2D3WA

Crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
244
structure length
244
Chain Sequence
MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent transporter sufC
publication title Crystal structure of Escherichia coli SufC, an ABC-type ATPase component of the SUF iron-sulfur cluster assembly machinery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 70
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d3wA00
4DLYA 4US1R 3HPQA 4Q7JB 4NU0A 2MSEB 2RKOA 5JBQA 1O3YA 4TTQA 1YRBA 3AEZA 5TARA 2OFXA 2C95A 3K0CC 1L7VC 4B2LA 2BC9A 2QGNA 1S4QA 1KAOA 1EK0A 1AKEA 3GPLA 3GCGA 4PFSA 4QBFA 4G5RA 1TX4B 2FN4A 3QE0A 1GL9B 4B73A 4D4KA 3MJRA 5CYPA 3EZ6A 1SXJA 3GLFA 1VKJA 3EC1A 4DXAA 1E2GA 1FX0B 1LF0A 1R6BX 3GEEA 3MCAA 3SBEA 4C0LA 1R5OA 5CM8B 1KI7A 1XWIA 2FFAA 2G88A 3CRMA 3K0FB 2NIPA 3FMIA 2VP2A 2O8BB 4TYWA 2CEAA 1Z0IA 4OL0A 1H8HD 4PO8A 5JRZA 2OUKA 1VCIA 3SJBA 5IK2A 4NYIR 1IAQA 4HLQB 2PCJA 4WOPA 4L15A 1X6VA 3CLVA 3QVUA 4IOLA 1NKSA 4A15A 1CU1A 4WZAE 2O0JA 4F7WA 2O8FB 4M1YA 3B1WA 5AJYA 5F2EA 4DB4A 1Z0FA 5J40A 1W0JD 3K70B 1KI6B 4Q7KA 3ETLA 4Q1EA 5DGXA 1K5DA 4FMBB 2WWHA 3HJNA 2XSZD 4JL8A 4Z8XA 3ZIAD 1AS2A 3B1ZA 3I1FA 3RC3A 5CLQA 1N25A 3FMPB 2JATA 4M1OA 5GJVC 3HPRA 5FUXA 3QXSA 2VBCA 1RYHA 4HAVA 3A1WA 1SKQA 3FVQA 2O8CA 4A0FA 1Z22A 5EE5B 3A1VA 4HZUB 1HT1E 2VSFA 2KE5A 1NJFA 4A0HA 2WMOB 4ZI2A 3AVVA 4DLZA 2O0KA 4PAOA 3K0FA 1XMIA 1XPRA 3LVRE 1PUIA 3OEHA 5H8WA 4PR0A 5JEDA 3FTQA 4A0GA 1BS1A 1G6HA 1W36D 4YDHB 3N2IA 4EFLA 1U9IA 1EX7A 1YVDA 3BGWA 4JBWA 1B23P 1NG9A 5FI1B 2RGDA 2X1VA 4YQFA 2VLIA 4HLUC 4TMKA 4RFVA 4QC2A 1U9IC 1VHTA 4BZXA 4F4CA 1IN6A 3KB1A 4KFTA 4V03A 3ECCA 1AIPA 4Y0AA 3SFVA 2JDID 4NONA 1J7KA 1WDTA 2GILA 2CNWD 2FU5C 3CNLA 3SQWA 3L0IB 4ABYA 2VH5R 2ZUCA 3T35A 1QHGA 3DVLA 2GAAA 4L9SA 5H1YA 2GZDA 4Q21A 1KK3A 2CVFA 2BKEA 3KKQA 1S2MA 3BORA 2CK3D 3L8YA 4JS0A 4MGIR 3U4QA 2K5UA 1II0A 3T12A 3K0SA 4B3XA 3IBYA 3PFIA 4JBXA 4DSUA 4L16A 2QN6A 3CRVA 2ZAMA 3NIBA 4OI1A 1S9DA 4P32A 4G01B 1U99A 3SEAA 4AYXA 821PA 4OI2A 5C1BA 4PZZA 1H8HA 4DDWA 1Z28A 4HYYA 1TEVA 3TR5A 5DIFA 1W36B 2VP6A 1WBDA 1IHUA 4S35A 2D7DA 2P6UA 3W3ZB 3ZS9A 5CDFE 4LSGA 4GSYA 2WWFA 1YZTA 2IF0A 4TQAA 2PMKA 2ZPTX 2H57A 2BCJQ 1W7AA 2RH5A 1W0JA 1NG1A 1ZNYA 2WKQA 4KYUA 4FMCF 3TUZC 4BFWA 3C7KA 3I3SR 5JI2E 3ZZTA 2XSZA 4B3FX 5SZKB 4JKIA 4A36A 4B3GA 3ZIAA 4YXWD 1VG1A 3B85A 4BFTA 2J0UA 2HCJB 1EG7A 2RHMA 1NN5A 3EZ7A 5DN6D 1EFRD 2DHRA 1GTVA 2KBFA 4M4SA 3QSYA 2R6GA 4KODA 4EKDA 2HF8A 4QJ5A 3OIVA 1HQCA 3D31A 3PITA 3SQXA 1XZQA 2EFEB 1Y3AA 2N46A 4QGFA 3AGPA 4QJ3A 3OAAD 1MO3A 1Q20A 1UM8A 2YOHA 4M0LA 3K1JA 2A5DA 3KKPA 1E2IA 1XD8A 4HLCA 4ESVA 1N6OA 4DEYA 3I8XA 2ZRAA 3VKWA 3AF3A 4CEIB 1Z2CA 2EU8A 4A92A 1TF5A 5CK5A 3TR0A 3AGQA 4M1TA 5B57C 4JVMA 2NO6A 5J47A 4DHEA 5KYKA 2GK6A 4GI7A 3RWOA 4Q03A 4C0KA 2BMJA 3I8SA 2AD5A 3W8RA 2IEZA 3TGPA 4JVLA 2ZRHA 3LW7A 2EVWX 1XF9A 2MSDB 3A4LA 3I4LA 2FPKA 1VECA 1CP2A 1TL7C 3L2OB 2Q21A 4DLVA 5KNCA 2JDIA 4J0QA 2JLSA 3U6BA 4Y0VA 1TQ4A 2CNWA 2DFLA 2WIBA 3GFTA 1KJWA 4EUNA 2OBNA 3RS3A 1S9HA 1OIWA 4NBSA 1J8MF 1HQYE 1EESA 2WJIA 4MITA 1UFQA 4ASUD 1YR7A 2OFWA 5DO9A 2FPMA 3H4MA 1HT2E 3OHMA 5CYOA 4B33A 4UNNA 2CLCX 3ZVMA 4UJ5A 3R9IA 2CK3A 4U02A 5SZHB 3CH4B 4KXFB 4FWIB 1XCPA 2C9CA 3HDTA 5CLLA 4A6PA 3KDSE 4DCUA 1QDEA 1KK1A 5AWFC 4B32A 721PA 4B43A 4LHVA 3FYHA 2PBRA 3LLMA 4QHTA 1CRPA 2WJVA 1XXHB 1Z29A 3L0PA 3RABA 1E2NA 4QBHA 1M7HA 3I32A 5BW8A 3C16C 5KNDA 3GLIE 4CEIA 4OI4A 1EGAA 1KK0A 2QM8A 1IONA 3ZVNA 1IJFA 4KV9A 2CLDX 5EP4A 3GLHA 5A5GA 5F3WB 3RVBA 1VCMA 1LFDB 1T5LA 5H70A 4NH0A 3OIUA 2QY9A 4BFZA 1D5CA 1AS0A 1NBME 3G82C 2CXXA 2HJVA 4BLPA 2ZETA 4AY2A 2IHBA 4YXWA 4LHZA 4IKEA 2ZI9A 3QY0A 4IVPA 5DN6A 3R7WB 1EFRA 2QMEA 1CR0A 1E1RD 2VQSA 3QG1A 1EX6A 3VR5A 4ZCIA 4JSTA 3PUZA 4Q66C 3H2YA 1BO6A 2ZE8A 2ZRCA 4PPQA 3OAAA 5ELXA 2QRZA 3QQ5A 2D74A 4JYBA 2ZJAA 4MYCA 5BN4A 1RIFA 1M7BA 3B2EA 1HUQA 2JEOA 2FZLA 4TTPA 2ONJA 2BMEA 4M1WA 3ND9A 5BYJA 4DLWA 4QM6A 1I4TD 1OF1A 1P2TA 5KSYA 2A5YB 1NMXA 2GZHA 3UXMA 1TMKA 5EUMA 2F55A 4B3BA 1R0XA 2F1RA 2ZRGA 3KJHA 3C5HA 3MUFA 3TSOA 1YZKA 5FOVA 1ESNA 4HAWA 2XTZA 4LC0A 4TMXA 2V6IA 2LWIA 3UIEA 4W7SA 4B75A 1KSHA 1T5IA 5CB8A 4B47A 2N1BA 3RS5A 2VP9A 3LDAA 3J81k 3UANA 3PV0A 4C9BA 1Z07A 2UVQA 3ONWA 4JT2A 2BMDA 4LC1A 4BRUA 4ACBA 2ZI6A 1P61B 4Q19A 4ASUA 1E2DA 3BOSA 3CPJB 2RGXA 3MWJA 4ZIRA 1N6KA 1OYWA 2PJZA 1UKEA 5FOUA 1ANKA 1II9A 1M8PA 1L2TA 1Z0AA 2IXEA 2L0XA 4ILEA 4LWZA 4DBLC 4G5QA 1IM2A 5C4MA 2Z4RA 2OCYC 4C0JA 2O8DA 1P9NA 1YHNA 4K8OA 4P4UA 2EWWA 5JRJA 2XJ9A 3BE4A 3K09C 1G20E 5DI3A 1P5ZB 2BM0A 4LYAA 3LVQE 1NMZA 1E2FA 2AHOA 2R8RA 3RNLA 3UMSA 3NHBA 3U2QA 4AKEA 1LY1A 3B1XA 4JLVA 2RGGA 1FTSA 2NTYC 4KFSA 5TB5A 4Q4AB 2NZ8A 3KTAB 3OIWA 4TL8A 4A6XA 4DCTA 1M7GA 2GCOA 2QGZA 3PEUA 1DAFA 1RVDA 2HT1A 2QPAA 2PT5A 4HAZA 3R20A 4FWTA 3A37A 3EW9A 4NHOA 1KGDA 3ZDQA 3W8NA 1KZGB 2B92A 3GEHA 2ZVPX 4YLGA 4A0RA 1GVNB 2YYZA 3CPEA 4RY2A 2MMCA 3DKVA 5EXSA 2W2XA 2HUPA 4U5XA 4LRWA 2Q3FA 4Z54A 1XEFA 1E1RA 2Q0HA 4US2R 4OI0A 4IDHA 1N3BA 4QXAA 2MMGA 1E6CA 4R9UC 1OXVA 4Q1BA 5JJLA 2ZEJA 5KO2A 2QT1A 3A6PC 