2IYRA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
164
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
total genus 62
structure length 164
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyrA00
2QPOA 3QY0A 1E2EA 1NG9A 3THYA 5CB8A 5FL7D 4YDSA 5CB6A 3A58B 3V00A 3RLFA 5EP2A 1XTJA 1NVUQ 4OK3A 2WKQA 2VHQA 1XD2A 1U81A 3B1ZA 3P26A 4HLUC 4OJKA 4F4IA 4Z51A 4LUCA 1YR9A 2NO6A 1UKEA 1KJWA 2QRZA 1XEXA 4UNQA 4B44A 2OFOA 4HI0E 3GLFA 1CJKC 2ZITA 3NH9A 2IW3A 4ACBA 5JJLA 4ZDKA 1Z6GA 5KNBA 4Q21A 3GEIA 2H17A 4MYHA 4XSGA 1EXMA 1WB9A 2P6RA 3VNVA 2Q3MA 4DLUA 1R0YA 3HR7A 2X1VA 2OT3B 2QU8A 3SHFA 3UXMA 4WXPA 5JZVA 5KHOC 1F48A 1W1WA 3B85A 1CR1A 5GJWC 1WRBA 4URWR 4QGHA 5KTYA 2BMFA 1JEDA 1GVNB 1Q44A 3UPUA 3FHTA 3QI2A 3RC3A 2VRWA 5CIQA 4HZUA 1JR3A 3BH7A 3IHWA 4UXJA 2XEXA 4LYHA 2EWVA 4FINA 4A9AA 3PUWA 4DDWA 4AWXA 3VKGA 2ZS8A 4G5RA 2CHGA 2O8FA 3PUVA 1E1QA 1EK0A 1OW3B 1P73A 2XTMA 3KXKA 3C5HA 1NKSA 2KJQA 2GAOA 3FFAA 3L0IB 1IN5A 2VP2A 2J7PD 5CDFA 4D0LB 3H0KA 3B5JA 4MH0R 3W6NA 3B6EA 1KYIA 1P62B 1VHTA 3VQTA 1L4UA 4JYBA 1E2LA 5CITA 2XNDA 1GNRA 3AKDA 4MYTA 4UXIA 3DZ8A 1JR3E 3D6TB 3CZQA 3K0AA 4M1TA 5CK5A 4P4SA 4P32A 4LYJA 1NJFA 5H68A 3RRYA 2ODBA 2WAXA 5KSYA 2F9LA 5EUMA 4D6PA 4RZ3A 2GXSA 2WAYA 4PPGA 4B34A 2ZR9A 3ZS9A 5L3QA 1E1RD 2R62A 5CJ2A 4BZXA 1CJMA 4JVLA 1ZIPA 5ANRB 2HV8A 4CEHA 3T61A 1SVLA 1XXHB 1P3JA 1DS6A 4BLRA 4AD8A 1NMXA 1GTVA 2NZ8A 5E7IA 1YR7A 4LWZA 3C7KA 1PUJA 2YKGA 5KNDA 2CLCX 3J81k 4QC2A 4DT1A 5FBVB 2CK3A 2D74A 5GVSA 4ESHA 3NTUA 1RZ3A 4KITB 3OE7D 2ZYUX 1D9XA 3WNBA 2GETA 3WP1B 4OYHA 1MO6A 3QKSB 4BFUA 2CL7X 2ZETA 3TW4A 4C0QC 1QDEA 4PAQA 1IY0A 3QOFA 1GIAA 2J59A 2WWHA 1I2MA 3FKSA 2N42A 3VX3A 1ZD1A 3AV0B 1YE8A 4NYJQ 2BMEA 4JSYA 3WXMA 4OQXA 3KJHA 4LJ6A 1LY1A 3LXRA 1YHNA 2QP3A 4NYIR 5FTKA 1T4GA 1W0KA 2A5GA 2A2ZA 2I1QA 1BMFA 1Z0JA 4CF7A 1A5TA 2JJ1D 4BFYA 1XPUA 4Q1BA 4FW9A 4Q19A 3F5FA 1TEXA 4TL7A 3BFKA 4N1AA 3AEZA 3Q8XB 1DELA 3QKTA 4FMDB 4KLZA 2VP0A 4Z1MA 3OEED 1CRQA 4M4SA 3C14C 4D80A 1EX7A 4C0SA 1XEWX 2A5JA 2FPLA 2JLSA 1HUQA 1R2QA 2RKOA 1IN7A 2W0MA 4TZ6A 2AFHE 2NZJA 5E95A 3K0AB 4Q01A 2FZ4A 4M9QA 2F1HA 1KO5A 3OESA 2ZXUA 2J0QA 4KXFB 1S1CA 2VQSA 4KCGA 3KKPA 2ANBA 4GZLA 3KXLA 3THXB 5C4GB 1LTQA 2ZUCA 3AF4A 1XF9A 5DI3B 1SXJC 3KFXA 4ITRC 2EFGA 2RHMA 1GFIA 3N5CA 1Z0KA 1KSFX 4LHXA 4BUJA 2C98A 2VL7A 2BMJA 3TAUA 1WA5A 1II8B 1Z6AA 1KY2A 1QHIA 3NHBA 5GJBA 3CNNA 1J2JA 4EJSA 3KQNA 1R6BX 4Q48A 2NO7A 1IJEA 2VPPA 1W44A 3SFVA 3PUXA 4IOJA 2VP6A 3B1WA 4EPYA 4HAXA 4MGKR 4DUGD 1N0WA 2QMEA 4B2LA 1HTWA 2ZI5A 1D2NA 1DVRA 2B92A 2ZPTX 4NYIQ 3FDIA 3TE6A 1ZUNB 1Z6YA 1D6JA 1I2DA 2R6FA 2KSQA 4DSOA 1YZTA 4PPFA 3OEHA 4BGDA 3MUFA 3ICEA 2ZTSA 4GZMA 4MRPA 1JAIA 2R6AA 4Q7KA 5SZIA 1H8HD 4W5WA 2OFXA 2ZYTX 4WOPA 3TH5A 3GLHB 4X8LA 4CT4B 2ASEA 3KX2A 2FPMA 4FIDA 4UKDA 2OAQ1 2LWIA 2BBWA 4QGFA 5TXGA 1I4DD 4Z8YA 721PA 1Q3TA 3W90A 2QM8A 5EZ6B 2BJVA 2ZR0A 3LAWA 2O8CA 2IK8A 3Q85A 1G3MA 2E87A 5JSZB 4XVRA 3I4LA 4EAQA 1RC8A 2FG5A 2GJKA 2YYZA 1G3QA 2GXQA 4BFWA 4QHSA 2WWYA 3REGA 5D3QA 4HAWA 2Z43A 3QPWA 2V4ZA 4U02A 3U7HB 2MSCB 2UVQA 5E7JA 1E2QA 2QGZA 2C78A 4H1UA 3NDPA 4RVCA 5GJCA 5HTKA 1Z0DA 1FPMA 5HR5A 2W2VA 1OIWA 2X2EA 2ZROA 1TEVA 3MFYA 2DR3A 3AVXA 1XXHA 2RB4A 1Q22A 2ZYWX 4I1UA 1T0HB 3DHWC 4RD4A 4DB2A 3RS7A 4DDVA 2OM2A 4O0MA 4RCYA 2AK2A 1U90A 3QF4B 5FTMA 1AKYA 1PLKA 2RGDA 4LK2A 1MH1A 1SZPA 1PUIA 5EE0A 4LPKA 6Q21A 2AD1A 2PL3A 4EJSB 2WJYA 3CF0A 2IS4A 2FFAA 3LRPA 4KFRA 1NSTA 1E69A 1KI4A 4Q1EA 5KUTA 3DPUA 2O8DB 4CRWB 2B7BA 1NVVQ 5C4MA 3OZXA 3REFA 2OCAA 3PV0A 1M8PA 1OSNA 2X19A 1QHXA 1XWIA 4V0OA 1VCOA 2J0UA 3MWKA 2WV9A 3OE7A 5JS8A 3KDSE 2JGNA 1XX6A 4V0LA 1NLFA 1NNEA 3WHKA 4PC6A 4AIIA 3CRVA 2FJUA 2FA9A 4HAVA 3P4XA 3HYRA 2J5XA 3ZQJA 4A2WA 1SVSA 3CPJB 3P20A 2XB4A 4B73A 4C0JA 1W36D 3TSOA 4B6EA 2GRJA 1T91A 1S96A 1TUIA 3QBVA 4KI0A 4W5HA 3AUXA 4L9WA 3AKYA 2XOKA 1P9NA 2QM7A 4GMXA 2I3BA 4YXWA 1RRPA 3ZZTA 1SVIA 2JJ1A 4C0LA 5D3MA 1R5NA 4QHTA 2HXYA 1E2GA 3TKLA 1DO2A 1KI2A 3EIHA 3QXHA 3SJCA 2D62A 3QVVA 2IYLD 2EVWX 1J70A 4HEJA 2REBA 2W6ID 4G3XA 3VR5A 4DLXA 4C30A 1E4VA 2ORVA 4PC7A 5FBQB 3QENA 3U44B 1KDPA 3K09A 1S0UA 3NBZC 5BN4A 3D31A 4JVMA 4HB4A 3VU9A 4EPXA 1E0SA 3QXCA 4LJYA 4PR0A 1Z0AA 2XNSA 1S8FA 1BOFA 2NPIA 2C95A 4KHZA 1CKEA 4TLDA 1LB1B 3TRFA 1X86B 1ANKA 1NMZA 3SEAA 3GLFE 2IHBA 4I1SA 2ZU0C 3D3QA 2QL6A 5KU1A 2BOVA 5G41A 3U3MA 2H7VA 3K0FB 4RFVA 3SJAA 2Z4SA 2ORIA 2Q9BA 3TIFA 1LS1A 2WPDA 1SHZA 4JS0A 4S35A 1P2VA 1ZM9A 2OCPA 1Z29A 3A1TA 5E3HA 5FPKA 3TNFA 1UKYA 2CNWA 2QE7A 3EZFA 3VU9B 4O2RA 1DADA 2DY1A 4BLPA 1JB1A 2PX0A 4LCBA 1R0ZA 4DUGA 1XU4A 3AP1A 4YMTA 2CLDX 4US1R 1AGPA 1GKUB 3L0OA 5IK2D 2HDNB 3ZVMA 2OLJA 2O8BA 3RABA 3LBHA 3U5ZB 2KE5A 2RGGA 1WCV1 3K0FA 4KSBA 3IO3A 1AM4D 2G77B 2DPXA 4EKDA 1WBBA 4QBFA 1Q57A 3MJRA 3RVBA 1RJ9B 1Z5ZA 3VR3A 4PZZA 2Q9CA 5HE9A 4O2LA 2ZSAA 5H1YA 5LPNA 3RRNA 1UEJA 2REOA 4OQMA 3KQLA 4NTZA 4Y0AA 1IJFA 1AK2A 2Q21A 1ZINA 3RSOA 1I4LD 1H8HA 1WXQA 3ZDQA 2KB0A 2ONJA 1SVWA 3FHOA 3M4YA 3N2EA 1TPZA 2JLUA 4DBLC 1YR8A 2ZRBA 2QP9X 5CLLA 4TYNA 1NKTA 4BEBA 2JLXA 3V4RA 