2NO1A

C4s dck variant of dck in complex with d-dc+adp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
240
Chain Sequence
b'TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxycytidine kinase
publication title Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 240
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2no1A00
1COWD 4IOLA 2WM9B 1KGDA 2IYQA 2ZI5A 3BERA 4LBZA 4Q18A 1JQJC 1VIAA 1IY2A 1E9AA 1G41A 1YZUA 2FFQA 2FE4A 2FGJA 3OHMA 3SJAA 3EIEA 3MRSA 1A82A 4OQMA 1D6JA 1EFTA 3GMTA 2VTKA 3A1WA 4PSAA 4G5OA 1VG1A 1QBKC 3ASYA 1U8ZA 4Q4AB 1DG1G 1TUEA 3AKCA 1P4SA 2PZEA 1ZVQA 1OFTA 1ZAKA 2ZI7A 4FIDA 2OT3B 1GG2A 3TR5A 2IYTA 2XJ4A 1MO6A 3W5JA 4Q66C 4WAUA 4BFYA 1G3QA 2RGXA 5AUPB 2CL6X 3UK6A 1KI9A 2EWWA 1H8ED 3QNUA 4RD6A 3WMEA 2XZOA 3S1AB 4PC1A 5C2JB 5CLLA 1SXJD 4PQFA 5EP3A 5BN5A 3QJYA 5AJZA 3B85A 4DSUA 4A2QA 1VCMA 1LS1A 2ERYA 3IBYA 4HAYA 1KSGA 4A92A 1RC8A 2VHCA 1E2LA 1II0A 1KO7A 4A8JB 2HUPA 3R8CA 4UNRA 1CBUA 1R0XA 3BH6A 1NSTA 2P2LA 3U3OA 5KUTA 1XMJA 1Z83A 4AYWA 3L0OA 3TSOA 3VU9B 2GXSA 5CIQA 3DVLA 3U61B 4RJLA 1KDPA 4QHSA 3NWJA 1DG3A 2OHFA 2V3CC 2QE7A 1B0UA 3KFVA 1AJEA 1R2QA 2CL0X 3U44A 4M1TA 1NMZA 3U7EB 2FOLA 2A5DA 5ANRB 2IUTA 3GLHA 1DAIA 2RGBA 3KTAB 2A2ZA 4Q1BA 1G8YA 5HZHA 1RFLA 5EXSA 2NO1A 1DO0A 2QPOA 2J7PD 4URYR 3DZ8A 3B6EA 2VP9A 2R8RA 5FBLB 2PEZA 2ZRAA 3WYGA 2XNSA 2OEPA 4KITB 5KNBA 3Q3JB 2QBYB 4OI0A 1E4YA 1A5TA 4ARZB 2OXRA 3M0EA 4I99A 4LCBA 2GA8A 2IYZA 4JT2A 4R9UC 1JR3D 1VTKA 3CX7A 4DZZA 4EQ6B 2OAQ1 2PH1A 4R2IA 2F3TA 2VLIA 2PJZA 3TBKA 4GL2A 2BMJA 1OH6A 2JDIA 3Q85A 4LOAA 1XTKA 3KXKA 4NTZA 2B92A 1UAAA 4C7OA 1AS2A 2HLDD 2AFHE 4JLAA 3T1QA 2C9YA 3A1SA 1US8B 3I4LA 4RCZA 4U00A 5GJVC 4B71A 3K70B 8OHMA 3WY9A 1ZNZA 2KE5A 3GJ4A 1W49A 1UPTA 4KFSA 2O8EB 2ZU6A 2QT0A 1GOTA 1Z06A 4JLKA 1ZD8A 4DLRA 4QOSA 3RS7A 2W58A 5KTYA 2H1LA 3O8BA 4B2PA 3QKUA 1W7AA 1G8HA 4PXAA 2QAGA 4NDZA 1T91A 1TX4B 3CZQA 1X6VA 1Q1EA 3EPHA 1ZNYA 1R7RA 2IYRA 3EX7C 4PPQA 1OB5A 1OB2A 2CHVA 4LY6A 4L9SA 3ZD7A 2O52A 2HEIA 5D3MB 4F4CA 4OHVA 1N6IA 1VECA 1R5NA 1QHGA 2QSYA 4C3ZA 1U99A 2QQ0A 2GJKA 3NBZC 4KVAA 3BFXA 4MKHA 3NH9A 4BFTA 1Z6XA 1NVVR 1EXMA 3L8ZA 2BJVA 2IYLD 1GL6A 1NY6A 4A8JC 1WRBA 2BCGY 1YKSA 3AF3A 4CW7A 2Q6TA 1NMYA 4LI0A 1X86B 3EIQA 3U7HB 4D0GA 3A37A 4E22A 3RLFA 5KU1A 4UJ5A 1NG1A 2ZRNA 4Q4JB 1HA3A 4MRRA 3ZQ6A 3UWKA 5DIFA 2CCJA 3FFAA 1NN0A 4IW3B 3K1JA 5EXTA 4DC9A 4TMZA 5FBWB 5JRJA 4LHXA 4DEXA 5KSYA 3K53A 1UF9A 3EZ7A 3K9GA 3GJ5A 1E9SA 4F38A 1VG9B 2CK3D 3Q7QA 1VIYA 2RCNA 3W3AA 3ND9A 4Y0AA 2F9MA 4DDWA 3MUFA 1NBMA 1XF9A 4TQUS 3KQUA 3BBPA 5AUOB 4JYBA 2H57A 1ZMXA 4MITA 1H8EA 5J47A 4KO8A 3WNCA 1T9HA 1LB1B 4HZUA 5JFGA 4KFRA 2QGZA 4OI1A 4B6EA 3PXGA 5KDOA 3T15A 1JEDA 3HPRA 4R71A 1IHUA 1FQJA 2IL1A 2OILA 2V1XA 4PHHA 5AUNB 3C8UA 3T1TA 3THWA 1GZSA 4LWZA 2W00A 2IHYA 2EYQA 5IK2A 2VP4A 4DCNA 2ZYUX 1VYVA 3SFVA 4BE7B 1HE8B 1L4UA 2WBLC 1N0VC 3DKPA 3LQRA 4PHFA 4MDFA 4NMMA 1KI2A 5JWHA 2PLFA 3K70C 1W4CA 1QHYA 1FTNA 3LWNA 3QXXA 3SHFA 1NN1A 2YOGA 1N0UA 5FTNA 3VKWA 2GWHA 1KOFA 1KI4A 4NPHA 2MSDB 4TN1A 3QKSB 3O47A 2RHMA 2QA5A 3UXMA 1OXVA 2AD1A 1UDXA 2GHIA 2H5EA 4B3XA 5GADl 4POAA 2FFBA 4P32A 4F93B 4IDOA 4A36A 2JIZD 1E98A 4GP7A 1Z47A 4X8OA 3D6TB 4YQFA 4II7A 1JEEA 2GJSA 2RH5A 2VO1A 1K5DA 2W6JA 3BOSA 2GEDA 2J0UB 4M1SA 3WHLA 1XCPA 2MMCA 3CF6R 3PJRA 1EESA 3LVQE 3EZ9A 2D62A 1S8FA 3QG5A 5E7JA 5JHHB 3VKGA 1NLZA 4LUCA 4OQXA 1SKYE 3IQWA 3QOFA 4PO1A 2VRWA 1WQ1R 4G5GA 4LZZA 1NY5A 1GKYA 1I4LD 2IX3A 2O5VA 2K5UA 1KNQA 1YJ5A 4JKIA 4D80A 4MKFA 1S1MA 2Q9AA 4EJSB 1G8FA 3SYKA 1EX6A 2C98A 1S3SA 2ZYWX 2HLDA 1CXZA 1S3GA 4QC2A 4BRUA 5FOXA 1DE0A 3RS5A 2W2TA 3PIRA 4P33A 821PA 1DBSA 2GNOA 1XNJA 4UXHA 1KHTA 1BH2A 3R9IA 4KODA 2ZI3A 2ZE8A 3W8RA 1AZSC 4I1OA 4Z1MA 1Z6AA 5BYKA 5J4YA 1BOFA 3LXRA 2FJUA 2NPFA 3RRNA 4UJ3A 1FPMA 1KIMA 1FTSA 2B6HA 4XTCS 5F3WB 3UMFA 2VIIA 2FPKA 3E70C 3FKSA 5LB2A 4ZKDA 3EPJA 1BIFA 1TADA 4BLQA 1GUAA 4NCJA 1WDTA 3BFVA 5TB5A 1LF5A 3QI2A 2IXFA 1ZM2A 1VG8A 1E69A 4NYMR 1CU1A 1QHXA 1R10A 4BFXA 4G01B 1ZW6A 3OAAA 4BLRA 2ZS7A 2Z43A 3HWSA 4XWOA 3DKVA 2C77A 1GM5A 2ZVPX 2NTYC 1SKYB 5AK0A 3RAPR 721PA 4TZ6A 5L3QA 2D4HA 1GFIA 2J59A 1U98A 2BBOA 2PT7A 1VCNA 2ZSFA 2CE7A 5JS7A 1DAKA 1KI7A 2EFGA 2WOOA 4NYJQ 3FE2A 3EG5A 1RPZA 3NBXX 1EX7A 2JLXA 2FMXA 2ODEA 2QUZA 2AN9A 4DIDA 3EC1A 1DTSA 4KSBA 4LRWA 1CR4A 1T6NA 1CJTC 1F48A 3E1SA 4Q48A 3M6AA 3V00A 4LYHA 1W5SA 1CR2A 2PEYA 1WBBA 3W6NA 4I1SA 1ZU5A 4ZIRB 2FA9A 4EIWA 2IYXA 1DAFA 1NN3A 3J81k 2YJTD 5KOYA 2IEZA 621PA 4NCHA 3H1TA 4RFSA 1ONBA 4TL6A 2YHSA 2GXUA 2R6FA 4BFZA 2R6AA 2VSFA 3D8BA 3KKOA 4RSGA 2QSZA 4I81A 1GAJA 1XXHE 4URVR 3VR1A 1OXSC 1KZ7B 3I3SR 2W6IA 4OKSA 2XNDD 5JMTA 3TMKA 3AVOA 3THXB 2BM1A 1E6CA 1CJKC 1ELOA 2J1LA 3SBEA 4B3CA 2OG2A 2TMKA 3T1OA 4OBEA 2Q3MA 2WWGA 4YMWA 1OIVA 2ZSBA 4EJSC 3L8YA 3IIKA 4FXPA 1D5CA 2YWHA 5H68A 4DHEA 2DWQA 1UJ2A 3GCGA 1FZQA 5KPDA 4TYYA 5JS8A 4NH0A 4D4KA 4D4JA 4H1VA 4PQYA 1E2GA 2RHDA 2YC2C 1ZCAA 1ESMA 3IIMA 3CNOA 4Q9HA 1G7SA 2CJWA 1J8YF 1I2MA 1KO8A 1TU4A 3HDTA 3GLGE 2JLWA 3PCRB 3T5GA 1RE0A 5GVSA 3U3MA 3PG5A 2BV3A 2W83A 1RZ3A 