2FWAA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89n from the acidophilic bacterium acetobacter aceti, at ph 7
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAANLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
total genus 50
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fwaA00
5BOSB 5CLJA 4GRDA 3TRHA 2YWXA 3OPQA 4ZMBA 4B4KA 5CLIA 4YCCA 2H31A 1U11A 2FW7A 4YCBA 4YCDA 5CLHA 4ZJYA 5C5DA 4Z7JA 1D7AA 5BORA 5CVTA 1QCZA 4YCJA 5CTJA 2FW1A 4ZC8A 3OOWA 5CLFA 2NSHA 4AY3A 2FWIA 1O4VA 2ATEA 2FWBA 2FWJA 4AY4A 4ZK2A 2NSJA 2FW6A 1XMPA 3ORSA 5BOSA 4JA0A 3RG8A 2FWAA 2FW9A 3RGGA 2FWPA 3LP6A 3KUUA 2NSLA 2FW8A 5CLGA
chains in the Genus database with same CATH superfamily
3AHGA 1ZXXA 3PFKA 1GOTA 1S3IA 4X7MA 1Q83A 2E21A 1HYQA 4EK9A 5AYVA 3RU9A 3RVBA 3C1UA 3SHVA 2ZRBA 2GTPA 2VQSA 3FNBA 2AR9A 2A0XA 4NDZA 4MWEA 4L4UA 4C07A 1AH2A 1OB5A 4A10A 1JNXX 2MSEB 4EKNB 4M0UA 4F3KA 2HC9A 3I2KA 5KO2A 5I7OA 4ND3A 2RGGA 2IYWA 2J31A 4QUIA 1WHTA 2VP2A 4HNQA 2GEUA 1D2AA 1R1DA 2X5JO 4LGMA 4MQ5A 4MYDA 3O92A 5F7OA 3EOBI 3JTMA 2WUFA 3NC0C 5C5CA 3FMVA 4XFDA 4D0RA 2XBMA 4FLFA 1MFPA 1OI3A 4AYWA 4U2KA 3OTOB 3OCUA 4GVXA 3INRA 4NEQA 5J2TF 5DBHX 2MMGA 2DWUA 2JJ1D 2VAMA 1SM4A 3LXMA 4JENA 3U4AA 1EIWA 5FL7A 2TMYA 3T3DA 5L3SB 3DPUA 1TU0A 3WYEA 4KP7A 3FCAA 5THXA 5F7ZA 1QGUA 4C21A 3AR7A 5EJGA 2BMEA 3CVOA 4E6PA 5BN1A 3PI6A 4FLEA 4X94A 5D3QA 3CA8A 2QQ5A 1J25A 1DKUA 2PYDA 2Z09A 3HJHA 5LL6P 1O4VA 3JD4A 4EJ0A 1IN7A 1TK3A 3I32A 4IQ4A 2AS0A 4BE4A 3FMPB 4DARA 4MQFA 3FH0A 4EO7A 2QNRA 4QT4A 2FRDA 4DCVA 1WD5A 3CZ9A 1RWMA 4C0LA 2QLJA 3M5DA 3I9V6 3PQ2A 2Z1MA 2JBAA 3LUDA 5J2UF 4HPXB 2DC1A 2YZNA 1XRJA 1ZLXA 2VSQA 3B5IA 5KDLA 3UAZA 3I2YX 3GJ6A 1QZTA 4XVHA 1CJBA 3TRFA 5LP6F 3H3XA 1PJBA 1Y3CE 1TFUA 4KGVA 3M4NA 4RL6A 5ALYA 3CN9A 1F3LA 3GFVA 5FUYA 2JNWA 5IBQA 1GN9A 1PV2A 3UBTA 3B13B 4BX8A 1C5KA 2XUJA 4B84A 5JBQA 2IH5A 4LZPA 4YJGB 3FETA 3RYIB 3UH1A 2CJWA 2LR0A 4GPBA 5LUAA 2JLBA 1HQCA 1G64A 1V5WA 2L17A 2H2DA 5K05A 4GKVA 4GSKA 1HETA 1E7QA 4H1HA 2G5GX 3UCXA 3O1JC 4ANFA 5G53C 3FSGD 1TA4A 2CJPA 4ND8B 4GQIA 3AF4A 3WQQA 4E4TA 4CCWA 5BVHA 2V1UA 4FXPA 3NDBB 1XDBA 2COKA 2QTLA 3IAHA 2NTEA 4PYKA 3ICQB 2WLSA 3HJRA 4KN6A 3FZQA 2CJYA 3IDZA 3E0XA 3IP1A 4TRMA 4XDYA 4ZDWA 1XD2A 5KOJA 5F23A 3HBLA 3W05A 2PBRA 2C7QA 1R10A 4XIYA 4IEFB 3GAAA 4AKSA 2B69A 1I6MA 4MCHA 4ZODA 1NBEA 4PYNA 2BLLA 2YXBA 4DKXA 2GUGA 4IMPA 1KZHA 2FDXA 2BEVB 1N5RA 4F3TA 2XOEA 1D6NA 2C5AA 5B6PA 3ANYB 2WWIA 3KEMA 1QC5A 4Y3UA 3V8PA 3VQTA 4B5LA 4D96A 1CB0A 4RJ2A 3T5AA 2M6RA 3B1VA 3UAVA 1QIFA 3R3XA 4PHGA 2IYRA 3G3EA 1KORA 1YJQA 1NONA 3OEHA 3ZDDA 1OXSC 4RSMA 2I67A 1J8MF 3RSFA 1E3DA 2A30A 1O6FA 1RJWA 2X2EA 4UUQA 5TQ0B 2VUHB 3ILVA 5SY9A 3W1WA 5F98A 4FK8A 2ID9A 2G77B 1FQKA 1MTOA 3L4JA 2XQIA 2RGEA 3L7NA 4AF6A 3HXOA 2P78A 4WDQA 3L93A 2EX1A 1EZ4A 5LC1A 3NPMA 4DMFA 4ARAA 4NJEB 2W4IA 3UOGA 5ALEA 4LHVA 2EX0A 3TSOA 4YUZA 3LYLA 1F6WA 4DIOA 2QN6A 3TLKA 1K5GA 2HUNA 4YEDA 2RHBA 1W0JA 3RBVA 1SUCA 1OYVA 2ZWVA 1COWA 4XB1A 2DUWA 4ZD6A 1VP9A 1G42A 3TEMA 3V1UA 5K7SA 5L95A 4MHOA 4IV8A 5FWNA 4MQBA 3L1JA 1GM5A 1I6KA 3ZI7A 4EVQA 3OOSA 3RI3A 3M1AA 3KALA 1LV7A 2JFFA 5AW2A 1CTQA 1GG8A 2WU4A 2MIIA 2B0JA 3F2VA 4KWHA 2OGWA 4BE9A 4BVEA 3GNTA 1YQXA 1EKXA 2G1AA 3EZXA 2X0JA 5F4ZA 2QB5A 1F0KA 2XMRA 2DPHA 2I8LA 1ZGAA 4PNPA 5LZ7A 3SLGA 3FG9A 1G8HA 4JZYA 3MJCA 3FYTA 1JSCA 4CG0A 2EQ5A 1U8UA 1K6EA 3KOWA 4ATNA 1TF2A 2R5FA 4IJKA 2X4LA 1XJQA 4NAHA 5A0FA 4TSFA 5DNWA 1I2CA 5KJCA 2FHSA 2ZRGA 3TSAA 4DA7A 4DV3B 1N8SA 1NG1A 2RJNA 3PE4A 4RY0A 4TOIA 1BE1A 1F6BA 1G6KA 1T8PA 2R6R1 3BEOA 2R4UA 3L0BA 4UZEA 1F14A 2X9GA 3LA8A 3LC0A 3TUIC 3AZPA 2PG3A 1JUDA 1Y6FA 5JVDF 3PNOA 1MAVA 3QEMB 4GU5A 4L5AA 4TMWA 3FNQA 5LQSA 2GYYA 4PXSA 2J0UB 3M1LA 5DXJA 4ZICA 3FF4A 4YNBA 2WU0A 3CVXA 3AG6A 2BUCA 1RLIA 2H11A 2WUVA 2IFTA 2ZW9A 4O2BA 4ZPXA 1KVQA 5I7HA 1SKYB 2IIPA 3DBRB 3F1LA 3GH3A 1U0SY 3ON5A 2Y92A 3EQ6A 4MAAA 4KVGA 3B78A 3RJTA 3LRTA 3QVOA 2AV6A 3D3KA 1YK1A 3MELA 3ADCA 1OGIA 2P2SA 2EV9A 4E2YA 4OBWA 1FLVA 3OLQA 2IZOA 1QHIA 5ITZA 4CN9A 1UODA 3EZLA 1ISHA 3HI6A 1DG1G 3CUEF 3HP7A 3QVMA 4P8RA 1U9YA 2AX3A 4K26A 3K6SB 1LJ8A 4EGQA 3FMIA 1E2JA 2B4QA 4Y9TA 4BGEA 3IDQA 5DHPA 1HE5A 3PB3A 4EPVA 3BK2A 3RF7A 4MVYA 4Y1FA 4ZAWA 2HCFA 3QIVA 1S2NA 3NWOA 3O0TA 2YWEA 5HQ3A 2XUDA 2EZ4A 5EUCA 4D3XA 1N3BA 3OZAA 3U7EB 3WL7A 2D0IA 3LT1A 3BXHA 1CYEA 1ZUNA 3G0OA 3ZD9A 2FOIA 4M1OA 2HSZA 3RYFB 4P0TA 4L28A 2Q3EA 1ADJA 3M2TA 3AHJA 4M0LA 1FP6A 4R4JA 5DLEA 3TB4A 4EHDA 1H0SA 2PUHA 2OCAA 3Q7PA 3GJTA 4E5MA 3K1TA 1CQIB 3WAGA 4FDAA 1G59A 3IUQA 3PTZA 4ZCSA 4PVDA 5U4XA 3RKUA 4JLPA 1YRLA 4ZCTA 3L7AA 3GHYA 4O4JB 4GMHA 3R5XA 1WCWA 2YYZA 3G23A 4RQAA 2FPPA 5EG5A 5ALFA 3CO5A 3CZQA 3ZW9A 1ENOA 4EQZA 4TUYF 4QLOA 5AJVB 3EWAA 5CFPA 1YK0A 3PDWA 3ZGNA 1XTRA 4XVUA 5KMGA 1HNXB 2HQ1A 5E95A 2DU8A 4M99A 5TGTA 2XGGA 4V0KA 2JI7A 2R8XA 4XWKA 3W6NA 2AFIB 1E79D 3CH4B 4H60A 1Y5MA 3KWFA 4JT9A 1HTWA 1RDFA 2IDKA 4F5DA 3LU1A 4PYQA 1ZI8A 2VJAA 1VLQA 4H4DA 2A5DA 1C3XA 4Z99A 2FP4A 3SU8A 1Q15A 3ZVNA 5EFOA 2QW1A 5CA0B 1UFRA 1ECGA 3R7WB 3SFTA 2F17A 1M2EA 