1WBDA 5J4LA 4QNMA 4A15A 3PJRA 2ANCA 4AK9A 4Q9JA 3SU8A 5K8LA 1R5BA 1YZKA 3B8HA 3TK1A 1G3UA 2N1BA 3U3JA 3U6BA 2YNMA 2G0TA 1SXJB 2FV8A 1IONA 1AZSC 3O8BA 1NVXQ 3CO5A 4F91B 2D3WA 1M34E 2P5SA 3CBQA 2YINC 1KDOA 2F43A 3FMIA 4D81A 1YQTA 1RE0A 1GRRA 2NPFA 2ZI9A 2NO9A 5GADl 2A5FA 4BQSA 1FW6A 3VMFA 3SC3A 2XTZA 3BB1A 2FE4A 2C03A 1NRJB 621PA 2J9RA 1PV4A 1XMJA 5AJVB 4BLTA 4AY2A 4ON9A 3RS4A 3GJ6A 4C9BA 4PAOA 1AA9A 4I99A 3LQQA 3IIMA 1II9A 4AKIA 5J4VA 2QAGB 3U61B 1XD2B 5LB4A 2HT1A 3TQCA 3GLHE 1GITA 1J7KA 3I72A 1W36C 3HU2A 5JRJA 5JHHB 3DKPA 2FX3A 3SQWA 5C46F 3U2QA 3AQ4A 3LW7A 4LY6A 5EXPA 5L8VA 1OB5A 2CL6X 1F2UA 4JLDA 3FWYA 3KJGA 2IHYA 4DZZA 1OKKD 1ZNWA 2OXRA 4AKGA 3R7WA 2Z6VA 2GZHA 4MRRA 4RD2A 2QPTA 3UMSA 4B2PA 3CONA 3K09C 2D4HA 1TADA 2IEYA 4LJ5A 2XGJA 5FTNA 5J47A 3TVDA 3ICQB 2CE7A 4DCVA 1IN6A 1BYUA 3PIRA 3GLHA 2KBEA 2IF0A 2PT7A 2NIPA 1U8AA 4M8NE 4NBSA 1G17A 2BDTA 2ECKA 2BBOA 2HCJB 1XD9A 2NQ2C 3ZJYA 5JEDA 1OB2A 4TMXA 5FPTA 2DFNA 5L3SA 2BCGY 3HYTA 3OAAD 5HZHA 2H18A 1DAGA 2BVNA 3RAPR 4BRUA 1G6HA 1NL3A 1OF1A 1SVKA 5G3YA 4KVAA 1A82A 1ZIOA 2GEVA 3GLIA 1ZC4A 1G8YA 4HSEA 3CX7A 4EPRA 2A78A 5TARA 1QVAA 2IC5A 2XXAB 5F9FA 3EG5A 2HUPA 3QSYA 1U2RA 1VDZA 3UWKA 1CULC 1N0VC 3VAAA 4RZ2A 1YRAA 3DOFA 1W4CA 5FH9A 4YLGA 3WYGA 1OH5A 1E2FA 4MQBA 2GXAA 3B2EA 1F60A 2OG2A 3I8XA 2NMVA 1KMHA 4G5QA 2CXXA 3BRWD 3W9YA 2O8DA 1WE2A 3B1VA 4AYTA 3B82A 1W7AA 2HF8A 2FEOA 3GFPA 4PC2A 3TVTA 5AUPB 2QAJA 5SZKB 5B64A 1Q3HA 3AKEA 2ZUDA 4TTRA 2WPDD 1XTIA 4B33A 2IL1A 5DGXA 1N6PA 4RFSA 3SR0A 2J0VA 4HUQB 1LF5A 5JWOA 4BFXA 2OFWA 2B21A 2QE7D 2GEDA 4KAXA 2IUSA 4WZ6A 2WICA 4QM6A 4IRUB 4FI3C 3GFOA 5EXSA 3SZRA 3KQKA 1JPNA 3SOPA 1IXRC 1YR6A 4HATA 1CRPA 3V9PA 1TMKA 1YZQA 1HT2E 1OV4A 4IDOA 5FR1A 4Q4AB 4DLVA 3BB3A 1VG1A 3HWSA 3UG7A 2J41A 4XWKA 1H8EA 2ZJ5A 1HE1C 5IK2A 1J90A 4PPQA 2P5TB 4D4MA 1IAQA 4R71A 4LC1A 5F9HA 3FTQA 3E5HA 4AURA 4QM7A 1QG4A 1AKEA 1VKJA 1LW7A 2ZS9A 3OIUA 3P32A 4ZO4A 3SYNA 4XD7A 3FMFA 1S9HA 3U7FB 2O8FB 1OFHA 2AN9A 4Z54A 2AX4A 1GL9B 2GEUA 1QF9A 4LHWA 4GPTA 2OSBA 2MMCA 1X8LA 1XCMA 4TLBA 1R0WA 2W0SA 1OLOA 4WAUA 2OV2A 4URZR 4YMUA 3ECCA 3TUZC 4NU0A 1CJVC 2V55B 1KAGA 1C9KA 5FOUA 3QUSA 4X8OA 1KJZA 1MRSA 2B7CA 2OBMA 1ZYUA 4NYMQ 1TQDA 4N0EA 4Q5IA 1G7CA 2FEMA 3MWYW 4OHWA 4A8JB 2VA8A 3MJHA 1KY3A 1ZCBA 4RJLA 2AKAB 3F3YA 2YC4C 3BS4A 1EFTA 2JIZD 2NG1A 3EWAA 2BJWA 5AWFC 3CZPA 3RYTC 2B6HA 4HZIA 2O0JA 1OFIA 4M22A 4D0NA 2ZREA 1SXJD 2OILA 3AVVA 2GZAA 1EGAA 2P2LA 3IPXA 5L3QB 4X8MA 1M7GA 3H2YA 1ZP6A 2DWPA 3LQRA 2MSEB 4LBVA 2YVUA 4LJAA 3KZ1E 2IWRA 3EPHA 2JDIA 3SN6A 1W0JA 4IKEA 2WKRA 3AVTA 2HCBA 5TV2A 2FN4A 4J0QA 2FGKA 3SNHA 3U7EB 1QZXA 4ZI2A 4UNRA 4QGAA 1D8TA 3KQHA 4NPHA 5JFGA 5JLJA 2R6CA 1JJVA 3EC1A 5AUQA 4L9SA 3T5DA 4HDCA 2VBCA 1P4SA 3QEOA 5IRCD 1E79D 1EWQA 1V43A 4IVRA 1NG1A 3A1VA 4W9MC 4NHOA 3FFBA 5EXXA 1OKKA 4B3GA 3ZYCA 4LBWA 1K5DA 4JLPA 4OK5A 2CBZA 3BFVA 4FMCF 3GJ8A 2GHIA 1XPOA 1N5IA 1W5TA 1KSGA 2ZJAA 4MGZR 5FOSA 1OXVA 4MGYR 4RY2A 4QBIA 3FYHA 5J4HA 2AK3A 1VG9B 1KMQA 4L5BA 2GA8A 3ZVLA 4OBEA 3ONWA 2O8EA 4TL9A 5DIFA 4EQ6B 1E6CA 2J1LA 2QQ0A 2OCYC 2OESA 5CK4A 3TUJC 1US8A 3OAAA 1FL9A 1FUKA 1ZM3A 4Q9KA 3A4NA 4XWAA 3I32A 3FPAA 3NH6A 1IN8A 4QOSA 2DYKA 1U99A 3GLIE 1AS3A 2GILA 3GLGE 2RCNA 2BM1A 1X1SA 4TSFD 1Z6TA 3QKSA 3KUDA 221PA 1D9ZA 1TAGA 2VTKA 4GOKA 3KJIA 3TW8B 2CCJA 2JLWA 2FSIA 5DLQC 4IXMA 3W3AA 5FI1B 1NVVR 3KJEA 1I4TD 3U3OA 2PX3A 3W6PA 2VIIA 1OXSC 2QP4A 5AJXA 4B3FX 2B8TA 5BXQC 4M1OA 2O5VA 4ZCIA 5KDLA 5EUQB 1GUAA 3T1OA 2ZI6A 3TR5A 4YMSA 1G6OA 4G5SA 3LX8A 3GJ3A 1E9RA 2PJRA 4FXPA 3CIOA 1U9IC 1VCMA 2GF0A 3AGQA 3FE2A 4AG6A 1DG3A 2VF7A 3V4FA 5FPYA 1C1YA 4OKSA 3PEUA 3SBEA 1XPRA 2DWOA 4WA7A 4GI7A 2A5YB 2ZS7A 5DSZA 3ASZA 4Q4AA 4UXHA 3ADCA 1QHGA 1Z28A 2QUZA 4JLMA 4TQ9A 4B3BA 1NJGA 3AVPA 5ELXA 5CYPA 5HKKA 3C4JA 3NC1C 1KHTA 3E1SA 3CRW1 2PCLA 3KXIA 4P0TA 1H8ED 4QGGA 2RGAA 2BBTA 5C1BA 3HPQA 1NIJA 1GRQA 2V1XA 3A37A 1ZVQA 1FNNA 2V54A 3FKQA 4FWTA 2FZLA 4PPNA 2G88A 4YC7A 1OFTA 3EARA 1P60A 4XD7D 2OUKA 3Q72A 2CVHA 2F6RA 2XX3A 5FOVA 4LYFA 3TAHA 4V0KA 1QRAA 1ZNXA 2JLQA 1GRNA 2EWWA 4GOJA 4U5XA 3TUIC 2GK6A 1YZNA 3THWA 1AN0A 5HCNA 4DIEA 4TYQA 2WWGA 3X1ZA 4DKXA 1FZQA 3P4YA 4JLKA 2EFDB 4A0GA 4EDHA 4C2UA 2WJGA 2G9NA 3EPKA 3HU1A 3DMNA 1UBEA 2TMKA 3OHMA 4K81B 5LB2A 1HEIA 1FTNA 5FOWA 2JCSA 3GLIB 2PCJA 4LV6A 4M1YA 1RRFA 4KFTA 4LV5B 3SE0A 4A0RA 5E4FA 3AP3A 1UDXA 3U7GA 1R7RA 1G4AE 2PZFA 2ZI7A 2CCGA 1XNJA 2C9OA 1E9FA 3QXXA 4KODA 3LLUA 4MRNA 1Y63A 3O8DA 2AKYA 2V1UA 4EFLA 2IUUA 1W5SA 4PO8A 1SXJA 4M21A 3W8NA 4Y0VA 1E0KA 4HLUA 4LSGA 3S1AB 2P0EA 2YOHA 2ZRJA 4YONB 5KDOA 2W00A 2DFTA 1AS0A 2JEOA 4PZLA 4UQOA 2LCFA 1IXZA 1OHHD 3RNLA 5DYGA 1GZSA 2YZ2A 3TMKA 2VHJA 4PFSA 3R7WB 3F8TA 1U8ZA 5JJIA 1DARA 1PJRA 3R9IA 2QG6A 3VR2A 2R8RA 4A0HA 3SS8A 2E9SA 2NGRA 2FSFA 3ZZ0A 3RC8A 1Z22A 2ZJBA 1AGRA 3RS0A 4IVPA 1AQYA 1CR2A 1FNMA 2HJGA 1G5PA 4KBFA 2BV3A 2IYXA 4I81A 4ZDIA 3I92A 3NWJA 4NONA 1Q0UA 4C0KA 4XWOA 5JEEA 4IEEA 2WTUA 1G21E 2F1JA 4Q03A 4RCZA 1P9RA 4B48A 4G5OA 3H86A 3U3KA 1QHYA 3X1WA 4Z8XA 2D2EA 4CZ2A 3VFDA 2WMOB 3EZ7A 