2NO1A

C4s dck variant of dck in complex with d-dc+adp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
240
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxycytidine kinase
publication title Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 240
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2no1A00
4QHYA 4DSUA 4LYHA 1SHKA 1OYYA 2IK8A 3PFIA 1GG2A 2F1IA 4QGGA 4G5OA 4UJ3A 3HYTA 1NLZA 1CEEA 1T9HA 3Q72A 1W0KA 3AH8A 5KO2A 1CJVC 4X8HA 3X2SA 1QHNA 2OT3B 4UXIA 4D4JA 3C15C 3NHAA 1Z0JA 3SOPA 3EXAA 5HE9A 4HAWA 4MKIA 2ZI9A 4IXNA 5L8VA 4J0QA 1L4UA 3E5HA 5HE8A 3CB4A 3HP1A 3ZQJA 5E7IA 2QTFA 4RFSB 2W2VA 2C96A 4F4JA 4IFBA 2YOHA 3EASA 4XTCS 2VP6A 1ANKA 5DISB 5BYJA 4UXJA 1WDTA 5FBRB 3EIHA 4DLZA 3LFUA 3NVAA 4LC0A 5CB6A 2AL7A 1J90A 3NBYC 3OIUA 1YR7A 3WBKA 1MT0A 2J7PA 1Q1BA 3WXMA 2PT7A 1VG8A 4TYWA 2WWGA 1QBKC 5K8IA 3U3RA 4YMSA 3X1XA 2AKYA 5EJEA 3KXIA 2Q9CA 1ZAKA 4DVGA 3U4QB 4QJ4A 2Q0HA 4QFMA 2HCJB 3PEWA 3RAPR 4DHEA 1F2TB 3QKSA 4CEIA 1DAMA 2D4HA 3LWNA 4GMXA 1E2EA 3SNHA 5JJIA 1IHUA 3NG1A 4CDGA 1I4LD 4HLDA 1JXOA 3L0PA 3SJZA 3T15A 1G5PA 1ZJ6A 1FTSA 3R8CA 4GZLA 3VU9B 2C04A 4JLVA 4GZMA 5EE0A 1ZNYA 2CL6X 5FOUA 3I1FA 1X1RA 3VR2A 1Q1ZA 4ASUA 1BYIA 2MMGA 1M74A 3RC3A 3K9GA 5DLQC 1G64A 1E9CA 2R6DA 2IYXA 5GJBA 3IHLA 4JLBA 5A5GA 1Z6YA 3GEIA 2YZ2A 1ZM2A 4TYPA 3EZ6A 1H8HA 4D0NA 3EARA 3LXRA 1G7CA 1X1SA 3GLFE 4FMBB 1T3SA 4L4UA 1W47A 4HZUA 2QPOA 3Q7PA 1GSIA 1YZNA 4UNRA 4Q9LA 1OLOA 1VYVA 2IXFA 1ZM3A 3BWDD 1M8PA 1QZXA 2FSHA 1OIWA 2R44A 4HB2A 5AWFC 3UIEA 5B64A 2XZOA 3FYHA 1KZ7B 3LO5A 1W0JD 2CCJA 2GNOA 2ZTSA 4FWIB 3FHOA 5JWHA 4R2HA 3GJ0A 4LGMA 5FOTA 3NC0C 2KBEA 1FZQA 3AGQA 2C8VA 1S3GA 1MABA 2VL7A 4DCNA 4BZPA 4A6XA 2IF2A 2HCBA 4B3BA 4PAOA 4TWZA 4YMWA 1E2MA 1II0A 4P4SA 2OBMA 4KFRA 5JJKA 1A7JA 1NF3A 3Q8XB 2Z43A 4RD1A 1TNDA 1N6IA 2ZJOA 3OF5A 4Q1CA 1U99A 4TMTA 3AVXA 4LSGA 4Q18A 2PLRA 4O2RA 4JL6A 2JGNA 2YWHA 2MSDB 3U6KA 5FOWA 2OEPA 1PJRA 3K0AB 3EC1A 1A2BA 1GITA 4JLMA 4LRWA 4LYAA 2PCLA 1VTKA 2J1LA 4Q7JB 4B33A 1G5RA 3K0FB 2BBOA 3QENA 3CRVA 1DS6A 2ZQ5A 1X8LA 3CWQA 1E3MA 3A1TA 1UBEA 2GXAA 1ZINA 2J7KA 3THOA 4D2IA 4JL8A 3SYKA 1ZD8A 1KO4A 4M2LA 1VCOA 2R6CA 1VCIA 1XDBA 2O52A 1JALA 5C4GB 1UM8A 4EPWA 4AD8A 3BGWA 3V4RA 3ASZA 4NE2A 1RE0A 3U60B 2JJ1A 2QZ4A 5KSYA 3ZLJA 1HE8B 3VR4A 3DZ8A 4KO8A 1GAJA 2J3EA 1T0HB 3QXHA 2FG5A 1QHXA 1N0WA 3GEEA 1OXXK 3KKNA 4F93B 4ERNA 2WSSA 1KNQA 1JJ7A 3HU1A 4Q7KA 4Y0VA 2G1JA 2OFOA 2ZREA 1S96A 2JLZA 2JLSA 4AKHA 4QHSA 4DT1A 5FPTA 3DL0A 1XMJA 3K9LA 4TQ9A 1KGDA 2ERXA 2NZ8A 2ZRIA 1EFUA 3ZZ0A 3HDTA 2ZS9A 2R6FA 2GJ9A 1G16A 2HJGA 4JLKA 5TARA 3QF7A 3QKTA 2B92A 3SQWA 4BPBA 4PZYA 2OFWA 4OI0A 2GZAA 3PUZA 2IYSA 2I4IA 4URUR 4CT4B 3RS5A 5LB2A 4CRWB 4RZ3A 4M1YA 5FL3A 2WJHA 2GK6A 1P7CA 2EWWA 5L3QA 1N6RA 2O5VA 1T0JB 2IYWA 3GLFA 1XD2B 1J99A 3QXJA 1R0XA 2HV8A 3VNVA 2N42A 1T8TA 1B0UA 4B71A 2H17A 4EFLA 1KI7A 1D8TA 1ODFA 1H65A 2PX3A 1E4YA 4KLNA 4PHHA 2ZJ8A 1UBFA 3TNFA 3R8FA 4XD7A 5EP4A 1FW6A 1ZD1A 4JIMA 5CLLA 2IUTA 1NLFA 4DLSA 4FXPA 3K0CC 4KVAA 2XOKD 3MMPA 1E2PA 1SXJE 1DG1G 3W34A 2F55A 1W36C 2ODBA 1UKYA 2J59A 2ZI4A 3BB4A 4OBEA 4MRPA 1UAAA 4NCIA 2W6JA 4YMUA 2CLCX 2PEZA 4NYIR 1BKDR 4GFDA 4ACAA 4TT3A 2FU5C 2UVQA 2P6UA 4KI0A 1COWD 3QPWA 5BWMA 1KHTA 1AA9A 3KL4A 2XITA 3NBFA 3PXGA 2X19A 4G5QA 4YXWA 5KNDA 2XB4A 4LJYA 5HTKA 1F2UB 1Z6AA 2D7CA 4BFTA 1P4SA 1SVSA 3LVQE 1J70A 3AP2A 2FOLA 2JLRA 3T61A 2GBLA 1ZIPA 2BV3A 2J46A 1G7SA 3BH6A 5L3VA 2IYUA 1TX4B 4S2EA 3LRPA 5JZVA 1GDDA 3B60A 3CM0A 3K1JA 4R98A 3HR8A 3KB2A 3W6NA 5GADl 2EYUA 4M0LA 2GEDA 2NG1A 3LV8A 2GAAA 2DBYA 4IEEA 4W9MC 1XJ0A 4II7A 2F1JA 5B58C 2IT1A 3EA5A 3TUZC 3K0CA 1CR2A 2P2LA 3KUCA 3GLGE 3AVYA 2P67A 3TW8B 1TQDA 5JRZA 5EUQB 3X1ZA 4RJLA 4M4SA 3ZVLA 2ZRPA 3GLHB 3I4LA 1ZM9A 4FMDB 1G8PA 5JCZA 1U8YA 3EX7C 3FKSA 4XWKA 4JVSB 3S1AB 2YC4C 5FBWB 2VP9A 3CNOA 3L0IB 5KYKA 5KDDA 1OXUA 3U3KA 1BS1A 4XTRA 3HU3A 3OEHD 1KOFA 1OFUX 3VHLB 4Q7LA 2QSYA 3OESA 2EFEB 4M1OA 2A5GA 3QOFA 3CKLA 2ZRFA 4BEJA 5JFGA 4C7OB 4HSEA 2FV8A 3QKRB 2ZJ2A 3IQXA 1F3OA 2VSFA 4A8JA 2F6RA 2BCJQ 2ZRLA 5IF9A 1MO6A 2GXUA 3DOFA 1U9IA 1K8RA 1BOFA 1TUIA 4XWAA 2FPKA 4PO9A 2HJVA 4LZZA 3X1WA 4JT2A 3MLEA 1GUAA 2EYQA 3BC1A 4MGZR 3FDIA 4V0NA 4DEXA 2CHGA 2O8CA 4B32A 3RANA 1XJCA 4OI2A 4LV8B 4Y0AA 2BJWA 5JRJA 3KKMA 4B2IA 3WYAA 4KLZA 1LB1B 3SZRA 2VTKA 2R9VA 1GNQA 3OE7D 4OK6A 2V7QA 2ANCA 4N0DA 2ZR7A 2QN6A 4ESHA 1M7GA 2WKPA 3AVUA 4A6PA 1JI0A 2ATXA 2TMKA 2QT1A 4FINA 621PA 1IY1A 4CIDA 3ZH9B 4JVMA 1W36B 2FDCA 2QSZA 4I1SA 1SXJA 1Z6XA 1OIVA 3NH9A 3U3JA 2NPFA 2QI9C 4PPQA 1A5TA 2ORIA 5IT5A 1E2FA 3RRNA 4BWYA 3N5CA 2D06A 1AQYA 3VKWA 1EFCA 4D0GA 1P61B 3NH6A 4K81B 3G0HA 5SZKB 5B30A 2HT6A 1N0VC 1SKYE 5F3WB 1XD8A 3T12A 3EPHA 1IN7A 4TYQA 1E32A 3MJHA 1T5IA 4O0MA 3PUXA 4LBZA 4XSGA 5HR5A 4L8GA 2OLKA 3IBYA 3T35A 4JKIA 3MAAC 3MGCA 2VEDA 2QMEA 1NSTA 4UNPA 3B1YA 4DCUA 4KBGA 1DAEA 2VHJA 3GJ4A 3O8DA 5GJWC 1VG0B 4PC7A 3RDPA 2EWVA 3TGPA 2E1RA 5TVKA 4A9AA 4KITB 1IN6A 4O2LA 1NMZA 1Z07A 4FMDF 2VHUA 3QXCA 5FL7A 4D80A 1DAIA 4NCHA 3IO5A 4UNSA 1E2LA 3GLGA 1QRAA 4QRHA 1OF1A 4B3GA 4OJKA 2ZS7A 