1E2HA 1WMSA 2GBLA 2AX4A 1OW3B 1OXUA 3GLIE 4QJ3A 2YOHA 1XFAA 2KB0A 2ZTSA 3L2OB 2R6GA 4KU4A 4A2PA 4ZDKA 4KLZA 3V4RA 3ZD6A 1J90A 4TTPA 2W0SA 1GDDA 1G5PA 2WMOB 5HKKA 1TL7C 4QHYA 1II9A 1N6OA 5HPYB 1P9WA 2FEMA 4NBSA 2V7QA 4TYWA 4XSHA 1QHHB 2NZJA 4P4SA 4YMUA 4AI6A 1XXHB 3BB4A 4L9WA 3VR3A 2MSCB 2ODNA 3ADBA 3MSXA 2OFWA 4B76A 2VP5A 3DO6A 4JLJA 2PJRA 1F2TB 2WIBA 4BWYA 5IF9A 3OEHD 1MR3F 2IS4A 1R6BX 2V55B 3I61A 3W8NA 1CTQA 1Q3TA 1IJFA 2R6DA 3DM9B 4QBHA 4QNMA 5B58C 3C14C 1G7TA 4AKEA 2DY1A 2XSZD 1RJ9B 521PA 1GNQA 3TQFA 3CRRA 1NI3A 3KFXA 4OHYA 3VMFA 2YWFA 3LBHA 4MGIR 1P2TA 3TW8B 4OHXA 5FTJA 3T5DA 2GCNA 3OIVA 3GLGB 1A2KC 4QGFA 2WWFA 5K8IA 1P2VA 3EZFA 4TLEA 5DSZA 4ASUD 3KXLA 4ZI3A 3KXIA 2VHUA 4LYAA 1KSFX 5AJVB 5HTKA 2RGNA 2IS6A 4Q21A 4I1VA 3Q7PA 4OQLA 1ZM9A 4Q1CA 3GLIB 4IJMA 5KNCA 4A9AA 2KBEA 2WPDA 1E2QA 5CLQA 3LQQA 3QENA 3NBYC 4TMTA 2B7BA 3SYNA 1A7JA 2NZ8A 5FR1A 2VBCA 4Q7KA 1QG2A 2EFDB 3AF1A 1W0KA 3OFNA 3LBIA 3W6OA 4O2RA 5SZIA 3BH0A 2GETA 3ZS8A 3CH4B 1YRBA 4QRHA 3THOA 1XD8A 4RCYA 1G3UA 4XOIA 3QBVA 3IDQA 4KI0A 3RWOA 1T0HB 3FFBA 1NP6A 1NL3A 4R7ZA 4V0MA 1E2KA 5CDFA 2BBWA 3FWYA 4DRZA 4GBMA 3W34A 5FL7A 1QVRA 5K8TA 2EW1A 3H2YA 3K0EA 3C41J 1YVDA 4TLAA 2GF9A 2X77A 1DAHA 2ZJAA 1G20E 3AVYA 1UFQA 4V03A 5DH9A 4RZ2A 3A1TA 2FSGA 4PPGA 4YC7A 3AKDA 4A6PA 3FKQA 5LD2C 3THYA 1N5JA 4M1YA 5L3SB 2QRZA 2ZJZA 2ZI9A 2G3YA 1XU4A 3HR7A 2KI5A 1X1RA 4DUGA 3B5JA 4GNKA 2GEVA 2XZPA 2P6RA 4RD4A 3PFIA 1JJ7A 2ZPTX 3WHKA 2ZJ5A 4Q7JB 1WP9A 2AR7A 1RVDA 3WRYC 4XD7D 4ACBA 3VR6A 4D0NA 4HB2A 2RGCA 1BMFD 2C8VA 4J0QA 3K70D 4OL0A 4MYUA 5B57C 2R2AA 2X8AA 3L43A 3R9WA 4JS0A 5EE9A 5AUQA 1HE1C 1G21E 1UBGA 1J7KA 1P9NA 2ORIA 1II8A 2EWVA 3E2IA 4EPRA 4UNQA 1KI6B 2ZS9A 1JAHA 3B7GA 2D7DA 3CF0A 4F7WA 3QF7A 5CJ2A 4O0MA 4MYCA 1MABA 3P26A 1KDTA 2NOAA 3C7KA 2JLVA 2DWOA 1TQ6A 4G3XA 2ATXA 4QBGB 3AQ4A 2RAPA 4JLBA 3ETLA 4NL4H 3AVUA 3TIFA 4JJZA 5J40A 4HSEA 3LO5A 3GJ7A 5J5CA 1M7GA 4OYHA 4GZLA 1D2MA 3SOPA 2ZUBA 2XZLA 5JRZA 1Z0AA 2CEAA 4URWR 2VPPA 2REBA 2QP3A 5JCZA 4NHOA 1N6RA 1Z0JA 4PC7A 4TLBA 2XTMA 4I4LA 1XD2A 3EWAA 3OESA 3TAUA 2OUKA 1VHTA 3VR5A 3UMSA 1AGRA 1PZNA 1YRAA 4NYIQ 3QY0A 4X8LA 1Z8FA 1WB9A 4MKGA 1AGPA 1GL9B 4NP6A 2PX0A 2WSSA 4Q4AA 3EZ2A 4JKYA 1P72A 2DWPA 3U3JA 4RZXA 3AP1A 3QE0A 3RS2A 2OSBA 2X19A 2CHQA 3P4YA 4RD2A 3QVVA 3VNUA 3AF0A 2AL7A 2XB4A 1RRPA 2IEYA 4MKIA 3M4YA 1JXMA 1NJFA 2A5YB 1Z22A 5FPYA 4FCTA 2EFCB 1VYUA 3K9LA 3MWYW 1M34E 2A3RA 1S1CA 3CW2A 5TV2A 3RSOA 4FMCB 2RMKA 4WZAE 2FGKA 2XGJA 5CB8A 2ZRCA 4P4TA 1Z07A 3QPVA 1P2UA 3I5XA 2UZ3A 3KJIA 4IFBA 4M4SA 1E94E 1XJ0A 2NO7A 2ZRFA 2IS2A 4S2EA 2GCPA 2J87A 4OHZA 1F3OA 2WWXA 3JZAA 4DEYA 1T3LA 4GP6A 4HDOB 2NO6A 3F0TA 5BXQC 1KKLA 3EARA 4TMXA 5JWOA 1KYIA 1IJEA 1NVXQ 1CS4C 2RB4A 3LY5A 4B3GA 2JJ2D 2NPIA 2JGNA 3C16C 2HT6A 2YVUA 2J5XA 4MGZR 3GFTA 4TLDA 5JCPA 3CRVA 3KTAA 3L0IB 1BYIA 1N5LA 1RRCA 3I5YA 1CULC 1T8UA 3RWMB 1FQKA 2ONJA 4BFWA 1XRJA 4DVGA 4CEJA 5KSZA 1Q21A 5F98A 3E5HA 2GVZC 1MOZA 5SZHB 4PSKA 1KSJA 4DBLC 3SQWA 5C1BA 2FFAA 3GJ3A 2CDNA 3TVDA 1OFHA 3AVQA 2ANBA 4C0QC 4C2UA 2IYVA 1X1SA 1ZINA 4LHWA 4RKFA 5KPJA 1UBEA 3AM1A 1T3SA 4EFNA 2B8TA 2R9VA 1C4OA 2JCSA 4XTRA 5FOSA 2CNWD 4EFLA 1WA5A 2YV5A 3PR1A 5IRCD 1IN4A 1UKEA 4Q9KA 2ZYTX 4FMDB 4UXIA 4LJ5A 4M1OA 4TWZA 3NG1A 4TYPA 1MT0A 1G4AE 3FB4A 4TL9A 1KNXA 1HEIA 1HH4A 2ZJBA 2ZR9A 3PV0A 2IF0A 3K0FB 4N0DA 5FOVA 1CJMA 4A2WA 2I4IA 1U0JA 3B1ZA 2ZIAA 4Q1EA 3FHTA 2YWEA 3BE4A 5CK4A 5EUQB 3RHFA 1P9RA 1G7CA 3TUJC 4B2IA 4KLNA 4M1KA 4C0AC 5FI1B 4PZLA 4FMCF 1XPOA 4BZQA 3QF4B 1D9XA 1HUQA 3DL0A 2ZRMA 2JJ8A 4DLXA 3KJEA 2QT1A 4A0GA 1PLJA 1RKBA 1S2MA 3L0PA 1D2EA 1TEVA 5KSOA 4CVNA 4CRWB 3TKLA 4TL8A 1OH7A 2FSIA 1E2FA 3BH7A 3LLUA 1HURA 1I4DD 1MO4A 2CMKA 4AK9A 2O8DA 4MA4A 2YKGA 2IWRA 1Y63A 4V0NA 3OIYA 2ZEJA 3ZVLA 2NQ2C 1M1YE 3EWSA 2G0NA 2OCPA 3A1UA 2BBSA 2CXXA 2GAAA 5DI9A 1XEXA 2GJ8A 3GJ8A 1IBRA 3TSZA 4M9SA 4LYJA 4BFVA 3R8FA 1R0YA 2VHTA 4IOMA 4Q4JA 3H4MA 3UG6A 1SVIA 1JXOA 4HLCA 4LHYA 3K0CA 1E0JA 2QMOA 2D2EA 2JLYA 4QG7A 4C0SA 3JVUA 4JBWA 1KI8A 5EE1A 4DT1B 5B2ZA 1CJVC 1E2DA 4PC2A 4TSFA 5L3RA 5FOUA 1KSHA 2O8CB 2J7KA 1HTWA 3CX6A 3RYTC 1KY2A 2NIPA 4RVCA 3BK7A 4TT3A 1KJZA 4UNSA 1G19A 4XVUA 4HUQA 2AXNA 2ZUDA 1NN5A 3GJ6A 3PUVA 4W5JA 5EE5B 2W2VA 3F8TA 2IXEA 2VHQA 2G88A 3IPXA 5E7IA 4Q00A 3VX3A 4AIIA 5H8WA 2D06A 4MRVA 3TH5A 2Q3HA 5JJKA 2Z83A 1C9KA 1T0JB 1UBFA 1Z6GA 1L7VC 1OE0A 4FMDF 2ZSAA 4AKGA 5ELXA 4IDPA 4JVSB 2IYUA 4QJ5A 2PT5A 3T35A 4FI3C 2O8BB 4PHTA 5HCNA 1DEKA 2EVWX 2QMUA 5FTLA 5EP1A 1COWA 2OFXA 3IIJA 4IDNA 2RGAA 2AKYA 4F92B 4HAXA 4EUNA 2D3WA 1GILA 3QBTA 1DELA 1Q22A 3LXXA 4BZXA 4FWIB 2DBYA 4TYNA 4BEBA 4DLZA 3UKDA 1CRPA 3TAHA 4AD8A 4ZCIA 1JPJA 3TQCA 3AVXA 2J0VA 1G18A 1C1YA 4MRSA 2ZXUA 5AR1A 2XX3A 1GRRA 3IHWA 4LJ8A 2G83A 4WOPA 1MO5A 4JLPA 1P5ZB 1W1WA 1MKYA 3PQCA 1KZGB 2HJGA 2V4ZA 3U3RA 2ZRGA 4C7OB 1TU3A 3QQ5A 5KDLA 3K0AB 3ZDQA 4YXWD 1SZPA 4CEHB 3K09A 2A7QA 1SXJA 3OZXA 4QM6A 2FZLA 4MUBA 3TW4A 1JALA 3MCAA 1KJYA 4EKDA 1OLOA 1PV4A 3KKNA 1Q3HA 2HJVA 2XJ9A 4IRUB 2XITA 5FR2A 4G5RA 4W9MC 3NBFA 3TGPA 2WKQA 2V8OA 1NBME 4RKEA 2XXAB 2ZRJA 