1JS1X

Crystal structure of a new transcarbamylase from the anaerobic bacterium bacteroides fragilis at 2.0 a resolution
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
Knots found
sequence length
324
structure length
324
Chain Sequence
MKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYTGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLPHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcarbamylase
publication title Crystal structure of a transcarbamylase-like protein from the anaerobic bacterium Bacteroides fragilis at 2.0 A resolution.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 110
structure length 324
sequence length 324
chains with identical sequence Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.9: N-acetylornithine carbamoyltransferase.
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
X PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1js1X02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1js1X01
1Q95A 4EKNB 3TXXA 1ACMA 8AT1A 1AT1A 2BE7A 5G1OA 2H3EA 3TPFA 3LXMA 4IV5A 3E2PA 1ZA2A 4KGVA 1RAIA 1RABA 3GD5A 1RAFA 4AT1A 4FYYA 7AT1A 3KZNA 4BJHB 4A8TA 1SKUA 2FZGA 4OH7A 3M4JA 4KGXA 1C9YA 4KGZA 3M5CA 5G1PA 4AMUA 1I5OA 4KH1A 1RAAA 2QG9A 2QGFA 2YFKA 4A8HA 4F2GA 1DUVG 1TUGA 1JS1X 3Q98A 3L04A 3UPDA 6AT1A 2W37A 3SDSA 3MPUA 1NBEA 1EZZA 3KZOA 3R7LA 4KWTA 4EP1A 3KZMA 1EKXA 3D7SA 4JHXA 2I6UA 2OTCA 1XJWA 1PVVA 1TU0A 4JQOA 1RADA 1RAHA 2BE9A 1VLVA 3AT1A 3D6NB 3KZKA 8ATCA 3L06A 3GRFA 3KZCA 1EP9A 2P2GA 1RAEA 4E2FA 2IPOA 3NPMA 2ATCA 4KH0A 4H31A 1RAGA 2AT1A 3L05A 9ATCA 2A0FA 2FG6C 1F1BA 4A8PA 1DXHA 1FB5A 1A1SA 2G7MC 1R0BA 4ANFA 2FZKA 1AKMA 4WTOA 5G1NA 4NF2A 3M5DA 1FVOA 1PG5A 3CSUA 4FYWA 2FZCA 3R7FA 4JFRA 1ZA1A 2HSEA 1OTHA 3L02A 2FG7C 2EF0A 1D09A 1ORTA 5ILQA 3M4NA 4F04A 1TTHA 4FYVA 4AM8A 1R0CA 5AT1A 1ML4A 3R7DA 1RACA 4FYXA 2AIRA 2RGWA
chains in the Genus database with same CATH superfamily
2C2KA 3RTGA 3SDZA 4MKXA 2XW6A 5C51B 1SKMA 4BMDA 4BLPA 1KO1A 1ZVMA 3PXBA 3W6OA 2BR3A 2F7SA 3B6ZA 4GU5A 5G1OA 5A6SA 2GJ4A 2ZE8A 3BKXA 4S04A 3GLRA 1D2EA 2AQHA 1CZHA 3HVUA 2Q41A 2V8BA 3VSEA 1SKYE 1JYFA 3M49A 2CXSA 4P82A 5HIJA 4BMOB 3T06B 1G8JA 3ANTA 3HR7A 1ZM3A 5IT0A 2ZSFA 5DKFA 3EXHA 3DPUA 3NBAA 1YDGA 3RQSA 1V6CA 4FINA 4AY2A 1R66A 3TQRA 2AG8A 1FUKA 1ONBA 1ZXBA 1U7TA 1C9YA 2Z43A 2ARKA 2GFHA 3L01A 4DCPA 3SZRA 1E3JA 2ICAA 1GZHB 2GWHA 2YDYA 4Y0AA 1RRKA 2CYBA 4DEVA 2VSFA 3L92A 3H11A 1DWQA 1ZC3A 1XR3A 2WJJA 3EY4A 4MO2A 5EMNA 2R97A 1KEVA 1M2FA 2VAXA 3DZKA 3HSKA 1PJLA 1NASA 3HXQA 2WJAA 3H04A 2P2SA 2VCYA 3GUCA 1LLUA 4LE2A 3NC1C 3K16A 4P98A 4QEDA 1KY2A 1BFKA 4TKVB 4UBJA 5IARA 5J1SB 4K0KB 3NGMA 4U39A 1XG5A 1WXDA 4GUDA 2FB9A 3ZV7A 4L50A 5BMVA 3IA2A 2BI8A 4MNTA 4DCJA 3PHLA 4MICA 1D4ZA 4OU4A 3L1VA 1EFPB 1FVHA 4LVOA 3ZXSA 2CBZA 3WFIA 2O0LA 5H80A 2BISA 2NM0A 3OE7D 3DUFB 3RAPR 4CMIB 3CLVA 4CMCA 2BM1A 3QSGA 4G0WA 1CV2A 4URYR 1H5QA 2C61A 3RT1A 3BDAA 2PXXA 3R5SA 4XVQA 821PA 2IU6A 4UUAA 3G49A 4LDNA 4GQIA 3G5LA 4N18A 4M1TA 4U00A 5I4CA 5J40A 3T5TA 4M9CA 3DCYA 5BVGA 4QG7A 4C6TB 3DAPA 1NXQA 2IZOA 3GEBA 3PFGA 1C4OA 5BXYA 3UFXA 1DC7A 4MR8A 2PWAA 2QTVB 5LNK6 4ZMSA 1RWOA 4UXJA 2AMYA 2NSHA 5MGNA 2FG6C 2ZSHA 2OLEA 4XI9A 3HADA 3ZU4A 4UM8B 4AROA 4DMLA 4EY8A 4JEMA 5HM8A 3LA6A 2I0FA 3PUYA 2R11A 1RYEA 1U1CA 4RK1A 5IBCA 2FWPA 4WCFA 3OFNA 5CT9A 4ZYVA 2JVKA 2VJDA 4YMSA 3H16A 1OWOA 4RPIA 3OO0A 5KSOA 1R8QA 2DF8A 4DMHA 2X7HA 1E2GA 2M6RA 1LTQA 5KX5F 1CJKC 4HX2A 4I50F 3DCNA 5EIFA 2W5UA 4BUJA 1NF3A 2AFIA 2PKEA 3K9CA 3FPAA 4AC9A 1U7UA 3EJWA 4TZKA 2GZMA 2HSEA 3L0OA 2C2XA 3LV8A 4IIBA 3IPLA 3JQRA 1XP8A 5EXSA 5AVJA 1TFRA 3DYIA 1SU4A 2A1TS 3ESXA 4B3RB 2ZRHA 5JY6A 1N8SA 4IGAA 2Q3EA 4E12A 1TTHA 2I4MA 4FMBB 3RTAA 1CZLA 1BQ4A 2ZJ6A 3KQWA 3KVVA 4HZUB 4K88A 2PM8A 1UBEA 1V8FA 3KJXA 3T0FA 3BDVA 3WMFA 3T8YA 1FNDA 1GGJA 2QW1A 5AI6A 5HXAA 4WKPA 1SY7A 1WJGA 2BSXA 2OGSA 2FPMA 4KMOA 1KHHA 5BSHA 4CEJA 3LECA 3I9LA 3GGDA 4RIHA 2CC2A 1V96A 2IHBA 4MPRA 4JLAA 2H2IA 2QOEA 3BMXA 4CMEC 4ZZ3A 4CF3A 4K1XA 4BGVA 3N2EA 2F2TA 4EBBA 5KYYB 2QRJA 1XRPA 3UH0A 3D8NA 4YRGA 5C9ZA 3PEFA 3TMAA 2C7QA 2E4AA 3BGVA 3ZXXA 1DX6A 1Z28A 2ZT6A 1CS0B 3DLBA 4Q7MB 2O2IA 4W5JA 3WB0A 1BD4A 4G0UA 4DLPA 4JJGA 3B5IA 1EXNA 2Z1MA 1QQ6A 4K40A 3HZOA 2H2DA 1EP2B 1P33A 2NUBA 1V71A 1BMFA 3EVNA 3NCTA 1P62B 3AEUB 3V42A 3C24A 2BP7A 3ZCTA 1PKEA 5AM1A 3W34A 3V4RA 3H2HA 2WU8A 4B3BA 3QYJA 2Q21A 1NZDA 1Z5OA 2GFIA 5ESXA 4MUIA 2P9GA 1EFPA 5BN1A 3VA7A 1N1MA 2AQ8A 3TNYA 3WWPA 2QXYA 4GIBA 4U2GA 5EHNA 2XSZA 1DX4A 4MEBA 4MGHA 3WTCA 4ND2A 4CM4B 3UQYS 1NMQA 2GHRA 2P4UA 2WG2A 1L5GB 4EPRA 5C1BA 5CVTA 3RG2A 1P6UA 2XB6A 1L7MA 1L5LA 4MS4B 3QYFA 3V4ZA 1OXTA 1H9AA 3BWCA 3K5WA 3MBKA 4QWMA 1CJMA 5E6SA 3ZCXA 1N2JA 2FFJA 1XPRA 3GBSA 2DPYA 3OQPA 1FFHA 4IQFA 4FMCB 1KI4A 2TRSB 4C6TA 3FBTA 5MHTA 2P4QA 1TO1E 4JB3A 1QGUB 3B85A 3Q5EA 4BUCA 1VPVA 1R6UA 1ECGA 1EGMB 4LWPA 1M83A 5JJ5A 3S2IA 3WGYA 5AVQA 4A36A 1KMIY 3F4KA 3EC2A 3ZE7A 5G41A 4QYIB 1TRHA 4CM3A 2VP5A 2BRUC 2DPGA 5JQGB 1N77A 3KZVA 4WAUA 4WLUA 1MX1A 1E4VA 2OXCA 5C81A 3TW4A 5DLPA 5B58C 5B1DA 2FPWA 3N5CA 4BEBA 4HKTA 1CJCA 2FSUA 3JD2A 4GXRA 1KS2A 