2A9KA 3UKDA 1W4RA 3QQ5A 1U0JA 3BERA 3EASA 1E9DA 1Z63A 4DLRA 2CVFA 4N3NA 4IXNA 3NHAA 3NVAA 4JLJA 5FBLB 1KI6A 421PA 1N6RA 2FSGA 3UG6A 2JLZA 5AUNB 1FMJA 2CE2X 3NC0C 2WIBA 1G8HA 2FMXA 5DO9A 1KJYA 2H57A 1KO8A 4DRZA 4KJZA 1N6IA 2EQBA 5CM8B 4G5GA 4Q66C 1SVMA 2QN6A 2GJ8A 4PHGA 4GRAA 4Q4HA 5FPSA 1TF2A 3WMFA 3WBJA 4Q4JA 3QIAA 2BEKA 4BZPA 2VP5A 3BXZA 2J0SA 1JBKA 2ZRNA 2CK3D 4D26A 1UJ2A 3BAFA 2W83A 1OH6A 1P61B 4DC9A 3CR8A 3C41J 3VTKA 5UKDA 4BFTA 2ZE6A 2ZRPA 1GG2A 3I61A 3GLGA 5LD2B 3ZVNA 3QG5A 2D06A 2PZGA 1XMIA 3FKSD 2WBLC 3IIJA 1EWRA 4M9XA 4DCNA 1KK2A 2LKCA 4LBZA 3ZD7A 1VG8A 4IDHA 3R9WA 4LJ9A 3D7MA 2QENA 3RRMA 4ZPXA 3O47A 2ZRIA 1C4OA 3RDPA 2X77A 4UNNA 3T5GA 5DISB 2GVZC 3HP1A 4AG5A 4OI0A 4GL2A 2IF2A 1UBFA 1IN4A 3L43A 3BK7A 1XMVA 3UANA 1E2KA 1UEIA 2B8WA 3CPHA 3CWQA 1B23P 1JQJC 3WNCA 1CP2A 5LD2C 3PCRB 4W7SA 1TF5A 5FPHA 4URXR 4QJ4A 1RW4A 1AIPA 1CLUA 4RD0A 4GSYA 5FUYA 1KNQA 4CT5A 5HPYB 1MR3F 4ASUD 4ZKEA 4HDQB 3IQWA 3N2IA 4V03A 5DH9A 3Q5DA 4LHVA 3I5XA 2YHSA 4I4LA 4JLAA 1E9AA 1YU9A 2ZSBA 1KGDA 5IF9A 1G7SA 4P31A 3K9HA 4MITA 4DCTA 4JL5A 1P5ZB 4TZ0A 3NIBA 3SI7A 2F7SA 1DAMA 4XOIA 3H1TA 1AJEA 4B76A 5JECA 4JBYA 2ZJ8A 1E2DA 4PO9A 4F4JA 1AZTA 1HY3A 4NCIA 4OI2A 4FN5A 4OHYA 3LVQE 2F3RA 4OK6A 4L8GA 2IYWA 1G64A 2IYRA 3Q5EA 3T12A 1SVOA 1KO1A 1PLLA 3LY5A 3GEHA 4IVQA 4Q18A 1G4UR 4RZXA 1ZU5A 3K0EA 4MDEA 4URVR 3OIYA 4ZDJA 2CCKA 1Q12A 2IXFA 2YJTD 2C77A 4FMDF 4GNKA 1U8YA 1T3HA 4G0NA 1HQYE 1XMSA 3CWZA 2ZAOA 2JA1A 5D3MB 3EC2A 1NMYA 2ZRHA 2QT0A 1LNZA 1CF4A 2ZI3A 2VSOA 3K1JA 2QQEA 3ZZUA 3GJ0A 3M1IA 4PTLA 2RAPA 4B2IA 4FD2A 1XD8A 2BIFA 2XSZA 1HE8B 5DI9A 4JL6A 1LFDB 2G0NA 2NO1A 4JKIA 4S2EA 1ZJ6A 1U0LA 3CNLA 4C7OA 3UK6A 1VYVA 3WP0A 3LA6A 2QZ4A 1KI1A 1KAOA 4TMTA 4HYYA 4JIMA 2EYQA 4WIAA 3T06B 4LZZA 2IEZA 5TDHA 4YMWA 4EJSC 2FDCA 2FFBA 3ZIAD 4M1WA 4TYWA 3UWOA 4TL6A 3L0SA 1DEKA 2C96A 4BLSA 1A2BA 1US8B 3LBIA 2WIAA 5BYKA 3AM1A 1ZM2A 2F3TA 1H65A 3SQXA 5F3WB 3ADDA 1XJ0A 121PA 2FFQA 1CEEA 4RD3A 4K46A 1KNXA 1CBUA 4B32A 5AJWA 2XJ9A 1T3LA 1D2EA 3C5CA 1P75A 2J46A 2JLRA 5IDVA 2PEYA 2O8EB 1XEWY 2HXSA 3C15C 1UFQA 2HLDD 1F3OA 3X1DA 2MSDB 1K5GA 1KI8A 2NTYC 4Q02A 2ERYA 2RGEA 4RD1A 3W8RA 4DEXA 1T6NA 3CRRA 4D82A 3I73A 3JZAA 4E09A 1FFHA 4CEIA 1G19A 2IXEA 3LH5A 4A92A 2KBFA 2HJVA 4GP6A 2H8KA 5SZJA 3U3RA 1E2HA 2WVJA 3ETLA 2XTNA 1FUUA 3IQXA 2ZEJA 3MCAA 2DBYA 4LRWA 4PHTA 1II8A 5C2JB 3LVRE 1HURA 5EP4A 2YOFA 4JBWA 1E2NA 3GFTA 3OIWA 5L3VA 4HUTA 2H5EA 4PZYA 1ZUHA 3LNCA 4HLQB 4LPSA 3SFZA 1E4YA 5BN5A 4C0BA 3ADBA 1P7CA 2W2TA 3AF2A 3SDZA 3BJIC 2CL0X 3BE4A 1ZD8A 2J45A 4NP6A 4PAMA 3LD9A 5EP1A 1VG0B 2PMKA 1VCIA 4UJ5A 1KDTA 4OJQA 1HT1E 4XVQA 4V0MA 2UZ3A 4NZYA 4GMDA 4ARZB 4BFVA 1TL7C 5FR2A 1TF7A 1Y3AA 4I1VA 1JQLB 3AH8A 3WMGA 1J8MF 2DCUA 4PHHA 2IS6A 1KSJA 1A4RA 4GBMA 3AB3A 2W6JD 3PUZA 4JJKA 3UMRA 2V8OA 2JASA 4BRWA 2QROA 1Z2CA 3KUCA 2QSYA 4WW0A 3EIQA 1X3SA 2ZUBA 3NKVA 4DB4A 2V9PA 4EUNA 5FL3A 5DN6A 1Z06A 3BOSA 4JL8A 4B6FA 2IX3A 2ZJOA 4TT3D 4EQ6A 1UKZA 3PEVA 2W6IA 3E2IA 1YVDA 1P2TA 4JJZA 2J3EA 1GM5A 1GNQA 1OIXA 3SJZA 2YWEA 1U94A 1COWD 4IDQA 4ARZA 2ZQ5A 1BIFA 3UIEA 2C04A 1F5NA 1XTSA 3KKQA 4NMMA 3R9XA 3PENA 1CR0A 3T15A 4TLCA 4ZI3A 3ZGXA 2CHVA 2FH5B 3NBFA 1T3SA 2JLYA 2WSMA 5JMTA 1ZUIA 1CXZA 1YZLA 3Q3JB 4CVNA 4ZV4A 5JCPA 3A6PC 4M1SA 1DE0A 3JVUA 4NH0A 2GCNA 3SYKA 1XP8A 4V0NA 4LGMA 1SGWA 3CRQA 1KTVA 3T35A 3K0SA 3L2OB 3WNDA 4BFZA 1NVWQ 1QVRA 4QBGB 1X8JA 1RPZA 2ZRLA 1FQJA 4A1FA 2DFKB 3BBPA 4B75A 3QKRB 1KI7A 2WWFA 3CX6A 3THOA 2I1VB 4BZQA 1RYFA 5FL7A 2GKSA 2JJ8A 2QA5A 3PITA 3BWDD 1VIYA 3FVQA 3QVUA 1N6LA 1SKQA 1ZCAA 4LV8B 5TMPA 1N0UA 1R10A 1UDWA 4GT1A 2ZM5A 1EFUA 2YV5A 4Q00A 3CW2A 2VYFA 2ZSDA 2VHUA 3GQBA 1QHSA 4CIDA 3OIVA 4Q1CA 4YQFA 5SZHB 3IEUA 1G3IA 2RGNC 1Q20A 4EPWA 1KKLA 1CIPA 1MO3A 1GL7A 4V02A 2DWQA 2H1LA 4MUBA 3ZD6A 1W46A 4QG7A 4KU4A 3WRXC 3TGPA 1FOEB 1M7HA 4Q1DA 4C0AC 5EJEA 2OEPA 3B7GA 2OO7A 5FUVA 4BLOA 2XZPA 2FSHA 2EYUA 1Q1EA 4E5UA 3THXA 5F98A 5JJKA 1ZM4A 4XTRA 2OBLA 4AI6A 1KMHB 2IYQA 2WJJA 2HEIA 1VIAA 1JR3D 3Q7QA 3BC1A 4EFMA 2IS1A 2XZLA 3SJBA 4POAA 2XJ4A 1OYYA 1TQ6A 3DOEA 4TN1A 4GDFA 2PJZA 5P21A 4DDUA 2XXAA 2JATA 1E9SA 5JWHA 1CU1A 4TMVA 3ZIAA 1NY6A 3QF7A 3SBDA 4IOKA 4IFBA 4JLNA 4OQFA 4PSVA 3RWOA 1E1QD 2EFCB 1DAIA 2BEJA 4PQYA 1N6OA 1OPXA 2A5DA 4QFMA 4QL3A 4Q4JB 3VKWA 1OH8A 5BW8A 1TU4A 1NN1A 2J7PA 3X1YA 4DIDA 3R20A 4LYAA 4RZUA 4FCWA 4XSHA 3AF3A 1ZM7A 2KWIA 5J4KA 1LS6A 2NOAA 4JLBA 1G8FA 2XNDD 3HJNA 1XTRA 3L0PA 3DM9B 4F4CA 2EFHB 4G01B 4MKHA 1E0JA 3ADKA 3BFXA 4MKGA 2N46A 1X1RA 2AXNA 3LDAA 2ZRAA 4Q7LA 2PLFA 3WHLA 1E1RA 4UJ3A 2ZRFA 2QBYA 1GP2A 3NEYA 3FOZA 5BN3A 3M6AA 1D2MA 1PLJA 1TTTA 3PEYA 1JECA 3LXXA 3CR7A 1JJ7A 2IWHA 2IYSA 3EWSA 3W6OA 1W4BA 5E7MA 1S4QA 1KO4A 1WQ1R 3K9GA 2ZRDA 3WYFA 1CJTC 4ACAA 4QJ5A 4D0GA 1MKYA 2QAGA 4MGIR 2GJAA 4TQUS 2YWGA 3PXGA 3IHLA 1EESA 2R2AA 3CF2A 3GJXC 4TYYA 1FTSA 2ZIAA 3DDCA 3EX7C 1GDDA 1N6HA 2WJVA 2ZSFA 3CX8A 5JBQA 1W2GA 4KVGA 5TVKA 3DL0A 1YKSA 1GNPA 2PZEA 2VEDA 4HB0A 3GCGA 1NP6A 4EPTA 3K9LA 1E94E 1ZMXA 2JJ2D 1O87A 1G8PA 3JVVA 1W49A 2QTHA 2GF9A 2W2XA 1OFUX 