3QXXA 3BJIC 1RE0A 4BUJA 2ZE6A 5JSZB 2H1LA 3K9HA 1OXTA 2YWFA 1S1MA 3CB4A 1DEKA 1SULA 5FFMA 1ODFA 2C98A 4Q1AA 3QEJA 5FBLB 1M1YE 3CH5A 1XMVA 3BH7A 4XVRA 1X3SA 1Q3HA 5JWOA 2FDCA 2AWOA 4GOKA 4Z8YA 3MMPA 2ZRIA 4URWR 1U81A 4HDQB 3EAQA 3P1JA 4DLXA 5FTLA 3TW8B 1JR6A 4HSEA 3PUYA 4GZLA 1G3IA 4XSGA 4PPNA 4D0GA 1E2JA 4V0ME 2RAPA 4X8HA 1GKUB 3U6KA 3U7FB 1XU4A 1L4UA 1OXUA 3ADKA 2GCNA 2C03A 5LPNA 2IS6A 3EPJA 4CZ2A 1G6OA 3U3JA 2ZRMA 2JA1A 1ZU4A 2XAUA 1W4BA 1KSJA 1FTNA 5KNBA 3CBQA 2ZJOA 3U44B 2HXSA 2AK2A 3C41J 1U94A 1FMJA 3QEOA 4MQBA 4TLAA 1N5KA 1ONBA 1E0AA 1PLJA 1A2KC 121PA 4ARZB 2ZU0C 3CUEF 4MRRA 4R98A 3M1IA 4D82A 2ZXUA 4G1UC 4E07A 4OHYA 1NLYA 4IXNA 4FN5A 3L8ZA 4PHHA 4OHXA 5LDDC 4E09A 5FUYA 2ERXA 1VDZA 5AJZA 1COWD 1YRAA 1FFHA 2BMFA 2FFQA 2ZSEA 1NJGA 3BH6A 4MDFA 2FFBA 4IEEA 1E98A 2IXGA 4N0DA 4PO9A 3THXB 4CDGA 2FPLA 1ZM4A 2VRWA 2A2ZA 4LJ9A 1M34E 3DM5A 4OKSA 3D6TB 1Z08A 3P4XA 3NWJA 2IXFA 1T0HB 2VP0A 3BBPA 1XP8A 1A4RA 1KDRA 4GRAA 1GIAA 3KXKA 4GZMA 4WXPA 3WNDA 4EJSB 4RD2A 1VIYA 4LUCA 3TSWA 2X2EA 2ZS8A 4LBWA 2FOLA 2PZEA 1NSFA 2WJGA 2YOGA 1LF5A 3RANA 1KI9A 2IWHA 1XD9A 5C46F 2ZITA 3I61A 2IYRA 3EX7C 3TK1A 2WSSD 2FZ4A 3BRWD 4U7DA 2W2TA 4TQ9A 3RAPR 4EFNA 4CYMA 1KAGA 4IOJA 2WKPA 2VL7A 1E2HA 2OXRA 2R62A 3K9GA 3X1WA 2GWHA 5TV2A 1FNMA 3WBKA 1TPZA 2GK7A 3K8YA 2BHRA 1AZTA 4PZYA 3IGFA 4NZYA 3PEYA 1YZNA 1G7RA 1VTKA 1ZW6A 2G3YA 1E32A 2HCBA 2QZ4A 2YWHA 2Z43A 5B2ZA 2WWWA 3U60B 5JJKA 1NIJA 3NH6A 3AF4A 1P7CA 4BZQA 1W44A 2QTVB 4HAYA 3AVWA 3CNOA 2QAGA 2IYWA 2ZU6A 1DBSA 4PO1A 1SZPA 2OBLA 2XTNA 4A8JB 2QPOA 3WMFA 2REOA 3THYB 1OFTA 4Z1MD 2QAGC 4A9AA 3B1YA 5FPYA 5HE8A 4CEHA 2VP4A 4M8NE 3OZXA 3TAUA 3RSOA 1L8QA 3UWOA 4BLRA 1N2CE 1R0ZA 4EJSA 3AF0A 4XVQA 2RGEA 421PA 3LWNA 4IDNA 4QNMA 3VR2A 1L4YA 3QKTA 1CIPA 3WBJA 1PVOA 1Q1EA 4W5JA 5IT5A 1RRPA 4M22A 5JFGA 1FPMA 1GRNA 4OHVA 1XXHE 3WP1B 3RRYA 3AM1A 2RHDA 2AXPA 5DH9A 4IOKA 1YZUA 1CF4A 4BFSA 1E0SA 1Z3IX 3HYRA 5E7MA 4C7OB 2XXAA 4NE2A 1W4AA 4M9SA 1COWA 2HJGA 2R9VA 3CX6A 3X1YA 1G9XA 2YC2C 1N6HA 3B7GA 3RRMA 4KFUA 4A4DA 1GKYA 4I4LA 3RC8A 1IY1A 2V55B 1HEIA 4LHYA 5KPDA 1ZNZA 2CHVA 4U00A 4XSHA 2AWNA 2P65A 2DY1A 1GOTA 4BFXA 2WVJA 3AVUA 4EPVA 1TUIA 3CF6R 1CJMA 5BYKA 3DOEA 1XPOA 2ZSBA 3WHKA 2CHQA 3HYTA 1MO6A 3NDBB 2KB0A 2REBA 3GLFB 1SXJB 2UZ3A 1GRQA 2W0MA 1I2MA 4NCKA 5FL3A 4QKQA 2XJ4A 3BK7A 1MOZA 4I1VA 4TMZA 2ORVA 2WSSA 2HF9A 1KOFA 4Q9LA 4PHTA 3U3KA 4BECA 2JJ8A 4Q9JA 2WICA 3KXIA 5DHFA 3Q85A 4C4PA 1SHKA 1SVSA 2FGKA 4DDVA 4PC3A 2IT1A 3IDQA 3M4YA 5CM9C 5BN5A 1ZJ6A 1SVMA 1UBGA 4M21A 2DPXA 3EWAA 1T9HA 2NO9A 2GHIA 4KBFA 4L8GA 1UEJA 1WMSA 4KVAA 3MLEA 1E2PA 3O8BA 1D8TA 4MUBA 4IDOA 5KU1A 3TBKA 3FB4A 3VR6A 5DHAA 3ZH9B 4LOAA 3BC1A 1CJKC 3K0CA 1Q12A 2X19A 3C15C 3IPYA 5E4FA 3VX4A 3CONA 3VTKA 4WA7A 3NBXX 4Z1MA 3X1XA 4D25A 2WSMA 4WW0A 3ZQ6A 2FV8A 1GWNA 1K6MA 3IEUA 4TSFD 1E9EA 3TAHA 4D0LB 1GILA 2J5XA 2FWRA 3F5FA 2F3TA 4HB2A 1IN5A 2D4HA 2ODNA 2IK8A 2O8CB 1AKYA 3KZ1E 4EPWA 4B34A 1WXQA 3SNHA 1E9FA 2P3SA 4IHQA 4EDHA 1AGRA 4D2IA 3MG9A 5K8LA 1OXXK 1ZUHA 5FI0B 3ZGXA 3TKLA 2W0SA 5SZJA 2A5JA 1GRRA 2QQEA 2X2FA 2OBMA 3MGCA 4DLTA 4P33A 3V4FA 1DTSA 3NH9A 5J4HA 1F60A 3CR8A 1T3SA 4DDUA 1JQLB 4RD0A 2XEXA 4EPYA 1OSNA 1UEIA 2F7SA 1TAGA 4Q9KA 4B35A 2F1IA 2GCPA 2W00A 1XNJA 3QXCA 3UG6A 1ETUA 4EQ6B 5FUVA 1IY0A 3CF2A 3A36A 2SHKA 3CM0A 2J0SA 3B82A 2XX3A 2GKSA 1HH4A 4PC6A 4PQRA 2RGNC 4WZ6A 4BRWA 1DAHA 5EZ6B 1UKZA 3B78A 3NDPA 3TSZA 1XJQA 4P4TA 3BFVA 2VYFA 2ECKA 2RB4A 5L3QA 3AVYA 1SVWA 3ICEA 2OZEA 1TF7A 2DFTA 1X8JA 4TL7A 2ZUBA 3SYNA 2WMNB 1X1SA 4JBYA 2FE4A 2V7QD 1N6RA 4TMVA 5CK4A 2IYXA 5AUNB 2ZANA 4YMVA 4O2RA 1W2HA 1S3SA 2H92A 2DBYA 2RGCA 3U4QB 1H8ED 3BB1A 1KIMA 2P5TB 2AL7A 2BKUA 3SC3A 1U8YA 2ZI4A 1IBRA 4RZ2A 1VHLA 3SU8A 2E87A 3GLGA 1G7SA 4RVCA 5KTYA 1VCNA 3KJEA 4DSTA 4AKIA 3QJYA 3UK6A 1Q44A 5FPKA 2ZRPA 1MR3F 3CWZA 2CCJA 1IN7A 2ZI7A 3BIFA 3C5CA 1S1CA 4TWZA 3T34A 3QI2A 4DLRA 4EQ6A 1VG8A 4HLUA 4PANA 4CRWB 4LBZA 2IS1A 4NP6A 2BJWA 1OFIA 4XJXA 4TZ0A 1OFHA 3UPUA 5KSPA 1VYVA 3HP1A 3QF4A 2CL7X 3W90A 3QF7A 3T1QA 3KQKA 3SZRA 2ZVQX 3A1UA 3PR1A 1XMJA 1HYQA 4W5WA 4JZKA 4DCNA 2J0UB 1NKTA 3AVXA 3CPHA 1TQDA 4GT1A 4HB3A 1Q3TA 3VR3A 4TSFA 2WAYA 2C2HA 2ANCA 1DOAA 1QVRA 4TYYA 1XEXA 1F48A 2NQ2C 3CZQA 3WYGA 5J4KA 4Q02A 4LJ5A 1W0KD 3Q5EA 4M1SA 1G8FA 3BB3A 4M9QA 3FKQA 4V02A 4C2TA 3R9XA 1JEEA 3SYKA 2ORIA 2E9SA 2NMVA 2FJUA 3EIEA 4M1KA 3JZAA 4Q4LA 5DLQC 4EAQA 3ZVRA 3QXHA 3B13B 4X8LA 2QPTA 2B8TA 4GMDA 3GJ6A 4UJ3A 5GVRA 1CULC 2E1RA 1HURA 3QPWA 3RYTC 2JCSA 5IRCD 2IF2A 1ZNXA 1XJCA 4X8MA 3K70C 3LXXA 3LV8A 3NKVA 5HE9A 2ATVA 1EFHA 1RZ3A 2F9LA 1LNZA 2NGRA 2CE2X 1CBUA 1AJEA 3BFKA 2YV5A 1KDPA 1VCOA 2BWJA 3QPVA 4KSBA 3KXLA 2DFNA 1ZM3A 2IYUA 2IYTA 3FHOA 2ORWA 3K53A 1G21E 2DFKB 1Z8FA 4JSYA 2ZR0A 4LJ4A 3JVVA 2I4IA 2ODBA 1XD2A 2VF7A 4Q47A 1OKKD 4I99A 3SI7A 4CVNA 2PLRA 1HTWA 2ZS9A 5IHPA 5KUTA 2YHSA 1J90A 2ZRDA 3ZZUA 1JR3D 4ZPXA 3THWB 1PV4A 1D2MA 1JAIA 1QF9A 2D06A 2ZTSA 4XD7D 3SHWA 4PQFA 1XMSA 2V7QA 2WOOA 4TN1A 2YNMA 1GAJA 3M6AA 3ND8A 3W6NA 5JS7A 1D6JA 1YZGA 4II7A 1H8EA 1CRQA 1TQ6A 4HDOB 1N0UA 1US8B 2FEMA 1RPZA 5B58C 