2WWRA

Crystal structure of human glyoxylate reductase hydroxypyruvate reductase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
322
structure length
315
Chain Sequence
LMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Specificity in Human Glyoxylate Reductase/Hydroxypyruvate Reductase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GLYOXYLATE REDUCTASE/HYDROXYPYRUVATE REDUCTASE
total genus 105
structure length 315
sequence length 322
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wwrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wwrA01
5T64A 4IGEA 1H9BA 3BHJA 1PJQA 1VL0A 3ZU4A 3EYWA 4UAGA 3E48A 4CMHA 4RORA 4QT0A 5EJ2A 2HUNA 5TNXA 4YAJA 4E0BA 3F46A 3IMFA 5DCUA 2BKAA 5AOVA 1SOWA 2F1KA 1BXGB 3U4IA 3GG9A 4GAEA 4AFNA 4IDCA 4CLDA 3VH3A 3GNSA 4PCVA 2I65A 1NQ5A 3UCEA 3BTSA 3TZKA 3UXYA 1NP3A 4E30A 4PLVA 5J23A 4RPJA 3B70A 2AEFA 5JCXA 3OHSX 2PD6A 1ZJYA 4AJKA 4PLFA 4L76A 1PL7A 3IIEA 5CDGA 1QYWA 3JQBC 2AEMA 1QYXA 3BXXA 4BMSA 3KSDO 3GFGA 2F00A 2VZ8A 4PZCA 3WS7A 5IZ4A 3GEGA 3UW3A 5K6AC 1EUCA 1YQXA 2CFCA 4XQCA 2P9CA 2ET6A 5C7IO 1E7QA 2W2KA 2X5JO 1GFSA 2CF6A 4R54A 5DOVA 3VDRA 4R9SA 1HYGA 1DEHA 1X15A 1Y6JA 2RHRA 4TSKA 1B2LA 2HJSA 4RVDA 2ZYGA 2Y1CA 4GKVA 4W7HA 3JQ9C 1ZJZA 6LDHA 3H8VA 3DBHA 1M67A 3GAZA 1XIVA 4LSMA 4PG7A 1FDTA 4MVJA 2V65A 4B4VA 1JAYA 4WJZA 3ZHBA 1LDEA 4XA8A 3B1JA 1FDWA 1QYVA 3K2EA 4JIGA 4C4OA 1UXHA 4IUYA 1I36A 3JQ8B 3EMKA 5DT9A 4JBIA 3AUAA 1PS9A 3E5MA 3RI3A 4Y67A 3NX4A 4OM8A 1L1FA 3W6UA 2CD9A 4HUJA 1QYCA 3F4LA 4XRRA 2DFVA 1LEHA 3L77A 4Q3CA 1LDMA 3OJEA 1FJHA 1LLUA 3K96A 5BNFA 4R1UA 4EBFA 4BGUA 4JN6B 4NZ9A 2P4QA 3GVHA 3ANMA 4OJNA 4PG6A 4KP7A 3GZNB 4XZ3A 4OIMA 4DQXA 2VZ9A 4JBHA 3HDHA 3BMCB 1WAMA 1GZ3A 1NR1A 4J4TA 1U3TA 3FTNA 3QJ5A 3BIOA 1E7YA 1X1EA 4BNYA 2ZTVA 3RWBA 1TLTA 3GHHA 3UGKA 4AG3A 1UJMA 2IEDA 4CMJA 1LDBA 3GMSA 2HLPA 1OC2A 4YWJA 1DFGA 2C5AA 3ZN2A 1NTOA 2C7GA 3AI2A 1V0JA 3EW7A 1UUFA 3IP3A 2W8ZA 1O8CA 4TRMA 4IJKA 3UH1A 4B7XA 5TF4A 3KYCB 3FBTA 3BHMA 1U1IA 5C37A 3QWFA 1K2WA 3WR5A 4HXYA 3PWZA 5FI3A 5TJ9A 1D1SA 1H0KA 1UXJA 2NU7A 3X2EA 3JQBA 5JS6A 4YTEA 3WQSB 4L0QA 4OOFA 5KIAA 2OO5A 2DAPA 2J3JA 4L9RA 1LTHR 2HRBA 1ZXBA 3JQGB 3W1VA 1YONA 4XDYA 2Q2WA 4XYLA 1RM3A 2YDXA 1FDVA 3VH4A 4IXWA 4TVOA 2Q1WA 1Q0QA 3OMLA 3WGZA 3WGTA 2EP5A 4BUCA 5L3ZA 2JHGA 4WK6A 4KTTE 3BMQA 3Q1LA 3FPCA 4E33A 1ZEMA 1YO6A 1LC0A 4CR7A 2HAEA 5TT1A 1GU7A 1V3TA 3GNTA 2QW8A 1WDLA 2PV7A 3KRTA 5COBA 4UULA 1VLLA 3H9EO 4MVJI 2UYYA 3RC7A 4BO5A 2HSDA 3R1IA 2IZZA 2YQ4A 5AVOA 3FI9A 3CEAA 5B4UA 3HADA 4I1IA 2V7PA 3L9XA 2NADA 4QFCA 5DNAA 3UCFA 2Y0DA 3WMWA 3LZ6A 4LCEA 4DYVA 2LDBA 4L75A 1Q0LA 3JQAD 4TRRA 4NBRA 3ZWXA 1W73A 1L7EA 4J1SA 1Y8RB 2GNAA 4WUVA 5F1PA 3VOSA 3JSAA 4ZA2A 2QZ9A 2TMGA 1G0OA 3ZNPA 4NK4A 5JFOA 2HMUA 3EHEA 3FHLA 5KNLA 3FWZA 3WDSA 1PX0A 1T2FA 3QRWA 2ZCVA 2Y05A 1E3LA 1CDOA 2A9FA 2YJZA 4Z0PA 1KEWA 4CM7A 3QIVA 4IINA 4YXFA 3JQ7A 3D64A 3A9WA 2EEZA 4GX1A 2JFFA 4JLWA 4P4NA 1CJCA 4ALLA 1T4BA 4D45A 3E18A 3MTJA 2FPGA 2J3IA 2YUTA 3AU8A 3U5TA 3QP9A 1E0DA 1IY8A 3WGYA 1HL3A 1HDCA 4IXTA 5F5NA 5TIIA 1I2CA 1HDXA 4E5MA 1C0IA 3WYCA 1ZEJA 1VSUA 4UVEA 4B4UA 1Y1PA 5L95A 1E7MA 1VE9A 1AE1A 3ROQA 1PJ4A 2OXIA 5EIOA 1U9JA 3PIDA 1FXSA 3DTYA 4DPMA 3SLGA 2PY6A 5JBIA 3U4DA 1IULA 2H6EA 1IZ9A 3AI1A 1ISJA 2D3TA 4Z3DA 2WSBA 1Z7BA 4ND5A 4BGVA 3P7MA 3A28A 2Q1SA 1LRJA 3CMMA 4M87A 2PNFA 4NG5A 2PZJA 3RSHA 4GLOA 4BL5A 4NDNE 3ZV4A 3G79A 3INTA 4CMEA 2YDYA 4WGGA 4OL9A 4XIJA 5L7TA 1WNTA 1YXMA 4DGSA 2BGLA 4CLXA 5KTKA 3ANLA 1BDBA 3GNQA 2W2LA 3JYPA 1KOLA 3ADOA 4B7CA 4NFHA 4OKIA 4RVGA 1H94A 4ZD6A 4XD2A 5FF9A 3L4BA 2WEKA 3PQEA 4YJHA 1DO8A 1PJ2A 4BGEA 1M76A 4IJUA 1PWZA 4RLSA 1QMGA 3OIDA 5BSHA 5KJ6A 4NJMA 3WB9A 4AJ4A 4MKXA 1OBFO 4TWRA 1KC3A 3IC5A 3LYLA 1WPQA 2DUWA 3OETA 4YDRA 1EFKA 4F6LA 5DP1A 4K6CA 1YL5A 3QVTA 5TX7A 4M49A 1HYHA 2HCTA 1P44A 1CQIA 2NTNA 4CM6A 2X22A 4DWVA 5U9CA 4FFLA 4MVJD 4MVJH 1KEUA 4NBUA 4HFJA 3WGIA 4ZRNA 4EI2A 1RYEA 1JAXA 4YT5A 3LF1A 2NVUB 5JSFA 3GDOA 2ZYAA 1UH5A 1BHSA 1EE2A 3DZBA 3A14A 1N2SA 5K9ZA 1XU9A 1BSVA 3NT4A 2HDHA 5BSFA 3I9JA 3MEQA 1C1XA 3BMNB 1PR9A 4FFMA 3CKYA 4BNJA 2ZQZA 4OO3A 1ZSYA 2E4AA 2VYNA 1BXZA 3C3XA 5DBGA 3EK2A 1EVJA 3NYWA 1QORA 3KYDA 3DO5A 4BO7A 5A5EA 2AE1A 1CYDA 1ARZA 1BXGA 1GQYA 3GUCA 1I5RA 1GQQA 3OQ6A 3TDKA 2O4CA 1ISIA 1GV1A 3UFXA 2OHXA 1A4IA 3KV3O 1A9ZA 4JJFA 1Z74A 3GEMA 4ROSA 4LSWA 4RV9A 4WKGA 1AXGA 2X0NA 4I5GA 5ES3A 5JAQA 2BD0A 2VNAA 1KY4A 3IUSA 4JGBA 1H9AA 4DTIA 3PGJA 1DXYA 4LRTB 2P68A 2I67A 2BI8A 4A2CA 2JHFA 4A7PA 2X7HA 1KC1A 2ZKLA 3RAJA 3UKOA 3VTZA 3MJTA 1TT5A 3UF0A 2RBEA 4J16A 4E2ZA 1NM5A 1P9LA 3NEPX 3JCZA 4CMGA 1YKFA 4YYZA 1E92A 5B12A 2GASA 3KYDB 4PG5A 3QW2A 4Y98A 4L74A 5EN4A 3DWFA 2VQ3A 4IIVA 4D7AA 1ZNQO 2BRUA 2EW8A 4E12A 2HU2A 3DAFA 1T25A 3JD2A 3RBZA 1PJBA 3ZWWA 1R37A 2E82A 2FP4A 3FF4A 3QQPA 1LSOA 1ORRA 2CDCA 4FC7A 3JD0A 4D43A 4E3ZA 2V6GA 4EYEA 1ULSA 3G17A 2VOEA 4WLOA 2YQ5A 3DZIA 3S2EA 1EUDA 1MV8A 4AJNA 3L9WA 4R41A 5L4SA 3E9NA 4LVUA 4UEJA 5C5IA 3O4RA 1P45A 1A27A 2GZ3A 4UVIA 4DREA 2J3HA 4O1MA 3B6ZA 4ALKA 1B3BA 3JQDA 1UP6A 3I23A 1F14A 1RKXA 1ONOA 