2WWRA

Crystal structure of human glyoxylate reductase hydroxypyruvate reductase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
322
structure length
315
Chain Sequence
LMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Specificity in Human Glyoxylate Reductase/Hydroxypyruvate Reductase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GLYOXYLATE REDUCTASE/HYDROXYPYRUVATE REDUCTASE
total genus 105
structure length 315
sequence length 322
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wwrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wwrA01
4CQMD 1GQQA 3NUGA 1RJWA 1P1IA 3GHYA 3H2ZA 1ENOA 1AGNA 1MC5A 1R0SA 3RUAA 1B0AA 4E5NA 3OECA 3PWZA 4RVUA 1ORRA 2B83A 4D0SA 1PJ4A 1N7HA 1EVJA 2BF7A 2ZIZA 1HETA 3G17A 4R1UA 4EDFA 4NZ9A 1PEDA 5FEUA 4XIJA 1GV0A 1GUYA 3JQGB 4OXKA 1SPXA 5FYDA 4Y9DA 4CR6A 3JYQA 3I9NA 3PK0A 3GDGA 2VOEA 1E6UA 3I83A 3EZLA 1Z82A 1QXSA 4E2YA 2W2LD 3T7CA 4O59O 4FFPA 1UAYA 4NU5A 3PIDA 4ESOA 1EDOA 3KRTA 2X1HA 3GUYA 5A9TA 3H3FA 3H9EO 1KEWA 4BGVA 3OIGA 3ETDA 3D64A 4EW6A 1IYZA 1YONA 3ZCXA 2VRCD 4Z0PA 3W4IA 1SB9A 2H6EA 4JJGA 3GAZA 4AG3A 4HBGA 4DYDA 4TKLA 2W8ZA 4URFA 3U0BA 1D8AA 4E31A 4TWRA 1UDCA 2Q2VA 5CPBA 2X8LA 2NU8A 5JC1A 1WPQA 1NX6A 5ICMA 5L7WA 4YTEA 2HRBA 3JQ9A 2I9PA 4BKUA 2P4QA 3IC5A 2Q1TA 4B7CA 3F1KA 1MP0A 2WYWA 5DOZA 3H9JA 4A73A 2CFCA 1DFGA 3GVIA 2AXQA 4D79A 1LSUA 3SLKA 5DNAA 1VJ0A 2O3RA 3RVDA 1E6EA 3D4NA 1H6DA 3GUCA 3CMMA 1Q7BA 3UF0A 2JCVA 1EQ2A 4OXYA 1LSSA 2HK7A 4AJOA 3X2FA 2B5WA 3D4OA 1AHHA 1GAEO 4IS2A 1DAPA 5IDXA 2OHXA 4TROA 3TL3A 4F6LA 1GEEA 3RBZA 3GNTA 1HWYA 3H5RA 4DVJA 3H9QA 4B4UA 2ZB3A 4HFRA 2QIOA 2DUWA 1ARZA 1X7DA 3IAHA 2Q50A 5BNTA 3HZZA 3VZPA 1K6JA 1GYQA 4NU6A 3FPCA 2G5CA 5TRTA 4MO2A 5T57A 1BW9A 4EUHA 5JFOA 2FOIA 4MKZA 4Z9FA 4OSOA 2PWZA 3FTNA 1F12A 4PLPA 4EYEA 5KNLA 3VKVA 3V1TC 1EVZA 2O3SA 3G3EA 4XJTA 3WB9A 4C4OA 1SB8A 1ZXLA 2VNAA 2X22A 1MG5A 4YRBA 1MXFA 3S55A 4WLFA 4BNJA 1UZNA 1FDSA 3M2PA 3R0IA 4ZA2A 3WSWA 5AVOA 5JMWA 1YJ8A 2JHGA 3I6QA 1R0KA 1E3LA 3SJUA 1QRRA 4OH1A 1YB5A 5COQA 4DLAA 4AJJA 1GEGA 2NTVA 2JHFA 3Q3CA 4GGPA 4CL3A 4WK6A 1N9GB 3SBOA 4HKTA 1CRWG 2IRWA 3OHSX 1T2EA 3OICA 4DPLA 1BRMA 3NEPX 1NTOA 2R00C 5KVQA 4M54A 4IM7A 4I5DA 1AHIA 3L6DA 1VJTA 4CR7A 3HN2A 1A27A 2J3KA 1BHSA 5I9LA 2PD4A 5EMHA 1GUZA 1O95A 1ISJA 5H83A 2GRAA 1EVYA 3TRIA 4BMVA 1E7SA 3JV7A 1BWSA 5LDGA 1GFSA 4KTVE 4OM8A 4ALJA 1IPFA 4TRMA 1VM6A 4XQCA 2ZQZA 3RC9A 3E48A 2VWPA 3MWDB 1OAAA 1DDOA 3FWZA 3I9LA 3QVOA 4PRLA 1JU9A 4BKOA 5F1OA 3WGZA 2HMWA 3VPGA 5A4DA 1UJMA 4NHEA 4WCFC 3ZNNA 3OJEA 4CLOB 2O4UX 2Y1GA 1FDWA 2C82A 2Q4BA 1X7HA 1ZEMA 2BMAA 2G1UA 3K8ZA 2V6BA 3CPSA 4MP3A 3ANLA 2BFAA 4NK5A 1HE2A 2XXJA 4PLFA 5JO9A 1M75A 4BO9A 4FS3A 3PPIA 2J3JA 1DXYA 3GVCA 4WLUA 1KIFA 4PGFA 4FN4A 3BA1A 4ZQBA 3ZHXA 3AW9A 2FHSA 3O03A 3VOSA 1NBOA 4XRRA 1GYRA 3GGGA 4JJIA 3ZWAA 1LLUA 1I0ZA 4YDRA 3RCBA 3KYBA 1TLTA 4GKVA 5IZ4A 2VHYA 4CV2A 4IDEA 4OQYA 1EE2A 1RM3A 3E9QA 1BDBA 4E12A 2WD8A 3WYEA 4DL9A 2VHZA 2AQHA 2B36A 2FZWA 1UXIA 5CEEA 4RQUA 3JSAA 1VLLA 2FWMX 4ALLA 5G0WA 3RFVA 2YDXA 3LT4A 2NM0A 2HMUA 4Z9XA 1E3EA 3IOYA 4CMCA 2C54A 4IMPA 2XXBA 4DA9A 1QSGA 3DZFA 4XQEA 4GH5A 1ZMTA 2HAEA 2G76A 1ISMA 2PKRA 1I8TA 4CMHA 2I5PO 1YOVA 1YS4A 3JQ6A 2BI8A 3WJAA 4UEOA 4BB5A 1XCBA 3KUXA 5C3MA 5CG1A 1JA9A 2AE2A 1SAYA 3ZWPA 4BHTA 3D1LA 1Y8QB 3DHEA 3ITKA 1P31A 1H5QA 3SVTA 3DHNA 3DOOA 3EK2A 3JQGA 2Y1OA 2VYND 1ULUA 5AQ1A 1PZGA 1C1XA 1TT5A 3IKVA 5H81A 3P2OA 3WSVA 5ES3A 4XQ9A 1LQUA 4JN6B 1Y9EA 4CMIB 2NU9A 3PHGA 2GCGA 5DF1A 5T5QA 4BNNA 4CLXA 4PN3A 5A1TA 5AOVA 4UVDA 3FBGA 3TFQA 1PJBA 1GY8A 1QYVA 4ZQEA 4RF2A 2LDBA 1V8BA 3JTMA 4ROSA 4D0RA 2IEBA 1QYWA 4PLHA 3RROA 4E30A 4J1TA 4FB5A 4MIOA 3TZCA 3W8FA 1ZMOA 1XA0A 2PZLA 2RHCA 1JTVA 4J1SA 5IFLA 1JLLA 1YBAA 2D5AA 3IJPA 4KUHA 3BMOA 2SCUA 4TMFA 3TZHA 3AFNA 4FFNA 2P4HX 4WOKA 4EJ0A 1R37A 4LRTB 4CQLA 4FFOA 4IDGA 4R3WA 4Y6SA 3EDMA 3ANNA 3E1KA 4R9RA 4N5NA 5L9AA 1PIWA 2GPTA 2Y1FA 4MKXA 2X5KO 4XR4A 4Y98A 2YHUA 2FP4A 4NK4A 1TT5B 3DL2A 4RORA 4WEOA 2ZCUA 3Q2IA 3ORFA 4XDZA 2BHLA 3P2YA 4DMLA 2POQX 4AJIA 1NPTO 4H15A 4BKPA 5G4KB 1JKIA 2NUAA 4ZD6A 2ZTVA 1Y9AA 4WUVA 4YAJA 3DONA 1DFHA 5B37A 1XYGA 1XIVA 1WDLA 3WMXA 2RHRA 3AOEC 2I67A 1JKFA 4JBIA 3FBTA 2HQ1A 4MKRA 5DT9A 1DRUA 3S2IA 5G0UA 4RVGA 3SC6A 2ZB4A 1XQ1A 1ZJYA 3V2UA 2BGLA 3QWBA 1VL6A 1ZIDA 3LF2A 4RL6A 1PTJA 4EUFA 3ONFA 3OJOA 4P4GA 5HRUA 1WW8A 4BNKA 4GLOA 3R6DA 4PG5A 2B4QA 4NJMB 4ID9A 4II3A 2YV2A 3O8QA 5BR7A 3LC2O 2BFPA 5CG2A 3C1OA 2VNSA 4HNHA 4R01A 1C0KA 1NFRA 1X15A 1IOLA 3DBLB 1ADCA 1VC2A 3GRKA 2RBEA 3PLNA 4W7HA 1U7TA 1ID1A 4CLRA 3F9IA 3I1JA 3O26A 2IXBA 5JSFA 4GBJA 1EEHA 3C1TA 4QUKA 2CF5A 3FD8A 4M86A 4D3DA 1NXQA 3ZNPA 3E8XA 4GAEA 1GUFA 3FF4A 5IF3A 1EBUA 2B35A 4NBWA 3GT0A 4NR0A 4E6PA 4W99A 1HXHA 1A71A 1KVTA 1A9ZA 1AUPA 3RASA 3PLRA 3ROQA 3AOEA 3P19A 4L8VA 4CMBA 4WE3A 3D3WA 2A35A 3GVHA 1KERA 3Q1LA 5I8WA 5MDHA 4LVCA 2O4CA 2RCYA 3I5MA 4GX0A 3W8DA 1KVUA 5DOVA 4BO0A 2C07A 5KVCA 1WMBA 4S3MA 2Q2QA 5L4NA 4YAGA 3KV3O 2V6GA 1E3SA 1BXGA 1P0FA 2FN7A 3RUCA 1I36A 2D3TA 5JAIA 1T2AA 4HFMA 3WTCA 2Y66A 1CERA 1VSUA 3HG7A 4RDHA 