2NO1A

C4s dck variant of dck in complex with d-dc+adp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
240
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords deoxycytidine kinase
total genus 96
structure length 240
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2no1A00
2J46A 2ZTSA 4GP6A 2GZHA 1RPZA 4ZV4A 1LF0A 2J0QA 4CF7A 2JLRA 1J8MF 3A36A 4M1KA 4TMKA 1R8SA 4Q00A 2P3SA 2ZVPX 4Q9LA 4XWOA 2O8DA 1P2TA 2YYZA 3RS2A 3O8BA 4GNKA 1KAGA 3QPVA 3I5YA 4GFDA 3U4QA 3NC1C 3UMFA 521PA 2IWHA 2D3WA 3L0IB 4TLAA 4HLCA 4L9WA 3I62A 2W00A 4TQ9A 1WB9A 3LXRA 3GFTA 3G0HA 3AF4A 4WXPA 5AUNB 2IUUA 1Z0AA 4ACBA 1HTWA 1OE0A 2WJJA 4EPYA 2QRNA 3BFKA 5BN5A 5JFGA 5BWMA 1RRGA 4YC7A 1XPUA 1TQ4A 3Q5DA 4QM6A 4H9GA 3PEUA 3EZ6A 4XTRA 3BRWD 4XH9B 2FH5B 3B9PA 3LBIA 3TQFA 1JALA 1RRCA 3OF5A 3WYFA 2IYSA 2DWOA 5DGXA 3FPAA 4AKEA 1MABA 1QDEA 3QXHA 2QPTA 2V8OA 2VH5R 3Q7QA 4DCNA 1JXMA 1UADA 1WF3A 4JLNA 3TQCA 2O8EB 1PVOA 4LJ6A 5SZHB 2JDID 1RYFA 3CWZA 4IDNA 4PZLA 1OFUX 2R6GA 1SXJA 4KHZA 1YZTA 3W8RA 3ICEA 4X8HA 2ODWA 3PIRA 3LQRA 4G5QA 1HYQA 3PUXA 1HEIA 2FV8A 4LJAA 1EX6A 4M9ZA 4MRVA 4DLYA 2GRJA 1S9HA 2D74A 2ZSDA 4P3YA 3WMFA 4EQ6A 4KSCA 3U3MA 1E0KA 5AJXA 2ZI3A 3AVUA 3NBXX 1GRQA 3GLIA 4QG7A 3FOZA 3LRPA 3PVSA 4DRZA 1VTKA 2VP2A 3PQCA 1VCIA 3KDSE 5DI3B 1R0XA 4URZR 3L2OB 4URXR 2KI5A 1WBDA 2CBZA 1MO6A 4Z1MA 1EGAA 1OXXK 1ZU4A 2JJ1D 3CLVA 4ZCMA 2O52A 3U4QB 4CT5A 4JLDA 1GDDA 4DLSA 2QAJA 4DC9A 4D25A 5FPHA 4Q4JB 1KKMA 1KI7A 1YRAA 2EVWX 3QKTA 1TADA 1CEEA 4MKFA 5JZVA 1YKSA 4GZMA 1G5RA 2QP3A 1BYUA 2ZREA 3R8FA 4GOKA 1W0JD 1WA5A 2WV9A 3SBDA 3T12A 3W6OA 4X8MA 5CITA 3RS3A 1MT0A 4BRUA 2JLSA 3QG5A 3L0SA 5C18A 1GKYA 2LKDA 2ANCA 4HDCA 1YVDA 1ZD1A 2ZUCA 2FGJA 2ZYWX 1KK2A 3AKEA 5KDLA 4QGFA 2SHKA 3E70C 4ZDWA 4OQFA 1W47A 2VSOA 1IHUA 5JECA 4YMTA 3GLFE 3VKGA 2Y8EA 1SXJB 2E87A 1U9IC 3U7EB 2PCLA 2PL3A 1RJ9A 3OEEA 4TLBA 2XSZD 2FEOA 1XEWY 1RZ3A 5KU1A 1XFAA 3DMDA 4A2WA 2VHQA 2AN9A 1E2NA 1RRPA 2NOAA 4Q7KA 1W2GA 2ZRNA 1EFHA 1G7RA 4KVGA 2BMFA 4R98A 3CH4B 4OJQA 1EK0A 3W6NA 1OHHD 5HPYB 3KJGA 4ZO4A 2CHQA 1VHLA 2Q21A 3D31A 2FSIA 4HUTA 2E1RA 2BEKA 1T8TA 2F3TA 3Q3JB 4DLTA 1B23P 2RB4A 5H70A 3NC0C 4JBYA 1Y63A 3TSOA 1EWRA 3KQLA 3I4LA 2VL7A 4JKIA 3F3YA 1UDWA 4HAYA 4NYJQ 2CVFA 1K8RA 4MYHA 4PTLA 3THOA 4BFWA 5C1BA 1E2DA 1MRSA 5AJZA 2ZJ8A 2GXAA 2C98A 2OAQ1 3I92A 4GOXA 1Q12A 2OCAA 2BCJQ 3CX8A 4US0R 1CXZA 2IF2A 3FFBA 2QPOA 4Q7MB 2ZM5A 3UG7A 3SQXA 1HT1E 2OHFA 1ZMXA 2IYXA 3CKLA 2YINC 4KCGA 1DBSA 4EJSA 4JVLA 1X1RA 3OEHD 1W46A 1KI8A 2UZ3A 2AX4A 2GEUA 4Q21A 4EIWA 4DDUA 3AVXA 1AS0A 4HLUA 1UKEA 1NVVQ 2QP4A 3PCRB 5JWOA 1XTQA 4PXAA 3SJBA 1RYHA 3TR5A 2KB0A 1WXQA 4DCVA 5JLJA 4F91B 5JS8A 1P3JA 4JT2A 4TMTA 1NBME 3K0FB 3W34A 2B6HA 1AK2A 3NBZC 1R6BX 3VR1A 3TGPA 4D80A 5C4MA 3MJRA 3QNUA 1GILA 3A8TA 4DLWA 2RGCA 2AXNA 4F4IA 1NI3A 1JPNA 1E1QD 2QUZA 4CW7A 3O8DA 3IIKA 4ON9A 5DHFA 4MGYR 1GRNA 3EZ7A 4B3DA 1VCNA 3KL4A 3VQTA 3MG9A 4BLSA 1HT2E 2UKDA 4TQUS 4U02A 2JATA 1DAFA 1SVWA 3WP1B 1OB2A 2YV5A 5J4HA 4E03A 4IHQA 2E9SA 1ZU5A 4E22A 4LBWA 4YQFA 1E2KA 3DPUA 3O8RA 1Z0KA 3CIOA 5EUMA 5J4VA 2O8FB 8OHMA 2YJTD 5FOUA 3SFVA 3TSZA 3EASA 2QM7A 4KBGA 1NY6A 2OG2A 1R0YA 3ZZUA 3NBYC 1L2TA 2PX0A 3GLHA 2ATXA 4BRWA 4NCNA 4K81B 5JI3E 2IYYA 1CJMA 3HYRA 2ASEA 2OUKA 1KJYA 4EFMA 3P26A 4G0NA 5KTYA 2MSCB 4JL5A 4AIIA 1UF9A 4A0RA 2N46A 1WBBA 1S3SA 3U61B 1JR3A 1KDTA 3EC1A 3VX4A 3PENA 5GVSA 3BB3A 3QVVA 2GZAA 3FKQA 4UNSA 4GP7A 5DYGA 5C2JB 2Z43A 1DADA 3SYKA 3RNLA 1UFQA 3E2IA 3FHCB 3QEJA 3HU1A 4RD4A 2ZI4A 4LHVA 4Q9HA 5EXXA 3GP8A 2D2EA 1N5KA 1BYIA 2O0HA 5C4GB 5BXQC 3PUVA 2IA5A 4C9BA 2QAGC 1ZYUA 3Q85A 2J87A 2NO9A 2P6NA 4D4LA 5JSZA 5IF9A 4Q7JB 1TUIA 2BHRA 1G291 2ZUDA 1DAHA 2GZDA 5L3VA 2PJZA 3ZIAA 1CJVC 4R71A 2V3CC 1XMJA 4PSVA 2A7QA 2NO6A 2IS4A 2AR7A 4Q4AA 5IK2D 4URUR 2CLSA 4JLAA 2Z4RA 5GJBA 1SULA 1COWA 2B8WA 2WZQA 5AJVB 1ANKA 4IFBA 3CR8A 4Q1AA 4R7ZA 2GBLA 2FPMA 4QM7A 1G1MA 1W4BA 4ZI2A 2EWWA 3GJ0A 2D62A 3C4JA 1TEXA 2HF8A 3GLHB 3OHMA 4B3GA 5CIQA 1II8B 1N6RA 4ZDKA 3TNFA 5TXGA 3VR4A 3G5UA 1ZAKA 2BIFA 4HUQB 4LBZA 4A6PA 1VIAA 3ZVNA 1Z22A 4B3BA 3ZQ6A 3C16C 4N0EA 3THYA 3QI2A 4HYYA 1BS1A 4TL9A 3IIMA 3B85A 3S1AB 1M1YE 3R8CA 4EAQA 1KTVA 3N5CA 1PLJA 3B9QA 1E9CA 2XX3A 1DG1G 1YRBA 4PC2A 3MD0A 4URWR 4F93B 4BZXA 2PT5A 2Z0MA 1KI2A 1G3QA 2EQBA 2GJAA 1U8ZA 1Z06A 4LV5B 1U8AA 3RHFA 1EG7A 2GTPA 3ZIAD 1NN5A 1H8EA 3AH8A 1Q21A 2ZETA 3E5HA 1OXSC 1GIAA 1W1WA 1AQUA 1E1RA 3LO5A 5FFMA 2B92A 2Q3HA 4TL8A 2AWOA 2OO7A 2RGEA 2G3YA 1B0UA 2F43B 4M9XA 2KBFA 3VAAA 1Z8FA 1L7VC 3QPWA 4LYJA 3MUFA 1OXUA 4FN5A 5TARA 5LPNA 4ZKDA 4LDJA 4WA7A 4NYMR 1KO4A 1XJCA 2W83A 2XTMA 3H1TA 1TTTA 2VHUA 1SKYE 4PPFA 1HUQA 1KK3A 4KFRA 3TBKA 1E99A 4Q9IA 4KAXA 2ZJYA 3LDAA 3KFVA 4JT4A 4OQMA 4TSFA 3GD7A 1VCMA 4DCSA 4QJ4A 2FFBA 5CM9C 3FFAA 1NLZA 1W4AA 2NO0A 3WNBA 4DCTA 4F4CA 1QHYA 3K09C 1XJ0A 5EXPA 4D26A 1CP2A 1QBKC 4JJKA 4QOSA 2PJRA 3P4XA 1G6OA 1Z2AA 5KNBA 3QUSA 4GMDA 1T0HB 5FPSA 3ZD7A 4PSKA 4MGKR 3QSYA 4RKFA 3T61A 3C5HA 1T9HA 1E98A 1KYIA 2DWQA 4MKGA 2REOA 4DLZA 1XXHE 2RMKA 2C99A 2CMKA 4D0GA 5KUTA 5GJWC 4LYAA 