2D3WA

Crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
244
structure length
244
Chain Sequence
MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Probable ATP-dependent transporter sufC
publication title Crystal structure of Escherichia coli SufC, an ABC-type ATPase component of the SUF iron-sulfur cluster assembly machinery
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d3wA00
1W0KA 2ZS9A 4HB4A 1G8HA 2GXSA 2ANBA 2C77A 4LJ4A 2WWFA 2WIBA 2GZHA 4AI6A 1YE8A 3KJIA 1NLZA 2VF8A 4BLPA 3ZLJA 1G5RA 1ZNYA 4JBYA 3O8CA 4G3XA 3DHWC 1EK0A 2QUZA 3PVSA 3IHLA 3Q5DA 3GEEA 1F3OA 1VYUA 1XMJA 3BXZA 4LDJA 1P2VA 4Q7LA 3TNFA 1B23P 2O0JA 2ZRFA 1JR6A 3ZGXA 4PANA 5FL7A 4PXAA 3T1VA 1GDDA 1KJYA 4IOMA 1O3YA 1YJ5A 2ZSFA 1II8B 4GOKA 5GVRA 1TUEA 1P3JA 4DZZA 4NCIA 4Q4HB 3WMFA 4ESVA 3VR2A 5BWMA 1B0UA 2PX0A 3AVXA 2UZIR 1XB2A 4OJKA 2ZRGA 5JRZA 5HKKA 1TQ6A 1WRBA 4DLSA 1FP7A 2QY9A 4JT2A 1KO4A 4NDZA 5L3VA 1XXHE 3I8XA 4QC2A 2YC4C 2IYXA 1WCV1 1OB2A 2C99A 3ICQB 2WSMA 2QT0A 2J0SA 3BRWD 1NVVQ 1F2TB 2ZROA 3MG9A 3X2SA 4ZKEA 4EKDA 3CRRA 4NYMR 2NPFA 3BGWA 1VG1A 2ODWA 3QBTA 1DBSA 4PAMA 3MWYW 5LBIA 5IK2D 1W2HA 1RRGA 5DO9A 1GL6A 3PQCA 1PJRA 1Q21A 2VP9A 2W58A 4QGHA 5CK4A 2WSSD 1M2OB 1ONBA 2VL7A 3AVTA 1UF9A 2VHJA 1Z83A 4LWZA 2FNAA 2GETA 3TQCA 2E9SA 1NKSA 5H1YA 3W34A 4TLDA 4O3MA 2FE4A 2VA8A 1T6NA 4PO8A 3SJCA 1P2TA 2PZEA 2ZEJA 3C4JA 3THYB 3ZVMA 3B82A 1ZM4A 1ETUA 1P2SA 1H8EA 621PA 4AC9A 3KKQA 4L8GA 2WVJA 1WMSA 1U81A 1E98A 2OBNA 4Q4HA 3LD9A 2VEDA 4QM6A 1W36C 2A9KA 1HT2E 2Z6VA 3RHFA 4A15A 4DSNA 3TUJC 3KFVA 3W6PA 3LY5A 3QKTA 4DIDA 3I8SA 3BJIC 3ND9A 3A6PC 4Q21A 3BH7A 5FUWA 5D3MA 3HWSA 1Z0KA 1N2CE 1KSFX 3NEYA 1V5WA 1FX0B 3AM1A 4HAZA 5KSOA 4MRPA 1OPXA 2NQ2C 2ONJA 1D8TA 1D5CA 1TAGA 4D4KA 3T1TA 5KDLA 2JLVA 4TTQA 3NG1A 3QENA 5HE8A 5DYGA 1G8GA 4A9AA 3X1WA 2DB3A 3VR1A 4JLVA 4YDHB 2F1HA 1TU4A 2XJ4A 3LO5A 5DISB 1E9DA 1P2UA 1E2PA 3Q8XB 3TAHA 4B3GA 3LFUA 5HE9A 1Y3AA 1DOAA 1W36D 221PA 3K0SA 2BMDA 2V1UA 4V0NA 4C0HA 5FPKA 4PPGA 2GJAA 2RGEA 4HLQB 1UBGA 1M74A 4XWAA 4B33A 5EJEA 3LX5A 1N5IA 1QG4A 2JIZD 3KQKA 1XXHB 3I72A 4DCTA 5HTKA 1EFCA 2J0UA 2XGJA 1Q22A 4JKIA 1XTKA 1Z6TA 3CH4B 1ZW6A 3QVUA 4NYMQ 2JLXA 4II7A 4L9WA 2L0XA 1CJKC 1AKYA 5EP4A 1QHSA 1N6OA 2PJZA 3DKVA 2GK7A 3O8DA 1OXVA 1KO8A 2IYQA 3ZVLA 2ZREA 1OXXK 4JL5A 3KTAB 1US8A 1CJVC 2ZIAA 2KWIA 3GJ5A 3DEFA 3CIOA 3K0AB 5EXSA 4FMCF 3GMTA 4P31A 3UIEA 3TQFA 2YV5A 3W3AA 4TSFA 2O8CA 2NO6A 4ON9A 3IPXA 2PMKA 2G88A 3UANA 2Z43A 1FUKA 4OK6A 4CW7A 2OFOA 4PHFA 4RD0A 2IYRA 4W5JA 3R9WA 1NF3A 3FOZA 1F6BA 3EIQA 5UKDA 2QRZA 2P5SA 1P72A 2JCSA 5SZJA 4LHVA 3I3SR 1FW6A 1EGAA 4QHYA 1XXHA 2IYSA 5FR1A 3TW8B 3OEHD 3SFZA 3QF4A 3CKLA 1Z6AA 3PUXA 1SVWA 1G17A 5AUQA 4QJ3A 2FPLA 2WJJA 1GKIA 2PLRA 2ONKA 5KHOC 4LHYA 2DR3A 2CK3A 2C8VA 2VTKA 1LV7A 2WKPA 3QUSA 1WB9A 3U2QA 3E5HA 3C16C 3U5ZB 1KI9A 1WBBA 1E2NA 2R2AA 5FBVB 3VKHA 1ESNA 3U3OA 2RGNA 4DLTA 4Q48A 3OF5A 3Q85A 2G3YA 3OZXA 1N6IA 1EFHA 4MGKR 3EC2A 3OAAD 4F38A 1Q3HA 2WJVA 3KTAA 1VHTA 4DCUA 1KMQA 3GJ4A 1FMLA 4TYQA 1XZQA 2MSEB 2OCAA 4UXIA 1Z6GA 2EU8A 5JI2E 5FI0B 3L8ZA 2WWWA 2BM1A 5CK5A 5KSPA 4JBXA 2J1LA 5E7JA 5EE3A 2ZS8A 3U61B 2W00A 2ZJ2A 1MV5A 1Q57A 2HF8A 2J7PD 1UPTA 1VPLA 2DBYA 4NCHA 5ANRB 4E5UA 3FHOA 4IVRA 2H57A 3S1AB 2LKDA 1XWIA 3K9HA 2H17A 2NG1A 2WPDA 3AGQA 2DFLA 4L5BA 3SFVA 2V55B 3I4LA 5DI9A 1XTSA 2WIAA 2OLJA 1XEXB 1DAMA 3N70A 1DE0A 4CYMA 1IXRC 4FINA 4LJ6A 2W6ID 3K0FB 5FUVA 1GRNA 1G21E 3QE0A 5F3WB 4W9MC 2ZUDA 1QVRA 4DT1B 2DFKB 5IF9A 4IW3B 3I5XA 1GVNB 4KYIB 2GZDA 1T3LA 1VHLA 2PCLA 1Q12A 1Z2CA 2ZSEA 2GF0A 1FTNA 1IOZA 3P26A 4XVUA 3AKEA 1G8FA 4TYNA 2JLYA 3IO5A 3U3JA 1L2TA 3SBEA 1XTJA 2FA9A 3NXSA 1XMVA 2QMEA 2JLQA 4I1OA 4C0JA 2X19A 1XCGB 2O52A 5EZ6B 5K8TA 1JPNA 2R6GA 3QKSB 4B32A 4B6EA 4C0KA 2GRJA 4FCTA 2ZE7A 2FOLA 3UATA 4EJSC 4A36A 2JATA 2YZ2A 4FMDB 3U3MA 3L0SA 5IK2A 4EPXA 3AF2A 4GZMA 1AQUA 4Q9JA 3KXLA 2RB4A 2W0SA 4DSUA 4QOSA 5LPNA 4PR0A 1WQ1R 3F8TA 4RD4A 1MH1A 5EXTA 2VLIA 2WSSA 4G5GA 1KY3A 2DCUA 1DO0A 1N6NA 5DSZA 2ZYUX 1ZU5A 3ZIAD 4P4SA 2REOA 2MSCB 1XTIA 3K0CC 5CM8B 4EPVA 1JXMA 4C0QC 4C2TA 2BDTA 1XCMA 2HF9A 3TUZC 1YR7A 4AG5A 2IUTA 4N0EA 8OHMA 2ZRNA 2ZAMA 3GJ3A 1T3SA 1XRJA 4A8JB 4W7SA 1CJMA 3FKQA 3TGPA 4OHXA 5KO2A 3LNCA 1MO5A 3TW4A 4AYTA 4MYCA 3A1UA 2OFWA 4XWKA 3PEUA 3AVUA 1OJLA 1UBFA 2RGXA 1RC8A 1NRJB 2O8BB 2ODBA 3EWSA 2XNSA 3RSOA 3K9GA 3QKSA 3BBPA 2HXSA 1V43A 3HR8A 2OFXA 1ZM9A 5F2EA 4QFMA 5H68A 1E99A 1P62B 2QZ4A 2BEJA 3SJAA 4M9XA 1SHKA 3ZQJA 3PFIA 3RWMB 3BS4A 4ZI3A 5CYOA 2XZPA 1DO2A 5FI1B 4TQAA 1KI3A 4O25A 3PITA 2EWVA 5JWHA 1S4QA 4WBSA 3WXMA 4LJ8A 2YVUA 1ZM2A 3Q7PA 4PZYA 1GIAA 4QGFA 4WIAA 1Z47A 4JL6A 1IM2A 5HCIA 1Q1EA 5KTYA 4S2EA 3X1YA 4GFDA 4EIWA 1HH4A 2JLZA 1VECA 3MMPA 4PHHA 2CLCX 4YONB 4LV6A 2QMHA 3O8BA 1E79D 2Z4RA 4MKHA 1XD2A 2P3SA 4TLEA 2ZI9A 1NBME 3FMIA 4K8OA 4Z54A 2A7QA 5CJ2A 5J40A 4W5WA 3L0PA 4ZCIA 5HZHA 4R7ZA 4TYPA 3T12A 1OE0A 4Q7KA 1VG8A 4LRWA 4P0TA 1SXJC 4B76A 1Z28A 2IS1A 2GEDA 3FPAA 1ZC4A 1ZAKA 2AD1A 2BV3A 2GF9A 1J8YF 1N6PA 5FL7D 5B64A 3LWNA 4Q18A 2OCYC 2W2TA 3CW2A 1GITA 3KDSE 4HB2A 4RFVA 