2WWRA

Crystal structure of human glyoxylate reductase hydroxypyruvate reductase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
322
structure length
315
Chain Sequence
LMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLYOXYLATE REDUCTASE/HYDROXYPYRUVATE REDUCTASE
publication title Structural Basis of Substrate Specificity in Human Glyoxylate Reductase/Hydroxypyruvate Reductase.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 315
sequence length 322
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wwrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wwrA01
2VWGA 3K96A 3ZWVA 4HWKA 3WR5A 4IPTA 3OETA 1LLQA 1KC3A 3TPCA 3EY4A 3QVSA 4YQYA 2IXAA 2GRAA 1YE3A 2FZEA 2X23A 4PVCA 4WLVA 5DBGA 1DO8A 5ER6A 4CMKA 3UAGA 1N2SA 3GVXA 2HU2A 1GUYA 1F14A 5CDUA 3I5MA 3QWBA 4IDBA 3C1OA 1GV1A 5BR7A 4E0BA 1RWBA 4FSHA 4AJ1A 1UJMA 3QE3A 4YJFA 4CQLA 1GV0A 2BFPA 3GT0A 4E3ZA 3Q9NA 4UVIA 3ONEA 2GYYA 3O9ZA 4IIUA 3RUCA 4YJHA 1NQOA 2VHVA 3KM0A 4JBHA 4B8WA 1BXZA 3C7CB 2CDCA 3INRA 3QWHA 5L95A 5TLSA 1DDOA 1BVRA 5T67A 5ER9A 5ES3A 1MG0A 4TMFA 4I9NA 1LRJA 2NACA 5CEEA 5DCUA 8ADHA 2NTNA 1KVTA 1NNUA 4K28A 2Q1WA 4J3FA 4IBOA 4NJOA 4HNHA 5C7OO 5A4DA 5I7FA 3GH3A 1PZEA 2Q1SA 2BF7A 1HDZA 1HLDA 2J3IA 4CV0A 2HLPA 1P44A 1E1NA 2B36A 2H6EA 4Q3NA 5AXDA 3BTVA 4GLLA 2Y1GA 5JCJD 1O5IA 4ALLA 3F5SA 4UEOA 4DPLA 2AEMA 4QEDA 2B69A 2W2KB 3VTZA 3BMQA 4FC6A 4FOOA 3WYBA 2GNAA 1C1XB 2O50A 4WECA 4ALJA 1H9BA 4YJDA 4JBIA 3Q0EA 3TWOA 4PG8A 4RF2A 1DLJA 2FPGA 3NX4A 5KKCA 3NTOA 4RPLA 3EHEA 3TZHA 4A26A 1XEAA 5JO9A 4MO2A 4CLOA 3WYEA 2OO5A 1EK5A 4GKBA 3G0OA 4RF4A 1ZEMA 3WLFA 4CQMA 5J23A 2BRUA 3UFXA 5JDIC 1DAPA 1R16A 3MJEA 3DTYA 4RVUA 4IM7A 4WGGA 3U9LA 3IQDB 4CM4B 3LU1A 2VYVA 2OUIA 3HFGA 4EJ0A 2XXJA 1ADGA 4R9RA 2QW8A 3FBGA 4CMHA 1E77A 2Y1DA 4UULA 4WLOA 4HV4A 3AFNA 4FCCA 4RCVA 5DULA 3QVXA 3I1JA 5DCYA 4ZRNA 1YB1A 4E31A 1WMAA 2X0JA 1B2LA 1PJ3A 3DTTA 3GF4A 2W98A 1Z6ZA 3V2HA 4R51A 1KS9A 4L4RA 4B3HA 3L77A 5CEFA 4G5HA 4NBTA 3GVHA 3L6DA 3UW3A 1N9GA 3RD5A 4CR8A 4EUHA 3EMKA 2OL4A 3RFTA 4CLEA 4E33A 1UDAA 3WNQA 1DEHA 3I9KA 4YJFB 4CQLB 4JCOA 1RJWA 4M1QA 4O63O 3AY6A 1LBEA 3GN2A 2EEZA 1V8BA 4LVCA 3H6KA 2QIOA 4YJHB 3UCEA 4ZD6A 2VZ8A 4JBGA 5CG2A 3FRJA 4L75A 3DHEA 4BO6A 3PI7A 1JVBA 4H7PA 1BRMA 1E0DA 3NV9A 3JD4A 1FJHA 2BGLA 3RCBA 1JU9A 4E12A 2AXQA 4YVFA 5THKA 5IN4A 4E4YA 3WFJA 1WMBA 1JN0A 2C2YA 2BD0A 5TQVA 3AY7A 4ND1A 4HP8A 3MJ4A 5A03A 4GGOA 4D0SA 3DEYX 1EE2A 5ITVA 4YT2A 1AXEA 2BELA 3BHJA 3U4IA 4EJ6A 2RCYA 1LC3A 1SPXA 1R4NA 1K6JA 4XEHA 4P8RA 2PFGA 5GY7A 5A02A 1JTVA 1LRLA 1HDYA 1LSJA 3OP4A 5EINA 5JCJA 4CPDA 4LCEA 1LRKA 3WGOA 2FZWA 3ZNPA 3BMQB 3BTUA 4OQYA 4PCVA 4BO0A 3GG9A 1T2DA 1PGQA 5A06A 3N58A 3MWEB 4XYLA 2E37A 2BI7A 2UV8A 3DZHA 1RM4A 4PG5A 4ZU3A 3VVCA 1XDWA 4CLOB 1M6WA 4RZHA 4HX5A 3JTMA 3NT5A 4CQMB 2ILTA 2Q4BA 1HYEA 3OEYA 1ZW1A 5CP8A 1SAYA 2PKQP 3AUSA 3GZNA 2E49A 3UXYA 4TRJA 1ZJYA 1ZSYA 3VHRA 3UHAA 4DYDA 3B1JA 5JAZA 4GPD1 1MG5A 1X1TA 5A9RA 3ULKA 1PZGA 3ZWMA 4NQZA 2VWPA 2QRKA 2D2IA 1Q2XA 4PLPA 4U6SA 1T2AA 5ILGA 4XR4A 2C07A 4W9NC 4FFMA 1K0UA 2I3AA 2X0IA 4IDEA 3GDOA 2YQ5A 3GMSA 4O6VA 1PJSA 1ZZEA 3SVTA 3PYLA 3WMXA 2W8ZA 2B4TO 2D3TA 3ADOA 1I0ZA 3C85A 1VJTA 4I08A 5JNLA 1U5CA 1PGNA 3E18A 4JX8A 4B4VA 1EUCA 3Q11A 4GWGA 3WGYA 4AFNA 1WW8A 3RUFA 1VKOA 2AE2A 3ZU2A 4BNXA 5IZCA 2PGDA 5LCXA 3ZWXA 2JCVA 1N9GB 3FNHA 1NQ5A 2QQ5A 3RU9A 4MVJH 1X15A 3UVEA 4M86A 1E92A 3AI3A 3MOGA 2NVUA 2I99A 2G82A 3F6YA 2EGGA 2OP0A 2IE0A 1D4FA 4IXWA 1R0SA 4PLWA 4Z0HO 4WLFA 3PJEA 3GAZA 4BKQA 4J4TA 1U7HA 4P4NA 3JD3A 5BSEA 2GN6A 1WLYA 1DIHA 2IYPA 5DNAA 2ZK7A 3C8MA 1PQPA 2I76A 3QWIA 3ICCA 4DBZA 1NQTA 1CERA 5TRTA 1MFZA 2GN9A 4CODB 4KWHA 1K5HA 5A9SA 3Q1LA 4ZQBA 4CMIA 1P77A 3INGA 4ZJUA 3GNTA 4BO1A 5I7EA 2Q2WA 3OECA 4YQZA 2WWRA 5EQDA 1X0XA 1R4NB 2ZJ1A 3STHA 2NADA 4J2HA 5K0ZA 4AICA 1Y7TA 3VKUA 1XYGA 3I4CA 4Y67A 1DAOA 1EZ4A 2HRBA 3E8XA 4I9HA 4M54A 5AQ1A 4A27A 5C5IA 1BWSA 1XHLA 3H9JA 2DBRA 3DBLA 4M49A 3GGOA 5BNTA 2H9IA 4NNJA 3TSCA 3CKYA 3P19A 4QTZA 2ZIZA 3CE6A 2JD2A 2Z95A 4BO9A 3K9QO 4CL3A 2QYSA 3E1KA 1X1EA 2OBNA 2C54A 1HXHA 1JDJA 2FMUA 2FR1A 1FDVA 4KDEA 2AHRA 4Q9NA 3SX2A 3IP3A 1HDOA 1UDCA 1YB5A 3WXBA 1R0LA 3GZNB 3K30A 5H81A 3B6ZA 1B14A 3H2ZA 4MVJE 4Q3EA 4CUKA 4R3NA 4ALKA 5IZ4A 3JSAA 5B12A 5ITWA 2CFCA 5DDIP 3W4KA 4B8ZA 2X0NA 1HT0A 4Q3AA 5ENDA 3B20A 1TI7A 1NWHA 5KVCA 1AUPA 1NM5A 1ZH8A 1T1SA 4BHTA 5KVSA 4BO5A 3AM4A 3O03A 3JQFC 1N92A 4OSOA 1P0FA 2ZTVA 4HFRA 4YYZA 2QZ9A 1CEQA 3GGPA 3ROPA 1KY4A 1H94A 1YL6A 4KP7A 4B4WA 1VE9A 2X0RA 3VPHA 4M89A 3GEMA 2NQ8A 4PZDA 3ROMA 1Q0HA 3NAQA 1QLJA 3L4BC 2EW2A 5HM8A 3OJEA 4YJGA 2WMDA 1ZK2A 1QKIA 2A94A 3V1TC 4XX0A 3WTCA 3QRWA 1HWYA 1TXGA 2CY0A 2TMGA 2AEFA 4WE3A 1E7QA 5IN5A 2HCTA 4N5NA 1OFGA 3S55A 4CLDA 4FFPA 2D0IA 3ZH2A 1VLLA 2AA3A 4ROSA 1ISMA 1ZSVA 2B83A 3C24A 1B15A 4NI5A 2NVUB 3OIGA 5JMWA 3PDJA 2HJRA 1V35A 3I9NA 1C3VA 3PJDA 5HBRA 5CEJA 3MJVA 2J8ZA 1CRWG 1YO6A 5DOVA 2X8LA 4IMRA 1LLDA 2BGKA 4RGBA 3D5TA 4ZQHA 4ZQEA 2NU7A 4K26A 2G76A 2CSUA 2YW9A 4I9UA 1JKFA 5JS6A 1IULA 2C82A 3ENNA 4A03A 2R2GA 5A9SB 3RI3A 3DAFA 3AOGA 1ZKMA 