3QWBA 1WDKA 4GLLA 2NM0A 3F6YA 2R2GA 1RYDA 4AJPA 3L6EA 1I3LA 5KOIA 5KVSA 3CINA 2D5AA 3GDFA 2C29D 3JQFC 3OBBA 4NQZA 4DBVO 4GI2A 3WFJA 3KLMX 1IZ0A 3ADPA 3Q2IA 4YJFB 3EGOA 1OZAA 3PPIA 5LC1A 1GYPA 4O6VA 5G0UA 5IAAA 1H2HA 1UAGA 4KDFA 1N92A 1N9GA 5TQVA 3SC4A 2O3UA 3HB5X 5KVCA 2CF5A 4WLFA 5I8WA 3RIHA 1WMBA 4GSLA 4WEQA 4R9RA 2FSVA 3FNHA 1M6HA 3DZJA 5DF1A 5A3JA 3RU7A 4N5NA 3GK3A 5DN9A 1JWBB 4NMHA 2Q1UA 5JY1A 2JAPA 2XXBA 3Q3CA 1VRWA 4I9NA 4RF4A 1X13A 1FMCA 1A4UA 2PGDA 1VI2A 3I9NA 4JX8A 4ND4A 3AUSA 3WYEA 3PYXA 4U5QA 4ALMA 1K6XA 2NQTA 2EKLA 3LLSA 1RWBA 4QEDA 2XAAA 2A92A 3E9MA 4NIMA 4Z9XA 3OEYA 4BNUA 3S1LA 1HTBA 1DHRA 1TA4A 1K89A 2W90A 5T5QA 3QWAA 4DLLA 2EP7A 1DOHA 4O59O 1PJLA 2JKVA 3ONEA 3ROMA 2DPHA 3A06A 1KIFA 4WCDA 3PI7A 4KTVE 1DIRA 2C5EA 1DLJA 2OFPA 3C7DB 3TPCA 4JCOA 1SEVA 1KY5A 1HDGO 2VUTA 1DAPA 1M75A 1V9LA 5BSEA 5HBRA 4R68A 1KERA 3PZRA 2HKIA 2PKQO 4BVAA 3VPFA 3PJDA 1LI4A 2FZEA 2PGLA 3TOZA 5C7LO 1ISGA 4FGWA 4LVCA 2QQ5A 4BNWA 2BI7A 1NASA 1YQGA 1NAIA 5JAIA 3DFZA 1A72A 2GDZA 4W6ZA 3MJEA 1SO8A 2QX7A 3MJVA 3N58A 4ALNA 2EIHA 1P1HA 2PZKA 2O48X 4B3IA 3P2YA 1VPDA 4I8XA 2FOIA 3D3WB 3PHGA 2VHWA 4PLGA 4DRYA 4EJ0A 1IPEA 5LCXA 2Q46A 2H63A 1GR0A 1N8KA 2W2KB 3G3EA 5G2OA 3WGHA 3NT5A 3M1LA 3C1TA 1QV6A 1VM6A 4D41A 2B69A 3KYBA 1H6DA 2OL4A 4HX5A 2Y66A 3PTZA 1P1RA 2GN6A 3SBOA 4RLHA 2X5OA 1HDRA 4LRSB 1LXCA 4I08A 1WWKA 1C3VA 4PG4A 3QVWA 1LU9A 3JQAA 3IQDB 1HE5A 4BNKA 3LT1A 1SOVA 3ZWBA 2B36A 4YB8A 4WCFB 2Y1FA 1O9BA 2DTEA 4NNJA 3W4JA 3ASUA 5AYVA 5A9SA 4JXKA 4ND3A 1KVRA 6ADHA 1XU7A 3DBRA 4RPKA 1ZSVA 4GSKA 2GN8A 1UDAA 2E6UX 4CMCA 1U3WA 2FWMX 2I3AA 3OEWA 1KEVA 1ZXLA 3ONDA 1I2ZA 2BFOA 3VPSA 1GZ4A 5A04A 5IXYA 3PHHA 2G1UA 4E5PA 1SPXA 5G4KA 4B8ZA 4BO1A 3L07A 1DIHA 1R16A 1JU9A 2C2XA 4R1TA 1I32A 2JD0A 4RZHA 3O26A 3ZV5A 3CMCO 4E13A 3HDQA 1X0XA 4W99A 1WMAA 5CDYA 2TMDA 4XYEA 1XQ6A 2AMFA 1LDGA 1AN9A 3GGGA 3NAQA 2GZ2A 3ITDA 3OH8A 1LLCA 3BHIA 3DZGA 5EMHA 2OBYA 5CEEA 1PZEA 3WSVA 2BELA 4J4HA 2V6FA 3CZMA 2GD1O 2GO1A 5BNIA 2YHUA 5CP8A 3E6AA 4J0EA 5C3MA 1YJQA 1HXHA 3JD4A 2A35A 1T2AA 1NVGA 4RQTA 1DC4A 3MOGA 3IDSA 1Q2XA 3JQ8A 2Q50A 3OF2A 4BNMA 4D42A 3H3JA 2D5CA 1WVGA 3U4HA 5MDHA 3JQAB 1DFIA 5TSDA 4ESOA 2GERA 2HRZA 4Q3DA 3I3OA 3ZU3A 1U5AA 2IE0A 5HRUA 1R4MB 4ZN6A 1AXEA 1A7KA 1QG6A 3VPGA 2YFHA 5A05A 1ZMTA 4XB2A 3V2GA 2PD3A 1ZMOA 2PFGA 4NJOA 5F21A 1GAEO 1U3UA 2HK8A 3B20A 4ZQHA 3TSCA 4MINA 2UUPA 1R15A 2SCUA 3GLQA 1CWUA 5MGBA 2VYVA 1OC4A 1U4OA 5JNLA 4OOEA 3PHIA 3R0IA 2B4TO 3NDRA 5AXAA 2VWQA 1ZCJA 2V6MA 1HF3A 1TT7A 2NQ8A 1PWXA 1ZFNA 3QVXA 2ZTUA 2EXXA 2OGUA 5FEUA 1PQPA 3Q11A 1PGQA 5I7VA 4YJDA 4IDFA 2P9EA 3H6KA 1I33A 4N5MA 3ETEA 2B0JA 1HSZA 3LF2A 1ML3A 3C85A 3VAZA 4L4SA 2OOSA 1YQDA 2Y1OA 3PXXA 3AM4A 4YAEA 2NU6A 3FD8A 1FK8A 2B4RO 4XQGA 4MVJP 1GY8A 1MXHA 2GRAA 4BKPA 3PQFA 1XGKA 4BGIA 2P5YA 2AA3A 5DZSA 3I1JA 5ILGA 1AHIA 2DUUA 4PLTA 4BNIA 1UXKA 3G1TA 4BB6A 2DM6A 5L53A 3H4VA 1EDZA 1E5LA 1NVTA 5U4QA 1XSEA 1NPTO 4R3WA 4EUEA 1GTMA 3K9QO 1SNYA 1YDWA 4IQ0A 3WNQA 2CNBA 3F1LA 4DXHA 1NX6A 3GUYA 1EVIA 1Y9AA 2PZMA 1V35A 3DMYA 1E3IA 4XYGA 4B7UA 4PG8A 3IOYA 3UAGA 4BNFA 2WD7A 1KVSA 3KZVA 1PGPA 1LUAA 1X14A 2FR8A 1NFFA 1H6CA 2X5KO 3MTGA 4CLRA 3ZU2A 1QYDA 1C0KA 1SMKA 2X58A 5KKAA 1DC6A 3V1YA 1G0NA 5TT0A 1IUKA 4II2A 1GV0A 1N5DA 4R5MA 3OP4A 1DFHA 2DT5A 1LBEA 1JDJA 5B1YA 4Q3EA 5TRTA 4AJ2A 4DIOA 1PEDA 2CZCA 4IS2A 2HQ1A 1XR3A 5JY6A 2B5WA 1WLYA 4UVGA 3VZRA 3WIDA 4CMIA 3WGQA 4FB5A 4YJFA 1U28A 3PJEA 5IXSA 2CDBA 4LMPA 3ZWYA 1ENZA 2FHSA 4J9UE 1OI7A 2O3RA 3VKUA 1OMOA 1VJ0A 4DMLA 2NU8A 3JYLA 4CV3A 3AY7A 5TGDA 1N7HA 4RDIA 1N1EA 4XYMA 3KSUA 2P4HX 4PRLA 5FI5A 1MG5A 1MLDA 4JBGA 2QIOA 3JV7A 3BTVA 1EBUA 1NHWA 4W9NA 4WLVA 2Q3EA 2UVDA 1OOEA 1IYZA 4D3DA 1JTVA 1W6UA 3C8MA 3PHLA 3RUEA 1I3KA 1HE4A 1SC6A 1MG0A 1ADCA 3GZNA 3JD1A 3F5QA 5I9NA 1LA2A 4IS3A 3D3EA 4UVDA 1XHLA 3MWEB 4MKRA 3VH1A 3PIIA 3RJ9A 3UHAA 2Y0EA 2Y93A 4UREA 2NACA 2XXJA 3ZWMA 1F17A 3C7CB 1ID1A 3H3FA 4CQLB 1KEPA 5T57A 4J6FA 1O89A 4OMUA 4ZVVA 4F46A 4MVJM 3VH2A 3KOUA 1ENYA 1CERA 1LQTA 1Z82A 2CDAA 3S2IA 1U4SA 4PIVA 4GL4A 1F0YA 1WP4A 4KQWA 5JPIA 1DRUA 1CEQA 3GY0A 2AQKA 3P5SA 5AXBA 5K0ZA 3CH6A 3MCVA 3TN7A 1QP8A 1I30A 2WJPA 3IP1A 1KVQA 4DLBA 4OAQA 4K6FA 1E1NA 5A03A 1B7GO 1P0FA 2R6JA 2YFQA 3TL3A 4QECA 4BNGA 2BF7A 4CM4A 4IY1A 1Z45A 2WYWA 3KYCA 3WLFA 3F4BA 4I9HA 4IM7A 1QV7A 4PFJA 3ZW8A 3PYLA 1ZUD1 1C0PA 3RC1A 4LN1A 4NU5A 1XLTA 2IDZA 2QZZA 4A27A 4BO9A 1HKUA 1K6JA 2AQHA 4U6SA 3W8DA 5L7YA 2IRWA 1I01A 4CMEC 3S2FA 4B8WA 2AXQA 2AEJA 3TQHA 3OJOA 1EVZA 4XKJA 3I6IA 4J90A 4A03A 3JQ9A 4MVJF 4JJGA 3VZPA 4QTZA 1YGYA 5IZCC 5H81A 4BQPA 4XRGA 5THKA 3TL2A 3O9ZA 2CMDA 3TZQA 5EINA 1GDHA 4Q3AA 1HDYA 3LC7O 1Q7CA 4U7WA 2I66A 3LU1A 3HN7A 2PWZA 4MP3A 2H9IA 4DUPA 2I99A 1JA9A 1Z6ZA 3FCOA 4QO8A 1LQUA 1MC5A 3GN1A 4TZTA 3SXPA 5CDSA 4EEXA 4R01A 5G4LA 2HK9A 4FW8A 2J5QA 1PIWA 4GBJA 3Q6IA 2ZJ0A 1NAHA 4BO0A 1BMDA 3GN2A 4M89A 2VHVA 4JP2A 3DBLB 4WLNA 2PKQP 5FFFA 4PGFA 2O3JA 2FN7A 5B37A 3JYOA 3IS3A 2CVOA 1LJ8A 4CMBA 2XOXA 1LSJA 3ABIA 4DMMA 3DBHB 4CLRB 2ZJ1A 4J4BA 2X86A 1ENPA 3VPHA 1GCUA 5G0VA 4H3VA 1VJTA 3ZNOA 1Z73A 