4OQNA 3LVQE 4Y0AA 1YZUA 1VDZA 1W1WA 5FTLA 2J46A 1DVRA 5IT5A 4XOIA 1U9IC 3W8NA 3PEYA 1XEWY 3FVQA 3HPRA 4K81B 1G41A 3PUZA 1ZINA 2WKQA 1N0UA 5FTMA 5JLJA 5JI3E 1X8LA 4DCVA 4DCNA 2NO1A 4FMBB 1OH6A 1KAGA 3AF4A 1OW3B 4MYUA 5KPJA 4ZCLA 5C4GB 1XDBA 2OUKA 4BEJA 3ASZA 1SXJD 1AA9A 3KKPA 5TB5A 1SVOA 2F6RA 4UXJA 5JZVA 5FL3A 2B7CA 4WOPA 4XSGA 4D25A 4TMVA 2FEOA 3NBZC 4M2LA 5TARA 4CIDA 1RJ9A 4B3DA 3VTKA 2JLRA 2V9PA 5DI3A 4IHQA 4B2PA 4RFSB 3U4QB 2VYFA 2KE5A 4MKGA 1ZD8A 3SHWA 2ZRCA 4WVFA 5HZKA 5FOTA 3OEHA 3U44B 4MITA 4LUCA 4MUAA 4TQ9A 4BFVA 2C5LA 4KODA 3HR7A 2JGNA 5J47A 4D4JA 4QBIA 1AM4D 2QL6A 3CPHA 1ZIOA 3GJ0A 2F3TA 1R7RA 4KI0A 3AUXA 4IOKA 3EZ9A 2VP4A 2ODNA 4ZIRA 5KSZA 5KUTA 3J81k 4TL7A 1NP6A 4HB3A 3EZ6A 1ZYUA 3OAAA 1AS0A 1E3MA 3NBFA 4A0FA 2GDJA 4YDSA 2B8TA 2RGGA 1IAQA 3JZAA 4KBGA 2Q3FA 1R0XA 4FN5A 3NBYC 3CF2A 1E2KA 4PQFA 4TL8A 2AFIE 1MKYA 5AJXA 1W46A 2ZETA 1TNDA 2NIPA 1D2EA 4KFTA 4Q7JB 2FFHA 5EE1A 4A6XA 4J0QA 4Q4AB 3OFND 3SJBA 5G3YA 3WY9A 2Z5FA 2J7PA 3K70C 1S96A 1JQLB 2WM9B 3WP1B 4URUR 3CZPA 4BFUA 1PLJA 2LCFA 4RFSA 4B3XA 4CGZA 4LYFA 2AKYA 2YYZA 4P32A 4DDTA 3IIJA 4JJKA 4HYYA 5CB8A 3GQBA 1EESA 1Q1BA 2WKRA 3MGCA 3A4MA 2GEVA 3C7KA 3MWKA 1T0HB 2D7CA 4WXRA 3GPLA 2W6IA 1KKMA 2C98A 3RS0A 1L4YA 2XTNA 1MO6A 4MQBA 5E7IA 3EIEA 2WMNB 1W0JD 1NSTA 3K8YA 4X8HA 4UKDA 4BFZA 4R98A 2EFCB 1OH5A 2JJ1D 3TJZA 2ZJOA 2OILA 3A58B 4D6PA 3CX8A 4Z1MD 2BBTA 5AUNB 1KI1A 2ZYWX 2HV8A 2J5XA 2QGNA 3DPUA 4PPQA 3AVYA 4DDWA 2REBA 1M7BA 2BJVA 3H86A 4OBEA 2IF2A 4BFWA 2EYQA 3WYGA 1RYHA 2C9YA 4TL9A 2AK3A 4LC1A 3RDPA 2IT1A 1MABB 3L8YA 4M1OA 3C14C 2H8KA 2ZJ5A 1E32A 3KKMA 3TSZA 3G0HA 2ZI5A 1RPZA 2WJYA 4D82A 4HDOB 1JECA 2I4IA 4LHXA 4RD3A 4NL4H 2KBFA 1ODFA 1IY2A 1XCPA 4Q9HA 3U7EB 4F7WA 2GAAA 2PT7A 2ODEA 1CR2A 4QJ5A 2IUSA 1NVWQ 2FFAA 4OQMA 2D2EA 2EFDB 3HYTA 2F3RA 2JAQA 2J7KA 5JCZA 4XD7A 4KITB 5FTJA 2G1JA 1Z0DA 2QPAA 3MCAA 4LJAA 3H84A 5L3QB 4DEXA 3ZIAA 2IL1A 1HQYE 4M1KA 3BH6A 5FTNA 2VP0A 3WRYC 1ZVQA 3WMEA 4DXAA 2B7BA 2E1RA 4UNSA 2C03A 4KAXA 4MUBA 2ECKA 4PAQA 1AQYA 2CK3D 3FYHA 3N2IA 1YHNA 2Y8EA 3IKJA 5JEEA 4EJSA 1ZUHA 5DE3A 2JJ2D 4NP6A 1IONA 2A2ZA 2UZ3A 3EWAA 3MSXA 1M1YE 2Z4SA 2FX3A 3HU2A 4LJ5A 1W4AA 4Q7MB 5AJZA 5LB4A 2VO1A 3B8HA 5EUQB 3ZZTA 5FFMA 2CCGA 2QP3A 4TLAA 4BWYA 1MABA 3ADBA 1R5NA 1BIFA 1XF9A 1BO6A 2GCNA 3BOSA 5E3HA 4LV5B 4BLOA 3REFA 1BOFA 2PBRA 1N6LA 4Z51A 5IRCD 1KMHB 2QRNA 5L3RA 2PCJA 3IEUA 3K0CA 5GJVC 4B2IA 4DCSA 2NMVA 4RD1A 4F4JA 2W0MA 3SNHA 4NONA 4BLRA 2CVFA 4FWIB 1KI7A 3PEVA 1CJUC 1OIWA 2ZUBA 3GEHA 4EFMA 5J4KA 3ZS8A 3K09C 2E87A 1AGPA 1ZRHA 1Z0JA 2IXFA 4M9ZA 1MRSA 1TTTA 1ZCAA 1IBRA 3GJ6A 1ZU4A 4YMVA 1VTKA 4XJXA 1SULA 3RAPR 2WV9A 2GBLC 2HYIC 5JJLA 3EXAA 3BD9A 1RKBA 5FOVA 2BKUA 4EPRA 2VHQA 4M1SA 3W5IA 2HUPA 2O8DB 1KDRA 1E79A 2CL0X 1XU4A 5SZHB 4B73A 1NLFA 3CBQA 1U2RA 5CLQA 4M1YA 2LKCA 3SR0A 4XWOA 2QI9C 2GJ8A 2R6FA 3B2EA 3B7GA 4GZLA 2FMXA 2FEMA 4FD2A 4R71A 3ETLA 5B2ZA 4OHZA 1TF2A 4JYCA 4LSGA 3AF1A 4KSBA 3SJZA 2VP5A 3B1WA 4F4CA 4JS0A 1SVKA 4ZDWA 2I1VB 1UKZA 4M8NE 5DHFA 1M6NA 2VP2A 2A3RA 2XTZA 3REGA 5EZ5A 1QHYA 1E2MA 3O8RA 1PLLA 4EQ6A 3P4YA 3DOEA 1FNMA 2P0EA 5KDOA 1WF3A 2ZUCA 5FOXA 3VQTA 4LOAA 5G3ZA 2XXAA 4GP7A 1UADA 2CJWB 3AP2A 4PSKA 4ERNA 3GLGA 3KB2A 3I32A 3QJYA 5AJYA 1VIAA 1KNQA 1NIJA 4MGYR 1G291 1SXJA 5CITA 5KPDA 4OJQA 1R4AA 3BK7A 2WAXA 2OBLA 1N6HA 1YZQA 1UFQA 4JLNA 3QNUA 1N6RA 1C4OA 3HP1A 4U7DA 1JALA 3E2IA 4KV9A 4TMWA 1QHIA 2O8DA 2WMOB 2QPOA 1K6MA 2ZPTX 2F9MA 3DVLA 1DAHA 3OIVA 3OIYA 3UWKA 4DSOA 1KK1A 1U9IA 1J7KA 1G7CA 3Q5EA 4M21A 1E9SA 2PZFA 4PSVA 2DWQA 5P21A 2GHIA 4EUNA 1G6OA 1KK3A 4LX0A 1DAFA 1RFLA 2YINC 1II8A 3AKDA 3QXXA 1R0YA 1HA3A 4BFYA 5JSZB 2OE2A 2HDNB 3CNNA 3P4XA 3DM5A 1NNEA 2ZRKA 3CB4A 3LAWA 5CIQA 2CHGA 3K70B 4IFBA 4RD6A 1OXSC 1ZD1A 4DLZA 1F2TA 3AUYA 3EPJA 1TQDA 1A7JA 2ZJAA 3K0EA 4EAQA 4A8JC 2BBOA 2EFHB 4ASUD 1Z6XA 3QXJA 1AK2A 4CVNA 3QG5A 4C7OB 1CKEA 4B47A 5FR2A 2JASA 1X1SA 3OEED 4V0KA 3A36A 2CBZA 3OFNA 5BXQC 1GRQA 1HYQA 2J0VA 5AJVB 4QNRA 1SKYE 4PC7A 3GLHE 1Z0AA 1DARA 4PZZA 1CF4A 2OV2A 2O0HA 2AL7A 1OFUX 3U7FB 3CZQA 2V6JA 3SZRA 1G20E 2PEYA 1EG7A 3B5JA 1JEEA 3FE2A 4JLKA 4KHZA 1NKTA 4N1AA 3UK6A 3THYA 2AD5A 3B85A 4PFSA 4Z8XA 2J3EA 2AXNA 1NJFA 1RRPA 2PMDA 2R62A 4XIGS 2IW3A 5CM9C 3U3RA 1NY6A 3B6EA 3GEIA 3GLIE 2QM8A 2VSOA 4GMXA 2DWOA 1HT1E 3OIWA 4HEJA 5CLLA 4BZPA 5JRJA 5KOYA 4BPBA 1NI3A 2FF7A 4Q9KA 2YOGA 2WTUA 1W0JA 1HE8B 2ZRHA 5KSYA 4A1FA 2AKAB 4FI3C 1TEXA 1N5KA 1N0VC 2JJ1A 2FU5C 3CF0A 1WDTA 1QHXA 1FL9A 4MDFA 4NCNA 4Z1MA 1TUIA 4NE2A 1XTRA 5EXXA 1FX0A 1E9RA 3BB3A 2G77B 5CYPA 3C5CA 2XAUA 1G9XA 1I4TD 4PC3A 4P4TA 3K53A 4LPSA 4A0HA 4JBWA 4AIIA 1G3IA 3LXXA 3QXCA 4GDFA 1GTVA 1E9CA 2OLKA 2W2VA 3BORA 3FWYA 4X8MA 3ZVRA 1GM5A 2XNDD 3ND8A 2PJRA 1CBUA 4YMUA 5EUMA 1IXZA 3CLVA 1U8AA 1K8RA 1KO5A 1YU9A 2CL6X 3JVUA 1I4DD 2GTPA 1G4AE 4L16A 1Z8FA 3P27A 3LXRA 5F9HA 2FGJA 721PA 2JLWA 4Q5IA 5E95A 1X8KA 4H1UA 2F43B 1KI4A 3D8BA 2PH1A 4BQSA 1KDPA 5FPSA 4QBFA 3WNBA 4LHZA 2WICA 4W5HA 5A5GA 1UAAA 2ZE5A 3QPWA 4HZIA 4C0AC 1HURA 4HAWA 2WPDD 3IDQA 5EE9A 4B3CA 4B6FA 5GADl 2UKDA 4B71A 1GOTA 1Z08A 