2FWAA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89n from the acidophilic bacterium acetobacter aceti, at ph 7
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAANLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
total genus 50
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fwaA00
2FWAA 4Z7JA 2FWPA 2FWJA 1QCZA 5CLIA 1U11A 2FW1A 2FW7A 3KUUA 4AY4A 4ZJYA 4ZMBA 2NSHA 5CVTA 3ORSA 4AY3A 2FWBA 3RGGA 1O4VA 5BOSA 4YCCA 5BORA 5BOSB 1D7AA 4YCDA 2YWXA 5CTJA 4JA0A 2ATEA 2FWIA 2FW9A 3LP6A 4ZC8A 2FW6A 2H31A 4GRDA 5CLHA 3RG8A 3OPQA 3OOWA 2FW8A 5C5DA 2NSLA 4YCBA 5CLFA 4YCJA 5CLJA 3TRHA 2NSJA 4ZK2A 5CLGA 4B4KA 1XMPA
chains in the Genus database with same CATH superfamily
3NASA 4UREA 4V1CB 2H9AA 2XUOA 3DO6A 1DXYA 1U0FA 4MVJP 5EQFA 3ZZ1A 4AS1A 1CUGA 3ETGA 3HUFA 5AH0A 5DRTA 4BFYA 1XNQB 3EIUA 7MHTA 2NIPA 3HB4X 4HGPA 4RH3A 2J6BA 4YREA 3TZBA 4CMBA 1W7AA 5FLEX 2E89A 2EFJA 2W9XA 5CA1B 2YR0A 2H1OA 4HOYA 1VLVA 3UYKA 1VGVA 5TQ0A 2P6OA 4BLQA 4QUHA 4JASB 2VF2A 1AKQA 3JYNA 2JH9A 4RHFA 4HFRA 2COEA 3NTLA 3GJRA 4B3XA 1T25A 1W30A 2PGOA 1GRQA 4Z9YA 4C5BA 3I42A 2XCTB 3N2IA 5IP5A 2IYUA 1J1ZA 4LX0A 4O59O 4TUYF 1X92A 4CN8A 1QIDA 1BTOA 3E8SA 1QHHB 2RGGA 3I6QA 3CRZA 2Z1DA 1LX7A 2BHTA 1JHUA 3EQ7A 4EGJA 2W6ZA 3THYA 2N3ZA 5FLXA 4LDRA 2OPHA 1PEYA 4ZQCB 1BYIA 4OQFA 2B8TA 4TYMA 2BELA 1XLVA 2BSXA 4XCXA 2V3VA 4PFKA 2JI4A 1U0HC 3MHTA 3TL6A 1CW2B 4MZDA 3TQOA 1O6FA 4P80A 1LRLA 3SJAA 1X9GA 1BWQA 2XYPA 2WWIA 4Z0TA 4RTRA 1PL0A 2HIMA 2JCGA 2PO7A 3ERCA 2O54A 1DEAA 3KV3O 1QIHA 4Q7MB 5HZKA 1KJ8A 3ANXA 1CKEA 1CY7A 1KTVA 1QC5B 3ZY5A 1QFSA 2ICAA 4M46A 3PC3A 4XPIA 1FE8A 1O0BA 3AERA 2ORYA 4GOOD 4JU9A 2IU3A 4RIHA 4CCSA 5LQCA 4MRAA 2R6AA 4ON9A 1R9JA 4LJRA 1W88A 1UFRA 2WZBA 4IJMA 2Y71A 4NYMQ 4EABA 1ZICA 1J1IA 3G1TA 5KIAA 1J06A 2CEKA 3STXA 3S2SA 1IXRC 1EP1B 3LCUA 1SJ9A 2XE4A 3NBKA 2NZXA 1M1NA 3AHEA 3PQ3A 1KMQA 4K6KA 2G5PA 1BXGB 4I5FA 2GCGA 1QYRA 3IEPA 4XFJA 4MDFA 1KGDA 4II3A 2A67A 3H42B 3T5AA 1SCBA 4G4SO 3H84A 5LP6C 1XHLA 3MT8A 5FX2A 1R4ZA 3CVVA 1GPJA 4HWOA 1ZJWA 3ZWOA 4EPXA 4B6SA 4UHHA 4ZHQB 3P2JA 1FS5A 3M3HA 4ZU6X 4P7KA 1KSHA 2BN4A 2ZKIA 3RYHB 4EY8A 3GLFE 1DXHA 2PRKA 2Q07A 3K9LA 3K8ZA 1XJWA 1FDTA 5U1PA 5I3ZA 5IM4A 1SUSA 1XAGA 4BNUA 3AVXA 1WCIA 4RADA 1PW7A 2ZQZA 4A73A 4TTIA 2H6EA 2VDNB 2YJ3A 2NYVA 4FMCB 5I9MA 4BX0A 2OCYC 4QU9A 4RHYA 3EZFA 1Q6YA 3MFYA 4WJZA 2XYGA 3ROKA 1M73E 4CGZA 4LBZA 1GCOA 4BMXA 1QOPB 2VT6A 1ZK1A 1ZNYA 4R6WA 1SQ6A 5HHTA 2CVHA 1LKZA 2YN2A 3JQ9C 4HBGA 4HNRA 2PSSA 1KARA 1PVDA 1U3DA 3DBRB 3RANA 3ZK7A 1TM5E 1LBIA 1CXZA 2JGDA 1FW6A 4GH5A 1U8YA 5GGXA 1E9CA 1TT7A 2XB9A 3BHIA 2G80A 3CU5A 3MCTA 4IFEA 2ZS7A 2CLFB 2FZVA 1RIFA 5TRTA 3D1JA 3P9IA 4WQMA 8LDHA 2CE2X 5F3WB 4S1TA 5EWJA 1TJ5A 4EPYA 4ZAWA 4NKRA 4L5YA 2JLAA 1RHUA 2GZAA 3QV1A 1WZEA 2ZE8A 1UC4B 2QVGA 3W2TA 1L1RA 4OSPA 1YZTA 3CWQA 5AXCA 3CE6A 1UPBA 1YB4A 2HCTA 5BO5A 5HKAA 2HSJA 1ETHA 3JQGB 5HIKA 3KQKA 1IBMB 4R3NA 1OI7A 1ZVKA 1EGHA 3FZNA 2BGUA 3IQWA 4CM8A 4U8HA 4UTRA 5CU7A 1DGQA 1QP8A 3ZTTA 3WLOA 4DEVA 4I4NA 2OUKA 4NYJQ 1JDSA 1P8JA 5E1BA 1OV6A 3H5NA 2WFMA 2CBXA 3MLBA 2Y05A 2CWDA 2VWHA 4GM4A 3URKA 3DAHA 2JAQA 4AM8A 2RE8A 4UMFA 3K05A 1E6KA 5FULA 1QQ6A 2BGMA 3RFFA 3JAKA 3BJEA 1DAFA 1OWLA 3EF3A 3NG1A 3OJCA 2C83A 1CJTC 2J3QA 3PHGA 3PRHA 3QKTA 2MSLA 4MJ3A 5EMKA 3VTFA 1Z2DA 1KZ9A 3NWBA 5IAGA 5LP6A 2PUCA 5IJ0B 2V97A 2ZRFA 4IXWA 2VYVD 3OPYI 4PANA 3BKWA 1J8FA 5DULA 3ZIUA 5L3SA 4QLAA 4NMHA 5AXDA 3GPIA 4X64B 7ADHA 4U7DA 1JLHA 2FSPA 4Z8YA 3IDOA 3M70A 1T4CB 4UATA 2WJJA 5ADUS 5EWMB 5DHQA 1A5AB 1G8PA 1RM0A 1Z5WA 2FFRA 2HO4A 3AI2A 5CX4A 4LXYA 1EX1A 2NXNA 4Q05A 1G21E 4Q4JB 4BDTA 1P19A 3IVAA 4FILA 4HNSA 1O5OA 3S8MA 3ZXYA 4ZV4A 1CQWA 1AD2A 5A4MS 1URPA 5CXQA 2Q0HA 3RUFA 2Y2VA 4QAQA 4UDOA 4MI9A 3KQOA 3I1JA 1QUEA 3B82A 5B2EA 3FOZA 3TXYA 1LC3A 5AUNB 1WXGA 5AHKA 3HCBA 3WLKX 1UDBA 3D6TB 4IS2A 4AF7A 1W48A 4D8UA 3U7FB 1C3XA 1YB7A 3REQA 4QARA 1JZTA 3UT6A 3G9XA 2H1CA 4UQLA 4ZAGA 1BX1A 1ZGAA 4M0FA 4CM1A 1JTVA 2Z3ZA 3TLYA 4QLBA 4DCCA 4TRRA 2DHDA 3TFWA 1JWLA 1S7CA 1C0PA 2FQXA 2EFCB 1CRLA 1IZZA 3AP1A 5C31A 5BMVA 1NMEA 3ZDAA 4HUTA 3U4MA 3G8BA 2H4YA 4JLNA 4B31A 4WT7A 5IRCD 3ER6A 2DFNA 2A1TS 1CERA 3KJGA 2O2JA 4X90A 5KYTA 3ET5A 3C14C 1JAXA 2TRSB 4QDXA 2PWZA 2IY8A 4REMA 1F60A 4RHEA 1AXEA 3ABQB 2BEUB 4HS4A 5FI1B 4ARBA 5JYBA 4K0KB 4I6GA 2NUPB 5HR5A 2ASEA 2SHKA 4GP7A 4ZMSA 3BORA 3DAFA 4EG3A 5IXYA 1OIXA 1M2FA 1RRPA 3GFRA 4X45A 3W05A 1T1GA 1EXMA 5F4BA 3V48A 3NJ4A 1JALA 3P96A 4TMWA 5CYGA 3IOEA 3WWCA 3CHYA 1Z2CA 4G86A 4X85A 3E9RA 1TNDA 4OSEA 4EB6B 4R5MA 1ZKMA 1N3LA 1S01A 2XJ4A 3HDTA 3R40A 1HM5A 5EIFA 3A6LA 4CUZA 4LQ4A 1Y1KE 4JJFA 2BV3A 1Q1GA 2VDQB 4M1KA 1BE0A 2QD4A 1ZNXA 3KNZA 3O9MA 4I50A 2Q27A 3T5MA 3PQEA 1EFRA 5EJ4A 4XLTA 3VR0A 2WWGA 3VHXB 1XJQA 3W9SA 4LF7B 3SJCA 3GL9A 3DKPA 1W0KD 3PFGA 5AVRA 3TGLA 1G6HA 3QUBA 4AFNA 4CL8A 4TLAA 1V47A 1OH5A 1EE2A 4FFOA 2W58A 2WJAA 2ZUVA 4GSYA 3HCAA 4WACA 1UKYA 4A10A 2GTIA 2QRMA 1H2EA 4MI1A 1WKCA 2XY4A 2JLYA 4FT4A 3S4YA 1NP7A 5HIAA 2DUNA 1RRCA 3HFRA 4MCJA 2WMNB 3O4VA 1YQWA 1WW8A 3GYGA 5BOSB 2Q3FA 