1JS1X

Crystal structure of a new transcarbamylase from the anaerobic bacterium bacteroides fragilis at 2.0 a resolution
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
Knots found
sequence length
324
structure length
324
Chain Sequence
b'MKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYTGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLPHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcarbamylase
publication title Crystal structure of a transcarbamylase-like protein from the anaerobic bacterium Bacteroides fragilis at 2.0 A resolution.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 110
structure length 324
sequence length 324
chains with identical sequence Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.9: N-acetylornithine carbamoyltransferase.
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
X PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1js1X02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 1js1X01
1RAIA 1RAGA 3R7FA 2OTCA 4A8HA 1AT1A 3MPUA 1EKXA 3M4JA 2EF0A 5G1OA 4WTOA 2AIRA 4JQOA 2AT1A 3L04A 1FVOA 1ZA2A 2A0FA 2FG7C 2H3EA 1OTHA 3L02A 4OH7A 3M4NA 3CSUA 4KGZA 1EZZA 4FYXA 1D09A 2QG9A 1ML4A 2ATCA 1TUGA 3TXXA 4JFRA 1RAFA 4EKNB 2RGWA 4AMUA 1PVVA 4JHXA 4F04A 3NPMA 1A1SA 1R0CA 4AM8A 2FZCA 4A8TA 1I5OA 2IPOA 1SKUA 3R7DA 1R0BA 3M5DA 1DUVG 1ZA1A 3L06A 4E2FA 1RAEA 4KH0A 3D6NB 3M5CA 4A8PA 3KZNA 3E2PA 1JS1X 1ACMA 1DXHA 1AKMA 4H31A 3SDSA 1TU0A 2BE9A 3KZOA 8ATCA 3R7LA 4F2GA 2HSEA 4IV5A 1C9YA 3Q98A 3AT1A 2QGFA 4NF2A 7AT1A 1NBEA 1EP9A 3GRFA 1RADA 3D7SA 2FZKA 4KGXA 2I6UA 4FYWA 9ATCA 5AT1A 4FYYA 3L05A 4EP1A 1Q95A 1XJWA 3LXMA 1PG5A 2FZGA 3KZKA 2BE7A 1RABA 8AT1A 3KZMA 4AT1A 3KZCA 4KH1A 5G1PA 2P2GA 6AT1A 4ANFA 2G7MC 1TTHA 3UPDA 3GD5A 5ILQA 2YFKA 1FB5A 1VLVA 2W37A 2FG6C 1RAHA 4FYVA 1F1BA 4KGVA 3TPFA 1RAAA 4BJHB 1ORTA 5G1NA 4KWTA 1RACA
chains in the Genus database with same CATH superfamily
2A9FA 3PCRB 5REQA 1PK7A 2GAJA 3QLEA 4NBSA 2WFZA 4B0PA 3AQ4A 1EFVB 1YFKA 1IY1A 3VHQA 4HNTA 1E1YA 3UJAA 3U4MA 3ZJUA 1M2EA 3V80A 2ERCA 1W5TA 1EVEA 4MIKA 3RS9A 3CUYA 4ZCLA 4AD8A 5ARBA 4G0VA 2PMKA 3IAXA 3ONNA 2GF9A 2J46A 3Q0IA 5ALKA 4EG6A 3UHAA 1H1TA 5JQGA 1J8DA 1L9XA 2A0FA 3H9CA 2F90A 1U3WA 3SJAA 4CXMA 1HDGO 2NSLA 3LT5A 5H02A 1Q7BA 4Q16A 2IHTA 2F1KA 1JQJC 1W4ZA 3ED5A 3C16C 2OO7A 3F96A 3FDFA 4AB1A 3I83A 2IBTA 3UYLA 2VAWA 3MWEB 4UEQA 2BFEA 2G82A 1RHJA 4P4SA 3L1KA 3P9YA 2HMSA 3FTQA 2GBIA 2FUNB 1D1SA 2Y0CA 4MRRA 1EIZA 4UM9D 4RCZA 1EFRD 1T2FA 3T1NA 4EBFA 4N39A 2JLZA 3P2OA 5HM8A 2VSXA 3LKZA 4AUEA 5PNTA 3CIFA 3FLEA 4FT4A 1SIUA 1CC1S 1J2UA 3C3CA 5KJEA 1UFVA 3G9ZA 4GMXA 5C1IA 3VI4B 3JQRA 2XB2A 1VA4A 3AZOA 3KQWA 1EG2A 1E7MA 3H9JA 3C7TA 5LQSA 2I76A 1NUHA 3KAJA 3MCTA 3JTEA 1KSGA 5F9HA 3L06A 4BRSA 1OI7A 4YT2A 1CZNA 1O08A 2WT9A 2R48A 4NBNA 1BHJA 2CVPA 2F00A 4UU8A 4BBPA 1YU6A 5IM5A 3ZCQA 3THYB 1IRXA 2XCLA 3VAYA 3RM3A 2JLAA 3ZH2A 2ZG6A 4ZGBA 4DE5A 3S6JA 1ELOA 1CUCA 3ONVA 4PW0A 2NOAA 1KFEB 4JGGA 1JFFB 3ILVA 4BXOB 4ZVKA 1E8MA 1YI8A 2OLKA 4JXZA 521PA 2H7XA 1EIWA 5KJ6A 2IYEA 4ZOQI 1RQPA 3MRSA 2UYQA 3Q9SA 4J0CA 5CXSA 3RVJA 5J1SB 4IFEA 3QE3A 4FYWA 2VTKA 4HB0A 3O8QA 4PNHA 4TL9A 1BIFA 1MJFA 1Q95A 2NVUB 3TQFA 1OV4A 4KUEA 3T1TA 2EDAA 3NIDB 2PSDA 4MLPA 4DDTA 1PV4A 2I2BA 1Z22A 1XRMA 3FSRA 2NZ8A 3H7AA 4Q3KA 2WKSA 3P9IA 4YO8A 4J0FA 2PD3A 4WZ6A 1T4CA 4WUVA 4A1OA 3TZ6A 4W9MC 2Q4DA 1ZNXA 3BGVA 5E1OA 1OYVA 3IRVA 3EGIA 1W59A 1NP6A 3FPGA 1UZMA 3WKCA 3FKSA 1EP3B 2BGWA 3HB7A 3UUGA 3G2JA 2UZ4A 4CHTA 4JLOA 2WJZB 3LDAA 3JVEA 1W29A 4ZCTA 2B98A 1I6KA 2HM7A 3DAGA 2E4AA 4NECA 3UIEA 4ERNA 1HO3A 2B34A 4ARSA 2DWUA 3A31A 3DE1X 4B74A 3IMFA 1KI4A 4CR7A 2PUVA 3VR2A 3CUUA 1XROA 3DP7A 3MOSA 2EFGA 1O6GA 4UOZA 2CXPA 2K2QB 1MHPA 2D13A 4IILA 4FQ8A 3QY9A 1F14A 2GNOA 1SUCA 2I71A 2MMGA 3WLTA 2AJDA 4P5DA 4A3SA 3JYHA 3ZLTA 4C22A 5LB2A 2V4UA 3BREA 1F5NA 1YOVA 1ONSA 2JLVA 4JLKA 3B51X 2VUSA 3AUKA 1O2DA 5CLFA 4EI7A 3B52X 2BR4A 2GK7A 3I5AA 3O26A 4QVGA 3I09A 4ON9A 2A88A 1S2LA 2AW5A 2MSLA 4OH7A 4YP5A 3LT0A 4PIPA 1FDWA 1JHOA 2P40A 3ACBA 2YYYA 4TT3D 4RNCA 1PU2A 2CDCA 2Q4RA 4WECA 4WLVA 3W0LB 3AZPA 3PWTA 1HNXB 2DKOA 2GUWA 3B3QA 2XXAA 1BVYF 3PYLA 2NADA 3HU5A 2IF0A 5JNWA 3B70A 3D6FA 1HDEA 3KQYA 5ALDA 2W2LD 5IK2D 2M2IA 3QJGA 5H1YA 1BCRB 4KZPA 3OCUA 3HM9A 4AY6A 1J25A 5EUBA 1QU2A 4PSCA 1HM5A 2G0TA 1NV9A 2BRUC 4FT2A 1E9EA 3BE6A 3O4FA 4KO4S 4U1RA 1PFKA 4Q4AB 3F2IA 3I5MA 5FO1A 2OYCA 5AI9A 4CIBA 5GZ3A 3R40A 3ZHTA 3AI1A 4QM6A 4QWMA 1YNSA 1XK7A 5I48A 5BPFA 3H9EO 4AJ4A 4WY8A 1FF9A 3M49A 3RARA 2F7SA 3F78A 1JDSA 1MRNA 1Z8HA 1P7CA 2VK4A 3UCFA 5JDCA 4Z7OB 4KIUA 4CCSA 4UASA 3INTA 3P2EA 2UZ3A 4IIXA 3ZBUA 4JU9A 5KVQA 3WB1A 4ED9A 3GA7A 2QGZA 3UMSA 1U2SA 1JPUA 4FZ5A 4YC7A 2AKYA 2RDMA 3NHLA 2Z5FA 3WX0A 3PL1A 3OJOA 1TQ6A 3MIZA 3EBPA 5BURA 3D3JA 1A4XA 1AG9A 1GL3A 3UFBA 1DQSA 2BDTA 3BE5A 4XOUA 3TR5A 2AZXA 3BL5A 5EYPB 5E8JA 3BB3A 3O8OA 3ICVA 2QJOA 1QQ7A 3NBXX 2O8CA 2QMUA 3AETA 1H9BA 3MTAA 5F7XA 4OLHA 4OLBA 2DR2A 1YHNA 4YTEA 2I8AA 2TMKA 3NHJA 5FBHA 4CG1A 1JYSA 3WK7A 2JI4A 4HUJA 2YRFA 3I9JA 3JYLA 1EXMA 4LRWA 3ZN2A 4DRYA 4F4IA 5AXDA 1G42A 4F3NA 2PN1A 3ASZA 