2ZJAA 2G3YA 1NLYA 1RYHA 1IONA 1VCNA 3OAAD 4JLOA 2HLDD 1LY1A 2QY9A 3A1WA 2OSBA 3ZS8A 1WRBA 6Q21A 2ZVPX 4JYCA 4IHQA 1W46A 2CNWA 5DH9A 2QP9X 4Z51A 2D7DA 1U0LA 4JBYA 5E3HA 4NCKA 4HATA 3DO6A 5H68A 3LX5A 1LFDB 5EP2A 4X8OA 1DAGA 3BH0A 2O8EA 2OLJA 1N5LA 2ZYWX 2AKAB 3W8NA 4B47A 1XZPA 4OI1A 3AKEA 2CLSA 1KJYA 1NN3A 5CJ2A 4EKDA 1BH2A 1HTWA 4KHZA 5D3MA 2YWEA 2JATA 3BJIC 1VYTA 2XB2A 1WBDA 2CXXA 1Z0FA 4M1SA 1ZNWA 4ZIRB 2GF9A 5UKDA 1E79D 4Q03A 2VRWA 1H8ED 5KHOC 1KDPA 4LC1A 3T5DA 3NTUA 4DB4A 4TL8A 3NHBA 3V4FA 1G4UR 2ZYTX 5TY0A 4MUBA 2LKDA 2PLFA 4XJXA 4C30A 4C9BA 1BMFD 1GRRA 1P2TA 1F6BA 1Q44A 4WA7A 4XIGS 2IUSA 3D6TB 1TL7C 2ZRNA 3UG7A 3Q7QA 2BCGY 1G6HA 2ZJYA 1SHZA 4KV9A 3GJXC 1GL7A 1HURA 4KCGA 2ZJZA 4F4IA 4B48A 3C4JA 4DCTA 3MCAA 2Z83A 4US1R 1W49A 3C16C 3G5UA 3SS8A 2H16A 3P32A 2JJ2A 2PZFA 4LUCA 3B8HA 1DO0A 1PLLA 2YOGA 5K8LA 2OM2A 2WJGA 1W36D 4NTZA 4G5SA 1NN1A 4PC1A 1DELA 4D0LB 2GZDA 4P32A 3LW8A 5KSOA 3B1XA 1E6CA 1G19A 3THWA 1MRSA 2C77A 5G3YA 5B57C 2GHIA 1TU4A 2B8WA 1Z0IA 2FFBA 4HAYA 2CL7X 4BFZA 2NIPA 1R5BA 2Y8EA 1XEXA 3AVTA 1U2RA 1LS1A 2MSCB 4A92A 2O8DA 3L0OA 4JJKA 1XNJA 5HCIA 3RRYA 2PL3A 1E0SA 1EX6A 2QP4A 2J9RA 3EIEA 1ELOA 1US8A 3GP8A 1Q21A 4DRZA 1NY6A 3MWKA 4F7WA 3AF1A 1X86B 3AUYA 3MFYA 1JQJC 3G82C 4PAMA 3CUEF 1G1MA 5L3SB 4I1UA 1DO2A 1A82A 1R4AA 2GXQA 3VR3A 3F3YA 3RNLA 1W0JA 3L0SA 1T5LA 3U7HB 4K8OA 4B3FX 2PJZA 3K70C 4JJZA 5J4KA 4YLGA 1CJMA 3O8CA 2CLDX 4CW7A 3LQRA 1ZBDA 5LD2C 4ESVA 4H9GA 3ND8A 1CLUA 2J0QA 2QAGB 1L8QA 4QGFA 1NG9A 1TF5A 4C0JA 1KAGA 2WWWA 3B78A 1R7RA 2WAYA 3PJRA 1YZLA 3UANA 1ZC3A 3A37A 2RGXA 2H57A 1CJUC 3BXZA 3K09A 2RGDA 1CP2A 4PC3A 4CEJB 5JBQA 1O87A 4RCZA 4BLOA 4JLNA 2GJKA 4BLSA 1N6HA 2QBYB 2C9OA 4D6PA 2V9PA 2F9LA 2KJQA 2RAPA 4IDNA 1U90A 1YHNA 1K5GA 5FI1B 5M04A 1S1CA 5KNBA 2ZYVX 2XAUA 2JCSA 4D4KA 3BFVA 1NI3A 3ETLA 4QM6A 2NQ2C 4DCVA 3QEOA 4NZYA 2RGBA 5JI3E 4RFSA 1NP6A 4DUGD 1E9SA 2A3RA 4IEIA 3O47A 2WBLC 2QROA 5DN6D 3U5ZB 2AFIE 3FPAA 3LNCA 4XWOA 4CYMA 1PV4A 3KXKA 1FUUA 2H5EA 2F1RA 1ZIOA 2ZEJA 1Z8FA 4LY6A 4MGYR 1TMKA 4IRUB 2RGEA 5DE3A 3A1VA 4NH0A 4URVR 4B34A 3CF0A 4MKHA 4MRSA 3RYTC 3CIOA 1GKYA 3LD9A 2RGGA 3DHWC 2Q9AA 1M34E 3W6PA 4B44A 1XX6A 1DG3A 2YWFA 2ZUDA 1NKSA 2NO0A 1HQYE 4RZXA 2UZ3A 1OB5A 1KK1A 4POAA 3PQCA 3GFPA 1F2TA 2NPIA 2Q3MA 1E9BA 3WNDA 1P2VA 1R0YA 1WF3A 3F8TA 4GP7A 4HEJA 2EFHB 3I8SA 3PUVA 3CPEA 4KFTA 4CT5A 2OXCA 2ZXUA 3FOZA 4M1MA 5J4YA 5TXGA 4I81A 2WOJA 3GJ5A 1N25A 2CK3D 3FTQA 1MRNA 2JASA 2PCJA 3C5HA 4QC2A 3SU8A 3VU9A 2BEJA 4EPVA 3AF4A 3UG6A 1E2DA 2RGCA 3PITA 3V9PA 4B2LA 3U44B 2XJ9A 2C99A 2GJAA 3LBHA 3ADDA 3TK1A 3SFVA 1OB2A 3R9WA 1KSJA 3AVPA 2F9MA 4UKDA 3CONA 5BQ5A 2FN4A 4RZ2A 3IGFA 3ZIAD 4C0KA 1E2QA 2DYKA 4LWZA 3VR5A 5HKKA 5H8WA 4AY2A 1HUQA 2ZS8A 2AK3A 2FSFA 1YR6A 3K70B 2CEAA 3PCRB 1I2MA 2VYFA 5IHPA 1WCV1 5LD2B 1UKVY 1YKSA 3OEED 5FPKA 3ZJYA 3GPLA 4TN1A 3D7MA 3SC3A 2RGNA 2BWJA 2CE2X 2H1LA 3DPUA 2BMEA 3H2YA 2FFAA 4DWJA 2FX3A 2AXPA 2DR3A 2XSZD 1KK3A 3I61A 1E0KA 1CU1A 4HB0A 1WMSA 1KMHB 3QXSA 3WMEA 4F92B 4BUJA 3VX4A 2O8FB 2KE5A 4NP6A 3L8ZA 1KDTA 4U00A 4O3MA 1NVUQ 1E1RD 5DYIA 1COWA 1E2HA 3KX2A 2VP0A 4JBXA 5AR1A 2ODWA 1I4TD 1T8UA 2XNSA 1KKMA 3GFTA 1IBRA 3WNBA 2BM0A 3SYLA 2CDNA 4BLTA 4BQSA 3DZDA 2WJVA 1XTQA 3NEYA 2VHTA 3RRMA 4DCSA 4C0SA 4A36A 1UFQA 2CMKA 1L4YA 2O0KA 3K0AA 3FMPB 5C18A 5IK2D 4AG5A 3U61B 5LDDC 4HAXA 4DDWA 3D31A 4U7DA 4WAUA 3AEZA 3K0FA 4JT4A 2IF0A 2X8AA 4DSOA 4R71A 3W3AA 1J8MF 2QA5A 4GOXA 3EWAA 4L15A 3EZ9A 3MWLA 2JLQA 2GDJA 4QBIA 3D8BA 2ONKA 4JLPA 4LOAA 4Q7MB 4RKEA 2P5TB 4ZO4A 3TJZA 1SVWA 2ANBA 3HU2A 3H0KA 1A2KC 4QJ5A 2ZE7A 3B1ZA 3BIFA 5AK0A 2XNDD 4PSAA 2YKGA 5DHFA 3AP3A 4XSHA 2WKQA 2J0UB 2EVWX 3OFND 4KFSA 1HYQA 4GDFA 3O8BA 4ZKDA 1DARA 1T3HA 1KK0A 1RRFA 3GLHE 2BC9A 4EUNA 2K5UA 2OAQ1 2WV9A 3EZ2A 3OEHA 3T06B 1KK2A 2AWNA 4EJSB 1G3UA 2ZU0C 5C2JB 3ND9A 2J0VA 4OHWA 2W00A 3BERA 4DKXA 2FZLA 4B6EA 4TLAA 4OQLA 1D9ZA 1KSFX 3IIMA 2G1KA 2Q3FA 2R6AA 1JR3D 2F1HA 1EG7A 2IYVA 3TSZA 4AI6A 1W1WA 2NMVA 2G0TA 3PEUA 3TVTA 4ZV4A 2ECKA 2OFXA 3BAFA 2ZUCA 1ZUIA 2YVUA 1TF7A 1NMYA 3TE6A 5CDFE 3F0TA 5FTLA 2BHRA 2IS1A 2KSQA 1FPMA 3NBXX 5BXQC 4IVRA 4KBFA 2DFLA 2QEQA 1Z6GA 3LAWA 4Q1BA 2WOOA 5EE5B 5E4FA 4RKFA 3KTAB 3OE7A 1JPNA 4ARZB 1XD2A 3A1UA 5SZHB 2J87A 4PHGA 2QE7D 1Z5ZA 3OIYA 2PMDA 4UNQA 3IEVA 1E98A 1UJ2A 1TTTA 1IXSB 2H92A 3BB3A 5CJPA 2P0EA 4MDEA 3K70D 3PEYA 4AYWA 2IS6A 2ZRGA 4LK2A 4NHOA 2ZE6A 2FSIA 3B6EA 2KWIA 1CXZA 4CGZA 4TLDA 1A1VA 2ZANA 3NKVA 1J7KA 721PA 1P62B 4A2QA 2G6BA 2R6GA 4TL6A 3RS7A 4OJQA 5DI3B 1FFHA 2NO1A 2KBFA 3BH7A 1OKKD 5CYOA 2AHOA 3BD9A 1Z47A 2BIFA 5GJCA 4Z8YA 4U5XA 3KXLA 1IJFA 4JS0A 3CF6R 1RPZA 4DLVA 1VECA 1G3RA 1Q3HA 1WQ1R 2F43B 5CIQA 1JAHA 3R20A 1T91A 5KNCA 5AUOB 4DDUA 4GL2A 2PEYA 3RRZA 1F2UA 1FQKA 2RH5A 2ZRHA 3QF4B 5EZ5A 1U8ZA 4E5UA 3RLFA 2DFTA 3DMNA 4B2PA 4ZDIA 4LBWA 1KI6B 3FWYA 1W4CA 1S0UA 2BKEA 1P6XA 3KQLA 2FJUA 4ACBA 5BN4A 2FFQA 2J5XA 1R10A 3E1SA 3K53A 1KY2A 1OH7A 1OJLA 1YRBA 1IAQA 3THXB 5EQTA 4FCWA 1Y3AA 2VHQA 5DSZA 4RD3A 3PUWA 5G3ZA 5GVSA 4N1AA 1II9A 3NIBA 4JLJA 3QBVA 1XRJA 2F3RA 2VA8A 3CNLA 