2NO1A

C4s dck variant of dck in complex with d-dc+adp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
240
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords deoxycytidine kinase
publication title Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 240
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2no1A00
2FGJA 3FMFA 2ANBA 2OUKA 1F2TB 2O8BB 2HYIC 2H17A 2QE7D 2YOGA 1G3UA 2X8AA 3LRPA 2HCJB 2ZRJA 1ZBDA 5K8LA 2Z43A 1P2SA 4EDHA 5FUVA 1G5TA 4URYR 1Z0AA 4TYQA 1ZC4A 2ZREA 3R9IA 1Z0JA 2JLUA 2RB4A 3T35A 3EWSA 3TW8B 4DLRA 2JLZA 1SKYE 1YVDA 2QT1A 1E9DA 3T34A 4XOIA 4O25A 1C4OA 1E2FA 2V6JA 3VR3A 2WWGA 5FOVA 4I1UA 3GLIB 5EJEA 3OEED 3T1TA 2GBLA 1L7VC 1KO5A 3G82C 2J0UA 1DAKA 1XEFA 4PC2A 2FV8A 1FOEB 3FMIA 4B35A 4BFZA 5BQ5A 3H84A 3R7WB 4PPGA 1E69A 3PEVA 3U7FB 3B2EA 2FSHA 2BMFA 3H2YA 1DG3A 4RKFA 4C2TA 1NSTA 2NMVA 4P32A 4KITB 2GJAA 1YZTA 4GOKA 1P61B 3BBPA 4IKEA 4LBZA 4GMDA 1TU4A 4URXR 4LI0A 4NYMR 1NVWQ 1XD2B 3WRYC 3SDZA 5FUWA 2VO1A 4ZI3A 5AWFC 1P9NA 2DFKB 4Q7KA 1NNEA 5E95A 3VQTA 1G3MA 1P2UA 5JWOA 3TLXA 1XJCA 1ZYUA 4DUGA 2V7QD 4XH9B 1H65A 3TH5A 2QTVB 3DMDA 4JVNA 4MDFA 3OIYA 2V1XA 1JR6A 6Q21A 4M1TA 2IYVA 3DZ8A 4XTRA 2YJTD 3QJYA 2H16A 3SHFA 1JQLB 3GPLA 2QI9C 3DL0A 2DY1A 3LDAA 4GDFA 5EXTA 3CRW1 1YHNA 1RRGA 3I5XA 2R6GA 4EKDA 2E9SA 2O8DA 2CCKA 1ZNWA 3VU9A 1TF2A 3X1XA 4D26A 2CVFA 2OV2A 1Z6AA 1WF3A 1R10A 1CR1A 3MWYW 2ZE6A 5EE0A 4HATA 2HDNB 4JBWA 1F5NA 2R65A 4PC1A 4ILEA 3VFDA 1NMXA 1KI3A 4XVQA 4A92A 3V4RA 1OHHD 4MRPA 5CIWA 3WNDA 5KSOA 4JBYA 2Q3MA 5C2JB 2OCYC 2IYTA 1OSNA 3RABA 3W9YA 3ZZTA 1NMZA 2P67A 1CJMA 3WRXC 3WP1B 1VG8A 2OSBA 4Q7LA 1N5IA 3AF4A 3U6BA 2GBLC 3QXJA 4YMSA 5FPYA 2XB4A 2FPLA 2ZI6A 4UKDA 1E9AA 4DCVA 3NBFA 2OCAA 3A4LA 1FZQA 1YZLA 2X2FA 2J41A 4GT1A 1UDWA 4XTCS 1G41A 5BN3A 2P3SA 3SNHA 1ONBA 4PHTA 1KOFA 1P62B 1ZU5A 4W5JA 3AVVA 3B1YA 1VG0B 3F3YA 5L8VA 1UBFA 1YR9A 5EZ5A 2PLFA 2IYUA 2HF9A 1NIPA 2E1RA 4MYTA 2JA1A 3AF1A 4M22A 3EZ7A 3B13B 4OHVA 2IUSA 3VR4A 1WDTA 2X1VA 1LW7A 2P6NA 4P31A 4B74A 1CJTC 3A36A 4DZZA 1CJUC 3TW4A 3TSZA 1XZQA 1G21E 5ANRB 4C30A 4BFUA 1ZM2A 4B2PA 1GKIA 1TU3A 2KE5A 5BYKA 1SVOA 4YMVA 1R7RA 5HCIA 1VTKA 4H1UA 4KBGA 2QU8A 1G291 5KYKA 1DAGA 2CNWD 4WZAE 2H57A 4Z1MD 1AN0A 2H1LA 1ZM4A 2AWOA 4ZDWA 5IF9A 5CK5A 2AK2A 3NC0C 3ETLA 1AZSC 4JIMA 2H5EA 2VYFA 2GTPA 4NHOA 5LBIA 1OB5A 1Z06A 1FQKA 2YC2C 2HV8A 4OHWA 3VKGA 3EXAA 4B3FX 4UNSA 2QY9A 1UKEA 2R6AA 1YZQA 4PQYA 5CIQA 2OM2A 3TUZC 2IW3A 2GXSA 4RD1A 2GXAA 2BJVA 2F6RA 5JRJA 1UKZA 3T5GA 3U3JA 2FA9A 3GJ8A 4HZUA 4K8OA 1A1VA 2FDCA 4C7OA 4IVQA 3I73A 1DG1G 1NBMA 4FIDA 1XXHE 4NONA 5FOWA 2ZIAA 2YKGA 1IJEA 1ZD9A 3K70D 4HLCA 2IYQA 4OK3A 3S1AA 1ZUIA 3C14C 4TLEA 1KI7A 1KAOA 3EZ6A 3WY9A 4LJ5A 5JFGA 1G17A 4LGMA 1Z0IA 3B7GA 4TYYA 1KIMA 3LLUA 2OFWA 3GLGE 1QHXA 2BHRA 2PLRA 2LKDA 2Q9CA 4Z54A 2V1UA 5D3QA 4W5HA 4BLQA 2C2HA 1N0VC 2XOKD 4KU4A 3RS7A 2FF7A 4B75A 4ZI2A 2W00A 1I2MA 4Q4JB 4DLUA 5CM8B 3EARA 3ASYA 4CT4B 4A15A 1S0UA 2V6IA 1XXHA 5EP3A 1QVAA 4IRUB 5CDFA 2JJ2A 3QXHA 2QPOA 3UG6A 1M1YE 1ESMA 3EZFA 4IHQA 1D6JA 4W9MC 3CRVA 3SS8A 2G3YA 3B8HA 2WV9A 2R9VA 1XRJA 1LS6A 3LW8A 4GZLA 3MWLA 1OH8A 4UXJA 1W44A 5DISB 3GLGA 3K0AA 2QP4A 3SYLA 1RPZA 2P2LA 4Q01A 4WZ6A 2GZHA 5DSZA 2XXAB 3TQCA 1VIAA 2HJGA 1W36B 4MUAA 2RGDA 4NCHA 1DAEA 1D9XA 1S3SA 1T5LA 4ON9A 3ECCA 4OHZA 1X3SA 1XF9A 2DYKA 5E7MA 3LLMA 2C04A 3EWAA 2XZLA 2X2EA 3CPJB 1AKEA 1F2UB 4QGHA 4ZDIA 1FL9A 4B3DA 4CEJA 5FBRB 1EX7A 3C7KA 4ESVA 4TQ9A 5HPYB 5LB4A 3GJ6A 1E0SA 4OI0A 1QG2A 3Q72A 3ZQ6A 2REBA 2WMNB 2WWIA 1GL7A 1XMJA 3FB4A 2YC4C 3BB3A 3CPHA 2IYLD 2BMDA 1XEXB 1FX0A 2G9NA 2PEYA 221PA 2XSZD 4LJAA 1OFIA 3X1ZA 3AP1A 1G8HA 1IN6A 3OE7A 2OFXA 5HCNA 3ZYCA 5A4JA 1BYUA 5JJLA 4L4UA 1IOZA 3EIQA 2ZRDA 4TMTA 4R7ZA 2ERXA 1EX6A 4OK6A 4JKYA 2BEKA 1OFUX 1Q20A 3AVUA 2I1VB 3P32A 5L3QA 2ATVA 4KFUA 3CPEA 4TLCA 3EA0A 5D3MA 2XTNA 3CH4B 4ACAA 4P4UA 3TE6A 1D2EA 2NG1A 5H68A 4XIGS 4LV6A 1CJKC 2VLIA 1E9EA 1U99A 3OEHD 4JLJA 4RSGA 4MKGA 4UNRA 3UMRA 5KO2A 2ORVA 4ZPXA 2B8TA 2P0EA 2F43A 4NYIR 2CBZA 1PZNA 2ZRAA 1U0HC 2W83A 3AF3A 2ZU6A 1ODFA 5UKDA 4HDCA 2HLDD 2QMHA 4C0KA 5G3ZA 1NG1A 2GKSA 1L4UA 1XCPA 4Q48A 1GSIA 3M1IA 4FCWA 2KBFA 4FW9A 3KKPA 4URVR 3W5IA 4TSFA 5H70A 3QEJA 1OIWA 1JJVA 3MRSA 4OJQA 1ZU4A 4TMWA 2JLWA 4NYMQ 4POAA 3B1XA 4TMZA 3CKLA 1HT1E 5FTJA 1GP2A 5EE3A 1JR3E 1TF7A 5TARA 1Q44A 3IQXA 3MWKA 1E2HA 2RHDA 2IXFA 4Z8YA 4HDOB 3H0KA 1G8PA 1TUIA 1IHUA 1DELA 1UKVY 4PAMA 4O3MA 1KYIA 5ELXA 2GCOA 3CX8A 2W6JD 3I72A 3R9XA 4AKEA 1AJEA 1RJ9A 5GJWC 5B58C 1XMIA 1TPZA 3GLFE 2OCPA 5TB5A 1E2QA 3FDIA 5TMPA 3B82A 4GBMA 2VSXA 4G3XA 3B9QA 1JBKA 1E2NA 3O8DA 3HWSA 3NWJA 2QTHA 3SE0A 1SXJB 2J0VA 2ZJ8A 1X6VA 421PA 2CJWB 1YR7A 1QBKC 2FFAA 4FCVA 4D4LA 4F7WA 1JAHA 4QKQA 2O0HA 4RZ3A 4U7DA 4QJ4A 2WPDA 4MRSA 5FTLA 3CONA 2A5DA 1R2QA 4YMWA 3RSOA 1P5ZB 3HR8A 4NP6A 4UJ3A 2LWIA 1EFRA 1S2MA 3IKJA 1SVIA 1G4UR 4RCYA 5FTKA 2C9OA 2CE7A 1E6CA 3TIFA 2QE7A 4LHYA 3W6PA 3GLFA 3FKSD 5GVRA 5B57C 1Z2CA 2ZRBA 3FYHA 4B34A 2BBWA 1E98A 1W0JD 2ZRCA 4JL8A 2FMXA 1G16A 1XFAA 1ETUA 4TN1A 1OIVA 4M2LA 1RYHA 3IGFA 3K09C 1LB1B 