1L5ZA 3FD8A 3SLRA 5IKOA 1NG9A 2C00A 1IAQA 2H85A 1GRRA 1HE3A 3LCCA 3Q1LA 1BJTA 2NZXA 4DL9A 4IDFA 4NBTA 3M33A 2PBLA 2IC5A 2XNKA 3L7BA 3MVEA 1FFBA 1AKWA 5E6UB 3AK4A 1IAVA 3PFNA 1VQ1A 3CZRA 1DBVO 2OZLA 4JMPA 3UH1A 4RKQA 4XAQA 2GA8A 3K73O 4PO8A 4LWZA 3RW9A 1HLFA 1Q21A 3HBMA 1N2EA 3T35A 1J8VA 2K4MA 4CDMA 4ETNA 4IX1A 4GOND 1QIKA 2WAAA 1QRTA 3A3KA 3RKUA 1HNWB 2DWPA 5DTEA 3LHIA 3G0IA 5ALDA 3AY6A 2PT7A 3EAQA 1EP1B 3RNLA 3F3KA 3MMZA 4EENA 3MUOA 5IFKA 3H0CA 4QXAA 5DNVA 5JCOA 2Q50A 4QECA 5ICEA 4WLVA 1NR5A 4PCAA 1KI2A 3MHTA 1TB4A 2J9YB 1TQ6A 1I2ZA 4O4JB 2ZT7A 1YBFA 2JHGA 3D3NA 4D41A 3CWZA 1UMKA 5DWDA 1J99A 1ADBA 2ONKA 2R5FA 2W93A 3HLYA 1J8DA 3IEXA 3BD7A 2G5PA 3CGGA 2X2EA 1FSSA 3T12A 3CMMA 1U0GA 5C5EA 4ZGGA 2H4YA 5JH7B 4D9HA 3GJ3A 1PR9A 3Q5DA 4LJLA 3H1AA 3E23A 3TR0A 4CF6A 3VKGA 3FXAA 2PVCA 4WDQA 4X7PA 3AEUA 2CXNA 2G6TA 4XR4A 3T41A 4H1HA 1XDGA 3EC7A 4MQLA 3TNJA 2CXHA 4N5LA 5CT5A 1A88A 3TOZA 4Z1OA 4MKFA 3ZU5A 4EG7A 2B9EA 3BGSA 3QGMA 4TS4A 5EFOA 4BX9A 5BWLA 5F7XA 5LA6B 4EG8A 4Y3UA 1R6VA 2EX0A 4RVGA 4CMBA 1PJSA 3H18A 4EEXA 4KO8A 5DP2A 5DXFA 2E55A 1B8OA 2AJBA 2QV0A 4G84A 4CM4A 1WMAA 3TM4A 1PD1A 2R7MA 3PDCA 2QPTA 4MS4A 4LGYA 1Y6FA 3D3KA 3X2SA 4REQA 4OQLA 5BYJA 5AJUA 4DCOA 1IQUA 4LECA 2ZR0A 1Q6YA 4M4SA 3TRJA 4ZDKA 3HCDA 2H48A 3ZDXB 4TYQA 2HRQA 1I1NA 4LE1A 3NWOA 4DM7A 1EMDA 4D8UA 5JWHA 4JQOA 1RMTA 1USGA 4HSGA 4WNAA 3VC7A 3IESA 2O50A 3EVGA 2IOHA 2XMCA 1UK6A 3ZEAA 3RODA 1U1IA 5BRNA 5I01A 1QUEA 5EUMA 5ALEA 4L7QA 3OMLA 5JEDA 2ATXA 2XOXA 2Y1LA 2QM0A 1U7WA 4CCWA 4HYQA 1L5KA 2I2FA 2CJFA 2DFVA 3DEFA 1U2QA 3OIVA 4LXGA 5HYVA 2AA3A 2WTEA 1F5NA 1ESEA 1PR4A 1W94A 3WFJA 2ZWAA 3ISVA 2NXEA 5HMMA 1NVXQ 1T1GA 4JI7B 1OJ7A 2GYUA 3WYGA 1ACJA 3GUYA 1SQGA 5I7OA 1CQIB 1FPMA 1M6EX 1F0NA 1S8AA 2Q6VA 3VZQA 1GLGA 2D5CA 3ND8A 1Y9DA 3B3GA 3KEMA 3TGLA 1PWYE 1NVTA 1VKNA 2AUMA 4RM2A 1G18A 1N9ZA 1NZJA 1MJ5A 4GPD1 4DCCA 3RH0A 2BFAA 4IO1A 3UJCA 1UC9A 2FGKA 5JPIA 1W35A 1E5TA 2ZXEA 4MX8A 2WIJA 4AG5A 4CXMA 4BWFB 3RV4A 2QHXA 4BYGA 3HR4A 2JGNA 2GPAA 3DCJA 1GQFA 4P33A 2HQ1A 5JVDB 5L9AA 4ZN6A 1H3FA 3PE3A 5HOEA 4ZVSA 3IC5A 1DC6A 2P0EA 2CVHA 1NSTA 4I7EA 4IH1A 3BSWA 1F6WA 4EH1A 1JT2A 4NZPA 4ED9A 1ZN9A 3ZK7A 5IAAA 1W76A 1OE0A 2OHIA 3W9YA 2HPZA 4CFYA 4X64B 2AKEA 3SHWA 1QF9A 3RAJA 3ITNA 4AP9A 2RHTA 4IGEA 1RRMA 1MGOA 1W5EA 1YB4A 3R8CA 2V7UA 5SY6A 2QD4A 5CA0F 3U4MA 2ZAMA 4ETMA 2I66A 4R1PA 2B4KA 1NBMA 2JIOA 3AU9A 3DTVB 4XQEA 4EPYA 2ZI4A 2O52A 3E27A 3RJMA 1PZXA 3KL4A 5BV1A 1R6AA 5BN3B 1FNBA 2QRMA 3CZCA 3LT0A 5KVVA 4DLUA 1GILA 1UPUA 2A94A 3IVMA 3R23A 2HO5A 3BCRA 4FDTA 4B8WA 4D3YA 4F3NA 2RH9B 4NONA 1KBQA 1U0TA 4RZUA 1T0IA 4J7XA 3NKVA 3TGWA 2XZDA 2GUWA 1N7JA 1W4ZA 2EJUA 1KPHA 1S4QA 1Y48E 1S3SA 1TA9A 1EGQA 2OLKA 1EG7A 2VH5R 3LT2A 4IFBA 4MWCA 3QW2A 1E3QA 5ECYA 4YAFA 3N8DA 1NIJA 1F60A 1DXOA 4UAJA 2EBWA 3CLTC 4NBSA 2M6KA 3K1JA 3O8BA 3T4XA 3OJCA 3UC5A 3IQZA 4ZHQB 5CBPA 1QP4A 3KJQA 2O2YA 1WLYA 1S2LA 3N2ZB 3BAFA 4JQCA 2BTOA 4MVYA 2QZZA 3AF1A 3I30X 3IPXA 4KLAA 2AEFA 5IASA 1UBNA 4EG3A 2NV6A 1QYDA 2IYYA 2IYVA 3C1OA 4ALNA 1JAIA 1DKMA 5E4TA 2EEPA 5ALSA 3ZHSA 4TYYA 1GL7A 3ONVA 2LTAA 3K2BA 3QVKA 4HXYA 4MWSA 3VX4A 2PX0A 3BXHA 1LNSA 4XQGA 4TOIA 1AXEA 4U5XA 3WI7A 4J0GA 2FPSA 4BPRA 4Q3OA 1Z8FA 4UAUA 3B2QA 1WZNA 3OHPA 4YCJA 4JHXA 4C29A 4JKYA 2R48A 1LI5A 1CEQA 3ZY5A 1WW2A 2FH5B 2WRZA 3EZ6A 2AG1A 2BKUA 4IUYA 4ECEA 1OSNA 4PXSA 4YV0A 2UYGA 3FWKA 3D6NB 3RSCA 1Q77A 4Y2QA 3TXYA 4PGAA 5FEUA 1IVYA 5FBWB 2AG5A 5LOVB 4LHSA 4ZRDA 4D97A 3NNDA 3RT7A 3UMRA 3VAYA 1JFTA 3DTTA 3GC6A 1LCIA 1GUYA 2C20A 3T5BA 2J5RA 1P1HA 4Y9TA 4TSKA 3DE1X 4OF4A 1NBAA 5DTMA 3UOWA 1KVTA 4ER6A 4BN0A 3PGJA 4R5MA 1CUSA 1P0IA 3AZOA 5CVCA 2OFWA 3HCAA 4YJGB 4DW8A 5F7OA 1AE1A 1TZBA 3JQFC 1PJ3A 2I4OA 4IZOA 3D5QA 4WX2B 5D3MA 4UARA 1YR6A 4AVYA 3E9RA 3IE0A 3T38A 2Q0XA 4WY5A 4FVTA 3JRWA 3OM0A 4CI9A 5JZ9A 4OXXA 4MZXA 2DFTA 4P81A 2C7BA 2M9MA 2BGGA 4RIFA 1WW8A 1Y5RA 4UTOA 3TL3A 2OXEA 4KWCA 4BX2A 3Q15C 1LSUA 3EGOA 3AV0B 3IPAA 4CKYA 3C8ZA 4E4YA 1FLVA 1ZA1A 5DHRA 1UC5B 3PITA 5TPZD 3STTA 1E2HA 1K2VN 2PZKA 1CE8B 1YJBA 3VNBA 1GGEA 2Y1GA 3DTVA 2CHVA 3IP6A 4O63O 1ORWA 3EG5A 5LP1A 1UEJA 2VDNB 3LYHA 3UANA 3UAGA 2Z2IA 1SVMA 4DBZA 1DC8A 1UXGA 2VXOA 3OM1A 3RC2A 2C1EA 4H27A 2Y0BA 4BLSA 1CUCA 4B33A 2VZEA 1Z56C 5FBLB 2R79A 2GBLC 4ENTA 3PVSA 3JQ8A 4PZYA 1BG6A 3C8UA 5AKJA 5GINE 3EOBI 5BRAA 3ZVMA 4PZUA 2WLSA 4HLQB 1EE9A 4G09A 4GUAA 1OV4A 4AB1A 3EFEA 4HWPA 3KR9A 1V8ZA 1WUKS 1E1LA 1G5PA 4TWJA 4ZHQA 3CUYA 1YVRA 5I7SA 4B79A 1PJCA 4O02B 2W42A 1G8YA 4B1FA 2XPCA 3GT3A 4L0QA 5TR9A 2QGZA 2EFGA 1C1XB 3H1TA 3IUPA 4WACA 4KIGA 1KXJA 4Q4LA 1LVHA 3ILHA 4GOKA 5CYOA 4XB6B 3JQFA 1E69A 2A9KA 2OVFA 3LZ6A 3IKTA 1E62A 4KO3S 1RWQA 2EBUA 2YC4C 1THTA 2KYRA 1G2QA 3LPCA 1JKFA 4Z4GA 1N2HA 4CI0B 2YN4A 2QUAA 1RE0A 3OIWA 4NP6A 4ARUA 1SCAA 1URPA 3QIAA 2IBSA 3GP3A 2ALJA 1VJRA 2MWMA 4H6XA 4HUQA 5DP1A 2Q9UA 2ZBGA 4UUMA 4TV9F 1RXIA 1IMOA 2TMGA 1KFKB 1C7EA 1S2OA 1SA0B 3AKEA 3CW8X 1FFXA 1YZ3A 3Q41A 5H70A 5JYBA 5LOVA 4YRFA 3M4XA 1TU0A 1GPH1 2GBCA 4V02A 2XVYA 4WT7A 3UWPA 1RAHA 4R8RA 1VKOA 4ZVKA 4D0RA 2WTBA 1X94A 3AT1A 3I1YA 4YB8A 3VC3A 5CBKA 4NH0A 3TFWA 2PKQP 4MGIR 3I2FA 1UADA 