2F9LA 5LDDC 4KBFA 1IXRC 1BIFA 2ZRCA 1FQJA 3WRYC 1W7AA 1FFHA 4OI0A 1XD2B 3PJRA 2C78A 5DISB 5KO2A 4Q66C 3WYGA 1IN7A 2W2XA 3KKOA 1OIVA 1X8JA 4JVMA 1IXSB 5CLLA 3KUCA 4IOKA 4V0MA 3FB4A 4KITB 3ZS9A 4TL6A 1Q44A 2XJ4A 4FCTA 4DWJA 4EFNA 5KPJA 2XNDD 1TAGA 2XJ9A 3L8YA 4MH0R 1TU3A 1SGWA 1GL7A 1E9FA 2GHIA 1YZKA 4HDQB 1TF5A 1ZVQA 3IBYA 3LAWA 2BM1A 3NG1A 4MUAA 3MMPA 4KVAA 2RKOA 1CULC 4IW3B 4ZCLA 3K9NA 4FMCF 1T0JB 1KGDA 4DEYA 3KTAA 5FTNA 2ZRLA 3FGNA 2ODNA 5KHOC 2F7SA 2RGDA 2CCJA 1US8A 4E09A 2ATVA 3QY0A 2CK3D 4I1SA 2ZI7A 3BH0A 4LC1A 3UG6A 2ZANA 3AGPA 3AP1A 3W8NA 2NGRA 5F9HA 1UBGA 2FU5C 3EZ9A 1EESA 4NCKA 3HYTA 3Q72A 4Z51A 3DDCA 4KFUA 2OXRA 4A2PA 3WXMA 2G0TA 4M21A 3AUYA 2W6JA 3RC3A 3A1TA 1OHHA 3A1UA 3RLFA 1FX0B 3CPEA 3AGQA 2DFNA 1DS6A 5KNCA 3N2IA 3UPUA 3V4FA 4RD3A 1GSIA 2RH5A 5B30A 5BW8A 3R9XA 4QC2A 2DYKA 3B7GA 4PPQA 5C46F 2QBYA 4NYMQ 3AF2A 4CVNA 3VR5A 5HCNA 1D2EA 1PZNA 5E3HA 2A5DA 3B78A 3OEED 1LTQA 2AD5A 3PG5A 4UXHA 3DOFA 2QNRA 5AK0A 4E5UA 5CB6A 3DOEA 5BN3A 2QG6A 4GL2A 5IDVA 2P67A 1VG0B 3WHLA 2RGGA 2EFCB 1R10A 4F4JA 1KI1A 1CJKC 1G41A 2XAUA 2Q6TA 4JIMA 2GCOA 4FMDF 3BC1A 4MUBA 4XSHA 1G9XA 1RE0A 1OYYA 4H1VA 4AY2A 4GT1A 4EUNA 2GAAA 3DO6A 5JWHA 2VHCA 3QKSB 1XX6A 1RC8A 2A5JA 3RAPR 4DSOA 1E0AA 1GNRA 5FL7D 3BFXA 2IK8A 3D8BA 1ONBA 2ZYTX 4A8JB 1SKYB 1NJFA 4NU0A 3T1TA 1C1YA 1MOZA 2ZI5A 1A7JA 2ZJAA 5E4FA 3KUDA 4DT1B 1Z29A 1SVKA 1ESNA 2OBLA 3GQBA 1XRJA 3PUYA 1ZJ6A 4RSGA 1UDXA 4W9MC 2PCJA 3N70A 1DEKA 4LV8B 1NF3A 4MA4A 5TB5A 5KSOA 5FUWA 3RRYA 2V7QA 2NZ8A 1E69A 4JYCA 4G1UC 3LA6A 5F2EA 4IVPA 3DM9B 4Z1MD 2PT7A 3IPXA 2PLRA 4M1SA 4LJ8A 2DHRA 5FPTA 3A6PC 2ZIAA 3QF4B 4NHOA 4WBSA 1MH1A 1T5LA 3BFVA 4WXRA 2WVJA 4Z8YA 3MAAC 3RWOA 1W4RA 1Z0DA 4FWIB 4Q03A 2HJGA 4XD7D 2GCNA 2JCSA 1FMLA 3BH7A 3IO5A 2W0SA 1NNEA 1FOEB 2FEMA 3J81k 1L4UA 1P2VA 2N42A 1SXJD 1E0JA 4QGAA 4DLRA 1NSFA 4P32A 1Z0FA 4IDQA 4PR0A 5D3QA 3T1VA 2IXGA 1RKBA 1H8ED 4KJZA 2AFHE 1E94E 2C5LA 2PEZA 221PA 3RSOA 2PBRA 3U7GA 1W44A 3AB3A 3H2YA 2QENA 3TUJC 1TPZA 3X1YA 4B3XA 4LJ4A 5J4KA 5DO9A 1AS3A 1XCPA 4RZUA 5L3RA 1X3SA 5EE5B 2VP6A 1EXMA 1E2GA 3NHAA 4TWZA 2KWIA 1Z07A 2OLJA 4TMZA 2OM2A 1T3HA 1E3MA 4BLRA 3CB4A 2OBMA 4NBSA 4JYBA 1X1SA 2BKUA 4KODA 4WZAE 2IBMA 2WJVA 3BIFA 3NHBA 4QNRA 5FPYA 4MGIR 3QVUA 3CX6A 2QBYB 2HDNB 3V00A 1G20E 3CPHA 1KO5A 2BMJA 4QBHA 2PMDA 1I4LD 2CHGA 4DVGA 3FDIA 1CRQA 1XXHB 3GEHA 3FMOB 1Z0IA 3MWLA 4BE7B 3PUWA 2WSMA 5EP1A 5L3QA 1Z3IX 1HH4A 5ELXA 3QF7A 3X1WA 2D06A 4URYR 1NY5A 1M2OB 4PANA 3AV0B 3OESA 3WMEA 4EQ6B 1NMZA 5A0FA 1E9RA 4PO8A 1R4AA 2WAYA 3PITA 4US2R 2FX3A 4V0KA 4QHYA 4EPXA 2XXAA 3BK7A 1MKYA 2C96A 4IDOA 2ZRDA 1N6OA 3EPHA 3KJHA 1P2UA 1CR4A 3SEAA 2Z83A 1A2BA 1DTSA 4HZUB 1E32A 2WMNB 2RGNC 4BLQA 2GXSA 2KE5A 2QPAA 5DNYB 1XMIA 2YKGA 4UXIA 5CM8B 2R6FA 4LJYA 5AUQA 4Q1FA 2ZR0A 4XIGS 1NN3A 2OLKA 4PQFA 4PX9A 5E7JA 5JHGB 1TF2A 5FBWB 2A5GA 2WWFA 2ORIA 3EC2A 3K9LA 1YJ5A 4QL3A 4RY2A 1EFRA 3B8HA 4BFVA 2W6IA 4CEHA 1JXOA 4MRRA 2FFAA 2ORWA 3SHFA 4Q02A 3VKHA 4MYTA 1ESMA 1L8QA 2WWXA 2JLZA 3LW7A 1P9RA 1BMFA 1KNQA 3K9HA 4PC3A 2FF7A 1E9SA 3QXSA 1XNJA 4LOAA 1E9DA 2IS1A 2QRZA 3AKCA 2H16A 3IPYA 1XTJA 2G77B 5SZKB 2G0NA 4MDEA 2A30A 1CLUA 2V1XA 2GXUA 2JLXA 2LKCA 1W49A 2J9RA 5JWRA 2H5EA 2HCBA 3W90A 1QHHA 1V43A 4D82A 1P4SA 3CF6R 2MSDB 3S1AA 2GDJA 3LFUA 4R9UC 5AR1A 3IGFA 3B82A 2FNAA 2QMOA 5FOTA 3BORA 3SNHA 2XOKA 4DB4A 4P0TA 3A37A 1K5DA 1XD8A 1G8YA 3K0EA 2OILA 4TTQA 1JPJA 1U0LA 2A78A 1DAIA 1N6HA 3I32A 3RRMA 4QJ5A 4Q01A 3FKSD 3TH5A 2QTHA 2CJWA 2AXPA 2ZRHA 3EAQA 4LJ5A 2P2LA 3HPRA 4YDSA 4AYXA 3ZGXA 4DZZA 4WZ6A 2ZRJA 1FP7A 2GCOB 4D4JA 4QBGB 2B7BA 4BECA 4OHXA 3B1ZA 3KJEA 1E2EA 2PMKA 2VO1A 4GI7A 1GOTA 3CWQA 4B2IA 1G16A 4K8OA 4QHTA 2ZR9A 2QQEA 3D3QA 3FYHA 3CRW1 4DCUA 3K0CA 1W0KA 1QHSA 4US1R 1ZUIA 2H1LA 2D4HA 3TIFA 2WWGA 3X1DA 4Z54A 2WIBA 1U90A 1IN6A 4QBFA 2I4IA 3SDZA 2ZRMA 5DSZA 2WSSD 3DKVA 3GFOA 3E1SA 2X77A 4WW0A 3KKQA 1N25A 4R2HA 3MSXA 1HY3A 4BGDA 1W36B 1IN4A 2R9VA 2OAP1 5DHAA 4BLOA 3A4MA 1UBCA 3VR2A 621PA 2J45A 4M22A 1QHGA 1AZSC 4MQBA 1UPTA 1VDZA 1Z6GA 2VPPA 2CLDX 4QKQA 2QGNA 2O5VA 2Q3MA 3AF0A 2CNWD 2ZU0C 4ABYA 4C0LA 2YOFA 5KDDA 4Q1EA 5E95A 3L0OA 4CIDA 1X8LA 1ZM9A 1P9NA 3AP2A 1M8PA 5CJPA 5HKKA 2CLCX 3HR7A 2WICA 5FI1B 1ZC3A 2WWIA 4N1AA 2XTZA 2O8DB 5FL3A 4I4LA 3B1WA 4G5SA 3L82B 2ANBA 4IDHA 2ZEJA 3EW9A 5E7IA 4D0NA 3ZS8A 3OAAA 1AS2A 3GLFB 2QTVB 2HYIC 3DEFA 4LCBA 1NKSA 4NP6A 4PO1A 1X86B 1UBEA 1ZP6A 2CJWB 1ZM2A 4TL7A 4QFMA 5CB8A 5G41A 4Z8XA 4M4SA 1H65A 5DYIA 3VHXA 5HR5A 1Z28A 3DHWC 3WBKA 2V6IA 3ETLA 4P4UA 4E07A 4C0AC 1M74A 4LHXA 2ZJZA 1NBMD 1JAHA 3ASZA 3LW8A 1DE0A 4II7A 5FTKA 5JJLA 3BOSA 1AZTA 2C9OA 1GTVA 4M1TA 5P21A 1XD2A 4QJ3A 1OFTA 4EFLA 1E79A 2NTYC 2J0UB 4ARZB 3U60B 1P73A 3OAAD 1OH6A 4IKEA 1GUAA 1QHNA 5CDFE 3T5GA 4UXJA 5M04A 3NEYA 3I3SR 4JZKA 5SZJA 4B43A 1LFDB 1W0JA 1KSJA 3EG5A 3OFNA 4AG5A 2F1JA 4NH0A 2YVUA 2FSFA 2R62A 1UAAA 3THXB 1BKDR 1IXZA 3ND8A 3Q9LA 5FI0B 5K8TA 3VFDA 4EJSB 4FCVA 4LPSA 1JEEA 4HZIA 5EE9A 2HT6A 3DKPA 2ZROA 4LHYA 2IEZA 1FQKA 2X2FA 4JMPA 4MKHA 4KXFB 4HLDA 1KK0A 4MRNA 4C4PA 4YMVA 3VU9B 3F5FA 