4BMNA

Apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
252
structure length
232
Chain Sequence
GPAMYRLLNKTAVITGGNSGIGLATAKRFVAEGAYVFIVGRRRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPIATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALCLOHOL DEHYDROGENASE/SHORT-CHAIN DEHYDROGENASE
publication title Structures of Alcohol Dehydrogenases from Ralstonia and Sphingobium Spp. Reveal the Molecular Basis for Their Recognition of 'Bulky-Bulky' Ketones
doi rcsb
source organism Ralstonia sp.
total genus 91
structure length 232
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bmnA00
4W82A 5G0TA 3DBHA 1N1EA 3NTQA 4BGVA 1LEHA 3FNFA 4ND4A 4TVBA 1YE3A 1LU9A 4KTTE 2EKQA 4WLFA 1N8KA 4O5OA 3TL2A 3OICA 1GUYA 1VL8A 4DXHA 4ESOA 4NQZA 4HWKA 4R16A 3F47A 4LCJA 3S55A 3FNHA 1JN0A 1ULSA 3FSRA 2EIHA 3C3XA 8ADHA 2VRCA 3PZBA 4RVGA 2AHRA 4PRKA 3PYXA 5G4KA 2GNAA 4IY1A 4CMHA 4GH5A 1PL8A 2R2GA 4J43A 3TNLA 4LN1A 3ENKA 2D5AA 2E4AA 5JAQA 5I9LA 1VI2A 4CMIA 1YQDA 4PGFA 1L1FA 2X9VA 1C0KA 4RZIA 3QP9A 4LRTB 3EC7A 3KYCA 3W4JA 5CDSA 5IXSA 5JSFA 3NKLA 4PLPA 4KDEA 4X54A 3RUEA 3CMCO 4BO0A 1R12A 2NTNA 5L3ZA 3WWYA 2W2KB 4IJWA 3A06A 2FPPA 4N7RA 3RC9A 4B4OA 1XDWA 3IOYA 4GVXA 3WB9A 2OFPA 2DAPA 4WLEA 3BA1A 1QRRA 2YQ4A 2Y1OA 4ALNA 3CXRA 1A71A 1R6DA 5G0UA 1AUPA 1YOVB 3A4VA 3BIOA 3RKRA 2Y68A 3F6YA 4AJLA 1ZK0A 3ICPA 3HB4X 4PG7A 2QW8A 2I99A 5EERA 1K6XA 1HZJA 1H2HA 2X6TA 2VCYA 1YH3A 2YHUA 2BFAA 3TOXA 4NI5A 2CMDA 2JKVA 4XGKA 1ZVMA 1P1RA 4E5KA 5FEUA 2PV7A 4AJEA 2G5CA 3AJRA 4GKVA 2PZKA 3DEYX 5F5LA 4DYDA 3RBXA 5JCJD 4IJKA 1DXYA 2OBNA 2O48X 1E6WA 1T25A 4G2NA 2B4TO 3SC4A 3OQ1A 4CR8A 3RBVA 1R4MB 1OI7A 5A06A 4YXFA 3WGGA 4BKQA 2WMDA 1I0ZA 4PZCA 3C85A 3HSKA 5A02A 1PX0A 4MVJG 3JQBC 1Y9EA 4U8GA 4QFCA 4EJ6A 5T8KC 3O26A 4BQPA 2ZCVA 4FJ0A 3NTRA 4AJHA 2JFHA 5U4QA 4XGNA 5JBIA 3H9UA 2Q2WA 1DB3A 3N58A 3RVDA 1GZ6A 1UP6A 3OA2A 4P4GA 5L7WA 1I2BA 3OIGA 3HQ4O 2C2XA 4IJVA 1LLCA 1BW9A 2UVDA 5EQDA 3FPLA 1YDEA 2J3IA 1ZJYA 2NU7A 3QHAA 1HL3A 2AXQA 4NBRA 2Y0EA 3JQ9A 4BOYA 2C54A 3E5RA 1DSSG 4L76A 1KYQA 5A3VA 1V3UA 3ZU3A 4YT4A 2DQ4A 3F9IA 4WCFC 2Q3EA 4BNGA 3RUAA 2B69A 1XKQA 4LW8A 4YR9A 4CM7A 3JTMA 3PZRA 4FDAA 2A92A 4LISA 1GZ4A 4NHEA 1WP4A 4WCDA 1LUAA 4YB8A 1ZH8A 1KOLA 1GTMA 4FN4A 3U5TA 3JYLA 3BMOA 1K89A 1NQ5A 1DC3A 1XSEA 3INRA 4L9RA 1KVSA 4EW6A 4BV8A 5EPOA 4IDEA 1KVTA 3QE3A 2HLPA 4FFNA 3G17A 1R0LA 4D3SA 4MP6A 4AICA 3RUIA 2GASA 2DPHA 4IJUA 5IXYA 4U6SA 2P5YA 4PIVA 3AY6A 1D7OA 2BGLA 1DOHA 2O2SA 3UH1A 4IQ0A 3VH2A 4LRSB 5JDCC 5LDHA 4CM9A 2WE8A 4XKJA 4WNIA 2G82A 2JAHA 3GVXA 2YDYA 3WNQA 3TQHA 1DFIA 3RKUA 4EJ0A 3DR3A 3AY7A 5F1PA 1GYPA 4RORA 1O89A 2YV3A 5CHEA 1PR3A 4Y6SA 1OC4A 4R54A 1PJ2A 4TMFA 1UJMA 4B4WA 4AJPA 4WE3A 1QV6A 5C7IO 3HJAA 3PIIA 4BNHA 1R15A 1D3AA 4HY3A 4R51A 5JAMA 2EJVA 4PLWA 5F5NA 3CH6A 2OZPA 2UUOA 4YJGB 3VDQA 1ULUA 4MVJA 2J8ZA 4Y6RA 4XD2A 3QV1A 3D64A 4CLXA 5L4NA 3STHA 3NGLA 4OSOA 5DULA 3CMMA 5CAEA 3BMNB 4GWKA 3VOSA 3DL2A 3GGGA 3MTGA 3FNEA 1Y8RA 3DQPA 4UREA 3P19A 4YAIA 3KSUA 2CF5A 5TLSA 2GPTA 3DMYA 3JQ7A 2ZYDA 4PZEA 3WMWA 4DGSA 1E7RA 5DF1A 3K31A 4RCVA 1YKFA 5I8ZA 1YQGA 3WXBA 5BSFA 1PTJA 1ISGA 5IZCC 1M75A 1HLDA 2P9CA 2OHXA 2VOEA 4K26A 2WD7A 3ZV6A 3VKUA 3LYLA 2BKAA 4A10A 1H93A 2VHZA 1SB8A 3PJGA 1FDSA 2DT5A 1PSDA 1F14A 2IZ1A 3LVFO 2QHXA 4DUPA 2FZWA 2HJRA 3R3SA 6LDHA 3UHAA 4QQRA 3ETGA 3RSHA 4CLRA 1DLIA 1BDBA 3ROQA 3MOGA 1E3WA 2B37A 1GCOA 1ZCJA 3BTUA 3ZHBA 1M2WA 4MKRA 4TKLA 2X4GA 4IBOA 4BNLA 3MJCA 2VYVD 3CTMA 1EVYA 2EGGA 3EZYA 3I9LA 4GMGA 2P91A 2QRKA 1U3UA 1PJSA 1M6HA 5GY7A 1DAOA 2JCVA 4NU5A 2I65A 5A5FA 5A9TA 1GZ3A 3QVSA 2IEBA 3MJ4A 3QRWA 2OUIA 3VPSA 1KETA 1NYTA 1FMCA 4CR7A 3VDRA 3IDSA 1QYXA 2BI8A 3OIFA 3P7MA 1X15A 4J4TA 2C29D 3I23A 4I5GA 2PZLA 2ZTUA 4DIFA 2PTGA 1EBFA 1BSVA 4E5NA 4XA8A 2QRLA 1DC6A 1GQQA 3OMLA 1R4NB 4O63O 3DFZA 1UP7A 3IKVA 2B36A 1HSZA 1WZIA 1KEUA 1YDWA 3GPIA 3IC5A 7MDHA 3NJ8A 1G1AA 4XIYA 2F1KA 2D0IA 3PWSA 1V6AA 4NR0A 3NAQA 2NVWA 1FDVA 1CWUA 3GNSA 5TT0A 3W8DA 1E3WB 4YQYA 1IE3A 4J1QA 3T4EA 3PQEA 3TWOA 4E12A 4R1UA 4K9DA 5ADHA 3IQDB 3H5RA 4GI2A 1BXKA 1MFZA 3GDOA 2VZ9A 4XYGA 4BNUA 3IP1A 5KVQA 2AEMA 4UVIA 1CRWG 5COQA 5C37A 3PIDA 1Q2XA 2DPGA 1GEGA 1OBFO 5HA5A 4RVUA 1LA2A 2NU9A 3D3WA 5TGDA 4D79A 3L9WA 5KIAA 4YJHB 3C24A 2YQ5A 5GMOA 4YT2A 1K5HA 4M1QA 3TZCA 1DIAA 4R5HA 4OO3A 2QQ5A 1Z45A 3EK2A 1VE9A 3UCFA 1GPDG 4PLVA 1E7SA 1P74A 2QZ9A 3UUWA 2QRJA 4KZPA 3NX4A 4LVCA 4PG5A 4DREA 4IS2A 3HDHA 2HK8A 3GG2A 2WYUA 3GMSA 3EYWA 3LK7A 2ZJ1A 1JAXA 5KJFA 4J1TA 4AJ4A 3PP8A 5K6AC 3DHNA 4FPXA 4JJIA 3FTNA 2XXJA 3EVNA 1DFGA 3G1TA 2WTBA 2R00A 1PJQA 5DNAA 1NAIA 4NFYA 4KQWA 1XU7A 3QVTA 1ZZEA 3OJLA 1GU7A 4CM6A 3WICA 4L4SA 2C5EA 4NU6A 4Q3AA 4KDFA 1K0UA 1WDMA 4BMSA 1JWBB 3GRPA 4O0LA 3WFIA 4IQGA 1YJQA 1HDZA 1NFFA 1RPNA 4HP8A 5DCUA 3RC2A 3JQFC 5A03A 2EF1A 3Q2IA 2QIOA 4DMMA 1LRJA 2HCTA 1I2CA 1UZMA 4WCFB 5TRTA 4R41A 1S6YA 3LT2A 4AJNA 4NH4A 4FGSA 4R69A 4D42A 2O4CA 2QYTA 5BNIA 1BTOA 4RVSA 2XF8A 3BXXA 1FF9A 1QYVA 4BGIA 4AG3A 3F1KA 3VH1A 4AJ2A 1TEHA 5G0WA 3I6QA 2HSDA 4L8VA 5EJ2A 4GL4A 4MVJI 1SZJG 1HDXA 1GYQA 1R66A 1I2ZA 3EAGA 