4A26A 1NQTA 4JBHA 1LRJA 3BIOA 4JK3A 4ZGWA 2YFQA 3FI9A 1CJCA 2X9GA 4MP8A 2BH9A 5CEJA 4JROA 4PLCA 3GPDG 4I1IA 1U3WA 4W7IA 1NHWA 1Y81A 1ZBQA 4BQRA 4BV8A 1IY8A 2AEJA 3HE3A 5C7IO 3BTSA 4CV0A 3C1AA 4CM5A 3UUWA 2W90A 5JCXA 2BI7A 2OFPA 3GF4A 4IXTA 4YQYA 4YA6A 3ADPA 1HSOA 2UAGA 3M2TA 5ITVA 1F06A 5I7FA 3VPHA 3RAJA 3OJ0A 4YJFA 1PS0A 4YYZA 3GAFA 4RF4A 1EUDA 3H8VA 2VUTA 3E9MA 3JQAA 4YJHA 2NVUB 3A06A 3HDYA 4J90A 1N7GA 3MZ0A 1WLYA 5I9NA 3GEMA 3VZRA 3JQBC 1U4OA 2E49A 4CUKA 1AE1A 3PQEA 1Z6ZA 4MIEA 2P9GA 3V1UA 2Q99A 3TN7A 3ZU3A 3UAGA 4BS9A 3GNQA 4J7XA 5JW6A 1ONPA 3Q9NA 5GZ3A 1NNUA 4FOSA 4RPKA 5G4LA 3NT2A 2P68A 1P9LA 3INRA 3INGA 4UEKA 1Y8RB 4BNVA 2WYVA 3MTJA 2DT5A 3F3SA 4F46A 2H5LA 1T4BA 2CMDA 1UP7A 2QZZA 2NVBA 1T24A 3BZUA 2HSDA 4RQTA 3JYOA 5BT9A 5KJCA 2Y93A 3JQDA 4AJ2A 1WXDA 2Q1SA 4IINA 2EERA 4D3FA 1BVUA 3QVWA 4D44A 5L53A 3HB5X 1Y8RA 2GDZA 4I9UA 3PJGA 1H2HA 4B3IA 1VPDA 2WSBA 2Y1DA 4YCAA 3DR3A 1KY4A 3RFXA 3ZWWA 4ZVVA 2YJZA 1Q0LA 3BMQB 5JBIA 4R1SA 1PSDA 5LDHA 3KLMX 4F45A 1ADFA 4ILKA 1JW9B 4QSMA 1R6DA 5B12A 1PZEA 4OOEA 3WGHA 1HDXA 3AM4A 3HDQA 2D4AA 2VN8A 1LLCA 1T2FA 5CDTA 4TZTA 4ZQHA 3DDNA 5CFZA 1Q7CA 3WGOA 4XA8A 2PA3A 3C7AA 3JQFA 2GASA 4RVFA 4AL4A 5A9SA 2X7HA 4TRNA 4E0BA 4O6VA 1U2DA 4CM1A 5C37A 4DQXA 2C2YA 2EEZA 3ZH2A 5JLAA 5KKCA 1HE3A 2IE0A 3KYDA 4FPXA 3CZMA 4M87A 5KJ6A 4I5FA 1VKNA 5G0TA 3PYMA 1LDBA 3C7CB 3AWDA 4RO0A 5HBRA 1PGOA 1S7CA 3CEAA 2EIHA 4W9NC 3A4VA 2FMUA 3KSDO 5EL0A 3ZHYA 1V3VA 3OIFA 4JLWA 4I9NA 1O0SA 4J9UE 4Z0TA 4XKJA 3PGJA 2PKQO 2P5UA 5KCZA 5A06A 2NWQA 4FR5A 1DO8A 1LX6A 3PTZA 4IJKA 5C7LO 3D5TA 4BL5A 3A1NA 3PDJA 4FGSA 2YQ4A 4FSHA 3LC7O 2NVWA 2UUOA 4YJGA 4HFJA 1RYEA 4IS3A 3DZHA 2B37A 3WS7A 4CM7A 1BDMA 3AM5A 1KVQA 1R16A 2EJWA 2CDBA 3FNGA 3UFXA 4BIIA 4LGVA 5TNXA 4BNHA 3UN1A 4LW8A 1LU9A 5KVSA 5B4TA 3KBOA 1KETA 1D1SA 1PX0A 2AHRA 3LQFA 3NDRA 4IZIA 3S1LA 2O7QA 3LT0A 3RC7A 1E1LA 3VC7A 4FQ8A 3K9QO 3R3JA 5IZCA 5A3JA 3UKOA 3BTVA 3PJFA 4MVJM 2Q2WA 2W2KB 4DGSA 5C5IA 1GYPA 4TVOA 2Q1UA 5DP1A 5ENDA 2QHXA 1CWUA 1E3IA 4UREA 1NM5A 1FXSA 1I10A 2QYSA 1PJSA 3Q0EA 2PGDA 1KVSA 5TQVA 3DC2A 3R3SA 4IQ0A 1TA4A 2Y0CA 4J16A 2RAFA 2C59A 5T64A 3QVSA 1D7OA 2ET6A 3AI2A 2AMFA 3E9NA 3WLEA 3I52A 2VHWA 2E48A 4B4OA 1I30A 1C14A 4K6CA 3ENNA 3OETA 1W73A 3OH8A 3QWAA 1KS9A 1JDJA 3NT5A 3SX2A 2OMEA 2PD6A 1E1NA 2ZKLA 1P1RA 1LDYA 4L76A 1LDGA 1Z73A 3CXRA 4UUPA 4W6ZA 2FR1A 1Q1NA 1VJ1A 2I65A 4BGEA 4PVCA 4NBRA 1UZLA 3QE3A 1NR7A 4O63O 5G4KA 4E5KA 1I3LA 3ROKA 1O8CA 2W98A 4R69A 4BMNA 1HTBA 3BMCB 3U4HA 5L3ZA 1B8VA 3DBVO 3EZYA 4J1QA 5FI5A 5TJ9A 5KOIA 4YT4A 5HA5A 3GG2A 3OF2A 2ZJ1A 4BO6A 1PJLA 1UZMA 3I4CA 4JIGA 4PG6A 3S2GA 4AJ4A 2D59A 1O89A 5JCJA 1YJQA 4MOWA 3ZW8A 1FF9A 2NQTA 3GH3A 4GMGA 1TVEA 1YDWA 4E4YA 4NFYA 4B4WA 1L7EA 1WP4A 1PS8A 4N5LA 3DMYA 2WJPA 4RF3A 4X54A 4BNZA 1Z75A 3M6IA 2I99A 4LRSB 3UCEA 1JN0A 3QLJA 3F47A 3QWFA 3U09A 4P38A 4IBOA 3ROPA 3H4VA 4JNKA 3TZQA 1LDMA 5CP8A 4D42A 4DPKA 2CUKA 3FNFA 2E6UX 2OOSA 4CL8A 3A28A 2H1SA 3SC4A 4YRAA 3WQSB 3DBHA 2GYYA 4YBZA 5G0VA 1GQ2A 1K6IA 4WJZA 5EN4A 1NP3A 1UAGA 1PJQA 3RIHA 4FC6A 4KUEA 1P1JA 4CM8B 4YT2A 3RKUA 1PS9A 3QSGA 4N54A 1PZHA 4PLTA 3W4JA 1B14A 4XIYA 2B4TO 3JQCA 2HJRA 1U4SA 2NVUA 3JQAB 4I9HA 4YJHB 4GLLA 4DXHA 3GQVA 1T25A 4RZHA 1GU7A 4BNWA 2VWQA 4OYRA 5JCJD 1ONOA 3ZWXA 2IYPA 3DQPA 5HS6A 3ZV3A 4KP7A 1IUKA 1Z74A 4J1NA 2P9CA 4RF5A 3DZIA 5G2OA 3GEGA 4HWKA 3AU9A 4M55A 4DC0A 4BNXA 4Z9YA 5F1PA 1LBEA 4K1LA 4J2OA 3K6JA 4GVXA 4NG5A 1ENPA 2CSUA 2AW5A 4XYBA 4YAKA 2EWMA 4IY1A 2DFDA 4YJGB 3GMSA 2QQ5A 3RUHA 4IIVA 1XQ6A 1YKFA 1D4FA 4R4JA 4NIMA 3L77A 4OXNA 2QRLA 1RKXA 3LLVA 1P1HA 2O2SA 4FJ2A 2E82A 3RUEA 1PJ3A 1R12A 4DLLA 2C0CA 2GN9A 3COSA 3CH6A 4WLEA 1I5RA 3TQHA 4Z3KA 4AFNA 1AXEA 3H65A 4ALKA 3L9XA 4XCVA 5A3VA 4QT0A 1DC5A 4PZCA 1GADO 4KOAA 5TF4A 3U9LA 1OBFO 3O9ZA 5I8ZA 2AQKA 4MVJH 1GDHA 1IZ9A 1JQBA 1VL0A 1X0VA 3O4RA 3PDUA 5T8KA 1H2BA 1H93A 1ZFNA 4KWIA 1U7HA 2VHVA 4GSLA 4XB2A 3GEDA 3G0OA 2GR9A 3QWHA 2OZPA 1EQUA 5JDIC 3EC7A 3CE6A 4IIUA 3IKTA 2ZTMA 2PD3A 5DCUA 1EMDA 1FDTA 1CQIA 1UXHA 1J5PA 3LSYA 4BNMA 3JQ9C 5F3RA 4CLOA 1WZIA 1R4MA 4XGKA 2R6JA 3PHIA 4J49A 5DCWA 4OL9A 1DPGA 1H9AA 5COBA 4MVJG 3CINA 4GX2A 1ISHA 2GD1O 4N7RA 1V6AA 3KSUA 4P8RA 5TIIA 1L1FA 3AY3A 2DTEA 4PLGA 1CYDA 3PHJA 3FRJA 4IUYA 4K6FA 3UXYA 4XEHA 4QXMA 3WGIA 2FR0A 1U8FO 4IMRA 2IYOA 2WM3A 1DRVA 2VTEA 2Z95A 4XYGA 1H6AA 1E7QA 3RBXA 3GY0A 4GGOA 4ND5A 2AA3A 4OO3A 4BGIA 1B26A 2ILTA 5JPIA 1Y1PA 4HXYA 2PGJA 1XWFA 1U5AA 1Z7EA 4PZDA 1SBYA 4AJLA 1ZK4A 1MB4A 4KZPA 5I7SA 3H7AA 1NPYA 1HRDA 1A7KA 5AYVA 3FN4A 4UAGA 3LLSA 3TNLA 3O8QB 4EJ6A 4A10A 2HUNA 3LVFO 3WXBA 4DBZA 3GN1A 2OUIA 5THKA 1E3JA 1CF2O 3Q2KA 4DLBA 1QP8A 3F1LA 3IMFA 4ZN6A 4U0KA 2EV9A 1NAIA 3FNHA 1E7YA 2FPIA 1WAMA 5A9SB 1LC0A 3JYNA 4M8SA 3F4BA 3HDHA 1UR5A 3RJ9A 4JP3A 3ABIA 3Q6IA 5THQA 3QRWA 1NYTA 2EP7A 1LJ8A 3RI3A 1N92A 4J91A 5AXDA 1YQGA 1C3VA 2WD7B 1N1GA 2JFHA 5EPOA 1QMGA 1JAXA 1E1KA 1E0DA 2UDPA 4XRGA 3A9WA 3OM9A 3U3XA 3SXPA 1KEPA 1DC3A 3JQAD 1UP4A 2DQ4A 4RPHA 3FSRA 2EW2A 1A9YA 2VYNA 3GOHA 3GN2A 5A02A 3K31A 1FMCA 1T4DA 2GUGA 3BHMA 2DTXA 2YDYA 3B1JA 1VSVA 