2NO1A

C4s dck variant of dck in complex with d-dc+adp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
240
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords deoxycytidine kinase
total genus 96
structure length 240
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2no1A00
3PEYA 2H92A 2G83A 2WICA 3HU1A 4H1VA 4Q9HA 2FE4A 3L0OA 5AUNB 4O25A 5JS7A 3X2SA 2QG6A 3B78A 3GLHB 1KYIA 1Z3IX 2NZJA 2QMHA 2B6HA 3BWDD 3GJ8A 1MKYA 1OV4A 2VH5R 4KI0A 4D4LA 4DUGA 1EFRA 2IYZA 2DHRA 3DVLA 3K9GA 1CULC 4RKFA 2BMJA 1SULA 2X8AA 3K09A 5K8TA 3EC2A 5L3SA 1SGWA 5DIFA 2KE5A 3QSYA 4BPBA 3TK1A 1YZUA 1NN0A 3Q8XB 3B2EA 4TSFA 4ZI3A 2JJ2D 4Z1MA 3QBVA 1G5RA 4A9AA 5CJ2A 2CHQA 2AWNA 1XJ0A 1DG1G 2FPKA 2FEOA 4V0OA 1HEIA 4TZ6A 1G6OA 4F93B 2BCJQ 4ILEA 1IOZA 2CDNA 1LF0A 2ODBA 1VCIA 1N5IA 3U4QB 2CK3A 5JHHB 4F38A 1M8PA 2JJ1D 3NC0C 4D25A 1S96A 2JLQA 1QHGA 4PO8A 1MO4A 1E1QA 1SKYB 3KKNA 2G9NA 1G5TA 3B1XA 2REBA 3MUFA 4IXNA 5CIQA 1DAEA 4Q9IA 3ND9A 5DE3A 4JT4A 3X1YA 3C14C 3EPHA 4UNSA 3K9LA 4MGYR 3AP2A 821PA 3DMDA 3VAAA 5KSZA 4PAQA 1SXJC 2QNRA 3TGPA 2NPIA 2JLSA 4TL6A 3UG7A 2WMOB 4JLNA 3IDQA 4TLDA 4HB2A 3SEAA 2F7SA 5JWRA 1NKTA 1NL3A 2GEDA 1GRQA 3W5IA 2VBCA 5J47A 1R4AA 3MMPA 2CLDX 1RFLA 1NBMA 3KKPA 2IEYA 4KFUA 2QORA 2R6DA 4IOJA 4IDPA 1PZNA 3I8SA 3FB4A 4OHYA 3ONWA 3TR0A 4OJKA 2ODWA 4QG7A 4IFEA 2BEJA 2B21A 1E96A 2JDID 2HT1A 1YZLA 5FOTA 1P2UA 4D6PA 2PT7A 4E5UA 3TW8B 1Q3TA 5BN3A 2A9KA 2IYSA 4JLJA 4JL8A 3GCGA 1M2OB 1IAQA 3B1ZA 3P32A 4KO8A 3TW4A 4ASUA 1BYUA 3FFAA 3IIMA 1SVSA 2QPAA 4DCTA 5JWOA 2PMKA 5P21A 2MSDB 2BMFA 1CR4A 2FFAA 2JA1A 3U5ZB 2O5VA 1G3MA 1CJUC 4IDQA 4CT4B 1G17A 3PUWA 1CJTC 1XNJA 2XJ4A 1KI6A 3DDCA 2AFHE 5G53C 5TMPA 3PUYA 4DB2A 4Z8YA 1DO2A 3AGQA 1QF9A 1XMVA 4F4CA 4EQ6B 4GP7A 5HR5A 4JJZA 4YMUA 3TAHA 2ZRKA 2YYZA 2CEAA 1DAHA 2O0JA 2IK8A 3QE0A 3P27A 4DLYA 1IQPA 2J0VA 1M1YE 5GJCA 1NI3A 2RCNA 3GLGB 1UF9A 1AQYA 1LS6A 4WAUA 2IXGA 5EZ6B 1N3BA 4L5BA 1G18A 3S1AB 4KITB 3I5YA 2QP9X 1KAGA 3BFKA 1HE8B 2D2EA 2WWWA 3OIWA 3QG5A 4FMDB 1E98A 4HAUA 2ZR0A 3AV0B 3IHWA 5E7IA 5EE3A 1I2DA 2QM7A 3UK6A 2J87A 5J4VA 1OHHA 1WE2A 3KJGA 3KKMA 3NVAA 1OH8A 1E2NA 2IXFA 2I1QA 2QEQA 1E3MA 4ESVA 4TLAA 1QHNA 3TQCA 1Q44A 1E9AA 1E79D 1G8YA 3DM9B 2HF9A 5KTYA 5C4MA 2C03A 3GJ6A 1JB1A 4HLCA 4KVGA 4ZCIA 2V7QA 1KY3A 2YV5A 4D0NA 5JEEA 4I4LA 3AKCA 4XSHA 4G5SA 3EZ6A 1NSTA 3Q7QA 4TLBA 1OXVA 4TMWA 4DLUA 2OBLA 4U7DA 4YC7A 2F55A 3I1FA 1LS1A 4DLXA 2IS6A 3R9XA 4GP6A 1NKSA 1IJEA 2WJGA 4CVNA 2O8BB 4V0KA 4DLRA 1G3QA 2ANBA 3B5JA 3ZDQA 4QBIA 4IJMA 5DN6A 1KSHA 1UPTA 4EAQA 1U9IA 4FI3C 3WMEA 1ZU4A 3SJCA 4TL8A 2W2XA 3LQRA 3UWOA 4KLZA 1ZRHA 1TX4B 1D6JA 1N5LA 3ADDA 4JVNA 1U8ZA 4D82A 3I4LA 2IXEA 4OQXA 1ZUIA 1P73A 5E7JA 4B73A 1KI7A 1P61B 5KHOC 4GFDA 4JLDA 4YDHB 4BLQA 2OFXA 3UIEA 4AYWA 2P3SA 4QM7A 3OIYA 1NRJB 1Z6GA 4MKHA 3K0SA 3HWSA 4LJ9A 4ACAA 2QI9C 4G5QA 1RKBA 2PMDA 1GUAA 4IDHA 4WA7A 4F92B 1HTWA 2X77A 2RHMA 4H9GA 4PSAA 4V02A 4PPNA 4LDJA 4RD0A 5KNDA 3GLFA 1UADA 4E07A 5DYIA 3A4NA 1U94A 2P5SA 2EYQA 1AS2A 2FSFA 1Z5ZA 4OI4A 3I61A 3MD0A 1VYTA 3PR1A 4Q4AA 3UATA 3F5FA 2KI5A 1QVRA 4P32A 4OKSA 1FW6A 3R8CA 3SZRA 2QGNA 4B6FA 2WWGA 2QRZA 3OE7A 5M04A 1PLKA 2F1HA 4QGHA 3VHXA 2NGRA 3T06B 1BIFA 2FA9A 2XTMA 2VSXA 1BOFA 2WWHA 1NF3A 3O8BA 4FCVA 1G20E 3PQCA 4A0HA 1RRFA 1XJCA 4YMTA 3LDAA 1XPOA 3AKDA 1XX6A 4CEIB 4BECA 3OEHA 1A7JA 2KWIA 3LQQA 3I62A 1IY2A 3WYAA 1CKEA 2W58A 3SJAA 2X2FA 2ZS8A 4JT2A 1C9KA 3CRVA 5IT5A 4B76A 2REXB 2ZI3A 3SS8A 1L4UA 3O47A 5EP4A 1HYQA 1U90A 4HAYA 1AGPA 3CNLA 5DO9A 1XCPA 1S9HA 2OFWA 1N0WA 2C9YA 2ORIA 2QTHA 2ZSBA 4HZUA 1LY1A 2ZE7A 2QM8A 4A4DA 1HE1C 2OLJA 1KTVA 1J2JA 1YZGA 1Z63A 4F91B 1II8B 2PH1A 5EQTA 2BMEA 3K70C 5CM8B 1ZYUA 1NMZA 4XOIA 2OM2A 2Q6TA 4EIWA 3LVQE 1BO6A 4AIIA 1UM8A 1KAOA 5F2EA 4B3FX 1F2TA 3LVRE 3P4XA 1G9XA 1NLYA 1NP6A 1FUUA 4BFTA 1XZQA 3QXJA 4TYWA 4G0NA 1E32A 1KO1A 2EWVA 5C18A 5JECA 4DIEA 1GL7A 3A4MA 2C95A 3QKSB 4ZIRA 1XTQA 3RS2A 2A5JA 3NXSA 1EWRA 1KZGB 2OLKA 4HUTA 2XX3A 5ANRB 3THWA 4QM6A 3J81k 2WOJA 1EXMA 3PIRA 5CYOA 2OCBA 3PEUA 5KDOA 5HE8A 1CU1A 4MDFA 1PLJA 4NHOA 4ZDJA 2WIBA 5FBRB 1QRAA 1OKKD 2EQBA 3P1JA 1CR0A 1K6MA 2GZAA 3F3YA 3HPQA 3QKSA 4W5JA 1XDBA 3NC1C 4LJAA 3E1SA 4UNNA 5JJIA 1QHHA 2J1LA 2ASEA 4G01B 3QVUA 4B47A 2XXAB 4Q00A 3ZH9B 1OLOA 2RGXA 1ETUA 3SBEA 1N6KA 2ZRCA 1W1WA 1US8B 2ZJYA 2A3RA 1CIPA 1P62B 2XZPA 2Z5FA 3MFYA 4LV8B 1KJYA 3I72A 1L2TA 1XEWY 2RH5A 4IFBA 4NH0A 2F1IA 1W5SA 1IN8A 1UKZA 1QDEA 2WJVA 4DEXA 1LV7A 4RFSA 2JASA 1T8TA 2GKSA 5BW8A 2EFDB 2JLRA 1PUJA 1G7RA 1UFQA 1RZ3A 2DFNA 3H4MA 4AG5A 1W46A 2WVJA 4HUQA 3SHFA 2BKEA 4WW0A 1JAIA 1N6RA 1MV5A 2BJWA 2Z4SA 4HLUC 1R0YA 1DVRA 5DNYB 2SHKA 3GJXC 4I1VA 4OK5A 4BZXA 1E9RA 2GCOA 3CX8A 2W2TA 1R6BX 1L7VC 2QRNA 1G3RA 2J46A 4MH0R 5KSOA 1ODFA 4M9SA 1D8TA 3FTQA 5GJBA 1NN1A 2JLWA 2IX3A 2GJAA 1CP2A 4NYJQ 4EDHA 3P26A 3Q5EA 2N1BA 3THYB 4A6PA 1W36D 3KX2A 3AVTA 3AF2A 4M1KA 3PJRA 4LK2A 2IA5A 2IYYA 1E0AA 3LO5A 5SZIA 4JVSB 5FOSA 1ANKA 1HUQA 1A4RA 2Q9BA 2ZRDA 3TSWA 1AN0A 5GVSA 3PV0A 3BC1A 4YONB 1R0XA 5HCIA 2FJUA 1LTQA 4TQ9A 3HR8A 1KI1A 4FN5A 4Q4AB 