2EWVA 4RD0A 3WNCA 4RFSB 3NTUA 4A8JC 1G8HA 2YWFA 1CKEA 2WJGA 4NPHA 1KMHA 4F38A 2HCJB 5AUPB 2O8EA 4OHZA 1R0WA 2QA5A 3GJ4A 1PUIA 5GADl 1F48A 1QVRA 2JJ1A 5SZIA 1J70A 1N6IA 1J8YF 2GK6A 5FOVA 5KYKA 3KTAB 2NIPA 4JSYA 1S96A 2O0JA 1HE1C 2G1JA 2ZSAA 4G3XA 3NDBB 4IFEA 4C2TA 2G6BA 4P4SA 5CDFA 2BVNA 3OIYA 4N0DA 5EQTA 4DEXA 4IEIA 2WSSA 4GZLA 4PAOA 3NDPA 1YZNA 1AQYA 1I2DA 4W5WA 5BYKA 2KBEA 3TAHA 4ZDJA 2XZOA 1XEFA 1R2QA 2HT1A 1JB1A 1Z6YA 3LWNA 5H1YA 1IN5A 2GEVA 1DARA 4QXAA 5FUYA 2JJ2D 1ZC4A 4M1YA 4LUCA 5HCIA 1KI4A 5D3MA 4OHYA 3OIUA 2P65A 2Q9CA 3T35A 3VR6A 1ZNZA 5TV2A 2LWIA 2VSXA 3RC8A 1G3MA 3UKDA 4AWXA 2ZS8A 4M9SA 2I3BA 2YHSA 1E2IA 4FINA 3KX2A 2ERYA 3BS4A 5J40A 5LB4A 2ZJ5A 5DI9A 3AP3A 1JR3E 3P1JA 1N6NA 421PA 4M1WA 1Q20A 2GKSA 3THWB 1J90A 1AKEA 1II9A 4PC6A 4Q7LA 1G19A 3MWYW 1KO8A 1II0A 2I1QA 3KKMA 3NBFA 3MCAA 4RD1A 1G8PA 3V9PA 1BO6A 1EFUA 3ONWA 3REFA 1GWNA 2CE7A 4NL4H 4DSTA 1KI6A 1HE8B 2ZRPA 2BCGY 4AG6A 1GVNB 2YWHA 3IEVA 3IHLA 4RZ3A 3ICQB 2QE7A 3I1FA 2REXB 2QROA 3TLXA 5KNDA 1P72A 4JKYA 4IRUB 2WTUA 1OF1A 1XZQA 1TQ2A 2O8FA 1NG1A 1NKTA 3QBTA 3RWMB 1E2QA 4Q9JA 4RFVA 4ARZA 2ZRIA 2P5TB 3P32A 1I2MA 4DSNA 5EJEA 1NRJB 1BMFD 3W5IA 4BEBA 2EYUA 1S1MA 3VKWA 2UVQA 3KKPA 4KO8A 4Q48A 3U3OA 3GLGA 1US8B 2AFIE 3SU8A 4C3ZA 2JGNA 1XU4A 2FZ4A 2GJKA 2R2AA 2R6CA 4MYCA 2JJ8A 1IY1A 1NMYA 2IWRA 3LV8A 1GITA 2J59A 2QEQA 2ZSEA 3SS8A 3X1ZA 1BH2A 2FSHA 4CDGA 1VKJA 3F8TA 3EARA 2J0VA 4MKIA 5TDHA 3EIQA 4CGZA 4Q4LA 3MJHA 4UNQA 2D7DA 4I1UA 3ZQJA 3HR8A 2G88A 5AUOB 2IYQA 2EFEB 2X19A 3K53A 1CJUC 5LD2B 2JIZA 3KFXA 1UKZA 1ZD8A 2ZE6A 3L43A 3AVVA 4Q47A 1DAKA 3T15A 3U6KA 4TMXA 2FSGA 3BBPA 1XP8A 1YZUA 3A1VA 3T1QA 4G01B 1GZSA 1N6KA 2ZJBA 3THWA 4LHWA 3BH6A 4RZXA 4LC0A 1OT3A 2C9YA 2GVZC 2IUSA 2P5SA 5A5GA 3WBJA 2WM9B 3GJ8A 1PUJA 2BJVA 2EFGA 2F1HA 2XZLA 1CJTC 2AWNA 4M0LA 2OFOA 3B1VA 2DPXA 2GJ8A 1ZM7A 2H17A 2YWGA 5TVKA 3BGWA 3WYAA 3GPLA 1DG3A 2F6RA 3PUZA 2JLYA 5CK4A 4A9AA 3A1SA 4DIEA 1G17A 2XTNA 5FOWA 3GJ5A 3X2SA 4GOJA 1G7CA 5JEEA 2GILA 2V54A 3VTKA 3IQWA 1SVIA 3IIJA 1ODFA 2O8BA 4LK2A 3NVAA 4DUGD 2P0EA 1IM2A 4HB0A 5G3YA 4DSUA 4CEIB 3TMKA 1LW7A 3PEVA 3R7WB 3KZ1E 1E2FA 1VMAA 1G8FA 1KSFX 3I8XA 4A15A 2F9MA 1MABB 5EP2A 3TE6A 3UMSA 4V0NA 5JRZA 2F43A 4MITA 5B58C 1OIXA 1OH5A 2IYTA 4JSTA 3TR0A 1R8QA 4B3CA 4B48A 3K1JA 1P75A 1I4DD 4YMWA 3BJIC 4FW9A 1SXJE 2Q3FA 1VG1A 1Z08A 1A5TA 3QF4A 4OQNA 4Q4HB 5FBRB 1S8FA 1LNZA 2QGZA 3NKVA 3K9GA 4V0LA 1OLOA 1KOFA 2GAOA 1YZQA 3K70C 2AK3A 1JJ7A 1JAIA 4Q5IA 5LBIA 2DBYA 5HZHA 2QORA 3HJNA 4HB3A 2H7VA 3LXXA 2XEXA 3EZ2A 1T8UA 4NKRA 2QY9A 3CRRA 3FMPB 4P4SB 5GVRA 3SYLA 5AJYA 3U2QA 1QHXA 2BDTA 4XTCS 3VMFA 3ADDA 2A5FA 1Z2CA 4BFXA 1UEJA 4ZIRA 2OCBA 2Z4SA 3L0PA 4TZ6A 2R6DA 4DLUA 3ZVRA 4B33A 3ZYCA 2X8AA 5G3ZA 2VEDA 3GLIB 2FPLA 4PPGA 4IXNA 4B75A 3EWAA 5DE3A 4AI6A 1NVUQ 3SJCA 1U0JA 2O8BB 3KB2A 5FBVB 4L9SA 3OFND 1DELA 4C0HA 4OHWA 1CIPA 3QBVA 1JBKA 4EPWA 3QKRB 1F2TA 4TLCA 4ESVA 2GJSA 1F60A 4Q1CA 4W7SA 4Q4AB 3O8CA 1VIYA 2QP9X 1II8A 4HSEA 4Y0AA 3REGA 4B3FX 1E79D 2WOOA 4DLVA 3U3JA 3OE7A 4L15A 5LD2C 3QXXA 2IYRA 3R7WA 1CRPA 4A0HA 5EZ5A 4BFUA 1O3YA 4G5RA 4W5JA 3L8ZA 5F3WB 1NBMA 1J2JA 1VPLA 3TVDA 1SHKA 4FI3C 4DDVA 4MRSA 4QBIA 2HF9A 1RJ9B 3EPLA 3CONA 2B8TA 1KDOA 3P4YA 1KO1A 2AD1A 1R5NA 3CRVA 2F3RA 1F6BA 1N0UA 1GL9B 1KAOA 1KHTA 1ELOA 2J7KA 3LLUA 1M7GA 5JJKA 2NPIA 2OCYC 2WKQA 1N0VC 2OESA 1IJFA 1XCGB 2J7PA 4TYWA 1TF7A 4POAA 5FTMA 2QU8A 3LH5A 1VCOA 3WHKA 3MFYA 2DR3A 2W6JD 2WJYA 3EA5A 4H1UA 4LPKA 3T06B 2J0SA 3BE4A 1Y3AA 3ZVMA 1G5TA 3QG1A 4L4UA 2QL6A 3C15C 4WZBE 5DH9A 3JVVA 2XB2A 2TMKA 3UMRA 2PEYA 2NQ2C 4C0JA 5CIWA 1KI3A 1U98A 4JBXA 1KJWA 2CK3A 2GEDA 5LB2A 4EJSC 2B7CA 3PR1A 2BBSA 2ONKA 1CTQA 1F2TB 2WOJA 3RVBA 4A92A 1VHTA 1ZUNB 3A1WA 5FOXA 4M2LA 4O0MA 2PX3A 3AVYA 1E9EA 1WRBA 1E4YA 4ESHA 1A82A 4NZYA 1NG9A 4BLPA 3A58B 2HLDA 1AM4D 1JR6A 4AYTA 4BEJA 2IW3A 3OZXA 1CU1A 1D8TA 2BBWA 1CS4C 2IXFA 3UATA 2ZITA 3QKRA 2AK2A 2XNDA 4P33A 4HLUC 5HZKA 4B32A 1ZIOA 2REBA 3KXIA 4JLOA 4JVSB 1W36C 1GNQA 4KFTA 5EE0A 1MR3F 4DBLC 1PLKA 1XZPA 3TUIC 1IBRA 2O8CB 3W9YA 4KLNA 4DT1A 1N3BA 4AK9A 3U7HB 1IY0A 1E2JA 1IN8A 1OB5A 4B35A 2QN6A 1R0ZA 1AIPA 2EFDB 2J0UA 3UXMA 1DO2A 1OFIA 1UJ2A 4ASUD 4YXWA 2OBNA 3IEUA 3FKSA 3F0TA 1T6NA 4FIDA 2QMEA 3W3AA 3VNUA 1A4RA 1IJEA 2ZI9A 4WOPA 5JRJA 3U3KA 3CZQA 1ZNWA 1RRFA 2OXCA 1HURA 3RDPA 1A2KC 2RGAA 3UWOA 3SC3A 3GLHE 4IOJA 3SN6A 4B6FA 1V5WA 3FMFA 1XTRA 1P62B 2GWHA 4V0ME 2JLVA 4IOMA 3QKSA 2X1VA 5KSZA 4KLZA 1Z6XA 4X8OA 4OI2A 721PA 3THYB 3VX3A 2C2HA 2A2ZA 1T3SA 2VA8A 3AVOA 2QTFA 4LX0A 3QIAA 2ERXA 3AQ4A 4U7DA 1FPMA 4BQSA 2N1BA 2P6RA 3CRQA 3Q5EA 4NONA 1G3RA 1TQ6A 1ZM4A 5JSZB 5DLQC 4RFSA 2W6ID 3BXZA 4TT3A 2J41A 2Q9AA 3CNNA 5FTJA 3CRMA 5L3SB 1VYUA 2MSEB 4JL6A 5J4YA 5IRCD 2FMXA 2MMGA 2YNMA 4C0BA 1VG8A 3JVUA 3T1OA 5DN6D 4C2UA 3B1XA 4LJ9A 4F92B 4NE2A 3DL0A 1IAQA 5B64A 4XOIA 2WAXA 4TQAA 2ZRKA 3K70D 4HEJA 4BFYA 3H86A 1W5TA 3D7MA 1JQJC 3CH5A 3SE0A 2GBLC 1SVLA 4EPRA 4ZI3A 3CNOA 3ECCA 1YR8A 2QT1A 3M6AA 4URVR 5KPDA 4UNRA 1HQYE 1DAMA 1OXVA 5G40A 4L16A 1ETUA 3HPQA 4BLTA 3HU3A 4B2LA 5JCPA 