2D3WA

Crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
244
structure length
244
Chain Sequence
b'MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent transporter sufC
molecule tags Biosynthetic protein
source organism Escherichia coli
publication title Crystal structure of Escherichia coli SufC, an ABC-type ATPase component of the SUF iron-sulfur cluster assembly machinery
pubmed doi rcsb
total genus 70
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d3wA00
3WMGA 1E9AA 1GM5A 2C9OA 1P9WA 1XPUA 4NYJR 2ORWA 1Y3AA 2ZR0A 4M1OA 4YXWA 2ZRMA 4V0LA 1GOTA 3U3OA 3KJGA 3UMSA 4IXMA 2CK3A 1XD2B 4NDZA 3RS2A 1QHIA 4C30A 5HKKD 1U81A 3VQTA 2CCGA 5FBQB 1FMJA 2E1RA 1BH2A 1ETUA 4RZ3A 5AR1A 1G16A 1S9HA 2ZR7A 4Q9HA 5GJWC 4AKIA 1U8AA 2WMNB 2H17A 4BFWA 2BC9A 2F43B 1JECA 4LCBA 5FOSA 1A2BA 1GKUB 1II8B 2ORIA 3LVRE 1XTIA 3QG5A 5TMPA 2GESA 4TLCA 2XJ4A 1FP6A 5DI9A 1KYIA 2IYYA 3H84A 1EESA 4LJYA 1R0WA 1YJ5A 3A4LA 4DDWA 3U4QB 2OEPA 3X1XA 2WJYA 2DFTA 3BWDD 4Q1AA 3CR7A 1SZPA 2IK8A 3QF4A 4Q03A 4DBLC 4IFEA 3TR0A 2CHGA 1KJWA 5FPSA 5CJ2A 5B57C 2IHBA 4TMXA 2IT1A 4H1VA 5EXTA 2YWEA 1KDTA 3GLHA 4XWOA 4DCVA 3U4QA 1SQ5A 2NPFA 3W8RA 4YMTA 1QHHA 4FCVA 3MFYA 2Q0HA 3K70B 1AGRA 1M1YE 1U0HC 2I4IA 3P32A 4HUQA 4DLXA 2XNDD 4TQUS 3DKVA 4A2WA 1OH8A 1VHTA 5EXXA 4KI0A 4WAUA 3ZVMA 2ZJZA 4DEYA 1OB2A 1ZIPA 2VP4A 1NJGA 3BB3A 3LXRA 2BVNA 1TQ6A 1PLJA 4LK2A 1ZJ6A 4B2PA 3VFDA 4X8OA 4Q7LA 4DCNA 3WYGA 2J7PA 4BFYA 5KSYA 3IIJA 2IYTA 1GFIA 2H16A 3SI7A 3GJ4A 5AK0A 2YOGA 4URUR 1L2TA 4B71A 4QHTA 2R6GA 3GLIB 3B13B 1XJCA 2J1LA 1N6LA 1E99A 1S96A 4AIIA 3P26A 1XEFA 4G5OA 1YRAA 1SXJA 1DS6A 5EP4A 2HT6A 2BMJA 1ZNWA 2XEXA 3T12A 1H8HA 4HB0A 1FPMA 4GRAA 1QHNA 4LBVA 3VKWA 5FH9A 1F2UA 3MJRA 4F93B 2GZHA 1Q21A 1J8YF 4P4SB 2ZSBA 2GCOA 2E9SA 3GEIA 4ACAA 2QMUA 2FFBA 3BERA 4JL6A 4JLNA 4ZDIA 1G18A 2ERXA 1UEIA 4DLZA 2B7CA 2C9CA 2QAJA 4GOJA 2ZRPA 4PZYA 2IX3A 1AJEA 1H8ED 1HQCA 4DHEA 4OQNA 3EA5A 2JCSA 4S35A 1N6KA 2H18A 4A6PA 2WWHA 3LX8A 5JBQA 4POAA 2AK2A 4NYJQ 3RS4A 3SJCA 4MGYR 2IS2A 4PR0A 5HPYB 5EE5B 1F2UB 3X2SA 3EWAA 2GWHA 2KJQA 4HEJA 1HE8B 1KJYA 4M1SA 1IXSB 1E69A 3O8BA 1GIAA 3SHWA 2VHCA 2B8WA 3DM5A 5C4GB 4D80A 3VHLB 5L3SB 2B7BA 2YJTD 4YMSA 3GLIA 5C18A 3DKPA 3TSZA 4Q18A 4Z8XA 3R8CA 3AVTA 1S8FA 5FPHA 5CDFA 1DADA 1Z0DA 1DG3A 4JLMA 4L15A 1YZUA 2CLSA 2FWRA 3IUYA 4QGAA 3D31A 1KZGB 3AF0A 1AQUA 1P6XA 1RRFA 3FTQA 4PSKA 4V02A 1XFAA 4PO9A 2ZI5A 2IL1A 1KSJA 1OXSC 2BKEA 1SVMA 4EJSA 1RE0A 3P1JA 2P5TB 4UXIA 1CLUA 4UNPA 3RS3A 4LSGA 3TBKA 5AWFC 5BN3A 2ZRIA 3AQ4A 3ADCA 4F38A 5GVSA 2EFDB 3E1SA 4M22A 1TQ4A 2IYQA 2OCBA 1RRPA 2GEUA 1QBKC 2CEAA 3CPHA 5KPJA 2QZ4A 1NVXQ 1T3HA 1TX4B 2QP4A 2H5EA 2QE7D 4I81A 4JLBA 4PANA 4E22A 4TTPA 1ZUIA 5AJXA 4PQFA 1KKMA 2PMDA 4OYHA 5DLQC 1CJTC 2ZJYA 3EIEA 1QHXA 1UFQA 4ITRC 1DAFA 2DFKB 3PIRA 1PV4A 1XJQA 1ZC3A 5TVKA 4KVGA 3MG9A 2WAYA 4DIDA 1RJ9B 4P31A 1G17A 3TE6A 4KXFB 3RDPA 4AURA 1XCGB 2CLDX 2IEZA 1OIXA 4RD6A 1CIPA 2OM2A 3N2EA 1T0HB 5HE8A 5JJLA 2J0UA 2VQSA 4HAWA 2KI5A 3QKRA 1G4UR 3AKDA 5JRJA 1Z0KA 3THXB 1LF0A 4LPKA 3BB4A 2ZI6A 2HLDA 4Q66C 2ZE6A 1QG2A 3U44B 3PEYA 5GJBA 1JJVA 3B1VA 5E7MA 2QSYA 2NG1A 1MO3A 5L3QB 4DJTA 5AUPB 2ODNA 4YQFA 1FP7A 2R2AA 4CT5A 1P60A 3RAPR 3LBIA 1WMSA 1EFUA 5JSZA 4OI1A 4YDHB 4DB4A 2ZTSA 3HPQA 4TQAA 3ZVRA 5HKKA 1NMXA 3BH7A 3HYRA 1ZC4A 4LV8B 3IIKA 1Z22A 3D8BA 4CYMA 3CM0A 521PA 4PC7A 1G3IA 2VTKA 4K81B 4BQSA 3B1WA 4X8LA 2O8FA 1C9KA 1P4SA 5LBIA 1G7TA 3DPUA 2D2FA 2TMKA 2QUZA 4Q1FA 3WRXC 1KTVA 2IYRA 3PV0A 5HTKA 3O8CA 3RS7A 2Z83A 3ZIAD 1KIMA 2OXCA 3QKSA 3UPUA 2GXUA 2WICA 3QPWA 1GWNA 2DBYA 4MGZR 3IEVA 2RCNA 4Q48A 4CT4B 4IOLA 4E07A 1FQKA 3CW2A 4BGDA 3CRMA 3FFAA 2BJWA 4TMTA 3GJ8A 3SYKA 2ZE7A 2RGAA 1D2EA 4XD7A 5EUQB 3EXAA 3UWOA 3U7GA 3KUDA 1Z6YA 5E7IA 1D2MA 3QY0A 3F3YA 4E03A 3QUSA 4CEJB 1Z0FA 2VP5A 2CLCX 3G82C 1A4RA 2BBOA 4W5HA 1OHHD 5BXQC 4FWIB 2JDIA 1DAMA 4HAYA 5JWHA 2X19A 3OIYA 1UBCA 3A37A 2NTYC 1A82A 3NBZC 4L9WA 1KNQA 3WP1B 2GJSA 2J59A 5J4KA 3DL0A 4HUQB 5BYJA 5FTKA 3J81k 4Q02A 2F3TA 3C14C 2R6FA 2VHTA 4GI7A 1XZPA 3V00A 1N0VC 5P21A 1N6HA 2B8TA 5IDVA 4HLUA 4XTCS 4CEJA 3R7WA 3PR1A 4R7ZA 4JLPA 4BLQA 3RANA 2A5JA 3ADDA 3LA6A 1JAIA 4FMDF 3Q7PA 3NBYC 2QMHA 4JT2A 1U94A 4BLTA 1ZD8A 4OL0A 4HB3A 4OK3A 1KK2A 3KTAB 2C78A 2IS1A 4EQ6B 2V6IA 3LY5A 1NJFA 5F2EA 5FUYA 3EPKA 4LHZA 1W5SA 3SFVA 3KUCA 4CGZA 721PA 3SC3A 2OBLA 5CDFE 2QROA 4E5UA 5FUWA 1F3OA 2F1HA 4B2LA 3TGPA 1JQLB 4BZXA 3OAAA 3QVVA 2ZI4A 4QM6A 2QAGA 2PLFA 3DOFA 4WW0A 3EZ2A 3QXJA 2UZIR 3OFNA 3GFPA 3K8YA 2IYZA 2RAPA 1NIPA 2HLDD 3C4JA 5BWMA 3GJ3A 3WYAA 4Q1BA 4EQ6A 4JYBA 4OI0A 3TVDA 3VKHA 3W34A 5CYOA 2PCJA 1RW4A 3KKPA 1XB2A 4D25A 2PEZA 4CRWB 2AD1A 3MCAA 4W5WA 1TU4A 1UBFA 5IHPA 1BKDR 1LS1A 2ZVPX 3W8NA 4DLYA 3T06B 5J4HA 3RABA 3BAFA 3TIFA 2Q21A 1T8UA 2Q9BA 1X8LA 5GJCA 2CK3D 4BASA 2F55A 3NWJA 4L4UA 1GRNA 1T6NA 2F43A 4R2IA 1GRQA 1CJKC 2ANCA 4IFBA 4DT1A 2PZEA 2VF7A 4TYWA 5BN4A 2GJAA 1P61B 2HDNB 4HDQB 3K9NA 3BK7A 1SXJE 3K53A 5TV2A 1ZW6A 2IHYA 3OIVA 2G1KA 4JIMA 4Z1MA 5K8TA 1DPFA 5GADl 2VSFA 2V4ZA 3K0SA 2QY9A 2D06A 3LV8A 4GDFA 2AD5A 1Z06A 2GBLA 1Q44A 