3FR7A 3L4BA 2VHXA 2I6TA 2GZ1A 4YPOA 4JBGA 3V2HA 2YHIA 3B70A 5C7OO 3UH1A 5L4SA 1SO8A 3VH3A 3LYLA 5B4VA 4BNGA 2GF2A 2YW9A 1BSVA 1GPJA 3JQ8A 3W6UA 3NTOA 3VVCA 4IDFA 3BMNB 4IDCA 1QORA 2JCYA 3NGLA 1YBVA 5A03A 3DAFA 1NPDA 2JKVA 3QV1A 4PG7A 3V8BA 3FR8A 1R66A 1P1KA 4LVUA 2EHDA 4WECA 3RU9A 3KETA 3ZV6A 1C0LA 3WGGA 4ALMA 4UVIA 4XYEA 3TFOA 2J5KA 4LCJA 4Q3AA 1J6UA 5GMOA 3VTFA 3LU1A 2E4AA 1IHYA 2Y68A 4M89A 1N8KA 1RYDA 3W6ZA 4Y6PA 4YXFA 2EP5A 1ZH8A 3GG9A 2RH4A 3GZ4A 5BNIA 2EF1A 2YZ7A 3FHLA 1DHRA 3H9GA 4RJTA 5ADHA 2VZ9A 4FOOA 1KBZA 3NJ4A 4NQZA 2Z1MA 3LC1O 1GPDG 4XX0A 4JJFA 3EW7A 5JY1A 1Y8QA 2B69A 3B6ZA 1M66A 8LDHA 5DN9A 2PFGA 3QIVA 4TVBA 4ALIA 3HADA 5HWSA 2O3TA 1UXJA 3GA0A 4QTZA 1K3TA 1N1EA 4UVGA 2W4QA 4XGNA 1LSOA 3KSZO 3E03A 3G49A 4E33A 3I6IA 1MV8A 1LA2A 2EG9A 3E82A 3U62A 4L75A 1HKUA 4L4XA 3HB4X 1YL7A 2XAAA 2PK3A 2ZB8A 3SLGA 4ZICA 5JAZA 4FGWA 1T1RA 2NU6A 1O94A 3NJ8A 2HCTA 1LLQA 3AFMA 4L9RA 4M1QA 5F5NA 3KEOA 2Y0EA 5JYEA 1K89A 2UV8A 1WWKA 1LUAA 3R1IA 1JVBA 5CHEA 3T7EA 1KEUA 3ON5A 4E21A 4CM3A 1NWHA 1SOWA 1NQ5A 1YB1A 4LSMA 2JD0A 3EVNA 4EBFA 2GZ2A 4DIOA 5A5EA 2Y0DA 3RUIA 1MGOA 1E7WA 2CF6A 5DCYA 2C29D 4MVJF 9LDBA 2X5JO 4ZRNA 5DP2A 2DUUA 5CEFA 1UP6A 3S2EA 1TT7A 3DZJA 3JYPA 4O0LA 2D0IA 2JFFA 5GZ1A 4H3VA 2B5VA 1FDVA 2EGHA 3TJRA 3CIFA 3S2FA 3UVEA 1ISGA 3B1FA 2GO1A 3G1UA 4JGBA 1OFGA 2A4KA 2X9NA 2J5QA 3GK3A 2NTNA 3BMNA 2LDXA 4H16A 4BNTA 2ZK7A 5KJFA 3G1TA 3F46A 2O48X 2GN4A 4NFHA 4HADA 3PJEA 1RM5A 3FNEA 5JE8A 1QG6A 4A27A 5IDWA 4IQ8A 2CY0A 1ZEJA 1GZ3A 4INAA 2G17A 3VDQA 2YQ5A 4EUEA 1ENZA 1ADBA 3TPCA 1HSZA 1QR6A 2Y05A 1QYDA 3DBLA 3B1KA 4FFLA 3UOGA 2YV1A 4ZRMA 3E18A 4F3YA 1NHGA 4LCEA 2HO5A 2O3JA 1H6CA 2FSSA 2HMTA 2I3AA 1GZ6A 5IN5A 2GN6A 4ND2A 4YT8A 4Q39A 3MJEA 3QVTA 4U0JA 1PU2A 1EVIA 4E5MA 2B0JA 4MVJP 3ZZNA 1Q7GA 1E3WB 3ZW9A 1V0JA 3WQRA 2YFHA 3BHJA 1NWCA 4Q3EA 1E6WA 1LEHA 2NU7A 1T2DA 3EGOA 2CDAA 3I9JA 3PQFA 2Y99A 3RQSA 5KTKA 3LF1A 2WDZA 3AUAA 4IGEA 4DC1A 3U49A 4Y8VA 4ND1A 4RGBA 2CVZA 3D5QA 1PJTA 2C20A 1EUZA 5DBGA 3OQ1A 2WYUA 3PWSA 1NASA 3K73O 3IL2A 2YUTA 2A92A 1Y5RA 5EQDA 5EQFA 3GFBA 1LTHR 4CPDA 1E7RA 1PL8A 3ZU2A 1U5CA 4J0FA 1ENYA 1A5ZA 1MXHA 2JD1A 5JDCC 3QA9A 1KYQA 4L73A 4CQLB 4DBVO 1R0LA 4WGGA 1T26A 3JQ7A 4YJDA 1ULSA 1MA0A 4GX5A 5DZSA 5KVVA 1S6YA 1SC6A 1TXGA 3BMOB 1XGKA 2PKQP 1RPNA 3GRPA 1K5HA 4TRJA 5FI3A 3IJRA 4YQZA 1F8FA 2DBQA 1ZW1A 4IDAA 5JS6A 1GCUA 1OOEA 4K9DA 4BO7A 3S8MA 4CLDA 2VTDA 3DFZA 2NSDA 1DIGA 1EUCA 3DHYA 4RPJA 2P5YA 4UUOA 5U1PA 1MX3A 4U7WA 1BXZA 2YV3A 2HMSA 3IP3A 5DBFA 1IPEA 5IAAA 1JKJA 5JDCA 1B15A 1YL6A 4YJFB 5JY6A 3KOUA 2FY8A 3VTZA 1XU9A 1JWAB 3AOGA 4EITA 4ZJUA 3C24A 4H7PA 4R16A 5TLSA 1P44A 3DAGA 1CETA 1KC1A 2VWGA 3UGKA 5K6AC 3H6KA 2BFMA 1A7AA 1U9JA 5L45A 1E77A 4B79A 1SCUA 4CMJA 1MUUA 4BOYA 1U28A 3Q9UA 1JVSA 5A05A 2C2XA 3GMDA 5TC4A 3N7UA 2QG4A 4UVEA 4EZBA 2EKPA 4M49A 4R3NA 3L0DA 3ICPA 2FRDA 3MJSA 4OKIA 3TDKA 3IQDB 1LRKA 3DAPA 2DTDA 3PEFA 3PYLA 2WTBA 2DPHA 2G82A 2VT2A 4NMHA 4UUNA 4U5QA 2AE1A 3MJVA 1DIBA 5U4QA 2OP1A 4BNYA 4PLVA 2HU2A 4II2A 4PG8A 2ZATA 5KJ1A 4ZU3A 3NAQA 1R15A 3DZBA 5TT0A 1NQOA 3DO5A 4R54A 3HFSA 5DULA 3KO8A 1B3BA 1XSEA 2Z5LA 4HP8A 2EJVA 4L4SA 4RLSA 1X0XA 3HN7A 2H9IA 1IULA 1XELA 2X0NA 4MIYA 2AEFA 1W8DA 3AUUA 4LMRA 2GLXA 4R1TA 1D3AA 4CV3A 2PR2A 3WOHA 2IEDA 3QJ5A 3ST7A 3OEYA 1JWBB 3W1VA 3K2BA 5IXSA 2Q1WA 1HE5A 4F6CA 3W4KA 4CUZA 2PH3A 6LDHA 1X14A 4DYVA 3VZSA 4IGFA 1I2CA 3WYCA 3PZRA 4PVDA 4G2NA 4RVSA 1UH5A 1E3WA 2EGGA 3EUWA 3WTBA 4B7UA 2AQIA 2TMGA 3G79A 2ZYDA 1E5QA 2FZEA 1ZVMA 3ZWBA 1GTMA 3PFFA 3WNVA 1A72A 2WEKA 5BSGA 1P3DA 1M2WA 4C7JA 5CDYA 4XGIA 6ADHA 3V2GA 3D3EA 4PRKA 4Z6KA 1O9BA 4G65A 1QV6A 3K5PA 4ZQFA 3AJRA 3ANMA 5DBIA 5BNFA 4J4BA 4YB8A 3JQ7B 3OQ6A 1A4IA 4RLHA 1HDRA 3H3JA 4CLEA 1ZNQO 3JD3A 1P33A 1C0PA 3GGPA 1XEAA 5EESA 2HLPA 1N2SA 3BTUA 4KTTE 2EW8A 5LCXA 2J5RA 1HDYA 3I23A 4WKGA 1BW9B 3VPXA 1KC3A 1O6ZA 3Q11A 1RWBA 2Q45A 3C3XA 3I9MA 3V1YA 9LDTA 4IPTA 1GZ4A 2DLDA 2PTGA 4LISA 4J0EA 3PP8A 2BFOA 2H63A 3E6AA 3IUPA 4TRRA 4KUGA 3GDFA 5K6AA 3RUDA 3E5MA 1ZSYA 4L74A 3D4PA 4GX1A 3B20A 4I08A 3WGTA 4E5YA 3WLFA 4J2HA 3AUTA 4BQPA 4XD2A 1SEVA 2OBYA 4CUJA 3K2EA 5TGDA 5TT1A 4E13A 3WNQA 1E5LA 1WDKA 3GC6A 1XR3A 4IJWA 4BO3A 2ZTUA 3WFJA 3PQDA 1WNTA 3CSDA 3I9KA 1DSSG 3CTMA 1Z7BA 5JDIA 2HKIA 2VRCA 2JJYA 2UUPA 2X23A 5FWNA 3PVZA 3TF5A 3MJ4A 3VDRA 3LK7A 3OEWA 1UUFA 3GNSA 3WBFA 2C5EA 2Y1CA 2ZYAA 3M1AA 5IDYA 1EK5A 1DC6A 3GVXA 3K96A 3JYLA 3GPIA 4XWYA 1G6KA 4FC7A 1H0KA 1Y7TA 1YL5A 3VVBA 1ADGA 1FDUA 4GKBA 4BNLA 1I24A 1I01A 3DEYX 3KXDA 2G0TA 4GPD1 4GSKA 5COAA 1ZZEA 3WGYA 3E5RA 3U5TA 4A5OA 2PH5A 1Q0HA 4EI2A 1ISIA 2XPCA 4JXKA 1HDGO 3VAZA 1ZXBA 4D7AA 4IXWA 4DIFA 2DU8A 3TSCA 5L7YA 5L51A 3L07A 4W4TA 3PJDA 3RC2A 2CD9A 5CAEA 2D2IA 2NACA 5TJHA 5B1YA 1ML3A 1LNQA 1BTOA 4XDYA 1LC3A 1U3UA 3GLQA 3T4EA 1YOVB 2F1KA 1NFFA 1PQPA 3ZHZA 2DKNA 2C5AA 4QO8A 1PGPA 3C85A 2P91A 4DPMA 5JNLA 3H5AA 1DHTA 4NBTA 4YAEA 1R4MB 4WNCA 3KM0A 4Z3DA 4YT5A 3MOIA 1QYCA 2Q49A 1J0XO 4WASA 5H82A 4BKQA 1CQJA 2HJSA 1CEQA 2F00A 1G1AA 2BELA 1F0YA 1UDAA 3C8MA 4FJ1A 1QLJA 1ZO8A 5ER6A 3MJCA 2PZKA 3ZU4A 1HDCA 