1GUZA 1YRAA 2QX7A 3LL4A 3T3EA 4F4DA 1NT4A 4ZTZB 2PUCA 4DT1B 2XTZA 4N5DA 2OC4A 1H2ZA 3IO3A 3N7TA 5K1ZA 3UANA 2OM2A 2W48A 3IB3A 4ISBA 3F74A 3WLRA 4FFBB 1M34B 2TECE 1XMSA 3H04A 5DT9A 1N8SA 2GN9A 4KHZA 2BTQA 1M6VA 2MSDB 1R5NA 4F2PA 1V5WA 4OGLA 3VV3A 4ZCIA 1DGQA 2XQFA 1FB5A 3JD3A 3WLEA 2GF2A 3R3WA 4AULA 4DMKA 4BFTA 1PSZA 2QE6A 4Y9UA 3FTDA 3WK6A 4Q05A 3DLHA 5JZBA 1COWD 3BX1A 2ZYTX 4JBLA 4XYLA 1EVKA 4UTZA 3GBVA 4RPHA 4TSFD 3TG8A 1QGOA 3HCWA 2BFFB 4OBXA 1BMFA 1GXSA 2O5CA 2BFCA 2NVOA 1D1PA 1W88A 4PSKA 1U1FA 3GLIE 1GKLA 2WOJA 2YOHA 2PYDA 3DYIA 3RBXA 5L9AA 5K8VA 3HBLA 1NU8A 3E2IA 1DHRA 4ZTUB 1BVUA 1O58A 7REQB 2DQKA 3F3SA 1RR6A 3WGQA 3C41J 3F3MA 3A26A 4HMQA 3LX5A 1RKXA 3E35A 3HXLA 3MJFA 4FGWA 2Q3HA 5DTIA 4ARZA 3PITA 5JECA 4QQRA 621PA 2W8ZA 2ZCVA 3G88A 4CQJA 2OECA 1KAEA 1NMXA 4K9DA 3ZVKA 1KSFX 1Y33E 1Y9JA 4QG7A 3SZGA 3EZNA 4PPQA 5B30A 1XXHB 2FA9A 3F8WA 2DSTA 1UXJA 3JPWA 4QJ5A 2NXJA 1ZH4A 1LVUA 3FVWA 3GJZA 3NV9A 3HXOA 4QUHA 2QN2A 3LRPA 1KOGA 2WVHA 3P4YA 3IIMA 1HOTA 3LQ1A 1NI3A 4B4OA 3LF2A 1P7PA 2WAYA 2R8XA 4NZMA 2AC2A 3DCIA 3HVUA 3JTMA 1NLMA 1B6TA 1XGKA 4L8LA 5FNZA 1Y6GA 2D5AA 3COWA 4MB2A 2X7XA 1SXQA 1KTIA 5HS6A 3RFXA 1KORA 2PSFA 4GEKA 4AO8A 3QLVA 4ALNA 4RC9A 3IQZA 4UHJA 1H2FA 1JH8A 4RFSB 1SKMA 1B8VA 2XVAA 4BGVA 4B3HA 4OYYA 1T0JB 3I62A 1KWKA 1ZH2A 2H4WA 1P5RA 2AZMA 3LFTA 3M6FA 4ND7A 3JQQA 2NYUA 4B79A 3LLVA 1QHGA 3E1GA 2NUAB 4MVJE 3NDBB 3OQHA 1MTOA 1N7IA 1TTPB 3W3AH 3PDCA 4GKBA 3UM9A 3ASVA 3TUZC 4ZO9A 4FM9A 4KIFA 4NJMB 4AP5A 4PGMA 3QQPA 1SG9A 3C97A 3FWKA 1G8HA 1YC5A 2YBDA 3NOXA 2UUOA 5IASA 3LPAA 1GDHA 1TEHA 1I8TA 1S3FA 3CZ5A 4XQ9A 3TECE 5DTQA 1Z33A 1JSLA 1E0AA 4FHFA 4CMCA 1GSIA 1ENOA 1Q3HA 4DAOA 2GPYA 4KHPB 2QZ4A 2FPIB 2CNBA 1R1DA 2C0CA 1JI0A 3JW8A 4G5XA 1TYBE 5C80A 2IIVA 1PLKA 3AU9A 3JQDA 1GU0A 3NHPA 3OY7A 1U5BA 3H16A 3BCSA 2L69A 4XIJA 3PTLA 3PK0A 3M6UA 4J4BA 4TRJA 3VKUA 4WBNA 2IS6A 3ABRB 4KGXA 2P2LA 2YQZA 4N3CA 4Q4JB 5LN1A 1MO2A 5DNVA 2I4OA 3GLUA 2JIOA 1LC0A 1T4MA 2GWRA 2XYQA 1MB3A 2D8AA 5CT4A 3PCXA 4FD3A 1R10A 1S89A 4W5NA 5A5DA 2FW0A 2BBSA 3LOPA 4M6WB 1W8IA 2BP7B 3TF5A 1FY2A 2PLAA 5K8IA 4TQUS 2FMKA 2O7NA 2MHCA 4S1NA 2DKNA 5AI8A 1U7ZA 4Y1GA 5DKFA 1C1DB 1OV6A 1RCTE 4LV8B 3ZVRA 1UC4B 3HXPA 4I4TF 1LDMA 4Y2HA 2Y3IA 4W6ZA 4U5QA 3CEHA 5FIUA 2QORA 1Y8RA 2AQHA 2HHAA 1I2AA 2AXQA 2IU4A 3KZXA 5AOVA 3VZRA 5K99A 4PFJA 1NHWA 3FB1A 3ROEA 4DSTA 2PGOA 4UBMA 1T9BA 3W5BA 3OZXA 2GSDA 1QDEA 4MWBA 3V6MA 5BSFA 5JMOA 2J6BA 2RGDA 3LY7A 1Z4PX 3RWBA 4DSOA 1G41A 3CUWA 4XWOA 2WFLB 3GN1A 3A11A 1O87A 1QV9A 1TKBA 3GJ8A 1YRBA 3FPFA 3I32A 5EQTA 4DW8A 5LU8A 2XD4A 1WNFA 4IOKA 4URZR 2EKDA 3IPAA 1N6PA 3M4JA 1MA0A 4MYTA 4DCUA 4PN3A 4OOEA 2Z2JA 3AGQA 5F21A 3CX7A 3QFTA 1QFMA 5B5SA 2O8BB 2WKWA 1CZKA 1JH9A 3TZKA 2Q3BA 3D6TB 4P31A 4K9PA 2A0XA 3CJRA 4I4IA 2J5XA 1K4KA 1L4LA 4KLRA 3FNEA 3KHTA 4JVLA 2FHPA 3DDHA 4F38A 2YCBA 3WAGA 1WHTA 3U26A 4C7OA 2JD1A 2C03A 4HDSA 4DIUA 4DLZA 1T6NA 3IKJA 3OA0A 3DW1X 2OHHA 5AO9A 3BD9A 4HDOB 3KPJA 4FEEA 4JAVC 5BUZA 1ZP6A 3TX6A 5FWYB 1PW7A 1A1SA 4JBXA 5MFZA 3UMYA 3S2FA 4C0HA 4X61A 5A9SB 1XD8A 2BDEA 4FDMA 4I99A 5CDHA 1QWSA 5AJXA 5JAPA 2IVFA 1FDRA 3R7DA 2NAFA 4QL3A 2VPYA 4D9KA 1NN0A 3AERB 3F8TA 2GN4A 3NPAA 4MKGA 4C30A 3VH2A 4C3OB 1LJUA 4EX6A 1JSXA 4Z8YA 3IIEA 1V1JA 3WLLA 2GAFA 3BHJA 4W4TA 2H1RA 2C1EA 5BVGA 1X1RA 4OIMA 2DLDA 3EA0A 3FM9A 5EHGA 3LDHA 1RAEA 5TARA 1O77A 2JF0A 3N2ZB 4QX6A 5C5DA 4ZN6A 1FZTA 4YQFA 2IYRA 4HVCA 4LDZA 3I1YA 1Z5WA 1V6SA 4IXDA 4BOYA 4PGGA 4P82A 4TUYA 4DL9A 3SZUA 1I9GA 3EFOA 4JLMA 3KDSE 3Q0TA 4K86A 4JI5B 3M6AA 1VBNA 5EJ8A 1R3UA 4TMZA 2XMGA 4R0MA 1JJVA 1SY7A 1UJ5A 1PQ4A 4FGLA 2YMQA 2ZCUA 3F8SA 4WA7A 2ISSD 4JJZA 5TJ9A 1MOPA 4IICA 2IBSA 5EHNA 3VNAA 5KEIA 5DHUA 1ZR4A 4D9NA 3PNYA 5EI5A 1WR8A 2QIOA 3IP7A 5DGIA 1LDYA 1H2EA 3RUEA 5LR6A 1I7SB 1MMFB 1RBMA 3PUKA 1M8GA 1P62B 1S1CA 2FQXA 3JAKA 1EYZA 4ZC1A 3QBTA 4F72A 3WGGA 3L0YA 2OO3A 2HMUA 4X1KB 4YPOA 4IAOA 4GKKB 2X0NA 4HZUA 4DA8A 3P4UA 1JPJA 3OQBA 1TKCA 3R1IA 4OJQA 2V3CC 1ST2A 2VZ9A 1PAUA 3ESAA 4L9SA 1O95D 1T1RA 2QLMA 3GGJA 5AOCA 4TLBA 1ZO8A 1AJEA 4LG1A 1MAAA 2ES4A 1WMAA 4LMPA 4NCIA 3ELWA 4ROSA 4MRSA 4RU1A 5TQ2B 3VMMA 1M2GA 2ZUDA 3LVFO 3GWZA 4YA6A 4CUZA 5JH7B 4E09A 1VFPA 4AS2A 1COZA 1DB3A 1DCKA 2H1VA 2QU7A 2GZRA 3EAQA 3OEHA 1XYVA 3DZJA 1P4HA 2WHYA 4O4LB 4UTPA 4GWLA 4I50A 4L7QA 4U9IS 5ALMA 2SICE 4HGYA 3ZGYA 3IO5A 5FLEX 1UAAA 3WIBA 1BNCA 4D02A 4QYXA 1I3LA 4CUKA 2JVIA 2WAOA 4IVNA 3KR1A 4DDWA 1Z62A 4KUGA 4KWCA 5JYDA 5DLQC 2ESRA 1XCJA 4G4JA 3WJ2A 1D6JA 1TRHA 3RADC 4LISA 1JU4A 1H0SA 1HE3A 1Z88A 3NC0C 3A1WA 5JSKA 3ZLVA 4GNKA 2W58A 1Z9BA 4MYSA 3ZQKA 1L4EA 2RGRA 4NZNA 3LY5A 2G4LA 4EQ6B 2P3OA 1XVTA 1T29A 4X3CA 5IJAA 1ABEA 1JHUA 1F3OA 1E77A 1LXCA 1Y9DA 4Q1BA 1XN1A 1WXEA 2BWJA 2DFVA 3FFBA 4OB6A 3WNZA 1OI4A 2P9JA 3ZU5A 1DV2A 2O2GA 2XZDA 5K8TA 1N4DA 2CCGA 1X1QA 4GC5A 3OTHA 3MHTA 3DHYA 1SZDA 1Y82A 1TAGA 3L0ZA 4IIFA 2YWEA 2C29D 3OPYI 3KQMA 4KWHA 3BCHA 4X45A 4GLFA 3SJCA 2H51A 3STWA 3K70C 2ZYAA 5CIWA 4BYGA 3QEKA 1P29A 5DCYA 5FWXA 1SD1A 2ILVA 5IFKA 2HO4A 2Y6UA 1U11A 4A15A 1TIBA 1VG0B 3OAAA 1O6CA 2YZMA 3GGOA 4K9SA 2DZDA 2VP9A 5HFAA 4HB4A 1U98A 4AJJA 1YIAA 