4P4NA 1NVMB 2YHIA 4RPJA 3X2EA 4DQUA 5ES3A 3DHEA 5EQFA 5DT9A 1E5QA 3JQ8B 1EFKA 3AWDA 2A35A 5KWEA 3NDRA 1MUUA 1A4IA 3L0DA 1PS9A 4MOWA 4MPDA 1PGJA 4H3VA 3S2FA 9LDBA 5JNLA 2VZ0A 2Q4BA 1NPTO 2DVMA 3AFMA 1LLDA 2W90A 4FJ1A 4RO0A 1GQYA 3JQAD 3AM5A 3WQSB 3WX0A 1A27A 1C3VA 2FY8A 1Y9AA 2DFDA 1UH5A 2IRWA 3HE3A 4M55A 1T4DA 4J1SA 5A9RA 1I33A 3AY3A 4J16A 1HRDA 3DFUA 1DIRA 4WPGA 4PN3A 1K6JA 1UP4A 4M87A 3GA0A 1NPDA 4JIGA 4JQCA 3GZ4A 2PGLA 4A2CA 4AJIA 5DZSA 1R16A 5CEJA 2H63A 5I7FA 1C0LA 2Y93A 1YWGO 1D4FA 4PLCA 1H9AA 1ENPA 2GERA 1D8AA 3HHPA 3MOIA 1U2DA 3DC2A 3KYDB 2H9IA 3I9JA 4D44A 3ORFA 1E3IA 1RYEA 1WVGA 5CDGA 5G0SA 3K5PA 4NZ9A 1B8PA 1DPGA 1UZNA 1ISMA 1VL0A 4R01A 2DBZA 1ZEJA 1CJCA 1ENZA 2FHSA 4MJLA 4NG5A 4ZVVA 3U49A 5A3JA 3ZDFA 2EKLA 3HWRA 4KWIA 4YRAA 5BT9A 3L6DA 1N9GA 2H5LA 4LMPA 1NPYA 3E1KA 4CMEA 4BGEA 1O8CA 1U3WA 2G1UA 2PH5A 3HFGA 4GKBA 4HFJA 3CZMA 3WSVA 1C1XB 2O3RA 3PK0A 3R3JA 3UAGA 3PLNA 4B7XA 4N5MA 3PQDA 2PGJA 1GV0A 3MJVA 4FFRA 4Q3DA 5DCWA 4Z0TA 5JW6A 2V6BA 1B2LA 2FR1A 3GR6A 4PLGA 2Z95A 5I7SA 1T2DA 1GCUA 3JD1A 3ONFA 1U7HA 2BFOA 4L74A 4UULA 5B4TA 1QG6A 2Q46A 3AOGA 2IYOA 3H9JA 3W6UA 2HAEA 3RU7A 4I9NA 3CUKA 1VC2A 4OXYA 2E37A 1F0YA 3SBOA 1UXHA 1T2CA 2X5KO 2NU8A 1Z82A 1MP0A 3IAHA 3L6OO 3H3JA 4QFDA 1Q0QA 4NJOA 2XAAA 3FTPA 2WEKA 4M8SA 4DLAA 5BNTA 3GH3A 4NJMA 3ZZNA 5CG2A 5EN4A 3ZWVA 3H6KA 4JP2A 2BELA 3ZWNA 1PJCA 3JCZA 5KVCA 3UXYA 4KTVE 4D41A 4XIJA 3ZWWA 3Q3CA 2CUKA 2PY6A 4PCVA 1B3RA 4UEKA 2Q1SA 1ISHA 2O7SA 3PGJA 4C7KA 1QR6A 1H6BA 2EWMA 2BGMA 5BSHA 3E6AA 3GEDA 1U8XX 3KBOA 2VNAA 4XYMA 3W8FA 2IODA 1X0XA 1RM3A 1DIHA 1PR9A 4E5YA 5T64A 4PLFA 1HE3A 3ROKA 5AXDA 2P4HX 4MO2A 1ID1A 4F45A 3GFGA 5B4UA 2WDZA 3INTA 1VL6A 4RL6A 4BNIA 4XYLA 3KZVA 1Y5RA 5A4DA 4L73A 5JAIA 4B79A 2VYND 3GDGA 3FPCA 4E3ZA 4CM9D 3GOHA 1ZK1A 4XR9A 5CFZA 5KVVA 1Z7EA 3DB2A 5JCXA 2AQIA 1A4UA 1H2BA 3E82A 1U4SA 4Y9DA 3UN1A 2O3SA 3ASUA 2JHFA 2X23A 1EBUA 1G0NA 1JKFA 2W2LA 5HWSA 2PFGA 3EHEA 3ZU4A 3UFXA 1NWCA 4JBIA 3TZ6A 4IIUA 3ROMA 5C3MA 3DZBA 3OJ0A 1F17A 3GG9A 3KRTA 4ZN6A 3GN1A 3LC1O 4YAKA 2IZ0A 5FI3A 2X0JA 4XQEA 4CUJA 2NWQA 2VRBA 2EV9A 2V6FA 3SLGA 1RKXA 4FB5A 4MVJP 1KEVA 1NQTA 4J7XA 4EITA 5AOVA 2NM0A 3PEFA 1RJWA 1PZGA 1L7EA 1ZKMA 2JD0A 4WEOA 1BXGB 4PVDA 5JDIC 1ISJA 3ZWMA 4FC7A 3H5AA 2QX7A 1LDEA 1JKIA 2DC1A 3VZQA 1YBMA 4J90A 4QO8A 4OOFA 4JNKA 2W2KA 3QJ5A 2HK7A 4LSMA 1DLJA 1Z6ZA 5G2OA 4UUPA 1DRVA 2JL1A 3G0OA 4RPLA 4II2A 5HRUA 1T1SA 2P2SA 3RBZA 5ICSA 5IFLA 4DBZA 5K0ZA 3RC7A 1U28A 4RLSA 1DBVO 4YQZA 4E5PA 2W8ZA 3COSA 1LBEA 1HYHA 3KSDO 1YOVA 3FBTA 4ITUA 2Q1WA 4ZHSA 3PWKA 1IULA 1SEPA 3B1KA 4WGGA 4GX5A 2RBEA 2I3AA 2Y1EA 3ANLA 2IYPA 2LDBA 5B12A 1YBAA 3S8MA 1SB9A 3WGTA 2GZ1A 2GO1A 2GSDA 3AOEC 1I3MA 1GUFA 1VJTA 3QWAA 1ZFNA 2ZK7A 2OXIA 4EGFA 1E7YA 2P5UA 1P45A 1Q1NA 2DTEA 1R4MA 1QORA 1J6UA 1YJ8A 2VNSA 3ENNA 5KCZA 1AXEA 1GR0A 1WLYA 1YL6A 3PRJA 4B8ZA 1W0CA 2W4QA 4FBGA 4TZKA 3VTZA 2C2YA 1FK8A 3PJEA 1E3SA 4BKRA 3BHJA 4EUFA 2X86A 3E9NA 5H81A 3HB5X 3DZIA 1DIGA 5U1PA 5JO9A 2I9PA 3FHLA 3ZWYA 2TMDA 3D4NA 4UUMA 4B8WA 3L6EA 1KC1A 2Y99A 2WE7A 4N5LA 1B14A 2O23A 3WBBA 1MFPA 3U3XA 3ANMA 1BRMA 4OXKA 4II3A 4M86A 2EJWA 4Z9XA 3KYBA 4GLOA 5G0VA 1XELA 3UICA 1NASA 1T26A 3MEQA 5TNXA 4D45A 4CQLB 2Q2VA 4JN6B 2D59A 5MGBA 3PQFA 3NTOA 3V1TC 2P9GA 1OFGA 2J3HA 3DZFA 5JLAA 1NR7A 3T4XA 5DN9A 3A28A 1LSUA 1XCBA 3D3EA 3M1AA 3EVTA 4TVOA 1HYEA 1CQJA 1PU2A 2VN8A 3IUSA 4TKMA 4BNVA 2AE2A 1I36A 4XB1A 3B6ZA 4Q3BA 4E6PA 5FF9A 5GZ1A 4IPTA 5JY6A 3RD5A 2AG5A 1ZUD1 2EW8A 3P2YA 3U4IA 1HE5A 3WG9A 1TI7A 4I5DA 3JQAB 4TRJA 4UUOA 2O3TA 1F8GA 3K2EA 2DLDA 3ZNNA 1IUKA 1QLJA 1IY8A 1HDRA 2RH4A 4YCAA 4U0JA 4GWGA 4JBHA 1JDJA 4ALIA 4CLEA 1ADFA 5TT1A 1X7HA 3ZU5A 2IZZA 2D3TA 3Q6IA 4DYVA 2FP4A 2D4AA 4UUNA 3JV7A 1O94A 1R0KA 2BHLA 3VC7A 4E13A 5FI5A 4XCVA 1X7DA 3JQCA 4CM4B 1HDGO 5AXBA 3DO5A 2NU6A 4OH1A 3L07A 4GBJA 2ZYAA 3MTJA 1E3JA 4ND1A 4JP3A 2VHWA 4OXNA 2FWMX 4A0SA 3ANNA 2UV8A 2NQTA 3QWFA 2C07A 1ONNA 3CE6A 2G17A 5EIOA 4GSKA 4CJXA 4K28A 4IINA 3SVTA 2WD8A 1QYDA 3IP3A 3LZ6A 1LDYA 4YPOA 3MJTA 3PHLA 1F06A 4EDFA 4XR4A 3OSUA 1C0PA 4FC6A 1MB4A 3AUUA 3W4KA 2FN7A 3E9QA 3CSDA 2VWPA 3VZRA 3V2GA 2PNFA 4YJGA 1IPEA 3M2TA 1NVTA 3ADPA 1LC0A 1VLLA 4WOKA 4PZDA 4M89A 4OJNA 3BMNA 3KVOA 2PKRA 1YQXA 1SAYA 4CL3A 1UAYA 1PJ3A 3G3EA 2CF6A 3Q11A 3DBVO 3ICCA 2PD4A 3K30A 3I4FA 4P22A 3O4RA 2PD6A 5F3RA 2XPCA 2NVBA 4F46A 3DBLB 3RWBA 4GSLA 3GY0A 4TZTA 2VHXA 1B16A 4OGWA 3F1LA 3PJDA 3WGOA 1MV8A 4OIMA 3RAJA 1GY8A 2JCYA 4HUJA 5A1TA 1M76A 3ZWXA 1K6IA 3T7CA 4E32A 3K96A 1BXZA 1EK6A 2BD0A 2WM3A 4CUZA 4R5MA 1EVJA 4A26A 4QUKA 1KVRA 2QG4A 4R1TA 5L9AA 1P33A 5JO0A 1K3TA 2NVUB 4BNJA 3PHHA 2X5JO 3DXFA 2PH3A 2Y1DA 4E2ZA 1WDKA 2O3UA 4MVJF 1DO8A 4EZBA 3EUWA 4NIMA 1N7HA 3VHRA 5CEEA 4OQZA 1E77A 3OECA 3HDYA 3DONA 5AYVA 1XEAA 1DHTA 2HU2A 3OEYA 3EDMA 1H9BA 2Q50A 3DOOA 3BHIA 4NDNE 4J4HA 3QWHA 2PR2A 3C1TA 1V9LA 1X13A 4B3JA 4CMCA 4URFA 1SNYA 1N1GA 2NNLD 5TQVA 3CINA 3PI7A 1D1TA 4QSMA 4BO9A 5JFOA 1EK5A 1YVEI 1OC2A 2WYWA 1HTBA 1WWKA 4ND5A 3DOJA 4AJJA 4GX2A 3NUGA 2X0RA 3RUHA 5JPIA 2Y67A 3JD3A 3TFQA 2GUGA 1PJBA 1NP3A 1XG5A 1R4NA 4CQMD 5KJCA 