4L76A 4CMIB 1MX3A 3AI1A 1PIWA 5JE8A 2Y1CA 4CMAA 3HB4X 2A35A 3MJSA 5TIIA 3DMYA 4OXKA 1V0JA 4KQWA 3ZV6A 1VJ0A 1GL3A 1AE1A 1QSGA 3DOCA 4P4LA 5GZ3A 3D7LA 4OMUA 3W4JA 1PR9A 4K6CA 3LLSA 3NUGA 3DBLB 3TRIA 5IFLA 3SLKA 8LDHA 3OFSA 4BNFA 1H2HA 1J49A 1GEEA 4BNTA 3RC2A 1LEHA 3LZ6A 3PHHA 3CTMA 5KVQA 1NPTO 3JQGA 7MDHA 4GX2A 4P22A 3JQFA 4WNCA 5F5NA 4BNKA 4AJEA 4F3YA 2C5AA 5I8ZA 4F6CA 2ZB8A 4R1NA 4NFSA 5KJEA 1NPDA 4AJLA 3WDSA 4DQVA 2VTEA 4NMHA 2GZ3A 4FFNA 4UUPA 3FD8A 1KEPA 3GHHA 4QT0A 2NM0A 1UXJA 1DBVO 4UVEA 3L4BA 3H5NA 4UEJA 1J6UA 2HUNA 1PJLA 3EZYA 2JD0A 1BXKA 1LDBA 2P9CA 1ISHA 5BSFA 1KYQA 3I52A 2QHXA 3D0OA 2XF8A 4UVGA 2UUOA 1BTOA 2BFMA 3QLJA 2Y1OA 4QFDA 4YDRA 1QYDA 1HDGO 2VUSA 3PYXA 1LDGA 3U0BA 4FGSA 5I7VA 3C7DB 4NBVA 4DIFA 4YJGB 5JCXA 3PFFA 4DTIA 3ST7A 1VM6A 4IINA 3S2FA 4N5MA 4J0FA 1PU2A 2V6FA 1M2WA 1P45A 5DCWA 1W73A 1H0KA 4IIVA 1RYDA 4GAEA 5FEUA 2Z1NA 4ESOA 4RPGA 5JYDA 5EIOA 2WYUA 5ENVA 1UDBA 1PR3A 4H3VA 4TQGA 1LSSA 4BIIA 5H83A 4XGNA 2BHLA 2DFDA 2NLOA 1EBFA 4CM9D 1E1KA 1G1AA 1WVGA 4BQPA 1NAHA 3C1TA 3GFGA 3UCFA 4ALNA 3O26A 3N7UA 4TZTA 1SNYA 1A7KA 1HTBA 3PJGA 3GUYA 4S3MA 4ZA2A 4DQXA 1QV7A 4TROA 5JDCC 4PLVA 5G4KA 2FY8A 3DZBA 1DFGA 2YDYA 3WB9A 2VYND 1P1HA 4DLLA 4ZHSA 5CDGA 5L53A 3KO8A 2R6JA 2NVWA 1I01A 2J5QA 4RJTA 3WIDA 3ZN2A 5JO0A 2J5RA 1E7RA 1E3LA 1PGOA 2OFPA 2GN4A 3PHGA 4TVBA 1VKNA 4MIOA 5G2OA 3GPDG 1HETA 1EUDA 4MP3A 5G4LA 2VHWA 4DMMA 2OXIA 1JLLA 3CINA 3PIIA 1U2GA 1Z74A 3G3EA 3FR8A 2ZTLA 4MVJF 1DPGA 3BMNA 1LUAA 3HDJA 5L4NA 1H5QA 3OA2A 4ILKA 3RKUA 1DIBA 3PPIA 4KQXA 1HYHA 2CNBA 2VT2A 3ZHBA 3EVNA 4D3FA 3L9XA 2Z1MA 3G1UA 2HRZA 2EJVA 1ZBQA 4JJFA 5A1TA 3JQAD 3JQGB 5KTKA 3KRTA 4PLGA 3E82A 3FCOA 4U0JA 3ZNQA 3DHNA 2JJYA 5KWEA 1M67A 4RQUA 2AE1A 2VRBA 1I10A 1XELA 2NNLD 1E3IA 2V6GA 4U6QA 1CDOA 3GG2A 4FW8A 1FDUA 3HWRA 1PJCA 3FR7A 3WYCA 1O0SA 3M1AA 5JMPA 4DLAA 4BVAA 4CV1A 4D44A 5CG1A 1T1RA 4XDZA 4I5GA 3QHAA 5FWNA 3OM9A 3DBRA 3DO5A 2D8AA 3ON5A 4PLZA 4CL8A 4RL6A 2PLAA 4YPOA 1A71A 3A06A 1YVEI 2CMDA 4XD2A 5LC1A 4QSMA 1HDRA 1ZNQO 3ZU5A 4D79A 2H5LA 1QYWA 1WNTA 1R6DA 5B4UA 4EDFA 1ZO8A 4BO8A 1PJ4A 1UXKA 4WUVA 4XIJA 1I3KA 3R1IA 5F3RA 3HG7A 1AHHA 3E5RA 1LNQA 2WE7A 2GERA 4HFNA 5A5EA 5I7SA 4EYEA 5JDCA 1QV6A 1JQBA 4RPHA 3OIDA 1RM5A 3HDYA 4AL4A 3ZU3A 3QIVA 2PV7A 1QG6A 4FFOA 3K2BA 3WWZA 1DHRA 4QFCA 2P9EA 1P9LA 2EV9A 2QRLA 4XYMA 4CM9A 4QQRA 3AUUA 1KEUA 3VZRA 4DREA 3F1LA 1GQYA 2DBQA 3KEQA 4MDHA 3ZWCA 4XQEA 1VL6A 1KOLA 2X22A 1K3TA 3DAPA 5G4KB 2GCGA 3OQBA 1I3LA 4LN1A 4A10A 1MV8A 3A4VA 2CF5A 4O0LA 2VYNA 1QYXA 4BGIA 4J9UE 2PH5A 3F1KA 3BHIA 1H6DA 1HDCA 3OSUA 2R00C 4AVYA 5IDQA 3IS3A 3AM5A 5U4QA 4K9DA 4R01A 1YDEA 2EF1A 4UAGA 5TX7A 3D3WA 4OAQA 4RZIA 2B4QA 1ONOA 1J4AA 2EXXA 4LMRA 4U0KA 4YB8A 3RBZA 1GTMA 4FN4A 4IDGA 3UGKA 3PLNA 1P1IA 4XQCA 3B70A 3BMNB 1DC3A 5TJHA 4BS9A 4H16A 4C7JA 4JJGA 5G0SA 1IYZA 4NIMA 3IP1A 3ZWYA 3EC7A 1LI4A 2P5UA 4BMVA 4FOSA 1K6XA 4BKOA 2TMDA 4WEOA 2GF2A 4CJXA 2Z5LA 1PL7A 3AK4A 4MVJI 4NBWA 1T4BA 4Z9FA 5FF9A 3GHYA 4KZPA 1B0AA 4TRRA 4D3SA 3JQAA 1ISFA 1D3AA 3W8DA 1GEGA 3LC1O 4GMGA 2V6BA 4W99A 3TQHA 1L7EA 4BKPA 4AJ4A 5G0UA 3WFIA 2DBVO 5BQFA 5HRUA 4G65A 1UXGA 4JP3A 2DT5A 2GASA 3GLQA 2J3HA 1PJQA 2JAHA 1YL7A 5F5LA 1HLPA 3DBHA 3DFUA 1T24A 4MKXA 5HWSA 4RQTA 2VHYA 1N1EA 2F00A 2X5OA 1UZMA 1DFHA 3DBRB 1SZJG 4G2NA 4NFHA 3ZWOA 1DFIA 3JQEA 1IHXA 1IHYA 2CUKA 2HMTA 2W90A 4NK5A 4BNZA 1GD1O 5I9LA 1M6HA 3O4RA 2EHDA 2HJSA 3WJAA 1NASA 3CZMA 3W6UA 1SEVA 2O3SA 3EDMA 3VVBA 4I5DA 4BB5A 1U4OA 3E9NA 4L4XA 4TWRA 3W8FA 3K2EA 1F8FA 1ZUD1 3UOGA 3Q3CA 3GN1A 3S2EA 1HE3A 2EIHA 3LT1A 4Y6RA 4K6FA 1MXHA 3MCVA 3TDKA 4YAJA 2YFQA 5A3JA 3ADPA 3WGQA 1VRWA 4PFJA 2YFHA 3GNSA 3LQFA 3VZSA 1XCBA 4E2WA 1IPFA 2O3TA 2DTDA 1ADCA 1G0OA 3EYWA 1XU9A 1B7GO 1LDNA 5DP1A 1E3WA 1NHGA 3U4DA 1U7TA 2R00A 4IS3A 4PVDA 4UUNA 1DIAA 2EGHA 5I9MA 3WBFA 3E6AA 1WDKA 3CEAA 3NT2A 4B7XA 4XYBA 2J6IA 2Y0CA 3ONFA 2HKIA 1G0NA 5FI5A 1LX6A 1GZ4A 5JAQA 4UUMA 4IJKA 2EKLA 4IDCA 1ORRA 1PJTA 3FWNA 3E9MA 3GOHA 5L7YA 3QSGA 5CDTA 4J16A 4NFYA 3D4PA 2DKNA 3D3WB 4HKTA 4D46A 2HQ1A 4EITA 4RVHA 1ARZA 2AQHA 1WPQA 4RPJA 3JQ8A 1TEHA 1QYCA 4GX0A 5L51A 1EVIA 3FNGA 3I9JA 4AJJA 3RUDA 2D5AA 3S2IA 1KY5A 5EQFA 1E5LA 4OYRA 4AJIA 2O4CA 3HNPA 5CHEA 1F8GA 1ZSNA 3HJAA 3PGJA 1Z7EA 3PLRA 1H2BA 2Q2QA 1DRUA 4WKGA 3DB2A 4FB5A 1OC4A 4P38A 4R1UA 2EP7A 5B4TA 2ET6A 2LDBA 1VPDA 2I3GA 3GMDA 3WIEA 2VQ3A 3JQAB 1JKJA 3H9GA 1C0IA 1HL3A 1U3TA 5T57A 4BMSA 2EWMA 2JFFA 1MGOA 1RM0A 3E48A 3QP9A 4A7PA 2DPHA 4IXTA 4L73A 1LTHR 2VNSA 1XGKA 4XA8A 1Z75A 5T5QA 3VH3A 4DA9A 3JQ7A 4ZN6A 1PTJA 4PGFA 3GY0A 4FD3A 5L7WA 3DBHB 4A5OA 5JDIA 3K31A 2OGUA 3VDQA 3H9EO 4NPCA 2JD1A 3VDRA 4BB6A 3JQBC 4BMNA 3WX0A 2X5KO 3G1TA 4RVFA 4FGWA 4YAEA 2PY6A 4F45A 1FMCA 4D45A 4LGVA 1ISJA 4JJIA 4KOAA 1M75A 1ID1A 4LSMA 1R0KA 2GUGA 5FFFA 3RC9A 3ZWWA 5IF3A 3TZCA 4IJVA 1ENOA 1M76A 1ZXLA 1B16A 1I3NA 1Z7BA 5KJCA 2HMVA 1BG6A 3VOSA 5TNXA 4QXMA 4E21A 1B8VA 3UCXA 3WSWA 3WBBA 4BNIA 2O3RA 2DUUA 4N54A 1NVMB 4XYGA 3FN4A 1GQ2A 3H8VA 3KOUA 1B3BA 4GGPA 1T2FA 3HDHA 4Z9XA 1BHSA 1X7HA 3TOXA 4M87A 1ZVMA 1E3WB 2PK3A 4LISA 3SC6A 2RHCA 3GEDA 3PYMA 