 4DREA 4E2ZA 3K92A 4HFMA 1YL6A 3FN4A 5F1PA 4IQ8A 3VH1A 4HV4A 3HDHA 5JLAA 5A5EA 3M2PA 1PQWA 3TFQA 5DOVA 3PVZA 4NBUA 4BKUA 2PK3A 1VSVA 2J5QA 5JFOA 1RKXA 1RYDA 5AOVA 1C0KA 5GMOA 1Q0LA 1I3LA 3JQ9A 1P1FA 3DC2A 2GD1O 3PP8A 4J3FA 4XGIA 2GGSA 1AE1A 3UVEA 2BI7A 3C7DB 4IXWA 4XB2A 4CM5A 3IUPA 4W82A 1H6DA 3JQ7A 2X9GA 1QKIA 4CMEC 2PGLA 3QHAA 3B70A 3DHEA 3KVOA 3QIVA 2IYOA 3U9LA 2IZ0A 2NVUB 4RJTA 1ZJYA 3UHAA 1MGOA 2ZTUA 3LF1A 2BF7A 1I3MA 2NADA 3HG7A 1A9YA 3AI2A 4YCAA 5TT0A 4TKLA 3ZHZA 1HE5A 3EC7A 4TWRA 1ZVMA 4I5GA 1MLDA 3HFGA 3UCFA 5A06A 4Z0HO 1LU9A 1Q7CA 3L77A 4XQGA 1Q2XA 4CMHA 2PD4A 3RIHA 5ADHA 5I8WA 2WJPA 1ZXBA 3JQ7B 1SEPA 4CMJA 5L40A 4OHUA 1NVTA 4IS2A 1VJTA 1SNYA 4ALKA 2ZATA 3BMCA 4JNKA 3C8MA 4X54A 4FD3A 3ZWMA 4AJLA 5KWEA 4HY3A 3IAHA 3HN7A 1IB6A 2R00A 4MVJD 5AVOA 3ZWNA 1BXKA 3DMTC 3DWFA 2GLXA 5FWNA 3JSAA 1P1HA 1ZK3A 4BKRA 1PL8A 2ZB7A 1QSGA 5HS4A 3PLRA 1NPYA 1JW9B 2DBVO 3GEDA 1A7KA 2IXAA 2PV7A 3WX0A 5KVCA 1NASA 5LC1A 1U4SA 4J1QA 4IMPA 2A92A 2Y67A 3QSGA 5J23A 4IMRA 1ZK2A 2A4KA 4I5DA 5JYDA 3BMNB 3JYLA 5ENVA 2AXQA 3BAZA 3WYEA 3S2IA 3VPHA 4BNYA 1QR6A 4WLEA 5A3JA 4L8VA 3INRA 3W1VA 3E9NA 1V6AA 2DPHA 3Q2IA 2BD0A 4EITA 4L4RA 1NVGA 9LDTA 4N5MA 2ILTA 4WLVA 2XXBA 5JAQA 5JW6A 2WDZA 2O2SA 4I9UA 1BSVA 4P4LA 1N8KA 5GZ3A 4CMBA 2HUNA 2HMTA 3X2FA 4GMGA 5F21A 1E5QA 3TSCA 3UXYA 4YAKA 5C37A 2XPCA 3CUKA 4A27A 3D5TA 3TZQA 2XXJA 2ZYAA 3SJ7A 2B35A 3ASVA 1IZ0A 4Z6KA 3MJTA 4NQZA 3GG2A 2RIRA 5JCXA 1B16A 3Q11A 1FDVA 4TZKA 3T7CA 1H5QA 4CUZA 1M6WA 3ZNOA 5BNTA 2EIHA 3LT1A 4E5KA 1I2CA 2G1UA 4BNGA 5JDIC 2FSSA 1H94A 3EVNA 5FYDA 5BQFA 5A04A 3BMOA 2QYSA 4FW8A 4H16A 4XGKA 5ICSA 1T4BA 2E49A 3LC7O 1KC1A 1E77A 4J0FA 3FNFA 2ZB3A 4GL4A 3WNQA 4Z0TA 1B2LA 4CJXA 4NBVA 2EKQA 3H8VA 3NRCA 4EW6A 4QFCA 4P22A 3BHIA 4B4UA 4CQLA 3WWYA 4DPKA 3NT5A 3HZZA 4A73A 1Z6ZA 1DIHA 1PZGA 1E0DA 3PI7A 3KSZO 4J91A 3W6ZA 5ITVA 4FJ2A 2B36A 4LVUA 1HT0A 2GYYA 3BZUA 1N1EA 3QVSA 1PS0A 3WXBA 5DN9A 2ZQYA 4IDGA 4JX8A 2PZMA 5U1PA 2EP5A 1LRJA 1ULSA 1PGPA 2D2IA 2X86A 4JBGA 5KKCA 1U5CA 3K8ZA 5AXBA 4YEDA 1A9ZA 2C7VA 3BMOB 3ZHBA 1T1RA 3D3EA 4IXTA 1ENYA 4LRTB 1IE3A 2O3RA 3JD3A 2UVDA 3L6EA 3SJUA 4CQLB 1A4IA 2PLAA 4HNHA 3KO8A 2VHVA 3KRTA 3SC4A 3VDRA 4GVLA 4K28A 3GVXA 4JJGA 2AE2A 1EFKA 1VJ0A 1QMGA 2D8AA 2X1HA 1ADBA 3DFZA 2CZCA 3ORFA 4WE3A 3RBZA 2X6TA 4G5HA 3RUCA 1PZHA 2VUTA 1O8CA 4ZICA 2NV6A 3PGJA 1IOLA 4B79A 4I8XA 5TNXA 4I5FA 2P9EA 3FSRA 4CLHA 2GPTA 4DC0A 1UAYA 2FRDA 3ZHXA 3G1UA 3GEMA 4W6ZA 5TJ9A 3OFSA 1JKIA 1WZIA 3ZV4A 4FFLA 3IKTA 5A3VA 1ONPA 4J7CA 4YAIA 1GD1O 2Y68A 4CM4B 3Q9NA 2CVQA 2W8ZA 1UUFA 4FFNA 1XQ6A 4D79A 2P9GA 2B69A 1GEGA 1OZAA 3G79A 4ALIA 4PRLA 5JAMA 4L73A 4NDNE 3K96A 1LDBA 1LLUA 3KSDO 3NUGA 2FR0A 4GMFA 4QTZA 1I2BA 3GN1A 3QV1A 4FPXA 3ROPA 4A2CA 4FCCA 2I5PO 1Y7TA 3I52A 5IZCC 1V9LA 1DLIA 4D3DA 4DBZA 1KVTA 1EVZA 1YOVB 3TDKA 3MJSA 1N7HA 1RYEA 4GGOA 2A35A 5COAA 3T7EA 1C14A 1PJLA 2OL4A 2B4TO 2YFHA 4NZ9A 1VL0A 2J5KA 1J6UA 4YJDA 3PHJA 2VQ3A 1B8PA 1DFHA 1E6EA 4OYRA 1QG6A 1WXDA 1Y8RA 4E21A 4GSLA 1DJNA 4KQXA 1YQDA 1ZIDA 1E7SA 4DXHA 1GDHA 1P0FA 2FSVA 3TRIA 1J5PA 1MP0A 1I30A 3UAGA 3MEQA 3HADA 