4DSNA 1K8RA 3AP3A 3TJZA 2F43B 2ATVA 1W4AA 1X8KA 4NE2A 5BQ5A 3BB1A 4LJ6A 2QAGB 2ZE7A 1NMXA 2OCAA 5TXGA 1TPZA 4LBVA 4BLTA 1EFUA 1GITA 2WWHA 3MLEA 4PR0A 3ZIAD 1KK3A 2XOKD 2IXGA 2ZRIA 2B21A 3ECCA 4Y0VA 4ESHA 1JI0A 3BXZA 3BAFA 4MGYR 1EG7A 2J7PA 5AJWA 4CEIA 5B64A 1ZUIA 4Q5IA 5DN6D 2A30A 4JLNA 3ZJYA 1XTRA 1OHHD 1ZUHA 3ONWA 1CRQA 1XB2A 3KZ1E 3RRYA 3U6KA 3EPLA 1OV4A 2FU5C 5FUXA 2OXCA 3IPYA 1JR3A 5KNDA 1LV7A 4WW0A 2KBFA 4JIMA 3SJCA 1U90A 4A0FA 3CZPA 2IYYA 5TDHA 3I1FA 3AF4A 4EPYA 2P5TB 5E7MA 3B78A 3A4LA 5DLQC 3KQHA 3BRWD 3VHXA 4EPVA 2G1KA 1E79D 1LNZA 1CEEA 4G5SA 4KFUA 3FMIA 1QHNA 4UKDA 4GT1A 4E03A 1H8HD 3DOEA 1NJGA 4ZIRA 1ZC4A 2JJ1D 2P5SA 1W4RA 2WAXA 3G82C 4XJXA 4B33A 1XEWX 3RANA 2ZITA 3BIFA 5DHFA 3QXSA 3KUCA 3BFKA 5C4MA 4M0LA 2LCFA 3RABA 1UKVY 3PUYA 3WYFA 1XBTA 3EA5A 1U9IA 2N42A 1OKKD 1XTJA 2R44A 1G16A 4DCTA 2OO7A 2H18A 3KB2A 1W2HA 5EZ6B 3THXA 4LJ9A 3O8CA 4JT4A 3Q9LA 2NG1A 3NC0C 1IM2A 1W4BA 4C30A 4ZI2A 4CYMA 2G0TA 2GCOB 3CR7A 1Z63A 4PAQA 3GLFA 3OF5A 2GZHA 5DI3A 5FUVA 1R8QA 4Z8XA 1F60A 4FW9A 4GOXA 2C78A 4NYIR 1EFRD 3PVSA 3U3KA 2DYKA 3BD9A 4BASA 5KYKA 4FCWA 2YWGA 2C96A 2OBNA 5J4LA 2GZAA 1JECA 5JJIA 1FNNA 4DDUA 4WIAA 4IKEA 2QAGC 4MGKR 3I92A 2WWWA 4Z8YA 4QL3A 5FUYA 1N6PA 4QKQA 1Q1BA 3TRFA 1I2DA 1U0HC 5L3VA 4ILEA 1M7BA 4C2TA 2WHXA 4HAVA 3B9QA 4JBXA 3HP1A 1Z5ZA 1V5WA 4PHGA 2CK3A 4ZO4A 3LDAA 2P65A 3O8DA 3SN6A 3AKEA 4Z54A 1RYFA 2BC9A 1VCIA 3EASA 1QHHA 1GWNA 2DHRA 3ZZ0A 1T5IA 3LA6A 1QZXA 4E09A 4PPNA 1BYUA 3R20A 4OHWA 3CRW1 1FNMA 4HB3A 4HAWA 1BS1A 3P27A 1JBKA 1I4TD 2NO9A 2QM8A 2FG5A 3LNCA 1F2TA 3CBQA 3QEJA 3SDZA 2ZJ8A 3I8SA 3IBGA 1R5BA 3VFDA 3HYTA 1JJVA 2G77B 2OCYC 1G4UR 2ERXA 4HYYA 1IY1A 2KSQA 2ZUCA 2CVHA 2PCJA 4LSGA 4DCSA 1TF5A 3TR0A 3H86A 1FX0A 2QMHA 2REXB 4HLDA 1GNRA 4ESVA 1GKIA 1RJ9A 3DMDA 1KKMA 3N5CA 5A4JA 3ZYCA 3NKVA 2VP0A 4Q19A 2VYFA 2WJIA 4KVGA 5TARA 1G1MA 4U5XA 1DO2A 3UPUA 1Z08A 2GJAA 4W5HA 1Q57A 5J4HA 4D2IA 2V6IA 3WBJA 1Z0FA 2BOVA 3MG9A 2X1VA 2XOKA 3BORA 1M74A 2JIZA 5AJXA 4YMTA 2Z5FA 2J3EA 1MRNA 3CF2A 2OLKA 2VHJA 4BEJA 1DAMA 1L8QA 4US0R 4AYXA 2DCUA 5LD2B 2PMDA 3K8YA 1U94A 1XWIA 4XSGA 4TMVA 1HV8A 3KX2A 4M1MA 3W6PA 4M9ZA 1E1RD 4M22A 4B74A 1GKUB 3QKRB 2HDNB 1GRQA 2OV2A 4DSTA 2LKCA 3QUSA 2O0HA 2ZR7A 3OE7D 3U60B 2GDJA 2ZAOA 1AM4D 3VNVA 4XVQA 1WCV1 4PO8A 4O2LA 1E2EA 2ZJYA 3GEEA 3RVBA 4LX0A 4RFSB 4EPTA 3KL4A 2QEQA 3U4QB 2LWIA 2OLJA 3SQXA 3P4XA 2ZSDA 1Z0IA 3O8RA 1AKEA 2WSMA 1PLLA 2IS1A 4M2LA 3I73A 3I32A 5KHOC 5L3SA 1RRGA 1F2UB 5UKDA 4V02A 5FH9A 5JSZB 3OEED 3ZZUA 1P7CA 1WE2A 4JL5A 4WXPA 1SQ5A 3W5IA 4OK3A 3C4JA 1Z29A 3SS8A 2OAP1 3ZVRA 3K9HA 4URUR 4Q4HA 1CR1A 2HXYA 1XMIA 1W0JD 3IILA 1ZIOA 2HT1A 1KI3A 2W0MA 4DDTA 3LAWA 1E2NA 1AQUA 3K0SA 4B35A 3EXAA 2OBLA 2CJWB 5BN3A 1N5IA 1ZJ6A 1VCOA 3RS3A 1M6NA 3GFOA 1ZCBA 5DISB 3CPHA 5GJWC 3ADDA 4TQ9A 2LKDA 1E1QD 3VHLB 4IEEA 2FSHA 2ZYVX 2XB2A 1P2SA 1E9FA 1T3HA 3KJHA 4OQFA 4QM7A 1IOZA 3AP2A 5TMPA 4AURA 4N0EA 2HF8A 5JEDA 1N6KA 2RGEA 5BYJA 4B73A 3UANA 3U6BA 5H70A 1P6XA 2H92A 4TL7A 1HY3A 1K6MA 2WKPA 1NVUQ 5FPSA 1CJUC 5EP4A 3SJZA 3KKMA 2MSEB 1KK0A 4DCUA 1W47A 1Q12A 4KYIB 3SU8A 2QN6A 1D9ZA 2P3SA 3NDPA 3L82B 4V0OA 1SKQA 3U2QA 1ZRHA 4TTQA 4V0ME 3B9PA 2BWJA 4Q01A 1PLKA 3REGA 4JL6A 4OK5A 1Q44A 1IN8A 1NIJA 5F9HA 4D4MA 1DAGA 5C18A 2XNDA 2R62A 1YZNA 5DHAA 2AK3A 2CLDX 2P0EA 3DEFA 1E3MA 2QI9C 3CONA 1YZTA 4M8NE 1N0WA 4YDHB 1OFIA 4BLPA 2DR3A 3VR2A 1ZUNB 4O25A 2VEDA 3U7FB 1OH5A 2IW3A 4B75A 3CRMA 3B1WA 1XJQA 1G8GA 4MUAA 4L16A 4AYTA 2YYZA 5SZJA 5DYIA 4LC1A 2NGRA 1ODFA 4GFDA 1TMKA 2F3RA 3AGPA 4L15A 4PQRA 1IXRC 2KWIA 1AA9A 3FDIA 4MQBA 2J0QA 1N6LA 3AB3A 3Q5EA 3SHWA 1OFUX 1ZU4A 3I62A 4Q03A 2BM0A 1ZNWA 1OT3A 4W5WA 2ZJOA 2F9LA 5CJPA 2DFNA 5G41A 2UZIR 4EFMA 4NCIA 3WNBA 2NO0A 3LD9A 4IFEA 1V43A 1YR7A 3B1XA 5G3ZA 2F1HA 5CB6A 1M7HA 2QE7D 1KY3A 3CKLA 4R2HA 5FOWA 4NONA 2GTPA 3BS4A 1EK0A 4JLDA 2O8FB 4XH9B 4BRWA 1G5RA 4WBSA 3KJGA 3VX4A 2VSXA 4LC0A 5JZVA 5E4FA 3HJNA 5FI0B 3I72A 2C04A 2OESA 1LFDB 2A5GA 4PTLA 4HLUC 4BQSA 4KXFB 2G9NA 2KJQA 2GBLC 3NHAA 3OEHA 3LV8A 4GOJA 2QP4A 1NLYA 4D0LB 4NYMQ 1DADA 5BN4A 1G7RA 3D31A 2ORVA 2WMNB 4AG6A 3THYB 1Q0UA 1W5TA 3GEIA 4YDSA 3TSWA 3NHBA 2XSZA 2GXAA 2X2FA 2IF2A 1JPNA 4NU0A 1YQTA 1ZP6A 4JLOA 2JDID 4OI4A 4HDQB 3R7WB 2HYDA 4C0BA 3TNFA 1KI1A 2QAJA 3SNHA 1KDRA 1FUKA 1Z3IX 4P31A 3S1AA 1W36B 4ASUA 1S4QA 1QG4A 2IK8A 4CIDA 4B2LA 1OXXK 4G5QA 1SVMA 1VMAA 4JSTA 1E9DA 3X1ZA 3QVUA 4WZ6A 4DDVA 4U7DA 4KFTA 4WA7A 1W0JA 5FTMA 1II8B 4A8JA 4D6PA 2ZRDA 2C5LA 2WIAA 3VU9A 1XP8A 2G1JA 2BMFA 5CIWA 1GSIA 2V54A 3IO3A 3F5FA 2ZREA 2V1UA 2VP6A 1W44A 3FMFA 5CYOA 4Q1DA 2V9PA 1Q20A 5JEEA 3AUYA 1YU9A 5G40A 1DPFA 4MRNA 4A6XA 1YR8A 2Z6VA 4QHTA 4LBWA 2RGNC 4M21A 3T06B 1SVKA 5FL3A 3X1WA 1HT1E 1KK2A 4UNNA 3VR4A 4A1FA 3P1JA 3UMRA 3GEHA 2A5FA 3MMPA 1E9BA 1X3SA 1XD2B 3FPAA 1TTTA 2QBYA 4FD2A 4ARZA 3X1DA 5EZ5A 4B3BA 3LLMA 4QGGA 2BDTA 3DMNA 4QBFA 4DLVA 4EQ6A 4B3DA 2BBTA 2F1JA 4M53A 5FFMA 2F6RA 1OYWA 2J45A 5EP2A 3NEYA 1YR9A 3N2IA 4KV9A 5K8LA 4B32A 1NKSA 1E9RA 3B13B 3SR0A 4D4LA 2Q9CA 4DB4A 3OIUA 1AS0A 1UEJA 4LJAA 4XD7A 2D74A 2QU8A 