2IYRA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
169
structure length
164
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 164
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyrA00
3U7HB 4QHTA 2FU5C 3PG5A 3R8CA 1Q1EA 1FFHA 4JMPA 1OFTA 1Q22A 3PEVA 2GXUA 5C4MA 4Y0VA 4U00A 2ECKA 1R5NA 4E07A 1OXUA 2YOHA 1JB1A 1GZSA 2EQBA 2AHOA 2QENA 5HTKA 2FMXA 3RAPR 1VHLA 3CLVA 1RJ9A 2YV5A 4EUNA 5JJKA 3OFND 1TF2A 3D8BA 1E2EA 2VPPA 2QL6A 1IBRA 1A5TA 4BFSA 2R6AA 4LBWA 2H5EA 4TWZA 3ZVLA 2IS1A 2R2AA 1KO4A 5AWFC 3VX3A 2O0JA 3UIEA 2D3WA 4Q4AB 2HF9A 1EFRA 4HAUA 2JLYA 2BDTA 1F2TA 2B8WA 4QFMA 1Z22A 4CEHB 2FZLA 3HR7A 1GSIA 1XD8A 5F9HA 2AR7A 2ZRGA 1YZQA 4AG6A 2FNAA 2VO1A 2JLZA 4B3FX 3I92A 4EDHA 5KSZA 1HE8B 3U44B 1P5ZB 1Q3TA 1DARA 1JR3E 4EPXA 1YZNA 2ODWA 4GZLA 4MRPA 5TXGA 3ZVRA 3T1QA 4AKGA 3H0KA 1CR0A 2Q3MA 2HV8A 5EE5B 2GA8A 4D2IA 4ESHA 4Q1EA 2A78A 4FWIB 1W47A 1U81A 1IONA 1GOTA 2ZYWX 4GOXA 2IYRA 1V5WA 2F43B 5P21A 5J4VA 4OK6A 2W6JA 1E2IA 1XRJA 4LHZA 2ZAMA 3TUZC 1KSFX 1G5PA 4JJKA 3NIBA 2WSSD 1T8TA 1MO4A 2N46A 4K81B 5FTKA 3U3KA 3LAWA 2ZE5A 4EFLA 1PLLA 3IQWA 3CBQA 1H65A 5DLQC 1O87A 2OAQ1 3QG1A 5FBQB 5TB5A 2AXNA 4XIGS 4DUGD 2B6HA 2HJGA 2NGRA 4A0FA 1W36B 2GDJA 2PX0A 4D0LB 3U4QB 3GLHE 4WVFA 2J0QA 4F91B 3QXCA 1QBKC 2Q21A 2ZAOA 2PZFA 3SFZA 1DEKA 3CNOA 3NHAA 3PUVA 4A4DA 1N5JA 3QSYA 2R6GA 2ZSDA 2OBLA 1ETUA 5FFMA 1Z6TA 1T3SA 4Q4JA 4Q5IA 2UZ3A 2Q9AA 2J45A 1AIPA 4FW9A 4KI0A 5CLLA 3AGPA 2JLVA 4OQLA 2V1XA 2BMJA 2QAGB 3PFIA 2J7PA 3U2QA 3ICQB 4WAUA 4BPBA 2ZI7A 4AG5A 1MH1A 4PO9A 2O8FA 1KI7A 1M7HA 4PSKA 5JRJA 4R71A 1FQJA 4P3YA 1RC8A 1F48A 2J1LA 1YE8A 3EPKA 1SVWA 2GXSA 2YKGA 2PEYA 1ODFA 1XD2B 1XTQA 2ZR0A 2BV3A 5E3HA 4D4KA 4JLBA 3LBNA 4BZPA 4ZKEA 3EZ7A 3W6NA 2GJSA 4NMMA 4Q03A 4AYWA 3DHWC 4V0MA 2XZLA 4E09A 1FNNA 2ONKA 2G9NA 3BRWD 1TL7C 5CDFE 2C78A 2WIBA 2DWPA 4DSUA 2QBYA 1KO5A 4PFSA 4ARZB 1BYIA 3LXRA 2NQ2C 5C4GB 2IYTA 1WMSA 1NLFA 1WA5A 1BMFA 3L0SA 5TDHA 1OYYA 3CRVA 2X2EA 1KYIA 3TQFA 1LVGA 4U7DA 1QG2A 1YKSA 4EJSA 4NYJQ 3SEAA 2DFLA 4TL6A 1Q57A 2GVZC 1ZW6A 3NBZC 4LZZA 2PT7A 5B58C 1N6KA 3QY0A 1CP2A 3V4FA 2EYUA 1A2KC 5K8LA 3DZ8A 3GFOA 1Z47A 4KODA 1DG1G 4GT1A 1H8HD 3QUSA 1X86B 3QBVA 2ZQ5A 4TQAA 1HT1E 3TAHA 1W36D 4NCHA 5L3RA 2CEAA 1CS4C 2FA9A 5B30A 2ZJZA 1AN0A 2ZE7A 3FB4A 3VR5A 2C9YA 3IUYA 2GK6A 3K70B 1ZUIA 3AF2A 3B1ZA 2IYSA 4AKEA 4UNPA 3J81k 1VIYA 2WVJA 3HP1A 1VYTA 1SVKA 2ODBA 2JGNA 4UNNA 3QXHA 3TK1A 4GP7A 1YZTA 2JA1A 3NBXX 4HLCA 3U7EB 1OXSC 2V4ZA 2GHIA 2IS4A 3X1YA 1YZKA 4DDVA 2GCOB 4CEIB 4DLUA 4QC2A 4YDHB 1N5KA 2FSIA 3W34A 3K0SA 1I2DA 3EA5A 4LV6A 1E9AA 2QPOA 3GMTA 1BIFA 4BASA 4KHZA 1LFDB 1UEIA 1SXJA 4PQRA 4OK5A 4JVNA 5FTLA 1Z0JA 3B85A 5JEEA 2ZRPA 4O2RA 2IS2A 4KFRA 2J9RA 3D6TB 1VG1A 1X6VA 1FQKA 1W46A 4D25A 2W83A 1P60A 4NYMQ 2AFIE 1YVDA 5D3MA 2ZE8A 4NCNA 1VPLA 2PCLA 2DWQA 3K0EA 3QKSA 2EW1A 2R6CA 1F2UB 2N42A 1E69A 1NIPA 3CPHA 1EESA 1HURA 2D06A 5JHGB 3QBTA 4WBSA 3RABA 4LYAA 3FKSD 1CEEA 4L8GA 4I1SA 1ANKA 3WRYC 4M1KA 3KQNA 2CJWA 2FSHA 2ZJ5A 3OF5A 4JVLA 3K0CA 3ZD7A 1GNQA 3KQKA 3RS2A 1PV4A 3FFBA 3H4MA 2DR3A 3SBEA 1UBGA 2ZRKA 2PH1A 3R8FA 1ZNWA 1NMZA 4KFSA 4PPQA 4C0AC 3EZFA 1NP6A 1RZ3A 2GESA 3K70D 4NYIR 4CEJB 2FSFA 3TSWA 2C8VA 4BRWA 4URVR 1OLOA 1XNJA 1G4AE 1OIXA 1ZVQA 4S2EA 1NI3A 1KJZA 2HLDA 4A1FA 3ADBA 4PHHA 4QGGA 4M1OA 1DELA 1N5LA 2MSCB 2VHTA 1JJVA 1N6NA 1KZ7B 1NF3A 3RS0A 3AVYA 2W2XA 5TY0A 1UJ2A 4EAQA 1XX6A 2RB4A 2ZRMA 5H8WA 1SVOA 1U8AA 2ZRDA 2EFHB 2VH5R 3PUXA 3VTKA 4HDCA 2ZU6A 4DLVA 2R9VA 3UPUA 1YRBA 4JVSB 1A4RA 4V03A 5DIFA 2IEYA 3Q5EA 5AUNB 1D2EA 3OE7A 3QXXA 3THYB 3TVTA 3CH4B 4OYHA 1MABB 2IYQA 4M1MA 5DGXA 5FUWA 3S1AA 4TT3A 1JR6A 4M9QA 1UBEA 1Z08A 4DHEA 1MRSA 1OH6A 2C96A 4LPKA 1F5NA 3W6OA 4B35A 3GJ3A 1CR4A 4TN1A 4RZUA 3AF4A 2TMKA 2ZRCA 1OSNA 3SYKA 1S1MA 1Z0DA 1C1YA 5AK0A 5EE9A 2CVFA 4IXNA 4K46A 2OLJA 3BB1A 2X2FA 3B1VA 3E70C 1HEIA 1D2MA 1XCMA 3CPEA 1GKYA 1VCIA 3OZXA 3U5ZB 2HUPA 4JSYA 3VR2A 2FEMA 2XOKD 4URUR 4TZ0A 1ZIPA 2ZTSA 1P6XA 3LBHA 3REGA 1T5LA 4Q4HA 1FMLA 2VEDA 2OAP1 2A2ZA 3M1IA 4PPNA 5A0FA 5DN6D 3EZ2A 2RGEA 2X1VA 4IXMA 1UEJA 3ZZ0A 2P6NA 3W5IA 1MO3A 2BBTA 3DVLA 1Q1QA 1K5GA 3AB3A 4D4JA 4CEHA 1U99A 1U2RA 2UKDA 5JHHB 2EVWX 1UBFA 2GEUA 4FINA 5DI3A 2ZRFA 3WBKA 3R9XA 4C0BA 3A1VA 2O52A 1CKEA 3A36A 1WRBA 4HI0E 4GMDA 4JLVA 1VKJA 2A3RA 1UAAA 2E1RA 5TVKA 3UXMA 4ACBA 2ZRAA 2VP6A 2ZJBA 1F3OA 1RJ9B 4XD7A 2V54A 1U9IA 2WJHA 3CW2A 4IDOA 4ZV4A 1KKLA 2DYKA 1RFLA 4AURA 4IEIA 3FKQA 1AGPA 2VHQA 3IO5A 2JLQA 4NPHA 4BFYA 4M2LA 2ATVA 1HA3A 3ZS8A 1A1VA 1R7RA 3MWJA 4JSTA 4GPTA 1RRCA 1XFAA 3QPUA 1F2TB 5BYKA 4RCYA 4HAYA 2X77A 3G5UA 3Q7PA 4UNSA 3K9GA 1G19A 4B44A 1N0UA 1GKUB 1JXMA 3VR4A 3AVUA 1NIJA 3QXJA 3GJXC 4CT4B 1UKVY 5AUOB 2G88A 2RH5A 3K9NA 1SHZA 2ONJA 3ZIAD 4TYYA 5C18A 2WAYA 3GLHB 1UPTA 4XTRA 5J4LA 3BC1A 3UK6A 1BYUA 4Q7KA 3LV8A 1GL6A 1KK2A 4ZDIA 2WJIA 4JLNA 1WBBA 2HF8A 5JZVA 4V0NA 4V0KA 4BFXA 2GAOA 2NZJA 3L0PA 1S96A 4DKXA 2C2HA 1R8QA 5CM9C 2JASA 821PA 4LHYA 1I4DD 1XBTA 2XZPA 2WTUA 1SVIA 1U0LA 1KI1A 1NSFA 5JSZA 4M8NE 1TQ4A 2EYQA 2WPDA 1ZNXA 1E0AA 1SZPA 