2VYNA 4EJMA 1K0UA 1ZSNA 4FGSA 3ZW9A 3LLVA 4ZGWA 1HDXA 4L0QA 3TL2A 4AJIA 5KTKA 4R69A 4P8RA 1Y8QA 3GDFA 4RPGA 1ULUA 3VPFA 1PL7A 1ZNQO 4TVBA 4TMFA 1YB4A 2GO1A 1SMKA 3PWKA 3LT4A 3W6UA 4TVOA 4QX6A 3L07A 2QHXA 1EZ4A 1Y8RB 3VVBA 4E30A 4UREA 5T8KA 4BO7A 3WR5A 5IXYA 3QVXA 5L7TA 1UDAA 3D5QA 4LGVA 1T2DA 4AJHA 1PQPA 5ER6A 1UXKA 5A9SA 2VRCD 3U0BA 1J0XO 1Y8QB 1C1DA 1T24A 2B5VA 2FPPA 3DBLB 3GGGA 1ADCA 3S8MA 5JMWA 3JYNA 2PH5A 2PNFA 2ZCVA 1PWZA 7MDHA 2W2LD 1HRDA 1ZEMA 3SC6A 4JCOA 1E3LA 2AA3A 3NDRA 3S1LA 5TRTA 4CLXA 4HXYA 3PJEA 5T5QA 3KV3O 2J5RA 1WP4A 4QO7A 4KWIA 5BSFA 2EW2A 3HUDA 4QFDA 4TQGA 3RI3A 3JQEA 7ADHA 1TLTA 2VHYA 5A9SB 2ZIZA 2VZ9A 3HQ4O 1QYVA 4ZHSA 4W99A 3BTUA 1JVBA 3WFIA 1C1DB 3U49A 4RVGA 1PJCA 1DEHA 3OQBA 5K6AA 2FWMX 1BVUA 3DHNA 2C7GA 1GYPA 1E7YA 3JQ8A 1V3UA 1A7AA 1HYGA 4R3NA 3ICCA 4EYEA 1E6WA 3CH6A 2J6IA 3V2UA 1MFPA 4M55A 2W98A 1Z75A 2ZCUA 4U8GA 3V2GA 4J4TA 4NBTA 4E13A 4DYVA 2I65A 3AM4A 3VOSA 2A94A 3H2ZA 4I9HA 5G0VA 4A0SA 5TIIA 4D0SA 3OEWA 4R9RA 1JQBA 2VHWA 5JC1A 1PS8A 1V35A 1PGOA 4AFNA 1GPDG 2FMUA 5HS6A 3M6IA 1TT5A 3QP9A 2IZZA 4HBGA 4TROA 1MV8A 2XF8A 3F4LA 1GYQA 4A7PA 1KEUA 1H6AA 5BSHA 3ANLA 1LQTA 2YDXA 3C3XA 2Y93A 1OBFO 4RVFA 3ZWPA 5G4KA 1VL8A 2F00A 3WFJA 4Q39A 1PJ2A 1UH5A 3GHYA 4NU5A 2P68A 4DBVO 1GADO 5JY6A 3JQFA 2WMDA 4YVFA 3F5QA 1HETA 1E5LA 2JFFA 3WNVA 4D3SA 4XCVA 4CUJA 5JO0A 2QG4A 1R16A 2ET6A 3TNLA 3WGIA 1ZSYA 2RHRA 4ESOA 1TT5B 2HMUA 2D4AA 4BMSA 1T2EA 4Y6PA 5ER9A 5ES3A 1U1IA 1BRMA 2B4QA 2QRJA 1DRWA 5CAEA 2DM6A 1MC5A 3CSDA 4YQZA 4EJ6A 4XIJA 1YBMA 4TSKA 4MVJI 3EVTA 5G4KB 4CLOA 4BNLA 1XU7A 3DOJA 4UVDA 5JO9A 1Y1PA 3AFNA 3GC6A 4ZA2A 1Z73A 1EUCA 4H3VA 1O5IA 2VT2A 4NJOA 4NIMA 3U62A 2NQ8A 1E6UA 3HSKA 3FR7A 2SCUA 3JYOA 2C54A 3RUDA 4BB5A 3RCBA 3PJFA 4IDCA 3A1NA 3GZ4A 3ITDA 3EZYA 3JQBA 2VYVD 5IJZA 1DAPA 1IPEA 3M1LA 3E18A 4OM8A 2DUWA 4WGGA 4MIOA 2AEFA 1M67A 1QYDA 3SBOA 1RJWA 3F6YA 3KM0A 4PZCA 1FJHA 4OSOA 4BV9A 3GVPA 3GEGA 3NV9A 2I6TA 3WGQA 4CLOB 1XKQA 3GPIA 3SX2A 3C7AA 4PRKA 2BFAA 1HTBA 5JSFA 1YKFA 1E7RA 3WOHA 1E1NA 4XJTA 4DIFA 3TFOA 1DB3A 1VC2A 3IUSA 1XLTA 1CF2O 4MO2A 3ZGYA 1QP8A 4WCDA 1XR3A 4R01A 4RPKA 2CMDA 4UEKA 4Y6RA 1MG0A 2DUUA 3W8FA 4IZHA 5AXCA 4PG5A 3ANMA 3OQ1A 4IIVA 5B37A 4MJLA 3RROA 1NR1A 5TSDA 5LDGA 1UJMA 1KY4A 3OETA 3I1JA 4B7CA 4PLCA 2ZTVA 2QRLA 5H81A 3TQHA 1LTHR 4TKMA 5DDIP 4TRNA 4RLSA 2X0JA 4R51A 2FZWA 1VPDA 4YAJA 5L7WA 4Z0PA 4KMSA 1KVUA 4YT8A 5IDWA 1LSOA 2GR9A 2VT3A 4GI2A 2G82A 3QWIA 4MKZA 1AHIA 1H2BA 3VZQA 4H7PA 4UAGA 4DPLA 5EESA 1EFLA 4DWVA 1A4UA 4Y9DA
chains in the Genus database with same CATH superfamily
1DTEA 1PNOA 1RQRA 4N3NA 4NY1A 2VHZA 2HBZA 3N7TA 4RQUA 1JL3A 3PEUA 5EMKA 3G49A 2AZMA 1NSFA 2E3JA 3GA5A 2OCLA 1YQEA 4JYCA 5J5CA 3ZCUA 1Q0TA 3NJ8A 2CNDA 3QG5A 4JXZA 1EWYA 1TUEA 2Q1WA 3HHPA 4FP9A 4P92A 4TLMB 2WWXA 4IL5A 3CVJA 2XI4A 2QP9X 1UC4B 1KQ3A 2GYUA 2Q8NA 2WMYA 3U4QA 2NU7A 2B34A 1X92A 2DSTA 3R5JA 4LXIA 4BAZA 4UJ5A 2Z83A 2AOWA 1Y4SA 3FDZB 3AUUA 2WF5A 3FPGA 5ITSA 2RHDA 1ECLA 2PKQO 4LHEA 5EWJB 4HWGA 1M8GA 1P9OA 1S01A 1XTUA 3D4LA 4X6YA 4XEHA 1XELA 4PXYA 1XXHE 4H17A 2Q27A 3ZD9A 1JEQB 5K8TA 4U7TB 