2A3RA 2XNSA 3HR7A 1C9KA 2N42A 3HJNA 4Q9IA 4N3NA 4OQXA 5DI3B 2ZVPX 3OEEA 4EQ6B 1E2MA 3I4LA 3PEYA 3U3OA 4DCNA 1EESA 1US8B 2BMEA 1W5TA 1KK1A 4Q47A 1Z29A 4NKRA 3TUJC 4LJ6A 1XPOA 2GVZC 1YU9A 3CR8A 5EZ6B 2SHKA 3P4YA 1KDRA 2JATA 4M9ZA 1TQ4A 521PA 1Z6TA 5DN6A 3CIOA 1TAGA 4M0LA 4P4SA 2G0TA 1ZC3A 3DZDA 3PV0A 3ZIAD 2O8FA 4MRNA 4LV5B 5KSZA 1OH5A 1IAQA 1KMQA 4AY2A 1IN8A 2YWHA 3F0TA 4A8JB 2V7QA 2ZANA 3CLVA 2AD5A 3MD0A 1FUKA 2GRJA 1ZIPA 3NEYA 2ORIA 3QG5A 4IVRA 3Q7PA 4JVMA 5J4KA 4S35A 4LYHA 2B7BA 4V0NA 5C4GB 5JCZA 5K8UA 1UDXA 3PJRA 1NJGA 1JI0A 2A5FA 4TTQA 4WVFA 5FBWB 5F2EA 4AD8A 2ODBA 3IUYA 3U7GA 4AURA 1Z8FA 4K81B 4B2IA 2QTFA 5LD2C 2AWNA 3T1OA 1E4YA 2QNRA 3SU8A 2EWVA 3VR1A 1MABB 3BRWD 1JXMA 3GJ0A 4C0LA 1ZIOA 2RGNA 4MQBA 4G5RA 5DO9A 2ZSBA 3CX6A 3HU3A 4CDGA 4DSUA 4F4IA 3NXSA 3R9WA 5GJBA 1G6HA 1N2CE 3CR7A 1I4TD 3PUVA 5FPTA 3U60B 1NL3A 3EASA 1OHHA 1JAIA 3I62A 1RRPA 5JRZA 3TBKA 4IXMA 2D7DA 4N0DA 4B44A 1KK2A 1E32A 4QBHA 1BOFA 3PFIA 3MWJA 3A1WA 3CRRA 4Q1AA 4DDVA 1LNZA 1E9RA 1VYTA 1XD8A 4A9AA 1KMHA 1TEXA 4TZ0A 1K5DA 4JKIA 1PV4A 3IIKA 3OIWA 2VH5R 4PFSA 3GJ7A 4JT4A 1BIFA 1XB2A 1JQJC 4LC0A 3QSYA 4KODA 2ZE5A 2ZE8A 3RS5A 3CB4A 4NE2A 1IN4A 1KZ7B 4JLNA 3UANA 2G83A 2I1QA 4CW7A 2IF2A 3EC2A 1EXMA 3RC3A 1FW6A 1Z6GA 1T4GA 4Q9HA 2KB0A 3B9PA 2RKOA 3RAPR 4RVCA 1GAJA 2BKUA 4PHHA 4TWZA 5SZIA 3W5JA 2IS2A 1VYVA 1VECA 4OJKA 2EU8A 3CF6R 3QXSA 3MJHA 4KVGA 4OK5A 4PPFA 3EC1A 2P6RA 2OLKA 2DB3A 4BFWA 4UNPA 4JLOA 5DH9A 1PJRA 3GLHE 1QHSA 5SZJA 3PENA 4U02A 3BB4A 3OIUA 5FPHA 2OFOA 4WXPA 2WICA 3Q7QA 4PZYA 2QEQA 3THWA 2VA8A 4V03A 3EPKA 2ZRPA 1NN1A 3ZH9B 1XMVA 4ZIRA 4D2IA 4JL5A 1Z6YA 1E96A 2KSQA 1RFLA 1YZNA 2PCJA 3LFUA 3PR1A 4HAUA 1QVRA 4I1VA 2A5YB 2IL1A 3R8FA 3K0FB 2FU5C 2WOJA 1B23P 2OLJA 4FWTA 4WA7A 1OLOA 3H4MA 3BFXA 2CNWA 3AH8A 3AKYA 4Z1MA 2J0SA 5J4HA 2BJWA 2ZYVX 2F9LA 3LX5A 4IDOA 4O2RA 2BBTA 1AGPA 3GLHA 2Q9BA 2ZSFA 4FMDB 4XWKA 2RGNC 1NN0A 2QAGA 3B6EA 1PUIA 4QRHA 2JEOA 2ZAOA 2BBOA 1W36D 3UKDA 1N0WA 1ZP6A 2IYYA 2JLSA 5BW8A 3HDTA 1WMSA 2Z4SA 1WB9A 2J0UB 2J59A 2YHSA 3VHXA 1OB2A 2AKYA 5HZKA 1QDEA 5AUOB 4MH0R 1CU1A 2HXYA 3FTQA 3SJZA 4Q4HA 3IIJA 1JPNA 4B6EA 1FNMA 3MUFA 2R6FA 2L0XA 3ZDQA 4E07A 2EFDB 3OFND 2JIZD 3CZQA 3WYAA 2YOFA 1JNYA 2OEPA 2XZPA 4GOXA 1Z83A 4EJSC 4PSAA 3M4YA 5HR5A 1T8UA 2ODEA 2C8VA 5FFMA 1LS1A 2GXUA 4MRRA 1SKYB 2YOHA 2O0KA 4HB0A 4JZKA 4HLDA 1S4QA 4LYJA 5KSYA 4Q03A 4FCTA 4FMCB 3BK7A 3BXZA 4IVPA 4NYIQ 4OQNA 2UZ3A 4DHEA 1E0AA 4C0JA 3Q9LA 2XOKA 3LBNA 4TYPA 3BFVA 2ZJ2A 4I81A 1KI6A 1CIPA 1D2NA 2J5XA 1AZTA 3GFTA 2C78A 2VRWA 2ZUBA 4E09A 3VKWA 5JJIA 2FPKA 2Z4RA 3ICEA 5CLQA 4CIDA 2ZJBA 1S8FA 3U2QA 3EW9A 2O8DB 3SC3A 4QBGB 3DKPA 5KTYA 2IUUA 2GXQA 5EUQB 2R62A 1Q0UA 3NDPA 1UPTA 1E79D 4DSTA 3C41J 1NRJB 1A4RA 1XX6A 2CCJA 2QM8A 5JCPA 1GIAA 4WZBE 3PG5A 2CVHA 4NU0A 4URWR 3C8UA 1RRFA 4D0LB 1JXOA 4ARZA 1MRNA 2DCUA 4L9SA 3RC8A 3L43A 1XEWY 5LPNA 4DB4A 3DHWC 5FTMA 3DPUA 1T9HA 3JVVA 4LJYA 4Y0VA 2WWFA 4CEIB 1U8ZA 1E2EA 4LWZA 3HU2A 4RD2A 1SKQA 4KLZA 2QAGC 2ZYWX 2CL7X 2WKPA 3QKSB 2WJJA 1W1WA 4DLVA 2DFNA 3ND9A 1GRRA 2XGJA 4QFMA 1FNNA 1J8YF 4TZ6A 1ANKA 1E1RD 2W2XA 5GJVC 4JJZA 2ZSEA 3U5ZB 1JEDA 2B7CA 4D81A 2O8EA 5KNCA 4KFRA 2XSZA 4KVAA 3JZMA 4X8LA 3PUWA 4MRVA 1SVMA 1Z0KA 2KI5A 1E9BA 1E0KA 4ERNA 1N3BA 1P73A 3NH9A 2DWQA 1E9CA 1BYIA 4HAYA 2NIPA 3DO6A 5FR2A 4A82A 3THYA 3AGQA 3ICQB 4QM7A 4Q66C 4RFSB 5IHPA 4D82A 4RFVA 1D2MA 4EFLA 2BDTA 5DGXA 4D6PA 2A5GA 3B1ZA 4MGYR 4AWXA 4QBFA 2JASA 2V54A 3IILA 3LQRA 3DMNA 3WYFA 4OBEA 1N6RA 2W2VA 1SXJD 1DAFA 5J4VA 3SEAA 3LBIA 4TL9A 2ZSDA 4Q1FA 1GRQA 4QBIA 2PCLA 2WIAA 2WKRA 3OAAD 3BB1A 2F7SA 3OESA 3GLIE 3U61B 2C95A 1Z63A 3AM1A 4BFVA 2A5JA 1GNPA 3WYGA 2FJUA 1ZCBA 3EG5A 3JZAA 3U7EB 3BOSA 5K8IA 1R6BX 4CF7A 1A2BA 1F2TA 3L8ZA 4IFEA 2O8BA 3U7HB 2Q0HA 1NJFA 3G5UA 1AGRA 1XU4A 1WCV1 2HLDA 4KHZA 4KLNA 1E1QA 1T0JB 5TVKA 3RRNA 4BECA 5JEDA 4IXNA 1QRAA 4LRWA 4P3YA 1X8LA 2AL7A 3SJBA 2UKDA 3EPJA 4A2PA 3LVRE 1J99A 3T61A 2GA8A 1CKEA 2QMEA 1CP2A 5LB2A 2REXB 2WMOB 3KQKA 4I1OA 5JJKA 1E9FA 2OBLA 3CM0A 3GLIA 3NG1A 4GP7A 5AK0A 2D2FA 4M8NE 4US2R 2QAJA 3IBGA 3KX2A 2GEUA 1YR8A 3QPVA 4W7SA 3FHOA 2YYZA 3W34A 3EPLA 1TTTA 3QXCA 1CULC 4G5OA 3R7WA 3SOPA 1W47A 1ZD1A 4A0RA 1A2KC 1JECA 5JLJA 3W8RA 4TL8A 1Z0FA 1UADA 2WJGA 4D0NA 2AKAB 3SI7A 1QHYA 2BM1A 2BV3A 3AVPA 1ZCAA 4IW3B 4PO1A 2W6JA 4TT3D 2QSYA 5EP1A 2GAOA 4QL3A 4U00A 4DC9A 1KI8A 5KU1A 1P2TA 3E70C 3BFKA 1MV5A 1P72A 2O0JA 2P5SA 1RE0A 1RYFA 1CR0A 2FH5B 2I4IA 3P27A 5E7IA 4B48A 4QOSA 1DEKA 2A7QA 1IXZA 1N5LA 2PZGA 3B85A 1KK0A 2R6CA 3NC1C 2XTMA 2HT6A 3PEWA 4YONB 8OHMA 4RD3A 2OILA 3VHLB 3RRMA 1HEIA 1MRSA 5J4LA 1GITA 1P75A 2FFQA 4PQRA 2JDID 1XXHB 1Z2AA 4TLBA 5CB6A 3THXB 1NBME 4IDQA 3T06B 3WNCA 3H86A 1XBTA 3IPXA 3QKRA 4PANA 3ZVRA 2IWRA 4IDNA 1TADA 4RZUA 3FKSA 4MGZR 4UNQA 1BKDR 1KKMA 3RRYA 1S1MA 1W0JA 3GLGB 4IOLA 5KDDA 1H8EA 4DCSA 2QQEA 4PSVA 4LK2A 4CGZA 4DLXA 1XCGB 1KY3A 4JLPA 4D0GA 4BLRA 1BO6A 2A78A 3T1QA 2MSCB 4PR0A 3W3AA 3LXXA 2AX4A 4HUQA 1LVGA 2DFTA 4CEJB 4CEHB 1QHHA 2ZVQX 4RZXA 1LV7A 2D62A 4JVLA 2ODNA 1N25A 5FPSA 1IN5A 5FUYA 2NO6A 