3RRMA 1US8A 3ZS9A 1BMFA 1HT2E 4HAUA 4L5BA 5BW8A 1TQ2A 4M1WA 2X2EA 2WWYA 4PZZA 1NBMD 2NMVA 1NNEA 1YE8A 1FUUA 1RYHA 3ZVMA 4NYJR 3RRZA 4DT1A 2HF9A 4Q1FA 2O8EA 4LGMA 4TMWA 2D7CA 1L2TA 2O8CA 1GTVA 2YZ2A 3HPQA 1U8AA 4M9QA 1YR6A 2CL7X 4OJQA 1M2OB 3F3YA 1N3BA 1Z0DA 3P20A 2YINC 4CF7A 4HI0E 3U7GA 4DXAA 2IT1A 2QM7A 3AF2A 2PZFA 1PJRA 1OPXA 121PA 1MV5A 1Q1QA 2C9CA 1MO3A 1CIPA 1RRFA 2GAOA 5IK2D 5D3MA 3C5HA 3CO5A 1W36C 3QEOA 2QTFA 2XTNA 3M1IA 3EIHA 1IN7A 2N1BA 1W46A 5FPKA 1OH8A 1B23P 3T61A 1VPLA 3AUXA 4MH0R 3CIOA 1LVGA 4JVLA 3MAAC 4R98A 2E9SA 2GJ9A 3L0SA 1S0UA 1KMHB 5P21A 1DOAA 2H16A 1SVLA 2XEXA 4D26A 3TUZC 1G6HA 2WJHA 1A4RA 3GLHE 4DIEA 2J0SA 2O8BA 2ZRBA 1VYTA 5DO9A 3CNLA 4BLSA 2RKOA 2FWRA 3IUYA 2DFKB 5DYGA 3N2EA 1SVSA 1ZM3A 3NIBA 3REFA 2GKSA 2QG6A 2W6JD 1CF4A 4HB4A 2OZEA 1JAIA 1O87A 2WAYA 4CEJB 1XX6A 5FOTA 1N6HA 1U2RA 4QBIA 2GZDA 3D7MA 3EA0A 1TF7A 4JVMA 4X8MA 4IXMA 3HU3A 3A58B 2ZI4A 1E2MA 4V0KA 2V6JA 1FP6A 3IQXA 1ZYUA 1IY0A 2RGDA 3IEUA 2DPXA 4I1UA 1E9CA 4BGDA 1NSFA 5B30A 3PEUA 1WXQA 5EJEA 3CWZA 3K0AA 2FFHA 2EFEB 3MWLA 4D82A 4JJKA 4CEHA 1F6BA 3KUDA 2OE2A 2FV8A 3MJRA 4HATA 1S9HA 2FSFA 4EAQA 4EDHA 421PA 5EXXA 3UATA 3PEVA 4Z1MD 2DB3A 4ZPXA 3MGCA 2XXAA 4DLSA 1XPUA 2Q0HA 2F43A 4UXJA 1SGWA 4X8HA 3U44B 5EE0A 3A6PC 3FKSD 1GRNA 1PVOA 4TQAA 1XPRA 1R4AA 3GLHB 2JAQA 2VF7A 1VHLA 2QRNA 4LYFA 2IBMA 2ZI6A 4LV6A 2JJ2A 2WVJA 5E95A 3QKSA 4Q47A 5F2EA 1FW6A 2QL6A 3OAAD 4QJ4A 3KQNA 1XTSA 1G6OA 1SVWA 1TUIA 3GPLA 4LJYA 4TMKA 2O0KA 2XTZA 3A4NA 3FHCB 2O8DB 2J0UA 4IVPA 1Z6TA 2JLZA 4GMXA 3FVQA 4BLOA 1WF3A 1XTQA 1QVAA 1AS3A 3SBDA 2VA8A 5CK5A 1W48A 1VKJA 3QPWA 3WMGA 5LPNA 1T5LA 1XEXB 2BVNA 4JYCA 4DLTA 2JA1A 4S35A 1E2JA 1KO4A 5SZKB 1N2CE 1NKTA 3BJIC 4D81A 2QMEA 1FMLA 2ODWA 2Z4RA 2ZRPA 3TVTA 3ZLJA 4G0NA 4DSOA 4EJSA 3AV0B 1J70A 2Q9BA 4DLYA 4PAOA 3LW7A 2CLSA 3GFPA 2AHOA 4HZIA 1IXZA 4RD0A 3LH5A 4AKIA 4MDEA 2FX3A 3CB4A 3QKTA 3RSLA 1E0KA 4RY2A 4KHZA 2VL7A 3SC3A 1UM8A 2CNWA 1AN0A 1E32A 2P6NA 2QORA 4ZCMA 1UBCA 3VAAA 3AVTA 1AKYA 3QXJA 4B43A 3AVPA 1E2PA 2XAUA 3PEYA 1AIPA 1J2JA 2BCJQ 1RW4A 2BMEA 3WXMA 4D25A 1P62B 2J41A 3ASZA 3I8XA 2I3BA 2W6ID 2QPAA 4HUQB 4JSYA 4OQNA 1OXTA 2VP2A 221PA 1SXJE 1MRSA 4RZUA 4KYUA 4IDHA 5CYPA 5AWFC 3ZH9B 4GOKA 3UIEA 1JB1A 1YHNA 5LBIA 2C99A 2FPMA 2WJYA 1H65A 4CDGA 4BFSA 4KSCA 3CUEF 3Q5DA 1QDEA 1IN5A 1R0ZA 2O0JA 3FMOB 2EU8A 3X2SA 1FMJA 1ZNXA 2ZRLA 2AD5A 1XD9A 3ND8A 2WOJA 4BUJA 3QIAA 4F91B 1XDBA 5HE8A 4Q7LA 4LV5B 5G3YA 2GCOA 3GJ0A 3PUZA 1XCGB 3LRPA 3H84A 4JL8A 2AKAB 4B47A 4OJKA 1GIAA 1T4GA 3CWQA 4H1UA 2ZSEA 1TF2A 4HB0A 5JI2E 3T1VA 2ZROA 1J99A 4FCVA 4G1UC 1CKEA 3A1VA 2A9KA 4Q7MB 4URXR 1KTVA 2GVDC 1P75A 3QXHA 1XEFA 4DLWA 3AGQA 3AH8A 4XWKA 4PANA 2ZR0A 4GSYA 1EGAA 5HKKD 2P67A 5EQTA 5JWRA 1XCMA 3MWJA 1SHZA 2MMGA 1P73A 2V7QD 3IGFA 2FDCA 5M04A 4QGAA 3X1YA 1NG9A 1JR3E 5A0FA 5TVKA 5D3QA 1QHSA 4RZ3A 2GESA 3B2EA 4HZUB 4DCVA 1QF9A 2DFTA 3NDBB 1SXJB 3NXSA 1F5NA 2ZU0C 4PPFA 5JLJA 1SVOA 2A78A 4NZYA 3PEWA 1P61B 3FYHA 4P0TA 1S96A 3MWKA 4WZBE 3MFYA 3RS0A 2I1QA 3UWOA 2D2FA 3T12A 2IHBA 4ERNA 5AJYA 4PO9A 3THWB 3EC2A 3RS4A 4BZPA 3FOZA 2JASA 2QNRA 4TTRA 2WKRA 1FFHA 1KAOA 1NIPA 3K0CC 5EUMA 3NH6A 3WP0A 1Z2AA 2PLRA 2F55A 3W90A 1XZQA 2H17A 1DARA 1Z6YA 3HYRA 5LB4A 3ZGXA 1TEXA 2JLUA 4FMBB 2P6UA 1SULA 2REOA 4OI2A 3FGNA 5FBRB 4MYHA 3FMPB 1W2GA 1ZBDA 4DJTA 3Q72A 1LY1A 3EAQA 1N6NA 4LHZA 4US1R 1LTQA 4GZMA 4ITRC 1UKZA 4CEIB 4RD1A 2WPDD 2N46A 4YMSA 2QROA 2BIFA 2JLSA 3GLFE 2YC4C 4GMDA 5FUWA 1YZLA 3OFND 4L8GA 3WNDA 1W0KD 2IA5A 4KBGA 1AK2A 2HV8A 1KO5A 2B7CA 4GPTA 2EYUA 4PC3A 4JLVA 3AVVA 4YONB 3BC1A 1DS6A 4LK2A 3SFZA 2WJVA 2A5JA 1CP2A 4NKRA 4PX9A 2QTHA 1XXHA 3QKRA 1S9DA 4JMPA 5FL7D 4Q02A 4YXWA 3DHWC 4Q1AA 2PX3A 4ACAA 4NCKA 4ZDWA 5IT5A 3WMFA 5CM8B 4LJ4A 4QXAA 1JR6A 2WZQA 4KCGA 4AWXA 4L4UA 3CRQA 4Q4LA 5FTKA 4QGHA 2QGNA 5DNYB 4C9BA 2AK2A 3GP8A 3U4QA 2PMKA 1A1VA 4BECA 4DUGD 3B8HA 1IN6A 5JBQA 3AEZA 4UNPA 2H7VA 5FPHA 4XVRA 1LS6A 3DDCA 4HEJA 3DZDA 1EWRA 1F2UA 1FL9A 4LHVA 3NC1C 3GLGA 2ZAMA 3SEAA 1SHKA 1KMQA 5JHGB 1OYYA 3DOFA 4QNRA 5JSZA 1W36D 4O3MA 1FOEB 2BEJA 1DVRA 3HR8A 1SXJC 3BGWA 2IUSA 2JLRA 1OSNA 1L4YA 2ZVQX 3K09C 4Q9IA 4XWAA 4W7SA 3ZIAA 4A0RA 1Q1ZA 3GLIA 3W9YA 2H8KA 5FBQB 4UQOA 2R6CA 3WRXC 3GLFB 5FBVB 2OCBA 1N25A 5DI3B 1Z28A 3FTQA 2UVQA 1G3RA 3B82A 5DN6A 5EE3A 5HE9A 5L3QB 4K8OA 1OHHA 4ABYA 4CGZA 1GP2A 3VTKA 2DFLA 1PUJA 1UKYA 4IOKA 3B60A 2FEOA 2R65A 4US2R 3SI7A 2WICA 1GVNB 3D3QA 4HLUA 5KO2A 2VF8A 2BHRA 3EZ6A 1YZQA 3IKJA 2SHKA 1LW7A 3BWDD 4JZKA 4IDQA 2VSOA 1IAQA 3QSYA 3OIWA 4LV8B 4IVRA 2IUUA 2JATA 1E79A 5EXPA 4Z51A 1OF1A 1CR0A 1KK1A 2FZ4A 3RC3A 3C15C 3TK1A 5J4VA 5JJLA 1H8HA 1CLUA 2JJ1A 4B3FX 3SE0A 2CLCX 2BKEA 2J46A 2FPLA 1KAGA 4GRAA 1EWQA 1NVVQ 1G8PA 2FN4A 2IYSA 1LF0A 3A4MA 4A82A 2PZGA 4KBFA 1K5GA 4RFVA 5F9FA 1O3YA 2YOFA 1E9EA 4FWTA 2IYWA 4TLCA 1ETUA 2J9RA 1FP7A 1YZGA 4YLGA 1E0AA 1NLFA 2JLQA 1J8MF 1OKKA 2WSSD 5CM9C 2JEOA 1XZPA 4CT4B 1U81A 2AWOA 4MRPA 1FX0B 4DB2A 3IO5A 1JNYA 3G5UA 2QENA 4N3NA 3RC8A 1G3MA 4ZV4A 1NF3A 2BEKA 4NCNA 3ADCA 3ZQJA 5E3HA 2RGGA 4TZ0A 5IDVA 1ZM7A 1KJWA 