5BQFA 2JAPA 1ZK1A 2Y1EA 4AJNA 2VZ8A 4CM6A 2GNAA 3AY6A 2O2YA 1SZJG 3JD2A 3L4BC 1ZCJA 2D8AA 3BXXA 2CZCA 3PHLA 3GFGA 3PXXA 5LC1A 4C7KA 2O7SA 4TKMA 1F14A 3JQEA 4E2WA 2HDHA 2NNLD 1RM0A 4IJVA 1YO6A 3GDOA 3ONDA 4G81A 3HSKA 1NAHA 1HZZA 2YHIB 4BO2A 1EBFA 1SNYA 1C1XB 3KTDA 1DOHA 2X6TA 4IQGA 4XZ3A 5GZ6A 4B4VA 3D3WB 2EKQA 4W82A 5T6BA 2FPGA 4J4TA 2VYVA 1PQUA 4J4HA 3K92A 3FPLA 4HNGA 4RDIA 1PGNA 3ZWNA 1I3MA 4CLHA 3OQBA 2QX7A 4OGWA 2PZJA 1YBMA 4ND4A 2WE7A 1XDWA 1DJQA 4HX5A 1CIVA 1SEPA 4R1NA 4UULA 3ZV4A 2PY6A 2YYYA 1C1DA 3L4SO 5A5FA 3ADOA 1M6WA 4A03A 4CMEA 1XLTA 3ZWVA 1EFLA 2ZYGA 3DMTA 1M67A 1HL3A 1ZK3A 4BGUA 5JXWA 2I66A 2BLLA 3LT2A 2X5OA 3ROMA 4IJUA 2E37A 1E1MA 4BKRA 3QVXA 3BMQA 4DQVA 3WG9A 1HLPA 3ZWCA 4WPGA 2J8ZA 2Y67A 3HJAA 2CVOA 1EK6A 5AXCA 4D45A 2J6IA 5IG2A 4HFNA 3VPFA 1LDEA 1DEHA 3RJ5A 1RM4A 3UHAA 3WYBA 1K0UA 2NV6A 4DIBA 1YE3A 4ZQGA 2BD0A 4E32A 5DDIP 4PLWA 4N18A 3ITDA 3PZBA 3WJ7A 1YWGO 1I2BA 3L6EA 4AJPA 2OL4A 4MJLA 2X86A 3WX0A 3KHUA 5I7EA 3HNPA 1Q0QA 1X1TA 1IZ0A 1BG6A 1B16A 3LZ6A 1VL8A 3RWBA 3VH4A 4EJMA 4QX6A 1PQWA 4WLVA 3DZKA 3NYWA 2B4RO 4GQAA 4YRDA 3WIDA 1GCOA 5T67A 1ZK2A 1G0OA 3DBRA 1P0CA 4FJ0A 4IZHA 1C0IA 1IL0A 3OIDA 5A04A 5IXYA 3N74A 1GL3A 3OMLA 4BMSA 4CM4B 3EY4A 1N5DA 3RU7A 1EZ4A 4RVHA 3ZU5A 4AVYA 1DBVO 4JQCA 4YEDA 4BO1A 4GL4A 4AICA 5F21A 3D0OA 3ENKA 3PRJA 2FR8A 3JD4A 1AXGA 2BKAA 1Q2XA 1PWXA 4OQZA 1QYXA 3WICA 5EINA 4OMUA 1P74A 5BSFA 4CODB 1YH3A 1DJNA 3UCXA 4AJ1A 2C7VA 4XQGA 2VUSA 4D41A 1LRLA 2FSVA 2OORA 3AI1A 3WBBA 4RPGA 2OXIA 3HUDA 3NV9A 4WCDA 1SMKA 3T4XA 3C7DB 5BSEA 2XF8A 4MDHA 4B3JA 1I32A 3MEQA 3OSUA 1PGJA 2AG5A 1PWZA 5B4UA 1FK8A 2IZ1A 2VT3A 5I7VA 4WCFA 2AQ8A 2O50A 1V3TA 4I5GA 4ND3A 2R2GA 1IHXA 3OFSA 3VH1A 2ZQYA 3ZHBA 1LQTA 3M1LA 5ILOA 3BAZA 1QKIA 3PWKA 1HF3A 5J23A 1NVMB 3QHAA 4NNJA 4FDAA 4UVHA 1R4NA 5CPFA 3QQPA 1L7DA 4E3ZA 1XHLA 3RBVA 2NQ8A 2Q3EA 1P1FA 5TX7A 3QW2A 3EMKA 1V35A 2GZ3A 5BSHA 7ADHA 1DLJA 2I3GA 4MINA 1HLDA 3GHHA 5JMPA 2VZ0A 3RKRA 2JCXA 5KJEA 1H9BA 2ZJ0A 4ALNA 2WE8A 3CZRA 3MTGA 2IXAA 5EJ2A 5HTOA 1G0NA 4PZEA 1ZJZA 3DZGA 4J7UA 2PV7A 4OAQA 3MCVA 3L9WA 4QO7A 2NLOA 3F5QA 3VZQA 5MGBA 1HEUA 3DOJA 3P5SA 3QY9A 5IDQA 2CDCA 2X0JA 3H5NA 4CLRB 4AJHA 4DMMA 1B8PA 1PJCA 1W4ZA 3KLPX 3JQBA 4NBUA 1LXCA 1DIHA 3QP9A 1LSJA 4DWVA 1U3TA 5L7TA 3AY7A 3NX4A 1I2ZA 4MVJI 4RVDA 1YQDA 4YR9A 2OP0A 3RUFA 1PR3A 4L4RA 1LLDA 4CMAA 2OBNA 1TEHA 4RCVA 1F8GA 3WMWA 3WQQA 3UICA 2QRJA 2WD7A 3DB2A 2PGLA 2ZTLA 1NFQA 2W2KA 3EHEA 3HQ4O 4OHUA 5T8KC 4WLNA 3DOCA 1OC2A 2W2LA 4UEJA 4BNUA 5EERA 3ZV5A 1XU7A 5L95A 4YACA 2PNFA 4DQUA 2GERA 3L6OO 2Q4EA 4CM4A 1BXGB 2BGKA 1ZK0A 2DBZA 3D7LA 4NJOA 3U4DA 2OO5A 4MVJD 2HK8A 4Q9NA 5AXBA 8ADHA 2PLAA 2O3UA 4XJSA 1HYHA 3PIIA 4FIZA 4NPCA 4CQMB 4KMSA 3KYDB 5G0SA 4BNIA 4EEZA 2O3QA 2IDZA 4XYLA 1KVRA 3FTPA 4CQMA 4EGFA 3ZWMA 3AK4A 5FF9A 2EKLA 4KQWA 1QLHA 3U4CA 4CV1A 4E2XA 1NVTA 4KQXA 1U2GA 2BRUA 4J6FA 3WIEA 3ZNQA 1M6HA 2DC1A 2FPPA 4GWKA 1OI7A 1N9GA 2JL1A 1ZSNA 3H9UA 2D5CA 4K28A 2VWHA 5K9ZA 4MVJA 1DIRA 1U8XX 4BNFA 2DM6A 2UYYA 4Q3NA 1DFIA 4A7PA 3NT4A 3VHRA 3CMCO 3GVPA 3GZNB 3PFWO 5IZCC 3EVTA 5ICSA 5ILGA 1V3UA 3DBHB 2D1YA 4J43A 3HHPA 4P22A 2ZCVA 3U4IA 4XYMA 3H2SA 3NDIA 2V6MA 3BTOA 2VUUA 4IDBA 4I5EA 3TOXA 4CMIA 5IJZA 4BUCA 2RH8A 3PHHA 3AUSA 3JD1A 1XKQA 3SEFA 2IZ0A 3TZ6A 1YQXA 4GVLA 1U3VA 3ULKA 5HS4A 1VRWA 2IZZA 3NGXA 1SOVA 4JX8A 5F5LA 5L40A 4I8XA 4BVAA 2V6FA 4DTIA 5HM8A 4OKNA 7MDHA 2VYVD 1ONNA 3IIEA 1DRWA 1MFPA 1TI7A 4UUMA 1NVGA 4RPLA 2CVQA 5L4LA 1Z45A 3AI3A 4FBGA 3ZGYA 4Z0HO 4U8GA 3KYCA 1I3KA 4QFDA 4DUPA 4W9NA 4U6SA 5FFFA 4R68A 2R00A 1J4AA 2GGSA 3W8EA 3INTA 4DRYA 4MPDA 1DIAA 3WGQA 1J49A 5TS3A 3NRCA 4AJEA 1OMOA 3WFIA 3ZDFA 1LDNA 1WDMA 3IS3A 4NBVA 2VRBA 2GN8A 1P77A 1MG0A 1B3RA 2Q46A 1VI2A 3DXFA 3FWNA 4S1VA 2P9EA 3OJFA 3P7MA 1Y6JA 3V5NA 4JCOA 4WLOA 1HE4A 4TSKA 3WDSA 1R4NB 4IDDA 1YB4A 4CM9A 1HZJA 5A9RA 3F6YA 2ZB7A 3BYZA 5CDGA 5CDUA 3JD0A 2JD2A 3F4LA 4KDFA 3KVOA 1ZUD1 2QW8A 5JO0A 3I3OA 3BHIA 2DAPA 2AEMA 3LDHA 4FFRA 3HWRA 4L0QA 1I33A 4GI2A 3IP1A 3KZVA 3PYXA 3RFTA 3TWOA 5KKAA 1PGQA 1WMAA 1MLDA 1WZEA 4G5HA 4BO5A 4HV4A 1YRLA 4PG4A 1HYGA 4R51A 1Y5MA 2PZMA 3TOZA 1BVRA 1C1DB 3DTTA 2TMDA 1EE9A 4YVFA 1KY5A 3JQFC 2VQ3A 4OJNA 3HFGA 3ZNOA 5JAMA 3DWFA 2QYTA 1NR1A 3CUKA 3UW3A 1W0CA 1BGVA 3F5SA 1DC4A 4O5OA 4GMFA 1F17A 1K6XA 4LMPA 2NTJA 1OC4A 4O1MA 3O38A 5F1KA 1KEVA 4J9VA 3EAGA 1ZSVA 1HYEA 4R5HA 2WMDA 2XOXA 3DTYA 3NKLA 4FFMA 4TQGA 5IN4A 1W6UA 4MP6A 3A14A 3HDJA 5GY7A 4KDEA 4MVJE 3NDJA 4OOFA 2DPGA 1BXKA 2J3HA 3EYWA 3WR5A 3ASVA 2X9VA 4OIMA 1ZKMA 4P4NA 2DBRA 2VCYA 3ZWOA 1HDOA 3DMTC 4YAIA 4PIVA 5ENVA 4HUJA 4ONEA 1LI4A 1IB6A 3OJLA 4FW8A 1KOLA 3RSHA 1D1TA 2X58A 1CDOA 4YWJA 4CMEC 3KB6A 1T2CA 1AN9A 2RIRA 2VOJA 3KYCB 5JYDA 2HK9A 4DREA 3MWEB 1FJHA 1UDBA 5KWEA 5EIOA 4FCCA 1NQAO 2Z1NA 4CMKA 3STHA 3GR6A 2V7PA 3QWIA 1WVGA 2V65A 3JQ8B 2X0IA 5CDSA 3CKYA 4WOJA 3N58A 4E2ZA 1TB4A 2X4GA 3DBRB 4KWHA 4PFJA 1E7MA 4A0SA 4CR8A 1O5IA 4CM8A 4D3SA 4D43A 4TZKA 1XG5A 2HMVA 3ZWYA 1VKOA 1DB3A 1OZAA 3RC1A 1X7GA 3OA2A 4RV9A 4P4LA 3SJ7A 4WNIA 3ASUA 3I4FA 4BB6A 3LT1A 1PZFA 3OP4A 3X2EA 4NI5A 3IDSA 1A4UA 