2BUBA 3V7FA 1NSTA 3GAAA 4E31A 3RB8A 1HDYA 3EUFA 1KGSA 1O94A 5E1OA 1DJQA 4I9NA 1RBMA 3TB4A 3GP8A 4LXTA 3T3EA 1U5AA 1R1DA 1JR3D 1DEAA 3AY6A 5G40A 4L9RA 4D3XA 4X3CA 1W7AA 1Q1NA 2XVYA 4S05A 3EQ2A 1L5WA 4OBWA 5CLLA 4AJ2A 1DX9A 4MIKA 1Q15A 1EK5A 1G2IA 1DQPA 1U6IA 4RDHA 3FWZA 3HXQA 1YJBA 3PFKA 1E2KA 5HNKA 3T94A 1Z82A 4N5LA 3EA5A 3VR4D 3DZGA 3PKZA 1G4UR 1X6VA 4PGHA 1E9CA 4J0DA 2GWRA 3BGSA 2WSMA 3Q87B 4W1SA 5D5HA 3B85A 2AI1A 3ED1A 2PKRA 3M5PA 4L5IA 3O1HB 1KXZA 1TEVA 4MQ5A 1E18A 3R6GA 5D3QA 1WB9A 3FOZA 1UXJA 4I2NA 3DDCA 3GEPA 5BSEA 2HJWA 2P35A 4CEIB 2XBLA 5JS8A 1CQZA 1H65A 2DPMA 2R6JA 3SS9X 1NYRA 1QU2A 1ECGA 2WM9B 4YC7A 4S0XA 2DKOA 1V0JA 3PENA 3Q72A 1XKTA 3B2NA 3MJEA 3PGLA 4D3ZA 4D0NA 4MWGA 3OZFA 4TWBA 3TCXB 3LDHA 5IWCA 1J9GA 2OM6A 2R65A 2CNKA 3AOGA 3GPDG 4HGRA 4QGBA 5EKXA 3PDIA 4I1YA 1P31A 3UOGA 1R5BA 3OPVA 2R00C 5AM2A 1RE0A 1H2RS 5FBKA 4NJEB 2BFEA 3OIFA 5JZMA 3Q9SA 1ZOSA 2NNWB 4F72A 3NCTA 3L7OA 4UTXA 4OK3A 1YB6A 4EHFA 2R4QA 2CCKA 1E0AA 3NVKI 1UKYA 1K86A 2C8VA 2FMHA 3P9YA 3KE8A 5I9MA 3IUNA 1LPPA 1T8YA 1XRRA 1YRLA 3HJUA 4Y98A 3J81A 3WTBA 5EJIA 3EVFA 1P2BA 4UJ3A 1VGQA 2P6OA 5DN6D 4KQHA 4DR4B 2BSXA 1QIKA 3VR1A 2PLNA 3AUTA 4ENWA 1P6UA 1CJBA 4G6ZA 4PX9A 2VK8A 3KZOA 2JD2A 4FFVA 4JVMA 2FWAA 4EB6A 1AMUA 4JQCA 2ACVA 1W1WA 4IIBA 3MT8A 4WKOA 1KYZA 1XTBA 2HLPA 1TQHA 3G23A 2B3TA 3TQCA 3L06A 1QBGA 1X7ZA 4Q18A 4WPGA 3MGAA 4DA6A 4NCNA 2EBWA 1AG9A 1U7DA 4XGNA 3DONA 2XOXA 2OUIA 2HF8A 3TPZA 3ZC3A 2JHCA 2NGRA 1PT7A 2NW6A 3ZUGA 1ZNWA 2O2EA 3AB7A 2NVUA 2XNCA 4KN9S 3V4PB 5CITA 5THXA 4EPYA 1UM9B 3VSCA 1RYNA 2XNSA 1OXUA 3D8RA 3ORSA 2C77A 3T9BA 4IHJF 2C2YA 4B87A 5K99A 5CLJA 3CEMA 4QAJA 5HKBA 1F48A 5EAIA 3HCWA 3DBRA 1G21A 2IYPA 5KNCD 3V8NA 3G5LA 4C7OB 2VNKA 2YINC 4IJUA 1IZZA 1KY3A 4N39A 2XDQB 3OBIA 1A9QA 1RLMA 2C5GA 1QQ6A 3MJ4A 1V25A 1V8DA 1XQVA 4BV2A 3GMDA 2I29A 2XRFA 4ND1A 2A1IA 4MUEA 3WHKA 3WP1B 3L05A 2MCFA 3U7QA 1CQWA 4HQFA 5EINA 3GLIE 3PFGA 4PZDA 4ZYZA 3ZDDA 1FVFA 4KLAA 1GUFA 1WG8A 3K94A 2CMFA 4AP5A 1N3BA 1VI2A 3IUEA 3OQOA 4Z99A 3TXXA 4JIGA 3WFZA 5DBEX 3VM6A 3QWBA 4WBNA 3FUVA 1J99A 3WS7A 4CV3A 3M89A 3PCXA 3CKYA 1PEDA 1HOXA 3AHDA 1EX7A 2IOFA 4O4LB 4PLFA 1KIFA 2EGGA 2OBLA 4JLSA 4WXHA 4CFZA 3U56A 4JDUA 5U4XA 3CV3A 5EQDA 2TMDA 4QPNA 2CD7A 3DKVA 3S0JA 3V7UA 4EFDA 3LHIA 3MBOA 2N9UA 1DOAA 2O3UA 2NTVA 4IIJB 1TI7A 2XB8A 5JCOA 2QZSA 3BWBA 1NV9A 4PX5A 2XE8A 4CR8A 5KTRA 4JBIA 5D2CA 3A9CA 1O97D 1BQEA 3RD5A 1Y1TA 1LF0A 4A1OA 1BE8A 1JR2A 4BJ3A 1ZCFA 3P9SA 3CF6R 4M1WA 4X7BA 5K4GA 1FSPA 1FZTA 1JKJB 3DNFA 1TUIA 4B3JA 5B1HA 4HDRB 4PZZA 1MEJA 1U04A 2JZNA 2GPWA 4FBLA 4BFYA 3NDBB 1HL3A 3K1JA 4EHHA 3ZKAA 5HKLA 4RK4A 1UPBA 2FDXA 4GI5A 1PS9A 3LDFA 4P0TA 1B93A 3OZRA 4N3AA 4DDKA 2DWPA 3B3QA 3N39C 3UJHA 4IKEA 1UF9A 3ESRA 2HH9A 5TGZA 1DU4A 3K0CA 4Q3NA 3W6PA 3TLGB 3CX3A 2BGLA 5D7BA 1XC7A 3G8DA 4D92A 4M7RA 4EEZA 1PFKA 2VRNA 2W2MA 1WULS 3T3MB 1LEHA 3JU3A 2VXOA 4PCVA 4NG4A 1DAIA 3PSHA 3TH5A 5KQGA 3SDZA 1Q0RA 3FSEA 4XYLA 2J1LA 1PGQA 2JBHA 4QJ5A 4TKZA 5I4CA 2PD3A 1OAOA 5BVGB 5C4GB 1J7KA 2FUEA 4E2XA 2HZ7A 2Q0SA 3PQCA 5A3QA 4ABTA 4PXSA 3QVGA 3WIEA 4JC4A 1KI3A 