1Q57A 1NVWQ 5J5CA 1KZGB 1DAGA 4AKHA 3AUXA 4CEJB 1XWIA 1G6HA 2BEJA 2RHMA 4P31A 2QT0A 2H8KA 2QMUA 3HU2A 4BFTA 5CLQA 2AL7A 2A9KA 1DVRA 4QGHA 4B73A 1NLFA 3WRXC 2ODBA 5EP3A 4GBMA 1LVGA 1KNXA 2CCKA 1JECA 4OI4A 3P20A 1COWD 1F2UA 121PA 1SVOA 4C7OA 4CT4B 1Z83A 4XVRA 2W2TA 4HLQB 5H68A 3ZZTA 1YR9A 5CYPA 2DFTA 4C0KA 1X6VA 4D4MA 1G5PA 4WAUA 1QVAA 2RHDA 2DB3A 3TAUA 4O2RA 4JLPA 1ZNXA 5FBQB 5UKDA 1ZD9A 1U2RA 3GJXC 1N6LA 1CR1A 1RVDA 1R5BA 2HUPA 4RZ2A 2ZSBA 4V0OA 5IT5A 3RYTC 5DN6A 1E2LA 4IDPA 1HQCA 4RKEA 1KY3A 2PZGA 1E2HA 1N5IA 2JA1A 4FCWA 1NIJA 4PZZA 4TMWA 2WKPA 4UJ3A 3BAFA 5FH9A 4XD7A 5G53C 1GP2A 2KSQA 4O3MA 2H57A 1D9ZA 1LF5A 2ZAOA 4NYIQ 2FWRA 3RS0A 1Q0UA 3RRZA 4A4DA 4A82A 4B71A 2OFWA 1SVSA 2AHOA 4G5GA 1Z6AA 3BWDD 4GSYA 4RD2A 3U5ZB 1QG2A 3K0SA 3M4YA 4IOLA 2VRWA 2IHYA 1VYVA 4CEHB 1P61B 4HB4A 4L5BA 1OXTA 4NDZA 1JR3D 4DDTA 4LYHA 1UBFA 1W48A 3GEEA 2G83A 2QI9C 4Y0VA 5FR1A 1EWQA 1KIMA 2CHVA 1FX0A 2RGXA 2OEPA 4RVCA 5D3MB 1YHNA 2V7QD 2ZJOA 5FPKA 1NN1A 3C7KA 1S3GA 4JBWA 5A4JA 2ZRFA 1KMHB 1VYTA 4LYFA 3H0KA 3QKUA 1F3OA 4LY6A 3T5DA 4I99A 1E96A 3SBEA 2C8VA 2YZ2A 3W6PA 1SKQA 1SHZA 3EXAA 1XMVA 2IYUA 1ZRHA 1T91A 1TX4B 4HATA 4AURA 1S9DA 4M8NE 3R9WA 4OL0A 3CNLA 3V4RA 2OT3B 5CK5A 5FL7A 1UM8A 4OK3A 5KOYA 1FZQA 1QZXA 4B34A 3AVTA 4HI0E 4YXWD 5KDOA 1LS1A 4ASUA 1VG9B 2BWJA 2CVHA 4D4KA 1ZBDA 3KB1A 3N2EA 1XDBA 4DLXA 2ZQ5A 4UKDA 5JHHB 1WE2A 3ND9A 4QNMA 3AVPA 4P4TA 5L8VA 3PV0A 1NJGA 1Z0JA 1E1QA 2I1VB 4XSGA 1SZPA 4TYQA 1YR7A 5E7MA 2VQSA 3CX7A 4IJMA 2IL1A 2A5YB 3LD9A 2ECKA 5JMTA 2MMCA 4AKGA 2WIAA 1DOAA 2V4ZA 2YOGA 1AGPA 3B5JA 4GPTA 1KMQA 3KQKA 3H4MA 4R2IA 2QSZA 2F1IA 3C14C 3CW2A 5EE1A 5B2ZA 4CRWB 1N0WA 2VF7A 2V1UA 4TTPA 5GJVC 2O8CA 2QAGA 1M7HA 1G4AE 1E6CA 2HLDD 2WMOB 2JLUA 1XTIA 5HTKA 2ZYVX 5JEDA 1OV4A 3BB1A 5IHPA 2IC5A 1KK1A 3SR0A 1U8YA 4PC7A 3GLGE 2ODEA 4LWZA 2ZXUA 4TYYA 3FWYA 1P2SA 2IYVA 1Z5ZA 2HJVA 3TUZC 4DJTA 4ILEA 3H84A 2G1KA 2H92A 1Z47A 2RGBA 2GF0A 3FTQA 3NIBA 2BMEA 5AJWA 2NMVA 5BQ5A 2ZYUX 1WDTA 2C04A 1MO5A 2FN4A 3FMIA 4IVRA 2ZAMA 3GJ7A 3AF3A 5EZ6B 1EFTA 5TY0A 2WKRA 1IQPA 1XF9A 5JBQA 1GFIA 2QZ4A 5HE8A 1HV8A 2EU8A 2BBOA 2D2FA 1T5IA 4KSBA 5FR2A 3WY9A 4EDHA 5JI2E 2A3RA 2XGJA 1LS6A 4HAUA 1KSHA 5L3QB 1ZCBA 2J7PD 4PO9A 3LNCA 4C30A 4Q1DA 3AM1A 2IEYA 2F1RA 1DO0A 2WHXA 3I8SA 4XWAA 3AF1A 3UIEA 1G64A 3RS5A 1TMKA 4PSAA 2VP0A 1P6XA 4NYIR 3EX7C 3C8UA 3UK6A 1ZM3A 2PZEA 1NVVR 1S0UA 1XB2A 3TW8B 1YE8A 4J0QA 1XBTA 1SVMA 2JAQA 3K8YA 4IEEA 2FOLA 4HDOB 2GA8A 4AC9A 4BUJA 2ZRBA 1FW6A 1E9AA 2C03A 1XXHA 1QF9A 2CXXA 1NP6A 3HWSA 821PA 1MO4A 5FTLA 1ZIPA 3C5CA 2GCPA 1ZNYA 2DY1A 3IKJA 1N5LA 1Z63A 3PEWA 3X1XA 4ZCIA 2NZJA 1GRRA 1F2UB 4JJZA 5F9FA 1JEDA 2ZR7A 3IILA 2OV2A 3UANA 3KQNA 3DMNA 3GLGB 3CZPA 3CPJB 3MGCA 1EX7A 4OJKA 5J4LA 3SJAA 1IY2A 4JLMA 5F98A 3ADBA 4TLEA 1KKLA 2VP5A 2P6UA 1W2HA 3IQXA 4NCHA 4M1OA 2OCPA 1GL6A 4NCIA 5HKKD 1D9XA 3CUEF 2OSBA 4KV9A 3K09A 4LZZA 1W4CA 3RRNA 2FFHA 4TSFD 3LBNA 4AD8A 2C9CA 1ZINA 4B44A 1NL3A 1G7TA 2BMDA 4PAMA 3TKLA 1GKIA 1FUKA 1UKYA 4QRHA 1FNMA 2Q0HA 3R20A 3BD9A 1U99A 5DIFA 2JASA 3SFZA 5K8IA 3I5XA 1RW4A 5CYOA 4PFSA 1YZLA 1OH7A 2JDIA 3JZMA 2O0KA 4PC1A 1E1RD 3I72A 4MGZR 4FMDB 3TJZA 4EPTA 5K8UA 2CE2X 2VBCA 4QHSA 4PPNA 1PJRA 1ZCAA 2W2VA 4B47A 3RANA 1FMJA 3ZDQA 4Q19A 4JVNA 2Q9BA 4JLBA 3PFIA 2L0XA 5FUVA 4B6EA 1OFHA 1Q3TA 3ADKA 3CBQA 1GAJA 4DUGA 1KZ7B 4IVQA 1Q22A 4DKXA 3K0CC 4DXAA 4G5OA 4HUQA 4KFSA 1P9WA 3Q7PA 3KXLA 1E2PA 1G18A 4LGMA 2G9NA 4A6XA 3LBHA 1N5JA 1D5CA 4U5XA 1MV5A 4KI0A 4X8LA 3RS4A 2ORVA 1D6JA 3GLFA 1CBUA 2BJWA 1K5GA 3D6TB 4UNPA 4A0FA 4RJLA 3EA0A 4XVUA 3ZZ0A 1LB1B 2GXQA 2ZE5A 4DB2A 2YC2C 2RGNA 3I61A 1K6MA 1Q1QA 1W5SA 2OFXA 3NEJA 4O2LA 4LI0A 4MDFA 2OZEA 2IYZA 4NTZA 2YOHA 1T3LA 4DIDA 3CF0A 3U3RA 2C77A 3RSLA 3AEZA 3A4LA 4U00A 5IK2A 4AYWA 4BFZA 2IS2A 1OYWA 5L3SA 4FXPA 2AKAB 3LVQE 4B76A 3K70B 2QMHA 2FFQA 4M9QA 1U94A 2NG1A 5J47A 4C0QC 3CO5A 1QG4A 3LX8A 3U44A 4D2IA 3DM5A 3QENA 4ZDIA 2F55A 1Q1ZA 2HXYA 3FHTA 2YC4C 1AJEA 2V9PA 3LY5A 1N2CE 1GG2A 1N6PA 3TW4A 2DCUA 5JS7A 1E4VA 1G21E 1JQLB 4NMMA 4QGGA 4A1FA 4EKDA 1CR2A 2K5UA 1LY1A 4ITRC 1RIFA 3EWSA 3AVWA 1NSTA 1TL7C 3MRSA 4NCJA 4TT3D 2DFKB 3TRFA 1AKYA 1JNYA 2R65A 1TUEA 5H8WA 2B21A 4GDFA 2H18A 4F7WA 2Z5FA 1H8HD 3EPKA 1NVXQ 3SQWA 4TZ0A 2VP4A 2DFLA 2ZE7A 5DI3A 1LV7A 3THXA 3KQUA 1G7SA 3MWJA 1FTSA 4GRAA 2BKEA 1XEXA 1XTSA 1UEIA 4JLJA 4HAXA 3RABA 2HXSA 1KY2A 3JZAA 1IONA 2X2EA 1G3UA 1WQ1R 3TSWA 1VECA 3O47A 3VU9A 1RFLA 2D7CA 3SI7A 2IYLD 4B2PA 1AGRA 1BOFA 2FGKA 2QE7D 4JS0A 4ERNA 3QOFA 4TTRA 5EUQB 3ZJYA 4OKSA 3LQQA 4XVQA 3RS7A 3GEIA 2BV3A 1R5OA 3QQ5A 3ASYA 1TU4A 4CEJA 2XB4A 5FBLB 4I1VA 4RD6A 1GKUB 1SQ5A 4YONB 3WMGA 3ZVLA 4D6PA 2WWWA 5EXSA 4LBVA 1QRAA 1XPOA 1OIWA 1PV4A 2FZLA 3HP1A 3NH6A 1KI9A 1QHHB 2IHBA 1XD9A 1FTNA 3QXCA 5CJ2A 3QEOA 4I81A 2IS6A 3SHWA 1C4OA 1NMXA 2IYWA 2CEAA 4DHEA 4EPVA 3PEYA 4AKIA 4LSGA 2VSFA 3CR7A 5ANRB 3T34A 4A0GA 4MRPA 3AKDA 1GM5A 4HAZA 3WP0A 1XJQA 3GFPA 2NPFA 4N3NA 1DAEA 3LLMA 2ONJA 3B1YA 2W58A 3B60A 2JJ2A 3FE2A 3IDQA 2GJ9A 5FOSA 2IF0A 1EFCA 4C0SA 3CF2A 2QM8A 3GJ6A 3GLIE 1G4UR 2BOVA 2CL7X 