4XQ9A 1E7SA 1O9BA 1GYRA 1SEPA 4IQ8A 3IDSA 4TKLA 5TT0A 1I32A 3FTNA 4R5HA 3ZNOA 5BNFA 5L4SA 2V6MA 4IQGA 3KSDO 4LRSB 2Q99A 4F6LA 1EVZA 1X13A 4BNJA 1Q1NA 1VC2A 1OOEA 4MKRA 4BNGA 1YWGO 2X1HA 1F06A 5I8WA 3WQRA 2ZTMA 3V1UA 4Z3DA 1CJCA 2I67A 3LC7O 4OXYA 4HADA 4TZKA 1NWCA 2VN8A 3K5PA 4CR7A 4CUZA 1J0XO 4L4SA 2J3KA 5CPFA 3DZGA 1I30A 3JQ8B 3WG9A 4CM5A 1SOWA 1PL6A 3H5RA 2GZ2A 3DL2A 4RDHA 3D4NA 3VH1A 3ZV5A 3UKOA 4J91A 1FDWA 5CAEA 4TKMA 4BGUA 2E6UX 3P7MA 4FC7A 4FS3A 1YL5A 3CPSA 4A0SA 2JCXA 3LK7A 1MC5A 3PHLA 2Q1UA 2C7VA 4WPGA 4DC1A 4J90A 4PRKA 3DONA 3SXPA 3RFXA 2B37A 4PG6A 3P2YA 3BTSA 2PKQO 4NJMA 4ONEA 4OGWA 3UUWA 3DDNA 2O3QA 4IGFA 1DXYA 4N5LA 5KKAA 3JQBA 1ZK0A 2GSDA 3RC1A 4CLXA 3GGGA 3EW7A 1KVRA 3AWDA 3WGTA 2NVBA 2DPGA 3JD2A 3VTFA 3JQ7B 2AG5A 5A04A 2DVMA 4NU6A 2PWZA 3BYZA 1UR5A 1E7MA 4WOJA 5I9NA 5JFOA 3TL3A 1EFKA 1NFFA 4AJNA 4BGEA 2B0JA 3ASUA 4J49A 4ZQGA 5F21A 2C0CA 4CV2A 4IMPA 3WQSB 1NTOA 4RLSA 4W9NA 4PN3A 5GZ6A 4YAKA 5JPIA 2IZ1A 1JAYA 1GU7A 2ZYGA 4AJHA 1PS0A 5B37A 1E3JA 2AEJA 3V1YA 1DRVA 1OBFO 1R4MA 1U5AA 4YBZA 2EERA 4FDAA 1OC2A 3CXRA 4LCJA 3B1FA 3TFQA 3F4LA 3E03A 4B4UA 3H3JA 1F17A 1Y9AA 3KVOA 3RROA 3BA1A 2Q2VA 3FBTA 4CMEC 2IRWA 4ZICA 2ZCUA 4IJWA 2PTGA 1E3EA 3X2EA 2Y1FA 1PQWA 3HZZA 3FNFA 3NYWA 3U4CA 1I33A 3AJRA 4OKIA 4RF3A 3ZZNA 3NT4A 2E82A 4BO3A 4YRAA 2JHGA 5JBIA 4LK3A 4MJLA 2E4AA 1LC0A 3S1LA 5JC8A 4DIBA 2P9GA 2FHSA 4ALIA 2OORA 3PWZA 4TRNA 1C1DA 4XRGA 1GCUA 2I9PA 5HTOA 3TL2A 3LT0A 5CFZA 1Z45A 4IZIA 3KSUA 2G5CA 1BMDA 1SC6A 5AXBA 2EKPA 4U7WA 1GY8A 2YY7A 3A14A 5JYEA 2O7QA 3HSKA 1G6KA 1I2CA 3KSZO 2B5WA 1UP6A 2DTXA 1KIFA 1LA2A 3H65A 4BL5A 2PNFA 2WYVA 3PGXA 2VWHA 1WZEA 2CVQA 2P4QA 5IDXA 3RQSA 3LF1A 3IC5A 3DMTC 4RV9A 3OA0A 4J4BA 1DC6A 5F1PA 4GVXA 2PKRA 1HSOA 1PX0A 1RYEA 4RLHA 1H6BA 2PZLA 4E5PA 4NJMB 4QO8A 2OZPA 2NSDA 4PIVA 3PXXA 2RHRA 5T8KC 3L6EA 1I36A 9LDBA 4EI2A 1I5RA 2PZJA 4PLCA 4E5KA 3RU7A 5F1KA 1T2CA 3IMFA 4MINA 4PRLA 2AQ8A 2ZTUA 4WLUA 4YACA 4YT5A 1C14A 4YCAA 3TN7A 3GRPA 3IAHA 2AQIA 2HAEA 4H15A 4ND3A 4O59O 4DYVA 2B4RO 4GWKA 1EK6A 3PVZA 3WMWA 3RUIA 3QWFA 4MVJD 4R54A 2NV6A 3FTPA 1R37A 3UN1A 4J1NA 2UYYA 3M2TA 3U5TA 2GDZA 3KB6A 2Q46A 4P4GA 4RVDA 2DU8A 1PZHA 2C59A 1Q0LA 3PTZA 3DWFA 1N8KA 3KYCA 3LYLA 5BSHA 3DZIA 5A9TA 3D4OA 1KVSA 4J9VA 2PD4A 3OH8A 4NBRA 3RIHA 1GZ6A 3AY3A 4FR5A 3H2SA 1Y5RA 4D0RA 3AUTA 1JVSA 3WGZA 1R4MB 1C0LA 2PR2A 3M2PA 3O8QA 4BO2A 4CMEA 1D7OA 1U9JA 1ZIDA 4MVJG 5L7TA 4UEKA 1YQXA 3V2UA 1YONA 1ENYA 3GVCA 3OQ1A 1AHIA 3T7CA 3BZUA 4CM8A 2BFAA 2HMWA 2X58A 1FDTA 4ND4A 4CMGA 3ZWPA 1PS8A 3M1LA 3JD0A 3GDGA 3GDFA 2JAPA 4HNGA 4DWVA 1C0PA 2IYOA 2YZ7A 1QR6A 1JA9A 2P5YA 2ZJ0A 3K92A 4EJMA 2X86A 4J2OA 1ZK1A 5ADHA 1F0YA 4FFLA 3U49A 3K6JA 1YQGA 2VUUA 2ZQZA 2ZB3A 2GO1A 1SCUA 4E32A 4IY1A 3DOOA 1I8TA 4BNVA 3I9LA 1C1DB 2EKQA 4YT4A 5U9CA 1DJNA 3Q9UA 4LRTB 4NBUA 3HQ4O 3KLPX 3D5QA 3QVWA 4OO3A 4AJPA 1XA0A 2VZ0A 1Y6JA 3DMTA 1ZCJA 2Y99A 3OF2A 3KEOA 5C7IO 1HYGA 4I5EA 4R1SA 4J1QA 3A1NA 3D1LA 3OBBA 4NK4A 2GN8A 4U8GA 2OOSA 4L74A 4EW6A 4ZVVA 3PJFA 3QWAA 1B3RA 2C2XA 4MKZA 5T8KA 2QX7A 2VOEA 1GUZA 1IB6A 2XOXA 3F47A 4II3A 1N7HA 3IKVA 2GLXA 4FJ1A 3EZLA 3IUSA 3I83A 3JYQA 2P91A 4KUGA 5DBIA 3H5AA 2DM6A 3S8MA 3ZGYA 4BNLA 2CZCA 1CQIA 1HSZA 5TJ9A 4BKUA 1H6AA 1ML3A 4XKJA 2I5PO 5G0TA 1LSOA 3E9QA 2DAPA 1P1FA 4GX1A 1V3UA 3NDJA 3C3XA 1PZFA 3UICA 4C4OA 4WJZA 1RPNA 4RF5A 3MZ0A 2F1KA 3RUAA 2NU9A 3PRJA 4GX5A 1P31A 2DLDA 3R3JA 4W82A 4L8VA 1E7YA 4IS2A 4E6PA 2EG9A 1V3VA 4MVJA 5GMOA 5TSDA 2QZZA 5CDSA 2BLLA 1Q0QA 5T64A 3KYCB 1YJQA 3GZ4A 3OJLA 4EBFA 5AVOA 3GPIA 5GZ1A 3RJ5A 4YTEA 4XWYA 4EEZA 1E1LA 5MGBA 1DLIA 3DQPA 3MWDB 4XIYA 5A5FA 3O8QB 3S2GA 4CLHA 2D1YA 2PD6A 3F4BA 3PK0A 3SBOA 1FDSA 4OSPA 3FHLA 1LXCA 3DZFA 2AQKA 4CM8B 3LF2A 4R41A 4Q39A 2A4KA 1E3SA 3HE3A 3IJRA 3JYPA 4Z9YA 3T4XA 5CPBA 2IZ0A 3I9MA 3W8EA 5TC4A 4GSLA 1ISIA 3NJ4A 3ZHYA 4Z0PA 4E2ZA 2HO5A 1YDWA 3LC2O 1IUKA 1R15A 3NJ8A 3BMCA 4KDFA 3ROKA 5IG2A 2WEKA 4J7UA 1UAGA 1UZLA 1B8UA 1PWZA 2X9NA 3ETDA 4OL9A 1YRLA 3ZNNA 1VI2A 5DP2A 5BNIA 1Q7CA 4R4JA 4Y8VA 1R12A 4I5FA 5DF1A 1QMGA 4ZRMA 1PGPA 2YHUA 3H3FA 3H4VA 1W8DA 4HBGA 4JP2A 4CM3A 4OOEA 4GH5A 2JHFA 5B4VA 3ORFA 1EMDA 4WCFC 3CSDA 1ADFA 1DOHA 1TB4A 3KV3O 2VCYA 3PZRA 3NGXA 3LVFO 1B8PA 1MB4A 5DOZA 3L9WA 5COBA 2VZ9A 1K6IA 2NUAA 3K73O 4ND5A 1HE2A 2FPIA 3AI2A 3IIEA 1IZ0A 2X5JO 4BQRA 1DRWA 5KNLA 4CUJA 2UVDA 4WNIA 1SOVA 4KTTE 3GQVA 4F46A 5DZSA 3WGGA 1BW9A 1YB4A 1BVUA 2WD8A 3KTDA 1AN9A 3DOJA 4NG5A 3I3OA 5K6AC 1UXIA 3DFZA 3RWBA 1Q7BA 1UZNA 1DSSG 4KUHA 3TZQA 4OH1A 2HDHA 2ZCVA 1VSUA 2IZZA 1WDMA 3JYOA 3KYDA 1N5DA 3T7EA 4BO4A 4JN6B 1DC5A 4WEQA 1HE5A 1HDXA 3KYBA 4K1LA 1X7GA 5L3ZA 3PQEA 3WLEA 1U2DA 9LDTA 1GZ3A 1MC4A 4QO7A 3ZW9A 3EUWA 4CMCA 4GLOA 2IODA 1HE4A 3AFMA 4CM1A 3M6IA 2B5VA 1NQAO 2FSSA 3GNQA 4OXNA 4ALMA 5TT1A 4RVSA 3ZW8A 4FJ0A 1CIVA 1M66A 2Q1TA 2O2YA 3ANMA 2FOIA 1LDEA 2O48X 4PLFA 5EMHA 5G0VA 4WK6A 4TRMA 4RVGA 2BMAA 4U5QA 3ANNA 3KLMX 4WASA 4XGIA 1NR7A 4Q3CA 4PLTA 1E7WA 5EERA 3QVOA 2FRDA 3OJ0A 4J1SA 4LMPA 1IY8A 3RBVA 2PH3A 1I2BA 3KXDA 5DT9A 1ULSA 3PWSA 4CMJA 4RDIA 3OEWA 3CUKA 4FQ8A 4MPDA 3GK3A 1NHWA 1CQJA 