3DJYA 3SX4A 4OX9Y 3H9JA 4YA6A 3PD7A 4RV4A 2DWUA 4MYCA 1P77A 4LHSA 1GT91 4NMWA 4NR0A 4XD7D 2MU1A 3S70A 1T3LA 2O07A 4MPPA 3N86A 5HA5A 3QBVA 3L8YA 2VUUA 3UNXA 4ACBA 3CGWA 4ZFNA 3GA0A 3OQNA 1C3OB 1G66A 4YV0A 4KRXA 4GOXA 4UNPA 4MROA 5KNBA 2ZDQA 1XFDA 3PQDA 5C8YA 3E1SA 5B3KA 1CZUA 1O96A 2P11A 3OX2A 4Y18A 4YMSA 4PS1A 2IZOA 3NCHA 3BK7A 3C15C 2GEFA 3HKCA 4INPA 1K6IA 1AKRA 1MRNA 2H5LA 1NXXA 4RFLA 5KPJA 1PJ8A 4R1OA 4RKWA 4TMVA 4ZC8A 5BSVA 3RVOA 4YRAA 1SU6A 5DTQA 3WK4A 9GPBA 4JI4B 4RIGA 1V41E 1XB2A 3MVEA 1VBFA 4OG2A 2YUTA 1G8PA 2O4CA 5LOVB 2AFHE 3TINA 1R3UA 1FXWA 4H1HA 1RYZA 4AZ0A 4XR4A 1K3TA 1TO1E 4ZO6A 4P93A 5IJ0A 3O2JA 5LA6A 3Q15C 1XUOA 1WSWA 1EX1A 2Y05A 5I7WA 5KQPA 3BFXA 1PR9A 4MJ3A 4P4SA 3TMAA 4ECEA 4MZXA 2CLHB 1QYIA 2OZVA 2E2WA 1PEYA 2XTAA 4ZARA 3PVCA 5FLXA 1PL0A 4MSUA 1S1CA 4FDMA 1RW4A 4RX1A 4EI7A 4MQFB 4CQMD 1EQAA 4P2BA 3PQ4A 1TL7C 1CEYA 3GDHA 3I61A 1GKIA 1I4DD 1U2DA 3OPYI 3UYLA 4N7RA 4PW0A 3QGMA 4F96A 1S7CA 3FVVA 3LCRA 1LZLA 3NAMA 2OC4A 5CP8A 4GPEA 4RMHA 1NOJA 4UOZA 1GTJ1 3R74A 3EPKA 1SVSA 1V3VA 1E3IA 1LXCA 1Q1GA 2DBQA 5DNVA 2Z5LA 3E03A 4JT8A 421PA 2ZYSA 4XIYA 4RJ2A 3K70B 3FOCA 4LDAA 1MG5A 2O8FA 4I55B 3SVLA 3KTDA 1RCFA 1PG5A 1BCRB 1YR6A 3BDVA 3GO4A 3NFRA 3U5TA 1JU4A 4MV1A 3GH1A 3ZE1B 3OZIA 1M8KA 2AUNA 1Z62A 2H5IA 3PLNA 1DBWA 3QE2A 2ZYIA 4O2BF 1I7PA 2QGFA 3FUTA 1F60A 4M0DA 3RJ9A 4FCVA 3CR3C 2FK8A 4QXAA 5B4TA 3IXMA 5BQXA 4YHBA 2J7PD 4OXKA 2PGNA 3RSQA 3VPDA 3NTUA 4AZ3A 1NVBA 1P60A 3PNSA 1T4MA 3M2TA 4TMYA 4UASA 3TI7A 4N9WA 1NF3A 5BT9A 1VMKA 6LDHA 4F86A 4P7KA 1ZK4A 4GM0A 4OHXA 1QZXA 1E1LA 1PV1A 3CXUA 4FS8A 2A5JA 16PKA 5K3BA 3EH1A 3AETA 3I9NA 4V0KA 3I72A 1SBYA 5GWXA 2H1VA 1TJ4A 3HI4A 2PGXA 2OFXA 1HEYA 3OY7A 3OBBA 4F3RA 3ENWA 3QSYA 2H4FA 4KQJA 4EFLA 4OGLA 5H68A 3UO8B 4CV2A 1R4MB 3W2FA 5LFAA 1Q0SA 4LWQA 4QEZA 4QODA 2YXEA 3TSZA 3T54A 3KIPA 5EQFA 3K3PA 1OIWA 5IC6A 2UZAA 4EFMA 2E5WA 1I5RA 2QVYX 4K6CA 4AYTA 2WJ4A 1DBQA 1NP7A 3B8EA 4WKPA 2ZUEA 2JZCA 4QOJA 2GASA 5EIAA 1USGA 3AK4A 3FRJA 2M9MA 4IWXA 4LI0A 3O4IA 4LK3A 2HBQA 4WMLA 1RNLA 1I1HA 2OCDA 1NI4A 4ZT5A 1EK0A 5M04A 3PFNA 1KEEA 2A57A 1M7GA 3HCRA 3LVRE 1XMIA 3JAKB 3MINB 5K6AC 1P4HA 1WTCA 1VSBA 3ICVA 1GTVA 2XUZA 1BG6A 2ZSUA 4PR3A 5K0FA 2BDEA 3A7DA 2ZSIA 4RSGA 4RXUA 4OAPA 5EZYF 4WLOA 1ZUHA 5DLPA 1ZHHA 2NU9B 1H0SA 4QM6A 5JIBA 1R6VA 1US8B 1QJ4A 5IEBA 3MWDA 2JK0A 1AF4A 3U7HB 1U0JA 2A33A 3AZQA 3V4SA 5H59A 4AUNA 4RTJA 1JHYA 2ZPAA 4IR7A 3W7AA 5AKXA 2ONYA 1T9BA 1TU4A 4Y6GB 3LYHA 4FYPA 4M8SA 1KBQA 5DI3A 3M1IA 4L8WB 4IY1A 4ZHQB 2QR5A 3IKVA 2WUFA 3A4IA 3HFRA 4C3ZA 1QFXA 2DUJA 1N6LA 3I9V6 4KQ9A 2KJQA 2WPNA 2QE7D 3MIZA 3ZEAA 3G17A 1IUNA 2P6PA 1RXCA 5EIXA 4XVQA 2QORA 4RK0A 5JS2A 2G9ZA 1FIUA 3AJ9A 2X8BA 1N5OX 3G0OA 1W0KD 2JEYA 4Z51A 4AY6A 1PWYE 3VHLB 3ITEA 2FPGA 3KLOA 2YASA 4ZO8A 3WQSB 2D0IA 5EE9A 3RU9A 1C1XB 2ZGVA 3KEOA 3QBTA 4I8IA 3H5IA 2CXSA 3LI2A 2E6UX 3VSAA 3L93A 1RC8A 3Q3GE 4DARA 1Y9EA 2W00A 2PS9A 3C1UA 3EXG2 3A8TA 3GRCA 4GX0A 1P7CA 4KP7A 4Q7MB 3INGA 3RU7A 4NU6A 4C9BA 4H3SA 4NOMA 3X44A 1ULAA 5AOCA 2JRCA 5T3UA 2DR0A 2Q2OA 1L4MA 3NGMA 3PYXA 1E8NA 4M9ZA 5G0UA 4EUKA 1WHSB 2ZYRA 