1D8TA 1E9DA 3IGFA 1EFTA 3G82C 2E87A 2G3YA 4A15A 1P3JA 3BFKA 4O2LA 1II0A 3OIUA 4OI0A 1KHTA 1XEFA 4C2UA 1ZMXA 1SXJC 1W5TA 2IL1A 4A6XA 2IXFA 1Z0KA 1RVDA 3C5HA 4MYHA 4AC9A 3CKLA 3LO5A 2NPFA 5F3WB 1DVRA 1S8FA 1XD2A 1ZC3A 5G40A 2QY9A 4XVUA 5KHOC 1L4UA 3B60A 3CZQA 2KBEA 3IEVA 1XD9A 2DFTA 1XU4A 4IOLA 5IT5A 3ZYCA 2QA5A 3IIMA 1P9RA 1EFRD 2BEKA 1QRAA 1ZYUA 4HLDA 4QRHA 4A0RA 2V1UA 3FTQA 4BFWA 4GI7A 1GNRA 5EE3A 3GFPA 1B0UA 1NN5A 2WWGA 3GD7A 3KXLA 2VRWA 2KB0A 3TMKA 2G1KA 4DSNA 4FCVA 1KO1A 3RSLA 3K0CC 5FPHA 1T0JB 5GJCA 4Z1MA 4A0HA 2OG2A 3FMOB 2ODNA 2PBRA 1YR6A 4P4TA 1E1RA 3WMEA 3IPXA 1DAHA 4LCBA 2DPXA 4B47A 3Q8XB 5FTNA 4GMXA 1NN1A 2RHMA 3V4RA 2RCNA 3GPLA 1R6BX 2W2VA 2W6JD 1HYQA 1AM4D 4IRUB 2QRZA 1AS3A 4JLOA 5E7JA 5EUMA 3PEYA 3B82A 5FUXA 3HU3A 3GCGA 2CHQA 3W8RA 1P2UA 4RD3A 1WF3A 4OI1A 4Z54A 2BEJA 4DT1B 4D0NA 2R65A 1NNEA 2IWRA 3CRW1 4EJSB 1ZM3A 1KI6B 1DE0A 2HT6A 4CEIA 2ZS8A 3RLFA 1EGAA 4HATA 2BCGY 2HDNB 3TIFA 4N3NA 1QHXA 2O8EB 4IKEA 5GJBA 2H8KA 2WWFA 3HDTA 3JVVA 5FTMA 2JLXA 1KY3A 3DM5A 3SBDA 5K8TA 3T12A 4B6FA 3BBPA 4M9ZA 4PPGA 4Q7JB 3AQ4A 3NDPA 5KOYA 1JAIA 2X8AA 1G17A 3KQLA 1K5DA 2G83A 4IOKA 1UDWA 4QHYA 1Q12A 4RZ3A 1SULA 4DIEA 3KJEA 1EX6A 1UF9A 1ZBDA 3NVAA 4DRZA 3BFVA 1ZD8A 4I1OA 1IN7A 3K09A 4PO8A 3EPJA 2J7PD 4KBFA 3CX6A 2OESA 1F2UA 1GL7A 4DXAA 3EASA 2GEDA 2BJVA 2H57A 4W5WA 1NKTA 2FWRA 2GWHA 4WIAA 2Z0MA 3BFXA 3T5DA 1D6JA 3LH5A 2CK3A 4MKIA 5DI9A 4NCIA 1NBMA 4TMVA 1N6LA 4JKIA 4KYIB 1ZP6A 3AVWA 2QQEA 4TTQA 2OFOA 3X1XA 4GNKA 5CIWA 1XMVA 4TL8A 4P4UA 3GEHA 5FPYA 3UWOA 4LJAA 4F7WA 4CZ2A 2HYIC 5BN4A 1E32A 3TKLA 1GUAA 1ZCAA 4JLKA 3AKCA 3CO5A 3N2IA 1MRNA 1IN5A 2QUZA 4IOJA 3NKVA 4JBYA 4TLCA 3VAAA 2XNSA 2V7QA 3U3MA 5D3MB 4TL7A 1BMFD 1TUIA 1CBUA 2AWOA 4ZI3A 2ZJYA 3B5JA 4EPYA 3QKSB 1Z6GA 1FPMA 2AK2A 1HQCA 4LC1A 3FPAA 4BFZA 3DDCA 1E99A 4KFUA 5JJIA 3THXA 1JPJA 4PAOA 3K9HA 4L5BA 1XEXA 2WWYA 4I4LA 3FMFA 1Y63A 1J70A 2JJ8A 2CJWB 4DCVA 4B76A 1QHYA 2IHYA 2NO9A 2R6DA 3DMNA 4LJ8A 4TMKA 2XTMA 6Q21A 2HT1A 2FDCA 1FUUA 2WOJA 4RVCA 1VCNA 2VBCA 4PC7A 3THYA 4LJ4A 3CX8A 3PITA 1NG1A 4KXFB 1GILA 1Z8FA 2JCSA 3K0FA 4RKFA 4DLZA 2FF7A 5EUQB 3RHFA 5IDVA 1KK0A 3AVPA 5JS8A 1TU3A 4F93B 5KNBA 2ZI9A 1TQ6A 1UKZA 2XZOA 5IRCD 2QEQA 4MUBA 1OF1A 3MSXA 5FOSA 1P61B 4OBEA 1E9BA 3U6KA 5EZ6B 1E1QA 4BLSA 4MA4A 2QTVB 5FBVB 5FPSA 3P26A 1W36C 3AVXA 4B3DA 3CF2A 5HE9A 3VNVA 1Q3HA 3RS5A 4DCTA 3WP0A 2ZRLA 3BWDD 4YONB 2EWVA 2A7QA 1A7JA 1E2FA 2NO7A 3EG5A 3P20A 3R7WA 2QP9X 1A2BA 2NO0A 3MGCA 5KPJA 3P4YA 5FBWB 5HR5A 2PEZA 4R2IA 2QAGC 3ZS9A 4EFMA 5AJYA 3X1WA 1G4UR 2H7VA 2CLCX 4JLJA 1DBSA 4HDOB 1JR3A 1N6HA 1XZPA 3E2IA 4MYCA 5DO9A 4M0LA 3SJZA 3SJAA 2OZEA 5FOUA 4PSAA 3RNLA 2EFGA 3C15C 2ZI3A 2RGBA 3T5GA 1W4RA 4JLDA 3BD9A 3X1ZA 3U7GA 1G7TA 2XB4A 1PJRA 2ZYUX 3EAQA 5CB6A 3FHTA 1D5CA 1T3HA 1E2HA 2A5FA 1S3SA 4Q4HB 1JXOA 3CNLA 5E4FA 1FL9A 4A2QA 2V6IA 3C41J 1XCGB 4Q66C 4DBLC 3FVQA 4Q9KA 3PQCA 4LV5B 4C7OA 2UVQA 2QN6A 2AKYA 2HLDD 3UG7A 4M1TA 1X8KA 2YINC 3CX7A 3QI2A 4XWAA 3DM9B 5CM8B 5H68A 4TZ6A 2XNDA 1ZUHA 2IF0A 3BGWA 5DI3B 2DY1A 3BH7A 2ORIA 1XTRA 4YMTA 1S3GA 5HZHA 2V9PA 3IHLA 1E4VA 1N6OA 3NG1A 1EG7A 2F1HA 2WWWA 3AUYA 3L8YA 2ZRIA 1TEXA 1IHUA 1U8ZA 3B9PA 3C14C 1OFIA 5GVRA 1OFUX 3GLHA 2G77B 3RC3A 3VHLB 5B57C 1DS6A 3QIAA 1LF5A 4DLWA 2Z83A 5FOWA 1G5RA 2WJVA 4YC7A 1NLYA 3K70C 2C77A 3OE7D 3BERA 1QF9A 3SC3A 2QG6A 3G0HA 3VQTA 4TT3D 2VLIA 3SYLA 1DAGA 3B78A 4DCNA 4BFUA 2PT5A 2OILA 1GRNA 2QORA 4OHVA 1Z3IX 1G3IA 3KB1A 1E2PA 2YWFA 1VYVA 4EPRA 4ABYA 1C4OA 5B2ZA 1MT0A 4ITRC 3DEFA 4BLRA 3D31A 3EC1A 1E9CA 4R7ZA 1GFIA 4QXAA 2DFNA 3AKDA 4YQFA 4XWKA 1ZNZA 4A8JB 2AL7A 3RS7A 2W6IA 5G53C 3I72A 5JMTA 1KDRA 4CYMA 1Q1ZA 1Q44A 1VDZA 1D9XA 1SVSA 2F3TA 3KL4A 1E2NA 2O8BB 1Z0FA 1GIAA 2IYXA 5CDFA 2CHGA 2JJ1A 1M1YE 4LV8B 1ZIOA 1HH4A 4ZI2A 1PZNA 2PMDA 5FPKA 5JS7A 4BLTA 1CJVC 2RGNA 4RD1A 2WHXA 3R9WA 2EWWA 1R8SA 1YRAA 4PHFA 4B32A 2O8DA 4QNRA 4WZ6A 4M1WA 2R62A 5JSZB 1TX4B 3THWA 3AVVA 4UJ5A 2J0SA 4XJXA 2J0UA 2YNMA 1NLZA 3UWKA 3KJGA 1E2KA 4XOIA 1VYUA 4EKDA 1IQPA 4V02A 3U60B 4G5RA 1CR1A 1UKEA 1GM5A 1ZC4A 4IDQA 4D81A 3AF0A 2FN4A 1VHTA 4XD7D 3CM0A 4US1R 4TQUS 4PR0A 5F98A 1CULC 1JECA 5AJWA 3VU9B 2AWNA 3OEEA 1QVAA 1P9NA 1AZTA 3OEHA 4NONA 5JBQA 3LQRA 1E79A 4Q9JA 4X8MA 5AJXA 3Q5DA 1KNQA 3OAAA 1ZM7A 2PL3A 4URZR 4XTCS 5JCZA 4B3BA 3LLUA 4FI3C 4AIIA 2IHBA 2ZJ2A 4Q9LA 2GVDC 4WA7A 5LB2A 3DL0A 4DT1A 3AP3A 4Q01A 4PPFA 1X8JA 5HKKA 1KI6A 3L0OA 2B8TA 3BB3A 4DDUA 2OHFA 4QJ3A 1I2MA 3HR8A 2O8EA 2I3BA 2FGKA 4OJQA 121PA 5H1YA 1DAKA 5BXQC 4ZPXA 2QT0A 4MRNA 1E0KA 4D80A 1NVVR 2D7CA 4NE2A 1GRRA 1BO6A 2JIZA 2FG5A 3PUZA 1W48A 4HB2A 2Z43A 3AH8A 1TU4A 3AVQA 4ZCIA 3QKTA 5HE8A 1XEWX 1ZM4A 1MOZA 4D4MA 2C5LA 2KWIA 3EWSA 3W8NA 2F1IA 3T34A 4DEYA 1II8A 4JLAA 2V3CC 1Z2CA 3U6BA 2WPDD 4BLPA 4W7SA 3SYNA 3CUEF 5G3ZA 3U61B 2CDNA 3KQUA 4LHVA 2ZIAA 2W58A 4DCSA 2HCBA 4EPVA 1XEWY 4XSGA 3CZPA 1YHNA 4F38A 4UJ3A 4IEEA 3LA6A 3HU1A 3UMSA 3GLGE 2KSQA 2RGXA 3EPLA 1E4YA 3Q9LA 1TTTA 2IUTA 2GF0A 1KKMA 1W0KA 1XMIA 1ZAKA 1T9HA 1KGDA 4BQSA 4OL0A 4MKFA 4GDFA 1Q21A 4GOJA 1KI4A 4DSOA 