2JFGA 4OHUA 1PGJA 4JXKA 5ICSA 4XGKA 1IOLA 3MEQA 1P74A 3MJTA 3QA9A 3KBOA 4YR9A 4OKNA 4W6ZA 2GR9A 2VT3A 3U62A 1Y5MA 1EQ2A 3ENKA 3F46A 1BDMA 3Q6IA 4OOFA 1BSVA 3TFOA 4WCFA 2VUTA 3BMCB 3IJPA 3TNLA 3TF5A 1YQDA 1O8CA 1P3DA 1PJ2A 7ADHA 3EAGA 4ZQFA 5BSGA 1JW9B 3IOYA 5KOIA 1AGNA 3CMMA 2Y0EA 3JQ9C 3PFWO 3R6DA 4TVOA 4BOYA 2I65A 3CIFA 1UUFA 1KETA 1PEDA 3U3XA 3OQ6A 5HS4A 1XQ6A 4BV8A 1K89A 4DGSA 4KMSA 5AYVA 2H63A 4XJSA 2Y05A 4IDFA 4QUKA 2CDBA 4GBJA 2BKAA 1HRDA 2DC1A 4PG4A 1Y81A 5K6AA 1U1IA 3BAZA 1XG5A 1NVTA 1T4DA 2GD1O 3WSVA 1SO8A 3AUAA 4D43A 3DR3A 1WDLA 1GYPA 4JNKA 3P5SA 2YHIA 4B3IA 2HMUA 3R0IA 4L9RA 4FFRA 5IXSA 4GL4A 3VZQA 4JROA 3INTA 3Q2IA 2WE8A 1H93A 3G49A 4PZEA 1BW9B 3FPLA 1HZZA 4GVLA 1HF3A 1GCOA 2JFHA 2WM3A 1LSUA 1NXQA 1KVQA 1WAMA 1NYTA 3X2FA 4EZBA 4BNUA 1ONNA 3BTOA 1YXMA 5EN4A 4YRBA 3KYDB 1H9AA 2VTDA 1MLDA 1TVEA 1U8FO 4AJOA 3NDRA 2XAAA 1NFQA 3UF0A 4NU5A 5THQA 3RKRA 4B79A 1YBMA 5COAA 3BIOA 1KBZA 4UUOA 4MIYA 1GAEO 4E13A 3JQ6A 2BH9A 2NTVA 5ILOA 2QRJA 1TLTA 1OZAA 1YJ8A 1EUZA 2FR8A 1YBVA 4Z0TA 3VC7A 4BO7A 3PEFA 4E5NA 2FP4A 4II2A 1QP8A 4YRDA 3VAZA 3GA0A 3AU9A 5TGDA 1QYVA 1SBYA 3LDHA 4B7UA 5JC1A 5IZCC 4W7IA 5MDHA 3RC7A 4YWJA 3GUCA 3KZVA 1KERA 5LDGA 3ETEA 4B4OA 1IZ9A 3QW2A 3ASVA 2NTJA 1XKQA 3FI9A 1MUUA 1VJ1A 5AXCA 1EBUA 3C7AA 3NDIA 4OJNA 1YGYA 2WSBA 4DPMA 2X9VA 2POQX 4FJ2A 3CMCO 2D4AA 5FI3A 2VHZA 3AOEC 4N18A 2IXBA 2PZKA 2Q50A 1XIVA 1GUFA 2VOJA 3JQ9A 5C7LO 3MTJA 1A5ZA 1EDZA 1VSVA 2P2SA 3BMOA 1D1TA 3VKVA 3U09A 1S6YA 4MIEA 3ETGA 3NEPX 3PQFA 3FPCA 3WS7A 5K9ZA 3LT4A 4WCFB 3ABIA 3QQPA 4XB1A 3L6OO 4W7HA 4R5MA 3GRKA 1KC1A 5JSFA 1QORA 1RM3A 3GAFA 4NH4A 2NU8A 4OIMA 3ZHXA 2HK8A 5C3MA 1ONPA 2YJZA 2A9FA 3RSHA 3NKLA 3JV7A 1ZK4A 1QLHA 1WXDA 2CVZA 1ENPA 5JY6A 5U1PA 2YYYA 2NWQA 4BNNA 4FPXA 3PHIA 4RPKA 4CV3A 5JLAA 3WGIA 4FIZA 3LLVA 3CH6A 1U4SA 4S1VA 5IXYA 2FN7A 5KVVA 3IL2A 2G17A 1HKUA 3QV1A 3K8ZA 5H82A 5G0WA 4DLBA 4Y6SA 3JYLA 1BXGA 1CWUA 1D1SA 1MA0A 2Y93A 2YHIB 1X14A 3AW9A 4HUJA 1EE9A 2YV2A 1W4ZA 6LDHA 3TZ6A 4HFJA 4R69A 3SJ7A 4YA6A 4DVJA 2YDXA 3L4SO 1CF2O 4Z3KA 4DPKA 4Q3DA 3BXXA 3ZV3A 2OMEA 2HK7A 3ITKA 2HK9A 4XJTA 3AM3A 1L1FA 3FWZA 2D59A 5IAAA 4CM6A 3H7AA 2JCYA 3H9UA 3PQDA 2OHXA 2JL1A 4I8XA 2Q45A 4AJ2A 4DBVO 3F3SA 1IPEA 4J7CA 2UDPA 4URFA 3GR6A 5JXWA 1Z73A 1DB3A 5L40A 4XB2A 3RVDA 3RFVA 2O23A 2CDAA 1PS9A 2HMSA 1BGVA 2RH8A 3GVIA 3Q2KA 1A9YA 2PGJA 3EGOA 4ITUA 4AG3A 2J3JA 4DC0A 1W0CA 1LDYA 2PGLA 2WD7A 2NQTA 1L7DA 3VZPA 3WOHA 3TJRA 3ZWBA 4EEXA 1NAIA 1ZJZA 4R68A 2RIRA 1EVYA 1LLCA 3NTQA 1TT7A 3JD1A 1F12A 4KUEA 1E1MA 3AOEA 1WWKA 3O38A 2W2LD 1AXGA 2EP5A 3HB5X 1OI7A 5KCZA 3F9IA 5F1OA 5BT9A 2V65A 1S7CA 1N1GA 3DZKA 1UH5A 3IKTA 4YAIA 5HA5A 2NU6A 1JWAB 4C7KA 4MVJP 1XSEA 1TT5A 3NRCA 5FYDA 3I6IA 3I4FA 2SCUA 4J6FA 5TF4A 4Y98A 2Q49A 1YS4A 3DAGA 3ONDA 1MP0A 1MFPA 1ADBA 2X9GA 3BMOB 3HADA 2XXBA 1LU9A 5B1YA 4Q3BA 2ZQYA 3EVTA 4D42A 2G0TA 4DUPA 1UAYA 1ZK3A 2Q3EA 3VPXA 2HSDA 3PHJA 2EJWA 1JAXA 1O6ZA 4XDYA 2C29D 3RAJA 1SB8A 1FF9A 2VRCD 4E30A 1XQ1A 1IL0A 2P4HX 3ANLA 2JKVA 1YOVA 1EQUA 1U8XX 3F5QA 1ZMOA 2GZ1A 4YAGA 1DHTA 4J1TA 2VWQA 3IUPA 4MVJM 4E5MA 3T4EA 3GVPA 1A27A 3MOIA 1Y8QA 1T26A 1YBAA 2O3UA 4JK3A 3VPGA 2LDXA 3OHSX 3OJFA 2XPCA 5IJZA 3GEGA 1P0CA 1Z82A 3W4IA 4IJUA 1BXGB 3D3EA 3ZHZA 2I6TA 2Y68A 3UH1A 4X54A 4MP8A 4LSWA 1Y8RA 4GMFA 2RH4A 3KHUA 4R9SA 1GPDG 3PWKA 3FF4A 4UVHA 3L07A 4E5YA 4MOWA 5C37A 4W4TA 1JKIA 4BV9A 2YQ4A 4WLNA 1PL8A 1NFRA 3SEFA 5L4LA 1YKFA 2J5KA 4RO0A 2IEBA 4DIOA 4ID9A 1PSDA 1ZFNA 3JQDA 3LT2A 4XYEA 2CF6A 1LDMA 3CZRA 2X7HA 2VHXA 2UUPA 1HZJA 4LVUA 1E6WA 5TS3A 4CR6A 3B1KA 5A05A 2WD7B 2ZATA 1A4UA 2ZB4A 3PDUA 4TSKA 4INAA 5AOVA 1NVGA 2ZYAA 1O94A 1EDOA 2FR0A 4J43A 1T2EA 3SLGA 1CETA 1GPJA 1GFSA 3GC6A 1KVUA 1A7AA 3VPSA 4IQ0A 1QRRA 1B26A 4ZGWA 2W2LA 3N74A 4A2CA 1GQQA 1PJBA 2Y66A 3ZWAA 3ZV4A 3WQQA 3A28A 3SC4A 3SJUA 4IDAA 4HFMA 4Z6KA 6ADHA 1VL0A 5JAMA 2O3JA 2AW5A 4EGFA 1TT5B 3JCZA 5KJFA 1I3MA 4J4HA 4JLWA 1GYQA 3OMLA 2VNAA 1X0VA 3R3SA 4O5OA 3VH4A 2H1SA 1ZMTA 3P2OA 2A92A 1OAAA 3W1VA 3DZJA 5JAIA 3AU8A 4M55A 1EVJA 4FBGA 1XWFA 4L0QA 2GGSA 3WTBA 1U3VA 2RAFA 3RUEA 1UP7A 2O4UX 1O89A 5EJ2A 1GR0A 5EESA 3L0DA 1LQUA 4XR9A 4BNMA 1A4IA 2BGMA 1JWBB 1VL8A 4EUEA 5DN9A 4GSKA 3DC2A 2VRCA 5IDWA 2B35A 1YOVB 4XRRA 3RUHA 1T25A 4MP6A 1E6UA 1DIGA 2OP1A 4R16A 4D41A 3LSYA 2DUWA 4WOKA 1H6CA 1LLUA 3DXFA 3OJOA 1MXFA 4JQCA 1XR3A 1Y8QB 2Y67A 3QJ5A 1BDBA 4D7AA 3ICPA 4NZ9A 3ITDA 3WNVA 4G81A 4BNWA 2FWMX 1J5PA 4DXHA 2YV1A 3WGHA 1XLTA 4WLEA 5EL0A 2QYTA 2ZYDA 5T6BA 1Y8RB 4B3JA 1V6AA 2EW8A 4O1MA 1W6UA 2DBZA 4YXFA 1Y1PA 3KUXA 1QXSA 4OQZA 2CVOA 3WWYA 4E2XA 4CLRA 5COQA 3OICA 4CMBA 4DMLA 3VPFA 2Q4EA 1GDHA 2IDZA 3HN2A 5L9AA 2YV3A 1P1RA 3MTGA 2O7SA 2AMFA 4KTVE 3V5NA 4I1IA 1DJQA 4DRYA 1NX6A 5KIAA 2X6TA 1O95A 5EPOA 3A9WA 4BUCA 4RORA 2Y1EA 3COSA 2IEDA 3HDQA 4N7RA 1D8AA 2CD9A 4BNHA 1WZIA 4D3DA 1P1JA 3JQCA 2UAGA 1KEVA 4B7CA 4LW8A 2OBYA 2C20A 1LJ8A 4HXYA 1U28A 1ZEJA 4YT8A 3BHMA 4YEDA 3PP8A 2ZB7A 3RJ9A 2PD3A 4R3WA 1EEHA 2Y0DA 1U3WA 3GFBA 3ZI0A 2V7PA 3C1AA 3QVTA 2RBEA 5DBFA 4BKRA 2WDZA 1Y9EA 3FSRA 4GKVA 1PWXA 2I66A 2DQ4A 1IE3A 3DHYA 