2GSDA 4WEQA 3VKUA 3WWZA 1YXMA 4Q3DA 3NTQA 4CM9D 5U9CA 2DBVO 1DAOA 3VPSA 4FD3A 4LSWA 2A94A 3MOGA 4B8WA 1GR0A 1K2WA 2DVMA 3ONEA 3PI7A 4Q3BA 1PR9A 2DFVA 1PJ2A 1QV7A 3RD5A 1ISFA 4NJMA 3ETGA 5KIAA 4K26A 4HY3A 1PL6A 2CNBA 4PLYA 3PGXA 4BO8A 5AXAA 4NDNE 4CJXA 3GGOA 5TSDA 1YVEI 1GD1O 1B7GO 4ITUA 3MJTA 3NTRA 3OBBA 1U1IA 4PLZA 4R9SA 3UCFA 1YDEA 1H94A 1P45A 4PCVA 3ZI0A 4OSPA 1YGYA 4QEDA 1GV1A 4J3FA 4NFSA 4A2CA 1E92A 1EFKA 4RZIA 1PL7A 2X0RA 3BMCA 4N5MA 3TZKA 4CMGA 3DFUA 4B3HA 2IODA 4BO4A 1IE3A 3ZN2A 4JP2A 3VH2A 2HRZA 5I9MA 4Y6RA 3AU8A 1HDZA 3ETEA 2UVDA 4J7CA 4B8ZA 4LK3A 5ER9A 4D46A 5JC8A 1EDZA 1HT0A 1T1SA 3IUSA 4QQRA 4U6QA 4XB1A 2JFGA 1BMDA 4AJKA 1B8UA 4Q3CA 4LN1A 2AG8A 4Y67A 2QRKA 3AM3A 4BV9A 1DLIA 4XR9A 2YY7A 1I3NA 2I76A 1UXGA 2NADA 2C7GA 3JCZA 3K30A 3TL2A 4ZHSA 2P2SA 2O23A 4QECA 2J3IA 2EXXA 4R41A 3FCOA 4NH4A 2QZ9A 1JAYA 3GZNA 3OA0A 1H6BA 1UXKA 5JAQA 1V9LA 4B7XA 4E5PA 2JAHA 1VE9A 4GWGA 3I9OA 3ICCA 1M76A 1MC4A 4EEXA 2WWRA 1MFZA 1X1EA 2BGMA 1X13A 2A9FA 3WWYA 5K0ZA 1GQYA 3KEQA 4R5MA 5ITWA 4WCFB 1B2LA 4QFCA 2OGUA
chains in the Genus database with same CATH superfamily
3OHMA 4HS4A 1F6DA 2EZ8A 2Q5IA 2ZRDA 1R3UA 3AZQA 1M1ZA 1NVEA 4EA6A 4F3CA 2QP4A 3RUAA 2GK7A 1MC5A 4LI3X 2J41A 3VZDA 4CIYA 1XDDA 2WWYA 3PWZA 3QI7A 1ORRA 4D0SA 2WTMA 1CZRA 1EVJA 2FVYA 1ZGBA 3HP4A 4QULA 1BMFD 2ICAA 4YUXA 2ZIZA 1CQJB 3NANA 4J94A 2IELA 3H5TA 1T8UA 2JIQA 2FN4A 1RI4A 1SBZA 3THWB 3SC3A 4WDQA 4TV8A 4YUYA 4NZ9A 4EH1A 4WKCA 3RO7A 2FEKA 2PUGA 1GV0A 1GUYA 2A9VA 1P3Y1 4OXKA 1SPXA 4DCPA 2JLUA 5BYAA 1WU7A 1OIVA 1IK6A 5B7QA 1YDHA 3BGWA 4EL0A 4TXHA 5KNDH 1AZLA 3AWIA 1RLIA 3PIRA 3K0CA 1QXSA 1YR1A 4IX9A 4E2YA 2W2LD 3CCBA 3L7MA 3T7CA 3T1YB 1FTQA 1UAYA 1H66A 4B7AA 3KRTA 3OX4A 2KHZA 3MMZA 3NWBA 3LUDA 4BGVA 3OIGA 3VKGA 3ETDA 4PSKA 2PBLA 3OT4A 3CVOA 3LNTA 1IYZA 4TLEA 2Q4DA 5AK0A 2JFQA 2HLDA 3SFZA 3GP3A 4IV0A 4Z0PA 3ZHUA 1SB9A 5CBPA 1N6KA 4DRXA 3A04A 1OXTA 1UJCA 4HBGA 2Q3HA 3ECCA 4U7PB 3QX9A 1UKYA 4URFA 4MVWA 2I8CA 4MS1B 4NCIA 5DSZA 2XUAA 1J0CA 2BRUC 3OLWA 2FPOA 2Z57A 3WHKA 1N34B 1E18A 1EGHA 1U9IA 5JV5A 2NU8A 4PO3X 1C3OA 3P9IA 5EE3A 3WRYA 1WPQA 5JC1A 4YTEA 2VBIA 3IVXA 2I9PA 4D8UA 4EO7A 2P4QA 2ZU6A 1KH2A 3EEFA 3IC5A 1H5NA 2Q1TA 3QF4A 4E6EA 1HE8B 2QIPA 4IP0A 3U80A 3CA8A 3UJ3X 2WYWA 4MULA 1TEZA 1Z08A 1CZLA 2LRHA 1P7VA 1LSUA 4G37A 5PGMA 1EK1A 3ZCVA 1HK7A 2A9PA 4Q0MA 3TJMA 3HVRA 1S96A 2Q6IA 3TSAA 1H6DA 1L8OA 3O83A 1G8SA 2FKAA 5EJGA 4NLLA 2RKBA 1QIHA 3G2HA 4RZ2A 5KYYB 3V97A 3EH2A 2VP0A 2HK7A 4G8BA 4OHMA 4UXJA 5KNCA 1FUUA 1Y1RA 1Y82A 4RJKA 3RYCA 3OQNA 5CHYA 1O0BA 2PRSA 4B84A 1AKEA 3U4QA 1QM5A 4JBXA 4KAFA 4MWGA 3GLGA 1U8TA 3RBZA 1JG6A 4JT9A 1GNTA 2O6HA 4JL6A 4NC9A 3VPDA 4P35A 3UATA 1GPH1 4NTZA 1M34A 1P2VA 5HBRA 5K01A 4NU6A 1EKXA 2G5CA 2R86A 1D0IA 2Z08A 2H07A 1ZA2A 4MKZA 2C2OA 4R2WA 5C8ZA 1F12A 4PLPA 2C5BA 3P26A 3FSGA 3K0HA 2MYUA 4XIGS 2A78A 3BUSA 4UNQA 5YASA 1BX3A 3EGDA 4QUIA 1OH7A 3K20A 2SHKA 1MXFA 5FWDA 2YFKA 1QCZA 3F9RA 1UZNA 3M2PA 2H59A 3P9ZA 4D80A 3WSWA 4DA8A 2IIQA 5BW5A 2JHGA 3FZNA 3QELB 4HYQA 4RFVA 3T6KA 2CLCX 5MN4A 4PXYA 3TBKA 3SJUA 1YB5A 3A1UA 4DLAA 4N0EA 4AJJA 4CL3A 2JHFA 1YQUA 2FF5A 5HK9A 2WJVA 3IXMA 1QIMA 1BJKA 4OUDA 3ZHTA 2XOKA 5CD1A 2ZE5A 4JP1A 4AY5A 4MGYR 4QBHA 2OZVA 2Y71A 1SVLA 4FDTA 1A9TA 4YCCA 4Q6WA 3NEPX 3N2IA 1NTOA 7REQB 4W8OA 1Y7HA 3MPUA 2GD0A 1PK7A 3C45A 2DFNA 1VJTA 4CR7A 4ENUA 3HN2A 4QUHA 2ANCA 5ISMA 2FJUA 2J3KA 1BHSA 1NUSA 1OLUA 2VHEA 3ABZA 4LQ4A 5CA0A 1P4RA 5EMHA 4K3VA 2I3BA 4ZT5A 4TXNA 3HU1A 3KOOA 2C58A 2VF7A 3LTEA 5LDGA 4OM8A 2BEUA 3CE9A 4K86A 1Z0DA 1P2FA 4XE5A 2ZQZA 1XKTA 3E7WA 3RC9A 5JZOA 1MOPA 4OU4A 2VWPA 2J08A 3EIUA 1OAAA 1DDOA 3FKSA 3IUNA 3LS2A 3PL1A 4MQLA 4NV0A 1USIA 4TUYB 4NBSA 1TCBA 4PRLA 5EZQA 1JU9A 5MHTA 1NI5A 2GZAA 5F1OA 1P3JA 3C3DA 3BGSA 1L5OA 3PC2A 4QGFA 4GC9A 1UBKS 4U4AA 4WFKA 4ZAXA 3J81A 3TQRA 4C21A 1O95C 2REOA 2KJQA 4NHEA 3VNBA 1M74A 3EMBA 4P86A 1R3DA 4AZVA 3JZDA 2IDJA 4MR8A 1JTEA 5BYJA 4JLJA 3T3MB 3K2IA 4CLOB 2O4UX 2Y1GA 1FDWA 4UNPA 3WLQA 3ZWKA 5E4JA 1ZEMA 3K8ZA 2V6BA 4EHLA 2C04A 3M7IA 2D2EA 1SG9A 1DARA 3OF3A 4DMUB 4HBZA 3EPHA 2BFAA 2EDCA 3JZMA 5LXTA 3AR3A 4TMYA 4OXXA 2G08A 1CUSA 4FS3A 5ABPA 4GOOD 1ZMBA 1X7XA 3GVCA 4WLUA 1SPBS 1JHRA 4IKPA 1CK4A 2FHSA 1OAKA 4MRPA 2CLSA 2VPWA 2VDWA 3O03A 1Q20A 5EVJA 5BN4B 1GT6A 1Z4KA 3AH8A 5DYGA 3UNXA 3VOSA 4I9GA 1D09A 2I22A 3GGGA 2DFPA 3ZWAA 2W37A 4TWZA 1G5IA 1I0ZA 1TRHA 2ZI4A 3RCBA 4PZ9A 3NHBA 3RS5A 2VHYA 3D8RA 4IDEA 3OTHA 2IVZA 2NVOA 2WFLB 4GNRA 4JOBA 4OQYA 1MZPA 1RM3A 4Z49A 3Q3GE 3HVKA 2WD8A 4DL9A 1P60A 2VHZA 4WBNF 1JDBC 2E2WA 1D2CA 1SIBE 3SS9X 2FZWA 2FFHA 1PT5A 3CNLA 1IN5A 1A9QA 3F6BX 3KKMA 4PAMA 1UFOA 3O0DA 1RTTA 1XZIA 4PE5B 1IEXA 4JUBA 5IC6A 3CLUD 3SVZA 5E1BA 3V7UA 4DV2B 3IOYA 3N2KA 1OQAA 1XA3A 1R6TA 4JQYA 5KNDA 1UMCA 1N0UA 4KI7A 1YIAA 2FZLA 4JBLA 3HJTA 1N6OA 4BPRA 2ZIWB 1G21E 4CCYB 1BFDA 4RCYA 1JG4A 3JQ6A 1YS4A 3FPAA 2BI8A 2PRZA 4PAOA 3VR0A 3RTGA 3VNVA 2DY0A 2J48A 1XCBA 3ASZA 1LNZA 3QG5A 4MVXA 4QREA 1L7VC 4B7ZA 4KR3A 4BRSA 1JA9A 2AE2A 4JY7A 3ZWPA 2C31A 4B6OA 1I1QB 1KO1A 2FK7A 4K9QA 3W5UA 2WA1A 4EFLA 2EAUA 3DHEA 