2D3WA

Crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
244
structure length
244
Chain Sequence
MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent transporter sufC
publication title Crystal structure of Escherichia coli SufC, an ABC-type ATPase component of the SUF iron-sulfur cluster assembly machinery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 70
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d3wA00
2OESA 5D3QA 4EAQA 3H84A 1JXMA 4TMXA 3I61A 2ZUBA 1W4RA 1XTIA 5KTYA 3I72A 4JLVA 4HB2A 4PPFA 2VTKA 4Z54A 3WMFA 4IVPA 1CULC 4BRWA 2A3RA 3V4RA 3ZVMA 1BYUA 3WHLA 2VP2A 3OEHA 3KTAA 2BBOA 1JR3A 1U0JA 3BD9A 4GOJA 3HDTA 3EARA 4LC1A 4RZUA 1KI7A 1CR1A 3B7GA 2ZJZA 4EDHA 1OH6A 4A36A 2CCKA 1GFIA 3QXXA 2DR3A 3QKSB 3SS8A 1NSFA 1J8YF 3THYA 3X1XA 3F3YA 5JECA 3VNUA 1XBTA 1FTNA 2R62A 5F2EA 1CRPA 4JS0A 1A2KC 2CE7A 2BEKA 4A4DA 2ZI9A 5KUTA 5J4HA 2YKGA 1OB2A 1GZSA 2CHVA 3SDZA 4B43A 1LNZA 3WNDA 1UKEA 1R0ZA 3GLGA 1AS0A 3ZD7A 1SXJD 2XTMA 1ZCAA 4BECA 2QNRA 1U99A 5BN5A 1TU4A 1DE0A 3NWJA 5CB6A 1CTQA 1KI6B 1W4AA 2ZRCA 3BB1A 5FPHA 3R8FA 2QBYB 5DHAA 3BXZA 3LFUA 4I1OA 4IEIA 2QGZA 3IUYA 2QM8A 4URUR 2JLVA 1G5RA 1S3SA 1XD8A 2PCLA 5LBIA 1DAFA 3T06B 1E0SA 4Q4AA 1ZIPA 2QSZA 2IF2A 1EFRA 4QBIA 5G53C 3DEFA 3ASYA 3G5UA 4BZPA 1KZ7B 1NRJB 5FTMA 1KK2A 3ZIAD 1YE8A 2IEYA 4GZLA 3W8NA 1ONBA 4TT3A 1SVLA 1E2QA 4KCGA 1W44A 1Z0JA 2HF8A 1VHLA 3C5CA 3AM1A 1F6BA 2IXFA 2QI9C 2RKOA 4QKQA 1E96A 4ZDJA 1E9CA 4JL6A 1LVGA 2HV8A 2JASA 4K46A 4LHWA 421PA 4P33A 2H7VA 2J9RA 2W2XA 2IYRA 2KB0A 4W5HA 1GVNB 4MKFA 3X2SA 1UF9A 4ESVA 5CITA 1CKEA 4TTQA 5KOYA 1KKMA 1XRJA 1RRFA 1Z8FA 3QG5A 4TLEA 3IO3A 2YHSA 2FV8A 4M1WA 3KJIA 4AD8A 1R8SA 4HI0E 1UPTA 4ZIRA 5ELXA 2BHRA 3X1YA 2RHDA 3L0PA 5DLQC 3L43A 3RWOA 3VR5A 3HU3A 1XTJA 2AX4A 1RFLA 3JZMA 4QHSA 1UADA 2OCAA 5G40A 1TUEA 1XP8A 3Q5DA 2QRNA 5A4JA 4P4SA 3VR2A 3QJYA 4TYYA 4X8OA 4B32A 1Z07A 1NP6A 2QAGA 4LUCA 4E5UA 1TQ2A 3U3RA 4I1SA 2HCJB 1SXJA 4JZKA 3PJRA 1CJTC 2HT6A 2X8AA 3QG1A 3HU1A 3MWKA 2PX0A 4RD2A 1F2TA 3BH7A 3U2QA 4AKHA 1S9DA 2O0JA 1I2MA 4I99A 3OIVA 5CLQA 2FPLA 2OFXA 3UWOA 3M1IA 3GLHA 5HZKA 1Q44A 4H1VA 1FUUA 1P75A 1XJCA 1R8QA 4C4PA 2GWHA 2ZITA 3GLIB 1U9IC 2GCNA 4KBFA 5UKDA 1NLYA 3ND8A 4M9SA 3TE6A 3RHFA 2R8RA 2BM0A 4IDHA 1DAMA 2HLDA 5CJ2A 3CZQA 2CJWB 3ZS8A 4BLQA 1BMFD 1U8AA 3CWZA 5KSZA 3J81k 5JRZA 4JSTA 3SFVA 1TUIA 2WKPA 3RS0A 4M1SA 4B3DA 4X8MA 2WSMA 1P2UA 1HT1E 4M4SA 5AWFC 3UXMA 3K0CA 3SQWA 4G5QA 1S3GA 1ESNA 1N6KA 1OIWA 2CL6X 3OF5A 4Q7MB 1KK0A 1X86B 2IYZA 4FMBB 4O25A 4V0NA 1OLOA 3K0FB 4NYJR 4POAA 1RZ3A 2CBZA 1XMJA 4TQAA 4QNRA 2XJ9A 1OHHA 4V02A 4C9BA 3CM0A 1Z47A 3ZVLA 1G291 3LX5A 3P20A 3KTAB 5FPYA 2A5FA 1GRQA 1ZC3A 4DDTA 3TQFA 4DDUA 5JWRA 1EWQA 1MO5A 2UVQA 1NN0A 2ATVA 2P67A 3QUSA 5AJYA 1EESA 4HUQB 1UBFA 5EQTA 3AVTA 5LD2B 5DSZA 3THYB 5GJBA 1A4RA 1FMJA 3WYFA 5B58C 4NP6A 1P4SA 4NKRA 1AGPA 2X2EA 3B5JA 4HAZA 5C2JB 1OSNA 2GEUA 3QNUA 1OXTA 1KMQA 1NJGA 3GJ6A 3U6KA 4RD6A 3SI7A 4NMMA 5H68A 2V54A 4HB0A 3TKLA 1Y3AA 1US8A 1FW6A 1HURA 3MRSA 3PEVA 2BDTA 1E2JA 1W0JD 3BB4A 1GSIA 3FVQA 4NL4H 4CEIB 3Q7PA 3GJ0A 4H1UA 2PBRA 3AV0B 5SZKB 1II8A 1GL7A 4JYCA 4HAUA 3AVYA 1VPLA 5CM9C 4TZ6A 4UNRA 1G9XA 2IUUA 4EQ6A 1R7RA 2IW3A 4G3XA 4HLCA 2X2FA 4NCIA 1JJVA 3UATA 2V4ZA 1BMFA 2K5UA 1DAKA 3MG9A 4IJMA 1NG9A 2YC2C 2ZJYA 5FOSA 1FL9A 4PPNA 4A2PA 2YWFA 3HR8A 4B3GA 2GXUA 4PXAA 2AK3A 1GITA 1E2MA 2OO7A 2P0EA 4YMWA 1Z22A 2HJVA 4K8OA 1PJRA 3IHLA 2HUPA 2NZJA 4JMPA 3W3ZB 2CLDX 4M53A 2C78A 3JVUA 4BFXA 3ZH9B 3HPRA 4DCUA 1DO2A 3RRMA 5KYKA 2P5TB 3TSWA 1PVOA 1KI8A 1QRAA 2XTZA 1UBCA 2GCOA 4A0FA 1IAQA 3R9IA 3WY9A 2ZJBA 4O0MA 1IN6A 1F5NA 1GNQA 3DKPA 1II0A 1Z28A 4KO8A 4JLJA 1SULA 2ZRHA 1D5CA 3O8CA 3LXXA 4ZIRB 5H70A 1ZAKA 1TF5A 2FFHA 4M22A 4V0LA 3FFAA 5FL7A 1G7TA 3QPVA 3LA6A 1E9AA 3A36A 4KSBA 3S1AB 3VR4A 4D4KA 2O8DB 2H16A 3ADBA 2H17A 2JLUA 1TF2A 4I4LA 1E1QD 4B75A 4OHYA 3IBYA 3PVSA 1ZMXA 1P73A 3B9QA 3AF1A 1ZM2A 3JVVA 2QAGB 4M9XA 2MMCA 1VIAA 4GMDA 5JCZA 2ZRMA 1SXJB 1VMAA 4AIIA 1G3UA 5F9FA 4DCNA 1SHKA 4Q9LA 2MMGA 1OYYA 3LBIA 5BYJA 3QPUA 4P4UA 2KSQA 1F2TB 3T35A 1D2NA 1GL6A 3UANA 4JBYA 4B48A 2OLKA 2Z4RA 3KUCA 5FOVA 1Z06A 1GG2A 3QQ5A 2FFBA 3LVQE 2XZOA 1Z6YA 2Q0HA 4US2R 2G0TA 3DDCA 1JXOA 4GBMA 2CDNA 1QHXA 1ZRHA 4Q1AA 3AUXA 3NDPA 1OFIA 1X8LA 1HYQA 2OHFA 1P72A 1G4AE 2GAOA 3QVUA 5C46F 1OKKA 3LRPA 2QU8A 2EQBA 1GTVA 2ZE7A 3PEYA 4KU4A 1CBUA 2DBYA 2OAP1 2BJWA 2BV3A 5JS7A 1AQUA 1ZNXA 5JJLA 3CONA 5H1YA 3SYKA 4BFWA 1ODFA 1VCNA 4TMKA 1D6JA 3BAFA 4RFSB 4LJ8A 2I1QA 1RVDA 2WOOA 2XXAA 1RW4A 2ZIAA 2JJ8A 2ZS7A 5IK2A 4KVAA 3N70A 1SVIA 4IXNA 1E2EA 4RJLA 1L8QA 5KSOA 1X8KA 4QBFA 4EFNA 3U7HB 1W7AA 1S96A 4JLNA 1Z2AA 3ZZUA 2O8EA 5HE8A 2ZI3A 3CWQA 1QBKC 2J59A 3EAQA 1XFAA 1HEIA 4A9AA 4BPBA 2IS4A 2CCGA 2R44A 2B7CA 1VTKA 3RS2A 3TK1A 1G8YA 3U60B 4ACAA 2C99A 4PSAA 4OHVA 2PZEA 5L3SA 3KXKA 2QMOA 3KXLA 4LBZA 3TGPA 5H8WA 4M0LA 2EFHB 3QPWA 4JSYA 4B47A 4KSCA 1T9HA 2QA5A 3KKQA 2D2FA 2QP4A 2OAQ1 3KJGA 3GJ5A 3A1SA 1J70A 3SOPA 3BE4A 2CNWD 4C3ZA 4JLAA 1SZPA 1US8B 1UBEA 2F3TA 2MSDB 2BWJA 2NTYC 3THXA 4X8LA 3A58B 4W5WA 5BN3A 