1LS6A 4R2HA 2V8OA 1RYFA 2VF7A 1JEDA 2GF9A 3QVUA 4UXJA 2F1JA 4KJZA 3K1JA 1M34E 1W2GA 5IF9A 2C98A 3WBJA 4DLSA 4BUJA 1AK2A 2O5VA 2Z5FA 3TE6A 3NHBA 3SQXA 5L3SB 2XB2A 1IXZA 2WMOB 2WOOA 2GXQA 5FBLB 1RPZA 4Z1MD 3M6AA 3AF1A 1E0JA 1R5OA 4DB2A 1W5SA 2Z4RA 1SVMA 5IK2A 1JNYA 4W9MC 4FWTA 2OUKA 5FL3A 3IPYA 1E1RD 1EX7A 3QENA 4BZQA 3FOZA 4MDEA 5UKDA 2CL7X 5M04A 1WXQA 2QU8A 4ZDJA 5KNCA 4QG7A 4I99A 4MKGA 2J7KA 2A5JA 4MUAA 1VG0B 1WP9A 2WV9A 1N0WA 4URXR 2DB3A 4RZ2A 3DKPA 3RRZA 4QM7A 3MJHA 1OH8A 1KO7A 4GSYA 1NRJB 3WXMA 4AKIA 2GBLA 1DPFA 4L15A 1XJQA 2C03A 2WJJA 2BWJA 3KB2A 1Z29A 4JKYA 1OIVA 2VIIA 2XEXA 4BLQA 1YR8A 1N0VC 5FOVA 5TV2A 4PC6A 2ZEJA 2ZRNA 4UNRA 5CIQA 4A92A 3KKMA 2HEIA 3O47A 3THXB 1G5TA 3U7FB 4TSFA 4Q02A 2GCPA 1XEXB 1E2DA 2J0VA 4CT5A 4X8LA 3NC1C 4ZO4A 3HPRA 2FOLA 1HT2E 3SZRA 3H1TA 2Q3FA 1UDXA 2NZ8A 4H1UA 4MRSA 3PVSA 2ZJ8A 2BMFA 3L2OB 4IDNA 4II7A 4RZXA 2ORVA 1XPOA 1G3UA 1KMHA 3W5JA 3BH0A 1QHGA 5CK5A 1Z6YA 3MLEA 3K0FB 2OFWA 3P27A 4K8OA 2ZSFA 4KBGA 4NCJA 2VA8A 4V0OA 1AQUA 2P6RA 1EFHA 1YQTA 1W7AA 2OM2A 2AX4A 1T91A 2ANCA 3EXAA 4GFDA 5G3YA 1HV8A 4KO8A 2FFQA 3W90A 3QPWA 4NCKA 3SNHA 4AD8A 1MKYA 5BYJA 3CIOA 2CK3D 4XWOA 1NMYA 2G0NA 1NBMD 2GJ9A 5AUQA 4LUCA 3W3AA 5DYIA 4DSTA 5ANRB 3I32A 2CMKA 1FX0A 2IYYA 4IVRA 5F9FA 2HCJB 5BWMA 2NIPA 5SZJA 2QGNA 3I3SR 1QHSA 1EK0A 2AK3A 2YC2C 3PIRA 3R7WB 3QJYA 3GFTA 5KDOA 4QJ4A 3W6PA 1MO6A 2EFEB 3AF3A 1GWNA 4AI6A 2H17A 2V7QD 2B21A 4OHXA 4EIWA 2VSXA 2IXEA 4TQ9A 3SU8A 3NTUA 3EPHA 2F7SA 3DO6A 1FP7A 2YVUA 1G1MA 2ZRJA 1VMAA 4A9AA 4O0MA 5CITA 2D7DA 2YYZA 4QGAA 4DVGA 4DEXA 3REFA 4EPWA 4QNMA 2ATXA 2OBNA 4Q4LA 2GXAA 1ZD9A 1Q1BA 2F9LA 1Z06A 3A4LA 3GJ6A 1T4GA 4CIDA 2H18A 4TYQA 3T61A 3CF6R 2OT3B 3JVUA 3JZAA 3SHWA 4D4LA 2P0EA 3OHMA 4LY6A 4I81A 4MGYR 4P33A 4ASUA 4CVNA 5J47A 2QAJA 3NC0C 1G41A 1LY1A 4QBFA 5CLQA 3TLXA 1N2CE 5F2EA 2WSMA 4RFSA 3C7KA 4PO1A 1OJLA 5KO2A 4QGHA 1ZRHA 1LB1B 3V00A 1R10A 4AWXA 4EJSC 2BCJQ 521PA 1WQ1R 4GRAA 4A0GA 4D82A 2E9SA 3BJIC 1G8PA 3KKPA 1OW3B 1E9EA 2ZYTX 4OQFA 1RE0A 1QZXA 3PR1A 2JEOA 1T8UA 1JBKA 4A8JA 1E1QD 2ZRBA 3UG6A 1KMQA 4OHYA 1Z83A 4F92B 3A1UA 1COWA 3SJBA 2W0SA 4AYTA 2O8BA 2C04A 2G0TA 1J7KA 4URYR 2C95A 2D62A 5FL7A 3LW8A 1L7VC 1BKDR 1FZQA 5LBIA 1IY2A 4RCZA 4ZIRB 5EP2A 1P75A 3QEJA 4IDHA 3A4NA 2KE5A 1UKYA 4M53A 3NBFA 1G8YA 1ZJ6A 3HU2A 4HLUA 3WMFA 3LWNA 1JR3D 3K53A 2WJYA 3KTAB 2Q9CA 1XPRA 4FD2A 1W4CA 5EE1A 3NH9A 2H92A 3PV0A 4ZDWA 2GTPA 4D0GA 1IJFA 2Q9BA 1MV5A 2A5GA 2OCPA 2QZ4A 5J40A 4F4JA 3ZVNA 1LS1A 3MFYA 4MDFA 2NO6A 4JL5A 3VU9A 4HAXA 4HEJA 1KI2A 2WM9B 1OT3A 3EIEA 3CNNA 3SN6A 4XVQA 1E3MA 2QSYA 4W5JA 1G3QA 2QM7A 4DLYA 2V55B 1GNPA 2IYUA 4B48A 5DNYB 4G5OA 5LPNA 2DFKB 2O8DB 1ZNYA 2AKAB 4HUQA 3LXXA 3THWB 2GKSA 2XNDD 2QP4A 1E9FA 4LBZA 3FYHA 2ZYVX 2J0UB 1S4QA 2NMVA 2CE2X 4HAWA 1PLJA 3KJIA 4GOKA 2F9MA 3B1YA 3I1FA 1KIMA 5KNDA 2CCKA 1KDPA 3BAFA 2OFXA 3KXKA 5KTYA 3EIHA 2CCJA 3ZZTA 2ERYA 3I4LA 3KX2A 2XXAA 4QJ5A 2BIFA 5LD2B 5A5GA 1OH5A 1JPNA 2JATA 4KCGA 4QGFA 5DYGA 3CRMA 1G16A 4BRUA 3B9QA 2WAXA 3DPUA 2RGAA 1KK3A 4WZAE 1TADA 4FCTA 3ZJYA 3NBYC 5FI1B 2CL6X 2PZGA 3LX5A 4IJMA 1N5IA 4Q1FA 4A36A 2IUSA 3TSZA 2VHCA 4LYJA 4Y0AA 4HUTA 1F60A 2VP0A 4NZYA 3TJZA 4FMCB 1JQLB 4AYXA 2DHRA 2K5UA 1YR9A 1LTQA 3AV0B 4PC1A 1EXMA 5CK4A 2W6ID 4QBGB 3SE0A 2WBLC 3QXSA 2KI5A 5GADl 2LKDA 4RY2A 2WWXA 2CBZA 4OKSA 2JJ1D 1BOFA 2QNRA 5KSPA 3WHKA 4B33A 1KAOA 3AGQA 1RRGA 1XJ0A 3OIVA 3KUDA 1EWRA 4NYIQ 3H84A 5HZKA 2XSZA 4Z8YA 3DOFA 5FR1A 4TYPA 1E2MA 4TMTA 3VX4A 2P3SA 2LCFA 2ZE6A 1L8QA 4OJKA 3PEWA 5KDDA 1II8B 4IW3B 1UBCA 3CRQA 3T35A 2IS6A 2PJRA 2ZPTX 2REOA 2IYWA 3T1VA 4BWYA 4DLXA 4ERNA 5A4JA 4O3MA 4L4UA 1DAIA 5L3SA 3F3YA 1VECA 4LSGA 2WIAA 3E1SA 2ZITA 4Q1DA 3IEUA 2IX3A 3OIWA 1E2LA 2OCYC 4G3XA 3EARA 1W4AA 2FPLA 3OEED 2ZM5A 2F3RA 4WXRA 2BOVA 3OEHD 1AKEA 3B13B 3GJ7A 4RD0A 1E79D 4PSVA 4QL3A 4ILEA 1RKBA 4MQBA 4UNQA 5JWRA 3OAAD 1ESMA 2RMKA 3C5CA 1GTVA 1P7CA 1I4TD 2HJVA 1ZINA 2B7BA 3TUIC 2JDID 2QI9C 4NYJR 1FP6A 5DHFA 1CU1A 1US8A 2GJ8A 1ONBA 2YZ2A 4OQNA 4OQMA 4PXAA 3RYTC 5HKKD 3EIQA 3IILA 2XTZA 1W44A 1W0JA 1VIAA 4C30A 3Q3JB 2MMGA 2VF8A 1U9IC 4BZXA 1GKIA 1GAJA 2PJZA 5EXTA 1WE2A 1P2SA 3TR0A 4YMVA 2JIZD 4HB4A 2A30A 3MMPA 4JYBA 4PHTA 4LC0A 1TNDA 1GG2A 5KDLA 3ADCA 1I4LD 3KJHA 4MGIR 2RHDA 4CGZA 4LOAA 1Q0UA 4BEJA 5FI0B 2OE2A 4LDJA 5EE0A 4X8HA 3AVTA 1AA9A 1E2QA 1NY6A 4LYFA 2B7CA 4IFBA 1AS0A 3ZLJA 1HQYE 4HAZA 1TAGA 1G6OA 4PZZA 2G6BA 2NO1A 3CPJB 1X8LA 3GQBA 4A8JC 2ZSEA 3PEUA 2QSZA 3T1TA 2CLDX 3AKYA 1XZQA 2FFBA 5CB8A 2IBMA 3MWLA 3U3RA 4MKHA 3JZMA 2P6UA 3F5FA 3WHLA 1R0YA 4C0JA 3I61A 1N6RA 4A6PA 5L8VA 3MRSA 3QQ5A 4TMZA 5IHPA 4GZMA 2NG1A 4B75A 1SHKA 2JLSA 3B7GA 1W0KD 3K0AB 1GL9B 5J4KA 3ASYA 2PMKA 5BW8A 4NYMR 1Z5ZA 3EX7C 2D2EA 1S0UA 3U3OA 1SVLA 1KMHB 3QF7A 2WWHA 3PXGA 1R2QA 4PHGA 3LNCA 1S2MA 2FPMA 4N0EA 4UQOA 4ESVA 3T1OA 3BXZA 1P9WA 3NEYA 1Z28A 2GJAA 5E7MA 3QKRA 1T3LA 3I62A 1PUIA 4Q48A 1W4BA 2C99A 4IVQA 1R0XA 2ZR9A 2CNWA 4P0TA 2DWOA 4RD4A 2QQ0A 3RS4A 4CF7A 5K8IA 1N6IA 3GLIE 4HAVA 5IK2D 1A82A 3WY9A 1OHHA 3ICEA 4PTLA 3AP1A 2AFHE 3B2EA 