2GRJA 3KKQA 2Q21A 2L0XA 1KI6A 1EFRA 3KKPA 2OBMA 1D2NA 2GK7A 3EW9A 1G9XA 1GL7A 2C9OA 4HLQB 3CX8A 3RNLA 1X8JA 2PBRA 3CH5A 4TYQA 1U9IC 3JZMA 4IEIA 4IXNA 4K46A 4PSVA 4Q9LA 2ZM5A 3IEVA 3PENA 4FINA 3LVRE 1TAGA 4PC6A 3B1VA 1EFHA 1P3JA 3KDSE 1QHIA 4HAZA 1PUIA 3UG7A 5HR5A 2GEUA 1OJLA 3LBNA 4IHQA 3X1XA 2GXQA 4AY2A 2ASEA 2CVFA 4P4SB 5HCIA 4LDJA 4U02A 1BKDR 1R0WA 1RIFA 3NVAA 3GQBA 2O8FA 1ESNA 2HYIC 4MYTA 1ZM4A 2Q3FA 2BMDA 3H0KA 1R8SA 5CITA 5CDFE 1ZD9A 4RD3A 3AVWA 1XJCA 3HU2A 3CLVA 1HQYE 1E2IA 1VG0B 2E87A 2QTVB 2ZE6A 3QPUA 4DLUA 4A0HA 3CR8A 1TQ4A 2FH5B 2BJWA 2E1RA 3CNNA 3LFUA 3LX8A 4JVNA 4QFMA 5H1YA 4DWJA 4B48A 1WBDA 1ZIPA 1HYQA 1G5TA 4A15A 4FN5A 4IOJA 1HQCA 1U8YA 5DGXA 2YNMA 3R9XA 4ZKEA 2OM2A 3FHOA 1M8PA 1P60A 2C03A 5HZKA 1Z0KA 1R5OA 2ZJ2A 2W2XA 3CPJB 2F7SA 2CE2X 2VH5R 3K9NA 3P32A 3C5CA 1E0SA 5KSPA 4B6FA 2ZRHA 3R7WA 4BFUA 4YMVA 3QXCA 3AKYA 4K81B 4PAMA 1Y3AA 5IHPA 4EPXA 1IQPA 1OIXA 2CBZA 2WWIA 1ZD1A 4Q4HB 4C4PA 3ZVNA 4C0LA 2ECKA 2EQBA 4C0JA 1OIWA 2ODBA 1T8TA 5KDDA 5L8VA 3BB3A 4P3YA 4PZYA 2CCKA 2I1VB 2WJJA 4KAXA 1NVWQ 4HUTA 3Q8XB 3WYAA 1BO6A 4LPSA 3G0HA 5JECA 4WXRA 5J4KA 2Z0MA 2ZS8A 4AKHA 3W3ZB 1KO1A 2QP9X 5A5GA 3T34A 1JQLB 4ON9A 1KDOA 2QZ4A 1ZC3A 2Y8EA 3MD0A 2IWHA 2CHGA 2PCLA 3DPUA 1E1RA 1G291 3QG1A 2B8WA 5C46F 4P4UA 4LPKA 3A36A 4URZR 4F4IA 1MH1A 2C95A 5GJCA 1XTIA 2ZANA 2IC5A 2CCGA 4GDFA 3KQKA 2VQSA 2WJGA 2ZQ5A 4LJ7A 4OK6A 1AQYA 4EPWA 1NRJB 3OE7A 4DKXA 1D8TA 2HCBA 3RDPA 3PUXA 1UEIA 4HDCA 2ONKA 4V0LA 3LX5A 5TY0A 1E96A 3SJBA 4E5UA 1UDWA 4H9GA 1Z2CA 1IONA 4XIGS 4B34A 1YZKA 2PL3A 4ZDIA 1XMVA 4N1AA 2Z4SA 3GD7A 5G53C 4AC9A 5GVRA 4M9XA 1ANKA 4ZCLA 3VQTA 3TLXA 3EPKA 2FF7A 3N70A 5JI3E 3B1YA 3TE6A 3V4FA 5FPTA 3V9PA 1X8LA 1DAEA 1XEWY 1A2BA 1EFCA 2AWNA 2OFOA 2C2HA 3WBKA 2EFHB 3WP1B 2GK6A 3ADKA 3OEEA 4BPBA 2ZRKA 4WVFA 3SZRA 4A4DA 4CZ2A 1VDZA 3VKHA 1U0LA 4GI7A 2F1RA 1E4VA 2QY9A 3TUIC 3NEJA 2QPTA 4F4JA 1N5KA 2QQEA 2GF0A 5C4GB 4AG5A 3KQLA 3JVVA 4TSFD 4C0HA 3HU1A 2ORWA 4C0KA 4ZDJA 3ICQB 1QRAA 1GNPA 3DM5A 3IHLA 1E99A 3MJHA 3U5ZB 2ANCA 2ZE5A 4KJZA 5K8UA 5BWMA 4CT5A 2G6BA 2ZETA 4TT3D 3LW8A 1UADA 3KB1A 5DE3A 3K0FA 1MABB 1E1QA 2HXSA 3SYLA 4B44A 5GJBA 3CM0A 1TQDA 6Q21A 1TNDA 2FNAA 3ZZTA 1IXSB 2AXPA 1G3IA 2GILA 3CPEA 3QF4A 2BKUA 1G17A 4E07A 4JBYA 2F1IA 3PITA 3NTUA 5LDDC 2WV9A 3A8TA 4Q9JA 4PFSA 2HCJB 1XMSA 3GJXC 4LBYA 2UKDA 4JLMA 1AZTA 2WTUA 4IVQA 3PUWA 2AFIE 1G64A 3ICEA 1KMHA
chains in the Genus database with same CATH superfamily
1COWD 4HRYA 3KBOA 1KGDA 2HMTA 1LWOA 5CTJA 3ZXIA 5U4XA 1NMQA 1G41A 4REOA 1AF4A 3KQMA 2G4LA 3GQVA 3TIVA 1M5UA 3G79A 4JYZA 4WINA 3SC4A 2FQWA 2C7VA 2Z3VA 3A1WA 3OZEA 3D8UA 3UN1A 4D42A 1VG1A 1NMEA 1QBKC 2AS0A 1HLDA 3DDUA 4K9RA 4Q4AB 1YCHA 4KPFC 1D2HA 1UKAA 1V16A 3AHHA 4PLTA 4BTVA 1TUEA 1QP4A 3I01A 1E1CB 3A2NA 1N2EA 2PZEA 3BL6A 4UBLA 3VPGA 1E62A 1QTNA 1B74A 2ZI7A 4CKCA 1GG2A 2IYTA 3E5MA 1DX6A 3IULA 3EDRA 3NWPA 5LP6F 5HIAA 5TLSA 3AY3A 4LE2A 4Q66C 2B4TO 4WAUA 5FI3A 2JAXA 5CB4F 1KI9A 4HDSA 3RRXA 4RD6A 4JVOA 1WM1A 1KC1A 2I6QA 1GTMA 3S1AB 3NHYA 1M0WA 3IP8A 2ZWVA 5GIPE 4JA2A 5EP3A 3TD6A 2WP8J 4LOKA 1A76A 2HO5A 1F9EA 2ICAA 4C21A 3B85A 2YVQA 4H7DA 1R9JA 3S8YA 4Q24A 4A92A 3T0GA 4ZOLF 3T7IA 2X2PA 2R8XA 2VHCA 1UM9A 1KO7A 1Q15A 2PZKA 2ZJ1A 3JYLA 3N8DA 4RYLA 3FF1A 4O08A 3R8CA 3ZJ5A 4UNRA 3GLFB 4LYGA 2WJAA 4EA7A 1XMJA 3GT0A 5G0VA 4AYWA 4MAAA 1LPBB 1OVMA 4NATA 3K9CA 2ZLBA 1YDGA 4MI1A 3TSOA 3QW4B 3U61B 1XJWA 4QUBA 4KOEC 1P4RA 3HKBB 3OKCA 4QHSA 3V7FA 2OHFA 1BXZA 3GO4A 4ZMRA 2QRKA 3IAUA 5SYMA 3I52A 4XW2A 1JHOA 1R2QA 1ZN7A 2NZWA 3GXBA 4E5YA 3U44A 2PX6A 4A5OA 1NMZA 4GI5A 4H17A 4PIVA 4WI1A 2A5DA 5T4EA 1K6IA 5B3JA 2BFNA 3C6QA 1THZA 1F0KA 5EMHA 2RGBA 3KTAB 4HN9A 2A2ZA 4MW4A 1G8YA 3JQRA 4KB5A 3GFQA 2VPIA 2EF0A 1QX3A 2NO1A 5DBOA 1DO0A 1W59A 2QPOA 5BR1A 3D4NA 2ETXA 3DZ8A 3B6EA 4Y2YA 1R50A 3TG8A 2A9QA 2FOXA 3NT5A 4LKRA 5TPWA 1EFDN 4ESOA 1L5WA 1G5IA 1GN8A 3NM6B 1UPXA 4RVGA 2XUDA 2FSVA 4FDLA 3SC2A 2CNLA 3WYGA 3BMNA 1Z68A 1NVTA 3BXPA 1F51E 2AMYA 2B1QA 2VJLA 5HJ7A 4OI0A 1HRKA 2OXRA 3M0EA 3QP9A 2X22A 1Q2XA 2GZ2A 2X9QA 2VPYA 3UH0A 3K2BA 4BN0A 4CM9A 1ZJWA 2P9CA 5BQXA 2V3VA 4R2IA 5TS2A 3TL6A 1U5CA 5TGDA 2PJZA 3CX3A 1NF9A 3TBKA 2W6NA 3DD5A 4DA4A 1XMOB 4MJXA 1JDSA 1X1BA 1U2PA 1WUJS 1UAAA 3FGPA 5EJFA 2HLDD 5I9BA 1IMOA 3ZWXA 5LP6A 2FZCA 3N6XA 1U28A 3I5UA 2NVWA 2RAFA 2C9YA 4X20A 3A3KA 4ZXFA 1US8B 4F71A 3AG5A 5BNTA 4U00A 3F5QA 3WDMA 1VJGA 2P4QA 4IXWA 1DRJA 1IUNA 3HQ4O 3JALB 1QFJA 3PIIA 2IU6A 4KWTA 5FEMA 3KALA 3LKZA 3R3JA 1WBJB 1UQTA 4OIFA 4R7GA 4FN4A 2DUUA 2WYUA 3T5TA 1JIIA 4ZK2A 5ELLA 4YYZA 1U0GA 3DQQA 4ZEXA 5C1PA 3WBFA 9LDBA 1QV6A 5EZYF 2CFSA 3KYCB 1SBCA 1W7AA 1E1YA 1G8HA 1XK7A 3GUUA 5IVKA 3C4VA 3NOOA 1ZVVA 2EJCA 2QAGA 1ONNA 4JKOA 3CZQA 5HS6A 1NQWA 4C7VA 5GTDA 4M0DA 5JD5A 3EPHA 3HWWA 1R7RA 2IYRA 2Q4BA 3R3SA 3E8SA 1GAEO 4MEAA 4R8MA 4CTNA 3KCNA 1OB2A 4LY6A 1MEOA 1VGRA 4L9SA 4WUTA 1EQAA 1ORIA 3L8CA 5CRIA 3O3MB 2C88A 4XASA 5D3MB 1N6IA 3ZDXB 3RSGA 3PXBA 4NEQA 4F6RB 1HNXB 3K6KA 4C3ZA 1VKHA 3C1OA 3AIMA 3QHPA 5KYXB 2QQ0A 2GJKA 5HF6A 2C58A 5IW8A 4R2LA 4IJVA 1M3SA 5BVHB 