2W00A 3QKUA 1G41A 3CH4B 1S3SA 4OJQA 1U0JA 3PG5A 3U5ZB 2X77A 1GITA 3AKCA 5CJPA 3F5FA 3TLXA 2QA5A 4FW9A 1JALA 3EZ9A 4JJKA 3VR6A 2IYXA 4JVSB 4QXAA 4AYTA 1YZKA 2OV2A 1KAOA 3HR8A 4M9XA 5KSOA 1NL3A 4DUGA 1GL9B 3AKEA 2JLRA 1OPXA 4ZCMA 4I99A 4RCZA 1NSTA 2D3WA 3T1QA 1M7HA 3I4LA 3KJIA 2ZUBA 5JS8A 2I1VB 3KKMA 2IWRA 4RD0A 2AXNA 4LC0A 2AKYA 2KE5A 2Z4RA 4JLVA 3GLHE 2O8EB 4DIEA 1VYTA 1CKEA 3ASYA 4RD3A 1IN7A 1JAHA 4MRRA 4B43A 2BDTA 3DMNA 2XOKA 2NQ2C 2C9YA 4IDQA 1VCMA 3KQHA 3M0EA 4FWTA 4BEJA 5FPKA 4TMWA 3NH9A 1WBBA 5TY0A 3NEYA 4ZV4A 1KDOA 3KQNA 3MD0A 3OE7D 4HLCA 1KI9A 2ZYWX 2MMCA 3K0AA 4KCGA 4FINA 4NYMR 2OFWA 2A3RA 4UXJA 1XNJA 3CPEA 2VO1A 1DE0A 2R65A 1G8FA 4OI4A 4MH0R 4MDFA 1QHSA 1ODFA 1NRJB 2C96A 1E1RD 4J0QA 4ZCIA 3EZ6A 2XXAA 2D7DA 4XVUA 3D6TB 4URZR 2PH1A 3EAQA 4RZXA 5TXGA 3QE0A 4L16A 2CHQA 3RC3A 2FJUA 2HYIC 2OESA 1AK2A 2WIAA 1FX0A 4XSGA 3ZZ0A 3M6AA 4M9SA 3EZFA 2F9LA 3I73A 4UJ3A 2WPDA 2J7PD 3PJRA 3QNUA 1E0KA 2CL6X 1L8QA 1VIYA 2G3YA 5F9FA 4RSGA 2GJ9A 2FZLA 2BOVA 2ZREA 1AA9A 4HZUB 5KNCA 4UQOA 1E94E 2XGJA 5C4MA 1QHYA 5KU1A 1W4AA 2FE4A 1E6CA 4JLAA 1E1QD 2HF8A 2GZDA 3K9HA 5CITA 4DWJA 1A2KC 3IHLA 2I3BA 1OIWA 1OFHA 1Z28A 4D0GA 2HCBA 4EPTA 1E98A 1TEVA 3KJHA 3OIUA 3E2IA 1KAGA 5HCNA 1XMVA 1W48A 2ONKA 3AH8A 1Q3HA 4BLPA 2QAGB 4Q4HB 2Q3FA 1L4UA 4YMWA 1T3SA 4D0LB 5J4VA 1ANKA 3FMIA 3BIFA 3GEEA 3EZ7A 4AYWA 3UIEA 3HR7A 3GD7A 4EPWA 3FVQA 3LLMA 5DI3A 1N6IA 3GP8A 4AKEA 2QI9C 1TL7C 3VX4A 3CKLA 5FOUA 5BQ5A 4QGHA 2PZGA 2QMEA 1QDEA 1E9FA 5KYKA 3KTAA 4BRUA 1TADA 3BB1A 3B5JA 4ZDKA 2L0XA 2AKAB 2R9VA 3K70D 4OBEA 3B1XA 2OHFA 1D6JA 2BCJQ 1E79D 1CF4A 2CMKA 2VLIA 3WYFA 3MJHA 1NBMA 4QOSA 1P9RA 3B1YA 4CF7A 2WPDD 1R7RA 1VECA 4GFDA 1AS3A 3VR1A 3L2OB 5IK2D 2UKDA 1T5LA 3AF4A 5K8IA 1XDBA 2VIIA 4OK6A 2FSHA 4LBZA 1DAEA 2NO0A 3K9GA 2O52A 1ZNZA 2FA9A 4ZI2A 2C2HA 4TSFA 2FF7A 1HQYE 2A5FA 2YYZA 1P75A 1W4BA 2PX3A 3DVLA 1OFIA 3DHWC 3KKQA 3KL4A 1CP2A 1U9IC 2YV5A 3WNDA 2V1XA 1Z6TA 3AUXA 2VEDA 3BS4A 5FOTA 4C7OB 1P2VA 2J46A 3PEUA 3IO5A 4KJZA 1OLOA 5CIQA 2EFHB 3QOFA 5UKDA 3GJ6A 1A7JA 1JEDA 4JSTA 5EP3A 2DWPA 4IRUB 1GVNB 2HEIA 2PL3A 2A30A 2XSZA 3CBQA 4HDOB 1E2QA 4LYFA 3GLFA 4HB4A 2OBNA 3B7GA 2P67A 2X1VA 4AG5A 4DT1B 3TUIC 4URWR 5HE9A 4JL8A 3GLGA 2ZSFA 2CXXA 3SZRA 3R8FA 3UG6A 2JLSA 2RMKA 1GKYA 3KB2A 3U61B 1QHHB 2JLZA 1Q20A 4QJ5A 1QVRA 3FKQA 3P20A 4IOJA 4JS0A 4TMKA 2JLWA 1XCMA 1OW3B 1E2PA 2X2EA 3T35A 5LDDC 3K0CC 3KXKA 1I4TD 4RKEA 3CWZA 4HB2A 4XWAA 3UXMA 5HZHA 1E2LA 1XEWY 1G9XA 3MRSA 5IF9A 3ZIAA 4LV5B 4NCIA 4MUBA 4DCUA 1DOAA 1XF9A 3F8TA 4PC2A 4BZQA 1TQDA 1XPRA 2FEMA 2P2LA 5DI3B 1KJZA 3OEHA 4HLQB 4A6XA 3MGCA 4HUTA 1CR0A 4Z51A 2ZYTX 3FHTA 1NMZA 3AVPA 4PAOA 1KI6B 4N0DA 4BZPA 4B32A 4Z1MD 3GLFE 1N6RA 5JJKA 1RVDA 5DYGA 2GEVA 1UDWA 5H68A 1MT0A 2ZIAA 1Z0AA 4QNRA 4CW7A 1E0AA 3F0TA 1M7GA 4QGGA 3U7EB 2JLVA 2PX0A 4QJ4A 4IOKA 1QZXA 2KSQA 3THWA 1N5LA 3TAUA 4D4LA 2QP9X 2ZUCA 5KOYA 4YONB 1XMJA 1GNPA 1R10A 1YKSA 4PAQA 4I1UA 3LLUA 4M1WA 5E3HA 2WWYA 2OG2A 2REOA 3MLEA 3TW4A 2IYLD 2ZPTX 1RYHA 1ZM2A 4GOXA 1WE2A 2ERYA 1T9HA 4IVRA 4RY2A 1VHLA 2V7QD 2VP2A 3QXSA 3B1ZA 3PVSA 5KSPA 1W36B 3HJNA 4QBFA 1XEXA 3QENA 2CDNA 4MYUA 3RSLA 1NBME 1QF9A 1LTQA 4OHXA 2J5XA 4TZ0A 4PPFA 4P0TA 4A4DA 3LO5A 3IHWA 4FMCF 221PA 1DBSA 4OQFA 4TL7A 1KSGA 4HDCA 1ZRHA 1K5DA 4WOPA 1N5JA 5ANRB 2O8BA 4HZIA 3CNLA 4LPSA 4G1UC 1XXHB 4JKYA 2X2FA 1SVOA 4AK9A 4MYHA 4A15A 4C2TA 1VIAA 3BH6A 1P2TA 1YR8A 4TWZA 2GXSA 1W2GA 2QSZA 2N1BA 5AJZA 4B74A 4YMUA 1EFRD 1XD9A 2AX4A 2WJGA 2AL7A 4G5SA 3W5IA 3HU3A 4EKDA 1G8YA 3WY9A 1ZM9A 3B9PA 1E3MA 2WKQA 5FOVA 5JS7A 2ZAMA 2FX3A 2ODBA 2QORA 3LQQA 2QEQA 5A4JA 4HAZA 2CL7X 1Q1ZA 5EJEA 2QM7A 1HV8A 2WKPA 3GMTA 5FR2A 421PA 2QBYB 1R5NA 3CRRA 1CBUA 2V9PA 4A0FA 3LRPA 3VU9A 3ZLJA 5BYKA 3I3SR 1C4OA 5B2ZA 2NO1A 1Q57A 5CK4A 3SOPA 5K8UA 1JJ7A 2WV9A 4ABYA 4OQXA 2FOLA 2DFLA 3A1VA 1AM4D 2G0TA 5BW8A 1WBDA 4TT3A 3VR4A 2GF0A 4XVRA 1YR6A 3LBHA 4Q7KA 4D82A 3MWYW 4DDTA 2EVWX 2FFAA 1JR3D 3HU2A 5KUTA 1TNDA 1NN1A 3FWYA 3KKOA 3TJZA 2KBFA 3SJBA 3VTKA 1NY6A 1TMKA 1WCV1 4A92A 4QRHA 1Z0IA 2XB2A 4ARZB 1E4VA 1W46A 3PENA 3QI2A 3FDIA 1NVVR 5JEEA 5LPNA 2WWGA 2NO7A 4EAQA 5LD2C 4R2HA 1W5TA 1SVIA 5FBLB 1DAIA 1RZ3A 2QENA 1UKEA 3DM9B 1OJLA 1ZIOA 2AFHE 4CEIA 3H2YA 5FBVB 1E2EA 3S1AA 1Z2CA 3OF5A 2QPAA 2WSSD 4QKQA 3AVWA 2MSEB 1U0LA 1JXMA 4B6FA 4C0KA 2LKCA 5C46F 4Q19A 3SQWA 1G64A 3TR5A 2WMOB 4TTQA 2FGJA 4DLUA 4QJ3A 4HAVA 1KO8A 2ZI9A 5KDDA 4NCHA 2IW3A 4QG7A 3A1SA 4EFNA 3BH0A 4BFSA 4K46A 4MGKR 3IILA 5FTLA 2BM1A 1ZYUA 4V0KA 3TQCA 4Q4JA 3K0FA 1GILA 4RFSB 4EPYA 5FBRB 4D26A 4UNNA 2FNAA 2F3RA 4Q9JA 5AUOB 2JA1A 4P4TA 1JR6A 1TF5A 2WWWA 3EA0A 3W6OA 2XNDA 3GJ0A 2KBEA 2DPXA 4M0LA 2QL6A 1UAAA 3EW9A 1MV5A 1E9RA 2ATXA 4EJSC 4EUNA 1CTQA 3ZGXA 3IPXA 2PCLA 4UNQA 2RHMA 4P33A 1W2HA 4URXR 4C9BA 3MAAC 2A78A 2DCUA 3ND9A 1Y63A 5E7JA 2D4HA 4W7SA 1IN4A 1R0XA 1Z5ZA 4AD8A 2IYVA 2D7CA 1OFTA 4X8MA 4DKXA 1JXOA 2HUPA 3THYB 2GVZC 1ONBA 3I32A 4NHOA 3JZAA 1YZLA 1BYUA 1UADA 3N70A 3EG5A 3T5DA 2WWFA 1R5OA 2O8DB 2XZOA 2H92A 1FQJA 4F4CA 1T4GA 1EWQA 1SKYE 2GCOB 3QEJA 3EASA 4DRZA 2V1UA 4DLTA 1G7CA 1HTWA 1LF5A 