2NZJA 4B3CA 3WBJA 3UKDA 3GJ7A 1P73A 4PO1A 1Q12A 1W4BA 1NJGA 1OHHD 1ZU4A 4FCVA 5AJWA 3GD7A 3ZVNA 3IKJA 2WJIA 2GILA 4OHVA 3KQNA 3GLHA 2L0XA 1FX0A 4BZXA 4YQFA 4AC9A 2EW1A 2P5SA 4Q48A 3S1AA 3CRMA 2FE4A 2G9NA 1P60A 1G3QA 4QXAA 4PO8A 4URWR 1F60A 2R2AA 1TQ6A 1NIPA 1P3JA 1KDOA 3RC8A 1Z6TA 4CVNA 2CHVA 4G5RA 5LB4A 1OH5A 4C2UA 4WXRA 4C7OA 3E2IA 1RW4A 1ZNZA 3QKRA 3FGNA 1XTKA 2HEIA 4EPRA 5CDFA 4LJ9A 1E79A 2AK2A 1H8EA 4E09A 2C9YA 3BORA 4G5GA 1XXHB 1GRQA 3DM9B 4LHYA 4IOLA 1XPOA 2OO7A 3TVDA 3HPQA 5G40A 4V0LA 2GAOA 5AUNB 2EQBA 1IOZA 3REFA 5FBVB 2ZSEA 2GVDC 2VP2A 5EXXA 4DBLC 2VH5R 1D2EA 2ZAOA 4R9UC 4AURA 4EPXA 5FOVA 3FMIA 1G8FA 3KQUA 2JIZA 2O8BB 2WHXA 3T1TA 2C98A 1R6BX 4PQRA 1TF2A 4HB3A 2YNMA 3SJAA 1XTRA 1S4QA 1U8AA 1ZVQA 3IHWA 1E9DA 4D4MA 4Q4HB 2ODEA 2WZQA 4L16A 2ORVA 4TLBA 5L3QB 4I4LA 3BB1A 1NJFA 5FUVA 1KAOA 3GJ3A 4H1VA 2F7SA 2V54A 3EG5A 1WB9A 2W2TA 2IX3A 4B76A 1UF9A 3VTKA 2REXB 1L2TA 1GVNB 5J4LA 2WWHA 2A7QA 3PIRA 2PZEA 1AJEA 1AS2A 2GJ8A 4B3XA 2A5JA 4R7ZA 1Z3IX 5SZJA 2GESA 1JNYA 1LF5A 4FCTA 1Z2CA 2C2HA 1ETUA 3CX7A 3H84A 4DZZA 2A5FA 3SHFA 3U6BA 3GFOA 1C4OA 2VIIA 2A9KA 4PAQA 4Q1EA 4TMVA 3OZXA 3W3ZB 4BFVA 4A0FA 2PBRA 4IKEA 1JECA 3ECCA 4HDCA 4UQOA 1AZSC 1E69A 2ONJA 1SKQA 1NIJA 1UEJA 2OBNA 2XEXA 5E7MA 2ZETA 3R9IA 4QGAA 2Q3HA 4EIWA 4RCYA 3DM5A 2EU8A 4DLTA 1IY2A 3I62A 2FMXA 3BE4A 2DCUA 3T1VA 3EPJA 1Q22A 3WP1B 3A4LA 1ESNA 2FSGA 1T6NA 1II8B 1KTVA 3EIQA 4MA4A 3KDSE 2BOVA 1SULA 1G6OA 4GOKA 3U7FB 1XU4A 4WZAE 3KKOA 2V6JA 3L8YA 3T34A 3B9PA 1AKYA 3AV0B 3EZFA 5C4MA 2E87A 1NKTA 2CJWB 3LH5A 5HCNA 2X2EA 3VAAA 4A0RA 2QAJA 1XTIA 3B1VA 4Z54A 1SZPA 1V43A 4TTQA 2QNRA 1RKBA 3EWSA 4TMKA 1SVIA 3EC2A 3PG5A 4QGHA 1AGRA 3P4YA 3IO3A 3I92A 2QPTA 3RABA 5P21A 3SBDA 1WBBA 4WZ6A 2DFKB 1QVAA 2B8TA 2XXAB 1PZNA 1ZU5A 2QP3A 2ZI3A 1XEFA 2HYIC 3RS3A 4UJ5A 3SBEA 1S8FA 4LHZA 1IJEA 3TAHA 1G8GA 2IUUA 1QF9A 4DUGA 1GFIA 4E22A 2QL6A 3B13B 4ZIRA 4Q9JA 1HH4A 5DN6A 2DB3A 3FHCB 3IIKA 1LVGA 2AXNA 1E9FA 1TU3A 3FMOB 4OI4A 3P26A 3UWKA 5EE1A 1GILA 2XGJA 1GL9B 4QBHA 5GVRA 5HPYB 1PLJA 1YU9A 5KUTA 3QSYA 1D2MA 1N6LA 2JDID 1P5ZB 4QOSA 4M9SA 5L3RA 2QU8A 4P0TA 5LBIA 2WKRA 2CE7A 1QHIA 1JB1A 4C0QC 1QVRA 3CBQA 4F91B 2NGRA 1Q57A 1ZUHA 2PT5A 2ZU6A 3KB1A 4ZCIA 1YZUA 1Q3TA 5DO9A 2UZIR 1N5JA 1OYWA 2QAGC 3CZPA 4XOIA 4HDOB 4HLCA 1JAIA 1CKEA 2VSXA 1X8JA 5CB8A 2BBWA 3VX3A 2ZJBA 4P4UA 1GNRA 5EE9A 5E7JA 2ZRJA 2CK3A 2ZSFA 5H1YA 2NTYC 5K8TA 1TQ4A 1JR3E 4AYTA 2P6NA 1NVWQ 1TPZA 1M6NA 2A5YB 2X1VA 2DWOA 2REBA 4BLPA 2QPAA 1JPJA 2XTMA 1Y63A 2ZSDA 5C46F 5G53C 5JECA 1ZM7A 5CM9C 2IYRA 5JWRA 4HLQB 1N0UA 4H1UA 4IOKA 4LPSA 1NNEA 4ON9A 4IW3B 1G3MA 1AQUA 4PANA 3ZIAA 4JSYA 1G291 4ILEA 4PPGA 3T5GA 1K6MA 1VG1A 3FMFA 3B7GA 4M22A 2MSEB 2D74A 1XPRA 2R62A 5EUMA 1WP9A 4Q00A 4RFVA 4I1OA 4NYJR 4KJZA 1Z22A 4OHYA 1GNPA 2D3WA 3OEEA 4JYBA 2QMUA 1G8HA 2EFGA 2QENA 2G77B 1R8QA 2RCNA 3ZDQA 1CULC 1E2GA 4YXWD 1AN0A 4TSFD 2GEUA 2QMHA 2XSZA 1NG1A 1CR4A 3QXXA 4X8LA 4EFMA 3A4MA 2ZRDA 4PFSA 3GLIB 3CNNA 3I5YA 3THYB 1KYIA 1VIAA 2RMKA 4MQBA 1RYFA 3CWZA 1UDXA 1E1RA 5JEDA 1S1MA 1CTQA 3ZD6A 4GT1A 4OYHA 1XJQA 3KQHA 4GMDA 2VQSA 4MH0R 5FUWA 4Z1MD 1AS3A 4URYR 1JBKA 5DGXA 1AIPA 2AFHE 2J45A 2RGAA 2W0MA 4CEJA 4Q66C 2DY1A 2WIBA 4PZZA 4BLQA 4M8NE 2ORWA 1E96A 3CX8A 5JEEA 2BEKA 2VHCA 5CYPA 1UADA 2GZHA 2QBYA 1RRGA 2JEOA 3AB3A 2GEVA 3M1IA 4IVPA 3P20A 1KSHA 2OCPA 3CLVA 1B23P 5IK2A 1G5TA 4PSKA 3WRXC 1ZP6A 4EQ6B 5EXTA 4YMVA 3ZGXA 4KYUA 2WPDD 2V4ZA 3R7WB 3KJHA 3DKPA 3KFVA 4MRNA 4FW9A 2WWXA 1JQLB 1OH8A 4M9XA 1EXMA 1IN8A 1FTNA 1CR0A 3UPUA 1GKUB 1NMXA 4GSYA 4LHXA 3TAUA 2WSMA 3QVUA 1KSGA 2H8KA 4KSCA 4KU4A 4QL3A 5JJLA 2JA1A 1ZMXA 4TQAA 5CLQA 1MOZA 3K8YA 1AZTA 1QHYA 3OFNA 3PV0A 2JLWA 4C0LA 1P2SA 2GCOB 1GL6A 1E2KA 1QHSA 4BFSA 2JLVA 2ASEA 1YZGA 5D3QA 2ZITA 1C1YA 1GM5A 1NSFA 4I1VA 5CITA 2I1QA 3WRYC 1M1YE 2W0SA 3AF2A 4NL4H 4V02A 2RKOA 4W5HA 2JLUA 1HE1C 3GCGA 4MITA 1GKIA 1SVMA 3RS0A 1M7BA 1RJ9B 2QQEA 2AR7A 4P4TA 4FWTA 1JR3A 3T1OA 5HZKA 3IQWA 1RRPA 4Q1DA 4RVCA 1OFTA 2EFDB 1QDEA 3IEUA 4PC6A 1LV7A 4TTRA 4DJTA 2Q6TA 3TLXA 1KZGB 1XZQA 4LYJA 1IXZA 1UBCA 1EESA 1U81A 2G88A 3U44A 5A4JA 4PTLA 3TMKA 2I3BA 4ZCMA 2W58A 2AX4A 2IA5A 2BM1A 1R2QA 3KJIA 3TR0A 1KI8A 2OV2A 2OHFA 3GQBA 1ZD9A 2WIAA 1VCMA 4PQYA 3U3OA 1QHHB 3RS2A 5FUXA 3JVUA 2VP5A 2HYDA 3AKDA 4B6FA 1SQ5A 3C8UA 1OXSC 3NDPA 1NVVR 4A15A 4IXMA 4LV5B 1N6KA 2O8DB 4N3NA 2J0SA 3SN6A 3IDQA 4XVUA 1Z06A 1IQPA 2GWHA 2XTZA 5EP3A 3AVVA 3GEHA 3U4QA 3SJBA 1XBTA 3EA0A 4Q9IA 2BVNA 4M1TA 3TQCA 1RC8A 3VR6A 1KMHA 4AKGA 1G3IA 4QKQA 1MH1A 3KUDA 1EWRA 2O8FA 2Z4RA 3H1TA 3KKQA 1FNNA 5JSZB 3AVOA 2XX3A 4GOJA 4ZCLA 4LI0A 4F38A 5DYGA 2C78A 3K9HA 4EJSC 5JHHB 2HT1A 2UKDA 1E2IA 3CRQA 5DHAA 2CL0X 3KJEA 1XCPA 2DWQA 1S9HA 3MRSA 4B43A 3LY5A 4BFYA 3FB4A 4AK9A 1SVKA 4Q4JB 2GCPA 4AWXA 5KPJA 1D2NA 5J5CA 1HV8A 5FI0B 3X1DA 2BMDA 2BJVA 4FI3C 3KFXA 3U7GA 1BO6A 5FBLB 1NBMD 4NU0A 5F9FA 4Q5IA 4ZI3A 4NYIQ 2CVFA 4FD2A 4L9SA 4V0KA 4WVFA 1FP6A 1MO3A 3JZAA 3Q85A 4HUQB 4A1FA 4AKIA 3FE2A 1N2CE 4W7SA 1JR6A 3VHXA 1L7VC 2OESA 1OHHA 3BS4A 2NO9A 1I4DD 4BFWA 1AM4D 4OK3A 2QORA 3RWMB 