2NO1A

C4s dck variant of dck in complex with d-dc+adp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
240
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords deoxycytidine kinase
total genus 96
structure length 240
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2no1A00
4CIDA 2ZR7A 1W0JA 2ZITA 3REGA 3BB1A 3K0FB 3WYFA 2OXRA 1JQJC 1JR3D 5DYGA 4DZZA 2FF7A 4R98A 3G5UA 5CYPA 5B64A 1R2QA 5JHHB 2AFHE 3UKDA 1JQLB 2A5YB 2ZSDA 3NXSA 1FNMA 2FE4A 1HE8B 3TE6A 2J5XA 1D6JA 2V1XA 3GP8A 3X1XA 1KO1A 5KSYA 4C0AC 2D06A 4RD6A 5DN6D 4A15A 3KTAA 4CEHA 4BECA 1E2HA 1TQ6A 1W4RA 3AGQA 1KDOA 4HAWA 1RJ9B 4LYFA 5DN6A 3QXCA 5J40A 4JYCA 4PZLA 3R9XA 4AY2A 1EFRD 1NBMD 1QHGA 4JBXA 3X1DA 1Z6GA 5EQTA 4O2RA 3KQKA 4JLDA 1KKMA 2QAJA 5D3MA 3UIEA 4YMUA 2E87A 2QROA 2P3SA 1KO7A 1JPJA 2XOKD 4GNKA 1IONA 2Q3MA 5BQ5A 2OAP1 4YDSA 4B75A 4M8NE 4PSAA 3X1ZA 2P65A 3BB3A 2QMEA 2WJYA 4R9UC 5AJZA 3WNBA 4LY6A 4QHYA 4URVR 3AUXA 5EUMA 4ZDWA 1ZU5A 3DZ8A 1ZM3A 3RVBA 3MG9A 1WE2A 2IS6A 1YQTA 4A9AA 2J46A 2V4ZA 4LCBA 4IEEA 1FUUA 3AM1A 4XD7D 1DBSA 2QMOA 5BW8A 5LD2C 4EAQA 5EP4A 2J45A 5CLQA 3U7EB 4QM7A 1RRPA 3H1TA 4A82A 3CW2A 1GIAA 4XSGA 3RDPA 3ZS8A 3VKHA 4L16A 3SJZA 1HQCA 5ELXA 1W5TA 2JLWA 4MKGA 1TEVA 1ZBDA 4C0KA 2P0EA 2UZ3A 3C15C 4KSBA 4D2IA 1NVXQ 1RJ9A 3GLHA 3LD9A 3I92A 3K9LA 3RS5A 2HXYA 4V0OA 2ZRKA 2FPKA 2ZJZA 4HAXA 2REOA 3A37A 4XSHA 3NHAA 3QBTA 4PPGA 2Q9BA 1ZCAA 5GADl 3EPJA 1NG9A 1KJYA 2WWIA 2A5DA 3IHWA 1T0JB 4XJXA 1E4VA 1CU1A 2N42A 2IWHA 3BAFA 2ZRIA 1WDTA 1G3RA 5FL3A 1U8YA 5KDLA 3LX5A 4WVFA 2QENA 3G82C 4IW3B 4A6XA 3D7MA 1BKDR 1D2EA 4HUQA 3V00A 1D9XA 3H0KA 5D3MB 1Z29A 4M4SA 1NVVQ 1E1RA 3QVVA 4HAVA 4QBFA 1P5ZB 2JLSA 2PX3A 3L8YA 4L15A 5HZKA 2ZYVX 4AG5A 2HT1A 4B6FA 3GJ7A 5B2ZA 3TUIC 3CH4B 4Q7JB 1E1RD 3BFXA 2OUKA 4C3ZA 2XOKA 4EJSC 3RWMB 2MSEB 4B32A 1KO4A 4Q9LA 1JJ7A 3NVAA 2GXQA 1T3HA 3LFUA 3GJXC 2VL7A 5A4JA 4KO8A 3EWAA 2ZR0A 1XBTA 1F5NA 1EGAA 3W8NA 4ERNA 3AKDA 1PLKA 2ZANA 3BGWA 2GAAA 5FPTA 2YOFA 1XMJA 4LJ6A 4L9SA 4WZBE 4AWXA 3BD9A 4IOJA 2B7CA 1V43A 2FFBA 1E94E 5FBWB 1N6RA 1S4QA 3P32A 4OHWA 2RHMA 2W2VA 2G0NA 4Y0VA 3VAAA 4MDFA 2IC5A 4AI6A 3KKNA 4PHHA 1P75A 1S9DA 1ZD9A 2OE2A 3FE2A 4ILEA 4IVQA 4NCHA 3KDSE 2BHRA 2CEAA 4KVAA 4TMWA 3QF4A 1E2LA 3Q72A 3OIUA 1G3MA 2CLCX 1AQYA 2KJQA 3R8CA 4MKHA 5JSZA 2BBOA 2B92A 2IF0A 5A0FA 5EP2A 4E09A 2C5LA 4TTPA 4YC7A 3N2IA 3C5HA 1G5TA 5JFGA 1E2IA 2G0TA 4UXIA 4RY2A 4A2PA 1OHHA 4JSTA 4HSEA 1RKBA 3RS0A 1DO0A 2NO1A 3JVUA 5E7JA 2GA8A 2EYUA 3O8RA 4BE7B 3KXKA 3H4MA 1GVNB 3SS8A 2B8TA 3CF6R 5CK4A 5EP1A 1KSGA 2JA1A 4ZPXA 3AUYA 3A4NA 3BC1A 4TLEA 2EVWX 2D2FA 1VIYA 1NLFA 1VHTA 4MRRA 1EFTA 1TNDA 2VH5R 3NWJA 3EC1A 5UKDA 4Z8XA 4G3XA 1AIPA 1N3BA 3KXIA 1KK3A 4TMVA 2W58A 3TW8B 1E9AA 3U7GA 1E6CA 3TVDA 2IYZA 4B73A 2V8OA 3GLFB 2ZJAA 1IN6A 4Q1EA 1T8UA 3BE4A 5DYIA 3ASYA 2GK7A 1W46A 3AH8A 1N5KA 1HYQA 3DZDA 4A1FA 1COWD 1DS6A 3RSOA 1M6NA 1NLZA 1NVVR 4NKRA 3ICQB 5JWHA 1H8HD 3RRYA 2VP2A 4I1OA 3AF4A 1XTSA 4H9GA 3U3OA 1PV4A 4CEIB 2VP0A 4GSYA 1FTSA 5BN4A 1XEFA 4O0MA 1JI0A 2B21A 4C9BA 4LHWA 2O8DA 1VCMA 4DEYA 3MRSA 3FHTA 1XPUA 4D4LA 2IYSA 2QPAA 4NPHA 1GTVA 4DJTA 4Q4JB 2IHBA 1W5SA 3IO5A 1NF3A 3IEUA 1CRQA 3ZH9B 4PO8A 5GJWC 3VX4A 2HYDA 4DEXA 5TV2A 3W5IA 4NZYA 2EFGA 3CPJB 1LF0A 1RE0A 3VR1A 4M1MA 4OQFA 1MR3F 1VTKA 2H18A 2O0KA 1ZRHA 3VX3A 2RH5A 3IKJA 3BRWD 1J90A 1U98A 3DPUA 1JR3E 2ZEJA 2PMKA 3WRYC 3SBEA 3CRQA 1GM5A 2RGCA 1ZYUA 4AYTA 4BFSA 5TVKA 4JL5A 4NYMQ 2IWRA 1GKYA 3EPKA 1Q1QA 1WMSA 3AF1A 3Q5DA 2FSGA 4JZKA 4JYBA 2VSXA 1P72A 4AC9A 3PUXA 2X8AA 4M2LA 3MD0A 2YVUA 4C0SA 1KIMA 1FL9A 2ANCA 4ZI3A 4NYIQ 1ZIPA 2QA5A 1T9HA 4XWOA 1G3UA 1PJRA 2HXSA 1OH5A 2XAUA 4JLAA 2IS4A 4LOAA 1TAGA 1XB2A 2WZQA 4IDHA 2Z6VA 1ZM2A 2OZEA 3NDPA 4W5JA 5FR2A 3NBZC 1US8A 4TYYA 2WKPA 1VIAA 5DNYB 4MITA 2FOLA 3IBYA 1C9KA 2E9SA 3AVPA 5TY0A 2AHOA 1NRJB 2OESA 3HR7A 3M0EA 3GFPA 3DM5A 1J99A 4K46A 1HT2E 4P4UA 1E3MA 1KZ7B 3KJIA 4LJ4A 2NZJA 1Z28A 1KSFX 3GLHE 3IQXA 4AIIA 2OFOA 4WIAA 1GRQA 2GBLA 4AD8A 2FFQA 2QN6A 4Q1DA 2ZI3A 2XNDD 4D4KA 1P2UA 4HDOB 3TSWA 4OI2A 1G8YA 3KQUA 1N6HA 1SVMA 4UNQA 1XMVA 3F3YA 3RYTC 4DDVA 4CF7A 5DH9A 1XPOA 3G0HA 2YZ2A 4KFUA 5AJYA 1RVDA 5FUXA 4DWJA 1A4RA 3TNFA 1CF4A 2JJ8A 2VHJA 3TKLA 4DXAA 5JZVA 3JZAA 4HB0A 3LAWA 4JT2A 4MKIA 5SZJA 4QBIA 2ATVA 2X77A 5JRZA 4NONA 5AUQA 1KAGA 1P9WA 4MYUA 3W6NA 3GLIE 4ASUA 5DO9A 1NVWQ 2OM2A 2D7DA 4O2LA 2WWFA 2JATA 2IS2A 1VKJA 4L8GA 1OLOA 4MRPA 3CNNA 1VCOA 1M7HA 5FUVA 1OB5A 2MMCA 3MCAA 2PJRA 4OBEA 2DWPA 4YONB 3GFTA 2PZFA 2NZ8A 3SU8A 5KNBA 4TN1A 4PTLA 2X1VA 2WWWA 2RGNA 4JBYA 4MYCA 3ADKA 1G64A 4URZR 3ZVRA 4I4LA 2BBTA 4QBHA 2VLIA 4TYQA 1XMIA 4B3BA 3U2QA 4XVUA 1VYUA 2J7KA 4FCTA 3U4QB 4OHYA 3CBQA 1JAIA 2GXSA 3CWZA 5JEEA 1NLYA 1SKQA 1EFUA 3T1VA 2WWYA 2UKDA 4Q47A 3FMOB 2F55A 3VU9A 4TZ6A 1IXSB 4AKIA 2C9OA 2J87A 2GZDA 3SHWA 1XF9A 4DIDA 1OKKD 4G5SA 4XWKA 2ZJ2A 4LC1A 4PSVA 2W6ID 3C7KA 4F91B 1N0UA 3EZ9A 4POAA 4GZMA 1S3SA 1OKKA 4GT1A 5B58C 2BV3A 1XPRA 2NPIA 2W6IA 4JVLA 3THYA 4GDFA 5CM8B 2GF0A 3AF0A 5HE9A 5F9HA 4BFVA 2A30A 2VBCA 1IN4A 4AK9A 3QE0A 4OJQA 2J0QA 1NMZA 