4KWIA 2WJPA 4XCVA 4PLYA 4GI2A 1P33A 1Q7GA 2WYWA 2G1UA 3HHPA 4WCDA 4NHEA 3V8BA 4NDNE 4JIGA 3HUDA 1FXSA 1UXHA 3ROQA 3I9OA 5ICMA 4GQAA 3RASA 3EK2A 2D5CA 3FNEA 1E6EA 2E48A 4IGEA 4R1TA 4Y9DA 2AG8A 4BNYA 1XU7A 1UP4A 4DQUA 3ZU4A 1NP3A 1K2WA 4QX6A 2WTBA 3HFSA 2BFOA 4PZCA 4NR0A 3NTRA 4IDDA 1YH3A 1NBOA 3TZKA 1DIRA 3TOZA 1E5QA 3PZBA 2QG4A 2O2SA 1TA4A 4PLHA 5IDYA 3VH2A 3PIDA 4EUFA 1NPYA 1LQTA 3G79A 3U4HA 4UREA 1ENZA 3MJCA 2W4QA 4M8SA 5HS6A 1ISGA 3JYNA 3KETA 3V2GA 3E5MA 2FPPA 3ZWNA 3OIFA 1RKXA 1SMKA 2FSVA 1KEWA 2W2KA 4ND2A 5KJ6A 1DC4A 3I6QA 3D64A 1C1XA 5KJ1A 1X7DA 1HEUA 3NGLA 5AXAA 3H9QA 4J7XA 3QY9A 4AJKA 4IZHA 4IUYA 4JGBA 4PG7A 4CM7A 2ZKLA 1R66A 1OMOA 4J0EA 4QECA 4XZ3A 2DFVA 4CLRB 4CQMD 1SB9A 1A9ZA 3W6ZA 3HN7A 4E2YA 4Y6PA 3ZDFA 5JY1A 3G17A 4OM8A 5A3VA 3I23A 5CDYA 5L45A 4UVDA 2P68A 2C5EA 4BGVA 5JW6A 4DL9A 2GPTA 3RBXA 1FK8A 1I24A 2YUTA 1A72A 2X4GA 2VYVD 4CM4A 1N7GA 3ZCXA 1EFLA 1U3UA 3DBVO 1I2ZA 1C0KA 1NR1A 1WP4A 2PA3A 3WJ7A 4A73A 1P1KA 1ULUA 1V9LA 2BI8A 2DTEA 1GADO 1V3TA 2PZMA 4HY3A 5LDHA 1PQUA 1CYDA 2C7GA 4XQGA 3WICA 1ZXBA
chains in the Genus database with same CATH superfamily
2E5LB 2VWGA 3V8MA 3K96A 2QTRA 4PCLA 5JJCA 3UGJA 4DR4B 1GILA 1RI4A 2VBGA 3ZOKA 1K5DA 4P58A 4IPTA 1V8OA 2NXCA 5E1OA 5LB4A 1CF9A 1KC3A 1QOZA 4WWHA 2QRPA 3QVSA 3TPCA 5FH9A 2IXAA 5K8IA 4BLQA 2GRAA 4Q4JA 1U3GA 2GD0A 1A5BB 1KMHB 2GLUA 3RAFC 4EHBA 1YZNA 3P4UA 1F14A 1KYZA 1TRKA 4Y6QA 1C7JA 1T3TA 4MGIR 2M98A 3RG2A 5CDUA 4DV1B 4RKFA 1RXVA 2P2GA 3K7EA 1RWBA 5HKBA 1JMVA 2X1VA 2YY6A 4X97A 3NTXA 3QE3A 4JJ7A 3AHIA 4B44A 2IDMA 2AC4A 4M0UA 2BFPA 4FT2A 1X2EA 3BFXA 5CVVA 2BBTA 4ZCPA 1W5FA 3F2VA 1PI3A 5LMCA 1H05A 4OI1A 1A2QA 2VP9A 1VBFA 4L95C 2XCOA 2BFFB 4LYHA 1W7AA 3A6KA 3PHBE 3C7CB 3K94A 4JLAA 2WTNA 3QWHA 2ZJ3A 2AV6A 1BO6A 1GHTA 1DDOA 2GXSA 4U63A 1YVPA 1M8GA 3LQYA 3KTOA 3H97A 5IUKC 3DMDA 4TMFA 3NC0C 4CKYA 5KYXA 2NACA 3CW8X 1KAOA 1KVTA 1A9OA 1VHQA 2HDNB 2XJ9A 2ZUDA 3VSEA 1FYWA 3IAXA 4LRUA 3HKBB 3SD7A 3I2KA 4BWGA 5CBPB 2AKEA 3G6KA 3VAYA 4X7MA 4JQSA 5A4DA 2QZJA 3GH3A 5FAXA 1PZEA 2Q1SA 1V96A 1U5BB 1JPJA 2IPXA 4RK7A 2WVJA 1FUEA 1JX6A 2J3IA 2HW8A 4CV0A 1Q17A 2HLPA 4QPPA 3OY2A 1P44A 2FYTA 2QRHA 1FP7A 3U39A 4Q3NA 5D1HA 3D7KA 3M34A 4ZT4A 1PDWA 2AUMA 2I7DA 2Y1GA 2QPAA 3Q3JB 5DNDA 2XT9A 3LKBA 3ZCPA 2VC2B 4UEOA 1ZJ5A 1KYWA 4KKVA 5AM4A 2W2KB 1OWOA 3BMQA 5HKAA 1EIZA 2GYUA 1RKVA 4YCMA 3V4FA 2M6LA 1H9BA 4JBIA 1Z4MA 4G0YA 2O07A 4WH0A 4ICIA 1AH2A 3Q0EA 1G4AE 2Z56A 1Z9BA 4S2EA 2R6CA 3NTOA 3QOYA 5KKCA 4RPLA 3EHEA 5KZMB 4DMFA 5C34B 3U1TA 2KBFA 2XECA 2EVWX 4B3BA 3MS2A 2OO5A 1JT9A 3AL3A 3G0OA 1UEXC 1TO6A 1J20A 3IO3A 1NATA 2CMGA 1N2JA 3DV0B 4M9UA 4WA8A 1KU6A 3WLFA 4UNRA 1Z2PX 3SHTA 2RGRA 3D3QA 2NYAA 2H5IA 3DLCA 2EL7A 3BULA 4WZAB 1GTG1 4H1TA 4IM7A 4OVKA 3BEDA 1JEOA 4TUYA 5DLYA 3V4LA 4ATNA 1BWRA 3AZPA 4QSHA 3ZCSA 3SFZA 2G7MC 4YMHA 2XCSB 1FCJA 4CM4B 4NAVA 1YB2A 1LB1B 2Y0BA 2PV0A 3QH4A 5BOSA 2J87A 2OUIA 1KDZA 3X1XA 5HZMA 3ZHVA 4TLDA 4S1WA 1UDWA 2QW8A 2WTMA 5IRCD 1JSCA 3IBTA 1LZKA 3PEVA 1U9ZA 2YWRA 3AFNA 3EISA 1K7FB 2FSHA 5IASA 2I8CA 4RCVA 1OBOA 5C51B 4TKVB 4ZRNA 3ND8A 4YP5A 1YB1A 1HDEA 2X0JA 3QE0A 1GZ5A 1E2PA 1B2LA 1GLGA 3BXOA 4JELA 5FAKA 3CR3C 3GF4A 2YZKA 2W98A 2JFVA 1Z6ZA 1FTQA 3JW8A 1Y3FE 4CEIB 4MYHA 3B9BA 4HNVA 4R51A 2JLXA 1KS9A 3MJFA 1BH6A 3L77A 4FE4A 3WKCA 2A6PA 4ITVA 1XZJA 5DLEA 4F5EA 1CZUA 2G5PA 1OFIA 3UW3A 1YQEA 4CR8A 3VM6A 3RFTA 2GD6A 4E33A 4Q48A 2XTNA 1B42A 3WNQA 3WWEA 3I9KA 4YJFB 3UAOA 1MHTA 2VCHA 4TT3A 5AM1A 1J2TA 4J0KA 3QSYA 4LVCA 3E2IA 2OBLA 3H6KA 3JX9A 4O4LB 5LQNA 4IIGA 4YJ2B 2VZ8A 1TL7C 2QLJA 1JYEA 3TAUA 2KX7A 2OHFA 2E87A 3DHEA 3KALA 2CLDX 3KJFA 2X0DA 4UBNA 3NDBB 1X7WA 4FYJA 1TM5E 1VB5A 3TEFA 3AB8A 1JU9A 2XSZA 2AXQA 4ZVNA 3WYGA 5THKA 4V0KA 3WFJA 5IKOA 1WMBA 3EIUA 4OUDB 3ZKWB 2A9OA 3GP8A 2BD0A 4M8KA 3PQ2A 3PUJA 4HGZA 4ND1A 3C6MA 4HP8A 4OHYA 4URYR 1K98A 4O02B 3Q7QA 4D9KA 5GIOE 3IB6A 5ESRA 2GEBA 3HVUA 4BLUA 1A1VA 3HUFA 1BVYF 1NVUQ 1RC0A 4MK4A 2CJFA 1XB2A 4R7ZA 4UM7A 5DM1A 1P7WA 1JR6A 1PDOA 3BMXA 1X7YB 2BELA 3U4IA 3NHWA 1NOKA 1ZHFA 4BQIA 2OG2A 4KXWA 1CY8A 4ED9A 4XEHA 1ZCAA 4P8RA 5IJAA 1JTVA 4LI0A 4DRXB 2MU1A 5JCJA 1KSHA 4UTRA 4Y2XA 1LNZA 3WGOA 4FSXA 3R41A 2A14A 4H4CA 1ZCBA 1E1RD 3R9XB 5TQ2A 2WIFA 1KQOA 4C0QC 1JMYA 3TQSA 3BFVA 2G9QA 5KNCA 1PGQA 2Z6UA 3N58A 3E7FA 5BO5A 4FKZA 5T3YA 2J9GA 2FPGB 4O29A 3D8UA 1Q20A 4IFBA 1HE8B 1B23P 3GBPA 4QREA 1RM4A 6CHYA 4M9RA 2XB6A 2AOVA 3FYUC 4ERNA 4RZHA 3QVGA 3AIKA 3GEHA 3NT5A 4QA9A 2OZLB 2X1LA 1R6XA 3UFXB 1SAYA 1F20A 2F64A 2VAMA 1RAFA 4YHHB 4TRJA 2XY4A 1ZSYA 4ARSA 1RAIA 5MN6A 4TTSA 5JAZA 3RU2A 5A9RA 1K7EB 4I50A 4P7FA 4RADA 3F7MA 4NQZA 5ADVA 2VWPA 3BAFA 2D2IA 3ETJA 3PE3A 5HF6A 1Q1AA 1T2AA 5DMXA 1CY4A 4HQFA 4XR4A 3X1WA 4ER5A 2C9DA 1EFUA 3NHZA 3SU8A 3AKZA 1QLWA 1BIFA 1V48A 3LP6A 1GNTA 3O74A 4QDUA 3STVA 3MT8A 1FTGA 2CLSA 4Y18A 2FXVA 1QF6A 3MW8A 4NU8X 3GMSA 1PJSA 1TYBE 1B2RA 3HCBA 3PE6A 3SVTA 1PW7A 5EGNA 2OM6A 1IVSA 1QH1B 2B6NA 2DCMA 3W1EA 3IDAA 5LQCA 1QCCA 1PGNA 4Q19A 2RHJA 4B4VA 1NM5C 1V5FA 2C31A 1VA4A 4WACA 3Q11A 1K5GA 5C53B 2G1JA 2P6UA 2XODA 2AE2A 2CYCA 4Y7CA 3UBMA 4HB0A 