1E99A 1IXZA 1G3IA 1UEJA 1JB1A 2QM7A 1VDZA 1RC8A 1II8B 4Q9KA 2ZRJA 4AKGA 4HDQB 3PENA 4YONB 1SVOA 1UFQA 3I62A 2FSIA 3K09C 4C0SA 3TAUA 1AS3A 5EP4A 2ORWA 2AXNA 4OHWA 1KI1A 5EJEA 3RS5A 1SVKA 5A5GA 3PUYA 5KDOA 4G5RA 4O3MA 3TH5A 2FEOA 1SGWA 3C8UA 3EZ9A 5CM8B 5FFMA 2J45A 1P9RA 1U2RA 5HTKA 3VKGA 4FMDF 1G20E 3TVTA 2NG1A 2D62A 1ZUNB 3D6TB 1XXHA 4YXWD 3R9WA 5JWHA 1LV7A 1EFHA 2QL6A 3B1ZA 3TIFA 2F55A 1Q57A 2ZRPA 1OF1A 1OXVA 1RYFA 1YHNA 1YR7A 3NVAA 4A92A 2IT1A 5EUQB 3AKCA 3LW7A 2XJ4A 4KBGA 1NBME 3U3MA 2F6RA 2C9CA 1RJ9A 2PT5A 3DO6A 3TLXA 4Q01A 2WHXA 5KHOC 2GCOB 1FQKA 1HTWA 3BB3A 5FBWB 4D4MA 4V0OA 1S1MA 1OH7A 1YVDA 1I2DA 1Q22A 1GKUB 2GXQA 2ZRKA 721PA 4PZZA 2AFHE 1Q21A 1P3JA 2ZRAA 3EA0A 1R5NA 3WRXC 1KAOA 4TLAA 4Y0VA 1YRBA 1Z0AA 2OBLA 4LC0A 5AJXA 3FMIA 3FGNA 2WWWA 3SNHA 3TUIC 1CJVC 2X1VA 4FCVA 4PFSA 4O2LA 1R10A 4P3YA 3U7FB 4M1YA 3BH0A 1JJ7A 4TMTA 2E9SA 3CRW1 5FI0B 1G7RA 5JI3E 3KJEA 3VKHA 2C04A 2WWIA 1YZLA 2IA5A 2O5VA 3T1QA 4C0BA 1JAIA 2EFCB 2XSZD 2VP6A 4PAQA 521PA 1LS6A 1P2SA 2IUSA 1Y63A 4BASA 1LY1A 2V3CC 4N0EA 4RD3A 1ZIOA 5JHHB 2LWIA 4HDCA 4LJ4A 3QEOA 3CRRA 2F1RA 2RCNA 4B73A 1NLFA 4FWIB 4GI7A 1R5BA 1M2OB 2FE4A 4NHOA 5FUYA 4LCBA 3WP0A 3AP2A 3SEAA 1E94E 5HE9A 1P5ZB 1U81A 3CIOA 2NGRA 2O8CA 4LYFA 4LX0A 1YZUA 1NMYA 1FMLA 1L4YA 3KQLA 1PLLA 4V0MA 2QBYA 2W6ID 2VPPA 1N0VC 1WBBA 1N6RA 2DWPA 1AIPA 5ANRB 1G8HA 3I73A 2GNOA 3NHAA 1M34E 4DWJA 2I3BA 2NMVA 5KNCA 2ZYUX 4ACBA 5A0FA 4L4UA 4R2HA 3MSXA 1VKJA 3LD9A 1JR3E 1NY6A 4JT4A 4KFRA 4Q7KA 4HSEA 4Q5IA 4B3CA 5EZ5A 2J7PD 3TQCA 3MAAC 3LBHA 1KZGB 1W49A 2NPIA 1G3QA 2W2TA 2ORIA 2XXAB 1ELOA 4WVFA 3U44B 2PLFA 1N6IA 5GVSA 4JJZA 4IRUB 4U7DA 2IS1A 1H8HD 1UKVY 3UMFA 2C98A 2WIAA 3IQWA 4DDVA 2V55B 2ZJ5A 2I4IA 3AP3A 3SJBA 3U4QA 1OH5A 3BGWA 4NBSA 2IYUA 2GAAA 2OSBA 2YWHA 3LY5A 3PUXA 2BMJA 1K5DA 3I5XA 2O8FA 1IY2A 4TN1A 1AA9A 3RDPA 5KU1A 4UNQA 4LHYA 4MDFA 3BC1A 3Q5EA 4M21A 2EVWX 4WW0A 3GFOA 4B2PA 4IFBA 5L3SB 1E2LA 2XTNA 3A1UA 3AP1A 4A8JB 2C2HA 4XTRA 1VCOA 2VSXA 3OIYA 4NE2A 3V4FA 4DLRA 3I8SA 4HAVA 3KJHA 3W5IA 4UXHA 3IIJA 2J0VA 1QHGA 2P3SA 2FSFA 4EKDA 5HZHA 2CHQA 4ZCMA 5C4GB 5E4FA 3AVOA 3U3KA 3THXB 2BMEA 4JBXA 3CX6A 4D82A 2IUTA 2Q9BA 4EUNA 3DM5A 3BFXA 2YC4C 3ZD6A 1BKDR 1HA3A 4OJKA 5EE1A 2N1BA 1CEEA 2JATA 1UAAA 1QHSA 1N6PA 2IK8A 3LBNA 1EFUA 4DVGA 2JLWA 1E0JA 1QHYA 2RGCA 4KAXA 3AEZA 1L2TA 3RLFA 3Q85A 1V43A 4RY2A 3AVWA 4PO1A 5KDDA 5BN4A 4WOPA 1QG4A 3LNCA 4TLCA 1E2FA 4HLDA 3LDAA 3H2YA 5J4LA 4JYBA 4ZI3A 4LGMA 5JZVA 3EZFA 2QMEA 4M2LA 3D31A 1TADA 1XXHB 4GT1A 3WBKA 1N5KA 4KV9A 4TYQA 5JSZB 2JJ1D 2JCSA 3QF4B 3UG6A 4M9ZA 5FPSA 2J7PA 4MGZR 5IF9A 5L3QB 1NN1A 3N2IA 2VHJA 1XTKA 4QBHA 3AF3A 3R7WB 2G88A 5JFGA 4FCWA 3ZVRA 1J8MF 2RAPA 2NO1A 4JVMA 2P65A 3DM9B 4D81A 3EIEA 2LKDA 1EGAA 3OFND 2D3WA 3IGFA 3VR1A 1H8HA 1N2CE 1YQTA 4MGYR 4PQYA 1WBDA 1IN8A 2PL3A 1X1RA 1GILA 2Q6TA 5FI1B 1R2QA 5CK4A 4G0NA 1KI2A 2VQSA 1WXQA 2J3EA 3E2IA 2OEPA 3K0FA 2C5LA 1R0WA 1XEXB 3QBVA 2YOHA 2NIPA 2YINC 3T5GA 4DB2A 3REFA 4F38A 2B6HA 2RGNA 4QC2A 1OXXK 2GKSA 4BLTA 5IT5A 2RGXA 2ERXA 1M8PA 1IJEA 2WJJA 4XJXA 3LH5A 1KJZA 5G41A 3RS3A 3AVXA 5B57C 2GJAA 3BJIC 1NVVQ 3BFKA 5J47A 4NCKA 4HUQA 4DLWA 4X8HA 2BVNA 4TQUS 2JDIA 4FI3C 2FU5C 2KWIA 4TMZA 5FBRB 4F4CA 3IIKA 4I1VA 2ZSBA 3ZQ6A 3C4JA 1X1SA 3N2EA 2WWYA 4PAMA 4C0QC 2D7DA 4JVLA 4YMUA 2HXSA 3B9PA 2QG6A 1DS6A 1ZYUA 3EPJA 2ZANA 4BLSA 5FOXA 2WJYA 2LCFA 3NC0C 1KDOA 1AJEA 1CJMA 2J1LA 5BW8A 2ZS9A 4FMCB 4LRWA 3RS4A 4E07A 1H8EA 2Z43A 2GEVA 3HYTA 2QPAA 1D9XA 4ARZB 4JLDA 1UDXA 3MGCA 3PITA 2ZRDA 3NH9A 3O8BA 2QP3A 4PPQA 1T6NA 4S2EA 4Q00A 2J0UB 1N0WA 2H8KA 4RFVA 3TJZA 4OQNA 4IFEA 2O8CB 2R65A 1ANKA 2ZE5A 4ZDWA 1Z5ZA 1Z29A 2O0HA 5LB2A 3MWYW 4CEIA 2DY1A 2OCBA 2HXYA 2OCPA 2N46A 3L8ZA 3THWB 2W00A 4PHHA 1E9DA 1KSFX 5KPJA 3KQHA 3K70C 1KO1A 3HU2A 2FPKA 1ZM4A 5E7JA 3A6PC 2CE2X 3MD0A 2LKCA 2ODBA 4PSVA 4JL5A 3K1JA 2EW1A 3ONWA 3CR8A 2FFAA 4AYTA 4G5OA 1CLUA 4PX9A 3VR3A 2ZRNA 2IS2A 5JLJA 1KI3A 3PIRA 1A5TA 1Q1ZA 3KDSE 1CJUC 2FX3A 2W2VA 3OFNA 1P9NA 2J46A 3MMPA 2WWGA 4ZPXA 1N3BA 2Z6VA 4Q4HB 4KXFB 3VU9B 3EC2A 3U4QB 2WKRA 1S8FA 4HAXA 1Z0IA 1IN4A 1Z6AA 2ZI5A 3SZRA 4IOMA 3G82C 3SYLA 2O8FB 1G41A 2WJGA 2XNSA 1HH4A 3L0SA 1G6OA 3BK7A 2JLZA 2ZJOA 4OL0A 5J4VA 4JIMA 4DBLC 2GDJA 1CS4C 1JQJC 1GL9B 2KBEA 3TMKA 3OIWA 3GJ4A 1PV4A 2ZR9A 2H1LA 5FTLA 1W47A 2IYTA 4PSKA 3W8RA 1ZCBA 2O8DA 3S1AA 4UJ3A 2OCYC 3GLFA 4A1FA 1DARA 3EXAA 1KK1A 3GD7A 2R9VA 3PG5A 3QXJA 3VTKA 2CHGA 4YMTA 4DSOA 4FWTA 2NO0A 4YQFA 2ZYTX 4GL2A 2RMKA 3RWMB 3BFVA 3SHWA 4PQFA 1M74A 2CEAA 4BFVA 2BCGY 1PZNA 1U0LA 3I92A 1WA5A 2QENA 2W6JD 2WBLC 1WE2A 2ZU6A 4IDOA 2NQ2C 4OQXA 2AKYA 2GK6A 2ZI4A 4GPTA 5CIWA 1QVRA 4EPWA 4M1TA 1IM2A 3VQTA 1BO6A 1W36D 1MO4A 3NC1C 4XD7D 3EASA 2NZ8A 3AUYA 3VHXA 1E2PA 2DPXA 4PPGA 1X8JA 4GNKA 1AZSC 5K8UA 1QHIA 4B6EA 4URVR 4AURA 5EE0A 3Q72A 3K53A 4IVQA 4OBEA 3T12A 2BBWA 1XPUA 4UJ5A 1E2HA 2XZLA 2AD5A 2A30A 2WMOB 4PHTA 3AVUA 4TLDA 1F2UA 1FP6A 3AVQA 4Q4LA 1IHUA 3VHLB 4LYHA 2R6CA 1XPOA 2IYLD 1E2IA 3KB2A 1KDTA 2FOLA 4URWR 4YMVA 1NLZA 4LSGA 2EWVA 5TY0A 1NG1A 2MSCB 1EFTA 5FL3A 2G1JA 2CVHA 4LHXA 1BOFA 2VBCA 