4BO7A 3TXYA 2XMGA 2VT6A 3WQBA 2OHVA 1OLUB 3DHYA 3K5HA 3RHFA 4D4IA 2CZGA 2VPTA 3NOVA 5KUTA 3BIOA 4WGGA 1TQDA 1Y89A 2W90A 2JGRA 3PQ6A 2FE4A 4ER6A 3UGJA 3FNRA 1PJCA 4FBMA 4AD8A 2PRZA 3ZHTA 5JNTA 4OHVA 1JXOA 1RCFA 2Z8ZA 3UENA 4GP6A 2O0LA 3OFJA 3PRJA 1MO5A 2A78A 3CZRA 2WHQA 4RKRA 2AX4A 1JLKA 4IGEA 1IU9A 5H5JA 1WZNA 2E55A 1V26A 4X65B 4NNPA 1JX6A 4AZ3A 1L3BA 2AF3C 4FFRA 5EP3A 3OOYA 3DLTA 2JVJA 3LBFA 2E87A 2FEOA 1LQ2A 2QNBA 3RIGA 4H3SA 1TNDA 2FUG1 1SK9A 2V7QA 5B53A 2D8AA 1IBRA 2YHIA 4H3KB 4MV9A 5G0UA 5TB5A 4UTNA 4ZVQA 2QZPA 2B2CA 3ZE1B 3ZWCA 2REBA 2HJHA 1U7WA 1WDWB 2AK2A 4LOAA 3NHZA 4QOEA 2J9FA 3F78A 8OHMA 3RAFC 4IMJB 4PIMA 3EGEA 3THXB 4RSRA 3K2EA 3SE7A 1WZUA 1Q12A 4N5NA 4BVBA 5LR6A 2WMYA 1DP4A 4WGFA 3HBNA 2BI4A 2NV0A 3W5BA 1AQ6A 1DIBA 3JZMA 1IM2A 2PLRA 5KC8A 4JT4A 1T2UA 2R97A 3K6JA 3KT3A 5SY6A 1QHNA 3GRKA 3KR0A 1GAXA 3OU6A 4XARA 3AHCA 3S2GA 2NZ8A 3D7RA 3VYWA 5BSGA 1KAQA 3T8YA 4JLBA 1JVNA 2XGOA 3HKEB 1JDBB 1XDSA 5JI3E 3BGOS 5BSHA 2XWBF 1W52X 2BFOA 1MH1A 3EA0A 5EIHA 3CZCA 4DNOA 1XGKA 5B58T 2B99A 3JQGA 1CBUA 1J7JA 4PYMA 1SBNE 3FGOA 4ZEXA 4LC9A 3ZHOA 2VCHA 4ARCA 2AUNA 5KNBA 2I8AA 4GOMD 3E05A 2I99A 1N75A 3A9VA 1JJAA 4NQRA 4WKBA 3IAAA 4ME6A 3ZK7A 2GN2A 1ISPA 1T5SA 3CVJA 5LD2C 5KWIA 1U0FA 2QR2A 2F3TA 1ES9A 3JZIA 2POQX 4GLOA 2CLIB 4IXMA 5G3YA 1T8UA 4CEJB 2WF5A 5CYOA 1KSGA 2NPIA 3I0MA 4LUCA 4U0KA 5FPYA 1SG9A 1SC4A 4LZNA 3ZBQA 4E15A 3DOFA 4IDHA 5AKYA 3LQ2A 2ASEA 1ZNXA 2C4TA 4NRDA 2JCYA 4FZJA 3NASA 3F8WA 3Q7EA 3FVTA 4FI3C 1RM4A 4X6YA 1GRRA 2ZJ6A 4AJLA 4WNIA 4UM9B 1PS9A 4X71A 3ZI0A 4HJXA 5EWJB 1H0RA 5B3AA 5J40A 3SJUA 1JBKA 2Q6LA 3H5LA 4EX7A 3LHFA 3OKPA 4FD2A 4II2A 3E6AA 2KB0A 1FEZA 5I7AA 3U4QA 4Q7QA 2EP8A 2PT7A 3TW4A 1XMJA 1TM2A 4CIVA 1KWKA 2QLLA 2ADOA 4F85A 2OMKA 3B2EA 1EFHA 3IUYA 4EI8A 3DFKA 4YJ3F 2HSEA 3UKJA 3EA5A 3DUWA 4PX9A 3EXFB 4J16C 4E1AA 1UEIA 2AC4A 2YVQA 4JBHA 2PFSA 1RJ9A 3K0EA 5FX2A 4YHBA 2QHXA 4DLSA 2Z1DA 4ARVA 4B7AA 2D3WA 4D8XA 5KTRA 3WWZA 4BB5A 2GMWA 4L27A 1NLFA 1OXTA 2QP9X 3DQZA 1XVIA 4JUAA 3F9CA 5K1ZA 4YYZA 3A1TA 1CJMA 2VHCA 1ODTC 3L9XA 1TTHA 2VK8A 2VZLA 3LBYA 4DLAA 3QE9Y 4EZBA 2VBFA 4AMVA 3BHNA 4R1OA 3WWDA 2PTHA 3BRWD 5TQ2A 3F8TA 4IDOA 1D03A 1M34A 2V65A 5J1SB 3T3IA 1VTKA 2JAXA 2OXCA 2OGUA 2VC2B 3QEOA 4HWSA 4R8MA 4X64B 1U0BB 2VDQB 2HLHA 3L0YA 3AINA 3B6IA 3ILXA 1YONA 4JWTA 4UPVA 1L5HB 5LD2B 2Y4OA 4M0EA 5DNVA 1WY5A 4V1CI 1BS1A 1GADO 3DL7A 3IH5A 1JG6A 1LPMA 1OY1A 5CVDA 1DJPA 1V1RB 3R9KA 1A3CA 1KIFA 1XMXA 2QTWB 1P3DA 2PXCA 5CDUA 2PGAA 4HEJA 2J9YB 4BEJA 2W42A 5KWSA 4UZSA 1A5TA 4W7HA 1YQTA 3ERCA 1MGOA 1U3VA 1YCHA 1BA3A 3WGNA 1QU2A 4RBNA 1MRNA 1NPYA 3EQ7A 2W2NA 1YL5A 1OWNA 2XPCA 4X1IA 4K9RA 2WJIA 4WOKA 1VB5A 1ISRA 5HCNA 1EQ2A 4PO9A 3EN0A 1ZEJA 1E94E 3Q3IA 4N6OA 3GOQA 4M54A 1YGYA 4CDMA 5J58A 3VVBA 1P17A 5GADl 2Q6VA 4XR4A 3FNHA 1DX6A 4PANA 4Y7DA 1O9HA 2A58A 1J06A 3OPYA 1I3OA 1VL5A 1EZ1A 2B35A 4CNBA 7REQB 5ITSA 4L0DA 3L7CA 2NUAA 1Z4PX 4AF8A 1D2GA 4DR6B 4MMXB 5DWDA 1SCAA 4NJMB 4X84A 3RFVA 4QVGA 3HWSA 2QL9A 3F49S 4DCJA 1JALA 1M2OB 4MVJM 4DQLA 1ZH0A 5LA6B 4Z3OA 2A5LA 4I9FA 4IO0A 4KV7A 5AK0A 1FDSA 4UMDA 4WXRA 3V1KA 1VJ1A 5C35A 1C9YA 5F78A 3FOWA 1WTAA 4YLGA 2H9IA 4JJGA 4PLFA 1BU8A 2OAGA 4ZZ1A 1AK2A 1JG3A 3I6BA 5EIBD 4R8VA 1NBIA 2FY8A 1K7YA 3D8UA 2QRPA 1CUZA 1CUUA 1JR3E 4JEHA 1W0KA 1SC6A 2ZIVB 4MW7A 2P2YA 1SCKA 2HSDA 3A0UA 4MRNA 2HIHA 3O2JA 4ZEWA 1H9CA 4DAOA 4ZQHA 4NS1A 1IB6A 2NVWA 1F60A 1FU8A 1P4GA 4AAYA 1M1XB 4X45A 4OSEA 1TYZA 3KHSA 2WMNB 2ZK7A 3G13A 1YH3A 5EE3A 2WZBA 4PSCA 4Z4HA 3G2QA 5K0FA 5A71A 4AWBA 4RTQA 1IAVA 2WD7A 3P9RA 4Q12A 4QPJC 3WI7A 3VZBA 4QUEA 2DUMA 2HHHB 3JD3A 1UBOS 4B6EA 2ZQZA 1NXVA 1QHGA 1ZK2A 3HGTA 3PFBA 4CMJA 1V16B 3TTYA 1R6XA 3RS0A 4ALNA 4IIXA 1XCGB 3S27A 3DDUA 3FDZA 1NQVA 3AP3A 1T5TA 5JATA 5C0OE 3PGXA 4HRAA 2V5VA 2RHCA 4D97A 1H8EA 1P6QA 3P0RA 2AEJA 3OY7A 4F4DA 3D6MA 1IXKA 3RU3A 2XGJA 1GN8A 2BWJA 4FMBB 5KVQA 2XTJA 3SF0A 3TFQA 4XWWA 1UM8A 1BEUB 1SUDA 2I22A 1Y7PA 2W2TA 5B4UA 3T0GA 4JIGA 1VECA 2PJDA 2YWHA 4NZZA 4ZV9A 1N5MA 4PYIA 1GL6A 1YA8A 4W1PA 5LU8A 2V5UA 2FK8A 3H0CA 3R6DA 3E9DA 1A8QA 3D0KA 2R6AA 3QXSA 5J4LA 2G1PA 5JXJA 3ZNQA 1QH8A 3O8DA 2XEDA 1Z47A 3LHIA 1D5WA 3SHQA 4C1NA 3BEDA 4F2GA 4Z1OA 1REQA 4JJ4A 4KMSA 3RSOA 3UBMA 1EX7A 1VIVA 2AG6A 2D62A 1NP6A 3O26A 3LXUX 4J43A 1K8YB 3B89A 1VYHA 3N8IA 2BZSA 3QFHA 4YK7A 3S2SA 1L5VA 1P7CA 1SVIA 4FJ2A 4EVSA 4ZOQI 2HV9A 2FFQA 2YS7A 3IOYA 5CEEA 5DBFA 4CM4B 4BV8A 1QMPA 1X9HA 5BOSB 5AVXA 1LBHA 3SXPA 1BVYF 1KIAA 3OEYA 4Y2UA 3HVJA 3O82A 2LTAA 2V6BA 3JQ9C 4HWTA 4RVNA 1EFPA 1M1ZA 2J7PA 1A2OA 1FJXA 4CQNA 1S5PA 2QVBA 3S1LA 2ON6A 3E3LA 4IHJB 3TLCA 3GLGE 1EE9A 1PGOA 2G06A 3D4OA 3PHBE 4DLTA 4C7JA 4ZDIA 4IOKA 1MAHA 1G6Q1 2ETVA 4O8ZA 4BNXA 2GERA 2ZGVA 2QUZA 2J0QA 4RK1A 3V6MA 3EPKA 1CUBA 2QAGC 5EJMA 3A4MA 1EVEA 5CLQA 1VJCA 5I45A 2OGTA 4M8IA 2XCTB 4GWLA 4QYIA 4X1KB 3TSYA 4M76B 4FUTA 2VJBA 3OF3A 5KINB 1D6SA 1LDGA 1KL7A 4KSCA 4BYMA 1USIA 4LBYA 5K3FA 1E5QA 3IPRA 3OQVA 4HPJB 1W25A 4G0PA 1FUYB 3TFOA 4O2LA 2PYZA 4BGUA 2ZE6A 2PGJA 1YVDA 4FC6A 4EKYA 1TAHA 2PX3A 4IKEA 3FFTA 3CW2A 1EFRA 