3PQ5A 3QENA 4G0PA 3VI4B 2XNSA 5EJ6A 3ZZTA 2XCTB 3AKDA 4W5JA 4U7TB 5AQ1A 2XTNA 3LV8A 2L69A 3LUHA 1C1XA 1TT5A 1XDSA 2CYAA 3IKVA 1MMFB 3UGQA 2BMEA 3VNUA 1VCNA 1KH1A 2QGNA 2YN2A 2HTEA 4XQ9A 4JN6B 1Y9EA 1W2HA 4G41A 1NBMD 2DCUA 4I4IA 1JWLA 3PHGA 4FGZA 2YCBA 4CLXA 5KSZA 1KJYA 3ESBA 2GCNA 5A1TA 4DJAA 3R0ZA 5AKZA 1P4GA 3IPAA 3CO5A 1YDMA 3KPWA 4ROSA 5I7UA 3O8LA 5CGQB 1L5VA 1NM5C 3KSAC 1Z2AA 5EGSA 4BEJA 1W87A 3AR7A 5K09A 2EJBA 1ZMOA 1XA0A 1KDPA 2RHCA 1JTVA 2ZKIA 3CLKA 4PRZA 3IJPA 4JOQA 4KSYA 4I8DA 2SCUA 3QEOA 5EXDA 1VMEA 3AFNA 4TYPA 1MB0A 3DMGA 1EFVA 4Y0AA 4KSBA 3GJ7A 3TZHA 4DLVA 5AWFC 1QHGA 2YXEA 2I6SA 2QUKA 2QTMA 4JASB 3M4JA 4FOPA 4M9QA 1KSGA 3E1KA 5FI1B 3GYBA 4HAXA 2B94A 1DBSA 2ENWA 3EE6A 5AHWA 5L9AA 5FR2A 2X77A 1GNLA 4IDNA 4EY3A 4CU5A 5B57C 5BN3A 1MQSA 5JD4A 3RADC 3UJ6A 3D5EA 3QFRA 4HR7A 1ATZA 3HXLA 2ZCUA 2WKPA 3Q2IA 3R0VA 1UBHS 5KREA 3THXB 1AM4D 1JYEA 2ASEA 2PKXA 4D8WA 3D6HA 2X7JA 4DMLA 2POQX 1HDEA 1OX5A 1XMJA 2ERYA 1U0BB 4AKSA 2NMVA 2W6OA 3T3DA 4DMFA 2R7AA 2Q28A 4HJRA 3THXA 1XIVA 2Y27A 1WSAA 4LDPA 2CVFA 3AOEC 4D99A 4XOIA 5FEMA 4HNVA 3OKFA 2BL4A 4JBIA 3FBTA 4IDOA 1N77A 1H8ED 4CQNA 1R0BA 4Z86A 3ZI7A 1MBZA 2E85A 3OTIA 4WHMA 5K8UA 4CKBA 3OQPA 4J0JA 1SBNE 4HXFB 3WFZA 3IA2A 2ZB4A 1FU7A 1ZJYA 2KWIA 3V2UA 3DDWA 3R7WA 5CVTA 1PWYE 1V6SA 1VL6A 4L72A 3DGEC 3HJGA 1DJLA 3GRRA 1PTJA 2IPMA 5AJWA 4LYJA 3ONFA 3PCRB 4BNKA 4GLOA 4AZ0B 4GXQA 1YZHA 4KFTA 4EMUA 4QPNA 3LK6A 4WXEA 1XX6A 3RK4A 4JKYA 5BR7A 3A32A 4CU2A 2BFPA 1D8TA 1IVSA 1KTIA 3UBTA 2M6RA 1EX1A 2VNSA 2EJUA 2RGUA 1X15A 3LP5A 4K9PA 3CW8X 1SUBA 3DBLB 1ADCA 2GBFA 4MKGA 4KL8S 4HF7A 5HMLA 5I5GA 2JIPA 1JH9A 1X74A 1JHUA 4JLNA 2C2HA 2PAFA 1L4FA 3F9IA 2A8YA 4PYNA 3DBIA 1CR6A 1KTVA 3A7DA 1LI7A 2JAQA 1EEHA 3GRYA 2CF5A 3FD8A 2ODAA 3VV2A 1KDOA 2A1TR 2G5PA 3G23A 5K4AA 3UHFA 5IF3A 2JIBA 1NC3A 1WXGA 4OXIA 1KEEB 3LX8A 1DO0A 4OHKA 2XUHA 1AA6A 1N57A 2PKYX 5HRAA 3K5IA 4TYWA 1GL6A 4H0CA 1DE0A 2CHQA 1XZAA 2IKSA 3ODPA 3V8MA 2BEVA 1T5LA 3ILHA 3W8NA 2HHJA 4MGIR 2Y2UA 3TL6A 1AUPA 3BE6A 2GWHA 4IIJF 4CMBA 3AOEA 2QP3A 1N6RA 2R4QA 7AT1A 4B3DA 1VYVA 3QYFA 5HF6A 1WUYA 1UC9A 3DE4X 3C48A 3KPUA 2VNKA 2A35A 3F67A 3IALA 1KERA 2YWGA 4EW1A 5F35A 4LVCA 1DTWA 1ECJA 3I5MA 1H3FA 2PPVA 4HMPA 3W8DA 4BO0A 5KTYA 1SH7A 3OU2A 4DRXB 2C07A 2QMZA 3LXUX 1WMBA 4G2TA 4JS0A 3CJQA 1LBHA 4LHEA 1ESDA 4S3MA 3BL8A 3WSTA 4YAGA 4Q1CA 2XCSB 5DNVA 2QR2A 3VR6H 1DCTA 1XP5A 2K2QB 3GARA 2D3TA 1Z2EA 2II6A 2LP4Y 3D7NA 3HG7A 3CX3A 3P94A 4A26A 1T0UA 4JBHA 1LRJA 2BFNA 2QXTA 3FNRA 4ND7A 1J42A 4ZGWA 2YFQA 1KPGA 4JA0A 4D1YA 2F1IA 1Q77A 2ZUDA 3L04A 1SQFA 2NYUA 2CKMA 3MGBA 2J3DA 2BH9A 3QYJA 4L6CA 2X15A 2YWHA 1ZIPA 2ZBPA 4IF6A 4PLCA 4W1QA 4YALA 5E6UA 4I1IA 2CDNA 3LECA 2HM7A 1ZBQA 4R9UC 1T35A 3R6WA 4F4IA 4JMLA 3QVGA 2AEJA 4OIFA 4Q9DA 3V4ZA 5C7IO 2EP8A 2FUG1 4CM5A 2QUHA 3UUWA 2YYSA 5DMXA 2OFPA 3GF4A 5G40A 5H1YA 4JLKA 4TKZA 3ADPA 4QOJA 1EM8A 1GSIA 4G9BA 4RE6A 5LYJA 3V8QA 5BR4A 4RZUA 4C0KA 2ES4A 3TXYA 1EM6A 2H57A 1XZQA 1X1QA 5I7FA 1YI8A 4YYZA 4RF4A 1EUDA 4GR4A 3AJ9A 1NUAA 3FYHA 4C0BA 3RANA 4LJLA 3MZ0A 3D4BA 2RAPA 5DLYA 1C2TA 2E5WA 3LA8A 5EIBD 5H59A 3PXCX 4JBNA 1FNMA 5LQKA 3HB0A 2P4SA 1G19A 4RVOA 2E49A 4CUKA 5LA6A 2Z2YA 5D2CA 1PNTA 4MIEA 3QKRB 4M9XA 4N9QA 3VNRA 3TNJA 3LPCA 2IYXA 1E98A 3ZU3A 5KQSA 1UPFA 4BS9A 4UCQA 2FQYA 3OTWA 4OLJA 1ONPA 3Q9NA 3EW9A 1NNUA 3ANXA 4XTCS 4MGEA 4Y2XA 3BCUA 4KMOA 1P2DA 4NMXB 4A2PA 1P2TA 2C4WA 5I9TA 4F3TA 2GJ9A 2R7NA 1NBWB 4TX1A 1HQCA 1XVIA 3Q40A 2QN9A 1EAMA 4UEKA 2A5DA 2GM5A 1BHJA 4F46A 4Q1VA 4HDQB 2H5LA 2ZJFA 4X1IA 1YVUA 3JWEA 5C34B 5FAXA 2OV4A 1VB5A 1T24A 2QZZA 3CX7A 2VBCA 1GFWA 1J2TA 2RC6A 4K9MA 1EP3B 1C2YA 3MAGA 4KSCA 4X9XA 4E5SA 5L8VA 2HA5A 3OZAA 2VJQA 4WZAE 4K9LA 5CXSA 2V96A 5AO9A 1CF9A 3P4YA 3RVLA 3H2IA 1FFBA 4IJ6A 3PJGA 3JALB 1H2HA 1VPDA 2WSBA 3IOBA 4A8HA 3SS7X 2PMKA 5KO2A 2BHRA 4HD8A 4OX9B 5A0TA 4KR9A 4ZVVA 1KI6B 1TMGE 1Q0LA 4MWEA 3RYHA 5CLLA 1PSDA 2X0KA 1X3SA 5LDHA 1EB9A 5DK4A 1JUDA 1H0SA 2PUBA 4JLBA 2XE4A 2UKDA 4YX9A 3AR9A 5C4GB 1V9SA 4QSMA 2DKFA 3LCRA 1XAGA 2W71A 4D6YA 4G25A 3AM4A 1M6EX 2DX7A 3SKVA 3G6KA 4G4GA 2Q2OA 4QGAA 4ZQHA 1ZNYA 5CFZA 4A6XA 4V0NA 1EBBA 2F3TA 1FLNA 4CTMA 5LBTA 2K5UA 2Q9CA 3MJFA 2GASA 4QDTA 3KZNA 4RVFA 5A9SA 2X7HA 3EDOA 1ZRMA 2JHCA 1G8KA 3OOSA 1XRQA 3SF8B 1OB2A 1J9EA 5C37A 1ZGJA 1RACA 3TTTA 1TRKA 4LECA 3B85A 2F62A 3GMTA 4M1MA 3FM9A 4M0PA 4QSHA 3LHFA 1KWGA 2IA5A 2XVXA 3H1FA 1XEFA 2P3OA 4DUYB 5LNK6 1J2RA 1SA0A 2UZ1B 3CZMA 3DV2A 2W42A 2XHEA 1OBVA 4XX1A 1R5BA 1VKNA 5KOHA 5EIBC 5KQGA 2GAIA 3ABRB 2NZ8A 3KDPA 2VSOA 1V5IA 3K8QA 1KK2A 4TS3A 1RKUA 1Y8CA 1PGOA 2FG5A 4Y2TA 2I8LA 2WSMA 3CEAA 3DGFC 2BIFA 1V25A 3ORSA 5ALQA 2AZXA 2ZWOA 3WHPA 2WJ6A 2FMUA 1JEQB 3CZ9A 2XNHA 3KSDO 3HHEA 4PWZA 3ZHYA 4ER6A 3A4MA 1CD5A 4I9NA 2VA8A 1E61A 3QX3A 3NTUA 2XECA 4HDRB 4OBWA 3L1JA 2QRQA 2PKQO 4LOIA 3H1GA 3K7EA 2P5UA 3UB3A 1L7XA 4X6UA 2NWQA 1TYBE 5A5VA 1VLVA 1DO8A 2YX1A 1UMKA 1YJBA 2G9QA 3D5TA 5A71A 4FGSA 5JQGF 2P9YA 1SBQA 4TL9A 4L16A 1ORVA 4JVSB 4YJGA 2A1UB 2DKOA 4HFJA 5E6UB 2PFSA 2YVQA 2HLNA 1U9ZA 2BBTA 1G6HA 3AM5A 4RK1A 4DKXA 1QF7A 3EUFA 5DX1A 