3PFGA 3WNVA 1EXMA 2H7XA 1SIOA 2ID4A 2VXBA 5CMLA 2B3DA 4RTOA 2J31A 4A8JC 5EQFA 3G17A 1GLVA 4MP8A 3VR6H 4BBZA 3A37A 2BLLA 2NAFA 4RU1A 4EYGA 1RKUA 1IOLA 5BUZA 2XKBA 2YMPA 3ZHXA 5HQJA 1GUFA 2AFHB 2WEKA 3CZCA 3CVXA 1CEQA 5ADUS 4KPYA 4YAKA 4QOJA 4MRRA 5DGTA 5DIFA 2CCJA 3FFAA 1NN0A 4EK9A 4LQDA 4DC9A 4WTOA 4IS3A 2H0QA 1NXTA 4QYIB 4DEXA 1GQSA 4COKA 2NT4A 3EZ7A 1E9SA 5CD9A 2HAEA 2WDZA 4JC8A 4J1QA 1C9YA 1RKVA 3FDXA 5KTMA 3BCUA 1NYRA 3K1AB 4F0JA 5KS2A 4Y0AA 2CZQA 4GU5A 1ICEA 1UPBA 1NOKA 3TLMA 4DDWA 1B0ZA 1Y8CA 2R48A 2GYUA 1XF9A 4PQEA 3KQUA 4BO4A 4OXNA 1O4WA 1S8NA 1MPXA 2H57A 4UC0A 4MXDA 4X54A 4MITA 1UPCA 5EJAA 2X6RA 1R8XA 3HBAA 2V03A 3KZKA 4HZUA 5DBEX 1ULSA 2BZ1A 1DLJA 4PGAA 1R18A 3AR7A 4YP0A 1L8LA 1JEQB 3HKDA 4WKBA 4GWLA 4B6EA 1MZPA 1ZZGA 3Q11A 4HH3C 3T15A 1Q11A 1V39A 3S2IA 4DA7A 5KDOA 1N7GA 2EZ8A 1IHUA 4PQGA 5EWMB 1FQJA 2IL1A 3QHAA 2WMYA 3OZFA 4J49A 2Q0SA 1E60A 4N4AA 3T1NA 1E1DA 3C8UA 5DT9A 4KQWA 5AUNB 1GZSA 1MDFA 1WHTA 4U3JB 2VP4A 1SQ0A 2ZYUX 3GRFA 3R6GA 4BE7B 3CNEA 1HE8B 4PHFA 3IQZA 4NMMA 1OYVA 2RJNA 3A6HA 1MJFA 3LCCA 2ZBEA 5A6SA 1W4CA 1Z8DA 3QXXA 4JB3A 4B5KA 5FLEX 1NN1A 1N0UA 1JS1X 3FRHA 4AJ1A 3ROEA 1P7WA 5PNTA 1KI4A 1A8QA 4CTJA 1MH9A 1X7WB 5KTOA 1E3SA 4NEGA 2G1UA 2QA5A 1OXVA 3UXMA 5A4FS 1RM4A 3ESZA 2H2GA 2H5EA 4DCPA 4LJLA 2AN3A 3JXEA 4MDYA 4POAA 3CEMA 3UFBA 4IDOA 4EEKA 1U2DA 1NHWA 1E98A 1E6KA 2H07A 3DBRA 4GP7A 3O3NB 4WFQA 5EHQA 5FQNA 3VO2A 4YQFA 3IVAA 1K5DA 3BOSA 2GEDA 3NI2A 1KZ6A 3HUEA 1Y6RA 4YJ2B 3LVQE 3EZ9A 3GELA 3NDRA 5D6NA 1AKQA 2C5AA 2J09A 3GFFA 4OHRA 1AD2A 4LUCA 1X8XA 3IQWA 5HDBB 4PO3X 3CCBA 1JKJB 2AOVA 3PFCA 1WQ1R 1LBIA 3CE6A 3G2PA 4G5GA 1ONSA 4LZZA 4PLYA 5FCDA 4PYJA 1V47A 1I4LD 2A92A 4YCJA 3DFZA 4J4HA 3P2IA 4P83A 5IH7A 2O3TA 4D80A 2WHEA 4MW2A 3TTYA 2MINB 4CCAA 4MPJA 1VJRA 1UODA 3EVBA 4YLEA 1YOVA 4FFOA 1CXZA 5B1EA 1X7HA 5BT9A 3VI3B 2D5IA 3P9SA 1DE0A 3FNEA 2W2TA 3T0IA 1EPUA 2O57A 4K9LA 5ALXA 1YS2X 2V6BA 2W2LD 2FRDC 3MS2A 4MV1A 5DBFA 5C7IO 4I3GA 3NGXA 1DKPA 1XNJA 2PWBA 2PRIA 4BP8A 1N4DA 1KHTA 3I9FA 4CUZA 3GGPA 2W2PA 1B26A 4UM9B 3M2PA 4K28A 2Y1XA 1BOFA 1Z4QA 2BEVA 4M0CA 1THTA 2HREA 2NPFA 3RRNA 2EQ5A 4F3YA 4RJTA 1KIMA 3R0ZA 4DV4B 1U0BB 2HMSA 4J43A 2O3RA 4XTCS 3N58A 5F3WB 1LC0A 1ZKDA 2VIIA 3E70C 1PGNA 4GGOA 2TSYB 3BFJA 2WP0A 1JWLA 1QO0D 4UAUA 5EVCA 4HGYA 1O96A 3AJRA 1F4VA 3JR7A 1B43A 2HIHA 1DDOA 1E69A 4RJIA 2BGTA 4LXTA 3T0FA 1N3LA 2Y93A 4RPIA 4W4TA 2BISA 5I9NA 2B8JA 3DW3X 1GR1A 3GJYA 3ZWVA 2FR8A 4IH9A 2C77A 3Q98A 5EC8A 5IAKA 1GM5A 1ZMRA 4RHUA 1WPQA 3PF9A 1XELA 5AK0A 4WCFA 3ZHVA 5B12A 1HPLA 4O02B 3DF9A 4TKUB 2C2WA 1DX9A 1GFIA 1U98A 2D1QA 2PT7A 2ZSFA 2CE7A 2QQ5A 1DAKA 1KI7A 2WOOA 4NYJQ 4XI9A 2GA9A 2FP4B 2HD4A 2KHZA 1RPZA 3ZJ4A 3AIKA 4R5MA 3EQ2A 3D3EA 5EN4A 2D5CA 2VAXA 2FPRA 2ADOA 1NPDA 1OGYA 4UREA 1CR4A 2RJ3A 1T6NA 2YV4A 4ENTA 1LNQA 3E1SA 1A71A 4I08A 2XAAA 5AM3A 2JIBA 3PL1A 4PZUA 3V00A 4LYHA 4B4WA 1DEXA 2YN2A 2PEYA 4DABA 2RG7A 1YA4A 1WPGA 2IYXA 3SPXA 1DAFA 4A8HA 3FZEA 4Y6GB 4A16A 4OTZA 1T4MA 2YJTD 4YJ2F 5BNZA 4K87A 4PGHA 1VPWA 2GKOA 4NCHA 4AP5A 1DIBA 2RONA 3H1TA 2V65A 1ONBA 4KGZA 2QTGA 4MVJF 4DM7A 1CUFA 1QO7A 1QYVA 2BL4A 4WBNA 1NKVA 4BFZA 5IABA 5JTTA 4MPDA 3D8BA 4K05A 1IMJA 1GAJA 1RBZA 4EI8A 1OXSC 3F6SA 3I3SR 3KT0A 3EH2A 2W6IA 1LJLA 4FHEA 3CVVA 4DMLA 2OGUA 3AVOA 3ESQA 4HDRB 2BM1A 4K9DA 1EXDA 3LY8A 4NI5A 1ELOA 3KTDA 4B3CA 3RAEC 1J56A 1WZNA 5ARCA 5EG5A 1KR2A 3CJTA 4EJSC 1XP5A 3DEZA 1Q0TA 3IIKA 4FXPA 4MX8A 3VR2D 1QH9A 5H68A 5JD3A 1IQ0A 1FZQA 4HT3B 2JFFA 4WNYA 4B4KA 2R6HA 4BVEA 3HCFA 3SMVA 2IGTA 2FUEA 3RU7A 5JNSA 4D4KA 1D6SA 4O2BB 4MR8A 4GVLA 4UNIA 1E2GA 4S3MA 2P9FA 2FEAA 1OU4A 2RHDA 2XQKA 3OY7A 3PCTA 5EMLA 3B3JA 2CHFA 4RK6A 1R4MB 4UBKA 2JFPA 3KPUA 1C3JA 1Z34A 1KO8A 2YMQA 4RF3A 1ICIA 5JXJA 3QEBZ 2OXTA 3DXFA 4N39A 3CJRA 4E6PA 3T5GA 4MS3A 1H1DA 2FWNA 2RGWA 2VATA 1LGYA 1NRWA 3E3LA 5GVSA 1FVFA 3E2PA 1JFFB 4LE0A 2OG1A 2PV0A 3M6IA 2HA5A 4U0KA 4BLWA 1RI1A 3SIXA 4KVFA 3B70A 1E2HA 2OHJA 4ZU3A 5HTOA 3LCVB 2AX4A 2QOEA 1OW3B 3JV7A 2DXIA 2FFRA 2OL4A 2XE8A 4HDAA 3GLIE 2HIAA 1XFAA 2KB0A 1X94A 1XMXA 2R6GA 4KMOA 2Q3BA 3F6CA 4KU4A 3CUVA 5E8JA 5BVGA 3G02A 3O9VA 3ZD6A 3HA7A 1GZ5A 1GDDA 5I9IA 1GTJ1 5AO9A 1TL7C 4QHYA 1II9A 5HPYB 5KTSA 1ZEJA 3OPYB 1F2VA 5FAXA 2VA9A 3CCCA 4NBSA 3UF0A 2O05A 4N65A 5EY5B 2OBXA 1QHHB 4ZWNA 3T3EA 5IUJC 5IJ9B 4QQRA 3L40A 4NZMA 2OCXA 1L8OA 4XB1A 3ST7A 5I4BA 4LWPA 5ALOA 3R74A 1RMYA 1EU1A 1E2BA 1K6EA 1TCVA 2XNKA 1JFSA 3DZHA 2ILVA 3EULA 3LUDA 3LIIA 1DFGA 3MWEA 1PWYE 2XYHA 2OFWA 1SC6A 1P8JA 1VJ1A 3A4YA 2VP5A 3BMCA 2OO3A 1G4HA 2UVDA 3MBIA 2YZGA 5AM0A 3WBBA 4BWYA 4EGJA 3IFSA 4OVKA 4P36A 1HDIA 2QTVA 4PS1A 4HV4A 2OD9A 3GGCA 4ZD6A 3DV0B 5IVDA 4D3ZA 2IS4A 3PR2B 1SBQA 5EJ7A 4M1ZA 3W8NA 2R8YA 4QBHA 1GU7A 2AN5A 1DXQA 2FLWA 3ASVA 5DIZA 2HB6A 5C8XA 3C14C 3LC2O 1U3VA 2JAUA 3PGVA 2DT8A 5D00A 521PA 4H4DA 3TQFA 1NI3A 1YCDA 2F4NA 2WLTA 5KX5A 3KFXA 4MQ5A 2FJ0A 1QH1A 4RTLA 3GEDA 2EWMA 3BG5A 1P2TA 4X90A 4KH1A 1G9SA 4OHXA 3RU3A 3TYXA 4B4DA 2GCNA 3ICOA 1SUEA 3GLGB 1U63A 2WWFA 3T41A 1P2VA 2G70A 3MA0A 3FNFA 4TLEA 2QD3A 1J8FA 4KOAA 