5CDFE 4HI0E 4B76A 2PX3A 1Z08A 1P4SA 3KFVA 5JI3E 2ZJYA 3CUEF 1XJQA 3QF4B 4LJ4A 4AG6A 4BRUA 2QA5A 5E3HA 3KKQA 1Y3AA 4JMPA 3GJ4A 5KSPA 3HYTA 2PL3A 3LQQA 5EXXA 2ZRFA 1D5CA 1DTSA 2A30A 3IHWA 5L3VA 1VMAA 5EP4A 2WSSA 1P2VA 1XP8A 1R0YA 2WM9B 4EPXA 3ZIAA 2B92A 1COWD 1T91A 5FOSA 3VR2A 4NCKA 1G1MA 5GVSA 3FHCB 1GTVA 4BEBA 2EYQA 2ZJZA 1OYYA 3SYNA 2DWPA 3GFPA 5D3MB 4M1KA 2J87A 3QBTA 2FZ4A 4JSTA 1G20E 4JBXA 1M8PA 1E4VA 2VTKA 3QEOA 2IT1A 2QROA 3PUXA 4DRZA 1MO5A 1MOZA 1DE0A 4TTPA 4EUNA 1KJWA 2R8RA 3R20A 2P65A 2ZR7A 3OZXA 2OAP1 4DVGA 3C5CA 4GZMA 3SQWA 3RDPA 3NBYC 3DVLA 5CM9C 1MO3A 2OBMA 2WJYA 2Q9AA 5CJ2A 2DFLA 3K53A 1HT2E 3VNUA 3RYTC 1TX4B 1K6MA 2RGAA 3SYKA 3AUXA 1Z0DA 5JS8A 1FTSA 4HAXA 1GKUB 3V00A 2ZJOA 4OHYA 1P7CA 2VHUA 3LWNA 5EE9A 4L8GA 4BZQA 1NVVR 4KSBA 3KJHA 3B5JA 2J9RA 1KSHA 2G77B 2QP9X 3MMPA 4JYCA 4RZ2A 2XITA 2Y8EA 2W6ID 3K9LA 1NLYA 1G5PA 2PX0A 1S3GA 1OF1A 1DAHA 1OJLA 2F3TA 2WZQA 1FMJA 3O47A 2XJ4A 3QVVA 2OAQ1 1GUAA 2C98A 5C4MA 1CRQA 3W3ZB 3EX7C 3K9GA 3KFXA 1S9HA 2MMCA 2AFIE 1Q1BA 1M34E 4G0NA 3NVAA 4PX9A 1WP9A 2GCNA 3N2IA 3PUYA 5JS7A 2VP5A 2GCOB 2CHQA 2FG5A 3TSOA 2IEYA 2IYZA 2PT7A 2WJVA 2GEDA 3TAUA 3CNNA 3T15A 1RJ9B 4K46A 3UXMA 1RIFA 2PZFA 3U3MA 3WBKA 1EFCA 4F93B 1KI2A 2IS4A 4HUTA 4C0AC 3A1VA 4DUGD 4NH0A 4R98A 4DDWA 2O8CA 1F48A 1KO4A 3D6TB 1IXSB 3QBVA 1U8YA 2H7VA 4R2HA 3SFZA 4DIEA 3ZQJA 5LD2B 4M1OA 3VNVA 2ZS7A 4JLVA 3SQXA 1OPXA 4V0ME 4Q4JA 3K0SA 2QGZA 3KQUA 1BS1A 3BAFA 3LXRA 3LH5A 2ATXA 5CITA 4E5UA 4H9GA 1T3HA 2PBRA 5GJCA 1N6IA 3ADDA 2EFCB 1NSFA 2QPAA 4TYNA 2NO0A 2ZYUX 4OQFA 1K5GA 4RCZA 5L3SB 4I1SA 3TAHA 4LSGA 2ZTSA 2V55B 4UNNA 1ZNYA 3QUSA 3BH0A 3FGNA 4PZZA 4XSHA 4ZCLA 1II9A 4GMXA 2XEXA 2JLRA 2ZRNA 1W0KD 4B3GA 1W5SA 3H1TA 1N5JA 4EPYA 1EWRA 1GDDA 2XXAA 4PAQA 3GEEA 4FINA 3KDSE 4AKHA 2GJ9A 4DBLC 2NO1A 4V0MA 5AJXA 3FE2A 4II7A 4Q18A 1F3OA 5HKKA 3RRZA 1VCOA 1UF9A 4ASUD 3O8RA 2BIFA 3AP3A 1PVOA 1KSGA 1F2UA 4Q00A 1RZ3A 2H8KA 5DE3A 4O2LA 3D3QA 5DYIA 2GK7A 2CLCX 4CRWB 4PSKA 3U4QA 4JLDA 2JIZA 1T3SA 2ZXUA 3EZ2A 1W4AA 3TUIC 1HH4A 1QZXA 1M6NA 1XEXA 2P6UA 5KPDA 3FKQA 4BLSA 1UBGA 1X1SA 3D8BA 1OXTA 2DPXA 4PC3A 1OW3B 3KZ1E 4C9BA 2MMGA 2WOOA 2GAAA 3HPQA 2O8FB 1UKYA 1KSJA 3NKVA 4FI3C 1AQYA 4LPSA 2ORWA 2IS1A 1OXSC 5DNYB 4GI7A 1MKYA 1VHTA 1S96A 3DDCA 2VSOA 3UWOA 2AXNA 1FTNA 4TYWA 1G6OA 1VG9B 3GEIA 3KXKA 4KAXA 4AKIA 3THOA 2D74A 2IBMA 4KXFB 1XPRA 4LYAA 4X8OA 3L0OA 4MUBA 5CLLA 2P5TB 3SJAA 4DT1A 3AB3A 3AF0A 1T5IA 1HYQA 2HUPA 4Q9JA 1XDBA 3BWDD 2F9MA 3BD9A 3PITA 4NDZA 1M2OB 2BEJA 4BASA 1E79A 5KNBA 3CF0A 2NPFA 1AQUA 2D3WA 5AUPB 1FMLA 3L8YA 3KL4A 3QQ5A 1E9SA 1CBUA 4IEEA 4PPNA 3GJ3A 4OI2A 4BGDA 4AKGA 5KNDA 1YZKA 4A2QA 3VAAA 3NHBA 1P9RA 3GEHA 3WHKA 2VIIA 4XJXA 4EJSB 2VF7A 2TMKA 4YQFA 4A0FA 3IDQA 1HY3A 1J7KA 1KMHB 2DWOA 5K8TA 1E2LA 4JT2A 4LDJA 3TRFA 3SR0A 3CRMA 3A37A 3TVDA 1E1RA 3SBDA 1HURA 3PEUA 4OI1A 3WP0A 2UZIR 1OH6A 1XPUA 3CNOA 1H8HD 1E2GA 4D4MA 2YWEA 3ADKA 3ZVMA 4GRAA 2C77A 2CL0X 3CRQA 4M9XA 1II8B 5FR1A 2QBYB 1U94A 2FE4A 2VP0A 3GCGA 2J3EA 1N6NA 1G3IA 1Z6XA 2AN9A 1KI4A 4M1MA 4WBSA 2QQ0A 4HSEA 3WBJA 4L5BA 3CWZA 4LHZA 3RHFA 3KXLA 4BE7B 2XAUA 4FMBB 4M21A 1SULA 3RWOA 2WHXA 1ZINA 2FEOA 2GESA 2ZQ5A 2ZU0C 3A8TA 1L2TA 3THWB 1SVKA 3RS3A 4IFBA 1MR3F 4BFYA 2JGNA 2HF8A 4YXWD 3A1UA 4G5SA 3VMFA 2IXGA 2PT5A 2WAYA 1W4CA 4FN5A 4EAQA 3QPWA 5JSZB 4DXAA 2FPMA 4A4DA 4HZIA 5JWHA 2IA5A 2PZEA 3MJRA 2GILA 3KTAB 2EQBA 2W58A 5E7JA 4C4PA 2W0MA 2A2ZA 4OL0A 5CB8A 2WIBA 2ZRGA 3I32A 1P3JA 2BBSA 3Q8XB 2QAGB 2VPPA 3LA6A 4PC7A 2BCJQ 1UEIA 3ONWA 4OI4A 4G5QA 1L8QA 3Q5EA 1TEVA 1XTSA 3UWKA 5DI3A 1EG7A 1X8JA 3PXGA 1KDPA 1KTVA 1Z3IX 1JEEA 1R5NA 4CT5A 1HE1C 1YRBA 1R0WA 1OFTA 3DEFA 3DM9B 2B8WA 2IEZA 121PA 1CJVC 2PMDA 4Q4AB 3WXMA 1NVXQ 1R4AA 2RGCA 1KK3A 1KO1A 5G3YA 1U0LA 1SGWA 2ZI9A 5EP2A 4L9WA 4C3ZA 4JL6A 4XWAA 2F1IA 5A0FA 4HDQB 1PLKA 1Q12A 2OT3B 1FQJA 1GL9B 4TT3A 1OT3A 3OE7D 3A6PC 2QUZA 4M9QA 1HUQA 2ZETA 1AK2A 1N6KA 2FN4A 4MYUA 4BPBA 5KDLA 3AVXA 1HTWA 2B21A 1XTRA 3AVQA 1SVSA 4B6FA 4FXPA 4M4SA 4A8JA 1TL7C 5SZKB 5JMTA 1IM2A 3P26A 3U44A 2F55A 1R8QA 1RC8A 3KUDA 5IT5A 2HEIA 4LOAA 3FMOB 1Q22A 2REOA 4PC6A 5CK4A 5J40A 1KI6B 4KSCA 3W6NA 1YQTA 1ZJ6A 2FSIA 2RMKA 3B1WA 3CO5A 4IEIA 4URZR 4IOJA 3VX4A 5FPKA 2OO7A 3BJIC 1D8TA 3TJZA 1U2RA 4YMTA 3CW2A 4DEXA 2JDIA 1PLLA 2KWIA 3LBHA 4F4CA 1W48A 4QM6A 1CR2A 5KHOC 1NVVQ 4P4TA 4BFSA 4EPTA 2IYSA 1E94E 4M1SA 3REFA 3GP8A 2QL6A 2IUTA 2ZUCA 3RLFA 2JLVA 3GJ5A 1MABA 1NY5A 3GQBA 3MSXA 4IDHA 2QGNA 4PQFA 4B43A 1I4DD 2WKQA 2ZROA 5A5GA 3FOZA 1SVLA 4QHTA 3IPYA 1CR4A 5DHAA 2ZUDA 5FI1B 4BLTA 2GEVA 3ZS9A 2NTYC 2N1BA 2GWHA 3U3KA 1I2DA 4YMUA 1Z07A 4JJKA 4A2WA 5HE8A 1ZD8A 2NZJA 4KFTA 4O0MA 4PO8A 3I5YA 2GHIA 3LY5A 4AI6A 3Q5DA 3KB1A 4NCJA 3BIFA 4MGIR 2J7PD 1IONA 4RD0A 4B73A 1M7BA 4A0GA 4ZV4A 2VEDA 3QXXA 5HZHA 3UG7A 3SN6A 3UPUA 1N6OA 2H18A 1N5KA 2K5UA 4M53A 1ZNZA 4NMMA 4KBFA 3X1WA 2FFBA 3ZD7A 4I99A 2GJKA 4LJ8A 2JLXA 1YR6A 2XB2A 1FFHA 1YZUA 2QT0A 1L4YA 4EPWA 5TV2A 3N5CA 3C15C 4BWYA 2CMKA 3E2IA 4TLDA 1CS4C 2GJ8A 1UAAA 2OESA 3RANA 2NQ2C 2PMKA 1X86B 4G1UC 4QNMA 1COWA 1X8KA 4X8MA 