5BQ5A 3THWB 1EX7A 3TMKA 1GRRA 4LBWA 3VR4A 2Q3MA 2ZYTX 1GP2A 3VR6A 2GWHA 2JJ2A 3C15C 4IDOA 4JJZA 2D3WA 4TMZA 3E1SA 1E1QD 4IDQA 3VKWA 1SKYB 3GLHB 1E0JA 4U5XA 3U6KA 2FSHA 3K0AA 1XMSA 2MMGA 2Q9CA 1CP2A 2ERXA 4CDGA 2GESA 1DAEA 5DIFA 2XOKD 1G3MA 2VHCA 4YMSA 1RYFA 4MRNA 2QTVB 2D62A 1KO7A 5CIWA 1YVDA 1JI0A 3RS4A 5FOWA 3IILA 1BYIA 2ZRPA 3MAAC 3GLIB 4OKSA 1JAIA 4ZCMA 1QDEA 3ZZ0A 1OYYA 1A4RA 2DWPA 4F4IA 5JBQA 2P5TB 2W2XA 1LTQA 1QHHB 1Z07A 1KJWA 4DHEA 1XPOA 4NZYA 3M1IA 2DFTA 4ZO4A 4Q9IA 2VSXA 3ZVNA 5D3QA 5K8LA 1A82A 4OQFA 4M9SA 4RZ2A 2JEOA 2Q3HA 1HUQA 4JLPA 3ZH9B 1IXSB 4YMTA 1XFAA 3CONA 2R6DA 2ZITA 2IF0A 1XX6A 3PR1A 5EP2A 2KI5A 5A4JA 3IUYA 1NIPA 4US2R 1U8YA 2ZRIA 3OESA 4OI2A 2QM7A 4QBHA 1NN1A 1E2FA 1WA5A 2HYDA 4I1VA 1X8JA 3SC3A 4I4LA 5AK0A 1E9AA 1E2LA 4G5QA 2AWNA 4RCZA 2FN4A 1ZMXA 2NOAA 2QG6A 2YWHA 3QKUA 4I99A 2HLDD 3K09A 3W5JA 4A2WA 821PA 3KZ1E 1AKEA 1U99A 2IYVA 4KFSA 5JJIA 3EA0A 3KJEA 5G40A 3T15A 4AURA 1E9BA 1JPJA 2CDNA 2H18A 3NKVA 4HDCA 1W4RA 3TSOA 2GBLA 4JVSB 1NBMD 2PLFA 1Q1ZA 5CDFE 3B13B 1KSHA 2ZAOA 2IS4A 2X2FA 2OZEA 2BCJQ 3RRNA 3RS2A 4WW0A 4FWTA 1W49A 1KAOA 2QN6A 3T1OA 4Q4JB 2CNWD 3S1AA 3AKCA 2AK2A 1G6HA 5EE5B 1N5LA 4M1TA 1E96A 4AG6A 4I81A 1NN5A 1M7GA 2WWHA 1XEXA 1GZSA 3DMDA 4XD7D 2V7QD 3VU9B 1NJGA 3LDAA 2G1KA 1IN6A 2HT6A 3K0FA 4LY6A 3SN6A 1YRAA 2ZRBA 4KXFB 4OQLA 2GJKA 2PEZA 3SI7A 3PUWA 4DT1A 2XB4A 2HJGA 3QSYA 3VX4A 5EQTA 4YLGA 1DG1G 1OT3A 2QORA 1L8QA 4GOXA 3IO3A 1X1RA 2QAGB 4D0LB 2JA1A 3QPVA 4HB0A 1MT0A 4WXPA 5AJWA 1HE1C 5EP1A 3V4FA 3AF3A 1A2KC 5TV2A 2D4HA 1G3RA 3FHCB 3PG5A 2REXB 4G5SA 4V03A 1J70A 3KKOA 3QEJA 3NDBB 2F9LA 2CHQA 3ZD7A 3AVOA 4IXNA 4B3FX 3IPYA 4JVMA 2ZANA 1XNJA 5M04A 3L0OA 2WOOA 2QBYB 1G7RA 1YR8A 1Z29A 4YMWA 1XEWX 1NLYA 2FPMA 2ZSBA 2RH5A 4E07A 1G5TA 3DM9B 4ASUA 1XBTA 4KO8A 1X86B 2O5VA 1W5SA 4LZZA 3P32A 2ZQ5A 3OEEA 1JNYA 3TIFA 5AUOB 1U0HC 1FPMA 1L4UA 2C04A 5LB2A 4Q01A 1AZSC 2IYWA 1E2HA 3AP3A 4M22A 5LDDC 5JMTA 3AEZA 1P7CA 1WXQA 1ZUIA 3TR0A 4G5RA 1F2UB 1OFHA 1T91A 4M9QA 4OHVA 5JS8A 3PXGA 4A92A 4RY2A 4X8LA 2K5UA 4CEHB 3LRPA 4B3BA 2QP9X 2VPPA 3A1VA 2QE7A 5JJKA 3EC1A 1E69A 3RS5A 3TRFA 4AKGA 3RRZA 1KHTA 4OL0A 1F48A 4GBMA 5E4FA 2RGBA 4A8JA 4CT5A 3RANA 4OHYA 5GVSA 1VCMA 3VAAA 3DDCA 2QNRA 5BYJA 3EPHA 1BS1A 1LS6A 2WOJA 3A1WA 2O8BA 2AX4A 2VHUA 4O0MA 3IHWA 3WNDA 5L3SB 2A5FA 4JYBA 5B58C 1T9HA 4Q4LA 3W6NA 4GSYA 1C9KA 2BEKA 2FPKA 3AP1A 3QQ5A 5J4HA 4YXWD 1VG0B 5FOSA 4RZUA 3RLFA 4PC6A 521PA 2IYLD 4NYJR 1P61B 3UG6A 1N5JA 1F5NA 2VF7A 3OE7A 1KI8A 3WBJA 3I73A 2XNDA 2ORVA 2ZJYA 3P1JA 4NCJA 4JVLA 3EPKA 2X1VA 3LQRA 2AXPA 4HI0E 4DLYA 3KQLA 5BN3A 4QHSA 1YZLA 1D9XA 4TN1A 4GI7A 1KI6B 1QF9A 2CMKA 1H65A 3FMOB 1U94A 3WBKA 4FCWA 4OHWA 2YKGA 1N0WA 2QA5A 2WWXA 2BCGY 4KVGA 3BFVA 3CX6A 2IK8A 4F92B 3M0EA 2P6NA 3MRSA 3IQWA 1KJZA 2KBEA 5J4VA 3TKLA 2BKEA 1NSFA 1O87A 2H16A 2P6UA 3B1ZA 3RABA 1J2JA 3QKRB 2FSGA 2GVDC 4L9SA 4FCVA 3SOPA 1JQJC 4Q1CA 3GP8A 3UKDA 3EIHA 3RC3A 2QQEA 3VFDA 5J4YA 4IKEA 4US1R 4EFNA 5C18A 2GEUA 3LVRE 4G1UC 3NHAA 1CULC 1G7TA 4DIEA 4KYUA 4Q00A 1UEJA 4MRVA 2ATXA 3THOA 1JEDA 4JLMA 2W6JD 1OXUA 3M4YA 3RS3A 1S2MA 1E1RA 1ZIPA 2Z0MA 1QRAA 3BIFA 4Q02A 1LY1A 1E1QA 3FFBA 1GILA 4CEJB 4IVQA 2GCOB 4IJMA 2C9CA 1X6VA 4PPNA 2BMJA 3DL0A 1KOFA 2W83A 2XTMA 1E0AA 1WP9A 2G0TA 4DKXA 1Y63A 1EFRD 3CRMA 4A2QA 2XOKA 2AWOA 5TMPA 4Q1DA 2QENA 4IEIA 2ZI7A 2V6IA 3IQXA 1JR3E 3T35A 3H1TA 1KSJA 1XZPA 4QG7A 2FZ4A 1K5GA 1CXZA 1QZXA 1T5LA 4DEYA 3U6BA 2Q21A 4M1MA 2XSZD 4I1UA 4GOJA 3CR8A 1T5IA 2DYKA 2IX3A 2IYTA 3FFAA 1P5ZB 3TE6A 4PC1A 4URYR 3U4QA 1MOZA 4UNQA 3QKRA 2EYUA 3WYAA 4V0LA 5H70A 4Q1FA 2GJSA 3SQXA 3U44A 2GCPA 4LYJA 1OXTA 5LD2C 2OT3B 1T8TA 5GJWC 3GJ7A 1SVMA 2OESA 2VSFA 2JDID 4HUQB 4FIDA 5L8VA 4F93B 4CEIB 1YR9A 4XTCS 4Z8YA 4NYJQ 1MR3F 4MGZR 4K46A 1OIVA 4JLBA 3NWJA 4ARZB 4HLUC 4FMDF 2ZR7A 2ASEA 4LGMA 3K70D 6Q21A 4JT4A 2J0QA 2CHVA 1R10A 1UDXA 2HLDA 3LQQA 2QAJA 2OO7A 1ZM3A 1E0KA 1G19A 1LB1B 2YHSA 4BUJA 2ZJZA 1W7AA 3KJGA 2EWWA 1DELA 3UMFA 2F1IA 4KVAA 4QBGB 4ZPXA 2GKSA 4AD8A 3AF0A 1CR4A 1GG2A 1R8SA 4H9GA 1NBMA 4Q4AA 3R7WB 2ZM5A 4OI0A 1HTWA 1E4YA 3CWZA 2BVNA 4TMXA 4TQUS 3CX7A 4E09A 1KSGA 1OF1A 3GFPA 1CJTC 2JJ8A 1NVXQ 3KUDA 2CNWA 2IWHA 1KY2A 1R8QA 2YWFA 4HDQB 1PV4A 2B6HA 1RVDA 2Q0HA 3NBXX 1RIFA 4ZDKA 3VNVA 2HXYA 3EA5A 1IN4A 4BLTA 5JS7A 2O8EB 2ATVA 1W4CA 2V7QA 2GJ9A 1NY5A 3MD0A 2IXEA 4LJ9A 4WAUA 2G83A 4UNRA 2C2HA 4D0GA 3NEJA 2WWGA 3C41J 4ZKDA 4HZUB 2CVHA 1RRCA 2YNMA 4RZ3A 3IEVA 3Q9LA 3P20A 2ZRJA 3N5CA 3I92A 4KCGA 3PEWA 4AKHA 3F0TA 4RKEA 1U8ZA 4DLXA 1GL9B 4CF7A 5F98A 1TL7C 2EW1A 3ZDQA 3CPJB 4BZXA 4DLWA 2ZVPX 2Q9BA 4NYIR 3EZ7A 4GMDA 4O2RA 3DOFA 1LFDB 2GXQA 1EFTA 1E2EA 1KGDA 5KNBA 3TAUA 4FMCB 1VG9B 2WJHA 1UBCA 2OXRA 2V54A 2LWIA 2NPIA 3BC1A 3CO5A 3QIAA 1OH8A 4B48A 4JZKA 1YZNA 3WMGA 2PX3A 4BEBA 1II0A 3PV0A 2VIIA 3SHFA 4ZV4A 3PUVA 5JFGA 1QBKC 1N25A 3H2YA 1UBEA 2P2LA 4MRSA 1IN8A 4PZLA 4TZ0A 4BRUA 2R6AA 2WZQA 4I1SA 2EFGA 2AN9A 4LYAA 3I5YA 3WHLA 2R6CA 3EAQA 4L4UA 3CF6R 4GRAA 5J5CA 1E2IA 5L3QA 2QPTA 2QGZA 1JAHA 2ZI6A 2ZRMA 2JLSA 4M0LA 1IY0A 1KDTA 4D2IA 1LVGA 1CEEA 1S1MA 1SHZA 