2XD9A 4L5CA 4LTDA 4ASUD 4LYAA 1R0SA 4NFYA 4OQQA 5AJVB 1KE2A 2YQZA 3FOFC 2RGNA 3A04A 4Q21A 4R1QA 4B8YA 1XUOA 4OQLA 4C7BA 4Q1CA 3NTOA 1PL6A 5KNCA 3OU7A 3LTEA 1TVEA 1GA1A 1RAIA 2DSTA 4UDYX 3NJRA 3RFXA 2WVGA 4H4EA 4A9AA 3LY9A 4F06A 4JITA 3IAHA 3DE5X 4KPUA 4Q4DA 1QNFA 5JDCA 2NZ8A 3O3OB 4O2BF 2Y6VA 3MOGA 5A3QA 1QG2A 3OFNA 1W0KA 3C6MA 2HTFA 3FWHA 2YZ7A 2JEZA 3VDQA 1RWVA 2JHAA 3H18A 3CH4B 4B82A 4QRHA 4Q9NA 1WSDA 4RCYA 4XX0B 3IMFA 2ODQA 4XOIA 1P2GA 1XN4A 3QBVA 4CIAA 3GROA 2KQUA 2YN4A 1PP4A 2VFAA 4R7ZA 1MAWA 4TPKA 1C0EA 3HFGA 2BBWA 3IIEA 4JBNA 2ILTA 2JI7A 3ZYZA 3EW7A 1NX9A 3W5BA 2FZGA 2PO7A 3H2YA 4EATA 3M2TA 4FONA 3K0EA 4DBLE 2V7VA 5BN1A 2NU8B 1A95A 2BMWA 2E6KA 1NQTA 3T3IA 3GB9A 3Q9NA 2WD9A 5AOAA 1UFQA 1SIWA 4FZVA 5NULA 1W19A 1AT1A 3CT6A 3NHKA 4QZVA 5DH9A 3R5KA 1RQPA 5E2IA 4L4XA 1SC9A 1WW3A 2WTEA 3U56A 1VLVA 3FKQA 4LGVA 3THYA 3NGLA 2NZ2A 5L3SB 2ZJZA 3WE7A 2I6UA 1VE9A 3PRKE 1XU4A 3HR7A 2KI5A 1RWNA 1P7PA 2C7GA 2CMHA 2OORA 2QJTA 3HB0A 4JYPA 4WLNA 5LCXA 5JMWA 2WQ6A 1C8BA 1NWCA 4LXYA 4X61A 4BNKA 1JJ7A 2HL6A 4NLLA 4MQEB 3KOMA 4DBZA 2Q4EA 4DQDA 3AOEC 3I9NA 3VJKA 2Z09A 1RVDA 4XD7D 2JAWA 4DR1B 1YGYA 5MFZA 4HB2A 2PS3A 2RGCA 4QXMA 4LWQA 5FYDA 3VPXA 1RNLA 5JCOA 4ZMSA 3P9XA 1XJ5A 2R2AA 4UTVA 2C94A 2X8AA 3SK0A 2PGOA 2JHFA 3C24A 3DFKA 4JS0A 4DSAA 5KWIA 1G21E 1UBGA 2G25A 1NX6A 1P9NA 3E2IA 1DKOA 2WILA 4JEMA 4O1IA 2W6OA 4UNQA 3TVYA 4CTOA 4CCSA 4IYRA 1TGVA 1LD3A 1J09A 2AJCA 1K1EA 3P9PA 4D6XA 4QPJC 4V0RA 1RJFA 1Z17A 3FIJA 4ZVTA 2MHCA 4MYCA 4J0FA 4Z3DA 1KDTA 2WHYA 3DMHA 3PCXA 2R1VB 4M8IA 3C7KA 4JLSA 3PLRA 2DWOA 3TNJA 2ATXA 3LRXA 2AT1A 4YWHA 1FJHA 1WXHA 3TIFA 1PN3A 1ZK1A 3M6FA 4J2OA 5EA2A 1M7GA 4NOKA 1AJEA 1KQOA 2ZUBA 1Y5LA 5JRZA 1TQHA 4YH1A 2MYTA 4IHJA 2VPPA 1UFKA 1Y98A 1B4DA 4FFPA 5AMXA 4ABTA 1Z0JA 4KRFA 3VH3A 3EBOA 5DSTA 1E1NA 1C2YA 1XD2A 1XFDA 4BBAA 1JVSA 2PS9A 3G0IA 3BCSA 1IFXA 1LPPA 2GK4A 2XQJA 3UUWA 1NVFA 3H7AA 1AGRA 1JBEA 1PZNA 4NYIQ 1XZGA 1SQSA 2CD7A 3LU1A 4LOIA 3QVJA 4PLPA 4X8LA 3TZCA 1Z8FA 4DJDC 1LPNA 5JQGB 3OICA 3EMVA 3EF1A 1GL9B 4YO7A 3TKYA 3FVRA 3RIYA 4I4IA 1LWNA 4NP6A 2PX0A 1ENPA 3RNOA 1WG8A 5CVVA 1SMKA 1XDDA 2G4CA 3BWBA 3ZKWA 4HP8A 4A27A 3UBTA 3U3JA 4BX8A 3R0QA 4JBLA 4OOEA 3OLXA 3QE0A 1EI9A 3SU8A 3P4YA 2EKBA 3QVVA 2MSWA 2AL7A 2WYVA 1HYBA 2XB4A 7ABPA 4MKIA 2ZT7A 5ICCA 1FDWA 2D0IA 1NJFA 1VSQA 1P81A 3L5KA 2G5TA 3RF7A 1UH5A 2IZ1A 4CL0A 4I5IA 2A3RA 1S1CA 4G1VA 4ZANA 5H7XA 3AJDA 5FULA 3NHSA 5A1JA 2WYHA 2G28A 3EH1A 3HCAA 4E7PA 2CLEB 3IEPA 4WKNA 3PNQA 1M2OA 3HBNA 3S2FA 2EL9A 1PJZA 1A77A 3LCMA 4MKRA 4NWIA 1P2UA 2BKXA 3DO5A 4RQAA 2OM6A 4I9HA 4ZV7A 3RODA 1C4KA 1ZBQA 3FUXA 3RWBA 2ZRFA 4L22A 4S2EA 2GCPA 2M1ZA 2J87A 3RH0A 3IP1A 4AJNA 1SBNE 2E4VA 4KMRA 2NU6B 5HZMA 4HDOB 3TLBA 1YUMA 1X7XA 3LHSA 2VRBA 2VVTA 3JWGA 3EARA 2HF7A 4FUTA 3H2JA 4JNCA 3LRTA 1IJEA 2RB4A 3LY5A 3M5PA 2NPIA 2Q5LA 2O4UX 1OROA 3H7IA 4X0EA 4MWZA 1XTVA 4MGZR 1WXDA 1XRRA 1GPAA 1O97C 2PUFA 1SBYA 4D8TA 1VMIA 3SKYA 3ISJA 1BDBA 1NXWA 4TV8B 1ORDA 1QHFA 1BYIA 1N5LA 2JI9A 4LXXA 2IY7A 3CZRA 3WISA 5TF0A 2VYCA 3I1JA 1DUSA 1CULC 1GQQA 1I3CA 1FQKA 5DX0A 2ONJA 4B0OA 2DERA 4DVGA 3N8KA 3KHTA 5AM5A 3CTMA 5F98A 4WK6A 3U7IA 2YW9A 4YBRA 3JZDA 2HQ1A 4ONEA 4MVJD 3WLJA 4JI2B 3D6HA 2VZ9A 1P77A 4GECA 4RDHA 4LNUA 1Y4UA 3W79A 5A5FA 1U9ZA 6REQA 2E1PA 3PFBA 1RHQA 3BT7A 3PJFA 4HO1X 1X1SA 4F85A 2O1EA 2VJQA 2FI1A 4RF2A 1BE6A 3A25A 5KPJA 3AM1A 4EFNA 1T5HX 3H17A 4PCUA 1JDNA 4XTRA 2P91A 1I80A 1PRYA 4PIMA 3JCZA 2CNWD 1GGVA 1R16A 3L7OA 2YV5A 2X13A 1UKEA 1ZS9A 5EQDA 1G8JA 3KWMA 4UXIA 16PKA 2WRZA 4L72A 1JKIA 2NUTB 3NG1A 4OSEA 6ADHA 4P92A 4QRDA 4UTNA 1D1SA 2YNMC 5EHXA 4ODIA 4Z9XA 2ZJBA 2ZR9A 2PU5A 1AHHA 4C2AA 4QXOA 3QJGA 2VCEA 2XPCA 3HDGA 2B94A 5K6AA 3WQHA 3B1ZA 2H2WA 4XQ0A 1FF9A 4GM4A 2YWEA 5I01A 1UQUA 4B2IA 4M1KA 3V5NA 3GFBA 2A59A 4PZLA 4CGYA 1DT3A 2HSJA 1WUYA 4BZQA 4S1VA 1FFXB 2ROQA 3NOVA 3JVDA 4LDZA 3DL0A 1W9HA 3DCIA 4L8FA 4UMDA 3FFWA 3WTCA 2J3JA 2DKOA 2QUAA 5C52B 2JBAA 2F48A 5D1NA 4JEIA 4C3VA 4ZAGA 4MV9A 1CRLA 1NTOA 1RKBA 2P9JA 1R6DA 3AR4A 3L0PA 1OFGA 4KAFA 4RDIA 5SY9A 4CVNA 1NYTA 3WNQA 5K09A 5KSOA 3ZGZA 1NZFA 4TL8A 1OH7A 3DEKA 3OQJA 5KYNA 5CAEA 1I4DD 1YMQA 2ASVA 3MOSA 3PLNA 4LMBA 3G7UA 2ZZMA 2NX2A 2JLCA 1IEQA 1Y63A 1LQ2A 4KRXA 4V0NA 5B1IA 4EHNA 2J0QA 4OYRA 4KGXA 4ZT2A 1QAMA 2XW6A 1M1YE 1OILA 2G0NA 3O8QA 1T4BA 3FOCA 4BAGA 1K86A 2B0CA 1UAGA 2X40A 5SYAA 1UZLA 1HWYA 3CVOA 1CZOA 2WUVA 5T3UA 3CSSA 3QE2A 3ZUPA 4M9SA 3I6QA 5CVUA 3WYEA 4BFVA 4PN3A 3NHWA 2VHTA 4FBGA 4Q4JA 2QMQA 1T4DA 3OPVA 2RI0A 3PFWO 4H18A 1T34A 4TV8F 4Y6PA 5B7GA 8ABPA 2E4UA 2EZ9A 4Z53A 1NW4A 4CKCB 3HACA 3AL0C 3AHIA 2JLYA 3OOEA 4FP9A 4DSUA 4JYAB 3FTPA 4JBWA 4BMNA 4M98A 3WAJA 4LJRA 4JX8A 1E2DA 1HQKA 3DEYX 4PC2A 4TSFA 2XBMA 4HDSB 5FOUA 3TZLA 2FMTA 4Z3KA 2QX4A 1KPGA 2J7KA 2O8CB 3IJEB 1QIFA 1NXPA 5KMGA 2CXQA 2YS7A 4K9SA 1TZ2A 2R8BA 1Z6PA 2Q1XA 1U7XA 2H4YA 3QVWA 3RTAA 3BFPA 4R1PA 3AW8A 4X1KB 1RWPA 5BQOA 3GJ6A 3OFSA 4W5JA 1LEHA 1UM9B 2H0AA 3UMJA 2X41A 2DMRA 2Y1KA 3CC8A 2IXEA 4PCVA 5CFQA 3SVLA 1V1MB 2RK3A 2VHQA 3AW9A 3MJSA 3O4IA 3GRYA 1GCAA 4GL4A 