3ADKA 3RANA 1FX0B 2ZJOA 3BE4A 3MAAC 3RSOA 4MRRA 2KJQA 2VL7A 3MD0A 2Z4SA 5EQTA 2H16A 2WKQA 5FUYA 3O8DA 4PZYA 4PZLA 1XMSA 2Q3HA 2VP4A 3LY5A 5HCIA 3DZDA 1AJEA 1R0WA 2BHRA 2ORWA 1RYHA 2D4HA 3NXSA 4N1AA 1NVWQ 3LFUA 3QEOA 4FCWA 5TARA 5AUPB 1XTKA 2FEOA 2ZRHA 1CRPA 5JFGA 5J4YA 2CE7A 4Q47A 4X8OA 4TSFD 5GJWC 4KU4A 5EXXA 3PUYA 2UZIR 4F4IA 5FUVA 1NL3A 1YZUA 221PA 1QG4A 3ZZUA 1OV4A 3VFDA 1RRPA 2JLWA 1PLKA 2J59A 2GK7A 2W00A 3NH6A 1J90A 3FMIA 4QBHA 1OXVA 4TLDA 4ZCLA 5DISB 1GP2A 2CVHA 3IKJA 1YJ5A 2OXRA 5FOXA 3TGPA 1C9KA 4ZIRA 2OXCA 3IDQA 1HY3A 2GAAA 4M21A 5EXSA 1QHNA 2VP5A 4KAXA 5CYPA 2WKRA 4OHZA 3KFVA 4LWZA 5JEDA 3KZ1E 4KVGA 1KOFA 4RFSB 2IF2A 2CCGA 4MYTA 1TF7A 1OH7A 4CW7A 3KXIA 1DTSA 2BJWA 2ZUDA 3FMPB 3KTAA 4DWJA 1CF4A 1W1WA 1E2GA 3X2SA 4D6PA 2QE7A 1SGWA 3QF4B 1KSGA 1B23P 4PQYA 3GJ0A 2PLFA 1FMJA 4QOSA 4Q1CA 3TR5A 2ZI6A 3SI7A 4DLTA 2P5SA 1E0SA 2VHJA 3QPVA 1IXSB 2QT1A 4BLOA 4C2TA 2XGJA 2I4IA 3SR0A 1DAFA 3Q85A 1S9HA 4IVPA 4PAQA 1G21E 2AD1A 2NOAA 3DMDA 3FHOA 1XPUA 3TW4A 5AJVB 1DADA 3B1XA 4Q1BA 1V43A 1DO0A 3CF0A 1II9A 3K09C 2GEVA 4EPTA 1UADA 3C16C 4LX0A 3RC8A 5FOTA 4WXPA 4FMDF 4BFVA 1WCV1 5JCPA 1E98A 1KJWA 4WW0A 2XAUA 4LBVA 2RGCA 3RRYA 4E5UA 4P4SA 3ZVMA 2IEZA 5CYOA 3BK7A 2ZROA 4EQ6B 4KSBA 4PANA 1W49A 1NY5A 1E96A 2N1BA 4KFTA 2PLRA 3FWYA 1Z2AA 3KDSE 5JECA 4TYNA 1E2JA 1KAGA 4POAA 4Q18A 1J8MF 2VTKA 3SOPA 1CTQA 1JI0A 4ASUD 1DAEA 3ZD6A 4Q9IA 1ZM2A 4JL6A 3TH5A 1XF9A 2RKOA 2J5XA 2L0XA 5KUTA 1OB2A 1IJEA 4MITA 3T15A 2F6RA 4M22A 2I1QA 4LHWA 2Q0HA 4TTRA 5DH9A 3VNUA 1JALA 4HUQB 2JDIA 1DG3A 4B34A 3BB4A 3BS4A 5SZHB 3MUFA 2RAPA 4JLPA 4PC3A 1U98A 2F1RA 2GRJA 2WICA 3BORA 4RFVA 3GLGA 3H86A 4LPSA 1OXTA 4B43A 1OYWA 3CRRA 2BBWA 1G8HA 4O25A 1IN8A 1G7SA 2VSFA 4JJZA 1ZU4A 1COWD 3BOSA 3WYAA 5EZ5A 2XXAB 2ZUBA 3L82B 4IOMA 5FL7D 4A82A 4L16A 2ZJAA 4B2LA 2OCBA 3ASZA 3KUCA 1G20E 3D3QA 1PVOA 2IWHA 4LI0A 3EWAA 1IN6A 3ZGXA 4W5HA 4Q9HA 3WNCA 3RS3A 3SJCA 2BM1A 2ZETA 5BN3A 4Q19A 3GJ5A 1NN3A 2CLSA 4G1UC 2BMDA 4U5XA 2XTNA 4Q7MB 4QKQA 5JRZA 1ZM9A 2FV8A 5C1BA 4GBMA 2IC5A 2NPIA 1AGRA 3HYTA 2GNOA 1KI8A 3I8SA 5GVSA 1G8FA 4U02A 1LNZA 1QHHA 5EJEA 2YHSA 3IIJA 4URWR 1NVXQ 3EZ9A 1RIFA 1XXHA 4D26A 4I1UA 1KZGB 5GJVC 4V0ME 5EXPA 3LVQE 3V9PA 2XJ4A 1KSJA 1XTSA 1Z6AA 3CONA 4BFTA 1FW6A 4B3GA 1CRQA 2VQSA 3DOEA 3ZH9B 2XX3A 2IYLD 4H1VA 2WWIA 1J2JA 4G5QA 3A1TA 1XTJA 3OIYA 3QOFA 1E9RA 1JQJC 1S1CA 3RVBA 2R6FA 3GP8A 1IY1A 3IQXA 1K6MA 1P62B 2X19A 4JZKA 4M9SA 5HCNA 1T0HB 3Q72A 2RGGA 1J8YF 1ZU5A 2P5TB 5JI3E 1CJUC 3VHXA 3IO3A 2ERXA 4OQXA 1OKKD 3TUJC 2P65A 3EZ6A 5DHAA 1VCOA 2QMEA 1M2OB 1GVNB 2KBFA 4UXIA 2YWGA 4AKHA 3TNFA 1IY0A 5E95A 2VP2A 2LKCA 2PCJA 1XXHE 1TPZA 1U0JA 4Q7LA 4QBIA 1OPXA 2ASEA 4XH9B 2A9KA 2C9OA 1K8RA 5EP4A 3FFAA 3WYFA 1CR2A 3MJRA 4HZUB 1HTWA 2O0HA 3AP2A 3O8RA 4DJTA 3GLFA 1T6NA 3IBGA 4RKEA 2ZI5A 3W9YA 3TW8B 1US8B 3WYGA 1CIPA 4C0QC 4NH0A 3OFNA 2ZU0C 1E9SA 4YMUA 1Z07A 4ACAA 2RGDA 5C2JB 4G5GA 3LRPA 3FDIA 4G0NA 4F4CA 2REBA 2C9CA 3F8TA 1N3BA 3GEIA 3VR3A 4DZZA 5B64A 1P4SA 1SXJE 3QG5A 4OK3A 1SKQA 1M8PA 4P31A 5JWHA 2IUUA 2P2LA 3EA0A 4KSCA 5ELXA 2IXGA 2IK8A 4HZIA 4KV9A 2CHVA 2ANBA 4L9WA 3K0AA 4NKRA 3AKEA 2XSZD 2GZHA 1MR3F 3CH5A 4C9BA 2FGJA 1TQ2A 2ZSBA 3RWOA 2QMUA 1F6BA 2BMEA 1OB5A 1CLUA 2MSDB 2IYZA 3I8XA 4WZBE 1L4YA 3N70A 4M4SA 1XP8A 4R9UC 3GLIB 3GLFE 2QTHA 4B74A 2FFHA 1H8ED 3SS8A 5K8UA 1N6PA 2JLUA 4TLAA 4B73A 2ZVPX 2BKUA 1WB9A 5DE3A 1J99A 2J41A 3LD9A 2Y8EA 3NWJA 5KU1A 4FXPA 4RD6A 2YOFA 4US2R 4HYYA 3RRMA 2AN9A 1G291 2YWEA 1SKYE 1Z0AA 2JJ2D 2RGNC 4US0R 2O8CB 3WNBA 4LYHA 2WSSA 4C0LA 2EFDB 2GETA 1ESNA 4EFNA 1G9XA 2ZI4A 1OIWA 4HB0A 4YMSA 3QKRB 5L3QB 4DUGA 1NJGA 2R44A 2VSOA 3IIKA 5HPYB 2FPKA 4OI4A 4B71A 1W0JD 2H1LA 5CJPA 3TRFA 1YU9A 721PA 1FTSA 4JT4A 4C3ZA 3MG9A 2ZS7A 1DOAA 1QHIA 5LD2C 1R0ZA 1CXZA 3TAUA 5KYKA 2B92A 4Q4AA 4WOPA 1XDBA 1KI3A 4B3XA 1U8YA 4LBYA 3GEEA 4HB3A 3UANA 2FX3A 3QNUA 1VTKA 3T06B 3OESA 3L0IB 5D3QA 5KSOA 4NL4H 1U90A 3MCAA 3U44A 2FZ4A 4L9SA 4N0DA 4ZDKA 1G18A 4KLNA 4C7OB 4Q21A 4MGZR 2A5DA 3VMFA 2JLRA 2OEPA 4HSEA 3SFVA 3E5HA 3LDAA 1AQYA 1HUQA 3O8CA 4TMWA 4V0LA 1NG9A 4MRVA 3P4XA 5DSZA 3QF4A 4HLQB 1G6HA 2WKPA 2ZREA 3KQHA 1KDOA 3UKDA 1YZLA 1TF5A 2BVNA 3ADDA 5AR1A 4NDZA 2F43A 2QTFA 1LV7A 3R20A 3AEZA 4LK2A 1MO5A 4DC9A 2BM0A 1DO2A 2PZEA 3THOA 8OHMA 1NVUQ 2J87A 3UATA 3A1WA 3AVOA 3C4JA 3MWKA 3IBYA 1EFCA 4QHSA 2P67A 1IXRC 1GITA 1SQ5A 1XJCA 4M1YA 5JLJA 3ND9A 2J3EA 5BQ5A 3SDZA 3IHWA 1Y3AA 2CNWD 1Z6XA 1H8HA 2A5YB 3UMRA 2LWIA 2MSEB 2QGZA 4P32A 3K9LA 4YXWD 3LBIA 4LJ7A 5JJLA 1KSHA 3LW7A 2QPAA 1OE0A 3TVDA 2G1JA 3U4QA 1AKYA 4EQ6A 1G3RA 1OXXK 1R4AA 1NVVQ 1OHHD 4ZKDA 5AJZA 3CR8A 1R5BA 4JT2A 4LRWA 3M4YA 3N5CA 2WMNB 3UMFA 4FN5A 3QVVA 1AS2A 1IN4A 1KK1A 4UXHA 2Z6VA 1ZD1A 2ODEA 3ONWA 2BC9A 4CRWB 2QAGA 4MYUA 3ZQJA 2QM8A 3I5YA 1OFHA 3W3ZB 5JWOA 1L2TA 4DCUA 2OLKA 2GCNA 3Q7QA 2VHUA 3X1DA 2OV2A 4BGDA 4MH0R 2BKEA 2ZXUA 4BE7B 1WDTA 4KLZA 3PENA 4M9XA 4YLGA 5G41A 4AY2A 1ZUNB 3L43A 3VKGA 4TTPA 3P1JA 4P4SB 1NJFA 3B6EA 3L8ZA 1P72A 1Z0IA 1ZCBA 1FUKA 1XB2A 621PA 1UM8A 1TQDA 3N2EA 1OKKA 1M6NA 2QP3A 