1V3VA 2EKPA 4FJ1A 3JTMA 3SEFA 2O3SA 1U8XX 3WJAA 4YVFA 1S7CA 4QX6A 1EK6A 4HY3A 4TKLA 5B4TA 1X0VA 1YBMA 4PLCA 2Z1MA 3H5NA 1NFRA 3MOIA 4BO6A 5T67A 2P5UA 2OBNA 1PZFA 5KCZA 3WYBA 1RM5A 3S8MA 3RUDA 1UZNA 1YB5A 3N7UA 1UAYA 5BNTA 5I7FA 2VNSA 3PHJA 3NV9A 3U62A 1OAAA 4TVBA 4RZIA 1QLJA 3H5RA 1TT5B 4G5HA 4KDEA 2VOJA 3INGA 4TZKA 2Q4BA 1HT0A 3AM5A 1KYQA 4WECA 2C0CA 3HN2A 5LDHA 2AQIA 3I4FA 4OKNA 1D8AA 2J5KA 4J2HA 3RUIA 4DBZA 3O8QA 4ZU3A 3DZKA 3GQVA 1J4AA 2A4KA 4E21A 2W4QA 4U6QA 1JVSA 3ETDA 3ZI0A 4C7KA 1I3NA 4ITUA 2QRLA 1RJWA 3PYMA 1UP4A 4ZGWA 5T8KA 1BVUA 2ZIZA 2O50A 4HV4A 2EJWA 5H82A 4YQZA 3AOEA 2X4GA 1LRKA 3LSYA 3GT0A 2JAHA 2WDZA 4DA9A 2X6TA 2FR1A 5CHEA 3U4CA 1K6IA 3B1KA 2V6BA 4PN3A 4OXYA 3TFOA 4IDDA 1C1XB 3L4BC 3PRJA 3ENKA 4D3FA 3QV1A 4FFNA 2NVBA 3ST7A 1XA0A 3VPXA 1J49A 4M1QA 3DZHA 1KS9A 4YJGB 1TI7A 2OUIA 3IAHA 5A5FA 5IN5A 2EV9A 4AJIA 1R0KA 2NVUA 4YCAA 1HE2A 1PU2A 1X7HA 5EERA 3V8BA 4CM5A 5IZCA 1J0XO 5LDGA 2EWMA 1QR6A 1I10A 3A1NA 1E6UA 3ZWCA 2HMTA 4E2WA 2I9PA 4HNGA 4PVDA 2FR0A 3D4PA 1T1SA 4D46A 3K92A 3FTPA 4DIBA 5A1TA 5EL0A 5TJHA 4BNLA 3D5QA 2O7SA 3JQEA 4PLZA 2DU8A 1T4DA 1VKOA 3CTMA 3UN1A 2QHXA 1ZKMA 3F5SA 3O38A 5I7EA 3D1LA 3PJGA 4CL3A 2H5LA 3DHYA 2DQ4A 4NFYA 4WPGA 4EW6A 4YT4A 3H5AA 4FIZA 5KKCA 2IZ0A 4YT2A 1I24A 4XGIA 1I8TA 2VRCA 2Y1DA 4IJVA 5EPOA 2PD4A 1IOLA 2ZTMA 3QWHA 4E31A 1ZZEA 2DFDA 3M2PA 3GGPA 9LDBA 4L4RA 1HLPA 1BW9A 3PJFA 3OJFA 2WYUA 5ER6A 3AI3A 1U8FO 2IXAA 1MFZA 4BOYA 1M6WA 5IJZA 1NNUA 4O0LA 1ADBA 4ONEA 4I9UA 3DZFA 4Y6PA 3UCXA 4CM8A 5A02A 5GZ3A 2C82A 4CR8A 3Q9NA 4HFRA 3WSWA 1PL6A 3LQFA 4GPD1 4CM3A 3RUHA 4Z3KA 3KSZO 4AICA 3W8FA 1Q7BA 1V8BA 1X7DA 1B8VA 2IYPA 4RQUA 2A94A 4CODB 3HB4X 3ZNNA 3H7AA 4L4XA 2DBQA 3K2BA 3WICA 1LX6A 2W98A 3JQFA 1HYEA 3ZV3A 2VRBA 4CMKA 4Y6RA 4ZQGA 2WE7A 2RAFA 3GVPA 1R4NA 4D79A 4CQMA 3KEQA 4NHEA 4FC6A 4FFOA 3CPSA 3RFXA 1Y8QB 1R6DA 2C7VA 2R00C 3R3JA 4BO2A 1JLLA 3L4SO 3RJ5A 3WQRA 4Q9NA 3ON5A 3AWDA 2VT3A 4RVFA 3BZUA 3RD5A 2BGKA 2JFHA 3LK7A 4CQMB 1YOVB 4YBZA 2YV1A 3VKVA 1NWHA 4FQ8A 4JP3A 2W2LD 3GPDG 3BTUA 4K26A 4ALIA 2HMWA 2OP1A 4UVHA 5JC1A 4Z0HO 2Y0CA 3FBGA 3BMQB 3WX0A 1BDMA 2DBRA 1EMDA 3OQ1A 3RUCA 1NYTA 3U0BA 4BQRA 2BGMA 2BLLA 4I5FA 3I6QA 4ZRMA 1LRLA 2E37A 4CV0A 4EZBA 4L73A 5A9RA 4UUOA 5L9AA 4NBWA 4CR6A 2VUUA 2VCYA 4IMRA 4Y6SA 4KUHA 3GA0A 1H93A 3I83A 1XELA 3JD3A 4N54A 1EEHA 1P1IA 2ZCUA 4FR5A 8LDHA 1E6EA 2GLXA 4P4LA 1P74A 2YYYA 2J6IA 2EGGA 4WLUA 3RQSA 4CLHA 2E48A 4DIFA 3H65A 1PSDA 3WBBA 3HDYA 4YA6A 5ICMA 1P1FA 3HDJA 1UXIA 4BKRA 3ORFA 3ZCXA 2VUSA 1U7HA 2Q45A 3BMCA 4M8SA 4D0SA 1DC5A 1YVEI 2RIRA 3AOGA 3FN4A 5JE8A 4OGWA 2AW5A 4H16A 1XWFA 3F1KA 5BR7A 1BG6A 4OSOA 4DPLA 3Q2KA 3V5NA 5L7WA 1R4MA 2D4AA 5L4NA 3OIFA 1HSOA 2ILTA 3RFVA 4N7RA 4IZIA 3WIEA 3FNEA 1ADGA 5KJFA 1MXFA 3AJRA 1HWYA 4N5LA 1GEEA 1TVEA 3FRJA 3BA1A 4P4GA 4INAA 5BSGA 1GEGA 3QLJA 3FNFA 4JNKA 3HFGA 4CUKA 4RVSA 2POQX 1Z75A 1E3EA 2DLDA 1LLDA 4BV8A 4J7XA 4XDZA 3ITKA 1YB1A 1NBOA 3K73O 2DVMA 3DHNA 4IZHA 1P1JA 3MJSA 4FBGA 1E7SA 1K0UA 4NJMB 3H2SA 1NQTA 1DAOA 1UDCA 2VHYA 1OFGA 3R3SA 1ADFA 3NJ4A 4TROA 3RC2A 4BNNA 3ZWOA 1XKQA 3KBOA 1DDOA 4J0FA 4A0SA 1Y9EA 3ZWNA 1O94A 1E7RA 2ZYDA 2GN9A 3HNPA 4FFRA 1DHTA 3DL2A 1ISFA 4HP8A 4BKUA 5BT9A 3PFFA 3C24A 3IL2A 3QSGA 4UEOA 1W8DA 4FOSA 4BNVA 4RJTA 1LSUA 1NWCA 2QG4A 4DLAA 4W7IA 1ISHA 2Z1NA 1MP0A 4XJTA 1H6BA 2OP0A 2B5VA 3W4IA 1UR5A 2HK7A 1ZBQA 2D1YA 4UUNA 1O95A 2Q2QA 4CM4B 3OA2A 5A9SB 4EITA 3O03A 3JQ7B 1ZSNA 4FDAA 5JC8A 2HMVA 2DC1A 1EUZA 1ZK4A 2FPPA 4MJLA 1CF2O 1E6WA 1EZ4A 1ZVMA 1WW8A 3DMTC 2Y1EA 3NUGA 3RU9A 2BHLA 1RM4A 3UICA 4BO4A 4YAIA 3OECA 3DR3A 3H9UA 3HHPA 4E2YA 2EERA 4Q3BA 5IDQA 3ZWVA 2VTDA 4YRAA 4U8GA 1U3VA 1YOVA 4OQYA 3T7CA 1L7DA 3BTOA 3VZQA 5TLSA 1NQAO 2FPIA 5DP2A 2UAGA 4IQ8A 1GL3A 3D7LA 3I52A 2IEBA 3RCBA 5IDYA 4XGKA 3C7AA 1AGNA 4GGOA 4UUMA 3GMDA 3HSKA 4YRDA 2IYOA 1F8FA 1HE3A 4FN4A 2FZWA 4XEHA 3SJUA 1PQWA 2GSDA 4WNIA 4F45A 2EGHA 5B4VA 2CVQA 1DBVO 4L8VA 2CSUA 3KTDA 5I9MA 4BV9A 4J49A 3D4OA 3B1FA 3TFQA 4BNXA 4CV1A 1PJCA 4M86A 4MKZA 3DXFA 4MOWA 3G1UA 5JO9A 1B8UA 5L45A 3WGGA 2GPTA 3G49A 4J43A 4RF3A 4BHTA 2G0TA 1HZJA 4CQMD 3RC9A 4MP8A 4WEOA 3ENNA 1PGJA 2D2IA 3AY6A 4LCJA 5G0SA 1PTJA 4B4WA 4CM1A 2UV8A 4PRKA 1R4NB 3PLRA 5KVQA 3ZU5A 4IGFA 4J7CA 1IPFA 3MJCA 4EJMA 1QLHA 2X0RA 3Q0EA 1G1AA 1Y5MA 2PR2A 3OFSA 1DSSG 3KEOA 3LC2O 1MUUA 3DBRB 4E6PA 2HMSA 1LDYA 3L6OO 4YJHB 1C14A 1DRVA 4P38A 1V3UA 2BFAA 5CG2A 3KHUA 4YT8A 3LLVA 1M2WA 5AXCA 2GUGA 3ANNA 3GHYA 3K8ZA 3I9KA 4WE3A 7MDHA 5A06A 4XWYA 4XX0A 1EDOA 3TJRA 4K9DA 4R51A 1B8PA 1GUZA 1Y7TA 2O23A 5A3VA 1E77A 2FSSA 2QRKA 3ZHYA 4K1LA 4MO2A 1KETA 2ZB4A 1NXQA 5FWNA 1DIGA 3GC6A 5I8ZA 2NWQA 5KVVA 3SJ7A 4EEZA 5K6AA 1U2GA 3WQQA 4EDFA 2H1SA 4IIUA 1F06A 4BKQA 2WWRA 1EBFA 3OQBA 3PZBA 4ZJUA 4J9VA 1EE9A 4R4JA 1P1KA 4MIEA 1HDZA 4IQGA 1I2BA 3VVCA 1BXKA 1YJ8A 5C7OO 3AOEC 1W0CA 4EUFA 3F3SA 1GUFA 3T4XA 3EC7A 3DOCA 3SLKA 4FSHA 2X23A 3NJ8A 4TRNA 5HS4A 1HRDA 3OICA 1BTOA 3PWSA 1P0CA 3TNLA 2YV2A 2AQ8A 1SCUA 4MDHA 4R3NA 2Q49A 4I5EA 4B3HA 1DRWA 5HTOA 3GAFA 3JYQA 4FFPA 1CRWG 1PZHA 5JMPA 4YACA 2P9GA 5JDCC 4CQLA 1A71A 1TXGA 