4BMNA

Apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
252
structure length
232
Chain Sequence
GPAMYRLLNKTAVITGGNSGIGLATAKRFVAEGAYVFIVGRRRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPIATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCLOHOL DEHYDROGENASE/SHORT-CHAIN DEHYDROGENASE
publication title Structures of Alcohol Dehydrogenases from Ralstonia and Sphingobium Spp. Reveal the Molecular Basis for Their Recognition of 'Bulky-Bulky' Ketones
doi rcsb
source organism Ralstonia sp.
molecule tags Oxidoreductase
total genus 91
structure length 232
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bmnA00
4DREA 3BAZA 3NGLA 5DBFA 1LSJA 2UVDA 2O3QA 1N7HA 1BDMA 1YL5A 3GQVA 3W4KA 2NUAA 5JC1A 1A4UA 1GZ3A 2X5OA 3LLVA 4RPKA 3RWBA 1ZIDA 1I3MA 2B4RO 2CFCA 2H6EA 1NFFA 4PRKA 4Q3AA 1NASA 5L40A 2NM0A 1PJ3A 1BGVA 1ZXBA 1X1EA 2BFAA 1T4BA 3IKVA 2WD8A 3GDOA 4IMPA 1KVRA 2G76A 2YHUA 4Q3EA 4PLVA 3ZWOA 2HMUA 4CQLA 3L9XA 2Y1GA 3H2ZA 4XWYA 2DFDA 4ZICA 3AFMA 1IPEA 4E3ZA 5CDYA 2VHYA 1VKOA 1K5HA 3PEFA 4J90A 1DRUA 4KOAA 1T1SA 5TX7A 3WGIA 4ZQHA 2WD7B 3EZLA 3RVDA 3QVTA 1MA0A 2NWQA 3JQ7A 2QHXA 4M49A 3WQQA 2XXJA 3W8FA 1NR1A 4WASA 1N8KA 3LF1A 4OM8A 1HDZA 4JNKA 1U7TA 3FCOA 2FZEA 3EGOA 4FCCA 1FDSA 1AXEA 4CM8B 3HG7A 4XR4A 1ADCA 4TKMA 5AOVA 1P9LA 4KP7A 4CV2A 2O3UA 4MKXA 4WEQA 5JLAA 4C7KA 1HE4A 3AUSA 4OHUA 1U4SA 2RHRA 4I9UA 5JYEA 4E4YA 5MDHA 3EDMA 5JE8A 3RUCA 4DC1A 1UDAA 5CDTA 4LSWA 2DKNA 4BKUA 2WYUA 5I7FA 3RCBA 3WR5A 5G0SA 2HDHA 1C0IA 2EV9A 3D3EA 4D41A 1F8GA 4MOWA 3UXYA 2FR0A 2B36A 3HHPA 1F14A 3PFFA 1LU9A 2V6GA 4QO7A 5ES3A 4DUPA 5A1TA 1VC2A 2EERA 4BGUA 4P38A 4CLRB 1XU7A 4FGWA 1FK8A 2P9GA 2JFHA 4U0KA 4KUEA 2O7QA 3K92A 1GFSA 1HF3A 4ZJUA 4IQ0A 4W7HA 1H6CA 2ET6A 3ZNPA 1EDZA 2A9FA 3LT2A 3H8VA 3DBRA 1LNQA 2X86A 3BMQA 4PG5A 1SC6A 4KDFA 1HE5A 3WTBA 2GN6A 3VH3A 1VE9A 3L07A 4Q3CA 4HXYA 4DA9A 5THQA 4ID9A 3RJ5A 3T4EA 3MTJA 1QLJA 4JXKA 4BQRA 2ZTLA 1HETA 3PFWO 1R4NB 3OF2A 4KTVE 3UFXA 3H9EO 1LC3A 1XQ1A 3KYDA 1NNUA 1PL7A 2NACA 3JQCA 1HEUA 4HFNA 1GQYA 1QYCA 1MFZA 2VRCD 3ADOA 2EGGA 3PLRA 1I5RA 3FWNA 1QV7A 4FIZA 1P1JA 3IP1A 3SVTA 3PQEA 4N5LA 2O2SA 3CZMA 1GD1O 3I3OA 4MO2A 5IN4A 1C1XB 3UN1A 4ZQGA 3G17A 1BXZA 4BO1A 1VRWA 1ZUD1 1A9YA 2Q4BA 1CDOA 1M75A 4UUNA 3TDKA 4IMRA 2RH4A 2ZCVA 5H81A 2GSDA 2JL1A 2DTDA 4J1SA 2G5CA 4BB6A 1DHTA 1XWFA 4L0QA 4UULA 4MKZA 4MVJG 3I9KA 2BKAA 4CR7A 2CUKA 3E9NA 2IEBA 2WYWA 4LRSB 5JCJD 3RIHA 2UUPA 3DEYX 3GPDG 3WQSB 4WK6A 2P91A 5GZ6A 4YJGA 5JC8A 3NDJA 1Y5MA 4O6VA 3ZWWA 3Q3CA 1ZSNA 4CL8A 2G0TA 2OFPA 1SEPA 4TSKA 1E0DA 1BTOA 1X7GA 5K6AA 1LI4A 1ZW1A 1UXHA 2VTDA 3GN2A 5KVQA 3KYCB 5HTOA 2J3KA 1XHLA 4RVDA 2BI8A 4FS3A 1H6AA 2DBRA 3VOSA 1SMKA 4WJZA 1UAYA 1PGOA 4MPDA 3IC5A 1XLTA 4PLFA 4MVJI 1K0UA 1NVGA 3OHSX 3U09A 4GI2A 4N18A 2F1KA 3RFTA 2VRCA 1M66A 3M2PA 1SB8A 2IZ1A 1NX6A 3ZU2A 5LDHA 4R1SA 1YOVB 5C7IO 1NQ5A 4WLEA 4TWRA 4KQWA 1U5AA 2ZTMA 2ILTA 2I99A 4QQRA 4IQGA 5EIOA 3R6DA 2ZKLA 1QRRA 1F8FA 1PS9A 2D4AA 3ANMA 1I3KA 3U49A 3ZWXA 1PQWA 4L4SA 2HRBA 3TL3A 3V1TC 4DL9A 1FDWA 4FOOA 1OAAA 1CYDA 1TT5A 3DAFA 4CM4A 1LDNA 1SPXA 4ZD6A 3IL2A 3D5QA 4WLFA 3DOCA 4Y98A 2QRLA 1HL3A 5AXCA 5HA5A 3SJUA 1XR3A 4FR5A 3WG9A 2O23A 3CEAA 5JCJA 2NVBA 3Q11A 3S8MA 2EXXA 2PWZA 2HRZA 4ESOA 1GV1A 3DAGA 1R4MB 2PV7A 2Y1OA 4I5GA 3W6ZA 2VHZA 5KJFA 4FBGA 3ABIA 3ZW8A 4CM3A 5TNXA 3SBOA 4UUPA 2X0RA 3OETA 3L77A 2J3JA 3G79A 2FZWA 1BHSA 3TZKA 2W90A 2HLPA 4LMPA 1Y8QA 4Q3DA 1GEEA 3FTNA 1H0KA 3S1LA 4EUFA 7MDHA 4RO0A 4BO5A 3QWBA 3GG2A 4EBFA 5I9NA 1M6WA 3WGYA 1YB4A 2H5LA 3A06A 2VZ8A 1ENPA 1OFGA 1QYVA 4B4VA 4PCVA 1YH3A 2C5EA 1PWXA 1D1TA 1EQUA 5TJHA 4PG7A 1IB6A 4YJFA 4XYMA 4Y67A 4YWJA 1HKUA 2D3TA 2ZJ0A 4XA8A 2C7GA 2P9CA 1AE1A 3BZUA 4PLTA 5HM8A 5K6AC 4QTZA 3I9MA 1LLCA 4J49A 5GZ1A 1PJCA 2BGKA 1PGNA 5KVCA 1E1NA 1G0NA 4XYGA 2YZ7A 4L8VA 2E37A 4WLVA 1LSOA 3DBHB 4YVFA 2BI7A 3RFXA 3ZI0A 1GYRA 2VNAA 3BXXA 4A0SA 3LT4A 2DBQA 1HYHA 3L4BA 1WDMA 4TVOA 4ZRMA 1PZFA 4OAQA 4TRMA 4BNLA 3HN2A 1ZJYA 1KY4A 4M89A 1ZK3A 3GOHA 1I10A 1MC5A 3KO8A 1EE9A 2CD9A 4PLZA 2Y1EA 3I9NA 3OSUA 3QV1A 4J3FA 4F6CA 2VNSA 4OO3A 3VDQA 1VL0A 2DBZA 4GX1A 4P4LA 4NBTA 4J43A 4OSPA 4D45A 3BHJA 4M87A 1ENOA 3WBFA 1N1GA 3MJVA 2LDXA 1FDTA 3RU7A 5A3VA 2X9GA 3KEQA 4AFNA 4EEXA 3BMNB 3ASUA 3SX2A 1O94A 3KSDO 1EBUA 3AJRA 3L6DA 5JBIA 4G2NA 3PWSA 4YR9A 2QIOA 1BDBA 1UP4A 4CMGA 1EK6A 1LLUA 1Q7CA 4EI2A 3RBZA 5L45A 4DVJA 1JW9B 4KMSA 4H15A 1P0CA 1CIVA 3FN4A 2O7SA 2OO5A 2Y66A 1K6XA 2PTGA 2HU2A 1I3LA 5KWEA 4XQGA 4XJTA 4XR9A 3BTUA 5KIAA 1QKIA 1RM0A 1CF2O 4BNYA 1QG6A 1GUYA 1DHRA 3OMLA 1M2WA 3RUDA 3WQRA 3GEDA 4ALMA 3LT0A 3IMFA 4B4WA 4KWHA 3V2HA 4DMLA 1E6WA 2NU6A 3G3EA 4U5QA 4BNWA 2C0CA 5COBA 3E5RA 1CRWG 2D59A 4AJHA 2BH9A 5KVVA 5COQA 4AJEA 4MVJD 3W4JA 4P4GA 3AK4A 3HDHA 5ER6A 4PG6A 4TQGA 1QR6A 3I9JA 2EWMA 3NT4A 4IZIA 4R41A 4CMKA 4DLAA 3DMTA 3L4BC 2O48X 1LDYA 1PQUA 2Q4EA 4YJHB 4YTEA 1IOLA 4HBGA 2OOSA 5KJEA 5CPBA 2HCTA 2HK8A 3F6YA 3IS3A 3RC7A 3E48A 5EPOA 4E33A 3D7LA 4D0SA 1I2BA 2FPIA 3E8XA 2R6JA 2C5AA 3FNGA 4MP6A 4RPHA 3HB4X 3U62A 4FC6A 3KLPX 1PGPA 1EVYA 3EAGA 4IGEA 5B4VA 1YONA 2DM6A 1H6BA 