4GPTA 4MPTA 2BJHA 3IT2A 3I2YX 5DHAA 5EQTA 5TC4A 1HYGA 3UKJA 2XT0A 2Z5VA 4FE3A 4Z0HO 1JJIA 2V0NA 4DY4A 2GBLA 2O48X 3JS5A 3FOFC 3RBXA 4CNBA 3RYFB 3CR3C 4ZJYA 1ZNQO 3BMCA 5FH9A 1T0JB 3NGXA 4OSOA 4ZV7A 2IZ0A 3TG2A 4OFBA 1VTKA 3K6RA 4IZIA 4DADA 1NRWA 2G82A 2UUOA 2AEEA 1X7DA 2ZU6A 4MQ6A 1U9ZA 2EOAA 5T3YA 1XPUA 1CQPA 1V7CA 2A59A 2JVIA 4BFSA 2PGXA 3KHUA 5E3JA 4I5IA 3MAGA 1DT3A 1BHQ1 3K70D 4WTOA 1O54A 1NULA 1T15A 2ZYGA 3M6MD 1D1PA 3HY3A 4DNQA 5DGIA 2ID8A 4D6YA 2BDEA 3RV3A 2RK3A 4Z4QA 4O2LA 1TW2A 1OWPA 2OQIA 1QR2A 2QUHA 4GWGA 2C9MA 2QMQA 4OKSA 1R0RE 1ZJYA 1N2OA 1DHRA 1T13A 2NSYA 4DABA 1KK2A 5BNTA 1N9KA 3QBTA 3T7SA 2ISQA 2CL0X 1M3SA 5FTWA 2VP3A 4TSFA 2VYCA 2B99A 4HVAA 3H86A 4I19A 4L5CA 3DXYA 6REQB 5EIXA 3Q10A 1E9VA 5EMLA 4IDOA 1NJ5A 1YCDA 1AZSC 1VBMA 2VA8A 4KRGA 3QX3A 4OX9Y 1WLSA 2P9BA 2VZLA 4S1TA 4MGZR 3K0BA 3OEYA 3QXHA 3OSZA 4PFJA 3ADCA 3GGGA 1XZMA 4R0NA 4EFKA 3PQ2A 4XLLA 2GSDA 1ZWKA 4E08A 2MIIA 2Q5IA 621PA 3FF4A 4MI3A 1C1XA 1XFDA 2ZSUA 3AL2A 4KXXA 4US0R 3K2EA 2HWUA 2QW8A 3H1BA 1A5ZA 1G0OA 3WAGA 2EWMA 3CH5A 5IRCD 1YZKA 3DW1X 3GMTA 2CSXA 4ESVA 3KVYA 3THWA 2W6PA 3LMKA 2HA3A 1UWVA 3LC0A 1UXHA 4Y6GB 3S2SA 5CM8B 4BFTA 4OHOA 3VU9A 4BFYA 1QAMA 1N2CA 3UVEA 3ZY3A 3EMDA 3E9YA 2RHOA 4D8YA 5K3AA 4X94A 4FC6A 1EK1A 4BNZA 1EVJA 3BTVA 5C32A 2GEVA 2V6FA 2W22A 1L5OA 1FVFA 1VA5A 3KVNA 4NBWA 3OETA 4OV6B 5EPEA 1VJ1A 9GPBA 4B3SB 1KAMA 1JIIA 5FA5A 4OSEA 4J2TA 5CDTA 3A6PC 5KU7A 1SVSA 5SZJA 1VP9A 3NWPA 1ICEA 3ZHYA 1OFGA 1PSZA 2PG3A 2GOYA 3SFTA 1V8DA 2X2PA 1GRVA 2GERA 1PQPA 2ETXA 4W63A 4QEKA 1S0UA 4M0EA 4XRRA 4R1UA 1O94D 4DAEA 4XPIB 3CC8A 1FJHA 2C4VA 1Q5PA 4LRUA 4EQ6B 1U81A 4JUBA 4JYBA 1DAHA 1XEFA 3OSUA 5KTTA 1J1UA 2AI1A 4BLQA 1RIFA 2XT9A 3GPIA 1NW9B 3VV3A 3I12A 4P58A 1AV6A 3RBVA 1GU0A 5B4UA 2X4DA 2X7XA 5KQRA 2I99A 1S9HA 5HDQA 3P20A 1E7RA 4G9GA 4WOBA 3GVIA 2QDKA 4AURA 4DJTA 2J9FA 3CX6A 1KWKA 4AJEA 2OFXA 1ZSYA 3CXUA 4HDRA 4GPBA 4LJ5A 4TS3A 4WSOA 1XDZA 2RGAA 3SYKA 4RK6A 2JIMA 1JBQA 4XASA 4YO7A 5BSUA 4F8JA 4UZEA 4ID3A 4FZVA 3AILA 1R0BA 3VR5D 1SXJE 4MYTA 4OREX 4MK4A 4KAXA 3K0KA 5KOYA 3RAFC 2Z95A 2FW8A 4N5MA 3S0JA 1W36B 2PLFA 4PV7A 2H1VA 2BZ1A 3CSUA 1EJ6A 3FM9A 2V1XA 1WEKA 2EQBA 2DLDA 5A9SA 2Q5JA 2I7TA 3LC2O 3ANYB 3G8CA 4LYEA 4G1BA 3I23A 3V80A 3PJGA 3C7CB 1AKTA 2VJLA 3HB5X 4B44A 6REQA 1EZ4A 1XLTA 1EBFA 1KP2A 4AY3A 1EVKA 1NAIA 1ZM7A 2BZ0A 4KO4S 2Z6UA 4FMDF 3ERCA 1Q3KA 4I4TF 4NC9A 5ESRA 5EEHA 3TQQA 4Q1VA 1J2YA 5CM2Z 1E2EA 2RH8A 1YO6A 1DKNA 1ZIPA 3E84A 3JRXA 1GWNA 4A5OA 2QX8A 3PCXA 3HPQA 4MKIA 2GTPA 3CZAA 4C4AA 5MN4A 2MINB 2H92A 2P2NA 2IXDA 1UPFA 4W6ZA 1EWTA 3JASA 2FAXA 3K4HA 5K0LA 2CYCA 2YVAA 2WA1A 3EDMA 5TX7A 3V8PA 5LMNB 1VP3A 3C5HA 3EDYA 1KK3A 3ABRB 1BE1A 1HDZA 1N1GA 2AF3C 2VOJA 3H87A 3ILXA 3QXGA 1UXKA 3NV7A 4FLMA 1W36C 3TDKA 3FSJX 5TF4A 2IIQA 1D7OA 4Q4AB 521PA 1E59A 1W4BA 1MJHA 1E2BA 4O1MA 4MV9A 3JQ9A 1WMEA 1MO6A 2JZCA 2V7BA 5KHAA 4PO9A 4JC0A 2ZIVB 3G9ZA 3RRNA 4JBXA 1A9YA 1P60A 1YVPA 1Y9AA 5LA6A 2P67A 5K8VA 2I2WA 5G0UA 3PHHA 3CKKA 3F8SA 1WBJB 1D6NA 3MHPA 3ZVKA 3VO1A 1WSDA 2FWNA 3B13B 4MQUA 4WH0A 5EWMB 5CYGA 1KI6B 4WQMA 5K99A 4KXMA 4QJ4A 5IYZB 5LKRA 1ZK1A 1YB1A 4V2IA 4C7OA 3RWMB 2WWHA 3ESQA 5H5JA 3WHLA 3PXAA 1Y34E 2AG0A 2IUFA 1UBJS 3MELA 5CDSA 3EIUA 1FS6A 2JG3A 3QEAZ 1JEOA 3FETA 4DYVA 3V00A 4ZK2A 2JDID 2WWFA 4I14A 4GM0A 4MR7B 4W8HA 2NTJA 5LB2A 4A5SA 3BRCA 4LI0A 5BWBA 5IVKA 3O83A 4CTNA 1GN9A 4EM6A 1G60A 3ABOB 3DVAB 4GBED 4J2HA 1LLDA 1WAMA 2PSEA 4ZOCA 5TMEA 4FGLA 4C0XA 4O1HA 1R6BX 3MS4A 2P6PA 1J9EA 1PFVA 4O8ZA 1IXYA 2GAAA 3BT7A 3WMXA 3T5PA 1RZRA 4Y9SA 1H2YA 1PT6A 1UMCB 4L72A 4JODA 5GQSA 4F96A 3IDOA 4MUJA 1P80A 1V11B 3T34A 4ABTA 5AW5A 3RF7A 3DMRA 2ZYSA 5F3RA 2NP7A 1T2AA 1UKCA 4IXMA 5JYCA 1TF7A 5ALMA 4FEGA 3DZDA 1DEKA 1PVDA 2IZ5A 1Q3TA 4TKLA 5AVKA 2Z8XA 5A1TA 5EE3A 1LTHR 2A0FA 2PKCA 3PZBA 4DZTA 4DN6A 4G5XA 4IR7A 4LQDA 1M2OB 3T7TA 1LC3A 2DBZA 1L8LA 2OHJA 4PCUA 4YDHB 1DTSA 3EXIB 3QXSA 4EAQA 4EJ6A 3ELYA 4HFNA 1WXFA 3KQYA 4OL0A 1L8XA 2QWXA 3ZV6A 2G71A 4NFSA 4TUYA 5A6VA 4LF6B 3AOEA 3KXDA 3U7FB 4KKXB 2GFQA 3GJ7A 4L07A 3B9BA 2Y0EA 2FR1A 3QNMA 1JKMA 2PEYA 1H8HA 4GE0A 4E7OA 3KQNA 4HPXB 3KAPA 3RC1A 4DJAA 3FMOB 1PL8A 4U7PB 4BV3A 3PP8A 4WGFA 4JUFA 1G66A 1P4GA 2NZ8A 1X1CA 1A4RA 1UPBA 5AYVA 3WKEA 2ASEA 1F0KA 1GL9B 1TQ2A 1U28A 3GDWA 2LKDA 4LSWA 1ISJA 4B3HA 4CLRB 3KQKA 2MINA 3G0CA 2QVXX 5ARBA 2EGHA 4BFCA 1QGYA 3QEOA 3NATA 3VYRB 3ZIAD 3UK1A 3LY9A 1GNPA 4NZOA 3RANA 1B43A 5E7JA 1OAOC 1D2CA 5B1EA 2I7VA 2OKGA 7MHTA 1BXRB 2XWBF 2P62A 3FWZA 4J0FA 1TYBE 1ZA2A 2GTHA 1LX7A 2SCUB 3X3HA 5A4KA 4PAMA 1F7UA 3LHFA 4MWOA 4WVLA 2GN1A 3OZUA 1ADGA 5A7FA 3W04A 1E8NA 2TSYB 1DKLA 4FMPA 5DV9A 4R9RA 3NBZC 3RS4A 1Q0QA 4EKYA 5IVPA 5ICCA 2WJ3A 1Z9BA 1KIMA 4PTLA 4DIKA 5I51A 4LYJA 4NK4A 1KEEB 3SNKA 1MMFB 1U4SA 3S5JA 1AJEA 1KI6A 3DKPA 1EFAA 2H5JA 3MS7A 4MRRA 1XSEA 5AJZA 1GDTA 3O9MA 2XDWA 1MJGA 3V97A 3X2EA 3OZRA 5B55A 3ROFA 2FSSA 4TLBA 4MDEA 4DTCA 1FYXA 4NQZA 2J59A 2UVPA 4KACA 4XOIA 2ORVA 5IFLA 2DBVO 3DLTA 4BNWA 4JYPA 2DFKB 2JAWA 3AETA 3GDOA 4KFTA 3OZFA 2FQWA 3JX9A 1NJFA 1VBKA 1WSBA 3CLRD 4IHAA 3QITA 4Q1FA 2IU0A 4RMGA 4DCTA 1S01A 2JF0A 2VL7A 5CX1B 3OFVA 