1XWIA 4YMSA 4RFSA 4IOJA 4PR0A 4AG5A 4RKFA 2JIZD 3A1VA 3TSOA 4UNSA 2G1KA 1WDTA 4LY6A 1RYHA 2DYKA 5DO9A 2P6NA 4C0LA 1VYTA 1TL7C 1PUJA 4JLBA 4NYJQ 1T5IA 3F5FA 3IPXA 4XH9B 3A4MA 2OBMA 3P26A 4B33A 3L2OB 5E7MA 5EXXA 1BYIA 1SVSA 4UNPA 1M6NA 2ZM5A 1E9RA 3KQKA 5JEEA 3D7MA 3A1TA 4LJYA 1D9ZA 1UEIA 4KYUA 4R2IA 5EE5B 1MR3F 2Z83A 2VP4A 1E32A 1VG1A 4HATA 1CJKC 3P1JA 4IOKA 4C7OA 4NONA 1VG8A 1E2DA 1ZD8A 2J87A 4Q1EA 4OI0A 4M9QA 4D0GA 1CU1A 1WCV1 3CNNA 3ICQB 1U94A 2QEQA 3GFPA 4GOXA 2EYQA 4PC2A 3PEWA 4P31A 3SJCA 2R6AA 3QKRA 2N42A 1MRSA 1U90A 3MWJA 2G83A 2ZAOA 1QDEA 2IYYA 3K09A 4GFDA 4A0RA 1A7JA 3WYAA 2A9KA 3GFTA 3AKEA 2NO6A 2QT1A 2G3YA 1EFCA 3TAHA 5F3WB 2VLIA 3L82B 1CR2A 5EZ6B 4RSGA 2YJTD 4QJ4A 2OT3B 2L0XA 1RRPA 3QY0A 5FTJA 3RC3A 3LX8A 4B44A 1RRGA 4JBWA 3WHKA 4NYIR 4BE7B 1N5JA 1DAGA 1W48A 2QPTA 2UZIR 1GDDA 3IIMA 2JJ2D 5AK0A 3QXCA 2G0NA 2OM2A 1JALA 4EFLA 1DTSA 1U0HC 5EXSA 3AF2A 3TR5A 3RANA 1HQCA 1TQ6A 3GJXC 2WWXA 5FH9A 3EA5A 3P4XA 1FQJA 2REXB 3MFYA 4NCJA 2FJUA 4L15A 1DG1G 3CR7A 1MOZA 1ZNWA 5FTNA 2AHOA 1KNXA 3C5HA 2G9NA 2FF7A 1N6LA 4DKXA 2FH5B 2R6FA 1T3SA 2V9PA 1E9FA 1XMSA 2OE2A 3RABA 1X6VA 1SKQA 2W58A 1R0XA 1KYIA 4II7A 4WAUA 1CIPA 1TX4B 2GJ9A 2VHQA 4L9SA 5CDFE 4CEHA 5GJWC 5EE3A 3CRQA 3W34A 2F1JA 5DN6D 5JCPA 2XB2A 3WMGA 1TPZA 5J4YA 3I5YA 1Q20A 3ICEA 1ZD9A 2XAUA 3EWAA 5TXGA 4B2LA 1C1YA 3OIUA 1VG0B 2JLYA 3FKSD 2OFWA 3GLFB 5DI3A 4V0KA 4D6PA 4KODA 5AJVB 1IN5A 3PR1A 3M6AA 4DC9A 3A1WA 1ZUIA 1R0YA 4AK9A 2PLRA 1GKIA 3FKQA 1GP2A 5CYPA 2GZHA 4MYTA 1W0KD 4OI4A 4LPSA 3E5HA 4TYNA 3TW8B 1DEKA 1XZPA 1TQ4A 1X3SA 2ZSFA 1W0JA 3QKTA 2GBLA 1AKEA 4CDGA 3IEVA 2G6BA 1GKYA 4J0QA 1I4TD 5JBQA 2QRZA 1OFHA 1WQ1R 2H18A 1GUAA 2PMDA 3CPHA 1W46A 3VR6A 1NMZA 3B1WA 3QVVA 3ZIAA 4PC1A 5JEDA 1YZTA 3BH6A 3TW4A 4IEEA 3DKVA 1LS1A 3ADDA 3CH4B 2XNDD 4IW3B 3SHFA 1G17A 1G5TA 2ZYWX 2JJ2A 2QAGC 4P0TA 3VAAA 1TU3A 1E6CA 1F2UB 4HDOB 1XEFA 1OIVA 1ZC4A 4UXJA 1TMKA 4B74A 2QQ0A 4RZXA 2O0KA 3DL0A 2VA8A 2IWHA 3W6NA 3KQUA 2DFTA 1TNDA 3U3JA 4MUBA 2WICA 4QGAA 4Z8XA 2Q3MA 4TTPA 3K0SA 3RS7A 4TYWA 1LW7A 1ZM3A 2EFDB 2A5GA 4ITRC 1COWD 2NO7A 3RSOA 2DB3A 2WMNB 4MYCA 4EPYA 4XVUA 2GXSA 1HE1C 3U44A 4UNNA 4KHZA 4F91B 4ON9A 3IDQA 4Z8YA 2FEMA 2OXCA 4ABYA 2ZSEA 4KITB 2BIFA 2ZRFA 1FOEB 3W3AA 1XB2A 2ZE8A 2ONKA 4CW7A 4LK2A 3KXIA 1T3HA 4LJ9A 3NKVA 4EJSC 4LV5B 3T1TA 3KKNA 4XIGS 5KNDA 2WVJA 1S1CA 3K0CC 3FKSA 1KK3A 1NY5A 4Q4JB 1BH2A 1M7HA 4ESHA 3SBDA 1DADA 2WAXA 4DCVA 4DRZA 3FYHA 3GQBA 1E1QA 1AQYA 2ZE6A 4A8JA 1TTTA 3HP1A 3CX8A 1E9BA 3LQQA 4C7OB 4GP7A 2A2ZA 3WMEA 2FZ4A 4G01B 2J7KA 4HUTA 1W2HA 3QBTA 2ZVQX 3QKRB 3LVRE 3K9GA 3LO5A 2FSGA 3ETLA 2IHBA 1MABB 1P9WA 3E1SA 2NPFA 4TL8A 2EFEB 4D26A 2IYVA 5SZIA 4DHEA 1W36B 3FMFA 2C8VA 3AKDA 3K9HA 3SE0A 4JLKA 5GADl 1E79D 3P32A 1KJYA 2QORA 1I4DD 3W6OA 3QKUA 4ZKDA 4MITA 1NF3A 3PXGA 1ZM7A 2RH5A 2ZS8A 2FG5A 4R9UC 4TL6A 1T8TA 1II9A 4LBVA 3I4LA 1A82A 2QTVB 3K70D 2YVUA 2EYUA 4Q9HA 3O8RA 3ZDQA 1RIFA 4XWAA 3UMRA 5EP3A 4NYMR 4PANA 4B6FA 2CXXA 1EX6A 4I81A 2AR7A 4DDWA 3AVVA 1GNPA 2GILA 4LPKA 4OJQA 1NSTA 2BBTA 3WNBA 4URXR 3QF4A 5JSZA 1OIXA 5D3MB 5E7IA 4DLVA 4TSFD 2VHUA 5L3QA 4JVSB 4L9WA 3B1XA 2X77A 3C16C 4Q1DA 3PQCA 3R7WA 3QOFA 4U02A 1KI9A 1B23P 1T4GA 3K0AA 4QJ5A 3ZYCA 2P6UA 2AFIE 4NTZA 3NBFA 2VL7A 3DZ8A 3QIAA 5FR2A 1VECA 2ZU0C 1P2TA 1DPFA 4CEHB 2FWRA 3K9LA 3UMSA 1QZXA 821PA 1Z6XA 2ANBA 2CL0X 4MA4A 2V1XA 2CMKA 3GEIA 1E2KA 1Z08A 3T61A 3WRYC 1HT2E 1XEXA 5AUNB 5DI3B 2REBA 2X19A 2VF7A 2WSSD 3D8BA 3KZ1E 3LWNA 4CEJB 1HY3A 3IILA 4AKEA 1FPMA 1W5SA 4LYAA 2W0SA 3SN6A 3GEHA 5F9HA 4PTLA 3GLIE 2CNWA 2HDNB 1U8YA 5HKKD 3WXMA 3AF0A 2FSHA 3HYRA 3B2EA 2ZXUA 2VHCA 4OHXA 1KO8A 1N0UA 2NO9A 4M1MA 1KI4A 2EWWA 3Q7QA 2ECKA 2NOAA 2OBNA 4AI6A 4BRUA 2YWGA 4MGIR 1U98A 2FGJA 2KJQA 3ECCA 4Z1MD 3B8HA 4WZ6A 4ARZA 1DAIA 2BMFA 2C95A 1NBMD 2VRWA 5TV2A 4TYPA 1T8UA 4AYXA 4TQ9A 1QF9A 2D06A 5J40A 5IDVA 4PO9A 2J0UA 4DEYA 1EG7A 2F3RA 1KY2A 1ZNZA 2GCPA 3FMOB 4EPXA 1PLKA 2Y8EA 2EU8A 1XMIA 4EPVA 4F7WA 2ODEA 4XWKA 1I4LD 3THWA 4DIDA 1AS2A 4A0GA 4YXWA 1OYWA 3FHCB 4RKEA 3GJ8A 4BLPA 4WXPA 4RVCA 3UPUA 2D2EA 2GEDA 1KKLA 4LV8B 4TSFA 4G5GA 4D0LB 2OG2A 1Z3IX 2O8BB 3PFIA 2Z0MA 2ATXA 2G77B 3EW9A 4I1UA 1DELA 2ZUDA 4ZCIA 1TF7A 3PUZA 3NDBB 4QFMA 1Z0KA 4CYMA 1J99A 1K8RA 3DVLA 4Q9JA 2WPDD 4Q4HA 3UKDA 2V6JA 3T34A 3VU9A 4F92B 1NNEA 2OV2A 5B30A 4BFYA 2AD1A 2BJVA 4KVGA 1G4UR 3U7GA 4A15A 2ZI6A 5LB4A 4MRVA 3GLGE 3NEJA 4BZXA 5C4MA 1IQPA 1XU4A 4HYYA 4PQRA 1Q3HA 4LJ6A 1T0JB 4XOIA 1G18A 1Q1QA 5TDHA 1KO5A 4AYWA 1GIAA 4HAYA 5DIFA 4BFTA 1G21E 2IYWA 2VP0A 2V8OA 1EX7A 2IC5A 3R9XA 4MGKR 3OEED 4XSGA 2F43B 1NIPA 1Q1EA 5AUQA 1JPNA 3SU8A 2OFOA 3GJ7A 1XD2B 3IHWA 3RVBA 3T1VA 4AY2A 5HKKA 2P5SA 2B8WA 2FZLA 2XSZA 3A4LA 2BEJA 3QXHA 4B2IA 3CH5A 3B85A 3I8XA 1G8GA 5DI9A 3OEHD 4HB3A 4P32A 1JR3D 2BBSA 1ESMA 2ZJ2A 1UJ2A 1KO4A 3EG5A 4S35A 4B34A 4BFUA 3FOZA 4H9GA 3RC8A 4WZBE 4A2WA 4PC6A 3NEYA 5P21A 1U9IA 2V7QD 5DH9A 1CRQA 4R71A 1KJWA 1F48A 2FNAA 2QAJA 1IBRA 4N1AA 5KSPA 3D3QA 3ASZA 3SYNA 2Q21A 1NN5A 1UKYA 2W6IA 3RAPR 3HWSA 1T0HB 2YOFA 2VEDA 3THOA 1YZGA 3H4MA 1MT0A 1SQ5A 2ZR0A 3HR7A 