3AKYA 4YMWA 3L2OB 4M1TA 2CVHA 5JS8A 4B33A 4O25A 4U7DA 1OIXA 2GKSA 1XU4A 1KI6B 3NKVA 3O47A 1G5RA 3QXSA 3TRFA 2IYXA 4G5OA 1ZMXA 2DBYA 2XEXA 5C4GB 1N2CE 2V7QA 4PZYA 2N46A 3B6EA 3NBYC 2J41A 5G3YA 4B35A 5B57C 3CX7A 3N5CA 4ZDJA 3SYKA 4TSFD 4IKEA 1N5JA 3LVQE 2WJHA 4E07A 3TQCA 3K9HA 2IK8A 2ZE6A 3WMGA 3K0AA 3QXJA 3WP1B 5FBVB 4LHZA 1R5OA 1Q12A 3OEED 3QKRA 3OE7A 1J8MF 4TYWA 1VG0B 2CE7A 1HEIA 1II8A 2ZS8A 1E98A 1E4YA 1R0XA 4B6EA 1LV7A 1IBRA 2XSZA 2XX3A 5FOSA 2H92A 5E4FA 5CB6A 2CK3A 1E2QA 3KJGA 3QKSB 3EZFA 2ZUDA 5E3HA 2BDTA 4EPYA 2EW1A 3EA5A 2NO0A 5EE3A 2KWIA 3WNCA 1ODFA 2C99A 2D3WA 3Q9LA 4IHQA 3SN6A 1ZAKA 2BVNA 2BMJA 3DM9B 2QT1A 4UJ3A 4PZZA 3SNHA 1E2NA 1Y63A 2IEZA 4OHZA 1F3OA 1KYIA 5AUPB 5EJEA 2O8EB 1F48A 5K8IA 2XXAB 1QF9A 4ACBA 4QJ5A 5FI0B 1N0VC 1OXSC 4NYJQ 1YKSA 1DG3A 1MV5A 3K09C 1DELA 1Z5ZA 4IJMA 4JLPA 2FX3A 5FOTA 4TYPA 4JBWA 1YRAA 1A1VA 3UATA 3GQBA 3GFOA 1NMXA 1P3JA 1TUEA 2PCJA 3A36A 4Q48A 2XGJA 2FFHA 1Z63A 1QHHB 2GEUA 2JIZD 2OXCA 4W5HA 2O5VA 1C4OA 1KI3A 3MWYW 4RCYA 2AFIE 2AWOA 1E9FA 2OBMA 3ND9A 1JR3A 3VR2A 1P60A 3B1ZA 1XRJA 1TQDA 1JEDA 3CRW1 1XWIA 4WAUA 4TSFA 1CJMA 4MA4A 4JT4A 1QVRA 2ZJYA 3KX2A 4M9XA 2ZSEA 4PPQA 3JZMA 2GWHA 1A2BA 3MMPA 1RC8A 3IBGA 4PXAA 1YR6A 2V6JA 1KO8A 3ZQ6A 1KMHA 1AJEA 2VA8A 1NMYA 1NJFA 4URYR 2Z0MA 5JI3E 1RIFA 3Q7PA 4RD3A 4TTRA 2ZRNA 2GCOB 2RB4A 1AGPA 3A1WA 5DSZA 3ZDQA 2QMHA 1QDEA 1M2OB 1BS1A 2BEKA 1W0KA 2DFLA 4ABYA 4CGZA 721PA 1QHXA 2RGNC 4FI3C 3ADBA 1GL7A 5CLLA 2DFNA 2V9PA 3TSZA 1SVSA 4AG6A 1YE8A 3LLUA 4YMTA 1TL7C 4I81A 2ZPTX 1MABB 2YC4C 1MO6A 1TF7A 1U8ZA 4P31A 4QL3A 3TLXA 4ESHA 2IYRA 5CK5A 1WP9A 2QT0A 1VG9B 2RGDA 2F1RA 4LGMA 5CIQA 1CULC 2ZRPA 4TLBA 2BC9A 4D81A 2ORIA 4DLVA 2O0HA 4LV6A 1HY3A 4B2IA 3MFYA 2KE5A 5KSPA 2ASEA 2ODBA 1T91A 3BJIC 4W5WA 1E1QA 1Z0FA 1KNXA 3UPUA 1VPLA 2AK3A 4FMDF 3TQFA 3B5JA 1ZNWA 4D0GA 1CEEA 1VCIA 1XJQA 5A5GA 2IBMA 4TTQA 4HLQB 3TGPA 1OXXK 4LWZA 4Q7LA 2DY1A 1GNQA 1XDBA 4DKXA 2ZRBA 3TW4A 1G8PA 2X2FA 3I5YA 5KTYA 4DCSA 1E9EA 2I1QA 3LBIA 2PEYA 3RWOA 1Z6TA 5AUNB 2VEDA 5L3SB 4R2HA 3IGFA 3PG5A 4EJSA 1UBFA 1F2UB 1GITA 2CDNA 4YXWD 1XD2A 3W6PA 4TYNA 4D80A 1AA9A 4TMZA 4CT5A 4BFYA 3LQQA 3KUCA 4N0EA 4DT1A 2NIPA 1XTRA 1H65A 3GEEA 2W83A 3KB2A 5JWOA 3GLFE 4M22A 3LXXA 1X8KA 5HTKA 1G17A 4NCNA 1JXOA 2F7SA 3RS3A 4QGFA 1WBBA 3A58B 1NBMA 1AKEA 3QUSA 1JALA 1XD9A 1VG8A 4DSTA 3NHBA 4RD4A 2AWNA 3OIWA 3OHMA 2QL6A 1WB9A 1YR7A 4S35A 1DAEA 2C95A 2CCGA 1R4AA 1U90A 5CIWA 1XJ0A 1M7BA 3LVRE 2JJ2D 4I1SA 4QJ3A 3F5FA 1K8RA 3WHLA 2QSZA 1E0AA 1Z22A 2QUZA 2Q9CA 3FFAA 3RSLA 3UK6A 1UFQA 4QGAA 1PVOA 4YMSA 3B1VA 3X1YA 2GJSA 3K70B 1NN5A 1G19A 4WXRA 4LBVA 1X6VA 2QBYB 1KY2A 4OJKA 6Q21A 2QORA 4XVRA 4TQAA 1YZTA 1EWRA 3VR4A 1IY0A 1WA5A 1H8HA 4V0ME 3U7FB 1OH7A 2DB3A 3R9WA 2JGNA 4D26A 5JLJA 1XX6A 4MUBA 2A9KA 5M04A 1ZNYA 3B7GA 2WSSA 1Y3AA 1II8B 3F8TA 4RZXA 3AVTA 4LJ5A 3LH5A 3PIRA 2BKEA 3VR6A 1EESA 3T5GA 3GJ6A 4LYAA 4DDWA 2C04A 4M1OA 4MGIR 4MQBA 3K9NA 4X8LA 2RGXA 3W90A 4LRWA 5H1YA 1X8JA 4OQNA 3U60B 3SZRA 2FDCA 3NC1C 2ONKA 3PUWA 2CHVA 3OEHA 5FOWA 2WOJA 1CIPA 4RZUA 4Q4HA 3LO5A 2A3RA 5HCNA 4HDQB 1W4BA 3ZVLA 4HLUC 2H5EA 5JBQA 2OILA 1OFTA 3OEHD 2AXPA 1S3GA 2YC2C 2BEJA 4M9QA 1NN1A 1UKZA 3P26A 5KDDA 3THWB 3M4YA 3L8ZA 4Q9IA 4LBWA 3SFVA 3HJNA 1UBGA 3IIJA 2KBEA 4Z1MA 1RFLA 2OSBA 1KAOA 4WXPA 4EFNA 1XCPA 4L5BA 3V4RA 2DR3A 3LBNA 3KQHA 1DAHA 1ONBA 2H17A 3BOSA 1JAHA 5J47A 2ZRDA 2Q9AA 5BYKA 5CDFE 4L4UA 4V03A 2WTUA 2GJAA 4J0QA 2GTPA 2WICA 5KOYA 2ZRJA 2IHYA 2W6JD 5E95A 3KXLA 3K70C 1XZQA 4G1UC 1LS6A 2WM9B 3T1OA 5K8UA 2ODNA 2XTZA 4JLKA 1V5WA 4EQ6A 4Q01A 2JAQA 3DMNA 5KSZA 5CYOA 1DOAA 3ONWA 4B43A 1U0LA 1OIVA 4EPTA 2D7CA 4MH0R 2R6CA 1I2DA 1SVKA 4Q66C 1K6MA 3B1XA 4XTCS 1JPNA 3LNCA 1G7TA 2O8DB 2VP9A 1FMLA 3KQNA 3FOZA 2RHDA 1COWA 1OB2A 1RPZA 4B44A 4PC6A 3R8FA 4B2LA 1GP2A 5DHAA 1Z6YA 3MAAC 4C2UA 4US0R 1B0UA 1BYUA 2ZE5A 2ZYTX 3B9QA 2OO7A 4HUTA 4RSGA 1JECA 1AZSC 2YWFA 2FU5C 3FMIA 2YWHA 3VHLB 3I5XA 2R44A 1NNEA 1P73A 1E2KA 8OHMA 1GL6A 2PBRA 4IDOA 3A1TA 1N6PA 1NN3A 2DFKB 3HYTA 3W3AA 4JLMA 1X1RA 4DSOA 1U0HC 4KLZA 2WIBA 3F0TA 2ANBA 1OHHD 3BS4A 3ND8A 4JVNA 5CJ2A 221PA 1N5LA 1F6BA 2R65A 4Q9HA 4DUGD 4B2PA 1Z6AA 3A1UA 3CR7A 2K5UA 2J1LA 1ZP6A 4IOMA 1KK0A 3GJ0A 4XVQA 3V9PA 4US1R 2J59A 3RS4A 3L43A 2LKDA 3GMTA 3GLIA 1MO4A 1YVDA 3I8SA 3WYGA 3FMPB 3FB4A 1SXJD 2BCGY 5EXSA 1P2TA 2VYFA 2CCKA 4NL4H 1NSFA 3IPYA 4DC9A 5JI2E 4CEIA 1TQ4A 3I73A 1SQ5A 4DSUA 3T15A 4OK5A 1W7AA 1F2TA 5H8WA 1E96A 3LLMA 4KCGA 2RAPA 3RANA 1G3IA 2IF2A 1J2JA 3K0CC 3OAAA 3QF7A 2VHCA 3SR0A 4KAXA 1W36B 4PO1A 1KDTA 5FTKA 4LC0A 3TIFA 3GLGB 2REXB 1YJ5A 2H8KA 3ZZUA 1YZKA 3IDQA 3EZ6A 4XWAA 4D4MA 3HU1A 2ZAOA 4NTZA 1R5NA 1M34E 4QHTA 2OV2A 4PAOA 4EFMA 3GCGA 4R7ZA 2I3BA 3I72A 3CF2A 1I4TD 2ECKA 3FKSA 1MRSA 4IVRA 4DSNA 2XNDA 2QPTA 2OBLA 4BWYA 5G40A 2JDID 2PCLA 1AS0A 3AVWA 2YYZA 3KKOA 3PEYA 2RGAA 3U3RA 3A1VA 4TL6A 1VYTA 3B8HA 1N6IA 1US8B 4GFDA 4MRNA 1QVAA 2BOVA 3B1YA 3NIBA 4LBZA 1F2TB 1BIFA 1SXJB 1WQ1R 3FVQA 5FTLA 3VFDA 2QNRA 3CX6A 2WMNB 5EXTA 2LCFA 2FSFA 3AP1A 4IFEA 4GI7A 4PX9A 3SE0A 5HKKD 4TT3A 4NYJR 3EIEA 