3LAWA 2VP0A 3ADBA 2ZR9A 1KSHA 2BHRA 3I61A 4B3CA 2IA5A 1G6OA 3PCRB 2O8CA 1MH1A 2DWQA 3IGFA 3KQUA 2G6BA 5DE3A 2JAQA 4ZI3A 4GP7A 3PUXA 2NZJA 3UK6A 5L3RA 3GPLA 1RYFA 4CEIB 4RD1A 4DUGD 2D2EA 1HEIA 5J47A 5JEDA 4DC9A 4KFTA 1V43A 1ZBDA 1NI3A 3NVAA 3NH6A 1EK0A 3KXLA 4Q5IA 5G41A 1AS0A 2JGNA 3PEWA 1TU3A 2XOKD 4FMCB 3TK1A 4NCNA 4JSYA 5JHHB 1CJUC 2XTMA 5EE1A 4IW3B 1ESMA 5F98A 4BFZA 4LJ6A 4TLEA 1VMAA 3SS8A 3NDBB 1E0JA 2OFXA 3B9QA 2YWHA 2EWVA 3B78A 1WA5A 8OHMA 4TYYA 4PZLA 4M9ZA 1SVSA 4G5GA 1PLKA 1KI3A 1EFCA 3BXZA 1BYIA 3PUWA 4MA4A 4N0EA 4Q47A 5L3VA 1MOZA 1VCIA 4PQRA 5L3QA 3RRYA 4XWKA 3EPJA 1FUUA 1AIPA 2P5SA 1KGDA 4PHGA 4C3ZA 2WVJA 2VF8A 4WBSA 5F9HA 3W3AA 4LJ8A 5AJVB 5A0FA 4Z8YA 2ZI3A 4BUJA 3U2QA 3THYA 2AFIE 4B34A 1YZQA 5SZKB 4IVQA 3O8DA 1N6OA 3LD9A 5CB6A 5J5CA 4ZDWA 3A4MA 5FL7A 5SZIA 2QPOA 2BWJA 1ZMXA 1KK3A 1GZSA 1UM8A 2OBMA 2ZS8A 1CJVC 2NO9A 4NU0A 4B2IA 1JPNA 2BEJA 1D9XA 2J0SA 4JLOA 1MRSA 2VH5R 4DVGA 3CRVA 4QFMA 2BMEA 4O3MA 2QN6A 2LKDA 2JLQA 1P3JA 1IBRA 3CX6A 1YZTA 2FPLA 3P4XA 4BFTA 3WP0A 1S0UA 4R71A 1J70A 2OCAA 4MGIR 3AP2A 4GMDA 2ZRHA 5DHAA 5LB2A 3EX7C 4Q01A 1NIJA 2JLYA 3FFBA 4WIAA 1Z2AA 1E2DA 4X8HA 4HAXA 2GJKA 3C8UA 1KK0A 1JR3E 2HXSA 3RWMB 2JJ8A 4RCYA 1QRAA 4M9QA 5GVRA 1G3MA 1UJ2A 3DZDA 1P9NA 1M34E 4Q7MB 5FUVA 3W9YA 3CH5A 2G9NA 4AI6A 1XMIA 1F2TB 2JASA 1XTSA 2KB0A 2ZYUX 4OHVA 4DSOA 1W0KD 2GJ8A 2ZJBA 3K9LA 3Q3JB 4DLVA 4F7WA 1SGWA 3FKSA 1JI0A 3I8XA 4RD2A 3SNHA 3TVTA 4JBWA 2BMFA 2XB4A 1JQJC 1KKLA 4A1FA 3T61A 3CF0A 2Q6TA 5EQTA 1MABB 3NC1C 3GEHA 4C0BA 2FGKA 2NPIA 4OQMA 1Q1BA 4KLNA 3HDTA 3DEFA 1U90A 1NNEA 1BOFA 3PUYA 4DEXA 4TMVA 2ZE5A 3FYHA 1F6BA 1N6PA 2IUTA 3FMFA 3GFTA 4LRWA 5KSZA 1KSFX 2GK7A 2ATVA 2CL0X 4H1UA 3TKLA 2QU8A 2ZSDA 3SBDA 3QBTA 4IXNA 2B92A 1WDTA 1EXMA 1COWD 1MABA 3TAHA 2ZQ5A 4M8NE 5FTJA 1G8PA 4MRVA 4CVNA 5JCPA 5DN6A 3AKYA 1NVWQ 4IHQA 3JZMA 1S1MA 4MITA 1GDDA 1Z0JA 3BE4A 1UPTA 4NKRA 4G3XA 1R6BX 1OE0A 4V0NA 2REBA 3WMFA 4B3FX 4CEHA 2Q9AA 1D5CA 2FMXA 3I8SA 2F1RA 1OKKD 4IVPA 1IY1A 4A2PA 3SE0A 4II7A 2P3SA 1II0A 4M1KA 1FMLA 5JECA 3B6EA 3EPHA 4XD7D 4DXAA 4AWXA 1G5TA 1LV7A 1TUEA 1KMQA 2DR3A 2IYSA 3TUZC 1KMHB 2G88A 1ZAKA 1P62B 2W58A 4B3GA 1XMSA 1GP2A 2FU5C 2WJIA 4ACBA 2OILA 4PX9A 3T1OA 3GLFB 1VG8A 3IQWA 1YRBA 4EPXA 4TYPA 1XTKA 2P65A 2C04A 4Q00A 2H1LA 1ZP6A 1U9IA 1E2FA 1VG9B 3AGQA 3I5YA 2P6UA 4LYJA 2V7QA 3L0PA 3PXGA 2Z0MA 5SZJA 1P73A 3ASZA 4MQBA 4MRPA 2AXPA 1W36C 4JVMA 4JVLA 2V6JA 4KFRA 2ZSEA 4LC1A 3GJ7A 2OO7A 4PZZA 4MKGA 3AF1A 3GLIE 2E87A 2IXEA 1LB1B 3FB4A 3REGA 4NONA 2GAAA 3KFXA 3MWJA 2IXFA 1AGPA 3CRW1 2LWIA 2RHDA 3L8ZA 4G0NA 2YC2C 4L9SA 3QPUA 1KK1A 1YZGA 1PVOA 4G5QA 4JYCA 1FTSA 2ZRFA 4LJ9A 5SZHB 1AQYA 1AN0A 2ZAOA 2F7SA 3OESA 3Q72A 4FXPA 5DO9A 5M04A 2OUKA 2VHQA 3L82B 3IO3A 1OXUA 3NTUA 4O2RA 3WNBA 2O0JA 1G6HA 2R6CA 2J87A 3L0IB 2C77A 4B3DA 4BECA 4KITB 2ZROA 3EARA 5B30A 1IY2A 1F5NA 3DOEA 2J0QA 3RYTC 2H7VA 2JJ1A 5FL7D 3UMRA 3WHLA 2QRNA 3IKJA 4EPVA 2PMKA 1O87A 3C16C 5DNYB 1NMYA 2C5LA 5JWRA 2DHRA 5FL3A 1HE1C 2H8KA 4JJZA 2RB4A 1E9BA 4PHHA 2V8OA 3FE2A 1B0UA 4CDGA 3FGNA 3M4YA 2D74A 3IIMA 1N0UA 3KZ1E 3AP3A 2VHJA 4WVFA 1K6MA 1E9CA 4KAXA 4MKIA 5E4FA 3NC0C 2PEYA 1ZUNB 1ZNXA 2FPMA 3FHCB 1FFHA 4JKIA 3A1UA 2Y8EA 2ZRGA 3W6NA 4D4JA 2VHUA 3BFKA 1T5IA 3NDPA 2CJWA 3VNUA 1XU4A 2C95A 2G1JA 2XNSA 4LJ7A 4Q4AA 1W47A 3SBEA 4YMVA 4KO8A 5D3MA 3KQKA 3AVQA 2FH5B 1SHZA 2G0NA 2QG6A 4PHTA 3K09A 2VYFA 2BJVA 3Q5EA 3U3MA 2Z5FA 1G3QA 4PTLA 3OHMA 3AB3A 2QPTA 4BE7B 4TTRA 4DCSA 3KX2A 2VRWA 1KI1A 1XD8A 4KBGA 5EXSA 2VPPA 2ZRDA 3VHXA 4O0MA 4LJ4A 4TYNA 1UEJA 4LHVA 3RWOA 2IF0A 1U2RA 1OH7A 1PUIA 3ZZTA 1HYQA 2XZLA 2VSOA 3TMKA 1US8A 3I5XA 3V4RA 1YU9A 4CIDA 3AVVA 1U98A 5IT5A 4CZ2A 5AJWA 4TL9A 1VCOA 3ZS9A 1AKYA 4LX0A 2CNWA 2QGNA 1ZM3A 1OKKA 5HCIA 1E0SA 3WBKA 3ECCA 3R9XA 1C1YA 1HT2E 1NBMD 3GJXC 1FZQA 3MUFA 4V03A 1U99A 5FTNA 3LNCA 2DYKA 3QKSB 5A5GA 1T91A 2DB3A 3TNFA 2ZU6A 4GL2A 1SHKA 1UDXA 4RVCA 2VSXA 4DZZA 4LI0A 1FTNA 1RC8A 4G5RA 2O8CB 4MKHA 1M2OB 1TUIA 1W44A 3CUEF 2QT0A 3K0CA 3V4FA 4KFUA 2ZRCA 1BMFA 4HSEA 3UG7A 2OLKA 2YOHA 4OHWA 4HATA 4B6EA 1PUJA 3KXIA 2CE7A 1JNYA 4PXAA 1XTRA 2WM9B 4PAMA 4B3XA 1CXZA 4B35A 2JATA 2C03A 4DLWA 4OJKA 3T34A 1NSFA 2CCJA 1R5BA 1LNZA 3U6BA 1KY2A 2KWIA 2ZJAA 4K8OA 1W49A 1R4AA 2JEOA 1W4CA 1E2JA 3MWKA 4XTRA 3NIBA 2A5YB 2DWOA 3TQFA 4L5BA 4M4SA 5EE0A 1OT3A 3CONA 1IJFA 5JI2E 1XTJA 3FPAA 3FMPB 4O2LA 4JZKA 3I62A 1UBEA 5JZVA 4NH0A 4LZZA 1Q3TA 2A2ZA 2W83A 5C1BA 5CK5A 4AKGA 2QTFA 4B75A 2F9MA 4QBGB 2A5GA 1NP6A 4D6PA 3W3ZB 1KI7A 1EFTA 1WB9A 1XEWX 1KO5A 3I72A 3KKNA 1CRQA 5FUXA 4D0NA 3QKTA 3U3KA 2IYUA 4KHZA 2CVHA 3IBGA 2WSSA 1WRBA 5E95A 3BGWA 5B58C 2ODEA 3L8YA 4ASUA 2YVUA 3ZYCA 2OZEA 4KLZA 1W4RA 5G3ZA 4LUCA 5CM8B 2ZRKA 4O25A 2F6RA 2IS4A 2IXGA 1IN8A 2OXRA 2EYQA 4U00A 3X1ZA 1I4DD 4U5XA 1SKQA 4RD4A 1KMHA 5DGXA 1OH6A 4IEIA 1IXRC 1G8HA 4GBMA 3NKVA 1E1RA 2QTHA 2YC4C 2ZUDA 3HYTA 4V0ME 5GJVC 5AUNB 2R44A 3O8RA 4M1MA 4A36A 4NBSA 4OK5A 1G291 1ELOA 2HF9A 1PLLA 1KY3A 2VL7A 4XJXA 3CO5A 4IKEA 2WTUA 2BMDA 3BOSA 4WXPA 1J7KA 3CZPA 1CR4A 4BLOA 3NHAA 4UNRA 1Z07A 4A0GA 3R9WA 4XSHA 1V5WA 1Z6GA 2NMVA 