3FE2A 1NMXA 2QMHA 4ARZA 4B3CA 3LLMA 1XMJA 2D2FA 2OSBA 1XWIA 4Q4JB 1BH2A 2FE4A 4BEBA 2O0KA 4Q1AA 3LVRE 1O3YA 3U3JA 2GBLC 3LX8A 5LDDC 3ZQ6A 1E94E 1KJYA 1JEEA 3CB4A 1GDDA 1IAQA 3HYRA 4R98A 1KDTA 4JS0A 1YZGA 5H70A 3KKOA 3FKSA 4C4PA 3SQWA 3VKHA 1GRQA 2O8FB 3A37A 4JIMA 4NP6A 4PX9A 4LJ5A 4TL9A 3PCRB 4IDPA 2DBYA 2YC4C 4TYWA 1RW4A 1LW7A 1T5IA 4Q00A 3EW9A 1E6CA 3GLGB 2QE7D 1QVRA 2D74A 4BECA 1G64A 2OO7A 4J0QA 4S35A 4CDGA 1XTIA 3AUXA 3B8HA 4IFEA 2EU8A 2ZANA 3WRXC 1N25A 2FH5B 4NBSA 4JL8A 2QBYB 2WJGA 3ZDQA 1D2NA 3QKUA 1FTNA 4DDTA 3WNDA 3KKQA 1NN0A 3BH6A 3NEJA 2YJTD 5BN5A 3GJ4A 1G7CA 1FNMA 3HJNA 2F55A 2EFCB 3A4MA 3F0TA 1CJTC 3CWQA 2GZDA 4QM6A 3KFXA 4JBWA 2GCOA 5SZKB 4DIDA 5KPDA 1M74A 4UKDA 4OI2A 5C46F 4A2PA 3I5XA 4GP6A 3TQCA 2BBSA 2GJKA 2AXPA 2FJUA 5EP3A 4MGKR 1ELOA 2AD5A 4KYUA 1H8EA 1VG9B 4A2WA 3M0EA 3PUWA 3GJ8A 1P2VA 1QHHB 4PQFA 4OHWA 1RRFA 3KKNA 1XXHB 1IOZA 5FTJA 2REXB 2DCUA 3HWSA 4B2PA 2QMOA 3VKWA 4E22A 1KI9A 2JJ2A 1Q20A 3LQQA 2ZR7A 4B2IA 3NDBB 4YDSA 4FIDA 1X3SA 4C0SA 4TMXA 3VR1A 3WP1B 4HZUA 1X1RA 1VCMA 4Z8XA 1KO8A 1DAMA 4JYCA 4LGMA 1JAHA 2MMCA 5FPTA 1M7GA 3RDPA 4LJ9A 4NTZA 4B6EA 4AK9A 4IHQA 1PUJA 1CJMA 1D9ZA 4LHXA 3VR6A 2R8RA 2QROA 1TMKA 4FMBB 5FBRB 4RSGA 5TMPA 1M7BA 2XOKA 1SXJB 1YR7A 3K8YA 4NHOA 5KSYA 3EC2A 1AZSC 2IA5A 3SHFA 2WZQA 3R9IA 2FFAA 4DB4A 4LJ6A 5DN6A 2JAQA 4CEJA 1G8GA 4C0KA 2GILA 5E7IA 2SHKA 5L3VA 2Q6TA 2IYVA 2OBMA 3P32A 2W2TA 3ETLA 1TUEA 2ZS9A 4E03A 2XJ9A 2IT1A 3RRNA 4M1SA 4H9GA 2OCAA 3TSOA 2HYDA 3A1SA 2QRNA 4PAMA 2BBOA 4HDQB 4XSHA 421PA 1G3MA 2GZAA 3GLFB 1LF0A 5J5CA 4DDWA 4PC2A 1G7RA 1HE1C 1TEVA 3HPQA 3GLIA 4C0HA 4Z51A 1Z63A 1EWQA 2ZVQX 1W2HA 5EP1A 1P73A 2HXYA 3A58B 3MWYW 3PJRA 1FOEB 5FH9A 1BS1A 1NBME 1VG8A 4FMCF 4G01B 4YMWA 1MABA 1SKYB 4ZCMA 3I73A 4DLRA 1XCPA 2ZUCA 4KVAA 2NTYC 2W0MA 2YWHA 4RD2A 1S9DA 4RJLA 3AM1A 3CR7A 2O8CA 4XVRA 3A8TA 3CWZA 1U0HC 5LB4A 4LJYA 1QDEA 1X1SA 2VYFA 2YOGA 4HLUC 2CXXA 4NU0A 1IM2A 1KNXA 2IW3A 2ZSAA 3FHCB 1WBDA 3D7MA 3ND8A 2VP9A 5FR2A 3RWMB 3C8UA 3BIFA 3ZIAA 5L3QA 4GL2A 4ON9A 2J46A 4KITB 3QE0A 1JJ7A 1KTVA 1SXJD 2QPTA 1NKSA 3H2YA 4G5SA 4YXWA 3O8BA 3TBKA 3ECCA 5J4HA 1NSTA 3A6PC 2V6JA 2PX3A 4TLEA 4JVMA 2XITA 2HXSA 4JLMA 1UFQA 3DKVA 4JBXA 5SZIA 4I1VA 5JI2E 1KY2A 1P2TA 2CL0X 3B1WA 3S1AB 1U94A 4TLBA 3FGNA 2I1VB 2FSGA 5CJ2A 1EFUA 3WMGA 1CJKC 4FMDB
chains in the Genus database with same CATH superfamily
4OLFA 1UZUA 2HKIA 4N18A 3OM9A 2CFIA 1PI3A 2JGFA 4JMPA 4MDHA 3RIGA 3SDSA 5C4MA 4MLZA 4GI5A 1EBUA 2YYAA 4Y0VA 2RBKA 4Q3BA 5E0OA 1LK7A 1R5NA 1OXUA 3ZN2A 4AJNA 2CBGA 2QENA 2AHOA 4JBIA 2DLNA 2FMXA 4KX3A 3WLFA 1U7ZA 1HNNA 1VSVA 4PYNA 3HUEA 3NORA 2ZWVA 5T7BA 4QDOA 2FEXA 3FPEA 4DLBA 4MRMA 3SX4A 1A5TA 2H4WA 3I9MA 2R6AA 1JLSA 4QSMA 1IC6A 1MEJA 4Z49A 2X7XA 4BWVA 4CXMA 2ZIGA 2B9EA 2RAFA 4GZ3A 4CIWA 2ADFA 4RTPA 1KO4A 4FYXA 5A0TA 3VX3A 3ZU4A 4C4ZA 1FNBA 2VWGA 2K7ZA 3VI3B 4Q4AB 4BWGA 2HF9A 1AHPA 2JLYA 4Q0MA 5GONF 2IOYA 1MNAA 3OJFA 5AVOA 1CUZA 3UBMA 2B8WA 4HNHA 1Z22A 2Q1TA 5CB4B 1AB5A 2XUOA 3HR7A 3NIWA 4BB0A 2AR7A 2ZRQA 3SNKA 1GU1A 2BF4A 2JFHA 5JRJA 2QAIA 3H2ZA 3I4FA 4FFOA 3W6UA 3P2IA 4Y9RA 3U44B 4DY6A 1P5ZB 3VU0A 1Q3TA 3OCXA 3X1MA 1FFDA 3BMQB 4BP1A 4Z4EA 2X0IA 1ADFA 5E1MA 3R7LA 4YCNA 1YZNA 1RLUA 2I7CA 3DTVB 1P80A 1Z7GA 1PFUA 4ZVUA 5TXGA 5M34A 3HZOA 2H07A 2Y1EA 4KAFA 5A62A 3KOZA 2GA8A 3IVCA 2FWJA 4X3PA 1FU8A 1YQ9A 2WYOA 3UJCA 2GDZA 2H0RA 3K72B 1C7ZA 2HRZA 1OASA 2CXTA 3AYXB 4RY2A 4WDQA 3AO0B 1GOTA 1OWPA 3D0KA 1E92A 2IYRA 3PQEA 3W78A 3VUFA 1O08A 4OK6A 5BWOA 1E2IA 1L5GB 4LHZA 1QONA 3TUZC 4I5EA 1EP1B 1G38A 4ZZ2A 1B93A 3OZCA 4J7AA 3E7PA 3ZJ5A 1PJZA 4X92A 3DR3A 4Y2QA 1WUYA 3QSGA 4LTDA 4D99A 1FC0A 1T36B 1TM1E 1VP3A 1J06A 1KXJA 1V5GA 4LWQA 5LUBA 3M82A 4D9NA 3W8FA 2UZ0A 1O87A 4D8UA 5LA6F 4G0MA 1EDDA 4XIJA 5F3RA 2G04A 5EWJB 1JT2A 2I99A 5FBQB 5LYJA 5TB5A 2WINI 4LTMA 1AC5A 1VLJA 2NGRA 1AUXA 2B37A 4A0FA 5BVGA 2F8TA 1M66A 2JEZA 1PP4A 5DSXA 5CW2A 2CYBA 2PRKA 2PTHA 5H5JA 1C2YA 1T9AA 1EVJA 1YIDA 3WWYA 4M9CA 4O63O 2HJWA 2OAEA 4D0LB 5JOQA 1LBSA 2PMWB 2ZATA 5AHRA 4BP9A 3QXCA 4GAEA 2Q21A 2ZAOA 3MT9A 3RU3A 3CNOA 3NHAA 4HTAA 3SFZA 1N5JA 4YI3A 2R6GA 4LXYA 4HGOA 4DW8A 2OBLA 4QXPA 3EPRA 5FFMA 4EGAA 2ZCJA 1YRYE 2ID9A 4RHXA 4Q5IA 1GPJA 3HSYA 4LX8A 1VPVA 3HYNA 4FW9A 4GD3Q 5K0LA 3SIWA 1AMUA 5B1IA 1RM0A 5JIBA 4JC0A 3L4BC 3OPYB 4S1NA 3T3PB 3KT3A 2BFCB 4KR6A 3K5WA 3VH1A 2FOXA 5JTUA 3FDJA 3ICQB 1U2DC 4AG5A 2PT6A 2YWDA 1RR6A 1SCUB 4K1LA 1VIVA 2OXTA 1KI7A 1M7HA 4GE3A 3OZRA 1BHO1 1RC8A 1EZ1A 2J1LA 1L1RA 1KC1A 2GXSA 5C53B 2PEYA 1ODFA 3DXXA 2H4HA 1NJ6A 2ZR0A 1EB9A 4D4KA 2VJYA 4JOQA 4KNYA 3OKCA 1HETA 5F5XA 4NMMA 4ZJYA 3WIOA 4AYWA 5B6JA 4E09A 2ISQA 1FNNA 2ONKA 3D8RA 1TL7C 1JWBB 1JG7A 4X64B 3T5AA 3K6SA 3L7JA 3PC7A 2DWPA 4F06A 3KLBA 1KO5A 1E89A 2BE9A 3LP6A 1ABBA 1BC5A 4G6ZA 1DAOA 2Z09A 1PIWA 4JODA 3TTTA 2IEBA 4CKBA 1U8FO 2GK4A 4I2VA 4ZQBA 4CKCB 3JAKB 2XGSA 3IDAA 4ALNA 1O0CA 2KYRA 4XSVA 3G8AA 3JQ9A 1KYIA 1IYZA 4YMLA 1YJAA 2P11A 3RC2A 3CNBA 3DULA 2DFLA 2XWSA 4YGXB 4BNVA 4OHMA 1YOVA 5BV7A 5B58C 2PT7A 1PUXA 2QN9A 4KIUA 5ALPA 