2ZRKA 2OG2A 3TKLA 3VNUA 1EFRD 2AD1A 3CZQA 1DADA 2XOKA 2J0UA 3QEJA 2WWYA 1IY0A 3C41J 4AYXA 4TMXA 5DIFA 4Q9HA 2NO7A 1W2GA 2YHSA 3AUXA 4RD4A 5J47A 3PUYA 2D62A 3UMRA 1ESMA 2QQ0A 2IYQA 1LW7A 2VO1A 3LDAA 1FQJA 4G3XA 4MYUA 3SHWA 1OV4A 1E2JA 2HDNB 4W5JA 4EJSA 2N46A 4WIAA 3H86A 4BGDA 4Q4AB 1ZW6A 4JZKA 4KSBA 5A0FA 2YWGA 4JSTA 1AK2A 1G4AE 4NDZA 3QVVA 4NPHA 3HYRA 2ERYA 4M21A 2A30A 2Q9BA 2OZEA 2HUPA 4KAXA 3J81k 5GJVC 4KXFB 2JJ2D 1NVXQ 1P2UA 4Q21A 1MR3F 4DSTA 4US2R 3PR1A 3DDCA 4CEHB 1N5KA 4LJ8A 4D4LA 3IILA 3B1WA 2XZLA 1XXHE 2D2EA 3I73A 1NN5A 2ZVQX 5CM8B 5FBQB 1VHTA 4PXAA 2GXSA 3KTAA 4ARZA 1YZTA 4M1KA 2IHBA 2QRZA 2FPLA 3OIWA 3PENA 1M2OB 2QMOA 5CK5A 3SDZA 5JI2E 4DLWA 4B74A 2ZI6A 3QJYA 1KI4A 4G01B 5FTKA 2X2FA 5TV2A 3X1YA 2PJRA 3MWJA 3TW4A 2J41A 4P3YA 2WJJA 2C95A 5JCPA 4Q01A 1KI3A 3ADBA 4P33A 4WBSA 2ZRCA 5H70A 2IYZA 4B75A 3HJNA 4JLAA 1F5NA 3W6OA 4RSGA 4AIIA 2ODNA 1G18A 2SHKA 1GOTA 5DI3A 2IEYA 4BFXA 1XFAA 4HAVA 4C4PA 4JVNA 3AVWA 1QG2A 1S9DA 3CH5A 4JVLA 1U98A 5JWOA 3AP1A 1IN5A 4JBWA 1ZNXA 2WTUA 3TR5A 3WMFA 4HDQB 1LF0A 1RFLA 2VSOA 5KDOA 2F43A 3QIAA 3QBTA 2FEMA 1OPXA 2IL1A 2LKCA 5JS7A 3VKHA 1YZQA 4NYMR 1IM2A 3PVSA 3I8XA 3TBKA 3RHFA 1E1QD 3LX8A 1DAHA 1MO4A 4Q1FA 3QF4A 5AJVB 3SEAA 3SFZA 3AKYA 3W9YA 3QKSB 4ABYA 4CEIB 4LJ6A 3DMDA 1KI6A 1YR9A 4KYIB 3L82B 4HB4A 4PZLA 5FUYA 4OQFA 2YINC 1GIAA 1VIYA 4IDOA 3MD0A 3WHKA 2W6ID 4FN5A 4GP6A 3PEVA 4BLRA 4EPYA 3RVBA 3ZVRA 3M6AA 4DSNA 3THXA 1T3LA 5JHGB 2OE2A 4UNNA 1FMLA 1G41A 1VKJA 4JL5A 5DI9A 1KI9A 1XCMA 3QPUA 4M53A 4CF7A 1C9KA 4NONA 2ATVA 3CH4B 3C7KA 4PQFA 4E03A 3MJRA 2AN9A 3ZS9A 1HT2E 1E2NA 1ONBA 4UXHA 2OAP1 4Q4LA 4A0GA 1UDWA 4TQUS 2Z6VA 2V1UA 1EX7A 2QM8A 1IN4A 5BYKA 3ZVMA 4BZQA 2VF7A 4PR0A 1FUKA 4WZBE 3EZ7A 1DEKA 4PSVA 1Q1EA 2FH5B 4X8MA 1CJKC 2FEOA 4D81A 1JEDA 1HQCA 1M7HA 2ZRBA 4HZUB 3U2QA 1K5DA 3LA6A 3A36A 4QJ3A 1YJ5A 3B82A 3ADCA 3U7EB 2KB0A 4L9WA 1R8SA 1BIFA 3Q9LA 3NEJA 4Q47A 3BRWD 1OW3B 4BRUA 3DKVA 4JKYA 1XF9A 1CJTC 5KSZA 5BN3A 5FTNA 1OIXA 4MKFA 2BMJA 2IYTA 3QQ5A 2ZM5A 1MABB 1P75A 2G83A 2ZPTX 3CF2A 3L43A 3N2EA 4IVQA 1E94E 2WWFA 4AKEA 4C2TA 2AWOA 2DHRA 4P4SB 3LBNA 1E99A 1XXHA 4DLYA 1ZCAA 3HWSA 1EGAA 3ASYA 1W4AA 1Z0DA 1XB2A 5AUPB 3GMTA 1CRPA 5AJZA 5FPYA 4LX0A 5K8UA 4LBVA 3ZZUA 4C0BA 3AM1A 3BFKA 3BOSA 2JDIA 4PHFA 4HAZA 4BRWA 3GJ8A 1XMVA 4OL0A 1ZCBA 1XMSA 2O8BA 1W0KD 4KFUA 4HZIA 1KIMA 4TLCA 4NBSA 4B3DA 1P9RA 3QNUA 1OFHA 2BKUA 1G21E 3OAAA 2D2FA 4TMWA 3A8TA 2HLDA 5FPHA 4BECA 4DXAA 5KU1A 4Q4HA 5JMTA 3AQ4A 2JLYA 2ZSAA 3ZZTA 4Q02A 2B7CA 4MYHA 3SJCA 1HEIA 1Z08A 3IUYA 2GBLC 1XCGB 1IXRC 4A4DA 4PHTA 4HUTA 1VHLA 5HKKD 1WE2A 4YONB 4EAQA 3WYGA 3IBGA 4TLEA 3U3MA 2PMKA 3CRW1 2ZR0A 4NYJQ 2F3TA 1G7TA 4KVGA 2J7PD 2XJ4A 4XVQA 3W90A 1KO5A 1PVOA 2X77A 3FHTA 1Z2AA 1G9XA 1RRCA 2MMCA 1E9EA 4M9ZA 2B6HA 2YJTD 4OK5A 1NL3A 2P3SA 3TSWA 1CR1A 1OXVA 4GRAA 1AS0A 3P1JA 3WNCA 3RSOA 5J4HA 2VBCA 1YQTA 3FVQA 4DT1B 1E0AA 2A78A 2P6RA 2GCNA 1XEWY 1BMFA 1FNMA 1PUJA 4LHWA 3TH5A 5DNYB 3AKCA 2FFHA 3AVQA 4M9QA 2OUKA 4LV6A 5FFMA 1N6OA 4TSFA 2WAXA 1SGWA 1XPUA 4WOPA 2BDTA 2WMOB 1XP8A 2AD5A 2CVHA 1CIPA 2OCYC 1HA3A 4QBFA 2QTVB 4FMCB 1II8A 2IC5A 3QUSA 4S35A 1KDRA 3LLUA 4A8JC 1XD9A 2OXRA 4ASUD 1D6JA 3GLIE 4URZR 1RVDA 1GWNA 3QG1A 1U9IC 4MGIR 4PPFA 1Z0AA 1TEVA 2CJWA 1O3YA 1RZ3A 2GJSA 4Z1MA 3GLFB 2R8RA 1F48A 4LJ5A 3CPHA 3KJGA 3UMFA 1KMQA 1H8HD 1FOEB 1LTQA 3CX6A 5FPSA 3SI7A 5BW8A 4U02A 4TTPA 2YYZA 1YE8A 5CK4A 4EPTA 3FKQA 1DE0A 2XXAA 3BK7A 1MKYA 1N5IA 5FOXA 1NY5A 1VG9B 1TADA 4L5BA 3VFDA 2WPDA 1SVOA 4MYCA 3KKPA 1EFHA 1FX0B 3TIFA 3L2OB 1DAKA 2XTNA 1SXJC 1UPTA 1Z83A 3CPJB 3QE0A 1G20E 3LLMA 4QNMA 5G41A 2IHYA 1NBME 3SE0A 1EWQA 1NN0A 2QM7A 3OIVA 1V5WA 3NDBB 1UBGA 2WJYA 2P65A 4US0R 4RZUA 4G1UC 4YDSA 1Z28A 2RB4A 3NC1C 2GKSA 3Q5EA 1XWIA 4JLDA 4V03A 3Q5DA 3REGA 4OHXA 5SZIA 3ONWA 4D82A 3TRFA 2DFNA 4NMMA 3ZQ6A 3W5JA 5KOYA 4ZKEA 5BN5A 1CS4C 1KI1A 4LHVA 1JEEA 2WVJA 4DC9A 3T1QA 3W5IA 2IYYA 4MYTA 1OT3A 2W2XA 5F9HA 1XEWX 1NVVQ 3CO5A 1U0HC 2O0JA 2VLIA 2ZIAA 4EFNA 1GZSA 2WICA 2Z0MA 5ANRB 1OH6A 2IWHA 1UEIA 2JJ8A 2JJ1D 121PA 5FTJA 1LS6A 3WY9A 4QHTA 2OILA 5TB5A 2FZ4A 1HY3A 4A0HA 3SYNA 4DDTA 1XMIA 4W5WA 4IFEA 3NXSA 4B73A 3SR0A 1UKZA 3I32A 1D9XA 2WSSD 4ZDWA 4KODA 2ZE8A 5F2EA 2REOA 4FMCF 3D3QA 3H4MA 3RS4A 1YVDA 1KJZA 2QUZA 3V00A 3E70C 4OQNA 3MSXA 4K46A 4C0HA 1DBSA 3A6PC 5FOSA 2DPXA 4PPNA 4A8JB 3KZ1E 1KY3A 2ZI5A 5E95A 5KTYA 5FR2A 1CRQA 1QG4A 4MRRA 1VPLA 2V1XA 2R65A 3GLIA 1P9NA 4IDPA 3THYA 4OKSA 1JXMA 2O8CB 4QG7A 1FL9A 2BBSA 2IBMA 5AJYA 3VKGA 1NRJB 4MDFA 2LCFA 4LJ7A 2HXYA 2VF8A 2BMFA 421PA 3TQFA 2NO6A 4DDVA 4ZDJA 1S2MA 2N1BA 2W83A 4F4CA 2BBTA 2CCKA 1ZYUA 4OHZA 1Z29A 4V0ME 1ZC4A 4LPKA 4O25A 4A2WA 1DPFA 1OFIA 2JAQA 1W4RA 3KQKA 3DEFA 5EXPA 1MV5A 2IWRA 2GF0A 2VPPA 2ZROA 5KPDA 2IXGA 4QBGB 1R5OA 3A1SA 1SXJB 2YV5A 3B85A 4M1WA 4XD7D 2FNAA 4TL7A 4DEYA 4EDHA 3UATA 2PH1A 1D5CA 4GPTA 4IDQA 2V3CC 2GA8A 4EQ6A 4P31A 2QTHA 4DLXA 3C14C 4YDHB 1KJWA 3FFAA 4Q9KA 3R7WA 4CZ2A 1NBMA 2EFCB 3NBZC 3R9XA 1XTSA 1CF4A 1E9RA 5J40A 2FF7A 2W6JD 4AG6A 1P9WA 221PA 2QGZA 1PUIA 4MKGA 2ZJ5A 4TT3D 2HF9A 