2JJYA 1ZMTA 4Y67A 4F6CA 5J23A 3BMCA 4HNHA 3ASVA 3PDJA 4Y6PA 4YJFB 5JMPA 2UYYA 1Q0LA 3KHUA 3F46A 3KSZO 4R9RA 4BB6A 4MKXA 3PWZA 3HUDA 1DRWA 2PZMA 4LCEA 5IDYA 3BYZA 1T24A 5AXAA 4KUGA 4DL9A 1O5IA 4AVYA 4IMRA 5DBIA 1VKOA 2W98A 3MJSA 4NBUA 4RPGA 1W8DA 4ALKA 2I5PO 2Q99A 2GYYA 2C7VA 4N5NA 3RU9A 4DQVA 1ZSNA 4R68A 2VOJA 4YJHA 3RJ9A 3H5NA 1IPFA 1EUCA 5IZ4A 5TX7A 1B8VA 2RAFA 1KEWA 1O0SA 3WQRA 2ZB3A 3D7LA 3I3OA 1TT7A 2GLXA 4RVFA 4K1LA 4ND3A 3E18A 1WW8A 3FI9A 1LC3A 1KC3A 2CSUA 3I1JA 3BMCB 3GFBA 3WSWA 2EKPA 1EQ2A 3AUAA 8LDHA 1J0XO 1SMKA 1BHSA 1KEPA 3WWZA 1WXDA 3GEMA 3FR8A 4MVJM 3VZSA 2CDCA 3LT4A 1HLPA 1T4BA 5DOZA 4RF2A 1Y8QB 4J0EA 4BNMA 4HADA 5DCYA 4ID9A 3JQBA 3LF2A 2D5CA 4NNJA 5T8KA 1XR3A 3IKTA 1P31A 4I9HA 3L4BC 2O2YA 4B7CA 1XQ6A 4IDGA 3JQDA 3RC1A 4DLLA 3OJEA 4EUEA 1XA0A 3KXDA 3ZV5A 1MA0A 3RI3A 3IUPA 2I6TA 3G1UA 5FYDA 4GGOA 3HN7A 1MX3A 3R6DA 2JFGA 5DP1A 3WMXA 4CV2A 5ITWA 2Z1MA 4YYZA 1HT0A 2GZ3A 1T2EA 4RPHA 1LDMA 4MIYA 4CM8B 5L4LA 5TS3A 5ILOA 4BO8A 3DAPA 4WUVA 1EVIA 5JCJA 1BMDA 5CPFA 2VHVA 4ZQEA 1HWYA 4ZQBA 4BS9A 3Q1LA 4U7WA 4WCFA 3ZW9A 1RM0A 4YJDA 2AMFA 1UDAA 1ZW1A 2E82A 2Y0DA 2ZCUA 4DPLA 4HV4A 1U2GA 3VVBA 2AA3A 2UDPA 4A5OA 2HMWA 4L4RA 3RFXA 4WEQA 3GN2A 3VZPA 1PL6A 1PZHA 3T7EA 2HRZA 1I10A 4JXKA 3RUDA 3UCEA 3D4PA 3E48A 3EW7A 3GT0A 4BKUA 1HF3A 1GYRA 4F3YA 5I8WA 2GN6A 1NWHA 2O3QA 2BI7A 4BNFA 4DPMA 1JVBA 2PKQP 1R0SA 3TZHA 3HFSA 2OMEA 5KNLA 1HDYA 3JQ8A 3UW3A 4EI2A 4NFHA 5K9ZA 1X1TA 3GK3A 3NDIA 1UUFA 3KLMX 4D3FA 3V1YA 4DBVO 3H9EO 4B4VA 3F4LA 1KERA 5HS4A 1ADCA 4IXWA 5JDCA 3IIEA 4QO7A 5ICMA 1ZK4A 1JQBA 2C20A 4OKNA 1EEHA 3I9OA 4RF3A 4XYBA 3I4CA 3DMTC 3FCOA 3LC2O 4W9NC 1D1SA 1JLLA 4PVCA 3W8EA 4PG4A 2F00A 4O6VA 1V35A 4BNTA 3NT5A 1TXGA 5KKCA 1KVUA 4DVJA 4DRYA 4U5QA 1EVZA 1VSUA 2DTXA 3DZJA 3QWBA 4OQYA 3OHSX 4XX0A 5JS6A 1EMDA 4CLDA 1YO6A 1G6KA 3X2FA 3K2BA 1M67A 1WDLA 4F6LA 1E7WA 5ILGA 2CY0A 5AQ1A 3KYDA 1DEHA 1Q0HA 1VRWA 4GLLA 3SC6A 1N92A 1FXSA 2B4RO 1XYGA 1IYZA 3JQ6A 1XGKA 3V1UA 2QZZA 2ZTVA 3QLJA 4JBGA 2H1SA 2VRCD 3GHHA 4BNZA 4B3IA 3WIEA 1I30A 4DTIA 5AXCA 3ONDA 4RDIA 1JVSA 3F4BA 1C1DB 1ZK2A 4NK4A 1U5AA 3BMQB 2YY7A 3PHGA 1I01A 1ZXLA 1A9YA 4PLTA 4C7JA 5ER6A 4J1NA 3ZWCA 2WWRA 3ZU2A 5IZCA 4EUHA 5IAAA 1GL3A 2P9EA 1ML3A 1C1XA 1UR5A 3KEOA 5G4LA 1E6UA 4N18A 2B5VA 1VKNA 5BSGA 1T1RA 2HUNA 4FS3A 2FOIA 5CDTA 1PQUA 4MIEA 3I5MA 1E1MA 3D4OA 1MC4A 1N7GA 4FW8A 2ZB4A 1CERA 2GDZA 4Q3CA 4WLVA 5F21A 5HM8A 3VPXA 5IDXA 1KBZA 3HG7A 4Y8VA 3WYCA 4CM5A 2VTEA 3RROA 1NM5A 1SCUA 3SXPA 3KEQA 4LVUA 5F1KA 4J9UE 2DU8A 2ZYGA 1U3TA 1E1LA 1YL7A 2VZ8A 4H7PA 3QY9A 1ONOA 3E5MA 1XLTA 5A05A 1LQTA 4ILKA 3QWIA 3NDJA 2D1YA 3VPGA 4R4JA 4DIBA 4GX1A 3GGOA 2I3GA 4LMRA 4J2OA 2VWGA 1U9JA 1LQUA 4K6CA 1GFSA 4Z3KA 1SBYA 3PXXA 4K6FA 2HMVA 2RCYA 1V3TA 2OBYA 4YDRA 5BSEA 3ZW8A 2A9FA 4DC0A 5L7TA 3B1FA 4I5FA 4XJTA 2VYVA 4XEHA 5HS6A 5IN5A 5I9MA 1PEDA 3U4CA 2X0IA 3WFJA 2B35A 4BO7A 3EZLA 4GVLA 2C59A 2B83A 4XQGA 4E5MA 4AFNA 4YACA 5LDGA 3JD0A 1Y7TA 2ZKLA 3F5SA 3TJRA 5IJZA 3OEWA 1NFRA 1HDCA 4BGUA 1S7CA 3KOUA 1F12A 1DJQA 1SOWA 4I9UA 5BR7A 2X0NA 3H7AA 3PTZA 4W4TA 1IZ0A 2RHCA 1HSOA 3CKYA 4BKPA 2Q2QA 3D5QA 3P2OA 1WMBA 3LLVA 1JWAB 4KUEA 1LXCA 4CLHA 3FD8A 4GMFA 3GUCA 2JAPA 4CUKA 3PFWO 2ZB7A 4ZGWA 4E2YA 1QKIA 4BNWA 2H6EA 4P8RA 3V2UA 5B37A 4BMNA 3O8QB 1ZSYA 2NTVA 4AJ1A 1V0JA 4OYRA 3B1JA 4CPDA 4BV9A 1YB1A 2GN4A 2Z1NA 5T5QA 5K6AA 2BMAA 3JQ9C 2J6IA 3IL2A 2DBVO 5CPBA 2X8LA 1CEQA 1A9ZA 1H6AA 1NHWA 3PFFA 3TFOA 3ULKA 3PHIA 1U8FO 2YYYA 1BXGA 3OF2A 5L40A 5KTKA 5GZ6A 1H6DA 2IXBA 5L51A 2E49A 3CZRA 1Y6JA 1PJLA 3U4HA 2B4QA 5FFFA 3TN7A 3ETDA 2P68A 4QT0A 1I8TA 2JFFA 4YWJA 2OGUA 2GD1O 3LT0A 4JK3A 4L4XA 3UVEA 3GLQA 3GC6A 4R3NA 3TL3A 3C1OA 1FDTA 1MXFA 2PGDA 2R6JA 3JQFA 4R1SA 3UGKA 1IHXA 4BNXA 2BLLA 4PLYA 1UDBA 1Z7BA 2Y1FA 3ONEA 1JW9B 3INGA 4JGBA 4A7PA 1JKJA 1P3DA 3M2PA 2PK3A 2CVQA 3D1LA 4MVJD 1LDBA 1M66A 3B20A 3MWDB 3I9MA 2FRDA 3IJRA 2D2IA 3KUXA 1EFLA 1FDUA 4W7HA 4ZJUA 1ZNQO 5JXWA 3AM3A 2CD9A 3DTYA 2GR9A 4D0SA 2D8AA 3AM4A 4MINA 3M6IA 1QP8A 5KVSA 1ZIDA 3ABIA 5KJ1A 4YEDA 1RWBA 5T67A 4CMJA 4CV0A 1YB5A 4TQGA 4FJ2A 5C5IA 4YAEA 4D46A 3WYEA 3PDUA 2EGHA 1GD1O 2HK9A 3A1NA 1DDOA 2HKIA 9LDTA 5JC1A 5L53A 1E1KA 1ADBA 1UXIA 3FWZA 5TJ9A 3QVOA 3V2HA 4D43A 2YJZA 3I83A 3WGHA 2BH9A 1I3LA 4P38A 2YUTA 1XHLA 1QXSA 1TT5B 4MVJE 5A9SB 4J9VA 4YRBA 2Y66A 4YT8A 1OAAA 5BQFA 4TRNA 3TSCA 2NSDA 4CV1A 3O38A 1FJHA 4JCOA 3JQGB 2X7HA 3WYBA 4CQLA 1DC5A 1NQOA 3GRKA 1BWSA 3VVCA 1AHIA 3KV3O 4RF5A 4KOAA 3MCVA 4CMBA 3IS3A 3JYPA 3LU1A 2DM6A 3GZNB 3VKVA 4FFPA 1KVQA 1W6UA 1X1EA 1VSVA 1IZ9A 3C7DB 1EE2A 3KTDA 4J0FA 4BNKA 4XB2A 2PZJA 2WSBA 2ZIZA 4XJSA 3GPDG 4J7CA 3JQAA 3ST7A 2FZEA 5LC1A 3AU8A 5DBGA 1IB6A 2ZJ0A 4FQ8A 3H4VA 3WTCA 2CZCA 1CETA 3NEPX 2WYVA 2GZ2A 3DBHB 1UXJA 3GGPA 3WGZA 1KIFA 1HE2A 2IDZA 4E33A 4CM4A 2J5KA 2HO5A 3BTOA 3WJ7A 2B0JA 3TZQA 4RZHA 3RFTA 5COBA 1Q7GA 2OP1A 4IDBA 4Z0HO 2C5AA 4G65A 4WNCA 1U4OA 4DMLA 3TRIA 4XGIA 1GPJA 3AI3A 1PJTA 2Y05A 1NTOA 1PQWA 1DAPA 1ZBQA 4CMAA 4XDYA 4BB5A 4RQTA 4KWHA 1C0IA 1SOVA 3RUFA 1BDMA 3SJ7A 5T6BA 4ZU3A 4AJOA 1FDWA 1I3KA 2J3JA 2PKQO 4ZRNA 1YS4A 4OL9A 5G4KB 