2R8RA 2WJHA 4ZPXA 1M7BA 2XXAB 1KJZA 3A4NA 3Q8XB 4D81A 4PQRA 2J3EA 3CM0A 2V55B 1U9IA 3HDTA 3OEHA 1OSNA 2VF8A 3NWJA 3B13B 2UZIR 2XITA 3BB4A 3SOPA 4LV6A 2FG5A 2RAPA 3WNDA 3EIEA 1GNPA 1KI6B 1NIPA 4TN1A 2WPDD 5BYJA 2GVDC 3IBGA 2IX3A 2HYDA 1QHIA 1CR0A 4PHFA 3W3ZB 3ZH9B 4PZYA 1YZGA 2ZS9A 3AKYA 2V6JA 3OIVA 4I1OA 4ZKEA 3EZFA 3P27A 2VHJA 2LCFA 4B74A 3UWKA 1M34E 1G8GA 4UQOA 1T4GA 1XCMA 4LRWA 1AN0A 1WCV1 4TLDA 4Q1BA 4TMVA 5HE9A 2J1LA 1XTKA 3AVQA 4CYMA 3VNVA 1ZUHA 2ZRGA 4OK6A 2W0MA 3QE0A 2BC9A 3U7FB 4XJXA 2YWEA 3W5JA 1SXJC 2ZU6A 1OKKA 4YMSA 1NN0A 4PAQA 1XEWX 2VHTA 2WBLC 3M0EA 1JJVA 3DVLA 4OI1A 4BZPA 3BERA 1XMSA 2XSZA 2Z6VA 2HEIA 4Q18A 2BM0A 3KQHA 2ZJ2A 4MYUA 3VHLB 3QJYA 4TYPA 1AA9A 3OE7D 2QQ0A 3M1IA 4GMXA 1W36D 2CL6X 3DZ8A 4ACAA 1S1CA 1OKKD 3B2EA 4C7OB 1E0SA 2NO7A 2IUTA 3IUYA 4RCZA 1U0HC 2GESA 3SZRA 2ZI6A 1HA3A 3ZLJA 4OQXA 1WP9A 4S35A 5EXTA 1R7RA 4KYIB 1OH8A 2DWPA 3U44B 1J99A 3MWKA 4A2QA 1E2MA 5K8LA 4K46A 1P7CA 2J5XA 1KDRA 1D2NA 1S4QA 2ZPTX 3LX5A 4A36A 2CDNA 3ADCA 1S2MA 1ZW6A 4O25A 2CNWA 3K0AB 4Q4HA 3NH9A 1L4YA 2WPDA 4Q4JA 4KU4A 3GCGA 2OE2A 3IHWA 2JLQA 1Q1BA 3KXKA 4PHHA 4HB2A 5EP4A 3R9IA 2VLIA 1TQDA 2ZE8A 4PHGA 4A8JA 4TYNA 2FDCA 3DZDA 3GJ3A 4CEIA 3LVRE 6Q21A 4JLVA 1KSGA 3VR3A 1DPFA 4OBEA 4JLKA 4UNNA 2JLWA 2RCNA 4FMBB 4IXMA 4JL8A 1G3IA 5GJCA 2EW1A 5AWFC 4WIAA 4HAVA 1CF4A 3QXJA 4D0LB 1O87A 1XPRA 4FD2A 4PQYA 1MRNA 3TK1A 4RCYA 4YDHB 5FUXA 4OHVA 1W0KD 1YQTA 2WJIA 2ZS7A 4HAWA 3B6EA 2FA9A 4BFSA 1M6NA 4PHTA 4FMCB 3EIHA 3KJIA 4FWTA 2ZVQX 2ZRAA 4M1MA 5KSYA 2BBTA 3U6BA 2FJUA 1YU9A 4LHZA 1FL9A 3ZD6A 4CZ2A 1OPXA 1Z6TA 2PZFA 2EYQA 3PXGA 4BASA 1PLLA 2R44A 3C41J 3GMTA 4NYJR 2FE4A 1TEVA 2WWHA 2WWYA 2FPKA 4DDWA 4S2EA 4YMUA 1FUUA 2GK7A 2NO1A 2XNSA 4ZIRB 1J7KA 2VTKA 3FHOA 3KKNA 4LJ7A 4XWKA 4BPBA 1D2MA 2C95A 4V02A 1KDPA 1E9BA 1YR6A 3OIWA 4WVFA 3MLEA 2AKYA 1F5NA 4W5HA 3SJZA 5JCZA 2XOKD 5TMPA 2VP9A 1Q1EA 1IOZA 1P5ZB 2PLFA 5B57C 1FNNA 3FVQA 1MO3A 1FP6A 2CCGA 1C9KA 5EE3A 2EFHB 2IXEA 3QPUA 5KSPA 3G82C 2R6AA 1P60A 2VYFA 4OK5A 2GETA 1OW3B 4OYHA 1OJLA 2GNOA 4BWYA 2VIIA 2HV8A 4KYUA 2QSYA 2CL0X 4L8GA 5BN4A 3EPJA 1WMSA 1X8KA 4LBYA 1NLYA 2QAGB 3NXSA 1H8HA 1I4TD 2JIZD 3K0FA 3SYNA 2GF9A 4M53A 5JJIA 4V03A 2ZUBA 2IT1A 2PH1A 1EFRD 4BZQA 3K0AA 4UJ5A 1XEXB 2ZSFA 1U81A 4YLGA 1KO7A 1UKVY 1JI0A 3IO3A 4OQLA 3I73A 4HZUA 4Q9KA 1Q3HA 1A1VA 2JEOA 1TNDA 3TVTA 2KJQA 2XZPA
chains in the Genus database with same CATH superfamily
2J46A 1ZUNA 3GXBA 1CUEA 3AK4A 2GZHA 3O4GA 3ROZA 1RXIA 3NX4A 4UM9B 3TIXB 2IYOA 3VKVA 1PUXA 1M8GA 4HC4A 5LDGA 1J8MF 2HJHA 4M1KA 3ZQ4A 4WOJA 5J2TA 1PSWA 4XIJA 2JFBA 3F2VA 2NU7B 5KX5A 3O0DA 1U7DA 2LUOA 1HE3A 1P2TA 1J49A 3R7FA 3G23A 3O8BA 3DTTA 3HFJA 1WSBA 3R3XA 3ASUA 3ABIA 3TPCA 4XPIA 3RF6A 1MVNA 1EA7A 2X0NA 3KPUA 3HWRA 3C1AA 3QLTA 1ZEMA 521PA 2GGSA 1EP2B 2XBUA 4AW9A 4V1CI 3QFHA 5HBGA 3KD3A 5E0KB 4L9WA 1PNRA 1JLMA 4TQ9A 3RGWS 1V3QE 1PTJC 1Z8DA 3AF4A 5IAKA 3T5TA 5AUNB 1NATA 3IELA 1QFYA 1ZJYA 1Z2EA 4O3FA 5FEUA 2B2CA 3A31A 3BPSA 2ZBFA 4PLVA 4D92A 1W88B 2VNIA 4QO8A 2FZVA 4NU8X 4BAGA 4KEAA 7AT1A 3RG8A 4CLOA 3V46A 3TO5A 3TLJA 2P7IA 3KU4A 3LE8A 1EIZA 4E2ZA 5C8VA 1BQ3A 3PEUA 4JOSA 2YMMA 2DCMA 3EZ6A 2BTQA 4U9HS 2B1JA 4XH9B 3RSZA 3LBIA 1M0SA 1H3NA 1ZMTA 3IVRA 3MTBA 3D3JA 3UC9A 2DLDA 3IQGX 3TLKA 4AKEA 4M7PA 4AMGA 1YCFA 2CWWA 2DC1A 2J9YB 4L4YA 2HCFA 3QXHA 2A9JA 2C57A 2PAFA 1JXMA 4CHGA 1O6CA 2BFNA 3E9CA 1YBMA 2JIPA 1CVLA 1F2VA 3G2KA 4X3CA 5F1PA 2FI1A 3T5PA 4N39A 5AVWA 3P9SA 1HDGO 1RYFA 2DBQA 3CWZA 5E7QA 2PFKA 5JSHA 5TSDA 2OZPA 2FN3A 4MUEA 4QQFA 3RKSA 4MGIR 3IULA 3KZOA 4Z3DA 4C4SA 1QAOA 1S9HA 3TRKA 3WMFA 3MOSA 4KSCA 1P74A 1K88A 2WFMA 2QM3A 4H0FA 2P9GA 2Y1FA 3EG9A 5HGJA 1VGVA 2AX3A 5FI3A 4PV7A 3ZUGA 5BNZA 5C51B 2H2WA 1Z45A 1XFDA 3A9UA 2XKKA 1LSUA 1J25A 3PQCA 2X8WA 2JFPA 2QD1A 1R0XA 2X0KA 3KDSE 5DI3B 2D13A 2EBHX 4V24A 3RGGA 3ANTA 3L2OB 4C5CA 4NAUA 2WU4A 4URXR 3P0FA 1WBDA 1MO6A 3F5QA 3MJFA 1CUSA 1EGAA 1OXXK 2X4LA 3ZWQA 2XQGA 3CZ5A 3E3OA 2XF2A 4ZCMA 2ZVDA 2WU8A 3G8BA 3U4QB 3ZHUA 2EGUA 4L0CA 5LZ4A 5FPHA 1NA5A 4G0MA 4OREX 1V4VA 3WQSB 1Q1GA 2GTHA 1KKMA 4S24A 5KTKA 5CB4A 1KY5A 2ZCUA 4RH1A 4AMVA 4TV9B 5I4KA 1B93A 1ZH0A 1LX7A 1HQDA 3DMTA 3ZZMA 1N2JA 5TMEA 2HWUA 1Q0PA 3AX6A 3R8FA 4GOKA 2QTVA 1W0JD 3FI0A 2I6FA 1VI6A 1WA5A 3I5AA 1CE8A 3F9IA 4NBVA 2N47A 2XDYA 5F7JA 1MT0A 4MI1A 3RS3A 7ADHA 1UQUA 2G9VA 4P98A 3UC5A 1CD5A 3BMOB 4HDCA 1ZD1A 3ABRB 1L8XA 1GUDA 4E2FA 4KZPA 3U56A 2FGJA 1MXHA 3U3XA 4DM4A 2ZYWX 3TDMA 4KLAA 4C4TA 3AKEA 3D1VA 4QGFA 5KDLA 3O4IA 1X1EA 3MT8A 3TDNA 3E70C 4EW1A 4NMWA 5H3CA 1JKJB 4DR6B 1YC5A 1W47A 3GLFE 1U2GA 2Y8EA 3ZOKA 3UK2A 2E87A 3MWGA 5EYPA 1THZA 4YYZA 3OHPA 1YSCA 1N2CA 3V4VB 4D8TA 1J0DA 1U0BB 1O77A 1Z33A 2FW9A 2HBZA 1GVHA 4R2XA 4LE1A 2BCEA 5EMNA 5A62A 3UT5B 4FEYA 1JTEA 1E2NA 2Y3IA 2VCHA 3DMYA 4J0HA 5IUNC 4WLEA 2NOAA 2FY8A 3WKEA 1B2RA 1YACA 1W88A 1YQXA 1MC1A 3BDVA 2ZRNA 4KQIA 1HR0B 3QVTA 5EUBA 5T7BA 1EFHA 3H9CA 4IIGA 2VJMA 2F90A 4CIAA 3CH4B 3UOGA 3PXUA 1EK0A 2WUEA 3GVXA 2ZUVA 3VRHA 4E11A 1OYOA 4KWHA 4G0PA 4D3XA 2GEKA 3PRKE 3D64A 5LQSA 4JC8A 2ZTUA 