3OD5A 4ER3A 3AZPA 2G1AA 3N9IA 2YL2A 2Z2ZA 4QJ3A 4L4ZA 4K6KA 2OB2A 3A4YA 2BF7A 4F45A 4P3PA 1PFUA 1VHLA 2A9VA 2JI6A 2EV9A 2YTZA 1V11A 3HZRA 4JJ6A 3LPMA 4CL3A 4V0ME 1CIJA 2IYTA 2GXUA 3BFPA 3L2OB 1KARA 4LBYA 1KQFA 3UMVA 1R0YA 1R8SA 2B7CA 2WU0A 3MJTA 4MI9A 2I7XA 3ZWNA 4DIUA 4EBFA 4M76B 1Z4QA 1ZCJA 1CC1S 3FPJA 3NHZA 1LD3A 1IEXA 1H23A 1SH7A 1JFRA 2F1HA 4OK3A 1XQ6A 3T1HB 1AK9A 4CM1A 2YWRA 4KHPB 4H7PA 2OILA 2X41A 5KOIA 3AOGA 2CUNA 1IBKB 1QQTA 1SQ0A 1IULA 5DK6A 3IKMB 4EJ0A 2VHZA 2B20A 1TQ8A 3FWHA 3HM2A 5B6JA 1D9XA 1I5RA 2J7KA 1VJDA 2FUG6 3PFIA 2D3WA 3Q9SA 4KNYA 2E21A 1SC6A 1Q14A 1N3LA 4GM4A 2PL5A 4DVGA 1HZJA 2V65A 4IHQA 4YRAA 3E8SA 2IYSA 3GEEA 2NU9B 3QLUA 1ORHA 1Z2PX 4WECA 5HM6A 4BHTA 2G1JA 2HJHA 3CVWA 4HAXA 3B89A 5FXMA 3KNZA 3OF3A 1T2UA 3FZNA 5C1PA 2ORWA 3QE4A 4R2WA 1TK3A 2NSLA 3F67A 4HDKA 4N0QA 5T4EA 5BSRA 1A2KC 1U7PA 3QWHA 4DM3A 1NW5A 4NHOA 2Q1WA 4GQBA 4JT2A 2GBPA 16PKA 2CL7X 1LDBA 5T4HA 3X1KA 5AK6A 4M86A 4QHTA 4C7JA 4Q4JB 2DG2A 3DQPA 3HUDA 1O6BA 1XAIA 1C7IA 2EFDB 4QPZA 4ZCSA 3ORSA 1SELA 2KB0A 4PHFA 5D7NA 1CEYA 1ZU5A 2VJAA 4V0OA 1V95A 3ZNNA 4F04A 1D0VA 2WQ7A 1GTL1 1NJGA 3PUWA 3DB2A 1H8EA 4FFSA 4F4DA 4B76A 3NJRA 3CPHA 4XVCA 1IJKA 2ZIAA 1ZMOA 5E4YA 2HLDD 1XNHA 2RGWA 2YVQA 3B1JA 4L7VA 4ZEOA 4EKNB 2CCGA 1M2VB 3CEJA 3HY4A 4WZBB 1XVIA 3TXXA 1QIJA 1XNQB 1QOPB 3SYLA 2PJZA 1NLMA 1JEQB 4LYFA 1PS0A 2FEMA 1BDJA 1I1OA 4ZQBA 1K3TA 4TMZA 4TKUB 1NXVA 3F71A 3M81A 4KLCA 4X45A 1KEEA 2BGIA 4QOEA 1G7CA 3DW3X 4DNOA 3BMNB 3IBYA 1X7XB 2YWEA 3RAGA 5HK9A 1UWKA 4M49A 4QDUA 4XSHA 1V37A 4A9AA 1L5YA 3IKJA 4ZD6A 1YB6A 4M0CA 1XXHE 3KTOA 2VSQA 5H4HA 3CUTA 4EI8A 3R40A 3EX7C 2EJWA 1HDYA 2ODPA 5D51S 1HDGO 2ZU0C 1KAEA 1EJ2A 2DLNA 1IZ7A 2Q4EA 1JQBA 4TS1A 5TQ0A 4EI7A 1A4UA 1VLJA 3NTRA 1CR0A 1ZISA 4ZAVA 2WWIA 1X9GA 3OVMA 4ON9A 4RENA 4JDUA 4RQTA 1EE2A 4AO8A 3BXOA 3ENVA 4QFMA 2G17A 1G1AA 1RXUA 2CD7A 5DSZA 5FUQA 3ZI7A 1NM5C 4B6FA 1NQTA 4O1IA 3UW3A 1DJNA 2XNJA 5CFOA 2AJDA 4K26A 4N41A 1YQ9A 4IW3B 5AR1A 5C8DA 1UKAA 2I6QA 2ZRLA 4LQCA 2PS9A 1CRZA 5K4HA 2V6JA 4HFJA 3TR6A 1FW8A 1P2GA 4XYEA 5C3UA 5DN6A 4YQZA 2H5EA 3IHKA 1E6EA 5G40A 1DSSG 1G8PA 1E20A 1PK8A 2EBHX 4LHWA 3GFOA 4OVKA 3FYUA 3DKRA 3W5UA 3W77A 4ZKDA 1OI3A 4RK5A 4BO7A 2P6NA 4G65A 3SM3A 4UFNA 5DSXA 3LOQA 2DUJA 3KZCA 4PO1A 5F5XA 5I8ZA 3K3PA 2I71A 5AW7A 3RIMA 2VQEB 4JQYA 2YJ4A 2XGJA 1ISFA 1Y80A 4UCWA 1ULHA 4URFA 4H77A 3CIOA 3IVCA 4FDAA 3WLEA 2W4IA 1P1RA 4ZT6A 3QBDA 1HLDA 1VPEA 2QTBA 1XCMA 4L9WA 4NABA 4MKRA 1NR1A 3UB4A 1DOAA 4YCMA 3I92A 5BSKA 2IHVA 1V48A 1N8TA 1HORA 2NU9A 4RANA 5I9IA 3FIUA 3JVEA 2UYOA 3M83A 5CPBA 2CJPA 4BL5A 5BMOA 2XQJA 2O2XA 3OKFA 2HLPA 4Y2GA 5EP1A 1NLYA 2VHQA 4EUSA 3AHJA 1C50A 1D3AA 2QMOA 2XDAA 3PFBA 5FADA 4YH1A 3W78A 1I36A 2A14A 3KPJA 4QUGA 4J0HA 2GJ9A 3M1AA 4L4RA 4NYIQ 3OJXA 4QLBA 4F5ZA 2LPMA 2BGJA 3BCSA 1QLJA 3HFSA 2ZREA 4E33A 4ZO6A 1HRDA 4PRYA 4S12A 1XZPA 4BNXA 1IEVA 4KQEA 3ROMA 3EVFA 1T5TA 3F6RA 5LD2C 3FZQA 1GAWA 3ASZA 3FHLA 4BO6A 3NT4A 2WWGA 2ZPAA 1GSIA 2P6MA 2RKBA 5GGYA 2XGGA 3ZWOA 1EM8B 4P32A 5ILQA 4WZBA 4NICA 2Z6QA 3WRYA 3K6JA 5AMXA 1TYZA 1R4AA 2PRKA 3DM9B 3MTGA 1JEQA 3NLLA 1X7HA 3S5UA 4D5EA 2CLCX 4NULA 3ZHCA 1M0TA 1AZTA 4H0FA 3RSHA 5JSFA 4TKUA 2F3SA 4FCTA 2QUZA 2HLHA 4LFAB 4MXDA 1GRQA 2RGCA 2Z8ZA 3BH0A 3EUAA 4G0QA 3QX7A 4TN1A 2YW2A 1F5SA 2CNDA 3DOOA 4UPVA 3EEFA 4J76A 1SVOA 2JI8A 4I8XA 4NZNA 4EZBA 4ZEVA 2I6SA 2PXCA 1KMNA 3CO5A 1Z18A 2EF1A 4M1SA 3DEYX 2ZZKA 4ZQCB 1OZGA 4HOYA 4C14A 1JQAA 2BEVA 1LK5A 4ZVQA 4BNFA 1PK9A 1C9EA 1RR6A 2NV2B 2N42A 2YNMA 4G81A 3ZNPA 5IF3A 2WDZA 1RBZA 5BSWA 2EZTA 1A8UA 4N3CA 1EFRD 1NJ6A 3KCQA 1TIBA 2JJ8A 1QX4A 2JLAA 2PU7A 1KYQA 4QBFA 5B57C 4G67A 5CXSA 2FDRA 1P9WA 2GF2A 2CMKA 4P7KA 1ZUNB 3GLGA 4QIHA 2D0IA 3LP8A 4DQXA 1TKBA 3KXKA 1HDIA 4B4WA 5HFJA 1M1ZA 4XB2A 1W0CA 2NQ2C 2VXYA 5DHPA 4OTZA 5DVZA 5K3OA 3GLIA 3CT6A 3DTYA 3I5AA 1SHTX 3OI7A 4HLCA 3VGJA 1W30A 2FY8A 4BGUA 2SKDA 4N5IX 3AB3A 1BS9A 4ENQA 3WAJA 3VU3A 1IPEA 1SBZA 1UZNA 3QPDA 4TSRA 4TVBA 1PJAA 4ZI3A 4YR7A 4TRJA 2FP4A 2B4AA 5JCJD 1CDDA 2OY0A 1WNTA 2H1CA 1W0JD 3TIIA 2WFLB 4I2VA 4IM7A 3RSFA 3G59A 1AV7A 5CCXA 1EKXA 4KRFA 1AQIA 1DIBA 1VJ5A 1CSEE 1QMGA 3VZDA 2WMNB 3KJZA 4BCDA 3M5WA 3VJRA 5A5DA 4B3XA 2GGSA 1MOPA 3AY7A 2C4WA 4H4CA 2IE8A 1GD1O 1HZZC 3RHTA 1IH8A 4BAZA 3LUDA 4YAGA 2ZSJA 1V3QE 1N5LA 1ADFA 1WSAA 1N1DA 1S2GA 5IULC 3DBRB 1T1IA 2B7LA 4FN4A 4P1ZA 3E5HA 5F33A 1FQWA 1JG1A 3MMNA 2NO1A 3RUCA 1BOOA 4NCNA 2BEUA 2SNIE 3HJCA 4MAMA 5AJYA 2J32A 4CF7A 2UZ1B 4D4MA 1ZO8A 2ZTSA 1RAGA 4O3FA 4EUHA 3MGKA 3OIYA 3T99A 5DGCA 2R00C 4EAAA 3TLZA 1XRNA 3ZZ0A 3LUPA 1G291 2GI4A 3LP5A 1U5AA 4LVCA 1E2PA 5IKXA 5LQAA 3SQDA 5ALLA 2PR2A 4QE3A 1T8PA 3DOEA 1RPAA 1ZVKA 5JFOA 3VZRA 2F3TA 1IN5A 1UBRS 2C29D 2FZKA 3H8JA 4JXKA 5A2QA 3BB1A 1E61A 4MINA 4TXLA 3P9PA 4AQDA 5F35A 3P2MA 4JENA 4RIGA 3DC2A 2EHJA 1K4KA 1RHMA 4A1FA 2WM3A 3WGUA 4ZZIA 4Q3NA 2C54A 3QI7A 3ZDYB 1EM8A 1W9MA 1Z5WA 1Q19A 2RFLA 1SUWA 3C43A 2W2KA 3WBBA 3GCXA 1HMYA 1ZVVA 1ZD3A 3MCUA 1CZRA 4RZXA 3LVBA 2KHZA 2FG7C 1Z68A 2GKSA 3OM8A 1NRXA 2BJVA 3LQ1A 1KDOA 5G4KB 3E22A 3A31A 3KU1A 3A2KA 1VSQA 1LDEA 2QRHA 3NDJA 4DUPA 4RPCA 4EZEA 5ADVA 4LC1A 1O0CA 1UZMA 