1BGVA 1UAGA 4N54A 3N74A 3ZI0A 3U09A 1P9LA 2VHYA 4CMIB 2PLAA 4FR5A 3GAFA 3KLPX 2CVOA 1GEEA 3DOCA 3KYCB 5THKA 3ZV4A 5EINA 3DZGA 2J5QA 4LSWA 4Q9NA 3BAZA 4FSHA 4B7UA 5FWNA 4YAGA 4DIOA 3VPHA 2CDAA 5B4VA 3V8BA 1B7GO 4M49A 5I7VA 3S2EA 5IF3A 1MG5A 1PIWA 3DBLA 1R37A 4RGBA 3EGOA 1LRLA 4R1NA 1H0KA 2Y0CA 2DUUA 2OO5A 1YB4A 3TOZA 3ZNQA 3F3SA 2JCXA 1YL5A 1ZXBA 1P1HA 3H8VA 4FIZA 3OFSA 4XWYA 3HNPA 3I9KA 3GNTA 2X9GA 4INAA 1A7KA 2NV6A 1Q7BA 1GV1A 2NADA 4TWRA 2EHDA 5TJHA 4CR6A 3GAZA 1ZMOA 2AQKA 3HDQA 1TVEA 2FSVA 4GGPA 3LT1A 2AE1A 2PA3A 5JYDA 4CMGA 2V65A 3P5SA 1GQ2A 3JD2A 1ISFA 2NVUA 1EZ4A 3SX2A 4C4OA 4IMPA 4Q3EA 5DDIP 3OM9A 5ITVA 2YW9A 4EYEA 2GF2A 3TPCA 1WAMA 3EY4A 3RFVA 3ZH2A 4GAEA 3UKOA 1HEUA 3DAFA 2R00C 1PZFA 1VJ0A 4ND2A 5CDUA 2GN9A 4DLBA 1SO8A 4YT5A 1LNQA 1J4AA 1XWFA 3RIHA 3AI1A 1E6EA 3K92A 4S1VA 2PD3A 2BGKA 6ADHA 4FFMA 4FOSA 1PGQA 2VWQA 3R1IA 1EUDA 2Q49A 1BW9B 1P1FA 5TSDA 3H9QA 3JSAA 4FGWA 3UOGA 4RJTA 2RHRA 1B3BA 2XOXA 1JAYA 4IZIA 1B0AA 3TDKA 4R3WA 4UEOA 2VYNA 3NT2A 1V8BA 5F1OA 2VTDA 4H15A 4BL5A 5JY1A 4YJFA 4E21A 3RJ5A 3WIDA 5JDIA 4PLHA 5ENVA 1WPQA 3SJUA 3KM0A 5COAA 2O3JA 4WECA 4IGFA 1Y1PA 2V6GA 5ENDA 4J3FA 3WGYA 5CG1A 4UVGA 3S2IA 2OOSA 3MWEB 1VM6A 2XXBA 5LCXA 3GVCA 2E6UX 1CIVA 1RM4A 4QECA 1LRKA 2AW5A 4LGVA 1NQAO 3BMOB 5DOVA 1DC4A 4FD3A 2FMUA 3WGQA 2CNBA 2I66A 2BRUA 3N7UA 3R0IA 3K73O 1QYCA 4Q3NA 3A14A 3HADA 3WOHA 1KS9A 1H5QA 3BTSA 5ER9A 3ZN2A 3ZV3A 4YVFA 4R9SA 3ZGYA 2AG8A 3ZNPA 4IDFA 4O1MA 1ZEMA 3AOEA 3WS7A 1UDCA 2AEFA 3ON5A 3WBFA 5TF4A 3Q2KA 1U7TA 1W73A 3QIVA 2OP0A 4OM8A 1HZZA 1I32A 2GN8A 2HJSA 2GRAA 3D5TA 3E9MA 4TRRA 3QQPA 1PQPA 2WJPA 3OBBA 1E1NA 5L4SA 3Q9UA 3JQEA 1RYDA 5KKAA 3PJFA 1A7AA 1ARZA 1Y8QA 2FR0A 2GCGA 1NHGA 3HN2A 1YONA 4HFMA 4NBTA 3C8MA 5I7EA 2VQ3A 2O4UX 4HX5A 2NACA 1VPDA 3ZHYA 1E3EA 4CODB 2DTDA 3VH4A 1T2FA 2Y1CA 3DTTA 3C7CB 2RIRA 5A5EA 3ROPA 5L45A 3WLEA 4ZRMA 4ZD6A 5HTOA 1UXKA 2NQ8A 2YV1A 4Z3DA 3FF4A 4ONEA 2E48A 4XDZA 5KJEA 4DA9A 2LDXA 2SCUA 3L77A 3OA0A 4CM8A 2BF7A 2RH8A 2GGSA 3RCBA 3WJAA 4BO6A 2ZQYA 3HDJA 4BO5A 4BUCA 2X58A 4Z6KA 4MP3A 4KUHA 2AQ8A 4WKGA 1Y8RB 4UVEA 3S2GA 4BHTA 5C7LO 4GX0A 1NNUA 4NFSA 2X9NA 1Z75A 3G79A 2B5WA 3JQ7B 4WLNA 4CMEC 4ROSA 1Y81A 1Z74A 4WK6A 4WOJA 4E0BA 4BO1A 4AL4A 3BHMA 2HMUA 5DP2A 3L9XA 4PG6A 4AJKA 1X7GA 3WGIA 2WD7B 3HZZA 4HFRA 4BNNA 3OQBA 2AQHA 4DPKA 1TB4A 3GUYA 3NT4A 4LK3A 3GMDA 4GQAA 1EQUA 3TF5A 1PL7A 4XQCA 4NMHA 1GUZA 4PFJA 3OIDA 4J49A 1LLUA 1M6WA 1J49A 4CV3A 4QEDA 1P0CA 4DWVA 2J3KA 4HBGA 3WDSA 3QA9A 2NTJA 3F5QA 4BNYA 4CLRB 2JD2A 2VT3A 2AEJA 2Z5LA 4OMUA 5A04A 3E8XA 4NPCA 5L95A 4OOEA 3FR7A 4H16A 3LDHA 3CEAA 5JE8A 5JYEA 2UAGA 5C7OO 2ILTA 4JJGA 3RUCA 1YXMA 4E2XA 1P1JA 3NV9A 4WLOA 2DFVA 1ZSVA 3V5NA 4P4LA 1NBOA 1K2WA 2ZTLA 3C7AA 3LSYA 1U5CA 1PGOA 4M54A 2VT2A 3JYQA 4HXYA 2IXAA 4BQRA 5CP8A 2ZQZA 5CEFA 4E30A 2A94A 3VTFA 1PJ4A 3AU9A 3OH8A 2YFHA 4HNGA 4S3MA 1ZO8A 2V6MA 3H65A 5JC8A 5KJ6A 2BFMA 4RDHA 3ZWAA 4TSKA 3BTVA 4IQ8A 1MXHA 1QYWA 4HKTA 1MGOA 1CQIA 2EG9A 4W7IA 2W2LD 3AW9A 3GQVA 4Z0PA 1GAEO 3NRCA 1L7DA 2ZB8A 4FFLA 1LSSA 5EESA 1PS8A 1N5DA 1J5PA 1ONPA 3DAGA 4BVAA 3ZWBA 1C1DA 4I8XA 2EXXA 3ZCXA 3ZNOA 3BMQA 4ZQFA 2YZ7A 1N2SA 1ENYA 5IN4A 2DBRA 1JA9A 4D0RA 2NUAA 4UAGA 2CFCA 5KOIA 2YV2A 1PGPA 2EP5A 1LSOA 2UUPA 3D3WB 5BNFA 3ZHZA 2VWHA 1B15A 1P77A 3U62A 1GADO 1ZJZA 5GZ3A 4QXMA 1GDHA 2OL4A 4QX6A 4E31A 1E92A 2Q45A 1LDGA 2FSSA 4RPKA 3SEFA 1VJ1A 2HMSA 4NBVA 4A73A 3AUTA 3I6IA 1YBVA 3PVZA 3QSGA 1I24A 1O9BA 4NK5A 1NR1A 4KMSA 4ZQGA 3ITDA 1PGNA 4YA6A 4OHUA 4CL8A 3DZHA 2JD1A 3W6ZA 2G76A 2YDXA 2I67A 5IG2A 3VAZA 1I3NA 3KO8A 4W6ZA 3WR5A 4BO2A 1MG0A 4RQUA 3MZ0A 4UEJA 2C0CA 2ZTMA 1WNTA 4RF4A 4A03A 4D7AA 4MVJH 4I5EA 1Y5MA 3QVXA 3RASA 1ORRA 3PPIA 2HQ1A 1O6ZA 1MLDA 1DRUA 3AUSA 1CF2O 4L75A 2BFPA 1ENOA 4J4BA 4YRDA 1IOLA 1P0FA 1X14A 4GPD1 1E0DA 1PZEA 3D0OA 3RQSA 1WZEA 1LJ8A 2FR8A 1YRLA 3TZKA 3OJOA 2JHGA 1YGYA 3L4SO 1UZLA 5MDHA 3LLSA 3CPSA 1DJNA 4ALLA 3SLKA 3OP4A 5IDQA 3PGXA 2HDHA 3WTBA 2Y1GA 2EW2A 4U0KA 4CLOA 3GDFA 4MP8A 2DKNA 1OOEA 4ZA2A 3O9ZA 4JLWA 4KQXA 4E4YA 2TMGA 3Q9NA 2X1HA 1XQ1A 3H2ZA 3ZWPA 1LI4A 4XRRA 1MC5A 1KY4A 4CM3A 4Y98A 1T2AA 2J5RA 2QYSA 3WNVA 3JD4A 1P1KA 4KP7A 4RVHA 4QTZA 1HYGA 3OETA 2YHIB 4EJMA 1NXQA 1BVRA 2EERA 3FN4A 1W4ZA 3JYNA 3I9NA 3PYMA 2Q1UA 3I52A 5H83A 3OJFA 3GF4A 4OKIA 4EEZA 4RLHA 1C14A 2YFQA 2CDBA 4IIVA 1U3VA 1O95A 4CQMA 2X22A 5THQA 3BZUA 4MIOA 3PYLA 1P1IA 1H6CA 1LX6A 2VUSA 4PLZA 5T57A 1LTHR 1SEVA 4XQ9A 4J2HA 2CVZA 4O59O 1XU9A 3A9WA 1WMAA 2OORA 2HMTA 3G49A 3NJ4A 1UXGA 4CLOB 4D3DA 1Q7CA 4EEXA 2VUUA 4BO4A 3U0BA 3O8QA 3GVIA 4RV9A 1AN9A 3WQQA 4B3HA 3PLRA 1BVUA 3U9LA 4ALJA 2ET6A 1HETA 4IGEA 1PWZA 1PS0A 4WASA 3FRJA 4HFNA 4ALMA 3K6JA 1OZAA 4XZ3A 3QW2A 4JX8A 1G0OA 3FNGA 3ETEA 3LF1A 1TLTA 3L4BA 4Q39A 3EMKA 4BIIA 4G81A 1LSJA 4TROA 2FPGA 4IDCA 3MJEA 4IS3A 4ZQHA 4E2WA 3B70A 3OQ6A 4J91A 1E3LA 1E7MA 5EMHA 3U4DA 3W1VA 4I08A 3ZWOA 2P4QA 4DQXA 2EEZA 2VUTA 4FFOA 5EL0A 1U1IA 1XIVA 2DBQA 2Q4EA 4FOOA 4CQMB 3VH3A 3KB6A 4PRLA 3DDNA 1KY5A 1Z73A 2C7GA 2G0TA 1X0VA 2O50A 4JJFA 2V7PA 4IDDA 1DFHA 1TA4A 2POQX 1DHRA 5DBFA 3O03A 4B4UA 4W99A 3M1LA 1A5ZA 