1MO4A 2O3TA 3AC0A 4X3OA 2IYAA 5IBQA 4QPCA 5CDFA 1ZUHA 3T5PA 5LA6F 4E22A 3DXFA 1LTKA 2EJVA 3TEMA 3LG2A 1TEXA 2ONKA 2VJAA 3ND9A 4X8OA 1EHYA 4BVBA 3ZDAA 1ZVJA 1HUQA 2XWJI 1ZWLA 3JS5A 4D8VA 1LPSA 3PVZA 4QU8A 5KSYA 1P4AA 4X65B 2IS2A 1QZUA 1XTTA 3P96A 4C29A 4CETA 4G84A 3WQHA 4OYRA 4EO9A 1J2JA 2PX0A 3QVLA 1LSOA 3V1MA 4BVHA 1PFQA 2IDKA 2OHOA 5CW2A 3WIOA 1QVWA 1IVNA 1YWGO 4ZGWA 5HA5A 2JZCA 4JIMA 1FK8A 2JAXA 1K5GA 5FPPA 4Z1MD 2XMSA 2I4RA 1P4RA 2VPXA 3FZGA 4G9BA 1F7UA 1QIDA 1MV8A 3ROPA 4NCAA 4JSRA 5CHEA 2UYYA 2BHNA 1O6ZA 1CVIA 4QEDA 4MQBA 3ZCVA 1OTYA 4GQBA 2WZBA 2R7NA 4CF4A 4Q4HB 4U7GA 4N8EA 1FSZA 2YZ2A 2JIBA 1MNQA 1A9XB 4BB5A 1WCWA 3PEEA 1KK2A 5DNWA 1XQWA 1Z34A 3LXRA 1AQYA 5CA1B 5I7SA 1LZKA 5JE8A 3N3AC 1IMOA 5BT9A 1TVKB 4QAQA 5E3HA 1UDBA 1FYWA 1LK5A 4Q3OA 4UMFA 4LXYA 3WYFA 2Q49A 2C77A 1GNLA 4FPXA 4IGAA 1B4DA 3KT6A 3B6IA 4RJ2A 4DLXA 1R0YA 2RG7A 1XCBA 4QUJA 3SSOA 2VQ3A 4YRBA 3KOWA 1H0HA 2CL7X 1ZMRA 4F92B 4JEMA 2B5VA 4LBWA 1F3LA 2C4TA 3DKKA 4YAWA 3T4EA 5JDIA 1TAUA 3EPRA 4QPPA 2AWOA 4B2IA 1I1OA 4FMPA 3QFRA 1JHVA 4NZOA 2DBQA 4CMIB 5AVUA 1WBBA 3DR3A 5LOVF 2OXFA 2XUZA 4OQMA 4Q9LA 2B7BA 1RACA 5KZMB 4LF6B 1ZVQA 2I2DA 2LTAA 5HJ2A 2HU2A 1AXGA 2MYPA 4X5OA 3PUIA 2CDBA 1M2VB 3P0HA 5D85A 1EVLA 4DC9A 4QQNA 4H60A 1I1NA 3ELDA 4J16C 5BYBA 3DOOA 5GV8A 3WBFA 5A3QA 1IWPB 1D6SA 2R85A 5DO9A 1ZKDA 1U9YA 4MW1A 4BLTA 1PK8A 1FLDA 3G9QA 4IUBS 1X39A 4TL8A 4YGYA 4S1VA 3PZRA 5JHHB 5KX5F 1CF9A 3QPAA 2VHEA 4IOMA 5BRJA 2GEUA 1PLLA 2O3UA 3OM0A 4QXQA 5FOVA 2J7KA 1J39A 2QMOA 1XJQA 2RH9B 4FC7A 4ZEVA 5C7YA 4ZYWA 1JE0A 4UBOA 1S7CA 2G6TA 3GXBA 3Q3VA 2D1QA 3WYCA 5LQKA 3H17A 3RBAA 1FRVA 2QPAA 1DX4A 2BMAA 1FTGA 4H6WA 4RMGA 1P2DA 3L4BA 4RSRA 3FFWA 1ZX1A 5CB4A 2GPJA 3B89A 3JQBC 3RQIA 1NN3A 1PL6A 3LC0A 5LBIA 3QWIA 9GPBA 4LZAA 2BR5A 4NYJR 3KTDA 3AF3A 4LDQA 4U6QA 4MV7A 3V1KA 2NQ2C 2RGXA 2CCKA 1QAOA 1K0FA 2ZRFA 1OILA 1ZN2A 1DKRA 2W00A 3V2GA 3K05A 2R7KA 4CN9A 4RVSA 2HU5A 4URHA 4WCFB 4LNUA 3D6NB 4GZ6A 3QY0A 4PYMA 4CL0A 4H3SA 3ZGXA 2VNJA 2AXPA 4PANA 3WYBA 5HGXA 2GN6A 4Y6QA 3PXXA 1DIOB 4TXLA 4Y9DA 3IEPA 2PQ2A 4ND8B 2J4CA 1WXFA 4NE7A 4GG1A 5I9MA 4ZRDA 4KQCA 1PJBA 5FULA 3G1TA 2V9ZA 3CR3C 3EXG1 5M29A 2O54A 3QM1A 4RD3A 3IAS1 1GLNA 2DXIA 1G3UA 1V41E 3KUDA 2DUMA 2FEOA 4FC6A 3QKSB 4PHCA 4C5CA 1WUJS 5LLTA 4OFBA 1KHHA 3BFVA 1UPFA 5JARA 2VDKB 3RVLA 1EFVA 2FWMX 4DMCA 1JA1A 1V8PA 2IU3A 1HE2A 1U90A 4WLEA 2HA6A 3OCWA 5AW3A 1ABBA 1ZJWA 5C5EA 1J7JA 5ICEA 3SEAA 4KAJA 2PT6A 1U94A 2WYWA 3T1HB 1MENA 4IWYA 1E3DA 1DQZA 4OHZA 1MO6A 4F0JA 3DDSA 3SIWA 4PYNA 4R69A 3TZCA 3C3JA 3PHIA 1DQRA 1Z4OA 2JAOA 4ZYUA 1ZW6A 3MWEA 5ERYA 4EG0A 4LFBB 3RV3A 4EG8A 3AP3A 5LQJA 2WUVA 4WFJA 3GL9A 1Y9AA 3OBBA 1ODCA 3DEFA 2D5BA 3B3JA 3IPLA 2VDLB 3NKVA 3MTBA 3PLRA 5EINA 3H2BA 3IEKA 5JWHA 4CZ2A 4D3FA 5FUQA 4RV9A 1CR6A 2LKDA 1RAAA 4CTOA 3C48A 2VC2B 3B1XA 4RKEA 1ZS9A 4GUAA 3UOWA 3K70D 1BA2A 1JI3A 4P80A 2PUGA 3MHPA 4B48A 4EFLA 4R81A 1RAGA 1HEUA 4XTRA 3EH1A 2VHJA 2QJTA 3FN4A 3FYDA 5KOIA 3WBKA 2BUBA 2WTMA 2EX4A 1L4BA 1X70A 5E4TA 2JJQA 3O31A 2Y9PB 3CNNA 3VC7A 4A8JB 1AURA 3HH8A 1AN0A 5TXGA 4M60A 3R3UA 3WGIA 2VWPA 3JRWA 4CF6A 1NXXA 1K88A 4KC0A 4L07A 4PR0A 1UBNA 1MBZA 5LP6B 2ZJ0A 5ALEA 3THYA 4BQNA 3FRHA 3P2IA 4TN5A 2G8LA 5DDIP 1YMQA 4CKEB 3H3JA 4BGEA 4TT3A 2I99A 4CM3A 3MTQA 2C2MA 4IEEA 1Y8QB 2W83A 3A9TA 4H9GA 4PZDA 4BAGA 5B6PA 4XUDA 7MDHA 4BXOA 5G40A 3FFXA 4L4UA 1CF2O 1NT2A 2JAPA 3MINB 3E0XA 3NGMA 4J0GA 5I7WA 4DA9A 1WPXA 2AF4C 1YB6A 2ISCA 2KI5A 2W2LA 2WJ3A 3O4RA 5IK2A 4CIYA 1QPZA 2Q6LA 2AG5A 4LKOA 1SPXA 2ORVA 4D6PA 1KMMA 1GAJA 1HYBA 3IX7A 1P0MA 3BZUA 2HAEA 2NVUA 4UCFA 1W36C 3HDQA 2GCIA 1J0BA 3IR7A 1Q2UA 2V6GA 1EGQA 3I28A 4JN6B 4C5BA 4AJOA 1V1MB 4BNJA 3M5DA 3ZHVA 2PR2A 3FNRA 5HKKD 1W6UA 4EY6A 5DOZA 1PD1A 1G3RA 4PY2A 1N7JA 2O23A 3RGGA 3WQBA 3KXDA 2GS9A 5DXFA 4K6HA 4CM8B 4Z99A 2ZIWB 3DE7X 4I9GA 3LQRA 1B00A 1MVNA 1VKNA 5FNVB 5MF6A 3KSUA 1JLHA 2EDCA 5H9VA 1AQIA 1X7DA 1XF9A 3M83A 5IM4A 4DR2B 4PHGA 3FPJA 2BMFA 3OU7A 1E3SA 3UCXA 5CB8A 3OCYA 4YB8A 4LYGA 1A9ZA 1XU4A 4KLCA 2BE9A 2XGSA 4BRUA 1M2OA 2FF5A 3FPKA 1JWAB 1UM8A 3MLBA 2NTNA 4KPUA 3RANA 1DFHA 4FB4A 1B43A 4CBVA 4K9LA 4PG5A 3TYXA 5T8KA 4C03A 5F2OA 4OH1A 1MAHA 3CUSA 3UHPA 5DNEA 1UUFA 1ENZA 4OI4A 5LZ2A 3KJFA 5DBOA 3LCRA 2RH5A 2VQEB 3RSLA 4MWZA 2B2XA 3BMNA 2QVXX 3EMDA 4M1KA 1R6UA 2V7QD 4HLNA 1QHYA 1EDDA 2HADA 1SUSA 3TIIA 3UWDA 3TRFA 5LP1A 1ISJA 1CE8B 1P5FA 1Y37A 2I2FA 4KG7A 4RH0A 3G3EA 5DSXA 4N01A 4FYHA 5P21A 1M73E 1RW4A 2BSQA 4M46A 4HDMB 1K5DA 3OE5A 4MW9A 4BVKA 2WE7A 1PTJA 3AEUA 2V65A 3R8XA 1YASA 3NVKI 3RASA 1C7RA 5BQXA 1BCRA 2R7AA 2R9VA 5B6JA 3NCHA 3OQNA 2FPOA 4MCAA 4W63A 3FB4A 1P18A 3LHKA 2OZKA 4PCVA 4EO4A 1BMTA 1PUXA 2P4EA 1DUIA 4KPEC 4Q4AA 3HB4X 4CG0A 4ZMRA 2PH3A 1R00A 3DFKA 2Y05A 3I12A 3K1JA 2EOAA 3VSCA 3ZKAA 4D0GA 2I7CA 5JY6A 1AN9A 2VNSA 1UJNA 3S2SA 2ORIA 3PQEA 2QTVB 2W8BB 4M36A 2Q3MA 4N12A 4UUAA 2D7JA 4L4RA 3PTZA 3NAMA 1HY3A 1UBSB 3FE2A 5SYNA 3GJ7A 4ATNA 4HNHA 1LEHA 3MB8A 3VPDA 2WVAA 2H2WA 3ABZA 4EFKA 2X8BA 2W6JA 2FPRA 3FSJX 3IVAA 5ALWA 3R7BA 5EYPA 3TXXA 2EL7A 4AY4A 4EMSA 5B7NA 1KPGA 2WD8A 2Q9UA 1LNQA 4LJ6A 3WO1A 4JHXA 1FVFA 5IX8A 4GDMA 3FDJA 