3KFVA 1CR1A 2ZJZA 1BOFA 3U5ZB 2D2EA 1OH5A 1MABA 4F38A 2GF9A 1T4GA 3R9WA 1OT3A 3IO5A 5J4YA 3QG5A 1OHHD 2QTFA 4AK9A 3F3YA 3GJ8A 4KVGA 3AKDA 4AURA 2V6JA 1G291 5L3RA 1E94E 3REGA 4M53A 4Q1CA 2QQ0A 2PT7A 2XB2A 1MRSA 2O5VA 4CEJA 3Q3JB 3X1DA 4JT4A 1GNQA 3GLHB 4UQOA 4DCVA 1R8SA 3CRQA 2BBOA 1P62B 2J0QA 2QP3A 3AB3A 1XX6A 1D9ZA 1S96A 2CDNA 4C0AC 2FX3A 4MA4A 1XRJA 5E7JA 4LYHA 3EPLA 2ANBA 1SVKA 2F9MA 4OQFA 4QRHA 3MFYA 1UADA 1FP6A 2XGJA 1UDXA 4V0KA 3LAWA 4NL4H 1Q1QA 3THWA 1G41A 2PLFA 2ZIAA 3ASYA 3G0HA 1Z0JA 3PEVA 5HKKD 1W0KA 3GJ5A 4H1UA 4LK2A 2GJ9A 4DSOA 2ATXA 2GJKA 1JPJA 3N5CA 5AJXA 4OQMA 3QKUA 3L0SA 3L82B 3U3MA 3AVTA 5CB6A 1G3MA 1OIVA 2AFIE 2QEQA 1US8A 2YKGA 1U0JA 2J87A 3FMFA 4B2PA 1GFIA 1LVGA 3RS7A 1KO8A 1U98A 1EWRA 3IPXA 4ZDKA 3WRYC 1BKDR 3C14C 4HB4A 2IYVA 3WY9A 3IKJA 1FL9A 2WWIA 1NF3A 2WJJA 5FR2A 3TW4A 1W4CA 2XITA 3UWKA 1FUUA 3KX2A 3X1ZA 1EWQA 2KI5A 3T5DA 1DE0A 4JVSB 4E03A 4BLQA 4D4MA 8OHMA 4MGZR 3PXGA 3KL4A 4PSKA 1O87A 1JXMA 1TEXA 4HZIA 4RZUA 2IYLD 1PUJA 3HR7A 1KY2A 1OKKA 1OYYA 4JLNA 5EP3A 3A4NA 1JJVA 3LD9A 4N1AA 3VKHA 5LD2C 1AQUA 2J59A 4P4SA 2XNSA 1Q1ZA 1JI0A 1ZC3A 1JR3A 3OIYA 1I2DA 1M2OB 4XD7A 2IW3A 4UKDA 3KQNA 1W4RA 2FSHA 4PTLA 1CEEA 1JECA 1TF2A 5G41A 4EFMA 4ZIRB 1J99A 4LGMA 1E9DA 4RKEA 2C77A 4HAXA 4PAMA 3TJZA 4QL3A 2J9RA 3WHLA 4RCYA 2NO1A 1FQKA 2IEYA 4MKFA 4WXRA 3GLFE 1DARA 1SXJE 2GJSA 3FMOB 4N3NA 4BEJA 2OO7A 4YC7A 5TVKA 3PUVA 2JLYA 1CS4C 2WOJA 3K0AA 2O8DB 5CJ2A 2P5SA 2XTMA 1OHHA 5DI3B 1XZPA 2LKCA 5FBQB 3MWKA 4G0NA 3TIFA 4HDCA 2EFDB 1CTQA 2CE7A 4G5OA 3SFZA 4MYUA 1A2BA 3KKMA 4JMPA 4O2LA 4CIDA 1KY3A 2JLVA 1TUEA 2B8WA 3O8DA 1N5IA 2W6ID 1ZRHA 3NEJA 2GCOB 2Z4SA 3D7MA 4G5SA 1MT0A 3SHFA 2XOKD 3AKEA 2QNRA 5E7IA 3UKDA 1ZBDA 2KWIA 5DYIA 5E95A 4HUQA 2GTPA 3B1VA 2BV3A 4TT3D 4B2IA 3Q7PA 3RS0A 5HPYB 2BEJA 1QZXA 1ZP6A 2ZJ2A 3GD7A 4A82A 5BXQC 5DNYB 1F6BA 4BASA 1JEDA 4OQXA 2C9OA 4B71A 4E22A 1FZQA 1G17A 2G77B 4TMWA 5J4LA 4TLBA 2QENA 4PAQA 1UF9A 1VG9B 3LQRA 5HKKA 2O0HA 4GP7A 3AVOA 2FFHA 1NVXQ 2NO7A 4Q4HA 2JLZA 1N6LA 2YVUA 3NBFA 2HEIA 5CJPA 4FCWA 4KLNA 2AKYA 3K09A 3JZMA 5D3MA 1N6PA 4R71A 1GITA 5FOXA 1K8RA 1SHZA 3FFAA 5G53C 1N6NA 1G5RA 1NRJB 5KHOC 2YJTD 4FMDB 4LYJA 1NN0A 4CT4B 5KDDA 3AUYA 1G8YA 1TU4A 2KBEA 2CL6X 2AK3A 3HWSA 5FBVB 1N5JA 1DO0A 1BIFA 4NMMA 5EZ5A 4PC7A 4WBSA 4FCTA 4YMSA 4DUGD 4B3CA 2QM7A 3LO5A 3FKSD 3T15A 1GNPA 5F9HA 4R2IA 3K9NA 4HB0A 1HE1C 3HU3A 3N2EA 2R65A 1OJLA 3CZPA 1KDOA 3QBVA 4B74A 3DZDA 5M04A 1P60A 2I1QA 4TZ6A 4Q48A 5EE9A 1T0JB 2QSZA 2G1KA 3ZVLA 1NN1A 3EIQA 3THOA 4RKFA 3IUYA 2IBMA 1P9RA 1HA3A 4C0BA 2ZJ8A 4MKHA 2QBYA 2CLSA 4DVGA 2JLQA 1RJ9A 2C96A 1YQTA 3QPUA 4JL6A 5FOWA 2HV8A 4IDQA 1S3GA 1ZM2A 3LLUA 1UBEA 1VIAA 5JCZA 4LJ7A 2OLJA 3B9QA 2I1VB 4MYTA 1MKYA 4XWOA 3SOPA 3EPHA 4EPTA 2ZRKA 4B3DA 2GZAA 4OBEA 5IF9A 221PA 2Q6TA 1LS6A 5DSZA 3CR7A 1RRCA 3Q8XB 2VIIA 3OEED 4OHWA 2W6IA 4UNSA 1S8FA 1DG3A 2XOKA 3Q5DA 3DKPA 2ZJ5A 2HXYA 3EC2A 1D2NA 5AR1A 1C1YA 4TT3A 2AX4A 3FHCB 3QKSA 2RCNA 4PXAA 2JGNA 1I4LD 5LBIA 5JZVA 2OESA 3FGNA 4B6FA 2CVHA 2X8AA 3IIKA 2OILA 3EXAA 5K8IA 2G9NA 3W6OA 2DWPA 4JL5A 4PX9A 3WRXC 1XTQA 3FE2A 2VHUA 4URVR 1XTIA 1E4VA 3AUXA 3VU9A 3W5IA 3I92A 2WBLC 3C8UA 4IXMA 1OH8A 1GL7A 1CJTC 2ODEA 2OXCA 2QTHA 3SJCA 5C2JB 4F92B 3W9YA 2D7CA 2ZAOA 1DELA 5FPSA 3IO3A 2H16A 1P9WA 3EA5A 4PSVA 4URUR 4OK5A 1JNYA 3W3AA 2REXB 4NDZA 1G18A 2Z0MA 2F43A 2DWOA 4ON9A 1NP6A 4OK6A 1QRAA 4JYCA 2CMKA 5KSOA 2PEZA 2RGAA 3KUCA 1RYFA 1YR8A 3AP1A 1E9RA 2LKDA 521PA 4DUGA 1Z6AA 1Q22A 3KFXA 3FKSA 1R4AA 4G5GA 1FNNA 2JLXA 1HY3A 2FMXA 3IIMA 1YE8A 1G5PA 2GA8A 2QAGB 2ZUDA 2VTKA 4PQYA 1EXMA 4ZKEA 4YMTA 5TDHA 5G40A 4IDPA 1AK2A 2JLWA 1ESMA 1TNDA 1OB2A 1FOEB 4CEHB 2ZI3A 1G4UR 5CIWA 4Q9IA 3MSXA 1XBTA 4UXIA 1IN8A 4EIWA 1IXZA 1RKBA 4O0MA 3AH8A 3IQXA 3LBIA 3HU1A 3P20A 2V3CC 3AKYA 1IQPA 2BBWA 2OAP1 2CJWA 4S2EA 4KAXA 4OK3A 3LNCA 1BMFD 1ZVQA 3QIAA 4N0EA 4YONB 4P3YA 3RWMB 3E70C 3BAFA 5ANRB 2GAOA 2XXAB 1QHHA 3OEEA 4URXR 2B7BA 5HR5A 1Z0DA 3KB2A 3K9LA 2HYDA 2C9YA 3H84A 3AQ4A 3BD9A 2AD1A 2VPPA 3GLHE 3LX8A 4XH9B 3FOZA 1WQ1R 3T1TA 2C5LA 2AFHE 4FINA 3KKOA 1J8YF 4QGAA 1KI8A 1WB9A 3GJ4A 1QHXA 4AKGA 4AD8A 4BWYA 2ZJYA 1ZUIA 2N42A 3KKNA 1ZNWA 4FW9A 5FTJA 4FD2A 4YMWA 1JJ7A 2YWEA 1KO5A 3KJIA 2QROA 5H68A 1T8TA 2Q3HA 1B0UA 5CDFA 4D80A 4QBIA 2ZS7A 4LV5B 1XFAA 2ZQ5A 5DE3A 5LB2A 2V9PA 2WPDD 2F1HA 4QGGA 1V5WA 2H5EA 4ZCLA 1Y63A 2GJ8A 4UXHA 3AVQA 1W48A 4JLAA 3TNFA 2GDJA 5JJIA 1XTRA 2R6FA 5LB4A 3EZ2A 3E5HA 2JJ2D 1ZD9A 3QKRB 4RCZA 2YOFA 5CIQA 2ZR7A 2FH5B 1NBMD 2OCAA 4GP6A 3NBZC 1U8AA 3FWYA 2FEOA 1VYTA 1D2EA 1SKYB 1BH2A 3AP3A 1CR2A 4TLCA 3B60A 5BN3A 3ZD7A 3QENA 3SJAA 4V0NA 3ADBA 4LV8B 4GPTA 4QHSA 4M9XA 1NY6A 4R7ZA 5JHHB 2XZOA 4Q1DA 2Q9BA 4C0HA 1XEWX 3IIJA 1G7TA 2H8KA 1II8A 2ONKA 2QA5A 5UKDA 4AKHA 1IOZA 2EYQA 1GUAA 4GMXA 1YZLA 4PC2A 1SVLA 4E5UA 2CCGA 4QFMA 2NOAA 4Q18A 3OESA 4URYR 1S0UA 3EPKA 2A78A 1JXOA 1Z5ZA 3Q72A 2PEYA 3U3OA 2Y8EA 2J7KA 5TY0A 1ZUNB 1T3HA 2RMKA 2R6DA 2J7PD 1UDWA 1BMFA 2H18A 1OE0A 1RFLA 4Q5IA 1GM5A 1Z2AA 2A3RA 1M74A 3N70A 4NYMR 3V4RA 4OJQA 3TQFA 3VAAA 4QBGB 2ASEA 3QKRA 2P0EA 3Q7QA 