2G1KA 2P6UA 5ANRB 3QPUA 1HUQA 1UBEA 5IT5A 1UEJA 1CJTC 4B3FX 1G7RA 2ORWA 4FMBB 4Z54A 4A6PA 5BN5A 4B48A 5J4VA 4V02A 2HDNB 2WWXA 2V1UA 2F6RA 1VDZA 3LA6A 3W34A 2IUSA 1KMQA 3NG1A 2NTYC 2H7VA 3X2SA 3VNUA 1VMAA 3OIYA 1IY1A 2EU8A 3PUVA 2J0SA 2PZGA 3L0SA 1OIWA 4PC3A 1U9IA 2D2EA 4LJ9A 4M1YA 3AP3A 3MJRA 2BMFA 2QE7D 4GMXA 4C0BA 2CE2X 2QGZA 4PO9A 1S0UA 4LPKA 5DI3B 5CITA 1P9NA 2YNMA 3K0EA 1E9CA 5GJBA 2GESA 1EX7A 1Z08A 1PLLA 1DARA 4ZCIA 2QM8A 3CM0A 1QHIA 1YRBA 3CUEF 1MRNA 4HB4A 1G20E 4F93B 1SVWA 4JJZA 3TJZA 1FPMA 4LSGA 1NY6A 2MSDB 4A0FA 1P2SA 3I8XA 2AX4A 3GLGE 4MRSA 3FKSD 2OAQ1 1BH2A 4JVMA 4D82A 4F92B 3QVUA 3CRMA 1UDXA 2BM0A 1NG1A 2ODEA 3ETLA 3MUFA 2HLDD 1TU3A 3E70C 4B47A 2BJWA 4A8JC 1QHYA 2ZS7A 3UXMA 4P4TA 1DPFA 3OEEA 3AB3A 2QQEA 2PLRA 3FYHA 1J8YF 1AS2A 4BGDA 2L0XA 5HE8A 2YOHA 4H1VA 3GLHB 4OQXA 1HH4A 1L4YA 1EFRA 4WA7A 3FTQA 2XB4A 3PCRB 2GK6A 2BCJQ 1T3SA 3NBXX 4P4SA 4Q4AB 4PC1A 3VTKA 3QQ5A 5KNDA 1XEWX 3EWSA 1TMKA 2R8RA 2EWVA 4TZ0A 3LRPA 1FUKA 1TQ2A 2F3TA 2GCNA 4RCZA 3P20A 2R6AA 2ZQ5A 3RAPR 3SYNA 2G83A 3CH5A 4P32A 3J81k 1Z06A 2ZJ8A 1SVLA 2QAGB 1N6OA 2A5FA 1E99A 1LW7A 5FOVA 1A5TA 3BWDD 2RMKA 4I99A 2ZS9A 2WJJA 1G8FA 2Q3FA 2A5GA 2Z83A 2HEIA 2AD1A 2WMOB 4QFMA 1LS1A 3VQTA 1CBUA 3EIHA 4MGKR 1IOZA 2FV8A 5F2EA 4HB3A 2BMDA 2FPLA 1ZU4A 5JHGB 1LFDB 4Q9JA 2WPDA 5FBLB 4K8OA 2JIZA 2A78A 4RFSA 1YZNA 1Z47A 4RD2A 3WBJA 2P6RA 3A6PC 1VCNA 4QNMA 4URWR 1XMSA 1G18A 4XIGS 2VHTA 1QZXA 3RLFA 2F3RA 2QMUA 1FTNA 4UQOA 2E1RA 1W0JD 2QTFA 2XNSA 1E0SA 1P4SA 5DI9A 3A1SA 4US2R 2NPFA 1Z0DA 2WJVA 1OXVA 4RFVA 3VHXA 1KDRA 2HT6A 3WMFA 3KTAB 4CEHB 1MO5A 2HLDA 3LW8A 3RHFA 4ZCMA 3AP2A 1DEKA 3U61B 2QAGA 4DCNA 2EFHB 5H70A 1G5PA 2C9CA 1NKSA 1XZPA 2C2HA 2C98A 4M0LA 5FI1B 5LPNA 3C14C 5TB5A 3REFA 4B3CA 4JL8A 4GOKA 3E5HA 2VIIA 4DBLC 1G41A 4NE2A 4C0JA 4D6PA 1E2JA 3QENA 2QGNA 2KBFA 1GKUB 2CL0X 3OE7D 3QXHA 4MYHA 3UWOA 2CNWD 2PL3A 1P7CA 5SZHB 4LDJA 3K0FA 2QZ4A 1X1SA 5GVSA 1VYVA 2FH5B 2BWJA 4O3MA 1OFHA 2FMXA 5TDHA 1Z0KA 1FNNA 1IQPA 4JKIA 4ZIRA 1G21E 5BWMA 2IL1A 4Z51A 3ZIAA 3WP0A 4UNRA 3KB1A 4IRUB 1FFHA 3HPRA 1FX0B 4RKEA 2O8EA 3AVOA 4Q18A 2W00A 3ZQJA 1GRNA 4D4JA 2ZI5A 4HAUA 1G16A 3L82B 4EJSB 1RRGA 2BKUA 4PPNA 2ZE7A 3WRXC 4NP6A 2I4IA 2YJTD 4EPVA 3TUZC 3HU3A 4DCUA 5C2JB 4URXR 4DLSA 3C5CA 3LBHA 4B3DA 2GCOA 2WPDD 1YZLA 1XTKA 2F9MA 4LHXA 1OJLA 5FR1A 3ADDA 1T5IA 4ZKDA 5FBRB 1KKLA 1NIPA 2GEVA 4JVSB 2V3CC 2DWOA 5IDVA 3WXMA 2B6HA 1SHZA 1E79A 4PFSA 4V0LA 2ONJA 4A92A 1S2MA 1IHUA 1Q20A 1XXHE 5C18A 5FH9A 3U3JA 4CRWB 1E79D 2C03A 2MMGA 4Q5IA 3VU9B 4QOSA 1UJ2A 2D74A 1ANKA 4WZAE 2IX3A 4AYWA 4TMXA 4ZDKA 4YXWA 4LHVA 1TU4A 5AWFC 1CKEA 4R2IA 3UANA 2QRZA 4PHTA 3NBFA 3DEFA 4HLDA 1TPZA 1PLJA 2JLVA 2FEMA 2VTKA 3HR8A 2CNWA 1XEXB 4DLWA 2PJZA 5AK0A 3T06B 1YR9A 3KJEA 3BFVA 4I1VA 3HPQA 4KBGA 4F38A 4W9MC 1W0KD 3B78A 2FJUA 4IEIA 5F9FA 4U5XA 1KZGB 4BPBA 3ICEA 3ZZ0A 4DIEA 4BZXA 4EKDA 2DYKA 2ZUBA 3BORA 3CRVA 4CW7A 1QG4A 2ZVPX 4GBMA 5L3QB 4LX0A 5HCIA 3I1FA 5LD2B 1A7JA 4A2QA 4KFRA 3NH9A 4Z8YA 2DHRA 2JCSA 4PAQA 1W1WA 1XFAA 3K53A 2WSSD 4QHSA 1NI3A 3OZXA 3U4QA 2PX0A 4D0LB 1AM4D 2QTVB 1X86B 2IXEA 3RC3A 3W3ZB 1E1QD 4LYJA 1RW4A 3THXA 5J4LA 1OXUA 4HLUA 4NDZA 4IFBA 4AYXA 3PITA 3EAQA 1II9A 1CR2A 2G77B 1Q44A 1QRAA 3MLEA 2QY9A 1NKTA 2HUPA 2LKCA 2QSYA 2QTHA 3BH0A 5BN3A 5E7MA 3QG5A 3QKTA 3EX7C 4ARZA 4GZLA 3VR3A 3H86A 5EE0A 2FGKA 1DAFA 3QI2A 4KVGA 3W5JA 3OESA 3CF0A 1ZW6A 4Q7MB 3R20A 3TUJC 2CLDX 4A0HA 4RZ3A 1ZINA 3Q8XB 4G0NA 4HEJA 1QHSA 3R7WB 3C41J 1G6OA 1GZSA 4F7WA 3TMKA 4CEJB 5FPKA 4EPXA 4BZPA 3BIFA 2WAXA 1G7SA 1NP6A 4LJYA 2YINC 3U6BA 3AQ4A 1OYYA 1OE0A 1S1MA 2R6FA 3THOA 5C46F 2VSFA 2IYQA 1L8QA 1W2GA 2VHUA 4CT4B 4EPRA 1XXHB 2ZUCA 2X19A 4OK3A 4DDUA 2ZXUA 1O3YA 1KJWA 4AKGA 2CMKA 2P67A 1OW3B 4NCKA 4P4SB 2JLXA 1IM2A 4U02A 3SBDA 1GILA 1CR0A 1P6XA 3QKRB 5IF9A 1B23P 2JLYA 2ZYUX 4KODA 5AUOB 3DL0A 4HAYA 1L4UA 3AVVA 4C7OA 4V0KA 1QHNA 3RS7A 2P5TB 4GOXA 4IOLA 3CIOA 1G4UR 2YOGA 2QP9X 1Q22A 5E7IA 2IXFA 2IYLD 5GVRA 4PAMA 5CDFA 2W6JA 2QP3A 1EK0A 4QXAA 5D3QA 3C4JA 1F60A 2NQ2C 4Q4JA 3T5DA 1N6LA 3NTUA 4TQ9A 4TLDA 1U99A 1BOFA 3NEJA 5JCZA 1BYIA 2JLZA 3AKCA 3HU2A 3PUZA 1OH6A 2ZTSA 1DVRA 2J9RA 1Z6XA 1YZUA 3K1JA 2GBLC 3TBKA 5DI3A 1SXJE 2ZJBA 1DO2A 1XCMA 1ESNA 4KYUA 3SFZA 4AKHA 4M9SA 3FKQA 3SC3A 4C0HA 2FPMA 2O8BA 1E2DA 3SQWA 1VG1A 4DDTA 1E9BA 2RGEA 2GAOA 3K70D 4HAZA 3IHLA 1ELOA 1Z2CA 3ZYCA 1G8HA 2ERXA 1KTVA 4C7OB 4KLNA 1TX4B 3M1IA 4EDHA 1AKYA 4HB2A 2QP4A 4H1UA 2ZRMA 2IYYA 4D0NA 1TADA 2F9LA 1M8PA 1GKIA 4BLOA 1OXTA 3O8BA 3M6AA 2NO7A 2Q21A 2R6GA 1S96A 4C30A 3WNDA 3AVQA 521PA 5FTMA 3H84A 1Q57A 4DUGA 2J0UB 3O8DA 3CPEA 4HZUB 1P2VA 5G41A 3RRZA 1E2GA 3QIAA 3CB4A 1Z0IA 2X2EA 1ZJ6A 1M74A 4OKSA 3ECCA 2CL7X 1CJVC 1E9DA 2PT5A 4B3XA 1OFUX 4ZO4A 1QG2A 2ZU6A 4B34A 3VNVA 1SHKA 1SXJA 5JMTA 3WHKA 4OI0A 3ZJYA 5EZ5A 4HLCA 1N5IA 4IDPA 5H68A 1UDWA 4GPTA 5IK2A 5JSZB 5IRCD 2P6NA 3CPHA 3PEWA 3FHOA 4UXJA 2ZRFA 3EC2A 2NOAA 1S9HA 2G6BA 1KI1A 3GLFA 2Z4SA 2G88A 2ZRAA 2PH1A 1CXZA 4JLNA 3FPAA 2ZI7A 1M1YE 1RZ3A 3KFXA 4B76A 2O8CB 1DTSA 2OLKA 1JB1A 4KXFB 5P21A 3QPWA 1E2FA 