2VP5A 2IEZA 2PZFA 3MLEA 2GK7A 2ZRIA 4FN5A 2AL7A 4GSYA 4DLXA 3QEJA 2QPOA 1KMHB 1OFUX 2QP9X 5J4KA 1XCMA 4JT2A 2GJKA 3AGPA 4DSNA 2YOGA 1YJ5A 1JBKA 3K0AB 2IF0A 2REOA 4CT4B 2D4HA 5IHPA 5EXTA 2AN9A 2WPDA 1HQYE 4IXMA 4R7ZA 4U5XA 1G7CA 4RD0A 1W4CA 1ZJ6A 4MUAA 1GRNA 5IRCD 4Q1FA 1XTRA 5LPNA 3U61B 2ZJAA 4B3XA 1O3YA 4IVRA 2RGDA 1ETUA 1JI0A 1SXJE 2WWFA 4F4IA 4Q7JB 3SBEA 3UWKA 2IYQA 2AWNA 4D25A 4KJZA 2CL7X 3DPUA 5HCNA 2EFGA 1JEDA 4BFZA 4DLSA 3M4YA 1QHNA 5FBLB 4PHFA 3GLHE 3OEEA 1FUKA 3OESA 3PV0A 3WP1B 4D2IA 4QOSA 2BC9A 3L0IB 3ZGXA 4TMVA 1UBGA 1NVVR 3VFDA 4DLTA 2HJGA 2HEIA 4LJAA 4RZ3A 4CGZA 1KY3A 1DAEA 5J5CA 4DEXA 4E03A 3NXSA 4CF7A 5KO2A 3ZVNA 1QG2A 1E4VA 2IL1A 2IXGA 3MJRA 2YV5A 1AK2A 3B78A 4BGDA 4B3FX 2C9OA 2PX3A 1XCPA 1HE8B 3CF0A 2V7QA 1KIMA 1XJQA 4IHQA 3K70B 4D0NA 4YDSA 1E2GA 2VYFA 1LTQA 1NN3A 2YNMA 1NKTA 1IJFA 4HEJA 2WM9B 4HB4A 1YZQA 1KTVA 3W6PA 2QROA 1VYVA 3FFBA 1JPJA 2JJ1A 3AH8A 1GNRA 3QXSA 3L8YA 3SJZA 1KAGA 3CW2A 5KSYA 4LV6A 4CZ2A 3VNVA 3CPEA 1V5WA 3MUFA 3EPLA 5JS8A 3TSZA 2ZTSA 1ZBDA 3OHMA 2W83A 5L8VA 3FDIA 5FPKA 2GJ8A 2YZ2A 4PHGA 1R5OA 1TEXA 3HPQA 5B2ZA 2J0QA 1TAGA 1G3RA 4DCSA 2ORVA 3TRFA 4US0R 3QSYA 2HCBA 3H86A 2JA1A 2HLDD 3NH6A 1OB5A 3FTQA 2CVFA 2XB4A 2GF9A 5HCIA 1IXSB 2PT7A 1E9SA 1JR6A 4LWZA 1ZU4A 5HR5A 5TVKA 2ZRBA 1KGDA 1GOTA 3SR0A 4PO8A 1OH8A 3LV8A 3TBKA 2WAYA 2GVZC 3O8DA 3ADKA 2E1RA 1SVMA 3UIEA 3FHTA 1XJ0A 3LW8A 3MCAA 2OUKA 5DHFA 2CLCX 3C41J 1F60A 1LF5A 1NIJA 2ZSDA 3KFXA 4OI1A 5FBVB 1DVRA 4KLNA 1WB9A 5BXQC 1XZQA 3IPYA 4ASUD 4RCYA 2OZEA 1OHHD 2VH5R 4L5BA 1XNJA 1ZINA 2WIBA 3SQXA 5FUWA 1E4YA 1JECA 1IN7A 5EUMA 4HLQB 2CCJA 2ZR7A 4QHYA 5E3HA 1KDPA 3C7KA 4DSUA 4AC9A 2DFKB 1G6HA 4FXPA 2FGKA 4MKIA 4F93B 1EWRA 1P61B 1WMSA 3EPHA 3ZZ0A 4LBWA 4N0DA 2PZGA 4G1UC 5DE3A 2BCJQ 5G3YA 4BFSA 3EZ6A 4JKIA 4P4TA 3U6BA 2C96A 3UK6A 1D2EA 4IDPA 4YC7A 4C30A 4NCNA 3GP8A 1T91A 2AXPA 3AQ4A 3SFZA 3RNLA 4DT1B 1YZKA 2XX3A 2DWQA 4OK5A 4RZ2A 2FA9A 4LHVA 3RYTC 4EPTA 2ZROA 1SKYE 4GMXA 4ZI2A 2GESA 5EP2A 4DCTA 3OE7D 1NVXQ 3VMFA 2ZRGA 3DOEA 4XSHA 3AB3A 3FHOA 3W9YA 1OFTA 3A8TA 5TMPA 2GA8A 1P6XA 4WZAE 4XTCS 4OQFA 4JKYA 3EZ7A 1S2MA 1YZNA 4QRHA 3EPKA 3AKYA 3T15A 3KKPA 1IOZA 2GHIA 2QE7D 2QQEA 4MDEA 2XZPA 1LFDB 4PZYA 5C1BA 1R4AA 4BUJA 3DOFA 4EJSA 1YKSA 2F1IA 2GRJA 3B1YA 4W5JA 4WBSA 6Q21A 4BQSA 3KUDA 4HLUC 2Q3FA 2Q3HA 2J5XA 3F0TA 4TTRA 4NU0A 5CJPA 3WNCA 4GDFA 1N5LA 3CX7A 1P62B 2AKAB 3ZZTA 4FD2A 5DYGA 2XITA 4Q9IA 4US1R 3RRYA 4LJ7A 4HZUA 4D80A 1LF0A 4GZMA 4Q4JA 4FMCF 2F9MA 3IEUA 4A0HA 4ILEA 1G7SA 5E95A 4ASUA 4DLYA 1ZM9A 1KNQA 1DOAA 2ZREA 3FE2A 1K5GA 1FX0A 2ZRLA 4Q1BA 5EE9A 4B76A 4Q02A 3KKMA 3B6EA 4Q19A 4Q48A 4FCTA 4LJ5A 1WF3A 4B3BA 1PUIA 2B92A 2DFNA 2RGNC 5DISB 5JMTA 5HPYB 2W6JA 4QBGB 5CK5A 1MABA 3FB4A 1DG3A 5FL7D 2QMHA 4JVNA 3A37A 1ZVQA 5LD2C 2XGJA 2FPMA 3LXRA 4XD7A 1HUQA 2ZQ5A 4JLOA 3SC3A 2JAQA 3NBZC 1IONA 4WA7A 3IO5A 4E22A 3GLGB 4G5SA 2GF0A 4XVQA 5CIQA 1Z6TA 3U5ZB 2IYXA 1NI3A 1G64A 1S4QA 1ZNYA 2ZYVX 1RPZA 2ODNA 1J7KA 621PA 1W2GA 4QHTA 1G5PA 2VO1A 5FPTA 1Z0FA 3OE7A 3P4YA 5BWMA 4KYIB 4QGGA 4NYIQ 1IY0A 1W4BA 1TQDA 1F3OA 2PJRA 1N6NA 5AJWA 1NVUQ 2ONJA 2PJZA 4A82A 2JGNA 1E98A 3X1WA 2F7SA 1C4OA 2R6DA 1E2NA 3EIHA 2D7CA 5D3MA 1P2VA 4LBYA 5FUVA 5FUXA 4Q4AB 5TB5A 4C2UA 4UQOA 3ZJYA 3AF4A 4Q18A 2JIZA 1FTSA 2QE7A 1OKKD 3DMDA 3EIQA 2GETA 1YRAA 3OAAD 4DXAA 5K8IA 5SZHB 3RRNA 1DBSA 1DAHA 1MO6A 2BOVA 1MV5A 3NTUA 1QHHA 4MKHA 1JEEA 2VSFA 1EXMA 1T3LA 4FMDB 3VX4A 3C15C 1JNYA 1VYUA 3EZ2A 4GP6A 1N5IA 1R6BX 3TUZC 1KSJA 2P2LA 4FIDA 3WBJA 4ZDIA 1OV4A 3BRWD 3NIBA 4CEJA 5IK2D 3H0KA 4LYJA 5JWOA 2A5DA 3DZDA 4O2RA 3V00A 221PA 3T5DA 1B0UA 4QM7A 3GPLA 1BIFA 4M1OA 4RD4A 2DHRA 5G3ZA 3O47A 4Q66C 5FOUA 8OHMA 1E9EA 3QENA 5B64A 3X1ZA 1J90A 4L8GA 3GEEA 3GJ3A 5KPDA 2V1UA 1XXHE 3ZLJA 5AR1A 4KLZA 2FFQA 2RB4A 2QGNA 2ZJ8A 1AM4D 4UKDA 2PEYA 5FOTA 1XEWY 2WJVA 5FTKA 2IS6A 1CR0A 2UZ3A 4CRWB 1VHTA 2ERYA 1G8FA 2OLJA 3NBXX 4K81B 4P4SB 3LLUA 1WRBA 3B1VA 3CF6R 4W9MC 5C18A 3CKLA 3FMPB 3WYGA 5JRJA 1Z63A 1YR9A 4JL8A 1FP7A 2BMDA 3C14C 4KFUA 1G16A 3AVPA 1XPRA 3EC1A 4JLMA 3BOSA 4TZ0A 2JLSA 2WKQA 4DJTA 2AK2A 5K8LA 1SXJC 4QNMA 2AWOA 4A2QA 2F9LA 4IKEA 5FBQB 4BLRA 3GLHB 3TR0A 5AUOB 4D4LA 2KI5A 3PEUA 4KI0A 3T1OA 2DFLA 3CB4A 4BEBA 2QUZA 3BORA 3MJHA 4Q1CA 3AGQA 4ZDKA 1CF4A 2O8BA 1VIYA 2IWRA 1M7GA 1A1VA 3Q8XB 4DZZA 2D74A 1VG9B 4BEJA 4OHZA 1D2MA 4MRSA 3OAAA 1ZU5A 4LI0A 1LB1B 4PZLA 4PC7A 2PMKA 4EJSB 1E0AA 2GJSA 4OKSA 2R2AA 3G0HA 1E3MA 3RSLA 2RGAA 5DN6A 4F4JA 2JEOA 2BM1A 2RHMA 1Q3TA 1RRCA 3X1DA 5CLLA 4BZQA 4IOLA 3CF2A 4C0HA 4ZKEA 4BLOA 1AZTA 3CRVA 4HZUB 3TUJC 5K8TA 2A5YB 4IDNA 1CXZA 4Y0AA 2BKEA 1FX0B 2CLSA 4TWZA 1MRNA 2IHYA 3QF7A 3QE0A 3QI2A 2WTUA 5JJKA 2HF9A 2C9YA 4V0ME 1W0KA 2F43A 2QZ4A 3PUVA 2XEXA 1XD2A 4RD1A 4U00A 1ZW6A 2XOKD 4C0AC 1MKYA 2RGGA 2PEZA 4Q21A 5FR1A 1GM5A 1S9HA 2BKUA 1UM8A 1UDWA 3KFVA 3VX3A 3KL4A 1OT3A 2J41A 4YDHB 2IXEA 4MYHA 2SHKA 3ZS9A 1WP9A 1K6MA 3GMTA 1IY1A 3U3OA 2GXAA 2QTFA 3Q9LA 2IYSA 4HZIA 4URYR 4GOKA 3W5JA 2VF8A 2XNDA 2JLQA 1E69A 2ZUCA 3CNOA 4WXRA 1Z2CA 1AGRA 4QJ3A 2MSEB 3OZXA 4M8NE 5CDFA 1L7VC 2JLRA 3B13B 2J0SA 