4WOPA 5H70A 2CBZA 3GD7A 5AJYA 2ZVQX 2CE7A 3B1WA 3KJIA 3Q5DA 4LOAA 3RDPA 1DOAA 5B64A 4AI6A 1GRRA 1F48A 3GLFB 4MYHA 3WBJA 5TY0A 1MT0A 2FDCA 2V6JA 2V8OA 2G88A 5FUYA 5DHAA 2R62A 5TARA 1G291 3VFDA 2FG5A 2BEKA 2A5GA 1M7BA 1ZM2A 5C46F 2PX3A 4DEYA 1AZTA 2ZR9A 1UKYA 2WSSA 4GBMA 3U2QA 2VSFA 1WCV1 3T1TA 3NKVA 4JLOA 2C77A 3RS3A 1N2CE 1E6CA 4M1TA 2JJ1A 2AXPA 4BLTA 3RLFA 2H16A 1CEEA 1CRPA 5EP1A 1KDPA 2QAGC 3B8HA 2DCUA 4PX9A 4N0EA 2K5UA 5EZ5A 4A6XA 3FGNA 5EJEA 2NOAA 2GXUA 4OK6A 1U2RA 3EW9A 4LYHA 4JLVA 3THOA 1JI0A 1E2IA 4PZZA 4B75A 1QHHB 5EUMA 3PUVA 3QJYA 3IILA 4TL7A 4BWYA 5HZKA 1T91A 3OF5A 5GVRA 1ZD9A 2ZI5A 4P0TA 1FNNA 4Z54A 1X8LA 3HU3A 3BFXA 4QKQA 3C41J 2WSMA 3IO5A 5J4HA 2YKGA 1G3IA 1G41A 5IK2A 4C2TA 2VL7A 5JRZA 4TMKA 2QN6A 5DI3B 4TYQA 1JALA 1MO3A 4EFMA 1PJRA 1DAFA 4O2LA 1TNDA 2IYXA 4TQAA 1SVKA 3W9YA 4EPTA 1YVDA 3DZDA 1TAGA 3ZD6A 1COWD 3PUXA 4II7A 4UNRA 3HPRA 1SQ5A 2RGAA 2IS4A 1SHKA 4O2RA 3CO5A 1EESA 3V4RA 3EPKA 3KXKA 1G7TA 5EXXA 2JDIA 3I73A 3ZS9A 4PTLA 1AQUA 3K0CC 4OQMA 1P75A 1UBEA 3BORA 2IHBA 4B3DA 5CIWA 1ESNA 3CF0A 5BXQC 3GJ0A 1Z0KA 1E2GA 4M2LA 2RGBA 1MO5A 1NIJA 3AF3A 4XH9B 3IPYA 2EFHB 3G82C 1U0LA 3UMFA 2ZUBA 2FH5B 3QPWA 5IDVA 5LB4A 1LFDB 1SZPA 3RRMA 3U6BA 4JVMA 3RRNA 2GESA 2H1LA 2YHSA 2ZUCA 4TZ0A 1T3LA 3RAPR 2VP0A 2D3WA 1ZIPA 1M34E 4QHTA 3A6PC 4WIAA 2ZQ5A 2LWIA 3O8CA 3ZGXA 5KNBA 1N0UA 2E9SA 1KMHA 3U7GA 4A8JB 2HCBA 3JVUA 2DB3A 2YOHA 2FEMA 2WPDD 5FPHA 1M74A 1OFTA 2WKRA 3EIHA 1XRJA 1LB1B 2NPFA 4C0KA 3SN6A 3A58B 1Z2CA 2A5YB 4BRUA 4GL2A 1R10A 4PHHA 3WYGA 1U9IC 3TUJC 4AKIA 3BRWD 3B85A 2W2VA 3GFOA 4NCNA 2WKQA 1A1VA 4DIDA 2O8EB 3QENA 1GKUB 1IHUA 2A30A 3KUDA 5E3HA 5CJPA 1XTJA 2FX3A 4WXRA 4D4JA 1BKDR 1ZNXA 3CX6A 3Q72A 2OBNA 3JVVA 1E4VA 2ZU6A 3LA6A 3NG1A 3SYKA 4AC9A 4YMVA 1MH1A 2FPLA 1YZQA 2RGEA 4DB4A 1XEWX 2HXYA 3TH5A 1KJWA 3DEFA 1ZNZA 4UXIA 521PA 5JJLA 1TQ4A 4ERNA 1KY2A 3V9PA 4A0FA 3GP8A 2DFKB 1F3OA 3QEJA 1P3JA 1UKVY 3NDPA 4Q1DA 3V00A 1J8YF 4D80A 3K1JA 1O87A 4R98A 3H1TA 1S9DA 1FX0A 2ZRPA 1OH5A 4WBSA 3EASA 4JKYA 2P65A 3L43A 4BFWA 2XTNA 2ZRLA 5HPYB 1GG2A 1P9RA 2RHDA 1E9CA 4XVQA 4WZBE 3M0EA 1YU9A 4GOKA 2YOGA 1U0JA 4JKIA 4V0NA 2BMDA 1R2QA 5B2ZA 3QKUA 4LPSA 2F43B 3EA0A 1JPJA 4B2IA 3NH6A 2XSZD 5AUOB 1W44A 2DBYA 4V03A 4HSEA 2GXSA 4YXWA 1Z0IA 4AD8A 1XPUA 3B6EA 1W47A 4E03A 4URYR 2F1RA 3FMIA 3ZIAD 1U99A 2C96A 3TNFA 3THXB 1XD8A 4LBWA 3CKLA 3PXGA 2P6RA 5J40A 3IUYA 4L9SA 5FBLB 3DZ8A 2C8VA 4NONA 3VX4A 5FUXA 3HYRA 5TXGA 3RC8A 3D6TB 5D3MB 3REFA 3SFZA 4LI0A 1SHZA 3RS0A 3WBKA 3ASZA 5CB8A 5HKKD 1AJEA 2JJ8A 4UJ3A 1XMJA 1V5WA 5DGXA 4GZMA 3OEEA 1G16A 1UEIA 2Q9AA 1J70A 5HCNA 2O8DB 1G1MA 1DARA 3M4YA 3K53A 1YR8A 2RMKA 3GJ3A 1PLLA 5FBWB 4HEJA 1N6IA 4Q47A 4M1OA 2FZ4A 4C0BA 2GJSA 2WPDA 1UBCA 1KK1A 3RS5A 3NWJA 3WNBA 4I81A 1TEXA 1YR7A 3K0FA 4TMXA 2FN4A 1TQ2A 2WM9B 3OE7D 3FOZA 2VHQA 1TF5A 2RGDA 4PC1A 1F2TB 3AVYA 2JLYA 2C78A 1MOZA 3RRZA 1XJQA 2JIZA 1Z0DA 3F0TA 4G1UC 2CHGA 4MQBA 4HB3A 4M1SA 1XEXA 5FBQB 3W8RA 4XWKA 1E2JA 4JLBA 3C4JA 3IGFA 3MGCA 721PA 1RYFA 3KJHA 1DO0A 2ZSFA 4KU4A 2OZEA 1W4CA 2GF9A 2EFCB 2QGZA 3NBXX 5FL7A 1ZM7A 1RJ9A 3BERA 1KO4A 2ZJBA 4KSBA 2UKDA 5AWFC 2ORVA 4GRAA 4CZ2A 3IKJA 4Q7JB 3A1SA 4Y0VA 1KMQA 2QAJA 5C1BA 4MKGA 4FINA 1Q1ZA 3H84A 3KTAA 1YR6A 3MCAA 3AKYA 2YWGA 4LHZA 4FMBB 4C7OA 3QXCA 1BH2A 3UG6A 4US0R 1JR6A 3WHLA 3WMGA 1WXQA 4QGFA 1G4AE 4N1AA 1E69A 2GVDC 1TQDA 5JWHA 1XU4A 2I3BA 3L8ZA 3VR6A 3OZXA 4Q1CA 4ASUD 2W0MA 4K46A 4B2PA 3DOEA 2KBFA 3Q9LA 1GZSA 2N46A 1GWNA 2J5XA 4QRHA 5FPSA 3HU2A 4CYMA 2WHXA 1GITA 1HA3A 3K0AB 2OXCA 3FKSA 3FE2A 4UXHA 5H68A 3IEVA 3QQ5A 1R7RA 3NBZC 1XCGB 1Z07A 1J90A 2GRJA 3QXXA 3KKQA 4KFSA 3CZQA 1P2SA 1EGAA 1OXUA 1KK0A 4F7WA 4JYCA 4KYUA 1VPLA 4ZDIA 2CE2X 1CR1A 2HEIA 3VQTA 1HURA 1XMIA 2J9RA 1RIFA 2AXNA 1DELA 3OFND 3BGWA 4RY2A 4M9QA 3QEOA 1N6HA 5FR1A 2WWXA 3ZLJA 4EPYA 1ZAKA 3AEZA 1KO8A 3REGA 4Q7MB 1IM2A 3IQXA 2ZRFA 5L3QB 3LH5A 2QAGB 3OESA 6Q21A 4Q7KA 4Q48A 4PC3A 2BBWA 1VHLA 3G5UA 3K9NA 4PC2A 1OYYA 3KXIA 3ZQ6A 4MRVA 1ZCBA 1OF1A 3GPLA 1II8A 1Q1EA 4FW9A 4EUNA 4HLQB 1T3HA 4B3GA 4AKGA 2VP6A 2ZRNA 2VP5A 3FWYA 2J7PA 4IVPA 4IDNA 3NHBA 1E2EA 4QNMA 1TL7C 4LBYA 2Z43A 5EUQB 2J0SA 2AR7A 2WTUA 3U4QA 1P60A 5JEDA 3MWLA 4FD2A 1C4OA 4PFSA 3T35A 4PO1A 1Z6AA 4XSGA 3D7MA 3EZFA 1NVVR 4L16A 2D7DA 1E2QA 2VQSA 1H8HA 2W6IA 4JBWA 2CJWB 4QHYA 2G0NA 5EXPA 1Q1QA 4ZCLA 3KUCA 3BB1A 4D26A 4PO9A 4GMXA 5DN6D 1VCOA 1EG7A 4HAZA 4PXAA 1VG0B 2IYTA 2IYVA 4AURA 3A8TA 2PJRA 4RD1A 1G8FA 3NEYA 4W7SA 4ZDWA 3AF4A 1S3SA 5HZHA 3GLFE 5UKDA 1X6VA 1ZM3A 4LY6A 5SZHB 1XZPA 2B8TA 3DM5A 4XWOA 3PCRB 4TLCA 3RABA 5E95A 3PEVA 1ELOA 1Z06A 1OH7A 2ZEJA 2VEDA 2AHOA 3LFUA 2PBRA 1KI3A 3K70D 5FTJA 3AVUA 4EPRA 2QQEA 3C15C 3FFBA 4XWAA 1CF4A 3NDBB 4DHEA 1OIXA 1G21E 5LDDC 1IN5A 1WF3A 4GOXA 4D2IA 1P7CA 2YZ2A 1EX6A 1SKQA 4HUQB 3RS4A 2QAGA 3UMRA 3W3AA 3ADBA 2QMUA 5CM9C 2H8KA 2GNOA 4HDQB 2Z6VA 1DPFA 1KSGA 4NYIR 2G1KA 2IC5A 2P2LA 3FKSD 3GJ7A 3SU8A 4DLWA 5LD2B 2HYDA 3SR0A 3VTKA 4E22A 1IXSB 5GJWC 4HDCA 4G3XA 1UKEA 2W6JD 1WMSA 2ERYA 3WP1B 5JHGB 3IIJA 3AVPA 5KSYA 4YXWD 3SI7A 1NVWQ 4LJ6A 2IWHA 