4CMBA 4U7WA 1PZEA 1XG5A 3JQAB 3VZSA 2DUWA 4BS9A 2DT5A 3BA1A 4GLOA 6LDHA 1IE3A 2Q1SA 4BO8A 4XX0A 3WMXA 4RPGA 1SB9A 3E9QA 1E7QA 3L6EA 1P31A 4CMHA 5IZ4A 2CNBA 2V7PA 5B4TA 4NHEA 5BSGA 4EJ6A 4IINA 5JDCC 2C54A 4G81A 4L75A 1X0VA 1A4IA 3E03A 4HADA 3O03A 5FYDA 4EITA 4J7UA 2Y1FA 3GLQA 3MTGA 4LVCA 3QP9A 1YDWA 1Z82A 3WBBA 5IXSA 2AEMA 1MLDA 1HDGO 3PWKA 3UHAA 1X7DA 5IN5A 3OJFA 1X14A 3I83A 2NU7A 1ISGA 4FFNA 4CMJA 3GUYA 1HWYA 2YV2A 3KYBA 5A9RA 2QZZA 4P4NA 4TRNA 4YPOA 2P68A 1DRWA 3TJRA 3DWFA 2YFHA 3BTOA 3JQ8A 2PKQP 5AVOA 4MVJH 1TVEA 5DBIA 3KHUA 2CDBA 2JFFA 4WCFA 4Z9YA 5A9SB 1HSZA 2VUUA 3C7CB 2VOJA 5I8ZA 1YKFA 2FSVA 3Q2KA 4ITUA 3AOEA 3V2UA 1YBVA 2JHFA 2QYSA 4GBJA 3WYCA 3K96A 4A5OA 5L7TA 1EFLA 1R66A 1NYTA 5F3RA 3LF2A 3VPSA 3ICPA 2JD1A 4NQZA 2ZK7A 2F00A 3DMTC 2WE7A 5CP8A 2PKQO 3EZYA 2TMDA 4IXWA 2DQ4A 3GVPA 5F5NA 2YY7A 1QP8A 3C85A 3HDJA 1NTOA 3LC2O 3MWDB 3ZU4A 2Z1MA 1N92A 3GGOA 2W2LD 1UP7A 4J91A 1VSUA 4LN1A 7ADHA 2HQ1A 3GGPA 3K8ZA 4NU5A 1KYQA 4XYBA 1TI7A 3LYLA 4R16A 3WMWA 4XYEA 1NWHA 3NDRA 1LUAA 1PIWA 2HO5A 1F06A 4HUJA 3UH1A 5L4SA 5L3ZA 3JYQA 3EVNA 4UVGA 4RORA 3VPXA 1I2ZA 2VRBA 1LX6A 1BW9A 1DJNA 2BMAA 3U4IA 4A73A 3RFVA 1LA2A 3S2GA 3GNTA 3GRKA 1JDJA 2CMDA 3DFUA 3CXRA 3NRCA 4CUKA 1SAYA 1BVUA 1ISMA 1I2CA 3ZWVA 5CDSA 4K1LA 1M76A 3QSGA 3HDYA 3PIDA 1P45A 3QHAA 3QVWA 4B7UA 5I7EA 1N9GA 3RUHA 1F12A 2WWRA 5U4QA 3ULKA 3ZWMA 2EP5A 3KTDA 3JTMA 3W1VA 5TLSA 4OKIA 3KLMX 4IY1A 4S3MA 1NPDA 4YB8A 4IPTA 3R1IA 2OBYA 4FDAA 4IIVA 2AE1A 4WCFC 4EW6A 1ZK0A 2CY0A 3I6IA 2W2LA 3H5NA 3V8BA 4YRBA 4Q3NA 1E6EA 1AUPA 3UAGA 5IF3A 3PZBA 3SC6A 3JD2A 3AOEC 2HJRA 3QJ5A 4DRYA 3M2TA 3MJCA 5TGDA 1I01A 3PYXA 1UUFA 3CIFA 4A10A 4IIUA 2PH3A 3JQFA 2V65A 2Q50A 3FF4A 3DO5A 4OMUA 3WB9A 5JY6A 3DHYA 3N74A 2PK3A 3R3JA 5JSFA 1AGNA 1WAMA 2YHIA 4II3A 2HMSA 4UUOA 1DSSG 1WMAA 2P5UA 4OGWA 1E1LA 3STHA 3ZWPA 5JY1A 2GERA 3Q9UA 4CLXA 5DNAA 3OIFA 2W8ZA 3TRIA 4Z3KA 4J6FA 3GK3A 1KVSA 1CQIA 2DFVA 3Q2IA 4NNJA 3ZWBA 4OIMA 4RF4A 5DZSA 2FP4A 2YV1A 2XOXA 1J49A 3HUDA 3JQGB 4NZ9A 1CERA 1YO6A 4NBUA 1JAXA 1T2AA 4E2WA 1HE2A 3P19A 1I32A 4LVUA 2ZQYA 4NBWA 3LDHA 4PLGA 4O1MA 3JD3A 3QWFA 1PGJA 3KVOA 3IQDB 1E92A 1EFKA 4HY3A 4B8WA 4B7XA 1NQTA 1NQOA 2AEJA 2ZJ1A 4H7PA 4NDNE 3S55A 5F1PA 2G17A 2NVWA 3PXXA 5EESA 1T1RA 1D1SA 4UEKA 1WW8A 5G0WA 5JMPA 1IHYA 1K2WA 1B3RA 1DJQA 4U6SA 3ZDFA 3IJRA 1YQDA 1B8PA 4BV8A 2Q1TA 4NFHA 1GQ2A 3PHLA 3ZHXA 2VZ0A 1BVRA 4CM6A 5A03A 4RV9A 4RQTA 3I4CA 3AY6A 3MEQA 5A4DA 4ALIA 1I30A 5G0UA 1QYWA 4AJPA 4I8XA 3HJAA 4JBHA 3K73O 2ZYAA 5H82A 4CQMB 4UVDA 1N5DA 4XGNA 3N58A 1J4AA 5ENDA 2P2SA 3ROQA 3OP4A 1HRDA 4FOSA 4XDYA 2GD1O 4CM8A 1E3WB 1U2GA 1H93A 1NPYA 2NADA 1KY5A 3INGA 4GL4A 2NSDA 2ZB8A 1Z7EA 4RQUA 2EIHA 3HNPA 3RUEA 2ZTUA 1F0YA 4JROA 1DLIA 4F6LA 3HADA 3ZCXA 3S2FA 2NNLD 4R1NA 4LSMA 2Q2WA 3ZNQA 2B5WA 3ON5A 1H94A 1NP3A 4WEOA 1U5CA 4DXHA 3RUFA 3JQFC 1EVIA 1T2DA 4BMVA 2VWHA 5ITVA 1X15A 4FFPA 1WDLA 3H5RA 4XEHA 5CDUA 2I3AA 3ANNA 3GA0A 3R3SA 4GH5A 2X8LA 4OOEA 2W2KA 1PGQA 4QUKA 1UZMA 3KSUA 2FRDA 2QQ5A 3OJOA 4KUHA 5B37A 1SO8A 4PZCA 3ZW9A 2FOIA 1DIRA 3TZHA 4BNJA 3FBGA 2QRJA 3TN7A 4CQLB 3H9GA 4HV4A 2DPHA 1UR5A 4YAIA 2AQKA 2YUTA 2VWQA 5ADHA 3DZBA 3PHIA 4XB1A 3WGZA 2DLDA 2FHSA 4BO7A 2B69A 2I3GA 2C59A 4OKNA 5DULA 1L7EA 1PJ4A 2XPCA 4BO6A 3GMDA 4BO4A 1DIBA 3NJ4A 3NJ8A 3OICA 4ZN6A 3DZJA 3ANLA 2I76A 3JD4A 3WICA 3NEPX 1IYZA 3WIEA 4E6PA 1LEHA 4YT2A 1DC3A 4IQ8A 4EZBA 3GAFA 4JK3A 3AY3A 3AWDA 1R0SA 4H16A 1GR0A 3AFNA 4YDRA 4KUGA 2LDBA 1HSOA 3WWYA 2JHGA 1AHIA 4J1NA 4Q9NA 2V6BA 3EK2A 4CV1A 9LDTA 1P1IA 2Y0CA 4AJOA 1JA9A 3DZHA 4BO3A 3G1UA 1YWGO 3AU9A 5MGBA 2HK7A 3GFGA 5C5IA 2QZ9A 3DXFA 4TROA 1O6ZA 5IDQA 3D3WA 2CZCA 1P74A 3VDRA 3KB6A 1PZGA 4BQPA 5U1PA 1BXKA 4YAKA 4MINA 3AI3A 1HDCA 2NQ8A 3WS7A 4WOJA 2EKQA 3DBRB 4XQ9A 3KBOA 4RPLA 1IULA 4ZU3A 3BMQB 3QY9A 1A7AA 1AXGA 1ZKMA 2GLXA 2JAHA 2X6TA 4ALJA 3ZNNA 3SXPA 1ISIA 2VWGA 1YQXA 3DZGA 3GZNA 3ZGYA 2I9PA 4NIMA 3MJSA 1DIGA 5EMHA 4PIVA 4A03A 3D1LA 1PZHA 4MP8A 3ETEA 3FNHA 1ZMTA 4R5MA 1DC5A 2OORA 2RIRA 3EY4A 3N7UA 3B1KA 3H6KA 1ZK4A 3BHMA 1ONPA 4NJOA 4IUYA 4WOKA 5CPFA 5LDGA 1V6AA 1ADFA 3W4IA 3NX4A 4OSOA 3KYDB 4TZTA 1TT7A 1O0SA 2Y99A 2EW8A 3RQSA 2OL4A 4HKTA 3NDIA 4FFMA 4O5OA 3FSRA 4QT0A 3CMCO 4E13A 2PH5A 4ZQBA 1R6DA 3T4XA 4DBZA 3BMOA 4N5MA 4JP3A 1ENYA 4GX0A 3TOXA 4BGEA 5BT9A 3MOGA 5JO0A 2EF1A 2O2YA 4EGFA 1YBMA 1BRMA 3AM5A 1ISHA 5F21A 3ZV3A 2FMUA 2GPTA 9LDBA 3T7CA 4RZIA 3SLKA 2D0IA 3M1AA 2OMEA 4UUMA 1U4OA 5I8WA 3IKTA 3EVTA 2AG8A 2NV6A 2BRUA 3A1NA 4NH4A 4RL6A 3I5MA 3OQBA 3NT2A 4E5NA 3TF5A 4LK3A 1GYPA 1MUUA 3SJ7A 5G0TA 2FWMX 2OZPA 3P5SA 1QLHA 2GNAA 4W99A 4QO8A 2RAFA 2NU8A 1LC0A 2Y0DA 2ZB3A 2JCXA 4P8RA 4YJGB 3TOZA 4ROSA 4MIOA 1EVZA 1DO8A 4Z6KA 5CDGA 1NPTO 1HDXA 2UV8A 5EJ2A 3W8EA 1Q7GA 1Z73A 4GQAA 2O3TA 4BIIA 3GUCA 4IDCA 5HS6A 2Q1WA 3TWOA 2Y05A 1C3VA 3IJPA 4BV9A 4DPLA 5C7LO 4BNXA 1MV8A 4DTIA 5JMWA 3NKLA 3PJDA 1KS9A 3FR7A 5IJZA 3HE3A 1GEGA 1MG5A 4Y6RA 3MZ0A 4BNIA 5U9CA 3WGHA 1R0KA 4W6ZA 1D7OA 1N1EA 4QFDA 4HFMA 4NMHA 5HRUA 4BMSA 1LTHR 4AJ2A 1VSVA 1A71A 2DPGA 5I9MA 3F5QA 1TB4A 3CMMA 5EINA 4BNHA 4ND5A 4I9NA 4BNFA 1PR3A 3KUXA 5COAA 