3PQ3A 3O4HA 1WY5A 4H3VA 1QNFA 5CFNA 1IWBB 3HJHA 1XXLA 1IIRA 3PPIA 4EABA 4QRHA 1LDNA 4NBKA 5JMPA 4ZCQA 5EP3A 3PFIA 1BGXT 1CUFA 3HGMA 1ZL0A 1E3LA 2JGRA 1BDMA 2O0LA 1JBKA 1TQ4A 2PZEA 3NONA 1CV2A 1E63A 4MVXA 3TOVA 2IDJA 2H6EA 1ZH0A 3VNUA 3RRJA 4NZ9A 3ROXA 1M34A 2DLCX 4M0KA 1U63A 2JFYA 1ODLA 4G5RA 5LQNA 4R41A 2XTJA 4QBFA 1ZBDA 1N5DA 2KBEA 5U4QA 4I1IA 4MXDA 3OSUA 3TLCA 1FUUA 5DWQA 5JXJA 3H6KA 1JAIA 1DINA 3VVLA 1NXSA 1T2DA 3E4CA 1P0CA 3EIHA 2VLIA 3LPLA 5TMBA 4EVRA 3MMNA 2QGFA 3MS7A 2VA8A 4QHTA 1NBEA 2BFFA 3HUTA 4JJKA 3WL6A 1U7UA 5BVHA 1UJ2A 3GG2A 1JAHA 3LC2O 4ZDKA 2H0AA 2ODQA 3B1FA 4NFLA 4JQYA 2D1SA 4HAOA 4PQRA 4O2AB 5LWHA 1N1EA 4DLLA 1VJDA 4JEUA 2JIPA 4RY9A 7REQA 4MO2A 3WL8A 2VAPA 1XMXA 3UGQA 2NIPA 3EXIB 1VE9A 1UMDB 4NP6A 4OBBA 4LTDA 5K0CA 4HYTA 3CF0A 1JHMA 1VJTA 4KL8S 4LHVA 5IABA 4Z3OA 3UBTA 4UBKA 4XUGB 4D99A 1QRRA 1XXHA 1ZITA 2QKYA 3BEOA 4QZVA 3O7MA 3PQDA 4HSGA 4O4HA 1KZ1A 2WTAA 3CBGA 3HHEA 4FBGA 4LVNA 4OQLA 4TSKA 2C2KA 3NU1A 3KPVA 1QYIA 2XCIA 1N2SA 1XLWA 2GBCA 1WUKS 3FY4A 3DZDA 4M0EA 4WZAB 3ICCA 1QX3A 2RAVA 4G2NA 4Y67A 4BVLA 3NIWA 4NIMA 4C2AA 5BQFA 2DETA 1DAEA 1ADFA 3L6EA 2OE2A 1Y4UA 5AW7A 2XGMA 2ZJZA 4MAAA 4KO1S 2FRDC 1QO9A 3IUPA 4QIHA 3QMWA 3N8NA 1L4MA 1JL3A 1GRRA 1E2HA 2HRZA 1UJ4A 3DZFA 4OGFA 4U2KA 4XW2A 3UENA 4AY5A 1H9CA 4DCNA 1S3SA 3QEBZ 1IM8A 2LR0A 3UJDA 2D4HA 4DCCA 4EIWA 5KJCA 4DR6B 3DTYA 1PRYA 1V5GA 3G49A 1JXQA 3EEBA 4FFLA 1AXEA 1GL6A 4GBED 2C84A 3R9XB 3RU3A 1HORA 4UU7A 1OT3A 1W36D 2NUAA 2FOXA 3ABIA 2PJUA 3QVOA 1W2GA 1X6VA 1NN5A 1TYCA 3DCJA 4IMIB 4BYMA 1FQJA 2OHFA 2XEXA 4X24A 2XA2A 4J2OA 2G1AA 1RYEA 2OWEA 4WW0A 1F9AA 2NXNA 2WIBA 2NZ2A 4NJMA 4XQEA 1OCEA 4RORA 1TX4B 4EUKA 5DV9A 4WKPA 2ILTA 3TAUA 2AT1A 4IYRA 3ZE1B 4B4DA 3RIGA 3UMVA 3L01A 1I6WA 4R9SA 4HT3B 2PFSA 3CZMA 1M7GA 4PZCA 2V0GA 1P19A 3M4ZA 4Q82A 3A3PA 2NU8B 3HSYA 4MDYA 1BYUA 4G3XA 2FPIA 4AL4A 2BGMA 4IFBA 4DR3B 1KE1A 5G02A 3DHVA 1MC4A 1F2VA 1GUBA 2XMZA 3IAM6 5DXAA 2P2NA 4GYKA 1T91A 5KDLA 3WXMA 2XOXA 3GFOA 4BNMA 3UXEA 2IHKA 4Y2YA 8OHMA 1X14A 1QCCA 2Q6VA 4U9UA 4Q3EA 1TZMA 3KXLA 2AI2A 2QMEA 3PDWA 3ADKA 4LJ5A 4RTOA 4D4HA 4ZQCB 2VSYA 3W2IA 3N8GA 4TOIA 1K6XA 1D1TA 1NJ8A 3KFXA 4NHOA 3EQZA 3H1PA 1S2GA 3I45A 4Q4JA 4I4CA 2PCLA 2CNOA 4YH1A 5FKJA 2IU6A 4UEOA 2F8TA 1VSBA 1U0LA 1CU1A 1TDJA 2FEAA 4Q1CA 2X15A 2DUNA 4A0RA 8ABPA 3S1AB 3WQQA 4QT4A 3CH6A 4M6WA 4EYSA 4TMTA 3GGCA 2BP7A 2ZYVX 4E2FA 4IDGA 1KYZA 2OXEA 1N32B 3VNQA 3MG9A 4GNRA 4HDCA 1C1DA 3DT6A 4QODA 2GJ4A 1G5PA 1XTIA 4KODA 4EM6A 3KEGA 3H11B 3K94A 3T3IA 5LQRA 1OE0A 4UFOA 3S44A 5FDFA 2ZSHA 4HWKA 1QBKC 5BW4A 4BP1A 1J1UA 3LWZA 1TC1A 1KJWA 3CVJA 4OSPA 1KAQA 1MNAA 3W9UA 3LWBA 4KTVE 1I14A 4BFLA 3PE3A 3DD5A 3JQ7B 3SIPA 2OCBA 1PNTA 5KQLA 5KWJA 1YZYA 1NF8A 3TXYA 1P3Y1 5IF3A 4YCCA 3SHWA 1DP4A 4NFSA 1EX7A 2WUWE 2HWKA 1W94A 4TX1A 3C4JA 5EMHA 1CWUA 1CJKC 1Q0SA 1XJWA 1R8QA 2PLFA 3RS3A 2UAGA 1KH3A 1V71A 2EGUA 4A0QA 5DNCA 2DUWA 2FGJA 3H5IA 4BMYA 1CUDA 1V8DA 3H2HA 2Q6IA 4HQKA 4OKIA 4P4TA 2FEWB 3ZD7A 2J6CA 2DFNA 2H1HA 3DOJA 4HYYA 4R9VA 3MB5A 3CT4A 1Y1LA 2VPPA 3PHJA 4RA6B 4RGVA 3VSEA 2I4LA 2E5FA 3D3WB 4LDAA 3FCAA 4WI1A 1O95A 3VR5A 2XIQA 2IPMA 2BF7A 1T9ZA 1Z0DA 2JAHA 4A2CA 1W75A 2ZATA 2MT9A 2J4DA 5KVVA 1JTVA 1V35A 3I92A 5BNTA 2AEMA 3MCAA 5KQSA 2PVCA 2VKTA 1VLVA 1MEOA 1JJAA 2AXNA 1ZLYA 1CK4A 3I0ZA 4MUMA 5DBEX 4EH1A 3OUZA 3MRTA 5FWYA 2IGBA 3K8ZA 3EA4A 4ZVVA 1F1BA 2AB0A 5KVAA 1DTSA 3P26A 1U3CA 5A9SA 3SN6A 4ZZIA 3EZ6A 4I9NA 3HVHA 5FTKA 5IU6A 2EG5A 1QJ4A 3P9NA 1UZUA 4M0LA 4URWR 4N48A 1MHTA 3E84A 2W11A 4HH0A 5J5CA 5T7BA 1F51E 1LTHR 4QYTA 3FDXA 5EERA 3OFND 5K0SA 1CZHA 4INZA 4UC0A 3RBVA 1DMRA 3W7BA 3H8VA 3FR7A 3BFPA 1JQ3A 3DAPA 5GPBA 1IN5A 1KF0A 4ADSG 3GVCA 3GCWA 2HFJA 5A1JA 2GYYA 4PAWA 4HRVA 4S0ZA 4FB5A 1VPDA 1P0IA 2NX2A 3F6YA 1IJFA 4G4IA 2H0QA 4NV1A 2BTEA 1KK1A 5D51S 1E9AA 3ANTA 4ND4A 2BIFA 1FVHA 3TSYA 4U7DA 3FYHA 1PGPA 1R6DA 2ZTHA 4PLFA 4LECA 3RSCA 2XDYA 1X15A 2DBRA 5FBKA 1HLPA 2R2AA 3RK1A 2MWMA 3C6ZA 2JASA 3INRA 3Q10A 2E87A 4Y0NA 5KVCA 1R0CA 3GRKA 4HI0E 4LE0A 4J0EA 1NM5C 3F49S 2Q2QA 4HAYA 3RS0A 1KZ4A 4ITUA 3BRQA 3CLRC 3D8NA 5AI0A 5G0TA 3PNPA 1XALA 2JFXA 2P5UA 4PPGA 4QGGA 1UBOS 2E0IA 5K05A 1M83A 3K92A 3DPSA 4X1KA 2GZ2A 4PINA 4MZXA 4OHVA 4Q37A 1FPQA 3GR6A 1T9GR 1G3QA 1SC4A 4BJ1A 2LNDA 3EC7A 1A4UA 4PZ9A 4WT7A 3VHXB 2ZCJA 1XCMA 3CGWA 2AZ4A 2OBFA 2PMBA 5EJ5A 1LNSA 2AMVA 3EUWA 3U9SA 1W7AA 4M88A 1VMAA 4OIFA 1Q0ZA 2KLBA 5TQ2A 5LKRA 5JH7A 2GTHA 1XE3A 4INPA 4F8JA 1D0IA 4LFAB 4JI4B 2QQFA 3OM1A 3HWWA 2P6OA 4AZVA 2V6FA 3DL2A 3FVRA 1IY8A 4FLEA 4HX9A 1RC1A 2EATA 4O4LA 4E30A 2OV1A 4IHJF 4Z1MA 3VOTA 3E9CA 3D4LA 1ISRA 1V95A 3OLZA 3AF4A 4G81A 4E11A 3K20A 3BE8A 1UK7A 3FFAA 2V9PA 2X41A 4DCSA 3LRTA 1F8YA 5I9SA 2SCUA 2ZUCA 3SM9A 5LZ9A 4UUQA 2A4MA 4EL5A 1ZUD1 2L82A 3FR8A 5TPZD 2DAPA 2J0UB 1T5HX 2ZZKA 2WTNA 5H8WA 1TPZA 2GZDA 2FPGB 1DKQA 1L8LA 1Z7GA 5ENVA 2Q5HA 1YZNA 3GMDA 3VQTA 5HM6A 3AR9A 2ZAGA 1X1CA 5CCBA 4PZYA 4P0QB 2BFAA 4RD2A 2OXRA 4XWYA 1P77A 2QTTA 4XI9A 4ALLA 1D7OA 2H4JA 2LKCA 3W6NA 3GARA 3OKAA 5JCZA 3Q8MA 1P7WA 2GTIA 1L7VC 1NBHA 4MX8A 4ZVSA 1GAWA 2X19A 1B6SA 2O05A 2Z9CA 5E0OA 1Z5ZA 2WJAA 4F91B 4CLXA 5KSOA 