4RD2A 4DDVA 5FTMA 1XF9A 1SXJA 1GNRA 4MUAA 3CR7A 1F60A 3HYTA 4BASA 2O8EA 4Q4HA 1ZBDA 2ZI9A 8OHMA 1P2TA 4URUR 2CL6X 4GNKA 2FOLA 2XXAA 3C7KA 1N6LA 4XIGS 5HTKA 5CK5A 3CRMA 4ARZA 4B48A 3U7HB 2IYUA 2VRWA 2WJIA 2OAQ1 2YC2C 3QPVA 1T0JB 4GSYA 4P4UA 3VR5A 1QHIA 2WSSD 4XTRA 1DAGA 2UVQA 2H18A 4C0JA 1E9BA 3WP0A 4CGZA 1GM5A 2I1VB 2W0SA 1ZC3A 4WZ6A 1FTNA 4JL6A 5DI9A 2QMOA 3U3OA 4BLSA 1PVOA 1R0WA 3EWSA 1GIAA 4DDUA 2JLVA 1I4TD 2ZI7A 2F3TA 4C0AC 3BOSA 1Q12A 2DWQA 1VCNA 4BFVA 3RANA 2KB0A 4URWR 4M1MA 1Z0FA 2XEXA 2YWHA 3CB4A 3F8TA 4Q01A 3X1ZA 4AWXA 3KQLA 4I1UA 3IBYA 2EFGA 4PPGA 4KAXA 1Z6XA 4M0LA 1YJ5A 4QGAA 1G6HA 5CLQA 1OXXK 2DWOA 3TE6A 1RRGA 3AVXA 3CF2A 1RRPA 4P31A 3SQXA 3T34A 2H5EA 3IBGA 4RD3A 4B74A 3ZZ0A 1E2HA 2PZEA 4Q1EA 1G3UA 4Q9JA 2BVNA 2F1JA 2XNDA 2QL6A 1W0JD 3U6KA 4L8GA 1YZKA 3SHWA 2B8WA 3CH5A 1TTTA 4DCVA 2GWHA 4JJKA 2W83A 5JS8A 1SXJD 2BBOA 2O52A 3AP1A 1DBSA 2IT1A 1ZNYA 3EPLA 1F6BA 2F6RA 2BCGY 2HJVA 2J3EA 3P4YA 4V0ME 1R5NA 4RZXA 2V9PA 3AVOA 4LC0A 1GL9B 3CWZA 1JEEA 3OAAD 3K0AA 2FMXA 3FHOA 1TUIA 3QF7A 4DSNA 1OFIA 3TRFA 4NYIQ 4Q02A 3TJZA 4TQUS 3DMNA 2VIIA 1CTQA 2ZANA 1W5TA 4FIDA 2Z0MA 5J4YA 5AR1A 1XTKA 2JCSA 4GMDA 3QVVA 1WB9A 2N42A 2CMKA 1X8JA 3RSLA 3R20A 5L3SB 3NH9A 2J41A 3QF4B 1JR3D 4LJ7A 4V0LA 2NIPA 4JYBA 4NCIA 3R7WB 4P4TA 3AUYA 1NMXA 1TMKA 1KDRA 1SXJB 2FGKA 2FPMA 2CCKA 3P20A 3CRRA 3QKRA 4US1R 4YMWA 2OE2A 3TKLA 4BLOA 1P4SA 2IYLD 2ZITA 1NVXQ 4A0RA 2RGCA 2Q3HA 1Y63A 4F4JA 4PHGA 4O0MA 1VIYA 5DLQC 2ZM5A 1T8UA 2IYRA 1VMAA 3MLEA 3TSZA 1N6OA 2ZJ5A 4AYXA 1EK0A 2OBMA 3CPEA 4DC9A 4IVQA 3MWJA 3W6NA 5A4JA 4UNPA 3TVTA 1UDWA 1KDOA 1G7CA 1T0HB 1W0JA 2OAP1 1AA9A 2V6IA 2XJ9A 3GEHA 3VU9B 4EPVA 4LZZA 4JLAA 4JBYA 3BIFA 2ZI6A 2IBMA 3SE0A 1T5IA 1MABA 1GAJA 3D3QA 2ZE6A 2YVUA 3EIEA 2WWFA 4XVUA 1YHNA 3WY9A 2V55B 3WYFA 4A82A 1D9XA 2BV3A 3CM0A 1OFUX 3LBHA 1EWQA 2BC9A 2MMGA 3KDSE 4MYUA 3VHLB 5LPNA 2R65A 2HF8A 3GQBA 4YLGA 3R7WA 2QU8A 4DLSA 3K9HA 2WWIA 4W5HA 3LBIA 4XD7D 2WJYA 1E94E 1XFAA 4JIMA 4QHSA 1TF2A 2VHCA 3K09C 2HXSA 2RB4A 1GNQA 4BFXA 4URXR 3KQUA 2J0QA 1G64A 1ZUHA 3RC3A 3KB2A 1P5ZB 1XTSA 1U98A 1KZ7B 2AFIE 2AL7A 3PEWA 4AKHA 2XNDD 1R5OA 1PV4A 1WQ1R 5JBQA 3AM1A 3LY5A 1JR3A 2QY9A 1CLUA 5FUWA 4HYYA 4IEIA 5CDFE 4EPXA 2GEVA 2AD5A 3BH6A 4IKEA 4DSUA 1II0A 2YC4C 3GMTA 5AUPB 5GADl 5ELXA 3W6OA 5JSZB 1NIPA 3FYHA 1ZMXA 2IHYA 3VNVA 3U60B 3W5JA 4RCZA 4QC2A 4P3YA 2FFHA 4MRRA 1IBRA 2ZXUA 1JECA 2Q9CA 3T1VA 1NG9A 4BLPA 2HLDD 1WRBA 2WZQA 2Y8EA 3BH0A 4DDTA 5D3QA 1US8A 5KDDA 1TF7A 4FMDF 4TL9A 3ZQJA 4RZ3A 2NO0A 1P9NA 2VO1A 4GI7A 4LYJA 4BZPA 1U0HC 4Q7LA 3KQNA 4KODA 3UWKA 4RFVA 1N6NA 2AKYA 1W4RA 3EX7C 4M53A 4Q1BA 2JEOA 4UJ5A 1Z6YA 2WAYA 4LV6A 4HAWA 3RS7A 1GL6A 2ONKA 1JQLB 4QBFA 4PHTA 1Z83A 4URVR 1IONA 5B58C 1OXSC 2VP9A 2XITA 2FZLA 4OBEA 5J4KA 2CNWD 3DHWC 2OO7A 1OXTA 4LYAA 4V0MA 2A5DA 3EG5A 1CJKC 3EZ2A 2GCNA 1L8QA 2PEYA 4Q4LA 4MRSA 2Q21A 4C4PA 3E70C 2AD1A 2O8FB 1E2MA 4BEBA 1N6PA 2VP4A 4ZIRB 4PSVA 3LWNA 3N2IA 1KNXA 1HQCA 4UNQA 1GP2A 1Z08A 4ZCMA 1CJMA 5TV2A 3BFVA 5AJWA 4PQYA 2GZDA 2MMCA 1NMYA 2ZRJA 3QY0A 4PQRA 4HAVA 1FMLA 2GEUA 1FMJA 1K8RA 1DAKA 1U8YA 2C9CA 3L82B 1K5DA 5K8LA 3U3RA 1WP9A 3KQKA 3X1WA 2UZ3A 3ZZTA 4IEEA 4POAA 3FMFA 3MAAC 3CZPA 2ZS9A 3CRQA 3CNOA 4DSTA 2EWWA 3GJ4A 1ZIOA 1DEKA 2GJ9A 2O0KA 1ZINA 5FH9A 1U81A 2ZE5A 3CPHA 4M8NE 1UBGA 1ZD8A 2ZJOA 1MO6A 3NBFA 1ZP6A 3BAFA 4Q21A 2ZYVX 3L8YA 2V1UA 5IHPA 2VF8A 4MGZR 1P72A 3GLIE 2VTKA 4IXMA 4MGKR 4KBFA 4A2QA 1JEDA 2IYQA 3KFXA 2ATXA 3MJRA 2IS1A 3CX7A 3W6PA 3AQ4A 2CL0X 1KI2A 2IEZA 2YOFA 5H8WA 3EC1A 4D81A 1TEVA 2KJQA 4RD4A 2VLIA 1N25A 3OEHD 3Q3JB 5BN4A 4EKDA 3AF0A 2QBYA 4IRUB 4ZI2A 2ZI4A 1UEJA 1T9HA 2R9VA 2FU5C 4Q03A 2F3RA 4JVLA 4C0HA 1DAIA 3UANA 3IPXA 1EFHA 2J45A 1Z22A 1ZUNB 2OCYC 5JCPA 5C4GB 4LV5B 3PITA 4UXJA 4C30A 1R8QA 2Q0HA 1AKEA 4HZIA 2X1VA 1U8AA 2KBEA 1N0VC 4TTQA 2REOA 1HT1E 1SKYE 2QTFA 4B6EA 3AVVA 4RZ2A 2PT5A 2BHRA 2R2AA 4BLRA 3VU9A 1QHSA 5CDFA 4B35A 3O8RA 4I99A 4OQLA 4Q19A 3T1QA 1AIPA 1QG2A 2HUPA 4IOMA 3TBKA 3BE4A 3GLHA 3IIKA 4WVFA 1Z2AA 3H0KA 1DAMA 2XAUA 2W6ID 2ZE8A 1GKYA 3I8XA 1RE0A 2FFQA 3QNUA 4PSKA 2QQ0A 1CS4C 1KSJA 2ZTSA 4B71A 2WIAA 1FX0B 1M7GA 4LHYA 1LW7A 1E9SA 3U7EB 1L4YA 5A5GA 2UZIR 1GRNA 4CEHB 3K0CA 4UKDA 2OXRA 3B82A 3RYTC 4URZR 5G41A 2FSIA 5BN5A 1KO7A 5FI0B 2Z4RA 5B30A 1VTKA 4ZO4A 2WBLC 1DTSA 2ZREA 3QXHA 2OT3B 4AY2A 4JLMA 4MRPA 1EX7A 1G7SA 2Q3MA 4C0SA 2AN9A 1T4GA 3TUIC 4ESHA 1XCMA 3RWMB 4BUJA 5KNCA 2QPOA 1E1RD 2YINC 3KZ1E 3A1UA 3LD9A 4TLEA 4MITA 4HB0A 5FOUA 2G3YA 2GVZC 5BYKA 2WAXA 1OB5A 1XBTA 1VDZA 1Q21A 2W6JA 2QUZA 2IUSA 4R2HA 2ZRIA 4GZLA 1RPZA 4ZKDA 1VKJA 4JZKA 1FP7A 2ZJ2A 1JBKA 3KXLA 4Q1AA 1MABB 1EFRD 3VR2A 2QTVB 3WNDA 5L8VA 4PAOA 1LF5A 1X3SA 3NHAA 1CBUA 3KB1A 1M7HA 4G5OA 2LKDA 3HP1A 2IS2A 2V3CC 2HJGA 3T5GA 2QENA 5L3QA 2ZSEA 1KGDA 4DXAA 4IHQA 4JSYA 121PA 2CLSA 2ZYTX 1AKYA 3TIFA 2ZU0C 3GFPA 3N2EA 1H8EA 1TU4A 4OI0A 5LB2A 1WBDA 1XXHA 2JATA 2BBSA 2FFBA 4PAMA 1BS1A 5CB6A 1AK2A 4QL3A 4CIDA 4J0QA 4FWIB 1J99A 2BIFA 5KPJA 2OHFA 4A92A 4YQFA 221PA 5IRCD 1OT3A 2QP4A 3LW8A 5K8IA 4EJSC 2QMEA 5KDLA 3SYNA 