2E87A 1IY0A 2WJIA 1KJZA 4GPTA 1KGDA 3P20A 1U81A 2O5VA 4NBSA 4DSOA 1A7JA 5FL3A 1G9XA 3IO3A 3QE0A 4RD6A 3DKVA 1OKKD 1JR3D 1ZAKA 3VU9B 3N70A 1Q57A 2NO9A 4NYJR 4GNKA 2WPDD 2MSEB 1NI3A 3W90A 5H8WA 1KNQA 1AKYA 2O52A 1XJ0A 3V4FA 4IJMA 4DEYA 2G6BA 4OHXA 2ASEA 1GG2A 2LCFA 4FD2A 2NZ8A 1CRPA 1N6HA 1N6PA 4C2UA 3FFAA 3KQHA 5B2ZA 2YZ2A 1OE0A 3K0FA 1D9ZA 2D06A 5F98A 1IN7A 4YC7A 1WXQA 5BN4A 3IO5A 2X19A 2OXRA 1TQ6A 2GZAA 4TQAA 4LBVA 2ONKA 4KYIB 4TMKA 3AKEA 1ZW6A 4FWIB 2DHRA 3FMPB 3B60A 5H1YA 2NGRA 1DO2A 4HYYA 1E2DA 5KUTA 3PQCA 3HYRA 2CHVA 2C03A 4Q9LA 4YDSA 3K0CA 3RSLA 2W6IA 2ZE7A 3GD7A 3PCRB 3CBQA 3QNUA 2QG6A 5G41A 3I61A 3Q85A 2Z5FA 2VP6A 3AEZA 4OQMA 3FFBA 1E0JA 3QI2A 1ZM3A 1WBBA 4DSNA 4GOJA 3BS4A 2ZAMA 2JJ8A 1XNJA 3U6KA 3D31A 3PVSA 3EPHA 5DN6D 3K70C 5L3RA 4PZLA 4OKSA 1W4RA 2IK8A 2FOLA 1MT0A 3L0PA 1TUEA 1KI1A 2OHFA 3A4NA 4C0HA 2GF9A 1KDTA 1VHLA 2WBLC 3AVTA 2Z0MA 1GWNA 2VF8A 4NL4H 4M1YA 1OXUA 3OEHA 1NLZA 2EWWA 5TDHA 3C4JA 3CX7A 5J47A 3SFVA 1BH2A 3R8CA 3X1DA 4B71A 2J46A 3QF7A 2WWHA 1DADA 5BWMA 1UJ2A 3QG1A 1IQPA 5FBVB 3TKLA 2ERYA 3QKRB 3KKNA 1JJ7A 1LF0A 2OXCA 2QRNA 4NCIA 4V0LA 3IIMA 2HXSA 5DLQC 2J1LA 3W8NA 2ZRKA 3NEJA 4RKEA 2AR7A 1W0KA 5CYPA 1WA5A 2B6HA 1M74A 5FOXA 3FPAA 1NKTA 4D80A 1G3QA 2WJHA 3EIEA 1YZGA 4ASUA 3E5HA 3OF5A 3TMKA 1UEJA 4A6PA 2CK3D 4HZUB 4HUQB 4DDUA 2QZ4A 1ZVQA 2JJ1D 4BZXA 1QHHB 4CEIA 2ZR0A 3K0EA 3L0IB 2KBEA 3E1SA 2EW1A 3QKSA 1SHZA 4EPVA 2DR3A 3N2EA 1GNRA 3GJXC 3S1AB 1NMYA 1YRAA 1RRCA 2VP4A 2ZI4A 3K0CC 1SQ5A 3KKOA 1XD2A 4QC2A 2VHQA 1G7SA 4DIDA 3KQLA 3FHTA 3IQWA 2FX3A 1SVWA 5C46F 1GRNA 1NF3A 1Z47A 2HJVA 4WXRA 2VQSA 2ZI7A 1E2JA 4QJ5A 2ZM5A 3TVTA 1MH1A 4YDHB 3VX3A 1FUUA 2AK3A 1F6BA 4ZKEA 3A4MA 4AC9A 1J2JA 4RFSA 4UXHA 2YWGA 5FI0B 4ESHA 3UK6A 4QGGA 1S1CA 3AKDA 4HAVA 4XD7D 3ADBA 2ODWA 2ZJ5A 2F1HA 4V0OA 2W0SA 3AF2A 4QGAA 1YKSA 1P60A 1U98A 1XMSA 4WAUA 4Q1EA 4LHVA 1NIJA 5SZHB 5IK2D 2RGGA 5FTNA 4JYBA 2ONJA 4DB2A 1JB1A 5FH9A 1G7RA 2QPTA 3K0AB 3UMFA 4QHYA 3ZZUA 2Z6VA 1T3LA 1DARA 2JLQA 2IYXA 4AYWA 2XNDD 4Q4LA 4Q1CA 4LHWA 3LO5A 3G0HA 1VPLA 3LV8A 4BEJA 3AQ4A 1LY1A 1VCMA 2ZRIA 2OG2A 2VHCA 4QHSA 3KJEA 1NVUQ 2IHBA 3L2OB 1GL6A 4ZCMA 2GF0A 2Q21A 3MAAC 4JSYA 1UM8A 1XTQA 5FBLB 1NN3A 4M9SA 3J81k 1AM4D 5FOTA 4Q9KA 5DHFA 4X8HA 2F1RA 1NG9A 2ANCA 3AUYA 2QP3A 1EK0A 1FX0B 821PA 5TXGA 3MLEA 1RKBA 2G88A 1W49A 3DM5A 4UQOA 4TMVA 2V3CC 3NH6A 3UIEA 1QHIA 4AK9A 5AUQA 4AYTA 1IXRC 2YNMA 3F8TA 2BOVA 3PIRA 1GOTA 1Y63A 3ZJYA 4R9UC 5JEEA 3L82B 1H8HA 5L3QB 3BGWA 2LKCA 621PA 4PHFA 5BXQC 1XEWX 1ZM9A 3BORA 5J5CA 2WTUA 4LUCA 2C9YA 2ZI3A 2BMJA 5FL7D 4DLYA 1U9IA 2OZEA 5AJVB 4EFMA 3ZD6A 3K9NA 4TL6A 1ZMXA 2PEZA 2JLYA 4PPQA 3NIBA 3SHWA 2O8CB 1FP7A 2GDJA 2IWHA 3I3SR 3QKUA 1AIPA 1TQDA 1BMFD 2NPIA 3K8YA 3GFOA 2QMUA 1Q1QA 1WBDA 4QGFA 3KUCA 2QENA 1NP6A 4Q02A 5KDOA 2F43B 4BQSA 5AR1A 5BYJA 4B3XA 4B3CA 4YXWA 1DBSA 3VR5A 3RVBA 3THXA 1E99A 4UXIA 4LPKA 4Z8XA 1NKSA 5P21A 4ABYA 4DLWA 5HE9A 1Q1ZA 1G4AE 4US1R 5G40A 4AYXA 4Q21A 4CZ2A 5GADl 3K9HA 4G01B 2VHTA 1TNDA 2WWXA 3MFYA 4JVSB 1OXVA 3VR6A 2CCGA 3FVQA 4D25A 2JAQA 4LY6A 2BCGY 2RCNA 3K1JA 4Z51A 4LHXA 4IOKA 3PUZA 4ITRC 2FSGA 1VCIA 1XZPA 2C5LA 4DCTA 1O87A 2GK6A 2ZS8A 2D7CA 3DOEA 3LX8A 1IY1A 4HLQB 2CDNA 1F60A 2IHYA 3QOFA 4D4JA 1XD9A 3A1TA 1U0JA 4CEHA 1AS0A 2C96A 2CL6X 1XTJA 1QHNA 3U4QB 1G3RA 2FFHA 3QIAA 3BERA 5JI2E 4R71A 4NTZA 1N0UA 3LNCA 4E03A 3QF4A 5IDVA 3KXIA 4WIAA 1W7AA 2IF0A 2FWRA 2I3BA 1N6LA 2C9CA 2CXXA 3GMTA 1DAMA 2HT1A 3RNLA 3ZVNA 1JALA 3Q3JB 3WNBA 4IDPA 2MSDB 4NYJQ 4DLTA 1ZM7A 5JWRA 3C5HA 1HV8A 1DVRA 2W2TA 3TGPA 4QG7A 4DWJA 4A1FA 1E2KA 4KO8A 4XVRA 2EVWX 3KQNA 2FGKA 1GFIA 2IYWA 4OYHA 5EQTA 4Q7JB 3ZZ0A 2HYDA 3MGCA 5EXSA 4NPHA 4QNRA 4GSYA 4Q19A 2G1JA 1GNQA 1AA9A 1EFHA 4B2LA 3HP1A 1U9IC 5DIFA 2NOAA 3SZRA 3LAWA 3TSWA 2CLSA 2FNAA 3GLFB 2J45A 4XVUA 4BLPA 4HB4A 4DT1B 1O3YA 1RVDA 1E2IA 1GILA 3WMFA 1OFHA 2QSZA 1Q3TA 1G64A 2BWJA 5B30A 1A82A 5KOYA 4LBWA 3K09A 2IYRA 1OXXK 2AHOA 3EZ9A 5C18A 2EFEB 2Q3FA 4Q5IA 4ZO4A 2VP2A 4LZZA 1E1QD 4TTRA 2D2EA 3TR5A 1VCNA 1T8TA 2BC9A 4C0SA 3QKTA 4XSGA 4BFTA 3BE4A 1W46A 2ZPTX 1J70A 1DOAA 1NLFA 1UBEA 4HAZA 1ZUNB 2AXPA 4DKXA 4GP6A 1IJFA 2GJSA 2VBCA 2VP9A 3OFNA 3P4XA 1R5BA 4B32A 1W2GA 2J7PA 5AJYA 3I8XA 1EFUA 4V02A 5EE5B 3T5DA 1VYUA 1GVNB 3CWQA 5AUNB 5F9HA 1C1YA 3OIVA 4P4SB 4Y0AA 4DLSA 5JHGB 1U8AA 2XX3A 3RS0A 4EIWA 1G19A 4ZCIA 3UMSA 4ACBA 3FWYA 4QXAA 4MKIA 5HTKA 1G7CA 2WAXA 2X77A 1A5TA 5J4YA 5G53C 4JLBA 2PH1A 3RS2A 1G8FA 4F92B 1CEEA 2EYUA 3KKMA 4KCGA 1VKJA 1DPFA 1DS6A 4KJZA 4ZDKA 4BZPA 3TK1A 3RS4A 3NBZC 3KJGA 3CNLA 5AJWA 1R0ZA 1HQYE 2OE2A 3IHLA 3MCAA 1J8MF 5LDDC 4URUR 1Q21A 3OHMA 4DCUA 4TQUS 3ASZA 3ND8A 4KI0A 3M0EA 2A9KA 4AIIA 4MITA 4WOPA 2YV5A 3CH5A 3QENA 3ZLJA 2ZRMA 4Q1BA 1OKKA 1JR3A 4BRWA 3ZS8A 5EE1A 1E3MA 3WMGA 2WWWA 3NBXX 5JBQA 1Q3HA 4RJLA 3VTKA 3NTUA 1KAGA 2R6DA 1NN5A 2ECKA 1ELOA 2ZI5A 3UATA 1PLJA 2GZDA 4EFNA 4CYMA 721PA 2FZLA 4TLAA 1B0UA 5EUMA 5JHHB 5L3SA 3W6OA 1UFQA 3AV0B 1ESNA 2CHGA 3AKCA 3LW7A 4BUJA 1H8ED 2FEMA 3JVUA 4AG5A 1DAIA 5DI9A 4DDTA 1YE8A 4C0BA 1T0HB 1XWIA 1M7HA 4L16A 1SXJE 1W36C 