1VSVA 1SQGA 2G6TA 1SHLA 2OO7A 3OD1A 4J0FA 4X61A 3LYHA 5SV2A 4GG1A 1KJQA 1NJ1A 2VZ9A 1EPUA 3PUVA 2C3MA 4LE0A 4L02A 4UXJA 5AVKA 2J3IA 5TS3A 2JGDA 2AN3A 1A8HA 1TZMA 1CR2A 1RADA 1IIRA 2BBWA 2IOQA 2ZIFA 3LXXA 2YIMA 2A88A 4MULA 3SBDA 1QYIA 5LQKA 3EK2A 3C15C 3HYLA 4HXYA 4OGWA 3UHOA 2I1LA 1D07A 1MX5A 4TKUA 1XZEA 2HK9A 4J7CA 4PG6A 4C6SA 4B31A 2AG0A 1G1MA 3SJCA 4GYYA 5LYJA 1UBTS 1R5JA 1O8BA 3GRPA 2PR7A 3JV7A 3ZV4A 3RHZA 3ZWVA 2UZ3A 2PZBA 4B83A 4ZZ3A 1G5QA 2I6SA 1NHGA 8ADHA 4QU0A 1PS8A 1GNSA 4F11A 3QHAA 4J2OA 4QREA 2TS1A 3JTEA 4H7FA 1IY0A 3BXXA 4CKEB 4JWKA 1I14A 4PLGA 4J4HA 3W9BA 5P21A 2J3EA 3S4YA 3TQIA 3CNLA 4DEYA 2IYOA 4BLTA 5A4JA 3HXQA 1O4WA 3WKEA 3MG9A 1TGYA 4YAIA 4CF7A 2QTCA 3OIWA 3GJRA 3TRDA 4Z9FA 1KMNA 1ANKA 2OYRA 1HE8B 3GRUA 1N6LA 2ZKIA 5JRDS 3PQ4A 3CISA 3KLPX 5DNAA 1CRZA 1VC2A 2ALJA 3H3JA 1CUJA 1K8XB 1T9AA 3VKVA 1EM8A 4EG5A 1LW6E 1RWBA 2VG8A 3OEHD 4LHXA 3SDZA 4BLPA 1ZS9A 1V7PC 4NPHA 1BWSA 4OGGA 4RGYA 3GRZA 1DC5A 4QRIA 5CXSA 2CF5A 3PLRA 2C0PA 1YFLA 1MVOA 3PA6A 1TVKB 3ROXA 2R62A 2FSVC 4G2NA 1N4AA 2ZRNA 4PZYA 3T9BA 2GKGA 1B16A 2F3QA 1RBZA 2HA3A 4O3FA 1ORIA 1MTZA 3DFUA 1FL9A 5A5VA 1E3EA 1B6SA 3N86A 4RFLA 1JJBA 1T4CA 3DDNA 1W0JD 2YYAA 3MS2A 4TMZA 4C22A 1COWD 1FDWA 3LFTA 4XR9A 3H7AA 2GQ0A 2HPVA 4G4GA 3RUPA 2XZOA 3CKKA 4P84A 4RESA 3LMKA 1LDMA 3VHXA 1W2WB 4MV5A 1TRKA 3C6QA 3E53A 4DPMA 1P4SA 3ZEAA 2OB2A 1F0NA 2IDMA 4OEHA 1U2GA 3HS3A 4XGKA 4KFSA 4LG1A 3HU3A 5JNLA 2GK6A 2ZT7A 5DGIA 4WQMA 1SCUA 3ZQ4A 3GLTA 4Q1EA 2FZ4A 2GJKA 4C3OB 1ISGA 2AOUA 1D2CA 1M7BA 3GGOA 4I6EA 4IIHA 2GRAA 4REMA 4R81A 1USKA 2WFZA 4FYKA 4P08A 4YT2A 3PFNA 4L85A 5C8VA 4ZOEA 3Q87B 2JIPA 3EFBA 5CJJA 3K8QA 4A73A 4AWAA 1VHJA 2PJUA 5ECGC 2E5WA 4YLEA 5HYVA 4L6AA 5BN5A 2BC9A 3Q6MA 5CXUA 1XLTC 3D3WB 3H2HA 3I01M 3BG5A 4GIBA 3PG5A 1L5FA 3CIFA 5C8YF 2PQ2A 1ZK0A 4CLRA 1NRJB 1V45E 1ODLA 4RD1A 1SBZA 1SMKA 2CSXA 4W82A 2E49A 5DVZA 2G7ZA 3V7YA 5KQSA 5K3CA 3Q2IA 5H9WA 1S2MA 1ZISA 2GF2A 4LHZA 1U63A 4BB6A 4L5YA 1O03A 1SHJA 2M1ZA 4WH0A 1N2EA 1CPYA 1WL8A 1EFVB 1I1OA 1K08A 3PCTA 4HNAA 4TWAA 4X00A 4G86A 4QOJA 2J0EA 1FFSA 2Q07A 2V6GA 4W1QA 4FZ3A 4JR0A 4N49A 4BYGA 4C20A 2F8LA 2QU7A 1QQ5A 2LWIA 2QAJA 2W22A 2WIKA 1ZZGA 2D3TA 2H1LA 1NT4A 1CUGA 3CF6R 3GFSA 4HLDA 4PBSA 3AEKA 4ZU6X 2ZYGA 1QG0A 1Z75A 3HA5A 1GPWB 4EGCB 1IZYA 3CEHA 4PLCA 3K0AB 5DI3B 2RAUA 1E4EA 2N1BA 2GHIA 2YWRA 3AHDA 1NF9A 3E3MA 4QG7A 5CT4A 1TQ4A 4O4IF 4A9AA 3C14C 4QECA 1AX9A 1RXCA 1WXQA 1NX9A 4QRHA 1NDUA 1G20A 4Q19A 5ALGA 1K98A 1XEFA 3OA0A 1II8A 2XRFA 1ETHA 1UFOA 1EUDB 1J0EA 2HDNB 4N4AA 5DT9A 2BW0A 3GZTB 1EGVB 4IJQA 5G2OA 1J24A 4JEIA 2I4LA 2G9NA 3OX4A 2GBFA 5H4GA 1P18A 2W93A 1W46A 3MTAA 3OI7A 4V03A 2ZFUA 1N8NA 2O6HA 3RYCB 3AZOA 5EKSA 4BO5A 1NUUA 1Z35A 8LDHA 3OE7A 1C50A 1E3QA 1C3OA 1VI6A 3LWBA 3OESA 4A0SA 1UMCB 2CL5A 1ULSA 4LSGA 1FFDA 1COZA 1DFIA 3EXG1 4F4FA 3RJMA 1FSPA 1Q6ZA 1YB2A 2ZJ8A 4YV0A 3QWAA 4YECA 2BH9A 2PH1A 4GC5A 3FX2A 4TL7A 4WD3A 3UC5A 3UHJA 4Y67A 5BMVB 3ABRB 5KHAA 1KXJA 5EHNA 3DTNA 4CEIB 1T9CA 4RA6A 4B17A 4S1PA 2D13A 1IOVA 1ZM9A 2QPAA 4KR0A 2JFWA 3R9WA 1Y63A 2FEPA 3IKVA 3Q41A 1Q19A 5CNIA 3ZHUA 1MLDA 2ZBEA 3QYFA 4EFMA 4HBGA 1NNEA 2AE1A 1AZWA 3AKZA 4GKJB 3UFBA 4DV2B 1SBCA 1QUFA 4GPAA 1KJWA 2CSUA 1VE7A 2WKPA 3EGDB 4E22A 1EU1A 3O4JA 1Z34A 4C05A 3BF7A 1CNMA 4FEYA 1NQOA 4H27A 3DFMA 4QHTA 1XAJA 2VLBA 1KOLA 4DBLC 2JRCA 5INTA 4J0QA 2QRUA 2YJGA 3DULA 3JQAB 3MUOA 3BMCB 4OFWA 1ZWKA 4CKZA 1JIKA 3BS4A 1GPH1 3GJ7A 5EZ5A 1BOOA 2ECKA 4CM1A 4CCSA 1E62A 4EEXA 4QTYA 5KC9A 2C3PA 4DXDA 1QQAA 2YMQA 3DYVA 3HB5X 3HDYA 4GH5A 1UPXA 4MVCA 5A6VA 3QSGA 4J1SA 3FY4A 2C2WA 3ILSA 3QPWA 4E03A 4ZK6A 1YTUA 4KREA 3KKKA 4M86A 2EL9A 4M37A 4OU5A 5HPYB 2W98A 3PTAA 1NMXA 1D1PA 1Y5IA 2W4MA 1OTYA 4DDMA 5HM8A 3WDKA 5T57A 1QBGA 1ZRHA 2P4EA 1GLGA 2QG6A 2V7UA 4M21A 4NCAA 1XNQB 1YA4A 4IEEA 5LB4A 2PO7A 1V7QA 3DWEX 3VZCA 4JB2A 4FHEA 4BX3A 4XD7A 4MVJF 5C5EA 1LCIA 3DEIA 1EUYA 2DFKB 3MGKA 3VAAA 2XA1A 3V7WA 4UCXA 2A35A 3ER6A 3MOIA 4OUDB 2QX8A 4H15A 4EPXA 5BSFA 5K6TA 2F00A 2QY9A 1P4JA 2V7QD 2ZRCA 5AJXA 1F0YA 4ZGGA 3PQCA 2XB4A 2ID4A 4PYOA 4PCUA 1RXEA 3NGLA 3O0DA 4Y2GA 4YJ2B 2BHLA 2YUTA 2HMSA 3K1AB 3OE4A 1O1YA 3QX3A 1U8EA 1R4AA 3R8XA 5L4SA 2R8PA 1E4VA 3GMTA 4DRXB 4DVJA 4LZLA 1YF3A 1ZQ1A 3I76A 4FJ1A 4KGZA 3WK4A 5BVGB 5K0SA 4I14A 3GLIE 2P9HA 3KBOA 3ZHRA 1ZO8A 1H1DA 2BFFB 2C5SA 3AM4A 2WHPA 3FPEA 4TTJA 3USCS 5LMNB 2DJIA 5JY6A 1ONOA 1E8DA 1QTIA 3JU3A 4TV8B 1LFAA 4E70A 2NO4A 3B51X 2OV1A 1RXIA 4M1MA 1YZKA 4F2WA 4GMDA 4OHKA 3ZGZA 4RLQA 5GMOA 4CW7A 5HVNA 4QTTB 2JFNA 3OFKA 1PFVA 3FJOA 3DR3A 4DIUA 2CUTA 1L4FA 3CH5A 4ZIRA 3A2LA 4HNHA 3CRQA 4RCZA 4ZP1A 4EQ6A 3BTSA 4RMHA 4YAGA 1V3TA 3U31A 3UZUA 1DMRA 5FULA 5K9ZA 3T7TA 3KQMA 1S8FA 1YE8A 4WMLA 3M3DA 2O6LA 3GP5A 4WJLA 2K4MA 4FT4A 1J0DA 4L9WA 3DE1X 1UMBB 4ZYYA 3Q3CA 4FYXA 1N0IA 3AIIA 3RS4A 5C18A 3EPJA 1Z16A 4BP9A 1PEDA 2FFRA 4G0VA 3T3PB 2W83A 3RYHA 4C5BA 3OM0A 1X3LA 4CZ2A 5JCPA 1QV6A 2H1HA 2VH2A 5E6RA 1JFLA 5JAQA 2RHTA 4JLKA 5IHXA 1F48A 1U9IA 2KLHA 4X0EA 4GYKA 5CJPA 3M33A 2CNWA 1C4XA 1ZNZA 1QJCA 5DRTA 1NQXA 4QXQA 4I46A 1N77A 