1Q1QA 3IQXA 4JLKA 3Q7QA 1JPJA 2GTPA 2MSCB 3MSXA 4R98A 4KU4A 4GSYA 1O3YA 2F1JA 3E5HA 1IOZA 4YXWD 5AUQA 3SHFA 4AC9A 4HAUA 3EC1A 4WA7A 4TZ6A 3PEVA 1UKZA 2RGNC 3WBJA 1WF3A 4C4PA 5DN6D 2FSGA 1OF1A 2YKGA 1J90A 1ZINA 1EFRA 1I2DA 1KZ7B 3TW8B 3Q8XB 4A2QA 2JLXA 2AHOA 1NLYA 4HLUC 4QM7A 2BCGY 3EIHA 1P2SA 5H1YA 1BMFD 4JLDA 4PPGA 1Z3IX 2NZ8A 4RKFA 2ASEA 2GK6A 2WJJA 4AY2A 1ZVQA 3LH5A 2IEYA 1UKVY 2AWNA 1HY3A 3R7WB 4DLRA 1PZNA 4LHWA 4C0QC 2IC5A 4JT4A 3RS0A 4L8GA 5FR1A 1IQPA 1VKJA 1IN5A 1OV4A 1G4AE 3G5UA 1TPZA 1XEXB 3C41J 4ZPXA 3MMPA 4JLJA 1CRPA 2JLUA 1NVVQ 1SXJB 1ZUHA 2GA8A 1W0KA 5KNDA 1OYYA 3ZVNA 1GSIA 3AM1A 4LWZA 2LCFA 3ZH9B 3LW8A 3RNLA 3K1JA 2YHSA 1KO1A 4UXHA 4WXRA 2NGRA 3VMFA 4UKDA 3BRWD 3FOZA 2R6AA 3TSWA 4C0SA 4BRWA 2WAXA 4BFVA 2A5DA 3TSOA 1EX7A 2YZ2A 4C7OA 1Q22A 1WP9A 2DY1A 1NN3A 3QXCA 5CYPA 3NBFA 4WZBE 2WHXA 3ZJYA 1R8QA 2EYUA 4NCKA 1ZD1A 4W9MC 2W6JD 1E4YA 3M1IA 1A5TA 1R0YA 2FDCA 4XIGS 4LBYA 3EIQA 1Z29A 1NG1A 2O0HA 2YINC 3AVYA 2ZJOA 1BO6A 3GFOA 1LFDB 4P4UA 5FTMA 1E96A 1FOEB 1VDZA 3CF2A 1HH4A 4KYUA 4PPQA 3TUJC 5CLLA 3WNCA 3X1YA 1JBKA 1DO2A 1CR2A 3RSOA 5KDOA 3KQLA 1DELA 4AG6A 1K5GA 4NYMQ 2CJWB 2GEDA 4KV9A 2IWHA 4ZIRB 4LBWA 5FI1B 4AKHA 3GJ5A 4LHXA 3THWB 1OB5A 2RGXA 5EZ6B 3QSYA 1TF2A 5FPTA 2BBSA 1GKIA 3N2IA 1KHTA 4TL6A 2XZPA 3C7KA 4N1AA 1RRCA 2HCJB 2GBLC 2AN9A 4FMBB 3U44A 3D3QA 1XJ0A 1GAJA 2GZAA 4A0RA 4UJ5A 3THXA 5H8WA 3RVBA 2V54A 1KI6A 3EWSA 3RHFA 1IONA 1UF9A 3OEEA 3OZXA 2P0EA 4PO8A 3U7FB 2FV8A 4TYQA 2A7QA 2AR7A 5JHGB 4QC2A 2WIBA 2ANBA 4UNSA 4EPRA 3G0HA 4BFUA 1NLZA 5BN5A 3VR2A 1Z08A 2ONJA 1OFUX 1X86B 1X8KA 4KSCA 4B73A 4YDSA 4QL3A 4TMZA 1CULC 5JWOA 1CJMA 1YR7A 5FI0B 3SYLA 3NEJA 2GKSA 4FIDA 1TQ2A 2FFQA 4HLDA 2RGCA 2XX3A 3T1TA 2J3EA 3P4YA 2NIPA 4LGMA 2WJHA 2AWOA 5DIFA 1VYVA 4ON9A 5KNBA 4B76A 1Z6AA 3QVUA 3R9IA 2ZI7A 1I2MA 1COWA 1KI4A 2J45A 3AF3A 5FFMA 4ESHA 5JSZB 5G53C 1KO4A 2IUUA 4EJSB 1N3BA 2CHVA 1XPOA 3AVUA 5DH9A 5J4LA 4D2IA 4C0HA 1Q12A 2QAGC 4GP6A 4TT3D 3BD9A 2GETA 3QJYA 5EE3A 5B64A 4URVR 1HA3A 2ZJ2A 3B8HA 3LFUA 1Z63A 5DISB 2ZANA 2OFOA 5HR5A 2HJVA 2MSDB 3EC2A 1NY5A 3FMOB 4TLBA 1SVLA 1ZM4A 1T8TA 4FD2A 2V55B 1VYUA 4ESVA 3TRFA 3ZD7A 1E79A 3KDSE 4US2R 2WWIA 2JIZA 4FCTA 4QBIA 4RZUA 3FKSD 1J2JA 1Z8FA 2OCPA 4GMXA 4XVQA 2UVQA 4ILEA 5LD2B 4EFLA 3LW7A 1X6VA 3X1DA 3A6PC 5HZKA 4NCJA 1SVKA 3THOA 4M2LA 1N5IA 4KVAA 1DG1G 2OSBA 2FPKA 1T3LA 4S2EA 4C0AC 1U8YA 1BIFA 1DO0A 2ODWA 1KNXA 3P27A 4FN5A 5EP2A 3CB4A 1L4YA 4GT1A 2REXB 2YWGA 2QBYA 2GHIA 1UBGA 2EFGA 4ZKEA 2OCYC 3X1WA 4Q1CA 2OAP1 4FMDB 4KBFA 2ZRAA 3GCGA 2GRJA 2W2XA 2J41A 1X8JA 4XH9B 2OAQ1 5J40A 1SXJC 2IBMA 2JJ2A 2BBTA 2W0SA 4WZAE 5CLQA 4PQYA 2FG5A 4C2UA 2PJZA 2X8AA 3K0FB 1MKYA 3H4MA 3GLGE 1VTKA 4RJLA 4JMPA 1OXVA 2ZYVX 1R2QA 2ZVQX 1YR9A 3A4NA 1L7VC 3AEZA 3VR3A 1FNNA 2NO6A 2QT1A 1PJRA 4IOMA 1OXTA 1AZSC 4NYIR 821PA 2C98A 2J0UB 3C15C 4IDPA 3LXXA 4B3BA 1VG1A 2K5UA 5D3QA 3U3JA 4M1YA 1NKSA 1XWIA 3VX3A 5KTYA 2ZRNA 2ZETA 1JB1A 1YVDA 3UATA 1E1QA 1MO6A 1KI8A 2BBWA 3EPLA 1LS6A 1RJ9A 1KOFA 1YZNA 2WJVA 2VBCA 2GCPA 1F2TA 4KODA 3ZVLA 3ETLA 2DFNA 2Q3MA 2EFCB 4QHYA 3CWQA 3PFIA 2G83A 4B47A 4D81A 1ZCAA 2I1QA 4Q1EA 2N42A 1XBTA 3RC8A 2VA8A 4P32A 4F4JA 1D2NA 3ICQB 1M8PA 2O5VA 1BS1A 2GF9A 2BV3A 2ECKA 4QGFA 2P6RA 4ASUD 2FZ4A 3ZZUA 1XTQA 2HV8A 3GLHB 3SEAA 3ONWA 5JCZA 3ZD6A 2RKOA 2EW1A 3AF2A 2QQEA 2O0KA 3O47A 4OI2A 2IYWA 5F3WB 3B60A 4LY6A 1OSNA 3UWKA 4MUAA 4RFVA 3C5CA 3N5CA 1FNMA 4DCTA 1EGAA 1ZCBA 3QF4B 4C0JA 3QBVA 2W6JA 3AUYA 4ARZA 4C0LA 4E09A 2C99A 2O8EA 621PA 2ZE8A 4F91B 1M7BA 3R20A 2WOJA 4LHYA 1F48A 2ZRLA 4I1VA 4LJAA 3K09C 4NE2A 1GNQA 2N46A 5EXPA 2CNWD 1VCNA 2R8RA 3A1WA 3RRMA 4D4MA 3LWNA 1MRNA 2OT3B 2XJ9A 5K8LA 3JVUA 1DTSA 4PSVA 3D7MA 3QXHA 5FOXA 1NG9A 1XP8A 2W0MA 3DDCA 5H70A 3B82A 3ADKA 1XRJA 3VAAA 4Y0AA 121PA 4ZKDA 2FEOA 2RGNA 1H8HD 1NN0A 2EFEB 2Z43A 4NL4H 1NN5A 3VKGA 4Q1DA 1P7CA 1CEEA 4OHZA 4IEEA 4DSTA 1XXHA 3K70C 3CF6R 3A8TA 4ERNA 1YHNA 3NXSA 2EU8A 4JBXA 4DDUA 4HYYA 1I4LD 1NF3A 4R9UC 1XZQA 1TAGA 4Q9LA 3OE7A 1US8B 3L0SA 4QHSA 1F60A 4QBHA 1ZU5A 4BEBA 1CS4C 2QQ0A 4GZLA 2XTZA 3A36A 2BIFA 2ZJ8A 4URYR 5TB5A 5LB4A 1OXXK 5KO2A 3BJIC 2VP9A 5G40A 4A8JB 1W0JD 4BLRA 3U3RA 1Z47A 3QF7A 2GNOA 4NMMA 1GNRA 1GL7A 1N5KA 2J0VA 3AP1A 5JRZA 4B33A 2QTVB 1EG7A 3I92A 1H8EA 4OKSA 4A0HA 1CR1A 4GPTA 1SKYB 2EQBA 2GILA 1AKEA 4G01B 1AZTA 3LQRA 3RS5A 2WSMA 1G5RA 2W2TA 5JMTA 3JVVA 5D3MB 2FSIA 3LX5A 3PITA 1G1MA 2PT7A 3A1TA 1ZM7A 2W6ID 4MDEA 1CU1A 2SHKA 4PSAA 5ELXA 1IN6A 1S9DA 4LYHA 5J4YA 5IK2A 3OIWA 4DLSA 1X1RA 3Q5DA 4ZDJA 1W36D 4BFXA 2W2VA 1KDRA 1UKYA 1G3UA 1ZU4A 3B85A 4DSUA 1N0WA 3KB1A 4P3YA 4I1OA 1RPZA 3BORA 1NVUQ 4GNKA 4BLSA 5EP1A 3CZQA 3DZ8A 4FI3C 2Z4SA 4PO1A 1Q0UA 2YNMA 4PC1A 3E70C 1X1SA 2PZFA 5FPYA 3CNOA 4V0OA 4LYAA 3SU8A 1R8SA 1YQTA 4FCWA 3RLFA 4U02A 2A9KA 2CVFA 2O8DA 4I1SA 2QM8A 4ZIRA 1OIVA 5JFGA 4LJ5A 1TEXA 5JLJA 1TF7A 5AJYA 1EWRA 4JVNA 3OFND 2YOFA 3HU1A 3WHKA 2PLRA 1HT1E 1GL6A 1RRGA 1J99A 2F1IA 1E9EA 4OQLA 2RGDA 1MR3F 4IDOA 2GVDC 3CIOA 1ESNA 4DB2A 2ZITA 3GQBA 1KDPA 5KPDA 5EZ5A 4M21A 5DHFA 4B48A 3MWLA 2JJ2D 3NG1A 4YLGA 2IF2A 1II8A 4F4IA 