4B7CA 4A4DA 4XFJA 4IDQA 1XZIA 3WADA 4RDXA 4RTKA 3LFUA 3GROA 1FLAA 4Z9XA 5F2EA 4E1VA 2QT9A 4LJ7A 2HT6A 2O3JA 4O6VA 4ENVA 1P5ZB 4GQIA 1JG4A 1JZQA 5JSZB 3KEOA 2EVWX 2GJ8A 2H57A 3GJ5A 4OCZA 3L6DA 2OAEA 4IO1A 1JEEA 4QULA 4Q9AA 1MQ9A 1RRVA 2NU6B 2X2OA 3CRQA 3NH6A 4F21A 5M34A 2ICAA 3AINA 4ZMSA 1XFDA 3E23A 5AJTA 3TBKA 5A0VA 3IDSA 3X1YA 3FXAA 5EMKA 4P83A 1Z5GA 5JC1A 2PMDA 3BSWA 3MVEA 3CKLA 5KJ1A 4L50A 1ZZGA 2ID7A 1PS0A 4G9EA 3U7JA 1BXRB 3AZQA 5EJ6A 2J5KA 5J58A 3KJNA 1QLWA 1A95A 1TK2A 3A6GA 3KPUA 5SYMA 3UB3A 4XE5A 3D6MA 2ZXEA 3ESDA 4DMLA 1QQTA 4Q7LA 3TOCA 4HDNB 5TX7A 1VCMA 1AF7A 2DTEA 3EBLA 3EXAA 1AKTA 3H13A 2B2CA 1QS0A 3A04A 3MSCA 4BLQA 4N40A 1JKIA 3HJFA 1W4RA 3PJFA 2BISA 5SZIA 3RF6A 2C07A 5KWIA 3D9QX 2IPAB 3PPXA 2B0CA 3H5LA 1CQIB 4YVFA 5C1OA 4GWGA 4W1SA 3QG1A 3F73A 2B6HA 3BDIA 3RYFB 4EJ6A 4P08A 2RKWA 4KK4A 1K6IA 4DHWA 4OJMX 1FFXB 4NICA 3RAPR 1E7SA 3HYLA 4HWGA 1DARA 2ZSUA 4Y2PA 4JP8A 5DTJA 5E9AA 4WLNA 1JHAA 1OZGA 1BX3A 4BO1A 2V4ZA 1FMCA 3GMIA 1A9XA 4DMGA 1YS2X 1KP3A 2I34A 5CA1A 3UW3A 2OB1A 1WTAA 2WM8A 1TVKA 3TMAA 2FLVA 5DX0A 3L7KA 3L1JA 2SHKA 5FO0A 3T3MB 5CDSA 4GVPA 1DBRA 5ADUS 1WW3A 1W46A 1K5PA 2NU9B 3SNHA 3WFIA 1IUOA 3QU9A 5FL7D 1J1ZA 1JWBB 2WLTA 5CIQA 3VU8A 1N75A 5JI2E 3DKRA 5LQMA 3MBIA 4C4PA 1V5FA 4FOTA 4PLVA 4YONB 1QU3A 2A67A 2YDXA 1KRHA 5DHTA 4CKWB 2VP6A 2Y2UA 3AT1A 4IKEA 4CMIA 5LJIA 1NRXA 3DUWA 2P2ZA 3K2IA 3KEQA 2DR0A 1N9GB 3QBVA 4YP6A 1EDOA 4REQA 1A4RA 5MN5A 1ZHOA 1C0PA 1JEAA 1TEZA 4MUGA 1M2VA 1ZK0A 1ZM4A 3UXYA 4AROA 4BLVA 5K0ZA 4A2WA 1SFRA 3O4GA 4IJQA 1SXJC 1Y5IA 2VSFA 1WXDA 1VE1A 4J1QA 4LQ4A 5HOEA 1I4WA 1CUVA 1DEKA 1NXVA 1F0PA 1KU0A 3Q15C 4GO1A 3MD0A 4HMOA 5DE3A 4BKOA 2XGJA 2GESA 2IKSA 1E69A 4CM1A 3URMA 4V0LA 3IHTA 2IX3A 3GJXC 3RVSA 3RW9A 3ZZTA 4EKEA 2WJ4A 4D4KA 1ND6A 3FA2A 3CZAA 4RWEA 3R75A 5AVYA 3ZGNA 2AFHB 2WK1A 1U2GC 2X23A 1O6FA 3EF0A 2I8CA 4P7BA 1T13A 4IDOA 1GNTA 2I1QA 5EP4A 5C52B 5KAPA 1GZ6A 1OWNA 2HB6A 3DMRA 3O0TA 5TS3A 6YASA 2O8FB 2O7VA 5KYKA 1BROA 4B3TB 2P9EA 4IIBA 5CH5A 1AQJA 1DDIA 1N92A 1FQWA 2VUHB 3IKMB 4EGJA 3RC8A 4B7AA 3HXQA 1YRYE 3EIWA 1KY3A 2NM0A 4JLNA 2P30A 4XWTA 1ML3A 2VSOA 2C7RA 3BORA 4C0XA 5J4VA 2ZRPA 5EE9A 3TI9A 4B5LA 2ZRQA 5AJYA 2GNAA 4CIXA 5IF9A 1TU4A 3UPUA 5ALGA 3CLRD 3HYSA 2JCYA 1J2TA 1E2MA 1HDYA 2YHUA 1VSUA 3C3YA 4PTYA 4NNPA 4WCFA 5T4EA 4YRMA 5BP7A 3H5VA 4X1YB 1WWKA 4RMNA 1P75A 4AJIA 2PVSA 2Q5JA 1R16A 2R60A 3D3NA 4WASA 1G8AA 1YV9A 3FCUB 4DA0A 4OMUA 4E5NA 2FUG1 2QD3A 1DC4A 3UF0A 3DFFA 4YRCA 3BSSA 1IOZA 3KXPA 2ZWMA 2XNJA 4ND8A 3AM4A 4EPXA 3KJIA 4HJRA 1AIPA 2I1VB 5FWDA 4JUCA 4M86A 4U7WA 1YXMA 1NPTO 4GU5A 5D7NA 2ZYHA 2AOTB 1IXRC 4KXLA 4YAOA 4N5IX 4M0CA 5J59A 1NYLA 1PIWA 3QKSA 4C76A 3UUWA 3R5KA 4JBYA 5F3RA 4ZCPA 2YICA 4AUKA 2HK8A 4QOFA 1P3JA 1NFRA 2EF1A 2VDJA 3IIIA 1E2LA 3G6KA 3JQ9C 1NQWA 3PQ2A 3DQZA 2MCFA 3ZC3A 5DLDA 1AV6A 1ZM7A 4KO2S 2CFSA 1U0GA 3L49A 4Q7JB 3VU9B 3WVNA 1DC6A 4NDAA 1B3RA 3D43A 1O5IA 2CB0A 4NE2A 1H9AA 2VTDA 1XZDA 4HN2A 4JODA 1J9ZA 4UEKA 4URUR 4Y0VA 2FX3A 1FDIA 1O57A 3C1AA 3SAJA 1ATIA 1STOA 4HGPA 5CA0B 3E82A 4Q7EA 5E8RA 4AP9A 2VCEA 2X9NA 2X9GA 5AKKA 5KNBD 1PVDA 1AM4D 1HLGA 1DFIA 1L5HB 4UZEA 3DBOB 4U6NA 1N5MA 2R8ZA 2YMLA 2G3YA 4NL4H 1IHDA 2C9MA 4WBSA 3S68A 1OB2A 1Z4QA 2QP9X 1Z4LA 1RFGE 3I58A 4H7JA 1IZ7A 2C4UA 2H7VA 2NYAA 4P84A 2JJ2A 3TTWA 1YJBA 2BGKA 4P0PB 2YRWA 1GPWB 3EQ8A 3KYBA 1Y1KE 2IEDA 2Q3DA 4MV5A 3G2KA 4WOKA 4XFDA 4FCCA 2HL6A 2QR2A 4BP9A 2YJNA 3HJCA 1RJDA 3MWKA 3NHAA 4MQLA 4BCCA 2G5TA 2ZI7A 3KUXA 4HEA6 1QOPB 1XYGA 2XGGA 2XJ9A 3FUXA 4JLUA 3B5EA 4UTVA 3JARB 4UBIA 2VQ6A 2F2TA 3G5TA 2CV2A 4RGYA 1BQ4A 3L07A 3N2KB 4RLHA 2BM1A 4TS3A 2FWRA 2JFOA 4A8JA 2PG3A 3B5IA 4LF5B 5LB4A 1XRRA 3K6RA 4KTTE 2DFTA 2V7QA 1NR5A 1C3JA 1O94A 1YJQA 1KAOA 4QBGB 5LP6A 4BQPA 4CKEA 3LCCA 3U19A 3L93A 1RWMA 3E4DA 4GD3Q 3EBOA 5ALHA 3WWYA 1YMUA 1CY1A 3U7RA 1Y8QA 4NJOA 4DQVA 4NBTA 1ESEA 1WE2A 5D1NA 1CDEA 2HK9A 2FFRA 2XUFA 4ZVUA 4C4TA 3MINA 1QP7A 5TGZA 3FHJA 5IBCA 3T7CA 3GMTA 3L40A 4EYQA 5JNSA 5KTPA 2HJ9A 3GW8A 1DI0A 1HYQA 4IX9A 2B8JA 2PPLA 2WD9A 3M33A 5HK8A 4HUQB 2XR1A 7MHTA 1QG4A 3L43A 3PNOA 5H7XA 2DPLA 3S4YA 4RO0A 1Y48E 3PFFA 3ZG6A 4UHCA 2PLWA 2QYSA 5ALZA 4DSNA 3U1BA 1LD3A 1RU3A 1V1MA 3KT3A 3L7BA 3BCRA 4KFRA 2ZI4A 4G24A 3HDVA 4G23A 2I29A 5ESXA 1NJ1A 1Z28A 3D7LA 2JFWA 5H3CA 1SIOA 3CR7A 5EUMA 2HK6A 4L0MA 4A2PA 2P7HA 1W30A 3WWEA 5AVJA 2Z98A 4OL0A 4CM8A 3HR8A 5FNVA 5FX2A 1T8YA 3VDQA 2V6BA 4EX7A 1CJTC 1FVOA 1I4TD 1MVLA 4KXQA 4V03A 3FSGA 1TYAE 1GPUA 4N18A 1OTHA 16PKA 4D8UA 3O0DA 2WTUA 4PTZA 3IHKA 3CTMA 3TAHA 4NYMQ 2DTXA 1XEWY 4KJXA 4LHZA 1HLFA 1ZK2A 4UHFA 1D0VA 3ZWCA 3Q9LA 4C7VA 4X60A 4R31A 4EYEA 3G8DA 2Q5QA 3HN6A 3BQ9A 1XTSA 4MPTA 1FFCA 4X9XA 2WA1A 1JB1A 5KKAA 3ABSB 1JVSA 3P0JA 3KLNA 2A6PA 5P8WA 5I9LA 3F47A 5CH8A 3Q6MA 2RGAA 4RTMA 1CUBA 2VYND 5DF1A 4N5LA 4MTLA 1B14A 2AYXA 4EDHA 4EB6A 3KYJB 1DRUA 2ZBQA 1SKYB 1ZMXA 2QD4A 3BJIC 4L78A 3A58B 2EQAA 4F12A 1CE8A 1SXJD 2O2JA 2CJYA 3I4FA 4RFVA 4QEZA 1D2RA 3NCTA 1Y6QA 3E70C 3TQQA 6CHYA 4LGYA 4IDAA 4HDMA 3F4KA 4BVJA 1CUUA 4PZLA 2VQSA 1RMQA 4UAGA 5TNXA 3ZDRA 3AVUA 3R4VA 1VIYA 1AKMA 1PE0A 1T10A 1DIGA 2HDOA 1DIAA 3W79A 2N47A 5DN6A 