3QY0A 3TI7A 2XRMA 2EYUA 1V35A 3B8EA 3DZ8A 3CZRA 4EL0A 1DG1G 1W8IA 3WSTA 5IDQA 3BPSA 3HVRA 3TAHA 3A7EA 1W36D 3FB1A 1T0IA 3PXEA 2FA9A 3QWBA 4UTNA 2ZJZA 2AEEA 3KOMA 2GK3A 2VPTA 2W71A 4Y2VA 3Q8MA 3VR5A 3IUYA 5JVDF 4OYLA 2GK6A 4DG5A 3OO0A 4RDIA 4D3XA 4R8LA 5JC8A 3QVGA 1U0EA 1O95A 2IYSA 2BZSA 2WUEA 3CGWA 3V4VB 3WA7A 4KFCA 4B6QA 4RJKA 3C3KA 2QJRA 3HKCA 5EKDA 3NBXX 3T94A 1IU9A 3U7EB 1OXSC 2ZYHA 4I55B 1Z9BA 3NTXA 3OLWA 3O0DA 5KREA 3CIFA 5HF9A 4OB7A 3ONDA 3T5PA 4YDHB 4BQNA 4EO4A 5L3ZA 3EA5A 4YRAA 2IODA 3AIIA 1FTGA 2GRUA 3L7BA 4LV6A 3E9RA 1KVUA 3OECA 5F64A 3BHNA 3RROA 3ZCPA 1UEIA 4EG5A 3HNOA 4NNPA 2FZWA 1RHQA 2OHHA 4NMXB 4OK5A 1FBNA 3W0LB 4JVNA 3D54D 3QE2A 1ORIA 1PDVA 1U1DA 1D8AA 3EFHA 4C2AA 3PRJA 5TT0A 1SCNE 1R64A 3E9NA 4LOKA 4UBNA 4TTAA 4YJ3B 2J9RA 3EF0A 1RJGA 3VU3A 4DQUA 1DWPA 3D1JA 4MVJF 4Q34A 2W83A 5EMMA 4CG3A 5HHTA 3TECE 2IDMA 2V65A 2ZE8A 3ON5A 1JJBA 1HG0A 4DR6B 3NYRA 4TKVB 3WQSB 2C2KA 2DWQA 4WSOA 3IAEA 3K0EA 4NK4A 2EW1A 2R6CA 5AICA 3I30X 3WK4A 5AW3A 5IH3A 4XGQA 1GTG1 1E69A 2C42A 3H6GA 2HDHA 2ICAA 4BUZA 4WZBA 4GF5A 3S2YA 1UZLA 5D1HA 4WBSA 5AKHA 5BR7A 1CEEA 4F2HA 4MR7A 3CE9A 4GVXA 1ZEJA 2PBFA 4HDNA 4IGKA 1TRHA 2ZJ5A 3FUXA 3MW8A 4N6GA 3ROKA 4JVLA 3ZD7A 4B8YA 4EZEA 4CE6A 2R48A 1HSZA 1FYEA 1KHHA 4X93A 5K3AA 3FTEA 1VJTA 1KJQA 1ST2A 3FFBA 3H99A 3TPFA 2UZ4A 3ETHA 3EHDA 4QULA 1P9OA 1Z8DA 2YY6A 3ANMA 3AX6A 3EZFA 4XYBA 5C1IA 3E9DA 4NYIR 4LF4B 2FSFA 3AI7A 3BTSA 2QUIA 1Y8QA 3JWIA 5BURA 1MAAA 2RIPA 4U63A 2RHHA 4DJAA 2O3UA 1F0KA 1JXAA 2AUMA 4A1FA 3FXAA 3AETB 1FB5A 4R9VA 5CD9A 1P29A 3SHOA 4NHEA 3G88A 5T8KC 4LOJA 3AJDA 1N8NA 5BNWA 3K9FC 2WU1A 3G9UA 3PNLA 5A3VA 1N1DA 2NYUA 5JQGA 1MIOB 4MEBA 1SOVA 1LWOA 2W2XA 3LY7A 5BY2A 1JQ5A 4EAQA 1XX6A 4QTTB 5F51A 4MV1A 1TB4A 5I7HA 4MQFA 3TOVA 1C3LA 2QTVA 1FXUA 1XZGA 4LIPD 1TW2A 4RLFA 2G4VA 1Y1TA 2R9VA 4KGDA 4WL0A 5EESA 2OGWA 3UPUA 2UYOA 2CB0A 5B55A 4II2A 3WBBA 3KQSA 3RKRA 1D6MA 1P4JA 4IXWA 1TRKA 1K63A 2IEYA 4RXMA 3PXDA 2AFHB 2FETA 1GR0A 4YDRA 1RU3A 3OE7A 2OVBA 4M1MA 4TWBA 1UIRA 2JK0A 4TT3A 1W6UA 5F2KA 3ZOKA 5KINB 1EFKA 4M9QA 5F12A 1M6HA 1AGYA 2W22A 1VM6A 1UBEA 1Z08A 4DHEA 2VPWA 5KYUA 1LBTA 1NV8A 3HBAA 1F5NA 1CUVA 1JBQA 4OGKA 4XKJA 5CYFA 5IC6A 3GJ3A 4FGWA 4HDAA 5TF0A 5DYWA 1WD5A 5H16A 3RAGA 3SYKA 8ADHA 4NOLA 4MROA 5KSWB 3UF0A 1GNSA 4IXNA 3UPDA 3IAM1 3BB1A 3B1VA 2F17A 3KTFA 3D7SA 5IVIA 1D2MA 3NCTA 3CPEA 1GKYA 2IVFA 2G80A 2X5OA 1ACMA 3NT2A 3DE4X 5K7SA 3ETNA 2DPMA 1JUDA 2XOKD 1CY7A 4C4OA 3KXDA 5K3FA 4C05A 4EUEA 5KOJB 2ZTSA 1P6XA 3REGA 4CUKA 1VC2A 4N5LA 4RIIA 4LXHA 2VEDA 1IZ9A 1XZHA 3LUKA 3M1IA 5EUBA 4HD8A 3RJMA 2C7PA 4CQMA 4Z3KA 2CXQA 1EJ6A 2VDKB 1S2OA 1XELA 4P3KA 4G5XA 1YB2A 3LC1O 4IIJA 1E20A 3A6FA 3DVLA 5C8YA 1K5GA 1Y4DE 3P0RA 3VC3A 2X13A 4ZU1X 4D4JA 5CB4A 1U2RA 1RMYA 2UKDA 3SDBA 4O4JF 5AW5A 1UBFA 4FINA 3WL6A 1UWCA 4KE8A 2ZRFA 2Z2KA 4O8CA 4UATA 3E03A 3WDMA 2O52A 3I37X 1RI5A 1WRBA 3QVTA 4Q3KA 4E5KA 1P8AA 2JAUA 3IT0A 4HI0E 3UO8B 3RYIB 2P78A 1PZHA 3N2ZB 5TVKA 4R81A 3QLUC 3B6MA 4E13A 2FRDA 2ZRAA 2VAPA 3DTVA 2JF0A 5ALXA 4YALA 1O4VA 3UWDA 3RC1A 4RSHA 2GPTA 4FGUA 2C3PA 2OKCA 1KKLA 1GA4A 1PZXA 1RFLA 2M2IA 3ESCA 3ITKA 3PX7A 1KVTA 2OHXA 4IEIA 1JQ3A 3UAWA 4NPHA 4B82A 2H4FA 2JLQA 3IO5A 4Y6GB 1ECPA 5AKKA 3RCBA 3SMVA 3V42A 4FEYA 1ZKMA 3V8RA 3BUSA 1R7RA 1KRHA 4LVCA 1V7ZA 4BJ3A 3HBMA 1Q2UA 3NETA 1YS1X 2J3HA 1QRRA 2L18A 3I2KA 3LGSA 4GR4A 3KC2A 4YP9A 3TOCA 5LOVB 4J1TC 2Z9DA 2QVXX 3G5UA 2E6UX 5EMHA 4DMGA 2OZVA 1P5HA 5CD1A 1HC7A 1VGQA 4WMLA 4AZ0B 4R8RA 1KEVA 1JXMA 2H8GA 3VR4A 4DR4B 3QXJA 1QANA 3C24A 3RYFA 4YCAA 2JCYA 3GJXC 3MHPA 3EWIA 2XYQA 4ES6A 2ZAYA 1NQAO 4U7HA 3K9NA 2B34A 1MX9A 1SHZA 4L0MA 4KOEC 4WERA 5D7BA 3W1EA 3ZXSA 1C1DA 2BTEA 2VI5A 3GLHB 4L0CA 3V2IA 4M0KA 3UK6A 1P2BA 1PGQA 3C8HA 3LV8A 5B57C 3KZXA 1LI7A 3EY9A 1XVIA 3OU2A 1ST3A 1E4EB 5JZVA 4V0NA 3ZK9A 3IR5A 2WKWA 2JVJA 3P9QA 4I8XA 3QWIA 3L0PA 4Z0HO 4D79A 1P44A 4EF4A 4MINA 3S0JA 3OCWA 1RT9A 2JASA 3AR9A 3PHLA 1GJRA 4UBOA 4J0EA 1SVIA 5IKMA 1EK2A 1NSFA 2YASA 3E27A 4JEMA 4N5HX 2WP8J 1TQ4A 1YC5A 1FS5A 2Y05A 3FCYA 4HQLA 3OZAA 3OPYA 4I5DA 4P2BA 3TINA 3LY9A 1NW7A 5DHUA 1Y1LA 1SZPA 4WV3A 3N0XA 3RBZA 1GZ6A 1A27A 1EFTA 4KV7A 2PUVA 5BQXA 5KB3A 1GPYA 4O2LA 1U11A 1L4EA 1ZN2A 1II0A 3DMTA 3OIUA 3GHHA 1XEFA 2ECFA 2L82A 2P1ZA 1YHYA 4HRYA 2MU1A 4AC9A 1C8LA 4E2YA 1S8FA 1TT5B 3ONVA 5BWNA 2RBEA 4BLVA 1AX9A 4PNHA 1NU8A 2MINA 5EWLB 1NX9A 3WJ2A 3JZDA 5IAAA 3THRA 4XVUA 5BNTA 2X3UA 4H77A 5HKAA 3MLBA 3IEVA 1XD9A 1WVMA 3G1TA 5EWMB 2QVYX 3ZYCA 1EBBA 1TK9A 3JALB 3NVMB 2WF5A 1M2NA 4FFSA 1EFRD 2EARA 2JPDA 1N2EA 4HLDA 5EJ4A 2BI8A 2QZPA 5K8CA 1RKXA 3I3OA 3FLEA 3TNYA 4QYIA 4ME6A 1NN5A 3WQQA 2J09A 5ICFA 4OTZA 2G5CA 4MIOA 3GD7A 1G5QA 2VRWA 2ZWOA 1FSPA 1PDOA 3RVPA 3TMKA 4EY4A 3U56A 4P8RA 5AW0A 3RSLA 1KO1A 3MWDA 3IXQA 1KP9A 3ZNQA 1A4IA 4GM0A 2IP2A 3TGWA 4OQQA 4OFWA 3HL4A 4NDNE 5DHTA 4C5CA 2W4MA 2OUIA 2I3GA 4GQAA 4P4TA 5K3CA 4C6TA 4QTXA 3V1UA 2NYAA 3IPXA 1DAHA 3HFGA 3PFWO 1YVRA 2RHLA 3A6KA 4FXOA 3Q8XB 4GGMX 4RHUA 1P7YA 2O8VA 5FTNA 4EJFA 4TXLA 4JI2B 4O4HB 1QBGA 5AKGA 2YIVX 4GVLA 