3C7AA 4BNKA 5JDIA 1B0AA 2W4QA 3U4CA 3IUPA 4L74A 2AQHA 4UVHA 4YRDA 5A5FA 1IPFA 1N2SA 3AI1A 4UVEA 2VWPA 2Q2VA 3D0OA 4YQYA 1V3UA 2E82A 3PDUA 1HDRA 2EHDA 4TVBA 4JJFA 1TT5B 4FC7A 4CM4B 3DBHA 2WJPA 3GH3A 1PTJA 2PZJA 2UDPA 5BNIA 1YXMA 3OEYA 2Z95A 1E3LA 3WYEA 4ZQEA 4FJ2A 4QECA 4FSHA 5BSEA 1B8VA 5JPIA 3F1KA 5JW6A 4U8GA 4DIOA 1EEHA 4GSLA 4FGSA 2IODA 4QEDA 1P1FA 2BGMA 3D4PA 5TRTA 4IDGA 4ND2A 5A04A 3LK7A 5I7SA 4K28A 3D4NA 1SOVA 2X0NA 2J6IA 4JGBA 1T4DA 1GPJA 3NTQA 3AY7A 3M1LA 5L7WA 1UXIA 5EQFA 1K6IA 1KC3A 4JN6B 1E77A 3GGGA 4E2ZA 4E5YA 1Y8QB 3JCZA 1RWBA 5KNLA 5F1OA 2BGLA 3C8MA 2E6UX 3C24A 3HDQA 3DTTA 1ISFA 4ZGWA 1ULUA 1UXGA 4Z0TA 3PHJA 1ADBA 4CUZA 4RVGA 3VTZA 5AQ1A 4W4TA 4RDHA 4XKJA 5DF1A 3WWZA 3I23A 4LW8A 1P33A 3PJFA 2Q45A 3TSCA 2B83A 3TFOA 4WNIA 5G0VA 1LSUA 3WOHA 4R68A 3I9LA 4GSKA 1K89A 3UOGA 2YQ4A 2AG5A 1S7CA 1H2HA 3JQAD 5JDCA 1Y9EA 3QLJA 3GMSA 3UVEA 4U6QA 3VH1A 4I1IA 3RUAA 5G4LA 3QIVA 2D2IA 3C1TA 3DBVO 4RPJA 4W7IA 3WGGA 4CMIA 1DXYA 4O63O 1DDOA 1XA0A 3HN7A 4YJDA 3WYBA 2G1UA 3EHEA 1GV0A 4U0JA 1WLYA 2UYYA 3A9WA 4INAA 3RUIA 5JDIC 4K26A 2HKIA 1W8DA 4IJUA 4GVXA 1X1TA 1E3JA 1ZSVA 5C37A 1XSEA 3GPIA 3LT1A 4BO2A 5JAMA 1JN0A 1C1DA 2Q99A 1YRLA 3PWZA 3HSKA 4JP2A 4RVFA 4AJJA 3OBBA 3TZCA 2VYVD 1LLDA 2J5KA 3JQDA 1J0XO 3RU9A 2CVOA 3TL2A 4NK4A 1T2CA 2FR1A 4OXYA 3F46A 4BNNA 3ZNOA 2PY6A 3NUGA 3UICA 5JO9A 3M6IA 4I5FA 1ZXLA 2IXAA 2O3JA 5GMOA 4ND4A 3WFIA 2O4CA 1JWAB 5T5QA 1DLJA 3F5SA 1PEDA 5KOIA 4N5NA 3ENKA 5AXDA 1ONNA 1ZEJA 1GU7A 5DT9A 3S2EA 4XIYA 4E5PA 4R69A 3RSHA 1KIFA 3ROKA 1V9LA 3Q6IA 4CM1A 4CM9D 4CR6A 2GF2A 4RGBA 4IDFA 3JQAA 3FNEA 3DC2A 1B26A 3O8QB 4NI5A 4OOFA 3GNSA 4Z9XA 5IDWA 3CSDA 5CHEA 4LRTB 1QYDA 1XDWA 3NTRA 4DGSA 2ZIZA 3BYZA 5KCZA 4PVCA 2J5QA 1SZJG 5DCYA 3LLSA 3PZRA 4ONEA 3WX0A 4II2A 1DC6A 4A26A 4FJ1A 4RJTA 2EKLA 2GN4A 3PQDA 5CAEA 2AHRA 1P0FA 2HUNA 4HX5A 2ZYDA 1U9JA 4TZKA 3VPGA 3DFZA 4LMRA 1HDOA 3RAJA 3GDGA 1YS4A 2PD6A 1A5ZA 4XB2A 4JCOA 2PA3A 3VZQA 4XQEA 3VZPA 3GHYA 2VYVA 4CM5A 1J6UA 3DHEA 3G0OA 1T26A 2NU9A 3DZIA 5FFFA 1U3UA 2B5VA 3ICCA 3IUSA 4YBZA 1VJ1A 8LDHA 3JQ9A 4J0EA 4LGVA 5IAAA 2BD0A 2ZCUA 4J16A 1UZLA 4R51A 2C07A 4MVJA 5A9SA 2C82A 1RYDA 4YACA 3QVSA 3EMKA 4DLBA 3U5TA 2IE0A 1P77A 1JVBA 4DQVA 4CM9A 1C0KA 1GCOA 4JIGA 4OYRA 5ITWA 2IYOA 3JYPA 4BB5A 5TF4A 4YCAA 3PHHA 3ZV6A 1MX3A 1L1FA 2HSDA 1C0LA 4PZDA 2HJSA 1JWBB 2XXBA 2GRAA 4RLHA 4YT5A 1NXQA 4RZHA 3RKRA 1I24A 2GUGA 4CMEA 3I4FA 4KTTE 3H9UA 4J4BA 1R0LA 1HZZA 2WTBA 4ZQFA 1I8TA 3RBXA 3QW2A 4J4TA 2ZB4A 2BFPA 2XF8A 1DPGA 2B4TO 3UW3A 1JU9A 3JQBA 3ZWAA 1Y6JA 2FPPA 5KKAA 4K9DA 2OBNA 1LSSA 1V35A 2EG9A 4MVJM 4GMFA 3U4DA 2X5JO 4D44A 4D79A 4AJLA 4XCVA 4PVDA 3NTOA 4EUEA 1A27A 1CWUA 2JJYA 5L4NA 3PYLA 1QYXA 5HWSA 2V6MA 1P1RA 4N7RA 2PGDA 1TEHA 1EZ4A 2UAGA 4XYLA 1LDMA 3MJ4A 5BNTA 3BMCA 1VKNA 1KOLA 3OIDA 1RKXA 3DBLB 4IBOA 3PK0A 2X5KO 4ND1A 2GGSA 5GY7A 1DFGA 5T64A 1BSVA 1U3VA 1LDEA 4TRJA 2C2YA 4HFRA 2NVUB 1ISJA 3H9QA 5BNFA 2I67A 5G2OA 3FD8A 1XU9A 3PGJA 3PHGA 3IOYA 5I7VA 2C7VA 4A2CA 3QVXA 2PZLA 1Q7BA 1ZMOA 3ZZNA 4L73A 3K2BA 1KEVA 1PJBA 2D8AA 4NK5A 3ITDA 1ID1A 3JQ9C 2CF6A 4AJKA 2HMTA 1R16A 3K2EA 2FR8A 1E3SA 1T2FA 4FW8A 3GY0A 4RVSA 4BKPA 1Y8RB 1WZIA 3CPSA 2AXQA 3DDNA 1ONOA 3PP8A 3C1AA 4HP8A 3PYMA 3WGTA 1KVUA 1W73A 3UUWA 4XGKA 2DTEA 3NAQA 4UREA 1NFQA 1C14A 1QSGA 1Y7TA 1EK5A 5IFLA 5JFOA 1U28A 5FF9A 1LDGA 1BXGB 4C4OA 5IZCA 1KC1A 5A05A 1MC4A 2EEZA 1U8XX 2DUUA 5A5EA 2EJVA 3ZHBA 1XEAA 5A9TA 1NVMB 1BW9B 2PLAA 4NJMA 1EBFA 1WDKA 2XAAA 3COSA 3VPHA 4BNTA 4G65A 4GAEA 2ZQZA 4M86A 5G4KA 4H3VA 4CMEC 4CLDA 4JBIA 3WLEA 2I5PO 2QRKA 1PL6A 2WEKA 4IDBA 1DEHA 3ONDA 4IDEA 4IZHA 2GN9A 1PS8A 4XGIA 3ZWNA 1NVTA 1W4ZA 1XYGA 3NT5A 3QWIA 1D4FA 1LQUA 1JKJA 3JQBC 1LJ8A 1N9GB 4MVJP 1DAOA 4OXKA 4RDIA 3D5TA 3QWAA 4OXNA 1HLDA 4L9RA 3TNLA 5BQFA 1Q0QA 1VM6A 3AOGA 4CLHA 2B4QA 1O5IA 1UDCA 3GF4A 1TA4A 2UUOA 1PJQA 1BG6A 3KM0A 5B1YA 1GZ4A 3PIIA 5LCXA 1Q0LA 4CODB 1IL0A 1NM5A 1RJWA 2VHWA 2VHXA 3OIGA 3GC6A 2VUTA 4R54A 1ZNQO 3O9ZA 1ARZA 4IJVA 4EUHA 4R01A 1BWSA 4BHTA 3K31A 2FPGA 3PJGA 1KBZA 4J9VA 1IZ0A 2YHIB 2PZMA 5T8KA 4IS2A 2HMWA 4AJIA 2X0IA 4KWIA 4CL3A 3UF0A 3KXDA 4TKLA 3GZ4A 3H9JA 3H3JA 3WSWA 5B12A 1GL3A 4FD3A 4J1TA 4PLYA 2Y1DA 3CUKA 1LLQA 4Y9DA 2P4QA 4RLSA 3JQEA 1DFIA 2WD7A 1H5QA 1VLLA 4NBRA 4OL9A 3ZU5A 2AE2A 2Q49A 4QXMA 3EYWA 1YJQA 1CJCA 1PQPA 1EUZA 4W9NA 2CDCA 4E0BA 5IZCC 2JFGA 5ICMA 3LC1O 3OM9A 3RD5A 4M8SA 4CLOB 1VI2A 3WDSA 3ZV5A 1DIAA 1O89A 2BLLA 5TJ9A 5AYVA 4PGFA 1ZO8A 2X4GA 5CG2A 4YT4A 2PFGA 4BNVA 5L4LA 1NAIA 1G6KA 1ZZEA 3CH6A 3F9IA 3FPCA 3JYNA 5DP2A 4Z0PA 3T7EA 4K6FA 1HDYA 2H9IA 4BMNA 2FY8A 3H5AA 5EERA 1J5PA 4CLRA 1Z7BA 1FDVA 1YBAA 1NHGA 4FN4A 3PGXA 1PL8A 4J7CA 3SC4A 1MXFA 1PJSA 2X7HA 2BELA 4OQZA 1P44A 1E3IA 1E7RA 5KTKA 1YVEI 2R2GA 3EUWA 4RVHA 4Q39A 4F3YA 5DBGA 2D5AA 1Z45A 1H9AA 1K3TA 1GQQA 4BOYA 2ZTVA 1IY8A 1O95A 5IDYA 3X2EA 1UZNA 3AM4A 1LRKA 3ASVA 3FR8A 3U0BA 3VVBA 4XJSA 5TSDA 1GPDG 2Q46A 4J0FA 4DBVO 3GN1A 1Z6ZA 3R0IA 1QV6A 4I5EA 1XGKA 1F17A 3JQ7B 4M1QA 4N54A 3VHRA 2I65A 3DOOA 1RM3A 2VYND 4S1VA 5IG2A 1OC2A 4L4RA 1NWCA 1R4NA 1PJTA 2YJZA 4IJWA 4GWKA 1CETA 2GCGA 1EVJA 