1N9GB 3GNQA 4A27A 3DBRA 4J6FA 4UVDA 1QLHA 1EUZA 4XYEA 4PG8A 2A4KA 1RM5A 1OMOA 3ADOA 3AK4A 4YAJA 1EDZA 4CM1A 3PHJA 5H82A 3AI2A 1JU9A 3H2SA 3ITKA 1IHYA 2Q1TA 2IE0A 4DC1A 2FPIA 3DWFA 3LC7O 3UCXA 1H94A 4IXTA 3ZHXA 2DUWA 5L7YA 1B8UA 3FBGA 3IMFA 4NBWA 4WLUA 4EBFA 1HDOA 3H3FA 2ZATA 2C82A 2EP7A 4L0QA 5AVOA 1NVGA 4BMVA 5HBRA 1AHHA 1NFQA 3DHYA 3GEGA 5JMWA 3NGXA 2X5OA 4OSPA 1QV7A 3AFNA 1HKUA 3JYOA 5U9CA 3VPFA 2NLOA 1CDOA 1CYDA 1BG6A 3GHYA 3Q0EA 3LQFA 3KETA 1AXGA 1LDNA 1ADGA 1AE1A 3UF0A 2I76A 2PWZA 3DMTA 4RVDA 3DBRB 4NJMB 1E7QA 1TT5A 3GVPA 4MKZA 4JROA 4W9NA 5TC4A 5A9SA 3W4IA 1AGNA 1F8FA 3K9QO 1NX6A 4IM7A 3QVWA 4FCCA 5I9NA 3IJPA 7ADHA 3K8ZA 1V3VA 3JQGA 4G5HA 4IUYA 3WLFA 1EDOA 5TIIA 3GZNA 4MDHA 3E03A 2HRBA 4YBZA 3GVHA 3CIFA 4BO3A 1B26A 3NYWA 4BKOA 4Z9YA 1SPXA 4J7UA 1EE9A 1NAHA 4XRGA 4IZHA 2IEDA 3S1LA 4I1IA 4UVHA 1LLQA 4WJZA 1JTVA 5IDWA 1E5LA 3C1AA 1DIBA 1PWXA 1HE4A 4IDAA 3FWNA 1QSGA 1HXHA 5CDYA 5JAZA 1IL0A 3H9GA 1P44A 4CMKA 1SC6A 1ZK3A 4YTEA 4Z9FA 4TRMA 1I5RA 3DZKA 1QMGA 4U6QA 5B1YA 4OAQA 2O7QA 1ISIA 1A72A 4ZICA
chains in the Genus database with same CATH superfamily
1QJ4A 2HF7A 1Z2PX 4V0LA 3PNYA 4N0PA 1ZCZA 1LEHA 3FNFA 4RYDA 4D74A 4PINA 2QN8A 3ZCPA 4KTTE 4PPFA 1CQZA 1T34A 3HJBA 2NZXA 3K0AA 4WZAA 4B74A 2PBFA 2FMIA 3U3ZA 3H5WA 4F85A 3C7KA 2ZYIA 5EE3A 3OICA 3S99A 1M0TA 3DD1A 2PXHA 1UWVA 3AJ8A 4NQZA 1U9IC 2L19A 1RI5A 4F96A 3AHEA 3CISA 1G21B 4K9KA 4R16A 2QRMA 3F47A 1EHCA 3EZ7A 4LCJA 3W2EA 5I3ZA 3MELA 4QTUB 3I1YA 4KFSA 1DQNA 4DV3B 3C3XA 5LZ9A 4I19A 5LA6A 3TRHA 8ADHA 1Z33A 5KYWA 5M34A 2A9VA 3R5SA 1WLSA 5AJYA 3G9TA 3NHAA 5F5XA 4GH5A 1EDDA 3WB1A 1A95A 2VJMB 1F51E 4AP9A 3TNLA 3IHTA 2VKQA 4LMAA 5BO5A 1E2QA 4RCZA 3D4LA 4PGFA 1X2BA 2OHIA 4J75A 4TM7A 4ZOLA 4M0CA 4RW0A 4RZIA 1R6XA 3CNHA 4RELA 1WZNA 1XCLA 4Z4HA 5CDSA 5AFSA 4KDEA 3CJQA 3QTTA 1UBSB 3DS8A 4X54A 4EYQA 4DCCA 4ARZB 4F06A 3S2UA 1R12A 3H0EA 5BP7A 3T9AA 2IYYA 2ZI6A 4JR0A 3PUWA 4IJWA 3PPYA 4N7RA 1OGIA 5CCXA 1Z4QA 5EJGA 1QFMA 4ZCQA 3WJ1A 2CDRA 3FPAA 2XD9A 3MD9A 4GVXA 5C0OE 4B43A 4BWGA 2X8JB 3KQKA 4WLEA 2F8SA 4XM2A 5AW9A 3D59A 4B7AA 4KREA 5LZ8A 2FSUA 4DW8A 2A57A 2EZ8A 2RFLA 3BQMB 3MJRA 3JQRA 5AK4A 1GNTA 1FUIA 1U9CA 3FGPA 3A4VA 3PC2A 3RKRA 3F6YA 1ZK0A 3HB4X 3ROXA 4DY6A 4TYNA 1AJEA 5EERA 2ECFA 3NANA 5EWMB 5KTSA 4LJ9A 4QBTA 2X6TA 3OM1A 3STXA 1DQPA 2YWRA 2Z5GA 2ZJ8A 2YHUA 1YSCA 4HO1X 5BMVA 4NI5A 5SICE 1QGZA 3N2KB 3M6XA 2A7QA 3Q12A 4YGYA 1N5MA 2A5DA 1YE5A 3FHJA 2L0XA 3KD2A 3NNNA 2C3UA 3EXHC 2G5CA 5FEUA 2OD7A 4JI6B 2XZPA 4GXQA 3OTOB 1WPGA 1CY2A 5JCJD 2E5LB 3CPHA 3N2GA 1IY0A 3BWXA 2O48X 3HB0A 1WIWA 4JEUA 4ER6A 1RFLA 1T25A 1X2EA 1NBME 2B4TO 3N76A 1M6EX 3TSAA 4CR8A 1R4MB 3MMXA 1QYIA 3CLHA 4YPVA 4EQZA 1MB9A 1M6YA 2OCKA 2VP3A 3KQVA 1YVDA 2ZIXB 2C5GA 4BKMA 3S40A 1X8JA 3OPMA 3SI7A 3PQ8A 1O4WA 3C85A 2XB6A 4MVJG 4AIRA 5T8KC 3O26A 1XMPA 2ZCVA 3RIYA 3NTRA 4AJHA 4LGCA 1B6RA 1UJCA 2FSHA 2JFHA 4XGNA 4ARIA 4YQEA 2R7NA 1DB3A 3IPCA 3RVDA 3AP1A 4E11A 5FBWB 2AJCA 1M6NA 1N0IA 1U31A 4R8KA 3U7JA 2KBFA 4IJVA 1LLCA 2DF8A 4UHJA 5FI1B 2BH2A 3PKJA 4DB4A 1WSDA 1YZTA 5IT9A 2UZ0A 3AHHA 3VHLB 2AXQA 3N0RA 2B7CA 3GRFA 1TGVA 3GJ3A 4V1CA 4AROA 1E94E 2CW5A 4KHPB 1LLFA 2J9XB 3E5RA 1DSSG 2ZS8A 4L76A 1WXHA 2C4VA 3WJ2A 2DLCX 4QRIA 4KRYA 1OYOA 1LJUA 1QF9A 1ZOOA 2B8NA 3AR8A 1HG0A 2Q3EA 3G6WA 2IEGA 1LTQA 2VF5X 3SBXA 4QGFA 3L04A 1M5TA 1YAJA 4HNAA 5K8CA 3FGOA 3CR7A 1VLHA 4YR9A 3KFLA 3C14C 4QGBA 5ILQA 2Q4DA 2P5SA 4QDUA 4KWCA 4CM7A 3JTMA 5AW3A 4ZI7F 3C3AA 4LISA 4Y9TA 5MHTA 1S4MA 3MGGA 2GBCA 1BJTA 1GPYA 2XX3A 1N1DA 4EHKA 1S2DA 1DE0A 1ZH8A 3CPJB 4YAFA 5CM9C 3PT5A 2A14A 5B3JC 5CYGA 3U5TA 3AF0A 1RAEA 1XSEA 1NV8A 2R66A 4HWRA 4DADA 3CQ9A 3EMBA 3UC5A 4ZDKA 2IEAA 3B85A 4C6TA 1NOJA 4EW6A 5EPOA 5LD2B 2J48A 2K4MA 4DSAA 4LJLA 1DBIA 5EZYF 1R0LA 1RHMA 4CT4B 4D3SA 1GL7A 1QIJA 4AICA 3L8GA 3ZCVA 6ABPA 2DPHA 5IXYA 2WSLA 4U6SA 3BE5A 2P5YA 4YRJA 3F5FA 1JRLA 3C6ZA 2FP4B 3EGVA 1K4KA 4PIVA 2JHAA 3AY6A 3FIUA 3TSWA 1KYIA 5FLEX 3BCSA 3L8MA 4ZCRA 1YZYA 3UH1A 1M2OB 2PMFA 3G9UA 4DQLA 3NAMA 2P6RA 2J67A 3HGTA 1RKUA 2NU6B 4JKYA 3OEEA 4WNIA 4C08A 1OA1A 3GVXA 2YDYA 3WNQA 3SIPA 2YS6A 3ESRA 1C1HA 3G02A 1QE5A 1WEHA 4RESA 4ISBA 4WKNA 2WI8A 3R7AA 5F1PA 1KJNA 2JZCA 1YR2A 2Z9DA 4EWLA 1Z07A 3MLBA 3CE9A 4RORA 3RHFA 2QZSA 2AN3A 3TQCA 2YV3A 3CONA 1XQVA 1KY2A 3QLEA 2CBGA 1YJBA 4Y6SA 4Q7EA 4CIDA 1PJ2A 1UJMA 3COZA 4G1FA 4CIAA 3BGOS 1U1CA 3Q2OA 3I6BA 2GX6A 3F5MA 3HY3A 1Z56C 1LBQA 1D3AA 1D2MA 1R15A 2VK8A 2ZR8A 3OZUA 4HY3A 4RZ3A 4W1RA 5THXA 4NVRA 2Q3FA 3UHPA 3CIOA 2QTLA 2IPNA 2OZPA 3UMBA 1ZP6A 4IFTA 3GLGB 3ORRA 4AMGA 4HWOA 2P4EA 4MVJA 5ALWA 4KCGA 3CRZA 3TZEA 4X5OA 3T3HA 3VQTA 2JFBA 1I1HA 3L05A 4M53A 4JEIA 1GPAA 3IQEA 4GLJA 5D2CA 5L4NA 4UHCA 4C4PA 1Z28A 3WQHA 5FNVA 1Q7RA 2GXUA 3LP8A 5CAEA 3MTGA 3DQPA 2FK8A 5EMMA 2COUA 2NPIA 3FPGA 1XTUA 1QH0A 3EVAA 4H7JA 4YAIA 3COYA 4D82A 3KR2A 2CF5A 2P35A 4PZEA 3HH8A 3TJZA 3WMWA 4DGSA 4DWJA 3KQWA 3K31A 3IRVA 4RZXA 2VCEA 1CUWA 1SWVA 2ZRPA 1ISGA 4DMCA 3DLAA 2HO4A 5BWBA 2P9CA 5JDIC 1A88A 3LYLA 4JB0A 4A10A 4RJLA 1ZCAA 2Y8EA 1H93A 4EMUA 4YRLA 3S5JA 4LVNA 3LKZA 2BLNA 3QNUA 4Q93A 2XNSA 