3WYAA 1F6BA 4HAZA 3DEFA 4JVNA 2ORWA 1MT0A 4LJ8A 1QBKC 4NL4H 4PXAA 5CIWA 3P27A 1BMFD 2P65A 2Z83A 3OF5A 2D2FA 3CKLA 2BM0A 3B9QA 1O3YA 1TQ2A 1N3BA 1Z83A 4TT3A 1E98A 3WY9A 1EFCA 1XCGB 2Q0HA 3OEEA 1KK1A 3GJ7A 2VP9A 4H9GA 2Z5FA 2QTFA 3TLXA 4NCHA 5M04A 1W36B 2WM9B 3CF6R 1MOZA 4E03A 2VSXA 3THWB 3ZH9B 5KDDA 2ZRCA 3GJ4A 4US0R 2ZANA 3AGPA 4DLWA 1UADA 4PO1A 5JI2E 1J8YF 4B3DA 2QMHA 1LF0A 1WMSA 1DG1G 3GEEA 3MLEA 5DE3A 5IHPA 3K70B 4IOMA 3R8CA 1MV5A 2GVDC 2CEAA 3K9NA 1OXTA 4L4UA 1KSHA 2V7QA 4RKFA 4NYJR 2I4IA 2IUTA 3M0EA 2Q9AA 5L3SB 2YWHA 1OIVA 3IDQA 4MKIA 3AP2A 4HDOB 3B60A 3LX5A 4OI1A 4DLTA 1P72A 1DTSA 1SULA 2Q6TA 5EZ5A 1QHNA 2R6GA 3PR1A 4IDNA 1GKIA 3VX4A 1M74A 4AKEA 5FFMA 2AR7A 1ZAKA 4B35A 3NBXX 4RKEA 1DAEA 4HLDA 4AKHA 3TQFA 1NLZA 2WSSA 3RRZA 4M2LA 2ZRGA 2GXUA 4Q47A 4D25A 3ND9A 5FUXA 1BYIA 3MAAC 4AC9A 3VR1A 1J99A 4DSTA 4KFSA 1FX0A 1UBGA 1L4YA 2E1RA 2GZDA 1JXOA 1VCNA 2ZRKA 1EX6A 1S1MA 3OEHD 4IDPA 4JSTA 1FP7A 3LO5A 3VR4A 1EFHA 1KKMA 2BKEA 2C2HA 2F1RA 1TU3A 3G82C 4K8OA 5K8IA 2BWJA 1KI9A 5K8TA 1DPFA 4DHEA 3IPYA 4XTCS 4U7DA 1T8TA 2X2FA 2AWNA 2RMKA 4FMCB 3FHCB 4KBGA 4LBYA 5JS7A 3IKJA 2GBLC 3BB4A 1E2IA 2AFIE 1L8QA 2A7QA 2J0UB 3PQCA 4TL8A 2QSZA 3PFIA 5FUWA 4B74A 2FU5C 1OH7A 4MYUA 2FF7A 3KKOA 3WRYC 2D7DA 3I62A 5JCZA 1NBMD 1ONBA 1BKDR 2O0HA 1WF3A 2FGJA 521PA 4B3CA 3UMFA 3MSXA 3EIEA 4BFSA 1RRGA 3CUEF 3EW9A 4TMKA 5A0FA 2L0XA 2F43B 2BHRA 1MABB 4IW3B 4DSNA 1XJQA 1XFAA 4H1VA 4MYCA 1G20E 4Q4HB 3GP8A 4QRHA 1ZNZA 1WP9A 3RWMB 4Q1FA 1RKBA 3MMPA 1E9EA 2QMOA 2O0KA 2QPAA 4AYWA 2GCOA 3BD9A 3EZ9A 3QF4A 1XXHE 5KYKA 1L7VC 2O8BB 2VH5R 2CJWB 1SKYE 2ATVA 3PVSA 1KI6B 3QPUA 4NYMR 4U00A 5KO2A 2AWOA 3Q7PA 2GWHA 4DCSA 1G18A 3BIFA 4LHYA 1FMLA 3DVLA 3EA0A 2FOLA 2QRNA 1W0JD 3VHLB 3ZVRA 1IHUA 2PLRA 5AK0A 4D2IA 4TLEA 2ZE5A 3MGCA 1W47A 3NXSA 4ZIRA 5EQTA 4A82A 2QBYB 1Q1ZA 2XITA 1NN5A 3FGNA 3TR0A 3GPLA 4C2TA 1ZRHA 2ZR7A 1K6MA 4BPBA 3MG9A 2ZU6A 3I8SA 4NDZA 4PSKA 4R9UC 5DHFA 4Q1AA 1E79A 2FPKA 2O8CB 4AYXA 4B3XA 5JWRA 4Q4LA 4JLOA 4OQNA 3TJZA 2ODEA 1Z08A 4R2HA 4ZIRB 4LI0A 1SHKA 3MD0A 3QE0A 1NI3A 5HCIA 3DKVA 4LJ4A 3FB4A 2ZSEA 4M9SA 5FOXA 821PA 3QJYA 3T1TA 2JJ2A 3LWNA 5H8WA 3I1FA 3X2SA 4WVFA 1E2PA 4DLSA 2GCOB 1G291 3A8TA 3IILA 1RYHA 1G7TA 2FFHA 1R8SA 3K8YA 2HYIC 1HYQA 2XOKD 3H84A 4Q9LA 4QKQA 4MRSA 4YXWD 3JZMA 2VSFA 2ONKA 1IM2A 2CDNA 3W5JA 4F92B 4NE2A 2PEZA 4UNSA 2OLKA 1JAHA 5JHGB 1PZNA 3CLVA 4PHFA 5EE1A 2ZJ2A 3QNUA 4MDFA 3BH0A 1TX4B 3K53A 3L8ZA 4LOAA 4TSFA 1N2CE 1U98A 3VKHA 3P1JA 4WZBE 3LFUA 2G1KA 5HE8A 2Q3FA 1IQPA 2MMGA 2X8AA 2ZAMA 2IS2A 1E0AA 1II0A 1Q1QA 2WJHA 3BGWA 1E2JA 4TWZA 3KB2A 5EE5B 4EFNA 4O25A 4TTQA 3KKMA 1JR6A 3LBNA 2C9CA 3SYLA 4ILEA 2VHTA 1EG7A 1W2HA 1GL6A 1UKVY 1Z47A 1ETUA 1Z2AA 1ODFA 1GILA 2NO0A 2UZIR 4CDGA 4GFDA 2YC2C 3W3ZB 5A4JA 5KPJA 2WJIA 2V7QD 4OI4A 2IA5A 3KFVA 1OXXK 1A7JA 2A3RA 2KI5A 5KSZA 1M2OB 5J40A 4FCVA 1JI0A 1VHLA 3NBYC 1ZBDA 2CNWD 5A5GA 5FBWB 4LC0A 3LW8A 5JI3E 4UNPA 5G53C 1ZNYA 3LV8A 2G83A 5EE9A 2RGCA 4R7ZA 4A4DA 5G40A 2QORA 2PBRA 1E99A 3QKRA 3VNUA 2ZE8A 3U6KA 4DLYA 3L8YA 2VF8A 2PH1A 2WSSD 1G16A 5KNCA 3G0HA 2GBLA 2ODWA 4A2PA 2ERXA 3EZ2A 4HB2A 5KOYA 3AF1A 4TMWA 3ZQ6A 2OBNA 3K0CC 1LVGA 5FTLA 1BS1A 5EXTA 4KSCA 3BH6A 3AVYA 1KK3A 3K70D 4IJMA 1NF3A 1KZGB 4R98A 2YWFA 2C8VA 4DXAA 1VMAA 2WZQA 1B0UA 5KSOA 2V6IA 2ZE7A 4LDJA 4ZCLA 5B57C 5J5CA 3HR8A 3KB1A 4JKYA 4OHXA 1M7BA 3EZ6A 1AS2A 1W4AA 3EA5A 2QMUA 3RS3A 4Q9IA 4QXAA 2AD5A 3A36A 4ZDWA 1SKYB 1IBRA 3X1XA 1NY5A 2GDJA 4WZAE 4IFEA 1DBSA 2V3CC 3HDTA 5GJVC 1T5IA 1QHHA 5JRZA 1BO6A 2XZOA 3CPEA 2REXB 3K0CA 2DHRA 5C18A 4DWJA 3R8FA 1NBMA 3EXAA 2R44A 3K70C 1U9IA 2VHCA 1EFRD 2YOGA 2Y8EA 2W58A 2IYUA 3QPVA 1E96A 4PQFA 5AJZA 4JMPA 3O8CA 1RFLA 2RGNA 4LJ7A 5CDFE 3F0TA 3I5YA 4ERNA 2ZYVX 2Z0MA 4IEIA 4IOLA 3IO5A 5KSPA 1G41A 1N6NA 1XB2A 1RRCA 4KLNA 5LBIA 3CRMA 4QHYA 4F93B 4Q7JB 8OHMA 3QEJA 1HQCA 1OE0A 3CB4A 5BQ5A 5LDDC 2AL7A 4DCUA 4DDTA 3U4QA 4DJTA 1OHHA 2A30A 2F1IA 2Z4RA 1UAAA 2C5LA 2C9YA 2RGBA 4JYCA 2CLSA 3L82B 4D4KA 4D4LA 2PMDA 2RH5A 4IHQA 1R5OA 3AVOA 5DNYB 1N25A 2EU8A 5J4YA 1IOZA 1MO5A 3EPJA 3ZLJA 2WHXA 3E70C 4KYIB 3IEVA 5CJPA 1XTQA 3T1QA 4B71A 3KKNA 2FNAA 2PT5A 2SHKA 2H92A 4DLZA 2F55A 1LV7A 3KTAB 4NCJA 5DI3A 2QTVB 1P6XA 1K8RA 2OCBA 4QNRA 2QI9C 4O3MA 3OFND 3W34A 4XH9B 1E3MA 4DVGA 4HAYA 3U4QB 4XJXA 3AKCA 3KQUA 4CEHB 2FWRA 3AUYA 1G1MA 2WWIA 4WBSA 1ESNA 1F2TA 3RSLA 2WOJA 4PANA 1SQ5A 4Q9HA 3CH4B 3B1YA 4KFUA 1U0HC 4PX9A 5B58C 4TTPA 5CM9C 4II7A 3B1XA 1GWNA 1DAFA 2ZVQX 2GJSA 3VR6A 1S2MA 3SHWA 4E22A 1ESMA 2R65A 3KTAA 2ATXA 2H16A 1G9XA 4NCKA 3IGFA 1Q21A 5BWMA 3A4MA 4QBHA 1KZ7B 1T0JB 1R0XA 1P2SA 2R9VA 1CS4C 1NIPA 1ELOA 1XBTA 3TBKA 4A8JA 2GK7A 3A1UA 4ABYA 2J7KA 4C7OB 3I3SR 2JAQA 1OT3A 5B2ZA 1IY1A 3FMOB 3O8RA 2QAGC 2BKUA 1UPTA 2WKPA 1S3SA 1VYUA 1HH4A 1Z3IX 3BORA 1R4AA 3GMTA 2IYVA 2BC9A 1JEEA 1VPLA 3B9PA 4RD6A 2XB2A 3GD7A 2QT1A 1M6NA 3Q9LA 4JBXA 4F7WA 3TSZA 4DT1B 2P67A 1GSIA 1ZD9A 4MUAA 4OHVA 4FCTA 1M1YE 3EAQA 1Q1BA 4KYUA 4RSGA 4KV9A 3W5IA 4HAUA 4BEJA 3GLFB 3C8UA 5TB5A 1YZUA 5FTJA 4HLCA 1HA3A 4M1MA 3IIKA 4ASUA 4Q7MB 