1DO0A 1M7GA 4N0EA 1GM5A 2IXEA 4GL2A 3U3RA 2RH5A 2GETA 3AVYA 2ZJAA 4LCBA 1AS2A 2BM0A 4G5GA 2GNOA 1SZPA 4M1WA 5BN5A 4YLGA 1NBMD 4C7OB 4GFDA 3EA5A 5FUXA 3CZPA 5KPJA 4HEJA 1GKYA 4I4LA 4UJ5A 4PXAA 3MG9A 5IRCD 1S9DA 4BLOA 3SJCA 2YWFA 2QORA 1G8YA 4F38A 3AVWA 4FMDF 2H92A 3QVUA 3NDBB 4JS0A 1LFDB 1KJYA 1OYWA 1QG4A 2WSSD 1HA3A 2OCBA 1GZSA 1FP6A 2OBNA 1SXJA 4PHGA 2ZYTX 1ZRHA 2VL7A 4Q7MB 2CJWA 1AS3A 2N46A 3OAAA 1R8SA 3U44B 1E2PA 1XCMA 2VHJA 1G7TA 1EGAA 3O8BA 3TR0A 4B3BA 5AJZA 2AD1A 1KDOA 4ZIRB 4E22A 4HLUA 4HB3A 2D4HA 2EFHB 2QRZA 2RHMA 3HU1A 4KFSA 2JJ2D 3CF2A 4B33A 3IEVA 3D7MA 3SBEA 1YJ5A 2AFHE 1OH7A 3BC1A 1KSFX 3I1FA 4JLKA 1QF9A 4XWOA 1G5RA 2BKEA 4H1VA 4LV8B 1WE2A 5JZVA 4MDEA 4FMCF 3M6AA 3TQFA 2HCBA 5EXPA 4LYFA 3GLHB 4LC1A 1R0XA 5C1BA 2V8OA 1KZGB 5F3WB 1U90A 1PUJA 4LJ7A 2RGXA 3F5FA 2ZSAA 2XZOA 2ZR9A 4EQ6A 3KJIA 5JECA 1G18A 3ZVLA 4LJ9A 3AP2A 5E4FA 1OIXA 1T6NA 3ADCA 1US8A 1HE8B 1NY6A 2Q3HA 4Q4HB 3IEUA 3KB2A 3B1VA 4US0R 3RWMB 1I4LD 1UBCA 1RW4A 2CK3A 3V9PA 1X1RA 2JJ1A 4A0HA 5B64A 4EJSA 5F9FA 4J0QA 2ZRHA 2JCSA 3K70B 1TF5A 3B78A 4U5XA 4L15A 1R5OA 1WRBA 4MYHA 1Z28A 2QM7A 4DLZA 5TY0A 3WMEA 3ZGXA 2R2AA 1W4BA 5M04A 1IY2A 1EFTA 3DOFA 3T12A 3O8CA 2J0QA 4NZYA 4QJ3A 2J7KA 4A6XA 4BFXA 2C99A 1CXZA 4KYUA 1MO6A 3P1JA 4S2EA 1KNXA 1II8A 3QPUA 2QBYA 1LTQA 2EFGA 1CLUA 2PJZA 1CF4A 2ZS9A 2GCPA 4ZKDA 4JLAA 4Q1DA 2G1KA 4PAOA 1W2HA 4XD7A 1J90A 1Z5ZA 2RAPA 2RGBA 4F91B 4LBYA 1SXJC 3TNFA 3HPRA 4DJTA 4LX0A 3AGPA 2CEAA 3T1VA 4MGKR 1KHTA 3EAQA 1VG1A 1QHGA 1VDZA 2F1JA 1TMKA 2XJ9A 3IBYA 4HAWA 5IK2A 1JPJA 2ZRLA 3X1YA 4F4JA 4V0KA 2XTZA 4ZDJA 1V43A 4HLUC 4MA4A 3I8SA 4D4KA 1KKLA 2XNDA 1P9WA 2IC5A 1LF5A 3EIHA 4MKHA 2R44A 5JSZA 2DBYA 1KO8A 3C16C 4OQLA 4ARZB 1FPMA 2FSFA 4R2IA 2IX3A 1IBRA 4TSFD 1ZUHA 1ZNXA 3L0SA 1VIYA 3AVOA 3KTAA 1HQCA 1KO7A 4TL7A 2Z83A 1XTIA 5DYGA 4C0QC 2ZITA 4B47A 1V5WA 3NHAA 4IOMA 4P33A 2RGEA 2F3RA 2KJQA 2NO7A 3LVQE 1II0A 4MYCA 4P0TA 4PTLA 4RY2A 4WW0A 5HKKD 2YINC 2IS6A 3VKHA 3REGA 3QY0A 2PJRA 4MKFA 2ZEJA 5CJPA 3X2SA 2O8EB 4HB2A 4PO9A 2WSMA 4EPRA 1SHKA 3I92A 2V4ZA 4CVNA 4Q4AA 3BH6A 1Q1EA 3A1SA 3THYB 5CYOA 4A36A 4RD4A 4KV9A 2G0NA 3A58B 2VSFA 4JLMA 1K8RA 4W5WA 1KY2A 3LD9A 4TMXA 2V9PA 1Z22A 2GVDC 5FL7A 2YVUA 1OV4A 1XTKA 1MO4A 2CLDX 2UVQA 1P6XA 2BVNA 3WHLA 1CTQA 1EWQA 4NCNA 2WWYA 1TQ2A 4A8JC 1WQ1R 5FOUA 2CE2X 3BH7A 1BMFA 5FBQB 2Q6TA 2QN6A 1KI9A 2QMOA 2WVJA 4N1AA 1EFRD 1G8GA
chains in the Genus database with same CATH superfamily
1R4ZA 5DLEA 4HAIA 4E32A 2ANBA 3GY0A 4FNOA 2IY9A 2HYIC 2H17A 1OVMA 2YOGA 4EA8A 4B3HA 3JYPA 5BPFA 2WG2A 1G3UA 4XB6B 4LXYA 3DOOA 3R0IA 4P98A 5T4BA 2ZRJA 3H2GA 3NQ41 5EWMB 3E22A 1ZBDA 1I9GA 4J7XA 4NDAA 1E7QA 1A5BB 1P2SA 1YE5A 5T5QA 4OD0A 4C21A 2ZREA 4ZAFA 2JLUA 3JQGA 1HDCA 2XEDA 3EWSA 3QFSA 1MW9X 4MO9A 4MV3A 4X60A 1EYZA 3RBVA 3WRXA 1CS0A 2I4OA 3ZK9A 1YA6A 4YVFA 2MTBA 4XOIA 2FUG6 4GXTA 5K6AC 3VYUB 3SAJA 3B36A 1X1TA 1ZK4A 2WWGA 1EIZA 1XA3A 1BQ3A 5JCXA 1MGPA 4TV8A 3T1TA 1BKYA 1VJ5A 4BJ3A 3DXZA 4PC2A 3OZFA 1P9OA 3BIJA 1VYHA 1ECLA 3CH7A 1RAGA 1PF7E 1C3EA 2C9MA 2YW9A 5ECYA 3JPWA 4NBRA 3U7FB 1G5FA 1ULTA 4WLNA 5T3YA 4RENA 2NZ2A 3H2YA 2JHGA 4CG0A 3SK0A 4JA0A 1YIOA 4RCVA 4C2TA 4ZRMA 5FWNA 1SUFA 1H0KA 1NSTA 2FEAA 2HCRA 1J42A 5HKOA 1U63A 3B53X 3LC1O 9GPBA 2GJAA 3U7GA 1IAVA 3CUKA 1M0TA 4BMVA 4R2JA 4LI0A 1V0JA 1VE5A 1NVWQ 1ADCA 2JVIA 4NYMR 3SDZA 3I2KA 5FUWA 2Y0EA 5GGXA 3P9SA 3SFTA 3F5MA 2O5EA 1NNEA 3F9RA 1XJCA 2X8JB 4DUGA 3RTCA 2Y1WA 4MVJH 2NYAA 5JROA 1TCCA 2ACEA 1MJGM 1PRYA 3R75A 3VJKA 2AMYA 4H7EA 3NU1A 4F8YA 3ZWDA 3KQVA 3R6TA 3HKCB 6CHYA 1VSQA 4BV2A 3KO8A 4R54A 3ST7A 2H16A 3VR6H 4DR5B 1AVTA 2GF2A 1JQLB 3LDUA 3I5MA 3DL0A 2JI6A 2M1XA 3LDAA 1C9JA 2VSNA 2JAXA 3EN0A 1E7SA 4DNQA 1YHNA 5CFOA 3TCKA 1BXKA 2CCKA 2G80A 4M88A 2PS0A 3PZRA 5BV7A 1I94B 2XWBF 3TI7A 2P2CA 2W8BA 2XKJE 3NYRA 1XZCA 2XUDA 4R1OA 2O59A 4FQ7A 2AYYA 3I6IA 4DLLA 2Q5CA 1RBZA 1YDFA 5JD5A 1D7AA 1M2VA 5K51A 5HKBA 2MINB 5P8WA 1KDYA 4HGNA 5KQSA 2ZT5A 4XRRA 3H5RA 4GAEA 1FIUA 2RBKA 2R2GA 1I51A 4H60A 1D2GA 4WXYB 1OHHD 3TAXA 3QYJA 5ALJA 4FDLA 2ZWPA 3JRWA 5A4MS 1N3IA 4QXMA 1EM8A 1Q6ZA 2FSSA 4BN0A 2PX8A 3SEQA 5H7XA 3ZJTA 4MICA 1OTXA 1JDTA 1OSNA 4F21A 2WKSA 3ITKA 3RAGA 3O1HB 2IGTA 1FJXA 2PANA 3IMGA 3KRTA 1EUDB 3WRXC 2VQDA 3D8UA 1VG8A 4WOJA 3ZCPA 2OSBA 4BGVA 4UFPA 3TKYA 2FUG1 1MOPA 1CE8A 3MB8A 2W90A 1PJ3A 2OGWA 2FPLA 3H3JA 1DOHA 3L8EA 4K26A 4QJIA 5IU6A 3LUBA 5JTUA 4DCVA 3NBFA 1OAKA 2OCAA 4J49A 1YZLA 2X2FA 3AFGA 4Q6BA 3UZUA 5ALEA 1YTLA 2J41A 4RESA 4XTCS 1GPWB 1VB5A 3DNPA 5EXDA 3LCMA 2WUEA 2ZWIA 3U1VA 4P9NA 4E33A 3SNHA 1ONBA 4CM4B 1H22A 1ZJZA 5I4BA 1KOFA 1BSVA 1ZU5A 4GECA 4W5JA 5DW0A 3B1YA 1HDGO 1VG0B 1GTG1 1R6XA 4NMHA 3SIPA 3AW9A 1I80A 2FPOA 1LK5A 3S28A 4OQYA 1IXKA 4PLHA 3UT0A 3WWPA 1ZH0A 3R5XA 3AF1A 1V1MA 1WOMA 2YZNA 3HGTA 1YRWA 3NASA 3B13B 4OHVA 1ZGBA 1BWPA 2IUSA 1SEPA 3IERA 3HCEA 4KE7A 1LRJA 4RF4A 4YIKA 1U1CA 4X1KA 4YEDA 5IJ0A 2P6NA 2ODTX 3IL2A 2ZYIA 1QH1B 4MUEA 1JBEA 1UODA 1XKXA 3LY9A 1XZQA 4R01A 3TSZA 4EVIA 3LCRA 5CLJA 1RI1A 1G21E 4KX5A 2PNJA 4C30A 3NXKA 3DYIA 1M1ZA 1AV6A 3OG9A 3TTVA 