5KYKA 1SZPA 1DTSA 2OSBA 2WJIA 4FW9A 4HZUA 2EVWX 1J99A 2WWIA 2QU8A 1IY1A 1EFUA 5FUYA 2OM2A 3VMFA 2A30A 3LLUA 4JKYA 3R20A 4G01B 1Z2AA 1EX6A 1R5OA 1U90A 1UDWA 1CLUA 4ZDJA 1GFIA 1XMIA 2ZSDA 4Q19A 4F91B 4Y0VA 5GJCA 4H1VA 3E70C 1T0JB 3A4NA 4BFSA 1AN0A 3RYTC 3FTQA 4DLVA 5K8UA 2Q6TA 1G8PA 4G5OA 1AS3A 1XJ0A 2C9OA 4O2LA 2NZ8A 1OFIA 1T4GA 4NU0A 3RS7A 2YWEA 4TYWA 2ZU0C 1KMHA 3SYNA 4YXWA 4ITRC 2ZSAA 3TSWA 4TZ6A 4QKQA 2OCBA 3D7MA 4LJYA 1KK0A 2IWRA 1S0UA 1S3SA 1ZP6A 4LHWA 4PC2A 1IHUA 3HJNA 3CNLA 3MWLA 3THXB 2CLDX 3H0KA 2ZS7A 1PUJA 3LX8A 5HCNA 5EXPA 3AV0B 1COWA 1F60A 4P4UA 5FBRB 1W48A 4OI1A 4KFRA 5JCPA 1CIPA 3MWJA 2J45A 2VBCA 1AGRA 2YC2C 3L0IB 4GNKA 2JLUA 4Q1EA 4MA4A 1D9ZA 5D3MB 4NYIQ 4C0SA 3EZFA 3NC0C 2FDCA 3D6TB 4RJLA 4MYHA 1NVUQ 3DZ8A 3K9NA 3MUFA 5EE0A 1BMFD 5JHGB 4A4DA 4DLRA 3TR5A 1W44A 3ADKA 4JVNA 3SU8A 1GNQA 421PA 1VKJA 3T34A 5J4LA 1ZD9A 1PZNA 2ZR0A 1CU1A 4PAOA 4RZXA 2QQ0A 4PQYA 2J41A 3ADDA 2W6JA 3R8FA 1G5PA 3CH5A 1D2MA 4DLUA 2OAQ1 3B1VA 4ACBA 3X1XA 1G1MA 2QP4A 1XPRA 2QAGC 2AR7A 2ZTSA 5C4MA 2CJWA 2IHBA 3TBKA 4DVGA 4EFLA 1EFRA 1TEVA 3KKNA 4LCBA 1HY3A 3I62A 3THXA 2CE2X 5DYIA 4D0NA 1ELOA 3TLXA 3UXMA 2NGRA 3RRYA 2J0UB 1GNRA 1OIXA 3NH6A 4ABYA 4DDVA 5LD2B 3ECCA 2VP6A 1NMXA 5SZIA 4BLQA 1CR0A 2X77A 1A2BA 4JSYA 4PHTA 2A5JA 4B43A 2XSZA 4A82A 3GD7A 3LW8A 1IN5A 1CRQA 2KJQA 4XVRA 1W2GA 1DPFA 4LC0A 3EX7C 3GLFE 3FGNA 1VYVA 3QPUA 2XB2A 4LBVA 3RWOA 4RSGA 3LLMA 4B74A 3QG1A 4Q47A 3KUCA 1US8B 4RKFA 2QE7D 2ZJ8A 3HU3A 4OK3A 1S9HA 3Q72A 4WZBE 3ZYCA 3B1YA 3ZS9A 1KZ7B 2JDIA 4UJ3A 2RAPA 1LS1A 4HAXA 1NG9A 2FG5A 4UQOA 3X1DA 3AH8A 5JSZA 3DO6A 2O8CB 4ZI2A 4NH0A 2IEZA 4US0R 1UM8A 2H1LA 2ERYA 4IOJA 2OCPA 4Q1AA 5IDVA 2IUUA 1LF5A 1SVIA 2ZE8A 2GA8A 4TLBA 4EPTA 1E94E 1ZC3A 2XEXA 2ZYVX 2RGCA 4XTRA 1Q0UA 3SE0A 3W6OA 4BZQA 1W5TA 5BW8A 5TXGA 4IVPA 3HYRA 1XEFA 4HLCA 3LH5A 2NO9A 1J8MF 2I1QA 1RZ3A 4IOLA 3LV8A 1D2NA 3AVWA 1ZCBA 2QROA 4PQRA 1ZJ6A 4C7OA 2BBWA 1GSIA 4LPKA 3QF4B 5G53C 3OE7D 5G41A 4A6PA 4TL6A 2R8RA 4BGDA 3D31A 5KNCA 2CCJA 3JVVA 4AY2A 1U0JA 2UVQA 4EPWA 1Z06A 1Q3TA 2XJ9A 2OAP1 3HDTA 2DFNA 3KQUA 4PSAA 2F55A 1UEIA 3I61A 3KFXA 2HEIA 2ANCA 4HLUA 3W9YA 4U02A 4A0GA 2WHXA 5JHHB 1CTQA 3SS8A 1ZNWA 1CRPA 4KJZA 2QTFA 4Q66C 1DG3A 2H5EA 3KJHA 4C3ZA 3FKSA 1E0SA 3KL4A 4G0NA 2QSYA 2V8OA 3V9PA 4QJ4A 4HUTA 2N1BA 2PL3A 4RVCA 2HT1A 3AGPA 4Q1BA 4YC7A 4KLNA 5ELXA 3QF7A 3TK1A 3BB4A 1P4SA 1QHGA 1MO4A 1R0WA 3CNOA 3IBYA 1T3HA 4HAUA 1KTVA 2D06A 3QEOA 4QXAA 4R9UC 1E1RD 1H8HD 2B8WA 1XPUA 4WZ6A 4FXPA 2C96A 1GKUB 4KFUA 2PT5A 4DUGA 2RHDA 3NVAA 1VIYA 1Z5ZA 3KXIA 5SZKB 2FSFA 1ESMA 1OHHD 4LI0A 2HJVA 5H8WA 4GL2A 1G16A 4HSEA 3GLFB 1Z6YA 4D26A 2J87A 1XTQA 1KDOA 4MKIA 5FPYA 4TYYA 1WE2A 1VCNA 2BM0A 4DB2A 1E2JA 4EPYA 4LV8B 5F9FA 5EP3A 3GCGA 1W47A 2IYUA 4PHGA 4A2PA 4MDEA 5DGXA 1Q1QA 3ONWA 4RD2A 3VR5A 1Z22A 3TUIC 2F43A 3JZMA 2O8FB 2ZRAA 3EARA 4RCYA 4AYXA 2XZLA 3QXSA 1NN3A 5DNYB 4URZR 2R65A 3UG7A 2BBSA 4B34A 3GJXC 3DZDA 1Z0IA 2RGAA 3CM0A 3H4MA 3UMSA 1GL7A 4AKEA 1XJCA 1UKVY 3AB3A 2NO7A 1E2QA 4CRWB 1PUIA 1OV4A 1P75A 1S1CA 2FV8A 3THWA 4NKRA 4UNNA 4HATA 1QVAA 2IYYA 3RVBA 1N6KA 3VX3A 1OLOA 4DC9A 4C9BA 3CRQA 1FFHA 3AVQA 5DN6A 5DLQC 2AFHE 2ORWA 2OHFA 3GLHA 4QRHA 3N2EA 1SVSA 1X3SA 3GLFA 4EDHA 2FGKA 2EFEB 4D4LA 1P9NA 2GXUA 4NPHA 2ZR9A 4P4SB 3A8TA 1IJEA 2FFBA 3SDZA 2CL7X 4B44A 2OXCA 3L43A 3Q7QA 4BE7B 3EZ2A 2GZAA 3I1FA 5B30A 2H7VA 1KKLA 4QHTA 3TVTA 3GLIA 1JXOA 1SQ5A 3QBVA 2EQBA 4ESHA 4IXMA 2NO0A 4LK2A 1UKEA 2G6BA 1QHHA 3UWOA 2O8FA 1RW4A 4BECA 4DWJA 1Z63A 1SKQA 2IYZA 2P6RA 1FQJA 3RRMA 4PO9A 3CUEF 3AVPA 2ZJBA 1OYWA 3L2OB 1W4BA 1NMYA 1SVLA 1D6JA 2OBMA 3WYFA 3AKYA 2IEYA 3K1JA 1TPZA 5FBWB 4QM7A 1KO1A 2X2EA 3ICEA 3NIBA 3T06B 3LBHA 1SGWA 3LBNA 1WBDA 5FH9A 1U98A 3U7GA 1BMFA 2MMCA 2V1XA 1ZNXA 4LBZA 4NMMA 2O0KA 4IRUB 5E7MA 2BIFA 3KQNA 1J90A 2N42A 3ADCA 2ZI3A 2GVZC 3LA6A 1YQTA 2ZXUA 1FTSA 4TWZA 2NTYC 3MLEA 4ACAA 3BB1A 1EWRA 2FSIA 4GPTA 4D81A 4AKIA 2VQSA 3B78A 1W36B 1FOEB 1JJ7A 3IBGA 2B92A 2A5GA 1E6CA 3F3YA 1Q20A 4HAVA 4MGIR 1OB5A 3NH9A 4S35A 1XD2B 1E4VA 1IN7A 4IDPA 4M4SA 2GK6A 3O47A 3RC8A 2SHKA 1P73A 3SQWA 3BWDD 4TTRA 1FMJA 4CT4B 5A0FA 4JMPA 3CPEA 5BN5A 1DAIA 1OFTA 4Q4JA 4GP6A 2H92A 4N3NA 1HEIA 3FHTA 2D7DA 2Z83A 4TMKA 2F1RA 1NG1A 5JECA 1JJVA 3HU1A 1BH2A 4V0ME 1PVOA 3VHLB 2N46A 1MRNA 1XP8A 3ZJYA 5HPYB 4XVQA 3VU9A 1UKYA 2C95A 4R2HA 2RKOA 4XSHA 5BYKA 1R0ZA 5K8IA 4YQFA 4TT3D 2P67A 2CXXA 4N0DA 4KU4A 4NHOA 2ZE6A 4P3YA 4QGGA 1KI2A 2QAGA 1CS4C 4CZ2A 2BHRA 3MJRA 4BASA 1P9RA 2HCJB 5C1BA 1IJFA 3AQ4A 3X1ZA 2XZOA 1JR3D 4E03A 2IBMA 1QG2A 1OKKD 1C1YA 3A4LA 2R44A 1W0KD 1U0LA 1G3QA 4U00A 3ZD6A 1I2DA 2G0NA 1FQKA 4MYTA 4V02A 3CRVA 1RJ9B 2MSDB 3M6AA 4ZDIA 2QBYA 2F1JA 5KNDA 1HV8A 5DI3B 4LBYA 5KDDA 3UMRA 5JEDA 3CRW1 1NN0A 2JIZA 1AIPA 1I2MA 1G3UA 1S8FA 3TVDA 1M34E 1R2QA 3L82B 3HPQA 4TMTA 4MH0R 2YOFA 4BFXA 1TQ4A 1II9A 3OIUA 1DS6A 2Q9AA 2CLSA 1VMAA 4QL3A 4E22A 4V0OA 3W8RA 3SEAA 3QXHA 4D4MA 4NBSA 5HKKD 1F2UA 1COWD 1DAGA 3OHMA 5TDHA 4ZIRB 4GT1A 4B75A 2RMKA 4AYWA 3B9QA 1ZBDA 4WZAE 4CEHA 2PZGA 3BERA 3VR3A 1YRBA 1LW7A 3R8CA 2BMFA 1QHNA 1Z3IX 3KQHA 