3DDCA 4BFVA 1QHNA 3SS8A 3FDIA 1P6XA 1AGPA 1PZNA 3DL0A 4MGKR 5GJCA 4AG6A 4XWAA 1QG2A 1RRGA 1YKSA 2GRJA 1M6NA 3LA6A 2ZRLA 3SJZA 4FCVA 1TU3A 3SR0A 3FFBA 4M1MA 2G0TA 3EZ9A 2D62A 2UKDA 2QG6A 1UJ2A 5P21A 1OXSC 1Z0KA 4LBVA 5L3QB 2IUSA 3NC0C 1WF3A 5TXGA 2BEKA 2BJVA 3VR1A 3GP8A 2EYUA 3GLIA 3U3RA 2JASA 2G6BA 1DAGA 3U7GA 4FI3C 1UKYA 2F6RA 3I73A 3A8TA 4CF7A 5JECA 2JLUA 2WPDA 4IW3B 2XZPA 3CW2A 1DS6A 3ADCA 4MRVA 3P4YA 2QE7D 4IRUB 3KQLA 2VSXA 3MWYW 3DMNA 4MH0R 4Q4JA 1T3LA 4DCSA 3GLGB 3IEVA 2JJ2A 3V00A 1G19A 1Z06A 1F2TA 3VQTA 3BB4A 1G16A 3UATA 1NBMA 3K70D 4IOMA 3CWQA 2ZRFA 3L0OA 2OHFA 2ZRJA 1DAKA 4A1FA 4KITB 1ZIPA 1J70A 2JJ1D 2RGNA 2EWVA 2BM1A 3VNUA 1XTSA 3A58B 3QF4B 1GZSA 1KI1A 1XDBA 1KJZA 4TL9A 1NVVQ 3BFXA 2IA5A 1KMHA 4RFSA 2QL6A 2ZSFA 2ERYA 1SXJC 4O25A 3AV0B 2V54A 1MRNA 1UBCA 5K8UA 3DOFA 2C99A 2IUUA 2GF0A 3LBHA 4LI0A 5AK0A 4DC9A 4ZDIA 2QORA 2HLDD 1KYIA 3NC1C 3TVTA 1XEXB 1QHIA 2WZQA 2WIAA 4DWJA 3S1AB 4FMCB 3WXMA 3CKLA 2J7PA 3TLXA 1X8LA 1E2EA 2A30A 1DO2A 5L3VA 2YZ2A 2C04A 1Q1BA 4M2LA 2WTUA 3B8HA 3NVAA 4QJ4A 3TQCA 1CJUC 1Z83A 4OYHA 3KUDA 4NYJR 4RZ3A 4ZV4A 1KDTA 2BOVA 5FL7A 4ERNA 1KHTA 1G3QA 3IBGA 1G3RA 3WMGA 3EG5A 2VEDA 3TUJC 1HE8B 4K81B 3GFOA 5JS8A 1ZYUA 3CX8A 4OJKA 2PJRA 2PCLA 5L8VA 2CHGA 5AJWA 2NO0A 4TYQA 4QM7A 4IFBA 3I5XA 1DAMA 1G8HA 3OE7D 1CXZA 1XD2B 1CKEA 3LRPA 2G0NA 2IS4A 1UAAA 1FX0A 1NI3A 2CBZA 3NBYC 4QOSA 5C4GB 1IJEA 3CX7A 4HATA 2XZLA 3VNVA 3DEFA 1R5BA 4LY6A 2V1XA 2ZYVX 3KQHA 2O8BA 3B9PA 4EPXA 1E2MA 5CITA 1R8QA 1IN4A 2EFGA 4AI6A 2W83A 1VYUA 2AKAB 2QE7A 1MABB 3S1AA 1PJRA 4LPKA 4JJKA 3ZQJA 2OCBA 3F0TA 1E96A 4UXJA 2DWQA 1NLFA 2UZIR 2B21A 4M9ZA 2O8FA 1JQJC 1KI6A 1N0VC 3AP2A 2HT6A 4JVNA 3A4MA 5FH9A 2BVNA 2WWGA 4MKIA 4D4LA 4DKXA 4WAUA 5B30A 4CEJB 4RSGA 1RW4A 2JJ1A 5JCPA 5HCIA 2J46A 5JLJA 4G3XA 4B76A 2IYZA 1P2UA 4JLMA 5EE1A 3T06B 5JHGB 1SVIA 4HEJA 1W46A 1XPUA 1G3UA 1Z6XA 4TQUS 2J3EA 2GXQA 2ZYUX 3DO6A 2WM9B 4NCNA 4W5HA 4TYNA 3LW8A 4HZUA 4I1OA 4PC1A 2HLDA 4JIMA 3RSLA 2DCUA 3PIRA 3LQQA 3TE6A 4PPFA 2WKRA 1OH7A 2ODWA 2OAQ1 3OFND 5HZHA 1MO5A 1N5LA 3LH5A 1EFCA 4DEXA 3B5JA 1UPTA 1CJVC 2JLRA 3R8FA 2QU8A 2EFHB 1DAIA 2NPIA 1G8PA 5GVSA 4TLDA 2QSYA 4L9WA 2ZJBA 3PUWA 1R2QA 3RHFA 2QI9C 3TH5A 4DB2A 1NVWQ 1W1WA 1X8KA 2GVDC 1VMAA 3G5UA 4JLPA 1AA9A 2NPFA 3RRNA 4V0MA 1E69A 3EIHA 3LBNA 2G83A 3H1TA 3I5YA 3EZFA 1Z47A 2PZFA 3LY5A 4DRZA 5LD2B 2JIZD 4LHXA 2O52A 3GQBA 4ZDJA 1T8UA 1P3JA 1NIPA 3OE7A 2QRNA 1GG2A 2ZE7A 5J5CA 2ZRNA 4C3ZA 3O8RA 3VHXA 3RS2A 4P4SB 4H1VA 4AIIA 2Z83A 2D2FA 2YC4C 1ZU5A 1AN0A 4A2PA 4O3MA 3MAAC 3BH0A 1W5SA 2VA8A 2KJQA 1MH1A 3W6PA 4XWKA 1E0KA 1V43A 5HZKA 4NCIA 1WA5A 1MO4A 4Q1FA 4LJ6A 3U61B 1WP9A 3GJ0A 1QBKC 2J45A 3AKCA 1NL3A 3X2SA 3D3QA 1Z6TA 1KI2A 1W36C 3K0AB 2H7VA 3EARA 1NLZA 3IHLA 3WYAA 4P31A 1E1QD 2VHCA 3CIOA 1P75A 3GFPA 2W6JD 4URZR 1XCGB 3VMFA 1JALA 1GDDA 4H9GA 1KO1A 2B6HA 4Q7LA 3HR8A 4JJZA 1W47A 2WJHA 1BYUA 1UKVY 1W49A 3IHWA 3MD0A 4I1UA 4KBGA 4D81A 4RD6A 1SKYE 5KSZA 5A4JA 2F3RA 2TMKA 4BLOA 3VKGA 3V9PA 3DM9B 3U7HB 1GP2A 4DIDA 4HUQB 2BCGY 3KJGA 1R0YA 2Q3MA 2ZSDA 4Q9HA 5GJWC 2I3BA 3WYFA 4KSCA 2QMOA 1NSTA 4TL6A 4KCGA 2P6RA 1KKLA 4KO8A 3T1VA 4ESHA 3M0EA 1KI4A 1SVOA 2VHTA 3CRW1 1G4AE 3R8CA 3UMRA 1WRBA 1G1MA 1FW6A 3OFNA 4HI0E 4Q00A 4BFYA 1GNRA 2A5GA 1AZSC 4Q4HB 3QOFA 3ZS8A 2P2LA 4DSNA 1EFTA 4IJMA 1FMLA 1KNQA 1QHSA 4D26A 5FPHA 2XB4A 2KSQA 2IYSA 5D3MB 2V8OA 1E9AA 3PEWA 1GL6A 1DADA 2VSOA 3DMDA 4C0QC 2WWXA 4AC9A 1E9SA 1E2QA 2P67A 3SYLA 1E9BA 1X1RA 4GFDA 4C30A 4D4JA 2IYYA 4BE7B 5TMPA 3NG1A 1R0WA 2JIZA 5FTMA 2FSIA 5HTKA 1H65A 5JI3E 3I72A 3P27A 4KYIB 3PVSA 5KPJA 2OFOA 3ZJYA 1NVVR 3WMEA 5F98A 2ZYWX 1N0WA 1Q0UA 2VHQA 4B44A 1JB1A 1OB5A 3QUSA 5DISB 4POAA 5AUOB 3E1SA 1IXSB 1T91A 3DPUA 4TTRA 1R5NA 1ZC4A 3MRSA 4X8OA 4F93B 1JBKA 2AR7A 2WAXA 3AF1A 3NXSA 5FBWB 4UNRA 4ZCMA 4XVUA 3VFDA 3LFUA 1XXHA 3ZD6A 4NTZA 4Q01A 3L43A 5FPTA 4MRNA 3TUIC 1P73A 1SGWA 1JPNA 2QBYB 1TADA 1RJ9B 4JLBA 2BIFA 3RDPA 1IXRC 3RS4A 1G64A 1OLOA 3ZLJA 1E1QA 4RD3A 4WVFA 2X77A 1UBFA 3PJRA 3TMKA 2W6JA 3GLGE 1DAEA 2EQBA 1KMQA 3BERA 5KOYA 3T1OA 2Q9AA 1OH6A 4D0NA 1E79D 4Q7MB 2GEUA 5JWRA 2QP4A 4LHWA 5BWMA 1CR4A 1ZIOA 1EFUA 1OFUX 4NYMQ 5EXPA 3R7WA 2J41A 4AWXA 1FP7A 1TTTA 2GBLA 4LJAA 1ELOA 2GESA 4QG7A 1C4OA 1ZCAA 2ZI5A 5EXTA 3AVPA 2WWYA 3QKSB 4MGYR 5D3QA 2GBLC 2GEDA 3VR4A 2PX3A 3GJ7A 2G1JA 3U7EB 3GJXC 4KFRA 1KKMA 1FQJA 1G5TA 5L3SB 1X86B 2GNOA 4ZO4A 4B6EA 2IL1A 4GNKA 1VG0B 3VU9B 4AG5A 1ZAKA 3EWSA 1XEWY 3DZ8A 5AJVB 2HDNB 5K8TA 5EP1A 1I4DD 2OCPA 3JVUA 3VX3A 2R6CA 2PL3A 4HLDA 4B48A 3TRFA 3P32A 5IDVA 1XTKA 1P4SA 1Z63A 1GKIA 3WNBA 3ZZ0A 3CO5A 1LV7A 2F43B 2IC5A 2DR3A 2ZRBA 4BFUA 4GDFA 4NCJA 1KZ7B 4DT1B 4W9MC 2A9KA 1E2KA 2PMDA 2IX3A 2BBTA 4CT5A 2FSFA 2ZROA 4DDTA 2ZM5A 5G3YA 1ZCBA 3QXJA 4GL2A 3D8BA 1CLUA 4NKRA 1XB2A 5DYGA 1OV4A 1LW7A 3IQWA 1Z6GA 1ZD8A 2WHXA 621PA 4JLJA 4QHYA 3QBTA 2XNDD 4ACAA 2AN9A 4I81A 5B64A 2NG1A 4JKYA 2OEPA 2PZGA 1DVRA 5FUWA 1YU9A 1OPXA 1QHYA 2VO1A 3WP0A 3Q9LA 4PHGA 5F9FA 4TMTA 1HV8A 3BWDD 3W5JA 4DZZA 3SDZA 4A2QA 5L3SA 4BPBA 2Z5FA 5HCNA 4OQLA 2ZR9A 2CJWB 4NCHA 4LPSA 4V0OA 4XOIA 4Q4AA 