4KWCA 3GK3A 1ZUIA 1JBQA 1KOJA 2WJYA 4MVJF 1ZVKA 3QLUC 4LCEA 4WFJA 4DMFA 1C7JA 3LFTA 5IUNC 2IXGA 1X0VA 2H4YA 3CISA 1AUVA 3SX0A 3P7MA 3MJHA 1JHQA 5CFLA 3AVWA 3MWYW 4ES6A 4R6WA 1GKYA 1K89A 1J8QA 1LPAB 1FVXA 2B94A 3KBBA 3EB9A 4PAWA 4CG0A 4EUHA 2OMEA 3Q1KA 4GKBA 1X15A 4I5EA 4KMRA 4XQEA 4DIKA 2CJXA 1FYWA 2X8LA 3DO6A 3DWIA 4RD3A 1IH8A 5ECDA 3VO1A 5LQJA 1JALA 2J33A 1IEXA 4B81A 4Q3AA 1V11B 1QVRA 1NAHA 2GK3A 3RVKA 5JJ5A 1OREA 1XRLA 2BVNA 3IVXA 4RVHA 4ABYA 3B13B 4KBFA 1XD8A 3F7MA 3IS3A 4BN0A 2BTEA 5EHNA 5D01A 3UFBA 4LGYA 2ZI4A 2HU5A 5C7OO 1CF9A 2C7PA 2C3UA 1BXZA 3OPYB 3AF4A 4RA9A 1E2NA 5CW1A 3QVWA 1HWYA 4CMAA 2P77A 2PX3A 5HX7A 3QFFA 2R6GA 2HQBA 1W1UA 2FQXA 1OX4A 4HDCA 1TCVA 5JVDB 3KWLA 4MUIA 4XSVA 5K05A 1NMSA 2FE1A 5ILGA 1IBLB 2FI1A 1YS6A 4ID3A 1AZWA 1U3VA 4E09A 2BHSA 1GO2A 2H5EA 4LDRA 4L4SA 1G8SA 5JJLA 3MRVA 1UBMS 4AO6A 1Y1SA 2JL1A 3OIWA 1UQUA 2C5AA 2IA5A 4G09A 4MLPA 3O1JC 5H1YA 2HJ9A 4KFRA 1EFDN 4NBWA 1F8GA 4HRYA 2G3YA 1TU0A 1L5OA 2GBLA 2WHPB 1XXLA 2H1OA 1UKVY 5F4BA 1XLTC 4ITUA 5FOTA 1E66A 4JZKA 4YIKA 5HIIA 4HYEA 3UMSA 5A4DA 4JR2A 4O6VA 1JLLB 4IG4A 2QVGA 1KK1A 2JAUA 3KJIA 2IPXA 2WD7B 2NXJA 1V7CA 1EDEA 2BHTA 4UAUA 1OYVA 2I3DA 3IQZA 2XB2A 2SHKA 1V48A 4MV5A 2O3TA 1C7FA 1MFZA 1ZYUA 4KI7A 4LV8B 4CEJA 2ZYWX 4HJRA 1Q12A 3NWJA 4WW0A 3U60B 2PX5A 4HJXA 1IEWA 3A9UA 3FUCA 3ONEA 2FZ5A 4HSGA 5G3ZA 1YCFA 3VU9B 4MKGA 2D13A 3VC2A 3IAM6 1TECE 1GFZA 1ESMA 2WKSA 4URXR 5I48A 2BJHA 1JE1A 4QDTA 5LZ4A 1UXHA 1RS0A 3PI6A 2OGSA 4XPIB 4B73A 5CEFA 2RAUA 3UN1A 5DBIA 3JWGA 4AUKA 5BV8A 3AM3A 3ABSB 5T41A 3CIFA 1NN1A 1MVOA 4WZBE 1U81A 5D7NA 2EG9A 1AGRA 2IGTA 5BYJA 3IAAA 3VU3A 4DSNA 1YC2A 1J5XA 5K0ZA 1TQ2A 5D51S 2EP8A 1O8BA 2IW3A 1AS2A 4DRXB 2L19A 2OWEA 5FB3A 1KRXA 3ZHSA 2H8KA 4I6GA 4OHMA 2XZDA 4MULA 3WQBA 3S29A 1KSHA 3PHCA 4GH5A 1ZGBA 3CUTA 2BHRA 4NHOA 1B42A 4TSFA 1XF9A 3A1WA 1ZW1A 3OE7D 3IT0A 2H4HA 1NLYA 1Q6ZA 2ESRA 3ND7A 2HXSA 1YUNA 3LP6A 4JQOA 5BSKA 3RFVA 3GDOA 2NTYC 4IHQA 4L16A 1V9CA 3SKYA 4EB0A 4IHAA 1A9TA 1FFAA 4GUAA 4ZVSA 4NYMR 2GETA 4YMHA 4DIDA 1IRIA 2O5EA 1W2GA 3KUUA 4R1MA 2YZ7A 5JFGA 2J9FA 3E5MA 4HWOA 5I47A 2W2KA 2BRUC 2C59A 1KJ9A 5JAHA 3ITKA 2IXFA 3W4IA 3VTKA 4NVRA 3LUFA 5EIFA 4Y30A 1XZ8A 4RGQA 2BI8A 2G80A 1R5NA 3L6DA 1ZN2A 3M6WA 3WWZA 5EJ6A 3I28A 5CNJA 3B6EA 1BVRA 2X7XA 1U80A 4G2TA 4MLZA 2YTZA 5HP4A 5E1BA 3FX2A 3S2GA 5KVSA 1BW9A 1E4VA 1XHLA 2AN5A 3EMKA 4IIGA 2FEMA 4WA7A 2JCYA 3B6JA 1F2UA 2P3OA 3L40A 2P0EA 1YE8A 5C80A 1LPOA 2IV2X 4KXWA 4NENB 1UXGA 3ET5A 3EFHA 4YONB 4GR5A 1RR6A 2BFCB 1DWOA 2A58A 2G0AA 2QENA 2IUFA 3EZFA 4KLCA 2XZPA 1KOLA 3HS3A 2F3SA 2FUG6 2JFYA 2CUZA 3L7JA 3E3NA 5TF4A 4OI2A 4DJJA 1PZFA 4TPKA 5EIHA 4KI0A 2JIDA 3KOOA 3ME5A 4HNTA 1WU8A 3EN0A 2VDLB 3L0ZA 3ROZA 4I36A 1CUUA 2Q07A 5BP7A 4IDBA 4BTEA 1I3CA 3WYDA 3ZCQA 3KDPA 5BMOA 3P26A 4UDYX 2FPWA 1L3BA 1O6BA 1O6ZA 1J21A 3N05A 4AXXA 2JFOA 3D8TA 2V5AA 3FBTA 4EHKA 2GERA 4JB2A 1N7GA 4CN8A 2XCSB 1QQ7A 5KWIA 1QONA 1D2NA 1XAJA 2P4SA 3BHMA 3UWDA 3M4JA 4ROTA 1M10A 1JWAB 1O89A 1YXMA 2XCLA 4XM1A 4TS4A 5L3QA 4S24A 2IWRA 1T5BA 2X13A 3TZCA 1CUDA 1J49A 3P2YA 2J6HA 3GNQA 2BFFA 4KVGA 1WMAA 