4BASA 3B78A 5IT5A 1F2TB 3DZDA 2HF9A 4PQRA 2EW1A 5FBRB 1RIFA 4CEIB 1Z8FA 4RFSB 1KOFA 3ZS8A 2K5UA 2OZEA 1N5KA 4BWYA 1IXSB 4C0HA 1PVOA 1XJCA 1OJLA 2AXPA 2F9MA 4A0FA 1MABA 2C99A 2CMKA 2WWXA 3THYB 3CNOA 3NEJA 2J87A 4M0LA 2V6JA 2XAUA 1FP6A 4A2QA 1RVDA 5DHAA 1Z0FA 1T9HA 3IUYA 3HU3A 3RS5A 1G5TA 4BLQA 3A1WA 2VO1A 2QEQA 1SXJE 2QY9A 4OL0A 1G3RA 3DM5A 3NDBB 3TSWA 2HT6A 4ESVA 3EPLA 1E9CA 1FQKA 1NSFA 2GCPA 4QJ3A 2VP4A 5AR1A 4P4TA 2D7CA 1P9WA 1N6KA 1E32A 1KO7A 1NBME 5EE3A 2IBMA 5CLQA 1GOTA 4CEJB 1GAJA 5DYIA 5BYJA 1EFRA 4ZCMA 1OXUA 1KK0A 2Q3HA 2GJ9A 1MRNA 4C4PA 5TY0A 1E9BA 5L3RA 1UBCA 1Z6XA 2JIZA 4JT4A 3QXJA 1CJUC 2IYYA 2CHQA 3VHXA 1NLYA 2XSZD 1W48A 2GNOA 3IBGA 4L16A 4A6XA 2IYTA 5GVRA 3MWLA 3NG1A 1XZPA 4WXRA 3GLGB 4OQLA 4M1KA 3U60B 4L15A 3QBTA 1TNDA 3PUYA 4JLVA 1AQUA 1MO4A 1QHHB 3DO6A 4DEYA 1TUEA 4PSAA 1N5LA 3C16C 1T8UA 1QG2A 3T34A 4DSUA 3G5UA 2JDID 1S9DA 5G3ZA 1JALA 4TQAA 4N0DA 1XTKA 1KDRA 1XCPA 1RJ9A 4C3ZA 1HV8A 2OXCA 1DAHA 3RANA 4OHZA 3AVWA 1JNYA 1V5WA 1F2UB 3N70A 1NN3A 2WOOA 4P4UA 3GJ5A 4BE7B 3AVQA 4NKRA 5K8UA 1FX0B 5F2EA 5EP3A 4CW7A 3OFNA 4P3YA 1T5LA 3B13B 4PC3A 5FOTA 1Z07A 1A2KC 1G5RA 2HLDA 3DMDA 2QNRA 1YRBA 1G8GA 4KO8A 1XEFA 4FWIB 4NCNA 2UKDA 4B47A 5HZKA 2DB3A 1X8KA 2ZJYA 2P3SA 4A6PA 3FMPB 3AVUA 2EFEB 4I1OA 3QXSA 1XZQA 1XEXB 3LLMA 4MA4A 4M9ZA 4MKFA 1JXMA 2O52A 3A1SA 2ZVPX 2R6DA 3HPRA 4EIWA 4XVUA 1VYTA 4PC1A 3IBYA 2AHOA 4P4SB 3KL4A 4GP7A 1OYWA 4HUQA 4E07A 2ZI4A 4P33A 1ZC3A 4CGZA 2QGNA 4R2IA 4TMZA 1JPJA 3AF0A 5JSZA 4M53A 4G1UC 4EPVA 1WDTA 2BBSA 4D4JA 1YJ5A 1ZW6A 3RS2A 2BMDA 1CTQA 3WMEA 1ZU4A 2G3YA 1N5JA 4JZKA 2HYDA 2WMNB 4F38A 4URYR 5B30A 1S3GA 3QG1A 1UM8A 1TQ4A 2IXGA 2BCJQ 3UATA 3RHFA 4US2R 3ASYA 2GESA 3CM0A 2P6UA 5H70A 2RGXA 4V0ME 1NN0A 4CYMA 4A36A 4BECA 2GTPA 1Z0IA 1UF9A 2VLIA 4MRVA 1KIMA 2CJWA 3U44A 4HZUB 2DFLA 2IT1A 1BH2A 3D8BA 1DO0A 5AJYA 3S1AA 1A1VA 2W6JA 2OHFA 1W0KD 1DOAA 1VECA 3MWJA 2IYZA 3PG5A 5AUOB 2G1JA 3PEWA 5DN6D 1P2UA 2G6BA 4FMBB 4TLAA 1YZGA 2ZJZA 3ND8A 4TYPA 4Z1MD 4XIGS 1IY2A 4CEJA 1XRJA 2OAP1 4YDHB 4W5JA 1D5CA 4ZKDA 3A4LA 1COWA 1XDBA 3H4MA 1VTKA 2RHDA 2ODNA 4A8JC 4YMVA 4B43A 1G7RA 4LX0A 2P6NA 4GOXA 1GKYA 3WBKA 4HB3A 2OE2A 4JVSB 2LKDA 3QKUA 5HKKD 4LHZA 1E2MA 2WWWA 1R8QA 1X6VA 1KI3A 3CH5A 5FI0B 2GAAA 4URUR 1DAKA 2ZRMA 5CYOA 1L2TA 5KPDA 3T1VA 4X8HA 3MRSA 2JLVA 4JT2A 1CR4A
chains in the Genus database with same CATH superfamily
1Q16A 3DGFC 1GADO 1K7FB 1E8DA 3Q8WA 3QY0A 1RBMA 2GI4A 3LGSA 1NG9A 5CB8A 5AD1A 4IDEA 3A58B 4AY6A 3I04A 5CXSA 3V00A 3WSTA 1MG5A 3N2YA 1ULAA 5EP2A 2YVLA 4BRSA 4A0FA 2BE9A 2CVOA 2B5VA 3ZI0A 4F4IA 4P3NA 1RPNA 2WYWA 3EVBA 4FFPA 1UKEA 4MZXA 1KJWA 1B6RA 1KRXA 3AWIA 5E2IA 2ZT6A 4B44A 3TXAA 4EG8A 4M0PA 1CJKC 2ZITA 4Q34A 1QGAA 5BN4B 5E1DA 4MA0A 4ACBA 4JLWA 4RGBA 2CLOB 2IVFA 2IXBA 3GEIA 1A50B 4XSGA 2O8VA 1TAHA 1JJFA 3HR7A 2NTVA 2PH3A 2X1VA 3VJMA 1J07A 5JZVA 3V8QA 1F8XA 4BJ5A 5K6AA 3TSCA 1DIAA 1A4XA 2TS1A 3QPDA 1J8FA 5A2QA 3T3NA 4ZQGA 4MA5A 1WKVA 4O6VA 1YTLA 1QIIA 1WRBA 1QO0D 4QGHA 1L9KA 2A8YA 5AO9A 2OECA 3L3BA 4MWGA 1E7YA 4DQUA 4YPFA 2QD5A 4P22A 4DCGA 1FFCA 1V11A 5HRAA 3AL2A 5CIQA 1IEWA 4HZUA 5JXWA 2JIBA 3CTMA 2G8NA 4IIBA 2ZXFA 4UUAA 4BVFA 4ZXPA 5BSGA 1Y8AA 2ZS8A 3UJCA 1EFAA 3R3UA 3JQGB 3EMBA 4G5RA 3R5SA 3GQVA 3ZJ5A 3HCWA 5CIYA 1TA0A 1KBOA 4Q9NA 8ADHA 2VBGA 3L0IB 3NOVA 3FWNA 3ZHZA 3VPSA 5CDFA 4J0GA 3I2KA 4PLPA 4ZRNA 1L4UA 5C4IA 1BCRB 4QU8A 3LA8A 4LISA 1BN7A 3FR7A 4ER3A 5CITA 1BX3A 1WDMA 1TT5B 2XNDA 2DUWA 3AKDA 3GDFA 5J2TF 2OHIA 1GNSA 2HNAA 4OA5A 5EJIA 1PAUA 3D6TB 4RVDA 4LXIA 4QICA 5CK5A 5DHUA 4BNUA 1XIVA 2QUJA 4LYJA 5H68A 3D0KA 5IABA 2F3SA 2IKQA 4Q3AA 4UVDA 1V48A 2C7GA 2X7HA 3A7DA 4EI7A 2YVKA 4BXOA 4B34A 4PPGA 4YWJA 4RNDB 4X20B 3ZS9A 5A4IS 5K0EA 1BEZA 2P5UA 3D7SA 3KWJA 2JFHA 2XWPA 3G5MA 4M8IA 4TV9B 3VI4B 4Z7QB 1CJMA 1MO2A 3NAZA 3Q11A 4DR4B 4MW0A 4GKKB 2RG1A 1C0IA 4GBJA 4ZHSA 1KEEB 2RK6A 2W6MA 1SVLA 2OVBA 3JTMA 3T61A 3FBGA 2EKBA 3GBSA 3SZMA 3UUEA 4PG7A 2WC1A 3VH3A 4B7AA 2A9PA 2PLNA 3DLCA 1DS6A 2F3UA 2XWSA 3HHEA 3HYSA 4L78A 4BLRA 1GTVA 3PRHA 4H7JA 1E89A 4F97A 5JDIA 1D6NA 4R1TA 4LWZA 5ITZB 1BXKA 1P1KA 4H17A 1NQAO 3AYXB 1WSBA 3BN3A 5TPZA 3SX4A 1NX9A 1FP2A 1ZK4A 1X7WA 1E5TA 4QC2A 3WADA 2D74A 3KKKA 4WWHA 4A2CA 3N2GB 1VL1A 1EK5A 3VZCA 1T13A 3OE7D 3PE6A 1U3CA 2FTKE 3VPHA 4QUJA 3WMRA 4G0UA 2P4UA 3LYLA 3QNWA 1M75A 1S2GA 3QKSB 2CY0A 4BFUA 3A04A 4DCPA 2HGZA 1QVWA 3OCCA 1ZNQO 3ABQB 3SZOA 3COJA 4G65A 3CEJA 3VX3A 1M6WA 4WHMA 4RK1A 3W5BA 4NYJQ 3U1TA 3GLQA 1QPZA 4PE5B 1V0JA 1YHNA 2QP3A 2Y99A 4JI5B 2J67A 1SA0A 3B2QA 4RACA 3WRVA 1XPUA 4HNAB 1MXFA 4NZPA 5AKKA 5HBGA 3G2HA 1C2TA 1L5MA 3C6ZA 3AEZA 3Q8XB 1ZXBA 3HWX1 5CH5A 4DQ0A 3MQ2A 1RP1A 5JXGA 4U2EA 4M9UA 2XUQA 2XYHA 4KLZA 2ZJ7A 3HJAA 2I5PO 1JHQA 2VP0A 4ZARA 4BGIA 4Z1MA 4D41A 1CRQA 4M4SA 4OHCA 1ENPA 2ZYAA 1ZOPA 3RFUA 1XEWX 2A5JA 2JLSA 4BWVA 1WQ4A 2YV3A 1YO6A 2RKOA 2R6JA 6PFKA 1E1LA 1TC1A 1NXSA 3QKWA 5E9AA 5HFAA 2RJNA 2J32A 3K0AB 5GV8A 3TXXA 4Q01A 5CVTA 1BS2A 1OYVA 1T34A 1SBIA 1XDZA 3AF5A 3GV0A 4RJKA 3SDBA 4G4SP 4NESA 1B6TA 3D3NA 5LXTF 1JHRA 