2R44A 5KDOA 4BEBA 3FHTA 1DG1G 4NYIQ 1F3OA 1IY2A 3KTAA 2JAQA 2FNAA 2DB3A 1ZM9A 3REFA 1JAHA 1LS1A 4DLUA 5DI9A 4XIGS 2RGBA 1Q57A 3ADDA 1E79A 1A7JA 4CW7A 1F2UB 2Q9CA 3PENA 2GXAA 1QHHB 2DYKA 1WE2A 4DT1A 2C8VA 4PPGA 1QG4A 3C4JA 4OHZA 4FMDF 3BXZA 4NYJQ 2IS2A 4ZDWA 2FA9A 2OSBA 4RD1A 4LDJA 4PSAA 3LX5A 5FOTA 1OW3B 1Q21A 1R7RA 3IILA 2J1LA 1ZD1A 4AYWA 2QMHA 1MV5A 2QUZA 4BLSA 5FR1A 5EXXA 1AS3A 2ZREA 1KTVA 1P2SA 2PH1A 1KNXA 2F1JA 3SBDA 5JWHA 5JSZA 1LTQA 4JLOA 4YMUA 3LXRA 4CGZA 4KU4A 4F4JA 2WV9A 3SE0A 2FSGA 2OV2A 3VHLB 2O8EB 5FBRB 1E9CA 2IYQA 1J2JA 1TQ2A 3NHAA 3PQCA 2NZJA 4L5BA 4D6PA 4LCBA 4US0R 2A7QA 2B7CA 1D9XA 4IVQA 1ZM7A 1KSGA 1A82A 2OE2A 3H86A 3NEYA 1NY5A 2BBSA 4RD4A 1KO4A 1WCV1 3I62A 2EFCB 2J0VA 1AM4D 3K0EA 2IWRA 2R6AA 2R2AA 1T6NA 1F2UA 2LCFA 1XCMA 2QAJA 5J4VA 3H0KA 5AUPB 4DIEA 1A5TA 2FG5A 1YZQA 4AYTA 4MRSA 3T61A 5A0FA 4GOJA 3PUXA 1E4YA 4DJTA 2FGJA 1NN3A 1YR6A 1P2VA 4KLZA 3DHWC 1U90A 4RJLA 1II8B 4GOXA 4IVRA 2QT0A 2XNDA 4MDEA 3U44A 4OQNA 1FUKA 4ITRC 2CCKA 3MWLA 2OM2A 3QNUA 5EE0A 1JR3E 4JLDA 5EQTA 4ARZA 5GJBA 2QP9X 5EP2A 1XTJA 2OT3B 1ZMXA 3KQUA 4C2UA 3ICQB 3O47A 2GXSA 3GJ3A 1E0JA 3EASA 2IUTA 1KI3A 4PHFA 3ASZA 3P26A 3HU2A 4TLEA 3UMFA 4L4UA 2O8EA 3AF2A 2Z6VA 4GBMA 4A2WA 1YJ5A 3A1TA 3CRRA 2MSCB 2V4ZA 4R2HA 2GVZC 4LYFA 1KJYA 5E3HA 3THXA 4EPRA 3SN6A 4BLTA 4IFEA 2VF8A 1G8GA 1ZINA 2AXNA 2D3WA 4K46A 4KI0A 3W34A 5JEEA 3O8CA 4UNQA 4UNPA 4MKGA 1KK2A 2C78A 4NPHA 2ZSAA 5GADl 5JMTA 2BDTA 3GEIA 2IHYA 1E99A 1YR9A 4I1SA 4HAUA 1NMYA 3PCRB 1WBBA 1RRFA 2W58A 4IEIA 1N6IA 5EE3A 1LB1B 1SXJD 4LBYA 4PZLA 4QNRA 1U0LA 1VPLA 4EJSC 1W2GA 4BGDA 1SQ5A 1P72A 4XTCS 1U8ZA 2ZE5A 4FXPA 3E2IA 4XTRA 5EUQB 5FOSA 3GLIB 1E2LA 2ZYTX 4F4IA 5FTNA 2FF7A 5C18A 2VHJA 3NTUA 1U0HC 3EA0A 4TYPA 1A1VA 2GXUA 3MJHA 4ZKDA 5IK2D 5FTKA 4WIAA 4DLSA 3RLFA 3PG5A 4Q4JB 1U2RA 2PX0A 4JLKA 4YDSA 3OF5A 2QMUA 1F5NA 2WJYA 4LV6A 4MUAA 2OG2A 5SZIA 3B6EA 2GEVA 4HUTA 1DPFA 1BYIA 1F2TB 2GETA 3GMTA 3BS4A 4MRPA 4QGHA 1RC8A 4RZXA 1R10A 4A8JA 1E3MA 3FPAA 3F8TA 1PLKA 2EW1A 2YWGA 1OIXA 4KHZA 4FIDA 2HYIC 2P6NA 3THYA 4Z51A 4LZZA 5FL7D 2VP5A 5KDLA 4A8JC 2YINC 1XJ0A 4LJYA 3CNNA 4WZBE 5EJEA 3CF0A 5BQ5A 2A5FA 1K5GA 4LJ8A 3UG7A 1KMHB 4RFSB 2CL0X 1GSIA 1QVAA 1Z6YA 5AUQA 4ZI3A 1KSFX 1PLLA 1NNEA 1AQYA 4V0LA 1W5TA 1KO7A 2OLKA 4BQSA 2W2VA 3A1SA 3OEHD 3QVVA 4P0TA 6Q21A 2H17A 2V1UA 4MYHA 4C7OA 4LX0A 3ZYCA 5G3ZA 1G7CA 3TVDA 3T5GA 4C0SA 4F91B 3WNCA 4KJZA 2GJAA 1NVUQ 1C9KA 3RRZA 4BZPA
chains in the Genus database with same CATH superfamily
3HK2A 5L6MB 2XUPA 4NU5A 3HJRA 2C42A 2MSWA 1PQYA 3QJGA 2UZ0A 4RF2A 5C37A 2ST1A 5FDFA 1WKVA 5I7AA 1Q6YA 1WPXA 2Q7OE 2J4CA 4R8VA 3CLTD 3KLNA 1Y7TA 1YRBA 2AT1A 3KR0A 4UZSA 5DNWA 3ZK8A 5TARA 3DQQA 4BBJA 3O4GA 1JE1A 1LI5A 4FYPA 2X0KA 3PX7A 1T9ZA 2RGWA 1EK0A 1CVIA 2X4IA 1AKEA 2ZUVA 1DCKA 2H4JA 5BW5A 2ZWVA 2VQDA 4MQMA 3ETDA 2FSPA 4GWLA 3UYKA 5KWJA 1GL9B 4D4KA 4BN4A 3MHPA 4D3FA 1EZZA 3H04A 3EZ6A 1SXJA 1OBFO 3W5DA 4TTSA 3KE8A 1FX0B 2H1RA 2FCRA 1YCGA 3ZNNA 1LF0A 3H42B 3MCAA 2VDWB 3GEEA 1N5RA 3DR5A 3DO5A 3NFRA 1JEAA 4IIJA 5LUBA 2XDAA 5F51A 2J32A 3MJVA 1FYXA 2WUVA 1JP7A 2PL1A 3ZNOA 2VP2A 3ER9A 4TYWA 4G1CA 1TZ2A 2CEAA 3W8DA 2JIMA 4WADA 3WNQA 3ACCA 3O9MA 2G70A 2TSYB 3BIWA 3I9FA 1Z33A 4EYKA 3SJBA 1BZYA 2BFNA 1IFXA 1RLOA 4RO0A 5HJ2A 1NKSA 1K06A 2QL9A 1CU1A 5FX2A 5HQ3B 2OXIA 4N5MA 2VRBA 4F7WA 1R6DA 4M1YA 4DB4A 1NI4B 4CMIA 3K70B 1YNSA 3GT0A 4H17A 4UDOA 1Z7BA 3ETLA 1L5GB 3VU1A 3ZDCA 2C2XA 5CFOA 5DGXA 1ZQ1A 1A8UA 3PUJA 4H4CA 2WWHA 5J5VA 4Z2YA 1SBTA 1F51E 5CDUA 3R6WA 2DR2A 1KMCA 1AS2A 5DLPA 2FRVA 4CIXA 1CIVA 4B0PA 2GAIA 1JQKA 2W4IA 4RU1A 2JG3A 4EITA 1FSZA 3UAXA 4XB1A 1PE0A 5JQGB 1J8FA 2P4SA 3R5KA 3EGIA 2L42A 4K88A 4QAJA 2GM9A 4H7FA 5LQNA 1NQVA 2SCUA 3OCXA 4HZUB 4ESEA 4F4DA 5IZCA 3NONA 3HL4A 3M9WA 4B3JA 1XKQA 3RVLA 2C5EA 4A0HA 1VLQA 4KDRA 2RHBA 2FW8A 4WK2B 4DQKA 5LQCA 2O0KA 1CDOA 5KYUA 1U3WA 3ZU4A 4M8KA 4P22A 4F1JA 4IF4A 1W36D 2BHSA 3MWDB 4EFLA 5L3ZA 3S3TA 1HRDA 3O0DA 2V7XA 3BGWA 4RBNA 3D6UA 3K31A 1HK7A 3H2GA 4L7QA 3RI3A 1WIWA 4TMKA 2BP7B 1U9IC 4GM4A 2VH1A 4NNPA 5DWVA 2FYTA 3D6JA 4YRRA 1FX1A 3SFVA 3ZU2A 1CIJA 1WDTA 2JFFA 3L1KA 2GILA 3ZQUA 3W2EA 3DSRA 4ABYA 2VH5R 1FQOA 3EB9A 4BRSA 3DVLA 1KYZA 4L9SA 4HXEB 5JO0A 2BM9A 2WP0A 4EX7A 5IBCA 2PH7A 1ZIDA 2YVAA 4MS4B 4R8MA 2C7OA 1KK3A 3ZHCA 5BOSB 2E4ZA 4PZ9A 4ZQFA 1MA3A 1R8YA 4DILA 2CK3D 1UINA 4JS0A 4MGIR 1XQ1A 1U5BA 2K5UA 3U4QA 1PFYA 4X1IA 4JGIA 3IBYA 4MUKA 5HDQA 1NUTA 2CXOA 1E3TA 1ZK1A 4L16A 4OHBA 4ZVUA 1D1PA 2ZAMA 4BGUA 3NIBA 1E4OA 1S9DA 1ZN2A 4P32A 4D9EA 4HVTA 5K8TA 5J23A 4OI2A 3W6ZA 4PZZA 1PS0A 3WIEA 5BWCA 2IVZA 4HYYA 5C1BA 1WJGA 1QFXA 3IUBA 3ILXA 5DIFA 4ECAA 1BKYA 1IULA 1WBDA 5HZGA 1IHUA 1N2OA 2BEUB 1CQPA 3GRRA 4LSGA 3UBMA 3OWHA 5HKBA 4MEJA 2Q9UA 3IUPA 1G6KA 4TQAA 4CCWA 1IBSA 4JUBA 2AEJA 1CUBA 4R1SA 2ZPTX 5LCXA 1SK9A 2A9VA 1VBNA 3COWA 3TUZC 1Y33E 1PDVA 1EP9A 3AC0A 3UB4A 2CGEA 2O07A 2WF8A 3E81A 2VUIB 2ZYGA 3ZZTA 2Z56A 1T6XA 3KR2A 1A8QA 1KE2A 4DA0A 1A7AA 2PGDA 4KP7A 2VHEA 3BFPA 4B3GA 2NU9A 2YJ3A 4MVXA 5T67A 2WJ6A 4BFTA 4HV4A 2HCJB 4HEA6 2TYSB 1M6VB 5DGCA 3UGJA 