2OFOA 4FMCB 1SVLA 5KPDA 1UDXA 1NSFA 3TUZC 3U44B 3RWOA 4EJSB 4P4SB 1DE0A 4NP6A 3BB3A 4LPKA 1E1RA 4DLZA 2P67A 4X8HA 2H57A 2IWRA 1NLFA 1W48A 2MSEB 3OIVA 1TPZA 4CRWB 4C7OB 1KI8A 4F4IA 4DLTA 1SVWA 2DY1A 4JLPA 4Q4HB 4R71A 2KSQA 2GF0A 2XB4A 1NLZA 3FHCB 1OSNA 1CRQA 1KO5A 2OSBA 4UQOA 1X8KA 5EE9A 5FOVA 4GT1A 3K0EA 1FNMA 4LBVA 4M1YA 4TMTA 1R5BA 3SFVA 4B2LA 3C5HA 1XXHB 3ZIAA 3FVQA 4G5GA 3W90A 3MWKA 2BJVA 3TR5A 3A36A 1HV8A 3KJEA 1G8PA 4TWZA 2ZRBA 2RAPA 2W00A 3QKTA 4L9WA 4MRNA 5J4LA 1NJFA 3H86A 3DOFA 2CXXA 1IXZA 1F2UB 4CEJA 2DPXA 3D8BA 4PC6A 3KKOA 3MRSA 4A2PA 3DKVA 3L0IB 4LHXA 3SJZA 2BOVA 2CCGA 4MUBA 2PL3A 3I92A 3BBPA 3EIQA 4FXPA 5EXTA 2EU8A 1X86B 2QZ4A 3KFVA 1MRSA 5G3ZA 2J7KA 5FTLA 4QFMA 2NO1A 3LXRA 1JPNA 4X8LA 1XMSA 1Y3AA 4L4UA 4DUGD 2WJHA 3LX5A 1J8MF 4B34A 1A2KC 3VR4A 4QBGB 5L3RA 3LRPA 4GDFA 2WOOA 3U3JA 4MGIR 4KJZA 4TSFD 4Q5IA 2P6UA 2JIZD 2G1JA 2O8BA 4B3BA 4TTPA 2P5TB 4ARZB 3I32A 3K8YA 2DFTA 1KKMA 1OHHD 1DS6A 1N5JA 1CJVC 1P6XA 3BJIC 1C1YA 1S2MA 2ZAOA 4OL0A 1COWA 1FQJA 1FQKA 2CK3D 3MSXA 1RW4A 4K81B 2ZVPX 3W34A 5TB5A 3SNHA 2ZR7A 4S35A 2GK7A 4CEHA 4Z51A 1JNYA 4OHZA 2CVFA 1FUKA 1YQTA 3EAQA 3JZMA 3U3KA 5EP2A 1OJLA 1OYWA 3LV8A 2P6NA 2B7CA 2A78A 3PFIA 5EP3A 4TYNA 4P33A 2G0TA 4OK3A 5KOYA 4W9MC 1KSFX 4CT5A 2NZ8A 4HAXA 2CLCX 3B1VA 1JXOA 3L2OB 1KK3A 4TMVA 4R7ZA 1MR3F 5BWMA 1X1RA 3A1TA 4KFTA 5KYKA 2IUTA 1SXJE 4XD7A 3V4FA 1J7KA 2ANCA 4DT1B 1SVMA 1JJVA 3VKHA 1B0UA 1W36B 4NCJA 3SQWA 3AB3A 2VHUA 4KHZA 4W5WA 1Z6TA 2R6CA 4NYMQ 1JXMA 1NBMD 4DZZA 1P9WA 5B57C 3VKWA 3EARA 1ESMA 5LBIA 1JAHA 3U3MA 3CIOA 1ZJ6A 4NU0A 2XGJA 5G3YA 3W3ZB 4RD6A 2QBYB 4R9UC 2GETA 3L0SA 3T1OA 5FPKA 2DWPA 3TSOA 2G6BA 3GLIB 3GFTA 4IOLA 4BZQA 2ZSAA 1OIVA 1IN4A 1KJZA 3DPUA 3ICEA 1M6NA 4RJLA 1TU3A 5AUQA 5JZVA 2R6GA 1YZTA 2CJWA 2XTZA 3NIBA 1FZQA 2OV2A 2R44A 4MYCA 3CW2A 5EXSA 4ZKEA 2R6AA 4PANA 4Q9KA 3VR3A 3T15A 1S0UA 3SOPA 1E2FA 621PA 3E5HA 3LLUA 4BQSA 2WKPA 3SYLA 2O8FA 1CR2A 2CVHA 1TQ6A 3OIUA 4L15A 1UJ2A 3RHFA 1D2EA 3I5XA 2VSOA 4LJ8A 2QPTA 1BMFD 4N0DA 4Z8XA 4EFLA 2F9MA 2J7PD 3AH8A 3JZAA 1A5TA 4H1UA 1VG8A 5KO2A 4BFZA 1E2KA 2NO6A 4ON9A 1E99A 1EFCA 2O0HA 3QUSA 3D31A 3SDZA 1LNZA 4YMSA 4C0LA 2EVWX 1S4QA 4KBGA 5F9HA 2OG2A 4QGGA 1B23P 2PZFA 3CH4B 4K8OA 1JJ7A 3CPJB 3NBYC 4HDOB 5CYPA 1UBFA 2D4HA 1FFHA 1H8HD 2FNAA 3FMOB 3IHLA 3HR7A 4HLDA 5CITA 1Z0AA 4Q4JA 4YDSA 2A7QA 2XB2A 3K0FB 3A1WA 4KSCA 5CK4A 1A82A 4PPFA 2DFLA 4AKEA 2ZJZA 1WBBA 2ODEA 2X2EA 1ONBA 1O3YA 1W2GA 3BS4A 2JLZA 4LRWA 4KYIB 4GOJA 3ZVNA 5DI3A 3I3SR 3A4LA 3A37A 2E1RA 4LX0A 2JAQA 4DCUA 3AP3A 5KSPA 1XB2A 1KI6B 1GVNB 4MKIA 1WA5A 4MA4A 4NYMR 1GOTA 1RYHA 3AVQA 4D4MA 4DDWA 1Q22A 3ZVMA 1T5LA 3ZVLA 4B33A 1KOFA 3VMFA 2B92A 2OCAA 2PCJA 2RGNC 1H65A 2NO7A 3LAWA 4NCHA 4NDZA 4PC7A 3WMFA 5HKKA 1E2LA 1T6NA 2BBTA 1G8GA 4U02A 4PPQA 1KI9A 1ZNWA 2HT6A 1PUIA 2LKCA 2IF2A 2QA5A 2AX4A 1R0ZA 2QROA 4KXFB 2GXQA 2D74A 1W0KA 2GHIA 4NPHA 3GLIA 3LBNA 4QNRA 2HDNB 3A1VA 4FWTA 3BXZA 4B44A 3GJ5A 4CDGA 2GILA 2QT1A 2GXAA 1I4DD 2D62A 3VNUA 1AGRA 3DKPA 1Z28A 5AJZA 4QBHA 2V4ZA 2CHVA 5H1YA 5FR2A 2GAOA 1FL9A 4ZPXA 1EFUA 2JJ2A 4Z1MD 2O8CA 1ZD1A 3R9WA 2Z83A 1I4LD 5LD2C 1RRCA 1OKKA 3SJBA 4OI2A 5BYJA 1XEXB 2EYUA 4I1OA 2PEZA 1E2PA 2VP2A 2ZUDA 4DCNA 5FL7D 2L0XA 1TUEA 5JI3E 3LLMA 2BWJA 1OPXA 2GBLA 1NVVQ 5JLJA 3R9IA 2X19A 4PQFA 2E87A 2F9LA 2P0EA 4IDOA 3KQHA 2O8CB 2PJZA 1E1QD 4EPWA 4AK9A 3EA5A 5DYGA 2I4IA 5KU1A 3PG5A 1IN6A 1JR3E 3CWQA 3GLHE 1ZVQA 2O8DA 3TMKA 1EFTA 3C5CA 1W2HA 4A36A 4IW3B 2ODNA 2IUUA 5KUTA 1Q0UA 1GILA 5EE0A 1Q57A 1S3GA 2GTPA 1XD2B 4LCBA 2FGJA 3ADCA 5D3MA 4TYYA 2VYFA 1V43A 2A2ZA 3AGPA 3N70A 3NTUA 3BB4A 2PX0A 2R6FA 3HDTA 1CXZA 1XWIA 2GCOB 4BEJA 5C2JB 1ZM9A 2OESA 3CLVA 3U44A 4U00A 5FUVA 2VF7A 2C04A 2VA8A 2GJKA 5FPYA 1RVDA 3AVWA 4OQFA 4OHVA 1VIAA 3TLXA 1NBME 1QBKC 1NJGA 4NBSA 1MRNA 4NZYA 4QJ3A 2ZRGA 4LYFA 4DLVA 4HLUA 1S8FA 4B32A 4FCWA 2VHTA 1YZNA 3ADKA 5HE9A 1K5GA 4Q66C 4MDEA 4TT3D 1ZM4A 1E9EA 4JSTA 2AWOA 5SZJA 2B7BA 3OAAA 2DYKA 1GFIA 3B13B 3E2IA 3QOFA 4NE2A 1HH4A 2ERXA 2HLDA 1F2UA 4A2WA 4CEJB 1SVOA 4LSGA 1FPMA 3QKRB 2OEPA 2VPPA 1AM4D 3LW7A 5DISB 1HQYE 2FWRA 4OHXA 3BH7A 1A2BA 4DKXA 5FOWA 3R8FA 3K70B 1W0KD 4OJQA 2GCPA 1VYUA 5JFGA 3S1AA 3DL0A 3QF4A 1GKIA 1NN5A 5E7MA 2BKUA 3GLGE 2OILA 1E0JA 2ZROA 1OH6A 2AKAB 2ZETA 1KDTA 2RGGA 4HZUB 2WWYA 2CNWA 3QXSA 4WZAE 3OHMA 2C99A 4HI0E 4XVRA 2FSGA 4S2EA 5GJVC 3VKGA 4DVGA 1WDTA 1XTRA 3L0PA 4O3MA 4B3CA 3CF6R 3ND8A 1OB2A 1H8ED 3EXAA 1FP6A 4LJ5A 4TYPA 5BQ5A 1X1SA 3UKDA 5AJXA 1YKSA 3VR1A 5DH9A 3ICQB 4C0QC 4EJSA 5K8UA 3QPUA 5L3VA 2HYIC 2XOKD 3ZJYA 4JMPA 1KNQA 1N5KA 2ZRAA 4DWJA 1E79A 2V7QD 4A8JA 1GTVA 3CNNA 4LHVA 1KMHB 1Q1BA 1QG4A 4DRZA 5EE1A 1TADA 4PHFA 2D2FA 3LX8A 3N5CA 4C3ZA 1W7AA 4DSOA 5EE5B 5JJKA 2V54A 3BK7A 1RC8A 2GAAA 3UMSA 4A1FA 2C98A 2F43A 2QSYA 1RJ9B 4OHWA 3ASYA 2CCJA 1XTIA 4LHWA 3EZ7A 4WXPA 4JLKA 4D0GA 5IK2D 3SBDA 1GNPA 1D5CA 2GA8A 4BGDA 3QI2A 4B3XA 1QHYA 2JLUA 3PVSA 3RNLA 3GEEA 2YJTD 4ACBA 4C9BA 1XEFA 3RVBA 4Q18A 5JSZA 2C5LA 2QE7A 3Q7PA 4C2UA 2G77B 3QG1A 1W49A 3ZVRA 4QJ5A 1FTSA 4M9ZA 4DBLC 2XZLA 1II9A 3ZS8A 1UAAA 