1PJSA 3KSUA 3JAKA 3Q11A 4L8WB 4DCCA 1B2LA 3CEAA 3ND6A 4GUAA 1U0NA 4E15A 1JIIA 1BRTA 1SVOA 3IUEA 3ZOKA 3KOUA 5BYKA 4G89A 4JQCA 1VTKA 4KBGA 2AQIA 1WCIB 4KDFA 1CJSA 1G291 4BTLA 3A7EA 1RMQA 3IKLA 1IDN1 1GZUA 2RKWA 4WZAE 4AY4A 2H57A 4OATA 1ZONA 1AN0A 4K5QA 4N7MA 2H1LA 4Y2QA 4YRCA 1WW3A 4ZOAA 4L0CA 2JH3A 4BPRA 2VDOB 4D56A 2ISQA 5K45A 1SG0A 5CK5A 1PT6A 5C1DA 4WL0A 5CXXA 2JBHA 5BMVA 3NC0C 3R5TA 3ETLA 1AZSC 2MR5A 5LBIA 2VYFA 4NHOA 2QIPA 2BGJA 3D6VA 3P45A 4L6IA 3HL0A 1R9NA 4QRDA 5H82A 3TX2A 1OB5A 1QQAA 4EHDA 4IHJF 4FBLA 5EVJA 1Y7HA 3TIVA 3ZE6A 3IEXA 4LXIA 2ZKIA 3UY4A 3FBWA 4B3FX 4B2YA 4JXZA 2JIQA 2V7UA 4OXIA 3U4DA 2R6AA 3VNUA 4F96A 2IDKA 1FC0A 4EA9A 1NXPA 1NF8A 1H69A 3I2YX 5DGHA 2CLHB 4EW2A 4G07A 4IVQA 3O1JC 5B7NA 1DG1G 4LECA 1E6LA 4FIDA 4OHKA 4LZJA 1RM4A 5FOWA 3UJ3X 2VKTA 4CE6A 5TGZA 1PO7A 2HIMA 2Q41A 4QJBA 3TIGA 6REQA 4E3ZA 1XTPA 2XV1A 1FSGA 3UBMA 3UGQA 1MD9A 4TLEA 4E14A 3G8YA 2Q3DA 1V96A 3A04A 3DPIA 1ES9A 1VE7A 1G17A 2JBAB 1AB5A 1Z0IA 3B7GA 5JFGA 4OG2A 2DJIA 4GZ6A 2EJUA 1KIMA 4GOND 4G0UA 4R1MA 2YZGA 2BHRA 5HS6A 3AL3A 3PVCA 4QPNA 2E48A 1Q83A 2NUTB 5CBPB 5D3QA 3WLSA 4BLQA 3FWPA 1MAAA 1CLEA 3U7QB 4Q16A 5I6DA 2FF7A 1E0DA 2L82A 4IGIA 3F9CA 4X66B 1I2MA 4RELA 4DLUA 2V0NA 4HD8A 4LYEA 5CM8B 2P2ZA 1JDBB 1DQZA 2FRVA 3DUFB 3NONA 1M34B 2WT4A 3ASYA 1H5QA 1S0UA 2UZ1B 3H75A 1XXHA 4A15A 1DQSA 1QVAA 3T9DA 1J0CA 2A0XA 2O3RA 3GW8A 4IRUB 4EGJA 3VDMA 4FN4A 1J09A 3EQ2A 4M1ZA 5CDTA 4W9NA 5CVVA 4W5TA 2WV9A 2HBRA 1A9XB 2YIMA 1L1EA 4P08A 4UFOA 1V7ZA 1LS6A 1EPUA 1HBJA 2I34A 1PR5A 3HYSA 3MJ4A 3OWOA 1LQTA 3OZBA 4NWIA 4U7HA 3CSUA 1H9BA 1Y6QA 1HC7A 3OCJA 4UXJA 3B3QA 2DKNA 4XPIB 1RPZA 1UBUS 5DSZA 2A84A 2AEEA 2GZHA 3FCYA 3MWDA 3WICA 2XXAB 3O8QA 3M6FA 4GICA 4P0PB 3E9YA 1QG0A 2HJGA 1WQ4A 2RGDA 1LEHA 2QHXA 1UPUA 3N6XA 2RAUA 4NCHA 1ZD4A 3A1NA 2GS9A 5FHRA 3OY2A 4KR3A 2BGRA 4AMZA 2N47A 1TE2A 2C04A 4E2FA 4HWGA 1DBVO 1AKEA 1OWNA 1F2UB 1RLTA 4S24A 4DAOA 4FYIA 5SYAA 3MJDA 4FC7A 5FBRB 2NSDA 4CHTA 5K8CA 2NVUA 5LB4A 3SHOA 1M1YA 3IE1A 3ZQ6A 1KOLA 2AYXA 3CF4A 1GL7A 1XTBA 3FB4A 4JBGA 3T5PA 4KR7A 1J56A 2D0IA 3IR5A 2BMDA 4W1SA 1FX0A 2WHYA 1OLXA 5REQA 4V3BA 2PEYA 3EDYA 2XSZD 4FX2A 4AJLA 3PHCA 4Y8VA 3A6LA 3GN1A 4GI5A 4RBNA 3RUCA 3ZDFA 3ZYCA 2Y92A 1BYUA 3PI6A 3GUZA 3NANA 2FMTA 2NU7B 3EIQA 4ZHQB 3N9IA 4XZ3A 4TMTA 4R7ZA 5TQJA 3VBCA 2B98A 3L77A 4LGCA 5I7SA 1UFVA 2ERXA 4MWZA 3U81A 1Q20A 5TIIA 5K8LA 3CLUC 3P32A 5L3QA 2P90A 1UQUA 1T0IA 1I1OA 2V4MA 3OKPA 3EA0A 3UMBA 3BE8A 3BDAA 5EJ6A 2JH9A 2RGUA 5AH0A 3I9OA 1V16A 2E4VA 1UIRA 1SUEA 1LDYA 4NG5A 2GPTA 1KR2A 4XIGS 2QTZA 4U7WA 3HB7A 4G2NA 5GIOE 3KZXA 5FUMA 3B7PA 1CQIB 1Y6GA 2JGJA 1GQSA 5L45A 4JLJA 4ETIA 4MKGA 2IH5A 3FZEA 1UK6A 3MHPA 5ENDA 5E9WA 4DCGA 4DZTA 3OX4A 3ZWYA 2B0JA 5KO2A 2EBFX 2B8TA 5K6RA 1Z88A 1E77A 1PZNA 1NDUA 1CZUA 3F8WA 2VA9A 4KHPB 2Y71A 2ZU6A 2HBZA 4P2GA 4ZZ1A 2HLDD 2QMHA 1Z45A 1TYDE 3H9EO 3HCWA 1QFXA 1C9DB 2ZWVA 5KQRA 3GLTA 3JQAA 1BE1A 1L4UA 1A9YA 4Q48A 4W9NC 5EPUA 3IQFA 4XQCA 4GEGA 1OAAA 2QTRA 3AF5A 3KKPA 3W5IA 3WLMA 4AZTA 5H70A 1QLJA 4LXXA 3LECA 3KALA 2QDXA 1BJKA 2MR6A 5LXTF 1OZFA 4HXGA 4B46A 5B4UA 4ZTUB 2PUAA 5EJFA 1CIJA 2F1OA 1ZU4A 2YYAA 4ZZ2A 2GJ4A 1AB6A 3R44A 3FFXA 4QUHA 4LAFA 1GP2A 1GLVA 3ZCQA 5EE3A 1X38A 1P29A 1TF7A 4LNUB 4YAJA 5TARA 1Q44A 4F46A 1TDJA 1HRKA 4Z8YA 2C42A 2JAWA 5GONF 1LRKA 4Y0NA 1OD6A 4FSHA 4YRTA 5C0OE 3H4IA 4Z49A 4G5YA 5ELXA 2GCOA 3H11A 3VH1A 3R3YA 2W6JD 1QIFA 3I72A 4PGHA 1F6WA 1AJEA 1RJ9A 4DG8A 1QRDA 3SSMA 1EINA 1TPZA 1Y81A 4UMFA 5CFZA 3PPXA 4Y6PA 2OCPA 3UCEA 2CF6A 1PHPA 5JDIA 3L7BA 1EE9A 1IWPB 3L9XA 4GBMA 4BZWA 1E3TA 2PA0A 2WSLA 3FBTA 1KH1A 1JBKA 2QN8A 4AJ2A 3HWSA 4JHXA 3SE0A 3T3OA 1G5HA 1TVCA 1A7KA 1WABA 4GXNA 4QDZA 421PA 3H6GA 1QBKC 2FFAA 2KW5A 2RIPA 4P4NA 4R16A 4U7DA 4XE5A 4QJ4A 2WPDA 3QRWA 4B3IA 1LPMA 2Z09A 3CONA 5FTLA 1ZH4A 2DVMA 3EXG1 3TLEA 1OFUA 1R2QA 1P5ZB 2EDAA 4NP6A 3TWOA 1S2MA 4OREX 3F6RA 3KTDA 1ZA1A 4QYSA 3W2HA 3AFMA 4MTLA 3T7RA 4BX8A 5JJKA 1RXVA 2C7RA 2QYTA 5K7SA 4L2IA 4G0WA 3W6PA 3FKSD 5GVRA 1KJQA 2XE6A 3KE8A 1KE2A 5IVIA 1NKVA 1E98A 3Q7EA 3I2HA 4HDAA 3NIWA 4JL8A 3EEIA 1HNWB 2VT7A 2PUGA 4TN1A 3FI9A 3ZZNA 4CKBB 5J2UB 3ZU4A 2D2VA 1CSEE 1PR9A 3IGFA 3K09C 4GLFA 3TLMA 3W7VA 2FN8A 2A3RA 1GUZA 2DKFA 3LTNC 3HJNA 4N3NA 5LIPA 2HMWA 3G2JA 4JD5A 2G5PA 3OEEA 1X1CA 3B6ZA 4LGVA 3AETB 1I24A 2H9IA 1TT7A 4D57A 1US8B 4RY9A 2BMEA 1W5TA 4Q47A 3WFZA 3Q98A 1Z29A 2AB0A 2H1WA 1YZVA 1NW5A 1XPOA 4LJ6A 3RGWS 1G8AA 2C5AA 2VRCA 3IJRA 2ZZKA 4MARA 4ZAVA 4PINA 3TJMA 4EGAA 4ZT5A 2EJCA 3A6EA 4EHFA 1X13A 5EZ6B 4Z3OA 1TK2A 4P3XA 2YJNA 13PKA 1U0OC 1WLYA 3LDFA 1NC1A 1QS0B 4M9ZA 2I9KA 1NW8A 2FPSA 4G1VA 1SK9A 4V0RA 4ECAA 3Q8KA 5C8DA 1RQ7A 4NFLA 3GUHA 2G0TA 4J3NA 3DZDA 3O74A 4J6EA 1A9TA 3PV0A 1F0YA 5AXAA 2W6PA 3GEBA 5CW1A 1W35A 3EXHC 4ZVLA 2GEJA 4EF4A 1H5NA 4PS0A 4CM8A 2Q0XA 1KMQA 4AZ3A 2WUGA 1C7RA 4ZVTA 3WL8A 3Q8LA 3F0TA 4QRIA 1S7GA 1QJCA 3EVBA 4BXOB 4GF5A 3MD0A 4XWWA 2QZPA 2QKYA 1K63A 2AYZA 2BTEA 4D6XA 4BN5A 1XI2A 3NEYA 4DUPA 4NBNA 3GLVA 2J6BA 3PWSA 4L4RA 3N74A 5JDIC 2GBCA 2N75A 3BXFA 4V0NA 5JTTA 5EIBC 1OI4A 