4ZCLA 2WOOA 3U60B 1H65A 2PJRA 2GXQA 4KFSA 3KJEA 3U7HB 1B23P 2RGGA 2JJ1D 1XCPA 2ZS7A 4US0R 1X3SA 1KI2A 4BWYA 1E2KA 1N6NA 1J8MF 1E9DA 2MMGA 3SFZA 5JI3E 3RRZA 1GRRA 2B21A 4MRNA 3RRNA 1E32A 5G3YA 4GZMA 2BM0A 4U7DA 4JBYA 2CBZA 3OAAD 4Q9IA 2XTNA 4XOIA 1II9A 4RFSA 5EUMA 1HUQA 3QEOA 1KO7A 1Q1EA 2ZRJA 2XXAB 1FUKA 1P5ZB 2JIZD 1N2CE 2D62A 3PQCA 3QIAA 4F92B 1E2NA 1Z83A 2CE2X 4OHYA 4HZUA 2JDID 1G8GA 3BFVA 1G20E 2GDJA 2FFHA 4MRSA 2G77B 3K0AB 3SYNA 3GLGB 3B2EA 2WZQA 1DAGA 4Q4LA 3A58B 1IAQA 5CIWA 2O8FB 1JR3A 4TQ9A 4B44A 3VNVA 5CB8A 4EIWA 3AV0B 1QVAA 2C8VA 3CX7A 4Z54A 3VR5A 4LV6A 1T0JB 5DSZA 2ZU0C 3BC1A 3NBXX 2Z6VA 2OLJA 3HP1A 4ZO4A 2B6HA 4Q4AB 3W5JA 2ZJ5A 1XX6A 3W90A 4GOKA 4PFSA 1GUAA 3PUVA 2R6DA 1WQ1R 1IY0A 2GAOA 1E2IA 3ND8A 1G21E 2FN4A 1M6NA 2J9RA 3DMDA 1Z6XA 4HI0E 4TL8A 3TH5A 3I1FA 3HPRA 1RKBA 4Q9KA 1S3GA 1K8RA 1OYWA 3W6PA 1FW6A 1N25A 1QHGA 2RH5A 3QKRB 3HWSA 2EWWA 2QRZA 3BFXA 3L43A 1D9ZA 1E9SA 1U8ZA 2O8BB 4Q4HA 1W7AA 2QMOA 2YWFA 1G3RA 3DO6A 2UZ3A 1SULA 4NTZA 5DYIA 1S4QA 4A8JC 4PC6A 2H57A 4M1TA 4MKFA 5CM9C 3ZDQA 1W1WA 3UKDA 1AS2A 2QGZA 2CCKA 4M53A 5FBWB 4DDVA 3AVXA 4IDNA 3OEED 1WXQA 3Q9LA 2IS6A 1DAKA 3QQ5A 4NP6A 3CPJB 2ORVA 1JEEA 5TARA 1GTVA 4KYIB 5FOWA 2RGEA 4JL5A 2RGBA 1OH5A 4P4SA 2AK3A 3LBNA 4Q4JB 1LY1A 1VG0B 2GXAA 1G5PA 1E2HA 4LDJA 5TDHA 3K0EA 4NZYA 3REFA 4YC7A 3QG1A 5EE9A 5JJIA 1S2MA 2PBRA 4IDHA 1DEKA 1FL9A 4QNMA 1LW7A 5C2JB 2BKUA 1D8TA 3CRQA 3QPVA 4PHFA 3S1AB 3KFVA 1XXHE 2J7KA 3CNNA 1G19A 2OE2A 2HYDA 2V3CC 2P6NA 4IJMA 4MYTA 3NHBA 1ZD9A 3BBPA 2QE7A 4LOAA 1HURA 3SQXA 4Q7JB 3ZQ6A 3FHOA 4Y0VA 2PT5A 1YE8A 4TLAA 2ZRBA 1A1VA 2Q3HA 3OEHD 3CLVA 4NPHA 1RIFA 4EFMA 3SN6A 5KHOC 3L0OA 1DVRA 3LDAA 2QNRA 3Q85A 3SJZA 4D4KA 3CR8A 5L8VA 2ZM5A 4BPBA 3H1TA 2IUSA 2HXYA 3WMEA 4PC3A 4RZ2A 2W6IA 3H86A 3IEUA 3IBYA 1M74A 1R0ZA 1TTTA 3V9PA 1GG2A 1P72A 1IHUA 2XAUA 4CEHB 2ZSAA 1FX0B 1SVWA 2ZS9A 2ZEJA 3VU9B 2BEKA 1NKTA 2NOAA 4DSNA 2VP6A 3SDZA 5IRCD 1LVGA 1S1CA 2WKRA 4V0MA 1W0JA 2FSFA 4A82A 3ZQJA 2GCNA 3SJAA 1MO5A 1NLFA 3CX8A 4N3NA 3T15A 3T5GA 2WBLC 4WZ6A 4PPNA 5L3SA 3U6KA 3AVOA 2ZXUA 4H9GA 1E2GA 3T1VA 4EDHA 1VPLA 5KDLA 2WWXA 4TLDA 4TN1A 3UMFA 3LVQE 4W5JA 1XD2A 3IPYA 4Q21A 4TSFD 4I4LA 3AGPA 4A9AA 1E2MA 3H0KA 3QXXA 4KSBA 1IJEA 3SR0A 6Q21A 3PUZA 3ICEA 3IDQA 1DAHA 4US1R 1DARA 1OHHA 2HJGA 1EX6A 1G7SA 3C5HA 3UANA 1EFHA 1SXJD 4MYCA 2Q9CA 1QG4A 3WXMA 1ZNYA 1MO4A 2QP3A 3ZS8A 4NYIQ 1P2UA 2XSZD 1IM2A 2R62A 3WRYC 4AYXA 2HT1A 1G7RA 1RFLA 2XITA 4A8JA 1IXZA
chains in the Genus database with same CATH superfamily
2QRQA 1N78A 3B12A 3T3IA 1EDBA 4L2IB 2FG7C 4HKTA 4NYJR 1RYDA 3TDNA 3CLRC 4QAJA 3RJ5A 4CKZA 1NW9B 1KL7A 3D5QA 4N7BA 3SWWA 2AE2A 3G5AA 1QONA 4YJFB 1M34B 2VOEA 1GR0A 1ZQ1A 1PZFA 1KJQA 1ZXBA 2YJGA 2AMLA 2Z1DA 4BV8A 3KE8A 1E62A 3MJSA 5ER6A 4F5WA 4I1IA 3AG5A 3QMVA 5T6BA 3SM9A 1QHIA 1UMKA 4OEHA 1AQLA 1U81A 2CCGA 3DUWA 1N1DA 1R0LA 3G2HA 3VH4A 3BXPA 2EARA 2AFRA 1SD1A 2FWPA 3F78A 3K2IA 2IE8A 4IM7A 5GJWC 4KQ9A 1FDOA 2GX6A 4QDKA 5B5SA 4AKIA 4G8JA 1BE8A 5JSQA 9MHTA 1V2GA 4ZVTA 2EBWA 1KC3A 5ES3A 4FQ5A 1GKUB 1II8B 3LVRE 4RNDB 1XTIA 3QG5A 4EWLA 2GESA 3A6KA 5TMPA 3OZBA 1QGED 3H84A 2FZKA 4WNAA 1YJ5A 3A4LA 4FFDA 5FUQA 2Q45A 5E8RA 3X1XA 1YDFA 2Y9MB 2QX4A 3I09A 2LCQA 1SZPA 1YVUA 4Q03A 4WEOA 4C43A 1QFMA 1RXIA 2XDYA 1G5FA 4P82A 1KJWA 1EGHA 1XTBA 1ES9A 3DKKA 1BMTA 2HSJA 3LY8A 2XRMA 4V0QA 5A4IS 3EVEA 4MV5A 3U48A 3OM0A 4E1AA 2C54A 1VGRA 2Y1XA 4IHJB 1PL7A 4GNRA 1EDZA 1POWA 1R0CA 1RMQA 1Z2EA 1JS1X 2IT1A 4H1VA 4HN4B 3BTOA 4R6XA 3VZQA 4DCVA 3U4QA 3TJMA 2F59A 4NI5A 3W8RA 4ND8A 1YFLA 3PX7A 1U3DA 1KEKA 3PCTA 4LQDA 3D4PA 2UUCB 3K70B 5A7HA 5IT0A 2OO5A 4HUQA 4E0BA 4DGQA 1OH8A 5AOAA 5LP1A 2MOKA 2ZJZA 4FR0A 2CLFB 1ZIPA 1J2RA 1NJGA 2AOUA 2XOEA 4K6OA 4RZIA 4LK2A 5BQOA 3VV2A 1HG0A 4KQGA 1VPWA 1I6LA 4RE5A 4WGFA 3VFDA 4IZ6A 5KTKA 3L06A 3CA8A 1H2YA 2VXCA 4PM4A 4KR0A 5CP8A 3R4CA 3G59A 1T5OA 2Y77A 3M7IA 3T9FA 1DKOA 4BFYA 4PBRA 3FTEA 4D8XA 5LZ9A 1S7CA 3L6DA 1MNAA 5AI5A 2O3RA 5DCUA 3GJ4A 3NYQA 4J03A 5AK0A 4II3A 3BREA 4GECA 5ALWA 4B71A 2A4MA 5D7BA 4QHTA 2GB4A 5ENDA 2A9QA 3W8DA 4ZHQF 1N6LA 3NV9A 4X00A 2ONCA 2BW0A 3P9ZA 1XEFA 3OG9A 4GE3A 1FJ2A 1YRAA 2JB9A 1B4DA 1K0FA 3PDWA 2HT6A 4TMYA 1C2TA 5EP4A 1D07A 3S27A 3Q9UA 3OJLA 2F3UA 3AEYA 2VT7A 3H5OA 4YP9A 1M5RA 1F2UA 4P4SB 3GEIA 1J4AA 2QMUA 5I7OA 4FC6A 2RHOA 1BHJA 1Z73A 4ZDIA 3M4NA 3WSTA 5JJ5A 5JZ9A 2B7CA 3GBSA 1EH5A 2QAJA 2IX3A 4QZVA 1AJEA 1HQCA 4IDAA 4NOLA 3WYBA 1V7PC 1S2LA 1KU6A 3TDMA 5F7OA 1N6KA 5BSGA 4J1TC 4BXOA 4KDRA 3BE6A 4A6PA 7GPBA 1T35A 2B3TA 5IJ9B 1PL8A 3A6JA 3SJCA 2AG0A 1QX4A 1RZRD 4P7JA 4PR0A 5HIMA 3AR6A 1UZLA 3I4FA 3KE9A 2ZKIA 3BJZA 3L9WA 1IZ7A 5EE5B 1DBPA 1ST2A 2MYNA 3DDOA 3PFGA 1RI5A 4R5HA 3X2SA 2ZKLA 4HEJA 3F6PA 2O3TA 1KJYA 4M1SA 3C6BA 1IXSB 3QFFA 4NPAA 4XD2A 2IV3A 3SHWA 3CKYA 1FRVA 2Z6AA 3MMSA 3E58A 5C4GB 1A9SA 4L22A 5L3SB 2B7BA 2YJTD 3GLIA 5CEEA 2DH6A 1JEQA 3UYKA 4AQ7A 2QRVA 3TSZA 4CN8A 3Q6NA 3DZIA 4R2LA 1BCRB 3USCS 1S8FA 1K97A 5JAQA 1T1JA 2JCXA 4R1QA 3OLQA 3LUBA 4JLMA 4NK4A 1YZUA 2FWRA 2WHQA 1NOIA 3D31A 1EP2B 3DQPA 2MTBA 3AF0A 3KBOA 1JIKA 1RRFA 3D8SA 