4B31A 2H17A 1T4CA 1E60A 2KMLA 4B3IA 5K0ZA 4JJEA 3ZWYA 1QFZA 2PUBA 1QG6A 3DFUA 2XKKA 5ABPA 3OKPA 3HB1A 2JB9A 3TRHA 5ALPA 3HCCA 1J25A 1QCZA 2PH5A 4MAFA 3OPVA 3PQ8A 2WFMA 3ZY2A 1IVSA 1H4VB 1Q57A 4NZZA 4P0PB 3B48A 1AZLA 4EUNA 1L4EA 1R5JA 3BWVA 1NPTO 3EE6A 4R54A 1YD7A 1CJTC 1RDFA 1V35A 1ZD8A 4B71A 1T2FA 1E3SA 2YUIA 4DC0A 3IAUA 3FOEC 1KJQA 1COWD 1VCIA 5F64A 3W2GA 3NIBA 3MJCA 3UJ8A 4UTPA 1EYZA 4EJSB 3VZBA 2ZAYA 1N2ZA 4KC0A 5B7GA 5KNBA 3OKCA 1MB3A 3NX4A 5T57A 1L4LA 1Z0SA 5IUKC 1EAYA 1D7AA 1QPGA 1H2ZA 1SC4A 5FPYA 3I6BA 5JNTA 1X13A 4U5QA 4JGBA 4UM9D 4X8MA 5COQA 5I9SA 1VI6A 1YZFA 1LI7A 2Q9AA 1O97C 2RBGA 2WHPA 5HKLA 2JEYA 3G2JA 5KSPA 2VHVA 3VR3D 2WWYA 4RVSA 1TLFA 2YQ5A 4IOKA 3L6EA 4N7JA 5AK5A 4F3RA 4F4IA 4ILKA 5CEFA 3WLHA 1N5KA 3ZI4A 1V6AA 3H2ZA 2QYHA 5AVZA 2B1IA 1RQXA 3ZOKA 2AV6A 2ZRPA 2DC1A 5DBFA 3BHMA 4D43A 5LQUA 5GZ3A 5CA1A 4E2XA 3T7KA 4HH1A 1MHTA 2FMFA 2H59A 4TV8A 2PQ2A 1I5EA 3MNFA 4GT1A 4PX5A 1ZI8A 3CLKA 3ER6A 3W1VA 1ODFA 2XXAB 2ZBVA 5ECWA 4MV7A 2Y8EA 1JKJB 1Z75A 4IOLA 1I51A 1MB0A 2RBEA 2JPDA 4LE0A 4A10A 1Z4KA 3GRKA 4G4SO 4EJSC 3FNRA 2VUTA 1CJUC 4EPVA 3OUZA 1EGVB 2FK8A 5HX7A 1PBNA 3CCCA 2C5EA 4JT9A 4MP3A 3B6IA 5KO2A 2WJPA 2QR5A 3NXSA 3RS8A 1S1CA 3DQQA 4RVCA 3TZBA 1O4VA 4UEQA 2AEJA 3D4NA 3K53A 4X1IB 3LFUA 3D4IA 3E7XA 1UBMS 4OLAA 3NS7A 3M1YA 4HWKA 3DD1A 2BAGA 2YYAA 3H5VA 1OX4B 1PHPA 2JGIA 4M7PA 4TLAA 3ZHZA 4CLOB 3HA7A 1JTFA 1G5QA 1FB5A 1Z45A 4F7DA 2OOSA 3WIEA 4O5OA 1ONOA 1SB8A 2ISSD 3GLFB 3BORA 3LY7A 3K0CC 3QFFA 5I9BA 4IUBS 1FDUA 1AUPA 4KSYA 2GZ1A 4NYMR 1W5AA 4PE5B 1HE1C 3R9XA 3WTBA 2I5PO 1BE8A 3D59A 3GJYA 5H3LA 1CX9B 2J87A 3B52X 3ZDBA 3R8FA 4Y0VA 2FN4A 3VNVA 3Q8MA 1GG8A 4FHZA 5EA2A 5DRYA 2XUQA 1JNXX 4RQUA 1FE8A 2VHCA 4HSEA 3LC7O 2ZB7A 2DX7A 3HXOA 4AF6A 5EMHA 1W4AA 1DV2A 2RGNA 4A3SA 3MCVA 4C4OA 3QKRA 2WOJA 4MUYA 2CN1A 5A02A 3B7PA 1LQTA 2AD5A 5LD2B 3FUWA 1OPRA 1VL5A 2Z08A 5GJCA 4BNHA 4E5VA 2J0QA 2FWMX 3ND9A 4TLLB 3T6KA 4CKCB 1XJQA 3MCAA 5CG1A 3OE7A 3KT3A 3Q9UA 3AVTA 5D2CA 3SR0A 1X38A 5A2GA 2ZPTX 1IXRC 4PINA 2D74A 4JVLA 5FTJA 4CEHB 2X6TA 1JQEA 1ZITA 2J0EA 1OWMA 1UDCA 2QAIA 3OP4A 7GPBA 2PS3A 4IIUA 5DULA 3EUWA 2D2EA 1JHQA 4KGVA 1KQOA 1GRCA 2Z5LA 4HDCA 3I62A 1DCMA 3DG9A 1IY1A 1L5HB 2JAQA 4JL6A 1K5PA 2XLBA 5JXHA 2VUIB 2OV8A 2V7QA 3S29A 1XQ9A 1ZCZA 1DIHA 3EIQA 4FHCA 5GPBA 1EINA 1XRJA 2G8NA 3Q7SA 3BK1A 5EXXA 4FCCA 4I1PA 3I1IA 2X9LA 3PGLA 4DWJA 4QAJA 4EQZA 4LAFA 1A5BB 4IDQA 4CL0A 2J3JA 4JLJA 3BFJA 3GV0A 4LEIA 4CM5A 5M5BA 3PNMA 5KVAA 4K03A 2I8CA 3Q7PA 4YCAA 2OP0A 3PNYA 1BFDA 5CH8A 2FTKE 2BGNA 2IHTA 1SBCA 1VHWA 4IV8A 5IPFA 2I6FA 4H17A 4XXHA 2AK3A 1JFVA 4OGKA 5EHIA 3O1LA 3OFJA 5AP9A 4UXHA 3ZYZA 1G20E 2C4UA 3EUFA 4OQZA 2VPIA 3BREA 4C4YA 3VTZA 3DXZA 4FU0A 1T36B 3OECA 4BMNA 2WSBA 4YV7A 1GGMA 3BH6A 1DAEA 3A1NA 3GQVA 1PO7A 4EA9A 4Q3KA 3U4QA 4HH0A 5K4AA 1JDBB 3UICA 1H2FA 2IVZA 3V8QA 3F74A 3NHMA 5F52A 1WB6A 3SXUB 3HUUA 4O4HA 1O4WA 4B6GA 1T8UA 1S2MA 2IXTA 4R01A 3UO8B 5BXQC 2QL9A 1GZ6A 3H1EA 3SX2A 1U8TA 2VKTA 5K3CA 4DT1B 1ZP6A 1ZLYA 3L7OA 4AZSA 3LUKA 1LRLA 2JEOA 4C88A 5GM1A 1PHRA 3MTJA 4CLOA 3FHOA 4WJZA 3IALA 1PDVA 4H9GA 2IPMA 2P30A 5KAMA 4CQMD 4MA0A 2Q3MA 4MIOA 2JFXA 3UXEA 4I4CA 4IIJA 1GXSA 5JV5A 3GLFA 3PL5A 1DO0A 1CU1A 5HE8A 5JFGA 1NI4B 5JNUA 3QKSB 1JZQA 2ACWA 4OX9B 3T5CA 2ECQA 5L95A 4KIWA 4L2IA 2DHDA 3E9DA 5JD4A 1GSOA 2FZVA 2X1MA 4COOA 2G09A 1LBHA 1TPYA 5IMBA 5KYWA 2OFOA 2PMFA 1JVNA 1ABBA 4O4IB 3BRWD 1WO8A 1C0KA 2VQ3A 3OEED 2BI4A 1CG6A 3KOOA 3CX8A 1VGRA 4NF2A 2ENWA 2R751 4I4NA 3R5HA 2JRCA 3ZQUA 1BHSA 3L9WA 5CFQA 1V7QA 3ADKA 4K81B 1T9GR 3EGVA 3EC1A 5HE9A 4HQRA 1J90A 1U9IC 1QE3A 4YR9A 5M34A 1GZUA 1CETA 2QT1A 2R9VA 4FNOA 3AVUA 4CKCA 4IO0A 4YJKA 3OF2A 3NOOA 1YXMA 1ZM2A 5HQJA 3PJDA 5LP6B 1WQ1R 3NIDB 1A1VA 1SU7A 4D9GA 3A6ZA 4ND3A 2Q62A 4PHHA 1ML4A 5J2UB 3F2VA 5HF5A 1E9SA 5J5CA 3SHTA 1EQ2A 2E1PA 2VDLB 3W5JA 4GX1A 4LRXA 4HNUA 3WO0A 1FPQA 2VHWA 2X9QA 3IQGX 4YP1A 1OCEA 5HFAA 5EINA 2HRZA 2OG2A 2I33A 2NT3A 3HHPA 1L5HA 1YRAA 1M66A 1AX9A 3C5VA 5IWAB 1M75A 1NWHA 1OY1A 1U9JA 3VI3B 4DDUA 4JV5B 3WGZA 1XF9A 2CVZA 3TSOA 1XMSA 2WLTA 1A76A 4EABA 4JOQA 2RD2A 5IHXA 4FK8A 5JAUA 3QVGB 4EA6A 1M1YB 5KOJB 4ZQGA 3L1IA 3NEPX 4UVEA 3I53A 3JWIA 3ONDA 2ZK7A 1G2PA 4LXYA 1H85A 4Q3EA 3T1VA 4N7RA 2B69A 1MORA 2BONA 1U4OA 2H0RA 5A0FA 1IRIA 1DELA 3FTNA 1LGYA 2M6SA 5IDQA 3G2MA 3C3XA 2JA2A 4LRTB 1IC6A 1BA2A 1PZGA 2HUPA 5LP6C 4B81A 4M46A 1IQ0A 1X1DA 4QPCA 2GCEA 4NBKA 4Z0PA 1RP1A 2HJWA 1A9XA 4C21A 4RYDA 1OIWA 2VJQA 4F4HA 1DXQA 4E31A 4JOSA 1M6NA 3AJDA 3JVUA 3M2TA 4P6VF 4PRKA 4G1MB 1O2DA 4JJAA 2CV2A 3CRVA 3SXUA 4ZOBA 1NVUQ 3EQ6A 4M1WA 2BKAA 5DLEA 3EGXA 3GWZA 4LSZA 4WDRA 1HEIA 1E2FA 1V1RA 2JA1A 4YTEA 4YT5A 5IUNC 4RHUA 5FR2A 1P2BA 4DT1A 4KPEC 2C9OA 1T3TA 4Q1BA 1E2DA 2I34A 4W1RA 2DERA 1YRQA 3MWYW 4II3A 5DZSA 3DMFA 1Y8QA 4LV6A 3E53A 4KUHA 2EERA 1PDOA 4AUEA 2C5AA 2X3YA 2YVKA 3KQTA 4DGQA 4DIFA 8ATCA 1USWA 4MVJA 3OZIA 4ALKA 3P0FA 2F43B 2RGDA 4TTVA 4OOFA 4EGCB 2P79A 5H9WA 4JSTA 1A82A 2R6CA 2QR3A 1NI4A 2XUOA 5KSWB 4ZRMA 5DRTA 4RYLA 3RJ9A 3DLIA 3WWCA 2VYND 4BO9A 3OQIB 2V98A 2RAFA 2WAXA 3U5TA 2P5SA 3VSBA 4JD5A 3BGWA 2C3OA 3K0AA 5D8DA 4GI5A 1DXHA 