3LLMA 1XDBA 3BBPA 4OK3A 1GWNA 2GTPA 4TLBA 1Q12A 1C9KA 1G8PA 4RCZA 121PA 2PCJA 5GJCA 2YWEA 3N5CA 5KDLA 4NYMQ 3EX7C 1COWA 4PC3A 3ZQJA 1KMHA 4EQ6B 1W36C 1S0UA 5EP1A 1AN0A 4JLPA 2P6RA 2JLXA 1G19A 4B35A 4EPRA 1XD9A 3NBYC 4LDJA 1UKZA 3IKJA 1AKYA 1U8ZA 4XVRA 3CUEF 4DB4A 2HT1A 1FNNA 1QHHB 3A4NA 3GCGA 1JQLB 2VHTA 2C77A 4CT5A 2V6IA 2OXRA 3NG1A 4OYHA 5M04A 1XEWX 1NMXA 2CK3D 4CIDA 1J2JA 1E0KA 1M7BA 3TVDA 4MRPA 1XTQA 4NH0A 2A5JA 2ZEJA 1E1RD 4OI2A 3CPJB 3ADCA 1GAJA 2HYDA 4XWOA 1NJFA 4JJKA 3TNFA 3PCRB 2B21A 2QMUA 4OQLA 1N6HA 3K9NA 5AJZA 3R8CA 4OK6A 1NL3A 1SKYB 4MKGA 4Q47A 5SZJA 3KKOA 1Z0DA 4Z51A 2XOKA 3REGA 1Z83A 4QGHA 3PUWA 2FDCA 1KO7A 4R98A 4W7SA 1T5LA 4NPHA 4TL9A 1H65A 1RKBA 4FW9A 4A6PA 2QN6A 4LZZA 1E79A 4ZV4A 2OILA 2ZI7A 5DGXA 1KHTA 3CBQA 5JHGB 2ANCA 1L4UA 3CO5A 2KBFA 3DMNA 4WIAA 3M0EA 1P60A 2B8TA 3QKSA 5F98A 4UXIA 2DCUA 3CZPA 4DUGD 5JJIA 4BWYA 4CVNA 4ERNA 1BS1A 2ODWA 3U7EB 2F1HA 5TARA 3CNLA 1YR6A 2O52A 5FOWA 1FZQA 4E09A 2GBLC 2GZAA 3LAWA 1KSHA 4FINA 2GZDA 1CP2A 1GRRA 3IBGA 4Q03A 3H1TA 5BQ5A 1M1YE 2VSOA 4V03A 1Z6GA 4TL7A 3BS4A 1OW3B 3RRZA 1KI6A 3IQXA 4URZR 3V9PA 1KDRA 3B82A 1W1WA 3B60A 5AUPB 2C03A 1ZP6A 2VIIA 4KFSA 1YR8A 1N6OA 4A6XA 3FWYA 4C0JA 3Q3JB 5JI2E 5DNYB 2IX3A 2A78A 1DO0A 3BIFA 1KOFA 3HJNA 5CB8A 3CLVA 3EWSA 2WJIA 1XMVA 2DWOA 4LOAA 4TMWA 1KSGA 1G1MA 1RE0A 2CK3A 3JZAA 1OXUA 4MQBA 2ZETA 1FNMA 2ASEA 3F8TA 4GRAA 4AWXA 2WSSA 4QM6A 1E1RA 3FPAA 2Q9CA 4DLUA 1Q1BA 4DLZA 2Z5FA 1OXSC 2O8EB 2PH1A 4M1KA 2UKDA 1A2BA 2QTHA 1SHZA 2ZAMA 5DYIA 2QY9A 1OPXA 1ZD1A 4C0KA 4OQMA 4LHZA 2Q9AA 3KQNA 2WV9A 1G3MA 1VCMA 3LQRA 5CYOA 1MO3A 4IDQA 2ZPTX 3UG7A 5L3VA 3L0OA 3CRMA 3VKWA 4AG6A 2E87A 1NKSA 3P27A 4QG7A 4Z1MA 4MRRA 3NHBA 5KNBA 4EIWA 1NBMA 1QVAA 2QSYA 2ZVPX 4MYUA 3W90A 5GVRA 3I3SR 2JDID 1W5TA 1TEVA 4A8JC 1D8TA 2KE5A 3KB1A 2WOJA 4KFTA 1VCIA 4C2TA 1O87A 2ZSAA 4ZCLA 4MH0R 2WWHA 4DUGA 5LDDC 1XX6A 2H5EA 1EK0A 4YLGA 2VP9A 2FMXA 2FN4A 2H92A 4ZO4A 4EFMA 3DHWC 4DIEA 1H8ED 2R6GA 2W0MA 2A7QA 2H57A 3R20A 4DT1A 3K0EA 1N25A 4Q7LA 1CR4A 1JAHA 4D4JA 2RGBA 3MWLA 4AKIA 4MRNA 1ZUHA 4N3NA 4NDZA 5EXPA 4QL3A 2B7BA 2TMKA 3K8YA 5L3RA 2QT0A 3E70C 3KX2A 2Z4SA 1NVWQ 1MH1A 1XTSA 3GLFE 1P7CA 4NCHA 3GLIA 1YU9A 2HYIC 4HAWA 1OE0A 4PAOA 2WZQA 4QXAA 2IBMA 1Q0UA 1PLJA 1EFRD 1IXRC 1HV8A 3BERA 1XF9A 3SJAA 2GVDC 4B71A 5BYKA 4DSTA 1XCGB 2YYZA 3I1FA 2CJWA 3ND9A 2WJHA 1SVWA 4HLUA 5GJVC 4NZYA 2RGEA 4QGFA 1OJLA 4TT3D 1RJ9B 4L16A 1FFHA 2I1VB 3BWDD 3I32A
chains in the Genus database with same CATH superfamily
2NSJA 2OESA 2WM2A 1ENPA 5D3QA 4I8IA 1XZCA 3H84A 3I61A 2JFQA 3EEFA 2I87A 1WU8A 3GWGA 1KE2A 2FPWA 1B6GA 4UHJA 3WK9A 4HMPA 4JLVA 3IOEA 3QBEA 1QPBA 3Q7IA 4PPFA 4Z54A 1SM4A 2HJWA 1CULC 4MR8B 4OM7A 4BRWA 4INAA 4FZJA 3K9BA 2ZBUA 4OAPA 2X5NA 4PVDA 1LLDA 1T35A 2LVBA 2WHPA 3HDVA 2ZBDA 4KO4S 5D2CA 5EMMA 2PFSA 3MQFA 2DQSA 4YP1A 3VYWA 1NDUA 3C8MA 3LF1A 4R54A 3KDAA 1AHNA 2W2KB 3HDTA 4BC1A 3IMKA 5EMHA 3OFSA 4LC1A 1Q19A 2HAEA 3LT2A 3UK7A 2GR9A 1G4HA 1GPLA 2GFQA 3O8OA 2CCKA 4WLNA 1GFIA 3QXXA 3IUPA 3KOWA 3QKSB 2XWPA 3AFGA 2Q3LA 1XPUA 3X1XA 1PQUA 3LKDA 5JECA 4N7JA 4I3HA 4DADA 3TLCA 1FTNA 2FSPA 3ISVA 5F2EA 4OQYA 3ROMA 3ZBPA 1O57A 1A2KC 5KUTA 4A4DA 1OB2A 3VR2D 2VPYA 2CHVA 4U7WA 1LNZA 2DHQA 1U5CA 1UKEA 3WXBA 4QASA 2I2XB 5LJIA 5ALLA 1NZDA 3ZD7A 1SXJD 3FYUC 1ZCAA 3PZRA 2QW1A 4ZQFA 4LJRA 1BWPA 3GFVA 1ZWKA 4MI1A 3NWJA 3L7AA 2QE6A 3ASVA 4XSVA 3GFQA 3IPRA 3ZDYB 2WZDA 2DM6A 1J2EA 5DX1A 3ROEA 5CB6A 2X2OA 2I34A 3HHPA 3SZLA 2PXXA 4YBRA 4LF5B 2R2GA 3WA7A 3TFQA 2QBYB 3GDFA 5DHAA 1QO9A 2I71A 1UKBA 4OXRA 5BR8B 1VKNA 3VVLA 4BNYA 4IEIA 2E5LB 3KKKA 3PL1A 5K03A 5DHSA 3SIRA 3EGVA 3HMKA 1WSAA 1E0SA 4Q4AA 4D8WA 2ISQA 1Z2EA 2IF2A 3A1CA 1EFRA 1KYTA 1H2XA 4QBIA 3QVMA 5BPHA 3ASYA 4JXXA 1LBQA 8MHTA 1L3BA 4E0BA 1KZ7B 5IN4A 5ER9A 1KK2A 5CH8A 1EMDA 3IVXA 2WR8A 1UBKS 4GZLA 5IEBA 1CJBA 1EFVA 2P4QA 3VRHA 1PNOA 2NVWA 4ZVTA 1E2QA 2EAUA 2NYUA 2WJPA 1JTVA 2HF8A 3QU2A 4NBVA 2B4RO 2R4QA 3NEAA 1U3VA 3IC5A 1J2RA 5AW5A 2WF8A 3LY7A 1Q0RA 1RWKA 1W88B 1E9CA 3LL4A 3G2JA 3W0LB 3L6OO 4V24A 3W1VA 4BX0A 2PM8A 1RQ2A 1SG0A 1XMPA 3D0KA 1J21A 1QTIA 3H8WA 4R8RA 2C20A 4GOND 4TGLA 2B2NA 5TGDA 2YASA 1GVNB 3TQTA 2QUJA 1O03A 1OBOA 4IMIB 4FSDA 1CKEA 4L5YA 1AOXA 1KVRA 4M88A 4PEVA 5KVQA 1E6LA 1RRFA 3HLTA 1DTWB 3NM4A 4EHAA 2FR1A 4JZYA 4M1WA 1WW3A 4IZ6A 3KJIA 4DNXA 3BWMA 3TI7A 5C80A 4HUJA 5KC9A 2IH2A 4HVAA 1VI5A 1NPDA 2PX5A 3X1YA 4PU0A 3RWOA 3INNA 4LGVA 4G1CA 1RFLA 4TRJA 2WUGA 3DKRA 2W4MA 1KFKB 3IL2A 1XP8A 3K1AA 2QRNA 2XUOA 3Q5DA 1VSQA 4FEYA 3QVJA 4TS1A 3VR2A 4CG1A 3QUQA 3L7BA 3EQ9A 3NPMA 1ADCA 1IK4A 4PCAA 4X8OA 2Q7OE 3UK2A 3ZHOA 1CCWA 1Y7HA 1ZMOA 2XBMA 1P1FA 2E5WA 1SXJA 3UMBA 1CJTC 2HT6A 5K8JB 4WNYA 2PX0A 1JVNA 2QLBA 2JC3A 3MS4A 3K1YA 1D07A 4JOCA 1E7MA 4JYAB 4BO3A 1L6IA 3QJ5A 2QN7A 2IUFA 2PSFA 4XJSA 3Q2IA 3VU3A 2EJCA 2PKRA 3R0VA 3QOXA 4R1UA 3GLHA 4EHLA 4RMJA 4H1VA 2HMUA 1R8QA 3HFJA 2ZITA 3GLIB 1MF7A 2WWTA 4IWYA 4K87A 2FVXA 4MVJI 4X0EA 2BE7A 1NGSA 1U28A 5DHUA 1VI2A 2BM0A 5I7WA 1ICEA 1DAMA 3AIMA 1Y1QA 4MQ6A 2JIMA 3CZQA 4I6EA 2CJWB 4GBGA 2BKLA 1BMFD 1U8AA 2J5RA 2PV0A 