3GLIB 2J3EA 4KITB 2QI9C 2NO6A 1G8GA 2G3YA 4DB2A 2YWGA 2HJVA 5L8VA 1E0KA 2UVQA 1IXZA 4GMDA 2FFAA 1W36C 3CR8A 1GFIA 5FFMA 1IJFA 4JLBA 1EXMA 2AKAB 2C8VA 1X8LA 5G53C 2WSMA 2WJGA 2ZM5A 3W6OA 1W44A 4ASUD 4RD0A 2ZSAA 3GD7A 4LHYA 2J0VA 3EG5A 2UZIR 4QNRA 2DCUA 1E9RA 2OCYC 4FIDA 3TR0A 1XCGB 2CHGA 1OH8A 4ITRC 2EFDB 1W36D 3IEVA 2YWEA 4PPFA 3QF4B 2WKQA 3C8UA 3D31A 3U3KA 2H16A 4KJZA 4HDCA 3SI7A 4RD1A 3UG7A 3BBPA 1GSIA 821PA 4C0LA 2D4HA 3AF2A 4PR0A 2YKGA 4ZV4A 1HV8A 2FA9A 5BYJA 4A8JA 2HF8A 4NH0A 5FOXA 2R2AA 4HZUA 5J4KA 4QRHA 3RABA 1E2MA 2GXAA 4LUCA 4LJAA 3CRRA 2O8FB 5DGXA 3AVYA 2CVFA 3NC0C 5HKKA 4KV9A 1KDPA 5KO2A 3FGNA 2QU8A 2Y8EA 4P33A 4ACAA 1L7VC 2GXUA 1M7GA 4DHEA 4LBYA 4A0RA 1NVUQ 3PUYA 1YR8A 2ZR9A 4FMDB 1Z2AA 1KK2A 2DPXA 4PHFA 4XTRA 5IK2D 5L3QA 5EP3A 3TAUA 2KSQA 1T4GA 3AVXA 4ZDIA 5C1BA 2Z43A 1J70A 4HYYA 1IN7A 4JJKA 3ZLJA 1KOFA 5G3ZA 4JLVA 1G4AE 3HWSA 4IDQA 2WWHA 4CDGA 2OT3B 1SKYE 1G3QA 2OCBA 5KPDA 5EUQB 1RYFA 2AXNA 1XEXA 4A2WA 4JIMA 1BMFA 3C16C 2CJWA 5AJVB 2XZPA 1ZIOA 3QXXA 1ETUA 1E9SA 4C4PA 3DMDA 3GEIA 2KI5A 1E69A 1HTWA 1KSJA 1XD8A 2V55B 3AF3A 1IY2A 1UAAA 4TMTA 4ESVA 121PA 2OFXA 1EWQA 1TF5A 5JJIA 1FP6A 1K5DA 5J4YA 2IXGA 2IS1A 4FINA 4M1WA 4QM6A 3SJCA 4GRAA 4OK6A 3TH5A 2QEQA 5CM9C 2VSOA 3SYLA 4TL8A 3A4LA 3B1WA 1E0JA 3PQCA 2YHSA 2BBWA 5FTNA 3RS2A 5DIFA 1T6NA 1U81A 2ZU0C 3KKPA 5KU1A 1WXQA 4IVPA 4DLTA 621PA 4UNNA 4TT3D 4DRZA 4BLQA 2IUUA 1KMHB 3SJBA 4BQSA 4G5RA 4QG7A 5FTJA 2SHKA 2MSCB 4E03A 1R0WA 2VP4A 1JJVA 1JR6A 2ZRCA 2CK3D 1XNJA 1T0HB 1EX6A 4IOKA 1AS3A 4ZKEA 3I61A 1KNQA 3R7WA 4AKEA 1GWNA 1K5GA 2ZSFA 4V0MA 4P0TA 2OFWA 5SZIA 2IEYA 2VQSA 2XZOA 1ZC3A 4Y0AA 1FX0A 3MJHA 2QG6A 1WBDA 2FEOA 2P5SA 3IQWA 5FBQB 5SZKB 2ZRLA 2EFEB 4ON9A 1HT1E 4F4IA 4E22A 1Q3HA 2HCBA 3IIKA 2WVJA 1FZQA 3NDBB 2QE7A 1ZD1A 5F3WB 3PVSA 2KB0A 1JEEA 4X8HA 5JS7A 2XTNA 3AKEA 3K0CA 4W7SA 1Q1EA 1BMFD 1KJZA 3NH6A 4GP7A 2VP6A 3EPLA 2O0JA 3THXB 3FDIA 1FQJA 2GVDC 3LY5A 2JASA 4JMPA 4DT1B 3P4XA 4YQFA 5JECA 3T12A 1R0YA 2OHFA 2Q6TA 4JSYA 3MWLA 5KHOC 2O52A 1VECA 3ZGXA 4M1SA 2V7QD 2QBYA 2ZREA 1WF3A 2OLJA 2XB2A 4BRWA 2W0MA 2WIAA 2ZE8A 3T34A 1NY5A 4BLTA 2QPOA 2RGGA 2WOOA 2FN4A 4BZQA 1T5LA 1UKEA 1Z8FA 1L2TA 4YLGA 1W49A 1KI9A 2GZHA 1G291 4NMMA 4U00A 2H57A 1QHHA 3VR5A 1CR4A 5DHFA 4BUJA 3LXRA 3T35A 2VHQA 2XSZD 4PHGA 4WW0A 2OBNA 1ZM4A 1HQYE 2JJ1A 2OCPA 3WY9A 1ZCBA 1TEXA 4FN5A 1KK1A 1TF2A 3CX8A 4CZ2A 4JLJA 3BH6A 3UMFA 3WMEA 4FW9A 2XXAA 3BB4A 3S1AA 5B30A 3GJ8A 3FMFA 3DKPA 2PEZA 4XD7A 3ZIAD 3OFND 4ZCLA 4LYHA 1TTTA 1F2UA 2Z4RA 4OQLA 2BJVA 5L3SA 1N6KA 3L0PA 1CP2A 5FPYA 4FXPA 4ZIRB 3I62A 1R0ZA 1XJCA 2ORVA 2YV5A 3OFNA 3PR1A 5LB2A 5HR5A 3UMSA 4HZIA 3KKQA 1TUIA 3KZ1E 2CJWB 3LW7A 4QC2A 4TLAA 1CTQA 2WV9A 4DLXA 5JJLA 4BRUA 3QKSA 2ZYWX 2ZI6A 4JLOA 2DFTA 3CWQA 1YU9A 4II7A 4LK2A 3TVTA 3THYB 2V6IA 3HP1A 3B2EA 3QEOA 4Q1BA 3U44A 3PEVA 4MKFA 1GRRA 2CCJA 3PEUA 1H8EA 3B82A 1KI8A 2BBSA 3DVLA 4EPWA 2ZIAA 2ODWA 2FGJA 3QNUA 4B71A 4BEBA 2NGRA 1N25A 4DCVA 3T61A 2JLQA 2GETA 5HPYB 3U7HB 1UBCA 1D2MA 2BM1A 4PC7A 2ZRGA 1ZUNB 4M53A 5EXPA 4RJLA 2IW3A 1QBKC 4IDNA 4M1KA 3V4FA 1R6BX 4Q03A 2R6DA 1NSTA 1PUIA 4MYTA 3RC8A 2RGBA 3T1QA 4KHZA 1D8TA 4TMKA 2O8FA 1YZQA 2XJ4A 1C1YA 2ZJ5A 2OEPA 1Z0JA 1I4DD 3HDTA 1DAMA 1Q1ZA 1MOZA 4RFSB 1CJKC 1A82A 1U8AA 3B85A 4FWTA 4XH9B 5JEDA 1R7RA 4PSKA 1UM8A 3CZPA 2Z5FA 1IJEA 2H1LA 3GJ3A 2A7QA 4LV8B 2JJ1D 3PENA 2CLSA 1SKYB 4LV5B 4YMVA 3BFKA 3W8RA 1N0WA 1AQUA 1T8TA 5K8LA 1W47A 1OV4A 1ZNZA 2VF8A 3LQRA 4KSCA 2HV8A 2JJ2A 1P62B 4KU4A 2VRWA 4K81B 4PQRA 3D6TB 4A0GA 1E2PA 1O87A 3RRMA 3SHFA 3B9PA 3MWKA 1SZPA 1UPTA 2C77A 4G5QA 1P9RA 2FWRA 1NN0A 4WOPA 4KI0A 3NEYA 1IN5A 1EG7A 3FWYA 2CBZA 2W2XA 2JLRA 1ZUIA 5JJKA 3UG6A 5KPJA 1LB1B 1GDDA 4Q21A 4Q4AA 4BLRA 421PA 1U0JA 2GVZC 1Z0AA 2BIFA 3EZ7A 1CRPA 3GJ5A 1FW6A 1RYHA 4M9ZA 1W2HA 3SQXA 3K0AB 2ZETA 3BERA 4Q1CA 4TL7A 4AURA 4IXNA 1H8ED 5KDOA 4NYIR 4JL6A 4URUR 1DAGA 2VF7A 3QOFA 4UNSA 3ZZTA 4QBGB 4X8OA 4DVGA 4TWZA 2R62A 1II0A 3TSOA 1Q21A 3WYAA 2XTMA 4L9WA 5LBIA 3EASA 3EPHA 3QEJA 5EXXA 3SJAA 3KJHA 1KI6A 5FUWA 5DLQC 4I1UA 4BLPA 1WRBA 2DWQA 4DCTA 5GJCA 1RRFA 3AGPA 2GJ8A 4BFTA 3IIMA 2FSHA 4LJ8A 1ZM9A 1KHTA 5AJWA 3DHWC 4DB4A 5C4MA 1OFIA 2GJKA 4MGZR 4FWIB 1IN8A 3QPVA 2EWWA 1UKVY 3K0SA 1D2NA 2O8CA 2FSIA 2GNOA 4OI4A 2J7PA 1G9XA 1R10A 2F43B 1OSNA 2NMVA 2GF9A 1U2RA 5JWRA 3I32A 3CNOA 1CLUA 2XITA 5JRJA 2WWGA 4FCWA 2J7PD 3GLGA 3LDAA 2LWIA 1X3SA 2IUTA 3KUDA 2GILA 3DKVA 5KYKA 1PUJA 1Z3IX 1ZNXA 4G5GA 5CJPA 1AK2A 3QJYA 1MKYA 1KY3A 4QJ4A 4WZ6A 1W48A 1HA3A 1MH1A 3SDZA 5BXQC 2ERYA 1GNPA 1XEWY 1SVIA 2EFCB 5EE9A 2PLFA 1P61B 2ZI9A 2REBA 2V54A 1GUAA 3CKLA 1HURA 1S8FA 4G01B 4YDHB 4RKFA 1D9ZA 5FOUA 4PC2A 1NJGA 3HYRA 4CYMA 2GCPA 3D3QA 1LNZA 1KGDA 1MO3A 2J0UA 4LPSA 3DO6A 2FNAA 2N1BA 5K8TA 3VMFA 2IYVA 4PANA 2PMDA 2GRJA 5GJVC 4KBFA 1A2KC 2F1JA 4TLCA 5DISB 2JEOA 4OHVA 2EQBA 2WKRA 1ZD8A 3RRNA 2FZ4A 4LJ7A 4D25A 1SXJC 1I2MA 1OYWA 3FFBA 2F43A 5J5CA 5CB8A 2A2ZA 2AL7A 4N3NA 2O8BB 3BXZA 1XTIA 2TMKA 4EFLA 2QM7A 5FL7A 3EZ2A 1EFHA 4JS0A 4QKQA 1U94A 5F98A 2NG1A 3KKMA 4V0NA 4Z1MD 3QKUA 2I1VB 3ZVNA 