1Y5LA 2VUIB 1TCCA 3SBEA 1QX3A 3PWZA 3QU7A 5JEEA 1ZPDA 2O2XA 4LZAA 5DGHA 4LVNA 1OFUA 4QYXA 1TLTA 2VJDA 3TI7A 2V58A 4ED9A 5KOHB 3VR1A 1AKNA 2NXWA 5AXDA 1UOOA 3UJNA 2PZ8A 4F6CA 2L42A 3ZJ5A 5F52A 1EG7A 2IYQA 4OHRA 5DV9A 4RNCA 5HKKA 2WT9A 3F3MA 4B81A 4Q4JB 3X1YA 5ENVA 5EE5B 4BQEA 4P0PB 4B3RB 1XMOB 1M76A 1DIOB 3DGFC 4MW1A 1L5MA 2ZIUB 1ZN7A 3TR0A 3HKBA 1D09A 3JALA 4FGUA 1TMOA 2AOWA 1SQ6A 2YCLA 4L5IA 4BMNA 5GINE 3GLIB 3RVKA 4IUBS 1UKVY 3T6KA 3IPLA 4MV6A 3OWOA 2EDAA 4GRDA 4NK5A 5FOQA 2WPDD 3GVIA 3MRXA 2G28A 2V4MA 4ALJA 4BBJA 4H3VA 3NOQA 3U49A 1NFFA 1E5LA 1EX1A 3OIYA 4HEA1 4WK6A 1L1FA 2QE7A 1TW3A 3AB3A 3ZCVA 4C3VA 1TB4A 1G3QA 3I5XA 4Q05A 1KMMA 2HT1A 2ZSIA 1HZZC 1Q0UA 1QK4A 3H4IA 3IDSA 4W9MC 2G83A 4M7WA 5J5AA 5TGZA 4J4TA 4YPFA 3R0ZA 1K0FA 4B8WA 4EJFA 1J97A 4R16A 2VLIA 5JSQA 3ND6A 5B7PA 1OTHA 1KE2A 1Z8NA 4LDJA 3V4LA 2XI4A 1WNFA 5G4KA 4Q7KA 2XQGA 2Q9AA 3W06A 4U7PB 3LPNA 1CW2B 4HC4A 1SA0B 1K4MA 4PQGA 1E1MA 4BJHB 1IJFA 5LFAA 1T2VA 1Q5PA 3C43A 1W44A 3T3HA 4V2IA 1Z62A 4W5RA 3QXXA 4YQYA 4IFTA 3A1DA 1KXZA 3NHAA 2VUTA 4X7BA 2ZDGA 5BV2P 1OBFO 5KYKA 3C8DA 2QYHA 3G2MA 1G9XA 1ATZA 2NYAA 1VCOA 1NMEA 2CMHA 2VJLA 3RUIA 4E5UA 1XJWA 1E69A 2XLBA 4RDXA 4Q7MB 4BNMA 1K2VN 3IAM6 3K5WA 1QG6A 4H1TA 5K0NA 4GRIA 1TJNA 4Q16A 1OLXB 5E7MA 3G2HA 3V34A 2O2ZA 1FLDA 1KYXA 5KX5B 4KE9A 4LXUA 2WJZB 4BV3A 2C2MA 3MJEA 2DWPA 4QJ4A 4B7UA 3M3PA 1AN9A 3AEQB 2H54A 2C2YA 1E6UA 5JS2A 3AGQA 1JE1A 6YASA 2Q5QA 4V1CA 2AD5A 3DYIA 2NACA 1Z0JA 3KZKA 3LV8A 5B3JA 3R4VA 3M9XA 3SLKA 4P9NA 5M7EA 4FR0A 2IW3A 4CBVA 3LY5A 3TRJA 4J1QA 4MO2A 1W0KD 5SY4A 1TUIA 3LWDA 2Q4DA 4Q9LA 1FXSA 1LBIA 3BE5A 1OXMA 4JDPA 4MEJA 3PPWA 4ALMA 1VLHA 1A9TA 3HE3A 1V8ZA 4WLOA 1KEVA 3Q8MA 5BR8B 3A3KA 4MPRA 1AV7A 1BCSB 1JI3A 1GPMA 3BSSA 3EH1A 3FCXA 3K94A 4C5AA 4WERA 4Z2YA 1WXXA 1VKJA 2GZDA 3CJTA 4K0RA 3L06A 3CLSC 4JJAA 3DBLA 5JXWA 4ABTA 2VK2A 2E85A 4OFXA 2BEUB 2ZVDA 3NDIA 5EZYB 3MGGA 2OKCA 3COVA 4EFKA 1W7AA 2RSLA 1YMQA 1XTKA 5FFMA 4ZVVA 4HUJA 3SQLA 3T7JA 3U48A 1TEZA 4K9MA 4QNRA 4CF5A 1IXSB 2XMCA 4GLJA 5DXAA 1JILA 1LFDB 1H8ED 1TL7C 2GEBA 3CLVA 3RU2A 3S44A 4QYSA 4BFVA 1E2KA 2VHJA 1XELA 4QD3A 3SX2A 1KOFA 5BSMA 2AC7A 1NRWA 3P19A 5EMJA 5J5VA 2CBXA 4FNAA 4NP6A 1X7XB 4EJ2A 1QH1B 3HFJA 1TECE 2D1QA 2C04A 3IQHX 3PDIA 1T0IA 2BDEA 8ATCA 3KS9A 4UARA 4F93B 3I1YA 3QWBA 4PZ0A 1HLGA 1ZCBA 1ODIA 2B21A 2CNKA 3C7AA 3P0EA 3USZA 1P7ZA 2VCYA 2H7YA 4N7RA 1J5PA 5JHGB 2DPXA 4MIYA 2PX8A 3T9DA 1NZDA 4F06A 2QJFA 3C98A 3PHCA 1MBZA 3EIWA 1OFGA 1BFKA 3JQBA 3Q9LA 1I0ZA 1R0RE 1A88A 3LP5A 4FP9A 1E1QA 3STVA 4P4NA 3UATA 2OZLA 2VAWA 3QHPA 3GVXA 4DQVA 2BEKA 3V8EA 1I3NA 4JD5A 4TMVA 1O5TA 4LEIA 3H5IA 5J47A 4DV5B 4ITUA 5H1YA 1HI9A 1Q74A 1KDPA 1E59A 3DLIA 3JPWA 4P1ZA 4RLHA 5IAAA 1XK6A 3IAFA 3DDHA 4ZYXA 1CUCA 1A7KA 2ABWA 3DZIA 1RD4A 4FU0A 2R1UA 1W94A 2QU8A 1NVVR 1KAEA 3RUDA 1LU9A 5KTYA 5IASA 4D1YA 2J7PD 2W5UA 1ONSA 2I03A 3MB5A 4TS1A 1P4RA 1UXIA 3LIIA 5DTJA 5ALUA 3TNJA 3U6KA 1DAFA 2JJYA 3RRYA 3FE2A 2PA3A 5IJZA 1EGQA 4W5JA 4IIEA 3M9WA 2NU7B 1JFTA 3UWDA 1CUSA 1NN3A 3F98A 1N6RA 3IALA 4YJFB 1QVVA 1I7DA 3VYUB 5DXFA 3A6PC 1X80A 1ZR4A 1U7PA 2I76A 1GL3A 4PX2A 2A9PA 3KG2A 2H4YA 3ASVA 3Q8LA 2A5GA 2OTCA 2H51A 2LCFA 1QF9A 5FWYA 2QPLA 4AT1A 1RI1A 2PMWB 5BYAA 2BVNA 4OP1A 1RVV1 2PWAA 4ENWA 4YAFA 1NR7A 3WLRA 4J03A 5JAZA 1JSRA 4TV9B 3DOCA 1I3KA 1QHFA 1LLCA 2C29D 3JAWA 4QGBA 4WRRA 3U19A 2GNPA 5CD1A 2NVBA 5DLQC 5MDHA 1E7SA 2FCAA 3AVQA 3PNQA 4NV0A 2JH8A 5CIYA 1V71A 2BFNA 1OWPA 1WMAA 3KYJB 4JC8A 4HCJA 1EFUA 1EG2A 3BVPA 3O03A 4NQZA 4UE2A 4I81A 2I6GA 4ENPA 4QGSA 5A62A 2I55A 5ADWA 2PCJA 1ITZA 3WLEA 5FAXA 4YTEA 2ZWMA 4OCZA 2C7PA 3A32A 3NRBA 4FGWA 1Z26A 3OOWA 2F3PA 2I4OA 1B42A 2H7VA 2VSNA 5BT8A 5K6AC 2E4XA 1OZGA 3RIHA 3W6OA 4G5QA 4TXHA 2I62A 3G88A 4MVWA 1ESMA 1OLSA 5KREA 4IO1A 1W4CA 1ZLYA 2RH8A 5DBEX 5SYAA 1HLFA 1DQYA 2ODAA 3PGVA 4P93A 3IKJA 1A5SB 3CCCA 2WUGA 4MSUA 1J70A 2CXXA 4KK3A 5C7YA 3DW3X 1AM4D 1R64A 5LBIA 3KUXA 2ZXFA 5G0WA 4QUAA 3ZQ6A 2AN9A 2H1WA 1UXKA 2PSEA 4BO4A 4DT1A 3ED5A 2C1ZA 4R9VA 4J0DA 4KX5A 1EIZA 3RLFA 2BFDA 4OHXA 2NNWB 4Y0AA 4IQ8A 3SDBA 1D5CA 1E2IA 3G5MA 4DDHA 1DC3A 2F4NA 4Z7OB 4D26A 2PWBA 2IU3A 4TKLA 1BNCA 4XASA 4D4KA 1VKZA 3ZWOA 3GDGA 2GKOA 4JUIA 4E2XA 5EIAA 4EJSC 3TF5A 4P4SB 3LWZA 1C9EA 2R9VA 1GYPA 2P9EA 4A15A 1Q57A 3GPCA 1Y9ZA 3B1ZA 3LC7O 2HA4A 1XA3A 1I9GA 1SU8A 3AERB 5A9TA 3E8XA 4EM6A 2O0KA 3H97A 5TMBA 1W48A 3IKLA 2GJ4A 4REQA 3AV0B 4AKTA 5B55A 1G55A 1QONA 5AJYA 2FPIB 3QTTA 5GVRA 5L3RA 1EJBA 2RBGA 4BFLA 5HF8A 4O2AA 2JGEA 1MAAA 2C96A 2YZGA 4E4YA 3EDMA 4BQIA 3NWPA 3KV3O 3P7MA 4IX1A 4TRNA 1DPGA 3COSA 6NULA 5JQGA 1LC3A 1M83A 2O2SA 4N41A 2A5FA 4OYYA 3V9AA 2NMVA 1P1HA 1D1SA 3H1AA 4GEGA 1EVLA 4GZMA 2VDUE 1L1RA 1U8ZA 4Z7QB 4KQHA 3W8RA 4KBFA 1Y6RA 1Y1KE 3OIUA 4HLQB 5C31A 1Y1PA 4MGYR 3O3MB 4N3AA 2Y76A 2ZEJA 4XB6B 2OBBA 4DQXA 1RC1A 1SK8A 3DZBA 5LXTA 5ICCA 3RJ9A 1R4NB 4OLFA 4TTIA 3ZOKA 1UK8A 4WKPA 1S4QA 5L3QB 4RMIA 1JB9A 4JT8A 1W85B 5EPEA 4FGZA 3HCAA 1WDTA 1C3JA 3R3YA 1M72A 4POOA 2O59A 1VYVA 1DRUA 2QD4A 3WRVA 5GOTA 2D1RA 1RXVA 1SEPA 3E5NA 3VSDA 1KDOA 1X7DA 