3CWZA 4BLQA 4Z1OA 1CZLA 4JSTA 5JRZA 3N0WA 2CXUA 2EXXA 3KB6A 2WKPA 2AJDA 5D00A 4X8MA 2WSMA 1Y8CA 4NAVA 4M4SA 3MN1A 5AWFC 2I7XA 3OMWA 3DVAA 5BWOA 2ACEA 1ILWA 4G5QA 5ALSA 3JSXA 2PKYX 2CL6X 4UASA 3U4GA 1OWMA 4DV3B 3RM3A 3M7IA 3EY4A 1X86B 4L95C 4ZANA 4GSKA 4ZVVA 4LNAA 2BE9A 3IAS1 4TM8A 3AI2A 1RWQA 3C2QA 3F8SA 4L5AA 1ZRMA 1KJNA 2GN2A 4WKPA 3DLCA 2G9QA 1JHDA 2XJ9A 5DX0A 1L5MA 3CM0A 1T26A 4MVXA 1IOLA 3ZVLA 1T1JA 3I04A 5BSVA 2WHPB 4CCWA 4PYOA 3TQFA 1F9AA 1JDSA 4WEOA 1MO5A 1RKVA 3J7TA 4DDUA 1P5RA 1QOPB 2C1EA 3D0QA 5AJYA 3Q0EA 1GCAA 2BGTA 1Z7EA 3E2PA 2AMFA 1RXWA 5A3VA 2PS1A 5JTUA 4CNQA 1S2GA 3PPWA 5DSZA 1YRYE 3DL7A 3TNDA 3VSEA 3OE5A 4R41A 4Z49A 2AJ8A 1A4RA 3C5WP 2B0JA 1F17A 2XLCA 1OC4A 2QRQA 3FFTA 4GSLA 3UAXA 1CYEA 1P4SA 2PV7A 3HZZA 4L2IA 1AGPA 1QFMA 4MS4A 3RKSA 4HAZA 4B80A 5JROA 1C9YA 1OSNA 1VJCA 3QNUA 2JRCA 1M2JA 3E9QA 4YAJA 1OXTA 1KMQA 3HKEA 5KYGA 1JFRA 2I7CA 3KT0A 1E92A 5KMGA 1GUBA 4RD6A 1XROA 3SI7A 2OAEA 3E53A 1SY7A 1SOAA 4ALMA 3EHEA 2V54A 3O03A 4WL0A 3S2UA 4HB0A 1AMUA 2F3QA 5TS2A 1Y3AA 2C9DA 1UMDB 3N8NA 4YI3A 4Z4GA 3M81A 3JQRA 1HQDA 4DJAA 3PEVA 1GR0A 1W0JD 2H2AA 2I67A 3IAAA 3E9YA 3CU5A 3GJRA 1GSIA 2G8NA 4B6QA 1U6KA 2X4GA 4H1UA 4POOA 2RHCA 2CHUA 1N9ZA 2TECE 1BHJA 2XB8A 3C5EA 1GL7A 3NI2A 2JIBA 2CDAA 3LKVA 3N7AA 4HAUA 4IMRA 4PBTA 4DAOA 4OH7A 3H1PA 3EMKA 3RIEA 4UNRA 2IUUA 3MGGA 2LGJA 2VDVE 2YNMC 3CSUA 2MTBA 3DHYA 2C9ZA 1WXEA 2IFTA 2W6CX 4MWSA 4YO8A 2WWVD 4IEFB 3PXEA 3ZHBA 3LX4A 1JJVA 4C2BA 4E5MA 5B1EA 4P7KA 2P35A 1AQNA 1BMFA 1PEKE 4MV1A 4IJMA 3PGKA 4PWYA 4PY2A 1EFVB 2ZJYA 3QM1A 5FOSA 3T0IA 1ONPA 2YWFA 3G1UA 4YV0A 1L5QA 5FYQA 2PRSA 4B3GA 4X1OA 2LD4A 2AK3A 4MVJM 2QN2A 1XXLA 1IIBA 1L5VA 2P0EA 2Y9PB 1Z22A 2EJWA 3S2FA 2NU9B 3T5AA 4GR4A 2NZJA 4JMPA 5D5HA 3S40A 2CLDX 1P80A 5TQ0A 5C81A 3SZ3A 2C78A 3JVUA 3L4BA 4HNVA 3IP9A 3EDMA 5C8VA 4RPGA 4JI1B 2DH6A 5L40A 3VJRA 2UZ4A 4BB9A 2VS1A 1YNOA 3QLEA 4WBNB 2XYVA 4FFMA 2HRRA 3HS3A 1UJ6A 1IAQA 3UWDA 3BT7A 1FFWA 1RYMA 3F6EX 3GVIA 4MEBA 1JDNA 2WRZA 1Z28A 4YAOA 4KO8A 3ILSA 2Z58A 3H18A 3HRHA 1SULA 2ZRHA 1D5CA 4NC9A 4FDVA 4PFKA 3PQ7A 3LI2A 5HIKA 1NU6A 3D4BA 5HWSA 5KNDH 4E5NA 2VNSA 1T6ZA 2XZDA 4KO2S 4RL6A 1I3LA 4M22A 5FL7A 5KNDD 2JHGA 3FFAA 1RM3A 3A36A 3KYCA 3LA6A 2D5IA 5B3JA 1QUEA 3H6KA 1XQWA 1TF2A 2Y68A 3VISA 3ZCSA 1RADA 4I9GA 2JGIA 2P69A 3ZTTA 9LDTA 3IAHA 4JJ8A 3EA4A 1XDWA 1ZM2A 3FDFA 4DG5A 1NV8A 2CMHA 4IF4A 2ZRMA 3TEMA 1SXJB 2QJRA 4AIIA 4HLNA 1AUVA 1UMBA 2WZCA 2MMGA 2WYUA 1OYYA 3HB5X 3FDXA 3L7NA 3QPUA 2AG5A 3ZNPA 5CFNA 1MG0A 2XKJE 4EUKA 5DSXA 2I6FA 1W25A 4NVRA 4F8YA 4B48A 4BATA 1LKZA 5FOVA 5FDFA 3QQ5A 3X1KA 2YVAA 4DLPA 2F9FA 1PJ2A 2VZLA 3CTMA 2BGMA 4WD3A 1NXWA 2Q0HA 4XB2A 4I55B 5JY1A 5C1IA 2J4CA 4GBMA 4BC0A 4J1TA 2CDNA 1RQ7A 1QHXA 3DD5A 3IIEA 4ER3A 2H63A 3KCQA 4HRVA 1HYQA 1NW8A 1P72A 4WDRA 1UPAA 3PICA 3PJEA 4V0SA 5AW1A 1B76A 3FWKA 1IRIA 2WHQA 1KU6A 2P1RA 1JJFA 2MIIA 1CBUA 4BVFA 1P7WA 1V16B 4WJKB 1DQNA 4AP6A 3RSGA 6GPBA 1GFSA 1L8AA 3E2MA 1G60A 2EBUA 4B4DA 5BRAA 5JS7A 3DVAB 3FTDA 4QU8A 2RHTA 2XCQA 4Y9RA 4PQEA 5JJLA 5H1YA 4FILA 3ZPXA 3A31A 4P6VF 4BFWA 1NDHA 2C2KA 4FUQA 4I4IA 1WKBA 3CINA 3QLUA 4RBNA 4ZVNA 3TG8A 4YCDA 3WK5A 3QMMA 4DIOA 3NIWA 4RFSB 2I1QA 2WOOA 4JFRA 2L42A 2PS3A 5MFPA 2NTVA 1SIOA 2F59A 2O07A 2ZIAA 4KVAA 3O9MA 5IM5A 4FC7A 4X7PA 1RMYA 1IBLB 1B3BA 5DNUA 1DWPA 5TF4A 4QQFA 3SF8A 5HMLA 2O8EA 3RD5A 5HE8A 2J59A 4OYLA 1WHTA 3T5CA 4GE0A 5B5SA 1I5EA 1OX4A 2HNAA 3KQTA 2HIAA 1B0AA 1DBPA 3B36A 2DUNA 4XR4A 1M66A 3GQVA 3LC7O 4BPBA 3DKKA 3C87A 1HFJA 1NHWA 2Q5FA 3ICVA 2BM8A 3AL3A 3VSBA 3QX8A 4UHFA 1FDUA 2R79A 3KJNA 4GEKA 4LC9A 2QM0A 4ACAA 4G37A 1Z6QA 2C99A 3NHLA 4L2IB 4MS4B 5KTTA 1MX5A 3K31A 3TI9A 3KXLA 3VKFA 1JHOA 2BZ0A 1SWWA 2Q4EA 3DGEC 4D9IA 3HKEB 3BSFA 5H8WA 4M0LA 2CYCA 3WAJA 4W5OA 3WB0A 2PVSA 2Y77A 2QP4A 2O8VA 1WLSA 3GJ5A 3KJGA 1CETA 3X2EA 2HA2A 4YYZA 1J70A 3SOPA 4OD0A 2CNWD 5ICEA 2XMRA 3O5AA 4HNRA 5H4HA 3E9EA 2PSHA 2P2DA 3GLRA 4WMLA 5JANA 2PZJA 4PG5A 1WOYA 2WF6A 3H5OA 2PUTA 5H5JA 1K3UB 5K6TA 2VA9A 2YCBA 4W5WA 4ED9A 1E99A 1Z6ZA 1HDGO 1RKUA 1VDZA 2QU7A 3EMBA 1Q92A 4KXMA 2HK7A 2ZRJA 4AKGA 5ITSA 4YONB 3NKFA 1UFQA 3L7DA 1MO2A 3K09C 4NDAA 1UBJS 3AFNA 3H5IA 2RK4A 4PLFA 1N8SA 3LCMA 3R5SA 1S2DA 5EP4A 1L4FA 2ORWA 1U0SY 4N3BA 4OHWA 4UUQA 5ABPA 1R50A 3RS5A 4ND5A 1DKUA 1FC0A 4LF8B 1RRKA 3LPNA 3TH5A 1N1DA 1B6SA 5FFMA 4YPOA 2C5AA 4W8OA 3IIIA 3TF5A 4MWDA 1U2RA 3CE6A 5HTKA 4U2KA 1SBYA 4F7DA 1G20E 3K1TA 1NM5A 1RJWA 5GOTA 1UIMA 4RTKA 1NXQA 1F9EA 4MS1B 5HMMA 1LXCA 1ZUNB 4W5NA 5JS2A 1NE7A 1XXHA 3DOHA 3R9WA 1PX2A 3L46A 3FCXA 1LV7A 1EFHA 2C5EA 3QVOA 5B7GA 4ARIA 3L1HA 5BOSA 4CLHA 5B1DA 1OXVA 1RYFA 1LBEA 2BGUA 3LW7A 2XJ4A 5BPFA 3VDNB 1P91A 5AVZA 4QSMA 5CA1A 1RJ9A 1CUIA 4LOIA 4MV7A 2Y9MB 2R4TA 2WHXA 4P92A 3FFWA 1I9GA 4D4MA 5I7FA 1Z37A 2DT8A 4V0OA 3DYBA 1YVDA 1H9AA 5KVCA 4BO1A 4U4AA 4F6RB 3FNEA 2HRQA 2X3FA 3FPJA 5DTRA 1NVEA 5FJIA 1P3JA 2I9PA 4DUYB 2ZRAA 1T4CB 1KAOA 4CKCA 3UW1A 1YBHA 1YRBA 4UOEA 5LBUA 5AJXA 3FGNA 2QD4A 2WWWA 3GJQA 4LNUA 4N47A 3TUIC 2YXBA 2V3VA 3KYCB 2P90A 4F85A 1JLHA 2NU8B 1IMJA 1NUHA 2Q4TA 1I3CA 3FZQA 4M1YA 