5FUYA 1PSDA 3QYJA 4W5HA 4FWTA 4HUTA 3CCCA 4G4GA 5FTLA 3A36A 3M1IA 3VR1A 4CG1A 4DA0A 1T9AA 4XD7D 2K2WA 1EFVA 2HBYA 3H6GA 1CLUA 3FLMA 5KTOA 4F21A 2W6CX 4A6EA 4CLRA 3QBJA 3SXUA 3S7TA 4RJKA 1XHEA 1MMFB 4LI0A 1BDBA 1KDRA 2QGFA 1ZCJA 1P8AA 1M2WA 3EC2A 3FNIA 4ZVTA 3S7ZA 3ZKWA 4XTCS 3VSDA 1A3CA 3K09C 4O3FA 4H0CA 1RXIA 1NM5C 2IUFA 3EZYA 3R3UA 1SVKA 1U3UA 2PUEA 2OYCA 1M6HA 2IGTA 5GY7A 1NJGA 3QOFA 4BMZA 5IAJA 1ESEA 1Y7IA 3BRSA 1FYXA 5A9TA 1CVLA 3QRWA 1PVDA 2B4YA 2BE9A 3BE4A 1Q3KA 4JC8A 4P4SA 4RXTA 1XZIA 4XVHA 5DW3A 1TTTA 1ESZA 2CKDA 3C4QA 2BI8A 4UCXA 4O4LA 3DUFA 2QM3A 4J4TA 3GBSA 2C29D 4PHGA 4XIFA 5DV9A 4K9PA 3T15A 2B1RA 3BBLA 4FGJA 2PZLA 4DIFA 5BQXA 2PTGA 1LPNA 4FZJA 3EWNA 1EBFA 3DZCA 3N8DA 4OQEA 4OXIA 1PR1A 1XPJA 1N1MA 2MJLA 4M0PA 2A1TR 3HCRA 4O63O 1I1NA 3DFZA 4DV0B 2DJ5A 2XDAA 5EP4A 3WO0A 3H6HA 1M5UA 3IC5A 3SS8A 2VLIA 1KI6A 2GWHA 2UVPB 4MWGA 3R76A 3WSTA 4EFLA 1KR5A 4OHWA 5FO0A 2A1TS 2VDWB 4GXTA 3GNSA 2ECOA 3W8DA 2D7CA 4L7QA 2EEPA 2FPWA 2V7UA 4E12A 2V7QD 3C45A 3NUQA 3R3WA 2JI6A 4YFVA 5C1IA 5L6MB 3TECE 1OD6A 4CG3A 4ZMRA 5B6JA 6CHYA 2WMOB 1BXKA 1SGWA 3HDVA 1YGPA 1LFAA 1FUYB 3K4QA 3QLUC 2VZ9A 4G0NA 4XYGA 5BN4B 3IP1A 2V58A 3E5HA 2I6SA 5KVQA 1HG1A 2AEMA 1RS0A 2GARA 4UVIA 3ZZMA 3S27A 1Z8HA 4L8FA 1DV2A 3C15C 5C37A 1Q2XA 3I76A 3PG5A 4WKPA 1CE8B 2C2WA 4MS3A 3T3IA 3DNFA 3ESYA 4PXYA 2IP4A 3L9WA 3GH1A 4UQPA 1X87A 4G23A 5KIAA 1NKSA 2NSYA 4WK0B 5FLKA 4PC1A 5BNZA 5GMOA 2P27A 5LPNA 4YT2A 1K5HA 4M1QA 3TZCA 3NB0A 2I1VB 4UXIA 2XRFA 4Z99A 1G5TA 2WT4A 3KKOA 3DTVA 3EH2A 3MCWA 1GPDG 4HF7A 1JT2A 1P74A 1TMKA 2J5BA 2RONA 3EXHB 3OPQA 4K87A 4KQKA 2ZE8A 4KZPA 4MQBA 4MRNA 4EECA 2JGIA 3T3OA 4ZV9A 3GP8A 3IPYA 1L5QA 1Y4UA 3K0KA 4I3FA 2PT5A 2WYUA 3GG2A 3GMSA 5HIAA 2CNNA 2YY6A 1Y37A 2ZJ1A 4U4AA 1JAXA 5JROA 1QBGA 3FFAA 1JR2A 4LIPD 3KJIA 3SDSA 4AJ4A 3PP8A 1TTPB 4LV5B 5IP5A 4KXNA 2IHKA 5CDFE 1QRAA 3DHNA 4RY2A 5GOTA 4JJIA 1YR3A 3B5JA 2IU0A 5ADUS 2IOQA 4FDTA 1TW2A 1QRDA 2PM8A 5EAIA 3OJLA 4QPCA 2GD0A 3WICA 4Q3AA 2B21A 4NU6A 2MINA 4KDFA 1WDMA 2C3PA 2X77A 3L8FA 4L6AA 2AFHA 4AZTA 2C3OA 1JWBB 4DV2B 3R5JA 4BX0A 1X7ZA 3GRPA 3BWYA 4IAOA 2ZIEA 1RPNA 4HP8A 3OIVA 4Z4EA 1IMJA 5HRAA 1SIBE 2OGZA 4HWGA 3JQFC 1V47A 1WTCA 2Q5CA 2ZJ7A 5IW8A 3OWHA 4EHDA 3V00A 3LM8A 2Z08A 3FUVA 3KUUA 4AI6A 1PR4A 3Q2IA 4IRXA 5B53A 3B9PA 2H5IA 2HCTA 3FYDA 4KXFB 3TNYA 4H0NA 4R41A 1S6YA 1HDIA 1T10A 2VJPA 4XIIA 3E9RA 1SVWA 3TZBA 1RZUA 3I58A 2O4CA 2EWVA 4X66B 2R60A 3GXOA 1MCZA 1CD5A 5LYJB 1KU0A 3T4PA 3ADBA 1JH9A 2WKSA 1QP4A 2XNCA 1IRXA 4BGIA 1XD8A 3NH6A 3F1KA 3L7DA 3VU1A 2ZWPA 3ZXUB 4AJ2A 3L92A 1WO8A 4Z7NB 3H4IA 2HSDA 2CB9A 4XDHA 3HLYA 1HDXA 4INOA 1L8AA 2JH9A 1YE8A 3IDQA 4U00A 2GCNA 1Z0AA 5IK2D 4P4NA 1RP7A 2R1TB 2YHIA 4WD3A 1IEXA 2F1JA 2F67A 5AVZA 2E89A 3ZBUA 1N3IA 3O5AA 1F2UB 4O4JF 3HCNA 3AC0A 3IHWA 4OA8A 1R1DA 4XFKA 1EFKA 3L6CA 3KJGA 2Q5LA 3KDSE 2RD2A 1ETUA 3UT6A 1F60A 2JBWA 3VU0A 4CN8A 1MUUA 3HO6A 1USVA 3L0DA 4JL6A 3SHVA 2CV1A 3R5FA 1V8ZA 4MOWA 2IX3A 4H7KA 3H42B 1FYFA 4R2LA 3U56A 2VZ0A 3HM9A 1K7FB 4R0VA 1Z2OX 2BBOA 1EXMA 2VH2A 3JQAD 4BLRA 3IYLW 2J4FA 1COZA 1W5EA 5DLEA 1Y9AA 2DFDA 1CJVC 3MCTA 3M5CA 5DN6D 3GPLA 3CVUA 2WVHA 2QOEA 2BFDB 2P7HA 1ZRNA 1SK9A 2C9BA 1UC8A 1DIRA 3KXIA 5CB4F 1XEXA 4PN3A 4NEGA 1UP4A 4NV0A 3GJ5A 1E2IA 4Q37A 4G0WA 3WBJA 3VNUA 2AXPA 4WZAE 4XX0B 3HUTA 4AJIA 4P0TA 4NZNA 3FMIA 1W5FA 4I4TB 4PNPA 5CEJA 3FM9A 1YWGO 5C8ZA 5L3QA 4F3TA 1RBYA 2FMHA 1PT7A 1ZITA 4YLEA 3UOWA 1KQOA 4RIEA 1QHEA 1W94A 2VA8A 2HJVA 3HHPA 3AEUA 1VMEA 3I12A 4D44A 3WWOA 4ICIA 4URVR 3LUHA 1L1RA 4Q1VA 2VDPB 1NN3A 4JC5A 4RK4A 4UQLA 4U5XA 3DVAB 2XQGA 3FPBA 4FMPA 5HUQA 5T4BA 4LX8A 4UBMA 1V5FA 1B8PA 3WWCA 1R5JA 1TAQA 5A6VA 1ISMA 3C5CA 2ZSBA 2W8BB 3JASA 1KRHA 2ZP1A 1CJCA 1FP7A 1RPTA 2RGYA 3G2MA 2APJA 4MJLA 4BVHA 3ZDFA 2EKLA 5A5FA 2Q3CA 3ANSA 4XX1A 2ZPTX 5FD8A 5JJKA 2OGSA 4HYYA 3S28A 3HGMA 1J24A 2P8SA 4CMEA 4RY8A 3PC3A 5B7QA 4ZREA 1NVXQ 4A92A 3HFGA 1OVMA 4P0PB 2V4MA 1KYZA 5FFFA 5J4KA 3WSVA 4FI3C 5A0TA 1RLUA 1XZKA 1DWQA 4EENA 1IEWA 3MJVA 1CZOA 1V6CA 1A8PA 1G8KA 2HSWA 2XB2A 3QUSA 4JS0A 3SHWA 2V6BA 5E3IA 5JW6A 2H1CA 3KJEA 4KXLA 2QLMA 4MW0A 1Q5PA 3L1JA 5HE9A 1T2DA 3HXOA 2HRDA 4BJHB 3K0EA 2BFOA 4R6XA 1OTYA 3B1ZA 2FN3A 5E9WA 4PGGA 4DLYA 1KZ6A 3P9QA 3H9JA 3VZDA 3W6UA 4HZUA 3CO5A 3TR6A 2RHWA 3COPA 3GJ4A 2ZSAA 3ZJ4A 1E1YA 1VC2A 1Y80A 2E37A 5KTMA 4O08A 1D5WA 3S4YA 1P0IA 2TMYA 1T2CA 2BZ0A 3K2QA 4LBZA 1TZKA 3DJYA 5IU6A 2Z2KA 4OB6A 2PQ6A 3IAHA 2ZYSA 3T5GA 3VYWA 3H3JA 2R751 1ZGHA 2OV6A 1AF4A 3IDAA 2YXNA 3ZPXA 5GJVC 1QO0A 4WJKB 3WMGA 5CITA 4NJMA 2AOTA 3ZZNA 3WAGA 2FZ4A 3KYJB 5EN4A 4INJA 3AEQA 3PGA1 3QI7A 3X43A 2O8FA 1M10A 5FOQA 4ZXFA 1RQRA 1RWPA 1IXSB 2HSEA 1J09A 3ONNA 5BPHA 2FWIA 4Q16A 3REGA 4E07A 3ZWWA 2F3TA 2AGVA 1GLNA 1SC3A 1YZUA 2AFRA 4DKXA 1KEZA 1RTTA 1V1RA 1XN1A 1QDUA 2O7SA 1CB0A 1H6BA 1N7IA 1W5BA 2OXEA 4OBBA 4DG9A 4K9SA 4N7MA 3GEDA 1N5LA 4O2BB 1U8XX 3D6UA 5JZ9A 2NUPA 3AYXB 3W8FA 1QP7A 2O2ZA 3WDMA 3TOCA 4OBWA 1DIHA 4E5YA 3IFSA 2NO6A 1FP2A 3BB4A 5AXDA 5LQDA 3THYB 3F4KA 4OHVA 2XMDA 3N7TA 1N6LA 1N2HA 3KP1A 3RB8A 4RPIA 1JP7A 1Z7YA 3ISJA 4M8KA 3G5TA 1VL6A 3LBHA 