4B4UA 2J5RA 3JYLA 5T8KC 3ZWYA 3GVXA 2W2KB 4M54A 5AXAA 3F4BA 4BNUA 4WLNA 1YL6A 3GDFA 4G5HA 4PG4A 4K6CA 2IEDA 1C1XA 2PR2A 3WIDA 5KKCA 5C3MA 4QSMA 3H65A 4D0RA 1SEVA 3IAHA 3RC1A 4ILKA 3DOJA 2IXBA 3W6UA 3GVIA 1B7GO 1FXSA 1V8BA 2GASA 2VT3A 1O8CA 4JQCA 4BO9A 3OJLA 1DFHA 1DBVO 4R9RA 1HE3A 5L9AA 1S6YA 3RC2A 1FF9A 2WYVA 5BSFA 1GDHA 2QX7A 4W9NC 3ZV4A 4NU6A 1V0JA 1YE3A 3WGQA 4E5MA 4PG8A 1KEWA 1T25A 4LISA 3VPFA 2DTXA 4NFYA 1ZCJA 3DTYA 1B15A 4DC0A 5ILOA 3LZ6A 2VHVA 1LRJA 4GX5A 4I9HA 3INTA 2A35A 5T67A 2VTEA 1YQGA 4WECA 1FMCA 4B3JA 2J3HA 3OQ6A 4FB5A 2HK9A 1GAEO 2H63A 1WPQA 2NTVA 3WSVA 1MG0A 1NFRA 3KYCA 4L76A 3GG9A 2YV3A 1D8AA 5CG1A 5TT0A 1P3DA 2VYNA 3I1JA 4YT8A 5EN4A 3RKUA 1M6HA 2V6FA 4AG3A 3W8DA 4NG5A 3KEOA 4CM7A 5JS6A 3D3WB 4QX6A 2VT2A 5FI5A 1MP0A 2A4KA 3DR3A 4B3IA 1G0OA 3GEGA 2O4UX 1RM4A 1YOVA 5AXBA 5L95A 1OMOA 1W0CA 3IIEA 3WNVA 3ENNA 2QYTA 4WNCA 3PJEA 3QWHA 3KZVA 4XDZA 3INRA 4WKGA 3DQPA 4WLUA 1WZEA 4NFSA 4D3FA 1E7MA 1UXJA 3GZNB 4J9UE 4YAJA 2X1HA 1PSDA 1QORA 3WJAA 3GAZA 4R1UA 3KRTA 5K0ZA 4R3NA 1AHHA 4O0LA 4ZA2A 4D7AA 4O59O 4Z3DA 2A94A 3MJEA 3C1OA 6ADHA 1E5LA 3MWEB 1LQTA 1VL8A 3K6JA 3GT0A 4OJNA 1R4MA 2AMFA 2EW2A 1A72A 1HZJA 1YDEA 4WPGA 3LVFO 1VPDA 1P1KA 3AW9A 4DYVA 2BFOA 3MJTA 1TLTA 4GVLA 1HLPA 1P1HA 2Y68A 3H2SA 4GPD1 2VCYA 3BMOB 5ICSA 1NHWA 4MVJF 2CVQA 4MJLA 1EDOA 2C29D 1Y1PA 4R9SA 4JLWA 1CEQA 1L7DA 5KJ1A 2GZ3A 5H83A 4B3HA 2OXIA 3C7DB 4F46A 1XKQA 3UCFA 3H7AA 3KV3O 5F1KA 2GR9A 4J7XA 1KEUA 3BTVA 4DYDA 2YDXA 1QMGA 1K6JA 4EJMA 5DOZA 1NQAO 3VC7A 4KQXA 1SCUA 5TC4A 2SCUA 3PTZA 1ZH8A 2PKRA 1SBYA 2OP0A 4LCEA 3U3XA 4AVYA 1I0ZA 4WE3A 1UJMA 1XQ6A 4AJNA 4DIFA 5KVSA 1ZBQA 3WGOA 1TXGA 4J2HA 3PQFA 2AQ8A 5JYDA 4BNMA 2OUIA 2B35A 2IZ0A 3VTFA 2ZB7A 2C20A 3FNFA 3GHHA 5KJ6A 1GZ6A 3ZHYA 3I52A 2AA3A 2Y93A 3NGXA 3K9QO 4MDHA 2JCYA 1GY8A 1EUDA 1Z74A 4Y8VA 3OJEA 4DPKA 2HMVA 3AM3A 2X23A 1U1IA 1LXCA 2O50A 1I36A 2YQ5A 4TRRA 5TIIA 2GDZA 2H1SA 2JAPA 3C3XA 1KEPA 1KERA 2AEFA 3GVHA 4PLWA 4MIEA 4Y6SA 3V2GA 1E1MA 2PGJA 1E7WA 3AUTA 2J3IA 3B1FA 4DIBA 4PN3A 2O3SA 3RROA 1Z75A 3DONA 3PRJA 5BSHA 5HS4A 5J23A 3ETDA 4CPDA 1OBFO 3BMNA 2CSUA 5IDXA 3G49A 3RC9A 3NV9A 3OA2A 2YYYA 3QE3A 4DQXA 3FPLA 2I66A 3P2YA 4YJFB 2OP1A 5HBRA 3RJ9A 1R37A 3TQHA 4IGFA 1XELA 4WLOA 1Y5RA 3HB5X 5B4UA 4DPMA 3WTCA 4Q3BA 4X54A 4XIJA 4XRRA 2EGHA 3B1JA 3UGKA 1B16A 1XIVA 1HYGA 1U3WA 3CE6A 4IDAA 4ZVVA 4PRLA 4IDDA 4NR0A 2AQIA 5FWNA 3A14A 3VAZA 1ENZA 2JD0A 3BIOA 4PLHA 3ZWCA 2GO1A 2OHXA 2X0JA 3FTPA 1WVGA 1WP4A 1B8UA 4WCDA 1HYEA 4JJGA 2YDYA 3E82A 4A27A 3E6AA 4A7PA 2NTJA 1E7YA 2RCYA 3L0DA 4AL4A 1OOEA 3B70A 4D3DA 3A28A 3WFJA 3V1YA 2NTNA 3DL2A 3DHNA 3JD0A 3RI3A 2IRWA 1ZEMA 4MKRA 2IZZA 1DAPA 5DCWA 1HT0A 1IZ9A 2A92A 3I6QA 4ZHSA 1M67A 2DC1A 4CR8A 1E7SA 1R15A 2GN8A 3F1LA 1Q2XA 2Y1CA 3L9WA 4BKRA 4JBGA 1GCUA 2YW9A 2PD3A 4YJHA 3O8QA 4YAEA 2X58A 1UAGA 3ETGA 3Q0EA 2E48A 5TQVA 4KDEA 1MGOA 2EJWA 1GTMA 5DN9A 5I9LA 3B20A 2JKVA 3CZRA 1JVSA 2PZKA 1DOHA 4MP3A 4CMIB 2B0JA 5DP1A 5T6BA 2QG4A 4AJ1A 3A4VA 1DRVA 1V3TA 2R00A 4B4OA 3E5MA 4B7CA 3OFSA 3AUAA 3GNQA 2RHCA 4FFLA 3H4VA 4M55A 4P22A 4YRAA 4YAGA 3DB2A 1C1DB 1HXHA 4YXFA 1LRLA 5ER9A 1E5QA 2PD4A 1ZK1A 2WSBA 4QFCA 5TS3A 2DAPA 3LC7O 3ZH2A 5FI3A 4DQUA 3Q1LA 3F3SA 4DMMA 1EUCA 2JD2A 1Q0HA 3AI2A 3ONEA 3AUUA 4D3SA 4PLCA 5JCXA 3ZHZA 3LU1A 4E12A 1OZAA 2GZ1A 3X2FA 1A7KA 3LQFA 5EL0A 4E32A 2IDZA 4CJXA 2TMGA 2JCVA 1AN9A 4ND3A 4UAGA 3HFSA 4W82A 5A06A 4CMCA 5JAIA 1PJ2A 3VKUA 3JSAA 2DVMA 4F45A 1EE2A 3HQ4O 4RF3A 5KJCA 1PJLA 5GZ3A 3JYOA 2D1YA 4FJ0A 5DCUA 5JNLA 4NBVA 3FWZA 2RH8A 1U3TA 4OH1A 1N7GA 3IDSA 1JQBA 3Q9NA 1IUKA 4GMGA 4MVJE 4UEJA 4YEDA 4URFA 5DDIP 3DAPA 1H6DA 2E4AA 2EP7A 1IHXA 3JQ6A 1Y9AA 3QA9A 4L4XA 2PNFA 3K5PA 3UKOA 5L51A 1YL7A 4YYZA 1LDBA 3WNQA 4MIYA 1GYQA 2B37A 4JX8A 2OGUA 3AU8A 4HFJA 2PGLA 4GGOA 4YA6A 4E31A 4KZPA 3RASA 4I5DA 1RPNA 4BGVA 4WUVA 4DLLA 2WE8A 3ITKA 3EW7A 3OA0A 4FFRA 3WLFA 2VUSA 3O38A 1DB3A 5CEEA 1PR9A 3MCVA 2VZ9A 1VJ0A 3QRWA 2VQ3A 4XD2A 1VJTA 4GGPA 1EMDA 2C2XA 3VH4A 1JAYA 1XCBA 2HAEA 1X13A 3KSZO 3OECA 4YQZA 3F4LA 3JV7A 1U7HA 2IYPA 4E2YA 5ILGA 4GLLA 1WWKA 1Y81A 2DBVO 4CV3A 4BO0A 3B6ZA 1YB5A 2D5CA 3U9LA 4I08A 1KVQA 5JAZA 1QXSA 3OEWA 3GVCA 5CEFA 1T2EA 4Z9FA 1H2BA 2CF5A 3O26A 3WJ7A 3IP3A 3ROPA 1JLLA 2R00C 3MOIA 1I33A 3CKYA 3DBLA 5DOVA 1ULSA 1WXDA 1E6UA 4UVIA 3H3FA 1WMBA 4J1QA 1UDBA 3ONFA 2J8ZA 3JQ8B 2NVUA 1I3NA 3UCEA 4E30A 4EJ0A 3I9OA 4WCFB 2P4HX 3PPIA 2I6TA 4RF5A 4BUCA 2G82A 1W6UA 3QQPA 4FQ8A 4XRGA 4PZEA 2ZATA 5FEUA 4Z0HO 2RBEA 2WDZA 4IM7A 1X7HA 3OJ0A 3ORFA 2VOEA 8ADHA 3VVCA 4TMFA 1NAHA 3PDJA 3UCXA 4BVAA 4CUJA 1V3VA 5JAQA 1JKIA 4CV0A 1EQ2A 1FJHA 3EC7A 3QVOA 1MXHA 1Y8RA 2WM3A 2Q2QA 3NYWA 2E49A 3PI7A 4R3WA 3V5NA 3ST7A 5EQDA 2X22A 2POQX 1MFPA 3TZ6A 3GR6A 2BFMA 3D64A 1RYEA 3TFQA 4R4JA 2P5YA 1BXGA 2Y0EA 2AW5A 4BNGA 1DIHA 4BL5A 3P7MA 2GZ2A 1GUFA 4R5HA 3O4RA 1VL6A 4HNHA 3ADPA 3GFBA 4RF2A 4XZ3A 4PLPA 1ORRA 3SLGA 4ALNA 4UEOA 1ML3A 4RCVA 1UH5A 1RM5A 3BMCB 4GKVA 4HNGA 3BHIA 3VZRA 1B14A 3L4SO 5IXYA 1Q1NA 1G1AA 4BGIA 2QW8A 3ROMA 3RBVA 4CQMD 4BKQA 4EDFA 3BTSA 4C7JA 1SOWA 4DWVA 1ZK2A 1PS0A 4E2XA 3VH2A 2NLOA 2Z5LA 