3KG2A 4OB8A 1C9DB 3GJQA 2QEQA 2JAWA 1HE1C 1HBJA 2G36A 4MAAA 3UAOA 1VKJA 4XJVA 2PBZA 3C5WP 1TVKB 3P71T 4KE6A 4RDIA 3LBIA 1ZUNB 2IPAB 1SC1A 2J9ZB 2JHCA 3E2MA 1FNCA 1Z8NA 2AR0A 3AVOA 4MV1A 5FYQA 3I9NA 3W9YA 3CNLA 2C9MA 1AKMA 3V2HA 4ARUA 1YU6A 4MWSA 5AKEA 4YIKA 3HKBA 5AK5A 1X1DA 3D31A 1FDVA 4C3ZA 1ABEA 5KYWA 2CNNA 2Z95A 3RHSA 4EPWA 1E9AA 2NZJA 4NZNA 3G2KA 4ZO7A 3QVKA 1H05A 1K7FB 2C94A 1W93A 4CFYA 2VTDA 3GQBA 2WABA 1JYFA 2JGIA 5CH3A 1GZUA 4GBED 1EVKA 3N2KB 3TOVA 3TCNA 4RFLA 1NW9B 5IU6A 1SU8A 2R11A 5AOAA 1T9GR 1UAGA 4HNQA 4ESHA 1QB8A 2HJ9A 4H3SA 3NC0C 2QD2A 2JFHA 5A4FS 2OGWA 2QE6A 1M0EA 2QMHA 3U9SA 5I51A 1ZCAA 3AUUA 1TMOA 2VK4A 2IU0A 1SFRA 3BAZA 5E3HA 3A4IA 1MF7A 3DV0A 3RAFC 4QUAA 1JX6A 2ODTX 1RYEA 4OGWA 3FRHA 3SKYA 4AZSA 3I83A 1GTMA 2Z3WA 2H59A 5FTMA 1ZXXA 5K8CA 2CW5A 1FFAA 1M34E 3QBJA 4RO0A 5G0SA 5IKMA 3V4OA 4G0OA 2YXLA 3RC7A 1O08A 3F7NA 4DR4B 2K87A 4XDHA 4HGYA 2AUNA 3EGXB 4XYLA 2VXOA 2PK3A 4JLKA 3CKMA 4P4SA 4CVNA 5A4AA 3VH4A 2PGAA 4C43A 4D9BA 4ASUA 3QBEA 1ZWKA 3DBLA 5F5LA 2W2NA 4G07A 2GAJA 2JI8A 4JI7B 5H4GA 1ENPA 1JG4A 2R9VA 3V33A 4A6EA 1CZLA 3WR5A 1JEOA 1RM5A 4HX9A 4N7MA 1GR0A 4QVGA 1EP3B 3I5AA 3UUFA 4CLOA 2ZPTX 6AT1A 1Q1ZA 4MV4A 1AVTA 2XWBF 1JEDA 1HQCA 1RHJA 3BQ9A 521PA 2H65A 3EBLA 3TIIA 3C87A 4KIJA 2WYIA 4AYXA 3GVPA 5EUBA 4X7BA 1QYXA 2QMYA 2IA5A 4H77A 1GITA 5BUQA 1NSYA 1VPDA 2ZJYA 1USGA 2XYQA 3FWYA 5L9AA 4LK3A 3R7FA 2Q2NA 1ZW1A 4OBEA 5EKUA 4N9QA 4ZC8A 4DCPA 2J6HA 3B5IA 1DHRA 5H8WA 1JG3A 2V7WA 3UCEA 3T1TA 4Q16A 4JI4B 4UFPA 4EVSA 4D9KA 2X4DA 3ZGVA 3OCWA 5CVJA 5KYXB 4FBGA 5BSRA 3BJMA 3CM0A 4TQ9A 1H1LA 3ADCA 1ZIYA 5FNVA 3ZLBA 1NBME 4BNWA 5ICGA 3ABRB 1W36D 4LCBA 2JI9A 2R47A 3K1AA 1SZCA 4JDUA 3G9UA 4KXVA 3K1TA 4MV5A 4XARA 1GZ6A 1JSLA 1LTHR 2JEOA 3AEQB 3CH4B 3IPRA 4FW9A 4DMRA 4B83A 1Q1NA 2O57A 4FDMA 2A9PA 3V4ZA 4C6SA 2QN9A 5C3UA 1LFAA 3LY7A 4GVLA 5LP1A 2UXDB 4Q4DA 1CYEA 3JVIA 1GTVA 3JQEA 4MVJD 4TLBA 4XX0A 3TIFA 5ETJA 3ZYZA 3Q6MA 2AXQA 3QZUA 3OFJA 2JD0A 5L45A 4GZ3A 4PZDA 3ZVNA 4RMGA 4G89A 4FHFA 4WLUA 4HVCA 3I1YA 4W9MC 4MW0A 1R5BA 1V1RB 5HFJA 2P30A 1B3RA 3GEEA 3DXXA 4R9SA 3F6RA 4B3DA 1PTJC 1QVWA 3TLGA 5C7YA 5CBKA 3A1SA 3UJNA 5I7FA 4Q37A 3IP3A 4J49A 2CUTA 3EW7A 1NOJA 3AVPA 4M9SA 2FSFA 2Q1SA 4LAFA 4D4HA 4LF9B 4NCHA 1D6SA 1MQSA 4ZYWA 5FL7A 1M8KA 1X74A 3WK6A 2PUBA 1VJGA 1TIPA 3P9ZA 4XWWA 1RQ7A 1V9CA 4V02A 1A8PA 1D7OA 2P5TB 1K8QA 1MT0A 2FX3A 2YWXA 2H1FA 4B3HA 1J24A 5HQ3B 2JLWA 1R0RE 3RV4A 1CJSA 3NAGA 16PKA 4WKCA 1BMDA 3SBXA 4QYIB 1QX4A 4BKRA 3A6JA 3RADC 3JVDA 3O90A 4MR8B 3FKJA 4KYVA 1SXIA 1FU7A 5G40A 5IMSA 2OG2A 4G36A 4WGGA 1O95A 1MENA 3FNBA 2A4KA 4CIXA 3IBSA 1LPBB 1C9NA 2AL7A 3L8EA 4R9RA 2JKVA 2KX7A 1E9BA 2HJVA 3ZV4A 1WETA 4BO1A 4CU2A 1H69A 1NP3A 4WECA 3P27A 3V1MA 2B1IA 2OCIA 3BCSA 3FWKA 3OZIA 4BN5A 1THMA 2VHUA 4DLWA 2R6ZA 1VSQA 1KU6A 2FXVA 3EF0A 1PNQA 2PH7A 6GPBA 3K6SA 3LRXA 1EM8A 1G21A 2DFKB 3WK5A 3X1DA 4HX5A 2ZWVA 4HAVA 2HADA 2OO3A 3PRYA 3CONA 4LN1A 2XCQA 1BWRA 5CFOA 1XZIA 2H2GA 2I4TA 3G2MA 1UPAA 2FX2A 2WHEA 5AK4A 5A1TA 4DV7B 3T7JA 4OUDB 3RIMA 1E20A 1SZPA 4BQPA 3RUEA 4ZHSA 1HRDA 2YHIA 5FPHA 3I73A 5KKNB 4NBLA 3JARA 1T2DA 4OKSA 1YZUA 3KUKA 1PD1A 2AOVA 3G2IA 3OWHA 4LI0A 1UBSB 4WUTA 1TF5A 2A0WA 2PWPA 3A04A 1NNUA 1VKOA 4QULA 4ZVTA 4ZWNA 1MJGM 2FA9A 3KT6A 1FQKA 4PY2A 4RIGA 5BV0A 1AZTA 3EEYA 3DHNA 4XOUA 1R4MB 5IKOA 2FI1A 3L0CA 3A8TA 1IL0A 2Q49A 4RFVA 3JALA 4GRAA 1J33A 1ICEA 1XRJA 3DC7A 3KSDO 4HZIA 5HF8A 1WSWA 1GTJ1 3F7OA 5LCXA 2JIOA 3B6JA 2FPMA 3ACBA 2HQBA 3V9PA 3B1FA 4XYEA 4ECEA 1EM6A 4HVLA 5JADA 3CZRA 5IF9A 1NQTA 3WRYC 3UFBA 2JVJA 1XYGA 2QPLA 1SKMA 4LYAA 4UDNA 4F5ZA 3PE4A 5AW3A 2NU7A 2PXCA 1QHIA 3AUFA 3B70A 1LBEA 2CN1A 3WNCA 2WT4A 3C3BA 3UYLA 2G71A 1CC1S 1EFKA 3GO4A 4FYIA 1G59A 2D62A 2XF2A 3FNQA 1SHUX 2VHEA 2PL3A 4QJ3A 2HCBA 2Y93A 4XFDA 3SEQA 4DQDA 1FZQA 5HMMA 4EFNA 5I4IA 4Z4FA 1PDOA 4MUJA 1Q3HA 2BMFA 2NYRA 1YJBA 2RJ3A 1FFXB 5FBWB 1KI7A 2RGDA 2BSQA 4NE2A 3X3HA 2P4EA 2F1JA 3JRNA 1N6KA 4DEYA 3VGJA 1N3BA 4OHPA 5CFZA 4KXQA 3EAQA 1AQYA 1KRHA 3BFJA 4Y2RA 1Z29A 2BONA 4CM4A 2BLNA 5KYNA 2OZPA 3JD4A 4H7PA 3IDZA 2HQRA 1CZHA 3OZBA 1XBTA 3QXCA 4KO4S 3RU2A 5JS6A 1R2QA 1UQRA 4DTCA 2OFPA 3C6ZA 4JR0A 2FFJA 1GOTA 2XMGA 2Y67A 2GQ0A 2PY6A 3DVAB 3EGIA 4AX8A 3CE9A 3CX8A 5EHZA 4X20B 4F86A 3MTAA 3UV6A 1EGAA 1SUBA 2R84A 1LD3A 4FDTA 3STYA 3M6LA 4BP1A 4TMKA 1QDLB 2OZLB 2PAFA 4Z9XA 2RHDA 4JROA 2FEXA 2DFVA 2RSLA 2O8BB 3FYUA 1I24A 3BRSA 1VZ3A 2UZ0A 2GCOA 1QG6A 2I7TA 2ZT5A 3ABZA 13PKA 3BFXA 4GIBA 4OVKA 3FR8A 5AIBA 4R7ZA 4ARZB 4BNZA 5LKRA 1M6NA 3RRXA 1GD1O 1IBRA 4D5EA 2X9NA 4RHXA 5J2TF 3ROQA 2CDBA 5CG2A 3PNLA 2CVOA 4BX3A 1QF7A 3NH6A 1US8B 3V4VB 2OCBA 3GGDA 1JA9A 1ACJA 4E2FA 1P7YA 5LQNA 2EGUA 1KAGA 3T9DA 1MAVA 5KWVA 2N75A 1J9GA 2A35A 2AG0A 4JLJA 2LVBA 5L40A 1C8BA 3G2PA 1NRIA 1X1AA 2X8JB 2Z83A 3D81A 3IP1A 3RK4A 3WBFA 3ZV5A 1FFHA 5HA5A 1Y8AA 1I2AA 1R64A 4X6LA 3KM0A 4TQAA 1I36A 3OSUA 1Z3IX 4XPZA 1HTTA 1YQ9A 3KVRA 4B17A 1EUDB 4XVRA 1QV7A 4OIMA 4OHOA 2P3OA 2VDLB 4ML3A 1KZ6A 4UTXA 3OETA 3EVBA 1QKJA 1TO1E 2JF0A 3DXFA 4RD4A 5HE9A 1G3RA 1KI1A 4I36A 5D00A 