3HCFA 2BEUB 1KIAA 2W2VA 3MJFA 2W6JD 1EP9A 1CQJA 2HN9A 2QRZA 5IEJA 3PEYA 3DBLA 2DUNA 3B82A 3MT7A 4EGSA 2EP8A 3GCGA 3HU3A 4IDCA 4EMTA 3UNXA 3K9CA 1SQ0A 2PAAA 4OI1A 3M6IA 1T3TA 1NNEA 2GFQA 2XCRB 3ORSA 3MERA 3HGMA 1DE0A 4BO7A 1IUPA 5HJ7A 2ZS8A 1IRXA 1ICIA 3SZMA 4DLAA 1L4NA 4KKXB 1A7KA 3G23A 5A71A 2YXBA 3GFRA 3ZXUB 3AIKA 3HDTA 4HUJA 1Y9AA 1V9SA 3E4DA 4YRQA 4QUGA 5KQSA 4B6FA 2JFQA 4UTXA 1WXDA 2WWVD 3J7AC 4OMUA 3KJXA 2P90A 1ATZA 4QYWA 4JUCA 4EITA 3VA7A 4IF4A 2P5UA 1GG8A 4DIBA 3OCYA 4BBJA 3RT7A 4DPKA 2QXYA 4YJ3A 1WUTA 3C4QA 5I5GA 2XODA 2X8AA 2OLEA 2QRPA 3KQLA 5FA5A 3RT9A 2HCTA 3SOZA 4POOA 2OMEA 1UDWA 3L04A 5EAIA 3RR2A 3M34A 4KWCA 3TQSA 1SULA 3Q0TA 3TLMA 5ALZA 3DPSA 1VKHA 4WXEA 5C8VA 4DDMA 1J1IA 2RI6A 2BT4A 1A2OA 1IN7A 3K09A 4PO8A 4RCVA 3COZA 3CX6A 5ERYA 4AECA 2JHGA 2Q50A 2RBGA 4MS4A 3IOEA 3HXPA 3DMHA 3LDGA 4UE2A 2JFBA 2H57A 2I6GA 4GNRA 3VV2A 2B7LA 2EHDA 4EW3A 5EUCA 3BFXA 3TQRA 3HA3A 1NBIA 3T5DA 2I4OA 1NQWA 4V1CB 1U2QA 3BXXA 5AW1A 1T8WA 1J6UA 1X13A 4TTQA 4LDNA 4H4EA 2FPOA 4TL8A 3GV0A 4PY2A 1CY8A 2PZKA 4AN0A 2DOKA 4C04A 1O6FA 4LJAA 5DBHX 2HYIC 5E4YA 1QGUA 1E32A 3BSYA 1ZCAA 4LJ9A 3N2IA 4UAJA 2QUZA 1W5AA 2PGOA 3GJTA 5MFPA 5AVZA 3AETA 1B4DA 1PFWA 4NQRA 1V5EA 4UMEA 1GT6A 4XB6B 1BMFD 1SC9A 4MS3A 3DSRA 4YPFA 1T2NA 2G9RA 2AR9A 5HGJA 4F3RA 1GAQA 4QAJA 2V7WA 3VNQA 1JA0A 2ODAA 3QKSB 4EPYA 1FX1A 4RIFA 1QFZA 1SBQA 3GNTA 3QUAA 3OFSA 4KFUA 4AJJA 4E14A 2WUWE 1V71A 1X9IA 2W4QA 3K9HA 3OBBA 4PAOA 1LA2A 4UZSA 1NMQA 4EB6B 1LSOA 3OQPA 5I6DA 3ZY2A 3RGWS 2OD7A 1QV9A 1FFSA 3LM8A 1UXHA 3QLEA 5CHYA 1QHYA 2IHYA 4B76A 4DCVA 5LQDA 2O5CA 4KQWA 1KOGA 1BDMA 4D8VA 4QG3A 1D6NA 4JGBA 1S7GA 1XYYA 2WRZA 2P62A 4DA6A 2WQ6A 4FEEA 2IHKA 3M6WA 1KPHA 1PS8A 2Q0SA 5EHQA 4HGZA 3R44A 2OHGA 3K8OE 4J0JA 1Y37A 2R2GA 4UW9A 3KJNA 5AHWA 4XIFA 1X39A 1JFFB 4G56A 3DVRX 1JIKA 3RVNA 4TVSA 1IRIA 3H9GA 3OA0A 3SHQA 5DOZA 3RHFA 1ZITA 3H3JA 2OV4A 4QOIA 3VTAA 8ATCA 4AZ3B 1CUGA 3N0RA 1E18A 4F93B 5JS8A 5H3CA 2ROQA 3Q7IA 1BXZA 1TQ6A 3PUHA 4M49A 4ALKA 2I4MA 1UM9B 1P61B 3JD3A 1E9BA 4OBEA 2FLKA 4A23A 2BKVA 4OQZA 2D59A 4BKMA 4BLSA 3NB0A 3WGKA 2C9ZA 5FBVB 2PZ8A 1HFWA 2PTGA 4IH9A 5AKYA 5I01A 4RPGA 3CF2A 3F9CA 4CMIB 2FWMX 1BDHA 1W34A 5KOJA 1X80B 4OYRA 1Z39A 2ZRLA 2ZW9A 2OKGA 3BWDD 4INPA 4XPIA 1X15A 5AK6A 2X0FA 3E7DA 4C21A 3DOIA 1U1GA 3V4SA 1E8DA 1PWHA 1RAAA 5CR9A 3R7WA 3OUUA 3Q1LA 4KN8A 1XCOA 4FGZA 4JLUA 5LA6B 5E3JA 2W4IA 3ZNPA 4NEHB 1OXBB 3UT6A 4YCSA 5K8JB 2EKLA 1QF6A 1EG2A 3BMXA 1SR8A 2HLNA 2QAGC 4I8DA 3ZNNA 4EFMA 1DLIA 1RHUA 2I2BA 1GYPA 3IR6A 5AJYA 4ALLA 2CLCX 1Y6RA 2HF2A 4V3BA 4HDOB 1RZUA 3KT0A 2DQ4A 1U2SA 3RIHA 4X6XA 1K3UB 3E2IA 4MYCA 4Y9TA 5DO9A 3SJZA 5KKCA 4EM6A 4MI3A 5IYZF 1V8OA 3WQRA 4TX1A 3RYIA 4D0RA 1GPDG 5BPHA 5FOUA 1QO0A 1E3WA 4KAJA 3RNLA 3O8LA 3SYTA 1J0DA 1KEZA 3WMRA 1S5PA 3F2IA 3T5GA 1W4RA 4JLDA 2X4LA 3BD9A 4P1ZA 1UZMA 1RXVA 4LY3A 3MUOA 1NI4B 2X9LA 4GM1A 4X66B 1D5CA 2A5FA 4E5YA 2O14A 3HJFA 1OJ7A 2OO5A 5ALJA 4LF6B 5E4FA 3UA3A 1YULA 4BCCA 2PQ2A 3LXUX 2V6IA 4I08A 2YWBA 4WK2B 4A2QA 5CMLA 5BV1A 1IZ7A 4XPZA 1D2GA 1UXIA 5CFZA 3TE7A 5GZ3A 2QN6A 3ISJA 2HLDD 3UG7A 4M1TA 4YRTA 4F5ZA 3NJ4A 5H68A 5BWBA 4TZ6A 4XGRA 3NVKI 2IV2X 2XNDA 4MJXA 4ZVKA 1ZUHA 2IF0A 3BT7A 3BGWA 1WOYA 3N3BC 4N5MA 2JJQA 3TRHA 1AHNA 1YA8A 2Z56A 4O29A 3HDGA 1S3GA 4WFJA 4AZ0A 4X00A 5L4SA 5CT5A 3IHLA 4LGCA 1EKXA 2GZ1A 3A3KA 2VVTA 1P4GA 3TDMA 3NG1A 3AUYA 2ZRIA 3C45A 2YCBA 3F3KA 1NJ1A 1TEXA 1W73A 4RM3A 1VZ3A 3TZBA 1P91A 2DT8A 3GLHA 3RC3A 2G77B 4BKRA 2O50A 3PHGA 2Z83A 5FOWA 2RJOA 1G5RA 4OAPA 4JI7B 1FW8A 4HN4B 1SWWA 1NW5A 2D6FA 3NV9A 3O4FA 3K70C 3DDSA 3W2FA 2FUEA 5FT9A 1H22A 2VAVA 3L1HA 1T4CB 4P7FA 5E8JA 3GAFA 3U81A 3VQTA 4DYDA 2HMSA 2ZWAA 3AHIA 4ALMA 5AW7A 4JY7A 3TD6A 5I7VA 3WJ1A 2HMWA 2OILA 2X86A 4OHVA 5IJ9B 1Z3IX 1HYHA 2ZB3A 4LSMA 3EHEA 4FDAA 1I3KA 1JRLA 3M6XA 5EVCA 3F2VA 3ZE1B 2XY4A 5B2ZA 1VLQA 2PO7A 5EZSA 1VA5A 3DEFA 3ZKWA 3DG9A 3PGXA 3D31A 3EVAA 2XOXA 4FFMA 4K9DA 1TM3E 4RGYA 4W8HA 3SY8A 5I5EA 3WGIA 1VOTA 2DFNA 3B7WA 5IVPA 4HC4A 5BWCA 4R1LA 5JVDB 1XKXA 1TKRA 2XHZA 4FILA 1KDRA 3KIPA 1T0BA 2RI0A 1SVSA 3KL4A 3T3EA 2O4UX 1Z5PA 4HRAA 4BTVA 2O8BB 3PJEA 5EOVA 1GIAA 5DHSA 2VOEA 4Z3DA 5KVVA 2JARA 4X1OA 5EWLA 4EWLA 1ZIOA 1HH4A 3QBEA 1EUCB 1NUUA 1PZNA 2PMDA 1XZJA 4XUDA 4MMZB 1V6CA 3DDOA 3QIVA 3SKYA 3TEMA 2QU7A 4BLTA 4EMBA 4MUEA 3O3OB 2B4YA 1V5FA 3R9WA 1TFRA 1E58A 3B53X 2RFLA 4OGLA 3T9BA 3RFUA 5ETJA 4WZ6A 4QQ8A 3THWA 2R62A 5JSZB 4AMUA 3HY6A 5JMPA 1IL0A 1POWA 2BHLA 3G49A 2HB6A 5C7IO 2H9YA 4XJXA 3W77A 1U8TA 4D3DA 1KAQA 1W87A 1FJ2A 1ONNA 4NMLA 5C34B 3ZXXA 1ML4A 2EL9A 5AW9A 3KJGA 1E2KA 4RMIA 4LRQA 1CR1A 5CEFA 2ATEA 2YH2A 2P41A 2XT6A 5KWIA 1YR2A 2FN4A 1VHTA 2FJPA 3CM0A 1KP2A 5ALLA 3KVNA 4US1R 3M3DA 4KQJA 3TLBA 4BNNA 4BU0A 2VAMA 3LSTA 1QE5A 2HJSA 2LRHA 2PSDA 4AX4A 4KRYA 1R0RE 4JT8A 1SQSA 5C52B 4WHMA 5CAEB 3OEEA 4XQ0A 3AJ8A 1JDNA 4NONA 4ISCA 5JBQA 2D13A 4CMBA 4RNCA 4IHJB 3QFCA 3HXTA 1QDLB 4FC6A 3M9WA 2WTBA 2B1JA 3Q5DA 1TJ4A 1WW3A 2ZJ0A 4Q9JA 5FBZA 2PL3A 4URZR 1AHIA 4EZIA 3BWXA 4GH5A 4M1EA 1HDEA 1Q0HA 4MUIA 4KWHA 