4BKOA 4GWGA 1E1KA 1T24A 4AICA 2EKPA 3CINA 4JJIA 3E18A 4WGGA 3K30A 1LBEA 2NQTA 3PVZA 2W98A 5A02A 4R1TA 5F5LA 1U2DA 3CTMA 3L6OO 4HWKA 3HFGA 3KOUA 3E1KA 4NPCA 5CFZA 3S2IA 1KETA 1R12A 2GYYA 2WMDA 3JQGA 3P2OA 4IJKA 4J2OA 2BF7A 4CMAA 5K9ZA 4B79A 4EEZA 1CQJA 1NR7A 5TT1A 1D3AA 3GEMA 1ZVMA 4BNZA 1JTVA 2Q1UA 1ZFNA 3LSYA 4B8ZA 3HWRA 3FHLA 5L7YA 4RVUA 1B2LA 3WXBA 2FN7A 4E5KA 4Y6PA 5L53A 2CDAA 2ZYGA 1OI7A 2CVZA 4FPXA 4J4HA 2Z1NA 1BMDA 5T57A 3V1UA 4D46A 1PX0A 4FFOA 5C7OO 1OC4A 1GADO 3KETA 1PU2A 4OQYA 3SEFA 1SNYA 2FSSA 3D4OA 1KVTA 1MB4A 3DZFA 4GKBA 4D43A 3DZKA 1YJ8A 3OH8A 3TPCA 4XQCA 1PWZA 4NJMB 2YFQA 1YGYA 1UXKA 5BR7A 3GRPA 5G4KB 1HTBA 1ZJZA 3F47A 4IXTA 2O3RA 3PLNA 1UP6A 1U8FO 4PFJA 1NBOA 1C0PA 3FBTA 4CQMA 2VN8A 5ENVA 3U4HA 5THKA 5A3JA 3E9MA 2Y67A 3ZN2A 1X0XA 1YB1A 2BHLA 1B3BA 4ZRNA 3JD1A 1E3WA 4CLEA 3VKVA 3ZU3A 1WNTA 1E3EA 4EYEA 3DMYA 4ALKA 1A9ZA 3G1TA 4ALLA 4CLOA 3FRJA 3HZZA 1GUZA 5LC1A 5CEJA 4IS3A 1H9BA 1ZSYA 3OQ1A 4LCJA 2X9NA 1JKFA 1ADGA 2Q3EA 4D42A 5JXWA 2DU8A 1FDUA 4GX2A 2P9EA 1O9BA 2X9VA 4E21A 4AJ4A 1DC4A 3FI9A 3TZQA
chains in the Genus database with same CATH superfamily
5HJEA 1Y82A 1TE2A 1H1LB 3NGLA 2W6JA 3KXLA 5DBFA 5EHGA 3TECE 3SZUA 4HUQB 2O06A 3I2KA 3G9XA 4DJEC 1QP4A 3OZFA 1SXJE 1F51E 1CLEA 2WWFA 1V6SA 4HHEA 1BDMA 1JXQA 2G9ZA 1L5GB 2RIPA 2XCLA 2VFAA 4G36A 4JGIA 3RWBA 2H6EA 1I3MA 4GVPA 1IDOA 2CFCA 4PRKA 1A88A 4GMDA 3SKYA 4F5YA 5K4GA 5K20A 2NM0A 1CQPA 1PJ3A 3UHOA 4KL8S 2H54A 2R5FA 4TMXA 1T4BA 5AJVB 2WD8A 1XZNA 3NETA 4IMPA 2G76A 4UFOA 1Q16A 3T5TA 3Q0IA 4HDKB 3ZWQA 3H2ZA 4XWYA 4ZEXA 1YQUA 2X2EA 4TTPA 3EWAA 3AFMA 2IS4A 3NEJA 2Z4TA 4IOJA 5D7BA 5H4HA 1N5LA 3TXXA 3ZGLA 1XA3A 3E4CA 3PEFA 4J90A 1DRUA 4KOAA 4UU1A 1V25A 2WD7B 3RVDA 3TE7A 3QVTA 2NWQA 4M49A 4B0OA 5HZMA 4Y3UA 2Z6AA 4WASA 1VZ3A 1Y6GA 2CLSA 4W8OA 3HN6A 1H3FA 2FZEA 3EGOA 3IYLW 5LU9A 2ZRQA 1CIPA 2UZ0A 2XD9A 4TKMA 1KQPA 1P9LA 5KBYA 4OA8A 3B3QA 3VKWA 3UBMA 5JLAA 2QXYA 5K3BA 5JCZA 3TAHA 1HE4A 3F7TA 4ZZ2A 1Z3IX 3FPSA 2JVIA 5JZBA 2RHRA 1KEEB 5JYEA 4BCBA 1BA2A 1T0JB 3R5XA 4C78A 2A9RA 4KE6A 4DC1A 1W48A 1UDAA 4XEUA 2JFUA 4BKUA 1W5SA 4PYKA 4RYDA 4JKOA 1XUOA 4O1HA 3DKIA 3SJAA 1K5GA 1SXJB 5BRAA 5HBGA 4BN5A 2HDHA 2GM3A 6GPBA 1MEOA 3LPLA 1TM4E 2E4ZA 1U2EA 4HRVA 4G4SP 1DT5A 3B60A 1S9HA 3NU1A 3K0AA 3PFFA 2C4HA 5CNJA 1Y5IA 3FMFA 1E9FA 1XU7A 3GUHA 3H8JA 2PO7A 1JHOA 4EF5A 4PW0A 2PX3A 1QO0D 1R27A 4KUEA 1GGFA 2O7QA 3DMGA 3FVTA 3K92A 1DJPA 1GFSA 4LNUA 2FEPA 1Q91A 3OFKA 4ZJUA 2VEDA 2GN1A 3P0HA 5EXEA 3DWIA 1E9VA 2Z9DA 3EIFA 1UWCA 2VYCA 5EG5A 4OFZA 2FPLA 4Q3LA 3DFFA 4HN9A 3EGDA 2GCNA 2QPAA 3TQQA 4H77A 4BLUA 1NJFA 1SQFA 1VMEA 5AW2A 1SVSA 1WXQA 3BD8A 3L07A 3CWQA 3NANA 4AG6A 4CG2A 1R6UA 3KTOA 3R8XA 3T4EA 4DY6A 2IZ6A 2GK4A 2RHTA 4JXKA 1NW8A 4G89A 1E5XA 1GA6A 1QWSA 5FNVF 1UBUS 2FJ0A 4UU8A 5FUYA 4KTVE 1TK2A 2EHJA 3PFGA 1G8JA 1S5PA 2RHHA 1NUAA 2BF4A 1GDDA 1NNUA 1P4JA 1PL7A 1TUEA 2R4UA 4G4JA 1M7HA 1CJBA 3JQCA 2IYWA 4Q66C 1QYCA 5AP9A 5LXTA 4KE7A 1MFZA 3WK6A 3AG5A 3WBJA 3FWNA 5B2EA 1RQNA 4FIZA 3DKRA 2W42A 3IP1A 3PQEA 1K5DA 1FRFS 2GAJA 2IEYA 4HZGA 4N5LA 4RELA 5EYPA 1JJBA 3ORSA 3I3OA 2AOXA 2HZ7A 2XEDA 1GSIA 5IK2D 1UF9A 2V58A 3HUUA 5CJ2A 4K2HA 4AP9A 3W5CA 2MSDB 3G17A 3WV4A 3TUZC 5K51A 1C3EA 2IY9A 5ALNA 5GVRA 1RP1A 1ZUD1 3R7FA 3OWXA 4Y2TA 4ZYXA 4RTQA 2RH4A 3DNFA 4URYR 2NXWA 3T3NA 3D3KA 2A1TS 3I01M 1V48A 2L69A 3E4DA 4DJDC 4ENTA 1DHTA 4L0QA 2QRGA 1PZXA 1VDZA 1S2IA 2VS1A 1PFGA 1IATA 4JLSA 2IEBA 4FGKA 3RIHA 2UUPA 1RZVA 2R0QC 2OYRA 2PZGA 2I6FA 3PXCX 3U39A 3GPDG 3L04A 5JC8A 3U7HB 1UANA 1Y5MA 1GT6A 4O6VA 3ESCA 2BIFA 3CONA 4MKGA 2G0TA 1QZUA 3H75A 1JG2A 5E2IA 5LIPA 1I13A 3FWYA 3ILYA 5KVQA 1W85A 3S2YA 4ENSA 5DMHA 1H6AA 2DBRA 2DFNA 2W43A 4CTMA 1SMKA 5I01A 2O5EA 5F1YA 4WJZA 1VJRA 2BFBB 5FX2A 5JSZB 3AIMA 4PLFA 5F7XA 3AW8A 4IEIA 5CLQA 4LY6A 1R6BX 2D2FA 4DM3A 1L9KA 3PWTA 1MU0A 2ORED 4GI2A 1QK3A 3U09A 1DBSA 1M66A 3SWWA 2IZ1A 2C88A 1E98A 1OH6A 2V7UA 3F3YA 3ZU2A 2HSWA 4U2BA 1JKXA 1NGSA 2YZNA 1E96A 5EUCA 4WLEA 4ARIA 4JI1B 2PRIA 4WESB 2WJAA 2XVAA 4XM1A 4L57A 5HXAA 1FTSA 1U5AA 2I99A 3QU2A 1QOPB 4IQGA 1UPFA 2JARA 3PRKE 3R6DA 1QRRA 4LJ7A 3JR3A 3U49A 3MLEA 4MA5A 3TL3A 4FX2A 2B21A 3V1TC 3CUSA 1O87A 1DKQA 1Q19A 3L2OB 3GGCA 4BNDB 3HU1A 3FUWA 5CH3A 3SSMA 2R1UA 3T5DA 5DV9A 4DWOA 5KPDA 3AH8A 1VGQA 4Y98A 5EJIA 2JH3A 3G5UA 2QRLA 3ESDA 4KZKA 4QYXA 4MLDA 5AXCA 1NG1A 2NAPA 1JVNA 3DMRA 3SJUA 2EU8A 3KAJA 2VQDA 3GELA 1IZ7A 5CA1B 3S8MA 2FMFA 5CB8A 2PWZA 2HRZA 3EBOA 3FRHA 4Q34A 1GV1A 3DAGA 1T4GA 5EKUA 3QTLA 3G7SA 2HO4A 3A4IA 1Z0UA 4DABA 3QLTA 4TYNA 4X1IA 1XZGA 4H9GA 5J63A 3UA4A 3GH1A 3QSYA 3SBOA 4UATA 3OZXA 3O73A 1S96A 4H27A 5AKZA 1B00A 2AMJA 1E3TA 2XNSA 3G8CA 2FFAA 1PAUA 1BHSA 2D3WA 4UU0A 4JQZA 2GWRA 1EVLA 5BN4B 3W3AD 3FTNA 1HMPA 3ND9A 2W9XA 4RO0A 1KZHA 3QWBA 3GG2A 4KO2S 1EWRA 2BEUB 4RTMA 1M6WA 1U9IC 1AGRA 1ZS9A 3WGYA 3A06A 4EHAA 3CKMA 3HKCA 3L6RA 3IT1A 1JR6A 4JHLA 1ENPA 3LFHA 1KYYA 1E3QA 4NNOA 4YIHA 1B42A 5KYYB 2F7SA 4GXNA 5HFAA 5TPZD 3V2IA 1J2RA 2HA3A 1NQUA 1RYHA 3QV2A 1M2OA 2B2XA 4YWJA 4F6RB 2YVKA 5ALWA 2C7GA 2P9CA 3BZUA 3K0FA 4P83A 3O8OA 4Z4GA 4CDNA 1XD2A 4QTZA 5K6AC 