3KDAA 4PSKA 3UW1A 4QDOA 1RQ7A 3H87A 1OOEA 1GZ7A 2IL1A 4RGBA 4ZT5A 2P4EA 4YCCA 4CG1A 1OXSC 2BKEA 4EJSA 5E1DA 4URFA 5IZCA 1AMOA 2P5TB 4RGYA 1CLUA 2B0JA 3GFVA 2XB6A 4UOQA 4HWKA 3RS3A 4OA8A 4OHOA 3UW3A 5G0UA 4BDSA 1C1XA 2A8YA 3KVYA 1E5XA 5KREA 4BJ3A 3DOCA 4PLVA 5BWOA 5HM8A 1J49A 2GEUA 2WJWA 3DT6A 2CEAA 4RKQA 1PGOA 4YI3A 1U0EA 1NVXQ 2DFPA 4DQ0A 1KJIA 1P77A 1EJBA 2RH8A 4I81A 1JG2A 4E22A 1F8UA 1QR6A 1W2WB 2YYSA 3OZWA 4G63A 4E5YA 5JPDA 3C7DB 5AW8A 3JQEA 3E9CA 3HMKA 4DWWA 4D56A 4ITRC 2EAUA 3PIRA 2R7MA 1XJQA 3LP5A 4I9UA 3RB8A 3MG9A 3G9ZA 4W5RA 4GAEA 2WAYA 2YRWA 2GLXA 2N9UA 4XX1A 4YUVA 3T5CA 3TE6A 4NBRA 3SKVA 5KWEA 4AURA 1XCGB 2ROQA 2CLDX 2COEA 2IDMA 2G5TA 3DZHA 3MCVA 4PFKA 3WKDA 5JAIA 2I9KA 1TOAA 5HE8A 3OLYA 1PBNA 1U7UA 2J0UA 1VL5A 3SX4A 2KI5A 3QKRA 5JRJA 2RARA 3A9SA 3THXB 4M9RA 3BB4A 1GARA 4BO1A 2EL9A 3FSEA 1UBRS 1E59A 1B41A 1ECLA 1L7XA 2JW5A 2XGSA 4UASA 4Z4CA 1XTVA 2I4NA 3BWVA 1W29A 1HNZB 2G72A 2CHFA 3S44A 5AUPB 1FP7A 1AZLA 1I0LA 2X9QA 1SCAA 3EVAA 3E05A 2PA0A 1GXSA 4IO0A 1JIJA 4AJ2A 3Q1KA 5ADHA 2CJXA 4WBNA 3EMVA 2EJTA 2ETXA 1ZUD1 1GFZA 3PE4A 4TM8A 2JJYA 4YJKA 4OI1A 3U4CA 3KR1A 1YS1X 2PKQP 3EE6A 4TQAA 3ZVRA 1ZGBA 3BH7A 4OHFA 3QBDA 2WD7B 3OUZA 3UB2A 3WAKA 2X8JA 2LE0A 3IRVA 4LV8B 1GYQA 1H2HA 5EZYF 5AK6A 1U3UA 1BGWA 3AU8A 4MDEA 3B1WA 1RAHA 1HDZA 5I7RA 2XUAA 1G7TA 5GZ3A 2TMKA 4Q1FA 3T0FA 3QOXA 2A58A 5MN5A 1DIGA 3DCNA 3EK2A 3HN6A 2IYRA 3FCUB 4OXNA 1HEYA 1K63A 3FDXA 5BNTA 1FSZA 3PUIA 4JOSA 4BQNA 4CMGA 2OXCA 2JZNA 5FIUA 2RKBA 1AKTA 2GN8A 2QF7A 4PICA 2R7NA 4ZQCB 4OD0A 4Q48A 3OHSX 3KPVA 3NZEA 3OE4A 3FFAA 4JC8A 5JYBA 2BJWA 1HWYA 2ZE7A 2D8MA 3F47A 5BY2A 4XD7A 3U7GA 1FYVA 2RHHA 4AZVA 1FDTA 4Q39A 5CYFA 1NF8A 1D2MA 5E7IA 2LTAA 3BWBA 4WESB 5DTRA 4JVOA 4CEJB 4GYKA 2R6ZA 2PN1A 1OU0A 3E1GA 2OB2A 2X86A 2X42A 4QU8A 3JQAD 1OHHD 5H9VA 2FPWA 3H18A 2A57A 4DV5B 1K4MA 2JDIA 3IC5A 3A31A 4JCCA 3I6ZA 3KSZO 1QPBA 2R00A 4LC9A 1CV2A 3FBGA 4L9WA 3HABA 1HT3A 2GJSA 5KQGA 4DFDA 3WGQA 3SQMA 3NT5A 5BYJA 5FTKA 4Q02A 3C14C 3AV3A 4Q24A 1FP2A 4Q9DA 3R3HA 5C7IO 2C61A 5P21A 3GRYA 3SC2A 5JALA 1V7ZA 5CBPA 4LKRA 2ICAA 4R7ZA 4JJIA 4JLPA 5F5XA 4BLQA 4C05A 2K7FA 3BDIA 3RANA 4ZHQB 4ER6A 3RBXA 5LZ4A 1M54A 1C2YA 4PS0A 4EGJA 3UV7A 4J7AA 2QMHA 2D5AA 3BN3A 2TMGA 4JT2A 4G2TA 5HXAA 4BLTA 2FWMX 4XARA 4HB3A 1KK2A 2D1YA 2KMLA 2P2NA 3OQOA 3F4KA 1GAEO 4BRSA 4A03A 3KHUA 3PE6A 5I4IA 2IS1A 5F2EA 4XYLA 5BUZA 4DAEA 4ZJYA 1BWPA 1FVXA 4JR1A 2XWSA 3TTVA 2WYIA 3KUCA 5K3FA 1OY1A 721PA 1HZZC 1FK8A 3PR2B 3T3EA 3F9IA 4J49A 1FU4A 4E5UA 1F3OA 2F1HA 4DIOA 4BZXA 1NP7A 4OB6A 3QVVA 1X7WB 1W76A 2ZI4A 4KNYA 2PLFA 5LQJA 2X4GA 3VPAA 3VNBA 3BRSA 5KYXA 2HMSA 2ZUWA 3J7TA 3R6WA 2IP4A 3GFPA 2IYZA 2RAPA 1DKMA 4MP6A 1YFJA 1DWQA 3NHSA 2H1VA 2QAIA 3P19A 4G5YA 5B3JC 3GJ3A 5KU7A 4EQ6A 4NE9A 3K0BA 2DQKA 4OI0A 1O94C 3TVDA 1HFKA 1K7EB 4WZZA 3G7SA 4GRDA 5BMOA 2AFHB 2G4LA 5IBRA 3WGZA 5CYOA 5BW5A 4CFYA 4N01A 4TTSA 1DOHA 4DV1B 1XB2A 2LNDA 2H6EA 2AD1A 2FPOA 3MCAA 5K3AA 4ZU6X 1UBFA 5IHPA 1BKDR 1RADA 1R6AA 2ZVPX 3W8NA 3KEGA 1JLSA 4Y1FA 4LVUA 1UPFA 2H9YA 3RABA 3PZRA 4C7KA 2PV7A 4EQZA 3BAFA 3TIFA 4PCUA 2Q21A 1TM1E 4EGAA 4N7RA 3LCMA 1APBA 3V8QA 3HWRA 4D9HA 2Q9BA 2PUFA 2R8XA 5DNEA 1JLMA 1SXQA 2BFCB 4L4UA 4YP7A 1T6NA 1GRQA 2C2XA 2XUZA 5DOVA 4AKGA 4BGUA 1CJKC 1YC5A 2EERA 4DT1A 1CZLA 3T4PA 2JFGA 1PJSA 3LPMA 1P61B 2AZMA 3LXMA 4NOJA 3R09A 7MDHA 2QK4A 1SU8A 3OU2A 1T2NA 3K9NA 3VVBA 3ZJ5A 4X45A 3ZWWA 2AI1A 3V9AA 3CZAA 2IHYA 4OUKX 1ODIA 1X7ZB 3JQ6A 4YCAA 4L8VA 4DV6B 3OIVA 3HGQA 3HM2A 4PYQA 1DPFA 5GADl 2VSFA 1V3VA 2V4ZA 2XR1A 3C3CA 4JUBA 2QY9A 2JBAA 1XRLA 4GDFA 3LV8A 3HB9A 1Z06A 1NM5C 3O2SB 3D3WA 1JAYA 4KXNA 1S3SA 4MO2A 1U0JA 3O2QB 4TPKA 1E2UA 2YRFA 3OQNA 1V4BA 1PGPA 2IPOA 4FW9A 4NECA 2EJVA 1GV1A 1JSXA 4UM5A 3GAZA 4CCAA 4ISBA 2FP4A 4MVXA 4XW2A 2IPMA 1KAOA 5KOHB 3LC7O 1KERA 1Q0ZA 2W2LD 1X0XA 3AKEA 3OBIA 4JU8A 1OPXA 3LWZA 1OFVA 3EXHC 3T4EA 3KSDO 2ZB3A 4XCVA 3R6GA 1TTPB 5JS8A 1C7QA 3KKMA 5SYAA 1BVYF 5E4TA 1ZD4A 2AXNA 1JDJA 2AKYA 2KE5A 4YRJA 4C1NA 4DIEA 1VYTA 1NE7A 2V7UA 1UOQA 3VV3A 4MKRA 2G7MC 3QEKA 2VAPA 1IN7A 2Z04A 1E3WA 1HQKA 3GVHA 3A9RA 3IOCA 3M0EA 5FPKA 1QV7A 4TMWA 3NH9A 5BUSA 4RTJA 1DLJA 5TY0A 3W1VA 3LMKA 4R1TA 2DR0A 1KDOA 4IV5A 4CKWA 2JGJA 2EP5A 4IZHA 4L8WB 3T8YA 5DGTA 3OE7D 1YQGA 4HLCA 4Z9FA 1KI9A 1B1CA 3DLCA 4D99A 1ORRA 1A3CA 2SBTA 3T94A 4FINA 4NYMR 4WZBA 4F11A 3CPEA 1IZYA 1YT5A 4AP5A 4JWKA 3MFQA 4MH0R 1QHSA 4MVJA 1B8VA 5IS2A 2C9BA 1NRJB 2QU7A 5FRDA 4ZCIA 2GA9A 1X94A 2I34A 4C88A 4TUYA 2XGMA 2W2QA 4NWIA 2BYTA 2D7DA 1XU9A 3CG4A 1OYOA 3IELA 4DYHA 4E31A 2O2YA 3F6SA 4URZR 2PH1A 2EX1A 3EW7A 2ZQYA 4KH0A 4ZD6A 2NZUG 3I30X 4NZOA 2WTEA 4ADSG 3V3TA 4DWOA 3DHEA 2L82A 1DV2A 4A8PA 1FC0A 4L9RA 4UCQA 1NBHA 4XSGA 3M6AA 4M9SA 3EZFA 2F9LA 2AOUB 2CXHA 3NM4A 4OXKA 4HEHA 2H0QA 3HB1A 4TWBA 5WRFA 1J5EB 1DBWA 1E0KA 4DJAA 5B1DA 4H27A 1A96A 1P4HA 4OYLA 1PFVA 1VIYA 3OVMA 1YRHA 5KSWB 4DIKA 3TX2A 1ULTA 2FZLA 5BWCA 4YT8A 3OQ6A 2NU6B 4DM4A 5BT9A 2AH5A 5CCBA 5IABA 4IF6A 3EBOA 5KAMA 3NX4A 2BKAA 1C4XA 2DKNA 1BSVA 3COWA 1F0YA 2XGJA 4GOOD 1QHYA 2DKFA 5JD3A 5SICE 3PNSA 4HGOA 3K9HA 