3ESRA 5KYGA 4KCGA 1T8SA 1UXIA 2PKYX 2WQZA 3KKPA 3R3VA 3THXB 1T8PA 2I3AA 2QOEA 4DC0A 3X44A 2NZUG 2AVNA 4N8SA 1FSPA 1XF9A 1Y5IA 2XQGA 4I8IA 5C7OO 3QUCA 4RANA 1Z0KA 5EJ2A 2FUEA 3QHPA 3AR5A 2C98A 2PKWA 2BMJA 2WM2A 3NM5A 5F23A 3SBXA 4RUKA 1KY2A 2VYND 3NHBA 5LBTA 1F8FA 4NDNE 3H1PA 3D4NA 2VPPA 3D8TA 1JQ5A 1Z2DA 3GOQA 3OJOA 1Z34A 4BVEA 5DHPA 3RVLA 3TDKA 1HTWA 1YMUA 2HTEA 4Y2PA 1H94A 1ZH6A 1D2NA 1DVRA 2C97A 2DC1A 3HP4A 4ZU1X 1QE3A 1KY5A 4HQKA 3CKKA 3ULKA 2JKVA 1I1OA 1VGQA 3CLUC 5J5VA 2EQ5A 4I2VA 3FDIA 4NYIQ 5AW7A 1ZUNB 1CNMA 4RGVA 2WSYB 2COKA 2R7NA 2GQ0A 3DUWA 3OEHA 4Y0NA 1C0KA 3RJMA 1J5XA 1PL8A 1BCRA 3Q15C 4AO7A 1CPYA 4J0CA 4P5EA 4Q7KA 5HNKA 2QLTA 1YB1A 5SZIA 3MJSA 3O1LA 5I7AA 4EA7A 2OFXA 2I7TA 4P53A 3TCKA 3BXFA 1JR2A 3F8SA 1QGZA 3CVYA 4L08A 2F48A 4AZWA 5E2BA 2IZ1A 5F5XA 1OLUB 4DTCA 3MT7A 1ZCJA 2BBWA 2O5RA 5CURA 4RQTA 4Z8YA 5TXGA 5IULC 721PA 1Q3TA 1KZYC 2WLSA 4IHJB 3I6ZA 2XB8A 4BKPA 3CJRA 4FHZA 3LAWA 4ICIA 2O8CA 2IK8A 3AJAA 1E7RA 3IEPA 3PNOA 2VBFA 1V9LA 3PYMA 2YXLA 3IE2A 1KTIA 1IDN1 3MVEA 4BFWA 1G3QA 2GXQA 4Q3BA 4E46A 3LVFO 4O4IB 3REGA 2E4YA 4O2AF 2WWYA 1DMSA 2NV6A 3SQDA 2Z43A 3O9VA 1P7VA 4H0FA 4QPDA 2MSCB 2UVQA 3HO6A 3R3HA 4HDNB 5E7JA 1SCUB 1UK9A 3IAEA 3NDPA 1J06A 2PTHA 3R0XA 4I0WB 4ZRMA 2YBEA 3WXBA 1FPMA 3G17A 5AM3A 2ZXEA 2DETA 1P91A 2BRUA 2I03A 1I0LA 3E84A 3BL5A 3K30A 2ZROA 3NHJA 4RXMA 2DR3A 1Y4ZA 3REQB 4QOJA 2RB4A 1QK4A 3V8RA 1UT8A 4YAJA 4B0OA 1EVJA 3GL9A 4LX8A 1YB5A 4RTLA 3RS7A 3UJ9A 3WGHA 4CIXA 1IWBB 2AA3A 4BFCA 4X7BA 2JEYA 2FY8A 2NM0A 3OF3A 3P2EA 1U7OA 1ZHOA 1IHXA 4L2IB 6Q21A 4CTOA 4MAFA 1QV7A 4MUKA 3WLJA 4EJSB 2WJYA 1LPSA 4MPRA 2FFAA 3LRPA 4K88A 4DCJA 3O95A 1L7PA 4UAUA 1EK1A 2WVGA 1E4EB 1CCWA 3FDJA 2O8DB 2Z1DA 1KL7A 2DJ5A 3AZQA 1S7GA 4RVFA 1NVVQ 2BKLA 5CU7A 1O0CA 3ZDBA 3IOEA 2ZT5A 3OZVA 5J2UF 2VH1A 1M8PA 5KQSA 3OQMA 5EJ5A 4PYJA 1ID8A 1HKUA 4UE6A 3MWKA 2J0UA 5JS8A 2QZZA 3KDSE 1XX6A 3TLAA 3FCOA 2PSSA 4MVJF 3A2NA 5IARA 1IE3A 1XVUA 4OHUA 3WHKA 4UOEA 4AIIA 3CRVA 2BDUA 2FJUA 2RH4A 2EKZA 3FUUA 5GQSA 3VC2A 2J5XA 3ZQJA 4OMCA 1YKFA 3B6IA 2FEAA 2PIDA 4QRIA 3T7IA 2FEWB 3HVRA 5GONF 5J59A 1MF7A 1EXVA 3HI6A 3QUBA 3AUSA 2D1RA 4REMA 5H3CA 2WTAA 3VUFA 1TUIA 5KQPA 1JIQA 1Y8RB 3HSYA 3AUXA 4W5HA 4ZXFA 3UMVA 1QYIA 3FF4A 3AKYA 3UAVA 3N7UA 4NAHA 2BHTA 2X3FA 5T4HA 1PJAA 3C3WA 5LP6A 4C0LA 3TL2A 3BL8A 2XTJA 3L0DA 3N76A 1R5NA 2JBHA 1SUCA 1DO2A 1GSOA 2PZJA 1IUNA 3SJCA 3ZXXA 2D62A 3CF4A 5KYTA 2EVWX 3UW3A 2AG0A 3F9IA 3NYRA 4KK4A 4FNAA 4CL0A 4G3XA 3VR5A 2J4FA 5AOCA 2G36A 1FSSA 2JJMA 1U02A 2QHXA 1E4VA 4N7RA 3FCAA 1S0UA 1VOTA 4DV3B 3L1VA 3LLSA 3NBZC 3D31A 5BN4A 2QG9A 5LSAA 2VJYA 1CVRA 4YRTA 3EAGA 2PX5A 3QPCA 3VU9A 3QA9A 2CJXA 4LJYA 4PR0A 3V6LA 1GQ2A 3EEQA 1PS0A 4NBTA 4C07A 1BROA 1RLTA 1Z7GA 3DYBA 4DWOA 1JIUA 4LWOA 1S8FA 4IV5A 2C4VA 1SUWA 2C95A 1MB2A 2RHWA 4KHZA 4Z9BA 5C3MA 1LB1B 4PGFA 4UEQA 3TRFA 4YYEA 2FCRA 4CKBA 1ANKA 3BRWA 3FUVA 3SEAA 2HDHA 2GR9A 1BQ3A 2Y92A 3D3QA 2QF7A 2AN1A 4ZVQA 1C2YA 1YJQA 2BOVA 5G41A 1FFDA 3GGJA 3PC4A 3SJAA 4Z6KA 5KYWA 2FF5A 3FRIA 3BE6A 3BMCB 1LS1A 4HWSA 3V55A 2DQ4A 2WPDA 3H4IA 2UYGA 2Z1MA 1LBTA 1U1GA 2MINA 1C0PA 1P2VA 3UMCA 1LDBA 1B0PA 2I8CA 3DEIA 4H4EA 4L2IA 4PYQA 4W1PA 3TNFA 2J85A 4RV9A 1HYGA 4Z49A 2QE7A 5FEUA 3IT0A 4FU0A 1V6SA 4N6GA 4Z4CA 4QAJA 4RHCA 3NTXA 1DADA 3KEFA 4EECA 5LYJF 5TQ0B 4DBLE 4WZBB 2P77A 2B1RA 2PX0A 4LCBA 3LECA 4TT8A 4DUGA 3WHPA 1XU4A 4TKMA 2VRCA 3JASA 1BW9B 1V41E 1TKRA 2ZG6A 3BKWA 3D7NA 4LA4A 3BE8A 5E1OA 4YMTA 5ILOA 3ZVMA 2HDNB 3HFSA 3OE5A 5CT9A 2O8BA 3U5ZB 2RGGA 3L7AA 3W5SA 4EGFA 3ORFA 4X91A 5B1IA 1VJ0A 2YNMC 4ZYUA 4D97A 4QBFA 4L5AA 1GYRA 1Q57A 3MJRA 3RVBA 3TYXA 1RJ9B 3EH2A 1ORVA 2Q9CA 2XA9A 1HE2A 3P0IA 4MV8A 5A0TA 3RRNA 4RGQA 3DTVD 1QYCA 1WEKA 2I55A 3ZKWA 4G0WA 1YDEA 1RXIA 3RSOA 1WXQA 4ROSA 5ESXA 1P6QA 3VNSA 3PPIA 2QSJA 3FHOA 3QXHA 3N2EA 1HOXA 2NTJA 3EGDA 4MR7B 3O03A 1YR8A 3GI1A 3NHYA 1D3AA 1GQFA 3P45A 3FVVA 4MVJD 4XRRA 1NKTA 5EJAA 3TLGB 2JLXA 1XDUA 2VTDA 2EL9A 2XQFA 2I62A 3VZPA 2E4XA 2ANCA 3R6LA 5BWLA 4Q9JA 3RC2A 2BL4A 1EU1A 3N0XA 3MBOA 3U7QA 1VE5A 1UFRA 1YZKA 3N6RA 1G3UA 3U3JA 2HMVA 2BAGA 2G0TA 1IOWA 1K4KA 4KN8A 2WW8A 1EG2A 3P97A 3RVKA 4WNIA 3TMYA 4BDSA 4PLGA 2V0NA 2XIQA 1NVXQ 4I4TB 3X1KA 2AC7A 3QNMA 4UPEA 1M34E 4H7HA 2ECFA 2WFAA 1KDOA 2F43A 2HO5A 3IUJA 2NXEA 4Q4DA 5LA6A 3RAJA 4D81A 1RE0A 4DMLA 2GNAA 4MULA 1V45E 4FHFA 4CKWA 1I24A 5C7YA 3WG9A 3VMFA 3GZJA 3HKCB 4X6LA 1FW6A 2UVPB 3BB1A 2FE4A 2J5KA 3ZDXB 1JT2A 1NRJB 2J9RA 5JV5A 1XMJA 2I2CA 1BD3A 1KIAA 1ULTA 2FWNA 1MB9A 4MVJG 4NPCA 4I99A 4Q3KA 4RMHA 3IIMA 4BNTA 2MYPA 2ZBDA 4YJKA 5AHOA 3V3TA 3B51X 4BZZA 3TD9A 3LCCA 1VPWA 4MB6A 1XD2B 2HT1A 3TQCA 1GITA 1H2BA 2QTVA 4TZTA 3QVSA 2EGHA 3DKPA 1JTEA 1Z82A 4IH1A 3SQWA 2A9RA 1R0LA 4RPCA 4MP3A 2QN8A 3UUFA 5IJ0A 3U2QA 1GQSA 4L3VA 3TFWA 4IJQA 3UUWA 1OB5A 4R4JA 1F2UA 4NEHB 3UOAB 2IQIA 3FWYA 3KYDA 3EK2A 2K2QB 4WKPA 3IVXA 4BQEA 3R5FA 4YP5A 2X6TA 2ZCJA 2Z6VA 1E8NA 4UTRA 2QPTA 2IJGX 1W85A 1HT0A 1J24A 2BFMA 5BP7A 5FTNA 3FXAA 4HNUA 3WWPA 4A0SA 2JFUA 3E03A 3TTVA 3T7RA 1PIWA 2V03A 4UHBA 2JK0A 3TBHA 