3B60A 1BKDR 1I4LD 3VKGA 1P60A 1KIMA 2P65A 3NDPA 4OYHA 5CB6A 3R9IA 2ZI4A 5CDFA 4Q03A 1FNNA 1FP6A 4DJTA 5CJPA 1A1VA 1DAKA 3W90A 1ZM7A 4L15A 4PTLA 3PIRA 1ANKA 3NHBA 1TX4B 1GWNA 2KB0A 4JL8A 2CCKA 5L3SA 2G9NA 1GAJA 3BH0A 2AHOA 1T8UA 1VCIA 3PCRB 2QEQA 4QNMA 1KNXA 1H8HA 3V00A 2YJTD 1RRFA 3IGFA 3IIMA 4DBLC 5JWRA 4JLAA 1HQCA 3ASYA 4BRWA 3TH5A 1L7VC 3NTUA 3QY0A 5DH9A 3C5HA 4URXR 3PUYA 3WHKA 4IEEA 4XH9B 4OQXA 1OHHA 1H8ED 2VHTA 1R5BA 4DDUA 1YZTA 2A78A 1EXMA 2X8AA 4AK9A 4PO1A 3BE4A 2GILA 2ZRDA 2IC5A 4IDHA 1AJEA 1PLKA 1KI6A 1R6BX 1GNPA 1E2DA 1XD8A 2OEPA 3KX2A 3RNLA 2XITA 4URVR 5IHPA 3U60B 2NZJA 2WBLC 3K9LA 4AWXA 4KSCA 1GUAA 4DSTA 2RGDA 3SYKA 2QMUA 2QSZA 2XX3A 4HAYA 4TLCA 5KU1A 1S3GA 2IA5A 1RE0A 3DKPA 3FMFA 4Q9LA 3LW7A 2WAYA 2IXGA 4JLOA 1TADA 2BWJA 3C8UA 3F5FA 5FPTA 2GXAA 3QVVA 1JBKA 3GFOA 3A1TA 2CEAA 4KLZA 4NCKA 2FZLA 4UXHA 3EW9A 4QGAA 4MKFA 4OI4A 3T1QA 3KB1A 4C30A 4V0MA 1YKSA 5FUXA 1JB1A 1MO3A 1A5TA 4CEJA 4MRRA 2GCOA 4M1WA 5TVKA 1YZKA 1DEKA 3U7HB 1FUUA 5BN4A 3SBDA 5DHAA 4DB4A 3PJRA 1YZGA 3CR7A 3D3QA 4JLJA 1ZUNB 5JWOA 1VYTA 3MJHA 3AVVA 1G64A 2D2FA 3R9XA 3PENA 1E9EA 3GLGE 2A5DA 4URWR 1SXJE 4P33A 3WP0A 4DRZA 1XJQA 4KBFA 4R2IA 2GAOA 5C2JB 1OSNA 3EASA 1NL3A 3G82C 4EJSB 1G7SA 3MFYA 5FTKA 1N3BA 4JLDA 2BJWA 2F7SA 3V4RA 4BLSA 3FB4A 1XD9A 5FBLB 2J9RA 3U3KA 5FPHA 1KK2A 2ZVQX 2DHRA 1NMZA 3BFKA 4C4PA 4HLDA 2BC9A 3VNUA 3G5UA 1KZGB 2GNOA 1Q44A 4M53A 1TF5A 2FWRA 3EG5A 2YWGA 4HUQA 4UJ5A 3BFXA 1OH7A 2KSQA 1LNZA 5B57C 4TSFD 2FH5B 3FKSD 4CEIA 5AUPB 4OK5A 3RSLA 2QTHA 5GJBA 1E9FA 2RGNC 4UNPA 4B35A 1IQPA 2RHMA 3WNCA 4ARZA 2FFQA 5HR5A 4WA7A 3UPUA 1EWQA 1K5DA 2R9VA 4NTZA 2VH5R 3W3ZB 4X8OA 2HCBA 3CWQA 3QI2A 1AS2A 2BMEA 3VHXA 1NVVR 3LBIA 2C78A 2ORIA 1G8YA 4IDNA 3EPLA 2DPXA 4JIMA 1DADA 4DUGD 2DY1A 2RCNA 4PX9A 3T5DA 1AZTA 1G18A 2YOHA 2QT1A 3R7WA 3B9PA 3GFTA 3ZQ6A 2IHYA 1UJ2A 1P6XA 5TY0A 4ILEA 1S9DA 5FBQB 2WWYA 1M8PA 2QMOA 3FDIA 5AWFC 3WRXC 4D80A 1G4UR 5AR1A 3A1SA 2A5YB 2IS6A 1TU3A 4C0LA 1FZQA 3FMPB 1CR1A 3ZZUA 4A0RA 3IIKA 4C0BA 2I3BA 4POAA 3A37A 2D74A 1BYUA 1KYIA 3BAFA 3T5GA 3Q3JB 4B2LA 4C2UA 5FOUA 2O8EA 121PA 3SYLA 2V4ZA 1ZNZA 2V3CC 1M7HA 2CE7A 1TQ2A 1VCOA 2IS2A 4TT3A 1GKYA 2J59A 2B21A 3NC1C 2ZU6A 3T61A 4PPFA 2BOVA 1YR6A 4EQ6B 2FJUA 5C46F 3QOFA 2TMKA 2VRWA 3GJ8A 1P9WA 1Z0FA 4LJ7A 1TF7A 1E2GA 3KXKA 4TTPA 2XXAB 1LF0A 3B1XA 4JSTA 3DMNA 1JR3A 2WJGA 1TMKA 4BFTA 2ZRLA 3GLGB 1OKKA 5DN6D 4IFEA 1SXJB 2OG2A 4LYHA
chains in the Genus database with same CATH superfamily
4ZQFA 1JR2A 2OL4A 5FYDA 1PP4A 3K6SA 3EVFA 2WJZB 1H6CA 2WWFA 2RAUA 3O21A 2W6PA 1Q1NA 2GZHA 1WW8A 1CQZA 2CFOA 1PZMA 2WIBA 3JD2A 4P98A 5EI5A 4AI6A 3ED5A 1QKIA 3WMWA 3SCZA 2YHUA 3PRYA 3TD2A 4BLPA 3ZLJA 3O8CA 4BKQA 1QOQB 1JXAA 2IZZA 2QUZA 2TMDA 3OMXA 3CB2A 3DULA 3JD1A 3GEEA 3PVSA 1RI4A 2OYSA 4MROA 5FPPA 4LDJA 3NEPX 5HILA 3TNFA 4P3KA 3QW4B 4CU2A 5ITSA 4M0PA 3ZGXA 1V1MA 1IM8A 3F3MA 4PANA 5FL7A 3T1VA 5FT9A 2Z6UA 1YFZA 1YRWA 1FEZA 1O3YA 1YJ5A 2ZSFA 3L7BA 1QYRA 2FVXA 4Q39A 2Z8YA 4NCIA 2GHQA 3KOZA 4N8DA 4IJUA 3L6BA 2PX0A 5EFOA 1FJ2A 4ZAGA 1UL1X 2ZRGA 4L50A 2IDJA 2QY9A 4JT2A 3WGTA 3L46A 3I6MA 5L3VA 4DMFA 3DHVA 3X1KA 1C9EA 2IYXA 1OB2A 1EXVA 1EXDA 3ICQB 2VC2B 2ZUVA 2B78A 3BRWD 1NVBA 3MG9A 1W1UA 4G2TA 1S02A 2D0PB 2BH2A 1KR2A 1PFQA 3ORRA 3JWGA 2NPFA 1EDZA 2F4NA 2ODWA 3BGWA 1DBSA 3CFYA 3QBTA 3ACDA 3L5KA 1RHRA 3ZJUA 2IPMA 2ZVDA 1T1RA 5HXAA 1KVUA 4YRGA 4JT9A 1EFAA 3CEMA 1GL3A 1JHZA 5DO9A 3KQWA 1M8JA 3JYHA 1GPAA 1PJRA 3VVLA 3SDBA 2JFWA 3VDXA 4BO2A 1ZVKA 1M2OB 3AVTA 1E77A 1WUKS 3AOEA 1CJCA 1GFWA 4IIDA 1ENOA 1C9JA 1Z83A 3DV2A 4L07A 5ERXA 3TL3A 3OQNA 4GKKB 1L5VA 1FRVA 5KC8A 1FS4A 2DHEA 4KPGA 2E9SA 4XRRA 1R0LA 5E6SB 2JKVA 4XLZA 4GQIA 4TLDA 4O3MA 2QZPA 2G9UA 2VNAA 5AI5A 2RHBA 4PO8A 3SJCA 4BYGA 3JD3A 2PZEA 1MTOA 1Q50A 2C84A 2OPBA 2Y67A 4MAAA 2DERA 4FSDA 3UMJA 2P2YA 4NMHA 1H8EA 1LNQA 2GSWA 3MT8A 1Z4MA 2F9FA 2AUTA 4BB0A 4REOA 3O8NA 4Q4HA 1Q0RA 5DT9A 3R3SA 1ZJ5A 2JFPA 3TCXB 2A9KA 3C6XA 1HT2E 1EVIA 5IJ0B 3W6PA 1NXQA 5CDHA 5FWXB 3I8SA 4DNPA 3QYFA 1EE1A 3VVCA 4FYKA 5TC4A 3HWSA 1Z0KA 1WCIB 3PWZA 3FETA 3FFWA 1KSFX 1HE2A 1FX0B 2FPGA 2UXCB 4HDMB 3IP5A 1QP8A 3G5MA 4RX1A 1X9GA 1E6MA 5AYVA 1KWKA 4R54A 5E9WA 1N7IA 2E6UX 5DYGA 3H5AA 4WCDA 1G8GA 1HRKA 3X43A 3B6IA 4ZAYA 5HOQA 2DB3A 3RM3A 1F20A 4BNIA 2SBTA 3M5PA 1UC4B 3D7NA 3EVTA 3NNNA 1L5NA 2XUDA 3S4YA 4JJEA 4M0CA 4S0XA 2IUEA 4U6QA 5I01A 3ZE6A 1EAYA 1Y3AA 2QX6A 3JASB 1BXRA 2V4MA 3VR5H 1VXOA 3OWXA 2CWWA 3MBIA 3ZHZA 3VA7A 2OV1A 1B14A 3KVYA 1OBCA 2ZT6A 3AEUB 4RA9B 2JD1A 2XWBF 5A9TA 5BNZA 1FMCA 5BSWA 1Y8CA 5K6AC 3KR9A 1Z2EA 3OCCA 3V6LA 2GJAA 4BNWA 4CUKA 5DNCA 4HLQB 4C04A 1JQKA 2Q5QA 1XZEA 2BFMA 5EJEA 5CCEA 2IV7A 2DH6A 1N5IA 1AO0A 3C45A 3KQKA 2HPVA 4I66A 3URKA 3I72A 3TFOA 3Q88A 4JUIA 4DMRA 2XGJA 3AFGA 1W5FA 1HT3A 1V1JA 2BGRA 2P8JA 1ZW6A 4V24A 1Y1TA 4NE7A 1BVRA 2GOYA 4CCSA 1CZNA 1M6WA 3KJFA 1GCOA 4L9WA 3PC3A 5I7OA 1YI1A 2L0XA 3WK6A 1QHSA 2EKBA 1NJ5A 4UEQA 3BRCA 4P5EA 5LYJB 4EKGA 2PJZA 1WVMA 2DCMA 1KP9A 1QLWA 3L6DA 4QQNA 4KOEC 3T5CA 3GU3A 3ZVLA 2ZREA 1NATA 1FUYB 1DKRA 2HMYB 3FSEA 1ZPDA 3KZNA 