4EPYA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epyA00
1QG2A 2REBA 2XSZD 2VF8A 2WHXA 2FEMA 1P73A 1VMAA 1GOTA 2GWHA 4Q1EA 1LS1A 3NEJA 5FPTA 4TSFD 3B6EA 2B21A 2YVUA 5EXSA 3KKOA 4L4UA 1AS0A 4A8JA 4ERNA 3T1TA 3RNLA 4B43A 3THYB 1G21E 2RAPA 1F2TA 1VG1A 3B60A 3U6BA 1YQTA 3MG9A 1XFAA 2D62A 2NO6A 3BH7A 2HDNB 4G1UC 3W9YA 2V4ZA 1J70A 5CDFA 2VO1A 3PXGA 2MSEB 3VKHA 1WP9A 1XCGB 4Q9KA 2RH5A 2G0TA 1OH7A 1E69A 4TTQA 4JL5A 4WZ6A 4BFZA 4E07A 3QKTA 3BFVA 1W0KA 2WSMA 2O0KA 1P2VA 4Q47A 4CRWB 2ZUBA 2BBTA 4LV5B 4URUR 4N3NA 4C0BA 5IHPA 1HQYE 1Z29A 2IK8A 3T5DA 2WSSA 1WB9A 3P20A 121PA 1W4BA 3ADCA 3A1WA 1T4GA 3V4RA 2OFWA 3TSWA 5KDOA 2XXAB 2QTFA 4JJKA 3RC3A 2R65A 4ZKEA 1KO4A 4Q4LA 3TH5A 1N25A 3U7GA 4GFDA 1RYFA 2QBYA 5EE5B 3SC3A 1COWD 2J41A 5J47A 3CZQA 4YXWD 3GFOA 2KBEA 3E70C 4KO8A 4MDEA 2WWWA 3W5JA 4RKFA 1T5IA 2J45A 4N0EA 1SZPA 2WICA 3UXMA 1ZD9A 4B3CA 3NXSA 5AJYA 1DOAA 3SJBA 4F38A 3B1WA 2VLIA 5DI3A 5GADl 1W36B 4P4SA 4FMCB 4I4LA 1MOZA 1D8TA 4LPKA 3GFPA 4CIDA 5KTYA 5HR5A 2IS6A 3GLHB 3PEYA 2ORIA 1YKSA 2X2FA 2ZRCA 5EP1A 4B3XA 3TUZC 4JLJA 4L5BA 5JEDA 1RRFA 1GL7A 4OI2A 2O5VA 4QNRA 3EPHA 3HR8A 5B30A 2PT5A 4C0SA 2FFHA 2R6AA 3AB3A 4Q9HA 4BE7B 3A4NA 4Q03A 3L8YA 3L0SA 2IYZA 1UPTA 4D4LA 4HZUB 3ZVRA 1LW7A 4IOMA 4W5WA 4BLOA 2YWGA 2ZRIA 4KU4A 4PHHA 4K81B 5TVKA 4EFLA 2C96A 3LVRE 3A36A 4MYTA 1UADA 1TEXA 2RHDA 4HDOB 1XBTA 4UNPA 5JCPA 2OO7A 1KOFA 3KFXA 5K8LA 3U4QB 5JLJA 4CEJA 3H1TA 5BW8A 3O47A 2F1RA 4ACAA 1N3BA 1DAEA 2GXQA 5FPYA 4QOSA 3MWJA 2IW3A 4A8JB 4F7WA 1OH6A 2HYDA 4B3GA 4UNNA 1T9HA 1YRBA 2N46A 2VP9A 3FE2A 4AK9A 3O8DA 4JMPA 4LHYA 4CZ2A 1F2TB 1NVXQ 3EZFA 1IBRA 3CF6R 4EUNA 5EQTA 3U3KA 3QY0A 2W83A 3IPXA 3QNUA 2WOOA 2ZRNA 1TADA 2QRZA 3QENA 2QP3A 2I4IA 1XEXB 2NPIA 1JAIA 3QF7A 4B74A 1OLOA 1YZNA 2IYRA 3OAAD 3QXSA 3TK1A 3LA6A 2ZSEA 5AJZA 4F4IA 4DDUA 3DO6A 1F2UA 1KTVA 1ZU4A 2CBZA 4Q7MB 2C9OA 1XJ0A 4LBYA 2WWIA 1W0JD 4TMVA 3GD7A 4DVGA 1VYUA 2PL3A 3HU1A 3NTUA 4RZUA 3FGNA 4HAUA 5D3QA 2OG2A 3AF0A 4HAXA 2ZI9A 4YLGA 3NG1A 5FBWB 5EZ5A 1NLYA 2CVFA 1F60A 3KKPA 1FPMA 2TMKA 1W36C 1G6OA 2QBYB 1R7RA 2QORA 1XXHA 1YE8A 2GA8A 4NCJA 2REXB 1N6NA 1BO6A 2QP4A 1IY2A 1W5SA 4JBWA 4EJSA 1CRPA 1NKSA 5GJVC 1LFDB 4URZR 3AKYA 4JL8A 1PUJA 1S9DA 2HT6A 4KBFA 5LD2C 3WP1B 1K6MA 1HTWA 2JDIA 2CCJA 2PMDA 4BPBA 4DBLC 1YZTA 2D74A 4HLCA 1ZIPA 2LKCA 4PZYA 5DI3B 1KY3A 1E98A 3R9WA 1IXRC 1CS4C 2BKUA 1G3RA 3UMFA 