3KAQA 3D31A 4PU0A 3AO0B 5COQA 4B80A 3H17A 1JDSA 3O82A 2QRQA 5KJCA 2YQ5A 4IDEA 1QHGA 2FMTA 2Z6UA 2WSSA 3H0EA 5CVTA 2IW1A 3TNDA 1R9NA 3WK7A 4CLEA 2HF2A 3GMSA 3USES 2C0CA 1P5ZB 1SD1A 1Q20A 2GF2A 2JGRA 1YASA 3KUXA 2GAOA 5DWDA 1WXXA 1L4HA 3D4IA 1VCMA 5HDBB 4KYIB 4YAGA 3ZDBA 6NULA 2GCPA 4Y1EA 2IYWA 5CIYA 3EAGA 4OGWA 1YFLA 4GWGA 5KYUA 4OL9A 3BEDA 4QTXA 5A9TA 3RC1A 2IEIA 3NI2A 3BWEA 1T91A 3P0HA 5ALPA 4ZCQA 2G06A 2QW1A 3EIHA 2Z3ZA 3AEUA 2HA6A 4G4IA 4HSEA 1D2RA 3D8SA 5SZKB 5T6MA 2RB4A 1AU9A 4QUAA 4DEYA 3NX4A 5JAIA 1JWBB 1SC3A 1TF5A 4QQFA 3ES9A 1PZEA 4RM2A 5JNLA 1P0MA 1HUQA 4TLCA 3DFUA 5I3ZA 5G3YA 2PUBA 5CM2Z 1IXZA 5F52A 1EFRA 1YB7A 2EWWA 3FZQA 1BZYA 4OCZA 5EXXA 5HFJA 3OHSX 2RK4A 4HWRA 4JUAA 4L6AA 5JZSA 4CT0A 4LKRA 2WIFA 2JLZA 4RAOA 1GGHA 3EMVA 3ESYA 4YRBA 4FGJA 2M1ZA 4FNOA 1MC4A 1D1TA 4A10A 4MYTA 2QM0A 4O4IB 4BBZA 4E70A 4N76A 3SIRA 4JK3A 1Z0SA 3QH4A 2HJVA 5C7YA 5IKXA 1XJQA 2EKLA 2YDYA 3K8QA 3QVLA 1WSAA 4RVSA 4X1YB 1K68A 3KQYA 1WOYA 5F33A 5THQA 3GVCA 1LPSA 5DT2A 1QX3A 4ZRNA 3VKGA 4MUKA 2VBFA 4D46A 4DV1B 2ZAIA 3B9RA 4R5HA 3ADOA 2PUFA 4F46A 3NORA 4G56A 5AIBA 2R48A 1JNYA 1K8XB 4UBMA 3TQFA 3K9LA 1XO1A 2GPAA 4L07A 4LDPA 5ARBA 2JFGA 1IXKA 1O3YA 4MQFA 5B3AA 2XA1A 3AVPA 4O2AF 1SXJD 3V8VA 2CBXA 4A0QA 4R68A 2PWYA 5TX7A 3WGTA 721PA 4O0LA 2N47A 1TNDA 2QUJA 3QW2A 3TVYA 3VR5H 4OLBA 1GR1A 2WT8A 4QSHA 2CLFB 1ZLYA 3EGEA 3DSRA 3OSUA 4RH3A 1TPZA 1Z4OA 4J1TA 1VHWA 2M32A 3T9FA 4GLFA 1U8CB 4EDFA 1QTIA 1T4DA 4GYKA 1XRMA 4D7AA 5ALFA 2ZJ1A 3LT5A 4A15A 4UHKA 3GXBA 2HHCA 2YFYA 3K1ZA 4Q9HA 3V9PA 2ZIWB 1V7PC 2PZFA 3N2KA 4AG5A 3DE4X 2AYXA 2OAEA 1G9SA 1VBKA 1C3XA 3BIWA 5BN4B 5F98A 2Q4BA 1RM4A 1D2MA 4QNRA 2AFVA 1JTVA 5JS6A 2I34A 2ZI6A 2XD4A 5LIPA 1ZC3A 1Y37A 4DG5A 1YVRA 1T0JB 3LJKA 2ZWOA 1B0ZA 1CVRA 3OQHA 5JWHA 4FDAA 5FPHA 3S2SA 4F4UA 4JT4A 4LQ4A 4F4CA 1QDUA 2OB1A 1YQWA 5J2TA 3NATA 3KD3A 4YBZA 3PHGA 4LZOA 3FHLA 3DG9A 3SHWA 2H4WA 5AOBA 3RG8A 5BVHB 4DA4A 1VKZA 4R0NA 1JLRA 3NHLA 1EGMB 1W52X 5KYWB 3I09A 3WLQA 2AJTA 2FNAA 1OFGA 5KTSA 4HYTA 3IV7A 1KY2A 3FJ1A 2V3WA 3Q8WA 4XDZA 4D42A 4KLNA 5IT9A 4Q15A 5F64A 4CKEB 1OGJA 1DHRA 2O23A 4O1IA 4GKAA 1R0XA 4U6QA 2ZJOA 2K7ZA 4CLRB 4CMKA 1H8HA 1ZM2A 2XNJA 2J3DA 3ML1A 2RCYA 1E7QA 2VPPA 2CLEB 5M34A 1GWNA 5SYMA 3DLIA 3L2OB 3S2UA 1MO2A 2V8BA 1TE2A 4I4TB 3SZOA 4XD2A 4C03A 5C2JB 4BO4A 5HUHA 3B5IA 4DAOA 3AYXB 5A4IS 3BD9A 1S89A 2PD6A 4HNAA 1OXXK 4CCYB 3R0ZA 1T5HX 4MP3A 1ZO8A 1BDJA 4B76A 1SKAA 1J2RA 2KBEA 4AG3A 1XCPA 3O03A 1TM3E 3TDNA 3EZLA 3QEAZ 1N2CA 1WW3A 4KRYA 2RHCA 4ETNA 2CE7A 3GJ0A 4DVGA 2P5SA 1KI9A 2Z6AA 4OATA 4AW9A 1JE0A 1F51E 3GIDA 2WUDA 3M6MD 4YJFB 3JS5A 3WQRA 1H2YA 2GH1A 1ODLA 2ZU0C 4OMCA 4KKXB 4RV9A 3H11A 1M0EA 2HIAA 5LLDA 2XH8A 2JW5A 4PAOA 3I5AA 1OT3A 4CGZA 1SQ0A 1XHFA 4BFLA 1M8JA 2AC2A 4GBGA 1XVTA 4L3VA 3TZKA 2BP7B 2VHXA 5CHEA 3HLTA 1NG9A 1VE5A 1ISMA 4Q93A 4D9MA 3OCWA 3X1KA 1Q1QA 3BGDA 4PC7A 4RAQA 5IXJA 1PVVA 3KK0A 1Y4AE 4AS2A 1TGYA 3CH5A 2CY0A 3EVEA 2JARA 4MIEA 4PCLA 4B3IA 4X95A 4ESEA 3OF2A 5BOVA 1JMKC 3RJTA 5JNVA 1KDRA 1XALA 3JQAD 2EOAA 2QMYA 4XUCA 3KZMA 4IH1A 1KJIA 3OECA 4AUEA 5BW8A 8ADHA 2GOYA 