1TEHA 3NT2A 5IDXA 2J5RA 3I9LA 5JW6A 1XQ1A 4ZQBA 4A10A 5JXWA 3RROA 2WM3A 5U1PA 1JW9B 3DOOA 4HKTA 4FPXA 1U7TA 4YR9A 3NDJA 5KJCA 2X0IA 2YW9A 5ITVA 4J1NA 3F9IA 4E32A 3FR7A 2BFPA 4M55A 3AFNA 3AUUA 5DULA 1X7GA 3TWOA 4XYBA 3CXRA 1DJQA 1T2DA 3O8QB 2X8LA 4R69A 3W8EA 4AJLA 4C7JA 1W4ZA 5COAA 2PGJA 4KZPA 1T24A 3LDHA 3DBVO 4EGFA 3GRPA 2VWHA 2B83A 2YZ7A 4S3MA 1AUPA 4ZQEA 7ADHA 4R16A 3TRIA 4J7UA 4B4OA 4XGNA 1R66A 3H9JA 4A26A 3EZYA 4BO3A 1C0LA 4LK3A 4AJ1A 3KXDA 1YH3A 3KLPX 4CLEA 3AU9A 5CEFA 2Y1GA 3K31A 3ZGYA 4UUPA 3SX2A 2CVZA 3NTQA 2J3KA 2PH3A 5JDCA 3CUKA 4CLOB 3OJLA 3WOHA 3M6IA 1GPDG 1N9GB 4CMIB 1R12A 1PR3A 1A7AA 2PTGA 1CQJA 3MJ4A 5HS6A 4R1NA 4GQAA 3DB2A 2C59A 1D7OA 4E5NA 3U09A 3PEFA 1ONPA 3U9LA 4WASA 4PLPA 4F6CA 1LC3A 1H6AA 4GX0A 3DAPA 2WYVA 4LW8A 3OA0A 4GX5A 2VT2A 3RASA 5COQA 4II3A 9LDTA 3QVSA 2ZB3A 2G82A 4OSPA 4RF5A 3MZ0A 4R5HA 3VVBA 3NGXA 4IDBA 2PLAA 5ENDA 4QSMA 1JKIA 5FYDA 1O5IA 1PS0A 3K30A 2X9GA 4IBOA 3GFBA 5L51A 3A4VA 1YE3A 3S2GA 1KVTA 2NLOA 2JCVA 4BIIA 4JK3A 3Q9UA 2VTEA 1D4FA 3AFMA 1ZK1A 3E03A 3JQ6A 2Z95A 1MGOA 3P19A 4FGSA 3QY9A 1PQUA 3WTCA 3CSDA 3WNVA 1LSSA 4LISA 3S55A 5G0TA 5T6BA 5CDUA 5EQFA 4E5KA 2D0IA 2B4QA 1ZO8A 1TB4A 1E3SA 3LT0A 3IUPA 3OJ0A 1YRLA 4FCCA 3VZSA 1NPYA 2HO5A 4D44A 3RBXA 1E7WA 2Q2VA 1SBYA 4NH4A 4RL6A 4BMNA 3WJ7A 2PH5A 2UUOA 1E3WB 3QHAA 5DCYA 3FR8A 3WWYA 3RUAA 1GYQA 3GDGA 3EY4A 3DAGA 3DFUA 3HUDA 3W4KA 1YBAA 2WD8A 1VL6A 4OHUA 1YWGO 2WMDA 3PGXA 1HETA 4Y9DA 3ETGA 1E1KA 3BMNA 4I5DA 3GGOA 4CV2A 5BQFA 2C54A 5CAEA 1QSGA 4FS3A 3MWDB 1EK5A 1JQBA 5JAZA 3QWIA 1O6ZA 1MC4A 3FNGA 4Q3NA 4H15A 3JQCA 4KWIA 2O4UX 4WOKA 2GCGA 5KJEA 4MVJE 1KBZA 2JCXA 3VDQA 1K3TA 4GKBA 4CM9A 4CMAA 5CDTA 4NK5A 3DDNA 5IFLA 3EUWA 1JKJA 3V2UA 3WBFA 3T4EA 3SC6A 1JKFA 4IMPA 4JJIA 1A5ZA 3AW9A 5ADHA 3DHEA 2NSDA 2J8ZA 3FSRA 2CY0A 4KUGA 3BAZA 4RPGA 4CJXA 4GX2A 2PZLA 4PLWA 4E2XA 2QYTA 4PLHA 3TZ6A 3WWZA 4TKMA 3PDUA 4N18A 4ID9A 3H9QA 1CETA 4K28A 1VL8A 4YAKA 4Y8VA 4HNHA 4ZQFA 5KJ1A 3C1AA 3QVOA 1PZGA 2Q4EA 4FJ0A 1B0AA 3PLNA 5JCJD 1LLQA 1NPDA 3ZDFA 2VZ0A 4P22A 3RVDA 4ZICA 4D3SA 1IHYA 4J1QA 2AG5A 3CE6A 2JCYA 3BYZA 3LC1O 1GPJA 3AM3A 2VHZA 2GGSA 5L40A 1E3WA 3RFTA 3LT4A 3F47A 3DTTA 3ZWPA 2IODA 2YV3A 5T8KC 5DBIA 1HDOA 4PLYA 1WZIA 2G17A 4GH5A 4Z9YA 1EVYA 5IF3A 1S6YA 4XCVA 3D5TA 4H7PA 1MA0A 1LDNA 1BVRA 2Y67A 2X0JA 2IXBA 4BB5A 3HG7A 4IDAA 1X1TA 1T26A 2I3GA 4GWKA 2Y68A 1HLDA 3QA9A 3QE3A 4NR0A 2NV6A 4GWGA 4FD3A 1GQ2A 4WCFA 3NRCA 1VC2A 3E9QA 3NKLA 1RM0A 1U2DA 4O5OA 3PQDA 2VYVD 3TOXA 3GF4A 3G0OA 4M54A 2PA3A 4W9NC 4CL8A 2FY8A 3EDMA 3P2OA 2BH9A 3LVFO 4RCVA 2NNLD 4WNCA 4DC0A 1BW9B 3NTRA 1GADO 1B16A 2AHRA 3K5PA 3BMOB 2X9NA 4U0KA 2QYSA 3WXBA 4DVJA 1GYRA 4QQRA 4ND1A 1I3MA 3ZNQA 5DDIP 1PJSA 1ZK0A 3VHRA 3TF5A 5THQA 2DKNA 5EESA 3L6DA 3ZHZA 2RH8A 5ICSA 4Q39A 3OIGA 5JYEA 1GCOA 3DMTA 4RVUA 4FJ2A 3COSA 1XCBA 4CPDA 1PJ3A 3M2TA 5JCJA 3D4NA 1PGNA 1I0ZA 1Q0HA 4O63O 4HFMA 4JQCA 3PFWO 4HADA 4IDEA 2ZATA 5CPFA 2BMAA 3DOJA 1FF9A 5F3RA 3C1OA 4BNTA 1SAYA 3UUWA 1YB4A 2AE2A 1A9YA 3DBLA 3FWNA 4BKOA 4U0JA 1SZJG 3WGOA 3ICCA 5A4DA 5GMOA 4W82A 1NR7A 4F3YA 1M66A 3WMXA 2VWGA 4AL4A 3HJAA 4TQGA 1PJTA 2LDXA 5G0WA 4NI5A 4URFA 2XPCA 2DTDA 3E8XA 1B26A 3KUXA 3TZHA 3VC7A 2I6TA 2ZQYA 4FOOA 2BFMA 1T2EA 5DOZA 3JQGA 4J1TA 2YHIB 2O3QA 2JFGA 3UOGA 3KM0A 5IDWA 1RPNA 3CIFA 3PVZA 4UEKA 3RBVA 1PL8A 3DQPA 3IKVA 4CUJA 1EFLA 4HWKA 1D3AA 3GG2A 2VN8A 2YY7A 2VWPA 1N1GA 4KQXA 3ZHXA 3JYNA 1IHXA 3U49A 5F1KA 4KMSA 1E1MA 4LMRA 4DPKA 1H5QA 3PDJA 2R00A 4MIYA 1B15A 4XR4A 3SVTA 4RPHA 4KOAA 4LGVA 1ZIDA 3NDIA 1ISMA 3I9OA 2RCYA 4NFSA 2O2YA 1UZMA 3RUFA 2C2YA 2DBZA 3CZRA 1FDUA 2O2SA 1ZW1A 2YHIA 4XB1A 1NHGA 2P91A 1BGVA 1T2CA 4YPOA 4R1SA 5ENVA 5TC4A 3V2HA 1E1LA 2OZPA 3H9GA 1BRMA 4NBTA 3AY3A 3WFIA 1DPGA 1IB6A 4Z9FA 5GY7A 1BWSA 3ROKA 1P77A 2ZTLA 5ITWA 2EJVA 2FRDA 1K5HA 1UDBA 4DQVA 4E4YA 4AJJA 4GVLA 2B37A 2JD1A 2WTBA 2AG8A 2HJRA 5IN4A 1GZ6A 3LT2A 1G6KA 5JDIC 1DB3A 4P8RA 3ZW9A 1NFQA 4DYDA 1HEUA 1MX3A 3GPIA 3I4CA 1DIAA 4RDHA 4Z0TA 1H2BA 2Y99A 5HWSA 4J2OA 2VYND 1P33A 5AXDA 5CFZA 1B3RA 4AVYA 2DPGA 2NUAA 2GZ1A 1T1RA 1DLIA 2GN4A 3IKTA 1YDEA 3ONFA 4A73A 3L0DA 1JVBA 4TMFA 4AJHA 3E1KA 4RPLA 3DEYX 5JDIA 1PGOA 1ONNA 4XIYA 3I9MA 4E5YA 2EHDA 5JYDA 3D0OA 4D0RA 1YL7A 1ZH8A 2C07A 1Z7EA 1R0LA 2VRCD 2FMUA 2I5PO 4ZHSA 2IZ1A 4PZEA 1QXSA 1O0SA 4BNHA 3HFSA 1Q7GA 1KVUA 4IJWA 2XF8A 4IPTA 1UZLA 3HE3A 1SB8A 3KO8A 4CM8B 1YL6A 3AUTA 4J3FA 3GR6A 2G5CA 1Q1NA 4G2NA 4RVHA 8ADHA 1Y5RA 4GMFA 2JD2A 3OSUA 4BNZA 4PVCA 4B79A 1EQUA 3N74A 3VTFA 5JO0A 1C1DA 1FDSA 4NPCA 5JMWA 4QFDA 1WDMA 1UXGA 3R6DA 2Q99A 4CLOA 4GVXA 4RGBA 1PS8A 2EKQA 4MPDA 1XG5A 3ULKA 4DL9A 1XDWA 3FPLA 2DBVO 4A5OA 3D3WA 1E3JA 4GMGA 4CUZA 4G81A 3GOHA 3AK4A 1NQOA 3NGLA 2DTXA 1VSVA 4YAGA 4OXNA 4OYRA 1JWAB 2WD7B 4BO8A 1IL0A 4OH1A 1MFPA 3KB6A 3NTOA 1UP7A 1Y8QA 4ND2A 3GRKA 3GVIA 4IDGA 4YEDA 1JN0A 1MB4A 1XEAA 4G65A 4BMVA 4Z6KA 1ENOA 2E49A 5DBFA 5F1OA 5HM8A 1NVMB 3ICPA 2P2SA 5ILOA 5CG1A 1QRRA 1WXDA 2D8AA 4YRBA 4KWHA 3V1UA 3EVNA 2X9VA 3GVCA 4YJGA 2JL1A 5I7SA 4YQYA 3WG9A 5ER9A 3ROPA 5GZ1A 2CUKA 4BS9A 1XYGA 3E5RA 2RH4A 3K6JA 3GH3A 4QO7A 2O3TA 