7ABPA 3TTTA 4EG1A 2E5FA 4TS9A 3UHAA 2EATA 3MTAA 1RBQA 2JCXA 1LBTA 3IUYA 1T15A 1VPEA 1AKVA 1DRWA 1SBIA 2Q6OA 5DNCA 3VU0A 3PA8A 3WLPA 1GGHA 3T1OA 1RWBA 1E4YA 1RQRA 2QNRA 1FSZA 1JJBA 1RKQA 2EWVA 3DQZA 1MABB 3GJSA 4P36A 3JQ6A 3SC2B 3VNBA 4D3FA 1CQJB 1U9JA 1ZIOA 3SKYA 2CHUA 4IIEA 4G5RA 4NZPA 1MB9A 1SZDA 4C43A 4DSUA 4EATA 2A8YA 4F4IA 1E2BA 2JLAA 1P5JA 5GJBA 3RPEA 1VJ0A 2YHBA 3JALB 3KXPA 3PUVA 5D2CA 5FPTA 1E4EA 3EASA 1KRXA 5D86A 3PI7A 1LWOA 1NJSA 1P4HA 1V3TA 1PCXA 1MFZA 5A7GA 2PT9A 2BM9A 4B44A 1KK2A 1Z6PA 5FYDA 3RSHA 2C8JA 4QYIA 5DMXA 4ZC8A 4DDVA 4QYXA 1EH5A 1R0SA 2IGBA 3OX1A 2IPMA 5CDUA 2E5LB 2I4TA 1XD8A 2HNBA 5E1BA 3PK0A 1PV4A 2VH5R 1E3SA 1OYOA 1KBOA 3GJ7A 4G2TA 1MIHA 4BVHA 4AQ7A 3F8SA 5I47A 1GQ2A 1LKZA 4H1HA 2M9MA 2VZ9A 3P2YA 3I37X 4QT0A 5SYNA 3O8LA 2YQZA 1X7DA 2Z95A 3L7JA 1KZ7B 2XUJA 5KTSA 2IF2A 4LE2A 1ECJA 1AKRA 3RC3A 1ONNA 1Z6GA 1OWMA 5DCWA 2D6FA 3GBSA 2SKDA 5FWXA 3B9PA 3GD5A 4IL5A 1U8TA 3ZGZA 4NBKA 5SZIA 3NIFB 3R4VA 2H0QA 3DDZX 3W5JA 4B3JA 3HJCA 2IS2A 2J08A 1VYVA 1VECA 3DLCA 4BEWA 3G9XA 5EHXA 5PGMA 1RCUA 1ZL2A 2R5FA 5ICMA 1XRNA 4FHEA 4OK5A 3UK2A 3OM9A 1O08A 4BFWA 2H4HA 3TOXA 2WIDA 4QOFA 3DJYA 3I04A 1E1NA 2CYBA 2OV3A 4UOQA 5DJ5A 3DKIA 2C0CA 3C3YA 4PZYA 2QEQA 4TTSA 3THWA 1SXHA 2VA8A 3OJXA 4EA7A 4W63A 1U3UA 4ND7A 1RPTA 5DPMA 2Z6UA 1FYDA 1NN1A 4RULA 1NLUA 1XMVA 1Z36A 1E96A 4HAUA 2CD7A 3LFUA 1LBEA 2NV2B 4I1VA 2Q5EA 3PS9A 4UULA 1VSBA 2IL1A 1AZLA 3LKVA 4PF1A 1RRVA 4G1MB 4EKYA 2DY0A 4MROA 2PS1A 1U3VA 2OLJA 1PJ2A 1IB6A 1L7EA 3FYSA 5K9ZA 1APBA 4FWTA 1FBTA 1HDOA 1S2NA 2EP5A 2X2PA 3BK2A 4XQ0A 1XZDA 4Z1MA 4D9EA 3K6SA 2R751 4B4UA 4YV1A 1ONPA 1SD1A 1CQZA 1VBKA 2ZYVX 1C7JA 4OBWA 5K0TA 3JQGB 4GPBA 3ABSB 1TM1E 4RLQA 2A59A 3CT4A 2C57A 3HY3A 2QAGA 2XD9A 3B6EA 1QIIA 3BIXA 1SU7A 4EWLA 1V47A 5A02A 1ZFNA 3UKDA 2IYYA 3HDTA 1WMSA 2AG5A 4TV8B 1UJBA 2Z4SA 3ON5A 5LU8A 1ZEJA 1ZD5A 4G9GA 1OB2A 2G72A 3ANNA 3PUKA 4PLPA 4EKIA 4YA6A 5LMZA 3FVRA 2I80A 4J16A 2HXYA 1Z56C 2ZT8A 5B1HA 1FNMA 3MUFA 3N2GB 3R7FA 4HDMA 2XXJA 4IXWA 4YV0A 1W30A 3NKFA 1X9HA 2OLEA 2H0AA 2C61A 1OT5A 2OEPA 2D1QA 1NVKA 4Q9AA 2P1ZA 4U4AA 1RFGE 5JSQA 1K08A 1UJNA 2YY6A 5JHGB 3K5WA 4I55F 5EYPA 3I2GA 5IVKA 1PTJA 1UC9A 2FR8A 3GUVA 1W0CA 2PVPA 1IWBB 3OM1A 4X41A 2GRUA 1F8UA 2HR1A 4XDYA 4LYJA 1TIPA 5KNLA 3RU2A 4MA5A 2EZTA 1YB4A 2HWXA 3DP7A 4FCTA 4FDAA 4TQGA 2OZVA 1XROA 4OQNA 5AK3A 4C0JA 3Q9LA 5C8YF 2W11A 1RXWA 1DXOA 3BFVA 3IMCA 1KI6A 4J0CA 1N0IA 1QCDA 1P7PA 1Z2DA 2Q4BA 5LNK1 2J5XA 2I4LA 5JD4A 3GXOA 4WX2B 3R77A 4OUDA 1HDZA 1LLDA 3D3WA 4XEUA 5TVGA 3NETA 2B36A 5CLQA 4CIDA 2ZJBA 3C1UA 4WDRA 3DVAA 5JCJD 4QX6A 1YIAA 3WGUA 4KO2S 1D0SA 2PK3A 3BPSA 4BGUA 2XMDA 3BMCA 2IXDA 2IUUA 3O2SB 1FYWA 1Q0UA 2C29D 5BNIA 2C2OA 2D00A 1LRLA 5HTOA 3T94A 1SZCA 4RHYA 1ZA2A 3Q0IA 1CUVA 4S0XA 1TYAE 3CVJA 3OJOA 2WYHA 5NLLA 1GIAA 2GUWA 3PG5A 4ZVPA 1QB8A 1EZZA 2XPCA 1A3CA 1FFCA 2QXTA 3JRXA 2CLEB 1IFXA 3UJPA 4ARZA 4ABTA 2XE8A 2XTJA 2JFUA 1MRNA 3C97A 3MTBA 4GR5A 3I30X 1JFTA 3EWNA 4L9SA 4FFNA 2NYVA 1EM8B 1XEWY 5LPNA 2C1XA 2UUPA 3I5AA 3JVVA 4YAEA 1UR5A 3DAFA 2WWFA 3FNHA 4OLAA 2GYWA 3W1WA 5K0FA 4NZOA 2WSBA 3GNLA 3OCYA 1EHYA 2QAGC 4KLZA 4EMTA 3WB2A 3KQPA 4J1QA 1JFFB 2G9RA 3ND9A 2FK8A 2H4YA 4ND8A 2J3HA 2XGJA 1ZMOA 2Q4RA 1DTWA 1ANKA 1E1RD 1UWCA 1NT4A 3H9GA 4J1NA 2ZSEA 2XLBA 3Q87B 4CF6A 4JCCA 1JEDA 5KNCA 4KFRA 4J16C 2ERCA 4F84A 1KEKA 4X8LA 4N39A 1N3BA 4AM8A 3NH9A 1KY5A 2DWQA 1PYDA 4WKOA 3WXBA 2ZBEA 4A82A 4YAGA 3THYA 4IJUA 1PGOA 2FQ1A 3UB2A 4QM7A 3ICQB 4RFSB 1BGWA 4KXUA 9LDTA 1D2MA 4U2FA 1J5XA 4D6PA 1XQ1A 4Q3NA 2FR8C 1TTQB 2GPBA 2QD2A 4GOMD 4QBFA 2JASA 2V54A 3IILA 3G0OA 4W4TA 3WMXA 3LUPA 3WYFA 1GU1A 4PVCA 4B84A 1AF7A 4F7DA 1WDMA 5KX5B 1YDMA 4G4SO 4V3CA 1DAFA 3DQPA 4HY3A 2Q46A 1TZBA 1V3UA 1NAIA 3AK4A 3GVPA 4ID9A 4Q1FA 4XJVA 4ZAXA 3A11A 5FO1A 4DDHA 1V35A 4HRYA 4G0QA 2WIAA 2DLDA 3BB1A 3BHJA 4OHOA 3IFSA 2B69A 1PZEA 5DT9A 2ADMA 5U1PA 4MQ4A 2P9YA 1P74A 3U61B 1CEYA 4D3XA 1AA6A 1Q92A 3WYGA 4FFMA 3E5NA 1BE6A 1ZCBA 2BD0A 1GA1A 2HFKA 2DCMA 3EG5A 4WFJA 3BOSA 5JMPA 2W4MA 5FJIA 2O2GA 3SLKA 3U7EB 5K8IA 1F2TA 1OX4A 2XYHA 3VHQA 3PLAE 3G5UA 4LZNA 2AVNA 1I7PA 1WCV1 1Z7BA 4KLNA 4HFJA 1VHQA 1XCJA 1YL6A 4Z0TA 5FV4A 4LZLA 4JB0A 1NR7A 3S7ZA 4X3PA 3LVRE 3DE2X 3EGDA 2P68A 3S1SA 1XMQB 1CKEA 2ZIFA 3L1JA 4MS3A 1JFVA 2JI7A 5A0VA 1NP7A 4BU1A 5K0BA 3UNXA 4F5ZA 2FOXA 3RFUA 2G06A 1SU8A 3OZCA 4YV2A 2IQ5A 3DCNA 2I6TA 3UUFA 4ZZ0A 3ILHA 1SR8A 4JV5B 3GLIA 1CD5A 4GP7A 4M8NE 4Y2TA 4ETWA 2VAXA 4W7SA 1YR8A 3QPVA 3W34A 2I33A 3H87A 5B55A 1B6SA 4UAUA 1FDSA 4G5OA 3WLQA 3LYHA 2BFBB 4RWZA 1U4SA 2YJ4A 5JLJA 1ZVMA 4TL8A 4Q9NA 4C08A 5IM4A 1PWYE 3GFFA 5BQXA 2BV3A 3EVTA 2HSZA 3IQDB 1BCRA 1H1LA 1ZCAA 3IP9A 4IW3B 2BFWA 4F3NA 1ML3A 6REQB 4P86A 3FN4A 3R0JA 1DGQA 2Y4NA 2QSYA 2LUOA 3AR6A 4U00A 5LC1A 3KOXA 1CUWA 2BGMA 2O0JA 4ARUA 1F14A 1R74A 2P5SA 3C3BA 4ND1A 1WSAA 3ENVA 4KRYA 1ORRA 1YL7A 3TB4A 3TS1A 5E7IA 2O8VA 2C8LA 2W5UA 2WHPA 5AMXA 5FEMA 2P77A 3NVKI 1XPRA 3A32A 3NLLA 5DTQA 4IQ4A 4PWYA 4YJ2F 2FSPA 3K4PA 3DJFA 1KK0A 3HZZA 3JYLA 5B7GA 2XTMA 5AHRA 4G4SP 1JAZA 5DWVA 2OILA 2HNKA 2ETVA 