1MJFA 3RTAA 1P17A 2P0AA 1EXWA 1T8TA 2JHCA 1QYXA 4M0MA 2RB4A 2C5GA 1Z4KA 3TPFA 2OGZA 2PR2A 5ES3A 2BP7A 3M5PA 1E6EA 3F71A 1BXGA 2Y0DA 1DMRA 3R40A 3SF0A 3KQLA 1AF4A 4B7UA 4MYDA 1RCFA 4TXNA 4HAYA 4BFWA 4PTLA 3UZUA 2Q99A 4YBRA 3KYDB 3RTCA 3T7TA 5C1BA 4XQ9A 2GXAA 3H6KA 4F1JA 2OAQ1 4GOXA 1Q12A 5C0OE 2H59A 5K0TA 2WQZA 3DCIA 2A0UA 4LRQA 3E8XA 1GZVA 4R83A 3OPYA 1V37A 1HDIA 2ZM5A 4J90A 2HK6A 4KN6A 4KN9S 1RQLA 2KPOA 3QKIA 2R85A 4EHAA 5IJ9B 4RKQA 4N0MA 4JVLA 4EJSA 4F2PA 1KI8A 3UCFA 5AVKA 5BUCA 5I7WA 4R7GA 3FZGA 1SG9A 1UKEA 2WV7A 1NVVQ 2WYHA 3PXCX 1RYYA 1QQBA 1Y8QB 3PCRB 3KAQA 3SJBA 3WL7A 3GRFA 3L1JA 5JYEA 4DCVA 2IUYA 1M66A 5LDHA 1GGKA 3SIXA 4TMTA 3LKVA 2Y1DA 3O84A 2QVCA 1VHWA 1C3VA 5LWHA 3K96A 3NBZC 1NYQA 3MJRA 1K27A 1X7DA 1USUA 2EG9A 3SXJA 2FP4B 3LPDA 5GONF 1PS9A 3IIKA 4YJ2B 3U16A 4Z2YA 3AM4A 1WTCA 4BLSA 2BFBA 3OF2A 1UXHA 4AB1A 2PZAA 4X45A 1W25A 4TQUS 2IITA 5JANA 2JATA 3J7AC 3HJCA 5ALWA 2E4UA 2YV5A 5IN4A 4IHQA 2E9SA 2PA3A 3CXRA 4DGQA 4HWGA 3ZDBA 1MN6A 2E3JA 2W2MA 2C0CA 3TSCA 1E2KA 3EIFA 4YQFA 1ESDA 3VC3A 4Q3DA 1JFFA 3LG2A 4WZBB 1EB8A 1SOWA 4LHEA 8OHMA 1DJMA 2FPIA 2P3LA 3AFMA 2YJTD 3TSZA 3EASA 2QZPA 1XNGA 1Y0BA 3C97A 2GHQA 2O1SA 1FYFA 2G67A 3C43A 3KLBA 4IUDS 4L1KA 1E66A 3PDIA 4BP1A 3GLHA 3SFTA 4B8YA 2JGLA 3HVRA 4NCNA 4K81B 3QU2A 1NXSA 3QFRA 4CQLA 2JZOA 1Z2PX 1ARZA 2IYYA 4FHFA 1F1BA 3UEOA 3WIOA 3A1DA 3UAOA 3GBPA 4BNDA 4EEXA 4EFMA 3P26A 2ZWAA 4KUGA 5KTYA 1QF6A 3GZ4A 2VF4X 3PXEA 1UF9A 2J3IA 4KRXA 4A0RA 3R7BA 2ADMA 3DDHA 5BV7A 6YASA 3SQLA 4QXRA 2Z5VA 3U61B 5TQVA 1TZBA 3E2PA 1A8SA 1KDTA 2QN9A 3EC1A 3EVEA 5HF6A 3P9RA 3PENA 1DRJA 3NZEA 3BB3A 4D02A 2GZAA 3FKQA 1LPAB 4UNSA 4C6HA 4M0KA 4BMSA 3O4JA 3RNLA 4H6WA 3JQ9C 3M83A 3DT6A 3E8MA 3GRCA 1P91A 1WUTA 3L4SO 3LT5A 1CY2A 2A9QA 4HWKA 4QJBA 3PPYA 3RBAA 5TRTA 3BZUA 1N5KA 2V0NA 3KWFA 3B52X 4ZOLF 1E2UA 1UJ5A 3LIIA 4Z1OA 2YCBA 5IZCA 1UPBA 1WUHS 1NRWA 3SVLA 4E5DA 4DMCA 3B1JA 5IWAB 4RTRA 3HGQA 3SXUA 4CF6A 1G291 2ZUDA 3R74A 3OI7A 1H9BA 2JANA 2XIQA 2EJVA 3PRJA 3WAKA 1E5DA 3ZIAA 2ECQA 4P8RA 3DAPA 2HNBA 2Y1XA 2QLFA 4PSVA 1XAIA 1X92A 3CNBA 5JUWA 4UC0A 4IV0A 1GPNA 2PA0A 1N5RA 4G85A 4OB8A 4I9UA 1VPTA 1KPHA 5B7NA 3RK4A 4IDDA 4Z4GA 1RWBA 1GAWA 3FBGA 3IAFA 2GPSA 1MV8A 4IFBA 2G28A 3WB2A 5CBPB 4YRJA 2PTHA 5MF6A 4BY9E 3E0XA 1MP0A 2D0DA 3N7AA 4RY8A 1OZ0A 2O7RA 3C4JA 1PV1A 1S2DA 1TEXA 3GJ0A 3OHMA 4X9XA 4B3GA 4IIFA 1GEGA 1T2AA 2A84A 3HCEA 2WZDA 2EP8A 2XRFA 4UUOA 4C4ZA 1VIAA 1WPGA 3P9PA 2ZWOA 1Z22A 5JS6A 4KR6A 4RM2A 4Y6LA 3ICCA 3QHPA 2FQXA 4ZRMA 3THYA 2QUHA 1B15A 2VVTA 3O1IC 4HYYA 3ZHOA 1H1LB 5CXQA 1GTG1 1FDIA 1RPAA 2HEGA 3IIMA 3PKIA 3B85A 3G0OA 3PNVA 4BMYA 1S01A 3JAWB 3ZE0B 2YW9A 4C6TA 5LYYA 4EAQA 4Z9YA 1ULUA 1DG1G 4HRXA 1YRBA 3CLSC 4YAUA 4MVJD 4URWR 4ZICA 3MC1A 3CVYA 4FKZA 1VL5A 2Z0MA 1K4KA 3G68A 1G3QA 1UZAA 1QPZA 3ZD8A 3HVIA 4B3JA 1SZJG 1U8AA 1UQRA 1WXIA 4UFPA 3W5DA 1EG7A 4BO0A 4H60A 2XYPA 3LY9A 1Q21A 4K6FA 4MI9A 1OGYA 4RF3A 1GGJA 3S2SA 3HA2A 2PKRA 1XALA 1LV8A 4C7XA 3WGLA 1X38A 4B4WA 3EXFA 2ZJ7A 4WLVA 4O1HA 1NW3A 1A98A 3A2LA 3P96A 2W70A 2G80A 2NYVA 1QF7A 2F43B 2YXBA 3E5NA 2KBFA 3VAAA 3QPWA 5EJ5A 5JR3A 1W94A 1ZGHA 1N9ZA 4CUJA 3MUFA 4CFSA 4FOPA 1JSCA 1ZVKA 2IODA 4WA7A 5AH0A 4RXUA 3UO8B 1J2RA 1A72A 1ZGJA 3KWLA 4YQYA 4PSDA 4EL0A 2W83A 3ZCXA 3SX0A 2GNPA 4IIJA 3TBKA 4C5AA 4ISBA 1E99A 1JHDA 1E1YA 3CTMA 2R4UA 4DCGA 1K6XA 1WKBA 3PDHA 3GA0A 4OQMA 4FGZA 4TSFA 2JFQA 5BR1A 4DCSA 3NYIA 4UEWA 5CM9C 3EDOA 4N01A 3WNBA 4F4CA 3FPJA 3LPAA 2O3TA 1XJ0A 3UNXA 3UB3A 3TD6A 3W9BA 4D26A 4JJFA 2PJRA 3PD1A 1GTL1 3RAJA 1Z2AA 1LKZA 5KNBA 1UJ4A 1ADFA 3QU9A 4GMDA 4KMSA 1PJCA 4PSKA 2J48A 1OU4A 1YBHA 2AW5A 4JWKA 2Y05A 2J67A 2YJ5A 4IQ4A 5FULA 3T61A 5B12A 4IXDA 2Y0BA 5BN5B 4DY4A 1WL8A 4MKGA 4FC6A 1V7PC 1EJ2A 2ASVA 4DLZA 3TG2A 2RMKA 1N2EA 1DJNA 3NWEA 4MVCA 3HDYA 1D7AA 1YB4A 1XVUA 2HWKA 3EVFA 5DX0A 5JJBA 5AVYA 1EP9A 3UK7A 5CLGA 4ZAFA 3D81A 4MQLA 5ICFA 4RHUA 3I6QA 4LY9A 1BIFA 1CJBA 2QS9A 3DHEA 3I34X 1W7AA 3N07A 4OAOA 1XD2B 1BC5A 3DFIA 3KSUA 4M8SA 3WGJA 4BC0A 1RZVA 1M6EX 3AB8A 4I4IA 4C01A 5KO2A 3W77A 5G1NA 1IN7A 1SC1A 4UUAA 5CLLA 1IXSB 4PLWA 1JKMA 3KZNA 3PE6A 4TL6A 2BFDA 2CB9A 2QQGA 2XJ4A 3I0MA 4FCTA 5GY7A 3DZJA 5AXAA 3PZBA 1XUOA 4I7EA 4MS3A 3L8YA 3GUUA 2HB6A 4KE7A 2BGTA 3FDFA 4AY5A 4MH0R 2XGSA 1IZ9A 4J0JA 2UDPA 3ML1A 3WLQA 4HDQB 4ENTA 4YJ2A 2NUBA 2XWPA 1UK6A 4MUAA 4C6TB 4B5KA 3MMPA 2XE4A 1P7VA 1TI7A 1CULC 3MB8A 2IV7A 1T0JB 4KWCA 4ZZIA 4D74A 3HA3A 4Z4HA 2GT1A 1ATIA 3ZR4B 2ODNA 2QTAA 1EM6A 1C30A 2DHQA 3DCJA 3UCXA 1H42A 4NENA 5H4GA 1US8A 4YP6A 3SKVA 3QY0A 2XT0A 1V96A 3VAZA 1VRCA 4I1SA 1ORWA 2PX6A 3UG6A 3AOGA 3M70A 3AP1A 1KQNA 1ZHHA 2FR8A 5F9HA 3ORRA 1W5EA 1FCJA 1NOIA 2GEFA 4IEFB 4D4HA 2I2FA 1L4GA 1TFRA 1VPVA 5K05A 5LLDA 2JLCA 1JG7A 2E6UX 4DWVA 4Z51A 1Q92A 2FPGB 4MV6A 3RYFA 1K7SN 1PFQA 3ESDA 1O0BA 1QR6A 5JMWA 3DZGA 4PGFA 1B6SA 1UWKA 1HFJA 3L0DA 4KQ1A 1GNSA 1WHTB 4RKWA 3WK9A 1MF7A 1OHHA 3A1UA 1TC1A 4RVOA 3RVRA 2DUJA 3WGIA 2AKEA 2ZZMA 3N86A 2HGZA 3PFCA 1YMQA 5EKXA 5G1OA 2DFNA 4M87A 3H9GA 3OQOA 2PU5A 4L28A 4R1LA 5KNCA 3QMMA 1VE9A 4BYGA 