4JL5A 1V6CA 4E31A 2P91A 4MS1B 1YR1A 5KWEA 1CJVC 2QQGA 3HBNA 3GJ5A 1P2BA 3HFGA 3TQFA 4GPAA 2SKDA 4AZ3A 2PKQP 5K20A 2PMKA 1ILWA 3KR0A 5T5QA 2FWNA 3PKIA 1FSFA 2OKCA 2FQXA 3DEYX 3KQOA 2DE0X 3KHKA 3H5VA 4RD0A 4W5JA 5BUCA 2OP0A 4AY6A 2JLVA 1EWVA 2FFRA 2B35A 1IBCA 1MJFA 5DMXA 5A2GA 1P3DA 1OI3A 3FOZA 1F6BA 3EEIA 5UKDA 2QRZA 4Z4EA 1O97C 5CVTA 3OT1B 5IRCD 3L84A 5LMZA 4LHVA 3I53A 4IFTA 3I3SR 2FOXA 4LVOA 2B2NA 3KHTA 3OX4A 2IYSA 2Q3BA 2R8BA 4PS0A 1MB4A 5HQJA 1JEYB 1ZKMA 3TW8B 4I1RA 3SFZA 1N5OX 2H2HA 2HRCA 3CKLA 1JDZA 1Z6AA 1J0XO 5LMNB 1AQ6A 5D6OA 1P1FA 2XY4A 3SZGA 1N2CB 2TMGA 1GKIA 2PLRA 5BSFA 4QARA 1ULBA 2IZ7A 5DK6A 4IIXA 3K4HA 4LHYA 2DR3A 4UHCA 2WKPA 3RUAA 4L27A 2GAIA 1WB9A 2YCBA 1K7XB 1EMDA 1IXYA 4E0BA 3HVIA 2R2AA 3VPSA 2BFFA 3U3OA 2RGNA 2FOIA 3BMQA 1GZ3A 4DIFA 1ZGZA 2NUPA 2RG1A 3I2YX 1J2RA 4U7PB 4MGKR 2KYRA 3OAAD 3ZWNA 4DLBA 3KTAA 3PWSA 5LKRA 5HKBA 1UH5A 1MX3A 2OZLB 4EJ2A 4P3XA 4G37A 2NUAB 2MSEB 1B0PA 3G6KA 2JJQA 1ENZA 2OCAA 1JDBC 2W93A 3FPFA 1M8FA 1Z6GA 4EHNA 4R0MA 8ADHA 5LIPA 1T4DA 3DBHB 3OETA 4WL0A 1M67A 3DYBA 1BE0A 5JI2E 4EF4A 2BM1A 2QN9A 5BYAA 4AKTA 1XI2A 2NT3A 4JBXA 4X7RA 1Y7PA 2UYYA 4DJJA 5JNSA 3O82A 2ZS8A 1E6UA 5K0ZA 1IEWA 1Q57A 2HF8A 2QTMA 1VPLA 6YASA 3BBLA 4F3CA 3EMDA 4E5UA 4IZHA 3RVSA 4M0MA 1ZSYA 1F38A 2H57A 3E18A 3S1AB 1TM3E 3JAWA 2LKDA 4JWKA 4EA9A 3RKSA 4L5BA 1Z4OA 2DFLA 2IHJA 3NJ8A 3SFVA 3NB0A 3IAAA 4KMRA 3AY0A 2WIAA 3KEOA 4F6RA 5CFZA 2CUKA 1GQOA 3N70A 1T5TA 4CYMA 4FINA 4LJ6A 3U19A 5AKEA 2W6ID 4N76A 3LQKA 1TM4E 1O6BA 1MW9X 4ANFA 4MA5A 2WHEA 1VSTA 3I37X 5ARDA 3HXMA 3DMTC 3K05A 4HVCA 1T8RA 1SUFA 2C4MA 5HRCA 1GVNB 4UVEA 2VVTA 4WZBA 5ECYA 4C5CA 3A4YA 1RHJA 1LUAA 3KT6A 3BEOA 3FOAA 3QVSA 1EVEA 1LJLA 1RMTA 1A7UA 1JNXX 1G8FA 2PK3A 2RONA 4F7DA 3RH0A 2ZJ3A 5AKXA 3DDZX 5G0TA 2H59A 1Z39A 6NULA 2GM9A 2Q4TA 4ND8B 1IIBA 2FA9A 3R7DA 2PUHA 4GGPA 2VH2A 3CR3C 2XMBA 3IA2A 4JDPA 1CY4A 3KKZA 1ISSA 2QVXX 1JLRA 1O5TA 1UMDB 1X14A 5JT1A 2GO7A 3K9CA 2O52A 3N7AA 4ESEA 3WGYA 2EFYA 4E4YA 3UYLA 1S7CA 5KNDH 1MN6A 1N0IA 2H2IA 3OZDA 3T1YB 4W5NA 4B32A 2I22A 2EW8A 2GRJA 2VH1A 2ZOSA 1I1NA 3MCTA 3S5JA 2PIDA 3EVZA 3P71T 5JYCA 2B83A 3L0SA 3DEHA 2ZJFA 4EPXA 3T6KA 1AQUA 2MU1A 4U2FA 4MV1A 4E5VA 4DSUA 1V8FA 2VWGA 2C57A 4ND3A 1Z75A 4QOSA 1NW9B 3O2SB 4RD4A 5THKA 1SXQA 1A9XB 3N2GA 2PSDA 4MS4B 3F6EX 5ENVA 3DMYA 5LJLA 2R0QC 1DO0A 3DT9A 4FYWA 4PYQA 3OU2A 1GKLA 1U9YA 3BWCA 1FMTA 4KRYA 4Y0NA 4YI5A 1XTIA 3C4QA 3CLUC 3AUSA 1QR2A 3K0CC 5CM8B 3ZR4B 2K7FA 3NOVA 4BMPB 2Y1FA 1L5HA 4Q3DA 1ODJA 4C76A 2HA2A 1NZDA 3DQPA 2OC9A 1YR7A 3ZDEA 4DR3B 1GAEO 4C2AA 3ZUPA 4BNFA 1Y9DA 3P9SA 2VTDA 3K0HA 1K89A 2MYNA 3SS9X 3NTOA 1XRJA 2RBGA 4P3NA 2QRVB 1BWQA 1TPYA 3JQAA 1YTUA 4GOND 5CLFA 3D7KA 3WQRA 1XZ8A 5KO2A 2IZOA 4BN5A 4MYCA 1F8GA 4BX9A 4R3NA 2HHCA 4MVJP 3Q2KA 1G2QA 1PV1A 1XDWA 3R6TA 3PEUA 2ORED 1UBFA 3AVUA 1TCCA 3DBRB 1E3LA 3ZWPA 2JK0A 3QJGA 3JTEA 3QKSA 4TXHA 3BBPA 4D9GA 2HXSA 3HR8A 3IPRA 1ZM9A 5BQFA 1U3TA 2IEGA 1E99A 3I52A 1ECGA 1HFWA 2A9JA 2QZ4A 1UXJA 5JXHA 1NDQA 5GZ3A 2JHGA 4M9XA 1Z34A 4N3BA 5C7LO 4G24A 4HX9A 3X2FA 3N2ZB 5FWYA 1QRSA 4RCVA 1DO2A 1HLPA 4UMVA 2X5NA 3DPIA 3WIVA 1KI3A 3UV7A 1RXUA 3PITA 5G0VA 4RV4A 4ZJUA 1GZHB 1QYWA 1D2AA 1Z2PX 2VQFB 5FPQA 3ACBA 1S2IA 3LVBA 4QGFA 4BCBA 1Z47A 1IM2A 3OZSA 3R5JA 4S2EA 3X1YA 1J1ZA 2Z2YA 4GFDA 5EVJA 3ZV4A 4WFKA 2FWPA 1VFNA 4NRDA 3JQ8B 3O8BA 2Z4RA 4MKHA 1VP9A 1XD2A 1ZO8A 2FXIA 2ZI9A 3D1JA 4YJ3F 2APJA 1KOLA 2A7QA 5CT9A 1GUZA 4FHCA 1X7ZA 4W5WA 5BRNA 4X64B 2VSNA 1PFGA 1SWVA 1J7JA 4D02A 3EJ6A 1VG8A 4YMHA 3RSSA 2FUCA 3IOMA 2ZIXB 3GVXA 4D56A 1ZC4A 1DC3A 2AD1A 1ABFA 2GF9A 3AI3A 3JS5A 5HFJA 3E9EA 1SCJA 3LWNA 2W2TA 1OI2A 2VJPA 5DNVA 4RTQA 1IOWA 1PX0A 3EQ2A 3KDSE 4UBJA 5I7WA 1OBHA 2ECOA 2HFKA 2Y77A 1VDZA 3LVQE 3VNSA 4IHKA 3BEDA 5TX7A 2N1MA 2NTNA 4FDVA 5IT5A 2DPMA 5COAA 1MDFA 2AFHA 3TDMA 4RLQA 2VHVA 3QJ5A 3NI2A 2WKQA 2PKEA 4MQLA 3K1ZA 3DLBA 1NX9A 1G21A 2E82A 2EP8A 3L1HA 1L7AA 5AH0A 2V7EA 1UK9A 4LDNA 3WSVA 1PG0A 5C4GB 2FN8A 4RVNA 4HVLA 3R3VA 1I24A 5IT9A 1HKHA 1VE7A 2JKZA 3G2LA 1SCUB 4NQRA 5AVZA 5JZVA 5FL3A 4IRMA 5SY4A 4M54A 1PS9A 5C8DA 1RQPA 3EBOA 3NBZC 3P0JA 3L4BC 3VTKA 1M8KA 2JLRA 1PX2A 5DI3A 2I3DA 4MAFA 3U4QB 1OXBB 1ZHFA 1M6EX 1U11A 1ZD8A 4JI0B 4DXHA 3SHWA 2ZRCA 4S1WA 2GERA 2BFEB 1ZI6A 4LGYA 3VDRA 3VMMA 3U44B 4MITA 4LUCA 4TQ9A 4BFVA 4D9EA 4KODA 3AJ8A 3OH8A 4LQCA 1R6UA 3GNLA 5J47A 5HQTA 1O95A 2IODA 3E5MA 3NHLA 3LGXA 4QBIA 1AU9A 3UGQA 4D4JA 4D9HA 1JDBB 1GCGA 4L73A 5AM2A 1F3LA 3VSBA 1WMDA 4OHMA 4TV8B 2F3TA 4UBKA 4ZEOA 3SEFA 1R7RA 5FUMA 5KIAA 1SHUX 2DZDA 2RI1A 1AGXA 3EZ9A 3RSFA 4ZIRA 3MT0A 5DLDA 1MFZA 4CCAA 4TL7A 2BR5A 2HSWA 2I33A 3P4UA 4HN2A 1NC1A 2P9QA 3DMPA 1AS0A 3H5NA 3X2EA 1I2ZA 4A0FA 2GDJA 2V96A 4ZICA 1E3MA 4Y9UA 1Q74A 2B8TA 3DW1X 3NASA 5NULA 1PYDA 4P0PB 2FPWA 3FYUC 4RTKA 3JZAA 3W5DA 4MHSA 3DTTA 2I3ZA 4G0PA 4GDMA 5JS2A 1W46A 4FQ8A 2V7BA 2NIPA 4KFTA 3ELWA 2UVPB 1FYXA 5KAPA 4Q4AB 5LP6A 2OHIA 3FOEC 3DOIA 1PGOA 4UCXA 3WY9A 3QFTA 4OB8A 4MVJA 3WL6A 4CKEA 5HUHA 1S96A 4C0XA 1DMRA 3EGDA 3QVGB 2QRKA 1PR2A 13PKA 3IAHA 5I4IA 2RH9B 2AKYA 2YYZA 5CVUA 3QW2A 