4GW3A 1M1ZA 3QSYA 4I9HA 3EC7A 3Q8MA 4NE9A 1D0SA 2CHUA 3CWCA 3I42A 5JT1A 5L7TA 2DMRA 4MP3A 1XDSA 1P4HA 2EFEB 1Y3AA 2BFMA 4Z9XA 5C8YB 2YNMC 5BRAA 1I6KA 2YOHA 3PL5A 1BE8A 1V37A 4I55F 1GZDA 2W2QA 3ILHA 2RC5A 3PTAA 5A62A 1U4SA 4I9GA 1C3LA 2P9YA 4GX5A 3VKWA 1JI3A 4DR6B 3AF3A 1EPUA 1AK9A 2ZGVA 4C3VA 2AF3C 3AGQA 5AJTA 4QUKA 2V7VA 3UGKA 3D0KA 3QA3E 5KTTA 1EGVB 2I2XB 4BMCA 3JYPA 1TJ3A 4GI7A 5DBHX 4R01A 4DDKA 2I03A 1BJTA 4ZCQA 2Y3IA 2YCBA 3CSUA 3HA7A 5D00A 3W8RA 4JVLA 3ZY5A 3TGPA 3QBEA 2NXWA 3LW7A 2EVWX 2MSDB 1UMBA 3EN0A 2FPKA 1VECA 2OXEA 1CP2A 2C7PA 3A4YA 3HXMA 1PFWA 1XEAA 5HPYB 4UULA 3K8QA 4GUDA 3K9CA 5K6RA 3R77A 1V41E 3D2BA 3L6EA 1FFXA 1ZH4A 3RS3A 2LP4Y 1J8MF 1KP9A 1HQYE 1QV9A 2BAGA 2ZRQA 5GP1A 2C83A 3V8BA 1ZZGA 2FPMA 1C9EA 1FLVA 4PLWA 4B33A 3GMSA 3PNSA 1Y0BA 4FWBA 3ZVMA 4UJ5A 4HNGA 2CK3A 3C85A 4L50A 5KSWB 1LKZA 4EUFA 4WCFB 1E1MA 4UATA 4FWIB 3DE7X 3NTXA 2GKGA 8ADHA 3HDTA 1IK6A 4N03A 5AOAA 3SF0A 3TDMA 4DCUA 2RCYA 4U3JB 5BNWA 1RZRD 3O2NA 5AWFC 2WG0A 4B43A 4DGQA 2PBRA 2GM4A 1JG3A 1XXHB 1XF1A 1ECPA 1SBYA 3RABA 1E2NA 4I9UA 3I32A 1FLNA 2RBEA 2WT9A 4HNUA 1O9GA 4CEIA 1VMDA 3QUCA 1R88A 3NJRA 5TT1A 4EJFA 4AJHA 2E6UX 3KTOA 2W7TA 4AW9A 4KWHA 1NHGA 4D9BA 3AOGA 3WL3A 5I9SA 3QBJA 4FTWA 3IDFA 4Q4DA 1PV2A 2D1FA 3GLHA 1K8XB 5CIYA 1S8NA 5L51A 3PHCA 3HBAA 1OFUA 5BR8B 3BMQB 1LFDB 1T5LA 1VIVA 4LOHA 4WLEA 5JW6A 4OAPA 3R3YA 5G0VA 2GYVA 2I6GA 3CZ5A 5J2UB 4IUYA 1EFDN 3RBVA 1DT5A 2A67A 4PW0A 2CXXA 2XLBA 1Q11A 1XLWA 2OL4A 4P5PA 4QGSA 4CIAA 1FU8A 2EJWA 4MMXB 4Y67A 4AY2A 2GX6A 1ILEA 3ER6A 3BZBA 3ZLTA 2ZZKA 1CR0A 1O96B 3TIXB 2WHYA 2Q5HA 4LTDA 3RV4A 3VBCA 4EQZA 1YTUA 4HRXA 2NP7A 4ZCIA 3ONFA 1KF0A 3O84A 1NPTO 1ZSVA 1YQ9A 2LDXA 3H2YA 5TQ0A 3C4QA 4B79A 1R0SA 5LYJF 3UAVA 1RNLA 3UFXB 2BGKA 1OWLA 4MWDA 2QZZA 1DZIA 3FZEA 1VE6A 3OQJA 3EBLA 3HKEB 5K3EA 4QX6A 2D74A 3NASA 1EUYA 4KQMA 4QECA 3M4ZA 4N76A 1J33A 1XA4A 3LUCA 4F06A 4HFMA 1Z5PA 4MYCA 5IC5A 1FNDA 3DEIA 4BMXA 1HUQA 3KC2A 2W11A 2VK8A 5KYVA 4CFYA 3O92A 4KZPA 3WK8A 2JA2A 1HDOA 4DLWA 1SKMA 5KSYA 1ATIA 2GZHA 4E1BA 2O3TA 4ME6A 1E5QA 5EUMA 4BB9A 1LI4A 1R0XA 1KOLA 1L1FA 2F55A 1U2GA 1Q0SA 4PG4A 2J4FA 1XJ5A 4HAWA 4HMPA 4TMXA 4HDRA 2YWBA 4IJ5A 5DNUA 6ABPA 3J81A 2LWIA 3HY4A 5ER9A 5K0CA 3LIIA 2OHXA 4RY9A 2BJHA 3ZV4A 3PNQA 4G8BA 2XT6A 2N1BA 2CNDA 3H4IA 1L5MA 3OA0A 3RS5A 3DFKA 4RSHA 2ZBRA 4LC1A 4JT2A 2BMDA 2O5RA 3LBYA 3QVWA 1AX9A 1RMYA 2ZI6A 4Q19A 3TIVA 4I5DA 3D1JA 4FYHA 4YK7A 4UCWA 1FRFS 2BT4A 2XF2A 3DR3A 3EG9A 2CL5A 1P5JA 4G5FA 3T7JA 4U9UA 3W3AH 1UKEA 4AY4A 1ANKA 1II9A 1M8PA 2XTAA 1L2TA 1NVTA 1Z0AA 4KJXA 4LRXA 4Z3DA 5KNBD 1RWXA 1UPUA 1YRLA 3QBDA 4ILEA 4G5QA 1IM2A 3IEIA 2Z4RA 2JGJA 4WKGA 5I7SA 1RZRA 4RACA 2NUAA 4BAUA 4QDZA 4C0JA 3HYSA 1YHNA 2IIBA 4K8OA 4P4UA 5JRJA 4AMUA 2XJ9A 3DAYA 3OJCA 1G20E 1UPAA 3H5OA 2BM0A 3PXXA 5JCOA 4YR9A 1MRZA 5IYZB 1N75A 3E3AA 2FUG1 4NJOA 3WB2A 1NMZA 1E2FA 2KHZA 1AHNA 1U8TA 3LP8A 3E6AA 2NT4A 3S99A 4AKEA 1KVRA 3O21A 3QMPA 5ADUS 2ZT8A 5K0TA 4Z3OA 2RGGA 1STOA 3LVFO 2ZIXA 3B8EA 2MR6A 3WYEA 2NTYC 4GUAA 3B3AA 3IAM1 5EZYA 1OPRA 3VVMA 1UXJA 1B6RA 1QK4A 3KB8A 3PC2A 4D9CA 4DRXB 4TL8A 1AKWA 1Y4ZA 3B36A 5FAXA 5BRNA 1GR1A 4EELA 5FAKA 4G89A 1YI8A 1NC3A 1RVDA 5E38A 2HT1A 3HJBA 1UL1X 2G9QA 3IOCA 3R20A 5CX1B 2W6NA 1K6IA 2B0CA 4XGQA 3EW9A 5AKJA 3TWOA 3UO8B 4UHCA 3W8NA 1IYZA 1DEAA 1CQJA 1NFFA 1REQA 2PO7A 1GVNB 3CPEA 3DOCA 3LUFA 3WLRA 1V11A 4RY2A 2MMCA 3H17A 2AC7A 1WKBA 4D0SA 2DFPA 4UUNA 4U5XA 1QPZA 1GA6A 4LRWA 3T4EA 3MUOA 4EYOA 3VC3A 1AB5A 4Z54A 1XEFA 2JH3A 2A8YA 2YMQA 1QYDA 3QELB 1DKQA 2J5QA 4DRYA 4YJ2A 4IMRA 3M70A 2B61A 3REQA 4MB6A 3PRJA 2ZEJA 3NHSA 5KO2A 2NN3C 3UCXA 3ZUPA 1OILA 1YOVB 3H2JA 1L9KA 3QXXA 1W1UA 5LMZA 3LKVA 3N2LA 3PPVA 1HDRA 2AJ8A 1MQ9A 3F71A 3KZMA 4R1NA 1G6Q1 4UBOA 1DKUA 2C9BA 3EJWA 3RQSA 2BGMA 4NY1A 3HQ4O 5FFMA 5EWMB 2Q62A 1BSVA 2XWBF 4P5DA 3QEJA 3DB2A 5LOVF 2BELA 3T7CA 4EY4A 3BH7A 2AZDA 4DN6A 5EEHA 5AOBA 5K03A 3RIEA 10MHA 1W59A 4LSZA 2CXHA 2ZRIA 1H2WA 1LJ8A 1DPGA 1QCDA 3UQZA 2FZGA 1BD4A 1ECJA 1L7PA 1MEOA 4GZLA 3A1CA 4X1YA 1BROA 2EERA 4EO7A 4V0ME 1JIUA 3IIIA 1TLFA 2F3QA 4KWTA 4HHEA 1XU4A 4UM9D 2ZTMA 4YJKA 3RT1A 3GDHA 1E6KA 4JBNA 4HX9A 5AK5A 1BQ4A 1CUVA 2XCUA 3KK0A 3AUSA 3PWKA 1GL3A 5LJLA 3B9BA 4CZ2A 1B4DA 3ET5A 1T36B 2LBPA 3U3JA 1YO6A 2V7GA 4J1TC 3ZEAA 4QPJC 1ZU4A 4MWOA 4KN9S 2XAUA 2EG5A 3B5EA 2P4EA 3WRVA 5KNBA 3FZQA 2FFRA 4OHUA 1B8OA 5D87A 1NJ1A 3U44B 3L0ZA 1DG9A 3GRZA 2DLNA 5JXWA 4TLAA 1U94A 3DOOA 4IPTA 4NPAA 4IZ6A 5IUKC 3VR2D 1X42A 1A2KC 1C7FA 4J0KA 4JI3B 1I33A 4PNZA 2APJA 1ORHA 3CUEF 4JJIA 4LYEA 4MRRA 5DGHA 4IV5A 3HCPA 2CFIA 3C43A 1L7DA 1LCIA 1IB6A 3EIWA 3M1IA 4FKZA 4G1UC 3MERA 4D82A 4B7XA 1XZGA 1WW2A 3B7WA 4CQNA 2R8YA 5AKKA 4F46A 5AVYA 3S8YA 5FLXA 4HVAA 3WSWA 1DO8A 2HQBA 4NR0A 3S40A 2AQHA 2ID9A 4GVPA 5EPUA 1RYBA 3RASA 3G7NA 3MB5A 2BMFA 1GAQA 3UHOA 4MKRA 3T9EA 1OBHA 4IEEA 1E98A 2O7NA 4P93A 4N0DA 4Z99A 6REQA 2DXIA 4X66B 5G0WA 1N0HA 3ZUGA 4KK3A 2XUAA 1TC2A 3A3KA 1YI1A 3R3VA 3H83A 1ISSA 3DE2X 3FF4A 1B6SA 3S7ZA 3UWMA 3ZDEA 1MQSA 3AR3A 4R1PA 3L3BA 1T5TA 2PU7A 3BBPA 1XP8A 2DPYA 1JEQA 2EJBA 2WIFA 3MJSA 