3DS8A 1A9QA 4QDTA 4OMCA 5C7IO 4C2UA 1VHWA 3CLKA 4MINA 1S5PA 5B64A 4FNOA 4O4JA 3HHPA 2QUJA 1VMDA 2O8NA 3WK5A 5JD5A 1FPMA 3AY7A 3H4TA 3HZHA 5B57C 4R2JA 3GOHA 3IUEA 2E1RA 2QUBA 1I5EA 1TUIA 3NHMA 4KLNA 3VSDA 2A59A 2JH9A 4BNFA 4MV1A 4YAJA 1AQLA 3OQVA 2NWQA 2QTVA 2AOVA 2ZUBA 1SCKA 3F6BX 4TSRA 3VI3B 4JC5A 4XCVA 1DZ3A 5DGDA 4BX9A 1BXZA 3EDMA 4C0QC 3KDPA 4TV9B 1OR8A 5BNWA 4H7HA 3PWSA 3SGLA 2X6RA 4I19A 3WRYC 3DVRX 3Q7TA 1Y5NA 1KJ9A 3IP5A 2Z4RA 1YR7A 2I4NA 5KTOA 1QCYA 5TF4A 3KPWA 1N0HA 2GO1A 1EFUA 3R0QA 2AGVA 2KBFA 4C0AC 1Q15A 3LSYA 4HRXA 1GA1A 4NESA 5LLSA 2XT9A 4YIKA 1E7QA 2QX4A 1QAQA 1XAIA 3PKZA 4DIEA 1C7IA 2JJMA 4UNRA 3BT7A 2A84A 3I37X 1RKVA 3GCDA 4ZDWA 3VV2A 4DLRA 4ZI7F 5CLJA 1ZVKA 2GCGA 4B4UA 3O6VA 3UJ3X 3HNOA 2XUAA 1ZGJA 4IH9A 5D5PA 5D3KA 2KMLA 3UBMA 5FRDA 2YN4A 1VCIA 4EHIA 2VUIB 3OWHA 3PXBA 4XWAA 3WMFA 2YYSA 1YZGA 4U2EA 5DYNA 1JWLA 1ZYUA 3CEMA 2HWYA 2ZWIA 3G7SA 4MUBA 4G4SP 1PUJA 4M2LA 1BOOA 1ZIPA 5F76A 1EKXA 4D43A 2O3QA 5FEUA 4E13A 3SS7X 2JC3A 2POCA 4A1FA 4IG9A 1YVDA 3U4DA 3D6UA 1YQEA 4D41A 2NG1A 4HG2A 4JQOA 3MTGA 1Y1SA 4RDHA 3FF4A 2JK0A 3DBVO 2YWXA 1FW8A 4JJ4A 4DG8A 3LLSA 2G9RA 3T95A 2BFDB 2CBZA 3PHGA 4ILEA 4LS3A 3WICA 5FUWA 3AXSA 1UIMA 1RRGA 3GC6A 4R8VA 4RKYA 3RU2A 3ZHXA 3ZS8A 4ZDIA 5BV2P 2PL1A 3I5UA 3HKDB 2ZFUA 4LNHA 4ESHA 4MVJM 4YBZA 1VI5A 1GRQA 3IC5A 5J9FA 1YTLA 1JMKC 1TOAA 2KPOA 4UE2A 3RUAA 3RUPA 3AV3A 2J3MA 2CHEA 4ZT5A 2H59A 1RQRA 4F04A 4OI0A 4OPMA 2DERA 2VS1A 3JX9A 4PWYA 5BSEA 2F62A 4LZPA 1PTKA 2VL7A 4AM8A 2GBLA 1VJ5A 2OUIA 3DOCA 3NS7A 4I08A 5GVSA 4G0OA 2OK7A 4XPZA 4AZWA 1LS1A 3EXIA 3NJ4A 4PO1A 1UMDA 3T5MA 3D2AA 4MQUA 3BRWA 4NFHA 1XL0A 3U56A 1SXPA 2QG6A 1TMKA 2YXPX 5AHWA 4N03A 1T4GA 1JMVA 1LTQA 3RTBA 3S1SA 4V0SA 3BXPA 3RIXA 1L4UA 2QB5A 1N6RA 4QOGA 1VSTA 2C5EA 3D1LA 2QTLA 3FZQA 3N0RA 4C01A 2RKBA 4R2KA 2MR5A 4ZXPA 4WZAA 4EHKA 3SOZA 1E66A 3CF4A 5KQRA 3KUCA 1IZ0A 1Z7BA 4KYTA 1QRDA 1QTIA 2NV2B 3N0TA 1UANA 4RVHA 2G83A 2IDZA 2FDXA 2BUCA 3OX4A 3I9V6 1U80A 3BRSA 1P2TA 1J9GA 2WPDA 3SX0A 2IZ5A 2ZW9A 3FRJA 2I3DA 3I0MA 3RUFA 1L1RA 5L3QA 2J9XB 2Q2OA 4LDPA 2VPQA 3U5ZB 3C6BA 3R9XA 1CJMA 5CPFA 2R4QA 1E79A 1CEYA 3K8YA 1MKYA 3B5JA 5FAXA 1HQKA 1Y7HA 3QX7A 1XQ9A 2BEVB 1DIBA 1MP0A 3ELYA 4PC7A 4QDJA 5JFTA 5LZ7A 4KPGA 3NANA 3QEMB 3H0KA 2FSUA 3WG9A 4ER7A 2E89A 2LCQA 4B3RB 2FJ0A 2HK7A 4Q01A 1FMTA 2AOWA 2NT3A 4KOEC 2YS6A 3SC2A 1Y3FE 1BX1A 3BF8A 3WIVA 1P80A 2IP2A 3EIFA 3I5XA 1L7DA 2GK4A 4D3XA 4FWBA 2EU8A 1NVWQ 2AJLI 2NU8A 1PHPA 2XVZA 2PGNA 4D46A 3GT4A 5I8ZA 4B8ZA 2BFNA 3LBIA 2WWXA 3FI0A 2QEQA 4IJKA 8ADHA 2WB2A 4O5AA 2GLTA 2PA0A 4NZYA 3BFJA 3QVWA 1WXQA 2FW1A 4KBGA 5CVTA 1ZM2A 3P9ZA 3OI7A 4QC2A 1Z0KA 3N7AA 2RHJA 3NHUA 1BMQA 4YV2A 2Z3ZA 3KTOA 2ZBGA 2IZ1A 2OR3A 1OBCA 4NEQA 2J5QA 2NO5A 2NW6A 2X8LA 1AGYA 4Q24A 4B85A 1JT9A 2DY1A 3AH8A 1XTPA 1A2BA 1IE3A 3FZYA 2OENG 2YXDA 2OTCA 3DF9A 1ZVMA 5E95A 4A8HA 3S1AA 3K53A 3OFNA 1YZFA 4LXXA 2YJZA 4WTOA 1EK6A 1QO0D 4RL6A 4F60A 1EGVB 4D4JA 4B3MB 4BHTA 1CYDA 5HMMA 1E92A 2XBUA 1EVQA 4XX1A 5ICFA 3FWPA 3KK0A 5AOBA 3H11A 1G17A 3H1FA 1QC5B 1UQRA 4DOMA 5A9RA 2JBHA 2J33A 5AUQA 4E5SA 1ZQ1A 3DL0A 3ZDYB 4QGSA 4NLLA 3HBAA 5A04A 3WKDA 4BO9A 1PGNA 1RYMA 2X7HA 3GBSA 5B3JC 2Q1XA 4N65A 5GONB 1W19A 2WTXA 2PBRA 3JQ7A 3L41A 3LDFA 4ZPJA 5E1BA 3RVMA 4LBZA 3AGPA 1FEZA 1AUVA 1T8PA 3DAFA 4JT9A 4QRDA 1DAKA 1RJGA 4U8GA 4XLLA 3UAXA 4EGSA 1ZCJA 1MTZA 1RVV1 5BWLA 9LDTA 1VJ0A 2D1TA 2F3SA 3WK8A 3KG2A 2RHTA 4O2RA 1KPHA 1KS9A 2UZ1B 2KB0A 2ZJ3A 1XK6A 3L0CA 2MR6A 3NUGA 4UREA 3KVOA 4B7UA 5CFLA 1VHQA 1AS2A 1GJRA 1TF2A 3CBQA 3GK3A 4TGLA 1IN8A 1T2NA 4XR9A 3KRTA 3UK0A 1A8UA 1QKJA 1OXMA 3E9QA 4G25A 4GGOA 1UMBB 4QTZA 1G6OA 4RA6A 5DZSA 1L5SA 4M1WA 2WU3A 3D3WA 3RC9A 1N3IA 4TQGA 3DL4A 2OAGA 3A8TA 2OQVA 3ZHZA 3B3AA 3MUFA 5ENDA 3TDMA 3O8RA 4RADA 1W0KD 1WX1A 4OP3A 2P2SA 4AUMA 1GGFA 4Q4LA 4ZAZA 4DWJA 4MJ3A 4BIMA 3A1DA 3WSVA 4BNKA 4WY5A 1QYCA 3NT4A 3PQ8A 2QK4A 2DULA 3FZEA 4WFIA 4Z0HO 2EBUA 2FRDA 2W42A 1JDPA 1M6EX 4UUNA 1XKQA 4GM0A 4X8HA 3WHKA 1CY8A 1NZJA 3B6JA 3FDZA 2RHGB 3MQ4A 3VXKA 1J49A 1YZTA 2A86A 3GJRA 4HVAA 5BR4A 1C80A 5CBKA 1RBYA 2P67A 1C7ZA 1EBUA 4X93A 4URVR 4WAUA 2P9GA 1T43A 1XNRB 2PMWB 2FZGA 3N2IA 3A7EA 1S8AA 2JLYA 5JJ5A 4J91A 1AHHA 1P9WA 4P1ZA 1P17A 2TMYA 3CKMA 4IS2A 3T7AA 1BDBA 3TJMA 3B12A 4F4JA 3QU4A 1SQSA 3L4EA 3TINA 2HC9A 4CVNA 2C2HA 1U6JA 2IYOA 4RENA 4MVJI 5ECWA 2RSLA 4X94A 2EQBA 1INLA 4KXYA 2BR3A 1E2NA 4B3DA 1YACA 4U2FA 1LV8A 3TQOA 2C7VA 2R751 2XH8A 4QJ3A 4E5YA 5C8YF 3QX3A 3GJ4A 3H2GA 3FZNA 4FNAA 1U4NA 3V8VA 3V2UA 2PU5A 2V8OA 4IDNA 2ODWA 3AU8A 3ITEA 4ZXFA 2JLXA 4QUDA 3ZQ4A 3S2UA 5JWOA 4KSBA 3ZBQA 4YYEA 1BGWA 1PT5A 3H5RA 3AX6A 1XB2A 3LBAA 3OLYA 3K6JA 4ALJA 3FGNA 5I4CA 2JG3A 4B3BA 1EPUA 2ZS8A 2BZ0A 2ZWAA 3QWHA 4TT8A 4OKNA 1FSFA 5KSZA 4OGGA 2JAWA 5CM9C 3QJYA 4RLSA 4KKVA 4IGIA 3WDSA 1J97A 2ZVDA 3VHXA 1XTQA 5EGNA 3ET5A 4R1PA 4DCMA 2EKQA 3EIUA 4R2HA 4G1UC 3KB2A 5JROA 5IJZA 1AS3A 2V3WA 2ZXFA 3NQ41 5F1YA 1W1UA 1WB6A 5FTMA 2GEBA 4YP0A 2WT8A 3GYBA 2GM5A 2K7ZA 3DT8A 2A9OA 3PA8A 1GUDA 4KXXA 1GSOA 4PLPA 5DTMA 4JX9A 2XKJE 1JXOA 2IL1A 2XWQA 3I04M 4NMLA 3IMKA 1VHLA 4P7JA 3SE0A 3ED1A 4P4LA 2D5IA 2WIJA 1JDBB 1JTFA 