4IWXA 3A25A 1RIIA 3ZCRA 3L7OA 4RPCA 4HAIA 5ENZA 5A4IS 5C80A 4NMMA 1K3UB 1L7VC 1OLXB 2ERXA 3E1GA 3S99A 3TPZA 1XKQA 4PZLA 1M2VB 5E3IA 1W6RA 4B6QA 2IEIA 2X8WA 4LVCA 3EHEA 5A9SB 2PZBA 1DRWA 1F14A 5AVSA 4FFSA 1U9JA 1XVVA 4UEWA 2ODPA 1C7ZA 1QTRA 3WLQA 1XN1A 3FPFA 3NT4A 1WHSA 4WZBA 3CEMA 4I6JA 4S1WA 4FGJA 5KNLA 4TMVA 1Y3IA 3Q2KA 4PAQA 3WRWA 1QANA 2GMWA 1AQ6A 1E3JA 4Q1AA 3TLJA 1KMMA 1JMVA 4ENTA 4ZDIA 4GZ5A 5ITWA 3LQFA 5A7HA 2A84A 5CFLA 3NPAA 2J0SA 1BFKA 4QUJA 5LLDA 4NOJA 4EDFA 4OHKA 3SZRA 3OPYB 3KLBA 1L9XA 3U7EB 3ZD6A 1LWNA 2AUMA 1ZCBA 3FYUC 2QW0X 3RVOA 4FR5A 1TJYA 3ZKAA 4HXGA 1OKKD 2BRUA 3M6MD 4A1OA 4KACA 1PFKA 4LVNA 5GGYA 4PV7A 1EFDN 1UKVY 5CFRA 1AXRA 2GH1A 5IC4A 1QRSA 2DERA 3ZU6A 5ALVA 4QTXA 5FHQA 4D6XA 1SIOA 3JVUA 2F3UA 3GEBA 1WAMA 3ZK8A 1M1YA 1W0CA 5K3FB 1XJ5A 1MOPA 2DY1A 1U9CA 4QXAA 2QENA 1Y1QA 1P2SA 3ESYA 4E5UA 4MW4A 3V4PB 4D81A 4YDQA 1DC5A 1PQUA 1UBTS 4LHZA 4W5HA 3ER8A 3GMIA 5EZSA 1VJ5A 4ZVQA 2OYRA 3AXTA 2GEJA 3RHFA 3N28A 2WMDA 2FP3A 3AUXA 3WNVA 2YVUA 4AUEA 4M2LA 5AJTA 5M04A 3F74A 3IOBA 3NIWA 4P3PA 1X86B 2O2ZA 1WDKA 4G0QA 5C8VA 4XWYA 4QUBA 1IRXA 1YIDA 2Z8XA 3N6RA 5EFZA 1CUJA 5BNIA 1PJTA 2KQUA 3CG0A 4XR9A 3COJA 2FCAA 1NYLA 1UK9A 5LQKA 1O87A 2PMBA 1WZUA 2YV2A 1DKPA 4F4JA 3DTVA 4HDRA 5CAEA 4TYNA 1Q14A 2WJVA 4C7OA 2HGSA 2O2GA 1Z0SA 3PENA 1TRKA 4IWNA 3AK4A 2X0EA 1LBSA 1Z7EA 5EIBD 3JX9A 3MTJA 1ZEMA 2NM0A 3V55A 4UEOA 2P9TA 5CA1A 3O4HA 4RHCA 4RESA 4KLAA 5AW5A 1XTQA 2B94A 2WDZA 3ZI4A 2J3JA 1PZHA 1TCCA 2XHZA 2D6FA 3UWSA 3EJWA 1TCBA 3FPHA 2FNAA 3OOHA 4HSEA 2C29D 4KEAA 4HB2A 4LXGA 3P9CA 1Y3HA 2WAXA 3C15C 2PGLA 2Q29A 1OBHA 2HMYB 1NT2A 3GR6A 3GZ4A 4B7ZA 2GNOA 4K1LA 4D79A 2AZTA 2FWRA 1DX9A 4DY6A 4RTPA 4MQFA 1SVMA 4IJKA 5DVZA 1WV0A 4H6XA 3U81A 2O7SA 2UVDA 1Z4IA 1WX1A 2BDTA 2PEYA 3OOYA 3E9DA 2VHXA 2R751 3SX2A 4YC7A 2XNHA 1WPXA 4KL8S 3OCYA 3ROFA 1LZLA 4UUPA 2BRUC 4M98A 4MCHA 4C21A 1NURA 4QSMA 3VC2A 1NLYA 1IJFA 5JI3E 2IPXA 2XI4A 1Y7PA 3W3AH 3TZEA 5BUZA 1WVGA 2QY9A 4EVRA 1IZ9A 1R88A 3IUQA 4ZTBA 3VVBA 3LT5A 3ZQ6A 1L5HA 3ETHA 1JIUA 3UAGA 1TQ8A 1ZIOA 3E7WA 4HN9A 4ZVOA 4JC0A 4OAQA 4DIBA 2VNJA 3DEZA 2IEZA 3WHKA 2ODQA 2X0JA 5E7QA 2GTPA 4M1YA 4EAAA 4NVRA 3C3YA 4UBNA 5K4GA 3BZWA 3R3WA 5KS2A 4JEUA 1FC0A 4WFJA 2G9ZA 3UK1A 2AOXA 1ZHOA 3EIQA 3AB7A 4BKQA 4B80A 2EX0A 1KO5A 2OHOA 3NOQA 3RBZA 1N36B 2EWWA 2QU8A 1CJKC 3QX8A 1DAEA 4TS3A 4Y2PA 4YMIA 5EE5B 4DVJA 5A5GA 5IULC 4ZV7A 3BTVA 3F4BA 2FPLA 1CS0A 3FGNA 3WRVA 3O21A 3OIYA 4OX9B 1XJCA 3DDWA 4KMSA 4O4JF 4PO1A 3VVLA 4RTOA 3ZW7A 2PLWA 3PR3A 4H6VA 4P4GA 4V39A 3N0TA 3ZHBA 3GD5A 2GF2A 2GFHA 2JDIA 3VNVA 1HE8B 1H0SA 3T1QA 1RBYA 4HUQA 2JFBA 1KC1A 4GQAA 2YFKA 4DA0A 4P58A 1JHQA 5AM4A 4TMXA 2ZIAA 3L92A 3MOSA 4IDEA 4MUXA 1YAJA 2E49A 4EJSB 3BB3A 3OFNA 1JT9A 2C5BA 5C5IA 1CUVA 3HRIA 4Y9RA 4P22A 3KOUA 5K03A 4R9NA 3ZWVA 1IHOA 1MMFB 1QHEA 3FG9A 3IPYA 2EZ9A 2GD6A 2XDQB 5LMZA 4E46A 3OQ6A 3SLGA 1BGVA 3P32A 1Z4KA 1RVV1 4JBHA 3TZCA 2EWMA 2HUPA 2R25B 4YJ2A 4H18A 5LVAA 5CXUA 1T9ZA 1TC2A 3EXAA 1Z73A 2ZE7A 2ZITA 3TR6A 1A5ZA 1BS2A 2B83A 4FZ3A 4NDZA 4NOKA 4W6QA 4AL4A 1WTAA 1Q91A 2AFHE 2X19A 4NAVA 4X3PA 3WV5A 5LZ2A 1VHQA 3PQ4A 2B2XA 3WIUA 4ALMA 1Z0UA 4DC1A 4KI7A 3Q6IA 2IS1A 1IUOA 2BFWA 2RG7A 5FUBA 3FAKA 3H9EO 4PLTA 4DIDA 1ORTA 5DGCA 1QHXA 4MVJG 1OA0A 2GN1A 1M3SA 1MB4A 1NJ8A 2GHRA 3GXOA 5DIZA 3ICVA 3L7LA 3ISVA 1TW2A 3L8YA 1NI4B 4WX2B 1FP2A 4PYMA 5JS1A 2CMFA 2GK7A 4UZFA 1FQJA 1OU4A 1RTKA 5DFAA 3LP6A 3TCKA 3BGSA 1QRUA 1LF5A 2RAFA 1QWOA 1L4NA 2BI8A 2X0IA 2IHJA 1EUQA 2B1GA 2ECQA 5AW2A 3V6LA 1RM4A 4K6CA 4MR7A 4X44A 2YHUA 2YRWA 1ZYUA 1RPJA 2QRZA 6ABPA 4HLDA 1YS9A 2BBSA 4LJYA 1L7RA 3MG9A 4J16C 5F64A 1G7TA 4Y2GA 2V8BA 3H11A 3H2YA 1NN5A 3GEGA 1CUWA 2YYAA 4MMXB 4RHTA 3RF6A 1FUEA 3AFGA 5CUQA 1TTPB 1C4KA 1ZDMA 4NR0A 2GK4A 2WTUA 1TM2A 2HBYA 3RWBA 3ECSA 4FMDB 4KVFA 4S24A 1VJ1A 1UMDB 3L8DA 3LQ4A 2WTMA 3VDMA 3VQTA 2ONCA 4LXXA 3ND7A 3DYVA 1C7QA 3FTDA 3G85A 1Q2UA 2V98A 2PZFA 2BEWB 3KS9A 3IERA 4LMRA 3L84A 1Q77A 2XE6A 4FZRA 2WG2A 3MPUA 2HBQA 1JQ5A 2JJQA 3OIWA 1L3BA 3PT5A 5F51A 3RB8A 2A92A 3HWSA 4H0FA 4MKZA 4OP3A 3QPBA 1K7CA 2IYQA 2HM7A 3E9EA 5J2UB 2UYGA 4UHDA 3W2GA 5D3MB 2F90A 5ALOA 2NU8A 5KYKA 4G25A 2ESRA 3BJIC 3L18A 1F5SA 2HLDA 1OWNA 1T8SA 3DZHA 3GZTB 1DINA 2CFOA 3LPCA 3R41A 1JQKA 2OOSA 2VRNA 3M2PA 1CBUA 3PNBA 221PA 2QUIA 2ZSJA 5JHGB 3V7WA 2CHUA 3DP9A 4A36A 3PDIB 2NTYC 2W2QA 1E1CA 1XAIA 4FYWA 1H1DA 1H3EA 2R5NA 4MW9A 1ZGHA 1H9AA 1QAMA 1CQPA 1PR6A 1A96A 1PQWA 5DTRA 3K0EA 1YJAA 2Q0SA 1L8LA 1Q5PA 1YQEA 1FTQA 4GRDA 4BFLA 1ETUA 3OX2A 1TMGE 2PIDA 5DE3A 1H8HD 4Y1FA 3RJ5A 5JDIA 3CMCO 1RZRA 4MB2A 4GL2A 2DM6A 5KX5F 1B6GA 4I3FA 4M0CA 3L7NA 4IIGA 1VCMA 2PDAA 1EVQA 3NANA 1XCJA 4PF1A 2R48A 1WLYA 3IMFA 3ZCQA 3ZJ4A 4L75A 1D2HA 1JAIA 1DADA 2QTLA 3DV9A 3HB5X 4PVCA 4RU1A 4IHKA 1WTCA 4MLPA 2H8KA 2A0UA 2QGFA 4UC0A 1NU8A 1Z37A 2RHHA 3IO5A 1RWVA 3ABOB 1KVTA 3LE8A 4OLJA 2WOOA 1KP2A 4KQ2A 4EI8A 2O8FB 2CMHA 3FYTA 4YAGA 3KBOA 4UOZA 4MS1B 1CF9A 4R2XA 2AQ8A 4IJ5A 4R8KA 2NUBA 4CKZA 2QG9A 5DXJA 3RYCA 2VZ8A 4IH9A 1R7RA 1R0KA 2H7XA 4HRXA 1KIFA 4IHJA 2UU9B 3DEIA 4IOJA 