2HSWA 1Q2UA 4D82A 4R5HA 1BX0A 4X6XA 2OUKA 3L1UA 4QU0A 3G9UA 3ODGA 1G7SA 1I1HA 4LC9A 2W6CX 4GOJA 4FP9A 4JI6B 3VHLB 3R7SA 1SPBS 5F1KA 1B2RA 4X6YA 3VUFA 4KRXA 4P5EA 1XA4A 3I1FA 3AU8A 1NGSA 5BYKA 3C6QA 2BFCB 1TQHA 1T35A 1MX3A 4FNGA 2REQA 1MAWA 4IIYA 5K8JB 1AXGA 1YDFA 4G8BA 4EB0A 3J7TA 2DHCA 2Z5GA 3BK2A 3L4JA 3SBXA 4BBPA 1TU3A 1YS7A 1Y4DE 1EG2A 5JROA 2PTGA 4IHKA 3LUJA 3JQ7B 3DZGA 4IPTA 3NCHA 2K7ZA 2YV1A 1C2YA 1T1SA 5LWHA 2JGLA 2CEAA 3T0GA 5EJ5A 3TEJA 3AKZA 1R4NB 4TT3D 3O3NB 5CLJA 3ZDDA 1FYWA 1GVNB 1QV9A 1L0BA 1U3WA 1Y7IA 2M1XA 5TJ9A 4A2CA 2X4GA 4CLXA 1P2DA 3P96A 2YQ4A 5IZ4A 1WF6A 2R8EA 1EUYA 2R1TB 1INLA 1YIAA 2DHQA 2ZIGA 2PZ8A 2H2HA 3EULA 3GLQA 5FOXA 4B7UA 5K3EA 2BFDB 1N34B 3HYNA 3Q3VA 2WD9A 4FUTA 4QLAA 1JU9A 5KOJA 1T5BA 2JBHA 4GZ6A 2C88A 1EIWA 2ZUDA 3FFTA 5K2MA 4Q1DA 5J2TF 4BC1A 1GYPA 1AKQA 1PEKE 1ZK0A 4XLTA 4OU5A 1H0RA 1P7WA 1JHZA 3CJQA 1WXIA 4A0FA 4DLSA 4E11A 3K5PA 3RASA 2J5XA 4QC2A 4AKSA 1D1QA 1T8SA 5JZVA 1O96B 4FFNA 1PFWA 1ATZA 3CTPA 3ZK9A 5CH3A 3EH2A 2ZJ7A 1KJIA 1NKVA 1KTVA 2JANA 3I4CA 3Q3EA 2XYPA 4JC8A 5LXTF 2IEAA 3V55A 4BBZA 1G9TA 3GEPA 1FX0A 1L7RA 3OU6A 4HDSB 4QUHA 3UV3A 3PR1A 3U80A 1X8KA 5LU9A 5EYPB 3S1LA 5F21A 4PXAA 2R6AA 3WB1A 2ZULA 3NDBB 3OM9A 3U9SA 2VBCA 1XALA 3WKAA 5A4AA 2CLIB 1BWRA 4EB3A 1QCCA 4EFDA 3N70A 3QH4A 4TX1A 1EA5A 1ZI6A 3Q7RA 4KR9A 2NVUB 3VISA 2VT7A 5GOTA 4IVQA 4CDRA 3K0HA 3HDYA 3JD3A 3GZNB 2OE2A 4OJYA 4AX8A 5CW1A 2HB6A 2OTCA 1AZWA 1F7VA 1KYIA 2F43A 3ZHTA 4AZWA 2XAAA 1LXCA 3TUZC 2HRDA 3WADA 2IEDA 3TFOA 1GGFA 1Z5NA 3BE5A 1KERA 2Z09A 5DB4A 1B26A 1R5NA 1T9DA 2D8MA 2P1ZA 1GUAA 3G2NA 2VK2A 2QN8A 3OQIA 3NYQA 4KVGA 5CJ2A 2Z58A 4YMVA 2WK1A 2IDZA 1G42A 1Q22A 5BQFA 3N53A 1X1BA 2HL6A 2E4UA 3X1MA 4EMSA 5K8CA 2WU4A 5KZMB 1Y6GA 1QPZA 4K46A 1EX7A 4JL8A 1FYEA 3JU3A 2ZJ2A 3ZLVA 3R6WA 4B40A 9ATCA 5J4YA 3ILYA 3TVYA 3TG8A 1Y3CE 1U8FO 1J70A 2ZB4A 4BEJA 4EOGA 3H2SA 3EGWA 1IG0A 3RHFA 3ZU2A 2DY0A 2VT2A 3PLAE 2XYRA 4GLFA 2QBYB 2FU5C 4UVDA 1PF7E 3CRRA 3NDIA 1ZAKA 2GZRA 1DAMA 3H2GA 2J3IA 3HMKA 1SIOA 1UM9B 3MLBA 1SCKA 3OY2A 2FW7A 3BGOS 2V4ZA 1KI1A 1O95A 1QZ3A 2XTNA 3A05A 2B5WA 3FMFA 3HN7A 2PZAA 3VH3A 1R4NA 3EK2A 3TCNA 5KYXA 4QZVA 3GNQA 3L8MA 1M54A 3LWBA 2IZ6A 1AB5A 1PI3A 3QX8A 3IOMA 3FSGD 5AUQA 3CBGA 5AK3A 2PZGA 3OLYA 3TJRA 3OMXA 5AT1A 2DKNA 3NFYA 4O0MA 3EZLA 4BQSA 5JS1A 2W2LD 1EEHA 3ZD6A 4OP2A 4MUEA 5E95A 1W88B 2RAUA 3A9SA 3BQMB 2CK3D 3CYFA 1QF7A 1UWCA 2OXTA 3THSA 4FMCF 4BWGA 1CP3A 2X3UA 3N8HA 4RMNA 3LZCA 4F1JA 3B3FA 3E2PA 3TH5A 2PGOA 3AHCA 5HW0A 5J4LA 4UCQA 5MN6A 1V41E 2QNBA 3K96A 4D8XA 2CGEA 1SVIA 2VDJA 1ONNA 3NWJA 4RX1A 4UKDA 4ZVMA 4F3KA 3W5CA 2G80A 3UENA 2JIDA 3U4IA 5K1ZA 3RPEA 3AEKB 2DBRA 4NHEA 4RF5A 3LQRA 2ADMA 5JQGF 5EE1A 1QHHA 3UHOA 4BNUA 5CFZA 1JPNA 4RJ2A 1FC0A 4L75A 4HDSA 1U2GC 4DFDA 4IDCA 3RVSA 2D00A 3TTSA 3ZWQA 3PZRA 1FDOA 4WCVA 4M6WB 2ZI5A 5HWSA 2Q4RA 4LBWA 1FFWA 3BWYA 2H1IA 2I65A 2PVSA 5ALJA 2NVUA 4P84A 1THZA 3S55A 5GIPE 1Y1LA 3VR6H 2FUNB 1OWLA 4WFKA 4QM7A 4FBGA 2AXQA 3V7YA 5ALRA 3GZNA 4X1YB 3VR1A 1DDOA 2H06A 1Y3FE 5DHQA 4W5WA 2WT8A 3QMMA 1OFTA 3SX4A 1IY2A 2QSYA 4A4DA 1XYVA 3FHJA 3PQ6A 1WV1A 2PFGA 4H6WA 3JQGA 2Q4TA 3QXCA 3FUXA 3VMMA 4IOJA 1KJWA 3L0SA 1KIAA 3QE3A 1AQ6A 4TLDA 1E18A 3H1FA 3G2LA 2A0YA 1SVNA 1V3TA 3PHIA 5DI3A 3G85A 4BVLA 2JFNA 4N5HX 2V6MA 1CRWG 2BE9A 1CFJA 2LNDA 3GGSA 2F6RA 2O05A 2BCGY 4KQ9A 1U2DA 1VLMA 1L7OA 3S40A 4RULA 5FNVA 2IHYA 3G2QA 1P1FA 5K03A 2GS9A 3A27A 1Q7TA 2GNAA 4O4JF 5ICSA 4Y6PA 3CRNA 8MHTA 5GIOE 3IQDB 4EF5A 4MYCA 1VE9A 1T2NA 1L1EA 2EL9A 2W4MA 2NXCA 3NBFA 3ED5A 4L5AA 3SC6A 1VE1A 2H1FA 5SV2A 5HKKD 1JLKA 3ILSA 1F3LA 3A7EA 5JH7F 2D06A 2VYQA 4KI7A 1N8KA 2WKSA 3Q12A 5DN9A 3THOA 2QBYA 3OLZA 3U7EB 3SS9X 1LY1A 1ZI9A 2FN3A 1V7PC 3H2YA 1XYYA 1R0LA 1RU3A 4MJXA 4YRSA 3PGKA 1RM3A 4UOZA 5KDDA 5EPUA 2QJRA 3AR3A 3W6NA 5KTOA 4C7XA 2ZWVA 4M9UA 3SE7A 1MN6A 1VZ3A 1Y1QA 1UDRA 3D2BA 3LX5A 1T8WA 3WS7A 1NNEA 1IY9A 3FN4A 3DMYA 5JO9A 2GRAA 1DTWB 4W9NA 1UAGA 3MSXA 5P8WA 2Q5LA 3HJBA 3ENNA 4NAHA 2QLLA 1Z0JA 5BN4B 3U1BA 2EKQA 3CZ4A 3RRYA 4C5CA 3QIVA 3EIXA 1Q74A 5HK8A 3L7CA 2WHRA 3DFZA 4QJBA 1DOZA 2C42A 4TYWA 1RJGA 1U1EA 1K5GA 2B4TO 3MWEA 3RSZA 5KX5B 4UW9A 4I50B 1AU9A 1QLHA 3PEVA 4DBVO 3PPWA 4KLZA 6GPBA 3P5SA 3V2HA 4NCBA 4IIFA 1HXHA 3G2IA 5T4BA 4OJKA 2AUNA 4RH0A 2R47A 2WJIA 4S0XA 2E4XA 3S2ZA 1E9FA 1E4OA 3TI7A 1DCFA 2JD0A 4L3VA 1OGIA 1SBHA 3KFXA 3WL4A 4J4HA 1SUBA 3X43A 5I4KA 1GCUA 3TD9A 4Z6KA 4EJFA 5C7IO 1TPZA 4UOQA 3UUEA 2W4QA 3NORA 5A3SA 2IX3A 5IXYA 1E7QA 2IT1A 2XUGA 3JZFA 2XHEA 3B6JA 5DMHA 1VE3A 1IHPA 3GLHB 1B14A 3PQCA 1LFAA 2XMQA 1IB6A 1P7CA 4R2IA 2PUTA 3E3NA 1DB3A 2DWCA 2GB4A 3UK0A 4FBMA 1Z26A 4IDDA 3JQBC 1Y1SA 1ULTA 2IW3A 3LRPA 4YUZA 4QRIA 3VC2A 2HEGA 2YVLA 1MD9A 4O2AF 1H4QA 3AXSA 5SZIA 1QP7A 1OVGA 1RXCA 3A58B 1GZ4A 3EJ6A 4NU6A 1FTSA 2H4JA 2I3ZA 2KX7A 3GH1A 3JALA 4Q02A 4U2EA 1AK1A 1QFYA 2ZRCA 4RKEA 4US1R 4KR0A 5DTQA 4D44A 4E5NA 2GXAA 4EPXA 4ADSG 5GONB 1TL7C 2K2QB 1QYXA 2IDJA 3GN1A 4EPWA 4OEHA 3OX2A 2GX6A 2VZ8A 1U1FA 1E79D 1C9MA 1BKDR 3WMRA 2I7DA 1PNTA 1RI4A 1SUDA 3SMQA 1ETUA 1NVMB 1P5ZB 3GGCA 3KWFA 3VPFA 2XE4A 4AZTA 1ZJ5A 2XLCA 3IUYA 2EIXA 1WXWA 2VAPA 5KBYA 3JAWB 