4CM9D 3KVOA 4KUEA 5DCWA 2O7QA 4HFNA 5CEJA 4MP6A 2D59A 4XJSA 3PWKA 5I9LA 5JAMA 5KWEA 1Y81A 3WLEA 1YS4A 4NBVA 3KETA 5IG2A 1YBVA 4WCFC 1DJNA 4XQ9A 5EQDA 2ZK7A 4EJ6A 1F8GA 1E5QA 1U5CA 1V6AA 1VJ1A 2Q1TA 4ILKA 4NU6A 3GZ4A 2GF2A 2ZB7A 3GVXA 4DQUA 3T7EA 3E82A 3ZH2A 5L4LA 2C20A 3DC2A 4OXKA 2PK3A 2GYYA 5A9TA 2VHXA 3U3XA 2NTJA 3BMOA 1C1DB 3INRA 1SB9A 4EUHA 1R0SA 2I76A 5TS3A 3W6ZA 3STHA 4RF2A 3HQ4O 3EAGA 1ZK2A 1EQ2A 1SEPA 1ZK3A 3V1TC 3OM9A 1AHHA 1J5PA 2UDPA 4AJEA 3I5MA 4DC1A 1LNQA 4X54A 4RO0A 1GUYA 4HBGA 3ZV6A 2RHCA 2B35A 3RKRA 2X1HA 3X2FA 4QUKA 4B3JA 2NTVA 3HZZA 2OMEA 2ZB8A 1P31A 3PP8A 3IJPA 1F12A 4MIOA 2GR9A 3EVTA 3H2ZA 1CIVA 2JJYA 3M1AA 2EF1A 3WTBA 2EG9A 4OQZA 1HZZA 2NVWA 3HWRA 4GGPA 4W4TA 5H83A 4TRJA 1Y8RA 2OORA 1IE3A 4WLEA 4JROA 1GD1O 1J6UA 1ULUA 1QKIA 4PZDA 5CPBA 5GZ6A 1DC3A 2NU9A 4J91A 4XQEA 5HA5A 1P3DA 1D1TA 3GEDA 3UVEA 5JLAA 3RKUA 5F5LA 4AJOA 5AQ1A 1B14A 2Z5LA 4S1VA 5G4KB 4QXMA 2WE8A 4ALJA 3TZCA 4XR9A 1WZEA 2EW2A 3ASVA 3IJRA 1DIBA 4MVJG 3ZZNA 2PKRA 1N7GA 3DONA 3EZLA 3PK0A 3ZWAA 2QRJA 1VKNA 4WOJA 2G76A
chains in the Genus database with same CATH superfamily
4B3XA 1WNFA 4BQNA 4TPKA 4D1YA 4CMHA 3FNBA 4JB3A 3ZU4A 1V25A 5BWOA 3E48A 5F78A 4QT0A 2PO5A 1GPH1 2HUNA 2Y4OA 5DM60 4C88A 1U0OC 3P4XA 4PEVA 1EXNA 4FLFA 3IBFA 4ZIRA 1TUEA 4J76A 3GG9A 1GOTA 2E0IA 4IDCA 2BFWA 4O5AA 2H7XA 3P2KA 4L4YA 4PCVA 4ZJPA 1D4OA 1YK0A 3TZKA 3HFJA 1QZXA 3BD6A 4AZVA 1SZPA 2IEIA 4MTLA 1TYEB 4RPJA 2AEFA 4FE3A 3OZRA 5JZMA 2PUAA 1MQ9A 4YMVA 5CIQA 3TSZA 3DTNA 2VT6A 4FDUA 5ALIA 3SI7A 3IIEA 5CDGA 3BXFA 3RTDA 1QYWA 2HJVA 5BN3A 1QYXA 3E8SA 4L85A 1HV8A 2BP7A 4G5QA 1AKYA 1WRBA 5K6AC 3Q6MA 1EUCA 1U8AA 2W11A 1UJCA 2ERXA 2P9CA 2GTPA 3BS4A 4ZT2A 4KQCA 1XZKA 1SKUA 3HWSA 2LUOA 2HUPA 3SR0A 4R54A 3E70C 2JDID 3U4MA 3PR2B 3VDRA 1M2VB 1BOFA 2RKOA 4I2VA 2HJSA 3DWEX 3LGXA 3MMPA 3PFBA 2NUAB 4G0WA 1S01A 4PSCA 2WHPA 1ZJZA 1G7CA 2XLBA 2QBYB 2RB4A 2X9QA 1VE7A 5KUTA 3BRSA 5FA5A 1U0BB 4LSMA 3WY9A 3K71B 2FMIA 4MVJA 1TK2A 4WJZA 4PXSA 1T2NA 5FBWB 2CVHA 5ILQA 1FDWA 1RU3A 2QOEA 2DQZA 2F3SA 4X41A 5EFOA 3UGQA 4B2YA 3Q3VA 1CEEA 5AI6A 3R9WA 4C4OA 4LYEA 3RYIA 3KKNA 5D5HA 4YCDA 4D4JA 2ZYIA 1Q91A 4BVJA 1JG7A 4NV0A 3M4JA 1PS9A 2ZBGA 2NGRA 4JA0A 4K2HA 1YHNA 1MRZA 3I0MA 3T8YA 3N6RA 4V0LA 3NX4A 1EP9A 4M0EA 4OM8A 2ZJFA 2CD9A 1ML4A 4YMTA 2O05A 4LE1A 1A04A 3TOCA 2JIZA 4HUJA 4F3KA 3F4LA 4D9FA 2FJ0A 2Q0SA 4G0OA 3L6BA 1C9EA 2QORA 4Q3CA 4C5AA 3DQQA 2OV8A 3LRPA 3K96A 1CV2A 4UBKA 4XEUA 5BNFA 1VIDA 4EBFA 5T3UA 4BGUA 1Z0IA 1QWOA 4NZ9A 3FCXA 2DH5A 3EPKA 3GVHA 3QE2A 2NZUG 2O54A 3LY5A 3MILA 5EKDA 3DUFB 4GLJA 1Y6GA 4JOQA 3G5TA 3COZA 1EFPA 2XJ4A 5J4VA 4XTRA 3ABSB 3V46A 1YR3A 1GZ3A 2FPXA 1E9CA 4J4TA 4TKUA 2OQVA 3BIOA 2IW1A 4XOUA 1GTSA 1XLUA 1CFZA 2NIPA 1AF7A 1WB5A 3OZFA 4BP1A 2C4NA 3MFYA 5CB8A 2DGDA 1DFGA 1V47A 2C5AA 3MG9A 4L57A 1J33A 3I32A 1NTOA 3AI2A 3N2KA 4RSRA 1UUFA 3JAWB 4QDOA 4ZODA 3T0GA 2DWUA 1KY3A 1TMOA 4BTVA 3FCCA 1XC7A 2BEWA 4K0RA 2A9QA 2HTEA 4KIGA 4Q6BA 3BHMA 3QWFA 4PICA 3GA7A 1SUWA 3X2EA 1M2NA 1UXJA 1O77A 2ZITA 1RR6A 3PIRA 3ZZ1A 1L0BA 3JQBA 4NESA 1FMTA 4YTEA 1U5BA 2XBUA 3WQSB 5JUWA 4OOFA 5FWAA 3OLVA 1FXWA 1FQKA 2J3JA 4QL3A 3SS9X 1U2QA 1ZXBA 3AJ9A 1GNTA 1J8MF 5A3QA 1RMQA 3CGGA 1AHNA 3MVEA 2AX3A 4G4SO 4D8YA 3ZVRA 2J7KA 2W6MA 4EYOA 5KYXA 2RD2A 2JHGA 4KTTE 4Z5XA 2PE5A 1TU3A 4N0QA 1YRHA 2BGGA 2PSHA 1Z18A 1LC0A 5CLHA 1QH1A 4JI1B 1SCQA 7REQA 3R0XA 4D4IA 1W2HA 1V3TA 2WP0A 4FONA 2YYSA 1CNEA 1WDLA 2WSSD 1C8KA 2HSDA 4CN8A 3W2HA 2X8JB 1D2EA 2CW5A 2GZDA 2IF2A 2YQ4A 3KQPA 5EMMA 1E2IA 1KFCB 1LVUA 2F90A 3CEAA 1RI2A 2QKYA 4C03A 2YWXA 3Q3JB 3I3SR 4I1IA 2NU9B 3RAGA 4ZEWA 5LXTF 2JI6A 1JLLB 3TX6A 1F3OA 3LZ6A 4LCEA 1PWEA 3U4QB 3MWKA 3Q8XB 2PFKA 1Q0LA 2A1UB 2RJOA 3X43A 3MUEA 5E9WA 3LHFA 3FKJA 3S44A 5K0TA 2CL5A 2WIFA 4ZALA 3ZGZA 3NUQA 5IABA 4YP7A 5DPMA 1W73A 1OH8A 5CH8A 2CYCA 1NX9A 2UVPA 4C21A 1SXIA 1YASA 3E1GA 1Z4IA 3I45A 5ALHA 3ZCUA 3ESQA 4R8VA 1QRSA 2ZBEA 3U1TA 2QZ9A 1V8DA 2HMUA 3BFXA 3ORSA 4JJKA 4W9RA 3EXIA 3WDSA 4TLCA 2QM3A 3HCRA 3QRWA 3ABZA 3PDCA 2BHTA 3S7TA 4JLNA 5LQNA 4P36A 3C3EA 4CTKA 2PIDA 3GP5A 1BKSB 2FK8A 2G0AA 1Z28A 2K7ZA 2X2OA 3JZMA 4G84A 2PX5A 4V0NA 3S28A 1CDEA 1CTQA 1CLEA 1RRVA 3JVVA 3QIVA 4YXFA 3JQ7A 3BGVA 3BOSA 4YIHA 2EEZA 1XD8A 1CC1S 1WSWA 4DM3A 4UTNA 1CJCA 1DOAA 2N75A 4I6GA 3MYRA 4ALLA 3ECCA 4DIEA 3LVBA 2JBWA 1QVAA 1JXMA 1JU3A 2ODPA 3AU8A 3I9V1 4W8GA 4W7SA 1NVAA 3ZLVA 2EJBA 1IY8A 1RYNA 2BEWB 1KFJB 2X76A 2ZIUB 3Q85A 1ZH4A 4HOYA 4IXTA 4L51A 5LZ4A 4ZVTA 3W5HA 3KE9A 3ZXUB 1TW3A 4A2WA 2AN9A 5BNWA 5FOVA 4PC2A 1BDIA 1KXZA 4E94A 2ZVPX 3KVRA 1GGEA 3L7YA 2QZ4A 4GOLD 3HKBB 5L95A 4GI1A 3ROQA 3SQWA 1M0SA 4QQNA 2LTAA 3UHOA 2ZAGA 3QU7A 3SLGA 5DGIA 5JBIA 5BQOA 3FVVA 1EAMA 3AI1A 1ISJA 2B21A 3G0DA 3FJ1A 2WSBA 5DWDA 4ZCTA 4B87A 3K8OE 4GI7A 2Q1SA 4G67A 3GLIB 1KSGA 3IEXA 3EFHA 4RULA 2VVTA 2VNJA 4ZAVA 2GJAA 3ZV4A 2HSJA 3BULA 3G79A 4CMEA 4H08A 1QS0B 2Z3WA 4OL9A 3UA3A 2OG2A 3H05A 2YWRA 1OWPA 5L7TA 2WMNB 1KGSA 2XDQB 1FSFA 4LTDA 1UK6A 5E1MA 1QIKA 1YXMA 2EDAA 4TWZA 2BGLA 4UW9A 5FI1B 5KTKA 1DKLA 1JH9A 3M6MD 1DQRA 2R6FA 1JR3D 3H2JA 4IRMA 4JIMA 