3TQFA 1VCMA 2PLFA 3X1DA 1HY3A 1AZSC 1ZCAA 2AK3A 3RRYA 5AK0A 4AG6A 5F98A 2HCJB 421PA 4EFNA 2EW1A 4CEIA 1IJFA 3HJNA 1QZXA 4TT3A 4AYTA 3U7FB 4DJTA 2C9OA 4CW7A 2GDJA 2JLXA 5F3WB 4NL4H 3CBQA 2ECKA 1OFHA 2ZYUX 3B1YA 3AF1A 2YWEA 3EZ9A 4A15A 1GDDA 1HT2E 1ZC4A 4KFRA 5FBVB 4M9XA 1D2NA 1YRBA 4D4KA 4LGMA 4US2R 2V1XA 1ZU5A 3QBTA 3T5DA 2ZS7A 4LJ4A 1Z0JA 3T12A 3Q85A 1D2MA 3DO6A 1VHTA 1I2MA 4LC1A 3THXA 5E4FA 2BM0A 2OUKA 5DSZA 4XTCS 2LCFA 1KHTA 3FHTA 4OI1A 1IN7A 4GPTA 2XZOA 2QT0A 5IF9A 1ZW6A 1P2VA 4M22A 3VX3A 3ZYCA 3OFNA 4ITRC 4Q9LA 1GSIA 1NN3A 1OIWA 2QP3A 3ETLA 2ZAMA 1G4UR 2XNSA 5JRJA 2WMNB 4R2IA 4LJYA 1KK2A 2IYWA 3IO3A 3AUXA 1DG3A 1KKLA 1NY6A 4NYJR 3FKQA 2GJ8A 3SC3A 4RSGA 3LNCA 2QE7D 3UXMA 2OCPA 2YNMA 3WNCA 1Z47A 4LWZA 3O8DA 4KLNA 4A8JC 4TN1A 2D7CA 2FV8A 2H7VA 1W36C 3QIAA 4HB4A 4N3NA 2PLRA 1Z29A 4QXAA 3MG9A 4OQNA 3IEUA 4RCYA 3NEJA 2EFEB 4U5XA 3CONA 3RSOA 3BD9A 5FI1B 4IVRA 2ATVA 3FMPB 2FF7A 4JL5A 2BM1A 2IL1A 1VG9B 3GLGA 5DHFA 2R8RA 1YE8A 3G0HA 1NY5A 2TMKA 3ZZUA 2J0UA 1NG1A 4MYTA 2GK6A 5SZKB 3W8NA 5FTNA 2YWFA 5JMTA 3PENA 3KL4A 3X1XA 1VYVA 4MKFA 4G5RA 4KV9A 3THYA 5FFMA 1XPRA 3TVDA 1S1MA 1KIMA 3M6AA 4BFUA 2C2HA 2ZRMA 4DCSA 1NNEA 1OE0A 4IOKA 3THWB 1E2DA 2XSZA 1AS0A 4I1SA 4TMZA 2IW3A 1T3SA 2VHJA 5JCZA 3LXXA 4FMCF 4P4SA 5A0FA 1XXHE 4A0GA 4BRWA 5J5CA 1G19A 3T61A 1JQJC 1BYIA 2D06A 1AS3A 4QOSA 3WXMA 2ZYWX 4PZLA 3FPAA 4KVAA 2NO9A 3ZD7A 4Y0AA 2MSCB 3AKEA 4Q4JB 2A5FA 3EPJA 3WRYC 2GZHA 4TTRA 1FOEB 2PZGA 3EWAA 5FOXA 1W4BA 1W4AA 4HATA 4QJ4A 4M21A 5FL3A 3B60A 1Q20A 2ZIAA 2BDTA 2RKOA 4RKEA 1VG1A 2ZJAA 3CR8A 3OEED 2ZJ8A 2NMVA 3C16C 4BFSA 1XP8A 3U61B 5TVKA 1D9ZA 3MJHA 4NMMA 2FSHA 2ZPTX 3TAUA 4D0LB 4ZDKA 4EQ6A 1Z8FA 1SVIA 1OW3B 4JBXA 4RVCA 4LUCA 2DR3A 2NTYC 4X8OA 1BMFA 4NKRA 2AK2A 4M4SA 3C8UA 1YRAA 1R8SA 1E0SA 4X8MA 1E9DA 2NG1A 3M1IA 4NCKA 3B9PA 1LVGA 5TDHA 1NVUQ 1QHXA 4B43A 1E4YA 1G8HA 1IY0A 3WRXC 4ABYA 1F5NA 3GEIA 2PCLA 1XD2A 2WV9A 4LBZA 2JGNA 2Q3FA 4BE7B 3MWYW 3PUZA 4KCGA 3KTAB 4FCTA 1S1CA 2RGNA 2J59A 2H17A 4CF7A 3B9QA 4M1WA 1VECA 1E0KA 3CRW1 1XD9A 3IQWA 4RZUA 3B7GA 1KI4A 2ONJA 5JI2E 2J0UB 1G5PA 2XOKA 5FTKA 5FPTA 2NQ2C 2ZSDA 4JS0A 4E09A 3FDIA 5CLLA 1IXRC 5G40A 5F9FA 1IY1A 1E9FA 2ZRHA 3WHKA 2CL7X 4PR0A 1Q3HA 1DADA 4ZV4A 3ECCA 2HV8A 2IF0A 5AJVB 1YR9A 4DT1A 2QSZA 4BFYA 3CUEF 3H2YA 2GBLC 4NTZA 4OYHA 4XJXA 4Q1FA 4RFSB 3UPUA 1QVAA 2WJJA 4PZYA 2ORWA
chains in the Genus database with same CATH superfamily
1VJ0A 3PEYA 3HU1A 5T6MA 2WICA 3QZUA 1RM0A 1WZEA 4FHZA 4J1TA 4MI9A 3L0OA 2JIPA 3K0KA 4B4DA 1EUZA 3HBJA 2QG6A 3X2SA 2JGMA 1USIA 1KYIA 1Z3IX 3HCRA 4PO1A 3S2YA 4Y6QA 1OV4A 2E0IA 4AY3A 2FUKA 5BW4A 4L9AA 2W6QA 3C3EA 3DVLA 3K9GA 3AHFA 4RKFA 3ESDA 5EZYA 4C5BA 1MJNA 5HFJA 1JFFB 3UT0A 4OAQA 5CH8A 1SGWA 1X7DA 5E8JA 1HDIA 3RNOA 3H9JA 1Q74A 3HCOA 3R3XA 3TK1A 5K99A 5U4XA 2ZZMA 5D5PA 5IN4A 4S04A 3T9EA 3QBVA 1G5RA 1B43A 3VZDA 3IPCA 2FPKA 1YBAA 1ZK1A 1G6OA 4ZOBA 1Q1GA 2BCJQ 3KSUA 3QUCA 1OQAA 4ILEA 5EZYB 2MCFA 3T54A 2D0IA 1VCIA 2Z2XA 3U4QB 1IVSA 4F38A 1MVLA 1SHJA 6GPBA 4JXXA 4KQMA 4KR2A 4GM0A 1MO4A 2BUCA 3IV7A 4MVCA 3KKNA 4FDAA 2G9NA 3ZHCA 2Z57A 4I5FA 1Z4LA 1FP1D 4YJ3A 2VXCA 3DW3X 3KPJA 5JW6A 2ST1A 3FHJA 5DE3A 2WDPA 4JT4A 4IIDA 1SG0A 3CCBA 3B2NA 4OG2A 3RE1A 5BUQA 1HI9A 1LPSA 4UHDA 4EY7A 3EPHA 3CLHA 3PNYA 3UK1A 821PA 1QNLA 1EMDA 2I3ZA 3HJRA 1SXJC 3TGPA 4BP3A 4YAWA 3E9YA 3KT3A 3HY3A 2WUVA 4TTSA 3NTVA 4A26A 5IMSA 3CSSA 1YCGA 5AK5A 4MP6A 1JPUA 4OO3A 1NKTA 2A94A 3Q2IA 4YK7A 4OREX 3W5IA 3Q8WA 5JD4A 2O2IA 2ZWMA 1VIDA 2CLDX 3MMPA 3VC3A 1YK1A 4ICIA 3UW3A 1TYDE 3HWRA 3M82A 1S2NA 1YB1A 2AUTA 3C70A 3GCWA 3ORYA 5DP2A 4A8TA 4E1AA 3TOVA 1X19A 3K5IA 2X5JO 1PZNA 5BWLA 3TECE 3Q11A 2X41A 1GN8A 3ONWA 1UMBA 2VJCA 1E1NA 2ODWA 3GC6A 4X1IB 4LEIA 2JDID 3MB5A 2Q5OA 3WLEA 1DU4A 1YI1A 1YZLA 2CLEB 3MERA 4A0SA 4MYDA 3HUTA 2HT1A 4Z4EA 4WXMA 4KDCA 3KOOA 5C8DA 1QR6A 2IYSA 4GQBA 4OJYA 4DPKA 4RNCA 1M2OB 1IAQA 1XVLA 3TIIA 3TW4A 1BYUA 1C7IA 1EI9A 1SVSA 2CJXA 2O1XA 2QW1A 2WSYB 2P2NA 3PHHA 4GKBA 4KMMA 5E4JA 4AUNA 5HUHA 1G5IA 2G9UA 1OTYA 2C2YA 3JYNA 1CR4A 2JA1A 5LDGA 2JHGA 2Z1MA 2O5VA 1QQ6A 1B2RA 1G3MA 4HWTA 2ZSUA 4RJKA 4AKSA 4DN6A 4EF6A 4BRSA 1QORA 1CJTC 1XNJA 2XJ4A 3ESAA 3PX7A 1F0KA 2D2XA 2AFHE 2VH2A 3BJRA 4B6SA 1VLVA 3OHPA 2EZUA 2LZ0A 4DQDA 4BJ3A 3ED1A 5B6PA 2W11A 4PZDA 3RAJA 2G7MC 3HVIA 4EZBA 3DC7A 5KNBD 4YP5A 2YYZA 3QE0A 3FF4A 3UMBA 3FBGA 2VPQA 1WDMA 3ZCTA 3ZWVA 3QFSA 3E5MA 3I28A 1PR4A 2EP7A 5FPQA 1Z5GA 3MWEB 3BGDA 5B7GA 3KPVA 4G9EA 3R76A 1BN7A 2C31A 1H23A 3UOWA 4D9JA 3K9CA 4R68A 4NFSA 2R5FA 3DJFA 1JSCA 4KITB 1Z0ZA 4YAJA 2QP9X 3ECSA 4UMFA 2WWWA 3HO6A 3QG5A 4BVJA 2RHWA 3GI1A 2CXTA 2KLHA 5E7IA 1MX1A 1I2DA 3PBKA 4TV9F 2BGJA 4CFYA 1OH8A 3JAMA 1Y1QA 2IXFA 3BTSA 2WEKA 4FOSA 3ZEIA 1LPMA 2G09A 1QP7A 4PX3A 3AY6A 2WG0A 1E66A 1G8YA 2WE8A 3JQ7B 3BXPA 4I8IA 4B4KA 1F0YA 2ID4A 1JB1A 2Q2QA 1Q1AA 3TGLA 2V7QA 5GMOA 2P41A 5C3MA 3OOJA 4IQFA 4GECA 3TAXA 1XL0A 5JPIA 4BNXA 4NOLA 4TLBA 4AMBA 2ZYRA 1PNRA 3PXEA 1U8CB 1MB0A 2YTZA 4YC7A 3SMVA 1M8GA 4MVJH 3L02A 2OZLB 1EUCA 5FFNA 4M8LA 1MENA 4MVJP 4CM8B 3AHCA 4JUCA 