4JJKA 1VBKA 1EAMA 4BDTA 3WG9A 4KQKA 4LECA 2XDQA 1XVLA 2CXNA 1WVIA 2ZBVA 4X3OA 5ALJA 5EUBA 5JE8A 1JUDA 3KWLA 3MWKA 4MEJA 1GZ7A 3ZE8A 5AXDA 3GBVA 2D7CA 1WTAA 2ATCA 3NQ41 1IQ0A 2CHUA 2ZT5A 2R1VA 2DPGA 4WINA 3WJAA 2ZWIA 4MQBA 4B3IA 5FV4A 5E7IA 3VHRA 1T3ZA 1E1NA 1INLA 2GN9A 2MIIA 1YQXA 3LS2A 1W0JD 4KK3A 3CKYA 3K8YA 2QLTA 1P5JA 4N6NA 4X8HA 4Z2YA 3RIMA 2XDYA 4BFZA 1YC2A 2H1CA 1C7EA 4ZMSA 4I8IA 3RIXA 1XRSB 2V9CA 4EL0A 5KTKA 3L02A 1X42A 2BMVA 3A58B 3GA7A 1DZ3A 3CX8A 1R0BA 4HBZA 2JGFA 2A88A 1IMOA 3BXGA 4RJTA 1IVSA 1V9LA 4JQSA 4ONEA 1U02A 4PSCA 3TZBA 2QGNA 3MNFA 3AVYA 3L9XA 4PPQA 2LUOA 4X3CA 1TO6A 2REBA 2BJVA 3A6GA 3T3GA 2IF2A 2L2QA 2EYQA 2C9YA 4RY9A 2AK3A 4AF8A 2IT1A 3GJRA 1I7DA 1A5BB 2ZIZA 3RVPA 2ZJ5A 3KKMA 1WOMA 1BMTA 3LCRA 3SQNA 3TSZA 3ZLUA 3G0HA 3K15A 1KQOA 3PJDA 4MWZA 2WJYA 4QEDA 4XGRA 4D82A 3TG8A 4B87A 1JECA 4C3VA 1LRKA 4OHRA 1Q0ZA 1V35A 2ZWMA 2KBFA 3FUWA 3ND6A 4NL4H 5EWLB 5EZYA 5IBRA 4I9UA 1TKBA 1IFXA 4JY7A 2JH9A 3E23A 1JWBB 2PT7A 4MW1A 4QJ5A 2FFAA 5JVDB 1XJ5A 2IUFA 5B5SA 1GGHA 2D2EA 3GEPA 3NBQA 2F3RA 1QIIA 2ZG6A 1RRKA 4KITB 1IY9A 2CMHA 2UUCB 1Z0DA 3MCAA 3WKCA 2GRAA 5HBGA 1X0XA 1RM3A 4DEXA 1BE8A 3FA2A 3IPLA 2QLMA 1HQYE 3DWGA 1GGKA 1VE5A 3WRYC 5FFFA 3WZMA 5JLAA 4WZAA 3DVQX 1Q17A 5K8VA 4QFDA 2GTIA 2O4UX 2YXBA 2DTDA 3IT1A 3PUKA 3G2HA 2ECKA 2NXCA 2RCYA 1AQYA 2CK3D 2W6MA 3FYHA 3KSMA 2QZSA 4IV5A 2QTRA 4JJ7A 4K7JA 4ZAXA 3TQRA 3A6LA 1Z13A 3NC4A 4RABA 2I4TA 3F98A 3PE4A 4ZJYA 5CA0F 5FQOA 1FUEA 2JJ2D 4CQJA 2UYCA 1ZGJA 2A2ZA 1TFUA 4LRXA 4MIOA 5AICA 2FX3A 6ADHA 2C4TA 1T3TA 1AKVA 2VO1A 1UKBA 2PGOA 2ODQA 3MCVA 3NYRA 2QXUA 4MVXA 1MABA 4AO7A 1C3LA 3JQGB 5SV2A 4B7UA 3NW9A 2F4VB 4JEUA 2COKA 1ST2A 5E3HA 4ZVPA 3S0JA 1J21A 4BLOA 4ZZ3A 2P75A 2QRNA 1F8XA 3L6EA 3IEUA 4TUYA 5L3RA 4F4JA 4Q1VA 4BLRA 3JYPA 2O2DA 2CVFA 4GX1A 1IG0A 2EBFX 3ZZ1A 5BSKA 4EFMA 4DV4B 4RV9A 1QKKA 3CEHA 4WKBA 1QQ7A 3B3FA 3BUSA 1Z0JA 1VB5A 1FFDA 2IXFA 1UMKA 3GEDA 3P9IA 4HMPA 2F62A 2NU6A 3N5KA 1ZCAA 1XDZA 4IY1A 4KXVA 1TTTA 2F48A 3MFQA 3ACCA 1VTKA 5JJLA 1SULA 3O4VA 1L8OA 2GBLC 2J6HA 3F7OA 3BDVA 1ECBA 1RKBA 5EL0A 2BKUA 5FOVA 3ZE0B 5BVHB 2VHQA 1KOGA 1UWCA 4XX0A 2AGVA 2FZVA 1KDRA 4LZLA 4YUWA 3QLJA 1P1KA 3I0NA 2MINB 3MGGA 3QBJA 2FR8A 5CLQA 4BJ5A 2QI9C 3FRJA 2C0PA 2R6FA 3KOWA 4LOIA 2FMXA 2GT1A 3LCMA 4NS1A 4FD2A 3A27A 4C4ZA 1AUXA 4J0GA 4CMAA 4R71A 2OCDA 2JI8A 1U7DA 4XB1A 5MN6A 2CFSA 4MIEA 4LSGA 1B6GA 3AF1A 3R23A 2HMTA 3V4PB 4OKNA 2ZDHA 1X80A 4YO7A 2Z8YM 4OTZA 2WJAA 4X1IA 4JS0A 1HETA 2D00A 1K08A 5DBOA 1WTCA 4A1OA 1O5IA 1WSWA 2Y2UA 3R76A 2D4AA 4MYRA 3WNQA 5ITZA 2I1VB 5DHFA 5AW1A 1IK4A 2A3RA 3AR4A 2J48A 1IWBB 1OI7A 4M0EA 1JA1A 4WV3A 3EMBA 3STYA 1PLLA 3HJTA 3TLGB 5A3JA 2EBUA 2GPYA 3BCUA 2TYSB 1ID8A 4LOJA 2QW8A 2GYVA 1SO8A 2V65A 4OXKA 5FOXA 4HYTA 4P38A 3MOIA 4KQ1A 2RHJA 1V0JA 4FDMA 3VOBA 2CJWB 2PGXA 4V1CI 2K2QB 5LNK6 1T9BA 3AP2A 4PSKA 3ZU4A 1V7PC 2EKDA 5IJXA 3BTSA 3OY2A 4MCAA 2HSJA 4ERNA 2V0GA 3KB2A 3I32A 4NZ9A 3QLUA 1VIAA 1KNQA 1NIJA 2RAFA 1G291 1SXJA 2E55A 2I80A 3GZJA 4MB0A 3NBAA 4WBNF 1N6HA 1U2TA 4TTAA 4JR1A 2PUWA 3GF4A 3R5KA 1C4OA 1X7XB 2I7DA 1NFRA 1K7CA 4TMWA 4XFKA 1ORRA 1QHIA 4MW9A 4XUCA 3EZNA 2CC2A 3BFPA 2AX3A 2HA4A 1JJFA 3OIVA 3OIYA 3UWKA 4YYEA 1K97A 1ZXBA 2XUPA 3GLGB 3RB8A 4ENSA 1J7KA 3Q5EA 4MYDA 3HY3A 1PS8A 1DMSA 2DP4E 3UJHA 4D8UA 4ZK2A 2WP8J 5ADHA 1MC5A 3WGQA 1DT5A 5KAMA 2DMRA 1KRHA 2KLHA 3ODPA 3SK0A 4HH1A 4DABA 5IWCA 3LXMA 1DAFA 5SYAA 4AZWA 2AQHA 2IDZA 1HA3A 4BFYA 4M60A 3R4CA 3ZBQA 1BCRB 5DBIA 3ECSA 4E32A 1YACA 1XNQB 1G55A 3DM5A 1GG9A 3PTZA 4X6LA 1NAIA 5JZ9A 3O6VA 1OWMA 1XDGA 3HCNA 3LAWA 3EYWA 3JVDA 5CIQA 2CHGA 5B3JC 5BOSA 3HBAA 1IQRA 4RD6A 2OQRA 1LLUA 3QFRA 3RVJA 4CIAA 3UAWA 3EPJA 1QB7A 1TQDA 2XWSA 4LCEA 1E2BA 4X71A 1C30A 3K0EA 3S40A 4A8JC 4G0MA 5K0NA 1FYFA 2CUNA 2PLAA 1X1EA 1DBWA 1Z6XA 3KJXA 4ASUD 5AW6A 5KVSA 3K71B 2LE0A 2C97A 5IABA 2HRQA 4C7OB 4BKPA 1X1SA 2A6PA 4O3FA 1X7YB 3TYXA 4C6SA 2CBZA 3OFNA 2JIQA 5BR4A 1ESCA 3H5WA 3W04A 3MTIA 1SWWA 3OQHA 1NE7A 2CNLA 3GV0A 4RK7A 1CF4A 3IS3A 1B43A 2O0HA 4ENVA 1KPGA 2AL7A 3SF8A 1Y1RA 5BUZA 2R1TB 2YHAA 4QUIA 1UBHS 2ORYA 1EG7A 3B5JA 1JEEA 1XLTC 3JZDA 4QECA 5F77A 3WK5A 3ZGVA 2AYZA 3UK6A 3THYA 2EARA 1HTBA 4PFSA 4Z8XA 3AG6A 3PYXA 4GWGA 2J3EA 1Y3BE 1FDWA 1K66A 4PYIA 4DDMA 1TZJA 1TCBA 1BDBA 1PZHA 4ZQIA 4EP1A 3B6EA 2VCHA 3RAEC 4NMXB 1HT1E 3CSUA 3OIWA 1P4RA 4K86A 3AX6A 3F9RA 3R3WA 3VBCA 4F84A 4BVJA 1AUQA 3C3PA 3M1LA 4UUMA 2FF7A 4CG0A 1XL0A 4F6CA 5BW8A 4UTVA 3HKCA 3B1JA 1HE8B 5AW7A 4JELA 5KSYA 3DUFB 2I91A 1P91A 1I33A 3SLKA 2JJ1A 3NUGA 3CF0A 1WDTA 1VYHA 1ZSVA 1NRIA 2ADMA 1PEYA 1E5LA 1TUIA 3GOQA 5IMBA 2GZMA 2R5NA 5EESA 5LA6B 3WWCA 2AS0A 1NVFA 1T2CA 2G77B 1C0KA 2CXPA 1JN0A 2ARKA 1XCLA 2FEKA 5AOBA 2XT6A 2O54A 1O0CA 1C1DA 4J94A 1GGVA 2D1YA 5TE9A 1G3IA 4MVJG 3ZQUA 3ZV3A 1PL7A 3VJLA 2W2VA 3BORA 3FWYA 4G0OA 2PJRA 4DR7B 1QHEA 3HNRA 3ND8A 3QX9A 1Z16A 4YMUA 3DLTA 5EUMA 4CIYA 1T35A 1IXZA 3DHYA 1U8AA 2PRJA 1IK6A 1K8RA 3PZBA 3V4VB 5I9IA 3LVFO 1JSZA 2GTPA 5L6MB 4XJTA 3G8CA 2VNJA 2RHRA 4E11A 4PN3A 4DKXA 2PWZA 3P27A 5LQNA 1D4AA 1KFBB 2OR3A 2W43A 3LK7A 5EKUA 