3AY6A 1SURA 2XY4A 1Z4OA 2I7TA 1OIWA 1OFHA 2HCBA 1RLJA 1Z36A 1ZQ9A 5SV2A 5C81A 1IVSA 1E98A 1VBKA 4ZI5A 2BGLA 3OIUA 5CLIA 4IQFA 2FEAA 4BBZA 3UGKA 3TZ6A 1CNMA 3K72B 1FXUA 1BQ4A 2X6RA 3S8MA 2Q3FA 1F6WA 1RACA 1T3SA 2V9ZA 4JEMA 3TRHA 4DR1B 1O95C 2VYVA 5T7BA 2DULA 2WMDA 4N76A 1J97A 3NRJA 3GD7A 4EPWA 3ILHA 5IAAA 3MT9A 1N6IA 2D2IA 2QTLA 4AKEA 2DAPA 1JKXA 1RAEA 2OZLA 4O63O 4YQZA 1O4WA 1QRUA 3BMOB 1NFRA 4G4SP 3L7LA 5FOUA 4B8YA 4UTXA 2W7TA 4ZT7A 3ZWYA 5ERYA 2FOXA 3ZNNA 3HV0A 2QJRA 3HN2A 1YUMA 2AKAB 3PT5A 4X41A 2R6HA 4OBEA 1DXQA 1X7GA 2Q7XA 2FHSA 1D6JA 3AJDA 2BCJQ 5C1IA 1E79D 1Y1LA 1F4PA 3L5OA 3M1AA 4KXXA 3T5AA 4P93A 4HDRB 5LR6A 3EIWA 3MJHA 1NBMA 2ORYA 3B1YA 3L0YA 1VECA 4U8GA 3O83A 1XCOA 3AJRA 4WZAB 2IV7A 4FZRA 4EJ6A 5K8IA 2AC4A 2ECFA 2VIIA 1XZAA 4TGLA 4OK6A 1MCZA 4GOMD 2FSHA 3GZNB 1QGUB 2AMJA 3EN0A 3I5AA 3K9GA 2FA9A 4FB5A 2C2HA 1NX6A 1T1IA 4TSFA 3O4RA 2O8VA 4U2KA 1K86A 4WFKA 1ZN8A 1W4BA 3DVLA 5JISA 3U1BA 3DHWC 3KKQA 3OICA 4YJ2B 3SSAA 1CP2A 2QX7A 3WNDA 2V1XA 1Z6TA 3AUXA 2VEDA 4OOEA 1DHRA 3KSMA 4DTCA 4C7OB 3FYUA 4B46A 1WB6A 2WTXA 1P2VA 2DBRA 1V4NA 3ZCXA 2X0KA 3DVAB 3IODA 4J6FA 4ZT3A 2EFHB 4X90A 1KAMA 1WKCA 1A7JA 3ZQKA 2G82A 4IKPA 1JG4A 1KU0A 3M49A 1SVNA 3I1YA 3V5NA 5AI4A 1JHAA 3ZEAA 5EP3A 3ABZA 4IRUB 2BAGA 3RUPA 1GVNB 2HEIA 3LPLA 2XSZA 3QLVC 5IUJC 2NT4A 1ZY2A 4HB4A 3NBQA 2Z9CA 2OBNA 2HL6A 3GLFA 3B9RA 2RI0A 2X1VA 5A71A 3K2BA 3TB4A 3ZGVA 3I64A 4YLYA 1PZMA 3BSYA 4DT1B 5EJFA 5CB4A 2QTVA 3RFTA 3ASUA 5E6SA 1X80A 3R8FA 2GBPA 1FB5A 1UJ5A 3PNKA 1R27A 1VB5A 3KB2A 2XUGA 3U61B 1W59A 3E8MA 1BEZA 2ZT8A 3GEGA 4KRGA 3Q2KA 1EB9A 1J6UA 1QVRA 3FKQA 4IOJA 4PY2A 1CUEA 4WLNA 4ZVKA 5LDGA 1OW3B 3E3MA 1E2PA 3INGA 2HGSA 3LP8A 3PF8A 5TX7A 3AJ9A 4EYOA 4XYGA 4I66A 4C76A 5LDDC 5I7SA 3O8QB 4ZZ1A 3CWZA 4GI5A 1J8DA 4NF2A 1MT3A 4R1SA 3H2JA 4EJFA 1D6MA 3SDSA 4DR4B 2GLUA 4FOPA 3URKA 5BMVF 1PVDA 4MUBA 2B5OA 3X1MA 3PNYA 1DOAA 1MA0A 1UK6A 3F8TA 4ZCTA 4LFBB 4PC2A 1TQDA 5D7NA 2B30A 5A05A 1KJZA 4HLQB 1L8XA 3GAMA 1RHQA 1SOMA 1N33B 2H1IA 4KIWA 3ZDCA 1YMUA 3ZK9A 1NMZA 1R9MA 3Q15C 3H17A 4HWGA 4Q3AA 4BZPA 5JJKA 1CX9B 3ABIA 1XKTA 4YN3A 5TNXA 3UAWA 2EF0A 4LDRA 2JFUA 2RGUA 3WGHA 1AY0A 5DYGA 1QGYA 3WGNA 1NF9A 2D0DA 2VJQA 3G2PA 5H68A 3RC2A 3JZDA 3RRFA 2LDBA 1YFZA 2P3LA 2DFVA 4QNRA 4UCXA 4NNOA 1M7GA 3RC7A 2X8WA 3LY9A 3U7EB 4DNQA 2JLAA 2PX0A 1KWKA 3HJCA 3EH2A 2CD9A 2H52A 1QZXA 2KSQA 3A6LA 5CD9A 1N5LA 2WA2A 2QP9X 4EB3A 4IS3A 3EQ9A 3IMFA 4FZJA 2BP7B 3NRCA 1I4WA 3TOVA 1XMJA 1KVUA 3K96A 2PKQO 3UK7A 3ZWVA 3D81A 3K20A 3OFKA 4I1UA 4M1WA 4G4GA 2OHOA 3K9QO 3KR2A 4P98A 2Q3EA 2ZGVA 2VHXA 2ZWPA 1CT9A 1JIIA 2REOA 3MLEA 3UMYA 3GFFA 2IYLD 1QIFA 2DTEA 4MJLA 1VMIA 1Y80A 4Y2QA 3ZDXB 1WE2A 1KR5A 1T9HA 1VHLA 3QHPA 2VP2A 2MU1A 3PVSA 4I46A 3T3OA 2G5GX 5LNK6 2A94A 2YS6A 3JVEA 3HJNA 3PXEA 4G24A 4OJNA 1P7VA 1XEXA 3I37X 3SHVA 3IP7A 3B52X 4CFSA 1UP6A 1JH9A 4Q16A 3RSLA 1B0PA 1NBME 4HDKA 1ZCZA 1NUHA 1LTQA 4JI5B 4OHXA 5A3RA 4TZ0A 3RUFA 3LO5A 2UYYA 2VYND 1DBSA 2W11A 4TL7A 2BZGA 2BUCA 3AXSA 3EBLA 4E5DA 4NATA 4WOPA 1N5JA 1OI3A 2BT4A 2N3ZA 2AJCA 3DMHA 1LX7A 3KLNA 1G63A 4HH0A 1UBLS 2C2MA 2CNOA 4QYIB 5J2TB 3V8NA 1XXHB 1DFIA 2OXFA 3EOAI 5B2EA 2PGDA 1YNOA 4QYSA 2VDMB 4UVEA 3CNEA 1YR8A 3BIOA 4BKRA 5T67A 2B61A 3WQQA 5AJZA 4B74A 4FYJA 4FFOA 5DBHX 4JBGA 1NI4A 8LDHA 3WFIA 4G5SA 4OSEA 3HU3A 1LJ8A 1G8YA 1PP4A 4JUDX 4CL0A 4EKDA 2M9MA 1ZM9A 1FRFS 2WF9A 4JXJA 4P3XA 3H4TA 4UZSA 5FOVA 3U3DA 4DMCA 5JS7A 4JASB 2UVPA 3D4NA 4LIPD 3N7UA 4ZGGA 1YDWA 4X9XA 3WRXA 2CL7X 5KYVA 3BCHA 1Q1ZA 2I7DA 5LP6F 2R6JA 2FKAA 1RQ2A 2V6GA 3GMTA 2QBYB 3V7NA 1YO6A 1E7MA 1R5NA 1CVLA 3CRRA 1P1FA 1FDUA 4FEAA 3AHEA 1CZOA 1CUAA 4ZT6A 2W90A 2Y9PB 3TECE 3ZHRA 1L5YA 3ZLJA 4TV8B 1QCZA 3M6UA 5CK4A 5TJ9A 4Z9YA 2VWPA 1K8YB 3RVMA 2VG8A 3SOPA 1O0SA 2QTGA 2FOLA 2DFLA 3HL4A 1AGXA 3GPDG 1EHIA 1V5FA 5E38A 3VR4A 2PUHA 2GF0A 1CQXA 1NVEA 1ZN2A 4INPA 4Q7KA 4Z5XA 3L4EA 2FFAA 1DWOA 3G3EA 4HHEA 3C1AA 3GFBA 4HDAA 2I65A 3HA7A 3QFCA 2KBFA 1M1ZA 3KYJB 1UBSB 1WCV1 4EECA 1I5EA 4F96A 1CRZA 4BLOA 1DL5A 1I9CA 4EEZA 1R4NB 4IGIA 1E4VA 1W46A 3PENA 4XM0A 4C2TA 3RREA 1LTKA 2C29D 4JJEA 3D6UA 4KO2S 3D0RA 5FFNA 4YV7A 4YJHB 1JQEA 4JP1A 3UJHA 2PUVA 3F6BX 5FBLB 4F2GA 4CIYA 3OE5A 1G1AA 4MVJE 4HDMB 3BVPA 3TNLA 4RKWA 4BNIA 2EATA 2ZAGA 1E2EA 1SXGA 3L77A 3DBOB 1Z2CA 3I6IA 3N0VA 4HLNA 5REQA 1WXEA 1U0LA 2MSEB 2I4OA 3N0WA 5AJHA 3A6EA 4ALLA 4D42A 5C46F 4OMFG 3AF6A 1YI1A 2JLCA 1VRCA 4TTQA 2FGJA 2J3IA 2XVXA 1QYIA 3LL4A 4DREA 3IULA 5KQLA 2IXAA 2PNJA 1EXNA 2PX5A 3A1SA 3EHDA 1O5TA 2BFFA 3OETA 4HY3A 4ZYTA 3BH0A 4M60A 5FTLA 5E9JA 3VPHA 1ZYUA 1NHWA 3L1JA 3UH1A 3QW4B 4RUKA 5C8ZA 4X97A 3K0FA 4TV9B 1WV0A 3COYA 2C4UA 2OGUA 2FNAA 4G9EA 4LQ4A 3LL7A 1Y5MA 4WK2B 2RIRA 2IU4A 5CT4A 4Q9JA 3IHKA 2ZTVA 5AUOB 3R3ZA 2JA1A 2D1FA 4E5MA 1JILA 4K9QA 4N7JA 1D04A 3EA0A 4J4TA 2XNDA 3GJ0A 2KBEA 3PKZA 1E1DA 2QL6A 2XUJA 3PEFA 4FX5A 4JZYA 3T7SA 3JWJA 1TJYA 3MCTA 2D0PB 3C0KA 1RKVA 1V8FA 1XVIA 5TSDA 4W8GA 4EMTA 3BCUA 4NG4A 3URMA 3ZE6A 2QRVB 1K7XB 4UUAA 3WWCA 1W2HA 1ITZA 4MUYA 4URXR 3G1UA 4QVKA 3WFJA 4FFLA 4GP9A 4B43A 1Y63A 5E7JA 1GUDA 5IARA 4EW3A 