2XI4A 2ZJBA 2PGDA 3N59A 4BNXA 1L5LA 1OFUA 4EYGA 5M5BA 2R6GA 2DEUA 4B6QA 1G6OA 1WBJB 2P65A 3HXPA 3FNHA 3MAGA 3TLYA 5ICCA 2AFHE 2WB4A 4FEGA 4YP6A 3U3ZA 2ZE5A 2VEOA 2J30A 1D0VA 1MAUA 1C30A 1ZAKA 3FTDA 5BXYA 5AW8A 2W6CX 1X15A 5DI9A 2DHEA 4E7OA 1G60A 1JH8A 3WXMA 2C9OA 5EJEA 3AI3A 4NONA 5CB8A 3C0KA 4F11A 2EGGA 1FFSA 3HDTA 4O2AA 4EGAA 5IYZF 2IE0A 3A6JA 3C3EA 1SHJA 2QPOA 3NHSA 5AVVA 3THWB 4JC8A 4O8CA 3MB5A 4J4TA 1JLRA 4AN4A 4AYXA 2CLLB 4P4NA 4CIBA 5JNTA 5KSZA 3RYCA 5BSEA 2GN6A 3H5TA 1NUAA 2R8ZA 2VF7A 1NW7A 4GOJA 1PQPA 5IKXA 4BN5A 4ZVRA 1IN8A 4YS6A 1EXMA 4CZ2A 1UBLS 5T4FA 3IVXA 3FZQA 4EG5A 1DKPA 3ED1A 2JEYA 5IT9A 4CODB 1BA3A 4CMIA 2GI4A 1K8RA 3GUZA 3PFBA 3PL5A 4ND7A 4O25A 1JJVA 3OECA 4BO1A 3TIIA 1JIIA 2WWRA 1G3RA 1T5DX 3IBYA 1X0XA 3STHA 2ZJ1A 1QG4A 3URKA 4EVIA 5MF6A 2C4NA 4C4SA 4HJXA 1Y7TA 3CLHA 3LWZA 3LQQA 3VR5A 1U7ZA 1XYGA 3I4CA 3DXYA 4A1OA 1T4CB 2HRBA 2ZITA 3IQIX 3W8NA 5AQ1A 1OA0A 4MWCA 4KVZA 4M49A 1FRNA 1J1UA 3OC6A 3ZXUB 3F8TA 4XVUA 1G64A 2J5BA 3ORHA 4IQ4A 4KK3A 4QTZA 3TD6A 1JFTA 1FFWA 5DW3A 1PT9A 4HPWA 5DHQA 1RAEA 1H4SA 4JKOA 1AVTA 4UHHA 2QYSA 3RWOA 1K0FA 1M6NA 3E1KA 4YJ3B 2XRYA 3A10A 1N9ZA 1TKBA 2OBNA 5JZMA 2C7RA 4P36A 1JDJA 2FMUA 5FTNA 1FDVA 3SX2A 2IH5A 1Y34E 3OEEA 1HDOA 3G8BA 3WXBA 1KO8A 3K30A 3EC2A 4HT3B 1VSQA 3ITNA 1CT9A 2R5WA 4D96A 2FKNA 4CKBA 1ABEA 2EU8A 4QFBA 3H5VA 1VJGA 2JI6A 2C83A 3JSAA 1P2UA 2CFCA 4FDTA 4ZALA 5REQA 3WMRA 3W4KA 4AD8A 1KP9A 3KEMA 2DHRA 4Q3AA 3IV6A 1Y4ZA 3TBKA 5JRDS 2ONYA 3ZQ6A 4F9TA 4BQFA 4DLWA 5KVCA 4DV7B 1P6UA 1ZH8A 3G89A 4PZLA 4BE9A 1SA0A 5K5EA 3AM4A 4I1SA 4QJ4A 1RWNA 2EFYA 1CSEE 2ZTVA 1XU4A 1XZNA 3FDJA 1L5QA 3H1AA 5H0IA 4W5OA 1CJSA 3HBLA 4RAOA 5EVCA 4BRWA 3PCRB 4W5JA 3ROFA 1H94A 3FTQA 2F55A 1GAWA 1J56A 4KP7A 5LR6A 1QVAA 3CZAA 3V97A 5IUJC 3GEMA 2NQ8A 1EUCB 2FJPA 2Q2OA 2WJHA 2B1QA 3UANA 3D5EA 1IUPA 3HBAA 4NYIQ 3DD1A 1OPRA 1QLJA 2O2ZA 3HWX1 5HM8A 1TAQA 3FOBA 3DE0X 4YJGA 2WMDA 1SD5A 1SU4A 2OK8A 2XDQB 1U0SY 1M0WA 2CY0A 4IX1A 4OEHA 2ZYUX 5DNCA 2XDWA 1T10A 2WF7A 3SBEA 4LY0A 4CLDA 4R9NA 1ZOOA 2X8AA 2A2ZA 3WGKA 1RWXA 3ZCTA 2ZBRA 1FRFS 4Q4DA 1E2FA 2JI8A 3TLGA 1B15A 1XCPA 2C94A 2NVUB 2XE8A 2Q62A 3L8CA 1CFZA 1TGYA 5AHRA 3ZJ4A 5IBCA 4YR7A 2H4HA 2R0QC 1QE0A 1H9CA 1C3VA 2OGSA 3DE3X 2PTHA 4CRWB 3H1GA 1U1FA 3OCZA 3OZTA 4PXYA 1M2KA 1CRWG 1MGPA 5DOVA 1JBKA 3NXKA 1K9SA 3FNIA 1LLDA 2HA3A 4IMRA 4I3GA 5BV2P 2IL1A 3D5TA 4ZQHA 3Q3VA 3GCDA 1YT5A 3KAQA 4WNYA 4ZQEA 2VHEA 3MILA 2R44A 3N2EA 4B0OA 3GFRA 2NW6A 4HGPA 3TJZA 1NF8A 4X93A 1IULA 4MLDA 2C82A 1JFRA 4IVPA 3NU1A 2R2GA 2CNOA 4EHAA 3SXUB 4BIMA 2BM9A 3N0RA 1MX3A 3ND7A 1KH1A 2A9QA 5JE8A 1X8JA 1WVMA 3ZLUA 3AIOA 4L0CA 3DMYA 3ZY6A 1V0JA 2X9LA 1F4LA 4FDUA 4PTZA 3WIBA 5IUNC 1Z63A 2VHCA 1AE1A 3KQOA 5JEDA 4BBPA 2R751 3LPCA 4NZPA 1L7XA 3D7LA 1YRAA 4QYSA 3UK1A 2JLVA 1P2FA 1PR9A 3SXJA 2XV1A 1TZBA 3LLSA 2GCPA 3C3CA 1MPTA 3HEAA 1NDQA 4DJAA 4EF5A 4WFKA 3HDVA 1G8FA 2YYSA 1OXTA 1KO1A 3GD5A 3NTVA 3P0RA 3SLKA 4GEKA 5CYFA 2QTBA 4IFIA 3T8YA 3ZUPA 2QRVB 4QBTA 1S89A 1H2HA 1W19A 4CYMA 3U61B 3GFOA 5TY0A 3H8JA 3BZBA 1T15A 4QULA 1W34A 4ZWNA 3PHHA 5KVQA 4UTNA 2FOXA 7MDHA 3OFNA 2IYEA 4NE9A 4EHKA 1MNQA 3SSNA 4BNKA 3G2NA 1XALA 4N0QA 3E3MA 3GFPA 4HS4A 3AL2A 5I8ZA 10MHA 3HKCB 3QBJA 2J9XB 4AULA 2OAQ1 4R1NA 4EFKA 1YBHA 4CEHA 1I6MA 2QN1A 1BYIA 4NMHA 1B1AA 2PUJA 1MRZA 2GZ3A 3EUAA 1PV4A 4IJQA 3FD8A 1J7JA 3WZMA 4C0BA 3FKJA 3D2LA 3IPYA 2WLTA 3TKLA 4DDWA 1DBVO 1H0SA 3L4BA 5DV9A 4AT1A 2YV4A 4IIJF 4TL6A 2YWDA 5D51S 2HUNA 3OWHA 2JD0A 3WKDA 5KWIA 3CPJB 1XYVA 3I0ZA 1K4YA 3NGMA 3O8BA 3UKJA 2D5BA 3D0OA 1K66A 2FZCA 3QLJA 1P5HA 4H6WA 1JAHA 2R65A 3RSOA 4DLXA 5A6SA 2VUSA 4IIYA 1DZIA 2W70A 3H4TA 1ND5A 1OD6A 3C7DB 1ZN9A 3QUAA 3UAXA 1KKLA 3PFFA 3ST7A 3TD2A 3S2FA 5ENZA 3RIEA 1UJCA 1EVKA 1KK3A 3FPGA 2NZWA 5IAEA 1W73A 4FHEA 3VR4D 4Q9LA 4GAEA 2FPUA 4RPGA 5JYDA 2CFIA 3H1EA 2WUFA 1I9CA 1UDBA 3RRYA 1SRQA 3E7XA 4LKRA 4BIIA 4KN8A 3GP3A 4N3GA 5H83A 2GXQA 4XGNA 2H7CA 3W5VA 4V38A 1EBFA 2XDAA 4QRDA 2XYGA 3V3KA 4LJLA 2WHEA 1XTIA 3NWBA 1P2VA 3L7YA 1WVGA 2B20A 4GG1A 1NAHA 3C1TA 3GFGA 4QYWA 3UCFA 3FY4A 5DI3A 4ZVMA 3SEQA 4L1KA 2HJ9A 3WSTA 1IJFA 2LTAA 5JG7A 4DQXA 3X1MA 1YK0A 1Y8AA 5JDCC 1D8TA 1MA3A 2WSMA 3VVMA 4D8YA 3IEVA 3DZBA 2D1TA 1OZ0A 3MM4A 1SU6A 2YDYA 3R7WB 5JZBA 2LVBA 3R3XA 2EL9A 3O84A 3JWEA 2UVPA 3KO8A 5C2JB 3NM4A 5C8YA 4RESA 2PT5A 3WIDA 2J5RA 1E3LA 4I99A 1PGOA 1U0GA 2EJBA 3WK4A 1NA5A 4MWOA 3ZE7A 2ZUBA 1YQTA 3WLNA 3PHGA 2DZDA 3C7KA 1KKMA 3ZXXA 1UBHS 3D6AA 1L7VC 4GLBA 3I76A 5BN5B 2ESRA 2VS1A 4Z49A 4RTJA 5HKLA 1YR8A 1EUDA 5DM70 3UC9A 4B5LA 1J2JA 1T8UA 4MP3A 5CTJA 2WKQA 4AP9A 3KOZA 3LKZA 2BL4A 3AMVA 2CJWA 3CINA 1JNXX 3L84A 4P80A 3GX1A 3G3EA 3UMJA 5LNK1 3FR8A 3ISVA 1OQAA 1DPGA 3LXUX 1BQ4A 1LUAA 2GPSA 4ZOLF 5L6LB 1C7EA 1E69A 1JKMA 4ILKA 2G36A 2RH5A 2CNBA 2GH1A 1L4FA 3EVNA 3ZHBA 2CHGA 1X7XA 3T1QA 2Q0QA 1CY7A 3WK7A 4G5FA 2HRZA 3OG9A 4JJFA 4UMDA 3R0JA 3JQGB 3DKVA 3KRTA 5CA0A 3DE2X 1HPLA 2FFAA 3FCOA 4OSEA 2AI3A 3VV2A 1JLSA 2KLHA 1Q6ZA 4CKWB 3DHNA 4ZYVA 1COWD 2IY9A 3NORA 3Q6MA 1DTEA 1EG7A 2AE1A 3I64A 4BMPB 4DIMA 5TEVA 1I10A 1QOPB 3CZ5A 3ORYA 2V6GA 