3CZ4A 3VVMA 3RV4A 1EX7A 2YVLA 2CFSA 1PVVA 2DUNA 1NT2A 3T3GA 5KVSA 3TOCA 1YRAA 3NHYA 1ZGAA 4MAFA 1QGUB 3CUTA 4NATA 3S1LA 2F8MA 3E7DA 2XYGA 5DI3A 1YB7A 5IZCA 1VKZA 3DTVB 2R1TA 5A3JA 4MVJM 5F2KA 2Q2WA 1E8NA 2WLTA 1HNZB 2J4DA 3SR4A 3NPMA 1IONA 1V41E 2A59A 3IR5A 4JI3B 4TVOA 4I3FA 4HH4A 4FLEA 3R7DA 5C5IA 3BERA 1CWUA 2GUWA 4UREA 4GI1A 3V4PB 2QYSA 2GRUA 1NDQA 3NOVA 3Q0EA 2PGDA 4Q19A 4XVQA 2IGBA 2H31A 2R6R1 1N2BA 2A1TS 1KE2A 1GXSA 1NKTA 2MSKA 3WLTA 1TA4A 2Y0CA 4LXTA 2OXRA 4Q9JA 2WKQA 3PITA 3JVVA 1X3LA 1XYVA 3A1TA 3R3ZA 1Z56C 2Z09A 5J59A 3S29A 3DLHA 1XZFA 4HZGA 2E1RA 2CT8A 3AI2A 1S9HA 4N5DA 1UBRS 1CFJA 2XT0A 4KGZA 5HCUA 2VJBA 3I52A 5CB0A 3L7AA 8ATCA 4EJSC 2JGDA 3CWQA 4MUNA 4DSZA 2YJTD 3G2KA 2CHFA 5TPWA 3TYXA 5AOCA 1C14A 4K6CA 2Z1DA 3V1MA 2IW3A 1FW8A 1N1DA 3TX2A 1W73A 2FCAA 3OH8A 4RIEA 5AUQA 1XV5A 3RTEA 1FU4A 1SHKA 4C08A 5A6SA 1FBTA 2J67A 3EZ6A 5FOQA 2IS2A 1VI5A 4JD5A 4D0GA 3UG6A 3WRYC 2ZKLA 2QN8A 3EGIA 3Q87B 1LDYA 2GJKA 4L76A 1LDGA 4H6XA 1YSCA 1L4LA 4UUPA 1XZHA 1ZM2A 3W2GA 4WESA 3AT1A 3SSNA 1P73A 5CTJA 2F3QA 3WYAA 2JH9A 4BGEA 1I9GA 3HEBA 3KTAA 3QJGA 5AI6A 1XTBA 3BDIA 4TKVB 4AYXA 5KYWB 4N9WA 4KO2S 4O63O 5TV2A 4JI2B 4UM5A 1U63A 1Z2NX 4RHXA 1T3HA 1XJWA 1Y48E 2C1EA 1EEXB 4EPYA 2MR5A 2VQEB 4F2WA 3V32A 2NO6A 1HTBA 3ILVA 1RLMA 5L3ZA 1SKQA 3ZE1B 2XGJA 4TMXA 1MAWA 4GDMA 2AD5A 3ACDA 1SVIA 3W3ZB 1CV2A 2LV8A 4UU8A 3U16A 3D6MA 1U0FA 1C3JA 1L4EA 4AURA 4WK0B 1XEXA 2XV1A 3I4CA 4PG6A 4BO6A 3S2GA 4BWFB 4EGSA 4EMSA 4C6RA 4D9JA 4F3KA 8OHMA 5TQ2B 5JCJA 2N3ZA 3ZW8A 4QGBA 1JIXA 4G86A 4IRMA 1FF9A 2J0VA 2RHJA 3GH3A 2WHPB 1CE8B 3IDQA 1QS0A 4GMGA 3L0ZA 4NFYA 4Q15A 1U8ZA 2DPYA 5TGTA 4CL2A 3O74A 3KFLA 3ANYB 1B00A 3RFFA 4P08A 3V6MA 1NRJB 3MWJA 3H86A 4X54A 3P71T 2OVFA 4QOFA 4ZKEA 3M6IA 2I99A 4LRSB 1NJ2A 1JN0A 2Z56A 1RRPA 3F47A 3UMFA 5AW1A 2M32A 3QWFA 2HMYB 2A5LA 3ZDEA 4F96A 4DS3A 2ZE8A 3EGDB 4DPKA 3TZQA 5CP8A 4GZ5A 4F8EA 4ETMA 4JB0A 2CUKA 4RIGA 1GFIA 2X40A 1DMRA 1GQFA 2E6UX 3D0RA 3WLKX 1AF7A 3N86A 1Z39A 2H1SA 1QQBA 3U9TA 1PUXA 4YRAA 1W35A 3OT1A 2JIOA 2GYYA 3C87A 3GJ8A 1GQSA 3S7TA 4FMDF 5G0VA 1NF8A 5GM1A 2FMIA 1A2OA 1XFAA 1P0IA 1S02A 4KFRA 2HPHA 1NXXA 3I0ZA 1LPBB 4Q1FA 5GJVC 1R2QA 4TSFD 1PJQA 2X2OA 3G2QA 4NCXA 3MM4A 1PWEA 4FC6A 1DADA 4KUEA 1J7KA 3UMBA 3HZHA 4G4IA 2GYWA 3TPZA 5LKAA 4C05A 5TGZA 3LVQE 1L7MA 3L3BA 3JVEA 1OFTA 2OG1A 2Q5HA 1PTJC 3LQKA 1WSBA 3JQCA 2O2DA 2HJRA 1JSRA 1LNSA 4GLLA 1R0ZA 3MK31 1G8JA 3TQTA 1T25A 3TLGA 1S89A 5A6SB 1BD3A 5HQTA 1SIUA 3BH7A 4GZMA 3LBIA 2VWQA 3LA6A 1R4ZA 4LHYA 2C88A 4ESEA 5ALKA 1ZGCA 4KP7A 1BCRB 1IUKA 3DNFA 4LY3A 3TINA 2QLLA 1AS2A 2JFUA 2QG9A 3LBNA 4RLQA 1B8OA 1QDEA 3FPHA 3DCYA 5J9FA 2WJIA 4AIRA 2VAMA 1OV4A 3M9LA 3UA4A 1UFQA 5IF9A 1ZI8A 4W1PA 1ZR2A 4LC0A 1QK3A 4EQ6A 5EOVA 2BOVA 1LPAB 1ZM4A 2D1RA 2XMCA 4J2OA 3K6JA 4GVXA 4JWKA 4QEZA 1FSZA 2V3WA 4XYBA 3C7KA 4H7KA 1L5LA 3HLTA 4BLRA 4QJ3A 5JWHA 5BT8A 5J5VA 1KKMA 4YJGB 3GMSA 4GD3Q 5EZ5A 3D3QA 5REQA 3WIOA 1KFJB 3VBCA 1CUYA 1PCXA 1T9ZA 4CKYA 1AUOA 4ZREA 4NIMA 3L77A 4OXNA 1QIIA 4CZ2A 3FOZA 1RKXA 3MJRA 1QLWA 5IPFA 2JFNA 1XJQA 3LLVA 4F38A 2E21A 3O8OB 4C0XA 2ZPAA 4TSRA 2QNBA 3PEEA 3LE8A 1PJ3A 1R12A 2IHJA 2QG6A 2ZEJA 1OH8A 1RBMA 1UQTA 4HDRA 2HR1A 1M8PA 1JHMA 1ZOOA 3TQHA 1I5RA 2BDEA 3IDAA 5E3IA 2CLKB 3BRWD 3EZGA 5D51S 1LVUA 4BJHB 2O8VA 2N0SA 1ZOSA 5AIAA 3B6MA 1GADO 2Q3CA 4KOAA 4PZCA 5TF4A 1OBFO 2B1JA 3O9ZA 3JVUA 1J90A 4MVJH 2J9ZB 3IQFA 4XLTA 5I8ZA 3EWSA 1LPSA 4I46A 3EFHA 5JSUA 1SXPA 4G5QA 1ZJ5A 1M33A 2JCGA 3K1JA 3ZG6A 1H2BA 4BGDA 2PXAA 2IHTA 1OKKA 2FPSA 3B36A 5H8WA 4XB2A 1K7SN 2VHVA 3GEDA 4MEBA 2CYCA 4H7FA 2R8YA 1SQ5A 1AKVA 4FCWA 1E9AA 1YQTA 5G3YA 3W1EA 5JDIC 1R9JA 4IIUA 3IKTA 4G1CA 4L6AA 4LYEA 3D2LA 4XPIB 5CX4A 2PMFA 5DWDA 3WL6A 1WKCA 3NIFB 1BX0A 1FDTA 3R7SA 1NG1A 4PNPA 1YOBA 1QFJA 1Z33A 1E2FA 4TTRA 5FWAA 4ZVKA 2EZTA 4YYEA 5JAUA 3LSYA 4BNMA 1JT2A 2W9XA 3E8SA 4CLOA 1R4MA 3GJ0A 1ZVKA 3WIBA 1OWMA 2PYIA 1FNDA 5DCWA 2Z2JA 1WS6A 3H11B 1SQ6A 5COBA 3WNBA 4WZAB 3VA7A 1NBME 1GG8A 3G1WA 4FLFA 2Z5GA 1H23A 4XI9A 4P8RA 4Z1MD 2YCLA 2BZGA 4J1TC 1X92A 4DSUA 2DTEA 3ESDA 1CYDA 2P77A 4K6FA 4KR6A 1FNSA 4ZV7A 5SZIA 3WGIA 1T5OA 1BQEA 5BSTA 2IYOA 1DRVA 3LWZA 2VTEA 3CN7A 4M6WA 1H6AA 3I0NA 3LQ1A 3P0RA 3RBXA 5EZSA 2AVNA 1CUJA 4AP9A 4OAPA 4MUHA 3X1KA 1SCAA 4PS1A 5IAJA 4CKBB 1Y1SA 1ECGA 4O2AA 3ORYA 4OTZA 2Q5QA 2VDOB 1PVOA 2DWCA 1Y1PA 2ORIA 1J1IA 1G3UA 1L4NA 2TSYB 1IG0A 3ZKWB 2AX4A 1WQ1R 2CFTA 3MT8A 4HDSB 5ALOA 4PZDA 1SBYA 4PPGA 3RG2A 1U9IC 3TX6A 4E5VA 4FUTA 1Y7PA 1YZUA 3H7AA 1RC1A 3NVDA 4JOCA 5FT9A 3AERA 2DUMA 3FUXA 4YRMA 1TJYA 2D0PB 3FN4A 4UTOA 2RI1A 2IK8A 3O8QB 4JI1B 1XTIA 4A10A 4EJ6A 1FPMA 4G85A 4PZYA 1WMEA 3GJTA 2NV0A 3VKFA 1E3JA 1GUAA 2VJAA 4NWIA 1QP8A 4FD2A 5AJZA 4V39A 2EV9A 3FNHA 4MPJA 4TGLA 3FSGD 2IVFA 2H1RA 2HY7A 3PEUA 3ZE0B 1OXSC 1ZIYA 3ERCA 1UR5A 3OX1A 1E1QA 1E96A 2ZRQA 3ABIA 1YV9A 5LQDA 1C4XA 1NUPA 1ZAKA 1N92A 3PQCA 4PCLA 1AT1A 4Q1BA 1YQGA 5AVKA 3PTAA 2WD7B 1HDIA 1N1GA 3W6NA 2AJLI 2JFHA 5B1DA 1BKYA 1E0DA 3ZGLA 4OP2A 2WKRA 2WIDA 3I5XA 2XXAB 3U3RA 1RAGA 1C8VB 2DSTA 2W6ZA 4QXQA 2PMEA 1QU2A 4QQNA 1PKXA 4NH0A 4KOEC 