1XTQA 4DLUA 4FMCF 5FL7D 4C0QC 3ZD6A 2WBLC 5LB4A 2G1JA 4A8JB 2CHQA 5IHPA 1RRCA 4GL2A 5EE1A 2IYUA 4M21A 5L3RA 1UF9A 5KSOA 2HYIC 2ZJOA 3KQLA 2P2LA 4MRVA 3SEAA 1CS4C 1FQKA 1W4CA 3EXAA 4OQMA 1LF5A 1UKYA 2JLUA 2A5JA 4Q9KA 3TAHA 4Q02A 1VHLA 2F1HA 3P27A 4F4CA 3D8BA 3I4LA 4C2TA 4EQ6B 4LZZA 2EYQA 4PQYA 3AEZA 2CXXA 1UEIA 2NO9A 2ZAMA 1G1MA 1Z07A 4P3YA 2Q0HA 2WJIA 1DADA 5FUYA 3X1WA 2CL6X 4BEJA 3QBVA 4DLYA 1IAQA 3PXGA 3K09A 3R9IA 3UWKA 2WHXA 4RVCA 4N0DA 2VO1A 4Q4LA 4EIWA 3PJRA 4R71A 3L0IB 1JXMA 2WAYA 2C9YA 1KO5A 4BFXA 1DAKA 2AR7A 2XJ9A 4IXMA 1ESMA 3A8TA 1I4LD 1U9IC 1Z83A 1GAJA 3H2YA 4KFSA 1LTQA 4OYHA 1BO6A 2GEDA 5HZHA 1J7KA 2QRNA 1XXHA 3QY0A 1D5CA 1ZUHA 2ZRHA 4NCJA 1NL3A 2VP5A 4X8MA 4NHOA 2ZVQX 5TXGA 4A36A 3KFVA 3EIQA 3TR5A 1KI2A 3ADCA 3QG1A 5LDDC 3IUYA 4N1AA 4A4DA 1Q0UA 4CEJA 3DOEA 4NBSA 4Q1AA 1R5BA 5AR1A 1JNYA 1Q1BA 1PZNA 2AD5A 4NYMR 2JDIA 1FMJA 5AJXA 1FOEB 3E1SA 3K9GA 4BLSA 4Q4HB 3CZQA 1YHNA 4FCVA 5TMPA 3QSYA 4Q19A 4QGHA 2RKOA 3A4MA 1LY1A 3IILA 3IPXA 3JVVA 3EARA 2Q3HA 4Q1FA 2IYTA 3IO3A 3UMRA 2IT1A 3DOFA 2HJGA 4RZ2A 3U3MA 3KL4A 2B7BA 1OPXA 4HUQB 1KI4A 2GJ9A 3W9YA 1KI7A 1AGRA 3ZS9A 3P4YA 4S2EA 4TQUS 1E32A 4GP6A 4QGGA 4XOIA 5DE3A 3VKWA 2AK2A 3O8CA 1GL9B 2C78A 2ATXA 2QQ0A 1G6HA 3OF5A 1NBME 1SULA 2IYWA 1OF1A 3CO5A 3MGCA 3L0OA 2IA5A 1KSHA 4MGYR 1YZGA 2AKYA 3AV0B 1EFCA 1N6NA 2PZEA 1UADA 4PQFA 1XTJA 3ZVMA 4MDEA 3OAAD 1CJUC 3OIVA 4OI1A 1GNRA 2D62A 2QAGC 2HF9A 4LI0A 4TL9A 2VPPA 3EA0A 1AZTA 1HE1C 1DE0A 2BMEA 4NU0A 3U44B 1OT3A 3GPLA 3U6KA 1FP7A 1IXRC 3K8YA 5TARA 4DLZA 2GDJA 2ZI4A 3PFIA 3ZD7A 2FZLA 3VKGA 4BFWA 1W4AA 4CVNA 3MWJA 5EZ6B 4KFTA 3DDCA 5KUTA 3BK7A 4BFUA 4UXHA 3U5ZB 2HCJB 3B13B 2G9NA 1AN0A 1ZVQA 2F1IA 1GOTA 1R8SA 3THWA 5EE5B 3Q3JB 1S1CA 1XP8A 2GZAA 1CR1A 1LVGA 1WCV1 4EUNA 1SVOA 1JBKA 2AN9A 1XD2B 3EW9A 1DAIA 4JKYA 1MT0A 4FD2A 2OG2A 4UJ5A 3S1AB 2W0SA 2ZROA 3CONA 4BASA 2FG5A 4F4JA 3N70A 1MABA 3TK1A 1T3LA 3I3SR 3FHCB 2B8WA 1Q3TA 4B74A 3Q7QA 3GEHA 1ZC4A 3Q5EA 2GHIA 3ASZA 5FPSA 5JCPA 1GG2A 4UNPA 3Q85A 2XZLA 1NIJA 3P1JA 4MUAA 3SOPA 4KYIB 2W2TA 1DG1G 1SGWA 2ZSBA 4OHXA 4Q7KA 3B60A 2R9VA 2RCNA 4HI0E 3LWNA 3N2EA 1R8QA 2C96A 3MSXA 3CLVA 4B3GA 3GJ4A 3WBKA 2OCAA 4DLRA 1ZM7A 4HATA 3CNLA 4UKDA 3LV8A 4ZI2A 4OL0A 4GOJA 5FPHA 4BFZA 3T1TA 5L3VA 3E2IA 5KNCA 3LX8A 3RNLA 5J4HA 3PV0A 4ARZB 4E5UA 4NCIA 3BH7A 4FMCB 1E2EA 3AVUA 1G7CA 4WBSA 4Q00A 2PT7A
chains in the Genus database with same CATH superfamily
4CIDA 1ORRA 2ZR7A 5CH8A 1C8BA 1W0JA 4FGWA 4O5AA 2ZITA 2XBMA 5EVCA 4R1NA 3IP6A 2M6KA 2HWYA 4DZZA 4R98A 4MW7A 1IM5A 1NZJA 2WJAA 5CYPA 1G5FA 2XCSB 3WL8A 3W5HA 4RS3A 1FMFA 5HKOA 1DKOA 2RJ3A 4KQGA 3SYRA 3UKDA 2Y1CA 1OR8A 1CUEA 1LRJA 2V1XA 1D6JA 3ESAA 4C88A 3X1XA 3GP8A 3DVAA 3AR8A 2D06A 2NTVA 4RD6A 1VL0A 2CWDA 3IVCA 4LOJA 3KTAA 4CCYA 4CEHA 1L1RA 2ZXFA 3LT1A 4CMEC 4GR5A 4YJGA 4ES6A 4ZHSA 4AY4A 1VSBA 5GTDA 2JLBA 3S4YA 4CLOB 1FP4A 4WQMA 4PSCA 3UYLA 2WNSA 1KQPA 3GPDG 3HVKA 3O4JA 2AR0A 3P4UA 3FM9A 4FT2A 4NJEB 4DIBA 5JS1A 4PZLA 1BKYA 5DVZA 1NBMD 5AHWA 5EWJA 3SY8A 4Q34A 4JBXA 5HDBB 4D4IA 4R01A 1QFZA 3BMOA 5EQTA 3GO4A 4WDQA 5HK8A 3MJDA 1KKMA 2FZEA 4JGIA 4PFJA 2C4TA 3JRNA 1A8HA 5JPIA 4IAOA 5FF9A 1KO7A 5KYTA 4HDSB 2DU8A 5KMGB 3COYA 1VE1A 1J4AA 4GNKA 4BV9A 1CS0A 3EYWA 3OT5A 5IDXA 4YUZA 2HRQA 3VOBA 1PW5A 3FPBA 4M8NE 4B75A 1AHHA 3X1ZA 2ZXEA 3WNBA 2QMEA 5A62A 4J7CA 4URVR 1E3EA 4ZVPA 2Q1TA 5F9MA 3EGDB 3AUXA 3EXG1 5CD9A 1SQ6A 4TS3A 1J22A 3DZ8A 3EISA 4FYJA 3VPAA 1APBA 4ZZ1A 2BGKA 2REQB 1GZVA 2IS6A 3MINA 4RAOA 4A9AA 1ZVKA 1T3ZA 2VDQB 4Q3BA 5CEFA 4ZA2A 5JYEA 4QTUB 3NLLA 4M9RA 2FQQA 4S1WA 4MVJI 4DY4A 1HNZB 2ZT6A 5C5IA 4OCZA 1JDUA 2F00A 3JQPA 3TZCA 1RRPA 5FLKA 5HCUA 1OX5A 3TFQA 4A82A 3KJFA 1JDPA 4XASA 1LZLA 3KCNA 5IKPA 1NXSA 1Q95A 4GOMD 3SJZA 1XRSB 3ZPXA 4CR7A 2OMKA 4X24A 2OV4A 1LJ8A 3KAJA 1CEQA 2XWJI 1WD5A 2UZ3A 3FNIA 4N7JA 4KSBA 1NTOA 1L4EA 1FP4B 1NVXQ 4W1QA 5BMVB 4RZHA 5AM0A 3R74A 1XKTA 4UW9A 2DULA 1T24A 4RK0A 2WRZA 4V0OA 1JEJA 2JANA 4XSHA 5K0SA 1VSUA 4IM7A 4IY1A 4PPGA 3BXXA 1JWLA 1C0IA 3EK2A 3VU3A 1IFXA 5FKJA 1NG9A 3CMCO 3IHWA 2J3QA 3A6PC 4XJXA 1M6VB 2N42A 2P6OA 1GTZA 2QU7A 1WDTA 2X8JB 1DV2A 3GUUA 3O3MB 1BCSB 1U8YA 4G56A 5FL3A 5HEKA 5KNLA 3LX5A 4H60A 2YWJA 5HG0A 2P5YA 3HDVA 5LR6A 1VI5A 4A6XA 1BKDR 2OHHA 5DULA 3SF8B 3UBMA 4HUQA 2DUMA 2H1RA 2ETXA 3M1YA 1BXRB 4M4SA 5HFNA 1DBWA 3REQA 3CLSC 4QBFA 2PX3A 2NV2B 2N9UA 1PDWA 4L15A 5FUQA 4EHAA 1B8VA 3ANXA 5KTMA 5CTAA 1JFRA 2X41A 1H5QA 2LCIA 3GJ7A 5DHRA 4M60A 1UC8A 3C7AA 4NCAA 4C3ZA 3GMDA 2XOKA 4KAJA 3F3MA 3P5SA 4B6OA 1P7VA 3OFVA 3G1TA 1O6GA 4Q9LA 3VR5H 1FEZA 2ZIFA 1UP6A 2GXQA 2P6MA 3JU3A 3NVAA 3GJXC 3TQSA 4CQLB 5FNZA 4ANFA 5A4JA 1DXYA 3CJRA 1NP3A 1XU7A 1FVOA 1WZEA 2ZR0A 1EGAA 1U8EA 3AU8A 2EX4A 3W8NA 4JT8A 3U7JA 1PLKA 3USZA 3WDLA 1YI0A 2IXDA 2VATA 1GNLA 2QF7A 4G89A 2HTEA 1E6EA 4JR2A 1QYRA 3RVSA 4DWOA 3GV0A 1V43A 3P71T 4CV1A 1TKRA 4OLAA 1HGXA 2W2VA 4CFYA 2HBYA 4M8IA 5CDHA 1QRUA 1W76A 3R41A 2IC5A 3KKNA 3ROXA 2JAPA 1F2VA 4RW0A 2ZYRA 4C4ZA 3A04A 2FZGA 1O6CA 3KDSE 3O84A 4TMWA 4C7BA 5J5AA 3BHJA 1YS4A 2GHQA 4RYDA 1MO2A 2H5LA 