4CLRA 3ZWXA 3EXIB 2HZBA 2WWFA 1OB2A 5BXQC 2QZ9A 3UJCA 5I7UA 4KN9S 2VKQA 4D9MA 1E9SA 2JBHA 4KN6A 4JCOA 2GFIA 2C2XA 1BNCA 1M5TA 1TOAA 3EH2A 4INZA 4ZOLF 2ZUTA 2ZB4A 5FH9A 4HH1A 4A8PA 3VPHA 2FZEA 2HFKA 1Z39A 4UUNA 4MHOA 5IDXA 2PZMA 1XQWA 3A05A 3U3DA 3GCXA 4OI1A 2WUWE 1P6QA 2YXBA 5BNFA 4W5OA 4JQYA 4V0RA 4UHKA 1P74A 5C4IA 2PTGA 1CULC 3LC2O 3I2IA 4PGMA 2OKGA 3PTLA 4EYSA 3ND6A 5DGDA 1AUPA 1R0XA 1YVUA 1EFPA 1USWA 2LCIA 2XRMA 3QV2A 2EQBA 3SXUA 2ZRCA 4C0HA 3NH9A 4DPKA 3MYRA 3GFVA 4EGFA 4OMCA 3V8PA 4J1SA 1RWKA 2FWJA 3D54D 1LEHA 4LJKA 1HQDA 2QZJA 4DUZB 4MUYA 3F0TA 1BKDR 4I4IA 5DLDA 3PDWA 4D9CA 2CLSA 4RM3A 2ANBA 4XQ9A 1FY2A 3EODA 1TGYA 2R6CA 3F5QA 5JDIC 1OYWA 2Q99A 1YGYA 3UH1A 2BHLA 4U6SA 2Y0PA 5BYBA 3EZGA 3O8QA 4K28A 4E1VA 4IVQA 2GEDA 2YVQA 2YOGA 4J43A 1GNPA 2ZB7A 3WGIA 3EEOA 4DREA 1EFUA 4UFOA 4KRGA 4M6WB 1CU1A 4D26A 3EDCA 4BLSA 2V7UA 1AA6A 3BREA 1R50A 2GI4A 4IG9A 4X62B 2UZ1B 3OZXA 1E5VA 4XGRA 3O92A 1QIKA 2Q1UA 2AXEA 5L6LB 4MDEA 1Q0HA 2C20A 5EEHA 3RF7A 3O4RA 4PLZA 1MAUA 4J76A 1HE2A 2TMDA 3K6KA 1SUEA 3U4GA 4R68A 3FETA 5EZYB 4GL4A 2LWIA 4W9NA 3AT1A 1F0PA 1XDZA 4WZAA 5FPSA 3WLMA 2GPBA 5JROA 4FQ8A 5C18A 3K0KA 3LFTA 4V0QA 4GKKB 4MP3A 4N7BA 4YRDA 3FPSA 1HSZA 2WUVA 1FQWA 3ND8A 4PCVA 4QUGA 2ZTVA 4KFRA 5DTJA 3ZU3A 1X42A 3KUXA 4UTOA 3PEFA 3CJQA 3VAYA 3IBCA 1NBIA 4NFYA 1U2DC 1WY5A 3JS5A 2ZUCA 5H3LA 4RD0A 1Z34A 1Y0BA 4WI1A 1AE1A 1IOWA 1E7WA 1W35A 4JSYA 5DCUA 3VYUB 3ZZMA 4F3TA 1G5QA 1R6UA 2GDZA 1H2WA 1QYCA 4Q24A 3U7RA 2GN8A 1NJ5A 1WY7A 1DRVA 2FPWA 3A3NA 4MUEA 4PINA 1F8YA 4U7HA 3TSAA 3A6HA 3X2SA 4R01A 4FC7A 4ZZIA 4P7JA 5CM8B 1GLVA 1KZGB 5L6MB 5LQUA 3NEYA 1H3FA 1NG1A 3OEED 3BGDA 1XVIA 3DEFA 3EMKA 1TXGA 2QHXA 3AL3A 1TFUA 4B85A 5JQWA 1RI4A 2QU7A 3ZE8A 3ZUPA 4MVCA 2NAFA 2ZRIA 3VR5D 4YMLA 1VMIA 2CFCA 4CMAA 1WNTA 3MXOA 2QMZA 1XZNA 4P2GA 4BZPA 3AIIA 5JMWA 5KAPA 1U2GA 3CW9A 2VSXA 9ATCA 3H05A 5FWYA 3AM5A 3RU7A 4IIUA 1H9CA 5U4XA 1Q1AA 2XNSA 5BR7A 1EBFA 4C7VA 4DGQA 1YI8A 4F2WA 1W47A 1Q3KA 1Z56C 1BN6A 1NVFA 4Y2JA 3MGGA 4A26A 3DMPA 2W7TA 1WLSA 2WWXA 5B7NA 1FNBA 2DBZA 2VT7A 3ZVMA 1ST3A 2Z1NA 3R5JA 3UUWA 1Z15A 2NW6A 5KU1A 5L3VA 1JW9B 2GKOA 1U6IA 4O5AA 2C59A 3TZHA 2XPCA 4AMUA 4PZ9A 4HG2A 5I45A 1Q0RA 5H7XA 1K68A 1DIGA 3T94A 2CV2A 3M6UA 3LUFA 1SR8A 3C3EA 1N9ZA 2HWKA 3DZIA 3PFHA 1NJ1A 3RWMB 4AWXA 4BGIA 2H4HA 1JFFA 1E2LA 1XZDA 3DZDA 4DZTA 2WHPA 4ERNA 4MJLA 1EWVA 3CZAA 2R44A 3RRYA 2FN9A 2FMTA 1E3LA 4HLNA 4R1LA 3V1NA 3E18A 2GD0A 3CLHA 1R8JA 5D84A 4IIYA 3PK0A 3WJ7A 4XSGA 5EYPA 1ZRHA 5E95A 1SXJD 5HOQA 1S8NA 2AFHA 2P2CA 4W63A 3I9JA 1B26A 3PGLA 4O2BB 3V8BA 5IWCA 1WMFA 3W6OA 4DZRA 4WFKA 2A5LA 1JS1X 1PR3A 2VCYA 1DUVG 1MORA 1N2BA 3T54A 2PEZA 4W5QA 3LCJA 5IW8A 1I7PA 3BMQB 3WKAA 3ZDDA 5CPFA 4NZOA 4G97A 1SQ0A 2GSWA 2FK7A 2EDCA 2OBXA 5DHUA 3H1BA 4X6UA 2J4CA 1IN8A 2GESA 3VJRA 1EVJA 5F12A 1Z5UA 3WY9A 4F6RB 3HSYA 3EG5A 1QIEA 1XMOB 3HLTA 3UT0A 2GWHA 4XRRA 1V3VA 1XF1A 2ADOA 4HP8A 4N5DA 5LBTA 1G60A 1T9HA 4IIJA 2JHAA 4J91A 3Q10A 4AY4A 3DA8A 3GFBA 3D3WA 5IBPA 4KJXA 5KDLA 3D2AA 1C3OB 2FPIA 1VBNA 1BJRE 2ZR7A 1PT7A 3EPPA 2XB4A 4M7WA 2KBEA 4M49A 5TPWB 4KPEC 4O4HB 1O0CA 4YA6A 4DXAA 4US2R 3VX3A 1Z7YA 1GT91 3OKAA 4Q9HA 3C6YA 5ER9A 1BU8A 2K7FA 2B82A 4ZZ0A 3M1IA 5T3UA 3O1IC 3ASZA 1Q74A 4OYYA 4EF5A 4UAUA 1TK3A 3TRHA 5GTDA 2ODEA 3GLGE 1PJRA 1ZK4A 1MV5A 4V0LA 3QA3E 4FHCA 3L4JA 2AXPA 3W6PA 3OQOA 2XTZA 2BP7A 1KE2A 5A4DA 3WLEA 4HHEA 3VPBA 1AHHA 4GR4A 2IF0A 5DEOA 4BX8A 2NO4A 2ZYHA 3KT3A 4YQFA 4DR2B 1R37A 1Y63A 1KU0A 4ZAYA 1BZYA 4KR3A 2O3TA 4AC9A 2EP5A 3MCAA 3IBTA 5F73A 5IDWA 4F4IA 4BVGA 2WHYA 1U0NA 3DDOA 3LUKA 1Q1BA 3IXQA 1G0OA 3DT9A 5FA8A 2VEDA 2O48X 2QTRA 1U7WA 5F5NA 5F77A 3DL0A 3I2YX 1PZNA 1MW9X 1U7HA 2NSYA 3A3OA 4KDRA 1MIOA 1U2PA 3QVWA 2H52A 2G3YA 3CUKA 3JYHA 4G4IA 5JNWA 4NDAA 1NATA 1GAJA 4R16A 1HTWA 2P68A 5IH3A 1ZH6A 4TV9B 1BDJA 5D7BA 3VUEA 5HUHA 2GK3A 3A1CA 3WRXA 4BQQA 1VG1A 3AUTA 5COBA 3ZWQA 4QFCA 1T1SA 3U19A 3DJFA 1B8UA 1ZHHA 2W8BA 2WZCA 5KC8A 1I4DD 3M6VA 4Q4LA 3DV2A 2BZSA 4TXHA 5E9JA 2BZ0A 2JBWA 3GEHA 1DAMA 4G0WA 1UL1X 4G1UC 5EGNA 3TKLA 2TS1A 1P6UA 2ZUUA 1YZGA 2IP2A 2GA8A 4TTPA 5DU2A 2B0CA 3TNJA 3UW3A 3H1PA 1I30A 5LZ4A 4L5JA 4CCYB 5LZ9A 5JATA 1NR5A 1MC1A 3WIDA 1WJGA 5I7AA 4JI6B 5JVDA 1NXVA 1TM7E 3TEJA 3IUBA 1O94A 3PJFA 1JR3A 2GZ1A 2G0NA 3KPJA 4QDZA 3SVZA 1FJ2A 1E92A 1QIGA 1ULTA 1EG7A 2FX5A 5FBLB 1AHIA 5E7IA 1IWPB 5NULA 3RODA 3WSVA 3CVXA 4U2FA 4WRRA 3QITA 4K9QA 3W78A 3ZXUB 5E7MA 1X3SA 2XAAA 1C4WA 4QVKA 3LI2A 3JU3A 3A6DA 4UU0A 4YDHB 3R9XA 4P7GA 3TQCA 2HREA 3BWYA 3IOMA 4GKAA 4JLDA 2Z2IA 1MX5A 5C37A 2YC2C 1RE1A 3ZWPA 3KV1A 1V7PC 1AMUA 2A9FA 4N1AA 2INGX 1DNPA 5TARA 3TOSA 2WQ7A 1E8MA 2O1SA 4ME6A 4MCIA 4JX8A 1AB5A 2FG6C 4K8RB 3CCCA 2WWTA 2GXQA 1PGJA 3PPVA 1UAAA 4NESA 4ARAA 2QJWA 1J2JA 2VIIA 3GT4A 4QGAA 1GPKA 1BXKA 1A50B 4DARA 2Q5LA 3HN6A 1X87A 2A7XA 2EXXA 1X9IA 2W2KA 3OTGA 4S1OA 4N6GA 3ZG6A 4EAQA 1DIOB 2FF7A 2D2EA 3DCNA 2IYXA 3FMPB 3ELBA 1RBZA 4EQZA 1C30B 2I1VB 4WNYA 3JYQA 3IAM1 4DCNA 3PUXA 3PFFA 1E9VA 1COZA 1OCEA 1PGQA 5BWLA 3EULA 2X40A 4F38A 3UQZA 3GFFA 2O7VA 2A78A 2AYYA 2C0PA 