1X7ZB 1UM9B 2H2AA 4CVNA 2WJGA 3CN7A 2OECA 4G07A 3W2GA 1G3QA 1CUCA 2ANBA 3KPYA 4AZ3A 4EAQA 1U9IA 3DULA 4HDMB 2O2JA 3WMEA 5HQJA 2BHSA 2OQIA 3EGCA 1V1MB 3B6ZA 3E0QA 3G0OA 2NPOA 3P2OA 3ZTYA 2OR3A 1QFXA 3LQRA 4MVWA 2VHYA 1V4BA 4TKUA 3D8SA 1VB3A 1NPYA 3DOIA 5DHUA 1WXEA 1D6JA 3HJFA 1YDFA 4UM5A 3E3NA 3MJSA 4NQRA 4B3HA 3IR7A 4OQXA 4M0PA 1P61B 1FLAA 3AWDA 4JLDA 3OX2A 5AHKA 4AYWA 1FVFA 5IUNC 3LKDA 4M76B 3EXFA 3IQDB 3MTEA 4TZTA 3K0SA 4Y1RA 5FKJA 1U7OA 2QI9C 5EQJB 1P1CA 1Q91A 1ZA1A 3M5PA 4V0QA 1GUAA 1VSQA 4YRAA 1GG9A 4E5SA 1SRQA 1B76A 1JW9B 2PMCA 2Q4TA 3EXEA 2JAWA 2XVAA 2N0SA 4GMGA 4H9GA 4PSAA 4PPNA 4LDJA 3EZLA 4IIJF 4L4YA 1T2NA 1UADA 5KNDA 3DBOB 4IH4A 4JB0A 1Q0LA 3VR0A 4U39A 1CQJA 1UT6A 2ZZKA 2P4QA 3ESQA 1QGUB 3GA0A 1Z5ZA 1U65A 1KFKB 2C4UA 5DNVA 1QGED 3GAZA 5ECDA 5B3LA 5I51A 3F5QA 3QE2A 4V1CI 3F5FA 1AUOA 4XQ0A 1I6WA 1VE7A 2KI5A 3R5KA 5L4SA 4P32A 1U7ZA 3CZ5A 3N2NA 3DE6X 1FW6A 2JKYA 4RK1A 1MV8A 1WMAA 1I36A 5DT9A 4XVHA 1Y1PA 3SZRA 4B6FA 1LRLA 3L9WA 1WOMA 4IS2A 4GC5A 1PLKA 2F1HA 3L7MA 4G67A 4B5LA 4HDKB 3VHXA 4X54A 3WI7A 3EVFA 3TTUA 1O58A 2C4VA 2OCGA 3PU6A 2VSXA 2JBAB 1BOFA 5F33A 1Y8RB 3EQ6A 5TVGA 1E3TA 2W2LA 5L9AA 3PQCA 1DINA 3FSGD 4UEQA 1RRFA 1XJCA 3M34A 4AICA 4P7BA 5B3KA 4RK5A 5EJFA 3I39X 5AW4A 1IY2A 1CKEA 3SJAA 2WYOA 2ZS8A 1V1JA 2CDRA 3LCRA 3NUZA 3CRVA 3LRTA 4R8LA 4N3BA 5KJ6A 1XN4A 2IU6A 2ZI3A 3A3KA 2GHQA 4OHCA 3SS8A 2FMTA 4W4TA 1CVLA 4AY4A 1JSRA 3KAKA 4FBGA 5DW3A 1NM5C 1HYQA 1U90A 2VPZA 2R60A 5T57A 5TSDA 3TOCA 4L4ZA 5FUMA 5EYPA 2ZAGA 4G26A 2ZSBA 1S9HA 1I94B 4RY0A 4HZUA 1LY1A 2ZE7A 3D6NB 4JGBA 1CUYA 4YDRA 3MPUA 3AVYA 2OLJA 1JKXA 4LTDA 2HQRA 5COAA 1CUVA 2FPSA 3W8EA 2V96A 4U7PB 4ADSG 4ES6A 5BSUA 3N2LA 3OO1A 5IP5A 1L7XA 4BNYA 3OT1B 3ZC3A 3GN1A 3VAZA 1AUVA 5AKHA 1MC5A 2I80A 2JI7A 2G36A 2HO5A 2PGIA 4PAGA 5CM8B 3G79A 2XLBA 4B3SB 2Q6TA 5A9SA 3MMSA 3PDUA 4JX8A 3HWX1 2RHOA 4I5GA 2ZUWA 5HIMA 5C0OE 5JNLA 1NVFA 2H08A 3OJOA 5DCLA 3B3JA 1J0DA 1EVLA 1V48A 4PSDA 5J63A 3I9NA 3KC2A 1RYBA 1V6AA 3K0HA 3OD5A 1LJUA 1I7QB 4G0NA 4PZCA 1KO1A 3F7NA 4ENUA 3AIIA 1UWKA 1Z5PA 2MR6A 1GL7A 2YV2A 1ZK4A 3LDFA 4DIEA 3PUJA 2C95A 4M3NA 4IWXA 4CF5A 1RYZA 2HFJA 3NXSA 1KZGB 3H6KA 4HUTA 3THWA 1CS0A 1HDOA 1TKCA 2GBIA 3KL2A 5C4IA 5K01A 3HJBA 4NFHA 4YRFA 4BL5A 3EGXA 4C5AA 5KDOA 3ZGLA 5F5XA 1XTBA 2P69A 1RAGA 5HE8A 1JTFA 4QVGA 4MDFA 1MQSA 1XVVA 1PLJA 4L75A 2WYUA 3KJZA 4RJJA 4ZDJA 2DR2A 1QRAA 4LNAA 5DYTA 4R54A 1K6MA 1QQ7A 2JGFA 3QKSA 1SCUB 4W5JA 3ZCVA 1X77A 3CZCA 5FWAA 3E1SA 4PXSA 2J1LA 2ASEA 1ONOA 3FNRA 3FVTA 4NOKA 3KVVA 4MCJA 3NASA 5AHOA 1JKJB 1HM5A 2ZAYA 4L8VA 4Q00A 2ILVA 2VJLA 1T0IA 3RAFC 3KZVA 3B1FA 1OI2A 3AEXA 1TVKB 4KN6A 3ZH9B 1ETUA 4TKVB 1N6KA 3OJ0A 1HE4A 3BJEA 4HBZA 4KIUA 3LPNA 4DIOA 2IJGX 4RA9A 1Q2XA 1GYQA 4PYQA 3UV3A 5FV7A 3WYDA 2A3RA 4W7HA 1YVEI 3SLRA 1S8NA 1DZIA 2XKAA 3N0TA 3I72A 3ORSA 1V4NA 2EX0A 3VOTA 2VVTA 2Q5JA 2XYRA 4EHNA 2CXQA 2RH5A 3HDVA 3LPAA 5KOIA 1BKYA 3OU6A 3M83A 1U3FA 4UVHA 2W37A 4BMDA 3HUDA 3M3DA 4WLNA 1LV7A 4RFSA 3NBUA 4ZTBA 1UXJA 3ENZA 1T8TA 1QHFA 2GKSA 4J0CA 4K2AA 4WRRA 3TEFA 3WMRA 1CEYA 2CV1A 1REQB 2P7IA 4H15A 1UFQA 3H4MA 2DFNA 2HPZA 1LFAA 1ZGJA 2JEYA 3UJ6A 2HF2A 2WVJA 3UJAA 2BKEA 3C48A 1Y6QA 5CP8A 1VJ5A 4WW0A 4HLUC 2Z4SA 1UBNA 2BJWA 4FEAA 1O95D 2G25A 1U1FA 4L74A 4JA2A 4UTXA 2GASA 1KEWA 2BTOA 4ML3A 1NPDA 3BWMA 1JXQA 2V7WA 5DNYB 1GGNA 4Q1EA 4QO8A 4BKQA 1L0BA 1HNXB 1HX7A 4BZXA 3CX8A 4O63O 2W2TA 4LOIA 1LDBA 2XPCA 5DX1A 2DBRA 2QRNA 2H7XA 2Y1LA 5KSOA 3IP1A 3RYFB 5GZ1A 4F71A 3MS4A 4OHUA 1JIIA 4ZU3A 3H2GA 3VSBA 2JLWA 1I1NA 1LK5A 2EJCA 1K2WA 1CP2A 1ISHA 3Q41A 4FDUA 1YZVA 1OX4B 5C8XA 4OQYA 4W6ZA 1W87A 2R8EA 3AUKA 3K05A 3L04A 4JCCA 4LK2A 4M1KA 1C3OA 1RM3A 4ODIA 2AG6A 3LO5A 4KNWA 5T67A 3O3OB 4JVSB 5FOSA 5T8KA 1GEEA 2Q27A 4GX0A 2O2XA 5GVSA 2PVCA 3BC1A 3PV0A 4YONB 5HCIA 3NAQA 4NENB 2XOEA 4TQ9A 5HX7A 3QWIA 2H0RA 4KKXB 3M5CA 3MTAA 3MT9A 4FLEA 2ZVQX 1G4HA 3IXQA 2BR4A 3BBLA 3B1WA 1ZSYA 3Q5DA 5D01A 1OBVA 3FYDA 5B55A 4AI6A 1GRRA 4OQDA 3GLFB 5FWYA 4MYHA 2EKBA 1WCIB 2CSUA 1EFLA 2V8OA 1FRVA 3PLRA 1YOVA 2G88A 3QLUC 4MR7B 2OXIA 1HE3A 1Z45A 2NZUG 5TARA 3B1KA 2VUUA 1G291 4TV9B 1EGQA 1PEDA 2FG5A 3VFDA 3PRJA 4IIXA 3PJDA 4OHPA 2I67A 1ZM2A 1DFGA 3KLBA 4DEYA 1L5KA 1AZTA 2M6LA 3VH3A 2WSSA 4GBMA 3GCXA 3QV2A 3JALB 4JP5A 4WN9A 5ETJA 3SQLA 4EG6A 1NQ5A 4BY9E 1V41E 2NVOA 1UQTA 1XU7A 3I6MA 2FZEA 3HVKA 3JQEA 3GOQA 4IGEA 2AXPA 3ZE6A 3RLFA 3B70A 1R6VA 5EP1A 1KDPA 1K7CA 1TK2A 3JR7A 4GI3A 3IP6A 1JFTA 3FRHA 2XHZA 3RYIB 4CKEB 4PRKA 5J2UA 2X1HA 4X1YB 2C4WA 2OD9A 1OCEA 3KVYA 4JDPA 4X64B 2A9QA 3KLPX 5EJEA 1NOKA 3KYDB 2Q5IA 4PXYA 1UIMA 4J7UA 3ZBQA 3THOA 3SBXA 2I8CA 1QHHB 4IJ5A 1H0KA 3GGCA 3PUVA 1U5BA 3QJYA 1CB0A 4TL7A 4WNIA 2Z2IA 3ZXIA 4A1OA 3U62A 1Y7TA 4C87A 1F4PA 1G8MA 3OFKA 1TOAA 1TA4A 3C7AA 1W19A 3WTBA 2XA1A 3QV1A 3NHZA 4IZHA 5IC4A 4HY3A 2YKGA 1M2WA 1G41A 3GBVA 4FNGA 1WCXA 2VL7A 1PK9A 2OTCA 4Z9YA 3SLKA 5JRZA 5FBQB 5AI8A 5JYDA 3N8KA 2QN6A 5DI3B 5L7TA 1EA7A 1K89A 5FNZA 4EFMA 1RCTE 4EF4A 3P9XA 3MGBA 4FT2A 1TNDA 1ZI9A 3HYSA 1KMNA 1MJ5A 3HHPA 1PD1A 5EIFA 2Q1UA 1TAGA 1RJGA 