5KHOC 1N1GA 4HNVA 2BH2A 3IBFA 3GMIA 2OYCA 4BO9A 2GNOA 1ZKMA 4YBRA 5JHHB 2IUFA 3SZ3A 2CLKB 2A1IA 2XE8A 3HCRA 4AY4A 5FP0A 1V6AA 5I48A 3ZD6A 3WMRA 5IULC 5D87A 1VKHA 1H0HA 3OT1B 1EUCA 1Y1LA 1TIPA 2AD1A 2HQSA 3K4HA 1KP2A 3LA6A 3NBZC 1FFGA 1BS2A 1YHNA 1ULTA 1L7DA 4LC0A 3UXYA 1YB4A 1R3DA 2VHTA 4DR5B 2WG0A 3E9ZA 4G4SP 4PHHA 1PS0A 1VKNA 3P2KA 4HDOB 5LZ5A 4GM4A 3AXSA 4UDYX 1VPVA 3VDMA 3MXOA 5GGYA 4IUDS 2FW7A 4TS4A 5IXYA 3VTKA 5KCZA 1U28C 2OP1A 4ML3A 3ONWA 4L15A 4RHUA 3REFA 3OJOA 4XDHA 4LMAA 1NMSA 3IEIA 4X66B 1NVDA 2MYUA 4H7HA 4X62B 2H2WA 3C5WP 2K6GA 4HAYA 3DLCA 5DK4A 3C5CA 5DRYA 3U4GA 3C3PA 1ZINA 2VPIA 3LUJA 4IJVA 4NZMA 4Y1EA 3IUPA 3SBOA 1FYDA 3DAOA 3WFIA 2HTFA 1Q17A 5JTUA 4K46A 4DJFC 1I1HA 1V41E 2ZPUA 3K0HA 2QM0A 2AL7A 1V37A 4DUPA 5H02A 1CFJA 1JIVA 1RHUA 3JQEA 4A5SA 1TMGE 1W8IA 2QM8A 3NTQA 5IARA 1FXUA 1L0BA 1UFQA 2GCNA 3C6MA 4OXIA 4TLMB 3TJMA 4DDUA 2I29A 1ZKDA 5HHTA 4U2EA 5DHSA 2OXTA 1H1LB 4CIDA 2EERA 1JA0A 1I4TD 2X42A 2Q7OE 3SX4A 4P5DA 1BMDA 2VWQA 3BGVA 1W36D 5K3OA 2C7VA 4BNNA 1PWHA 1GFZA 2R1VB 3ZU6A 1UP4A 1LS1A 1U1GA 1GLNA 2F8MA 4N9WA 3BM5A 3OE7D 2MT9A 5EL0A 3KPYA 4Q1VA 2DBQA 1M0WA 3H5TA 5F5LA 2G1KA 4RK7A 4BX2A 2VJYA 4F7DA 1AHPA 3GRVA 4XSVA 3GW8A 4RVSA 1TAGA 2D1YA 2Q8QA 1WEKA 2QTHA 2NAPA 4PZCA 4N3BA 4EPWA 3PNYA 2XQJA 4ZHSA 1E3WB 4ZAVA 3T5TA 4PQEA 4UVDA 3GO4A 2VTBB 2FUKA 5EHIA 3TBHA 1ECJA 4PLWA 4TPKA 3Q98A 4KPYA 3AR5A 5TMDA 4HF7A 4RPLA 1GA6A 3K1JA 4Z0PA 5A9RA 4EY6A 2IZ6A 2WJHA 5J2TA 2PL3A 1IBSA 3D8HA 3GJ8A 3RVSA 2A67A 2PGNA 5GGXA 4RK4A 3KWLA 4LWQA 1JRLA 1LVGA 3KLBA 3FFWA 3SG0A 4LKOA 3R7SA 1JEQB 1D2NA 1GG2A 4EIWA 5LN1A 4WOCA 4XAQA 3AXTA 4PS0A 1H2BA 2ZIEA 3TXXA 4O1HA 1UDCA 1Y9JA 4YP0A 5IMBA 2ZITA 3DKKA 4G4IA 4GP7A 3RVJA 3ZY2A 3NBUA 1VMIA 1Y3FE 2EWVA 1QU3A 1BMFA 4U5QA 3GH1A 1CK4A 2VSXA 3AI2A 1R2QA 1P2TA 1YNSA 1CJSA 2PLWA 2Q5FA 2CHUA 2B34A 2QD5A 2FXIA 4Q48A 3SZLA 3H1FA 4O3MA 1TEVA 3W3AD 1MIHA 1UBUS 1Q1BA 3T7AA 1QS0A 4EL5A 2AZMA 5AKKA 5ARBA 2CZQA 4DS3A 5AI5A 3DMTA 2HWYA 1KS2A 2XF8A 1RW4A 1P2DA 3AFMA 3CG0A 3BMXA 4I36A 4E51A 1IHDA 3PDJA 4P3XA 4YJHB 1CY8A 1C2YA 3TLZA 1PSZA 3PFGA 4XD7D 3VU9B 3H2JA 3P1JA 1PWZA 2YWGA 4W9NA 4RTOA 2Y6VA 4D4GA 3RAJA 1DO8A 2IXGA 4RGBA 2B2XA 3LUCA 1C9KA 2I3DA 1P7YA 2PGXA 2I2CA 4P5PA 2RGYA 3HM2A 4FHFA 4R1UA 3VR0A 4DL9A 2X0KA 3FDIA 1X2BA 5CYPA 1N92A 1TO6A 4TKVA 5IFLA 1KIMA 1YGPA 3VUFA 2NSDA 3O2QB 3OCCA 4XLLA 3T52A 3P20A 1BU5A 2A33A 2FRDC 1DX4A 4DEVA 4I1RA 4P33A 4DCCA 3K0CA 3ZY5A 2G67A 1FUIA 1XJ5A 2VPYA 2XVAA 3K70C 1JWBB 3KDAA 2AVDA 1OIXA 2DCMA 4YUVA 2PVPA 3RTBA 5FUQA 4WW0A 4IJMA 2C9CA 4K6HA 4OTZA 3BXZA 3THSA 1NW8A 2IDJA 4JUBA 4KJZA 4KODA 4REOA 5LVAA 5HTOA 1IBMB 3LX8A 1V1MA 3KVYA 1FXWF 1CE8A 3B7GA 4BB0A 3NBKA 4J7AA 1XAIA 5G0TA 1GSOA 1N2HA 5SICE 1Y9EA 1E8NA 2NZVG 5TT1A 1GXSA 2HJRA 1L2TA 1Z17A 5WRFA 2O1SA 2YTZA 3GG9A 8MHTA 1MX9A 3I2HA 2G4LA 4I1OA 2ZWAA 2VDMB 3VTFA 1HL3A 1JF8A 2NZ2A 4NABA 2JZCA 3DZCA 2Y27A 1T34A 3GI1A 3UJPA 2WU3A 4GOXA 4RV5A 1MV8A 5AT1A 4CODB 1X8KA 4BXOB 8GPBA 3F5MA 3TCKA 1ZJZA 3KL2A 1T25A 3FLBA 3H2SA 1Q0PA 1Q1AA 3LPLA 1ZMOA 4C4XA 4IIVA 1JHPA 3MWLA 2RJ3A 4OAOA 1EMDA 1C30B 1JPNA 3KTAA 4PLPA 1FOEB 4I4CA 1MP0A 4RABA 4YMVA 3L1KA 4I9GA 1FYXA 3COZA 2NZYA 4K7JA 2WQZA 5LMCA 4PGGA 3AFNA 4R1TA 3UV3A 2IPAB 3IQGX 4QNMA 5AD1A 1E20A 3Q40A 2Q62A 1XXHB 4U2GA 2OCKA 2PMBA 1LI4A 4LKRA 4ENQA 1TIBA 5HWSA 4DR1B 5JJLA 1NTOA 4OMDA 2CNWD 121PA 5FOSA 3B1WA 3HNPA 1VHQA 4KMOA 4N76A 3SF8B 4IKOA 4M83A 4KC0A 4DB2A 2DBYA 3L7IA 4D3YA 1CERA 2X3YA 5H8WA 1KPGA 1GUYA 1Z22A 1XTUA 4ZKEA 3WGOA 3IILA 4Z2AA 1AV6A 4MV8A 2N47A 1VPTA 3T5BA 3M0EA 2IDZA 4FD3A 5FNVB 3WX0A 2A92A 3GLGB 3KK0A 4LF6B 1P39A 1QX4A 1J8VA 3MMXA 4PBTA 2IPXA 4KJXA 1YZGA 3U7HB 1CUVA 2GVDC 5HKKD 3QBDA 1XKTA 4FM9A 3A25A 3ITDA 4JYMA 1I3LA 2JFGA 3D6AA 3WZLA 2CVPA 2WW8A 3WWOA 4MRMA 2Q7DA 1D2HA 2G82A 1XRRA 2PJRA 1QOPB 4FKBA 3BJMA 5BT9A 4LBZA 2BEWB 1V5IA 3MSCA 3LCUA 1G3RA 1D4ZA 2WP8J 4QUBA 3GIDA 1XU7A 2PGDA 1MO4A 3EIFA 4B34A 1Q16A 3HCNA 3T4XA 3TAUA 4KCGA 1HE2A 4QULA 3DKIA 3NM5A 1PLJA 2X0DA 1U2PA 3VR3A 2IIVA 1DTWB 1PFQA 1Y3HA 3EPRA 5ER6A 2ZIXB 1CKEA 2MSDB 3GAMA 4L9RA 1DBSA 2ATVA 1M6VB 1QPBA 2YXPX 4YT4A 4MGKR 1OE0A 1FW8A 3ZXYA 4UBLA 4MUBA 4MI1A 3HSSA 2YYSA 3TQSA 1BMQA 3FNEA 2P77A 2QVLA 4OI2A 1LDBA 1HORA 2BR5A 1G8YA 2C4VA 2X6QA 3G68A 3PEUA 4LJLA 4ZQFA 3VU8A 4O08A 1QO7A 3KZMA 3LCCA 3Q8XB 3ZV6A 2NP6A 3KD2A 2GASA 3N9IA 4NF2A 3VR6H 2G25A 2P3OA 1BE6A 3LLVA 4B8ZA 3CO0S 4DC1A 421PA 5AW5A 2EZ8A 5UKDA 1PEAA 4LF8B 1S7GA 2OXIA 1GZ7A 1JVBA 2W43A 3KPJA 4R5MA 3FIUA 4U2DA 3VC3A 5EKXA 4ZOAA 1HQDA 3EEFA 3IKMB 2ZVPX 4Q4DA 3DXZA 4NOMA 3X44A 4Q9KA 3KOZA 2IIQA 3K9HA 1T1JA 1Z74A 4PZAA 4PSUA 3TDMA 5CDYA 4W5NA 3TW6A 1X8JA 4DNQA 3ETJA 3G7SA 1WMSA 4QDUA 5G1OA 2REXB 2XNHA 2VL7A 4BKRA 4EUSA 2LE0A 4RANA 4HQKA 1LRJA 3IDAA 2R44A 2C00A 2PU7A 2PS0A 3T7EA 2FQQA 4KR7A 5I3CA 3T5PA 2HV8A 5HXAA 4HDNB 3NOXA 3ULKA 1Z5OA 2GK4A 3CR7A 1SOWA 1G66A 1G2PA 2JARA 3C7TA 1NUQA 3I6QA 2I6FA 1SQFA 2LGJA 2F1JA 2HXGA 3ENKA 2QM7A 3KIPA 2ENWA 1D2MA 3DVLA 2WIBA 4KYVA 4NARA 3V4RA 2V03A 4ZI3A 1RC0A 2XKKA 1NJSA 1JHOA 2W2KB 