4BV9A 1XA3A 4MIOA 4EJSB 2IUEA 4RD2A 1FJXA 2P9FA 3WLIA 3ZY2A 3TSWA 4N4AA 5A4FS 4BWVA 1A7KA 4LBWA 2EWMA 2D59A 1O77A 5KINB 1KI9A 3A6JA 1SUFA 2IYRA 2PRIA 1TVCA 1UT8A 5ALFA 5C0OE 3EX7C 2FUEA 5H0IA 1MX1A 1NVDA 4HVCA 4EHFA 2W2TA 2PRJA 1IDN1 2GBFA 3E9YA 4IOJA 1GPLA 2P35A 2WKPA 1E2HA 2PGJA 3K9GA 3PWZA 1KQNA 1YQGA 2GWHA 4YH1A 5DM2A 1QUEA 1GAXA 1JDSA 1KR2A 1TPZA 3UC9A 4J49A 5CEFA 1GU7A 1NW9B 1SCDA 3IGFA 5EUBA 2IZ5A 2YIJA 1YZNA 2QZ4A 3A31A 3PEYA 1E32A 2HCBA 2NSJA 1DZ3A 2EL7A 3QOWA 4YJ3A 2A1TR 2WWWA 3U60B 1SCAA 3AF4A 3QWIA 5IDQA 1WSDA 4L3OA 2PVSA 2K87A 1CJBA 3BRCA 2WY2D 4AUMA 1O94C 4GG1A 1PR6A 4DMRA 3OX3A 1IH8A 3ODGA 1KAMA 2R8EA 3KD2A 4PO1A 2ZU6A 5G0UA 3GDWA 1J22A 2XTNA 2YZNA 2GF2A 4P7BA 5HIIA 3UT5A 3FOCA 1QLWA 2NUPB 2REOA 2V0CA 2WNHA 1MA0A 2XWJI 3X2EA 4F9GA 1BHQ1 4HC4A 1UMKA 1NP7A 2BFFB 2PUCA 1GPAA 2VP4A 1DTWB 2Z30A 3OZXA 5HQTA 2CFTA 3KELA 3F2VA 4KI7A 2G28A 2BEVA 2QUBA 2X5OA 3F2IA 3JRNA 3LWNA 2Q4RA 3HCDA 4FFRA 3GCZA 3VR2A 1LK7A 4GO1A 2Y1EA 3BTSA 4QOHA 3IMCA 1K8ZB 2XODA 4W5JA 4TV8B 5KAPA 2C82A 3O7MA 2GCGA 5ADHA 5JFGA 4RA6A 1Z37A 4QARA 2Y2UA 4Q3BA 2ORYA 2FWJA 3AM1A 1J5PA 3II6X 5DH9A 1CF4A 3V7YA 3BL6A 1W85A 4ZTZB 4MAFA 2PG3A 2XV1A 3GB9A 1MOSA 5FNVB 4C7OB 4NE2A 2C3YA 1SQFA 3EQ9A 3G49A 3CBGA 3X1YA 4NV0A 1UWVA 3IKMB 1JVSA 1PJ8A 1WB4A 2DTXA 2YC2C 3NWBA 3RK1A 3WA7A 4F3YA 4KFUA 2XVXA 1NF2A 4AMVA 3ZJTA 4O8ZA 3H2IA 1RU3A 2WIJA 4CR8A 1GKYA 4I4LA 3WGZA 2V55B 2OZVA 4GLOA 3Q2KA 1FDUA 5KPDA 1DRKA 2XWSA 3ITNA 2AWNA 2P65A 3GI1A 3HLKA 2NU7B 3DFMA 1FTGA 3ICOA 4JFAA 2DY1A 2WVJA 4AQ7A 1KEWA 4EPVA 1TUIA 1EP1B 1JQ5A 1A9QA 2NZVG 3DBHB 3GMDA 4M0MA 3OLWA 5BPFA 5BYKA 2ZSBA 3HYTA 3Q4GA 1L8AA 4ZZ3A 1VI2A 1NHWA 3NDBB 3NAQA 3INRA 4TLLB 3SQOA 3MEQA 2ACKA 1OC2A 5I3ZA 3O4FA 4CHTA 1FFGA 5ALRA 1WB5A 1GRQA 2UZ3A 3NRBA 4QKQA 2XJ4A 2HQ1A 2ZPUA 3BK7A 1XAGA 3JRXA 4FCCA 2ORVA 1T9GR 5K6AA 1KOFA 2XMCA 4Q9LA 4S3MA 1NQUA 1JU4A 3PSAA 4BECA 5DHFA 4YAWA 3KXIA 4ODIA 1ZWLA 3A32A 4B7UA 4QPDA 4QRIA 3OPYI 2G17A 1SVSA 2ASVA 4WMLA 5KEIA 3TS1A 4PC3A 4CBVA 1SVMA 2K2QB 4QQNA 1CQZA 4AP5A 1T9HA 1OBVA 2C9MA 2Y71A 4GKJB 1UEJA 3WGJA 1F17A 3JZFA 1B76A 4AN0A 2OCXA 1X9IA 2HO5A 1NBEA 2YJZA 2P41A 4MUBA 5LQDA 2H08A 2P3QA 4IDOA 3TBKA 1ZLXA 1C80A 5DHAA 1QGUA 1DNPA 2E49A 4C88A 3GHHA 3K0CA 1Q12A 5E4FA 3IPYA 3VX4A 4NEQA 2GAFA 2PLNA 3C1TA 4J43A 4FNGA 2FPXA 3Q7SA 4YNBA 5FB3A 5EC8A 5K3CA 3STVA 1KMNA 2P69A 2AOUB 2VDOB 4FBGA 3VTKA 5I9NA 1Q15A 2VZ9A 4JYPA 2O19A 5CG2A 4WW0A 1YFKA 4UUQA 3ZQ6A 1GWNA 1R4MA 2HCTA 3IXQA 4I6GA 4TSFD 5D6NA 4D0LB 1GILA 1K97A 2GN6A 3MW8A 3NT5A 2PGNA 4JHLA 4S04A 2JFBA 2PGLA 3Q98A 1G60A 5IEBA 1IN5A 1ULUA 2IK8A 5TVGA 1CE8A 1KZYC 3FSGD 3FTDA 4ENTA 2XCLA 4HQNA 2HZBA 4JH0A 1ZUNA 3SNHA 1V3TA 1AGRA 4E13A 2CEKA 2A0YA 2OB2A 1H1DA 4UHFA 5EWJB 4C6TB 3GPBA 3D54D 4YHBA 2QQEA 4MDYA 5BQOA 1UBMS 4DIOA 3NAMA 2UVDA 4P33A 3V4FA 5J4HA 1CEYA 2JCBA 4I1IA 2XEXA 1I10A 2X13A 2F7SA 5D7NA 1DLJA 3E8MA 4Q9KA 4C4TA 2YQ5A 1AKTA 2GCPA 3QXCA 4FI3F 1ETUA 1H0SA 3AT1A 3F4BA 1IY0A 2FWNA 3RS8A 4B40A 3A36A 4YV2A 4AX4A 2SHKA 1HL7A 3FOWA 3FUTA 3HDYA 3NHRA 4QULA 2P4HX 1HYEA 1KYXA 1QFZA 4NH4A 2XX3A 2X3UA 4UM7A 2J0SA 1N2XA 1EGMB 1DCMA 3ZX4A 2BRUA 3PP8A 1RAAA 1RXEA 4WZ6A 4IZIA 4BRWA 1M8JA 4EYEA 3MINA 2MYNA 2I4NA 2HMWA 1XJQA 3W4KA 4E6EA 2M6SA 1TCVA 3IUMA 1Y4AE 4FFDA 4Y6SA 4ZVVA 3HM2A 4B4UA 3GH1A 3H8VA 1SVWA 4WERA 1ECLA 2FXIA 4E5KA 3W7BA 4ZYXA 1QTIA 1TF7A 4EF4A 1WDMA 3FCYA 3STUA 1PT5A 4ETWA 2HU7A 3IXMA 4M7PA 2Y99A 5AVSA 4TMVA 5KWSA 5AUNB 2Z2IA 2XQJA 5CK4A 1OWMA 2IU0A 3C39A 3TW0A 3UICA 2BGLA 4LN1A 3T94A 3ON5A 4UE3S 2P5TB 2VCYA 2H4HA 2BKUA 5CM2Z 4XCXA 2I6XA 3A6LA 1C3OA 1XVTA 2JH8A 3UENA 4YLYA 1VHLA 4TPKA 2PQ6A 1PVVA 3RU3A 3WGTA 4RVCA 3HY3A 3TTSA 2FMTA 1FE8A 2HHLA 4XX1A 3DOJA 4AJ1A 5LP6F 4G9EA 4DA7A 4AKIA 4ZT6A 4HYEA 1ZOOA 1Q44A 1XT6A 3IP7A 2RC6A 3SXPA 1U4OA 4BX2A 1N2ZA 2POQX 1FSSA 4Y2QA 3IR7A 1IN7A 2ZWIA 3E82A 1S1CA 3T34A 5F2OA 3M1AA 4ID9A 1JBEA 4CRWB 2J6HA 4R0VA 4XJXA 2Q5LA 3UPUA 4U7HA 4BQEA 1VYVA 4Z53A 2WZBA 3QF4A 4NBKA 3QF7A 1IUNA 3I6BA 3WKAA 5K0SA 5L6LB 4EEZA 4ER7A 5D8DA 3WL4A 1P77A 3EZNA 1M2HA 2VJCA 1T1SA 5DV9A 4NG4A 2EV9A 3GT7A 1IXKA 4JZKA 5ENZA 2J0UB 3BWEA 5FFFA 1WU7A 1TQDA 3CPHA 1XLUA 4GT1A 4H7IA 4HB3A 4RUKA 2WAYA 1AO3A 1V7ZA 4TSFA 3KVOA 4UAVA 2FX5A 3S8MA 1QVRA 2FMHA 3OCJA 2XQVA 3BXOA 2AN5A 4HGZA 4MP6A 1CP3A 2YZGA 3CURA 2CF5A 3FSGA 5T5QA 1W0KD 1HDYA 4D1YA 1FYDA 2VTEA 4X97A 5EFOA 3Q1LA 5F77A 3CLUD 4M9QA 1PGOA 2ORIA 1YWGO 3GRUA 3JSAA 3QXHA 2DPMA 1AKUA 1A72A 2PUEA 4UJ3A 1DP4A 1DINA 1Q14A 1R15A 1T8WA 2P8SA 2PYIA 3PXCX 5GVRA 1WHSB 1HURA 3QPWA 2XZDA 4CLRA 3RYTC 1H1LA 2XMGA 2FAXA 2XUOA 3CLRD 4KDCA 2EF1A 1NJ8A 4K3UA 4QXPA 4GI5A 3HZOA 3LV8A 3N5KA 4XZ3A 3MD9A 2PE5A 3LGSA 1EFHA 1RZ3A 3JPYA 2AQKA 3RTBA 2CE2X 5ALSA 1AJEA 4NU8X 1CY2A 1WX1A 2DFNA 2DQKA 2IYUA 2ORWA 3IVGA 3K53A 3T4PA 5KNDH 4QM7A 3QNMA 3CJTA 2H5IA 4HMOA 4JSYA 2HMTA 2TECE 1JHUA 1K7FB 2PS0A 3E9NA 5ECDA 1XD2A 4G0OA 1GTG1 2Z1NA 4Q47A 5G1NA 1OKKD 3CXUA 5ALOA 1UWLA 2PLRA 3CUKA 4MPRA 2J31A 3L77A 1XTBA 4RW0A 2H1CA 4AMYA 5B3KA 5JAIA 5KUTA 1CUFA 3ZI4A 1GT91 3FG9A 2E4YA 2H0AA 2O0MA 