3DEHA 1AKVA 4YK7A 4V38A 4UBIA 2TRSB 4P3KA 4PIMA 4ERXA 1OFTA 1Y37A 2E18A 2EJUA 4X8MA 5FHRA 5H7XA 4DKXA 2CYCA 2X3FA 3W5BA 3OWOA 4EUKA 1YZLA 1UADA 2J5BA 2SKDA 3N70A 3FZGA 3PWSA 5K8JB 2C3YA 4L3WA 4KSYA 3T5DA 2WWFA 3ZDEA 5CAEB 3B3FA 2O8DB 1H1LA 3ZCRA 1B93A 1CHNA 2GYVA 2H92A 4R9VA 1WVMA 3D1LA 1NXSA 1R6TA 1VKRA 1EWQA 1BFUA 1SKYE 4ROSA 3CSSA 3EASA 3HKDA 1IEVA 3QE2A 4DLTA 3EDRA 4ZGWA 2V1UA 2VP0A 1K5HA 1Q0TA 3LDFA 3R5XA 2HV9A 2NV2B 2FQYA 3PCRB 4HNRA 2O8CA 4MMZB 4YDQA 4BBJA 2DWQA 3D7NA 1T5SA 4C7XA 1MC1A 1SOWA 1COZA 3I4CA 2YY5A 3AX6A 1ODCA 4PYIA 4RLSA 4ZI3A 2P3QA 1LDNA 4JNCA 2NZJA 1XUOA 1QK4A 3N2ZB 3DTYA 1KZ9A 2E4UA 3GPLA 3H6HA 1RYFA 1M1XB 3KXPA 5J47A 1HEIA 5JEDA 5K2OA 1OAKA 4E5PA 5ALQA 4CV1A 1NUQA 2RG1A 5EGSA 1DZ3A 4BCBA 3NVAA 2Z5GA 4RHXA 3NH6A 1BU5A 7ABPA 3AILA 3FPEA 1UC9A 1B74A 3RTGA 1ISPA 1Y9ZA 2C4WA 2ON6A 2P8JA 4J91A 4JJ6A 3M6WA 2OXTA 2IKQA 3ONFA 4E6PA 2J0EA 2QRKA 3A1EA 3P96A 1XP5A 4H7EA 1FDSA 2C7RA 2XDAA 5FP0A 3HXLA 2O2JA 3LT2A 1GUBA 1QOZA 4RXUA 1CJUC 3ZU3A 5J43A 1C9YA 4RIHA 4U3JA 3IAAA 3L1KA 4DADA 2W4QA 3R5FA 4LFCB 3EPJA 4LF8B 2CLHB 1VMAA 1N5MA 1VLJA 2CYBA 5G0SA 4AP9A 5JXJA 1RWNA 2PZLA 3PXBA 1VIDA 2JIMA 4P3PA 3JS5A 3LBFA 1WA5A 1E4EB 3S70A 4AMZA 1LDBA 4NS4A 3EEBA 5HF6A 4G5GA 1A8IA 1S2IA 2HWYA 3C70A 3EY9A 1ZGCA 3KBBA 4N0EA 3Q7EA 7REQB 4O4IB 1JDBB 3DE3X 4Q7QA 1ILWA 4PQRA 5L3QA 3RRYA 1YI8A 2Y3IA 3HNOA 3CE9A 4WBSA 1ZGZA 4BUJA 3EPPA 2GUWA 3ZWBA 2AMVA 2I3AA 3EAFA 3MOIA 4RA9B 5JSUA 2C4NA 2FVYA 2SNIE 3ZW7A 5LBUA 3CXUA 1N6OA 3MIZA 4J3JA 3RHSA 4JEUA 1QB7A 3OCZA 2VFAA 3HY4A 4M9CA 1PR2A 4XPIB 4YECA 3WV5A 3MVEA 1O94D 3EIOA 1THTA 3RCBA 2C5AA 1NVMB 2IHZA 3ANSA 2ZS8A 3CZMA 4PR3A 4RYDA 1CJVC 1SM4A 2PMFA 4M86A 5C8XA 3I0ZA 4K0RA 5DGHA 2WG0A 2J0SA 1O4VA 1BKYA 4EF4A 2GZMA 3LVFO 1Q2XA 3WHIA 4ZYYA 1IOVA 4WLOA 1MX1A 3AI2A 2A1UB 3D0KA 5TLSA 1KY4A 1SOAA 2BHSA 2O1XA 1JEYA 1IQRA 2QN6A 4M6WA 4M76B 1WQ4A 4WADA 2FPLA 5JZMA 4WX2B 5TS3A 3FR7A 2IUYA 1XNGA 2ZRHA 5DHAA 3EX7C 3ZDYB 4Q01A 3ENVA 4MUNA 5THXA 1KVQA 1ZKMA 1DBIA 4NRDA 4X8HA 4ZV7A 2GJKA 2J9FA 4KXUA 3E9NA 1JR3E 2XYGA 1JZSA 3RWMB 3NFRA 4H2DA 1WV1A 4GOND 4RCYA 1QRAA 2EX0A 2F17A 1G3MA 4B7AA 3F5MA 4Q12A 1GG5A 4Q7MB 1A8PA 1JDPA 4M0KA 5FUVA 3CH5A 1NOJA 2G9NA 3W9YA 2H1OA 4P53A 4MV3A 4TUYF 4X85A 4FUTA 2G80A 2P8SA 3EZNA 2ZYUX 5F5LA 3BXOA 1CDDA 3W9UA 1BN6A 4MR7A 3K9LA 4IJUA 3RUIA 1SGWA 4RD2A 3TVTA 4JAVC 2E7ZA 4QXMA 4QUKA 1IBMB 2FMHA 5AKYA 3UJPA 3SMQA 1XCBA 3HFJA 1O97C 4FYHA 5EQTA 2YCLA 4FU0A 4J7XA 3NC1C 3ZOZA 3D64A 1FIUA 4LXIA 2NSJA 2J3HA 1U3VA 1L5QA 3H4IA 2JVJA 4AJEA 4P2BA 1QQ5A 3MS2A 2HU2A 3PUYA 3ELWA 4RENA 4HJXA 1YH3A 3FLMA 2OA0A 3GFTA 3O3MB 1QK5A 1VB3A 3TZLA 2I3DA 4FIZA 2WB2A 1WWKA 2AR0A 3TKLA 5E6RA 2DUUA 1FLVA 1Y1RA 1MLDA 2QU8A 2C4HA 1ZMTA 5B1IA 2B92A 3TQTA 4LNUA 3ZBTA 4YRIA 1PJ8A 2VPIA 4C4ZA 2HXGA 2CDRA 2ZQ5A 4K88A 1G8PA 1WW8A 5FTJA 1LJLA 2P5UA 3SMVA 3SYRA 2V3WA 4CVNA 5AVTA 1CQIA 3G02A 5ICCA 1NVWQ 5A7FA 3JZMA 2XA9A 3BE4A 4Q93A 4NKRA 1QYVA 4G3XA 1J0EA 2FF5A 3PHCA 1EMDA 4V0NA 4B3FX 1FFEA 4DPKA 2ZWMA 3BXGA 5JXWA 2FMXA 3H1AA 4E3ZA 4IVPA 2X2PA 4A2PA 4BN5A 1FMLA 3ELYA 3IP5A 4B3TB 4MRMB 4BJ1A 1G5TA 1LV7A 1NVAA 1XZCA 1QOPB 3ABSB 3WI7A 1QAQA 1OLXA 4WDQA 2DR3A 1KMQA 2YFYA 4BMCA 1M5TA 1KMHB 3TUZC 1ZAKA 2W58A 3PPWA 4B3GA 1XRSB 1XMSA 1GP2A 1X1EA 1HRKA 3EDQA 3JZIA 3DMYA 3EY4A 4ACBA 4PX9A 1A9TA 2BFAA 3FYUC 3I9V1 3IQWA 4O0LA 5JQGF 4DUPA 3NPAA 2CSUA 1ZD3A 2F62A 3FFWA 4TVSA 5HWSA 4C2BA 1U9IA 1HC7A 2VHWA 3AGQA 4BV9A 2GERA 1PBTA 3YASA 1KEPA 1UK7A 3L0PA 3PXGA 2LR0A 1U2GA 4YIKA 2AXPA 5G4LA 2FG6C 3EXG2 3PPYA 2G0AA 1FTYA 4H7HA 1GL3A 3PNVA 3LCUA 4XFDA 1FA9A 4C6SA 2E87A 4BC1A 1XVAA 3IQGX 5IBPA 4RJTA 3P9NA 3TG8A 4LOKA 4LVOA 2YVAA 4ZREA 5H3LA 1U31A 5FXMA 3CRW1 1JIUA 3M2TA 1QS0A 4OU4A 2BI4A 3K3PA 4L9SA 3A1CA 2A5LA 4G5QA 4JYCA 2D54A 2ZRFA 3MD9A 1ZK4A 3K4QA 4FDUA 4Y2HA 4FXPA 2F7SA 3OESA 3DCIA 4OJYA 3TPZA 1OXUA 3S55A 3VOSA 1IHDA 1OILA 1Z26A 1PSZA 2AUNA 2O0JA 2GYUA 2R6CA 5T4FA 1QFXA 2YWXA 4G8CA 2QRUA 4X91A 3DTVB 1V16A 3DOEA 2J0QA 2JJ1A 3WBBA 5FO1A 3BHNA 3B6IA 1ZEMA 2QRNA 5I51A 5IG2A 4XYBA 3DF7A 3C16C 1ZK1A 2VNSA 2B99A 3ZNQA 4BBPA 5L4SA 3DWIA 2C8JA 4JJZA 5FL3A 2NV0A 5ALRA 3U17A 2RB4A 3OA2A 1E9BA 2AYXA 4B8ZA 2WF6A 4LQCA 2OZLB 2YH2A 1W88A 4CDGA 1K2WA 3M70A 5CVVA 3M4YA 4XVHA 1GPDG 2D74A 3IIMA 3KQSA 2HLPA 2PAFA 3TDKA 1Y8AA 1YK0A 3NC0C 4GWKA 4UEJA 1H6BA 2PEYA 5JE8A 1GA6A 2FPMA 3O94A 3SR4A 3H2KA 3ZQ4A 1H2FA 1EFLA 4JJAA 1SCUA 2Q1XA 4RSMA 5TMDA 4D4JA 1CUYA 2GASA 4I36A 1M34A 2C95A 4UDNA 1TM5E 2VDPB 4HGNA 4Q4AA 4YMVA 2JF0A 1FVFA 4KO8A 4ESOA 3KQKA 3AVQA 4B87A 3RAFC 3V42A 4PHTA 1BG6A 3JD2A 1KR2A 2BJVA 2HMWA 3PWZA 4GDMA 2Z5FA 2EOAA 2GBCA 3BWYA 3DG9A 3SNKA 3CLSD 5TGZA 1ESEA 4C4YA 3KX2A 1E3DA 1PFQA 3W1EA 1MRZA 5EXSA 3UJ9A 3HXOA 5I3CA 1YWGO 1ZK2A 3VHXA 4O0MA 3ER6A 1HM5A 1IL0A 1RYMA 2Y0PA 3RWOA 3VPDA 1PJCA 4F84A 3K1AA 3ICWA 1CYDA 2EFYA 2Q2VA 1UJ4A 2VNIA 5AXCA 1UZAA 5JDCA 4ND2A 1AE1A 1AZWA 1VP3A 3NT4A 3TMKA 5AVVA 3I5XA 3V4RA 5JQGA 5EIWA 4HH1A 3RK4A 5INTA 1ZIDA 1L7MA 2V3VA 4TL9A 4GI1A 1SCDA 3SD7A 2XHZA 3A1NA 1AKYA 2CNWA 2QGNA 1QH1A 3L6UA 4NULA 1OKKA 5HCIA 4C4SA