4TZ6A 1P72A 1W48A 1GRNA 1W44A 2RHMA 2Z4SA 2FGJA 1KI2A 3IPXA 5L3SA 1DTSA 4ZI2A 3ADKA 3AGPA 2IEZA 1EFRA 1N3BA 3HR7A 3MUFA 2NOAA 2YOFA 1KO8A 3BBPA 1XTJA 1J2JA 2FA9A 3K0EA 3QKUA 2QT0A 3TUJC 3VQTA 2ZYUX 3ICQB 3FFBA 2GCOA 2ZRMA 4I99A 3EPKA 4TZ0A 1ZUNB 4BE7B 1Q0UA 3MG9A 2QAGA 2HXSA 1X8KA 3NWJA 5KDLA 2IXEA 1KO7A 4YMTA 1G17A 2OCAA 4WXPA 3AF0A 2YC2C 3P27A 1OSNA 2V8OA 3VR1A 4OQMA 1J8YF 3WP0A 1RJ9A 4Q19A 1KNXA 1W5TA 4BASA 2PX0A 2O0HA 1W7AA 4LYFA 1EFTA 2IW3A 3P4XA 4BEBA 1TEXA 4HLUC 1I2DA 3B5JA 4R2IA 2JIZD 4RD0A 3GLGB 1AKEA 3F5FA 3IPYA 4XVRA 1DAFA 1Q1QA 3ZYCA 5FTMA 4N0EA 5EXSA 3SQXA 3GJ6A 4TMZA 1W5SA 3W8RA 2QGNA 4IOMA 5ELXA 1T4GA 1CBUA 1E0JA 4ITRC 4LBYA 3A4NA 2ZRAA 521PA 4MRVA 3JZMA 1ZM4A 4Q1AA 2C9CA 1WXQA 3LW7A 4A2PA 3UMSA 4ZDKA 1LNZA 4FIDA 5JS8A 3FKSD 1AGPA 3RSLA 3K0SA 2ZR9A 4RD6A 4IDHA 1QHHA 2O8EB 3WHLA 3M0EA 1MO5A 2GK7A 1TQ2A 2FGKA 1GP2A 2V6IA 3C5CA 3K09C 2GVZC 1WA5A 2Q21A 2KI5A 2ZAMA 4IOJA 3K9NA 4GBMA 1G7RA 4B35A 4WW0A 2XNDA 4C0AC 3DVLA 3I3SR 4NYMQ 2RHDA 1DVRA 2Z5FA 4RD2A 3TSOA 5TMPA 4QNRA 5D3MB 2A5DA 3IIJA 5CIWA 4URXR 1KO1A 2A2ZA 2WMNB 3LQQA 1RIFA 4C3ZA 2VP4A 2FPMA 4G0NA 2IS4A 2V55B 2IS2A 1FP7A 2GTPA 3I72A 5JLJA 3I5XA 4XH9B 1Z0KA 2QRNA 4HLUA 1W2HA 1EK0A 2E9SA 1TAGA 1BYUA 1X6VA 4LJAA 3O8RA 4ZPXA 1E4VA 1R0WA 4D25A 4YC7A 3WMGA 5JSZA 2FWRA 4V0MA 4DIEA 821PA 1E9AA 5FH9A 1TUEA 4Z8XA 1N6PA 2C5LA 2I1VB 4RY2A 1QHGA 2V7QD 3QG5A 3TUIC 5EZ6B 3EAQA 1E1QA 1HT1E 2WWIA 2QG6A 1YZKA 2H7VA 4HI0E 2OCBA 4MUAA 4GI7A 3A58B 3WYFA 4TL9A 3LVRE 4DLUA 5IDVA 3UXMA 1SXJD 1UKEA 4A82A 4Q4JA 3CW2A 1X3SA 2PZGA 3EW9A 2W6IA 3UWOA 2C03A 3AF3A 3QPVA 3B9QA 1R5NA 3THWB 3CR7A 2QE7A 3QI2A 1KKLA 3MWYW 4PX9A 1OE0A 1DOAA 1SKYB 3CR8A 4HUQA 3LBIA 2ZUBA 2DWPA 2OBLA 4V0OA 5AJXA 5C1BA 3ICEA 2CCGA 2WM9B 5EP1A 2HF8A 2B7BA 3OHMA 8OHMA 5TDHA 5IRCD 1XEXB 2ZI7A 3EPLA 1ZRHA 4TYYA 2IYLD 5HZHA 4MGKR 1JJVA 1U94A 4DIDA 1S3SA 5FR1A 4NCJA 1VMAA 4GNKA 4QM7A 1Q20A 4LCBA 2B21A 1US8B 3B2EA 1N6NA 3N70A 3CRRA 1OKKA 4JMPA 5EE3A 4E07A 3ZD7A 1SVLA 1VYUA 3RWOA 3UK6A 4DB2A 4LJ4A 4NKRA 1FMJA 1A4RA 1G8YA 2CHQA 4IJMA 4PC2A 2ZSBA 3HPRA 4OQXA 4D26A 4Q4AA 4TYNA 3QY0A 5B2ZA 3M4YA 1VDZA 4NCNA 1YRAA 1U0JA 1Z63A 2GRJA 5FL7D 4HYYA 1GTVA 3JVVA 1OXTA 4HAUA 1R0ZA 2LWIA 2CBZA 2RGNC 2G0NA 2H18A 3DOEA 5LPNA 3Q3JB 3N2IA 4LDJA 5F98A 2JLXA 2ZE5A 4BFUA 3LXXA 4DLRA 5J4VA 1PLKA 5KSPA 4CEHA 3VMFA 3BFXA 2GETA 5AUQA 2XZPA 1YR8A 2CNWD
chains in the Genus database with same CATH superfamily
2QZJA 3S5JA 6NULA 1I24A 1OYYA 5F2KA 1X9IA 4B3RB 4G5OA 1UP4A 4UJ3A 4FOOA 2Q3BA 1NLZA 4PINA 1KQ3A 1W0KA 4X8HA 1QHNA 1M2OA 2E48A 2OT3B 4LXHA 1SOUA 5JCXA 4FZJA 2OZLA 1JW9B 4HH3C 3IOCA 5DNEA 2NXEA 4O4HA 3D2BA 2ISQA 1F5SA 3JYPA 1DJOA 4IXNA 3OPVA 2Q29A 1K68A 3DLCA 3QLJA 2V5VA 1MGPA 3ZQJA 1YQGA 4L5JA 3UAXA 3WYCA 4IFBA 1UJMA 1RRVA 1LXCA 4EQZA 1WW3A 5JANA 4FN4A 4XX1A 5DISB 1C9MA 2FZVA 3WXBA 3EIHA 4DLZA 2PIAA 4LC0A 3G79A 4YIKA 2H1VA 4KGZA 3OIUA 1YR7A 4PZAA 3WBKA 1ZHOA 1MT0A 1NPTO 3CXUA 4TRMA 4ZARA 4UTXA 3WJ1A 4DTCA 2ZG6A 2NX2A 4D9CA 4BX3A 2JD2A 3MJEA 2AZDA 4K5QA 4XW2A 1T34A 2CHEA 4TYWA 3D0KA 3H16A 4JLSA 4YVFA 3U3RA 5K8IA 2AKYA 2ZTHA 1RLMA 4JOBA 2DOKA 2Z8YA 1ZAKA 5E38A 4DVGA 3U4QB 2WQZA 1F0NA 4HDSB 2VNIA 2RHCA 3JCZA 4QTTB 2X7HA 2DLCX 3QKSA 4CEIA 3FWKA 3M4XA 5JSQA 1QLHA 4GMXA 1Q6ZA 4M1ZA 4KZKA 1USUA 2OXFA 2WFLB 5FWYB 3SNHA 1QYDA 1QDUA 1I3OA 3V8EA 3RVOA 2CC2A 5CEFA 1LTHR 4IG4A 1VRVA 4NOMA 3MYYA 1N2SA 2AOTB 1JHPA 2WIGA 1I2AA 5KQLA 2JK1A 5HP4A 1DL5A 1M10A 3SJZA 5H83A 1UKAA 4H7KA 3KBOA 4U6QA 1G5PA 2H4FA 1FTSA 2IVFA 1I7PA 4B6RA 1H9AA 3VU9B 4HGPA 2W98A 1FJGB 5DTQA 1IM5A 5EE0A 1RQLA 4U2BA 4WT7A 3S29A 2I7DA 1RR6A 2V74B 1RKQA 2CNDA 2D3TA 2A1TR 2W2PA 3FNFA 3FTDA 2YYAA 3NIDB 4G1VA 1T3TA 3VR2A 4ASUA 2C4UA 1L3BA 2BE9A 1N2XA 2DBRA 1BYIA 2VTEA 3KD3A 3L7NA 3JX9A 4DMKA 1Y6JA 2AB0A 2VYQA 4JENA 1OYOA 5I7FA 1Z5UA 5KWVA 1FVHA 3WL7A 1C4XA 2YZKA 4FFBB 4R0NA 2FFRA 2C58A 4ZGBA 3IHLA 3NTVA 3ZHUA 4JLBA 2JD1A 3GEIA 1WCYA 2YZ2A 4X7MA 3T7CA 2AGVA 4XR4A 1H5QA 5E9WA 4H4EA 1SHLA 1H8HA 4K6OA 4NMXB 3P2MA 5TRTA 4D0NA 3BRQA 3ESRA 3HZRA 3A9RA 3R5TA 4L4UA 5HGJA 1KEVA 1W47A 3IEIA 4HZUA 2QPOA 3Q7PA 1YZNA 4INPA 2C9ZA 5JPDA 3M33A 2FK7A 1M8PA 2W22A 2FSHA 1R6TA 2R44A 3CZ5A 3LIIA 4B9AA 3OM1A 3ROTA 1OWOA 1QK4A 2GNOA 3RNOA 1OGIA 3FHOA 2HF7A 4KNVA 7YASA 3U37A 5E9JA 1E4EA 5KVSA 4HNHA 3Q6NA 2KBEA 1FZQA 2XRMA 3JVIA 2UYQA 4B4KA 4DCNA 3E4DA 1V95A 4BZPA 3C3KA 4A6XA 2IF2A 3UVEA 2JI6A 1D6MA 3ZR4B 1OWMA 2QW0X 4L8FA 4B3BA 4BQFA 5J2UA 2A9FA 4RKWA 4TWZA 4KHPB 2DSNA 4BZZA 4IZOA 4D92A 4KFRA 2ACWA 2OLEA 3COPA 4NZPA 4R9RA 4X90A 4BDSA 1WCIB 1JHMA 3Q8XB 3DE3X 4XAQA 3ESAA 1DTWA 4DMMA 3GLTA 3K0HA 5KEIA 2RGRA 4BV2A 4OMCA 4XWYA 5HDQA 3AVXA 4LFBB 1EWVA 4Q18A 2IOHA 2MSDB 2BMWA 1VRWA 2H1FA 5CXUA 3ZCVA 1OWNA 2YJNA 1C3LA 1AC5A 3GLRA 4FC7A 2WJAA 2JCGA 4UATA 1XVAA 2PCLA 1JZQA 4OXKA 5D1NA 5ES3A 2N75A 3U17A 2H1SA 5FQOA 3ZY4A 3K0FB 1OILA 3AW9A 1DS6A 1FBNA 3CWQA 3R3WA 3NBAA 5J2TF 3NV9A 3ZQ4A 1UBEA 2J7KA 4IGIA 4G0OA 3EDCA 1ID8A 1OWPA 4J90A 5IFLA 2R6JA 3H0EA 2D1TA 4QTXA 1V11B 1ZD8A 1KO4A 3FSEA 4M2LA 2DGDA 3C6MA 1VCIA 