4HG2A 3OCWA 2C4HA 3SYLA 5FF9A 1E79A 1ZVVA 4YJHA 1XK7A 1MZPA 1PT6A 3L01A 4BGEA 1M76A 2IYRA 4GRAA 3H86A 4EA9A 1D2GA 1QMGA 5JNSA 1KJIA 1X42A 3RANA 5KJ6A 3WB9A 3OOHA 5FB3A 4IKOA 1Y80A 2HBYA 3QKUA 3U7QB 1ZP6A 1BIFA 2IZ6A 3IC5A 3DMHA 4J6EA 4TWRA 3HA2A 4I50B 1Z6YA 4LJRA 1FSZA 2UZIR 2H0RA 1QTNA 1SU7A 3BL8A 3DWIA 5DP1A 1PE0A 4D9JA 4LHWA 2W2TA 1TZBA 3WHIA 1P44A 1V3QE 1IN5A 1WO8A 3T61A 4HN2A 1DC8A 2X22A 3GLHE 2QTHA 4QREA 1NI4A 4MVJD 4Q19A 3U6BA 4FR2A 2Z56A 4C3UA 1VHWA 4FHDA 4HO1X 1G8HA 1XJQA 4I6EA 4OXRA 1K7EB 2VXBA 4J0GA 2FEKA 4K6OA 4XASA 1RYEA 5BURA 1YR8A 3L7DA 1WPRA 4QBKA 2ZI5A 3AEUA 2QSJA 3KJFA 1U0SY 2NX2A 3SZMA 1UH5A 4F3TA 1NUTA 1BHSA 2QA5A 2M6SA 3I64A 1M34A 4KYUA 1ZA1A 5CA1F 3PQ5A 1K3UB 1QS0A 2RMKA 1NVBA 2G0NA 1RCFA 1NBWB 2YOHA 1KY2A 2HDHA 3IEUA 3RSSA 3FLAA 4BWFB 1COWD 4CXMA 2Q6VA 4JX9A 2QZPA 3ZYCA 4FFMA 1A9SA 1HTWA 4L5BA 5KQRA 1SBNE 4BNJA 4OO3A 2XSZD 1N6OA 1T3GA 3L8YA 3RIMA 3UYLA 5DBGA 3NB0A 2EF0A 1EVJA 3NYWA 5A5EA 4IIFA 1W88B 3W1EA 3PSAA 5EWJB 1MZVA 2CXTA 1SCKA 2W6IA 3GUCA 1GQQA 1IB0A 1KJ8A 1ORDA 1PNOA 3NAGA 4RMIA 1UWKA 2L2QA 4CKEA 4ZFNA 5A4JA 4X1IB 3QXSA 4I4TB 4MQEB 3E2IA 1A4IA 3GQBB 4JJFA 3GEMA 1SXGA 1HE1C 5EG5A 1AXGA 2OBBA 2ZIAA 1RQLA 4AKGA 1UC5B 3HBJA 2EFDB 2VNAA 3IUSA 3QTTA 3CLRC 4LRTB 3OHMA 3KFLA 3WL6A 4A2CA 1KI9A 2JHFA 2ZJ8A 2C5FA 1M2EA 4X44A 3CLSD 4OXQA 1U2SA 2PVCA 5GGYA 3TLZA 1VZ2A 3RAJA 3U7RA 4UQLA 3DLPX 4N7JA 3R9XA 3SJAA 5EE5B 1TT5A 3UF0A 1PJZA 3OQHA 5EIXA 1P9LA 1YKFA 3SAJA 3SFVA 2DULA 2GASA 2G1PA 2ZSEA 2J6HA 4AMUA 2OFXA 4B48A 3NZEA 5JS7A 1IIRA 5EN4A 5CIYA 3D6TB 4IIVA 5EY5B 4D7AA 1S2DA 3FWHA 1GFWA 4E12A 2WZBA 1GSHA 2OM2A 3JD2A 5HFNA 1PJBA 2D13A 1FLAA 1R37A 2WQZA 4XM1A 3QQPA 3GLHA 1U9YA 2DHCA 3AY0A 3ZX4A 4FC7A 1KQFA 3AHHA 1RLMA 3JD0A 2QSZA 4X85A 3UT6A 4D43A 3R40A 2CFTA 3WYFA 3G17A 3NAMA 1A9XB 2VOEA 1G21B 2YQ5A 3S2EA 1V2HE 4BGDA 2OGZA 4FCVA 4ZVRA 1GZSA 3KUKA 3SIRA 4KR0A 3AEUB 4BMPB 2PUWA 1N5OX 3E9NA 3FYUA 4UEJA 2Z8XA 2O57A 2A1UA 5C5IA 5H9WA 2H4ZA 1P45A 1YJXA 5BYAA 1XTQA 4O1MA 3CVUA 5G1NA 2Z9CA 5JZSA 3JQDA 5JMOA 1ZC3A 5E2AA 1L4HA 2QD3A 3OE7A 5FADA 3ZDZB 3WGVA 5CFLA 4JEMA 3AKEA 1O96A 3DTVD 3DYIA 2ODTX 3KJXA 4IJQA 3S68A 4AJPA 5DK4A 2HT6A 3RTCA 4YX9A 5LA6F 2VDLB 1SHJA 1Z5UA 1C3OB 4OP3A 4KPGA 1V48A 3JQFC 1IUOA 5ALNA 2EBUA 5I7RA 2E5LB 3OBBA 1YJBA 4MVXA 4NQZA 1RVDA 2H08A 4UHEA 2I0FA 3FSJX 5JNWA 4GI2A 1XPOA 1IJFA 1RP1A 2X0EA 3WFJA 1W5SA 2Q6TA 2J45A 5EGNA 5LC1A 1OZAA 3PPIA 1S96A 1GYPA 2MYNA 4O6VA 5K3OA 4C01A 1J06A 1ECFA 4L5AA 3QKSB 4XCXA 2PBZA 4WNAB 2VJPA 3Q88A 5KPDA 3R8FA 1CPYA 3EF3A 4EPTA 5I8WA 3K1AA 3RIHA 2OCBA 4WEQA 4KC0A 3LKZA 2JS7A 3LL7A 4AX4A 3DZJA 5A3JA 1JNYA 2VDPB 3RU7A 2D5BA 3U9SA 5LQAA 3PXGA 3QLVC 2ZUTA 4CQNA 1JWBB 4YCSA 1V8OA 1OHHD 3HH8A 1R9JA 4A9AA 1FE8A 5B1IA 2Q5FA 2XXBA 4Y2UA 4E88A 3RS7A 2VBGA 1X7WA 1P75A 1N2BA 1VI2A 2VZLA 4L2IB 1VLJA 3AUSA 4ND4A 5FHRA 4EHIA 4HAWA 5A4FS 2AMVA 2FVYA 3E3MA 1R0BA 3H2HA 4AP5A 4E1BA 4R2MA 1BGWA 1JR3A 4QEDA 3L1HA 4HAIA 2OHOA 1MO6A 3I4LA 3IDFA 3LP8A 3OEYA 1WXWA 3HS3A 4HYYA 3DP7A 4LQ4A 3G2JA 1Z38A 1E4OA 3AX6A 2WKPA 2A5DA 5T5QA 4DLLA 2DH6A 2M1XA 4N03A 1GPAA 4O59O 1Q1AA 4ETWA 4WVFA 3M6AA 4EY5A 2J9XB 1JMYA 3P0RA 1QH0A 1TVMA 3W5VA 1D9ZA 1KIFA 2HW8A 3NP7A 2C5EA 1PFYA 1LPAB 2GA9A 2J46A 4BJHB 2OFPA 2HH9A 4JCOA 4LHZA 3TPCA 3C8DA 2J9RA 1M1YE 4JC8A 2Z0MA 1NJ5A 1QX3A 1KNQA 1EX6A 1TADA 3ZJYA 1P6XA 4I7EA 3FMFA 1XEWY 4UUBA 3D31A 5AK0A 3L4EA 4RD6A 1UFKA 5FWXA 3TZLA 2W70A 1AUVA 1ISGA 121PA 1QG2A 2BFDA 4FGWA 4MV1A 3IR7A 4PR0A 4AYXA 3DULA 1BCRA 1MCZA 3E4DA 1OH5A 3DT9A 5FYQA 1GL9B 2H9AA 4C6RA 1Q19A 3A6JA 2BI7A 1RI1A 3T7TA 5JAIA 4JB2A 2VNIA 1A72A 1KEKA 1BU5A 1MMFB 5JNRA 1WKCA 2D74A 1U2ZA 3Q72A 3MJEA 1SO8A 1BROA 2QX7A 3MJVA 2WWHA 3WRYC 4ALNA 5IF9A 2NPIA 3JWGA 2P7HA 2GZHA 2O48X 4X90A 3P71T 4B3IA 5FBVB 5FO1A 5HYVA 1MV5A 1QBKC 1XE3A 2FOIA 4FOLA 5HJ5A 1I6WA 3ZK8A 2XITA 1I7LA 1M33A 4EJ0A 4W5NA 1J1IA 1V16A 1IPEA 3GJ0A 5LCXA 2I1WA 4RMHA 3T9FA 2YWDA 2ZB2A 3IBSA 1X86B 4EGCB 2BTQB 2BUAA 2OVFA 3AESA 3LHIA 1N8KA 1NW3A 4HQRA 5G3YA 3ZCTA 1MOQA 3M1LA 5E9QA 4OU4A 3REQA 1AKTA 4I36A 3U3KA 5DWQA 5ITZB 3KYBA 3K70D 3FTEA 2X8JA 2XRFA 3HABA 1QHIA 1F1BA 2OCYC 2Y66A 3NEYA 2CXUA 1ZDMA 1OTXA 4JGGA 2GN6A 1FLDA 5DRTA 1CKEA 3F49S 3HMKA 4Y30A 3F6PA 5CX1A 4RLHA 4UTPA 3VDMA 4LRSB 5DHAA 1C3VA 4PG4A 3QVWA 5A4AA 5H4GA 3DEHA 4ZCLA 4HS9A 4Q3OA 4B80A 1J1ZA 1H1TA 3A7DA 3WK5A 5AM1A 1IN8A 1SOVA 3A10A 2ZM6B 4YB8A 1SR8A 3V7WA 5HIAA 2Y1FA 3VI4B 4TTJA 1NYLA 2JHCA 1A8QA 4EG4A 3NONA 5BSMA 3E7XA 3TXAA 3K5WA 2MJLA 4K9LA 1KVRA 3N2IA 3EGEA 1JHUA 3DBRA 2PAFA 4LJYA 3NTLA 4E46A 2E6UX 3OTIA 1U3WA 4R40A 4C5CA 4NDZA 4NJEA 4HS4A 5C81A 3OEWA 4CDNA 3RYHA 2OXRA 4AKTA 2QUIA 2GKOA 1UM9B 1YR7A 5CGQB 3W7VA 1I2ZA 1KHTA 1GZ4A 2NO9A 3VPSA 3D6FA 3CH4B 1SPXA 4E5PA 5D6NA 2C31A 3LXMA 4B8ZA 4EUSA 1CS0B 4KO3S 4NABA 4ZEVA 5F7XA 5J2UA 1Q3TA 3VSDA 1JU9A 2Z5FA 3T0FA 1RWXA 2C2XA 2WJIA 3Q5EA 3UT5B 4XI9A 1F2DA 2JHPA 2PH1A 3N8NA 3O26A 4EB6B 3TLGA 1RHJA 1JFFB 2GETA 2ISCA 4ED9A 2ZRCA 1WMAA 4G86A 1V4NA 5ALJA 3WLNA 1RQ2A 2AMFA 3M6FA 1QH9A 2LXNA 3VDNB 1PV1A 4F8JA 2GZ2A 1QUEA 5AHRA 4Q93A 2NO4A 