1O9HA 4P4TA 4ZI7A 3GLIE 3KC2A 3KIPA 2HSGA 2H4WA 3WRXC 1BCSB 5AM5A 1DJOA 1GDDA 4TVSA 4YALA 1ISJA 2DEUA 3IMGA 1NHWA 4D4LA 3IGFA 5LB4A 3QJ5A 1Y7TA 3AH8A 1W49A 3GVHA 3BF7A 3HA3A 3LSTA 1TD1A 4GI5A 4ZTUB 5A3VA 3DZFA 2F7SA 3KT0A 3RARA 5TPZA 5EJ5A 2GAFA 5FHRA 1S3FA 4RANA 4KG7A 1NVVQ 4TT3A 2C4MA 1ZD3A 1XCLA 2PCLA 4FNOA 3I8SA 4MHSA 4CL3A 5JAMA 4G9BA 3J80A 4BDSA 4G5OA 4MWBA 3VC3A 1FDWA 1EQUA 4NYIQ 3R7NA 3MERA 3KAKA 1G20A 1KC3A 1GLNA 1YCDA 2D7JA 3IUMA 2YXPX 1NVMB 2ZZKA 1KZYC 1ML3A 3IQFA 1NNI1 3L49A 5IAJA 3JSAA 2QUHA 3PYMA 3EFOA 3Q5EA 4YROA 4J6EA 5DM60 3GELA 4BV9A 3V00A 1GCUA 2BFCB 4KZPA 2A1UB 1E2NA 1ILWA 1NJ6A 2QMOA 2YY6A 2I4RA 4RGBA 3VR3D 3WGYA 5CLJA 3TBKA 1T9GS 1PR2A 2WTNA 5JWHA 1J21A 1TC1A 4FSXA 4KO1S 4CT4B 1ZRMA 2C78A 2NQ2C 2O5RA 4BLWA 2C0QA 3UJAA 4IHQA 1AZLA 1TECE 3QUQA 2GILA 1YI0A 4RZUA 1P5JA 3SNKA 2OVFA 2XWPA 4E2XA 5HQJA 4ZI2A 2A9QA 5SZIA 1LBTA 4FINA 4N76A 4DADA 2YYSA 1SCNE 4LZOA 2ZFUA 1HFWA 1X7XB 3KQSA 4AS2A 4LTDA 5B7PA 2RIRA 1YBVA 4D97A 1TEVA 4BYGA 3PC4A 3OQPA 2Z0MA 2PZLA 1JIVA 2FN8A 1XA3A 2WZDA 3I37X 2ZWMA 3H4IA 4II7A 5C1BA 4ZAVA 4QHSA 4BN4A 1ZI6A 3TZLA 1G2OA 2PKEA 1AC5A 1RXCA 3F8WA 4B81A 1RJFA 4EG8A 1NUTA 1VKNA 3E2PA 2Y2UA 1TB4A 4MMZB 1MDBA 1D3AA 3IUYA 3MA0A 1AF4A 2RGCA 1AIPA 3I2KA 3O0DA 4P7FA 4MRMA 2GBLC 3CR8A 3GQVA 4L3VA 4Y30A 5J4KA 2EP7A 3FOAA 1V8DA 3DHEA 4YX9A 5IEJA 3M6FA 4D8YA 2O52A 1R0ZA 4I4TB 4DOMA 3WXBA 4YWJA 4A3SA 4LUCA 3T12A 2O20A 2W71A 3FSJX 4DJJA 1VYVA 3AJEA 4RKRA 3LZDA 1T5SA 3ADBA 2RHWA 2ZUEA 1PK9A 1CUBA 3B7PA 1L0BA 3AEKB 4I5GA 5LDGA 1U4SA 1Z4MA 4RVNA 4JI2B 1JGTA 1G19A 4MULA 2XZPA 1W2HA 4NL4H 4DCMA 5JU6A 4G09A 3Q98A 3DBHB 3R4CA 1K3TA 4DEXA 3RROA 3VYTB 4WA7A 1MV8A 1KGSA 2FU5C 1G3QA 2I1LA 2ZI4A 3EY9A 3G8DA 4F5WA 3K70B 1JH8A 1CDDA 2CJPA 2CXHA 1XMIA 2HRRA 5LZ5A 5KYVA 2G9VA 4TLLB 1GRVA 1SHZA 1NXXA 5HJEA 3Q7IA 4IF4A 3GT0A 1C0KA 1Y6RA 4LMBA 3KJIA 1NN3A 1COWA 3PBKA 4JC4A 3IR7A 1YD7A 4S2UA 5EHGA 3ZCVA 3SHQA 2YN4A 2F62A 3GAMA 3RVBA 1T3LA 3IHKA 4G67A 4Y2UA 1P4AA 3H9CA 3L77A 2CJYA 1ESNA 1BKYA 4C6TA 3U09A 2IF2A 1MHPA 4GM1A 7GPBA 4MP8A 1C1XB 2X4LA 4TQGA 4X93A 4B71A 4IDDA 2AOUA 4Q4CA 5G2OA 1NUUA 2BGTA 3G2JA 4NLLA 4FOPA 1C1YA 3N6VA 5EVJA 3B9RA 3MINA 5I7RA 1Z0JA 5DHAA 1IZ0A 3QE9Y 4R1QA 5DCYA 3RRMA 1C7RA 3BXGA 1PFUA 2FPGA 2GVDC 2PXXA 3KZNA 4ZK6A 1SXQA 1YJQA 5AW1A 3JVEA 4I9FA 1KH3A 3KKZA 5BSGA 2PHZA 1MW8X 1O6GA 3A3PA 1KRXA 3H8VA 4BQRA 3HL0A 3D6FA 5E4JA 2HJHA 3SEFA 3IPAA 2WU4A 3NDJA 2F8SA 1GCIA 2CYBA 4K86A 2HJRA 2OC4A 2QX8A 4GUDA 4URUR 5TT0A 3VZQA 4PC7A 1S9DA 2ZUBA 3CGWA 5JNSA 2RHBA 2Q6KA 3AC0A 4P53A 4KCGA 1FLVA 4ALIA 3DLTA 5JEDA 4PZZA 4L74A 5FA5A 2F8MA 4TYWA 4U9IS 2QTVB 4UVEA 2C5SA 1M0WA 2EBHX 2O2HA 4BGUA 4KVAA 2J8ZA 3ZJ5A 3W5DA 1V9LA 3H9GA 3SEAA 3FPLA 1JLSA 1GSAA 3G2QA 1Z47A 4H1HA 1MVOA 1IJBA 1H4VB 2GA9A 4YRLA 1GA1A 4AW9A 4BJ1A 2P2SA 2VNSA 3MF4A 4D46A 1P62B 4LYHA 1HGXA 2QJTA 4UULA 3E35A 3P9NA 4M0PA 2HSWA 3B6EA 3EXEA 4F7WA 2O1EA 2VPTA 4YTEA 1FUKA 2HWYA 5FOVA 3MILA 2RHGB 4EQ6B 3UPUA 3THXB 3IIIA 1FSGA 5JJLA 3FOFC 2D59A 3GPLA 4YV0A 1GZ4A 3A4NA 3BMCA 4WBXC 2H29A 2IIPA 1A8SA 3HSKA 2JIDA 4Q18A 4W1RA 4R7GA 4BP3A 1PJAA 4BZWA 4E31A 2D2XA 3C7DB 3WQSB 1F9EA 1V43A 1K08A 2WK1A 3EVNA 1OC4A 2K2QB 2OCLA 9LDBA 4BMOB 4L3OA 1IUKA 1NRXA 1ZP6A 2IY7A 3QNWA 4LZZA 5IN5A 5LYJB 3PJRA 4KFUA 2R6R1 3QVJA 1V7ZA 2ZSHA 1P33A 3MWYW 4IX9A 1VMEA 4YAFA 1CQXA 2ASVA 2IE0A 1KOFA 2H17A 2JD1A 5DWDA 1QQ7A 4ZVKA 1GGJA 4LRXA 2NV2B 3V4RA 2QLMA 4UDYX 2OXEA 2W4IA 3QKSA 1DTEA 4M9CA 3SFVA 1YNOA 3UJ7A 4F4UA 5LQAA 2PRZA 4OQLA 1LSOA 2OV2A 3SC2A 4EBBA 4J1TA 4M0KA 1UWLA 4AT1A 1Y5NA 2JJ1A 4P3XA 4BWFB 1G17A 1NXPA 1ODTC 3CVOA 4P08A 3SFTA 2J5XA 2Q5QA 4HGRA 4LJAA 4RA9B 4ZQEA 2RARA 4Q3NA 2QB5A 4WNAA 4OQPA 2AQHA 5GY7A 1JXOA 5DB4A 4D9NA 3VU1A 2IFTA 1BS9A 5C4GB 3UV7A 1ZOOA 4E5YA 2Q4EA 3S81A 2ZTMA 4R8LA 5CFMA 3WAKA 1IN1A 2H85A 4K9OA 4QOFA 3W5IA 3WZLA 4QX6A 4XIFA 1V0JA 5KSPA 3ZIDA 2PQMA 3ED5A 3EVEA 5EE1A 5EP1A 3TEMA 1SA0B 2I2CA 2HMUA 2WSBA 2F9MA 1Z6AA 3L3BA 4OJTA 2DCMA 1J6UA 2XCIA 3PIRA 1NLMA 3ZZTA 1Y6ZA 2WNIA 3TG8A 3QYPA 5IJXA 1Z83A 4RACA 4BBZA 4J0QA 3WB1A 1JHXA 1D5WA 3D3KA 1TO6A 2I2XB 2QTTA 3NI2A 1KK1A 2PKQO 3TSCA 1OFUX 2X3FA 1FNMA 5JS2A 4M37A 2L69A 4LRTB 2Q8PA 3HB0A 2IEAA 3E2IA 4O4IF 3QMMA 4F2PA 1IZYA 2ZJZA 2ZJ7A 3HJAA 4B6PA 3LYUA 4PCUA 1DCKA 1C8KA 2G08A 3IBYA 1WB9A 5A6SB 4YAEA 3ESQA 3MJHA 4JOSA 1W2WB 1EHYA 1Z5VA 5C5DA 2D5LA 1QFXA 5JMOA 4PN7A 4QDTA 4JJKA 3G7NA 3HYLA 4KWTA 2J3MA 1CYDA 1X1BA 3OWOA 3PUZA 3ZDZB 4YRAA 4Z1OA 3VU0A 3CUSA 2AFIA 4R8VA 1JP7A 5F52A 2J0EA 2XYRA 1N1EA 5TGZA 1S6YA 1ADCA 5EIOA 4IDOA 2A5DA 4NXMB 1T2EA 2Q5IA 3LC1O 4LI3X 1NQVA 4ZO9A 3JWHA 3S3TA 1Y82A 3P20A 3T3HA 3RRNA 3CEPB 4N7RA 3W2IA 2C9YA 1LPNA 3RU9A 4GKVA 4QA9A 3TQIA 2CL0X 1EHCA 1XFAA 2EFYA 4D80A 1QZXA 1ZW6A 1KVQA 3PLRA 4J1TC 3WYGA 4BATA 4B8YA 3QWFA 2PNFA 4G65A 2BE7A 1AF7A 1XEWY 2PKCA 2Q1TA 1F48A 3AB8A 4E6PA 3J7AC 3LK7A 3IUEA 1QBKC 2FMXA 1BXZA 4GLJA 2EC5A 1LY1A 3EQZA 1XJ0A 1Z4JA 1Z7BA 4NBNA 1O5TA 4JLBA 1GLGA 5DYGA 3ZWYA 1DLIA 1ENYA 2ZRBA 2FETA 2Y1OA 5DHFA 2XDYA 2FP4B 1RHKA 1BVRA 4PM4A 3SU8A 3SIXA 