3QBEA 2JLWA 3UA3A 5E95A 1H6AA 3BMCB 3RUHA 4B17A 4H1UA 4BVLA 1NJ6A 2F43B 2GDZA 3D02A 5BSUA 3GCWA 1QH8A 3DNFA 3D8BA 1Z5NA 2PH1A 3EHEA 3K35A 5DWVA 4F1KA 4Q9AA 5CA1A 4PYMA 2QZ9A 4U8HA 4AKIA 1DIGA 1SKMA 2FYTA 4Y2VA 4CF6A 1UAAA 3CKMA 4HTAA 2P69A 1JA9A 2VK2A 3AHIA 3IKTA 5KTNA 2DUWA 3D8UA 1U2DA 1JSRA 1E66A 4Y6QA 4N39A 3RS9A 1DBVO 5DFAA 3ZY2A 1QBGA 4C0AC 4FGLA 2FZKA 1YE3A 2VAXA 4M7WA 1PL0A 4B71A 2IHVA 2FLKA 4U2BA 4NU5A 1GOTA 4JFAA 4DF3A 2V6FA 3FTPA 3MB5A 1GRRA 4PCVA 2VPTA 1HFEL 5CVVA 3VR4A 2Q3MA 2WTMA 3KV1A 3VR6A 2GWHA 3WLQA 2RHOA 4IDOA 3UAGA 2JHPA 4MPRA 4TMZA 2C88A 1VFPA 4IDQA 3LWBA 5B1EA 3VKWA 3OTWA 4QDOA 3MJTA 3GLHB 3PK0A 4RLFA 5E6UB 2FSHA 5DJ5A 2MMGA 3RPEA 5BT8A 3AIIA 1GDHA 4TVOA 4D98A 2D5AA 3WBBA 2WMDA 1IAVA 5EIEA 1F4PA 1G3MA 1VGRA 2VHCA 3ESZA 1RYFA 4YMSA 4B3JA 3FUCA 3P94A 4J2HA 2FX5A 3VYTB 3VZQA 3E15A 1QP0A 1DWPA 1Q7TA 5CIWA 2OSVA 3DLCA 2I3AA 4MTLA 5G4KA 4EZBA 4CXMA 2DWCA 3TLMA 4OKSA 1M66A 2CZQA 1JAIA 4MVCA 5FLEX 3V1UA 2Y1OA 3WL3A 1A4RA 2EKQA 3HP4A 3MXTA 4J4TA 3TLZA 4F4IA 1HXHA 2P5TB 2W2XA 1XLUA 3G8BA 4HDKB 4P7GA 4AWBA 4DHEA 2DFTA 3OTOB 3LT5A 2XE8A 1CNEA 2PKCA 2XB9A 4ZO4A 5EUCA 5K8LA 1A82A 1VPTA 2X40A 4X7BA 2Q3HA 1HUQA 4EEZA 4X1OA 4D8XA 3HDJA 1KQ3A 4Y6LA 4HSGA 3FF4A 5DLPA 3GR6A 3HCFA 1C4WA 2IF0A 2ZITA 1LSSA 2GCGA 2Z2IA 3PR1A 2KI5A 2VJQA 2NU9A 3ETGA 4AWAA 3B8EA 1UQTA 1NIPA 1U8YA 2CNNA 2J67A 2ZRIA 5FOQA 4YVFA 1E7WA 5I9NA 1NN1A 2EBHX 2VDPB 3KZXA 1E2FA 4J29A 5AK0A 2QD5A 3TNLA 3TLCA 2RFLA 5AM1A 1I1QB 1A5AB 1E9AA 1N0HA 3EFOA 3PGMA 4Y2RA 3VI3B 4RCZA 1DDOA 5F78A 1ZOLA 3TX6A 4BQRA 5JSQA 4AKSA 2QG6A 2V8BA 3OJ0A 4NBNA 3BWEA 1QP7A 1Z26A 2YZNA 3QE2A 2XLCA 4RM2A 5THQA 3VO8A 4A2WA 5IVKA 1DLJA 1TT5A 2OZKA 1DC7A 3QWIA 4G1VA 1L5YA 3UMMA 2C29D 4D3FA 3EA0A 1CCWA 2ZPUA 1YQGA 3RVKA 2CDNA 2IIPA 2YS6A 4P7KA 1BXGA 1W4RA 1XDSA 1Y8RA 2WM2A 3WYCA 1ML3A 3WKAA 4C14A 4JVSB 4IP0A 4PVDA 3MHPA 3B1FA 4DV1B 3B13B 2WILA 2ZAOA 2KPOA 4OJMX 5I7UA 2KW5A 2FTKE 5AFSA 2PKXA 1F4VA 4YAGA 4NPAA 2HFJA 5FO0A 2JFFA 3HUUA 3T1OA 1KMIY 3W77A 3OTGA 3ZK9A 3T95A 5EE5B 3WAGA 1M9NA 3L3BA 3KSRA 4EY6A 4WERA 3BE5A 5ADWA 1AUOA 1VJ1A 2YS7A 4Y3UA 3HB4X 1NN5A 2FN9A 2WHPB 3MQ2A 4XD7D 4H7DA 5JOQA 3KZVA 5IYZB 2PRSA 4J0EA 2HT6A 2WTBA 4KPFC 3K0FA 3SN6A 2CDBA 2X0KA 4HXEB 3ER8A 5HG0A 3GPDG 2UYOA 3B1KA 2GJKA 4FGWA 2PEZA 4QUKA 1TKCA 2YQZA 2XB4A 3IV6A 2I34A 4CV0A 2HJGA 3QSYA 2FUKA 4YLGA 3TXXA 1OT3A 1L8QA 4GOXA 4LQLA 3E7DA 2PAAA 2EX1A 2RJNA 3DJFA 5AKJA 4RNDB 3MN1A 1J8FA 4P3PA 4HB0A 3DFIA 4WXPA 2VCEA 5ALXA 4QIHA 1HE1C 1JQEA 4RZQA 5EP1A 1QFJA 3AF3A 3RU3A 3HBJA 5DBEX 3MEQA 1M3SA 2JIOA 4WOBA 1M2KA 3RTAA 4ZTBA 5GONA 1JKMA 1OLUB 2HJ9A 1S01A 4L9RA 1U8EA 4G5SA 1V11A 3HEMA 1PS0A 1R1DA 3KKOA 3IULA 4L78A 3NDBB 3ZD7A 5AOVA 1UQRA 6REQB 4X93A 4KE9A 4LIPD 1K75A 1T9DA 3R6LA 4I9HA 4ZC1A 2LP4Y 4QG3A 2G36A 5AVXA 3GXOA 4YMWA 1YR8A 3NAGA 4LE0A 4MGEA 1F2VA 4GPD1 1IUKA 3AETB 4RH3A 2YIDA 3WFJA 3WIUA 3CA8A 4C29A 3IT2A 3DM9B 2G1PA 3WDMA 4ZMBA 2JAOA 3IAEA 2QX9A 1XBTA 2OPHA 1X86B 3BXPA 4WASA 3G9TA 4YGXB 5B6IA 3LI2A 1A9RA 4EW6A 3OEEA 1JNYA 4GEGA 3U1BA 1QTIA 3PXCX 4RV5A 3EULA 1CUUA 2QR2A 1E2HA 3AWDA 1U3DA 3EXHA 4ZARA 4OUDB 3QFCA 5IH3A 1WXQA 5BSTA 1CE8A 4I4NA 3TR0A 3UBTA 4KQIA 3C6YA 1MXHA 2QSJA 4PNHA 5TVGA 3IKMB 3LDFA 5CG1A 5LYJF 5JS8A 4DC1A 4DXDA 4NXNB 2M98A 1SQSA 3VOTA 1QFSA 4XFDA 3VO1A 4CKWB 4WLNA 3LRPA 3UK2A 4OMFG 2VPPA 3KL2A 1NQVA 3RS5A 4AKGA 1R74A 1I2AA 1KHTA 1VA4A 3KYJB 5DGTA 5DLYA 3RRZA 2VDWB 4C7KA 5B36A 2PD4A 3P5BA 1RT9A 1CUXA 2RGBA 4PRZA 5HJEA 2YW9A 4FLEA 3TFWA 2PH3A 1SC4A 1RJDA 3HM9A 1T9CA 3IOBA 4MVJH 4O1HA 3VAAA 2F3PA 5BYJA 3RAGA 1BS1A 1CZRA 2IHZA 2WOJA 3A1WA 3IV7A 1SC6A 4HAOA 1ZISA 4LWPA 2JFOA 2VHUA 5E7QA 1VJ0A 2A5FA 1R16A 1J49A 4JXKA 3D54D 1D2RA 2WV7A 4GQBA 2M1XA 3F78A 4MX8A 3A2NA 4ZOQI 5IWAB 1F7VA 3FDXA 1UBMS 3QQ5A 4ROTA 5J4HA 2QQ5A 4RZUA 4UHDA 2OHHA 2IYLD 1ZDMA 2JGMA 3NPMA 1AVTA 4TTTS 4OSEA 1F5NA 2SNIE 1G42A 2JCXA 3BK2A 3U7RA 1IOLA 3P1JA 3EPKA 4GR5A 3LQRA 4F2PA 1KY5A 1YZLA 2PO7A 2R7MA 1K06A 3O03A 4C4XA 2CMKA 3P0RA 4CM8A 2JL1A 2XMSA 3FMOB 1LDGA 3TR6A 3UB2A 4MSUA 3COYA 4IM7A 4JUDX 4YJHA 4KVGA 5HDQA 3CX6A 1ZH4A 4ZQCB 4KQEA 3KR1A 3MRSA 1DAPA 4H0FA 3L7LA 2BR4A 4TS4A 4YWHA 1O8CA 4CQMB 2R7AA 2Z5LA 4FNMA 4MWOA 4CLEA 2BKEA 1NR7A 3RABA 2P6UA 3WDSA 1RCUA 2BW0A 2FSGA 2QX4A 2F1KA 1JQJC 3AERA 2GBPA 3C3JA 5CT8A 3EIHA 1RADA 3EMKA 4RIEA 3FZGA 5J4YA 1Z4QA 2IYNA 1A8PA 2XF2A 3IQIX 4G1UC 4HS4A 1A9ZA 5E1OA 9GPBA 1YR2A 3RHSA 1DG9A 4JQCA 4R5MA 1UM9B 3THOA 1X2EA 3KHSA 2W6JD 1YVRA 3RS3A 1SOMA 1ZIYA 2BGMA 3OG9A 1XZBA 3UOAB 2Z4TA 4DUPA 3A9TA 5KOIA 4AX8A 1XCOA 4J6FA 4EUFA 2QD3A 2I1WA 4Q02A 1EINA 4EKEA 4Q16A 4EW2A 1SUPA 1UBKS 1EUQA 4UTNA 4CEJB 2QTZA 2X8LA 3R5XA 1D5WA 2GBCA 1GTSA 1X6VA 3I4CA 1GHTA 3WK8A 1PJSA 4MUFA 3TB4A 1F9EA 1U1DA 1KOFA 2BMJA 4AS1A 3I9KA 5H3CA 1WP9A 4FZVA 1Y63A 1EFRD 3PUJA 4K2HA 4A2QA 2AWOA 4IZIA 4HWOA 4MQUA 4UZSA 5TQ2A 3T7IA 2VK4A 3AFNA 1Z35A 5KYTA 2ZI7A 4H7JA 1F51E 4L95C 4ETIA 5IZCC 4XWWA 1TK3A 3IQXA 2HJSA 4HDNB 5DHSA 1KSJA 2NZ2A 4HWPA 5DHQA 1Q2UA 2FZ4A 4KIGA 4PO3X 3SJUA 1LTKA 2E85A 1LLFA 1QZXA 1T5LA 3NVDA 3AFIA