3OT4A 1ID1A 2C1EA 1HEIA 1MRSA 2G09A 4W8GA 3O8RA 2V0GA 3Q41A 2FFQA 3NM4A 4C04A 1EK6A 1Q0LA 1XXHB 4NZZA 1Z2AA 1L5HA 3I09A 3THXB 4IDQA 3ABOB 3T06B 2ZPAA 3H86A 3QKRA 2ZWMA 1SCJA 5J2TF 4KQKA 5IT9A 2IZ0A 4I4TA 4IQGA 2IWRA 5L53A 1YU6A 2ESRA 4N5DA 3MWEA 3OCWA 4IDNA 4MTCA 3ZE7A 4PYIA 4UU0A 1TK9A 4ITVA 4A1OA 4RQBA 1X80B 1W0JA 2WKWA 1Q7GA 3JATB 3WVNA 4DLKA 4GE0A 4IOLA 4D99A 1WSWA 1Z4NA 2OD2A 2PWBA 5IJXA 5JR3A 4DCSA 4GO1A 4ZT6A 1VBMA 4LK2A 3WLJA 1GLGA 1YS6A 2C3PA 2VK2A 1K3FA 1T8RA 3KAKA 3OOSA 4GI3A 2CVZA 3CO0S 4RACA 3U13A 1OREA 1IL0A 1H0HA 2A78A 4PIMA 3MWGA 1NFRA 3T1QA 4PR0A 4FFDA 3W3AA 3LXXA 4H2DA 4TS1A 4TXNA 3T5BA 5IDQA 1NUSA 1NVTA 4HUQA 1STOA 5K20A 1Y5NA 4X3OA 4BIIA 1UPFA 3MMSA 4ARCA 2FDRA 5CXUA 3BJZA 3LTEA 1AX9A 2D62A 3ZXXA 5FPSA 4KXYA 5FUYA 3WISA 2V74B 4I1YA 1XZJA 2ID8A 2HBYA 2BFEB 2CD9A 2LCIA 2PX3A 3ETCA 4OQDA 4KNYA 1XJQA 1C3JA 5E3HA 4X91A 1JEYA 5REQB 5T8KA 1F0PA 3W0LB 4MEJA 2NV0A 3KVYA 1QWSA 3F2IA 4IV5A 3VC2A 3CVYA 1DTSA 2A30A 3IHWA 1JJIA 3OZEA 4GKAA 2FPGA 2V7GA 3LC0A 2LW7A 3FPBA 5GGYA 2QLJA 1MX9A 2B92A 1T91A 3AHDA 4Z5XA 1G1MA 1E6UA 1N7HA 2PR2A 2XUIA 3U0VA 1LSSA 3OQ1A 3JZIA 2CXHA 5HMLA 3TLKA 4FYHA 1OMOA 3VVCA 4G25A 2XVZA 4I8IA 5BYAA 1F8YA 1I5OA 4UARA 2RE8A 1PR3A 5IAAA 5JYBA 1O6BA 2FZ4A 3EJ6A 4JBXA 4JSTA 3DEHA 4KMSA 4MUYA 2VTKA 3QEOA 2IT1A 4JJFA 5GZ1A 3JQ7A 2HMTA 2NLOA 3EH1A 3QKIA 2Z56A 2R1VB 2H7XA 2QV7A 2R8RA 3PC8A 2OKGA 4RGYA 5B1DA 2PBFA 3ZHZA 3MQ4A 2J3IA 4LDZA 5B3LA 4DVGA 1ZICA 3A28A 3AI1A 3C5CA 3OA2A 4GZMA 4HNUA 2BMAA 3PD1A 3F6EX 3L9WA 3NVDA 4YRSA 4GOLD 1X15A 1MO3A 4HTAA 4TT8A 2BTOA 7MHTA 2GAFA 2WJYA 3IAHA 3MIIA 3MMNA 3GVIA 4B79A 1T1EA 1OPRA 5FA8A 3DLAA 4QEZA 2ZXFA 3K53A 1QP4A 2O06A 4ONEA 4ZYVA 1HT2E 3SZMA 2AJCA 3OFKA 1TX4B 1JAXA 1K6MA 2RGAA 5I8ZA 3JQAB 4RVHA 4OXXA 1YOBA 2NT3A 1Z0DA 3AUXA 4P0QB 2VOEA 1EMDA 4OHYA 2VHUA 5EE9A 1ZR2A 1Z3CA 3AC0A 1V48A 3QOYA 4L8GA 2B8NA 3UN1A 1G8JA 1EZ1A 2D5CA 1RNLA 4JLWA 5D7NA 2J9RA 4RZ2A 1W6RA 2G77B 4JYCA 1DQNA 2Z08A 1U2PA 1P4GA 2VNHA 1M76A 1FUIA 4K9PA 1CFZA 4DAEA 2ZVJA 5FNVF 1T25A 1PQWA 3L6UA 1ZMRA 3HB5X 2ZBGA 3QVVA 5CGQB 1EP9A 2C98A 1PK8A 1USVA 3EXHB 1GNSA 4YFVA 1VP3A 2ZJ6A 3DNFA 3K9GA 1S9HA 4BQFA 2RIRA 3FYUA 3DZHA 2AJTA 1PWEA 3NVAA 2YVLA 3N2IA 2VP5A 1M2NA 2GCOB 5IH3A 2FG5A 4U7TB 2GSDA 2P4HX 2WJVA 2EZ9A 3D5EA 4PYRA 3SXPA 3TAUA 3CNNA 3T15A 1FDTA 3CTPA 5IAJA 5BSKA 3L1IA 1SFRA 5CDYA 1RJ9B 3BKWA 4MCHA 1WSBA 1LD3A 3MZ0A 2HNAA 3Q8WA 1SH7A 2PMCA 2PZFA 2W2KA 3U3MA 3ZHBA 1EFCA 2IS4A 3DCYA 4C78A 4HEA6 4HUTA 4C0AC 3LOQA 2O8CA 4UHKA 4X94A 5GPBA 5KYUA 4PRKA 1KO4A 1U2TA 4K6KA 4QPZA 3QBVA 4UVIA 4ZGWA 3SVLA 4FYWA 1ESZA 4E51A 2VUSA 2ZS7A 3EUAA 2WUWE 3QMWA 2NU6A 1Q3KA 1Z74A 2ZKLA 3BD6A 5EXEA 1OPXA 5AKEA 3GFRA 5DBGA 1XZHA 4EG8A 4PLTA 3K2IA 3KQUA 2E1PA 3BAFA 3UM9A 1W85A 1Z82A 2AFIA 1NQVA 1T3HA 3KYDA 3HJHA 4M3NA 3SM9A 3ADDA 2M6LA 3KWLA 3FLAA 1XDWA 3CLSD 4N7RA 1UJCA 4LY0A 2NO0A 4UHHA 3RRJA 2XQGA 2AZMA 4RCZA 2QSUA 3IV9A 3VU8A 4BQRA 1YMQA 3PC8C 1CY7A 3WBFA 1QO9A 2CNNA 2PUDA 2YIDA 1XOIA 2X5KO 3QEMA 4ZVVA 1U31A 2P0AA 3HWRA 3P9PA 4I9HA 4DANA 1T5BA 5JAHA 3JRNA 3H1TA 1EWRA 1PSWA 2QZJA 2WW8A 3RW9A 4LW8A 1DQRA 3AM4A 4BTVA 5A3QA 2EHDA 4FINA 1IRXA 4R83A 4AC9A 4AKHA 3OIDA 3ELBA 2XGMA 3PHGA 2WZBA 4DBLC 3QVSA 4L8LA 1CZRA 1F3OA 4MX8A 2JNWA 1VCOA 2WA2A 4I5GA 3RRZA 2OV4A 4R6XA 2VWPA 3AP3A 3VZQA 1EEXB 5CBKA 1WCXA 4OEHA 5BN5B 1RZ3A 3L49A 1U7XA 3DLHA 1NXVA 3JV7A 4CRWB 1O57A 4RLFA 4NV0A 1XNQB 3AY3A 4L72A 1GV0A 1W4AA 4HZGA 4RVGA 1HH4A 3DDOA 4F06A 2QTCA 2P6UA 1NMSA 4TVOA 2XKKA 4EMSA 1UBGA 1LPAB 4OIFA 2HIHA 4JK3A 1E62A 4JQOA 3FB1A 1X87A 5GOZA 2IEBA 2JGRA 2MMGA 2AV6A 3R3XA 1U2SA 2CDAA 5ENZA 3EXG2 4EUFA 3UHFA 3JWJA 4O02B 5CB4A 1N78A 4AZ3B 1AQYA 2BMVA 3FYUC 4S05A 2ORWA 2V7TA 3ESRA 1UBHS 1SOWA 4FLMA 4R9NA 2VK8A 4P38A 2IS1A 4TKUA 3LXUX 5AQEA 5DNYB 4GI7A 4DEVA 3M7IA 4NEGA 1V8FA 4MV5A 2I03A 4JX9A 1E5QA 5HM6A 2ECOA 1G6OA 3WLOA 3KXKA 2PE5A 1NWCA 2YH2A 3EUEA 4R1SA 4UM8B 1NRWA 2XXBA 3VAYA 4EG7A 4Y2SA 3G0CA 2BFOA 1L7MA 2EF0A 1G2IA 3L0OA 4CKCA 1EWYA 3PF8A 3PE3A 3TRHA 3L7LA 3FM9A 3GAFA 3LCVB 1JWAB 1WP4A 3AF0A 4RM3A 2OMEA 1YCHA 1B8PA 2WYVA 1ZRNA 2EXXA 3MGGA 3D3KA 2EV9A 3PITA 5K3FA 5KOIA 4X7RA 1F3LA 3HY6A 4YRKA 4BASA 2AN4A 4LRXA 2PN1A 3LKDA 2D3WA 4MQEB 4LY9A 5AUPB 2ZUFA 4D92A 3QQ5A 1YB7A 3ICCA 1E9SA 3VNSA 5ER6A 4B5KA 3AR7A 2VC2B 4IEEA 4A2CA 4L28A 1SXQA 3ER9A 2VQEB 4TMFA 4RHXA 3ZGLA 4PPNA 3GJ3A 4OI2A 2Q1UA 3IUNA 1DC3A 1QGUB 1A8SA 3G5TA 1KFJB 3NHBA 3V4LA 3BCHA 2VIIA 4QYIB 3VI3B 4XJXA 2FTKE 4YQFA 1UBLS 3C43A 4RNDB 5CD1A 3ZU6A 1E2LA 2ACKA 4LDJA 1Q2UA 2Q2NA 4KE6A 4JFRA 2XQKA 3A0RB 4UMVA 2PUFA 1D6SA 1V25A 3PEUA 3S29A 1QDUA 3IE0A 4P4GA 2MSKA 3HKBB 1OH6A 4DW8A 1AK9A 1IBMB 1H8HD 1N2CB 2QF7A 4P35A 4ZCTA 2YWEA 3ADKA 5AKXA 3ZVMA 4FEAA 4GRAA 1JSCA 1ZCFA 4JYMA 1WVGA 2YBDA 5EMHA 4ME6A 4HOYA 3NWEA 3K31A 1W59A 2D0PB 1QF7A 3HADA 1R8YA 5GIPE 4M9XA 3PPVA 2AUTA 2QBYB 1IRIA 4R3NA 1DBIA 4JGGA 4G65A 2EZ8A 3V34A 4EF6A 2PZAA 1LX6A 2JCGA 1Z6XA 5BN1A 4NVRA 4NS1A 3FRJA 1WTAA 4DMFA 2QQ0A 3T7JA 2VBIA 4HSEA 3EC7A 3BZWA 1SUAA 3JCZA 5AVQA 3IPRA 4XB1A 4QTZA 4HXFB