2O50A 3M33A 1QONA 4Q00A 4AIIA 5H8WA 5JJKA 1ZSVA 2HA2A 2QW1A 3FCCA 3LPDA 1T0JB 4RO0A 3UMBA 2JIRA 1LK0A 2A1TS 2A9PA 3H3XA 2XDWA 3LA8A 3LYAA 4NARA 3DL2A 4G0WA 1GKLA 2FW8A 1SB9A 4XVHA 3WG9A 1R9GA 2W43A 1C30B 1D4OA 3T35A 4KBYA 5E7QA 5KTTA 2IIBA 4PHTA 1T2CA 1MQ8B 5EWJA 1YL6A 5HCNA 2EVWX 4Z2AA 5K99A 1DBWA 4DA8A 1P0QA 3EBLA 4X1OA 3RAJA 3IIJA 3VC3A 1A27A 3JTEA 2RGAA 1UFVA 4I8XA 2XBUA 2XD4A 3BD7A 3WAKA 3FYDA 5ILOA 1GILA 1TTQB 3QBTA 5TPWB 4OBWA 3DNFA 5L9AA 2CW5A 5NLLA 4WA8A 2J5QA 4BEBA 4YRMA 4ER7A 5IBQA 2O9JA 3TAHA 3A1EA 3QWFA 4NAHA 4CN9A 4EJ0A 3EXHC 4AD8A 4F3TA 3BGOS 1EUDA 2OHIA 1JPJA 3F90A 3P94A 2WD8A 3IDFA 2WABA 4RZSA 4LY9A 2J3MA 3OE5A 4MO2A 4MUNA 2JF0A 4M99A 5TMEA 1U8EA 3K05A 4CKEB 2HDHA 3HRIA 2XB8A 5GONA 1MKYA 2R86A 3QYJA 1KZGB 3SXJA 4HBZA 1K8QA 1HOTA 3GYBA 2ZIXA 3HXTA 4BB0A 1LV8A 1MNQA 1W94A 2HK8A 3LCRA 4KREA 3G2HA 3CIFA 3SBXA 1GPUA 1SZPA 3CRNA 3K09A 2A7QA 3OZXA 1XQ6A 1JALA 3UW1A 4EKDA 1OLOA 1UINA 2OENG 5FRDA 4BBPA 1Q3HA 2JZNA 2GEBA 2B0JA 5FR2A 4IRUB 2EERA 5HZGA 3N0VA 4G5RA 3BWEA 3VV2A 3GRKA 1L7DA 2WKQA 3JRXA 1ODLA 1SUSA 3R4VA 1J4AA 2H4JA 3TB4A 4N47A 2F43B 1Z8NA 4NMWA 5BURA 1W4AA 1AUPA 3ZWYA 1B15A 3NT4A 3NHMA 2Q3LA 4MWGA 2E85A 2QAGB 3HA2A 4M83A 4D6YA 2ZE7A 2UVPA 2F3SA 1QTIA 1BVHA 1JNXX 4WNAA 2ONYA 2QN3A 4HADA 4OL9A 5K45A 1BU5A 4ECEA 4EMTA 4B87A 2WWHA 3FZNA 2NXJA 4PR0A 3ZIAD 4R31A 4NS4A 2PL5A 4G26A 1AOXA 2CNDA 4Y0VA 5DTJA 1JI0A 2GHRA 3V46A 1P8AA 2B25A 2J7PA 3O75A 5AJWA 2IXAA 3ANYB 1NQAO 3UT0A 1ISIA 1PD0A 1XTRA 3ELUA 1OHHD 2H2DA 3K6JA 5K01A 3U09A 3DG9A 4KUGA 1R6XA 3ZHSA 2OXCA 4GW3A 1DAOA 2E3JA 4YJFA 1YB5A 1JR3A 5KNDA 5BRAA 3BJRA 2FWPA 3I2GA 3X43A 3EG9A 3SJCA 1BVRA 1E8NA 4YX9A 1QYIA 4A0FA 1U3DA 5FQOA 4RWZA 3EBPA 4AS2A 2ZFUA 2IYYA 2GR9A 4EPYA 5F7OA 3QGMA 1VLMA 3B78A 4E5KA 3A4LA 1GZ6A 3VHXA 2QVZX 4TVKA 3WX0A 5IJWA 1P29A 3RUAA 3KKLA 5LDHA 3CF4A 4EKIA 1SCDA 4E03A 1H8HD 1RPAA 3DOEA 4ZIRA 2VDUE 3WO1A 2AEMA 3RJZA 3OP4A 3CSUA 4BLUA 1XEAA 2XF8A 2O7RA 2YASA 5E4JA 4FEAA 4FR2A 4D02A 1RAEA 2NTJA 1WXIA 1OXMA 3GVCA 4D97A 1UMDA 1BWSA 3BIFA 3QXGA 4RKWA 3QXSA 2ZKIA 1V9CA 3BFKA 2LDXA 1UKVY 3Q6NA 1IC6A 4IQ0A 3VR4H 2HMWA 4CM4A 3R3ZA 2BM9A 4J94A 3K4HA 2OTCA 4BQNA 5D1HA 4N3CA 2QN2A 1O9HA 4J0CA 1A5BB 2H18A 3VH1A 1FMFA 1DXYA 2B69A 3THXA 5EESA 2Y9MB 3O8CA 3Q9LA 2GD0A 2NG1A 1RM0A 1T43A 3CEPB 3ITDA 5CX1A 4NCBA 4C30A 3FTDA 1H3NA 3GA0A 1FLAA 5TQVA 4CYMA 2GCOB 1A9RA 1PX2A 4Z0PA 1Z63A 1K8ZB 4YUWA 4LXIA 4L5JA 3UY4A 3C3AA 2YHIA 1HE2A 5DEOA 1F60A 4FW9A 4C03A 4RK0A 2C78A 1EFRD 4BASA 1JIKA 3GGGA 3FSRA 4C76A 3FETA 1I4WA 3KG2A 3QELA 3KELA 2GZAA 5J3JA 4KMSA 2P5YA 2WT8A 1ABBA 1JR2A 2EP7A 4REMA 4JJ6A 3G9ZA 4IKEA 1XG5A 4XCQA 3FZYA 5IYZB 1M72A 2WWWA 5GAJA 1XPJA 1Q1BA 4UOEA 3PVZA 1U0HC 5L3VA 4CF6A 2FHSA 2P35A 3WL3A 1W4LA 5KJEA 5H83A 4C2TA 1U11A 3GW8A 3JY6A 3ZDRA 4HAVA 1LLQA 1P39A 4QPCA 5KQRA 1W9MA 1Z5ZA 4MAMA 3WZ2A 1EVYA 3OJCA 1C8VB 4ZYLA 4ZO4A 1VRCA 5EIBD 3AWDA 3RGWS 4FEYA 3L8HA 2P65A 3ORSA 3E9YA 1RYFA 1VCIA 3EASA 2DHRA 1GWNA 4CM1A 1JFTA 2WTMA 3FJ1A 1Z4PX 3LA6A 1QYDA 5D5QA 2I7VA 3WGKA 3CUYA 1GZVA 1BYUA 2XNHA 4OO3A 5HOEA 1IY9A 1YOVB 1ZY2A 1Q7RA 3ESAA 3C7AA 1NXOA 2HNAA 2V5VA 5B55A 1ZAYA 3JD4A 3WGLA 1WOYA 2BGLA 1JBKA 1I4TD 2GOYA 4JY7A 3FZQA 4NH4A 1HYGA 3M49A 4CF5A 2C9MA 2QM8A 4OA8A 1F2TA 4MVYA 4F56A 1VLQA 2R11A 3OC0A 3GXOA 2IY9A 1IZ8A 3IBGA 3ROPA 3KPJA 4OM7A 4BU1A 1RPTA 1VIMA 3KJXA 3OM8A 5F5XA 5ENVA 5H4HA 1E2UA 4PRZA 4AY3A 1FSZA 1VJ0A 2Z5VA 3SCZA 4NNOA 2BEVB 5CFOA 2ZUCA 1GJRA 1JLSA 1GEGA 5I7FA 2BJHA 1RACA 2QMHA 1ZG3A 1GKIA 1P74A 1RJ9A 4U7JA 4WN3A 4KQXA 5EJ6A 4B40A 5A4JA 2OV8A 2Y27A 2AQHA 4YT4A 3DXZA 2HHLA 3Q3HA 5J2TA 1ZK0A 4FQ8A 3I0NA 1UJCA 1O96B 4U5XA 4D3XA 2I2FA 3ELDA 2GJAA 3COYA 4LA4A 4C7MA 5FJIA 4HGNA 2V59A 5DHPA 3WBJA 1ZGGA 3IHKA 4GKAA 2X1VA 3BORA 1R27A 4YMTA 1ZRMA 4FOOA 2V98A 3S5JA 5ICFA 1Y3HA 2DJIA 2VHJA 3D3KA 3B7WA 5CP8A 3RS8A 1UWKA 2P1ZA 4I5EA 2BHLA 2JFZA 2DCUA 3FI9A 3GRAA 3PKZA 4WCFB 3W2HA 4D46A 3SVTA 4JGBA 1AO3A 2FMIA 4AN1A 5ALHA 4LVCA 1KAMA 2FPPA 1F2DA 2Y1OA 3EDCA 3FOBA 3TINA 3VO8A 3ZGLA 1GDHA 5B7QA 1SOVA 3O1LA 5JNWA 1QTQA 4GOMD 1JDPA 1ZXXA 4M1QA 5FT9A 1DWUA 1U02A 3O94A 2HLNA 4YGXB 3A11A 3DL4A 1JAZA 4JUFA 2GCGA 3NNSA 4QWMA 1N9ZA 3CLRC 1A8SA 2YIMA 3OY2A 5BORA 1WQ4A 5BR7A 2R87A 4E88A 4M0MA 2G8NA 1PE0A 3FOAA 1PW5A 4QBKA 2QKYA 4KR7A 3GEEA 1GPKA 3RVBA 1ZIDA 3B7PA 3KL4A 2P4SA 2QEQA 5D3KA 2LWIA 2HRZA 3NTQA 4WBNB 1I01A 3U4QB 3Q8MA 1Z0IA 3O8RA 3EVAA 1ZIYA 1AKEA 1VJTA 4BZZA 2GD6A 1J39A 3I9JA 2QF7A 1G59A 5CGQB 1TM5E 3WJ7A 4I1PA 5HWSA 3I32A 3L9XA 1L4MA 1MB9A 3EQ6A 1RRGA 1BE1A 3LC1O 1OBOA 1U2SA 2J08A 3CY6A 3RI3A 2D6FA 1DKQA 3O8LA 1HX7A 1WE2A 5H9WA 1UC5B 3MMXA 4JQSA 5DM2A 1SQ5A 3A6KA 3EIXA 4OK3A 3W9UA 4C88A 3SS8A 3KQOA 4L4SA 4DXDA 1XNQB 1Z37A 4KXMA 1QYWA 1SHJA 4KWEA 2GFQA 2HXYA 2DLNA 4HYEA 3DDZX 2G7MC 1KI3A 4P35A 1VIVA 1J23A 4EY6A 2H59A 1NVBA 1RBYA 3LQKA 3RSHA 2OBLA 4ZT6A 4C4SA 1BA2A 3LP5A 3HXMA 1VCOA 1M6NA 3LSYA 1BS2A 5DISB 1X7GA 2RBGA 4MS3B 4TQ9A 1V8OA 3VHLB 1NW3A 2OV4A 1Q0PA 4AQDA 3K9WA 2B2XA 3RUFA 1T3HA 1WKVA 1XA0A 2QRQA 2LBPA 2WU4A 1I24A 3IPCA 3UJHA 5TMPA