3I05A 3UHFA 1SXHA 2WSSA 3KZKA 5KKAA 1FXWF 1VLQA 4D9HA 2ATVA 4G0PA 3FFBA 3ZCSA 3JV7A 3SHOA 1PVOA 1SKYE 3HCEA 1MNAA 5E6UB 1U8UA 2FR0A 5LJIA 3WAGA 2G07A 1CSEE 1J8QA 2Q5CA 2HDHA 1U1EA 1KP9A 2JD2A 5CTJA 1A69A 1X7YB 2DBRA 1P5HA 3L1KA 3SLRA 4DB2A 2ZQYA 4TTQA 2EZ8A 2UVPB 1YQDA 4B7CA 4ZPJA 2MDTA 3H04A 2IV3A 2X8BA 3GJZA 4KPFC 4JBWA 4TXJA 5BUCA 3C7KA 5KCMA 4E30A 4NJMA 2R5FA 2Z2JA 3VV3A 1QGDA 3N59A 3JQDA 3TOZA 4E2WA 5LP6B 5MN6A 4E5MA 1GCGA 1RNLA 1NVWQ 3H13A 3PGA1 1MTOA 1PG5A 1PV1A 2DFLA 2JGFA 3H16A 4RM2A 4Y9TA 3U7QB 4DMUB 4EARA 6REQA 2REQA 4M89A 2EIXA 1KYVA 3FCEA 1GKYA 3M4JA 1MABB 4JIMA 3TTVA 4EGAA 4ARIA 1E64A 4IKPA 4LWOA 3T5CA 3NALA 3QM1A 4D44A 2BOVA 3TKAA 1M8GA 1VB3A 3OF2A 4DMLA 4IWYA 3KPVA 3KCNA 1Z68A 1OD6A 2ZYSA 3ORQA 4RK0A 1P5ZB 1C41A 3UMFA 2SCUA 3OEWA 5BXYA 3U40A 3H0CA 1JDTA 3L6UA 3NGLA 1J90A 1YBMA 4Y1EA 2AMLA 4RE5A 1U1GA 3C3CA 5HS4A 1YL5A 1WG8A 2CDCA 2QVBA 1N6NA 1EGMB 2QRPA 4FYYA 3WICA 4YRMA 5LWQA 4LNAA 3O4JA 5KPJA 3EK2A 3CW2A 1KQGA 1GPMA 1ZGZA 1DTSA 3I23A 2OHHA 2Q41A 3K2BA 4XGQA 2ZVJA 4EA7A 4ZOCA 1KHTA 2C7BA 3R6TA 4R84A 3T1NA 4A82A 4LF6B 3KXKA 2DU8A 4OQNA 4UM8B 3F67A 4RDCA 3IVMA 5FPTA 2G1AA 1MNQA 4Z1MA 5DNCA 5JAZA 5D1HA 4ESOA 3ZN2A 2E5FA 2KLBA 2P9CA 1NGSA 5IDYA 2X9LA 1NUHA 3I2HA 3TTWA 5EXXA 4MOWA 1JIXA 3AERB 2QV0A 4NX2A 4E12A 3M89A 1ILEA 1PFGA 4BU1A 2YUIA 5K8UA 1ZI9A 2G67A 1K7EB 3K9FC 4I5DA 3DD1A 1CB0A 8ADHA 1BO6A 2NTJA 1EAMA 4UNNA 3WV4A 4YRIA 2OD9A 1IBKB 1XN4A 4RVUA 2VTVA 3D6JA 5K0TA 2F1KA 2VJCA 2F1OA 2V6IA 4PGFA 2I7CA 4QIHA 2GN9A 3QSGA 4OOEA 2P3SA 2OQIA 1GQRA 4Q3LA 2FSUA 1P91A 3Q3EA 1H8EA 1WP4A 3SXPA 3DW1X 1IZ8A 5IHPA 5IVIA 4IUYA 2WKSA 4V1CA 5IBCA 4AI6A 2R8RA 3CKLA 3UICA 4BWVA 2PH3A 1X94A 1B8PA 3Q0IA 4QWWA 2F4NA 5BN4B 3DUFA 2BFOA 3ZNQA 4HMPA 2V1UA 3LL7A 4L07A 3RAGA 1UODA 2ZTLA 3BG5A 3REGA 2PANA 2XWJI 1KA9H 1NRWA 1SC9A 2VJQA 2NSHA 3MGBA 3NBYC 3O26A 3P45A 1L2TA 1ESCA 3M7IA 3BXHA 4OJYA 2YWRA 4LZNA 4ZO4A 4EX7A 5JNVA 3LM8A 3A2NA 1N9GB 1X9HA 5JAUA 1X0VA 5FJJA 3RSSA 4PU0A 3BRCA 1T36A 4R3WA 1TPZA 2RGXA 2DXIA 1GXSA 5KSZA 4QQNA 3PYXA 2P91A 1AKYA 2IZ7A 2ZB3A 4RGQA 5EPEA 3WL4A 5ED4A 1EFRD 5K7SA 3AZPA 3TX2A 2CBGA 1MO4A 1P0PA 3KUDA 4KFCA 5JW6A 1DBPA 1NASA 3DLCA 5GINE 2HN9A 3TH5A 1QHGA 2XMRA 1JLLB 2WD7B 4N0EA 4RORA 4ZQIA 2B4AA 2D0OB 3M5WA 4FYKA 4D8VA 4F60A 4IQ8A 3QYFA 3RFCA 1HC7A 2JHFA 3NKLA 4LF5B 1K8XB 3UXYA 1X77A 1WUTA 5EWJB 5F9HA 3VZDA 1Y4ZA 1Q92A 1L5SA 1VHWA 1ZFNA 2HPZA 5DBFA 3RRFA 4NOLA 4C0AC 2I71A 1OI3A 4JGIA 1QNLA 1K97A 4WASA 1RXYA 3CGGA 3HY4A 4YRBA 2CFSA 2QNBA 5IUJC 1MB2A 1YK1A 1PFQA 5E6SB 4EFLA 5JDCC 3UVEA 1DC8A 1N7JA 3SHTA 4CM8B 2J5KA 2H57A 3BWDD 5CVDA 3GAZA 3DO5A 4CT5A 5JJCA 3AETB 2VDUE 4DILA 2P69A 1JEAA 1EFLA 1ECJA 2YIDA 4FYPA 4AO6A 2LE0A 5C7LO 3NATA 5IAKA 3G0CA 2NZYA 3CPJB 3EBPA 4KH1A 1LDNA 4OG2A 2NT3A 1BRTA 3ZK9A 2D0DA 4EECA 4IQFA 3OCVA 1WU7A 4LHVA 5H9VA 3DL4A 4TKZA 4DVGA 3DNPA 3PJDA 3TI7A 2SNIE 3IP7A 4U2KA 3VJKA 4BGDA 5I7WA 2ZT7A 2CSUA 2XUHA 3NT5A 3E3LA 1S1CA 1WDMA 3O9ZA 1GJRA 2EEPA 4IZIA 4O2AF 3IE1A 2RH5A 1X7WB 3L79A 3WIOA 4BO7A 3UAVA 4R6XA 3TLKA 5L3SB 1UIRA 3HC7A 4C2AA 1IBLB 3FPCA 4XKJA 3U3RA 4GU5A 1F3OA 1F4PA 4RF3A 4ZHQA 3B1YA 1R66A 3AUSA 4WD3A 2XT9A 3LUHA 4DAEA 5JFGA 2DWCA 4BQIA 1UFVA 3BEOA 3CNBA 2B99A 4JLUA 1IQRA 1WPGA 4R54A 5DT9A 3RYHA 3RLIA 2E6KA 5HIMA 1W87A 5GZ6A 2HU5A 5HDQA 1BDMA 2WA1A 3C3DA 2WFLB 4KXXA 4WZZA 1T15A 3BL6A 3L4SO 1Q15A 3QLVA 4U0KA 4OP1A 4QG3A 4N41A 2QX4A 4EB3A 2QRQA 3JRXA 4MRNA 4X84A 2ETXA 4LA4A 3U6KA 2GFQA 3RHTA 1QQBA 4W5NA 1GPH1 1CEEA 2N9UA 4CTNA 2I1QA 1MTZA 1T5DX 2HWWA 2J9XB 4BASA 3RG8A 2J5QA 3REQB 4C14A 1QDEA 3CJTA 1AKTA 1DV1A 3C4VA 4PO8A 3UJHA 1YRWA 4XQEA 2R1TA 1ZK3A 2H1SA 3GJ3A 1N2HA 1UDAA 4LTMA 5ELMA 4BO8A 4ASUD 3EH1A 2XGMA 3CCFA 2B1QA 4IUDS 2PL1A 1XDSA 4QOSA 3BD7A 1VSTA 2LW7A 3FVTA 3ONEA 2OV3A 1L4HA 3W5SA 4MV6A 1L7MA 1YS2X 2QI9C 4LBVA 1GY8A 421PA 1RADA 4EJ2A 1WVIA 5DTEA 4E88A 3GMDA 2CXXA 1ZH8A 1ZZEA 3FLBA 1SBQA 3RSFA 3EMVA 5AVJA 3STUA 2EKZA 3K73O 5GVSA 1IQPA 2C2HA 4GOKA 3SYLA 1GKUB 3HL4A 3JQGA 2AN5A 4A0RA 4DHEA 3ROPA 2B1RA 5KDDA 1FW8A 2EBFX 2CUNA 2BCGY 2GN6A 3FSEA 3R5FA 3IXLA 2ZT6A 1V9SA 2JAXA 3K6RA 2VYCA 4R69A 2YV4A 2FMHA 5TDHA 2AWOA 3FMGA 2ENWA 5EXTA 1A9OA 4P33A 5EZ6B 1TLFA 2W70A 2AKYA 1FX1A 5HX7A 4YAKA 2CXQA 5B57C 3RTGA 2AK2A 4JJIA 3ADOA 4U5QA 2OWEA 2CMKA 3D2BA 5K0SA 2VLBA 1F2TA 1BD3A 1JDVA 2HA6A 4WXHA 3FM9A 1Y1LA 2IBTA 4OYLA 2BKXA 3TSZA 1GQ2A 4KP7A 3TQRA 2CC2A 1E99A 3OUZA 4GXRA 4ESVA 3MLAA 4M9UA 3WI7A 4O02B 3DF9A 4GX5A 2OQRA 4U2CA 4CMIB 2OBFA 2PN1A 2PWAA 3UHPA 4BBAA 4X24A 5MFZA 3QBDA 4PRYA 1FRNA 4WKGA 4GR9A 4DNXA 3O4GA 1T4CA 4Z7OB 2R6FA 5EWMA 1NW6A 4QJBA 1P7VA 3C8DA 5H5JA 3SBOA 1XTIA 1P72A 3C8UA 4TN1A 3QY9A 2D06A 2R0QC 1J8YF 2WW8A 4Q4JA 4JHLA 4R1NA 2VJOA 1O77A 4D7AA 3BMNA 3KEGA 2HWXA 3CSSA 3ICPA 4TTVA 5CGQB 1KKLA 4WMLA 4C7MA 4Q3EA 1R8XA 2Q5FA 2IK8A 2JBAB 3BWEA 4RK4A 2OSBA 2HXSA 5ECWA 1J25A 3THOA 1SB8A 3AVTA 4AJKA 2GX6A 4LNHA 4K0RA 2FSSA 3D8RA 3FOWA 3IAAA 2QZZA 4M8NE 4BZXA 4R81A 5LWHA 1YJCA 1ZMOA 4DNPA 5U9CA 3C1TA 3MOIA 3LKVA 3KETA 4QDUA 1W4ZA 4I7EA 4TTRA 2BF4A 1U0JA 