2P4SA 3H75A 1ZGCA 3FJYA 3MEQA 3C7DB 1DBPA 3V6LA 2JFQA 3G0CA 1ATZA 1IOWA 4GX5A 4IV5A 1SHKA 4BB5A 3BTOA 1UT5A 3CO5A 4OJTA 3FCXA 1N5RA 5ALNA 5FWDA 1JDSA 1HZZA 3H2JA 2JDIA 3CT6A 3S0JA 2LXNA 4PTLA 4HN9A 3FBTA 2ACWA 5EMHA 4OQMA 1P75A 3BORA 4LOJA 4N3CA 2IHBA 4ZRNA 4B3DA 4BATA 5JFOA 3C6ZA 2PZMA 3KDAA 4XAQA 4ZZ2A 2ZM6B 3PGKA 1D0SA 1MJHA 3QVLA 5LKAA 4LF7B 5CVEA 4DCJA 1MO5A 3AF3A 3HBMA 4LYYA 4QYSA 3CC8A 4UU0A 3ZD9A 2LBPA 1NMEA 2CXNA 3PL5A 4WY8A 3TKYA 5AP9A 1C9NA 1LFDB 1SUBA 1VJCA 4KO3S 1Y4DE 1TCBA 5E6SB 3RRNA 2P6OA 2GESA 1NR7A 2W71A 3GGJA 3NNNA 4FE7A 4MVYA 2IDZA 3M9LA 2GYYA 1KDVA 1M76A 3E8XA 3FCEA 1K3FA 3PNKA 4ROTA 4WIAA 3W2IA 1L5NA 1IWPB 4FSDA 2DTDA 3O8CA 1N9KA 2JCXA 2E9SA 2M9MA 5KNBA 1OGIA 3KSAC 2IBSA 2HCBA 1PT6A 1XG5A 1GCUA 4KQWA 2R7NA 1YJQA 4HXEB 1ZN7A 4Q34A 5CB4F 1Z75A 3FNHA 3IQEA 1OFTA 3H5OA 5DTEA 4LVUA 3IQFA 4L8YA 1ECCA 2DP4E 2HMSA 3EIHA 4NJMA 2NPFA 1RQRA 4MLCA 2DQSA 3VYUB 5KYNA 4PHHA 4A8PA 4RMNA 2P5UA 3PDIA 1VDMA 1YE3A 3L6BA 3WO1A 1N2ZA 3S8EA 1T6XA 3B85A 3CW9A 3GFOA 1FQWA 4NCNA 4DG9A 1A1VA 2QTZA 4Q6BA 3PPVA 2O8EB 5BV1A 1UPBA 3NM6B 1IHUA 3OZDA 4A27A 5AVUA 3E9RA 2BFCB 4XYBA 3KQMA 1XTJA 4A10A 5E3HA 3NRJA 4WXRA 4DAOA 4KTTE 4DMHA 5FV4A 3MWDB 2ZU6A 1BGVA 3LA6A 3NG1A 1SUWA 2H6EA 2JFZA 3EIOA 3L77A 3UY4A 1H9CA 3TH5A 3ORHA 1JLHA 3W4JA 5JJLA 1TQ4A 2Q50A 3ANNA 4TVKA 5ELMA 2PS9A 5I4KA 1KY2A 4FDVA 2B3TA 1A96A 3EC7A 2XMCA 3TZQA 2XUHA 3V9PA 1ISGA 1KEZA 3ZGOA 4LKRA 3QEJA 1NWCA 1V25A 5C1IA 2HFKA 1M6VA 1A1SA 1A95A 1Y5LA 3C7TA 3EFBA 3JD3A 3QVWA 4H27A 4L5IA 4D80A 3FPEA 1O87A 1ZJJA 2JK0A 4K6CA 2JH8A 2CC2A 2DPMA 4F2GA 1WUJS 2IITA 2YIVX 2MYTA 4WN3A 2AEFA 2Z08A 3P4UA 2P6MA 2WT8A 5HPYB 1GG2A 5AIBA 3O3CA 4LHEA 3TIXB 3BG5A 1XZMA 1QGAA 2YOGA 1VMIA 4IR7A 5ADHA 3C7CB 2Y1DA 1B1CA 3GAFA 2F43B 4K1XA 5FHQA 2O2HA 5DNWA 1VHJA 2GPNA 4KWHA 4R0NA 2GXSA 4CU2A 1K0FA 1Z0IA 2DF8A 4QUEA 4RJ2A 4U8GA 2QNIA 2XUDA 4HGPA 1E0DA 3TD2A 4PQGA 5AKXA 2F1RA 1SD1A 1TEHA 4LBWA 3ROZA 4V1CB 1G98A 3A7DA 1YAHA 4E32A 3A1NA 4LTNA 4OQQA 3PXGA 3NQ41 3GVIA 4CKCA 2P6RA 1A9PA 4H7HA 2C4TA 4OHKA 3N0RA 4MS4A 4Z7JA 5FUXA 3A31A 2D13A 3HYRA 4PG5A 4UARA 2AW3A 3D6TB 3CTMA 1A69A 1GN9A 1YCHA 4LI0A 1Q0QA 3I3OA 4M1EA 5ED4A 2YXNA 3ETNA 5E6UB 3RS0A 3WBKA 1I5OA 1YIAA 5FDFA 1AJEA 3DYVA 4XJVA 2O59A 1V5WA 5DGXA 5HNKA 4GZMA 4BMPB 1G16A 3EXHA 5JAOA 1BKSB 2Q2VA 2H4WA 1UBRS 5K3SA 3R6DA 1HO3A 3CLTD 2BMVA 4OHOA 3VBEA 1PZMA 4BCDA 3HB4X 2PRIA 4XR9A 3GJ3A 1P3Y1 4M7OA 2H2WA 4OGWA 4HEJA 4Q24A 2C5SA 3CRNA 3IAUA 3JQ7A 5FBWB 4M1OA 3W3AH 2YZMA 2PBLA 2GJSA 3HUUA 3PXAA 3Q9UA 3QE4A 3DGEC 1UBCA 4MRMB 1KK1A 2XMQA 3NFRA 4ZV9A 4I81A 4NCAA 4RKWA 3FNGA 1RRMA 4L28A 1TEXA 5A3SA 5EIBD 1YR7A 3K0FA 2FN4A 3FPCA 1FFXA 1P1BA 2VHQA 4M0UA 4J49A 4EGJA 3Q1LA 5F2NA 4KBYA 3HKEB 1PR3A 4A8HA 3QEMB 2SKDA 3RRZA 3TTYA 5LSAA 4MXDA 3QTTA 4GEKA 2CHGA 4YECA 1U7DA 4HB3A 1XEXA 4XWKA 1WB4A 5L4NA 3L8CA 3NUQA 5KYTA 1H1TA 4UVIA 3BK1A 3M81A 3WLHA 5A1JA 4JDUA 1W5BA 3CUKA 2WIJA 2VHEA 3OTQA 3KJHA 2ZSFA 1PFQA 2XGMA 2YJ6A 4KU4A 1OD6A 4LZAA 4RK0A 2H1SA 1IK4A 3FUTA 2ADFA 3NBXX 5FL7A 5CBKA 1I10A 2FN9A 1RJ9A 3F7TA 1MEJA 1R0LA 3FYUA 1PBNA 4IDFA 3H16A 5JBNA 3II6X 1FFBA 4G09A 4GRAA 1R6UA 2NO4A 2PBFA 3IKJA 3NIGB 2PANA 4CZ2A 1U0RA 1Q84A 1Z7WA 3IUMA 4Y0VA 4MKXA 1OAKA 1SUIA 2FPIB 2Y92A 1V3QE 1Q1ZA 3NYWA 3THRA 1EIWA 4C7KA 3CUUA 4X63A 5F78A 1U5AA 4LHZA 3BMXA 4RVSA 1BH2A 1CCWA 3V48A 2VHXA 2AYXA 1WXQA 1ZESA 1Y9AA 2WT4A 2OZVA 2ZB7A 4FGZA 4MB6A 5FF9A 5T8KC 4PGGA 3IL2A 2GVDC 4DMFA 1D0IA 1TQDA 2A0FA 2I3BA 3E82A 3K5WA 3L8ZA 3OZXA 3P71T 4O5AA 3GFRA 1OU0A 4DLBA 1PWYE 3U3XA 3SCZA 1T4CB 4LFBB 1EP9A 2BTEA 1H85A 2J5XA 2GN2A 5FPSA 1HA3A 2C8JA 3EXG2 2GO7A 1AF7A 3MMNA 3BIJA 2YIMA 4FXOA 2HB6A 4MAAA 4U3JB 4UXHA 5H68A 3ROQA 2OXFA 3CNBA 4NR0A 2ADOA 1J90A 5AIAA 1DTEA 2FPGA 5HEKA 5EAIA 4BO2A 3A2MA 3AJDA 3RK0A 4CKZA 4MKRA 1EVJA 4EW2A 2H4FA 1F06A 1P2SA 2OBFA 3HCWA 4R84A 2R0QC 1V7PC 4JYCA 1Y48E 1VPLA 3ZLUA 4F60A 2VDNB 2CE2X 3G8CA 4W9NA 1XMIA 1GQOA 5HKAA 1J4AA 2AXNA 4M0KA 1HL7A 4CTOA 3BGWA 4LZLA 1K3TA 4P08A 2FMHA 3QEOA 5F3DA 2WWXA 4ENTA 2NU6A 1GAWA 1P3DA 4DTCA 5CTJA 3IP5A 1FSFA 3L6RA 3MQFA 3F5DA 1B8PA 4M54A 5EFOA 3OESA 1B93A 1JG1A 4Q0MA 4CHGA 3W3AD 4PC3A 4CKWA 2BBWA 1VHLA 3G5UA 3HKDA 5KQGA 1WXHA 4BDTA 1OF1A 3RK4A 3NJRA 1OR8A 4IO1A 4FW9A 1GNLA 3GCZA 3OG9A 2ILTA 2R48A 3OTHA 3HCEA 2VP5A 1KDYA 1V3VA 2QLLA 1CWUA 2EKQA 4IJUA 3S29A 3V2GA 4DXDA 4UUQA 4IDNA 3NHBA 3E27A 5MFZA 1E2EA 3EE6A 4LBYA 2POCA 1X2BA 2JFBA 2HAEA 1UBUS 3F2VA 1KEVA 4E51A 1C3JA 2EF0A 1MXFA 1ZVMA 1Z6AA 3PFHA 4XSGA 3RYCB 5KNLA 4ND3A 1KA9H 4L16A 2H4JA 3UV6A 4QAQA 1BG6A 1HOTA 5ITWA 1H8HA 2CUNA 2J32A 2VDLB 4QHYA 5C1OA 2X0RA 1PR0A 3BB1A 3QU2A 4XR4A 4PO9A 3VR5D 4OXYA 3E53A 3WLQA 5IZCC 1PL8A 1EG7A 4AURA 4BUCA 1VG0B 1LK7A 2IYVA 3R77A 4HPWA 3TSAA 4BNNA 1JRLA 1G8FA 1GVHA 2F67A 4EGQA 4MP3A 2ZG6A 4AJ4A 4QYMA 3K8ZA 1S3SA 5HZHA 5UKDA 1TTHA 3LOPA 1P8JA 5C9ZA 2C7RA 2QK4A 3FYCA 5FO0A 3BMCB 5F77A 2B8TA 4OGFA 4JJ7A 3BE6A 2C92A 4XWOA 3PCRB 4TLCA 3OE1A 4YCJA 3DQZA 5ELLA 1CF2O 2DFVA 1Z06A 2FB9A 4DCGA 2ZEJA 1OH7A 3N58A 1GADO 1VHWA 3AR7A 3LFUA 