3AX6A 5G1OA 3W7AA 3RU3A 2NP6A 4LZAA 3OZDA 3KJEA 1XYGA 2WWIA 4R5HA 4J2OA 5JS6A 1ZH4A 2NM0A 5FQNA 4J4HA 4KVFA 2J3JA 4DILA 1XVAA 1GPMA 1JAIA 2X3UA 2JL1A 3DH0A 1LY1A 4MI6A 3NIFB 1Z36A 4N0EA 1VPVA 4RD3A 4YRGA 4ROSA 5DTJA 3QE9Y 4HDCA 3HJUA 4QT0A 1WPQA 4AS1A 3V3TA 2JK1A 3FM9A 4CKXA 4DTCA 5ADUS 4W7IA 1BX3A 4B73A 1C9MA 3STHA 1LLCA 1GV1A 4J7CA 3ZE1B 2D1TA 5IYZB 4GI7A 4E13A 3OI7A 4MQUA 2CFRA 4HPJB 1HLGA 3L7JA 4IH4A 1JA1A 2H9IA 2B7LA 3HU5A 1C0PA 1PL8A 3AWIA 5IJ9A 1P5ZB 1UKAA 3CIOA 2NGRA 2Y76A 4G8JA 4RV4A 2P11A 1MORA 5EJ9A 3QEBZ 3IP3A 1YZUA 5AO9A 1L4YA 4L50A 3KQLA 3H19A 1JE0A 2PGDA 4V0MA 2JH8A 3DOIA 1J49A 1WBBA 3UENA 2DWPA 2F8LA 4BBJA 4TROA 3GCWA 3CUVA 4OHMA 4Y6PA 2FXIA 1DQZA 1M34E 1XA3A 3NHAA 5EG5A 5F4ZA 4DWJA 4X1KB 4BMOB 2R8YA 2QTCA 3MSXA 4KRXA 4KDRA 1SRRA 1A5ZA 4YRRA 4B3CA 2ZKLA 4Q5IA 4BBPA 5EZ5A 4C14A 5J5AA 3D8HA 4IDBA 3SF0A 3OLYA 2W2TA 1ELOA 4JR2A 4O1IA 4WVFA 1NE2A 3S3TA 2YDYA 1N6IA 4FZ5A 3OSUA 1O95C 1GTSA 2XGMA 3QLJA 3SF8B 1JH9A 3M6VA 4TTTS 2IS1A 3K6KA 3FJYA 4R68A 1H8HD 3TINA 1RHKA 4ECEA 4LTMA 3UMFA 2WIAA 1GPAA 2V55B 3SNKA 1SAYA 1OX4B 3I83A 4UC0A 3FAKA 1P4RA 5K0NA 1NJ8A 3U4QA 2P2SA 1OH5A 5EOVA 4R9SA 4FFLA 1C1HA 3RIXA 1Z35A 3QYPA 2OSBA 4J7XA 2YMMA 3PUXA 4NPCA 1K5DA 1L7MA 1SFRA 3GYGA 4FHCA 5DV9A 3OBIA 1L5OA 4TN1A 3SHTA 3I5XA 3T3MB 3OQNA 1HZJA 1U7PA 3BGSA 1CY1A 1TCUA 3BC1A 4JX8A 4WW0A 2I65A 3GFOA 3CN9A 5LUBA 3G7SA 2VK1A 3AP1A 3GG9A 3JQFA 4YRAA 4JAVC 1BD3A 3V4FA 3I8SA 3IOCA 3N2ZB 1M2VB 1Z4MA 1GU0A 4Y9TA 2CWWA 4H3KB 1MEOA 2XR1A 3PFKA 5HZHA 2CHQA 1J39A 4JQZA 4CG2A 5C4GB 3R77A 1PD1A 3CLSD 5E4FA 1XZ8A 3DOUA 2QDXA 3U3KA 3DNFA 3H2KA 4I3FA 2BMEA 3H5VA 4TVOA 3L6EA 2FUG6 1M5TA 4MROA 2IUTA 4NZ9A 5EIFA 1QV7A 4D6XA 1W8IA 1GGFA 2PQ0A 4GRIA 1VXRA 1IC6A 3BFXA 1SZCA 5AM4A 1M72A 5GIPE 3ZD6A 1BKDR 1N2XA 5AKKA 1Y9EA 2O6LA 5KHAA 2N1BA 2W2OA 4C6HA 2X4LA 3I5UA 3RS8A 1UAAA 5LVAA 1QHSA 1N6PA 2GNPA 2JLWA 1JFVA 4MXDA 1QHYA 4IGEA 1SOUA 4YASA 5E7QA 4I5FA 1P4JA 4Q6WA 4U5QA 3Q85A 1N5MA 3EEQA 5J4LA 1VHDA 4TLCA 4HLDA 5EJGA 3R76A 1U8TA 3G8CA 4ZI3A 4HN4B 1FFSA 4LGMA 4R0NA 3WX0A 4JXKA 2QMEA 1YAJA 4KQIA 3JALA 1TADA 2WIKA 3PX3A 4OB7A 1KTIA 1XXHB 4MW0A 4Y6LA 3PD0A 4KO3S 2SNIE 3FPBA 4TYQA 2JJ1D 2D0DA 2JCSA 3QF4B 3UG6A 3ZHUA 3VNAA 1C81A 4FSHA 5IF9A 1TCCA 5HXAA 3N2IA 3P2EA 3HZHA 3Q7RA 5EXEA 4F5DA 3AF3A 4MWTA 2G88A 3R7WB 1PJTA 1NA5A 2DH5A 1J8MF 2IZOA 4Q24A 3T6KA 5K3OA 2RD2A 3N0TA 2IP4A 3EIEA 1U2TA 1E5VA 3C1AA 4N82A 1P4AA 1AQLA 1IMOA 3IGFA 1J42A 1H8HA 1O94D 1YQTA 3VI3B 2V8BA 4C6TA 5BMOA 1K8XB 1L9XA 2PL3A 3CUUA 1UQTA 5FI1B 2WQZA 1KDVA 3WKBA 2GZMA 4CKCB 1PR6A 3BEDA 2J3EA 3M1AA 4V2UA 2PZLA 4FNMA 4HXGA 1R0WA 1X70A 4YJFB 3X3HA 3DF9A 4B87A 2N47A 4II2A 5JCXA 2NIPA 1PR2A 1DIHA 1W5EA 2CKDA 2HPAA 3A1FA 3L0CA 3Q8WA 4PBRA 3PNSA 3RSFA 2C2WA 1L5SA 3V3KA 5FIUA 1E64A 2B6HA 4BLTA 2GKSA 1XNHA 3JCZA 2L82A 4FYXA 1KJZA 1PJSA 3DOOA 5G41A 5LP6A 5BT9A 1HE3A 4DIMA 1UZMA 1T8YA 5CG1A 4EVIA 1SMKA 2V9ZA 3RSSA 4DR6B 2BVNA 2JDIA 2FU5C 5FBRB 3IIKA 3F7NA 4RIGA 1X1SA 5K05A 2JVJA 3N2EA 2PUCA 4PAMA 3ER9A 4JVLA 4RJKA 1GR1A 2EOAA 3B9PA 2Q5CA 5H9VA 1SB8A 4ZZ1A 1NUQA 4F3TA 1CERA 3P7MA 4HN2A 5JC8A 4L5JA 3EPJA 2WUFA 1R37A 1A5AB 3VZBA 4BLSA 3BMOB 1C3JA 3BULA 1PI3A 2LCFA 5EPOA 3HI6A 1P2FA 3U3ZA 2R1ZA 4M7OA 4I0WB 5BW5A 4RK5A 4UBJA 4QUDA 1GFWA 3HYTA 2QPAA 3N8GA 3P0EA 5GZ3A 4KMSA 4BMYA 2W6QA 3OCWA 2QP3A 1Y4AE 3NJRA 4NJMA 2H31A 3N76A 4S2EA 1N2JA 2J0UB 4Q00A 4BUZA 5AVSA 5IJ9B 4OQNA 2R65A 4ID3A 2G9VA 2OHIA 4I2NA 5CVUA 1Z29A 3DCIA 3IDAA 2WM8A 3CUKA 5EHIA 2GRAA 3RROA 3F5DA 1C41A 2VFAA 4L73A 1OZ0A 4D9HA 2N46A 1A50B 5BP7A 2W00A 2E6KA 2VPWA 1EAYA 1RHMA 1E9DA 3KQHA 2WP0A 1H2AS 3U9LA 2AMLA 4YJGA 3QEAZ 5H7XA 2JW5A 4LF9B 1ZM4A 4ZQEA 2DTXA 1JYSA 1U1EA 1ZOOA 3CR8A 3F8WA 3I9LA 3IT2A 1RWPA 3LUJA 3VR3A 2UZ1A 5K09A 2ZRNA 4XDGA 4CTNA 4R9NA 5IMBA 4RLFA 2JD1A 1A5TA 1ADJA 3W5HA 1XZKA 4HGQA 3WNZA 4ZOQI 2HSEA 4PRLA 1YQQA 4DMHA 3MMPA 1O94A 5CVJA 1GRVA 4BCCA 5LQUA 1N3BA 2RGRA 3NASA 4EHNA 1H2FA 1T2AA 4GHWA 3I45A 3I6QA 4AX4A 4S1NA 4P34A 1FVFA 4HAXA 3U4QB 2UUAB 3T1YB 4GKKB 1M6YA 4KWIA 4FHGA 3R3WA 2FWAA 3G82C 3SYLA 3IKVA 1XTVA 1C3LA 3UBMA 3G85A 1W1IA 4WOBA 2V98A 1Y1RA 3IJPA 1BOOA 3OZUA 3R3SA 3AESB 3AJRA 3INYA 4QPZA 4A73A 3S8EA 3BK7A 1LJ8A 1TO6A 2C0PA 1U9YA 5T3UA 3DTVA 4NAHA 4JIMA 4W9NA 5H0IA 4D56A 4A0SA 3B38A 1Y3BE 2GDJA 1CS4C 3DZBA 2VATA 2Z1DA 2CVZA 3DHNA 3EW7A 4FFWA 4Z7JA 1QS0B 2PMEA 1GL9B 3CZRA 2NVUB 2WINI 3OIWA 4R4JA 5B1IA 4JHLA 4G41A 2RG7A 3R6WA 2HQRA 2DUMA 1TB4A 5EINA 2AZ4A 1ZCBA 1OJ7A 3NNSA 2O8DA 4UJ3A 2Q2NA 3RYFA 4L6CA 3LC0A 4KPEC 5A3QA 5IKPA 1A8IA 3GD7A 1LX6A 4F3NA 4N7BA 3VTKA 4EL0A 4AUEA 3L1IA 5T4FA 3WL4A 5K0SA 4H2DA 1V6AA 2EZ8A 5TMDA 2ZYTX 1UBTS 4Y18A 4BQFA 2VK4A 2RMKA 5BV0A 3BFVA 1WZ2A 1QYCA 3VH4A 2DBVO 2MR5A 4PQFA 2AJTA 1Z34A 3N2LA 3TW8A 2WIGA 4OLFA 2BCGY 2CUNA 1KJQA 1ZSYA 1KORA 3I92A 2HR1A 3GGDA 3KZKA 4GM0A 2OGZA 1RZRD 3UWMA 5ULLA 3P0IA 2BFNA 2ZU6A 4OQXA 2YXLA 2AKYA 2HNBA 5CIWA 1QVRA 4K6GA 1JG4A 4JKOA 3JVIA 3OICA 4R3UC 3UJPA 3JALB 1RVV1 1KZ9A 4PWZA 5JAHA 2NSHA 4YNBA 5DBFA 4B40A 5LSAA 1X8JA 1A0OA 5AW0A 2YXEA 4NZOA 4B6EA 3NXKA 