3KS9A 5ALVA 2OECA 1L4KA 1N2GA 3H3FA 3DQPA 1LX7A 3H5TA 3IELA 4U9IS 4XPZA 1JHQA 2QN1A 5C4GB 1ZD3A 3V4RA 4LW8A 1RADA 3SXUB 3LOUA 1YIDA 3DT9A 3IB6A 1MW9X 1DEXA 2HXGA 2NNLD 5F51A 4JCOA 2FPSA 5KSYA 2WB2A 4JBHA 2A0FA 3DZ8A 3N86A 4KO8A 3VR4A 4RHCA 1OZGA 4DCJA 5ALFA 2FKNA 3JQBC 4A1OA 1OXXK 5JASA 3VA7A 3DAOA 2NU6A 4AJ9A 3FPSA 5F7OA 3DMFA 1U7OA 4Q7KA 1FUYB 3VKFA 2F67A 2JLZA 2VDMB 1BU5A 1SUWA 4KLAA 1EYZA 1Q74A 3HDGA 5FJJA 5KNBH 2P41A 2Z2YA 4IIJB 3HRHA 3HG7A 2OV1A 1HZJA 1PSDA 3OMWA 1R9MA 2MIIA 5EWJB 3AR9A 2FW0A 5AKHA 3AFMA 1V8OA 3HDTA 1BSVA 4WJLA 1EM8A 1L5YA 3N58A 4Z4HA 3EVEA 2GJ9A 3ZV5A 2PG3A 2V96A 1H2YA 1XTBA 2IW1A 4AF7A 4BGDA 3EXFA 4PZYA 2OFWA 2FN8A 3ORRA 2VWPA 3B51X 2NUAA 1L1QA 4NI5A 2I4IA 1GG9A 3IKMB 4LMRA 3FZYA 3HUFA 2B94A 2GK6A 4DCCA 5JH7F 3H6HA 1NBEA 1T5OA 3HCAA 5JYBA 2QUKA 5L4LA 1T0JB 4ZYVA 5BP7A 4ERXA 2QG9A 1NXWA 3AOEA 3KUXA 4GE0A 3GLFA 2H5JA 1ZVMA 1XD2B 2GLTA 2NU9B 4J1NA 1MG0A 1RBQA 3BJEA 5K3OA 1T10A 3Q8WA 3RVKA 3PEEA 4NBVA 1KH1A 4B71A 2JVJA 1V9CA 4S1NA 1XZAA 1UK7A 1Z8DA 2HA5A 3ACDA 2I2BA 3KEMA 3ISTA 5E1MA 2Y68A 4HG2A 4KLNA 5IARA 4BB9A 4P3NA 4AJHA 4B83A 2X0JA 5I9NA 4ZOCA 1ZD1A 1REQB 1UEXC 2XZTA 3PUHA 5CLLA 5T6MA 1O95D 4CF5A 2I6FA 2ZYIA 4L8YA 5BSFA 3HWWA 1IVSA 3K0CC 4AVYA 1IB0A 2HL6A 1I7NA 3QFTA 3MMPA 1E2PA 1GGFA 1DG9A 3FUUA 5AMXA 3ZXUB 3OF3A 3ZHVA 1W36C 3IVAA 2Q4DA 2Q50A 2YIVX 1J8QA 3RU3A 4DQVA 2XNKA 3AHEA 1V5EA 2VC2B 3BB4A 4MRPA 2XV1A 4P81A 4ZOBA 2XUKA 1AXEA 2MHCA 1CQJB 2PEZA 4NYIR 5BYAA 1FRNA 4ACAA 5CFZA 5JMOA 3K8QA 5EMNA 3MVEA 3BM5A 2PVCA 3FPFA 3QPWA 3V4OA 1QGZA 2PSJA 2JZCA 4EW6A 1YTUA 2RC6A 3QMWA 4GBJA 4XYMA 3PXGA 4GM4A 1JKXA 4LZLA 5BRAA 3GYBA 4KGXA 5KNDA 5CFLA 3S2EA 1FRVA 4UPDA 4LJYA 1MC4A 5HTKA 4NR0A 3O4VA 1P4SA 5LA6A 3KOWA 2R86A 4IX1A 3S6JA 3ZQUA 4EF6A 1EVYA 2J46A 2LIVA 3UJ8A 3LRPA 3OSUA 1GDDA 5AESA 3CM0A 4PYNA 5BN4B 2NWQA 2XYGA 4R98A 4Z9XA 3D4PA 2DKOA 4PICA 2VN8A 1AA6A 3V4PB 3V2UA 2YS6A 1ZOLA 5GADl 3H5LA 2V3WA 2XUDA 3O73A 4KXXA 4P2BA 4M0LA 1YR1A 3H3XA 4NOKA 2NG1A 4RMNA 2GAAA 3GC6A 1NU8A 4QGSA 3TG8A 2QKYA 4X71A 1EQAA 2RSLA 2AG6A 4H31A 3KJFA 2IIQA 2F1JA 4IV8A 3VPGA 1U63A 1IOWA 3EF3A 3IP8A 1QRRA 2IT1A 5KJ1A 2GEKA 1BE6A 4PYRA 1SUSA 2P2LA 2YZGA 3I37X 3JR3A 3TW8B 5TPWA 1IVNA 3AVYA 1BD3A 1GCAA 1ID1A 1IHYA 1DLJA 3H0CA 4R1OA 4J3JA 1YBFA 3X1ZA 1UFOA 4MOWA 1O96B 4KREA 3OT1A 5DGIA 2O5RA 2OXTA 3HN7A 3ZBTA 2AZMA 4L5AA 3MLBA 2Q5LA 5JCZA 2XOXA 3EX7C 2VAXA 4WX2B 4JVSB 1BDJA 2AHRA 5FBWB 1E5TA 1K4YA 3CNOA 3I1JA 3LHIA 4D9FA 1WCWA 5KDDA 4YQYA 1OVGA 3GGPA 4MPTA 3B3QA 2H4YA 2HNKA 3L8HA 4XTRA 2BSXA 3LWBA 5IDQA 1JHYA 1R6VA 1TM2A 1XTUA 2QSYA 4Q7LA 1THMA 4Q93A 3DTNA 2A5GA 4MPDA 4R8RA 1IZZA 2AJCA 1HNZB 4YCDA 4BEJA 1WDLA 1T29A 4HSEA 3NP7A 3OZDA 2G36A 1GPAA 4DJJA 2HIHA 1SBZA 2GPJA 4A8JA 5EY5B 1JDBB 1TZBA 3EZNA 2FUCA 5IF9A 1MO6A 5KVAA 4I2VA 2C5HA 1V1RA 3DOFA 1U9IA 1K8RA 1BOFA 1TUIA 2BGKA 4XWAA 2XQFA 1DSSG 2HJVA 3PPYA 3AJ9A 4JT2A 4XKJA 1Z4QA 4Y8VA 5BMOA 3MLEA 2IE0A 2ZWMA 3SS7X 1SOMA 2DY0A 2HCRA 4V0NA 2NAPA 5BMVB 5KWSA 5DBEX 4B32A 1NP3A 1JH8A 3RANA 4RJKA 2O05A 2Z9CA 1D7OA 2K87A 3KKMA 1DRKA 3EVDA 3H18A 1LB1B 2HA2A 3N2NA 2VTKA 5KKCA 4CUJA 4MUXA 3QI7A 2JVKA 4LXQA 2PA3A 4AS1A 4FOSA 4GLFA 1K2VN 2R5NA 4V2UA 3U7RA 1UCFA 2ZR7A 3HACA 3MELA 5D85A 5FNZA 4B3JA 4QELA 3VU3A 4KNYA 5A3SA 3E1KA 2WKPA 5LQNA 1MD9A 3HUEA 2V6FA 4JI1B 2WYHA 1IY1A 3WMXA 1W36B 4P80A 2QN9A 3CTPA 4YI3A 5C8YB 3UH0A 1WZUA 3G2IA 3U3JA 3WLPA 4E4TA 1CUSA 3PP8A 3WQQA 2PX5A 3QW4B 2ZSJA 3O0DA 2D5IA 2WW8A 4EZIA 4WHMA 4DNPA 4CTOA 4JGIA 4BO9A 1LI4A 1RABA 3N5CA 1M6WA 5AVWA 4L95C 2GR9A 4QOJA 3VKWA 1EFCA 3SIRA 1P61B 4K81B 4E5DA 3G0HA 5SZKB 3GUVA 4N3CA 5AKJA 4EZBA 3SSNA 1O6BA 1XD8A 5AFSA 2HWWA 3QXGA 3WOVA 4B46A 1BCSB 3D0RA 3RV4A 3WLMA 2GFIA 2GBFA 3HXKA 1AD2A 3HKEB 2VKQA 3T3MB 4E6PA 4A3SA 1AB5A 2VPIA 4GPD1 4ESOA 2VXOA 2C2WA 1ZUNA 1NDUA 3FCSB 3AI1A 5DOVA 2F3QA 3LWZA 4JKIA 4BS9A 5HR5A 1HBJA 2NUPA 2VEDA 3GPBA 5DNUA 5DGHA 5JS6A 2PAAA 1VJ0A 4RIEA 2VHJA 1YGYA 2Y0CA 4H27A 4Z9BA 3VR4H 3SQMA 2A9JA 2FEXA 4C01A 4M9RA 3G5TA 3EG9A 2JI7A 4LGCA 4PC7A 3H9GA 4PGFA 4ARSA 1J2YA 5F73A 5FTWA 1XRMA 3UCFA 4D80A 5FL7A 3NHPA 1H9CA 2ONYA 2Y1LA 3KT0A 4PZCA 3STWA 1FP2A 4UNSA 3UWSA 4BNGA 4Q6WA 4LZWA 2WSLA 3AG6A 3CH7A 4U4AA 4QRHA 2J0EA 3O7WA 4HQ6A 4B3TB 1MIOA 2ZS7A 5L4NA 3U16A 1NLYA 1RYHA 3KOYA 1LY1A 3ZW8A 3A1WA 2YJ3A 4R01A 4BKRA 3OIGA 1WRBA 5KVCA 2ZCJA 1T1EA 5L4SA 3VPSA 4JXZA 1W46A 2AOUB 2QRVA 2CNWA 5EWMA 2JD0A 4EUFA 4UHCA 4CU2A 4RIIA 2FQYA 4HATA 1I51A 5HM6A 3ZJUA 3AWIA 5EP2A 3NDRA 1GNVA 3AERA 1UK9A 3O38A 1XVLA 2AKAB 3FG9A 2HRRA 4WLNA 3W8NA 3HWRA 3DB2A 2ZAGA 4UD6A 3D8NA 3ZV3A 4AZ0B 4D02A 4EHIA 4XRGA 4ES6A 1NN3A 1QE0A 5CJ2A 4EKDA 4JCCA 1FP1D 3G2HA 2VCEA 1QFSA 4UU8A 2NV6A 1QHFA 2RHHA 3B1KA 3NWEA 2HK7A 4RLFA 3W2TA 3CY6A 2Q4TA 1RAHA 1MVOA 1MX1A 1F8UA 1NBAA 1UC8A 5IAGA 5TPZD 5UKDA 5JV5A 1EJ2A 4KRXA 1KWGA 2EZUA 3GPCA 1GTJ1 3DDSA 2FJ0A 1QYWA 1TZ2A 3NHBA 4TL8A 1DIRA 1G4UR 4YS6A 4N5DA 3V4FA 5FDFA 5K0TA 4HFJA 3SLKA 4WA7A 1Q44A 1F6BA 3PWTA 3TOSA 2IUSA 3DOJA 4U6NA 3UG7A 4OKIA 2BCGY 2NADA 1G6HA 3GHYA 2ZJYA 3L4JA 5DJ5A 2YHIB 