1SUEA 2QTBA 1R74A 1QJCA 4KRXA 4PAGA 2CYCA 3H83A 3OTWA 4Y2TA 1G2OA 3AR5A 5U1PA 3IVMA 4LFCB 5DW0A 3E5NA 3UVEA 3X1KA 4J94A 1MAUA 2I8LA 4KN9S 3ZV3A 4X20A 3QBEA 2H85A 4XPIB 4A0SA 3E48A 3O3NB 2R87A 3PHCA 4I81A 3S81A 2UYHA 3SMQA 1HWYA 1NQVA 4V0ME 1KZHA 2PGJA 1U9ZA 1WCXA 1BH6A 1KMNA 3LKVA 4WOPA 5CXUA 2J0UA 1DQNA 1GV0A 5HJ7A 2B92A 1GYRA 2D2EA 4DJ5X 3NAZA 3Q8XB 2HI0A 4NV0A 1FCJA 2JHFA 5INTA 5C4IA 5IULC 1Z2AA 2PGAA 1RJEA 2BDUA 2UKDA 2GD2A 5A0TA 3WY9A 3K0AB 2FJPA 3S2ZA 3UUEA 1OLUB 4BWYA 3E2PA 4YXWA 3ISJA 1QP8A 4I9FA 1XZHA 3BC1A 2J3KA 1CPYA 4BCDA 3E22B 1F7VA 4UHKA 4G4GA 4YHHB 1NF9A 3MCWA 4UMEA 3IP6A 5LSAA 1USUA 1KGSA 3VRHA 1CLEA 1N57A 2PRKA 4HCJA 2Y6VA 2DHQA 3NYRA 1I0IA 1NHGA 1OAKA 3HBFA 4Q00A 4HKTA 4B6JA 1PZNA 1MV5A 1PFWA 2F1JA 2A5LA 1I24A 2WHPB 3NKFA 5CT8A 3U7QB 4DXHA 5I5GA 4B3IA 2CEKA 4V0KA 3CZPA 2TS1A 3ADOA 4J7XA 1LA2A 4RJLA 3KD3A 3KE9A 5KNCD 2BGRA 4TROA 1W9MA 3A3OA 3EN0A 1JIKA 4QQ8A 2F3TA 4Z0TA 3M3DA 4HK4A 3DDZX 3MMXA 1XZEA 5AI5A 4EA8A 3PRJA 3G2NA 1BN7A 1P61B 3KQQA 4FFDA 4B9EA 3ZHYA 1BXRA 2Z6AA 4AMZA 1MABB 1NY5A 5L7WA 4LJKA 4XRGA 1ZJ4A 1QVVA 3GZTB 3T7SA 2IDMA 3RJ9A 1KJYA 4HDNA 3DE2X 2AZTA 4RAOA 2HSWA 4R8SA 1OYOA 4OTZA 4H59A 2V7WA 3AUFA 3IYLW 4H0NA 1RHRA 1ORIA 4Q1VA 3MYRA 3ECAA 4O4IB 1C5KA 2XIJA 4F3TA 2ZUUA 3AI3A 2AFHE 1CQIA 2A0UA 2BGIA 2IYUA 3H9QA 4GX5A 4FXOA 4MRVA 1S01A 1E3MA 5THXA 3RYFA 3ZIUA 2JRLA 4V0MA 1ZEJA 2M6LA 4ARAA 1HG0A 1O97C 4INOA 3F5FA 2XA9A 4DDMA 1L9KA 5HIIA 1FFXA 3UWMA 4G1VA 4DV2B 1OHHA 5A5FA 1SWWA 4F7DA 3D4OA 2FAXA 3OQIB 5FI1B 3M6XA 2QMQA 4LY0A 1C9EA 1SCQA 5AHOA 5LYYA 4DYDA 3AI7A 1K06A 2FK7A 3KNZA 2D0PB 2PUTA 4Q9JA 4QFDA 1DT5A 3GELA 2XCQA 5EP2A 3NC1C 5EQFA 1NURA 1DMSA 1R5BA 1Z6QA 1ATZA 2Q9AA 3PC3A 3HU3A 4QTXA 2OCLA 3EXHC 3HV0A 3X2EA 3A70A 3VPBA 3D0KA 4A6DA 1LDGA 4ALIA 1YQUA 3AR6A 4M8SA 1PJ8A 3A4NA 1W44A 1N6NA 4CKWA 3UKDA 2NU7B 1PT8A 4IOLA 5L3RA 4EG7A 5K3OA 2JLUA 1ZD1A 1P2UA 5AWFC 2CFOA 2BJVA 3R5TA 1N9GA 1ORRA 4J1TC 4M9QA 4W7SA 2XQVA 1FQOA 1V2GA 3NPMA 4EVQA 4BNVA 4TYYA 4F2WA 3LUKA 1AHNA 3WGVA 1SCBA 3ZE7A 4B31A 3CT6A 4DLWA 4XQCA 1XVIA 2AJ8A 1PS8A 2JFNA 4G2TA 4NJEB 2R65A 2WHEA 2R3SA 1LDEA 3BA1A 4LJAA 1OF1A 1HG1A 4R9RA 1WUYA 2YWCA 2ASEA 2HJWA 3NATA 5AVVA 5B1SA 3HP4A 3LNTA 1VLJA 2WR8A 4ENRA 4FOSA 1K8ZB 2NZJA 1LX7A 3D6VA 4BGIA 1QIFA 1OC4A 4OQ4A 5DIZA 3JWIA 3SJUA 4O2BB 3BWDD 2CNDA 1TMYA 3QW4B 3TLKA 1NX6A 2AFHA 4Q3LA 3UA3A 3U0VA 3BZBA 1YDWA 3C1UA 2AJTA 1J09A 2OGSA 1XA4A 1RYBA 2XNCA 1WXGA 2Q28A 1PYDA 4ZOLB 1M8KA 2JD0A 2C0PA 2HZBA 3N2NA 4TS4A 2PFKA 3B3FA 4MHOA 2KWIA 5I7VA 1NONA 1VTKA 4CUJA 3CNEA 4QEKA 4JGIA 3OQ6A 3SBXA 2RIPA 3VAZA 5AQ1A 3NRCA 4LJSA 3LSTA 1RI1A 1QFSA 1WZUA 1HTTA 4BNYA 1DU4A 3QV2A 5C7OO 4DF3A 1UBKS 3FOEC 1HQCA 4K87A 1DLIA 1H22A 4NK4A 3UWKA 3R24A 3GUVA 1UL1X 4GL2A 3L8YA 1F1JA 1JG3A 4PLYA 1NLFA 1E20A 3P0RA 4J2TA 1PR6A 1QOQB 5F12A 4MGYR 3AIMA 1C4KA 2GPWA 2OWDA 3EY4A 1FLVA 4X1YA 3VR4A 4EMBA 4GR9A 2YHAA 3QLUA 3A14A 1MT3A 3S70A 1Z07A 5CGZA 4E03A 3GVXA 4O1IA 4N5NA 1UPXA 2B3DA 2YVKA 1KVUA 2HRQA 3DMNA 4Z3KA 3DCNA 1BO6A 3LP8A 1SXJE 4J3JA 3W2HA 1ZRHA 2E4ZA 2VBFA 3AEYA 3MXTA 4JB3A 4N76A 3KVYA 4YJ2B 1OFTA 1ZGZA 5FEMA 1EFAA 4OK6A 3H2JA 1FDTA 2AOTA 3LUBA 4OJTA 5JAMA 2R6DA 1ZIDA 1G5TA 2IC5A 3LH5A 3VX4A 5C5IA 3HR7A 3QUSA 1URPA 3KBBA 3KELA 2REXB 4Y2RA 5EESA 3N59A 4WXHA 3IR6A 2L0XA 2CJFA 3I6BA 4RZSA 4AQDA 2G67A 4JELA 5SV2A 5LYJB 1S3IA 3FTCA 3ZX4A 2CNWD 4C2BA 1UC9A 4QECA 1TF5A 4D81A 1JEQB 1YULA 5EJFA 1P0FA 5CA0A 4EGFA 2SNIE 3E9YA 1JHRA 4M7OA 4MCIA 2FPMA 3ORRA 4DR5B 3OURA 4P6VF 2AC7A 3ZCRA 1EI9A 1YVRA 3SYNA 1CQWA 1L5HA 4BZQA 1DO8A 2NYRA 3RVNA 1XRJA 2RGEA 2YZNA 4BQQA 4DR1B 1EZZA 1C14A 4BZZA 3U60B 1VRCA 1CJCA 4CM5A 5BN3B 1VKOA 1G66A 3P2MA 3EXHB 4IMPA 2E2WA 3P9PA 2IUEA 2NSDA 4RK7A 3WMGA 3TG2A 1N5IA 1NMSA 1U7DA 1YA4A 3GAMA 2ZB3A 3INGA 3WB2A 4PC1A 1AKEA 3OO1A 1T0UA 4GMGA 1BZYA 4BKUA 4C14A 4Z4IA 1CUXA 3E7XA 1KKMA 2VYNA 3JARA 4KVFA 4JB2A 3CRZA 4HDKA 3SC3A 1NQAO 4HMPA 5KWEA 5L8VA 4FDAA 1P81A 5JSYA 1E6LA 2C5SA 1PR9A 1UBHS 2QDXA 4NEHB 1J5PA 1U3DA 3DDOA 4J75A 4JT4A 4AUNA 5IC6A 4BWFB 4E88A 1GVNB 4PICA 4IIEA 4C0WA 5L4SA 3CRMA 2HJVA 1YFZA 5EC8A 1MOZA 3D7MA 3KOMA 3ZR4B 2CVOA 3IQDB 4YFVA 1XTVA 1ONPA 1YAJA 2OP1A 1GKIA 1P2SA 2QV0A 3MT7A 4L7VA 4N1AA 2G09A 2OKGA 1AKWA 1U65A 4K0KB 3PTAA 1G9TA 1YMVA 1V9CA 2AS0A 4EMTA 1WIWA 1VRWA 4U2CA 4UU1A 3OPXA 3QBDA 4J76A 1I7LA 2I7XA 4FEAA 3ACCA 5EHXA 4PX9A 2GHIA 3VTKA 4GI5A 4H3KB 5H59A 3HN7A 3TRHA 2ZIVB 4HUQA 1F4VA 2FP4B 2H2AA 3O4VA 5K3BA 2C9ZA 3H5WA 2QL9A 3B7PA 4PXYA 5ALSA 3LBHA 4M9XA 4YUXA 1FRNA 1O97D 3D7NA 3ESBA 5GJVC 5HSGA 3ZDCA 3NXKA 4OSEA 1OLSB 3GLFE 2WMNB 1QH1A 2D5LA 3FNHA 1H1LB 5AW8A 4G56A 2JLSA 2Z8XA 4WLFA 3NYQA 1FDUA 1P4GA 3BQNB 3COPA 2P2CA 3CZQA 3G1WA 3P9CA 5EE5B 3TLEA 5L6MB 2L2QA 1AHPA 1AUXA 5D1HA 2XE6A 1IQUA 1G2QA 1UADA 4JD5A 3ENZA 5FI3A 1E3EA 2A5YB 3UWOA 1U7XA 4M38A 4GSLA 2MMCA 4ERXA 4Q1AA 4RETA 1CT9A 1P9RA 1R6TA 1GTG1 2PH1A 3SE7A 3O2JA 2IS4A 1E59A 4JJ7A 1CZLA 4J3FA 2BGTA 4ENTA 2IPNA 1LLFA 4RABA 3HMKA 5EVJA 4ZT7A 1LKZA 4AVYA 5CT6A 4DYHA 3TTVA 3HP1A 4JNKA 4B75A 5LA6A 3U49A 2LRHA 1YVUA 2XCOA 2M9MA 3BWBA 2XUHA 2PZFA 3PSAA 3MAGA 3QH4A 5E9QA 2FMXA 