3ZLBA 1ITZA 1LRJA 2F17A 2QX9A 4P84A 4U0KA 2OCKA 2PT7A 1ZXLA 2NIPA 2YWDA 5FBZA 4ML3A 3NUGA 3I53A 5KC8A 4WKNA 4AJ9A 3WGUA 2BDTA 3MS2A 3GU3A 4UREA 1LI4A 2HCJB 4DA6A 1E20A 3GUUA 4IHJA 1A2OA 1SRRA 1P6UA 3ZJYA 3HBFA 4JXZA 2XHZA 1TM5E 4PM4A 5FPTA 3CLTC 2BCGY 5L3SA 3HYTA 2IYEA 1J42A 5TT0A 1YFLA 1XWWA 2JI4A 3E1GA 4L6AA 1DAGA 5FWNA 4DCMA 4AP6A 1GT91 1QPGA 1Y1PA 4BV9A 1JQAA 2IYAA 3CEAA 3UAZA 5CNKA 1L9XA 3GVXA 4GI2A 1A82A 1YDFA 2GEVA 3A70A 3H8VA 3GLIA 3DQZA 4C0WA 2JB9A 3EY9A 4QG3A 2QN7A 3CX7A 1YQUA 1YH3A 2UUPA 1NDQA 1QVAA 2C8JA 3DB1A 2IUYA 1VKNA 2ZKIA 3LCJA 3OZBA 3Q3VA 4FDAA 3WGJA 3QSYA 1GTZA 1YBMA 1M1YB 3O3NB 5JZBA 2HPZA 4E5YA 1LBSA 1GGHA 4RZ2A 2ZUFA 3DOFA 5DNCA 3WYGA 1E2FA 2NMVA 1SCJA 1Y82A 4EY3A 1J5PA 1S3FA 3W9YA 1NPTO 3OLXA 2PT6A 3FYCA 3K05A 4EF5A 2O8DA 1JE1A 5JXIA 3J81A 3ABOB 1JHYA 3B82A 2G04A 2FEOA 2Q3EA 1QSGA 4I6EA 2QVCA 4PC2A 4YT4A 4LJLA 4F21A 3F1LA 4KRFA 4FDVA 2VZ8A 5C5CA 3W5DA 3AKEA 4TTRA 1YZVA 3PFBA 2RGUA 3Q10A 3L41A 5F77A 4HUQB 1U2PA 4BFXA 3ANNA 5KYVA 4G1CA 4IUCS 3QPAA 2LR0A 2EGGA 3QKIA 2R85A 1JPNA 3SOPA 3WLNA 4JGBA 4ZHQB 1Y4SA 2XMBA 4MWDA 3LCVB 4TMFA 4DR7B 3I9OA 2J31A 5K3BA 4EG0A 4EG7A 2HA3A 4KLAA 3T0IA 4H6WA 4OJNA 3PPWA 5ALWA 5B58T 2J41A 2BKVA 2ZJ5A 1HE1C 5IK2A 4D9MA 4OF4A 3BMXA 1TEZA 3Q9UA 4FSXA 3KFLA 1IAQA 1DLJA 4L8YA 2WYOA 2FWIA 4LC1A 5CD1A 3NDJA 4AURA 5F76A 1N3IA 1ZY2A 5G0TA 1JFSA 2X2PA 3DW3X 1AKEA 4ZO4A 3P32A 1FSFA 2J6CA 4POOA 2V6MA 2O5EA 1NFRA 4BRZA 1UOQA 5I48A 5JW6A 5LZ4A 1JB9A 1QS0A 3KSRA 3V8VA 1QFMA 2YZNA 3QW2A 2JZCA 3DR5A 1TJ3A 4YRFA 1X8LA 3LHFA 4TLBA 1DDOA 1R0WA 4UDYX 1GUDA 1OLOA 1YWGO 2H08A 4LYEA 1WY5A 2FPIA 4WAUA 4XPZA 1J2EA 1IBSA 1JR4A 3CCFA 5TGTA 3TBFA 4URZR 5AIAA 2QVGA 3ZN2A 1U2DA 3WYDA 2YXBA 4WFJA 1CJVC 2V55B 5D3KA 2FSPA 1C9KA 3OFJA 5KYYA 1R8XA 4Z4QA 3QUSA 2L42A 2B35A 4B2YA 4NMXB 1XZHA 5DNWA 4G5YA 1ZYUA 4MXDA 3UBTA 2ZCVA 1XROA 5FUMA 1W5AA 4OHWA 1PJ2A 3FZGA 4INAA 4J43A 5I47A 5C5IA 4RJLA 4GWGA 2VQ6A 4JR0A 4UDOA 4LMRA 2KX7A 4QBKA 1JFFB 4OGKA 1DRVA 1EFTA 1FYVA 2D4AA 4GOOD 3SPXA 1V1MA 2A1UA 3GYBA 5IU6A 1Y9AA 1VLHA 2VDWB 4MMXB 3RYTC 4HZIA 2O0JA 1RABA 4FE7A 4M22A 2ZREA 4OLHA 5AXAA 4CQNA 1VMEA 1UR5A 4EABA 1B73A 4NEGA 4NJMA 3AR6A 5C32A 2WD9A 1JXAA 1ZA2A 2GFHA 4G1FA 4IMRA 2C9DA 2CKMA 1OPRA 1ZP6A 3LP5A 4IQGA 5F52A 3EHEA 2ZBRA 1X74A 1OZAA 2GN6A 4AMZA 2AI3A 4LBVA 4QYMA 3KTOA 5THXA 1SUFA 5IKXA 1K9SA 2CFSA 1WETA 3FTCA 1NWCA 4XFDA 5CX4A 3T3OA 1P8JA 5FV4A 1W0JA 5IM4A 3KYDB 2HCBA 4J0QA 5LQAA 2FGKA 4ZOLB 3UAGA 4UNRA 4QGAA 1D8TA 1CJBA 3KV3O 4M0DA 1CDOA 2EHDA 4DA0A 1SCNE 5A3QA 3OT4A 3T1NA 5HFJA 1JJVA 3EC1A 4NDAA 4EO7A 4L9SA 1R3UA 2NSDA 4J1TC 3NVDA 2OBFA 1A0OA 2XOEA 1G21A 1UPFA 1E79D 1EWQA 1V43A 3ZTYA 3IAAA 3LYAA 3E0QA 1OKKA 3PQ2A 3W6UA 1EWTA 1WWKA 1E5DA 1XGKA 1MOPA 3DC7A 1LPBB 4LBWA 3RQSA 1VPEA 3UW1A 1YGYA 2IY8A 1H9BA 2Y1KA 3BFVA 4FMCF 2GUWA 3LBYA 2A1IA 2H4WA 1TVKB 3ORQA 4HWKA 3MK31 3F6PA 1USUA 3OLWA 1KSGA 3WK6A 1XK6A 1XZGA 5FOSA 4R2JA 5AW3A 1Y81A 1VCHA 1OXVA 4TRNA 3T5AA 2XCTB 1AURA 1HOTA 4QBIA 1SR8A 4JJEA 1QQ5A 3RKSA 3ABZA 4DY4A 3UCEA 1DBWA 5F2NA 1KQPA 1E3LA 3MWFA 5J4HA 5A4AA 3TOZA 2QZPA 4WZAB 5JCXA 3ONWA 3GA7A 4TL9A 5DIFA 2IH4A 3WI7A 5FHQA 5LCXA 5DV9A 2OCYC 2OESA 3SLKA 3VHQA 1GCUA 3TUJC 1NDHA 4WCVA 2XA1A 3OAAA 3JARB 5DRTA 4ZT5A 1FL9A 4B7UA 3VC1A 4D9HA 4HH3C 5DCWA 4YT2A 3FVTA 3MN1A 3ZXYA 2A9QA 4BVBA 1RQLA 2RONA 1VIVA 3FNFA 1M8GA 3NH6A 4MW5A 4OFXA 4U7HA 3WYBA 4QOSA 4AX8A 1JU4A 2X5KO 3HBAA 4J8PA 3QWBA 2O48X 1AS3A 4TSFD 1X1SA 1JG1A 4DQVA 3EMVA 1ZGZA 5LJLA 3UK2A 5G1PA 1D9ZA 1TAGA 2ZCUA 3VO2A 2EBWA 5AIBA 2BKAA 2QE6A 1Z45A 4D9NA 3IHTA 2BHSA 1NV8A 2WSBA 3HNRA 4QGBA 3M82A 1DI0A 3VR6D 5BOVA 4OQDA 1CWUA 3W6PA 2QP4A 4B3FX 2FWPA 1MAHA 3HUUA 1YRYE 3L1KA 4LE2A 5LZ5A 4M1OA 3OD5A 3GXBA 3NVMB 1E5XA 1CUFA 2C61A 4HRAA 3ZG6A 1M34B 1QU3A 1GUAA 1RI5A 1ZITA 1CE8B 2J3JA 1TQ8A 2QL9A 3VNAA 4KQEA 4BX0A 3BWEA 4NIMA 5JSKA 3CIOA 1U9IC 2C0PA 2YXNA 1VMKA 3AGQA 3NUZA 3NWOA 3VNBA 4AG6A 4C3OB 4CNQA 1DG3A 4FZVA 2VF7A 2WNIA 3HS3A 5EPOA 2BGWA 2JAOA 1QH1B 3CN7A 1C1YA 1Q0ZA 3TTXA 4OKSA 3PEUA 1G59A 1ULSA 1XPRA 1X9HA 4WA7A 1NVFA 4Y6OA 1YMVA 2NYUA 2OD9A 4Q37A 1TJNA 2Y27A 2RGWA 3ZJVA 3JQFA 4UXHA 4KR7A 2OHGA 1Z28A 1M72A 4TQ9A 3A31A 3AVPA 1AMUA 4F72A 5F12A 4PRKA 1F0KA 2HPAA 2AMFA 2WTMA 2ZBGA 3I28A 4ABTA 1HNXB 1H8ED 2QMZA 1EE2A 4QGGA 2BBTA 3NNNA 3HPQA 2YHBA 4FSHA 4AU1A 4E7PA 4YT8A 4MW9A 2VSQA 3B7WA 4M54A 4WGGA 4OJMX 2XUKA 1ZI6A 4BWFB 1YUNA 3A2MA 3KD2A 2AV6A 5AYVA 5LU9A 4FWTA 2V54A 1R9GA 1OFTA 1ZMBA 3LBFA 3QMVA 4XD7D 1SUIA 1ZHFA 2AJCA 3DEZA 3Q72A 5JPCA 2CYAA 2CVHA 2F6RA 2FN3A 1A8SA 2XX3A 2H9IA 4IV8A 1BA3A 4O2AB 1JLMA 4V0KA 2W8BA 5EIAA 1ZNXA 2PMBA 1GRNA 2EWWA 4MARA 4QEKA 1RNLA 3WAJA 5DOZA 1AGNA 1AN0A 1G8AA 2V9ZA 5I8PA 3AL0C 1EDEA 3F9CA 4RVGA 1L3IA 2DHQA 3P4YA 4HGOA 4JLKA 1K4MA 1PJCA 1AY0A 3E5NA 2FUG1 4KXNA 1CETA 2OO5C 2G9NA 2XOXA 3DMNA 3ID6C 4A03A 1IRIA 2QN3A 5K3AA 2TMKA 1ECLA 3OHMA 1IPFA 2JJQA 4K81B 5AI4A 3BILA 1RAGA 1V1RA 3F4KA 4PTYA 1RRFA 1WUJS 3RTCA 1RQPA 2H07A 2PN1A 4ZOEA 1W96A 4C3VA 1RHMA 1MP0A 3O83A 4R9RA 4DREA 1UDXA 3BIXA 4RMNA 