1MAAA 3CXUA 1GSIA 3E9MA 3G0CA 3HSYA 4F3RA 4BVBA 4E70A 3F49S 2A88A 3D7NA 4I50F 5BWOA 5BW8A 1Y5RA 3VNSA 3A7DA 3R0JA 5C46F 5BSRA 2PZ8A 4KIUA 4GMHA 5K8JB 1Z36A 5E3HA 1JIIA 5AK0A 2PS3A 3GHHA 4JHLA 1Y3HA 4UU7A 4Y9RA 5CB6A 1FEZA 2X3UA 1ESCA 2MYNA 2PT6A 3CW8X 3IOBA 4NMLA 4AUNA 1HT0A 3MMNA 1FFDA 2ZG6A 1A95A 1VG0B 1GNVA 1I5OA 1RJGA 1T1GA 1U9ZA 2HQRA 2RGGA 3NIGB 4IJ5A 4X1IB 1O6FA 4X54A 4BO6A 3RVLA 3T6KA 2XAUA 1GZ6A 1IATA 2CVPA 1VDMA 4FMDF 1G9XA 3H1PA 1OYYA 4HWOA 4JKOA 5HF5A 2FZWA 4H1VA 4GT1A 3L1HA 2GAAA 3DO6A 4ID3A 5JWHA 2C61A 2B69A 4B0OA 1E0AA 1MJNA 3NIFB 4S05A 3D8BA 2IK8A 3MUNA 4IIYA 1NJFA 2J4CA 4NU0A 3WHPA 4BYMA 5CFNA 3DB2A 2BGMA 1A7JA 3BMCB 5LMNB 4OV6B 1ESNA 3PUYA 2BW0A 3OFKA 4JA2A 1KOGA 5K45A 3GCZA 4W9MC 2PCJA 3OIFA 4WLFA 1SAYA 1NF3A 4MA4A 2ZYGA 5FUWA 3DFKA 4QPZA 2B4QA 2Q27A 3H8VA 4JYCA 3OU2A 3E53A 3HV0A 2PYZA 5HKAA 4QEKA 3W78A 3RIHA 2FDXA 3V3KA 1UBMS 4JLWA 3A6PC 2BZSA 2LNDA 1QQTA 1QV9A 3I12A 2AOUA 2HLHA 2GVNA 1T5LA 1G5HA 1ZI9A 1WY5A 4M55A 4JH0A 3E22B 1OWNA 3BFVA 4Z8YA 2NVUA 2HD4A 3IAXA 1L7AA 3ADPA 1AHHA 2Q4BA 1W4RA 1M6VA 2I1WA 1ZJJA 4J6FA 3IO5A 2JCSA 3BH7A 3QEKA 1RD4A 2DJ5A 3MCZA 2RKBA 4XPIB 1VLLA 1P2VA 1W4ZA 2JA2A 3CF4A 4KWEA 4QGAA 5G0UA 5CB4B 4YALA 1NSFA 4DV5B 4D3YA 4DABA 3RRFA 3L8EA 3DOOA 4N7JA 1R66A 2RHLA 3L7BA 3LA8A 4IDQA 3BK1A 3JQ6A 2IXGA 3TNYA 1BA3A 4Z2AA 1BWRA 4KJZA 4PG7A 1E94E 2PMFA 3Q8MA 4Z9AA 1SU8A 2FPGA 4ALLA 4NBNA 2Z8YA 1VGRA 3ZTWA 4LJ4A 1KARA 5DO9A 1AS3A 3BIWA 4M0CA 1E3TA 2J6HA 1NXTA 1BDIA 2VP6A 3NGXA 4Q3NA 2V65A 4TWZA 1ZJZA 4IS3A 4TUYA 1Z07A 1Y5IA 2OLJA 1ECPA 1T3HA 2BKXA 2P90A 4KWTA 3LI2A 5KAPA 3C3AA 1I9GA 1IY8A 3CB4A 3FNRA 1QNFA 4A10A 2EARA 1X1SA 2BKUA 4GPD1 2YS7A 4KODA 4OM7A 3BIFA 5FPYA 1T0IA 3QVUA 1GFWA 3BSSA 3K1AA 2VAWA 3PWZA 5K7SA 1O95D 3T0IA 3CVVA 2JD1A 2PMDA 3QLEA 1I4LD 4L0DA 4WQMA 1R4NA 3FMOB 4OUDB 1LRLA 3HJBA 3T7IA 2G7ZA 4B46A 5FQOA 3EFOB 4YR7A 3UMYA 5I7HA 3GRZA 4E4TA 2A7XA 3ZLUA 3DOJA 4PANA 5F78A 2GKGA 1N8SA 3E9RA 3INRA 4E5MA 4U7GA 3ZHSA 2XVMA 3GFSA 4RXTA 5IHXA 1P5JA 2FX3A 3OO0A 3BWVA 3SQMA 2XXAA 3U81A 3BK7A 2C96A 3WWZA 2OPHA 1VL8A 3MK31 2ZRDA 1I24A 3DE5X 4WXMA 1T1RA 1C0EA 1CR4A 1LU9A 3GPDG 2WMNB 1NVKA 2GXSA 2QPAA 2WKSA 4BLQA 2Q3DA 5DNYB 1VI5A 5JO0A 3OZSA 3L0ZA 5CM8B 2JAWA 3OP1A 1RWPA 3QFCA 2WR8A 5GAJA 1CY4A 1SO8A 2C92A 2OLKA 3CGWA 3G6KA 2CMGA 2Q1UA 4RJJA 5E7JA 2MINB 4DMHA 5FBWB 2A5GA 2SICE 3WKAA 3EC2A 5D5PA 3K9LA 4QL3A 2AI1A 2IP4A 4LXGA 3B8HA 3D6UA 1JXOA 2FFAA 5EI5A 3V97A 2JIRA 4YJGB 4MYTA 3I37X 4XGIA 1L8QA 3C8ZA 4YB8A 3V7FA 3WL4A 1BOOA 2OTCA 1LJLA 1KNQA 1P9RA 4OMFG 4PC3A 1Y8RB 1E9SA 4BQIA 2A6PA 3LT0A 4RK0A 3CEHA 3OA2A 2DZDA 3GRKA 3I9JA 3IV9A 3OJWA 4A8HA 3WI7A 4BV9A 1XTJA 4LZOA 2G0NA 2Y4OA 4MDEA 1MNAA 4IJ6A 3WVNA 1U8XX 4DAEA 1EVLA 1W49A 2HMAA 4MS1A 3KKLA 2HI0A 4ETNA 3W90A 5T4HA 1QHHA 1U8CB 2G71A 2IEGA 3IR7A 2Q1WA 4LDZA 3FOCA 2PUGA 4A7PA 1P4SA 1Q5PA 2PD4A 3A3YA 3GAZA 1YIAA 1ZJ4A 3E1GA 4I6GA 4R9UC 1Z8NA 5AR1A 4UTVA 2FNAA 2G6TA 1VSBA 2YV4A 5E2AA 4DYHA 4DB4A 3GUVA 3TNDA 3A37A 3ISVA 4IHKA 3HBMA 1XTVA 3VDXA 5CA1F 4TTQA 4Y2VA 1U0LA 3RRMA 3BEDA 3I32A 4R2LA 2Q5HA 4Q01A 1PYDA 3M8KA 1UMBB 5K3OA 3RYIA 4MP6A 3QEAZ 4G0OA 2YRWA 3OWXA 4LF4B 3HPRA 3GDOA 4XPZA 4YDSA 3THSA 4AYXA 2ZYRA 4F86A 4WZ6A 2J3KA 3KTOA 1ORRA 4HGQA 2GCOB 3E15A 3S2UA 1O4VA 2IZZA 2VAPA 3OECA 2B7BA 3HZRA 3P71T 1RWMA 1GPLA 1HYHA 1ZLYA 2CFRA 2E0IA 2ZJ6A 3K0HA 4OHXA 4XQ0A 4BECA 5LNK1 2I6SA 2W43A 3GDFA 3KJEA 4P84A 4PRZA 3U5TA 2VO1A 2ZYAA 3H99A 5DNUA 3VR6D 2C5EA 3CLTC 2W4MA 4C0WA 3P9NA 1GUZA 2GD0A 3OJXA 5IBRA 3SAJA 1TM4E 4DARA 5EIWA 3IPRA 4OKIA 3UAVA 4JC5A 1M2JA 4F8JA 3QVKA 4Z6KA 5TQJA 4AX8A 1VKOA 4N5NA 4B80A 3R5JA 4US1R 3X1DA 1HLFA 3EGEA 4H4DA 3I9OA 2O2ZA 3RJZA 2ZTMA 1KERA 1UJNA 3A9SA 3FCEA 2AN3A 4GM1A 2HHLA 4QBFA 1PG5A 2HV9A 3MGAA 1GV1A 3GFOA 2JNWA 3E1SA 3Q3CA 2MYPA 3KKQA 1U3CA 4UQPA 2M32A 1LBEA 1HY3A 2BFAA 2BZ1A 3FF4A 3IUEA 2OAP1 5CFQA 5DHAA 4AQ7A 3FZNA 4K1LA 1QHGA 4MQBA 2BMWA 4M0PA 1GYQA 3BMNA 1UPTA 3SIRA 1VDZA 3JATA 1Z6GA 1O54A 3JD1A 2X0RA 4RMJA 1IZ8A 4YGYA 3SD7A 4L51A 5CW2A 2YQ5A 1BDBA 2I0FA 3AF0A 3BTSA 4MVJP 1A9ZA 3UQYS 5KDDA 3LGAA 2I78A 5E95A 3PSHA 2X6RA 2HF2A 3KQPA 4FSXA 1JFLA 5IT9A 2V7EA 1X8LA 4R1QA 4II2A 1AH2A 3AP2A 5LQDA 4P2BA 3WMRA 5M2QA 1PE0A 2WICA 4TRRA 2O8DB 1KZYC 5G4LA 3L82B 1L1FA 4N3BA 1YRQA 4D5GA 1TEHA 2ZEJA 2DWUA 2HY7A 2Z5LA 3ZS8A 1OGIA 4GZ6A 2PVCA 4YO7A 3L7MA 4DMRA 1LLQA 7GPBA 3GLFB 2QTVB 3F78A 4EX6A 1U8FO 1XVTA 3P94A 1X86B 5SV2A 3GV0A 2B7LA 3V2UA 3FPKA 2H08A 2O3SA 1UJCA 2Q6VA 4QFMA 3UGKA 2X8LA 2C31A 3HVJA 4Z8XA 2O06A 5CB8A 1Z28A 2XOXA 3NHZA 4P4UA 4QE3A 3T9EA 3WBKA 4W5TA 1M74A 4LHXA 4XCVA 1TJPB 2MR5A 3ASZA 3D4OA 1GCGA 3F1KA 4ALIA 4JJ7A 2C9OA 3OOEA 1GTVA 5AESA 5P21A 4HQ6A 5LVAA 1Y8ZA 1OFTA 3AESB 4EFLA 2DQYA 5AHOA 3WR5A 1ADBA 1MHPA 4EI2A 1CVRA 2OZLA 3G1UA 1XTUA 3U60B 2ZSHA 1BZYA 3OAAD 2TYSB 3GJTA 4IKEA 4Y2YA 4CDNA 1UPXA 3B7WA 1P0MA 1YQDA 1XMPA 1U8TA 2Q2OA 3FTNA 5DHPA 1IPEA 3T5GA 2JEYA 4YRNA 3NEYA 3EGVA 2D1QA 5HX7A 4PZPA 3PF9A 3UJNA 5DGDA 1LFDB 1W0JA 2WNIA 4AG5A 2K6GA 4F6RB 2F1JA 1FJGB 1D07A 3ZU6A 4G2NA 2WJPA 