5JXJA 1LWNA 5KWIA 3K8YA 3EG9A 2BELA 2IY8A 2JANA 2JCGA 3QHQA 4I0WB 4M1ZA 2ZSFA 3NHUA 5BN4B 3HO6A 3HJTA 4JOSA 1ODFA 4ZREA 3IJ5A 1NKVA 2A78A 2W22A 2QTCA 4J0EA 1YCHA 1PYDA 3QEMA 1L4EA 4HLQB 2YJGA 4L08A 3LWDA 2DMRA 3ZEIA 5C3MA 3JD4A 2O8DA 1T2AA 1D2MA 4MR8B 3MOGA 5F98A 4M1SA 3IDSA 5JI3E 1AKUA 3JQ8A 1HL7A 3HCAA 3NC0C 3FX2A 4E7PA 3IESA 2AN1A 1B41A 4D42A 4RA9A 4S24A 1A5BB 3OVMA 1EFRA 4JU8A 4TWIA 2BR5A 2J0VA 3WIOA 1P19A 2D5CA 2FN3A 1WVGA 2VJMA 4L9SA 4B9AA 1QUFA 4ESOA 3CYFA 1JR4A 3HWWA 2GERA 2HRZA 2ODEA 5CLIA 3I3OA 1KIAA 1XZJA 1T43A 4DABA 2WKQA 1UAAA 1QG6A 2FW6A 1X92A 5HF8A 4MUBA 3CVJA 2H1OA 4X7RA 4ZVUA 1QQ5A 2HNKA 3V2GA 1EHYA 5HOEA 2H85A 3GLVA 1M2VA 2PD3A 3KOOA 3KT8A 1M8KA 4PC3A 3DH0A 4WH0A 5FL7A 4ZZ2A 2GXUA 1E9EA 1VCHA 1W34A 3SG0A 4AZ3B 3TSCA 5LYJB 2IF0A 3PG5A 2CLOB 4O2AB 2RI6A 4G89A 5LWQA 1AMNA 3RJZA 1Z7YA 2RHLA 1UEIA 1YS7A 1U4OA 2O20A 3CX3A 4WADA 5ALYA 1I94B 1AK9A 3F9CA 1U0TA 1ZCJA 1B73A 2V6MA 4JQOA 1Z0JA 4MQMA 5DLEA 5UKDA 1F2TA 4MGYR 3TD9A 2ZTUA 3W3AD 5LA6A 1M2FA 2HIMA 2J4DA 1KPHA 5K4AA 4Y3UA 5SICE 4YJDA 2P9EA 3AO0B 1I33A 2G4VA 2HPZA 3FPJA 1V43A 2ZU6A 4PNHA 5H59A 4Q02A 4N0DA 3URMA 5JHGB 2IBSA 1M6YA 2HJ9A 2JGLA 2WT9A 2XH8A 3BERA 2JJQA 2GPNA 1XJ0A 2OXCA 2Y1OA 3K0CC 3MSXA 2PYDA 1NE2A 3M8KA 4QBTA 4YAEA 2BFFB 5HK8A 3SGLA 1HFEL 1PFGA 2FZLA 2YJ3A 3BF7A 3L7NA 5ALOA 1VKJA 5KI6A 5KNBA 3G2IA 4L3VA 1F48A 4HUQB 1RJDA 2GRAA 2C4VA 2Q27A 1FNNA 1K8QA 2CDRA 2P5YA 3N6XA 3Q4GA 2AKAB 4MAMA 5IM4A 3FOFC 1DZ3A 3O4FA 4XUGB 4YJ3F 4KEAA 4NSNA 4B73A 1T5DX 3ZLTA 3EG9B 3X0DA 4RPIA 3WQBA 3WB0A 1BHO1 1SIUA 2OYSA 4NCXA 4BFZA 1XSEA 2BFCB 3LOPA 3M33A 5B6IA 1K8YB 4Z51A 4ZYLA 4EUEA 1GTMA 1FYDA 3B3JA 1DAFA 2FSPA 1OXBB 2V59A 4TOIA 4Q9LA 1J99A 3DXXA 3WNQA 4AS3A 3CRQA 5JFGA 2YMPA 4DXHA 2BT4A 3KB8A 2C8LA 4UE2A 1KI6B 1BU8A 3DMYA 5F76A 1V35A 3DOIA 3R7NA 1U7OA 4XYGA 5C5DA 2EOAA 1Q17A 1UADA 4KMOA 2ZLBA 2H00A 2PX4A 3UAGA 4B7UA 4BNFA 4C0HA 4YRMA 3C8UA 4YRLA 2O0JA 2WD7A 1EDBA 4J0CA 3SKVA 3GP3A 3O94A 5D7BA 4AZ0A 2IELA 4UXHA 4EK9A 2XCRB 3ZLJA 1G8AA 1C0EA 4A8TA 3MTGA 3FKQA 4TV9B 1JLMA 1X3SA 1PTKA 4I4NA 3TOVA 2X58A 3K0KA 2PT9A 1VBMA 4V0ME 1T9BA 2GI4A 1IUKA 1BS1A 1FMJA 2GPYA 3OEHD 3H8SA 5HQJA 3FHJA 4XCQA 4R5MA 4CYMA 4KU4A 2FN4A 3NOQA 2ROQA 1AGYA 4MQ5A 4HNAA 4MIKA 2G7ZA 4AJ2A 3F73A 3QE9Y 1P2GA 3IP5A 4JJEA 3THOA 3QUQA 5KU1A 1G9TA 1XZDA 5BWLA 2AJTA 1NJ2A 3OTQA 4DIDA 2PUBA 2A1IA 2JF0A 5LB4A 3DLTA 3WGQA 1U28A 3PJEA 5IXSA 1ST3A 4INZA 2P2NA 2CDBA 4KI0A 4CEIA 4LMPA 5HKKA 4NULA 3PD7A 3GLSA 4P4SA 1CXZA 1OMOA 1XCJA 5IBPA 4G8DA 5SY4A 2XXAB 4Q9KA 2OMKA 4ZGBA 4PHTA 4D8WA 2I2DA 3Q41A 4F8YA 2IT1A 1T1GA 4RDIA 1WZUA 3EEFA 3OU6A 2O7RA 4OQEA 5CU7A 4ZQIA 2H07A 4CNBA 1MLDA 4WESA 1SH7A 2QIOA 3BEDA 1GZDA 4P1ZA 4UNRA 3EW9A 4US0R 4W9NA 5BW5A 2HPHA 4BAZA 1EU1A 1IBKB 4A6PA 4JXJA 5H16A 2XOEA 1RWWA 1IYZA 1W6UA 2IHYA 3L7AA 1YDGA 1I3KA 3PHLA 1Z4JA 3H2KA 2CHUA 4FMPA 4PGHA 4QLOA 5DXFA 1RWPA 1MG0A 3F7OA 3SM3A 3SSNA 3P4YA 4ZJZA 4DRXB 1LA2A 3D3EA 2VP5A 2C8KA 5JALA 3M4ZA 4Q47A 2YINC 2R1ZA 2IYTA 1SG0A 4AKSA 5K8UA 3VFDA 2VAPA 2WSSA 4IXDA 1UKAA 3M49A 4P4TA 1DX9A 1FW8A 1NW9B 1PV2A 2ZS7A 4GBGA 3PXBA 3UUGA 2PXAA 4G3XA 3WKCA 5GIOE 2JFUA 2WP8J 3LBFA 4OX9Y 7MHTA 4F46A 4MVJM 9GPBA 2J3QA 2Q3MA 3KEFA 3Q0TA 2RHJA 1GITA 3MT8A 1SCUB 3I8XA 1TIKA 1CERA 1LQTA 2NU6B 2VK1A 3WO0A 4ARZB 4DJ5X 4GL4A 3CUSA 4F7WA 1WP4A 4NNPA 3NHAA 2XYQA 3UJHA 3M4NA 1TZ2A 3SFTA 4G8JA 2ATEA 4LI0A 1CEQA 1J8YF 2QUJA 4LQDA 1IBRA 4MX8A 3QLTA 2J33A 3TN7A 2R6GA 5C8YF 3FMOB 1JL3A 4R1LA 5B1SA 1DE0A 5GV8A 3D81A 2Y9MB 1OZHA 1UOEA 2NXWA 4Q18A 2O7VA 5J2TA 4K7JA 4PNPA 4I55B 2NUBA 4TMWA 3M6LA 3NBQA 1XEWX 1F0KA 2IUYA 5LKRA 3NPAA 1E1NA 3W2GA 5B3JC 2R6JA 1FFEA 4Q4LA 4CM4A 4BRZA 2X19A 3EPLA 1E3MA 1YACA 1SU6A 2G67A 2NO6A 4IY1A 4LF4B 3KYCA 4KVAA 3SD7A 3WLFA 1J22A 1IM8A 3F4BA 3FLBA 1X7WB 3C6BA 3P2EA 2JRLA 4MEAA 4MVCA 3DVRX 2QU8A 3VUEA 3GRZA 4DEYA 2J5BA 3RC1A 4KPYA 1XLTA 2IDZA 1M9NA 1DG3A 2Y8EA 4CKXA 3ZX5A 4BO9A 2D4HA 3EOAI 1K6JA 1PBTA 3WLLA 1C8BA 5L7YA 9MHTA 2ZJAA 4AP6A 2CHQA 3TLMA 4BVGA 1I01A 1L7QA 1XPJA 3S2FA 4I9FA 2A9JA 1XQVA 2IXTA 4B8WA 1ZXXA 2AXQA 1C81A 3GW8A 2AEJA 2R9VA 3ZHRA 4QLBA 1P2FA 3DKKA 3TLAA 3ZI7A 3I6IA 4J90A 1N9ZA 4C07A 2FFHA 4W5HA 2PZAA 1G4HA 5K0LA 2YJTD 3VZPA 2QY9A 5BN1A 3N87A 1J2TA 2GM3A 3MWGA 1ND5A 1R0WA 4FX2A 1QFMA 4BQPA 4CKBA 3DZDA 2IGTA 1JSZA 1UWLA 2CMDA 2XVAA 2XYHA 3K1TA 3KSMA 4HRXA 2IHBA 4P54A 1EJ6A 1HDYA 2BBSA 5DTQA 5EINA 2I66A 2ZYWX 4MUHA 3LU1A 4ZAZA 3V48A 4DJFC 1FJXA 1DJLA 3QV2A 4DUPA 2H0QA 5IMSA 4PYOA 4X1KB 1MC5A 2OCPA 3GN1A 4UMFA 5CDSA 5CD9A 3OTWA 4EEXA 1ZCFA 4DSNA 2HK9A 1Y34E 2J30A 3IRUA 2JH8A 3MHPA 3OCVA 5B7GA 2C3PA 1DV2A 2ZJ0A 2PLNA 2OTCA 4XLTA 2D2XA 1BMDA 4XFKA 4GM4A 4EGAA 2VHVA 3DBLB 4DC9A 2PKQP 2O3JA 2C57A 5H70A 4NCJA 2P2YA 2ZTSA 1V37A 4JT9A 2WHYA 1LSJA 5BN4A 2DFTA 3ILVA 3JXEA 1FDRA 4TV9A 3RIEA 3WOVA 4Y0NA 1OR8A 2EZ9A 3BC1A 4DOMA 4FR0A 2ZXFA 4AF6A 4O4LF 4JSTA 1L4MA 1VJTA 1V3VA 2EKPA 3W34A 1XJ5A 4N4AA 3VV3A 2BI4A 3F78A 1QZ3A 2AZXA 4EJFA 4BC0A 1N2EA 3EOBI 2ZI7A 3JTMA 4EJSA 3ZXSA 1U8XX 2PL9A 2WTXA 3OCZA 3KPYA 1W19A 2AH5A 2OESA 4JODA 3KQWA 4QX6A 3WJAA 