3G0BA 4FDLA 2VDVE 1KOJA 2QRQA 3FZEA 3GFTA 3I9NA 4KJXA 4MW9A 1ECJA 3FVRA 3LLVA 1HO3A 4N3NA 1J22A 1O6ZA 4MPPA 4BO8A 1Q12A 1VI5A 5K09A 2LRHA 3O7WA 3CW9A 2A92A 3PFWO 4UASA 2GF9A 3F3MA 3PC8C 1S96A 2A0KA 4GHWA 2QYOA 2Z8YM 3IB3A 5LYJA 4DE5A 3B7WA 4DV4B 3WRWA 1RPNA 2CWWA 2WABA 3AM3A 1AQLA 4N6OA 2RG1A 5EEGA 2B6HA 3ROEA 1A3CA 3TBKA 1U3CA 4BGEA 1FZQA 1E3WB 3CLSD 1I7DA 5AVTA 1XWFA 2XB8A 2HSDA 5B6PA 4DLLA 4ZIRB 1PR6A 4X6LA 1DTWA 1KEPA 2YY7A 3ETHA 1NFQA 4XWAA 3SJUA 4XYMA 3WLSA 4MCIA 2X0DA 3JZIA 3O8OB 4YJHB 2VSOA 4RO0A 2V0CA 2EW1A 4S1PA 5CPFA 5TRTA 1IQRA 4UQOA 2VSNA 1Z0AA 1WZCA 4I55F 5CT4A 3CE6A 3VTAA 3LY5A 5KMGB 2CVPA 2OB1A 4OUDB 3UIEA 4DRXB 5KX5A 3TFQA 5HP4A 2VWQA 4P4GA 4WZAB 4D3SA 2XBUA 3CUVA 4DQUA 3U5ZB 2ZRFA 4ZANA 2YXNA 1EBBA 2TS1A 3FNHA 1QO7A 3I9KA 3OCZA 3GJ4A 1NC1A 4KK4A 2K7FA 1XLVA 2PA0A 1MVNA 3E3OA 1QFMA 1QP0A 2X1LA 3EPRA 1M8PA 1W4LA 2Y77A 2QNRA 5B12A 3J7AC 4RD0A 3MW8A 1CF2O 3CUSA 3NHRA 3NOQA 4E6EA 3DLHA 1KI3A 3C7AA 1LV8A 1KZHA 2XYQA 4OXQA 2FV8A 3K71B 3OQMA 2FOLA 2JIPA 2ZWIA 5GJVC 3W5VA 1C7ZA 1A71A 4AU1A 4G63A 5DDIP 3ORFA 3A70A 4KL8S 3GLHA 2XH8A 3Q3CA 2CZGA 2J0UB 4FYYA 3ZZNA 3ZCPA 5CDHA 3O1HB 1WXQA 4YASA 1XNJA 5C7YA 1K1EA 3KELA 3KO8A 3QF7A 1BN6A 4G5GA 2W6OA 3QY0A 3RUIA 1E6UA 3KKNA 5FULA 5A4IS 1V8OA 3H9BA 4EDHA 1XELA 4JWTA 2GDJA 2QXTA 4Y6RA 4HMQA 2IUEA 1GGNA 3QY9A 2Q0QA 3A28A 1QU3A 4GYJA 4PNHA 3OFSA 4LZWA 1U0SY 4RSMA 3VR5A 1XZEA 1SUIA 3O74A 3Q0EA 1M73E 4PVCA 1AKRA 3AEZA 1UFVA 3OJWA 4RCYA 2ZE5A 4R1MA 3UPDA 3HE3A 1ZZGA 4BE4A 4E22A 5JNLA 4JBNA 5KTNA 4W6QA 2PXAA 1B8PA 3RJTA 1B3BA 3QEBZ 1REQB 1NBEA 3V33A 3UT5B 1FU4A 4PPGA 3JQAD 4QYWA 4KR7A 1XFAA 4A0QA 2GJKA 2Z4TA 4XWWA 1YS2X 2OC9A 5HMLA 2NLOA 2FHSA 1JR3E 3FTPA 3OTQA 3UJPA 4A2QA 2HADA 4FYPA 1E4YA 2GZSA 3UGQA 1UFKA 1K8RA 1NXWA 4JNCA 1GHTA 2VJMA 2VKQA 3WJ2A 4E5SA 1UEXC 1E0KA 4YUXA 3JWGA 3CR7A 2QVCA 2F1IA 3SPXA 4ETWA 4NESA 4BO4A 2PGDA 3JW8A 4ERXA 2BSAA 1MC1A 2CDNA 4LIPD 4Q9JA 1JEAA 3N8NA 1KO5A 1PT9A 1TAHA 1VB5A 3I39X 4TZTA 1X9IA 1YCFA 5AWFC 2CT8A 1NBIA 5HBRA 2WVJA 4JT8A 3E0XA 1QC5B 3UA4A 4C2TA 1YMUA 5FOWA 3M1LA 5DW0A 5B3JA 3THWB 3GJRA 4AJ9A 1RFGE 4YJHA 2VHYA 4Q05A 3DL0A 4YEDA 1YVDA 5JBQA 1SOAA 5AM5A 4KFRA 3RUPA 2FFQA 5BNFA 3OEHA 3EPHA 2CFTA 1XQ1A 1PSDA 2IYAA 3ZJTA 1A0OA 4WZAA 3S68A 5IN5A 4ZGWA 2DH5A 3QEKA 1DWUA 2VRCA 3T5DA 4P7GA 3W8NA 2Q5EA 3EA4A 2JBAB 4HWGA 3EFBA 4Y67A 2ZATA 4LISA 2HT6A 1BZYA 2EF0A 3OFND 4PG6A 4FWTA 4S3MA 3WGQA 4Z9YA 2JJQA 5ADHA 2NUTB 5CT8A 2O8DA 5FYQA 2AJTA 3HJRA 1JPJA 4YRQA 5REQA 1WCV1 4NBLA 1V5IA 3II6X 4X1KA 5EJ6A 2YW9A 3A1FA 3GAMA 1DI0A 3KDAA 5IDWA 4MPJA 3VOSA 1DEOA 2FN8A 3T1QA 3CZ9A 5J5AA 2IPXA 2A5DA 2AYZA 1NXPA 1C4KA 3EA0A 1B2LA 3PU6A 2QGNA 3L8DA 2PAAA 5JIBA 3NGLA 3GMDA 2Y0CA 2DQZA 1M2WA 1CHDA 3NW9A 1SUFA 2ECKA 1PNRA 2Q8NA 5GVRA 3VKWA 1QANA 1Y4SA 5CA0B 2FVYA 4JP1A 5IDYA 1M9NA 3DEZA 2O7NA 3S2UA 2RG7A 4YP6A 5I7RA 4PLTA 2HTFA 2JCBA 1CQWA 1WUJS 4I36A 1OU4A 3OZEA 4QT0A 4AMUA 3GK3A 5GMOA 5KAPA 3SF0A 4OGWA 4B73A 1G8AA 5B7QA 1QDEA 1REQA 5JTTA 3UT5A 4M0PA 2CXPA 4Q4DA 2GARA 4PBTA 3PPXA 4MKZA 4HF7A 3N2NA 1POWA 2BKXA 1WKVA 3H5OA 1PIWA 1SU6A 2XUZA 3I73A 3OTIA 4V1CI 1KO8A 3CT4A 2QS9A 3E7PA 4DCSA 1M2KA 4E88A 4EHAA 1WE2A 1US8B 3VDNB 1YGYA 1HMPA 3BTSA 2EATA 5K6AA 1P19A 2VN8A 3V1NA 4CLHA 1L8AA 2PPLA 2PGLA 3FRHA 2XJ4A 5KREA 3EEOA 3OJOA 2YVUA 4A23A 2AVNA 1TIPA 2G5GX 1VMAA 4PG5A 2PUEA 4CKEB 1LFDB 1F4PA 3WNVA 4EGFA 1CRQA 3R09A 1CZNA 4RV4A 3TBFA 3OLCX 3ZKAA 3G1WA 2Z6AA 1BYIA 3G8DA 4HR7A 4IDBA 5KKCA 1RWPA 3QXXA 1NQ5A 4KYUA 1DADA 1GPMA 1S89A 1XF1A 1N2IA 2X19A 1VFNA 2ZYUX 3B1WA 3R4VA 4UNSA 3UUWA 2XSZD 1J7KA 2WKRA 4N01A 1SCUA 3ZIAA 1XL0A 3RWBA 3OQ6A 2ZM6B 3P52A 3FCCA 4XVRA 5EXTA 4W5RA 1RLUA 1X0VA 3I9V6 1SKYB 1Y37A 2J31A 4IDAA 2A4KA 1RE1A 1UIMA 4AF8A 3Q40A 3DO8A 1RLMA 5H8WA 3DONA 1HBJA 3N0XA 2QVBA 4G4GA 5JCZA 4QDKA 3N28A 4QASA 1NP3A 3TNFA 5A4JA 2KBEA 5CEJA 2VP9A 5CLHA 3RK4A 4H7JA 3BD6A 4I1YA 3AIKA 1DBQA 4KR3A 5DNWA 1GPLA 1WDWB 3NOVA 4H3HB 4NCHA 1CUDA 1CB0A 1JDVA 5C1IA 1DWOA 4XJVA 4RPLA 2CNWA 5I47A 3PX7A 1XEWX 1JNYA 1EXWA 3FNIA 4UC0A 1T9AA 2ZQ5A 4C1BA 1YUBA 4WCDA 2PX8A 1GEEA 5TEWA 3C0KA 4BJ5A 1K06A 121PA 2Q3HA 3DBLB 2EHDA 2AFHA 2PQ0A 2NUTA 3ITKA 3OG9A 3DDUA 5T6BA 4DWVA 4Q1EA 5BW4A 2UYCA 3G2OA 3AGQA 1HPLA 3LF2A 4HD8A 5CHYA 3P2IA 3ITDA 5G0VA 3WZLA 2RHHA 4PPQA 5D5QA 4UCXA 5CDFE 2BMJA 1SC1A 4JP5A 3VJKA 1G5TA 4MQ4A 1Z0FA 3DA8A 4EGQA 4D26A 1V9CA 1GTMA 1MAUA 4FYXA 4ZJPA 1CUBA 1KZ4A 4O2BF 4UREA 1HT2E 2I9PA 1DC3A 1N3BA 1X92A 2CE7A 4EVRA 5E6RB 4F85A 4P3XA 1SQSA 4ZEWA 2QD2A 4MUNA 4QRHA 1FX1A 1CIPA 4QNNA 4P3YA 4YROA 5E7IA 2R5WA 3DE2X 1NVEA 5CA0A 4Q48A 2C82A 1NPYA 3OPNA 5IMSA 2ODAA 1Z13A 3KHKA 1FP1D 3ETEA 2HOQA 4RTMA 5C5IA 1OYYA 1DV1A 1BGWA 4DSAA 5K8LA 2ODTX 4R81A 3CUUA 3ICCA 5BR8B 1A50B 1RJEA 1UOPA 3BBLA 1BVUA 2PUWA 3IUNA 3WGTA 2LWIA 1QORA 4NZMA 1KS9A 2A78A 2C5FA 3QENA 3V3KA 4AN0A 4D3DA 1FNSA 2E49A 2YWXA 4DMUB 4Z5XA 5B3KA 1DMSA 1LZLA 1N6KA 1O77A 4Y6LA 5HF9A 2VRWA 3BIFA 4NU8X 3PHGA 1XTJA 2PDAA 3U3OA 3IHWA 3SIPA 1SXPA 1RYNA 1SRQA 1T6NA 4J0KA 2WMOB 1C3LA 1LBQA 4KXFB 1FCJA 1G6HA 1I6MA 1Y0BA 5ANRB 2I9KA 1DPGA 5AKKA 2V74B 4F2GA 1IUPA 1US8A 2HA4A 3L0YA 1RHRA 