1GL7A 2X2OA 2ZSKA 2PBLA 1X9HA 2K7ZA 4HQKA 1IULA 3IHKA 3VR6H 3UMYA 4TV8A 4UM9B 2V7BA 3MT9A 4US1R 3C16C 1IC6A 2KW5A 3P9IA 3ED5A 2X58A 1WIWA 3P32A 1BD4A 2C29D 2JJ2A 4LRUA 5LP6C 1ESEA 3P9NA 1LC3A 1PLLA 1CY8A 4NBKA 3ILSA 4OQPA 3BMXA 2OM2A 5FYQA 2WJGA 1KDVA 3FZEA 1L5WA 2AOVA 2WIDA 4EW3A 4NTZA 1W36D 4G5SA 4G85A 8AT1A 5KNDH 1DELA 3D8HA 1GGNA 3EEIA 3HVJA 4P32A 4D0LB 1YA6A 2ZRQA 4GIBA 2P6PA 3SDSA 2IZ1A 1NYLA 2ZBUA 3B1XA 3RRFA 4IUBS 4RZSA 2PZJA 5B57C 1B0PA 1EM6A 3T9AA 3I8OA 2X86A 3M1LA 3R6DA 2FOXA 3NGMA 1Z0IA 2FFBA 2G07A 2VJNA 3KCNA 3THRA 5T67A 3LM8A 2WD9A 3RBVA 3UB4A 2I55A 5FWAA 4ESEA 2NIPA 1OCEA 1Q0LA 2P69A 3W5BA 1XEXA 2FX2A 3RSZA 1U2RA 3ZOZA 1VI2A 2C20A 2W2QA 3RRYA 2PGXA 1QJ4A 5CBKA 3DV9A 2WAAA 2J9RA 3IA7A 3UICA 1FC0A 3CVUA 1UXGA 2GEBA 3O74A 4W63A 2UZ1A 3GP8A 3JWHA 1NY6A 3MWKA 4F7WA 2ETVA 1X86B 2GRAA 3NIWA 3O8OB 4MR8B 5IMSA 3MFYA 1RZUA 4K9SA 4EF4A 1NF9A 5FI3A 2I3ZA 1TO2E 3D64A 3G8AA 3TNLA 3FNIA 1A5ZA 2GXQA 3IMEA 3ETCA 1T0PA 2OK7A 3JD0A 3VR3A 4A16A 1CJSA 5J43A 1E6LA 3FOWA 3DZHA 3OJLA 4U3JA 10MHA 3K9CA 1JIJA 2OSVA 5J4KA 2HH9A 1CJMA 3NZEA 4MQFB 1O97C 4OGKA 2BGRA 2XQKA 4WZAB 3AL3A 4ZEXA 3QE2A 4ESVA 4XIJA 2RJNA 3LVBA 1RYNA 5K20A 2J0QA 1LBQA 4QGFA 5ILQA 2W2OA 1NG9A 5EIBD 1U8FO 3E35A 1TF5A 1DIAA 3FR8A 4JJEA 2FZEA 2WWWA 3UMCA 3EXG1 3VVCA 3QHAA 4D5EA 3PJRA 1PK7A 1TD9A 2LTAA 3A37A 5T64A 3WO1A 4DW8A 1OLXB 4URHA 3OLZA 4ZRNA 4KUHA 2F8TA 4DMRA 1QIMA 3GH3A 2AUTA 3NHFA 4F84A 5K6AA 2RGDA 3JYOA 5IVKA 4PC3A 3KPYA 1O87A 3VZCA 3B3FA 1T36B 3HNPA 3JQCA 4JLNA 4WERA 1N6HA 4AP6A 1I01A 2C9OA 2IXDA 2ZGVA 3ZX5A 4EECA 3H6KA 3A3YA 3DHEA 1YHNA 1K5GA 3E9QA 4M0CA 4C4SA 3QEBZ 2J07A 5A3JA 3Q10A 1LU9A 2I2FA 3ETLA 4CLOA 5KOJB 3BMOA 4QM6A 2RGBA 5JI3E 1J24A 4DY6A 3EGCA 4KV7A 2QLNA 5DV9A 4DUGD 3WADA 4BZWA 1SCJA 2EKZA 3O47A 1U3UA 2XR1A 5C1DA 3ANSA 4CYMA 3KEGA 3AM4A 1FUUA 1V6CA 1L3IA 2H5EA 3DHVA 3OCJA 3W8FA 2Q46A 3TRDA 4EYSA 1Z8FA 2Y0DA 4LY6A 5U1PA 2AEMA 1MX3A 3Q6MA 4KSYA 1FTQA 4JX8A 3A1VA 4NH0A 1Z73A 2B2XA 1WZEA 2TMGA 5I9BA 5C34B 3BL8A 4URVR 3HA7A 2A88A 4ZYTA 3G6WA 4HN2A 4BE9A 1FJ2A 4OSEA 5BNZA 4OYRA 5LP6B 1ABBA 3QH4A 1TJPB 1RJEA 4GG1A 5LD2B 3WYBA 4BUZA 1M8JA 2R7NA 4MLCA 1XX6A 4FOPA 3ROFA 1P7PA 1YL5A 5BUCA 2ZUDA 4B7UA 3TRHA 2HI0A 2NO0A 2PRIA 1J0XO 3GFPA 3SP1A 1XG5A 5JJKA 2JFXA 2BKXA 3EGWA 3DMYA 1LZLA 3EQ7A 1R0YA 1WF3A 4JP5A 4EKYA 1YFJA 4HEJA 1UM9B 1QRDA 2EFHB 3PUVA 5EFOA 4NCXA 1CY1A 1P6QA 5DTIA 4EYOA 1D0VA 3FOZA 2B7LA 5KMGB 1LQTA 1A9XA 3F1KA 5JAIA 5LQUA 3F6BX 2WOJA 4QASA 4FP9A 1YJ8A 5K0EA 3NJ4A 1UWCA 4TVBA 1VJRA 2VTVA 4PRKA 1IWBB 3QLEA 5ALLA 3UB2A 2PRSA 4EPVA 3KB8A 4G9BA 1C9YA 1P4AA 2PMFA 1R4NB 2PS3A 2RGCA 2XYVA 3UG6A 1H2EA 3IKTA 2XJ9A 4H1WA 4JI4B 3C5VA 2W2KB 5AJTA 1DXQA 1U3DA 3DE1X 3FHLA 2R0QC 3GX1A 4YRPA 1LCIA 3ZHTA 3CONA 2JFNA 2QDXA 4IY1A 2MR5A 3IGFA 4DA6A 3ZIAD 3GCXA 3GQBB 1NW9B 2DHCA 4BJHB 3E7FA 1JLRA 5HKKA 1O8CA 3E9EA 3LHKA 3R41A 5H8WA 2PUEA 1E8MA 4ZVVA 4AJLA 1GSHA 3VYWA 1WOYA 4ZZIA 2HA6A 2JCBA 1CQWA 3AT1A 1FFWA 3R6WA 4JITA 3KOUA 1WHSA 4YRQA 5IHPA 4N3AA 1WCV1 3PZBA 2CB0A 2EW2A 4QDTA 1I13A 1KS2A 3K73O 2FPXA 3F7OA 3T3EA 3UJPA 1LPBB 3IOYA 4QPPA 3HB5X 1TM5E 3DPUA 1MAAA 1ZSVA 4TXLA 2FB9A 4ZO9A 1PJ4A 3T54A 2WU3A 2I0FA 3U39A 2X14A 2IYNA 1YFKA 4FT2A 3SF8B 4ZMSA 3JWJA 2P27A 1UDCA 1WMSA 3RUCA 2OPHA 3W6ZA 3RRXA 4YR9A 4UEKA 1MC5A 4OXNA 4KQFA 2FZCA 2KE5A 3L8ZA 4NP6A 5B7QA 5DCYA 4CG1A 4AJJA 1Z45A 1COWA 2H31A 5DYIA 4AO8A 1DEOA 1U2ZA 3PICA 1PFWA 5L7WA 4NABA 4UTZA 1T8UA 5FX2A 1KKMA 1IBRA 3WNBA 2PZLA 5IX8A 2O2HA 3QYAA 4AU1A 4G4SP 2BFFA 4DG9A 5I9TA 1GFZA 2PUFA 4KW7A 4YJFA 2VHTA 1L7XA 4BGVA 4BB6A 3WL6A 4H18A 4DCSA 2CXSA 2QTGA 4QDUA 3LUHA 1UFQA 2CMKA 4YJ2F 1JSXA 2PL9A 4LZNA 3L5OA 2PKQP 1WABA 3NTQA 1H3NA 2X8WA 4N8EA 4AG5A 1LPNA 4GX1A 3D31A 3IQGX 3V1LA 1HT3A 2QHXA 4WAUA 3EUWA 3AEZA 3V1NA 1QSGA 1SQ6A 1MB3A 4JT4A 2PPVA 2X8AA 4J3NA 3KLPX 2O5CA 4R71A 1M1NB 1WUTA 5K0LA 3JD2A 1A97A 2HFKA 4B5LA 1J8MF 2NZ2A 2QA5A 3SKVA 3VO1A 2ALJA 1Y9ZA 4GOXA 3HC7A 3PGKA 2O2DA 3MWLA 2JLQA 2YQZA 3E48A 1NUAA 4UUMA 4X94A 4AJ1A 2HB6A 3VHXB 1NM5C 3F74A 2P5TB 3ETEA 4NC9A 1P9OA 5L7TA 3C4QA 4Q4DA 4QJ5A 2VK8A 4PZ0A 5EYPA 1IUKA 5P8WA 1P3Y1 3L1KA 4Y6GB 2Q1XA 3WDKA 3ZGVA 1SVUA 4XSHA 5K5EA 4E2ZA 2IPOA 3DVAA 5BQPA 3Q9NA 5ITZA 4GDFA 3CEHA 2W4QA 3BHJA 4ZKDA 2CF5A 3KO8A 1T3HA 1GPDG 4NEGA 1RRFA 1S6YA 5DHSA 4EKNB 1FRZA 1SUIA 3HCBA 1KEKA 3FGOA 3OEHA 2OM6A 5JY1A 1CW2B 3PHCA 2ZU0C 2ISCA 5C2JB 1K7SN 1PGNA 3M2PA 4NFHA 4CCAA 2CXOA 4CFYA 2GFHA 2FZLA 1JIXA 3TCNA 4OQLA 3UCEA 1D9ZA 4YV2A 2Q3FA 1BW9A 2R6AA 2Y1CA 3USES 2MTBA 4GC9A 4J7AA 3U7QA 4GPBA 3UHPA 1X0VA 2G0TA 3PEUA 3PDIA 4FFNA 3WWZA 1T6ZA 3PA8A 4AMBA 4ZV4A 4J1QA 4G24A 1SIUA 3BAFA 3M5CA 3DKKA 1YBHA 2EDCA 5A06A 5CDFE 3RKRA 3NXKA 4ER3A 3B36A 1XL0A 3FZQA 4LA4A 4OM7A 2IS1A 3OQMA 4WBXC 2VDWA 1FPMA 5DU2A 1CUAA 3NBXX 5BXQC 3S4YA 4G0XA 3DUFA 4S0ZA 4KBFA 4FZRA 3WSWA 3PJFA 1B93A 1KAEA 3EDMA 5K4GA 2HSDA 2WOOA 3HHPA 1FE8A 2G5CA 2QRKA 3ZGOA 5JO0A 2HNAA 3GIDA 3OE7A 4Y1EA 3QEAZ 1M66A 2FPRA 1ZDMA 1E1DA 2QE6A 1MP0A 1X92A 2J87A 2QE7D 3A1UA 3KV3O 1J21A 2HPVA 3U31A 3V1MA 3LDGA 3E58A 