3I9MA 5GOTA 4YV0A 1QX3A 2H4JA 2JDID 3NC4A 4JYZA 1N2BA 5GZ1A 1PJCA 2QK4A 3M4YA 1E1NA 4A9AA 4YVFA 2PSEA 4ZTUB 2R8OA 3B38A 5JW6A 3RFXA 4A2PA 2BI7A 4JR2A 1WQ4A 1GYRA 5KQPA 2O8CA 2OECA 3UQYS 1CEXA 4Z4HA 1HYHA 5CVUA 4ZVUA 3BL6A 4M88A 3CO5A 4ZRMA 3EZNA 1O6FA 3B6MA 3MS2A 5AUQA 1LPPA 1QNFA 1GUDA 3HN2A 4M1EA 4XSGA 2RGNA 1KY4A 5F51A 1L8QA 3WDLA 4PFKA 1RJGA 2ZRFA 3LPDA 3PJRA 2FA9A 5D5QA 1II0A 4MV8A 3ZZMA 4S35A 4JUCA 1A95A 1W19A 1QVRA 2LPMA 2XRYA 4FYMA 3OIWA 1GFIA 2FEOA 3FRIA 3JATB 4J3FA 4CKEA 5M04A 4F6CA 1THMA 2MYPA 3VDQA 1O8BA 1ZGJA 2GBGA 3DCIA 3U4AA 1ZJJA 4NBTA 5CCBA 2C9OA 3K9GA 3BHJA 1Z3CA 1SHJA 1Z15A 3ADKA 4PONA 1P9RA 5JJBA 3WAJA 1ESEA 2LDXA 2EJBA 4JMLA 4KDRA 4MWGA 5PGMA 1FLVA 1TRKA 1RBMA 4BVJA 2FEMA 2X9GA 4U63A 2WM9B 5BVGA 3WQHA 1H2RS 3AL3A 4B8YA 1O94A 3O31A 4IGIA 1EBUA 2B1GA 2WHPB 2Q6TA 2FDXA 3FYTA 2H1RA 3C14C 3H86A 3JZAA 4R1OA 4QEZA 3EAQA 3G23A 1CUEA 3H4MA 3MAGA 1QMPA 2P9YA 3EQ7A 1VE5A 3SYRA 1NNI1 2QIOA 1BDBA 4M0FA 4N12A 4EJSA 1KY2A 2HA0A 2WFZA 3K4QA 4EI2A 4YRSA 5AI8A 2EZTA 1W46A 5HKLA 3IBYA 4H15A 2H4HA 4BRUA 4DEXA 4TZ0A 2BT4A 1P0CA 1CIVA 2ZRPA 3AR4A 3IR6A 1C2YA 4NZPA 5KWEA 3TSOA 1MQSA 4KR6A 1V37A 2MSKA 3B52X 3SFTA 4EY4A 3BMXA 1L7BA 2QZSA 4ERXA 1CF2O 1SXGA 3FJOA 2AG0A 2WT4A 3K0CA 3OTOB 1X7YB 2OAP1 4MROA 4N03A 3FTQA 3SF8A 5F2NA 4YCNA 5SY4A 4PC7A 1N36B 3AP2A 1F2DA 3I9FA 4MUKA 3AUFA 4ZPXA 2IWHA 3VO8A 3WB0A 4Z54A 3G3EA 1U0RA 3GLHB 4U5QA 3RAGA 5COBA 2Z3ZA 2QPLA 4C88A 1R6XA 4QKQA 3B1XA 2AS0A 1Z2OX 4AJEA 2I2XB 1OKKD 4MVJD 2AOWA 1NW6A 2E21A 2Q2OA 5GONB 3UT6A 4BTLA 4HTAA 4YY3B 2KBFA 4I4LA 3U56A 1BCSB 3S44A 2BHNA 4PG6A 2I9KA 2LP4Y 2H0QA 2VLIA 4KFRA 4NBSA 3KQUA 4R41A 4Z7QB 2ZSBA 2VAMA 3K4PA 5HKKA 5DYGA 2X4DA 4IHJB 3GUZA 3W5AA 3DMTA 4IIEA 4PBTA 1Y7LA 2VHCA 4MV0A 1CS0A 2OK8A 4RHUA 5E4JA 5KYXA 3FE2A 3Q40A 4YTEA 1F8XA 1KJIA 1GVHA 4DLRA 1W2GA 1YIDA 2E18A 4B32A 2H18A 3F6YA 3ZC3A 3RC7A 2GK3A 3E48A 5AM5A 5EPOA 4HAWA 4D0SA 1I2BA 1GRCA 2I8LA 4B2PA 4MK4A 1N2XA 2R6JA 2X15A 4QTTB 3S99A 3U62A 2AIRA 3DE0X 5DGCA 2R25B 3V8RA 1Z0FA 4IGEA 5AKIA 5HIKA 4NOJA 2XTJA 5FOUA 3QENA 3DXXA 4U7WA 4WFIA 4TKZA 1LPAB 5ALMA 5TVKA 4MDFA 3DFIA 6LDHA 3BA1A 1SUCA 2QVGA 4GLOA 4Y2GA 3E9CA 1E1RD 3WMXA 2XUPA 4HAOA 2RJ3A 2HA2A 2ISCA 1WVMA 3W8RA 5ARCA 1XBTA 1I2MA 1ZBDA 2GJAA 3DJFA 3PNVA 3KQSA 5IZ4A 5LYJB 2VYQA 5BSGA 1E4EA 3Q88A 3QOXA 4P5DA 1A8HA 3M83A 2BWJA 5FL3A 5DVZA 2JCBA 1FUYB 1XZEA 1Q1GA 4EITA 3BERA 3QXHA 4L3VA 3ZVNA 4CEIA 1UBKS 3MTGA 5ALDA 4DHWA 2GF9A 1MJHA 3AF1A 1Z82A 1V2HE 2PJUA 3T1TA 1KS2A 2H3HA 3GJ5A 1EGVB 4BY9E 1MNQA 4JLBA 2VRWA 1UDXA 4LWZA 1QDLB 3J7TA 4WV3A 1RYBA 3AEKA 2MIIA 2WOOA 2YKGA 1TIPA 3HRHA 1F4LA 3KJZA 3OEED 3RRZA 4N3BA 2NU7A 1XZPA 2ZEJA 3ACDA 2I03A 4CMJA 1HWYA 1EHYA 1NSYA 2F90A 1HDIA 3KYBA 4ZIRB 4Z4CA 1GRRA 1NMYA 4JEMA 2HF2A 4P4NA 2P68A 4TRNA 4IOMA 5BQ5A 1N57A 4NYIR 2V1XA 4UJ5A 5IANA 3I6ZA 1MIOB 1M34A 1MB0A 1US8A 3BTOA 4RA6A 3JQ8A 2Q4TA 3SHTA 5AVOA 5FRDA 4DARA 1RRFA 4Z9YA 2JFFA 3OUUA 3AEQA 3A26A 4PFSA 5JWHA 4YONB 3WL6A 2OBMA 1XPUA 2ZAMA 2UZIR 4RA9B 3I1IA 3STYA 4FT2A 521PA 1VE6A 2K5UA 3HV2A 1C81A 5LP6A 2FSVA 4X97A 4KG7A 3OAAD 1ZIPA 2FN3A 1A9XA 4Z9AA 4G0ZA 5BSTA 3H1TA 1D2EA 4A5OA 1UPAA 2DR3A 2QQ0A 1QF7A 1T2VA 3TKLA 4R6XA 3ZDBA 4P4SB 4OIFA 3R75A 1Z6AA 3OTQA 3VPSA 4HT3B 4LKOA 2BUCA 5AI0A 2AMLA 2JD1A 3PFIA 4EYOA 1Z83A 2WIBA 2XYGA 2PYIA 3EGVA 4RNDB 4EPVA 2BGWA 1Z8HA 3TJZA 2O7VA 3NBMA 4D56A 1XD8A 4P93A 1K7YA 3GGDA 4XLLA 4OGLA 4RGYA 5HCIA 4D5EA 1RQPA 2DKFA 4RD0A 2YY7A 2CE2X 3DV0A 4N6GA 2Z1MA 5C0OE 5C5EA 4XWWA 1N2OA 1UPBA 2IYLD 4DCMA 2M2IA 5C8XA 2HQ1A 5E7IA 4R0MA 4CQMA 3K8ZA 2ZJ6A 1L8OA 1QG2A 1KYQA 1IG3A 3FYUB 4R16A 3CF4A 3WMWA 4K6KA 2PMKA 4I1SA 4DIUA 2ZBEA 3LZDA 1REQB 1F1JA 2FW6A 1AY0A 2GBFA 2PG3A 2YHSA 4M1WA 2QVZX 4RWEA 4MYUA 5JROA 1PIWA 4R8VA 1BE6A 2WSSA 1TGVA 3EVDA 5K3DA 3X43A 4BMOB 1TKBA 3PT5A 3VR2A 4WY8A 1F06A 4GYJA 5M7EA 4TQAA 1O1YA 1QUFA 3A05A 3I1FA 3VU3A 3CB2A 1TVCA 1NW9B 1N3LA 3BXZA 1SBQA 2LR0A 2QZ4A 1TCVA 3EVNA 3JYQA 4RORA 3RS5A 1GFZA 4BZPA 1JEDA 3UXHA 3IEMA 3NHSA 4DR5B 3EG9B 1RXUA 1XVLA 1LA2A 3RFVA 4L5BA 4A73A 4M0PA 2WVGA 3O1IC 3MIZA 4BAZA 1TQ6A 3OQPA 1CJTC 3MJFA 1NBWB 3IILA 5AVUA 5IC6A 1A9OA 3WKCA 5FUBA 1ZESA 3PVCA 3ZWVA 3RS3A 1YZTA 3UPUA 3QSGA 2REQA 3CNQS 2A0UA 2XIQA 4H60A 2WTNA 2IC5A 3PS9A 4D4LA 5HJ7A 5DHQA 5JNVA 2I3DA 1H1DA 3VR1A 3F96A 1GGJA 3K20A 1WTCA 2FX5A 2WMYA 1EVEA 3BKWA 1RQRA 2BTOA 3OOYA 3T7AA 3KAPA 4Q19A 4DM4A 2W4MA 5LMZA 3GCWA 3ULKA 5DU2A 2OLEA 2DH6A 3KTDA 3MERA 3JTMA 5TLSA 3UAWA 4E6EA 2XQVA 4KVAA 4PO8A 4S3MA 4OBEA 5FJJA 1R5BA 4Q9AA 4IPTA 4IIVA 4WCFC 4E88A 1KU0A 4YLGA 1XNGA 2W2LA 2WWWA 1E9SA 2AFIB 2QP3A 1FSFA 3OY7A 4WI1A 4CU2A 2PUBA 1F4VA 4PSUA 5AT1A 1AUPA 3DMFA 1GLGA 2C5SA 4WBNB 1L5MA 1YK0A 3UTCA 1OFTA 2ZUVA 3TLZA 4O2LA 4HNVA 3AOEC 3QJ5A 2KB0A 3C3DA 3M2TA 4XPZA 2GEJA 2RE8A 5TGDA 2E6KA 5LP1A 1I01A 3PYXA 4P3YA 3KQWA 3STUA 1SVLA 4A10A 4WADA 5GAJA 3UMYA 1GXSB 2VP3A 1RWPA 3DHYA 3MXTA 1DKMA 3QYAA 2E89A 3AF0A 5IAJA 3WNCA 5JSFA 1KK1A 1WAMA 3Q41A 4TLEA 5CVVA 4WDQA 4DIKA 2OHIA 1CY8A 4DDVA 1SKMA 4MUGA 4M0MA 3AC0A 2PLNA 5ED0A 2J45A 3T7IA 1SKAA 1E2EA 4OGWA 1E1LA 1P2VA 