1AN0A 1DUSA 1WCXA 4IFIA 4PZZA 4C0QC 3GVXA 5K0BA 2ZAOA 3BFKA 2H52A 5FJJA 5AKEA 1K9SA 5FPHA 1JTVA 2UZ3A 4X85A 3FRJA 5GVSA 3G13A 1KSHA 1QB7A 2YOHA 2ZUVA 3L7AA 3SDSA 4H1WA 4RTPA 1H93A 3WC4A 3DR5A 4ZTBA 3WLPA 4ZCIA 4L08A 3MWDA 1JE0A 1QHNA 4XJSA 4AI6A 1JA9A 1VIYA 4W5QA 4HGPA 3FPLA 5TJHA 1SM4A 1GUBA 5G53C 9MHTA 1JDJA 5A4DA 3EARA 3EN0A 1QH8A 5D6OA 1B0AA 1UZAA 2AOUB 1DJPA 4RXUA 3ZV4A 4BQFA 4ZYWA 3P0EA 2CNNA 3GXOA 2QRUA 3QG5A 1IZZA 2LW7A 1DIGA 3KX2A 3GVHA 1WETA 3TCKA 3Q9LA 2NPFA 1Z29A 3V7WA 1NNUA 5DM4A 1JBEA 2GM5A 2HLDA 3KEFA 2GZ2A 1XO1A 4MVJH 3U16A 4EHIA 1ZGHA 2I8AA 2YXLA 4J16A 3DMPA 4LTMA 5PNTA 3PEYA 1B4DA 2CVFA 2ZPUA 2HJSA 2BUCA 3LIIA 4TV9B 5D7BA 1FNNA 1KH1A 2ZBRA 3ET4A 2C9DA 1Q91A 2XE8A 4CLDA 2EIHA 2HA5A 2P40A 4S1VA 2B8NA 3UMMA 3ECSA 3Q4GA 4JZKA 4JKOA 1O5TA 2L19A 1E2MA 1CW2B 1WMSA 3TB4A 3QV1A 2WFZA 3OCVA 2R84A 1UJCA 5LUBA 4GGOA 1MQ8B 1NKSA 1RRFA 3F7TA 5H4GA 2D5IA 3NAZA 3KYDA 1NUHA 2G1UA 2H6EA 1OXKB 3I9FA 3RM3A 1EXVA 1ZK3A 4E5MA 2YY5A 3HGMA 3LLSA 4X92A 1R2QA 2MJLA 2EJTA 3USES 3U0VA 1A9RA 2PH3A 1QGZA 2PWYA 2XVMA 5SZHB 1GV1A 3Q8WA 1M6HA 4GKKB 3DAOA 1YR9A 2J3DA 5AHXA 2R6JA 2C77A 2GBFA 3RR2A 5ITSA 3RVJA 1GFZA 2FXVA 1ABFA 2HPHA 2ETVA 4B84A 4E14A 5BUQA 1B73A 4BY9E 2HH9A 1FMJA 3NHKA 4GZLA 2R1ZA 5ALYA 3PRHA 4WK0B 4WZ6A 5HRUA 3L6DA 4ALLA 5I7FA 3B9RA 2ANCA 2ZSDA 1LEHA 1AIPA 1N92A 2AXEA 2R6FA 2YOFA 4E5YA 1X8XA 2Q6LA 3AKDA 1Q84A 2HD4A 4RMHA 1VXOA 4JVOA 4JI3B 4RTQA 4BEVA 3EOAI 1BC5A 3FROA 3FUTA 3M9LA 4KQCA 3WQRA 3EAFA 2IWHA 4YPVA 1RWXA 1I24A 2FW0A 2NYUA 4FGWA 3L46A 5JG7A 1MG5A 3G5UA 2R6R1 1MXFA 2P9TA 4UHJA 3TTWA 2B3TA 2PYIA 4L57A 2DGDA 2BLNA 4PX9A 5E2BA 4GRIA 4P93A 4UU1A 4D92A 3MJHA 2Y1FA 3FVVA 2XWSA 4U1RA 5CIWA 4UHHA 1D0SA 3FGOA 4MMXB 3OD1A 5K7SA 4ZARA 4DSZA 3I5XA 1PU2A 1MTZA 3B53X 3DNFA 2JIRA 2BEWA 4XM1A 2YFHA 1XLUA 2N0SA 3KLBA 5NULA 4GMFA 2A35A 5DXAA 4PR3A 2HHCA 5C7OO 4HNRA 2X7JA 1EQAA 4ESHA 1JALA 3NM5A 3HH8A 1PV4A 2BTQA 3ZLJA 3BDIA 1GPJA 3M6AA 2RGXA 3FVTA 2ERYA 2Y1OA 5AOCA 3BAZA 1DCKA 3AINA 1II8A 3UJ9A 1XZCA 2ZS9A 3BWBA 2YXEA 4ZVTA 2K2WA 3F9RA 3D54D 4CMGA 4EJ2A 3R5XA 3HS3A 2AGVA 4DV0B 3FTDA 1RKVA 3GJTA 1EBUA 3GU3A 4TV9A 4N76A 1I0LA 1XTTA 4IY1A 2CCKA 4RNDB 2BGTA 4UE2A 1MNQA 2XVAA 5HBGA 5JNRA 1L1RA 3EFHA 1B16A 3L84A 4JT4A 1V39A 3H9CA 5GZ6A 5KJ1A 4R8KA 1EGAA 2QG6A 2KS6A 4Q3AA 4TZ6A 1CY7A 3DL4A 1KDPA 1HTWA 2OCDA 2VNJA 1FYVA 1TYDE 1JLMA 1YR3A 3DKKA 4E09A 2WTAA 3FAKA 1NYTA 3VVCA 4DSUA 1S4MA 2W6NA 3PI6A 4OOEA 1MA0A 4H0NA 1LVUA 1R50A 2PL1A 1USIA 2IYPA 4LOJA 2YV2A 1J2RA 3I9MA 4LS3A 4RZ2A 3UYKA 2XF8A 1DJMA 1YFZA 3BWXA 1Z6XA 5GP1A 2NNWB 1QGED 4QYTA 3ZDEA 1J9ZA 4TXMA 4I9FA 4CM7A 4E5PA 1KNQA 1VG8A 2YJTD 4EL0A 1G7RA 3I34X 4KBFA 3I45A 3C7TA 5KNLA 2UUBB 3AL0C 1D04A 2C8LA 3RGWS 3G0OA 4IMJB 5JI2E 4G0VA 3SXPA 4GXTA 3OEWA 1UFQA 3I04A 1SXHA 3BKWA 3NC4A 1Z73A 3EHEA 4JJ4A 1IN7A 1JSXA 2HCBA 4GP6A 3OCYA 3ZDAA 5F2EA 1PJQA 4HT3B 3ADBA 3H3JA 2QTMA 3KSZO 4KYIB 2I62A 1HM5A 2AYXA 4J0IA 4HLNA 4HQNA 3T52A 2LBPA 1CPYA 3MERA 3UY4A 1YNOA 1DNPA 1XDBA 4HADA 2INGX 4MKGA 4BVGA 4REMA 6ABPA 2YWFA 1XU4A 3QJYA 3DKIA 3FR7A 3CLTD 7ABPA 3P45A 1LNZA 4KSCA 3OKAA 1RC0A 4ID9A 5FQNA 4BO5A 1GRNA 5I9TA 1XJ0A 3PDIA 1X7WB 1O3YA 1WOYA 3DS8A 1QYWA 3N3AC 4QBHA 4YPOA 3I4LA 1Y3AA 3NHAA 5JSKA 5AVUA 3TAXA 1QO9A 1Q83A 1QZUA 1CJSA 3H17A 1UDWA 4R84A 3WYEA 1C2TA 3A9WA 4ILEA 2WYUA 2VR1A 3DTVD 1BS1A 1JJ7A 4C9BA 1W85B 1M2EA 4IXTA 4FMDB 1CB7A 2QYSA 3BMOA 3KOYA 4DR2B 3R3JA 3ZD7A 1JXMA 1TVMA 3KKQA 5ALQA 2F9FA 1I3KA 1CNFA 3LFTA 3TS1A 5JDIA 5I9NA 1U2ZA 3C4JA 2VQSA 4GOOD 1Y6ZA 1KR5A 2AOTA 4X97A 4QFDA 4MGEA 1ECPA 2QQEA 3GNSA 1PX2A 3AHHA 1P39A 3EQ8A 4YMGA 4CGZA 5JARA 4JEHA 5DNYB 2P3LA 1CDZA 3C5CA 4R8SA 2L82A 4R98A 3O9VA 2H00A 1BRTA 1RJFA 2BFBA 3U7RA 3PUIA 4BS9A 4ZXFA 3JVIA 4HZIA 5EXDA 2VZ0A 1Y5NA 1MPXA 3T7DA 4OI0A 1E9BA 1UK7A 2B92A 2P9ZA 1OTYA 3GZTB 4N0DA 5EJ4A 3FVWA 1JFFB 1KYYA 4WNYA 1IWPB 1R9GA 2VJOA 3T7EA 5EG5A 1N6PA 2Q1YA 1O9HA 3ZEIA 3MOIA 3OLQA 5SYNA 2DFNA 4C1NA 2XA1A 1NTRA 3G8YA 3TEMA 5IXSA 5KTPA 5K3FB 3U6KA 3PDWA 4HY3A 3F5SA 1AQYA 4I2NA 4JIGA 3Q0TA 3UFBA 1YB7A 4XX0A 4KK3A 3L7LA 4J7CA 1JFSA 3IXLA 3VDRA 2RJ3A 5A3JA 3M82A 1T9KA 1TF5A 3ND7A 1EP9A 1Y7TA 5IBRA 5F2OA 4PZPA 2ZRJA 3N7TA 5BQOA 2LD4A 4DJJA 1XMPA 1Z2NX 1K86A 3KOXA 5FPPA 3SEFA 5JAPA 4TVKA 1DRWA 3P2YA 4BWVA 4YWJA 3RHSA 1ZM4A 3UNXA 5JXWA 4ARZA 2B6NA 2J85A 1NJ2A 2FSVC 2PIDA 3K9FC 5F5NA 4R2HA 3ZJVA 2JNWA 5FO1A 3RSQA 1ODKA 4CG0A 2QRVB 4RAQA 4IH9A 2MSEB 4FQ8A 1COWA 1FJ2A 1TIKA 4I6JA 3Q2IA 3WISA 2DB3A 1GUDA 4MYRA 5AM4A 4E2ZA 4QDOA 1JEEA 3HA2A 4JGGA 4Y1RB 1K66A 2IXEA 2A2ZA 2QL6A 1XEXA 2HK8A 2G9QA 4GZMA 4P4NA 1KOLA 3SY8A 3VSCA 4C76A 1VE7A 1UBSB 2P5UA 1LLQA 2WWTA 4D25A 1SURA 4L5BA 4PHTA 1U2PA 4P4SB 3K09C 4A73A 1CD5A 1XJCA 4M2LA 1GDHA 1QTRA 3VR3A 2HXSA 3N05A 3R3XA 1IPFA 4KN6A 2JJMA 2XCOA 4R83A 3ZCSA 3I5YA 3R9IA 1BSVA 4DXDA 2GA9A 1OUMA 3QEJA 2A7XA 1KJ8A 1SC9A 4C4XA 1TUIA 4KXQA 4HNQA 3OX1A 3SJCA 4RFSA 3TL2A 4BP3A 1CVIA 1Z7WA 4JP2A 3RT9A 1AB6A 1YHYA 2OV2A 3KOMA 1JX6A 3IEVA 1NDHA 5LPNA 4KPYA 1VKHA 3T9CA 4NJMA 4MVJP 3EXAA 5HG0A 3RVMA 5C2JB 4KR6A 1U8UA 1JDNA 1W85A 2Q46A 3GHYA 3HDJA 4QARA 3IAXA 3PIIA 1V16B 2CFIA <