2ZI7A 4JJ7A 1E3TA 3I52A 4EHKA 4QECA 2WHRA 1Y63A 3O8DA 2V1UA 4UOQA 3JQFC 1M67A 1RRMA 4DRXA 4M21A 4BE4A 4Y0VA 1SNYA 1E0KA 3GNSA 3R5KA 3ROZA 3PUJA 4LSGA 4U2DA 5F4BA 4YONB 1Q84A 3UBMA 4QASA 3I42A 3WRXA 2DFTA 2Q9UA 4M38A 2YJ5A 1SUBA 3W79A 3GZNA 1NAHA 2JEOA 1UBMS 2LCFA 3IR6A 4ZVNA 3RNLA 3VYRB 2ZBVA 2GX6A 3GH1A 4PFSA 3L7NA 4FQ7A 2J33A 5JJIA 1NMSA 1DARA 4LZNA 1ADCA 5BNZA 1WOYA 1W30A 4DJJA 1G66A 3ISVA 4PGHA 2ZWPA 3ZIDA 2A9VA 4LDNA 2E9SA 2I8LA 2NGRA 1IRXA 3ZZ0A 1Z22A 2ZJBA 3EYWA 3INYA 3GRKA 3KJQA 5ITWA 5EZSA 5BRAA 4IVPA 4PEVA 3AF6A 5JNRA 1H5NA 1CR2A 4R41A 5K1ZA 3KT0A 1G5PA 2VNJA 4FDMA 4O4HA 4I81A 2JHGA 4C0KA 4XWOA 1DCFA 1FXWA 2ON6A 3TZEA 1NSYA 3GFSA 1WAMA 3RWBA 4DPLA 4XUGB 3FMVA 2HRZA 3LZCA 4G5OA 5EQJB 2CFIA 1XJWA 4L57A 4XIFA 5L53A 1QHYA 5ULLA 4ARUA 4UBOA 2VXYA 1JU9A 5CEEA 1V39A 1IEVA 1NULA 3VFDA 3ED5A 4L72A 4KZKA 1XYGA 3DAFA 5DEOA 4LK3A 3U17A 1W4RA 3QQ5A 4AJ4A 2CHFA 5JSHA 4R2LA 3D6FA 2WDZA 5C51B 4YJ3B 2R96A 1DKMA 4D0SA 1P3Y1 3JWIA 1IQUA 4MVWA 4MV6A 3NHAA 1BQEA 5FBLB 4PLZA 3LUHA 2ZAYA 1FMJA 3NHSA 3NC0C 4YTEA 1G8HA 5DO9A 1KJYA 3OZUA 5LZ9A 2HMWA 3A6KA 5LKAA 4DRZA 1T29A 2EQBA 1KC3A 2BFEA 4MOWA 3S29A 1ZMRA 3DEJA 4Q4HA 4AW9A 3OZSA 4Q4JA 3CLSD 4RZHA 3UFXA 4I5GA 2J0SA 2VP5A 4HH1A 4TVKA 4UCQA 5KTTA 4MYDA 3GJSA 2CK3D 1JLLB 2DMRA 4HR7A 3W7AA 1YF3A 2TSYB 2W83A 3F4BA 1FU7A 2F64A 1Y98A 3ED1A 1W8IA 3N1UA 5JH7B 3C41J 3HN2A 3H9QA 3DCJA 1H93A 3H04A 4OQ4A 4BFTA 2ZE6A 2P9JA 1GG2A 4JJ8A 1QMPA 4L8LA 5U9CA 1GPNA 2O2ZA 4UZFA 4CKCA 4H4DA 4D44A 1VFPA 3IIJA 4CKEB 2GSWA 3A06A 1NHGA 3VPGA 3SK0A 1EWRA 1SOUA 1NI4A 1Y33E 3HBNA 4M9XA 4DCNA 1N78A 2V5UA 3KQQA 3G02A 3I9KA 1VG8A 2PE5A 3FOBA 4RA9A 4XFJA 3BEDA 5FULA 3D7MA 1J2RA 2IP1A 3RRMA 1ZRSA 4KRYA 3O47A 5JT1A 3RDPA 4UNNA 3WB0A 4W6QA 3MC1A 2GVZC 2VRNA 4OI0A 1KFBB 1X1AA 2R79A 1EEXB 1WEHA 2IIQA 5P8WA 2QV7A 3VHXB 5IAAA 3UANA 4DV2B 1B2RA 3CPHA 1B23P 1JQJC 4P3PA 4YUXA 5EEHA 1CP2A 2Y71A 5LD2C 1X0XA 1V8PA 1YDWA 1NNLA 1NXTA 4WSOA 1KFEB 1RMTA 1YRLA 3FW1A 4U2FA 3MWEA 5BQPA 5AVUA 1AIPA 6ADHA 1TM2A 3VR4H 3NGMA 4R1PA 4DAOA 4GSYA 1C30B 1KNQA 4N3GA 1MR3F 4IDGA 3EUAA 2J09A 3K1AA 2L82A 4YR7A 2A35A 5FAXA 3L4BC 3HB4X 5FIUA 5CB0A 3W5VA 1ISPA 5J43A 4YMLA 4LOKA 5IF9A 2UZ0A 2PSJA 2IPXA 3VGJA 4MITA 4BWGA 3OC6A 4QYSA 4DCTA 3O3OB 1IK6A 3L77A 4TZ0A 1T0PA 1UQRA 2C2GA 1Q6YA 4O2AA 3PNLA 4RORA 1T8YA 2VQFB 3VYSB 4FZRA 2G25A 1ZJWA 3HL4A 5JECA 4JBYA 1E2DA 1VB5A 1AZTA 2Y77A 4NCIA 1EINA 4KYTA 1B15A 1N5MA 2FJ0A 1OX5A 4FN5A 3V2UA 1K89A 4BC1A 4FB5A 5KOJB 4L8GA 4CMIB 3P0EA 2C4WA 5A3JA 2ZT7A 1SVOA 2EG5A 2ZIXA 5MDHA 3OX3A 1KO1A 2EIHA 3LY5A 5B7QA 1GR0A 1VPDA 1ZU5A 2IGBA 3B5IA 3K0EA 1EQUA 3UMMA 1JA9A 1ZEMA 2GM4A 1JLHA 4FFSA 4DZTA 2O50A 3TIIA 1HMPA 1K7XB 2CCKA 3EEFA 4L7VA 2YJTD 3LE8A 4FMDF 4GNKA 1U8YA 4XR9A 4KIJA 4B45A 2XCSB 4EKNB 1C4WA 2NTEA 1B8PA 2YQ4A 3MZ0A 2E3JA 3ZQKA 2JA1A 1EUDA 1QH1A 3EC2A 4BO1A 2FCAA 4MV4A 2X9GA 3E2PA 1CF4A 2NP7A 2FLWA 5IAEA 3PDIA 4EL5A 3ICWA 1OFVA 1RZVA 2E1PA 1ODIA 1Y3BE 2G7ZA 3P2MA 3FAZA 4PSCA 3S3TA 3UT5B 1PNRA 4M8KA 2JCBA 3GJ0A 3M1IA 3SKYA 1BWSA 2J9XB 3AILA 3HDYA 4FD2A 4HXFB 3WWOA 4B2IA 2VSYA 3COVA 4L76A 3COWA 4FX5A 5JAMA 5LNK6 3ZCQA 1UJBA 4FNGA 4QODA 5DI9A 2JGLA 4IZIA 1V9SA 4AWAA 1WVMA 3LJKA 5HF8A 4F56A 1SD1A 4S2EA 3PA8A 4GMGA 4ZC1A 1C3JA 2JIMA 3D0RA 5ED4A 3WP0A 3HJFA 3TZKA 3CW9A 2EX0A 3TPZA 3ZCVA 4Z7NB 1CUGA 2VYCA 4Y9SA 1R37A 3DBIA 4WIAA 3LZ6A 1K7SN 1YIOA 5TDHA 4EJSC 2JGEA 2DTXA 4G9BA 5CTAA 1K06A 3EWIA 5DLPA 3R76A 3UWOA 4AKSA 4Z3DA 2QRMA 4C6TB 4D74A 3TZBA 2B4TO 1P1JA 2XMPA 2F3TA 3HZRA 1H65A 3EF1A 2QLJA 4NENB 5EZYB 1M8JA 3SQXA 1QUEA 5IM4F 1Z6QA 4L4ZA 2J4DA 4YHHB 2P1RA 1CBUA 2R7LA 3H19A 4K2HA 4KE8A 4Q15A 1NUQA 1JHPA 1R0SA 2O2DA 5AJWA 3RV3A 4B7ZA 3F6BX 4BNZA 1WKBA 4E5DA 9LDTA 5F5NA 3G1WA 4EYOA 3Q12A 2AN4A 1Y1SA 2PEYA 2QJFA 4GOLD 3TOVA 5A3VA 2EP5A 7REQB 4ZGGA 1UFQA 2GF2A 4DMMA 5I9LA 1G5QA 3X1DA 1G1AA 5EMJA 1DFIA 2NTYC 4QDJA 3IC5A 2XMCA 5CTJA 3W8RA 1SD2A 1ZUD1 2MOKA 3CRRA 1HG1A 4RHUA 2QX4A 4RU1A 3BGDA 3P9YA 3B3GA 1XZ8A 4CEIA 1C80A 3A10A 3GPCA 3LIPA 1OAAA 4Y9RA 4JP3A 1HEUA 2HJSA 3FI9A 3S68A 1FJXA 4GP6A 1JEQB 3VPBA 3ENQA 1I3CA 1CQXA 4G0XA 4ENWA 4FOTA 3IQXA 3RRFA 4DEVA 2ZEJA 4EGCB 1I10A 5HQJA 2PAAA 3D6MA 4W1SA 3MF4A 16PKA 5IYZB 2LGJA 5AHKA 1P9LA 2ZYIA 4N47A 1E77A 3K9BA 1SA0B 3LT2A 5BOSB 3TQSA 5KX5B 4JBWA 3T1HB 3GFTA 1O94A 1JAZA 4JUFA 5L3VA 2DPLA 3K16A 4AT1A 5HUJA 2I1LA 1NUAA 4TMYA 1QC5B 4LPSA 5CGZA 3SFZA 4ADSG 1E4YA 4K1XA 4PTZA 2ZDHA 4QTYA 3N0TA 5KYYB 1L8LA 2D7JA 4ALNA 5BUZA 4U3JA 1AH2A 3DC2A 3BJIC 3L8GA 4CDMA 2N47A 4DLNA 4OB6A 2FUKA 5EP1A 1VG0B 5JATA 2PMKA 1KDTA 3AHJA 2P69A 1HT1E 2X23A 1HFKA 4L0DA 2I3DA 1Y6QA 4C7VA 1A77A 4Z4EA 4V0MA 4XUEA 3TNYA 2W6CX 4HGNA 4RJJA 1TL7C 2FMHA 1LQ2A 1TF7A 4FYPA 3IOCA 1BX1A 3OOSA 4I1VA 4WE3A 3AH8A 3WMGA 3E18A 3ZU4A 4DF3A 2JFBA 4Q93A 5A02A 5K6RA 1DWOA 4GBMA 3AB3A 4LZAA 4DN6A 3I05A 3PA6A 3MJFA 5DBHX 3UMRA 3H0CA 2JASA 4HN9A 3JQ7B 2BT4A 2M1ZA 3URKA 1L6IA 3G3EA 5JYBA 1B4DA 1GCGA 1K66A 3JR7A 4OX9Y 3BOSA 1WS6A 3G1TA 1F6DA 2ZJOA 4EFKA 3IAHA 4TT3D 3AKZA 3CA8A 4E94A 5LYJB 2W6IA 5IBRA