2G1UA 1GQRA 3CO5A 3VM6A 3Q7IA 4DQKA 2HREA 3OHSX 5F3WB 3JQ9A 4BLRA 4TWJA 5IC5A 2WYOA 2WD7B 1AO3A 2IHUA 3GRPA 4KQ9A 4DARA 3PCTA 1XWWA 3NAGA 2AD1A 2V96A 3EHDA 3KALA 4F3RA 3S8YA 2R86A 4JP2A 3GX1A 4ZQIA 5DCWA 1SHKA 3KX2A 4JWKA 1Z2EA 1SHLA 1E0JA 1UBUS 3H18A 4JLSA 3WR5A 4HB3A 1T0IA 2FEXA 4XGNA 1DC3A 1KEZA 5EFZA 2XB8A 3DLPX 3L02A 2EBWA 3QWFA 3TN7A 2N3ZA 2QRVB 1X8LA 3M4NA 2VSNA 4HGNA 1ONBA 1U8TA 4BEWA 5DRTA 2WF5A 2X0EA 2ZJ1A 3DOEA 4U7TB 4FXPA 4B6QA 4KJZA 1NL3A 2Q5OA 3WSTA 1LBEA 3E3NA 4MW2A 4KE7A 5ECDA 3EVZA 4Y6RA 3DE0X 2IW1A 2IZZA 2JFVA 2O4CA 3MWDB 4GGPA 3NP9A 3TVDA 4ENQA 2VIIA 5LQUA 2W6OA 1MT0A 3SYLA 2GLUA 1CLUA 4G86A 7ADHA 4OA8A 1A8PA 5CDYA 2BGGA 5KOJB 4XLZA 5B55A 3BBPA 5DYGA 5JAZA 4KAFA 2EP8A 4OHMA 2PJRA 5AOAA 2WIKA 4YRRA 2Z8YM 2AMJA 2QZJA 2FXIA 4TV9A 1UODA 1SAYA 2J09A 3W34A 1EXDA 1LU9A 1O54A 2P5TB 4GMFA 1SBTA 3SXJA 3QENA 4L0DA 3SMVA 3KUKA 1SA0B 1GSHA 3LUCA 4C7KA 2HBRA 1HNWB 2QRZA 1T9DA 3MJSA 1CIPA 1IDN1 3F0TA 5AIAA 3UH1A 1MJ5A 3CJTA 1DG9A 3V1UA 3SP1A 3W2EA 3BBLA 1YBVA 2V7PA 5CDGA 2NZXA 1GPLA 4FI3C 2HSEA 5JS2A 1QHNA 1OFHA 1KJIA 5F3DA 1EDEA 3BFXA 3ZQUA 3PQ4A 4GI1A 5FOWA 1TJPB 1WM1A 4RTPA 4OM8A 3GRFA 5D86A 4DIFA 2PTGA 4UFNA 1ZN8A 1EXVA 1G8KA 3UY4A 2AK2A 9ATCA 4WJKB 1QR6A 4WN3A 3NDPA 3DA8A 2PT5A 1GWNA 2GO7A 5IAJA 2WUGA 4OXQA 1GCUA 2IUYA 1YJ5A 4KYVA 4BKRA 4RZ2A 3ZJTA 3IL2A 3Q2IA 2BMJA 5FYQA 4QE3A 2BBWA 4JT2A 3DYVA 3QVGB 3H6HA 3HC7A 2CL6X 3QE2A 4ZAYA 3ZY4A 1ECPA 1R18A 3OZIA 3K0CC 1SCAA 4PNZA 1Y3CE 2JHPA 2BFDA 2JCXA 3ANXA 3CW8X 2ZTUA 3I6IA 2YWRA 5DVZA 4E31A 4LRUA 1G6HA 1NJ2A 1EWYA 2VWHA 3HKDA 4D74A 1OH8A 3WL5A 4OJKA 3SIXA 5FF9A 2P9BA 3AJAA 3VR6D 2R1ZA 4PGAA 2PKXA 4XKJA 4F1WA 5KMGB 3V8PA 1OB5A 1X9HA 3O8LA 1EESA 4LF7B 3ZY3A 2HJRA 4DANA 2NZYA 2R79A 1KR2A 3EVNA 3GEHA 3HACA 5DW3A 4EPRA 2FW7A 2CE7A 3LO5A 1W87A 5FCDA 4YCMA 2QSZA 2P5YA 1JW9B 3VDXA 1SCUB 1EDBA 2GF0A 1U9JA 2I87A 1RXYA 3JPYA 1ST3A 2D0IA 4BJ3A 3UNXA 4LJRA 3ZKWB 4CEIB 2VZ0A 1R37A 5AVKA 3GDWA 1GAQA 1EM8A 5BNZA 1UJCA 1NU6A 1DLJA 4COOA 1FRZA 1IN1A 1X1BA 1UQTA 1X8JA 2PV0A 3EEYA 1V3QE 1P31A 2BV3A 1JN0A 5AI4A 1BOFA 2QTRA 3GLRA 1R50A 4YT8A 3UV3A 4V3BA 4BN4A 2D7CA 4OLJA 3D3KA 2BTOA 2JRCA 1U1DA 3PPVA 2I2AA 1WDMA 2J0VA 2OQIA 4WE3A 2FZWA 1A1VA 1UINA 1MJHA 2H4HA 1O96B 4PLHA 3KSRA 5HQJA 1P8JA 3S2IA 4CTKA 1E8DA 5J2UF 1XHFA 2IYXA 4N3AA 4AN0A 4D8TA 1RRPA 2FPLA 1K3TA 2G17A 1SHZA 3RRMA 3IULA 4HD8A 1S9DA 3JQCA 4UBJA 3R2JA 3RHTA 5TEVA 1OZFA 2BEVA 2KX7A 3NTOA 5B1HA 2RARA 4WIAA 3QEMA 3HJUA 3ZZ1A 3PWKA 1B3BA 3WIEA 4D79A 4QOSA 3EDCA 3PVSA 4NBVA 2PUEA 2VJKA 3KAQA 3M5WA 3JY6A 3HR4A 3OCXA 1AKUA 3BK1A 3FRIA 2EERA 4KB5A 2R6ZA 3PFGA 1V7CA 4L6CA 3O5AA 2Y0DA 3R8CA 1ENPA 1YH3A 4YMVA 2YMPA 2AF3C 3G8AA 5SZKB 3X2SA 3DDUA 4R84A 5CBPA 3WRYA 1Z8DA 2O50A 5AW2A 4C4ZA 1DWOA 2FN9A 4X71A 1QK4A 4XH9B 1FYFA 2B8TA 4DA7A 1QIHA 4R16A 3AHCA 3KJZA 2RJOA 2BJHA 5LZ4A 4G5YA 2ZT5A 1SG0A 3G9TA 4F9FA 4OHOA 4WOCA 3W5DA 3BG5A 1RBZA 2PX6A 1Q1NA 1WCIB 2NUTB 4C1NA 1U2ZA 2WBLC 3EULA 4CNQA 1J4AA 1MJGM 3I3OA 4R2LA 4P7FA 1NF3A 2OHXA 2LIPA 4AJPA 4D92A 2WF7A 4W9RA 2QMZA 2HTFA 3PG5A 1N34B 2XV1A 4FSHA 3ZU6A 2HLNA 1UBJS 3RC1A 2ID4A 5CCEA 2AVDA 3GLTA 3DD1A 3P2YA 4ZTBA 2MIIA 3I4LA 4P3KA 3W7VA 1O6BA 1M3SA 5JZOA 2J8ZA 1V37A 1Y3AA 1U8XX 3FOBA 4NULA 1E5LA 2E4WA 4YMTA 3OESA 3IPCA 3O3CA 1I4LD 4AYXA 2Y8EA 3QIAA 1QC5A 1JLSA 1BS2A 2RBKA 2P8JA 3PNQA 3PUZA 1WSBA 2F17A 2J9GA 2VOEA 4IDDA 1QRAA 1SULA 2Q6KA 4LUCA 3DEAA 1L8AA 3BOSA 3GFTA 4IHKA 3UPDA 3AJRA 3VHLB 5JNRA 4RA9B 4RM2A 1NVVQ 4I2NA 5E7JA 2FW8A 1SC9A 3HVJA 3RRBA 2JS7A 2VDNB 1VL8A 3C3PA 4NU5A 4CV1A 4ZAVA 3BMQA 1Q16A 4R8MA 2V7XA 3RVKA 1YE3A 3R6TA 3W5UA 3ZDEA 4YRDA 5E3IA 4K6FA 1ZRNA 3NYWA 1A7KA 1PFVA 4E3WA 1I1QB 2XMQA 3ZHBA 4QDOA 2UZ1A 2P6PA 3DHEA 4NMMA 1L7OA 2UU9B 4D26A 5HOQA 1XX6A 1IH8A 3KLPX 4GT1A 4JCCA 1DC8A 4ER0A 4IJ5A 1GG9A 3ERCA 2I22A 2H7YA 1QHSA 1SD5A 1XTRA 1UMBA 1ZRMA 2ZKIA 4P3XA 3JRXA 4BZWA 1KI6B 3BH0A 2RB4A 4BIIA 1W73A 1WF3A 2ZULA 5GGXA 1NUSA 3OP4A 4MVJG 4EEZA 4MOWA 4DPMA 2OY0A 2J45A 3KDAA 4A0GA 1XO1A 3AYZB 4X8MA 3LY9A 4EJSC 1EFPA 3TR6A 3NALA 1JQBA 1KFBB 4HL6A 4YRTA 1J0CA 1L5GB 1I2ZA 1UPCA 3QTTA 4HAZA 1EDZA 4ZZ2A 4I36A 3L7CA 3TJZA 5I9NA 2WU4A 3F6CA 2W2MA 4EKNB 1S8FA 1TM3E 3R5SA 4CLEA 3V9PA 1XHLA 1UP7A 2YHIB 3GLVA 3P4XA 2X4GA 3C3EA 4X44A 1X77A 1PQWA 4CL8A 1MO5A 2V03A 2C7OA 4AIIA 2QAGB 2YJ5A 4RPKA 4GECA 4DC0A 3DZIA 4R05A 3HO8A 3NW9A 1RWKA 2EZ9A 3HZZA 4WNCA 3T7JA 3ZIAD 4AFNA 3Q0EA 1S2OA 4ASUA 5JSQA 1EE1A 3PD7A 4JVMA 3GQVA 4RD0A 2DE0X 5EE1A 3PR1A 2FW6A 4EWLA 1GZ7A 2AN4A 3AHJA 5ER9A 4Z5XA 5HRAA 2R00A 1TVCA 4V24A 3QVSA 2VK1A 3P71T 3ZYZA 3O82A 4F71A 4WERA 4FMDB 4PF1A 3KKQA 3P9XA 4XJVA 1B16A 1NSTA 1CUAA 1IJBA 3PF9A 4XLTA 1E9CA 1Y8CA 3DVSX 1NQOA 3BL8A 1IZ9A 2A1TR 3W3ZB 4KO8A 5CFPA 2YFQA 4E14A 1FNCA 1WPRA 4DNPA 3A2MA 3RGWS 3V1YA 8ATCA 2ZSFA 2DPYA 5BMVB 2FZ5A 4YRPA 2YIJA 1YCFA 1S8OA 3A1VA 3NBYC 3R0XA 1IOLA 5B1EA 2ZDGA 2VYCA 3QEOA 1WZEA 4CIDA 1JXMA 1QCZA 1IXKA 3HY6A 4RHXA 4IDBA 1KC1A 1MW9X 2H1SA 1SIBE 2ZJBA 1FTNA 1KEWA 1T5TA 5KB3A 4ZVRA 4AX4A 4BUJA 3SQMA 1Y1RA 2CL0X 3R7AA 4JHLA 5DLYA 3FUCA 5HRCA 1NIPA 4D3YA 3GCZA 2CXXA 2OFXA 4JLVA 1Z75A 2J6HA 5JVDB 2ZYUX 1XDGA