1MVLA 1D2MA 4XD7D 3DNFA 5AI0A 3H5WA 1XMSA 2B94A 5DHTA 1H2EA 1EFVA 1P1KA 5JS7A 5CFNA 5EG5A 3PC6A 1THGA 1JG4A 4II7A 1CRQA 2JS7A 2H31A 4BP3A 3BJMA 1G8MA 2VNSA 1Q7CA 1XLVA 2ZJZA 4G67A 4QGBA 3U5ZB 2ZT7A 3COPA 4FSDA 1XWFA 2GF9A 1T4GA 2QYOA 4IGEA 7REQB 2F9FA 1MAVA 4HDSA 3QTTA 5JQGF 3NKFA 3DBRB 3PQ2A 4X84A 2VWPA 4D02A 2BZGA 2I2CA 1CQIB 4DR4B 1E6UA 4KVGA 4NBRA 2V6JA 4FYMA 3PIDA 3DXZA 5FXMA 1ZOSA 2FHPA 4Q1CA 2QQ0A 3Q41A 2VUTA 1DX9A 1MRSA 5SICE 1OOEA 1T0IA 3NAGA 2D5LA 1YI0A 2QLTA 4JT4A 1X7ZA 4UQOA 4OSOA 4EM6A 3CRQA 1MJFA 1QAQA 2BBOA 3D5QA 4GKBA 3OOJA 2R47A 1EXDA 5AVJA 2QI9F 4MA0A 2F8SA 1OLUB 3IOMA 1D9ZA 1FDSA 2E82A 1NXPA 3DE0X 3G13A 1T2CA 4GZ6A 2CB0A 2AMVA 1PAUA 3VMMA 3HRIA 4JNCA 2H2HA 3GPDG 2PXCA 4G0MA 4PZUA 5IJ9B 4WE3A 3U62A 4DC1A 4GEGA 3D7SA 4DFDA 2B3TA 4G37A 1D04A 4ALNA 2QZPA 1U8CB 4ZQEA 4R0NA 3MFYA 1B7GO 4R3NA 1FP6A 1MBZA 2JEYA 1GGJA 1UDXA 1X14A 4U7FA 4V0KA 3KXPA 4BZWA 3WGVA 4B3IA 4AQYB 2OGSA 2NU8B 3MJEA 5BNZA 3THWA 3N76A 3WLNA 1W0KA 3GJ5A 4KIGA 4LK2A 3RGGA 2BZ0A 1JPJA 3AVTA 3QKUA 3L82B 2HSDA 4Y8VA 5CB6A 1ADBA 1OIVA 1TM2A 2QEQA 1US8A 5JCXA 1U0JA 3G2HA 4B2PA 1A69A 1GFIA 1I5EA 1VC2A 1CRLA 1HX7A 2IIVA 4CCSA 4NEHB 3PQ5A 4DNOA 1O0BA 5ES4B 4PXSA 3WRYC 4D92A 4UD6A 3LS2A 2ZBQA 1DX6A 4KX5A 5TX7A 1NJ5A 3IKJA 5LIRA 3C7TA 1ZFNA 2WWIA 1NF3A 4UHJA 1Y3FE 3CA8A 5FR2A 3MBKA 4I6JA 5H3HA 1BX1A 3TW4A 5BN1A 1FRQA 2IU3A 2KI5A 2CJXA 3PQ4A 5ALGA 1E58A 3FI0A 4JVSB 4E03A 1Y5LA 4GGMX 2Z6UA 1FA9A 3JR7A 3I9NA 4J16C 2A33A 3CKYA 1O87A 4MV4A 3PXGA 5IKPA 3HO1A 4HAIA 1TEXA 4HZIA 2IXDA 3UGTA 2CYBA 1V2HE 3QU4A 2AJBA 1PUJA 2YRWA 3W6UA 1KY2A 1OKKA 1NWCA 1OYYA 4IUDS 4NOMA 1JJVA 4N1AA 4OB8A 4YTEA 1FU4A 3EF0A 1LPBB 3MT8A 4LNUB 5EN4A 4ZHSA 3DBIA 1VKHA 2ZWPA 3LUPA 5HBRA 4ZWNA 3P5BA 1J2TA 4TT8A 3ZH2A 1I7DA 4XD7A 4AJKA 4MO9A 4UKDA 2FSHA 5DN9A 3FJOA 2D1SA 1FY2A 5SYNA 1E9DA 4R68A 4RKEA 1OYVA 4QL3A 2QUIA 4RCYA 3QPBA 2NO1A 5ALLA 1FQKA 3G5MA 4MKFA 1SXJE 4L8YA 5LQUA 4KXNA 3M2TA 3MNFA 1JHZA 4LMBA 1BFUA 2GZMA 1RPNA 1U0FA 2A84A 2WOJA 4AUKA 2O8DB 2GWRA 2XTMA 3C6XA 2R6JA 1YIDA 4ENSA 2JLCA 1PG2A 5C8YF 3GG9A 5FBQB 3OMXA 5L45A 3BSFA 1M6WA 1XVLA 3EF3A 4LGVA 3TIFA 5BQXA 3BYZA 3PC7A 1P1HA 4EF6A 3KKMA 4O2LA 1FBNA 2YMMA 1RM4A 2VDVE 5CYGA 1Y8QB 4M86A 1N5IA 2QRVB 4Z7QB 2W6ID 1ZRHA 2LUOA 3NEJA 5AFSA 4C4AA 1TZMA 2UXDB 1UJMA 2Z4SA 1LDGA 3D7MA 2GPAA 4S05A 1JIQA 1ZJ4A 3A2MA 2IOHA 1ZBDA 4ATNA 3EAGA 3RFUA 4YT8A 1E62A 1XZCA 1T4BA 2MINB 1BMDA 2BV3A 3C8HA 3UB2A 2ZVJA 3GK3A 2FPGB 1IIRA 1KZ6A 1FP4A 1QC5A 1QQ5A 2YV4A 1RI1A 1ZP6A 1Z68A 4FFNA 4J4HA 4O4IB 5DNYB 1K3TA 1F6BA 4U5QA 5ES3A 3E1KA 1FZQA 2X0IA 3HXTA 4TMWA 3EBOA 2QENA 1ZGBA 3QW2A 2DUMA 2ZIVB 3NCHA 3OTHA 4O1MA 1BDBA 1E3SA 5AIAA 4FFBB 1F8XA 1F9EA 2A1UB 2RSLA 5REQB 1V1MB 3ULKA 3CN7A 4Q4HA 3STXA 1E7QA 4Y2JA 5CJPA 4BKRA 4WN9A 1XRRA 4WOJA 1NVBA 1Y1RA 5HRCA 4DLZA 2ONCA 1PGNA 4UHBA 2ADFA 5JSYA 5AVXA 5DHQA 4BNNA 5KVCA 2DKNA 3INTA 1AKVA 3FPFA 1ACMA 4M0KA 3NYIA 1G5RA 2VCEA 3P45A 4CHGA 3U9LA 4R2WA 2BY4A 2XKJE 3PNMA 4DLBA 5KHOC 1DHTA 4LYJA 1NN0A 5BVHA 4P9NA 3C6QA 3EVCA 2Y05A 4CT4B 2VJYA 4GWKA 1TU4A 3GA5A 3I01M 4IIDA 1DO0A 4I4CA 2QLNA 4JUAA 4R31A 3USES 5EZ5A 4WBSA 4FCTA 2A88A 1C81A 5EMJA 2XRFA 1WOMA 3UJDA 5TEVA 5ALWA 4V0QA 5HF8A 5B3AA 4DA6A 3AXTA 3HU3A 3OOEA 1KDOA 4Y1RA 3UFBA 3HA2A 5IG2A 4B74A 4LF6B 5GY7A 1C1HA 4EY8A 5AVQA 3PLNA 4JR1A 2P68A 5J2UF 3UUEA 3ZI0A 3ZZMA 3ABSB 2RGRA 5LOVA 4TZ6A 1DJNA 2QJOA 1IEQA 4AP6A 2G1KA 3ZVLA 3AXSA 3HWRA 2Q0XA 1NF9A 4N5LA 3IUYA 4EI8A 3P0EA 2VPQA 2ZJ8A 3JQ7B 3B6ZA 4JL6A 1DKLA 3L4SO 5ALHA 1S3GA 1VE5A 4IV8A 1UT6A 2YXPX 4PO3X 4GLFA 3WYCA 2OLJA 3B9QA 2QRQA 2ENUA 4MYTA 3G9ZA 2MWMA 4XWOA 3TOZA 1WDKA 2HWXA 4OYLA 4EPTA 3EPHA 4LFBB 4OBEA 2VZ0A 5AVVA 5IF9A 5H80A 3IDZA 2Q6TA 3KZKA 4N8DA 2NYAA 2UVPA 1UP4A 4G36A 4G5HA 1RRCA 3QYJA 1HG1A 1MO2A 2B78A 4FYJA 4R6XA 3OEED 3UY4A 4CETA 2W6IA 2QX6A 3TQRA 3HADA 1F4VA 5KOJB 3WTBA 2DBVO 2HJSA 2NTVA 1KYYA 3B3JA 3Q5DA 4KAFA 4X6LA 2ZJ5A 2HWKA 5AR1A 2XAAA 4JYZA 2AX4A 2BFDA 3DLIA 2QM3A 5JSKA 4C43A 2LD4A 3R0VA 1E59A 4PCLA 3QKWA 5LBIA 2R4QA 3KSZO 1PJ4A 2OHOA 4B6FA 4EFDA 4C4YA 2WUDA 1EEHA 1QH8A 2XIJA 2PUVA 2DJ5A 2PQMA 1JNXX 2C2YA 2E1PA 4DMKA 1OMOA 2OILA 2WDZA 3KWJA 3TQHA 2G9NA 3U0VA 3NR2A 5C4IA 2R0QC 3MPUA 2DWPA 4CT0A 1K4KA 1Z4PX 4Y6GB 1ZVMA 4TSRA 1XTIA 3GU3A 5GZ1A 2FEXA 4UFOA 3U7IA 3ZWWA 3LLCA 1UJ4A 3OPQA 1NXOA 4IP0A 3T7KA 1T0UA 4X61A 2OXCA 1NXSA 1Y89A 4C29A 3BWXA 4ISBA 4XPIA 3W9YA 2XNCA 3N2NA 1RKVA 5A2GA 5A2QA 2ZAOA 4D8WA 2C5SA 3T38A 3YASA 1KEEB 2JANA 3PXUA 3QVGA 4URUR 1NW4A 3QHQA 1Y6JA 2IDZA 1JNYA 4OK5A 3DMTC 4U2GA 1TM7E 3ISTA 2EP5A 3D6MA 3Q0EA 4ON9A 5KJFA 2SECE 3PJFA 5IYZF 2B2XA 2RHHA 2VKTA 3I01A 4OBBA 3ZW7A 5FUMA 3KL2A 2BL4A 2P2ZA 1RYFA 1YR8A 3KUCA 5DBEX 2LKDA 2OHIA 3T5MA 5JZBA 1MHPA 1GZ7A 1Z6AA 4QU9A 1LPSA 3E8SA 3KOUA 2JLXA 1FNNA 4YQYA 5CEEA 1J4AA 3IBTA 3CH7A 2O8NA 4ZKEA 3IMFA 4X0EA 4MEAA 4F04A 4C14A 2BMVA 5G40A 1QO9A 3B3FA 3IP3A 3PC4A 1O97C 5DNEA 5K3BA 2IKQA 2L2QA 3FUUA 3CUSA 1TNDA 3T4UA 5KQMA 2ZI3A 3RUEA 3TGLA 9MHTA 5CIWA 4ZMRA 5E9JA 4W9RA 4ND1A 4ZI5A 5LN1A 1UZMA 1P7WA 2OA0A 4EIWA 1SNYA 1RKBA 4WESB 4CKBB