3LYUA 1KHHA 1QIEA 3GJYA 3NPAA 4RL6A 1Y5RA 3VR5A 3U4QB 3THWB 3O47A 4L3OA 1BNCA 1SC9A 1Q0RA 2C2OA 1JU4A 4KN9S 4P7BA 1IEQA 3LLMA 4HEHA 4CM9D 3CSSA 1C9EA 1YR7A 4PRZA 5CFZA 1XDGA 4UW9A 4E5VA 2H1RA 1Z2AA 4DRXA 1G3MA 1A4UA 2YVLA 4WINA 2PSJA 5HBGA 1WDWB 4OI0A 2FNAA 2O3SA 2XR1A 4YX9A 2JHFA 2H7YA 4MUNA 4N4AA 1EBUA 1G0NA 2IUYA 2M6SA 1E2NA 1U65A 2M98A 1JKFA 2W0SA 4ZT7A 2W2LA 5F98A 2W6JA 3LW8A 2PFGA 3GJZA 3HEAA 4KKXB 5A6SB 3EHEA 2OYRA 4JT8A 1I4WA 3UFXA 3ZU4A 1N2CE 3DAYA 2GBLA 3NQ41 4FFVA 1GG5A 1AKUA 3PHCA 3GG9A 4IIUA 4UAUA 3SIRA 3UTDA 3GN1A 3LC1O 5B30A 4M7RA 4MXDA 1HOXA 2IZ0A 4PYMA 2X0JA 2PKEA 3UMMA 2L82A 4KQ2A 3K4HA 2C2GA 4PQYA 4RNDB 5AI6A 4C01A 5KTTA 2G06A 2RHLA 2CMGA 1XAJA 1AQ6A 2F8LA 4HDMB 2CNWD 3FDXA 4DCOA 1NLMA 1YK0A 1RVV1 4IJMA 1VCHA 4FB5A 3KZXA 1KEVA 1VYTA 1GN8A 3NFRA 5T4FA 2NM0A 1QIHA 2JD0A 4WEOA 1YMVA 1P81A 4C0WA 5HZKA 1TCAA 2QBYB 4G4JA 2Z8XA 2WSMA 2XYRA 1VIVA 1YDGA 3LDUA 5DFAA 2JBHA 1WCYA 3SLRA 3UV7A 4F4UA 4PW0A 1MHPA 1ST2A 4M2LA 3RUPA 1KK2A 3HBNA 3M7IA 4GLBA 3GRYA 3G2OA 3ZDDA 2Z43A 7REQB 5F78A 4QO8A 3VNQA 3PXBA 4HUQB 4JNKA 4EBBA 1OT5A 1DLJA 2V98A 2XMBA 3F8TA 5B2ZA 4C2BA 1ND5A 4OQNA 2BOVA 2GESA 2OCDA 5CYPA 1PD1A 1J1IA 2ZR9A 2ZE5A 3NRJA 4MB2A 4AWAA 5IFLA 1XZCA 4F60A 4DBZA 2B1JA 3PITA 5ERXA 4YDSA 2ZDGA 2WKQA 2DSNA 4E5PA 3EAFA 2JAQA 1LBEA 3COSA 2EBFX 3U7QA 3FBTA 4ITUA 1XZPA 4K6GA 2JIDA 3KOXA 4N65A 2B30A 4JVMA 3PRHA 3Q3JB 1SEPA 4F1KA 4DUZB 1EZ1A 1UQTA 4MMXB 3AXSA 3KTAB 2Y1EA 1YBAA 1JFFB 2AMVA 3KR1A 1NG9A 1NONA 3QEKA 4JHXA 4RENA 1JKJB 1CIJA 2GO1A 3ET5A 4YJ2B 4QTXA 2QD1A 1IHPA 2ZJ4A 1VJTA 4FR0A 3JWPA 2ZK7A 2ISQA 3JXEA 4MEBA 3AR4A 2OXIA 1PLLA 4DEVA 1TK9A 3KPYA 1E7YA 1U63A 1S2MA 1TZJA 2NO1A 3W0LB 1NVEA 5AD1A 2DYKA 1RWQA 4JYBA 4YAWA 1JR3E 1POXA 2B1IA 2ZM5A 5DM0A 2NO4A 4D9NA 2AKYA 3L8DA 4GDMA 3WWPA 3ENNA 4JGGA 4UTOA 1AXEA 3VGJA 3C1UA 1GR0A 1YL6A 3AIIA 3MS2A 4QGGA 5I5GA 1JLSA 3DKKA 2C2YA 4JT4A 1FK8A 5AJZA 4KITB 1G5QA 5JOQA 3PJEA 2WIGA 3WK5A 4KFUA 5JSKA 1NJFA 3BHJA 1JFRA 2X86A 3HB5X 2XE7A 3DZIA 2XCQA 1DIGA 5FBQB 1DARA 4L9AA 3ZE0B 4RMGA 3V7NA 3D4NA 5TGZA 1UK6A 3BRWD 3L6EA 4IOMA 2Z56A 1UKVY 2W6ID 1RADA 3VO1A 2H31A 4CYMA 4EAQA 1DRJA 2P2LA 4H3HB 4HHEA 2WE7A 1G18A 2ALJA 2AWOA 4I9GA 3U3XA 4P0QB 3ANMA 1JDPA 1XDDA 3B52X 3DTNA 1J70A 2XQIA 3G0BA 2UYOA 4JGIA 4WQMA 3ZC3A 4D45A 1WB5A 3O3OB 2Q2VA 2PIAA 5HPYB 4M8LA 1SOAA 3GCZA 1L5SA 3DDSA 4R2WA 1GTVA 2P9GA 1KOGA 5JLAA 1OROA 1DIOB 1Y63A 2OB2A 3GLFB 3L2OB 1LSUA 4HD8A 2VRWA 3D3EA 4NZOA 4QC2A 4ZFNA 1G59A 1HBJA 1U8UA 4LJ4A 1XZJA 1TU3A 3PEWA 4NXNB 5CT8A 4FHZA 3TTTA 1FDOA 4LOLA 3QFFA 3GRUA 1I2AA 3P2YA 3OFVA 1LI7A 4G8JA 4WMLA 1QR2A 4I5DA 4TRJA 4UUOA 1JIQA 3R40A 3D9QX 3ROZA 2A0YA 1IUKA 1QLJA 4MSUA 2RH4A 2WWHA 1KAMA 3TSOA 1JDJA 1W5AA 1IQUA 1B00A 4EJSA 1HFEL 1Q1EA 3HWWA 4ZKDA 2BGWA 2D3TA 4HQFA 3M89A 4KEAA 4DYVA 1U0JA 1Y1SA 2QEQA 2WUDA 1DQZA 2PMDA 5K3FB 4EPYA 1F5SA 4MR9B 2BCEA 2IZ7A 1A76A 4PQEA 3VC7A 2PUAA 1PHPA 3VNVA 2IPXA 1X7DA 3MCAA 1QZ3A 4EY7A 4YDHB 4US2R 4MWZA 3VAAA 1XTJA 3L07A 3IQGX 3MTJA 2OHHA 1LGYA 3D8BA 1W0KD 1XCPA 1Y3IA 2FWMX 2IIPA 4A0SA 4IWYA 2PFSA 3N5KA 4QBFA 1A04A 1ONNA 5D8DA 4ZC8A 1JSZA 4DVGA 1I4OA 2H1VA 4GSKA 5JMOA 1PNVA 4K28A 2EBUA 4IINA 1T5DX 2WD8A 1QYDA 3IP3A 3LZ6A 4A23A 4X84A 1XZQA 2VS1A 1XV5A 1JEJA 4LHSA 2CMKA 1F06A 3PHLA 1XBTA 1T91A 2CLSA 3ER6A 3OSUA 4XR4A 5DTIA 1U0SY 1OLSA 2GAFA 4KL8S 2GDJA 2VEDA 2V59A 3E9QA 2PJRA 2EVWX 1KQNA 1RXEA 3IXQA 5FP0A 3KZ1E 2P0EA 3SIWA 3LUGA 3VR4D 3OF5A 5F2NA 3FRIA 4CIWA 4P6VF 2RB5A 1LC0A 1FTQA 1VMAA 3L0CA 5ULLA 1H85A 1HLFA 3CLRD 5H5JA 4NHOA 4EH1A 3RJZA 4RV4A 3KKNA 2YW2A 5REQA 3NVKI 4FS8A 3UK7A 2ZT8A 3WKEA 1OFVA 1V8OA 1Z6AA 1ZL2A 3GQBA 3Q11A 5EEGA 5FA6A 3J7AC 3K30A 4C5CA 1ULTA 2H9YA 3AR2A 1VYVA 3O4RA 2QSYA 3R3HA 2J32A 2EZUA 4ZT5A 5ECYA 3T5BA 4F46A 2OBFA 3DBLB 2Q4TA 4L3WA 1CJMA 1P9RA 1QANA 3AF3A 1S1MA 4GSLA 4K6OA 4TLLB 2V55B 2DHQA 2B1QA 3ND8A 4MHTA 1B16A 3AX6A 3EDOA 4OGWA 5CTAA 2OXTA 1T6XA 2WF9A 4QPDA 1MV8A 3EHDA 4G86A 1DC7A 4LY0A 5BSTA 3RYIB 4N7JA 2Q5HA 5DHFA 4C1NA 4OIMA 1R5BA 4CI0B 1ZD1A 4JQZA 2JIPA 4Y0AA 5B57C 5K09A 1IU9A 4TT8A 1II8B 5BVGA 1RRPA 4HAXA 4DMGA 4F4FA 1JHRA 1P19A 1TM4E 3W6PA 4HT3B 3PV0A 1M76A 4MPJA 3ZWXA 4GGMX 1MU0A 1C3LA 3T7CA 4WIAA 1UODA 1EK6A 2PRIA 1FTSA 1HY3A 1MF7A 3EGXA 1IXRC 2IIBA 3GCDA 4IRUB 5EGNA 3A4MA 4JI3B 3FIJA 5CFLA 4R1TA 1XKXA 3AYZB 3O3NB 3EMVA 4F1JA 3W8RA 5L9AA 3GAMA 3PKIA 5AKLA 3UWSA 3ZHUA 4N9WA 2IVZA 3PHHA 2PH3A 5AKZA 3M1YA 4E2ZA 4RTQA 1ECLA 4J2TA 2O3UA 4BZPA 3E05A 1AUXA 1QFYA 4FXPA 4MVJF 4C6SA 4EZBA 4F2WA 1CUFA 3HVJA 2H92A 3GWGA 2OHFA 3EUWA 3OOJA 4NIMA 3ZDYB 3BXFA 1IB0A 3THOA 5AYVA 1XEAA 2OSVA 3T8YA 3I1IA 4K7JA 4X00A 3OEYA 1Y8CA 2Q50A 5FNVF 4FEGA 3DOOA 2Z8YA 3I9V1 3IB3A 4JASB 3FYUC 5JYCA 4NDNE 1GQFA 1DU4A 1DJPA 1N2CB 1UOOA 2VUIB 1VA4A 4Q47A 1FMLA 1SNYA 3OTIA 5ARCA 3CINA 2ZJAA 5TQVA 3IO5A 1OUMA 1PYGA 4YUWA 4GZMA 2FZLA 3FCSB 1SD5A 2FWJA 1PT6A 4PYKA 5HJ2A 3W2FA 4MW5A 1WWKA 3LPNA 3Q7PA 3WV5A 3DOJA 5DU2A 5LN1A 3MMSA 4AJJA 3MS4A 4YK7A 4KAJA 1SY7A 1ZPDA 2DT8A 3BREA 5C32A 5JPIA 4OAOA 3V97A 3U16A 2EKDA 1FYVA 2F7SA 2G9UA 2QRNA 3JD3A 4G1EB 1NP3A 2FLVA 1CF4A 