4UUBA 4F8EA 3W5HA 4BUJA 5ECGC 1BH2A 4N3AA 1G3MA 4XDGA 3HKBB 4CLXA 2HJSA 2GJSA 1H2FA 4RK1A 1QE0A 5KSWB 3BPSA 5HOEA 1O95D 2ZJ6A 4X61A 5ELXA 3UAWA 1ULBA 3IE2A 3L43A 4MQEA 2Q5HA 2ORVA 5DP1A 1X1EA 2CXUA 3GQBB 4EFKA 1LLCA 1AQJA 4V03A 2E1RA 3DVQX 4NBUA 2NUPA 2V6BA 1ZNQO 4Q39A 3T5DA 1G4HA 3N76A 2PGNA 1Q0UA 2CHVA 3LIIA 2I2AA 5K4AA 4CDGA 5ICMA 2AJTA 5EIHA 5HTOA 1AUVA 2HRCA 2XB8A 2LV8A 5LBUA 2FE4A 2P11A 4ZT5A 4OUKX 5G1NA 4EB6A 3CPHA 3GMSA 1HDYA 3C97A 2Q9BA 5AI6A 5FPYA 3BK1A 5A3QA 4F71A 4F92B 5CK5A 5SZKB 2REBA 3EZ9A 4HQLA 3WE7A 3UMYA 4Z7NB 3GRFA 2OCGA 5I9BA 1W4LA 1C50A 3B9BA 1YIAA 5MN4A 1MG0A 3RTDA 2V4MA 1AS2A 2Z6AA 3NCHA 3VHXA 4P4SB 3OECA 4ZGGA 4BOYA 3BFPA 1U04A 4HTAA 4V2IA 1YK0A 2VAVA 4HQNA 2HLPA 5I47A 4J4HA 1BDBA 4WN3A 4C87A 1W96A 1WM1A 3LCRA 4FCVA 1EYZA 1GO2A 4MRPA 3S55A 1GQYA 5KVCA 3CIFA 2PFGA 4OGFA 5AMXA 1EGQA 3M82A 4DLSA 5TGDA 2CMGA 1L1FA 5AKIA 3VI4B 2PT6A 3RV3A 4A0GA 3GCGA 1Y3CE 2NZWA 3U5TA 1FJXA 3GUZA 2IXBA 4PVDA 4OHRA 1XPRA 1FMTA 2QV7A 3C3XA 1EKXA 3E48A 3WWOA 4DR5B 4R8SA 4PWYA 2PVSA 2GD2A 3DZBA 1HDXA 3I4LA 3QW2A 4MW2A 4PXSA 4UAVA 4XWAA 3ZLVA 5BOSA 5IT4A 2WPDA 2NO9A 1RYNA 4ND2A 3N0WA 3LHFA 3R8FA 3KB8A 3WLSA 3EVAA 2OK8A 1TVKA 1N75A 2CZGA 3RFTA 3E0XA 1ZUNA 1R6BX 1T6NA 3B3JA 3HACA 3I76A 3O0TA 1H6AA 3QW4B 1A9TA 2GJ9A 2XKJE 2XLCA 2R00A 2DE0X 3MOGA 3HUUA 4MQBA 2WE8A 2KPOA 3H2IA 4XD2A 3M34A 5FNVB 1A7KA 4INAA 4E7OA 4UBLA 1QGED 2Y6VA 3PQ2A 3S2UA 3H3JA 4QQFA 3IKLA 2GO1A 1NL3A 1SIBE 3O6VA 3TFQA 4R51A 4V3CA 2X5KO 3K4QA 1XZHA 3STHA 2JH8A 3LAWA 5DYWA 4F2GA 3N2KA 3H7AA 2Q9UA 1B41A 4CKWB 1CIPA 4E5SA 4QYXA 4B4UA 1K0FA 3R7WB 4QODA 3UWKA 2FPOA 1I4WA 4LE0A 1MO5A 1P0FA 4Q4AB 4LZWA 1E2QA 3HVJA 4FE7A 1JJAA 1WZNA 1FP6A 1OX6A 5EE9A 3IURA 1RQNA 3MCZA 4PYIA 3TLBA 3FBTA 1A2BA 1TQ2A 4E1AA 1PG2A 1RKQA 2BMEA 5JXGA 5JWRA 3H5TA 1YFLA 2IXAA 4RPLA 2RJOA 3P9RA 4F9EA 4G0VA 3SJUA 2P9GA 3VTKA 1BMQA 5C7OO 4QYSA 4YWHA 3WB0A 2XGJA 3U1BA 2QG4A 3PWSA 3ULKA 1P9NA 4JP2A 1NM5A 3AP3A 1C7JA 1PP4A 3K0FB 5E1MA 1V5FA 3SS7X 2D5IA 3ZY3A 1SHTX 1QAQA 5C1OA 2R87A 2RI6A 4NEGA 3F5SA 1PN3A 4Q7LA 2C3PA 2ZSUA 4PLGA 2F8LA 4DSAA 5BWOA 1RRFA 2B35A 3IX7A 2PGDA 2BBOA 3CRW1 4ZQHA 1OFTA 1SK8A 2WOJA 4DLYA 3RG2A 4EPTA 1NJFA 4GYYA 3R0QA 5IF3A 3CZPA 1FSFA 3T35A 2ZSBA 4B09A 3KQPA 1YE3A 4ND5A 1G2QA 1CZUA 1FP4A 1YE5A 3JAWB 3T9CA 3W4KA 2IP1A 1UAYA 1M9NA 4JYMA 4M8KA 4D92A 2VJAA 2RIPA 4F2HA 2WU1A 4UM5A 4BBJA 1Y5MA 1NXOA 1HT3A 3K6SB 1HR0B 4FEAA 1UKBA 2FW9A 2EOAA 3GUCA 1NN0A 1G21B 4EZIA 5B5SA 2I80A 1XQYA 2B2NA 4E32A 5TT1A 5B7QA 2G6TA 3L6CA 5KYXA 2JKZA 2ZYUX 1CUZA 2QMEA 3H97A 4EHAA 1EJ0A 2QGNA 1CHNA 4UUOA 2DH5A 1P1KA 3WDMA 3OIFA 5K99A 3MBKA 2YHIB 3UK0A 4AIIA 4KGVA 4FFVA 1U9YA 4NJEA 3HUTA 1S4QA 1AS0A 3LDFA 3AONB 4RXUA 3AEQA 1EESA 3R9KA 3SC6A 1UDRA 3O47A 4L95C 4H60A 1Z38A 1RAFA 4GX0A 2R7NA 2Z5VA 1N6LA 2LBPA 4M7OA 3DTYA 4MK4A 2X4GA 3U4DA 1NBOA 4Q12A 1OH8A 3B1ZA 3W79A 4EZBA 3MIZA 5JZMA 3UKOA 5DNVA 4MGZR 5AW8A 1KEKA 1FXUA 3OI7A 3IQGX 3VBCA 1XQ9A 5I01A 1F3LA 1LJUA 2ZIEA 3LX8A 1D03A 3N8HA 1V1RA 4ROTA 1JRLA 2G06A 5DNAA 3F9CA 3VH2A 2NU7B 4XDYA 3WBBA 2I91A 2ZBDA 2X5NA 2ZAIA 3CNOA 2D5AA 2FLWA 1WBDA 2V6JA 2OHFA 1P8AA 3D7KA 1BQ4A 1OFHA 3IUJA 2F3QA 1ISHA 3KOOA 3ND9A 4FK8A 4Z49A 5LNK6 1FK8A 3VJLA 5A5FA 1M66A 2RC5A 2SBTA 3MTEA 2KWIA 3AGPA 1SQGA 2CWWA 2FZWA 4QOHA 2X7XA 1BE8A 2VJNA 2BTQB 4BMDA 4JVOA 3RPEA 4QNMA 5JJKA 2JNWA 1I9GA 2LCQA 3WP0A 2OM6A 3E4DA 3TSOA 5BPHA 1NAIA 2VYQA 1HDRA 3BE4A 4PLFA 1LK0A 1LRKA 3IYLW 4BO9A 4EUSA 3DTVD 2H3HA 4ZRMA 4EFMA 1RABA 1Q83A 1H0HA 3OCZA 1U3TA 3C24A 4LY3A 4QYIA 3DOUA 2W4QA 4DLLA 2WKQA 2V8OA 1JIKA 1F0KA 3NIBA 2GASA 3LVFO 4MR8A 4TXLA 4ZO6A 2J30A 5HF5A 2UUBB 1NUSA 1SHJA 2O8EA 1CJMA 1W8IA 2GCEA 4NCXA 3K09A 5JRDS 3FRJA 1EEXB 3USZA 1I51A 1Z6XA 1N1DA 2J3KA 2GJAA 1TK9A 1EQAA 2ZCJA 5SY6A 2C82A 2MU1A 3GH1A 1LLQA 1MR3F 1N6RA 3PWZA 2E9SA 4MSUA 1X19A 1L5YA 5EMHA 1K0UA 4KXMA 2WM9B 2W6NA 2IUUA 1BYUA 1GR1A 2OO5A 1QHNA 4REQA 3FYUB 4C7JA 2ARKA 1YMQA 4HZGA 3R44A 1UT6A 3D59A 621PA 5SICE 3HU3A 2HI0A 5KOHB 1XP8A 3EG9B 1Z5OA 2BMAA 4QTZA 5IEBA 1KI6B 1ZH4A 3LP5A 3IPXA 3SE0A 1FF9A 5DLQC 3G7UA 1XGKA 1KR5A 1XB2A 1B6SA 5SY9A 2CLLB 4EHFA 2O5CA 2VXCA 4R3UC 4X8LA 3D4IA 2BFFB 3FCUB 5DHRA 5K3DA 3ME5A 4Y9UA 2GO7A 1DEHA 5BV7A 4IDFA 2B5OA 1KI8A 2NZ8A 1BQ3A 4ZI5A 2F8TA 1SAYA 3RBAA 4BNFA 4KQXA 4QEKA 4RTKA 1NVGA 1T5TA 1NMQA 1RC1A 4MUKA 1TZBA 2PUJA 1GSOA 4N7JA 5DKFA 4ZYLA 3AHGA 2WTEA 2IHBA 4IDNA 2GEFA 1DJNA 5LXTA 2XTNA 3DVSX 3DW3X 1SBTA 1FYDA 4OHYA 1ISGA 3O94A 1RC0A 2YJ4A 3MMPA 4MINA 4Z53A 2F3RA 3FHOA 1XU9A 2GERA 1LI7A 1U1CA 2DSNA 3TXXA 5A1JA 2FDXA 2VPIA 1C2YA 2WM3A 3TDMA 3EAFA 3ZY6A 4FD3A 4D9FA 5HVNA 3SBDA 1P4HA 1GRNA 1XCOA 2BR4A 3BGOS 4MW7A 3CXUA 2H63A 3OUTA 4JSRA 2JDID 2KE5A 3HV0A 4GYWA 5JNLA 5AKLA 3PFNA 4YK7A 3ORHA 4GVXA 1FSZA 4LG1A 4TS4A 3UTDA 1OLUB 3VTAA 2HA0A 1F6WA 1K2WA 1TM4E 3B5EA 3K09C 3OFND 1WHSB 3MS2A 3OLVA 5DSXA 2O5VA 5CHEA 1JWAB 2POCA 1XCGB 1RHRA 4IMJB 1E9EA 4AG5A 1MGPA 4YBZA 3NDPA 1XQ1A 5JH7F 3DDCA 4LFCB 3UM9A 1M34B 2R8OA 2HDOA 1KY3A 1UBGA 3DVAA 1P80A 3VC7A 3BD9A 1E7SA 3V1TC 4MYRA 3W1EA 2FFAA 