4C7BA 3ANXA 2A0UA 1L5GB 3G9TA 3HVKA 2Z2ZA 4JBLA 1Q92A 2PUEA 2AYZA 4DNFA 5KMGB 3O4VA 3IV7A 3MOIA 4BO6A 5T67A 1U7UA 2HHJA 1TKBA 5AJVB 4DS3A 2ZROA 3S5UA 5KCZA 4OI4A 5NULA 1RM5A 5AM4A 3RUDA 3WYBA 1RC0A 1Y63A 3B1ZA 1RYYA 3JQQA 3HLKA 4JJ6A 5DV9A 3VAAA 1UAYA 1JPNA 2VNSA 3H2BA 4HEJA 1RWNA 4G5SA 4Z1MD 2CLDX 3NV9A 4BZPA 5G40A 5JVDF 4O4JB 4RZIA 2Q3DA 2VDVE 2WJYA 5TMPA 3RIXA 3C3KA 3T35A 3AM5A 5G3ZA 1KYQA 1DTWA 1P4RA 2CN1A 4X6UA 1PEYA 2AQIA 4DKXA 1UMDB 4DV6B 3G0CA 1WCYA 4J2HA 3RUIA 3ZYZA 2CD7A 3R6WA 5IVPA 4S2UA 5JWHA 3CQ9A 1EFDN 1PK9A 4ZU3A 4Y2GA 4H3KB 4NENB 3A9CA 2BC9A 4I1SA 3ZI0A 1I3NA 2FX3A 3LFHA 1JHXA 3QVJA 4PO1A 4B5KA 4ZGWA 1E1CB 2ZIZA 2YWHA 2O50A 1JPUA 4HV4A 4OJMX 3FA2A 4HDQB 2NP6A 1UPCA 3O3MB 5DNUA 3IPLA 4G4IA 4DLXA 1TCUA 2I71A 3K35A 4U7HA 2X6TA 2FR1A 3RK1A 3X1JA 3MN1A 1DKPA 1NGSA 5HCUA 5HJ7A 3DNPA 1UL1X 1KI1A 2F3PA 2J3LA 4DMGA 4PN3A 2XNSA 4ZCRA 1C1XB 1A8UA 2VF2A 3A26A 3GEBA 3JAKB 4OLHA 5BRJA 4NEGA 1S4QA 1B76A 3QV1A 4UVHA 5T6MA 3OPYI 2SICE 1BXRB 4FILA 5DMHA 2I22A 4I50A 3TL6A 3UJDA 1KS9A 2QRQA 5FNZA 4YJGB 4R2KA 4ZVPA 1TI7A 1N4DA 3IAHA 1FVOA 3ZE0B 2EV9A 5A5FA 1R0KA 3S2UA 3C4VA 4TV8B 2PFSA 4N3CA 3RREA 2YJ6A 3I53A 5JCPA 4V0OA 3UYKA 4GKKB 4CM5A 3P9KA 1ZGGA 1CQXA 3IX7A 3NVMB 1G5HA 1QHHA 2G40A 5IZCA 3EGIA 1J0XO 3AG6A 3KHTA 5LDGA 1E9RA 4MEJA 1BH6A 4LX0A 421PA 1QGOA 2GXSA 1ZAYA 4WVLA 1MO5A 5LVAA 4PSUA 2FR0A 1Y4UA 1Z0SA 2B4YA 4Z4FA 5AMXA 3DLIA 3K92A 4GC5A 2BTEA 3UC9A 3ZIAD 5AUOB 2O7SA 3DDHA 1DMRA 3VDXA 2BGJA 4YCNA 1S3GA 4FFWA 1TD9A 3GGDA 2XB6A 4DAOA 5IMBA 4H27A 4CIXA 4XVUA 4MYRA 2XNJA 3PJGA 4IRUB 3W6PA 4CL3A 3BL5A 1G8JA 2DQ4A 3TTUA 4KYVA 3SDSA 4OCZA 4NFYA 4EW6A 1FB5A 4YT4A 3VSBA 1NSYA 3FKSA 4XJXA 4PGMA 3W2FA 4Z4HA 4PU0A 3V32A 2E6KA 3RNLA 1YFLA 4J0HA 1I8TA 3IB3A 2O6HA 2V45A 2FOXA 3QEOA 2PD4A 4IJVA 4D9MA 1QRTA 2YXPX 2J87A 4ZMRA 1CG6A 3M2PA 3GGPA 3OPYB 5I7HA 5KTMA 1IXKA 3U7GA 3E58A 3IELA 2HY7A 3PJFA 2Q41A 1EHCA 1U0FA 1NW6A 2GHQA 5MFZA 5IJZA 2W7TA 3LDFA 5CB4F 1ADBA 1FVHA 1F8XA 2GAFA 3TGPA 1HNWB 3EXFA 5A02A 3Q9NA 1Y6ZA 4NMWA 3NXKA 1JTEA 3PKZA 4JGIA 3WSWA 2G9VA 3DEAA 3LQFA 1UKCA 1FRFS 4GPD1 4H4DA 4BQEA 4FUTA 2G8NA 4EMTA 1XTVA 3E9ZA 5KTPA 3I28A 3R7AA 2OY0A 2XTMA 3S1AB 2BUBA 4IG9A 4L4XA 1O5OA 1O6BA 2CBGA 1YQQA 3L8GA 2O9JA 4EF5A 3JQFA 3I2JA 1EVLA 5CFOA 5ES4B 1M7BA 2IC5A 1CRPA 4JHXA 3VYUB 2I4NA 1NF2A 2UVPB 1DBRA 2WE7A 2WUDA 1U8ZA 3LKVA 4IOKA 1R4NA 5E8RA 5TPZD 4CQMA 4I1PA 2X0KA 3JWIA 1W1IA 1Y1QA 1C3EA 4TTAA 3ACCA 4IGKA 1RWOA 3WKEA 4CKZA 5ITZA 1Y8QB 4X84A 1YQ9A 2DLNA 2KS6A 1K4YA 2VJBA 3GRAA 3R3JA 1DEAA 2BR4A 1YTUA 1GG8A 1NJGA 2X8AA 1Z7WA 3QVUA 4KXFB 2AN4A 3VXKA 5DM70 5EPEA 2YNMD 5M5BA 5F77A 3G0BA 2I9KA 3RYCB 1K66A 2GZRA 4L78A 3AWDA 1MQAA 1ULBA 5AJXA 3HXMA 1VCIA 4YMWA 1EUCB 1L4UA 1W29A 1ZM3A 2JFHA 3L0PA 3LK7A 2QRMA 3RT9A 2YIMA 4CQMB 3RRMA 1D2CA 3D0QA 4ZARA 2XGOA 4OHXA 1KO4A 1NWHA 2IV2X 4E09A 1R9GA 1E98A 2W2LD 4NF2A 4ALIA 4FU0A 3IURA 2HMWA 3MT9A 2OP1A 4K26A 1QB8A 1YZGA 4LV6A 2N47A 3FBGA 4OK5A 3D6MA 2NSLA 2EAUA 3BMQB 4QARA 4EG5A 4ZYXA 1CJBA 1P0IA 2JKYA 3QJYA 5H80A 5M3BA 5B3LA 1EXVA 3OSZA 3M3HA 4BQRA 3OZTA 2ZJBA 4I5FA 1N6RA 4NCNA 2B8NA 4ZRMA 1I9CA 2W2NA 1JQ5A 4EZBA 4LZPA 3B85A 3ORQA 1JT2A 2XY4A 4UUOA 1A9QA 1BFKA 1PZMA 2GT1A 3AFGA 3ORYA 4MYCA 5DHRA 2BV3A 1E3QA 2IEAA 1ZOIA 5EHIA 4CR6A 4F84A 3D8BA 3AP2A 2ATVA 4QDUA 3VPBA 4Y6SA 3UJCA 1JIKA 1SD2A 4B6PA 3GA0A 4C05A 4YRZA 4N54A 4JLJA 1E2EA 4N3GA 2P90A 4DG8A 3L1VA 2ZCUA 2N1BA 3UJNA 2AFHE 3R23A 3PEEA 2GLXA 3N2KB 2J6IA 3OPYA 3T7JA 1OXKB 2P11A 4QULA 4X1IA 3ONNA 4FI3F 1Q1QA 1KWGA 1PSDA 1Z0UA 2J0QA 2ZTHA 1RAGA 2HFJA 3VYWA 3TEMA 2VUSA 1EZ1A 4JOBA 1GG2A 3QYAA 2ES4A 1E2BA 1TECE 5EHXA 1DRJA 1HPLA 3VX3A 2XZLA 4IW3B 4B3DA 3EIEA 5FLYA 3RRYA 4AMBA 3IIIA 1KFKB 3LMKA 3RDPA 3Q2KA 3KT3A 1VZ3A 1ZUNB 1R4MA 1JPJA 3EA0A 2QLJA 1CZOA 4UBJA 1XTUA 2WQ7A 1GARA 1WCIB 3RFVA 3W5JA 4IZIA 1MOPA 3WIEA 2CVPA 5ECGC 1DTSA 2P62A 3N5CA 1WUKS 1SUDA 2H16A 4D74A 1P0PA 3LH5A 5BUCA 1HWYA 1GEEA 2D1TA 1T9GR 1P5FA 3WGLA 4DADA 5JRDS 4OQPA 5D86A 1Q50A 5GONA 5BMOA 3DVLA 1AF4A 2C42A 5ALZA 5H9VA 4DMFA 4DB4A 1F4VA 1X2BA 3K0FA 4C87A 3EEQA 3FNFA 4EFLA 3HFGA 4CUKA 3GJ8A 3IERA 2POQX 3L3BA 1COZA 2JW5A 3EIFA 3VNRA 4DCTA 5IVDA 3VOTA 1X9HA 5CNMA 1LW6E 1XOIA 1GQFA 4PYQA 4FYVA 4IZHA 1P1JA 4MCJA 4O4JF 1KE1A 5CCEA 4X91A 4FBGA 4H7FA 1E7SA 1GRCA 3H2SA 1JHOA 1NQTA 2G07A 3RS0A 1J2RA 1Q1EA 1KSFX 4P5PA 5H7XA 5LPNA 2XMPA 4F5YA 1JKXA 4BNNA 5BR8B 3KBOA 4DR1B 3G9XA 3CR7A 1GU1A 2ATCA 3OLYA 4J0FA 4KGVA 4R2HA 1NOKA 3EFOB 1G5RA 1E6MA 1UOQA 4P7JA 1AKVA 2OEPA 1GFZA 3C5HA 4FMBB 3LP6A 1GCIA 2XDQA 1ISFA 3D6HA 4BLTA 2QX9A 1DEXA 1Z4NA 3PFFA 4WFQA 3T4UA 1XRSB 4Z54A 3W5AA 2JLVA 3BCRA 2C3MA 3AB3A 1W8DA 1UINA 1YQTA 4ZCMA 2MOKA 3A58B 3R9KA 4L6AA 4BNVA 4CTJA 3OTHA 3ICWA 1CZRA 1NOJA 2CUTA 1CUVA 3BCHA 3A4NA 2Z1NA 5E6SB 2PTHA 1H6BA 2FWIA 4CN9A 2OP0A 2FXVA 2HK7A 4RD4A 5CITA 1ZBQA 5DM1A 4UUNA 3VVMA 4D81A 3LI2A 2OSVA 5JQGB 4ZDKA 3P9PA 1QCYA 4CM4B 3JX9A 5JSUA 3GFSA 4UDOA 3BIWA 2VHEA 5CVEA 1L1EA 5EUBA 3WBKA 1R9NA 3BJRA 1TPYA 4A0QA 5J1TB 3CBQA 1IMOA 2ZE7A 3HKBA 3AKCA 3ITEA 2WTUA 2H8GA 3EIOA 2HMVA 4OJTA 5JC8A 5CYGA