2P6RA 2R5WA 1TJ4A 3I37X 3QH4A 3V2IA 1E7MA 2E5LB 1SQSA 2DQYA 1SVOA 3L5OA 1CY7A 4IQ0A 2ICAA 2GJAA 1RYYA 3AF2A 4MVJI 5I4BA 5ENDA 5M5BA 2ZYWX 3KD3A 4RS3A 2R8ZA 4RC9A 2IYZA 3ONFA 3H05A 4B0PA 5CJ2A 3WDMA 4XYMA 2JA2A 1I80A 1PNTA 2KMLA 3S0JA 3QKRA 4XLTA 3G82C 3PNPA 4D9GA 4RK5A 1HF3A 1Y82A 2KS6A 2ZB4A 4RTNA 5JE8A 3GLFB 1HV8A 5B7NA 1CP2A 3C3YA 3WYDA 2ZTSA 2BGRA 1M34E 1XDWA 1T3TA 2ZBQA 2NQ2C 4MIKA 4N8EA 3TGWA 3ZHZA 3T9AA 4BAZA 1QE0A 2XXAB 2JLZA 3NT2A 1SVUA 1U1FA 1VMAA 1TZJA 4Q93A 3RNLA 3TWOA 1T2EA 3FYUA 4FX2A 4Y98A 4DBZA 1KYYA 3PT5A 4WL0A 4DLLA 4YXWD 1R8JA 5E9QA 4A8JA 5KYWB 2QI9F 1RWVA 3U1BA 2MR6A 5KVSA 1SVKA 1USWA 1NN0A 5HSGA 2W2OA 1J2EA 3AW9A 5LA6F 4KPFC 3KQTA 2H5JA 1XEWY 2XA9A 4IV0A 2KLBA 1G21A 4LMBA 1CD5A 4DPLA 4KIFA 4HZUB 4GT1A 2ZBUA 2X1HA 4G2TA 2EOAA 1E1QD 2X3UA 4JLVA 4DR3B 3G9TA 5JAOA 4TYNA 1XPOA 4EY8A 3FKJA 3OZSA 1C1HA 4QJIA 3GT0A 1QIEA 4LK2A 4F1WA 5JIBA 1F2UB 1VDMA 1OX5A 1CJVC 2MINA 2ZVQX 3DWIA 4X20A 3MWDB 1J2JA 1JQBA 3V42A 4Z8YA 2X13A 4FGJA 2DUJA 4RWEA 3UOAB 1XB2A 3T1OA 1I2MA 3HJBA 4ACBA 4JEUA 3PQDA 3K35A 3NIBA 1FP2A 1ZNWA 4RY8A 3S1AA 1F8UA 4FYPA 5ICSA 1IPEA 5EEHA 3GUCA 5SZKB 1B0PA 5BRNA 3AESA 4UPEA 4I1VA 3ESZA 3CN7A 2V54A 4ARZA 3V00A 4TM7A 2F1HA 3LGAA 1XZGA 2Y4NA 1ZHFA 3HLYA 3EVNA 3Q1LA 4CU2A 3KQUA 2C07A 4R1PA 4Q47A 5HF6A 4IHAA 3WMGA 2FPGA 2HWKA 2XW6A 5ICFA 1Q50A 1NYQA 4CMBA 1HKHA 4KSBA 4RTJA 2NT3A 2CK3D 3AVPA 2I7VA 3QTBA 1I8TA 2H0RA 2HFKA 1KEUA 1LZLA 2IEAA 2Q45A 4QHYA 5AW0A 1U0HC 2XHZA 3OQHA 4HYTA 4F9TA 2GTHA 5IN4A 3SMVA 3TYXA 3CIOA 3D4BA 1EBFA 3GUVA 1XRPA 3NHMA 1BKYA 1TYAE 3QF7A 3GGSA 4ZZ0A 1MIOB 1U8XX 1XKXA 3H04A 1B0AA 4PR3A 4XRRA 2WTAA 4D9MA 4H31A 1B7GO 2OV4A 4XM0A 3TOSA 3U3KA 1WD7A 1OU0A 5EHZA 3LXRA 4FYYA 3NHUA 3N2KA 3WICA 1SHZA 1FRFS 1IG3A 1XPJA 3KTFA 3W9YA 3ZHXA 3RK1A 5L53A 1DL5A 3D6UA 2IZ0A 2HA2A 2BMJA 1YWGO 2GM4A 1YZLA 4FEAA 1GYRA 2X40A 5GVSA 1QAQA 3GELA 2HY7A 3IVMA 4JP3A 5T4FA 5M04A 2YH2A 2CFOA 2WA2A 3C5EA 3RAEC 2WWFA 3JR7A 4A36A 2HU8A 4BDTA 3FBGA 3U3OA 3TPFA 3L0OA 1FYWA 1LZKA 4LS3A 1WXEA 4U00A 1GL7A 3PSHA 1LA2A 1TT5A 3OAAD 4RFSA 3UMMA 2IHVA 3CLUC 3T3EA 2BUBA 3JD1A 2BMWA 5LZ4A 4BFTA 1Y6JA 2GZ3A 1RE1A 2YFQA 2ID7A 4M0PA 3KVVA 3AETA 3GEDA 1BGVA 4ECAA 1E6LA 3BYZA 3UUFA 1LBTA 4HGPA 2LW7A 2FNAA 1R5NA 4CRWB 2ZZMA 1DOZA 3EGXB 3WHPA 5D85A 2ZJBA 4RQTA 3WG9A 2I2DA 5FTKA 2BUAA 1W59A 1WDLA 3A8TA 1UC4B 1LLQA 3AUSA 5ITWA 4DLNA 4ZCPA 3L6DA 3JQ7B 4GICA 5EWLA 3IB6A 1P5ZB 2GRUA 2GVZC 3CE9A 3OQ6A 5CMLA 5AHRA 2OCPA 4WEQA 4EGFA 4UNQA 4BU0A 4FC7A 5CDFE 3T3NA 1FU4A 4JJIA 3W5JA 3S2UA 4CDNA 4KNWA 2GCOA 3OECA 2XD4A 3ZHCA 1NW3A 5B1IA 4LZWA 1FFAA 1E2FA 2VWHA 2WJVA 3KU1A 3ZJYA 1PZHA 1F8FA 3T06B 5FUMA 1N7JA 3ELYA 3NVKI 2VJOA 3UTDA 1LK5A 2QRNA 4PO3X 1QVWA 1U1CA 3AEYA 4MKXA 1X70A 3QELB 5BNTA 4Q02A 3MUFA 4J8PA 3MCUA 2G08A 2XOKA 2V0CA 3JAKA 1Z0KA 2IE8A 2EGUA 3D02A 4KQJA 4LZOA 4PTYA 3K31A 3RODA 4NJOA 3SIXA 3UM9A 3ZYCA 2F4VB 1NLMA 3EQ8A 2EKZA 4LMPA 3FOZA 2B92A 5D6NA 2PY6A 5JJIA 4K9PA 4YIKA 4YMHA 3M4JA 1VSQA 3OE5A 3L7MA 3V32A 4NXNB 2WKRA 1MG5A 3B6JA 1CZKA 1Y8QB 5IC4A 4N3GA 2FFAA 3VJLA 4KO1S 1UJ6A 2PBZA 2ACWA 1N6IA 3KEQA 5D00A 1W5TA 3MLEA 4YYEA 3VOTA 2BBOA 3ZYZA 3MWFA 2J85A 2H4WA 1KFKB 1GZ5A 1Q7RA 2AJ8A 2H92A 2R7AA 4LYHA 4HLUA 4MDYA 4ZVPA 2J1LA 1JQAA 4KKXB 4DCTA 1KRHA 1X7ZB 2FAXA 4FDTA 1PFKA 2PFKA 5FTLA 2G70A 1PQ4A 5HS4A 4S0XA 3I09A 4CDRA 2II6A 4EYEA 1ZD5A 1I7NA 2JA1A 4C7VA 1YB7A 1H2HA 1H1TA 3QF4A 3WNVA 5KTNA 4C30A 3DHEA 4BFWA 2XAAA 1PGJA 3C3WA 2ST1A 3WQRA 2IUYA 3IP8A 3S70A 1Q77A 2CFTA 2VOEA 1Y8CA 2B20A 3PUZA 4RNDB 5TE9A 2VHEA 4CLOB 3B5EA 1QH0A 1GGFA 1RHRA 1L8AA 3TL2A 3UUWA 4QPNA 5CB6A 5EJFA 1BYUA 4K9OA 2F43A 3LBIA 4KV9A 3VR4H 1AKYA 2FR1A 4JK3A 3I8OA 5ETJA 1GPUA 4KO4S 2Z5GA 3ZLUA 2BKAA 3I9OA 4BL5A 3SC2A 3DAHA 3SYNA 5JASA 2XYVA 3BFJA 3ET4A 3FCOA 3NJRA 4V0NA 1P7WA 4EMSA 4K0KB 4AQDA 1I5EA 1LNQA 2R68A 2Q3HA 3DZGA 4QASA 4WNAA 2O14A 4EG1A 5F2KA 3KJIA 1UPFA 5H59A 1PTJA 1SD1A 2Z2ZA 3CKMA 3ELWA 3WB2A 3AY3A 3DOUA 2Z5LA 1VOTA 4MITA 2RMKA 2CF6A 4HTFB 5IYZA 1X39A 2Z83A 3OH8A 4DYDA 4F9GA 1JZSA 5FWDA 4XCQA 2GNAA 1GTZA 4ALLA 2P5TB 6REQA 1XWFA 4AG5A 5DIZA 1SAYA 1SD2A 1ECCA 5BW4A 3ESBA 2B78A 5LLDA 4LGCA 5MN4A 1NXWA 3HO1A 1SVSA 1KI6A 2COUA 1IHUA 4UJ5A 3ZIDA 4LV6A 1KI9A 4ZFNA 2O0MA 5EJ4A 4CMKA 3M6XA 4NV1A 3EPHA 4HGYA 2JGNA 4YRTA 1CY1A 5IABA 4ZEVA 1YKSA 3C4JA 5JWHA 3A9RA 5FQNA 1CF4A 2YXEA 1C81A 4PSDA 4XGNA 4BNHA 4CKCA 4ZI5A 3AUFA 3K0FB 3D54D 4N0QA 5K0ZA 2CLDX 2FDCA 3W34A 4RVUA 3K9LA 3I9JA 2OVFA 4N7MA 3KEOA 3RRNA 2QW0X 2OORA 5LOVA 2ORVA 2Q28A 4UBIA 2NM0A 1EUZA 1P2SA 1YDMA 5LBUA 1VFPA 4B48A 2G9QA 4KWTA 3WLMA 4DLKA 5IJ9B 5JQWA 3RIYA 1O0SA 1XVUA 2IQ5A 3I9FA 2FMIA 2QJTA 1U9JA 5JO9A 3NV7A 5CFMA 3B82A 2C2BA 1B15A 1C0LA 1NSFA 3AU9A 3GG2A 3E9EA 3ILYA 3QEKA 4LN1A 4M8KA 5FOTA 1E5DA 3H9GA 4LXIA 4UZFA 4PO8A 3GLHE 1G3IA 3WYGA 3QFFA 4WZZA 1Y1QA 5B30A 4RF5A 2W4QA 3T0IA 1F8XA 5H80A 3BJEA 5J1TB 1XCOA 1BMFD 2NUTB 1R0YA 4LY6A 5IUNC 4Q1BA 5EFZA 1CV2A 4PC6A 3VOBA 4Z3KA 4WOJA 3W5AA 1RABA 4RPJA 3CWZA 1ZQ9A 4Q7EA 3TNLA 5EJEA 3G5TA 4DM4A 3GGGA 2WM9B 4E12A 4KOAA 2BM8A 3W77A 