2FX2A 1ECFA 1G3MA 3FHJA 4CUKA 3QK7A 2ZLBA 3K72B 1SOUA 1VPTA 2D13A 3AIMA 5EP2A 5A0FA 3VC1A 4TTPA 1JDTA 5IM5A 4QYIA 3N2IA 2NZUG 1G5TA 1N1EA 5DM4A 1BS9A 4LVNA 1JPVA 2G0TA 4UXIA 4A2PA 3AU9A 3T54A 1P91A 2WP0A 3ZU5A 4W5NA 1OU0A 3AR4A 2B5VA 4Y1FA 1Y6FA 4PINA 1Y3HA 2G9UA 1YT5A 2YIJA 4DIKA 4WLOA 3KXKA 5KJCA 1IHYA 3Q8MA 3ZCSA 1R4MA 1YVEI 2B8TA 4HDNA 1VHWA 2OK8A 1YBVA 2WFMA 3AUYA 4HHEA 5F7OA 4X6YA 2EVWX 4FFWA 4HSGA 2WG0A 2XE7A 1NF9A 5GV7A 4EO7A 1KS9A 3OX4A 4YQZA 3D7KA 3HA3A 5EIOA 3F78A 3IALA 2G8LA 4X1OA 2DUNA 5YASA 3TS1A 2ATEA 1RXCA 2HQBA 4EEKA 5AM2A 3ETDA 3WWEA 1JH9A 1YL5A 2GPWA 4G4SO 4MV1A 1E9AA 3H5RA 3MA0A 3N6XA 3R0JA 4UPEA 3WA6A 3U7GA 2EHDA 4HBGA 4B73A 1CT9A 1THTA 1KORA 3HEBA 3BE4A 5CVJA 5CLIA 4FEAA 3RREA 4BEWA 5CR9A 2H5IA 4XQ0A 5DYIA 2Y9MB 1PKXA 3HMKA 3ASYA 3ZWOA 3TZEA 1N5KA 3UT5B 2AZ4A 2CFTA 3DZDA 3PNSA 2WJ3A 3E22B 3EUWA 4HDKB 4KUEA 3SKXA 4ENVA 1VKNA 1DKMA 4O2AA 4JI5B 3RU9A 5CA0B 4MINA 1F2DA 4EL0A 2W5UA 1H8HD 1U3VA 2AN3A 2ISCA 1MEJA 4I1OA 1XTSA 1USWA 1XC7A 3BGOS 1PV4A 3A14A 4GSYA 3KYIB 1CNEA 4G8JA 4IIVA 3ULKA 2W2MA 4DGQA 3BF7A 5BN4A 2JA2A 4KKXB 3K92A 2O8DA 4LHWA 4E7OA 1VCMA 5KI6A 3ELUA 3FHTA 1ZA1A 2IYSA 3G2QA 5FIUA 4QWWA 1YVUA 4L07A 1L5WA 4L8VA 2IHBA 4DJTA 1W5SA 3IO5A 4LFBB 4EY6A 2PWPA 3IEUA 1V1MA 2GYVA 5EMJA 2GKGA 2P2DA 1NI5A 3ZH9B 1YCHA 1RWXA 5TV2A 5AESA 4BNMA 2EFGA 2D2VA 1VLLA 3RVLA 5D85A 1L4LA 1C7FA 4PLYA 4ZZ0A 2C20A 2VF4X 2H18A 2D1SA 1ZRHA 3PD7A 3C3PA 1FDOA 2I78A 1PCXA 2QV0A 4Z9BA 1JR3E 1ML3A 2PMKA 2ZEJA 2OZLB 2PZMA 3B7PA 3CRQA 3EMDA 1ZYUA 1JH8A 3B1KA 3OPNA 3IEKA 4JXKA 3DBIA 4J03A 4KN8A 5TVKA 2IWRA 1RYZA 3CBGA 3STHA 3GPCA 4BVJA 1GKYA 3NZEA 3OWOA 1Q1QA 1WMSA 2OD2A 1L5HB 1GL3A 2AC4A 2G82A 5J2TB 2XH8A 3DFIA 2VSXA 4RHEA 1P72A 1M67A 2JIRA 2X8AA 3JAKA 2O5EA 1O96A 1VE7A 1SIUA 4KZPA 5K0TA 5MGNA 3IJRA 3WYEA 2OZKA 2ZWIA 1U5CA 2J9FA 3THYB 1UJMA 1ZIPA 4QBTA 1J24A 1T9HA 4R5MA 4RWZA 4UHFA 2E4YA 3WV4A 4BP3A 2OC4A 3O4FA 1J23A 2WKWA 3IHTA 4O1IA 2X14A 5GGXA 3T9FA 1OH5A 4DAEA 1TLLA 1A0OA 4IDHA 2Z6VA 4Q93A 4W5JA 5FR2A 4C5CA 1BE1A 3QJGA 1NPYA 1W30A 4TYYA 2FWIA 4FR5A 1DJOA 1GTSA 3ZTTA 2I6XA 3FJOA 4UCFA 2GSWA 2YWBA 2VYCA 5ER6A 2P79A 1GUFA 1PT5A 1E1MA 1C9KA 3I9KA 2E9SA 4CIVA 5TGZA 3LCRA 3DM5A 2OQVA 1J99A 5K8VA 3OWXA 1YUBA 1IK4A 1NXXA 1JWAB 1OI3A 5B7NA 2HJHA 1P74A 3CUSA 2NZJA 4QQFA 3TQRA 4CG2A 5A9SA 1TK2A 3IQXA 1Z8NA 2JKYA 4DCGA 2SICE 2YW9A 4KE8A 3QIVA 1ZD3A 3KYDB 1FX1A 1FYVA 3DE0X 4WIAA 4YALA 2FFQA 3CEJA 4AD8A 4F8JA 3U39A 1FJHA 1ZXLA 1G59A 1R64A 2VRNA 1GPJA 1PDOA 2WU1A 4JUFA 4KR7A 5EUCA 3WDSA 1WZCA 4D9GA 2Y1GA 3DR5A 1GQRA 2H59A 1R18A 4I50B 1SVMA 4IMPA 1ISJA 1YS9A 5IJ9B 1UPAA 5DBGA 3T5TA 2Q8QA 4WKNA 1XPOA 1YL6A 5AJYA 1A4RA 2V8BA 4YX9A 1AZLA 1YHZA 5B36A 2JKZA 4COOA 1CF4A 3LBAA 1L5GB 5ALDA 3DLIA 4XM2A 1KYXA 4HB0A 2X42A 4JT2A 1EH5A 2X77A 5TF4A 3X1JA 1XI2A 4RV4A 3GLIE 3LUDA 4RGBA 5ILGA 1XE3A 3N74A 2D7DA 3BWMA 1ADBA 3BULA 4O2LA 2JATA 4MCIA 3NQ41 1VKJA 2IS2A 4MRPA 5H3LA 1RLOA 2AG1A 4ABTA 2MMCA 1F7UA 5H83A 4JY7A 4ZVKA 1F7VA 1AD2A 2ARKA 1P0PA 4CG3A 1CDZA 2V7UA 3NHMA 4UTOA 4IGAA 2VPIA 3NTRA 4JBYA 3BHIA 4WLEA 2QQGA 1J0CA 3ADKA 3BDAA 2IP1A 4URZR 3ZVRA 5ERYA 4TYQA 2VLIA 1FCJA 1JILA 3TLAA 2FUNB 5THQA 4FCTA 3W5DA 3U4QB 4HDKA 4TTSA 3DLAA 3WLQA 4BAGA 3LS2A 4D4HA 1JAIA 3CV3A 4XARA 2GXSA 1DO8A 1GNSA 2ZIWB 4Y9SA 5JEEA 5HRUA 3T1VA 3OKCA 2VQFB 4Q47A 3V8EA 1T8PA 3VU9A 4HO1X 4AKIA 1ORHA 2C9OA 3LKDA 4EVSA 2GZDA 2PAAA 1XF9A 4P53A 2WSYB 1OKKD 3HZOA 3TX6A 4AS2A 3COVA 2CLHB 2FDXA 2Z8XA 1Q0ZA 3EEFA 4PSVA 4XZ3A 2XDQB 3VBEA 3WI7A 5LMUB 3C7KA 2QVZX 3T7AA 3EZ9A 2UZ4A 3JR3A 2NQ8A 3HJGA 5JH7F 1RXUA 5B58C 4JVLA 3A4IA 1TAQA 2GF0A 4E5YA 1X7YA 1CP3A 3N86A 3OU2A 4WX2B 4N5DA 3L4BC 5C0OE 4OJQA 2J0QA 3AKYA 3L2OB 4MS4A 3UMMA 1DU4A 4OQ4A 1JTEA 3WOVA 4B33A 3U4CA 1VZ2A 5JS8A 2UAGA 4U7DA 1OIXA 1QTRA 5B53A 3O47A 4RNDB 2ZB2A 5CPBA 3PEFA 2P9EA 4AN4A 2EZ9A 3SD7A 4KGDA 4B3IA 1ZMXA 1VLJA 2O05A 4HXYA 1G5IA 2V7QA 1I36A 2VSYA 3B6EA 5F4ZA 3NBYC 3ZDEA 4EARA 5FBZA 5BWNA 3N5CA 2R25B 4OQZA 1HDCA 2ZOSA 3AR7A 2H4HA 3LVQE 4MVJE 3TQCA 5FFNA 2IK8A 4YQEA 2OHJA 3WMGA 1BJRE 2ZSKA 4RKRA 3MOSA 2E5FA 2NZWA 1WIWA 1Q50A 1HR0B 3RIEA 1HOXA 1YQUA 1WABA 3OEED 2E4XA 3AEXA 3QKRA 1GTJ1 2NU9B 5KWIA 3FTEA 2XRFA 1I0ZA 2AC2A 1U2GA 1C30A 4UPDA 2ZS8A 3IPAA 1E98A 1R0XA 3H5VA 4Q05A 5JJCA 1A9QA 3MN1A 1E8NA 1K6JA 3D6JA 3VSEA 3VGJA 1AOXA 4AUEA 3EZFA 4J0EA 3WLPA 5B3JC 3ESQA 3M7IA 2EW1A 3W79A 3UOWA 1PR0A 4L7VA 5AOCA 2HTFA 2KWIA 3FZNA 2Z3ZA 3LP6A 1JA1A 2FP4A 4INAA 4MS1B 3HB9A 3MRXA 2V03A 1ZMBA 3CZAA 4EY8A 1ZAKA 1N4AA 1O57A 1JQKA 2BMJA 2TMYA 4X5OA 5EHQA 3UAZA 1PSDA 1TW2A 4UJ3A 1F4PA 3SNHA 3B7WA 2PSSA 3KZKA 3WGQA 1KYIA 3RJ9A 1FDRA 1F48A 1WSWA 1D03A 3COZA 4IDBA 5K8IA 4QJ5A 1A4IA 4NNJA 2XB8A 4GGPA 2PGJA 4NYJQ 2G6TA 4MYRA 5LMNB 4JLPA 1N2IA 1YR1A 2IXTA 3QY9A 5FOTA 1E6LA 3ZR4B 3C1TA 2IQ5A 1AKWA 3GQBA 4GGMX 1ZN7A 5B6PA 4EUSA 4CBVA 3P2MA 2XUIA 3A36A 1YB7A 2FFHA 1PDVA 1GGVA 4MUJA 1RAFA 3FVWA 3E1KA 1GKKA 3VTAA 3TDNA 2HIAA 2NACA 3WB9A 3VKFA 1B8OA 1ZCZA 1KFCB 3K0KA 5DCUA 1C4OA 4XQCA 3H87A 1KI3A 3ZHCA 2AFIE 2VA9A 4RU1A 2G1AA 