1R4NA 1ZMTA 3ISVA 4V0SA 4LKOA 1TA0A 3T9CA 2W5UA 4HNHA 4Y6PA 5ALOA 2VAVA 1I94B 1G4AE 3KSZO 4OHRA 4MKXA 3FHCB 1Q1BA 3QPBA 1T5TA 1J7KA 2UU9B 5DNEA 2PZMA 2H08A 3ZEAA 3K0FA 5LU8A 1KI8A 2GFHA 1XNRB 1IOWA 1UJ5A 3BQNB 2ZAMA 1D0IA 4DAOA 2VPQA 4ETNA 4AVYA 1T15A 2QTBA 1W29A 4HG2A 4IMRA 1R9NA 3VPAA 4MUYA 4B3CA 3MJSA 5KX5F 1TUIA 2CV2A 3LY5A 1GKUB 1GAXA 3QW4B 1JKMA 1LZLA 3ZZUA 4UKDA 2AVDA 3R5TA 1RAIA 2F3SA 2JFOA 1RHQA 2VK2A 2ZTHA 3GFQA 2I5PO 3OZCA 4PYIA 2GYYA 4IOJA 3BIFA 4WY2A 5FULA 3VDMA 3W7VA 2PL9A 4G9GA 4UHDA 3ZK7A 3KAJA 1Z2CA 3SQOA 3WIBA 2IPLA 2NUTA 4NX2A 2J7PA 1DMSA 1O95C 2QAJA 1P9NA 1IPFA 5IZ4A 1BS1A 3EXIA 2XBMA 2RAFA 4RCYA 4IOLA 5IHXA 2ZB3A 4EA7A 4CKZA 4HGQA 1YRHA 2BEUA 2GLXA 4D80A 1YQWA 4JLPA 2QU8A 1FNCA 3SQLA 5JSZA 4RLFA 3N0WA 4NTZA 2CXTA 2CSUA 3AUAA 4Y3UA 3CZ4A 1SMKA 3DMHA 4YRSA 1KR2A 4EMSA 4HDSA 4R2KA 1RJFA 3SEAA 4MUIA 3ZJYA 2G1KA 3GEMA 2EFYA 3LT4A 3WZMA 1Q17A 1RRFA 4J0EA 1WBJB 5DCYA 2BMWA 3IQXA 4CE6A 1TYEB 3M34A 1TAHA 3JQBA 3LF2A 4TQUS 3HKEA 3C3JA 4TLAA 2O2YA 1Q14A 3JQDA 1Z06A 3LTEA 3NOXA 5E1DA 3U3KA 2OECA 4TWIA 3KXDA 4U7HA 4URXR 1YU6A 4C4TA 2ST1A 3ZQJA 5JRDS 3IUPA 1KO7A 2I6TA 3AERB 1EXDA 5CA0A 1NXSA 2FPKA 1HT0A 4YREA 1SC1A 1U2SA 2IE8A 2SCUB 1NJ2A 1LDMA 2PO7A 3E9EA 3OQPA 3EG9B 3PL5A 4RPHA 5L4LA 3LXUX 4WZ6A 1V11A 3RUFA 1GA1A 1AQUA 1UJ2A 1XVAA 1P5FA 4NAHA 4QQNA 2ODPA 3LVQE 4LZJA 3MJHA 4RK0A 3BWMA 3IBYA 5I4KA 1U8CB 3DO8A 2BFBA 3EH1A 4HWSA 1HWYA 2VI5A 4Q9JA 2Z1DA 2AB0A 3Q1LA 4UXJA 4BU1A 1VKHA 1AGRA 3DMNA 3ZW9A 1RM0A 1EXNA 1VPVA 4JUCA 4G5YA 2XMPA 1DKMA 3VVBA 4PZAA 5K8IA 2AA3A 3OE5A 3ZKWB 3HR8A 3RGGA 1PAUA 3A9UA 1CY6A 3RFXA 2OCPA 1FFWA 1VIDA 3MIIA 4KACA 4G56A 4M98A 1IRIA 4EUKA 1KJWA 3QBVA 1XQWA 2A9RA 2II6A 4HPJB 1BGXT 4LY3A 1TFRA 1TECE 2VDNB 1GYRA 4BKUA 5I8WA 2BI7A 2ZUWA 1M7BA 1ONBA 4U9IS 3TZHA 1R0SA 4BMOB 3OC6A 5A7GA 3HFSA 3EIQA 5HQ3B 2EX1A 2BHTA 2DPLA 2BW0A 4YIHA 1ZNZA 3A9CA 3ABRB 2O0JA 3PNSA 3AR5A 5KDOA 4Y2QA 5K9ZA 1COWA 3GK3A 3T0GA 2Y1WA 2FFBA 4NYMQ 2G1PA 2V9CA 4E1VA 3U3RA 2J33A 3F4LA 4WZBA 1C8LA 2A59A 4D9BA 1ODFA 1KFKB 1VRVA 5FL7A 1E2PA 3FCYA 3MGCA 4AF7A 1AO0A 2YJGA 3MPUA 1NMSA 2C20A 3HXKA 5H4GA 4BJ6A 4P36A 5FJJA 1KAOA 2XMGA 2J0UA 3KL4A 3LQQA 4YMUA 2R6GA 2X6RA 4P34A 2O2JA 3LC2O 4HH1A 3BSYA 1PEAA 4PVCA 5ELXA 2J3LA 1V35A 2RJNA 1GPUA 1RXYA 2ATCA 3LL4A 2DETA 4DRYA 2VRNA 3DDHA 3VO9A 2R1VA 1JG1A 1VSUA 4EHAA 2HYIC 1XRQA 1YUBA 1KXZA 3D8NA 3QWBA 5JS6A 4OMCA 1EMDA 4IIJA 3E1GA 5K3EA 3WAKA 3JWHA 1ETHA 1T1IA 2Y76A 1XZFA 4FOTA 3X1WA 3X2FA 2XADA 1G20A 3DKPA 3MILA 1J5XA 1XXHB 2ZW9A 2WW8A 3IAS1 3U3OA 1XZEA 5ILGA 2CY0A 1T2NA 1VRWA 1V2HE 3SC6A 2JGKA 1DQSA 4DN6A 2IY7A 3TX6A 5IWAB 1XYGA 2CL0X 3D7SA 3JQ6A 2QG9A 3CT4A 2K2QB 3M9LA 1XGKA 4CNQA 3P2EA 4ZVKA 4B3IA 4Q9HA 4DTIA 1AZLA 2QTTA 1PNQA 3A0UA 3KZKA 1KFJB 4RDIA 3WK4A 1O96A 2GEUA 3GLKA 5F9MA 3TEFA 3TJMA 1FSPA 5IX8A 3BMQB 1T36B 1N4AA 2YY7A 4L1KA 3PHGA 1JI0A 1FS6A 2ZB2A 5H7XA 4AU1A 2G28A 4COOA 4HB3A 4F9TA 3TXYA 2IYRA 3LVRE 1YU9A 2WWRA 4OB8A 5KSWB 4LDAA 4QJBA 2V4ZA 3CZQA 3KEOA 3SD7A 4I14A 5GJWC 4C7BA 2C99A 2Q29A 5E1OA 3OD5A 1JX6A 3HKBA 2HF2A 2ZIUB 3LRPA 4CT0A 5BSGA 4B0PA 4GXRA 1SG6A 1MNQA 1LPMA 1T1RA 1A8UA 2GI4A 2GZDA 2E5WA 2HUNA 2FOIA 1IATA 2PAFA 1T8PA 2R6R1 2ZPAA 3DT6A 2PZBA 3L0SA 4G0MA 3L01A 4DC9A 4CL2A 4W1PA 1MT0A 5JS1A 4MIEA 2W71A 3R77A 4N0MA 9GPBA 5JLJA 3HTXA 5CW2A 2WHPA 4NF2A 4X3PA 4O2AB 1CERA 2GDZA 1YCDA 3MK31 2P3OA 4WLVA 5F21A 1SH7A 3VPBA 5HM8A 5TQ0A 2PMBA 3GJ8A 1KBZA 3V3KA 4C4ZA 4ER3A 4EUSA 1B73A 1ZI8A 1XFAA 2BIFA 2BR5A 1ODKA 2RMKA 2I0FA 2YTZA 3P0FA 3QYAA 1XD9A 1YS9A 4CM5A 4CKBA 2RGWA 1KZHA 2IELA 5AUQA 3KEQA 3UIEA 1XEWY 3FYUB 1QRTA 1L4EA 2HADA 5F1KA 1Z0JA 4LXXA 5DWVA 1H1LA 4EB6A 4S1NA 1PWEA 4H7PA 1BROA 2LE0A 3ETHA 3WLLA 2O1XA 5DLPA 2G36A 4HDKA 3QWIA 1GM5A 1C30B 1MOQA 2ZTSA 4HDRA 2NSLA 4OLAA 4HVCA 2FU5C 2D1YA 2XRYA 3AB3A 3R0QA 4DIBA 1KYYA 3OMXA 1RFGE 4J2OA 4DQDA 2ZYTX 1Y6QA 5JAUA 5KYNA 3K16A 1SKYB 3I42A 1CUUA 1SD1A 4K6CA 4LWPA 3LVBA 5K4HA 1LJLA 1SBYA 3PXXA 4IJQA 4WJLA 5ICEA 4X7RA 1XU4A 3FLEA 1N3YA 1V3TA 1N6OA 1E4EB 5TQ2B 2CEAA 2POCA 4ZI3A 5IKOA 1MAVA 4WNAA 1OT3A 3B1FA 5B1IA 4I5FA 2VDRB 4H4CA 2QGNA 2OQIA 3FA2A 3FWPA 4Q1DA 4RQAA 4MV4A 5IN5A 3R7BA 1PEDA 3U4CA 2X0IA 1VJCA 1ZQ9A 3MRVA 3C0KA 4B81A 2AOVA 3H5IA 4PONA 2HY7A 1RLOA 2C59A 2QGZA 1DP4A 2B83A 3G68A 2FSPA 5BWCA 1M2VB 2A0UA 3EGDA 1SCUB 4FUQA 2IZOA 1WF6A 4EF4A 3EEYA 4NOMA 3AINA 4I1PA 4OLJA 4NSNA 2ZKLA 4RD6A 3TJRA 2YYSA 1JHDA 2C9MA 1E59A 4D81A 2JGRA 1KO4A 1VBKA 2DMRA 5GV8A 3T1NA 3KOUA 1F12A 4M0UA 4XWAA 5F77A 4JQSA 4DJTA 3TXAA 4P3YA 3ENQA 5JASA 4CTOA 2UYHA 3K1AA 3NAGA 3UJAA 3FFTA 3D7NA 4CNBA 2I2FA 2NZ8A 4P3PA 2RHCA 4W4TA 2E7ZA 2AOUA 5CLQA 3WVNA 4EPWA 4YCLA 3I6YA 1HSOA 4RTRA 1SXHA 3D5QA 4IMJB 1JFSA 3B7GA 1WMBA 3LIPA 4HB4A 1PTKA 1E0SA 4WHMA 1JWAB 4KUEA 1Q15A 4ECAA 2FTKE 1LXCA 3U31A 2QPTA 3HUEA 4BQSA 1MQ9A 2C98A 3UQZA 3D02A 4DEXA 1UL1X 3T7AA 1T1GA 1RHKA 1T9BA 1YQ9A 3V8RA 4E2YA 1QKIA 4LOIA 3DOFA 5IEJA 2GOYA 3UUEA 3TI7A 4DRZA 1X80B 4AS2A 2PWBA 2PUHA 5JFGA 5B37A 5CVDA 2I78A 3O8QB 5EE1A 4ZAYA 3TH5A 4AJ1A 1V0JA 4A0HA 4BV9A 1YVRA 2JIZA 4PR0A 1ZDMA 1TEZA 2HPHA 1CEQA