2R1TB 2B7CA 3GG2A 1ZD9A 2NYVA 3EBPA 4IOLA 1Y48E 4OQNA 1QGED 3VPDA 3WYCA 3LX6A 1QTQA 2EIXA 2OFXA 3G8DA 1SOUA 4BVAA 4CV1A 5CG1A 4G24A 1FVXA 3A9UA 1MMFB 4I5GA 1I2DA 1OAOA 4CIVA 3DBRA 4PLZA 4CL8A 1JHVA 5KYKA 2FRDC 2ZRMA 2I3BA 3R0QA 2XWPA 4X7BA 1QHXA 3X2SA 4B45A 2XX3A 4Z7JA 5EMNA 4LQCA 1JDVA 1ZNQO 2VJMA 1E60A 3M6VA 1RPZA 5M29A 1ZG3A 1TUBB 1R6DA 2BN4A 3OUTA 4V1CB 4EDFA 1XFAA 1ZO8A 2OD2A 4B2YA 4ZI7A 2P3SA 4BO8A 1PJ4A 1SXIA 4RHCA 5FPPA 3W2IA 1GGMA 3PNBA 5F3RA 1Z88A 2JCSA 2B1JA 1ADYA 1AHHA 1C9YA 1JB9A 4D9NA 2ZUUA 1PKEA 4YX9A 1T9KA 5HK9A 3QVUA 2XHZA 1GUAA 2WQZA 3WHKA 3AX6A 4HFNA 2BYTA 4YI5A 2NGRA 3I9V1 5I7SA 2BSQA 5KDLA 4NE2A 4DC9A 5BSRA 2EZ9A 2WICA 2RJNA 3O7MA 4NCIA 4ABTA 2PV7A 2ZQ5A 3HZHA 3K2BA 4L15A 4F8YA 4I2NA 4Q7JB 1SIBE 2E2WA 2P9EA 3LKVA 3LUPA 2OECA 4XYMA 1W1UA 5KDDA 2HA2A 4DW8A 3K6SA 5F98A 1UANA 4DREA 3JPWA 1TYEB 4NYJQ 1GQYA 2ZBPA 4XQEA 2G28A 4OGLA 1VL6A 1KO7A 1OIVA 3IV9A 3R5FA 4LZZA 3W6PA 3FLEA 4IXDA 1U6KA 1I3LA 1YQQA 2V5VA 5CIYA 3N6XA 1HEIA 3F74A 2RC5A 1ZIOA 3HYCA 3IXMA 4IRXA 4CFSA 4KFTA 1ZHOA 1E1CB 2VYNA 1QYXA 4LYJA 1Q84A 2YY5A 4ND8A 4OQLA 4UCFA 1E89A 2BY4A 2NZYA 3MHTA 2Z9DA 1H6DA 3KTAA 4HMPA 1W4RA 4M4SA 5ALQA 2FPXA 3IS3A 4R01A 4H1WA 4A2PA 2FDRA 3RFCA 1KAHA 4YGXB 3WWOA 5ALLA 3PQ5A 5TX7A 4CDMA 4BXOA 4KDCA 2HV8A 2VDRB 3MGCA 3SHWA 4K1XA 1ADJA 2ZZKA 2ZUVA 4IDGA 4RMJA 3UGKA 3L3BA 4CGZA 4XQCA 4KNVA 4EG6A 1DC3A 1WO8A 1J8DA 3EEFA 5TJHA 4JJGA 1W94A 1Z4LA 3PQ3A 1IYZA 2DWQA 2ZULA 5ESXA 2MSEB 2Z08A 1PRYA 4W1QA 1LI4A 1R0RE 1XA3A 3M3HA 4BMVA 1X80B 1RZRD 1K6XA 4AYWA 1L3CA 2TMDA 2BLNA 2CMHA 3BJMA 4IJMA 2GF2A 4CJXA 7ABPA 4JEHA 1H2EA 4D80A 1T4BA 3ZIDA 1GL7A 2I7CA 3DNFA 2HSEA 3P2KA 2I91A 1ZICA 2O57A 4KQKA 2GFQA 5ALOA 2QTAA 2ZXEA 3VYVA 3JQAA 5IK2A 1D3AA 1L6RA 5AVXA 2PT7A 4E46A 2V6BA 5HUJA 1UOQA 3I05A 1JBQA 2ICAA 2ODEA 1RYNA 1Q1EA 3GU3A 4UDOA 5G0UA 4AJ4A 2DBVO 4U5XA 4QGSA 5C7YA 5HRUA 1JDSA 1X8XA 4QXRA 1NKSA 1NSFA 5JBQA 1YJ5A 3LBHA 4KIWA 5I7AA 2FZGA 1YS9A 4DUGA 1H3FA 5AJXA 1V1MB 1W85A 1EFCA 2V96A 1N1EA 1UZMA 1DFHA 2Q5LA 2YS6A 4WL0A 1EHYA 4LDZA 4S12A 4CF3A 2QTVA 1JHXA 2V4ZA 3JQEA 3QVMA 1IHXA 4REQA 1U94A 1EFVB 3NKVA 2HRQA 4TWZA 5CTAA 5I9LA 2H7VA 2ECPA 3CWZA 3H2HA 2EBUA 2BR3A 4HBZA 1KE1A 5YASA 4DNPA 2C9CA 3OU6A 3CZMA 3HV0A 4DABA 5LQKA 4M88A 1RHUA 3UAYA 3A6LA 3B5JA 1ORHA 3K2EA 1GN8A 1KI7A 3NWPA 1F8FA 5DNVA 3UOGA 1Z4NA 1DJLA 1QGYA 1R8SA 3D2AA 3IQHX 5DKFA 1CB7A 1V71A 5AHWA 2P41A 3N2NA 3RRBA 2O8EA 4V0MA 1Y6QA 3MCVA 1GUDA 5A3JA 3ADPA 1WZNA 2RI6A 3WGQA 3C3AA 1VRWA 1OX5A 1DOAA 3KE9A 2YFHA 4S35A 3HVIA 4ERXA 2QRQA 3GNSA 3LQFA 3Q3GE 5BSTA 3DH0A 4AMBA 1XN1A 3EYWA 1ADCA 2ZEJA 4A5OA 5CH5A 3C5WP 1Q0TA 3SZRA 3FYHA 5E8RA 3WV4A 1AKYA 3L7AA 3NBZC 2HIMA 2R1UA 1NMYA 4UUNA 4C6RA 4LNUB 5JSZA 1DMRA 5H7XA 3FCAA 3DOHA 4UXIA 1ECBA 1JP7A 1CUYA 2EGHA 1K8QA 2P2NA 1LPNA 1AG9A 3WBFA 4ARAA 3E6AA 4X8OA 5EJMA 4BZZA 5I4BA 1TKCA 3CEAA 1UBCA 4XYBA 4KXYA 1UCFA 2FF5A 2Y0CA 4FKBA 4DB2A 1LPAB 5JAQA 1VCIA 4L2IB 4IJKA 4XTCS 6AT1A 2EKLA 1Q50A 5EMMA 1RPJA 1NZFA 1GP2A 1ORRA 4AURA 2ALJA 5C52B 3EQ7A 4OV6B 3OI7A 3GOHA 5L7YA 2H4ZA 2J6CA 4NFYA 3D4PA 3D3WB 1T9AA 4HKTA 2YXEA 4YECA 3HKEA 3N7AA 2W4MA 4RVHA 5P8WA 5KEIA 3OPXA 3RVLA 4LHXA 4RPJA 3ZK7A 3HJGA 1NGSA 5J4KA 1L8OA 2PT9A 1IN7A 2AG1A 1EVIA 2QN8A 3FNGA 4RK0A 5J5VA 2D5AA 3RUDA 4GLJA 2OC4A 3BB4A 4KPYA 1IM8A 2WIJA 5EXXA 2H9AA 5EQFA 5KYGA 4OYRA 4AJIA 3E23A 4K05A 2OY0A 1OASA 5CHEA 4DZTA 3VKWA 3GPBA 1ZSNA 4WXHA 1H2BA 1QO0A 4UMVA 3DB2A 1GPNA 1CD5A 2JDIA 2HZ7A 4M37A 4FB5A 1OC4A 2ACKA 2JB9A 2EP7A 2H0QA 1U3DA 2LDBA 4P38A 4U7JA 5B4TA 1QJ4A 3WIEA 3OCXA 2R86A 4FHZA 3LP8A 5K0FA 5DHUA 4ER6A 4BMSA 4ZVSA 1RM0A 1G4HA 3GCWA 2DPHA 4L73A 4A8PA 1T5IA 2VNSA 4I1VA 4B3MB 3AEUB 4DA9A 4FLEA 1XAHA 2Q4RA 2OT3B 2UVQA 3RYTC 3KDPA 4MWGA 1GCAA 2OYSA 4FD3A 4CFYA 3E7DA 3DBHB 1J24A 3RSZA 5BWBA 1BJTA 1GVNB 1OFVA 4MITA 2QXYA 2UYQA 4RANA 3G82C 2J85A 4NPCA 5E2BA 3T9CA 1PEAA 4TLEA 3VXKA 4ZREA 1OV4A 2ACWA 2D8MA 3EGCA 4EENA 3WX0A 5KNDD 2WAAA 3G1TA 1FY2A 2GK7A 2WJVA 1CVRA 3S68A 4YAEA 4JLPA 1XK6A 2GETA 3C6BA 2RGAA 3CZQA 3ZY5A 1T36A 4KOAA 1FP2A 1SD2A 3CF6R 4CTNA 1L9XA 2VJKA 1Z0SA 3RSFA 2Y1WA 1J90A 3CEHA 3K9GA 1AA9A 2R5NA 2VG8A 3ZWWA 1TM1E 3TZCA 4E1VA 1ENOA 1M76A 1OLUB 1S2MA 3QM1A 3V1LA 3ZOZA 1ZXLA 4Y6LA 5LZ2A 1M0SA 1I3NA 2XMBA 2GEJA 2ZRKA 3UMRA 2L69A 3WA6A 4Z54A 4DE5A 1BG6A 3FYDA 2WNIA 3BXEA 5TNXA 1D2HA 4CWAA 1E2IA 4NJEA 1B8VA 2F1OA 3WBBA 2H07A 2Z6VA 3GEBA 3KDAA 4N54A 4TTQA 1WTAA 3J7AC 2CE7A 4Y0AA 4XYGA 3KOUA 3WYAA 2PUTA 7MHTA 1WTCA 2Q4DA 7GPBA 5CT6A 4G5OA 3M4XA 3PC6A 1E3WB 4MWDA 4JT4A 3VRHA 3BILA 1XZQA 3BE6A 3PYMA 3UHFA 1E7SA 2YR0A 4BLRA 1GYRA 5C1DA 2QMHA 1VG0B 3DEFA 4BMOB 4NTZA 1QGZA 4MRMB 2A0XA 4NESA 1M34E 1RHMA 4GR9A 2J3QA 3KSDO 5L4SA 4ESEA 5H4HA 2GPNA 4LRSB 2D6FA 2JGKA 4F6LA 1J39A 4KFRA 5EG5A 2LUOA 3NH6A 5MHTA 1C8KA 3MQ4A 5HXAA 4MKRA 2ISSD 3DEKA 5E9JA 2Q9UA 2X1HA 4BNGA 4QXPA 5HIIA 1I1NA 4EY7A 2VTVA 4YV1A 5I8WA 3IQXA 2YNMA 1NUSA 2QUKA 1U0TA 2DWUA 4HADA 4AP5A 3UMYA 1RI1A 4TZKA 3K5PA 1CUXA 1F1BA 4J2TA 1WHTA 2D2VA 4QUJA 2OAP1 1E1YA 3AF4A 3AHCA 1WCYA 3A2MA 2MIIA 4M9SA 4JZYA 1I30A 2I6FA 1SCJA 1II0A 