3V8NA 4R05A 1Q7CA 4CDNA 4GXTA 4EUEA 1P1RA 1DTEA 2OV1A 3RTGA 1GJRA 1TQDA 3RWBA 5BUCA 1WXWA 1N36B 3CRW1 4LE1A 3NHPA 4PICA 2DWUA 5GM1A 3SEQA 1XWIA 5KYUB 3PD1A 4CFZA 2RC5A 3AHDA 4JXZA 2ZJYA 3ZHTA 2WW8A 5F2KA 1RC8A 4UTXA 1ZJZA 2V6JA 4U2BA 1KO8A 1PQWA 3LUKA 5A5EA 1KMHA 1PFGA 2UYQA 2RKWA 2JIOA 2CLEB 4DIOA 5BWOA 4RD3A 3GFFA 3D5TA 3VPDA 3F9RA 3FFXA 3RJMA 1AGPA 3KVYA 2HPVA 2BLLA 1EMDA 3FFTA 3ZDQA 2HK6A 2NYUA 4CGZA 2BFFA 2DFLA 3GQBB 4AP9A 2VYNA 1QHXA 1W4LA 2RGNC 5TR9A 721PA 5I47A 1YKFA 2DFNA 1SVSA 4WFKA 3TRHA 3VPSA 1HDOA 1TL7C 4I81A 1Q2UA 2A1TR 4P9NA 5DK6A 4YAKA 1MABB 2YC4C 3L01A 2EATA 4QL3A 3A1EA 5FNVB 2QT0A 2WTEA 4FGJA 2WJ6A 1RT9A 3MGGA 4R0VA 2AX3A 2BC9A 3D3JA 4P5EA 4URHA 3JRWA 4QASA 4EYQA 4YAWA 1N75A 5TS3A 3UJCA 3VC7A 4LE2A 3ZBPA 1C81A 1FFGA 1UKBA 1ESDA 1W94A 3DMFA 2C58A 4DZRA 5KNCD 5B1IA 4MROA 1C3EA 3T3IA 4B2IA 1Q7GA 3OECA 1WWKA 4IGKA 1HE4A 3WRYA 2KE5A 5KSPA 2G5CA 2A0UA 2ODBA 3BJIC 4IMJB 4N3AA 3J7TA 5ALKA 3DLHA 4C01A 1CQXA 3UPUA 1BDHA 4B4WA 3BXPA 4DIUA 1J2EA 4B46A 4A2CA 1G21B 5L7YA 1VCIA 1V8DA 3E6AA 3S8YA 3MS4A 5DP2A 3T3HA 3KQTA 4C07A 3TO5A 4D56A 2BUBA 4LWZA 2G70A 2DY1A 4FSDA 2RH9B 2PJDA 2Q46A 3CLKA 3DT6A 3OBIA 3ILXA 4K3UA 4WCVA 4POOA 3EQZA 1G8PA 2VHZA 2X2FA 1WKBA 4I8DA 3TW4A 1R8JA 3F6BX 3MWGA 3PE4A 3NDIA 3HM9A 2Z2ZA 2DH5A 3KJQA 4QUBA 4F6CA 2DKOA 2VEDA 3H5TA 5AUNB 5L3SB 3ZW9A 3HP4A 3PG5A 1PL8A 4NARA 1H4VB 1UQRA 3HEAA 2GN9A 3I9LA 2WG1A 4NJMA 3PX7A 2P3QA 3FOBA 4EJ6A 3AK4A 3LQQA 4N0EA 4DR2B 2IZ5A 3Q3EA 4TWJA 2NIPA 1XTRA 5ALYA 4D44A 2IE0A 4JNCA 1KFEB 1LRLA 3EDQA 4I2NA 2QWXA 5JWOA 1GUZA 3GLFE 3LXXA 5EERA 3S7TA 2QUKA 4W5TA 2HNKA 4I50F 2E6KA 4YPVA 3RS3A 5JROA 3FPHA 3UV7A 2QW0X 3A58B 4QSMA 3C8DA 1MQSA 3TRKA 4D43A 3M4JA 4F9GA 4RD4A 2YJGA 1AXGA 2GNAA 2QL6A 3GMSA 3OQBA 3NAZA 4YFVA 3QFTA 1DAEA 3CLTD 2VBGA 5BUSA 1NW9B 1R4AA 1X9IA 5IFLA 5LXTF 2QJFA 3LVRE 3ZK7A 2QX6A 5HS6A 1PJCA 5GONB 1P18A 2GARA 1ODLA 3DC2A 1W73A 1Z22A 2Q8PA 1YRQA 3EXHA 5BSTA 3UK6A 1UFQA 3W7AA 2R8EA 4KE6A 2GJSA 3NCHA 1G19A 1YJ8A 5AXBA 4RHYA 2CXPA 5AOVA 4C6TB 4D7AA 4IFIA 4D02A 4ZYYA 3UGJA 1QTQA 3LOQA 3Q8WA 3HXTA 2QBYB 1FBTA 4BTEA 4EHJA 1RRVA 4NFYA 1HYBA 3JPYA 4TQAA 3IB3A 4NR0A 1EWRA 1YHYA 1U8XX 4LI3X 3U7FB 1CZHA 1MX3A 2D1FA 2WUFA 5BNTA 4L5CA 1L9KA 2A9KA 4MUBA 4D26A 2WA1A 1L7OA 3P9XA 2A4MA 1D6NA 2CD9A 3K2QA 4ZO6A 5SY4A 5I48A 2ZBFA 3VR4D 4GPEA 4CNBA 4TWAA 3H6GA 4RZXA 2OBFA 2BKEA 3H1EA 5FHQA 3T5GA 2BGMA 3CUKA 3VR6A 5A9SB 5IT4A 2C04A 4MQBA 2XCIA 2UVPB 5I7VA 2IODA 1U11A 2IP4A 5K8JB 3ZC3A 1P1BA 3L07A 5FAXA 3PUWA 1E1CB 4Q3EA 1JLLA 3ZWWA 2JCGA 1MW9X 2E4UA 2GBFA 1FK8A 3AL2A 4Q4HA 4QEKA 2A3RA 4RZUA 5CBPA 3G5AA 3ZVLA 2GN2A 1VSQA 4HLUC 2B25A 5JBQA 1IDN1 3GLTA 1U4OA 1VI6A 4NMWA 4EHBA 5C8YB 2YC2C 1QLWA 4U7WA 4KB5A 1LLCA 1WQ4A 1JTVA 1XTZA 1RYYA 3ZCUA 1J2YA 2E4VA 3FVTA 5KDDA 4R1UA 4O2AF 5LC1A 3EEIA 2EJCA 4IINA 1N5OX 1BU5A 5C8VA 2W42A 3A9UA 6ABPA 3NTQA 1Q2XA 5E9QA 1P5HA 4Z1MA 4Z7OB 2XQKA 3MTGA 3PXAA 1RFLA 2OSBA 3RAGA 4GLJA 1KFKB 1FBNA 2JGKA 1VCHA 3COWA 3KK0A 4FYHA 4F96A 5LIRA 3V4RA 3H9JA 1ZVVA 1PU2A 3NR2A 2PUHA 1DAHA 4OIFA 2H17A 3JD2A 4J76A 4LZNA 4ZOLA 2ZRDA 1A4UA 4MULA 1T6ZA 1I4WA 2PZKA 1DEHA 4O4IB 4Q12A 2EZTA 4V03A 3ZV6A 4G36A 4GNRA 5C5CA 4K8RB 4WCFA 5AVWA 2CV0A 2EBFX 2J33A 5FEUA 3ZWXA 7ABPA 3TRIA 3LRTA 2I8AA 4FMPA 5TS2A 1JIKA 1XDGA 2QVLA 1ZDMA 5HIJA 3FSJX 4HNSA 4ZVSA 4JLKA 4EQ6A 2JAQA 1QSGA 3DMNA 2WSBA 1DOAA 5ALZA 3M6IA 1N8NA 1WV0A 5CLFA 3D7SA 3GEDA 4BGIA 5KU7A 1NXPA 2ZG6A 3NHKA 4N0QA 4ENPA 4F21A 4DSAA 5A4FS 1SB9A 5DGTA 3MS7A 1K6MA 2DH6A 3ELWA 1JPNA 3LNCA 1G7TA 1SG6A 3O8OA 2NU6A 4IICA 2I2WA 3BJRA 4H16A 1COWA 3BTUA 1OB2A 4EA6A 3WGUA 4JI7B 2XUFA 3MUNA 4C2UA 3IIEA 4PYKA 1RXEA 3EB9A 5EEHA 5LZ7A 1RZRD 3MTDA 1B0UA 2AW3A 1E6MA 1GN8A 4HUTA 4FFBA 1MZPA 3E22A 2YWFA 1LLDA 1V1JA 3H16A 4QO8A 3VHLB 3WGKA 4EG8A 2I2BA 3JQDA 3V7WA 5EI5A 5K0GA 1TJ3A 4DMRA 4DC1A 1GL6A 2PBRA 4IDOA 2HRCA 1UJCA 4FE4A 3G1UA 4JLMA 3HYTA 3W3AA 4NATA 1X1RA 2P7IA 3RV3A 3K5HA 4DFDA 2A4KA 4DSOA 1RXVA 3TL2A 4KLZA 3Q41A 5JXHA 2ANBA 5CA1A 5DU2A 1SK8A 3W6ZA 221PA 1N5LA 3R6WA 2R65A 1EB8A 4B2PA 2WLTA 1UK9A 1WOYA 1UC9A 2MR6A 4WRRA 1IBCA 4R2JA 2J1LA 1UXIA 1ZP6A 2PU7A 2IY7A 3G2NA 2J59A 4J4TA 2W8ZA 2LKDA 3RS4A 3GLIA 5LYJA 3DBRB 1MO4A 3I8SA 3L0YA 4LW8A 5BSHA 5C32A 2J3DA 1SXJD 3E5MA 2GD0A 3ZNNA 2VYFA 4NL4H 3IPYA 3MCUA 2AI1A 1TQ4A 2R1VB 4WH0A 2K4MA 4IMRA 2HMVA 4DSUA 1JLRA 1TFUA 2HMTA 3NCTA 3T3GA 1BDIA 3ZE7A 6PFKA 3FOCA 5PNTA 1WPGA 4KQJA 2X23A 4MB2A 4KCGA 2I99A 2RAPA 2ZIGA 9ATCA 3IQGX 1E62A 4AZSA 2G80A 1J2JA 1ZLYA 2FPGB 3OAAA 1G98A 1IB6A 2JFQA 2VHCA 3HVIA 3QF7A 4KAXA 4X7BA 3M49A 2X0DA 3SR0A 3ZXYA 4TLMB 4D9MA 4LC0A 5B6JA 1HM5A 3IAUA 3M3HA 2SNIE 2IU3A 2REXB 3KT8A 4HNHA 5GZ1A 3CO0S 1I30A 1I5RA 1YZKA 4HEA1 3VAYA 1E3LA 3L4EA 4EY4A 1MJFA 2YFQA 4FP9A 3W0LB 4YMIA 4MW9A 2GLXA 5ENZA 4OQDA 5FQOA 5B4UA 1QKJA 1MAHA 1UMDB 1R37A 1AUQA 3BXHA 2XA9A 3ITDA 4I5EA 3EMKA 4PAOA 2H63A 2ID9A 3I72A 4K87A 3AIIA 3UICA 3ZLTA 1PTJA 1KARA 2Q3JA 4PRYA 5EPUA 1T5OA 4IVRA 3G85A 4AQDA 1D1QA 1RP1A 3D59A 4GPAA 2QPTA 1T8WA 4XUEA 4BWYA 5ES3A 2POCA 1I4EB 2I7VA 