5ILOA 2VJCA 2WMNB 3B6ZA 2BMWA 3I6MA 4IO0A 2YBEA 2FQ1A 4N6OA 4BBPA 4COKA 5TQVA 1BEUB 2WIKA 1OYOA 1JLKA 2HRBA 2YC4C 3KQKA 1V2GA 4L5JA 1RZ3A 1SULA 4W9RA 3D0OA 4DMGA 5B36A 4BX9A 1Z0AA 1R74A 2P2ZA 1R6DA 2LIPA 4D9IA 1N2EA 2QTAA 2HQSA 3LYLA 1ZRHA 4IFEA 4LECA 2X0EA 5I7HA 1R6XA 3CMMA 3F5MA 2A3NA 3UV6A 3JARA 1S2IA 2IL1A 2PR7A 3UXHA 1PSZA 1XEXA 3DTVD 1YSCA 3Q8LA 1VLZA 2CL6X 3LUKA 2YXLA 3QNWA 4OBXA 1X7HA 3F7TA 1NC1A 1OTXA 3Q12A 5CA1A 1Z74A 1SOVA 1WTAA 1XZGA 4WFKA 5ALWA 4UULA 3FYHA 5AVQA 5KX5B 1SCUA 3E9QA 3QY9A 1EVJA 1V2HE 3SJAA 3UCEA 2QROA 4W4TA 4DUYB 3ZWQA 1MT3A 2FFHA 3PDUA 3HMQA 2YZKA 3AUYA 2JLXA 1AUXA 1Q7EA 2FFAA 3IPXA 4ALJA 3IV6A 4XYMA 1VP3A 3O4FA 1ATZA 5JYCA 5HJEA 1LLQA 1U4NA 2EKZA 3ESQA 4TZTA 4ZCTA 1NR5A 2R8OA 3HO1A 2IHJA 2Z8YM 2LCFA 4B85A 5JAOA 4WX2B 1FOEB 4HXEB 4Q7LA 1GTMA 1DFIA 1U0GA 1XXHB 4GSKA 3I62A 1B0AA 5AKIA 2NSHA 3FWHA 3DULA 1UMBA 4HAWA 2IUYA 2CJFA 2QLJA 5DLQC 4FYHA 2BGGA 4BXOA 2WLSA 4QXMA 4ZI7F 2Q3EA 1FPQA 4PSAA 2OD7A 4G4SO 3KALA 3S2EA 5B3LA 3LUPA 221PA 3BFVA 3VAZA 1ZLXA 1E9AA 2BFMA 1ML4A 1P1JA 3N07A 3VRHA 5EJ8A 4JASB 4RMJA 1VKRA 3MB5A 2F8LA 2AWOA 2BZ0A 2GRAA 3BB4A 3RIGA 2D2VA 1WDWB 2XLBA 4LJSA 2YN4A 4E1AA 3GBSA 3GFBA 5EPOA 1FDSA 2MYTA 1JG2A 5DISB 2ODTX 4ZVPA 1TW3A 2CLIB 1A5SB 4ZVUA 2H7XA 1QHFA 4F1KA 1ZBQA 2GCNA 1XQWA 1JPVA 1NKSA 5GJVC 4KGXA 4CTNA 2ZWIA 2ZS7A 4Q7KA 5CX4A 2AG6A 1J0AA 3NT4A 3QBJA 4TL8A 3P2OA 2E85A 1U6JA 2IELA 3BE5A 4IDPA 4BEVA 1WL8A 5T6BA 3OY2A 1GV1A 2H7YA 2X4LA 3H3JA 3QA9A 5DLYA 5B7QA 3ABRB 1D7OA 4N54A 1ST2A 3DV0B 1Q1ZA 3ASUA 2H0RA 3EGCA 4MKRA 4TS1A 5AH0A 1OU4A 4D45A 4EG7A 3N8IA 2DT5A 3CVYA 4D5GA 3BWMA 4OLJA 1GFSA 4ZQHA 3HKDA 2PXAA 3FF4A 1F5NA 3HCPA 1NF2A 1VG8A 2QZ9A 3ETLA 5CDSA 1V5IA 2LXNA 4I9GA 3RC8A 1WXQA 4E08A 3UPDA 4TN5A 4CKWB 4EA6A 4EJSC 4F3CA 2LDXA 2V7EA 1XOIA 4L2IB 2I67A 4FKBA 3WSVA 2X76A 4KGDA 4B3GA 3DJFA 4Q0MA 4MQEA 4CIXA 4QDXA 1FRZA 3KQPA 4LSMA 5SY4A 2G70A 4EHJA 1JIXA 3G02A 5HZGA 4HQ0A 4QNMA 2ZT5A 3ROEA 1G8YA 4UTVA 2HPVA 3COVA 1A2QA 3L7NA 4QBFA 3KJQA 1ONSA 1EA7A 2DJIA 3MTQA 3N6RA 1V45E 1PSDA 2IE8A 2O0JA 1C9YA 3RANA 3ZD7A 4JX9A 2PZAA 3VU0A 2CXNA 4TTAA 2PVSA 3LY8A 1Q14A 4O2BB 2JIPA 3TOZA 1GAEO 3UV7A 5LIRA 3NHKA 3IJPA 2VIIA 1OC2A 3C4VA 4NONA 5A5VA 2ZI7A 5EUCA 4UVGA 2B30A 5BV0A 1J56A 2CNWA 2AEJA 3U16A 3MCVA 5KYGA 1ENOA 3VHXB 4CI9A 1HYHA 2BGRA 3WGGA 2NPIA 3OIYA 1LDYA 3ORHA 2WJHA 3LA6A 3ZIUA 2XT9A 3TR5A 1NA5A 1SGWA 4WOKA 5F78A 3M4YA 3LPCA 4MARA 2QJTA 4C3UA 4MIYA 4TSRA 1DELA 1DT3A 3L0DA 4LYEA 2X19A 3JWHA 3S2FA 2IY9A 3DMDA 3P2JA 3H87A 1FFHA 2DPGA 5H02A 5DYTA 2HBRA 1UP4A 1XN4A 1I01A 2YNMD 3CUVA 4Y8VA 5HZMA 3NETA 4O02B 2UZ0A 1J7JA 1WMDA 1WSDA 2B8WA 2HA5A 1DINA 1Y89A 2TSYB 5EMHA 1NC3A 2CL0X 1U0TA 4G0PA 4JJ8A 3RK0A 3ZNNA 4LY0A 1LK7A 3VYVA 5IAOA 2XUKA 3ABQB 3PYMA 2A0YA 4B5LA 2RHOA 3HB7A 5LUAA 5A6SB 3GLIB 1ES9A 1H23A 3BILA 2H1FA 3NHFA 2V7TA 1BIFA 2C61A 1QIGA 4HMPA 1U8AA 1VE3A 2DX7A 1JXAA 3RVSA 5TQ2A 3IKMB 4F5YA 1IN8A 1I1OA 2X0IA 3P0EA 3T12A 3EX7C 1VL5A 1KC3A 3N8KA 2GPSA 2EZ4A 4PO8A 2E1RA 1ZIXA 2QE6A 1K4MA 3O6VA 4PSUA 4QE3A 3KPUA 3TLYA 5JS7A 3LLUA 1JAYA 1QR2A 4AL4A 3UBTA 4E5DA 2QV7A 