2DZDA 2I80A 1VGVA 1Z88A 3JQAD 1UP4A 3L8GA 3MTAA 3QNUA 1DU4A 3SIPA 4DIKA 2W0SA 3FSRA 5FBQB 2ZYVX 5LYJB 1GZ7A 5EMJA 1CLUA 3UKJA 3LFHA 4L5YA 1WUJS 2P3QA 4KGDA 3BHMA 2DTXA 3Q5GA 4M8LA 3WOVA 2WF6A 2VHXA 4BN5A 2BSAA 4M8NE 4YPOA 2A5JA 5HIAA 2FZKA 4AXXA 5JI3E 4KLCA 1T8RA 1R9GA 2VCEA 3IUYA 2X19A 3BIXA 3LY9A 2GF2A 5B4VA 4X63A 3NTOA 3QJYA 4HO1X 3ZWDA 2EW1A 1NE2A 3CZ5A 4IDFA 4HVLA 1QORA 2JCYA 1YBVA 5A03A 3DAFA 1DQSA 3QV1A 4K6MA 2KE5A 3DKKA 1PLLA 4PU0A 5H3CA 4EHAA 2QTFA 4ZGGA 4LNUB 4BE9A 3SOPA 3UWSA 1Y3AA 2EHDA 4URXR 3RU9A 4DEVA 3ZV6A 1C0LA 2J9RA 1P0MA 2BUBA 4WOCA 3WGGA 5DTIA 4H4CA 3JATA 3RIYA 2VK8A 4XYEA 4OGLA 3TFOA 1JFTA 2DUJA 2O2XA 5GMOA 4ZKDA 4LYDA 5E6SA 1K98A 3LU1A 3DMFA 2AOTA 4M89A 4D25A 1N8KA 4ZEVA 1RYDA 5DHSA 4Y6PA 3W6ZA 4YXFA 2EP5A 2O5CA 1JMVA 1DTWB 1ZH8A 1GKYA 3KWLA 4ZYWA 2OECA 1V47A 2VDMB 3AL0C 2AOTB 2O7VA 4P58A 1RWNA 3ZUGA 4RS4A 3CH4B 1JHVA 1YFLA 4FOOA 5LZ7A 3BSYA 1L5KA 3NJ4A 2CV0A 3LC1O 3LBAA 4JJFA 1AQ6A 1Y8QA 1M66A 1Q11A 3SE0A 3UAOA 1Y37A 5CLJA 5DN9A 2VDQB 5SZHB 4E22A 8LDHA 1X9IA 2PFGA 2ZUCA 4F2PA 2IUUA 1Y3FE 3HV0A 4KQKA 2Q6VA 2H4YA 3DEIA 1Y1KE 2W11A 3EMDA 3K09C 3O8NA 3ZVKA 2JFXA 1N0VC 1C50A 2W4QA 3WGUA 5KQRA 3KSZO 3IV9A 4CT5A 3TW6A 4GBGA 3O0TA 5DFAA 4C87A 1QQ5A 3R9IA 3RSGA 6PFKA 1V11B 3O90A 3E82A 3U62A 2FN8A 4A1OA 4L75A 1BHO1 4JJ4A 3EQ2A 2PE5A 1GFZA 3A31A 1N78A 5CFLA 2XAAA 4KREA 5LQMA 4PZUA 5JAZA 3UPUA 3NIGB 4IXDA 2NU6A 1O94A 3O1IC 1S01A 3ZPXA 4I50F 1LLQA 4L9RA 5CCDA 3NBKA 5F5NA 1G291 2ZM6B 4JQSA 1ZG3A 2CBGA 2UV8A 3FOCA 2PO7A 4OJTA 1TU4A 1WWKA 2JEOA 1TF7A 2TECE 3R1IA 5FUWA 4R0MA 5K0SA 1GHTA 1MB3A 3T3IA 1SOWA 4HLUC 2JD0A 4YP5A 2C2GA 3KE9A 4KWCA 2FK8A 2UZIR 2FPLA 1RBQA 5A5EA 4YAOA 1MGOA 4R0NA 4DA0A 2ZDGA 1Z5UA 4MVJF 2E6KA 4QTUB 1Y9ZA 1DKPA 5DP2A 3WKEA 1WL8A 2FMHA 1YMUA 1XCGB 3ZY6A 1KSJA 3FY4A 3I6MA 5CEFA 4QDOA 1J8FA 1U02A 4NOMA 2O9JA 2VTKA 2RI6A 2NTYC 2D0IA 4UEQA 2D7DA 3V42A 1U3GA 4V03A 4A6PA 4U2BA 2MU1A 2VRWA 4P3KA 3GRFA 4RFSA 3ZOKA 2JEYA 3FB1A 3DWEX 4JP5A 3CIFA 3S2FA 3ITNA 1KP2A 2C4MA 3B1FA 1ZLXA 3G82C 4GLFA 2H11A 1OFGA 2G71A 2A4KA 1MZVA 1GLGA 1SXHA 1DEXA 1OWNA 3BMNA 3EHDA 4X44A 1K7CA 2ZDQA 3WB1A 3W05A 4DVGA 3H83A 2XCOA 3IV6A 3UMVA 2GZMA 1GZDA 3R7WB 3CB2A 4X65B 2WUVA 1G9XA 4GLBA 3PUZA 4HADA 3PJEA 5JE8A 1JNYA 2QMEA 5IDWA 3ROXA 1YZGA 3VDQA 1NW4A 4ZOQI 2FUKA 2XUGA 5ALWA 5CYOA 3SQDA 3UOGA 1QYDA 2CHUA 1EFVB 3B1KA 4FFLA 2YV1A 3LUGA 3E18A 4CNBA 5C2JB 3E27A 3QVLA 3HUTA 4MW7A 1LW7A 2HO5A 1K5GA 1JZQA 4NYMR 1KJJA 2GFIA 1EK0A 4HS9A 4PYRA 3LM8A 5IN5A 1AK1A 2X4DA 4ND2A 3RBAA 1WQ4A 2HSWA 4ABTA 1VJ5A 3FPBA 3QVTA 1E2LA 1M2VB 1DI0A 2JJ2D 1PAUA 3EQ8A 3LHIA 3N8HA 3OJWA 4J8PA 4ON9A 3UIEA 5FWXB 2VAPA 4RHUA 4D3ZA 1BXRB 3MBOA 3HTXA 1C7RA 2YFHA 3BHJA 2XNDD 3CN9A 2FXIA 4Q3EA 1LEHA 3G8AA 2PNJA 5JOQA 3EGOA 1C41A 1WXXA 2AN9A 3SX0A 3TS1A 3PENA 1PV2A 3DFIA 1JL3A 1NSFA 1TYAE 3TKAA 4M22A 3BXHA 3RVMA 4IGEA 4KIJA 2C2KA 1UC5B 2GEBA 2VDVE 3BICA 3RYCB 3VISA 4FB4A 3FPGA 2QXYA 1CY0A 1Z2OX 3JVDA 1W6RA 1KI3A 3Q3JB 4MX8A 1AJEA 2D62A 4A82A 3WZMA 1W19A 4CT0A 1ZONA 3COVA 2OY0A 1E62A 4ZZIA 4JC0A 5AK6A 5KTNA 1NI4B 3A2NA 2HK6A 3C98A 5LQAA 2PL3A 3H7IA 1CQZA 4MYUA 1OH5A 5EHZA 3FCCA 1ENYA 1L1EA 3DZDA 4H60A 4J0FA 2JD1A 3HKCA 3RTDA 1OU0A 2ZJ3A 5DMHA 4NXNB 3WAKA 1KO4A 2YIJA 3FETA 5KJCA 2M98A 4OYLA 1Y98A 1R0LA 4EG1A 2ZRJA 3B13B 2FG7C 3JQ7A 4BVFA 4AMUA 5B3JA 2G1AA 4KH1A 1XN4A 5FI3A 1RPNA 4TRJA 1K5HA 5I01A 3P9QA 1EHYA 1ZNZA 1RZUA 3B1ZA 1KJQA 3PQ8A 4CE6A 5C9ZA 5K05A 1X7ZA 4UUAA 3WAGA 4UXIA 2REQB 3KOMA 5DT2A 1KDZA 1GCUA 5JS6A 4K9DA 4UNNA 2GARA 3S8MA 4CLDA 4TMZA 5EHNA 1SUEA 5JPDA 3F7OA 1N5JA 1UADA 3DHYA 3ZD6A 2NT4A 1MO2A 1MTZA 2X2EA 4M3NA 5B1IA 3G7UA 2JATA 4BEVA 2OM2A 2F59A 3DW1X 4MNTA 3VR3A 2RHDA 4C9BA 1IPEA 3GJSA 5IAAA 3BWXA 1TMKA 4F2HA 1X9GA 3OCZA 3DDOA 3O2JA 5F7XA 3NJRA 1Z4JA 4LXQA 2BMDA 3ISVA 1R6XA 4OQDA 1EU1A 4Z4CA 4EITA 3B60A 4MKIA 2WJHA 3CSSA 4PC6A 4YJ3A 1G8MA 5EJEA 3DAGA 1CETA 1Z15A 3EXEB 1M9NA 1RPTA 4G0NA 3H6KA 4N40A 2P9QA 3CW2A 4QDJA 4BV3A 5FV7A 1L9KA 1LJLA 2V1UA 1NSTA 2QN6A 2HA0A 3CLVA 4FXPA 5EQTA 3A0RB 1E0KA 1VZ3A 2CUNA 3FA2A 1SHUX 4PZAA 4BMCA 1IVNA 1GZSA 1U28A 3D3JA 4LE2A 2F90A 3IESA 3GJRA 3Q9UA 4NENB 5TC4A 1HQDA 2GNOA 1U0HC 3GMDA 3H4MA 1C5KA 1E9DA 4FW9A 1IQ0A 2VDWB 3ZXUB 5HXAA 2PL5A 2QG4A 3OEEA 2QVBA 3NUQA 3L8YA 2PX3A 3JAWB 2BJHA 3ELUA 3K0KA 3EGCA 3ICPA 4CKCB 4OKIA 3QUAA 5KMGB 2QORA 1YRWA 4XSGA 4FNGA 1QFYA 2CEAA 3PYLA 2JJ8A 4HEQA 5ALFA 5DYWA 3QZUA 5E7IA 3S0JA 3EBPA 5U4QA 3OPYA 4MS4A 3UK1A 4PO8A 3CNOA 4BNYA 3A4NA 3FB4A 4P83A 3WYDA 5EHQA 3RSSA 4X8OA 1ZJ4A 5CBKA 2ZE6A 2R44A 4POOA 5KJ1A 1VLHA 1F8XA 3NAQA 1R15A 2QTHA 2XUQA 3AHIA 1Z3CA 2KBFA 5TT0A 2GZSA 3DO5A 2C0QA 1EA5A 4UC0A 1DWUA 1WB4A 3HFSA 4D9EA 4JJAA 1FTNA 3KO8A 4R71A 1B3BA 1XSEA 2Z5LA 3NIDB 4HP8A 1I3OA 2BM9A 2EJVA 1O3YA 5BW6B 3WGKA 4ZVPA 5FA8A 3FWHA 4YP6A 2P6RA 3WIVA 2XYVA 1T5BA 3OUUA 5JMOA 2H9IA 1RPJA 3AM1A 1T9HA 2UVPA 2X0NA 5LP1A 2BTEA 3I62A 4EIWA 2DOKA 4B43A 4LMRA 2GLXA 4R1TA 1T3GA 2WAYA 2ILVA 4KJZA 5AK4A 3QJ5A 3W1VA 3OEYA 5IXSA 2W2NA 4TYQA 2QRUA 2XUJA 4OGGA 3W4KA 2ZIAA 1KDRA 3UK6A 2PLNA 5B1EA 3PC4A 4QTXA 3VZSA 1T91A