1W6UA 4EZIA 2A4KA 5G0WA 4Z3OA 1DIHA 3M5WA 1JEEA 1YDHA 4J4BA 2ZROA 4RU1A 4MRNA 4YMVA 4HLDA 1P1IA 3HCAA 5DM1A 1RKQA 3FPEA 3FHLA 1VJGA 3O93A 3W6OA 4A8JC 3NTUA 3OLWA 4QU9A 4DW8A 5E7MA 2CEKA 5ES4B 1P7ZA 4OHZA 4DZRA 1RLOA 2PQ6A 2I5PO 2HPVA 1LRJA 3GFGA 3GJ4A 1F48A 5GADl 3MWFA 4GR4A 1OI2A 1J70A 1OXKB 1J8YF 5FO1A 4E2WA 1Z2NX 1V6AA 2L18A 4G0QA 4JXJA 3RQSA 4W5QA 4JSYA 4AZTA 1EZ4A 3C3CA 3F7MA 3DJYA 1VC2A 1IG0A 2LZ0A 3NYRA 2BVNA 1WD5A 2W8BB 4JQZA 1PQWA 2E5WA 1NI4A 4M89A 4H4EA 3UTDA 2WSSA 1PJ8A 1GD1O 1IEWA 3FWHA 3FZQA 3I64A 1NRXA 4D3ZA 4W5WA 3GGPA 1D4FA 5BYKA 1E3WB 1E6LA 1U1FA 3ENNA 2J07A 3LC0A 3LRXA 4I14A 5FQNA 4COOA 4QOEA 5HGXA 5GINE 1P3DA 2GEBA 2VT7A 4LZWA 5I8PA 2X42A 1I30A 5FUYA 3WB1A 3RR2A 3MBKA 1UJBA 2I99A 2P9CA 5D3MA 1RHMA 1JP7A 4H1TA 2ZBGA 1SWWA 5EIEA 4WNIA 2A67A 1ZNZA 5TV2A 1NDQA 4MR9A 4CR8A 3RC8A 5EZYF 1MJGM 1IEXA 3DEZA 2E55A 4KXXA 3BSWA 1MVLA 2D54A 2JBAA 1PR2A 4JLUA 4M9SA 3KX2A 1M9NA 4BN4A 2QRVB 4FGSA 2FRXA 1VKZA 3GIWA 1T8YA 4IKOA 1OFGA 1J9ZA 2AYZA 5DI9A 3AP3A 1JR3E 3CVWA 1N6NA 1W8IA 421PA 1YFJA 3JAMA 1UOQA 2LVBA 1XQ6A 4UVIA 1H4TA 1U0GA 1ID1A 1YS7A 4XEHA 1AKEA 2PD6A 2PNFA 4BIMA 5I7SA 4HNAA 1BJRE 2PUEA 1VBMA 1G19A 1QWOA 2Q46A 4AJNA 3MWYW 1TIPA 3SOZA 4PG5A 5ALEA 2OZLB 5B1EA 3E5MA 2XRZA 1X1CA 3QEMB 1S2GA 5CA1A 1L7PA 1G8PA 2ECFA 1IH8A 4EY5A 5JALA 1AQNA 2JRCA 1EFUA 3ONWA 3DAHA 3L84A 3D1JA 1HOXA 2C3OA 4NL4H 1XZBA 2IOQA 2BCGY 2RK4A 5C8YA 2CMDA 3V7NA 5JVDB 1GVNB 1KZ9A 1ZD5A 4KKXB 2ADOA 3IHLA 4RPHA 4ITUA 2V4UA 4K9RA 3ICQB 2HSZA 4FS8A 1OVGA 3U4AA 4P36A 1L5MA 2BMAA 3IC5A 4BJ6A 3N7TA 3SR4A 4Z86A 4XFJA 4FDAA 2LRHA 2PMWB 1P3Y1 3C7DB 4R5HA 1ODLA 1P72A 4RF2A 4IRUB 4XIFA 3IOMA 1C4KA 2IXTA 1PJAA 2BZGA 3NP7A 3ORSA 1NG1A 4MMZB 5U4QA 5KNLA 5A4MS 4ARZA 3P32A 1JHRA 5FBZA 4DSNA 5EJEA 2BN4A 3HLYA 3JD0A 3UA4A 2DF8A 5EEGA 3R8XA 2R8PA 2XMCA 1S1MA 3KWMA 4MUMA 1VMKA 3M1AA 3VKWA 4LTNA 3GLGA 1US8B 2XB6A 1TM5E 4L7VA 3Q3GE 4NJEA 4C3ZA 3TOCA 4DTCA 4BTLA 2FZ4A 2GJKA 4UEOA 1KC1A 2UYOA 1A76A 3ZXXA 5J2UA 1NMYA 3LV8A 1QKIA 2ZSEA 4KWIA 5LXTA 4EHKA 4HTAA 4EKNB 1MTOA 2BF4A 2G9UA 4LGCA 3IQHX 4CGZA 1I3CA 3NHLA 3UKJA 3BZBA 5GTDA 2WTBA 2D7DA 2YMPA 1J39A 4PSUA 3ZQJA 2VAXA 4ND8A 4U2CA 5LBTA 3N74A 3JD3A 5B53A 1CJUC 4MARA 1AXEA 3KFXA 3OT1A 3IB3A 3T4PA 1GQOA 1YJBA 2ZE6A 1OZAA 1OLSA 3EVTA 3AVVA 1VMDA 1DAKA 4TMXA 2FSGA 4S1OA 3BBPA 1XP8A 1YZUA 1FNDA 2ZTVA 2GK4A 3IEIA 5M3BA 1KGSA 4JUFA 2X9NA 5DNWA 1I4OA 3THWA 4OU5A 5TE9A 1F8UA 3BH6A 2CLLB 4GPIB 4N49A 2JVKA 1L4LA 4D3SA 1UK7A 1DQNA 1NI4B 1ZO8A 4LC0A 1G0OA 5K3SA 5KNDD 2P4UA 4Q34A 4ARUA 4NE7A 1UC8A 4PYNA 3GJ8A 1KZ1A 3L49A 1C7EA 1TO2E 2F1HA 4PY2A 1R3DA 4QQRA 2NQ8A 5EERA 4LF7B 5J9FA 3H2GA 3VC2A 2AWNA 4M0LA 1RADA 2TMYA 2YHUA 2DPXA 1XLVA 4IX9A 1Q84A 1VL1A 2GM9A 2BRUC 2H17A 3HFRA 5TVKA 5JLAA 3JR7A 3L1IA 2FPRA 3JZDA 3NT5A 3Q8WA 2BE9A 2JLYA 2HK7A 4A9AA 3VDNB 2GJ4A 5JVDA 4NC9A 2ZXFA 2QN7A 2N75A 5FOWA 3F73A 3D3WB 3QGMA 5EL0A 1BU5A 3EDYA 3GG9A 3LY8A 2WIGA 2JS7A 5L3ZA 4KDEA 1J5EB 5MDHA 5EMMA 1SXHA 5DCUA 4B4KA 2OYSA 2GILA 1SKUA 5JEEA 4KGXA 1T1EA 1W85A 3HDGA 3IQWA 3KPYA 5EIBC 5E6RB 4DPLA 1SVIA 2O8BA 4OGLA 5CFLA 1T3GA 4LK2A 3SXPA 4FB4A 3W1WA 2IV3A 3VISA 3QRWA 4HNAB 4URHA 4ZEOA 2D59A 3KZ1E 1VMAA 4MV9A 1G8FA 1MA0A 2BSXA 1JAXA 4H16A 3BMXA 5DBHX 2AMYA 4MEJA 3DV0A 1L6RA 3UMSA 1YZVA 4V0NA 4B31A 1AA6A 1X87A 2C0QA 1VPEA 2H1IA 5B7GA 4LF8B 3QTLA 2Q3LA 3T0FA 1ML4A 1FVXA 2PFSA 4TTTS 4B48A 1P75A 1NXOA 3SX4A 4AKTA 3LDGA 2C2GA 1DBIA 4QPPA 3D6AA 3MJSA 2IKSA 5EUCA 1EIWA 5K20A 1VL2A 5JBNA 1ZAYA 2NWQA 3R44A 4F4HA 5HIAA 3EC7A 2Q50A 1A5TA 1FFXA 4Z53A 5AW7A 3F8WA 4PTZA 3AR8A 2AOUB 4QRDA 1K3TA 3TSYA 2ON6A 4BLVA 3NKVA 4V0LA 1H1DA 3T3HA 1KOFA 4ZZ2A 4HPJB 1X7YB 3S2IA 5BR8B 1HE2A 1ZG3A 3QUAA 2NUPB 1JJ7A 2GR9A 5JCJA 5C31A 2HQ1A 4Y8VA 1QTQA 2C9MA 2QORA 1CZKA 3LUDA 2H7VA 3MYRA 5HS6A 1T8UA 2VXYA 4LXIA 1LI4A 2I4RA 3CKKA 4LNUA 5BV0A 1KWKA 2XLCA 3ELYA 3O4RA 1JLRA 2YMLA 4P5DA 3W5SA 1FLAA 1R4ZA 1K7YA 3WV4A 3ZUPA 4BFXA 4ZIRA 4UUPA 1HNWB 2R6DA 3NNDA 3TJMA 5F7OA 1B8VA 1WXHA 2YBEA 3JD4A 3ZYCA 2V6MA 2FPLA 1PFGA 2OXFA 3UKOA 1USVA 3EWAA 4YUXA 5DM70 1NVUQ 1KVUA 1YK1A 4NXNB 4GWKA 1L7BA 4OP3A 2BONA 1T8SA 3KB2A 1JKXA 5FBVB 4L9SA 3RTBA 5CAEA 1XQ1A 5DOZA 4OHWA 4UUNA 1LDGA 1OOEA 1SCUA 3QBVA 1KFCB 1PG0A 3WL3A 3EPPA 1F2TA 1MMFB 2WFLB 3DEYX 4GVLA 4GU5A 4ZWNA 2VQEB 4MS3B 1BE1A 3COJA 3S28A 1UFVA 3OM8A 3Q41A 2RGRA 4D8YA 1II8A 1AKTA 2VRCA 3OU7A 4HSEA 1M73E 2DR0A 3N2NA 5HOEA 4B3FX 2RH4A 4X3PA 1ORDA 1PCXA 1RYNA 3G5TA 3GP5A 3LK6A 5ELMA 4EGSA 2PSJA 2WABA 2Z3VA 2LV8A 5EZ5A 4A0HA 1F8YA 1O3YA 2BL4A 4G5RA 4KDCA 1QHEA 3UMCA 5F3WB 2XB8A 2QW1A 2FFRA 1SHKA 5K8VA 1Z0SA 1RAFA 1UPUA 3DDNA 2D2XA 4MRSA 2HF9A 4G9BA 2GN9A 2PZLA 4HWRA 3HNOA 4LI3X 4UEQA 2C8LA 1O9BA 1CSEE 5GM1A 2B8TA 1H0HA 4HDKA 2FYTA 3CRVA 2F3RA 4BB5A 1GL9B 1P8JA 3OZCA 1KAOA 1KHTA 2Q2VA 1L3BA 3A10A 2C84A 3IAUA 4XCQA 5JJKA 1XRSB 5IJ0B 4Z0HO 2OCYC 2ICAA 2R79A 3CEPB 4BPRA 4C4YA 2H1SA 3L07A 5LNK6 2FEPA 1VJ0A 4QECA 3USCS 1M76A 4RORA 1TF7A 3EEFA 4KHPB 2EEPA 3KVRA 3O8OA 1EQ2A 1VCOA 4NICA 5I3CA 3X44A 3FROA 3RODA 4IG4A 2VZ0A 1Q6ZA 3EA5A 4LPKA