2FRVA 1NW5A 2IEGA 1DRUA 4A3SA 4BNXA 2WV7A 1O77A 1RI1A 1UJCA 4II3A 1Z7BA 1D0IA 1OVMA 3EEFA 4GMKA 3V80A 2Q9UA 2ZR7A 4MPDA 2MSNA 2ZYGA 3DT8A 1CPYA 4PHHA 1M83A 3A9RA 4EY3A 1ZGJA 3HACA 3V8RA 2B7BA 2J32A 3AQIA 3JVVA 4G81A 4Z86A 2IP4A 1I94B 3GCXA 1X1EA 2RBKA 3T0GA 4H0FA 1UZLA 4AKEA 1NL3A 2AW5A 3DBHA 3OJOA 4PZAA 2NZXA 5B7PA 5IK2D 2FPIB 2IX3A 1Q7GA 3R9XA 2GVDC 1FQKA 3PK0A 3P0RA 3QLTA 2IDKA 3OU2A 4TXNA 2PR2A 5AW2A 2Q4TA 3LQKA 5IDVA 5TDHA 4W1QA 2JBWA 2CJYA 1GRCA 1HXHA 2YN0A 3KOMA 1MH9A 1OHHD 3A4VA 4N6GA 4XDYA 1NUPA 4JLBA 3NIWA 1LV7A 3AFIA 1KQOA 1OIXA 2FEOA 2I99A 1TFRA 2JAQA 3LWBA 3LG2A 4NABA 1VPLA 1CCWA 4RPHA 1COZA 1EK2A 3W8DA 3G8CA 3ICOA 2WYWA 1U7HA 3IEMA 3W2HA 1M34A 3HXOA 3DMRA 1F2VA 2UVPB 3NR2A 1GXSB 3D1LA 3IV9A 2O0HA 1NRXA 3RREA 3QNUA 2W4MA 5L3SB 3HA2A 2JC3A 1F12A 1ODSA 3W8NA 3TLEA 2BBOA 1JU9A 3LY7A 5YASA 3RVQA 3OIGA 5E7MA 2KX7A 3O3NB 2CHEA 4BNUA 4YUYA 1HE1C 1S3GA 5DM2A 1UAAA 1HK7A 3M7IA 4OI1A 4QOHA 1M2KA 1XIVA 4HH4A 4ARCA 2NP7A 2DOKA 3RKRA 1O6FA 4H6PA 1K0FA 2OHOA 3NIGB 3RS2A 4JLPA 4UEWA 3VO8A 4YRSA 5C31A 1FSSA 3E48A 1IYZA 4JJIA 5FWYA 6CHYA 1K8ZB 1P7PA 4M6WA 1D6JA 3NUZA 5FV7A 5KCZA 3QOWA 4N7BA 4PO9A 4BQNA 1VCNA 3IEKA 2BGJA 2HMYB 5JY1A 1Z7EA 3O84A 2QMHA 4RS4A 1H22A 2GZ2A 4WFIA 3ZOKA 1Y9DA 5DHTA 1TTQB 1JILA 3Q7RA 4ZTZB 1CXZA 4Z2AA 5CB6A 2Q1SA 1E2UA 3AJDA 3EF1A 1L3CA 3G0HA 3G9TA 1PFYA 5CB4B 1YL7A 3Q3EA 3T4PA 1HKUA 1OYWA 1VSTA 2Y6VA 3GLHA 2WWHA 3C7CB 2P9FA 3GN2A 3I4CA 4FONA 1RLIA 2BM9A 3IQIX 3U3ZA 5LM3A 3L0BA 3OMWA 1RCTE 3H9GA 4L6CA 1EP3B 3PF8A 3USZA 2DZDA 4C89A 2IVFA 4E0BA 2GZSA 3PIDA 1WA5A 4I1UA 4CR6A 4GPBA 4BNDA 2WKQA 5C53B 3VFDA 3JQGA 4D2IA 2W6OA 2G4VA 3NM4A 1MUUA 4Z0NA 5F9FA 3WI7A 5JU6A 1T8PA 2LWIA 4A0FA 3QUTA 5GY7A 3QMPA 4IJWA 3VTZA 3UCXA 2I54A 1KZ6A 4WA8A 5IZCA 3WAGA 2VPIA 3MS7A 5AW5A 3NYWA 4QRHA 2E5LB 1XTJA 3UICA 2BFPA 2HJHA 3GJYA 5CVUA 2VSNA 2P75A 4O4LF 3VMMA 2XAAA 1Z08A 5KI6A 5KOYA 2X5NA 4CMGA 1Q0HA 2YHIA 3O1LA 1E1DA 4OXQA 4CF5A 3CW9A 2BMJA 1K7FB 5J4LA 3SR4A 5HM8A 2BFOA 2PG3A 1PYGA 5TARA 5FV4A 3HBAA 3INYA 4IXMA 1V16B 3GRAA 4IIJF 3ZZNA 1HZJA 5A6VA 3GUYA 4NNOA 4G8CA 1N1GA 3SSAA 3UQZA 1IJEA 1D8AA 2TRSB 3UAOA 4A5OA 3UAXA 5CBPB 2NVOA 5JCJA 5KSZA 3U1BA 3FGZA 4LE0A 5BN1A 1QIMA 1XA3A 1EJ2A 5BOSB 3WWOA 2YW9A 2Q99A 2J87A 5JDCC 4AKHA 2DCUA 3MLBA 4KAFA 4RJKA 4RY9A 3UB4A 2FK7A 2ZP1A 3G9XA 1G7SA 1N4DA 1GGNA 5EFOA 4W6QA 1SB8A 1XZCA 4IF6A 4JLWA 1EJ0A 1J9EA 3OOWA 4B9EA 1AO3A 2ENWA 2AD5A 2PJDA 4QLAA 3FGOA 4UVHA 4M8KA 5AHXA 2JLUA 2R751 2VXCA 1USVA 3B3GA 1PQUA 2W6MA 3RKSA 2AN3A 2I1WA 3K5PA 3T52A 3DBOB 4LZWA 2QTVA 3G0CA 3HDQA 1IUPA 2NX2A 1R27A 4LOAA 3U3MA 4EPVA 5CJPA 3IVCA 4I66A 2Z56A 2VPZA 3FIJA 1IC6A 3AHHA 3K0FB 3WL6A 4JJ6A 3ZE8A 1GPMA 1YQGA 1HLDA 3BAFA 5DM1A 2W8BB 3JCZA 4NE9A 3UMVA 3DMYA 1R18A 4WY5A 3SZLA 1ZPDA 2C9MA 3DLPX 3V4FA 5TS2A 3I01A 4G63A 5EJGA 2ZBDA 1U2RA 2VYND 2R7LA 1GUYA 4JKYA 4BN5A 2O8EA 1X7YB 1QB8A 2VDRB 2F6RA 3ITNA 4HS4A 3LY5A 1KVSA 2Y0EA 5E0KB 4DIBA 1DC8A 4ASUA 1OB5A 1XEWY 3GQVA 3HCFA 3QKIA 2KS6A 1LBEA 2P78A 5ALEA 4J0KA 5DULA 2CLKB 2XQKA 1NN0A 2BFNA 1UWVA 3Q8XB 3EEYA 1Y5RA 4GKKB 3G0IA 3M3PA 2JKVA 1S2DA