4TVKA 2Y0BA 3HL0A 1QS0B 3A4TA 4AF6A 4OP2A 1AURA 3IVXA 5AW8A 9ABPA 5F52A 2NYRA 4ZYTA 3QLVA 2A67A 3B8HA 3KSDO 5KHLB 4OIMA 1WZUA 3E2MA 1F2TB 2ZQYA 4M1QA 1G2IA 2CC2A 1AMOA 4DIFA 1DCTA 5FTLA 2GWRA 3Q4GA 1OTXA 2EBUA 1JHQA 3CX6A 4M0FA 1CR6A 4JI1B 2KMLA 1Y9DA 3V5NA 1O97D 2JI4A 2EJBA 3FG9A 4IUCS 5HKKD 1ZK2A 4YUAA 4P80A 2G1KA 4N5IX 4LY0A 3EBOA 3KQOA 4HS9A 4PZCA 2YJNA 2JFBA 3RTBA 1CJTC 1MLDA 1KOGA 1B26A 3WLAA 2ORWA 2Y2VA 1UPCA 4MZXA 4XGIA 1IATA 1RR6A 1ZNQO 1ZVMA 5EL0A 1BEEA 4E2WA 3ORQA 2V1UA 4FFLA 2QTTA 3TWOA 4QARA 5FB3A 1RZUA 3HR4A 5KINB 4PYIA 1ZESA 2XZTA 2IUSA 2FPRA 2IITA 1IOWA 4UATA 2H7VA 2Z3VA 3CH7A 1XLTA 1JP7A 2PGAA 4YROA 2EU8A 3PUVA 4G07A 4N3GA 2JCXA 2W93A 4EGQA 4A1OA 5M7EA 2J0SA 3S81A 3LTEA 4Q4DA 4MRMA 2WF6A 3LXUX 1YDGA 4LWOA 4M1YA 4YEDA 2BMFA 2QE7D 1T10A 4O2BF 4I4TB 2EBWA 4PO9A 4RXTA 4LPKA 5DBEX 3GUHA 3JQ7A 5DYNA 4F85A 2ZWAA 1TKCA 3DZFA 5AOAA 2I7TA 4KC0A 1VBNA 1R3DA 5DWQA 4BMYA 4BVKA 2GESA 4MLCA 1DARA 1XZIA 3CM0A 3OI7A 5CD1A 4HB4A 2QD1A 1U0OC 1SVWA 1XQXA 3SF8A 3TJZA 2X8WA 3BD8A 3RGWS 3SX0A 1DT5A 1M6WA 4NENB 4ND1A 1G66A 2HA3A 4MRSA 5P8WA 2OAQ1 1BH2A 4JVMA 5FORA 3PNVA 4D82A 1HMPA 3CEAA 5HQJA 3Q12A 4CCSA 1UDXA 3P9RA 2BM0A 4HH3C 1L6IA 5KC9A 3KU1A 5KCMA 1GLVA 1N3IA 1WHTB 2R48A 4N6GA 4Z4FA 1VKOA 2Q2NA 3QYJA 4KAFA 1L7EA 2PYZA 2VFAA 3A6EA 1WLSA 3AB3A 5J2TF 1Y9JA 2YFKA 3AFHA 4RIIA 3RRXA 1J8YF 5LQSA 8ADHA 4BGDA 3DR3A 4PS0A 1A8QA 4AZ3A 4GKBA 4J2HA 3GLHB 4GWKA 1L4YA 2DOKA 1AHNA 3O38A 2FRVA 5C34B 1XYGA 4P4SA 1X0VA 1NM5A 1BVHA 3QQ5A 1XEWX 5HJ5A 2R8RA 1Z5GA 1YASA 2CLKB 5DTRA 1R6TA 5FLEX 5DM70 3OQIB 2GTHA 3QSGA 3P20A 4TTIA 4Z5XA 4BTVA 2TMDA 3JYQA 5EHXA 2E7ZA 2Z1MA 2BZ0A 2BUAA 4UHEA 1UBKS 4XOUA 2G83A 4OA5A 3CH5A 3VJMA 2G63A 4ERXA 2F3SA 4IX9A 1C1XB 1HMYA 4S04A 3KPYA 1SIOA 1ABBA 1Y98A 2J3HA 3N2GA 1DQRA 2WABA 4U2GA 2HEIA 2OTCA 3OM8A 4GOLD 4MIOA 2P9GA 1F8XA 1LS1A 5FNVA 4MGKR 1RQNA 1NHWA 1RC0A 1I3OA 3D3WB 1V1RB 4QUDA 2HK7A 4NV0A 4XAQA 4EMUA 4RTNA 4L3VA 1QP0A 2BMDA 2C4NA 3OOHA 1ZU4A 3ZJUA 1LFDB 3JVIA 2YHIA 2B9EA 3G5MA 1ZD4A 2JIZA 3M6LA 2TRSB 4KR2A 2AFHA 3LT4A 4RD2A 4RFSA 4U6SA 1TM5E 1JKFA 2B98A 2WE8A 4HNUA 3NI2A 5AW7A 1T5TA 4URWR 5FPQA 2PX6A 3VPCA 2F3RA 2CNNA 1FTNA 1VPEA 3RIXA 5CT9A 2E1RA 5FLXA 1JEYA 2RHOA 4XFDA 3IV9A 2JFOA 2Y9PB 1E0SA 4CMAA 2K7ZA 3L0DA 4US2R 4NOKA 1O77A 2WJVA 2YY7A 1VHQA 1OXVA 3AFOA 4CUZA 1D8AA 1SCQA 2XMSA 1LEHA 1U5AA 3WMFA 2XIJA 4HTAA 2EFHB 3THSA 3RSHA 2FP4B 1O58A 2J5BA 1JNXX 2C98A 3TNJA 1MB0A 1PFYA 5FBHA 5LPNA 4U2DA 3REFA 4XUCA 1ZISA 3HJAA 1V7ZA 3IESA 3E5HA 2VIIA 3S29A 4WBNF 4NE2A 3SM3A 4BDTA 3QENA 1Y80A 2QGNA 2HBZA 2WZDA 4QDXA 5LMZA 2CL0X 4U7GA 3WYBA 1DUSA 1E4EA 1BN6A 4LDJA 1UCFA 3K0FA 2C54A 5IMBA 1X1SA 5GVSA 1QPGA 2QSUA 1QP8A 1BXRA 2QYSA 3BBLA 3M34A 2FH5B 4OQPA 2BWJA 4AZ3B 2IP2A 3IP9A 1OFHA 2ETVA 2FMXA 5AVYA 1ZR4A 1WDWB 2ODQA 3B2QA 2FB9A 3DYBA 4G5HA 2BZGA 4ER3A 5I51A 5LNK6 4QVGA 4ZVNA 3RU2A 2IL1A 3AI7A 1FTQA 1JMKC 4Z51A 4OSEA 4UNRA 2J09A 2XB9A 4KO1S 2A57A 4PE5B 4IRUB 1MG0A 1XP5A 1FXUA 3HE3A 3HPRA 4TXHA 1U1DA 1OBHA 4FILA 4PPYA 4RKEA 4Y2HA 3NTVA 4J7UA 3UHAA 4CTJA 1N9ZA 1OZHA 4ZN6A 1P44A 1RQ2A 2GTIA 2ECPA 3HSKA 4EJSB 5FD8A 2FR8C 2XUOA 1GU7A 4EFDA 2ZE7A 4NP6A 1XALA 3UXHA 2YJTD 1PQ4A 2DBVO 5BV7A 4J4HA 4UM9D 5K6AC 4X91A 4BNGA 3PUJA 2MIIA 1JU9A 4RVSA 4URXR 4Q0MA 4DLSA 4CKCB 3CS3A 3C5CA 1UM9B 4IIBA 5TEVA 4CMGA 2GCOA 2WPDD 2QLTA 1RAGA 2BE9A 4FUTA 2ZBEA 4LHXA 1OJLA 4WESB 4XGKA 5AK4A 1T5IA 2RHWA 3X43A 1HO3A 1NR1A 4ZKDA 2H1VA 2GEVA 3ENNA 1HNNA 2FEKA 1XCJA 5KWEA 2V3CC 1KIFA 5I7UA 1S2DA 3PNKA 1MU0A 2OQ2A 4ZZ2A 5KB3A 1RAEA 1DFHA 4CM4B 5EKTA 5E6RB 3ROPA 1Q20A 5ARBA 1KRHA 4OAPA 5C18A 1M0EA 1R66A 3VU9B 1BNCA 1YFKA 3QKWA 1UINA 1U02A 3OMLA 4EI8A 2CXHA 3HCBA 4LXXA 1ANKA 1Y8CA 3EGCA 1ZICA 1N2ZA 4IIJB 1Q3KA 4IIDA 4MV8A 3KSBC 3M33A 4TMXA 4ZDKA 2CYCA 3ZOKA 5ICMA 2Z95A 1GPWB 5HPYB 5ES4B 1K3TA 4G5YA 1Z7YA 1G42A 2GFQA 5ALTA 5DX0A 1LVUA 4LISA 3KKEA 3WTCA 3C3EA 4BO6A 1F12A 3OQ1A 1KZ4A 3P0JA 4F5DA 3LI2A 1O6FA 4DLWA 1AKTA 3EYAA 3MYYA 1J7JA 5FYDA 1W8DA 3T06B 1Y9ZA 4I1VA 3V4PB 4PRZA 3LYLA 4PAGA 4F38A 3R9XB 3B78A 3G2MA 2FJUA 1AUPA 3DNMA 3I0NA 3MF4A 4IEIA 5EINA 3DSRA 4KQ6A 3S44A 5JDCC 4BZXA 3W06A 2FPIB 1KE1A 4CW7A 3NM4A 3A6DA 2GQ0A 2FQYA 3L0CA 3AO0B 3LQ1A 5E9JA 3QE9Y 2VDWA 1FJGB 1PR4A 1IEVA 1YZYA 5C31A 1A7JA 2O8NA 4A2QA 5L4LA 4QU0A 1XMXA 2GX6A 1NVKA 3GIDA 1U7XA 3K35A 5BR7A 2B4YA 5CDTA 4DUYB 2CXSA 2JCSA 3NAGA 3ZWDA 4GBJA 5JZ9A 4PAQA 5F76A 1W1WA 1XFAA 2OY0A 1UAYA 2P77A 2VHEA 3KO8A 3QVKA 4QHSA 2FMKA 3IR7A 4LFCB 1R9GA 3DGEC 2I6UA 3VNRA 1AM4D 4D8WA 3RC3A 4QLOA 3THXA 4MLZA 2HPAA 5DLEA 4WZBA 5E4YA 3HCEA 4H3KB 5ENDA 2XF2A 3SR3A 3H3JA 4DCCA 2G36A 3B89A 5I9BA 4AYXA 4G1FA 4GE3A 4CODB 3AB8A 1XVVA 2CFIA 4PBRA 4TWIA 5HSGA 4L4SA 4FW8A 2CFOA 2WV7A 5F5NA 1USIA 3UBTA 3BH0A 3QUCA 2GBPA 2W2NA 2W37A 5BN3A 2PRJA 4JYPA 5E7MA 5JNUA 3QKTA 4LF4B 2BGIA 4L02A 4LCJA 4NU8X 3KDPA 4ARZA 5EE0A 2OO3A 1B16A 1RWVA 3PC3A 4UAGA 3QI2A 4KVGA 2FW9A 2V97A 4UM8B 3GEMA 3FGPA 3OZVA 3W5JA 2C5EA 1AO3A 3IOBA 3NHUA 3NUQA 4MUEA 3TUJC 2VZLA 4RZ3A 4ZPJA 1ZINA 1Q92A 5KS2A 3H2ZA 3LDUA 2Y76A