3ZWPA 5CLFA 4D4KA 2GERA 4GE0A 3UA3A 5DNAA 3WL8A 1VCIA 3OIFA 3EVCA 1B6TA 4AQYB 3ZQ6A 3DO8A 1K75A 3G5TA 3QKSB 1DRKA 1KVSA 1AS2A 1ZLXA 1LWOA 2DFTA 3Q2IA 3ZWBA 3CT6A 3FKSD 1L9XA 3B1VA 3EIEA 2FP4A 3P0EA 1P2BA 2XOXA 3HUDA 3E5HA 1LPMA 4MV3A 1T2AA 3I9V1 4E2WA 3LWNA 3LO5A 5DGTA 1FMLA 4LVUA 5FXMA 3EF3A 3GFTA 3IPYA 2REOA 3LDHA 1NV9A 2FEXA 3JD3A 3NHPA 3B6EA 3RR2A 5L3SB 4IKEA 4B6GA 5E2BA 2AFRA 4LE2A 3TDNA 4LJLA 1E92A 3PQ5A 6AT1A 4HY3A 4B8WA 3NV7A 1SUBA 2ISSD 2J7PD 4NDNE 1XQXA 1GNPA 1YJBA 4UEKA 5B1HA 1KU6A 2RJOA 1IHYA 4YUXA 3IJRA 1DE0A 3A8TA 5DI3A 4Z7NB 1TJ5A 1YQDA 3G6WA 2R85A 2QS9A 4X6UA 1FB5A 1WETA 2Q1TA 3HXTA 3A6PC 1GQ2A 4JU9A 4M9QA 1FP6A 1HEIA 2B1IA 3BREA 1RAAA 2PLWA 5K05A 1KJJA 4WNYA 3X1YA 3G5AA 3IE1A 3AFIA 2FEAA 4PSKA 4Q7JB 3WGNA 4G9GA 2I62A 1OUMA 1OFUA 3GCGA 5G2OA 4EARA 3LHDA 3AY6A 1GTVA 3B53X 3HH8A 3NC1C 4G6ZA 5CJPA 3U9SA 4CHTA 5A4DA 5HQ3B 3OOJA 4N8DA 3IRVA 1QYWA 5GQSA 5BOVA 2WR8A 1C9JA 1HH4A 2ZS9A 2E4XA 4JBHA 1ZKDA 2G1PA 4DW8A 4G1EB 5H82A 3G9ZA 4PGHA 2PUEA 1R3DA 1PW7A 1HYQA 1L6RA 3ER9A 4DLWA 5KC8A 1K9SA 3A6GA 3F5FA 4GPTA 5ANRB 1CG6A 2NZYA 4CM8A 2YWEA 4JT4A 1E3WB 3THYA 1AN0A 1NPYA 2H7VA 2HQOA 2ZRNA 4RQUA 1AZLA 2ZB8A 1DXHA 1Z7EA 2EIHA 5KSPA 4LF4B 1LTKA 3AR3A 3L7NA 5C4MA 3G8DA 1YK1A 4KC0A 1OCEA 1PJAA 2SNIE 1M1ZA 4PYLA 3QF7A 4A2QA 2GBLA 2YFYA 3AQIA 4NJEA 4O4LA 5D01A 5IDVA 4AMVA 1CE8A 1QAMA 4R1NA 4PQRA 3C5CA 3KT0A 2SBTA 1VA5A 2B5WA 3BCSA 4D4IA 1NP3A 1A96A 1RJ9A 3VYVA 1XAJA 3CF2A 5IMBA 4BLPA 3H05A 2FW8A 5FTKA 1QHIA 4AC9A 1VJDA 4JI8B 3TTTA 2P1RA 3R3XA 3PGKA 5ITVA 3LVRE 4Q05A 3MS4A 4FFPA 3H5RA 2MSEB 4MUBA 4XEHA 4ZVQA 5CDUA 3ZD8A 4GH5A 1FLDA 2OB2A 2X8LA 2OCYC 2VPQA 2NUAB 5F64A 1UZMA 4GLBA 2BEVB 3KSUA 4XPIA 1JXAA 2FRDA 1C4KA 3ZCTA 5JLJA 1KMCA 1NOIA 3L7MA 3OJOA 2OCIA 5HDQA 3U7QA 4NCJA 4E70A 3R5HA 5E7JA 4GXQA 5JECA 3OPYA 3C6YA 3HI6A 1T5DX 3B48A 2QT9A 2HH9A 4RQBA 4PX3A 4CQLB 3NNSA 3SS9X 4BFZA 2DPXA 1I5OA 1W25A 3PHIA 5TQ2A 3DM5A 5LWQA 3IKLA 1CPYA 2DLDA 3WDMA 2B69A 2I3GA 2PZBA 2PQ6A 2ZR8A 4O3FA 4OKNA 4PZPA 5A4FS 4BO6A 2G3YA 3T35A 4K81B 1XL0A 3TQRA 2QW0X 1DIBA 3WYGA 4ZN6A 1NT4A 3BFJA 5JCPA 3DZJA 1R74A 3RUPA 5K3EA 2I76A 3JD4A 2EBUA 2QROA 1MQAA 1IYZA 2ZJBA 3G0IA 3WIEA 1FVOA 1RVV1 3G9UA 1LEHA 1DC3A 4ZT5A 1QPZA 5BO5A 1EK1A 4IQ8A 3QPWA 8ABPA 1U2TA 1NMSA 3FHCB 3TTYA 5ICCA 3K1ZA 2COKA 1EDBA 2R87A 3JWEA 3KHTA 4JK3A 4R8SA 2CUTA 3UUEA 4OJMX 2R2AA 1NQWA 1TEVA 2AD1A 3AWDA 4YRLA 1R0SA 1USGA 3WYFA 1SCKA 1GL6A 4YDRA 1TFUA 3OX4A 4URVR 2LDBA 3ER8A 5DI9A 2NPIA 4EY8A 4RH1A 4Z4IA 2JHGA 2YXLA 2FK8A 3UB3A 3Q8MA 3EK2A 3O7MA 9LDTA 1KXJA 2P2CA 1P1IA 2RGRA 2Y0CA 3DZHA 3EXEA 4QGGA 4BO3A 1YWGO 4HZIA 4G1CA 3AU9A 4BQEA 5CU7A 5HIJA 4ZOAA 1Z37A 3DVQX 3RRFA 4KR9A 1BZYA 1M8JA 1S89A 1JIVA 4JNCA 2DLNA 4O2BB 4FEEA 4OD0A 5FUWA 3ZXSA 4BQPA 2O2XA 4UMFA 4G0UA 4C3OB 3EBLA 4PCUA 4YAKA 1UKAA 5JADA 3GT3A 1HDCA 4RKWA 2Q4DA 2CLHB 4F9GA 4MS1A 4YUAA 3DBRB 1XJ5A 2O2IA 4PQFA 4CEJB 1JBEA 1ZKMA 3O2SB 1BHJA 5K03A 1YA4A 3H2KA 1W75A 2W2NA 1ZNXA 3KPUA 4IGKA 3BK2A 3C8HA 3DZGA 3ZGYA 4AZ0A 1L5WA 2XIJA 2ZBVA 1HT2E 1GCAA 2I7CA 1IEXA 1Q74A 1TCCA 5FPYA 2GM5A 2WDPA 2EDCA 1C8LA 4B83A 3P9CA 4DIEA 1DC5A 3CS3A 3EY4A 4EG7A 5C8YB 5J4HA 1K92A 2VR1A 3RS7A 5FPQA 3AIOA 3H4IA 3H6KA 5SYAA 1VPLA 1ONPA 4IUYA 2YY6A 5HFNA 2AW3A 1MA3A 3Q5EA 3DKPA 4ZRDA 1T0IA 1T6ZA 4F3TA 2MINB 2A3NA 2B8WA 3MYYA 4Q01A 4KN9S 1AV7A 2QTLA 4QTYA 2MU1A 4MDYA 4B31A 2FWPA 4REOA 5KEIA 1R5OA 1Y37A 2OL4A 2V7VA 2ZRGA 4HKTA 4O5OA 3EQ2A 5JFGA 3SFZA 1FNSA 2PH5A 2PBZA 3Q5GA 1J8DA 3ZJ5A 3GA5A 4DBZA 2RG1A 3A25A 1RXEA 4L1KA 2WU4A 2NXJA 4JP3A 1ENYA 3TOXA 4EUSA 1L5NA 1DQSA 3QTBA 1Y4AE 1JR4A 1RU3A 3FDIA 4EGFA 3WNZA 2GCEA 3JSXA 4ECEA 1QGAA 1PV2A 3DGFC 5F21A 2PUDA 3SXUB 4KXUA 9LDBA 1JECA 1WX1A 4RZIA 1RKQA 3SLKA 1G1MA 3M49A 4RXUA 4D8UA 4UUMA 4MW2A 3A1NA 4NH4A 2ZI4A 3UV7A 4EY6A 5FOTA 1JEEA 3DSRA 3LV8A 4QDXA 4S0XA 4X62B 4M8NE 4O4IB 4Q6BA 5IT5A 1M8GA 5HILA 3IR7A 2VKQA 3VR6A 4H7EA 2FWMX 4OHRA 4Q02A 4ZC1A 3TZLA 1E2HA 3V5NA 3P5SA 2GNAA 1U8YA 5JNTA 1N5OX 2NU8A 2NO6A 2VJPA 2JGNA 2H4XA 3M5CA 3MFQA 4G0YA 4Y9UA 1U8TA 2AI2A 2JCXA 2FPMA 3C3YA 3KK0A 4NYIQ 4YJGB 3H1FA 4FXOA 4B3RB 1ZUHA 3EBPA 5CDGA 2J87A 1NPTO 2UV8A 4P7BA 3LBIA 5EJ2A 5CA0B 3IXMA 5EJ6A 5LQAA 4WXMA 3BL5A 4G84A 1VE1A 2D1TA 4XVRA 4D6PA 4DPLA 4JEHA 4BV9A 5IRCD 3PCRB 4BNXA 3P0FA 3FSEA 2XDAA 4JXXA 3INNA 3UGJA 4N7MA 4H7JA 3T9CA 2G5PA 3WLHA 3A36A 2RGYA 1A8UA 1JDSA 1MOSA 2FX2A 2ZBDA 1MG5A 2ES4A 2VXCA 3LP6A 5K3CA 3U3ZA 3MZ0A 3PNQA 2C7PA 1OH7A 3TPFA 4PE5B 1R0KA 1NN0A 1N1EA 1SIBE 3KKPA 5F76A 3TMKA 3WRYA 3ZJYA 5C5DA 1DXOA 1E69A 1A71A 5I9MA 3T5AA 3F5QA 2G7MC 1JSXA 1KBOA 2VNJA 4J03A 4UNNA 2IPXA 5A1JA 2XDWA 3JASB 4ZOLB 2IBSA 4QJIA 3RSCA 3P9IA 3S7ZA 5COAA 1CJUC 4LSZA 3FDJA 4UVHA 1PL0A 3ECCA 3L8YA 4OUDB 5DMXA 4UVEA 4V2UA 1QB8A 2Q2VA 3DF7A 2OZEA 4JHXA 4YQYA 1BMQA 3A6ZA 3RYCA 3I72A 1RLOA 1J21A 3TGLA 2W6MA 1S0UA 4XD7A 2DETA 2ZCJA 3ZJVA 3CWCA 1XDDA 2XBMA 2W93A 1FNBA 2C3UA 3H5IA 4PF1A 5ALOA 5A4KA 2GZMA 1SKUA 2QTCA 3FCSB 2VP2A 3GH3A 1ILEA 1SY7A 1SK8A 3HEMA 1SH7A 4JLMA 4UNPA 4DJTA 3AKDA 1MABB 4MV4A 3OEYA 2Z95A 3FZGA 1XCGB 4ZQEA 4QECA 2WZDA 2YWGA 3CUYA 1TJYA 