4ATNA 1K9VF 2HSJA 3UKJA 5CA1F 4FN4A 3LTEA 5AOCA 3DQPA 4CE6A 1KAMA 4IVQA 2ZYGA 3QELA 3HA3A 1E2HA 1DEOA 2OVFA 2PG3A 3ONDA 4N6GA 4QGSA 1NI5A 1PD0A 1Y4SA 2D5LA 1F2UA 3UMVA 5C9ZA 1GUZA 1EQAA 1IHUA 3V8QA 1RAFA 1AY0A 4YMVA 2FOLA 3UM9A 4L78A 2XQGA 4C6TB 1FSGA 4HFNA 3M49A 3ORSA 2G1JA 3OOSA 3CZ9A 2CVHA 4UNIA 1N77A 5K3FB 3D59A 4YMSA 1Z4NA 2VBCA 3SQDA 2AJLI 2WLSA 4PXYA 4RKFA 4AG5A 5KOHA 5CT6A 1V1RA 2R7LA 5AVTA 1A97A 3DP9A 3IQGX 2G1KA 3MT8A 3OPVA 1BRTA 4LY6A 1RYHA 2DYKA 1ZGHA 3F49S 4XGNA 5IUNC 3P2IA 3FTNA 4D3ZA 4XIYA 5BW6B 1TL7C 1PUJA 1YMVA 4K05A 4X7RA 1T5IA 2Z3VA 3O94A 3O3NB 4MWCA 2ZTUA 2ZYRA 3BICA 4EHBA 3ZXSA 3ZV3A 2CC2A 3V48A 1ODJA 4V0RA 4JC5A 4JJ7A 3T4UA 2ZM5A 1EFLA 3D1JA 4EB0A 2VAVA 4HXYA 4FMPA 2PHZA 5B36A 3KQKA 4KN8A 5DK4A 3RTBA 2PUFA 4JI2B 3ORFA 4HWKA 1G66A 3BREA 4KYUA 2GF2A 2B4YA 2Q6VA 2FETA 4QDUA 5EE5B 2Y0BA 4LQ4A 1E32A 4DOMA 1ST3A 1JH8A 3U1VA 1CJKC 2VWPA 2O2YA 3EF3A 4IOKA 4RF3A 2QLNA 4OQPA 3GN2A 4Q1EA 5E9WA 2J67A 5FWAA 4BQIA 4OI0A 2QHXA 5CT9A 3G9QA 2Q3JA 3IVGA 4QUJA 1Z8NA 4GOXA 4ZVOA 1HTTA 3UNXA 4HNUA 4PC2A 5DTMA 4PZUA 4BNTA 4L22A 4NJMB 3QKRA 3JSAA 2H00A 1B41A 3DR5A 1OFVA 3I6IA 1O6FA 1N9GA 5M5BA 2A4KA 5JMOA 5B2EA 4DJ5X 3PU6A 4UDXX 1DIBA 4JP1A 5IUKC 4CR7A 4TN5A 3B7PA 4MQFA 4FKMA 3ZKWB 3IB6A 1X1DA 4BWFB 5ICMA 4P5DA 1R8YA 1Q6YA 2A4MA 4R1MA 2FMFA 4RSGA 2FR0A 3ZIAD 2OT3B 4K6MA 3QY0A 4UMVA 4B44A 4F45A 4ZYLA 3IALA 2XMQA 4JBWA 3C8DA 2GNAA 3K5WA 3QV1A 2VAWA 2PXCA 2C5GA 2ZJ7A 3BJRA 5JJCA 4EFLA 2QTVA 1YMQA 2OB2A 4E3WA 2VJMA 1RXEA 5HF8A 1YUNA 5A9TA 1GT91 1FQJA 1E2BA 1M6VB 1RWWA 1C7ZA 1OXMA 1TT7A 1CD5A 2PXAA 2VZ0A 2ZIGA 2UXCB 4RDIA 3RBZA 2GPSA 5DPMA 7AT1A 6AT1A 1RYNA 1PQYA 1MOZA 2BTOA 1EDEA 2QJFA 4GU5A 1CK4A 2RGWA 4JJFA 2AHOA 4UHDA 1IB6A 2PQ2A 2G9NA 5HJ7A 1N6LA 2I9KA 2JAHA 2QIPA 4RHUA 2WF5A 2O7RA 1E9FA 5BNWA 2C4KA 3OX2A 1G5FA 5A0VA 4RVDA 5DULA 4Q93A 1KYIA 2XIJA 2Y1DA 3QLVC 5HIJA 1PWZA 5LDHA 4GQIA 4PX5A 1FU8A 3W1WA 4ZICA 4ITVA 1O77A 4TV9B 2FN7A 2OXIA 5DN6D 1EXVA 2F1JA 3DLAA 1ZLYA 5J4YA 4EBFA 1Q20A 1XRRA 4YRFA 3G2PA 3N86A 4MIYA 1URPA 5CDSA 3ICEA 1U04A 1MC4A 1TLLA 2IQIA 5EAIA 1AA6A 4B2LA 3B3GA 4Q3BA 4EH1A 4QAQA 3EY9A 4ZC8A 2YVKA 2BHSA 2OFWA 5KTNA 1QRDA 3MYRA 2VDUE 3H9BA 1ZN2A 4BJ6A 4U2CA 4DC9A 3M1LA 5AM3A 5BV8A 2RIRA 1R0YA 4AK9A 1GKIA 2D2IA 1V47A 2GZHA 4MYTA 5CYPA 4EY7A 1WXFA 1W0KD 3DBLA 4IHAA 4H3SA 3E5HA 3TW8B 4MP8A 1ECBA 2V3WA 3EK2A 3M6LA 4OP3A 5AM2A 1JKIA 1AKWA 5TS3A 1O5OA 1TQ4A 1BHO1 1EDDA 1OVGA 2YHUA 3ASUA 3V55A 3K9CA 4ZK2A 2GBLA 1AKEA 4XFJA 4CDGA 4UPEA 3AJAA 2QRLA 1GKYA 4IX9A 2JKVA 4J0QA 3D6MA 2I6QA 2QRZA 2FMTA 1WQ1R 3WWEA 4KHPB 2H18A 4MJLA 1GUAA 2PMDA 3ROFA 3QVVA 3AYXB 3ZIAA 4PC1A 3UMCA 4CF3A 5JEDA 5JSHA 3H3JA 1NRWA 3L40A 4V3BA 5H02A 1X80B 3DONA 3DKVA 3CH4B 3LZCA 2FWIA 4KQMA 3I42A 2FPRA 3LGSA 4YUVA 2X8JB 4BTLA 2JCYA 2P4EA 3DB2A 2X8LA 4OGKA 3R3XA 1B8VA 1F2UB 4QNNA 1X1AA 4WOCA 2K6GA 4HDOB 4ISCA 4UXJA 3ZTYA 3QW2A 1XLTC 4HGRA 5ADVA 1C0EA 3KHSA 1IBMB 3BKXA 1JKJB 1YC2A 2OHXA 2VA8A 2IWHA 3ZZMA 1ZOIA 5F7JA 1J9ZA 1WTAA 3R6TA 4IS3A 5IAOA 4R05A 4IY1A 1LW7A 1SUIA 1VRWA 1ZH2A 2Z30A 3V7NA 3NP7A 1CUCA 4ITRC 4OU5A 1SQ0A 4GQAA 2NO7A 3OE1A 4EJ0A 2OQRA 3DNPA 4M0EA 1PWXA 5EJMA 1ZXXA 2O1WA 1HE1C 2JAPA 2RCYA 4Q3EA 4BVGA 4P0QB 5LP6F 1Q83A 3ZD8A 4DBZA 5LR6A 1P31A 3KXPA 4ON9A 4XB1A 4ABYA 3PR2B 2ZSEA 4GI3A 4NG4A 4HQNA 3WQRA 3HMQA 1B6TA 2J9ZB 1XB2A 3AHFA 4N8SA 4CW7A 1SCDA 4PVCA 4DQXA 3IUNA 4F4DA 4IIGA 4F97A 4ZYVA 5K20A 1U0NA 3KXIA 4TV8A 2CXQA 3CLUD 2XCIA 4G07A 3B9BA 1OBVA 4LV5B 5C7YA 3IA7A 1NQTA 3MOGA 3M83A 1NY5A 3DYIA 3KVNA 4A8TA 5DGIA 1Y37A 1ZX1A 1ZIXA 3HSKA 1YTUA 2POCA 4LY3A 3FYHA 3GQBA 1TLTA 1J1IA 3HZRA 4EYEA 4A8JA 3EJWA 4B9AA 2XWBF 4BNKA 2I8CA 1TTTA 2P9FA 1BAPA 1CNMA 5GONB 2A2ZA 5I7RA 3ZHTA 4EUFA 2A6PA 2WM3A 1VLHA 1NBOA 2JZNA 4XIIA 3SM3A 5K0ZA 1AMOA 4G01B 2J9FB 4RVHA 2Q8PA 4QPNA 1W2HA 2Z95A 1K0UA 4ZYTA 3QBTA 1MJGA 4E7PA 4NEGA 2BGWA 3NMUF 2A57A 3QKRB 2PPVA 2FSGA 4RLSA 5G02A 2FWPA 2C4MA 2VDQB 3H99A 3O93A 1U8CB 5FAXA 4MARA 4YCMA 5I51A 4IHJA 5SZIA 1HDIA 4BNNA 2M6LA 4E1AA 4EUHA 1DDGA 1BEEA 3ID6C 4Z9BA 2C8VA 2V7TA 1NYLA 3AKDA 4JLKA 4LXUA 1T9CA 3SHQA 1C4XA 3P32A 4GP9A 4LWOA 3E7XA 3A4VA 4BGIA 1A4XA 1GXSA 1I4DD 4DWWA 5JARA 4MITA 3OE4A 4X6XA 1U2GC 2W8BA 3BJMA 2RH5A 1GUFA 2PKCA 4YO7A 3PXGA 3V32A 2XGGA 5JDCC 2FG5A 3U26A 3IEIA 1DLJA 1G8MA 1QE3A 3F6BX 5HCUA 2O59A 2QTVB 2NU7A 2YVUA 1ZIDA 5CFPA 3K70D 1HNWB 4XWAA 5CNMA 1DQSA 2CXXA 2I1LA 2NZ2A 1C4WA 2AR7A 1CLEA 2NADA 5EIOA 4KNVA 1GNPA 4DJJA 3LT4A 1JHUA 3WBBA 4URXR 4RVGA 3EXEA 1ACLA 2ECOA 3I1IA 2VHUA 3U4AA 4AP5A 5L3QA 4JVSB 4L9WA 3RYHB 3DV0A 3R6DA 4J0JA 5EXDA 3ZWCA 3PQCA 2PT6A 3QOFA 4DJEC 1KI9A 5IX8A 3FYCA 3PJGA 3C7TA 2JZCA 4AY4A 4CMJA 2P6UA 2NT4A 2REQA 3NV9A 2CYBA 4AY3A 3KUXA 5FR2A 1VECA 3TOXA 2DXIA 2IEIA 4BJ3A 1QZXA 4L4RA 1JHPA 4D4HA 5F35A 4NK4A 1D04A 2AHRA 2CDCA 2WSLA 4PCVA 2PMBA 3BSSA 1NSYA 3BQ9A 4GWKA 5E4YA 1KWGA 3GEIA 4LRYA 3T61A 1NQAO 1J0AA 5BSFA 1Y8QA 1XEXA 1VKHA 3ZV5A 1CFZA 4G4JA 5A02A 2KHZA 5IAAA 2REBA 3NTOA 2VF7A 3M6MD 3DTTA 4PN3A 4CEJB 1M0TA 3E3MA 2BI7A 1N5DA 3IILA 1NFQA 4RQTA 3CB2A 5CCXA 4DCOA 5E6SA 2P5UA