1NXQA 3DTYA 3QOWA 1TADA 2ZANA 1ECPA 4LIPD 4MUJA 4K9LA 4MPDA 4FXOA 4MINA 2BZGA 4HQLA 4XGRA 5FI3A 1SVMA 1BKDR 5EI5A 1L7EA 2M6SA 3TFWA 1BJRE 1KP9A 5CBPA 1NOJA 1DKMA 1GTG1 3OCWA 1P7VA 2WJAA 3DWGA 1QBKC 2CD7A 4URVR 2Q3LA 1IWOA 4RLFA 2QN3A 4LDNA 4NOKA 3PKJA 5LMUB 1CX9B 4QOSA 2H0AA 5BNZA 2BV3A 4I3GA 1PR0A 4PY2A 1E2HA 1THTA 3FF1A 3FGZA 4D4MA 1CETA 4RZUA 3RASA 3EZ2A 1MMFB 1HM5A 1SUBA 2E89A 4UNIA 4NBNA 3H1BA 4FTWA 5BMVF 1J2YA 2B2NA 2HSWA 2OB1A 3EIXA 4Q6BA 4QATA 1T0JB 1G20E 4DWVA 2AMYA 2NN3C 2BFCA 1CHNA 2PJZA 3ESXA 3ZDAA 4R68A 2O4UX 5KNCH 3PQ8A 4KI0A 3ZEIA 1WKBA 3NWBA 4B6GA 2NV2B 2XUPA 1KEWA 3GOHA 4B3DA 2VQ6A 3H84A 2BN4A 1L8LA 1VG8A 1SU6A 1DUSA 1MCZA 1OHHA 1WKVA 2BELA 3FNGA 4JBGA 3D8BA 4ZRMA 4JJ8A 4A26A 4DV4B 4HQOA 1WXDA 2V5AA 4QPCA 4JI4B 1VPLA 2XE6A 3SQOA 5T4EA 4RVCA 4IG9A 5L3VA 2X2FA 1B2LA 3W7BA 3R8CA 1DADA 1U0GA 5HNKA 2BGGA 3TBKA 4EFDA 5AI0A 1HE1C 2PPLA 1HDIA 3OZTA 1JP7A 5J4KA 4WZAE 1SBHA 5A4AA 1OAKA 4P6VF 1XD8A 1MX1A 3DAGA 3ME5A 4Y2PA 1C3LA 2CVQA 4OXRA 3VNAA 4MGEA 3A70A 4WUVA 1GZDA 3FUTA 1XZCA 2DQZA 3PENA 4WPGA 1DWPA 4F5WA 1JPVA 2OMEA 2LIVA 2P2CA 2IC5A 4G0ZA 4M7RA 2IV3A 3RHTA 4TLLB 1U11A 2IU4A 2LPMA 2P6NA 2WF7A 3OO0A 2AFVA 4DR2B 3TTXA 2E4VA 4KACA 4FZRA 2ZB3A 1L5RA 3MLAA 4YA6A 5FYDA 2APJA 4C0JA 3Q3HA 2OWDA 4WXEA 3GYBA 4A23A 3HY4A 2P30A 1BS9A 4TT8A 5JARA 3QVKA 3IERA 4TS9A 3T1QA 1H3NA 4FIDA 1BW9B 3FBTA 4B3HA 4V3CA 3HN7A 4XKJA 1W96A 4MPJA 3ZH9B 4KXVA 1G4UR 3INGA 4NCHA 5T7BA 4QKQA 5MN6A 3LW7A 3RKSA 1Y81A 1BCRB 3HB7A 3O8LA 3QXHA 4B0OA 3LZDA 4ESVA 3T5MA 3B7WA 4MMZB 3SYMA 1R12A 3MS4A 1YB5A 2J0SA 4II3A 1V4BA 4ZYUA 2PR2A 1QYXA 1NUSA 3QVGB 5TPZA 4X6LA 2O5VA 3I3OA 2HZ7A 3CRNA 3BXOA 2JVKA 4FLMA 4ITVA 1NE7A 2QW8A 3VO2A 3ZGXA 5A3RA 1H2WA 3N1UA 4UBNA 2R11A 3G2IA 3NV9A 3V33A 4ZCRA 1WIWA 3NVAA 2V96A 1X8LA 3LZ6A 1O5IA 5LJIA 4A0HA 2R7KA 3GJ0A 1C7ZA 3NIFB 1ILEA 2IHTA 1H5UA 5I3ZA 3DHNA 4BVAA 4BEWA 2CFCA 4IVPA 5JSUA 2BBTA 2AXQA 2X6RA 2Z2XA 4G67A 1BXRA 3TO5A 5JD5A 5K8IA 4AY6A 4MUNA 1DXQA 4RZIA 3REGA 3N74A 2Y93A 1DKNA 3VUEA 1VIYA 3L0SA 5C8YA 2E1RA 1CF2O 4JZKA 3L6BA 2PRIA 2I2WA 1CUFA 1VPEA 2JASA 4FVTA 4F3RA 4EUHA 5BV0A 2WAOA 4HLNA 1ULZA 2EJTA 3UK7A 1R6BX 3FNFA 3VR3D 1BRMA 1SIBE 4BQFA 1NJ2A 2VUUA 1LX6A 1BMTA 1TPZA 1TM3E 2PXXA 4J0JA 4BZPA 5JISA 1PO7A 3ZDRA 4JSRA 4D0LB 1BVHA 1FTSA 1DTEA 1H5NA 2H9YA 4OOEA 2FR8A 1U2GC 1HR0B 3DE7X 3DNPA 1E0AA 3FLEA 2GYUA 4IS3A 1WG8A 3S6JA 4FEGA 5A02A 1DKOA 2YHBA 2HIMA 2GXAA 4L3WA 3UMFA 2Q2VA 2R4QA 1XVLA 4GR5A 4RK0A 3D0RA 1O6CA 1HG0A 5F1OA 2GSDA 1BJKA 3EUEA 3MNFA 5JYDA 2Q1SA 3SJBA 4KSYA 6CHYA 1A2QA 1SVWA 2YC4C 4QGGA 3E9QA 1JHYA 2Z8YM 1LW7A 3B8EA 4HG2A 4O8CA 4NH0A 5JD4A 1GFWA 4I1PA 1VJDA 3RT7A 1R6VA 4MB6A 5K8JB 3DHWC 2VDPB 4DLUA 5EZQA 3K4QA 4OA8A 1H4TA 5F64A 2RGUA 5TSDA 1DVRA 5T8KA 5C5IA 3MA0A 1RMTA 1T26A 3IBTA 2B1JA 2C9MA 4JEMA 3L40A 2QF7A 4DCPA 4ER0A 5TY0A 3V80A 4IZHA 1L8QA 2UZ1A 3OZIA 4J6EA 5EXEA 1TEHA 2VP9A 5KOIA 4XUCA 5DKFA 4OJKA 1VRCA 2IXEA 4G1EB 2OKGA 4RM2A 1LTQA 4NYMQ 1SJ9A 2RD2A 1R9MA 3EWSA 2YX1A 3ZDBA 3VKWA 3EUFA 3ZK8A 1CDOA 1SXJE 4RTSA 5CFZA 4AY3A 2ZRIA 4OHBA 4NECA 3R7LA 5IH3A 2Q8NA 3SQWA 1C4WA 3OX3A 4MKGA 1S4MA 3DE5X 3JWJA 4LXTA 3ZTWA 1P33A 3WL6A 4Z7NB 3G02A 4EPTA 3IKTA 2PKQP 1QE3A 1EWYA 1S89A 3SZMA 5IDQA 4JA2A 3H2IA 3VPFA 1BEZA 3H0EA 3IO5A 1Y3AA 4WASA 4J1TA 1P80A 4FCCA 4HR7A 5CCDA 2JFQA 2FPLA 2C3UA 4M9QA 1AKQA 1C2TA 1ZNYA 5AUPB 2J59A 1NNLA 4O2BF 4YRJA 3WSVA 2N9UA 1CNFA 3IRUA 3QE3A 4G5HA 4HH1A 2I54A 4EJ6A 4MP6A 1W36C 3EA4A 3RC9A 4RZHA 1ML3A 4RHTA 5HK8A 1NBWB 1WSDA 2HJSA 3D6FA 3LKVA 4JA0A 3WFZA 3ZIUA 3NQ41 3OZEA 2Z58A 3ROKA 1JFFB 1RQPA 4ZQCB 3ROQA 3YASA 5BO5A 4N1AA 1IJKA 3G2OA 2CLOB 2VR1A 1T36A 2IYPA 5BW6B 4DGSA 4N0PA 3IVCA 2WFMA 1J07A 5AKJA 1JXQA 1AGPA 4GHWA 4MUFA 6Q21A 1E3TA 2XD9A 4Y0NA 4W1RA 5D6OA 2P1RA 5IM5A 3TAXA 1NVEA 2NO9A 1QVZA 3U4MA 3PFIA 4HWGA 4ZT4A 4KNVA 2PSDA 3OC0A 4UHFA 3VMFA 4B6RA 2V9CA 3TTSA 1UH5A 4DUGA 1U2ZA 4CTNA 3RUFA 3RABA 4DG8A 3WHKA 3VV3A 2CUNA 1L4NA 4MVJA 3OZFA 3UUEA 4AFNA 4ND6A 1XALA 4P4GA 2Q21A 4TVKA 1HRKA 5JLAA 4K88A 3TX6A 2HYDA 1XHEA 2O2EA 3FKSA 1PYDA 3WV5A 2JLXA 3N5CA 2C9BA 1IHPA 3PUJA 4AN4A 3DDCA 2O3QA 3IYLW 1D0VA 5AKIA 3U7QB 5C7LO 1IPHA 1JG2A 1H4VB 1CUEA 1JU9A 3P45A 3PKZA 2GILA 3DBIA 5CNKA 2VPPA 5D2CA 4LPSA 4C7OB 2XX3A 1DHTA 2RKOA 4V02A 2INGX 3LTEA 1VBMA 1T4GA 4H4CA 4GZ5A 3ZCUA 2AOXA 1ST3A 4ROSA 4YX9A 4OBEA 4DPKA 5LIRA 4QC2A 3NTXA 5EXXA 2FCRA 2GEFA 2D0OB 5C46F 1ZMTA 3CB2A 2JCSA 1U7OA 2OWEA 3E3OA 2XOXA 2BE9A 3NDJA 4LXXA 4Q1AA 4RGQA 4RPIA 2BJWA 5EXTA 4N0MA 4POAA 4D9KA 1QHHB 3HVHA 3TJRA 3PDHA 1H69A 3BILA 1GSHA 5EJIA 4UU7A 2JCXA 4F71A 4W5QA 1E1KA 2BTQA 1Q0SA 2AI1A 2CVFA 1UT6A 1T9KA 4OQYA 3WMEA 2R8OA 2Z4SA 4U3JB 5TQVA 5J5CA 1X3SA 2QYTA 2FPOA 2ZETA 4HAOA 5JU6A 2I6XA 5E1DA 3DHVA 5D3MB 3W79A 3AHIA 4MDFA 4K9NA 2HF9A 4AQYB 1XCJA 4PPYA 4B87A 2VAVA 3GEBA 3RS3A 4DIDA 2JKYA 1O2DA 3EXHA 1R3UA 1ECFA 3L1HA 1UMKA 4W4TA 3T7IA 4LQLA 1H93A 1T5BA 2NUPB 3HZOA 4LWPA 4ZK2A 2CKMA 4G4JA 1MJHA 4C0WA 4QYTA 1QQBA 1XZPA 3QYAA 2ZAIA 5GP1A 2V0GA 4A8TA 1U3WA 1FTQA 4CCAA 2QR3A 2FQWA 5CHYA 1RQNA 5DOVA 