2LIPA 2WJGA 1X39A 4ID3A 3PRYA 3HJUA 4OY3A 5JYBA 1TQ2A 2EG5A 4ZPXA 1YUBA 3DL2A 1BROA 4RA6B 3QKRA 3WO0A 1Z4JA 4BGUA 4DM4A 5I45A 4JI4B 5KYWB 3OZWA 3DG9A 2PSEA 4PINA 1B6RA 1K7XB 3P2JA 3QLVC 3NBKA 4LHWA 4PQYA 4RY9A 4U4AA 1KDYA 4RGYA 3LK7A 1MC5A 2PO5A 1HQYE 1R50A 1ULAA 2LIVA 3GMTA 3DONA 4GF5A 3SXPA 1ZRNA 4JJ4A 4A91A 4KVGA 4I9GA 5K3CA 2B37A 1WKCA 2XUAA 4NJMA 4RIEA 4ONEA 2O0JA 3H16A 4QTTB 1JKJB 3DDNA 4LDAA 3QMVA 3FCXA 4RMNA 1SUAA 2O3QA 4RS4A 5CVEA 3W04A 3W5DA 3FGOA 1KY2A 4N5LA 5KKAA 3LQ2A 3FOWA 1GRRA 1ZK0A 2GSDA 2O2HA 3AF1A 4JVNA 1WBBA 4CLXA 3OU7A 4X41A 1G9TA 2DPGA 1O94C 2ZXFA 2AG5A 1AB5A 2DVMA 2IS2A 2PWZA 3C70A 3BD7A 3CUSA 5KQSA 3QI7A 1TM3E 1XVAA 4RY0A 3BICA 4WOJA 1KK1A 4I36A 3IHTA 3K8QA 5ELMA 4BZWA 2W58A 3VYSB 2E4XA 3QEKA 3RHZA 2CFTA 3BM5A 4AJNA 4MB6A 1SQGA 4PN7A 5JH7F 1QH8B 3P5BA 4Q5IA 4KO1S 4ZQGA 2WMNB 4I8DA 3U3KA 1XPRA 3JZAA 4IMPA 4LRYA 2V0NA 3V8QA 3WQSB 1FVFA 1OE0A 3HP1A 3AVVA 2FQQA 2CEKA 4GYJA 4EZIA 3H5WA 2F9LA 4QOFA 5JPIA 3U7GA 2OCAA 3I04A 2GTPA 1LX7A 1FNCA 5JH7A 2A67A 3W2FA 4AJHA 5GP1A 1GNVA 3LY9A 4U9UA 5B37A 1L5HB 1DRVA 1TMGE 1U5AA 2ZAYA 4YBZA 5EQTA 3PDWA 1RHJA 3LHIA 5BQXA 3KVNA 3UT5B 1O6FA 5CYGA 5TQ0B 3I2FA 3F4LA 4ER0A 1ZRSA 3ID6C 1S1CA 1ZYUA 3NNSA 1DWQA 4K9NA 5GV7A 1BU5A 3B51X 1N2XA 1OY1A 2HA7A 4F4JA 5IXJA 5JANA 3ADBA 1VYTA 4N8SA 5AK5A 1W0KA 4RKYA 4JYAB 3OCYA 2Q2VA 2QNRA 5B58C 4DV2B 4H4DA 2QZPA 2G6BA 2QX8A 4ZICA 2PTGA 1EESA 3WLRA 5EWMB 2O7NA 2EWVA 1BD3A 5FOUA 3HZZA 3FNFA 2B2XA 3GD7A 1GPLA 1DAMA 4I0WB 4PQEA 3L93A 3T61A 1K86A 3NT4A 3ZZNA 3VUFA 4BO3A 4BPRA 4YRAA 4QBFA 2BMVA 5KSWB 2PS9A 4FR2A 4HPJB 4MV4A 4XPIB 1L5MA 4F3NA 4UUQA 1US8B 1CRLA 1LTKA 4M0LA 1F38A 4ALIA 5E3IA 1F9AA 3E58A 2QS9A 2YCBA 3WLOA 5AKXA 1C1DA 2MCFA 4G5QA 4XRGA 4PNEA 3ZE2B 4CL2A 4Z53A 1Z16A 4YAUA 5FBKA 4NPHA 2P30A 2C7BA 2UYGA 2AG0A 4ZEMA 1Z45A 4IZIA 3UG6A 4XXHA 1URPA 4RYDA 3TUZC 2HIAA 2ZBVA 1V43A 2A1UA 2YY7A 3A14A 3PPVA 1R27A 2IU4A 2VFAA 4LV6A 1HRKA 2C96A 3HSKA 4XB6B 2N3ZA 4XGQA 1KDTA 3O4IA 4MUAA 4N5DA 5B58T 3U2QA 1JIJA 1Z7WA 3KP1A 4JQOA 1Y5LA 2PPVA 3OZVA 1XPUA 1JXMA 2VWHA 4TWJA 2OEPA 2P4QA 1TF2A 5IYZB 4EG4A 3RQSA 4RHEA 1EIWA 3IC5A 5KTRA 1ZH2A 3JARB 3KOYA 3ICOA 3DMTC 4DJ5X 4QYIA 2ZPAA 3DGEC 3R3WA 4EUKA 3CB4A 4JEIA 2PKRA 5B6PA 1HSOA 1RYEA 2C42A 3DZCA 3DHWC 3HYRA 2NUTA 1XPOA 1V11B 2QENA 1P9OA 3CVWA 4BFUA 2OZPA 2O5EA 3OTHA 3TRDA 1GRVA 1MJGM 3I8OA 4ARUA 3FYTA 4EM6A 3GJTA 5LXTF 4BB0A 1IIBA 3GLIA 4JV5B 2PZJA 3DJFA 4PLCA 3ZWDA 3GIWA 1T2CA 1D6SA 1MT0A 1VSTA 2CWDA 2Q3LA 5FTKA 1KRXA 1FP6A 2ZTUA 3SY8A 3EDYA 1AN0A 3B6MA 1AUVA 3KOOA 3TN7A 1ULHA 1FUUA 3Q88A 3GRPA 4MB2A 3IAHA 3UFBA 1P2DA 4X64B 3S28A 4DYVA 2B4RO 1Y33E 5E7MA 2QMYA 2X2FA 4EQ6A 4R2LA 3SG0A 1D5WA 2C4HA 3QWFA 4MVJD 2NV6A 3TNDA 4IVNA 1FMJA 5B1IA 2AJDA 1TF7A 2UYYA 4IEIA 4ME6A 4UE2A 3TIFA 2MSNA 4UNNA 4J29A 5EHGA 3OLCX 1BAPA 5JAOA 2W6IA 2I6SA 3DWFA 5BSHA 3DVSX 3DZIA 1ZOSA 3ETNA 3D4OA 3V42A 1KVSA 2VHUA 4NBRA 1V47A 1LLFA 3NHLA 1GZ6A 3IP7A 1Y5RA 3JQRA 5ALGA 1R4MB 3M2PA 3O8QA 4CMEA 2E1RA 2I1WA 1XD2A 5GM1A 1U9JA 3K0AA 4WUTA 4BO2A 5I4IA 2HSGA 1FFYA 1MB9A 1YONA 3C8UA 3GVCA 2OLEA 3ZS8A 1HFWA 1I6WA 1SA0B 3A3OA 2FSIA 3ZHUA 3BZUA 4CM8A 1UFRA 1HR0B 2PYDA 5F78A 1NI4A 4CF5A 4EW2A 3JWPA 2XUQA 1DKMA 1REQA 2O6LA 3ZXYA 5LQJA 2Y4OA 3OOJA 1VG8A 2GF9A 4R6WA 2WJ6A 2COUA 3PSHA 1VKRA 4GOXA 2ZJ0A 3FFXA 5FPKA 1QR6A 2P5YA 1TTTA 2IZ7A 4EJMA 2WR8A 3UMCA 2SKCA 4R6XA 3VKGA 2AF3C 1E3QA 1UWLA 2QTNA 3K6JA 2OKCA 4MVXA 3NAMA 5C9ZA 2UXDB 4TWIA 1D07A 1PD1A 1XRPA 2E4YA 2G06A 3O1JC 2YJ6A 1VRCA 2NT4A 1UKYA 3T7AA 4DLNA 4IKOA 4OAOA 1C7RA 1X42A 4OI2A 3CH5A 2OCGA 1D03A 3DLAA 3EE6A 1H1LA 1R74A 3FNQA 3I9LA 5U9CA 1RNLA 4L78A 3VNBA 3WQHA 4LRTB 3OJCA 4NBUA 1A88A 3KLPX 3I32A 3IAFA 4GUDA 2GYWA 4B34A 4OO3A 4WBXC 3GLGB 2VZ0A 1GNSA 1Y6JA 3X1KA 5FLXA 1CFJA 1T8SA 3KEOA 1HYGA 4JEUA 1IN1A 4G09A 4JC0A 3AJAA 3L43A 1CVLA 4XQ0A 3KL4A 2RKWA 4CCWA 5A6VA 2P67A 2O0HA 4EW6A 2GCIA 1Q19A 2MWMA 3QWAA 1YZUA 2L2QA 4F2GA 4A8JA 4EEKA 1IN4A 2QX7A 1PYGA 2VOEA 3OE7A 2H4FA 4OK3A 5CLJA 1IB6A 1SXPA 1VG1A 3F47A 4II3A 3JALB 4QD3A 2DJ5A 4CVNA 2QYHA 4EO4A 3DF7A 1QAMA 5F9MA 2IHTA 1G3UA 2A86A 2P91A 1FXWF 2WAMA 3GNLA 2RHWA 4FFBA 3ZGYA 2CZCA 4LGYA 2FPRA 5AM5A 4EFDA 3QPDA 4LY9A 1EFRD 1TAGA 5BW6B 4AZVA 1YVDA 4XKJA 5IH3A 3M6XA 2I5PO 3RFUA 3E9QA 3MGBA 1TCAA 1E3MA 3EJ6A 3KJZA 2DUJA 2NV0A 3FBWA 3C3XA 4Q66C 4WQMA 3WKBA 2XWQA 2AR0A 1M1YB 4EAAA 1I9GA 3KZMA 2F1KA 4V2IA 3L0CA 4U2CA 4BP3A 1M7GA 3LE8A 1MZPA 4MRVA 2GS9A 4GX5A 1D2EA 3QEMA 5JWHA 5KOYA 2WZDA 3R6LA 1RYBA 3O3NB 4DIUA 4A6PA 1NI3A 4DV6B 4L9SA 4R2KA 4EH1A 1E7YA 3O7WA 4MRSA 4KH1A 6REQA 4P82A 4QDZA 1VKJA 3L7DA 4UMFA 1YZ3A 1Q0QA 2WJAA 4OFWA 5H9VA 3ZHTA 1NUUA 4ZAFA 2EFJA 2YMQA 4EBFA 4EO9A 1U2DC 3GQBB 3T9AA 5AVOA 3GPIA 4NOLA 3KSMA 3RJ5A 2QSYA 5GZ1A 4MDEA 2R6R1 5MGBA 2PO7A 3DQPA 1BKSB 1IG0A 1TQ6A 1MBZA 3OPYB 3FPKA 4MV1A 4C2BA 3NM6B 3S2GA 1KEZA 1JHDA 3PK0A 3R2JA 1FDSA 3N2KB 2X19A 4IG4A 4RQAA 3QXXA 2XTJA 1DKOA 4F8EA 2NUBA 3COZA 2FUG6 3TLEA 1HURA 1SVLA 1DXOA 1YRHA 2ZRLA 4LDJA 2OCLA 4Q39A 4DCJA 1MO6A 3UO8B 3WLKX 1E3SA 3NPAA 4DLTA 1TNDA 3J81k 3HHEA 1DAFA 1M6VB 1N2OA 1SWVA