4F56A 1P1CA 4AIIA 2IHBA 2ZJ2A 5H0IA 1P74A 2VS1A 3ESQA 4YTEA 5LB2A 2OPHA 3R74A 4E0BA 1GGMA 1PJSA 3SE7A 1X8JA 1W93A 1WSWA 1SUDA 2HV9A 5H4HA 1FVOA 4ZOAA 3WAKA 4DM4A 3D81A 1PYDA 3EVGA 2RAUA 5LZ9A 1I2MA 4CUJA 4N49A 4J29A 2FGKA 4OJQA 4QUHA 3K71B 2LIVA 1C3OB 5H1YA 3SC2B 5K45A 3E35A 4YP0A 1E0KA 1FFXB 2VF5X 4LY0A 2H1OA 3CG4A 1D7AA 4X65B 3KTDA 1DIHA 1DKPA 2JIZA 3PUZA 3ZDDA 1HKHA 2CNLA 1AQIA 2Z43A 3FVRA 4NOJA 4KEAA 3AVQA 2VTBB 5T41A 5HE8A 5G4KB 1N8SA 5JAQA 3ROMA 2WYHA 1ZSVA 4BL5A 2FSVA 4K6HA 4DQLA 2H08A 4F85A 3FSGA 1EVQA 1DINA 1II8A 1JI3A 1SPBS 1TGVA 1KJJA 1WABA 4JLAA 3SXPA 3WJ7A 4EHHA 3U6BA 1QRTA 1XP5A 1U2PA 3IS3A 4BLPA 5LQNA 5CA1A 4W7SA 1YO6A 3IC5A 4KPYA 2I66A 4A5SA 2R0QC 4OXQA 1DDGA 4LHVA 1JIVA 4ZT4A 3JQBA 2W58A 4YECA 3WKEA 2HCBA 6GPBA 1XEWY 5JXGA 1ZI6A 2EDAA 4MTLA 1BS2A 4UJ3A 2CVZA 4WCFA 2AMJA 4CLDA 4PG8A 3ETEA 2HU7A 1IM8A 3A9VA 2KSQA 1OT5A 1V6AA 1RQLA 2OCKA 2RGXA 4LXIA 1CT9A 3IR7A 4RK6A 3V3TA 3DFMA 1XDZA 2DX7A 1E4YA 3I58A 5B12A 2P75A 5JZMA 1OTXA 2DR2A 1Q50A 2GF0A 3OWHA 4PAWA 4WBXC 3LT5A 1Y5MA 4K2HA 3G02A 1J1UA 4ZT6A 4BQSA 2C0PA 2EW8A 3CMCO 1EDBA 3NASA 5ALQA 3IBFA 1UP6A 1ZK2A 4HFJA 1CJCA 1I3LA 4GOJA 3DCYA 1HE4A 3HZRA 3FNQA 2V8OA 1RYFA 4HGRA 2VF7A 1JX6A 4I1RA 1JEDA 5F2NA 1LDYA 1TTQB 1USWA 3X3HA 4EYEA 1W581 4Y2TA 5K3DA 1GZ3A 2W90A 3IUQA 4JN6B 1SAYA 3ND6A 2WHQA 3WBJA 1XNRB 4KHPB 1IWOA 2O5VA 3PHJA 4N7BA 2X8WA 2A5LA 2IY8A 4HS4A 5IG2A 2R8BA 5IEBA 6LDHA 2WMOB 2WOOA 2GXQA 4QGSA 2UYCA 4Z1MD 1T3GA 3WBFA 1W5SA 2L19A 4IS3A 4W9MC 3BDVA 5EIBC 4MIKA 5GONA 5FL3A 3IPYA 4CKWB 1EX7A 1SIUA 3FOZA 3PX2A 2EEZA 2CL7X 4BLWA 3FOWA 1RIIA 1Z17A 2XQVA 5DT2A 4O4JB 4ZHQF 2DFPA 5CB0A 1M0WA 3N2KA 1KOJA 1OFUA 3K8QA 1WP9A 5DEIA 4YUVA 5SYAA 3RUEA 1S01A 2WF8A 1XHFA 3QYAA 2FQWA 1JVSA 3GW8A 5CVEA 5BN4B 2I67A 2VRNA 4RX1A 4BQPA 1JFFA 3L6DA 2CNKA 3CMMA 4BO3A 3KB2A 1SVNA 1Z29A 3DHNA 1JQDA 4V2UA 1EA5A 4AZ3A 4I4IA 1WB5A 3WX0A 4O5OA 5TV2A 3MOSA 4D8WA 4YLEA 4KXLA 1BX0A 3MGKA 1CZNA 3O47A 4EUSA 1K6JA 3U7FB 2QN3A 4TSFA 3AFOA 5D51S 1CDOA 1NFRA 1Y5RA 5BUSA 4CT5A 1HZZA 4D3FA 5AVKA 3UK7A 4DCPA 1W35A 4QDTA 1JMKC 3B2NA 4O33A 3THSA 1X80A 3KZKA 4H7FA 2Q3FA 2Z1MA 3WRXA 4OLBA 1IIBA 1U0NA 1WLSA 5YASA 1EHIA 2BMFA 2ZIEA 4RZXA 4B81A 1THTA 1UDAA 2G0AA 3CT6A 1VI6A 2DSTA 1H5QA 3A9TA 1Z0ZA 3WMWA 1VE9A 5JDCC 3BH0A 4JHLA 5LA6A 1BD3A 3V55A 3A9WA 1Z6YA 1Y4ZA 3K0FB 4KQ1A 3P27A 4K8OA 2ZSFA 2HIMA 3UMVA 2VA8A 2IU3A 2P0AA 3KYBA 5CTAA 4AS3A 1BMQA 3AM4A 2R7KA 2BTQB 2ZBUA 1EFHA 2NTNA 5F77A 1SC1A 2Y6VA 5F76A 2A14A 3NBKA 3UW3A 5LL6P 2ANCA 2QX7A 1OBFO 4FHCA 3IAXA 3WLAA 4KO8A 5JSHA 3W90A 4HH0A 3N05A 5IPFA 1DNPA 3SVLA 4F1KA 4KDFA 4RPKA 1A8PA 3B1KA 5J23A 2NQTA 2YVAA 3IUJA 4DAOA 2GJ9A 1NBMD 3DFUA 3KEOA 2ONCA 1BGXT 3DZIA 1UJCA 1NI4A 5AUQA 3W3AA 2BFOA 4E3ZA 1IOLA 3S7ZA 3S2UA 3I32A 2C7GA 4FOOA 1H6DA 3UOWA 3WLRA 4AUEA 2AE1A 2AJDA 2Q7OE 1XCJA 2JFXA 3GUHA 2QGNA 4ZU3A 1EK0A 2YC2C 2FN7A 4KMSA 3P94A 2PANA 3UAGA 1EINA 3PSHA 4AX8A 1CEYA 3HLYA 4QJ4A 1YDFA 3I05A 2EFEB 5TE9A 1QX3A 5B4TA 2X6TA 5CT6A 5IM5A 4IL5A 4D56A 2H3EA 3SICE 2DP4E 2PUJA 3U16A 2JFNA 3SU8A 3ZBUA 1KP3A 3O93A 4BCBA 3EPHA 3JVEA 1KFBB 5FTWA 3MRVA 2J6HA 1WL8A 5ALWA 2C8KA 1SKUA 4YAGA 3GNSA 4NAHA 4O0MA 2D7DA 1OLUA 4QGAA 4DEXA 1C2TA 4OBWA 3SVZA 2GN8A 3N28A 3V1MA 5CFPA 3P2KA 2AG5A 1U3TA 3D3EA 3C5VA 1NASA 4JWTA 4QNMA 4YAEA 5C5CA 1JHYA 1GUFA 1MAVA 1Q1BA 1ZD9A 2NXJA 3QGMA 3GJ6A 1T4GA 4FSXA 4IO1A 5MFZA 3T61A 3CF6R 3JVUA 3EGIA 3JZAA 2P0EA 5JROA 1FJGB 4JNKA 1WXEA 1B8PA 4YHBA 1ZNQO 1NF9A 3NTOA 4GLFA 3EH1A 4E5DA 5CLQA 1G1AA 3RVSA 2DFDA 3TLXA 4B4KA 3VH4A 5IJ9A 3OOEA 3MWEA 4AJLA 2PUWA 2CF6A 4I3FA 4EJSC 4AWXA 4H7IA 2A67A 3EDRA 5KNBD 4Q9DA 1PGJA 3ZWCA 1OW3B 4MPRA 3TPCA 4YT5A 1RE0A 1QZXA 3C8DA 5A1JA 1SXIA 1UCFA 1UJ5A 2C2YA 1T8UA 4BNZA 1EK1A 2QRKA 5B2EA 1E1QD 5JVDA 3P9KA 4GC9A 5DPMA 2Q7DA 3UG6A 5C5IA 5MN6A 1Z83A 2NU6B 1J9ZA 4WKGA 2O8BA 1OZFA 2C04A 2BFMA 1CUHA 1Z5WA 2AJBA 1L1EA 3BK1A 4FEAA 5FL7A 1IEXA 4BEWA 2VUUA 1L7VC 2FG7C 3C3MA 1EUCA 1FZQA 1Y8AA 4P36A 3CKYA 4RCZA 3ZE6A 1L7EA 2FUKA 2P6MA 3GFFA 3VDRA 3ITNA 4ZMBA 4IDHA 4MJ7A 1REQB 1YUMA 2E4AA 3A4NA 2EP5A 5FI5A 1MAWA 5IJ0B 3RU7A 3NBFA 3WLSA 1UFVA 2Y1DA 1RWXA 1KA9H 3PXXA 1O57A 3WGVA 1U6IA 2YJ3A 4HLUA 3DOOA 5E1DA 3LWNA 4MGEA 3NEAA 3DWFA 3KTAB 5EJIA 2Q9CA 5TJHA 5BV0A 1XPRA 1G60A 2ZIVB 5EE1A 3NFRA 5F21A 5CNJA 5IUNC 4BN4A 3PV0A 4D9FA 2GTPA 2ZULA 2GD6A 4RV5A 4I66A 1MV5A 2G9VA 4IYJA 4MVJA 3TTSA 4OXNA 3DVAB 1LS1A 1TVKA 3MFYA 4RC9A 1I36A 2E4UA 2NSLA 1GARA 2OB2A 4L3WA 3GX1A 4BB9A 4EYSA 4MDFA 2Q4DA 5EIBD 4EKNB 1Z62A 4JL5A 4QDZA 4HAXA 4N3AA 3H9UA 3HRIA 2YHIB 5JSFA 3PD1A 1UDRA 3E84A 1RI4A 3PFGA 3IV6A 4RU1A 3ZXIA 4Z53A 4I8IA 3GGPA 2V55B 1GNPA 3ED5A 5I51A 5M2QA 2AKAB 4HUQA 3LXXA 3WYCA 3NNDA 3WWDA 3O8OA 1IZZA 1E9FA 4LBZA 3TI9A 4YJ2F 3ZG6A 1KQGA 3G2PA 2CE2X 4QXRA 2II6A 1GT91 4GOKA 1DEXA 1WHSA 5DMHA 3WK8A 4UOZA 1VI5A 5LR6A 5E6SB 2I3DA 2XWJI 1N1EA 2CCKA 4K05A 2AG6A 3BAFA 3I09A 2OFXA 4R6WA 1BWSA 4E5NA 3KX2A 1C3OA 3SC2A 1UUFA 3JRNA 1RQGA 4LZNA 3T7SA 1NQXA 1R6VA 3I0ZA 4DM3A 2Y1XA 5LD2B 4RJJA 1ZEMA 4Y6RA 1JPNA 2GAFA 5A5GA