1T2NA 1V26A 1IHPA 3MJFA 1WQ3A 1RMYA 1BCRB 3BCHA 2QT9A 5G4KB 2OZLA 5IJWA 5KEIA 3RIXA 4N8SA 1G7SA 2CLOB 4H6PA 4YRTA 3ZI7A 2PAAA 1U3CA 3HXQA 2O8BA 4L8WB 3EGWA 4L9RA 2Z8YM 3DE2X 1UZAA 3RS3A 5HKLA 3ZV3A 3ZDFA 5E9QA 4ARZA 1P29A 5HRCA 1QP0A 2B4YA 4YCDA 5DNWA 2JLSA 3WBJA 3TNDA 3PICA 3OEYA 1A82A 3IPLA 1TGVA 5P21A 2Y1WA 4BO2A 4D56A 1OWOA 1US8A 1YKGA 1ZIPA 2VPQA 1WD5A 5KNCH 1CG6A 1SELA 2VJBA 2DF8A 4B75A 3U39A 2VH5R 3E5RA 2BD0A 3LXMA 3HR7A 1R1DA 4UHJA 4URVR 4X7MA 1EXVA 1IPFA 1QWSA 2VBCA 4AMZA 1D09A 3O7WA 3BAFA 3KEMA 4CETA 2DUWA 5K3OA 3QWAA 2EL9A 4BS9A 3ZY2A 5JLJA 2HTFA 3B3AA 3L6OO 1R5NA 2C9DA 2X8JA 4IRXA 5IMBA 1SCIA 2BEJA 4KIUA 4TMFA 2VVTA 4RW0A 4F97A 4MR9B 3SKXA 3SKVA 2IOYA 5FR1A 4C4SA 3LO8A 3MJRA 1FMJA 2NNLD 2P3QA 1ENZA 5AKYA 3RFUA 4JI1B 1NE7A 1XRNA 4JLAA 4AJ9A 3SEZA 3S8EA 3DZGA 3ZKWA 2O1WA 5LZ7A 4KFTA 3C39A 1Q7CA 3K1YA 2B7LA 4AN1A 1MJGA 4MCAA 1NTRA 3EDRA 3HBJA 1NLFA 4PBSA 3JXEA 2HHAA 3OH8A 3ZHZA 1NMSA 3BXPA 4HDMB 1QIIA 1JB9A 1OLXA 1Z08A 3MT9A 4LY6A 1H93A 1QK4A 4QU5A 1M2VA 2C0CA 1Y6QA 3ABSB 3NGXA 2OG1A 4N6NA 1NV8A 2I8CA 4E94A 5A9SA 4EBFA 4BFUA 1LSSA 4XJSA 1L7DA 1RM3A 4DCJA 1S2LA 1HDGO 2FB9A 4MQFB 2H8GA 5LA6F 1P1BA 5FWDA 4DDUA 3TVTA 3KXIA 3ZV6A 4BEVA 3T3EA 4ROSA 2HLDD 2PV7A 4YCSA 5K0JA 1K7XB 2O3SA 3DT8A 1Z4OA 4K40A 2RGAA 4TWJA 4MRRA 1WCXA 2KB0A 1Q1EA 3PHLA 3OQHA 3OPYA 2KW5A 1G9SA 4IMRA 4S0ZA 5FOTA 3K72B 3AM4A 4XB6B 1THGA 2JFQA 4D4MA 3DLPX 3HUEA 5GJWC 4ALLA 4XWOA 3M6AA 2ZWIA 2AOTB 4OREX 2VHWA 3LNTA 3LPNA 1I1OA 4N0DA 4YJ3F 3WGZA 5BQFA 4Z4EA 2JGJA 1K66A 1LDMA 1G6OA 1ZL2A 5EERA 2YQ5A 1L5GB 1H4SA 1RKVA 4MUAA 4UUMA 3GP8A 5J2TB 4PYOA 3PLNA 1I1HA 3L7AA 3HJTA 1NT4A 3M0EA 3GLSA 1T6ZA 4JA2A 4G5RA 1CVRA 1P44A 1HEUA 2ZYTX 1ICIA 3K20A 1T43A 1CP3A 1OYOA 3MPOA 4PTLA 1IVNA 5HKBA 2W2VA 3NYWA 3OQBA 5D5PA 4D25A 1WMAA 1ZR2A 2NO1A 1CS0B 4KC0A 3B5JA 3KR1A 3M4NA 2YZMA 1NU6A 4I1SA 3PD0A 4QPPA 2Z5FA 3AV0B 3T5GA 5JZOA 1FFBA 3K8YA 1GYQA 4NAUA 3SM3A 2ZULA 3UJDA 5E2AA 4YMHA 2VPWA 2DHQA 2HNKA 1OAOA 1RYDA 1HDCA 4OB7A 4YFVA 4FI3F 1ZSNA 4RVGA 3GJ7A 4FFNA 1YNSA 1W5EA 3AHIA 4LC1A 5FOXA 2XQIA 3NFYA 5A05A 3W6ZA 5ALIA 4DPLA 3FDZB 1USUA 4AY6A 2OV1A 1CR6A 2NZUG 1OH7A 1CZKA 2FJ0A 2O2CA 3IJ5A 1NZFA 1ZH2A 3H6HA 3ZHYA 4QRHA 3RVJA 2R8XA 5BSFA 2AB0A 2J59A 4U63A 1Z7GA 2IZ1A 3HLYA 2B78A 4K05A 2W11A 4ZVUA 1CEXA 4JYZA 1W19A 2QDXA 4AYTA 2OFFA 1G9XA 2C42A 3S7TA 3I01M 5GJVC 3G1WA 3QFSA 4E14A 5C53B 5EUCA 1NR7A 3BEDA 3NC1C 3EQ6A 4UXIA 3JD3A 4YDSA 4L9WA 4UQPA 4MXDA 3T6KA 2WYUA 1ZOSA 2AF3C 3EISA 2BDEA 2QNRA 4OQ4A 3RVDA 2JS7A 2HWUA 4MW6A 3VNAA 5J47A 4KOAA 2GEUA 3KJEA 3T7RA 2HC9A 3HDJA 1NNEA 5FOQA 2OM2A 4GVPA 1L6RA 3O8CA 1G8HA 1K75A 2QTZA 3ELDA 3KFLA 4ZODA 4OQYA 5IKXA 1QLJA 3AR8A 3C6MA 1Q0QA 1RXVA 1NUAA 5A02A 5JLAA 5L3QB 3ODGA 1SNYA 2WEKA 4WXMA 2DPLA 3TL2A 4A2CA 3GB9A 4M83A 3ZD8A 4CN9A 4LZLA 1PL7A 2XUKA 3QMVA 2A4MA 3U49A 4BFSA 4CQNA 3H5AA 4QO8A 1RACA 4EMTA 4AWAA 2WT8A 3G02A 3STWA 3M5PA 1GQOA 3AFNA 3JSXA 1JI0A 1YKFA 4PPYA 2AR7A 3OJEA 2B3DA 4MLDA 1PU2A 1RQXA 3HG7A 2BWJA 1C2TA 4YHHB 2X1LA 5EINA 4BVLA 1DC7A 1PYOA 4P7BA 1CY6A 4Z4CA 1GTZA 1C3EA 1TE2A 2LXNA 2Z6UA 1KZ4A 1IWOA 3L6BA 4GZ6A 5KWSA 5G0TA 3AEUB 3E15A 3N8GA 2ZBQA 4UDXX 4BLOA 5IVHA 3AWDA 2JEZA 4LK2A 1V35A 2P4UA 3ZU4A 3GLHE 3ZW8A 1X7ZB 2H9IA 3KTAB 3ZVLA 1QVAA 2C7QA 4HGOA 4IYRA 4EJSA 1WDTA 4G81A 1NYTA 3LBHA 4GT1A 4YEDA 1DBRA 3W34A 2Q45A 2BI4A 4OU4A 2QJFA 4QBHA 2B21A 4CNBA 2OFXA 4CU5A 2XDQA 1CZNA 1DG3A 3GRCA 1G63A 2X0RA 3ENWA 1P9LA 3GU3A 3LX4A 4B76A 2A86A 3ROGA 5CT6A 4N18A 4NENA 2ES4A 5IAEA 3PKJA 4FFBB 2YJZA 5TLSA 1YDHA 3CF4G 3QFRA 1QAOA 1ZONA 1JHAA 4XYGA 2QVYX 3KU1A 5DLEA 1WE2A 3NBQA 4JLPA 2NXCA 1EZ1A 4U7PB 5K9ZA 1S02A 1YB2A 3C6BA 2Z58A 1I5RA 3WKBA 4ENQA 2OPBA 1LB1B 3WMRA 5K0BA 2F1HA 4TWIA 4MLCA 3R5KA 3JQ8B 2YVAA 2IELA 4FFWA 4NARA 1KO8A 4A2PA 1W2GA 2ZE6A 4B9AA 3MWEB 5IVDA 2RJNA 1DL5A 1L3IA 3M8KA 1HA3A 2WQZA 3E27A 3D3EA 2I6UA 1NI4A 1RLIA 1ADYA 4WXPA 1Z36A 3F2VA 5CIWA 4RVHA 1F0YA 1J0XO 3B1VA 4JJGA 4WH0A 2Q6LA 1TEXA 5LZ8A 3S2IA 3MT0A 2OQVA 3QHQA 3ZWKA 2AEFA 4CQLA 2X3YA 4JZKA 4DIKA 1XFDA 3NHJA 4OBXA 3UOWA 5K0FA 1JFSA 3QLEA 1R9GA 1FA9A 2Q9CA 1LNZA 1T1EA 4X9XA 3B38A 5B3AA 3O73A 4JT4A 5KTPA 1Z2AA 2Z5LA 3D8TA 1RCFA 3MAGA 2XZTA 3TIGA 3MGAA 5SYAA 5B58C 3HVIA 4EHLA 5L7YA 5AVXA 1JKJA 4O4JB 3S40A 1XLTA 2YRFA 4BO3A 2D00A 1VCIA 1ONSA 5TMBA 2NVUB 2G9RA 2O5EA 2AZ4A 4ZVSA 3P9QA 4BU0A 2YJNA 1U8ZA 1YE8A 4ZOEA 2XUDA 3QVOA 2R5WA 4ETIA 5BSEA 1AURA 3VKUA 3HJFA 4JR2A 4HWSA 2QQFA 4U7JA 4BNLA 2F64A 4CI0B 5BUSA 3FZYA 4BFZA 3G88A 3KEQA 1AH2A 1Q7BA 4IOLA 5LU9A 1EFPB 2HD4A 3SBEA 5AI5A 1FZTA 3SXUB 4PZPA 2E85A 5D3MA 4TKVB 4KAFA 3ZCUA 4B5KA 4ETMA 3MW8A 3L06A 3N7UA 5L3ZA 2BSAA 2XJ9A 5EUQB 5H81A 1UK7A 3VH1A 1MBZA 2ID8A 4ISBA 4GOLD 3I9V1 4M9XA 3NMUF 1M10A 1PR0A 2ACVA 3G5LA 4A5OA 2O7NA 1E3WB 4LYDA 3PDIA 2JPDA 3CVUA 3KWLA 4M54A 2NP7A 2JFNA 5ALJA 2I7VA 1T0HB 4EMUA 1J97A 2EWVA 2XQGA 1P17A 3ZU5A 4YMSA 4DV2B 3DOEA 1OBFO 2LRHA 2DLCX 1T8WA 4RXTA 1GPNA 2NN3C 3ZTYA 3CLRC 4KLNA 1V5WA 3V2UA 2QNIA 3DE7X 1IY9A 1DBVO 3LLUA 1QPBA 3U44B 4BNHA 2XMPA 2YDXA 3K30A 1I80A 3RVKA