3T1NA 3WL4A 3PLNA 3C7CB 2PQ0A 2V97A 1BN6A 2HB6A 1GY8A 4FNOA 4UM7A 2PH7A 5FPQA 1GSIA 2P2LA 2VDJA 1C8LA 3N3BC 1H2ZA 3CH7A 2K2QB 3QEJA 1HC7A 5IJAA 3RVOA 4AF7A 3ED1A 3A37A 4HEHA 5I7FA 4DQKA 5AOVA 1AQLA 2PUFA 2YQZA 3A6ZA 3KAKA 4GXQA 2OLKA 2AJDA 4CCYB 4YLYA 2RI1A 2AZTA 1IHOA 3BRCA 4B32A 1JDSA 2A1UA 1IFXA 4P38A 4UTZA 2QQEA 1NKVA 621PA 3KTOA 1G291 3VTZA 4QM7A 4EB6B 4TL9A 1N6OA 3D1JA 3U39A 3ABOB 3UYKA 2FMFA 2QJOA 2OILA 2VATA 4O4LA 2YIJA 3RYTC 4D81A 3UK1A 4D43A 2VEDA 1I4EB 4RZ2A 4HDRB 3GFPA 2BJHA 1QIHA 2VUSA 4TMYA 1OFUX 2MU1A 3ANSA 3NAGA 3ITKA 2ZAGA 4CV2A 3L01A 2PH3A 3NH6A 5K0JA 1JWLA 1MC4A 4D7AA 4TV9F 1FFHA 3IIIA 2OBMA 1TTTA 1NNSA 1LPOA 1RQLA 3T5DA 4BASA 5JNRA 3IVAA 5DTRA 2NT4A 4R8KA 3WTBA 2J08A 5CVTA 2VNIA 2X9NA 4KUEA 4PLZA 4L6IA 5FB3A 1SHTX 5DP1A 5BV8A 3B85A 1PWXA 1WEHA 1IOWA 1U9IC 3DFIA 1DELA 3ZHQA 1E1NA 4Y1GA 1Z2DA 3GPIA 3M83A 1GRNA 3NUGA 3IOBA 4J0IA 2W8BA 4OI4A 5EVCA 1M2WA 2JD0A 2NTVA 2BIFA 2AXEA 3K9FC 2XOKD 5K8CA 4H7IA 4MUEA 3IEXA 5HK9A 2O3TA 4LY3A 4R71A 1KQOA 5H3LA 3T35A 1E3IA 1KNXA 3VO1A 3WLNA 1AHHA 1GZ3A 3EZFA 3OPNA 4XW2A 1S02A 3TKAA 4C4TA 5EJ8A 3JATB 2GPSA 4QHSA 1I3MA 3UK0A 2E5FA 4UUPA 1XCPA 1JQ5A 3RWMB 5BUZA 1YMVA 2JI4A 1CR6A 1QRAA 4X3CA 1VP3A 5E2AA 4KQ2A 4GECA 5AXAA 2FGJA 4ECEA 3D6TB 3CR8A 3VZQA 3ZVLA 2J6IA 5KWEA 5F9FA 3COWA 2AFHE 2FW0A 1YIOA 1Z36A 3AGPA 4YAJA 5DYGA 5HCUA 3TQFA 5EMKA 1SRQA 1T3LA 3F9IA 5C3UA 4WY5A 1WP9A 3CS3A 2WYHA 4AMYA 3C45A 2C88A 4DRYA 4FT2A 4CEHB 4NKRA 1JA9A 1S8AA 1KY2A 1XEXB 2RK6A 1KI8A 1HFWA 2UVPB 3AUKA 3SXJA 3SZGA 2C8JA 2AOTA 1BIFA 4LHYA 3RU7A 2XTZA 3ORHA 3OQIB 1RJEA 1BX3A 3AG5A 4LA4A 4ZV4A 2A9FA 3VH3A 2O8CB 4WKCA 2HK7A 3TLBA 4BRZA 4AMGA 4LSZA 2B4KA 4LF5B 4PW0A 3BXFA 4YFYA 4L75A 3PJDA 4NBVA 5CT5A 1XI2A 2RGNA 3PC6A 4RVFA 4RPGA 4ZO4A 3OWXA 4MQ6A 4RSHA 4B3FX 1F0PA 3PFHA 1M75A 4DRZA 4XGIA 3DVQX 4ZVOA 4EABA 5AK3A 4DMMA 1OGJA 5DM2A 4K5QA 2BGTA 2PL5A 1QYWA 2ZYTX 3EDOA 3I8XA 3K8YA 3KHTA 3OX1A 5ALIA 3RLIA 1BVRA 1FQJA 1EVYA 1MD9A 1ZGZA 3DXXA 3I04M 4JJ7A 4G85A 1AA6A 2Q4EA 2ETXA 3BTVA 1G8JA 1FS4A 1X1AA 2Q3CA 2QT9A 4FCVA 2P1ZA 2RDMA 5KYUA 3SIPA 3BWCA 2JLYA 4DKJA 3CE6A 1Z7BA 5H7XA 3IVXA 4PC3A 1A4IA 4Z1MA 5A4MS 5ALVA 5IK2A 2BI8A 1V4NA 3RF6A 4EG7A 1WB9A 4ZQBA 4LYEA 1TUBA 3IULA 5KSPA 3U81A 2QA5A 1EQUA 3LKZA 4XYEA 2JD2A 4AYTA 5JJKA 4WBXC 4Q00A 4XI9A 3FVQA 2XMZA 2GZRA 3JARB 4AMUA 4OQEA 4IYRA 2VJMA 4JI6B 3FGPA 1NUPA 1SZJG 2XB8A 3GFTA 2JGFA 3PHJA 3R6GA 4PWZA 3QMWA 3RTEA 4LSWA 4HVLA 4WBNA 5JPCA 1P91A 4NATA 1O89A 4ENVA 1YJ8A 4NEHB 5K4GA 1Y4UA 1PUXA 3VVMA 4Y1RB 1UK9A 3L46A 4KN5A 2NPFA 4RKWA 4ENTA 5B3JC 2OBYA 1CUYA 2MSCB 3BH7A 4BN0A 1E9SA 3DDWA 3BXGA 2RGAA 1VQ1A 2HBRA 4BRUA 5EERA 5CH3A 1KKUA 2F64A 1BOFA 2G76A 2PWPA 2WB4A 3HKCA 2AQKA 2CCJA 2RK3A 4E6EA 1K4YA 3A1FA 5EE0A 5B36A 3R75A 4B09A 1RHJA 3SIRA 1PR5A 3I01A 4BIMA 1KO5A 1QYDA 1JH8A 3KVOA 4LXHA 5G02A 1WBBA 3DVAA 2YC2C 4H35A 3E81A 4R54A 1LWOA 1MQ8B 3UOWA 4QODA 1I94B 5JFGA 5JWRA 2ZI7A 3LT4A 1ETUA 4GM1A 3ZIAA 3FYHA 3BGWA 1GZSA 1HDEA 3GXOA 5JCZA 1EVKA 1WY7A 2AQIA 3IV9A 4HD8A 4J9VA 4OV6B 4LJ4A 3U1TA 4YACA 5E3IA 1J0BA 2O48X 4M1KA 3NHJA 5TS2A 3LX6A 5F33A 3OZ7A 4L4ZA 1OBCA 1D2EA 4MW4A 3FMGA 4F3CA 3MJVA 4GI3A 4DADA 3D5QA 4EEKA 3GJSA 1XZKA 1RP1A 1RAEA 4DJEC 2XCIA 4DWWA 3UT5A 2E1PA 3PEFA 1Y9DA 1SXQA 3G85A 3IT1A 4U1RA 2ZSUA 2WWVD 4R2LA 5B3LA 1GA1A 4CG2A 2DY0A 2O23A 3CMMA 3JSAA 4I50B 3G5UA 2ODQA 3E7XA 3NJ4A 3TZ6A 1X94A 2D2FA 4IHKA 4Q1CA 3GCGA 3B48A 4B2LA 5LIPA 3EF1A 3LGSA 3FPJA 2CXQA 3JQBC 1JSZA 1KYZA 4U7DA 4Q6WA 4FYIA 3HK2A 2WHXA 3FBWA 1NASA 4GDFA 1WBDA 1T0PA 3RWOA 3ZTTA 2Z4TA 4R69A 1QDUA 1WUIS 4KR3A 3HMQA 1UBEA 3H18A 3EGVA 2JG3A 1PDOA 4MRRA 3PDCA 3FPCA 4YQEA 5HKOA 4MICA 1RLUA 2VYVA 3IBYA 2BRUA 2EHDA 3ORFA 1U7DA 2YV5A 3DZKA 2QLFA 2L0XA 3IP6A 2EKDA 4D44A 4CMEA 3OG9A 1IQ0A 5L9AA 1DQZA 3VR2A 5HA5A 1FRQA 4YCNA 5L3SA 3L2OB 4IIGA 3IJEB 2RFLA 3SNHA 4CTMA 2V3WA 4OQLA 3P97A 4R51A 3NBQA 4CM9A 3KUDA 2HDWA 1OHHD 2V7PA 2CT8A 4CQLB 4B3SB 3REOA 3CLHA 1XQ1A 1L6RA 1SIUA 1A7UA 2HU5A 3P0IA 4YCBA 3WA6A 4BS9A 4HNUA 1U8TA 1PGPA 4J0CA 3QE0A 1T6ZA 4TMKA 3LOPA 1M10A 4L76A 1C7EA 4ZARA 4MMYB 1DAGA 3FUXA 3EBPA 5DCWA 2WKWA 1I1QB 3HEMA 2FGKA 3KHKA 3ONNA 3EOAI 3QLJA 4Q4AB 1V8PA 4UVGA 4XEUA 5DMXA 3C74A 2HN9A 4HV4A 1XCBA 3IESA 3R6WA 5L45A 3KUKA 1L5SA 4UDXX 1E6MA 1CQZA 1LPNA 4DIKA 1XZIA 3UMJA 2XBLA 1Z15A 3T15A 2G0NA 4WESB 5LQRA 4DF3A 3BIXA 3FZYA 4L0MA 3ZDCA 2ZATA 2GH1A 3U4IA 3ZDZB 1DMSA 4ZOLB 4PICA 1NULA 2IYAA 2Q2WA 2XJ9A 3NAMA 3BL6A 3GLSA 1QJ4A 2PLFA 1HY3A 3NCHA 3TOXA 1P1IA 4YJGA 5C7IO 3RYIA 1VPWA 4ZYWA 3SFZA 4QGFA 1NVTA 1O94A 2P79A 3PUHA 4WNYA 1ZOLA 1TC1A 2HU7A 5A1TA 2Q0QA 3FIJA 3PFFA 5JS8A 4OI0A 2O19A 1J2RA 2MCFA 5CUQA 5EJ7A 3L4BC 3KQHA 3SSOA 2PUEA 1JU4A 5IT5A 1C0IA 1DRVA 4L8LA 1N7IA 1QGAA 1N2IA 3QY0A 4ND8A 1WVGA 3IUBA 3PA8A 3U3ZA 4FE4A 4HWKA 4UHEA 4E30A 4IRMA 1F6DA 2BFEB 5TPZD 1QK3A 3ROEA 4NMXB 3LDFA 1RYZA 3ICOA 4R31A 3PPXA 2QP3A 1C7JA 1JBEA 1LSSA 4CI0B 4FMDB 3UCEA 2B8NA 2JW5A 3CB4A 3E9CA 3VJRA 1IAQA 2ONJA 2C1EA 4BUZA 1DEKA 2Y66A 1JHZA 1H6DA 1Z88A 4WLEA 2HU2A 3TSZA 4MH0R 4M0FA 3UAOA 4I4NA