5HVNA 1B8VA 4LTNA 3ZR4B 4U8GA 1UOPA 2LBPA 4FGSA 3GZTB 4GOND 4QEDA 4ZVTA 3ZE6A 1S8FA 3M7IA 2BHTA 1W0JA 2Q21A 3RVSA 3IEIA 1M1XB 3CV3A 3SE0A 5A04A 4XWGA 2P27A 1P9WA 4RCYA 5E6SB 4DF3A 5I7SA 4WAUA 3ZDAA 1CUBA 4HYQA 1L4MA 2J6IA 1XZBA 3C98A 1GPJA 1XEWX 3WP1B 3M1LA 2WHQA 4K9QA 3AYXB 2WSLA 3Q9SA 5DGIA 4O2AF 1KZGB 2OFOA 3NTUA 1U3FA 1AA6A 2REXB 1IWBB 2W2TA 1Y8QB 4Q4HA 1X70A 3HXPA 1RWBA 1J24A 3K1TA 3AXSA 1AQIA 1C7JA 8GPBA 2O0JA 2QN8A 2QV7A 3GQBB 2O8EB 3ABZA 4KGXA 2YTZA 4FYHA 2BM9A 1H8EA 3DTTA 4B17A 3AVXA 1EM6A 4A6EA 2JHPA 2DMRA 4ISBA 3Q10A 4OFBA 1L7XA 5G1PA 3QUCA 4LDRA 4NBLA 1HQKA 2MCFA 3FSGD 4BMCA 4ER5A 5IBCA 4LGCA 1Z17A 4XKJA 5DF1A 4YRQA 4ZYVA 3HDVA 4I4IA 4LW8A 5AI5A 3QVLA 3IDFA 4ND6A 1E9BA 1P33A 2HSJA 1BIFA 4PYOA 1OFHA 4UDXX 5FP0A 2RHMA 3PJFA 1AQ6A 4TS4A 3NTLA 3PX2A 4BYGA 3TFOA 1Z4LA 1I2DA 3WOHA 3I9LA 1QH9A 2VHEA 1BE1A 1K89A 4GSYA 4GSKA 1P6QA 2YQ4A 3QH4A 4QRIA 3IFSA 1S7CA 4V3BA 2BEWB 1YQEA 2O52A 1ETUA 1QV9A 1T5IA 2BTQB 1XRQA 3IQFA 4KVFA 3NXSA 2HPHA 3GMSA 3P0RA 4LZWA 4Q3KA 1OV4A 1B76A 2H85A 2VDQB 4PPGA 5D87A 4UBOA 4I1IA 5E6RB 4B7ZA 3QBEA 1G8FA 5LFAA 4M9XA 4X1KB 3TBKA 4HPXB 2JI4A 1FQWA 3C1TA 1HFWA 4RPJA 4MKHA 5EA2A 3TQSA 4XASA 3FYHA 4FYPA 4HDMB 4JBLA 1ZH4A 1WR8A 1ZD2P 4RS3A 5KWIA 3OZWA 5AVXA 4YX9A 3EIOA 1JHDA 1WOYA 2VBFA 2WU8A 3R7SA 1CQWA 1PSWA 5KS2A 1L4HA 4BLQA 3A9WA 4UOEA 3L79A 2VIIA 4TMKA 4TMZA 1PLLA 1LW7A 2I8CA 1N2ZA 2GO7A 2NO5A 3K05A 4QDOA 4Q4JB 3LT1A 4WH0A 5TE9A 5A4JA 1LBSA 2CD7A 2ZU6A 5JAMA 2UXBB 4W5HA 1JN0A 1YVRA 2BR5A 2DCUA 4AJJA 4X24A 3OBBA 3O8CA 5JJ5A 1LLDA 2J5KA 1HK7A 3JQDA 2CVOA 2PMDA 3TL2A 1YOBA 2WWHA 1T2CA 3ENQA 3M4ZA 3W5HA 3CRW1 3F46A 1PTJC 3DWEX 1YZYA 1UJ5A 3NIBA 4C0QC 5J43A 5BR8B 1J99A 3LAWA 3UICA 1YASA 4I5FA 1TMOA 4DC9A 2O4CA 2GTHA 4U9UA 3ZBUA 1JWAB 4EB8A 3D8RA 4QARA 2BFCB 1DLJA 1UEJA 2Z6VA 1C4XA 3F5SA 5T5QA 5KOIA 1GQFA 2ONZA 3SQWA 3B3FA 3ENKA 5KCMA 1N75A 1ONNA 1TF7A 4LV6A 1ZEJA 4BE7B 1GU7A 5A0VA 5DT9A 1XCPA 3BRQA 3PG5A 3RB8A 5C52B 2WT9A 5FA6A 1TAQA 4MWEA 3BB1A 1UKZA 2EX1A 4KPUB 2YVUA 1JV2B 3FROA 2Z30A 3LPCA 4C21A 4CR6A 1PEAA 3M1YA 3DXYA 2PUAA 4PTLA 2C98A 5CJJA 2XCSB 4PBRA 3JQAA 4Z9XA 4OOFA 3BWVA 2BGUA 3CSDA 3P20A 3Q8WA 4S05A 4YAWA 4LRTB 5K3FB 1G9SA 1G4UR 1QG0A 1QYDA 1XDWA 2X2FA 1G5QA 2Q5IA 4QPPA 4DGSA 2SKDA 3KIPA 4C0KA 1X3LA 2J5QA 1SZJG 2X3UA 3GFSA 3P9ZA 3MLBA 1ECFA 4RMJA 2FPXA 1DKNA 4D9GA 2R8ZA 4RE5A 3SDSA 5CAEA 1ETHA 3KWJA 4TZKA 1EK0A 5GP1A 3D8NA 4GOOD 3S2UA 1BH6A 5LMUB 3DFZA 4LMRA 3ZE2B 2WOJA 3F78A 3WRVA 4IIDA 2GN0A 1YS4A 1PR6A 2R6ZA 4XWKA 2AMYA 4AI6A 4RTSA 2R96A 4C0JA 2YXPX 3EF0A 3M4NA 4XQEA 3DTNA 3GHYA 4CM5A 1DCKA 1J6UA 4HB0A 3ASYA 4CW7A 4KLNA 4NYMQ 2BDTA 4D81A 1WBJB 4GKKB 4OLHA 3HP4A 4HN2A 2P9BA 2RI1A 2YRFA 4X61A 1AUOA 1TIBA 4R1PA 5TXGA 4P3XA 3DZIA 3UFBA 3NYQA 1XZLA 1BS1A 2GOYA 5G53C 3ICCA 1NJGA 2Q7XA 3OZTA 2NYVA 4M0UA 1AZSC 4TYQA 4YBZA 5C32A 3CW9A 1R8QA 1JZSA 2BBOA 2ZCUA 3KKQA 1UZLA 2XNHA 2C07A 4R51A 1JPJA 2C82A 4LDNA 2ZVQX 4QGHA 3PEVA 5AKKA 5DYTA 3CZ4A 4YACA 1T8SA 2OYCA 4DZRA 4S24A 3UK6A 3K0EA 5IU6A 5LN1A 1POXA 2DR0A 2JGAA 3CW8X 4BQFA 4DLBA 1P77A 2XKKA 2CV0A 1U5BA 3G0DA 1I4LD 3CH7A 3SSOA 3SNKA 5MGNA 1JIIA 3D8BA 3DV9A 2PO5A 3T0FA 1R0BA 4JIGA 4OP3A 2VDNB 1SD1A 3WYNA 4NPHA 3T0GA 5BXYA 1RWVA 1MX3A 1L1FA 3ED1A 5DNVA 1UFVA 2PWPA 1NN1A 2HSDA 5KX5F 1WZCA 1C0LA 1HUQA 3NHYA 4GRIA 2BM1A 2F4VB 3AX6A 1JWBB 1O6BA 2CYCA 2XXBA 3W2FA 4E1AA 1RSZA 5FADA 1G2QA 3UAGA 1OXVA 4YC7A 4YT5A 1NXQA 3FTDA 1EFPA 3DOUA 3UYLA 4L8YA 1L4YA 4L72A 4UUQA 5C51B 3OURA 1OTXA 1XRNA 2GLTA 3IPAA 2R97A 2WJHA 3IVCA 2Z4RA 4J0CA 1XWWA 4CCYA 2B4TO 1SXHA 2ZXFA 3I0NA 4WK0B 1JU9A 4QU0A 1DBIA 4L9SA 3RTEA 3UOWA 2NT3A 2FPPA 5TMBA 2OBNA 4PR0A 3A4NA 3BAFA 3JWGA 1KI2A 2WIJA 2FQWA 2WSMA 2ACWA 4UXHA 2PSDA 1CUDA 1N7JA 4HAVA 1JLKA 1P2UA 3U4DA 1XALA 3K35A 2G71A 2VH1A 1Z34A 1Q11A 3N0VA 3ZTYA 2O8BB 4XCVA 3ZY2A 2WIKA 4EUEA 1AB6A 1N9KA 1QYXA 3N05A 2DPLA 3F98A 4N7RA 4ED9A 1X39A 4LXTA 1TEHA 5FBVB 2UAGA 3BH7A 3OZIA 3OM1A 4E7PA 3STWA 1ZVKA 3BMCA 1H65A 3I76A 5LKAA 1T2NA 4ZO8A 3BXHA 3AV3A 1ZAYA 5B7NA 3PK0A 2P11A 5BN5A 2Q9UA 1SCAA 2GGSA 3HY6A 4ND1A 3WGVA 3KR9A 4YI3A 3K3PA 5B2ZA 1PG0A 5T64A 1U3VA 1JTEA 1RE1A 3ZOZA 3I04A 4OMCA 1MCZA 4I8IA 2D1RA 3DEZA 3G0GA 1XEFA 2M9MA 2PUVA 3M89A 3PGJA 1JR3D 4TLDA 4CIWA 4ZYYA 1N4DA 3ELWA 3IVXA 2CWDA 3ZKWB 4EA9A 1W9HA 2WJ4A 3GBPA 2C1EA 5C18A 3ZZNA 2BBSA 3K2BA 1GGNA 1KEVA 1CUGA 4V03A 1ODIA 1VPTA 1CW2B 1KARA 2HMTA 2LZ0A 1OYOA 1E3SA 1T2FA 5D51S 2JC3A 1L5SA 4RFSB 4R3UC 3Q0TA 2H00A 3NASA 4UXIA 4DRZA 4PAGA 4RVSA 1W35A 3DDNA 2PVPA 5DBOA 3U13A 2TSYB 3KDSE 1S8OA 4IDHA 1IK4A 3PYMA 4R0NA 5HF5A 3IDQA 1VBMA 5IVDA 3AINA 1MGPA 3A6DA 3O91A 1IY1A 3IPRA 2XCQA 3CGWA 4K9NA 1NKTA 4UXJA 3H9CA 3IT2A 2O2GA 1Y1LA 3ZHBA 2JFWA 1QFZA 2BCGY 5A9TA 4AY5A 2CCGA 1UQUA 5ECGC 5U4XA 2Z8YM 1BW9B 1TGYA 1R0WA 4NJMA 1FU7A 3COSA 2ZZKA 1YTLA 3LWDA 3QFTA 3VPHA 2BHSA 1ZCZA 3ITEA 4G5XA 4P34A 4OHYA 1J2UA 2J59A 3NHKA 1S3IA 2P2LA 4YJ2A 2YZMA 1HZZC 1ZRNA 2EFDB 2I5PO 2ODTX 3CEPB 3O94A 2WEKA 1KPGA 1DEHA 2R6DA 3DO6A 4HWSA 2GN9A 1PS8A 4HPJB 2ZJ3A 2XT6A 1OTYA 1F1BA 4JP5A 1KSHA 2C03A 2GPSA 3NT5A 4B80A 3LBAA 5KTNA 1XRS