3HKBB 1IXSB 4W8OA 4YALA 1TTTA 2H92A 5CJPA 1HK7A 3O8NA 2W9XA 1EK2A 3UWPA 1O97D 1PN3A 4LG1A 4AYWA 4GMFA 2ZRGA 3MINA 4FBGA 2P9EA 3KYCA 1KY4A 4TLDA 3RT1A 3WGNA 4EOGA 1V8FA 3FCXA 4NICA 4B5KA 1AQLA 1OROA 2Y1GA 721PA 4I9UA 4V3CA 5LMZA 5E3JA 2G6BA 2PKCA 3IPRA 4FB4A 4HGRA 1Y6RA 2NO1A 1U9CA 4WECA 1YZ3A 3TOXA 4Q3OA 1LZKA 3VR6D 1QH1B 1XAGA 3VVBA 5IWCA 1ECLA 1RKVA 3U1BA 4PFJA 3EGEA 4Z8YA 3COSA 2BZ0A 3KXLA 4ZQCB 4RVNA 3T4UA 1RLJA 3TCXB 4DE5A 3CF6R 5BV7A 5KBYA 1RPZA 2F43B 1Q3HA 4C2AA 4LEIA 3MIIA 3R20A 5DW0A 5KNCA 4GL2A 2W4MA 3NT2A 4RADA 3JRNA 1YMQA 2CLFB 5SYAA 3RRZA 1EAYA 2PMBA 4MW0A 2RH5A 3WJ7A 3QF4B 4FYYA 4Y6LA 3X1MA 1HEUA 1Y3CE 5TLSA 3RLFA 3FPEA 4PGAA 4HH4A 4TROA 1KI6B 3V9AA 3FWYA 1W4CA 4MS1B 1VPVA 1S0UA 3MS2A 4X93A 5A3QA 4FKBA 4ZHQA 2KPOA 4G63A 4IJ5A 4BNXA 2JIOA 4ACBA 4KL8S 5C4IA 5CVTA 3E1SA 4FYJA 1QCZA 4CFSA 5KOHB 5LFAA 3G9TA 1WB5A 3PRJA 5K3FA 3RSCA 1OH7A 1ND6A 5LOVB 4UU0A 1N2CB 2H85A 1Y3AA 3NBMA 4FCWA 1X87A 4GL4A 1QH8A 3ZUPA 3PUWA 5G3ZA 3NVKI 3BIWA 6ADHA 3I2KA 1II9A 4YROA 1XROA 4DA8A 3I2IA 2D5BA 5GONA 1KORA 3ICVA 1CCWA 4A26A 1IZ8A 2WD7A 5M3BA 3GCWA 3CKYA 2ZUSA 1RWBA 1NE2A 5EVCA 3R7FA 3ZVNA 4Y6SA 2QTNA 3BIJA 4FUQA 1HZZA 3WDMA 5L6LB 3GMDA 5DX0A 1HFWA 4OUDB 3KQNA 3GLHA 3GJSA 5CDHA 3U9TA 1U2TA 4EX6A 3IVXA 3I2GA 4PPYA 4Q3CA 4HMQA 4HT3B 5F9MA 4CDMA 1RTKA 2Q1WA 3CUVA 3MAJA 4DABA 4KWHA 3S1AA 1PJLA 3D7NA 3CRMA 4FSXA 4HTFB 3T7AA 1S2GA 1UT5A 5HQ3A 4N39A 3UAZA 3AK4A 4PO8A 2GSWA 1F60A 1H2AS 1KXZA 2MSWA 4RQBA 4YJ3B 3QYJA 3M9LA 2I29A 3RC8A 1BH6A 1JVSA 1PL0A 1DC4A 4IMRA 2CHVA 3GG2A 3G0OA 1L5RA 3K3PA 2A14A 2JJYA 4G5RA 1NXTA 4ZALA 1RW4A 1ZNZA 3G5LA 5E9AA 1NLMA 4C7OA 3FGNA 1XTKA 4R6XA 4BB5A 4EPRA 4KXNA 2H4ZA 1X7GA 1TQ8A 2ZT7A 3TINA 1H8EA 2VATA 1EB8A 5CTJA 4E09A 5D3ZA 4JI7B 3GA7A 3NUZA 4PWZA 4G5GA 1XDDA 2WFMA 2O9JA 4IOLA 1LQUA 2YMQA 2OO7A 1JJBA 3A9UA 3HPQA 4V0LA 3BWVA 5AUNB 1L8LA 2EQBA 1F38A 1H1LB 2VP2A 5EXXA 3IUJA 3KAJA 4PNPA 3ZKWB 3K2IA 3FMIA 3R1IA 1G8FA 2GCGA 2JFHA 3OF2A 3JYLA 1FYVA 3Q15C 2NN3C 4L4ZA 2WHXA 3A2MA 4UCXA 3T1TA 1H5NA 2R8YA 4PQRA 1TF2A 3ESCA 3FSJX 2P9QA 3IUQA 4PCVA 4FYHA 4RA9B 1XNQB 2IPAB 1ZI6A 1S4QA 1TVCA 4FS8A 1VL1A 1L8XA 1ZJ5A 2HNBA 5D1HA 1IPHA 1Q7CA 5ENZA 5LXTB 2Q2NA 2WZQA 3I6ZA 4OREX 5IT0A 3DOOA 5L3QB 1GU7A 5DSTA 4I4LA 5TC4A 1U0NA 2ZXFA 2WZBA 1ZCFA 4B3IA 5CHYA 4J0GA 3QU5A 3JQ9C 2ECFA 1UF9A 3IESA 2XUOA 2DF8A 4DHWA 4IDEA 1GVNB 3UPUA 2WWHA 4U7WA 4S05A 3KAPA 1AS2A 3PXDA 1Q0TA 2GJ8A 4EY4A 1K66A 3E2PA 2XNJA 3L8GA 1DFGA 2ECQA 4R7ZA 1LJLA 1P8AA 1JNYA 1LF5A 4U8HA 4LVCA 4ZO8A 2AZTA 1YXMA 2C2HA 2DSTA 2JHFA 3K6RA 2A5FA 3LIPA 1A8QA 3GFOA 3SHFA 3TIVA 1UIMA 2YWRA 4Q1EA 1PS0A 1MTZA 1GEEA 2VZ0A 1RMQA 2A1IA 2WILA 2XH8A 3SC6A 2D59A 3IL2A 4PRZA 4Y2RA 3UYLA 4R2WA 4HDCA 1E69A 2QVYX 5BY2A 3PQ3A 4YRMA 4J0HA 1G0NA 3HA3A 4PIMA 3S68A 1LUAA 1OXBB 2EX0A 4LAFA 3IAM6 4Y18A 4ETMA 1P3DA 4Y2HA 2Q3HA 3LMKA 4L76A 4RCYA 1JBQA 4B81A 1JILA 4PWYA 4DLTA 3PTAA 1H2BA 1R8XA 4XCXA 2OWEA 1O9HA 1IY2A 3PHLA 3QMPA 4HNSA 5AJHA 1NE7A 2OVFA 3BE4A 3DSRA 3EPJA 5HRCA 1G98A 3GP5A 1JSCA 2OKCA 3PQ7A 3VBEA 3M9WA 4KPEC 3EIQA 2HTEA 1KTVA 2JBWA 4NAUA 4I3FA 1SULA 3C85A 3WOHA 4IJVA 2C0CA 4INZA 1GTZA 2HY7A 4WZAE 4YPFA 4JBLA 3W77A 3L8YA 4UAVA 4U9HS 1UAYA 1AKYA 4N47A 2PZ8A 5EPOA 3L0BA 4WZBB 2GMWA 5JG7A 1WS6A 4WEOA 3IERA 1T9CA 1GLGA 2EAUA 2QAJA 4Z54A 5JZOA 1V43A 3E23A 4TTQA 1L7DA 2VG8A 2ZQZA 1DCTA 1OUMA 1SVIA 3P45A 1W76A 4EB6A 2GM4A 4EB8A 4QGHA 5HZMA 1P1RA 3PIIA 4OV6B 3A1NA 3BSWA 3HB7A 4UFNA 1EP9A 4WZ6A 5LLTA 1AXGA 4GS5A 3OC6A 5DM4A 5HZGA 1V8BA 4QTZA 1J0AA 4LHEA 2QP3A 4MKRA 4OH7A 2HYIC 2A0XA 4MV6A 3PLRA 4YCBA 2YJ6A 2AJDA 2WK1A 3OFJA 1V4BA 1H0SA 1IJEA 5IC5A 3IQDB 5JBIA 4IHJA 1QF9A 4K9NA 1SRRA 3B13B 1H6BA 2NV0A 3LDUA 1DI0A 3RAJA 5C5IA 3N76A 2HJ9A 4Q9JA 4ZIRA 2WQ7A 1D2AA 4Z9YA 4RPHA 2E85A 4HO1X 3RC7A 1LVGA 2B78A 4JXKA 4NEQA 3BMCB 1M6HA 2YZMA 3GAFA 3IFSA 1X7XB 4FTWA 1SN7A 5ARCA 3VH2A 1AMOA 4XWWA 1KEEA 2I22A 5EE1A 4YYZA 2O1XA 4QBHA 4XPIA 1I2ZA 2IE8A 1PLJA 1YU9A 7GPBA 1D2MA 3QSYA 4EJ2A 1RMYA 4M99A 4XOUA 4R7TA 3WGIA 4YLYA 2WKSA 1ADYA 3NW9A 1C3OA 2CHFA 3HO6A 3K32A 4DKJA 2WKRA 2CE7A 1JJFA 2EC5A 4E13A 2Z2XA 3Q6IA 1QK5A 5JXJA 2DFDA 2EX4A 2POQX 2AV6A 1XP5A 3JU3A 3OEWA 1P1KA 4CDNA 2UDPA 2NGRA 1Q57A 1ZUHA 2PT5A 2I3AA 2ZU6A 4PLFA 1LWNA 3B38A 2QRHA 1S89A 5BN5B 3WQRA 2PRJA 1JAIA 4HLCA 1CKEA 1Y5NA 5CB8A 2Z6UA 2XA1A 3MWFA 3S3TA 2ZJBA 1ZA2A 3LL7A 3MOIA 2ZSFA 1ZO8A 5CDSA 5K8TA 3WG9A 4M8SA 1ORHA 4AYTA 1NVWQ 2QN7A 1V45E 2GPSA 4BLPA 1JFLA 3IMCA 3M5DA 5FXMA 1JDZA 1SZCA 4F97A 2HSZA 5ICMA 1J22A 3QFFA 2C2XA 4HLQB 2PV7A 1FFEA 1AHHA 1N0UA 4H1UA 3GZTB 4IUYA 1F12A 4HXEB 4PG7A 2PR2A 2C9DA 3AF6A 3E15A 3O4JA 5EOVA 4FNGA 2CZCA 1TLFA 4KRFA 5K05A 2GAFA 1K6MA 1J0DA 3QFRA 1SWVA 1HGXA 3DDHA 4RSHA 2D74A 1R0CA 2ORYA 2X6RA 3EDRA 1M75A 1XPRA 1WP9A 3BTOA 4D46A 5CJJA 1GZVA 5I7OA 3Q5GA 4UUPA 4NYJR 3IAHA 4CE6A 3Q3EA 1OXMA 4NXMB 3OLWA 4KG7A 4G89A 4MVJD 2D3WA 1CYEA 4JYBA 5JDIA 2EFGA 2YXEA 1XWWA 1NJSA 2BELA 1CULC 1E2GA 4P3KA 1AN0A 4IVNA 3W78A 3OQJA 1G63A 4DCGA 1EVJA 3T6KA 4DLPA 2PKEA 2XSZA 4RESA 4Z0PA 3EOZA 3C8MA 3VC1A 1OC4A