1XRPA 4WESB 2PBRA 1ZK2A 3K70D 3AVUA 3ZZNA 1GGKA 2JGAA 3DKRA 3L7CA 1PG2A 1Q3KA 5DULA 2XDQA 3AK4A 4BNHA 3IOEA 5JZ9A 2VYVA 3NALA 1P7CA 3MJVA 3AILA 4G4SP 5REQA 3WICA 2LDXA 5H02A 1UEXC 3W3AA 2IHTA 4DC1A 1ML4A 1UJBA 2H8KA 2GNOA 4IIJB 4FFOA 2Z6VA 4I0WB 4U2DA 4F5YA 2VC2B 3KWMA 3EGIA 1DPFA 1KSGA 1SZCA 2CEKA 2UVPA 1H6BA 1CUHA 1USGA 1P0QA 2IC5A 3M6LA 2QRKA 4XKJA 1RKXA 5LFAA 2HYDA 3SR0A 4E22A 2FDRA 4IL5A 1AXGA 1ZSVA 5AW6A 1EHCA 2BR3A 4RK4A 3WP1B 3ZOKA 3IIJA 2DSTA 5H82A 3UV7A 4AUKA 2XRZA 3CE6A 3MQ4A 5CD9A 3EMVA 4YLEA 2ZSJA 3PX3A 4RD2A 2YN2A 1FSZA 3T7TA 1XF9A 1QOZA 2E21A 3IMFA 4F6LA 1O6ZA 4HGYA 5AW0A 1R4NA 3HYTA 2GZSA 4YHBA 1J20A 4C7XA 1SMKA 4TVSA 2GBPA 3GYBA 2E4VA 1CUBA 4GNKA 5EI5A 4DMCA 2FOLA 2O3QA 1T8RA 3C7KA 3GYGA 4F8JA 5CK5A 1MIHA 4ARZA 2JANA 3U7HB 3K1AB 1NP3A 1NFQA 1K1EA 4D9BA 2I3DA 1P4AA 1KP2A 1HRKA 2VRWA 1RZVA 1T0JB 2WJIA 2M6SA 3A6ZA 1QHIA 3DKKA 3JD1A 3QPVA 4FX5A 3UXYA 1ZG3A 1V5IA 2RBEA 4D0SA 4GPAA 4XTRA 4YRRA 5IASA 3UJ8A 4E5NA 1X1AA 1XQYA 2FFJA 5KAMA 1E9BA 4HD8A 4LJKA 5BVGB 1DC5A 2W0SA 4XGQA 3E7WA 3ZWQA 4BLSA 1GUFA 1ND6A 1BVYF 1ZNQO 2RSLA 3Q3VA 2IHJA 4M0DA 4D8WA 4WPGA 1SXIA 4CM7A 1BU8A 2ROQA 1LI5A 3FNIA 1FF9A 1BS2A 3C3WA 4L50A 3IMCA 1IHYA 2Y1XA 2F3TA 4HQ6A 4QASA 3S2ZA 3ZKWA 3BOSA 2JFOA 3MT8A 4LJRA 4BFVA 2WUEA 3B8EA 4PHCA 1QGOA 4ISBA 5GOTA 1LDGA 2VRNA 3AW8A 2YWHA 4JNCA 3X1ZA 3FJ1A 4Q01A 1RM5A 2ZLBA 3ZYZA 1DB3A 3EEQA 3P96A 3PPIA 1MF7A 1LTHR 1Z6XA 4YP7A 1YJ5A 1CZHA 1O6FA 2XV1A 2Z09A 3GUCA 3PT9A 4LY9A 5CLQA 5BSWA 7AT1A 3AVXA 2W70A 3EOBI 5FBZA 5ILOA 4RD3A 2FMIA 2R96A 1E2HA 2RAUA 2VNHA 1W85B 2GD0A 2X15A 1FY2A 3LGAA 2JFNA 4LY3A 4Q9JA 4BJ1A 4EF5A 8AT1A 3OLXA 2XKJE 3NO4A 2HMTA 4DV6B 3OT1A 1PQYA 4AMGA 1DXOA 1PGPA 2FW7A 3K6RA 3SHWA 2WJAA 1QAQA 2B8WA 2OQVA 3V8RA 3CH5A 4R2WA 3TQHA 1AU9A 2F00A 5EQFA 5AHWA 3N5KA 3W5VA 2Q4DA 2YXDA 5KQPA 3OZAA 1DBSA 2IT1A 1Z38A 4UHCA 3P4YA 2J3EA 4TOIA 5I8PA 3KYIB 2V9PA 2AVNA 1ULHA 1JEEA 2ZBUA 2BMAA 3QF7A 3ZWAA 3F7OA 1K98A 4KLCA 2ZIVB 4BMSA 1IXKA 1T1EA 3TRFA 4Q02A 3N2GB 5TX7A 2J9XB 2BT4A 1CTQA 2ZANA 4FIDA 4LXUA 4BQNA 1W9MA 5F7OA 2WAMA 3OX4A 5AR1A 2JCSA 5AVZA 5KNDD 4F5DA 1IWOA 4R9NA 3OWHA 5COQA 1FLVA 2N42A 3PGLA 4WNAB 3K30A 3REOA 3VGJA 3NGMA 3K16A 3OFVA 3X1MA 3RSLA 4H7DA 1X94A 4KZPA 4JI6B 4WXHA 2V7UA 5CLJA 4CMEA 1ZCJA 1JR3D 3O2NA 4LJ7A 1H6CA 3KOMA 5LWHA 2Y4OA 1LBQA 2I7VA 4X84A 3C3DA 5JAPA 3AZQA 4BO3A 3KR9A 1JJAA 4P38A 3GPDG 2JLCA 2VDWA 5FNVB 5CA1F 2GPBA 4N9WA 2B4AA 2IYLD 5HXAA 4A0RA 2ZJ0A 2IELA 1I4EB 3GNLA 4IO0A 2QTNA 5JY6A 2I8LA 3ZDAA 2IGBA 1S8AA 4PHGA 3QWFA 5AICA 1HOXA 2IYRA 3OPVA 1VMAA 2G08A 3FYUC 3ICWA 3MLEA 5EIBC 2W2LD 3TSZA 1IZYA 1X70A 2OBMA 3C3MA 3SVZA 3T99A 4D8VA 3GJTA 1GSHA 3KKEA 5THQA 4TX1A 2QYSA 3LXMA 5A9RA 1ABBA 2JZCA 3U49A 1L5ZA 4I3GA 1AA9A 1L5FA 4P3NA 3UGJA 1FFYA 2Y1KA 1ZICA 1X92A 2OV1A 4MUGA 3E0XA 4JBYA 2OHXA 2ZI6A 3IT1A 1TCCA 1SQGA 2B5VA 1X3LA 4D44A 3IEPA 4WDQA 4GE0A 5AKJA 1KQGA 1E3SA 1ODTC 1YHNA 4FOOA 4OJMX 4RVUA 3WY9A 5B1EA 4A82A 1SCNE 5KSWB 2BV3A 2PVPA 3CM0A 1Q50A 4OLAA 1OFUX 4PS1A 2XYVA 3R3WA 2FPXA 4QULA 1YBHA 4BBAA 4YRKA 4HR7A 3OPMA 5LIPA 2WWIA 4W5HA 4XD7D 4CKBA 4YRCA 4QHSA 5TQ0A 2YRFA 2VHCA 3JRWA 4M8SA 2NN3C 3RC9A 2ISCA 4YJDA 2RB4A 1GNQA 5C5IA 2J33A 4BO1A 3KQUA 1ZUHA 3SP1A 5JDCA 1XTSA 4A91A 2AFIE 2EKDA 3QQPA 2ZW9A 3ITDA 3F6PA 1F1BA 1R5OA 4LXYA 4UOEA 2VK8A 3PRKE 4C4OA 2FSPA 5JWOA 2VF5X 1JR3A 1NJSA 1NZFA 2EHJA 2NAFA 2QY9A 3NR2A 4ZZ1A 4I4TA 1NQVA 1J1UA 4YP6A 5F73A 3AB7A 2C5GA 1YQGA 1QMGA 4EPXA 1YSCA 2GEVA 4RIFA 4B2YA 4JOBA 4NCXA 3HJUA 4OFBA 3OWXA 3AETA 4DCCA 4OVKA 4GGMX 3O9VA 3WK6A 1FLDA 2IHYA 5HM6A 3BJZA 3U60B 3D3NA 2OD7A 2B5OA 3SSAA 1GFWA 2GBGA 1HLPA 4P3YA 2DT5A 4MRRA 4AJNA 5EHZA 1AMNA 3G9ZA 2BRUA 2VXBA 5JQGB 1NG9A 3IESA 1EGHA 1RLTA 2C29D 2HLDD 2WZQA 3UAGA 3FLMA 4HNUA 1N4AA 5EJ8A 3Q3GE 5D3QA 2YHIB 3UFXA 5CA1B 3ZVLA 2PMBA 4FYPA 3ZQJA 4D3SA 2CFOA 3DTVB 2OZPA 5HIKA 4CLRB 1XK7A 1ZA2A 1U0HC 1KR5A 2A86A 4P7JA 5CNMA 4BZPA 3JQFA 4XVCA 2AKYA 3Q3IA 1XQ9A 1G38A 4QTTB 5MHTA 2A0KA 4FFRA 2BEVB 5FIUA 2C9MA 4MQEA 1FFWA 1P81A 1SUFA 1W5FA 1Y9ZA 3LBAA 4I50B 3OM1A 3RS7A 2V7XA 4B79A 4DOMA 4F84A 3H9BA 2JKZA 1T2EA 1DIAA 2H2DA 3MZ0A 4QELA 4QYTA 7ABPA 3O74A 4OBEA 3LM8A 5J4KA 3LUHA 3QUTA 1NJ6A 1QM5A 2YFYA 4O1MA 1CHNA 2TRSB 4O5OA 5B5SA 5IFKA 4NECA 2CLLB 2A5DA 1PFGA 2PGAA 1YS7A 5E3IA 1IDN1 1K8XB 2PEYA 1ZS9A 4UE2A 1YVPA 5BVGA 5A7FA 3N8GA 2J67A 3IJEB 2UYGA 4HG2A 2VP4A 5DP1A 4ZIRB 1T0UA 4FILA 3LWNA 1XMQB 2EJTA 4XYGA 1KNXA 4UNQA 3F6EX 3L93A 4IBOA 3ZLTA 4FQ8A 3V4LA 1NMYA 4HDNB 1L5HA 4R2LA 1NX9A 1DTWA 1W9HA 2IP1A 2XUGA 3AY7A 1HEYA 1E3WB 3NS7A 3UJ7A 4IJKA 4JK3A 1UMBB 4CLRA 1TE2A 1U8YA 3L82B 1GZ5A 2ZYIA 1NW7A 1DI0A 2UZ3A 4POAA 1B3RA 4HS4A 5F21A 3MAAC 3L0CA 1XXLA 2B6NA 3CZPA 3INRA 3LX6A 3N05A 3PJGA 3VZSA 1LV8A 2MYUA 4BP9A 3T3OA 2EWWA 4IHKA 1QH1A 1ZIOA 2PUEA 9MHTA 3ML1A 4R1UA 2O2GA 4XOUA 1WSAA 1RAIA 3H1BA 3ZHZA 5CVTA 4QT0A 1BAPA 3DNMA 3HQ4O 3CPHA 3FCAA 3HVUA 1UBGA 1VBNA 1UC8A 3R09A 1ZP6A 3BAFA 2EJBA 5IWAB 5CFZA 3I01A 3SR3A 5ICMA 2NU8B 5LLDA 1TD9A 4X20B 4HDNA 1J2YA 3BXEA 2PTGA 3DD5A 4R51A 4Q3AA 3GQVA 2VCHA