3MAAC 4UXIA 1TQ2A 4LGMA 5L3QA 2I3BA 1ZM9A 4LHVA 2JASA 3AP1A 4Q4AB 4W7SA 2BBSA 1X3SA 3I61A 3AVUA 2CL6X 4JLVA 4A2QA 3TMKA 5DI9A 2C5LA 3KZ1E 1KNQA 4OHZA 1DADA 1J90A 1U99A 2G3YA 2BC9A 2QP9X 4W5JA 4A8JC 1DS6A 2F7SA 3GLGB 1T8TA 1T3LA 1G3UA 2C95A 3Q3JB 4DEYA 3HWSA 3CWZA 1E2QA 1IXZA 2Y8EA 4TN1A 4FWIB 3FVQA 4NBSA 4RZ2A 3PFIA 1EWRA 1Z83A 1RRCA 4Q66C 4BLTA 1ZW6A 4NKRA 2E9SA 5E4FA 3D31A 2WWHA 4GP6A 4FI3C 4LUCA 3TSOA 4AKIA 1XTRA 2F43B 2GCOB 2H16A 1G4AE 4AD8A 3A37A 4CEJB 3LW8A 1E1RA 4QRHA 1U90A 2B92A 2R62A 4C30A 3WMGA 3NBXX 1HYQA 1E4YA 2B6HA 3TQCA 4LOAA 2GK6A 3LNCA 3F8TA 5JHGB 1NMZA 3ZDQA 4WBSA 2R6GA 4TMWA 5FOVA 3TSZA 3KB2A 4DHEA 1XZQA 1OV4A 1VKJA 1N6RA 2AD1A 2AL7A 4PAMA 3ZQ6A 1E9DA 1SHZA 4MKGA 4AG6A 5JSZA 1AGRA 1P9NA 2JJ1D 2AHOA 3MRSA 2VP4A 2UZIR 1G64A 2CCKA 4NE2A 1JJ7A 2ZRHA 2V54A 1KZ7B 2P5TB 4M21A 3JVUA 2EFEB 1E2EA 1XD8A 4QBIA 5FPHA 2ZU0C 1C9KA 4WVFA 3RS3A 1VCNA 2R6CA 3GLGE 2IYSA 1R5NA 1R6BX 1S1CA 2VH5R 3R9XA 3CNNA 2RGNC 3OIYA 2DBYA 4FMDB 3U7FB 1NVVQ 3C5CA 3IEUA 1OKKD 4B71A 1YU9A 2ZEJA 3ZD6A 2IWRA 4NL4H 4I1OA 4Q02A 1KK0A 1DAKA 1PLLA 4BGDA 5D3MA 3LBIA 1XXHB 4GDFA 3L82B 2BVNA 2WAYA 3ECCA 2ZSAA 4HDCA 1D9ZA 3KQLA 3BK7A 3NH6A 3VU9A 3P1JA 1B0UA 2ODWA 3MWYW 1U0HC 1KSFX 1JI0A 3C4JA 2V6JA 1H8HD 1E9EA 5EZ6B 4BLSA 2KB0A 2O0JA 1E9CA 4M22A 1JQJC 1KNXA 4PAOA 1LV7A 2HXYA 3FMFA 5KU1A 4OHYA 1FOEB 2FMXA 2BJWA 5FBRB 1RKBA 2WV9A 2X77A 3K09C 1OF1A 3GLIA 2VHJA 1RVDA 2WTUA 5EUMA 4MRSA 5KDLA 4AKGA 4FD2A 2D7CA 4F91B 4JLKA 3IKJA 4OHVA 2IF2A 2PZEA 2GJ9A 4QJ4A 3OF5A 2ZS9A 4N0DA 2P6UA 2FV8A 1LVGA 2V7QA 4KBGA 4RFSA 3MGCA 1XPUA 4JKYA 2QT0A 4D81A 2A5JA 2OLKA 4C4PA 4ZCIA 5JS7A 1YJ5A 3CRQA 4HI0E 1G4UR 2C03A 1D6JA 4RZ3A 3UWOA 4MDFA 3CUEF 5H1YA 1GL9B 1KO7A 4G5RA 1P72A 3EARA 1GRQA 4X8LA 1E0SA 2AFIE 5P21A 3SOPA 4MKFA 3U3MA 3B2EA 1KZGB 3ZS9A 5C46F 1CF4A 1QHIA 1XPRA 2BMJA 3PEWA 2DB3A 1C4OA 2JJ2D 4MYCA 1NL3A 1CR1A 5DYIA 3NDPA 1Z0DA 4LHWA 4M1TA 2ZAMA 1CULC 1YRAA 1Z47A 2GESA 1UEIA 4D0NA 4KJZA 2PZGA 4LV8B 4CGZA 1P75A 5JSZB 4V03A 1P3JA 2J1LA 5LDDC 3C7KA 5J4LA 8OHMA 2V9PA 4QBFA 4TL8A 3S1AA 3KL4A 3KQHA 3W8NA 4BZQA 4A82A 1Z6AA 3PEVA 1X8KA 3IIKA 4NYJQ 2R6FA 2NTYC 2VYFA 2V55B 3JZMA 5CLLA 1U9IA 4NYMQ 1XCPA 4BECA 5HCIA 4BFSA 1M7GA 4IOKA 2CNWA 2R2AA 3KJEA 2IX3A 1IM2A 1XEWX 4HUQA 5KHOC 4U7DA 2EWWA 3QJYA 2O8BB 1NKTA 4FWTA 4PC2A 2YNMA 3T12A 1S1MA 4G5QA 4KCGA 4V0ME 1PUIA 4ZO4A 3ZGXA 4UNRA 5JRJA 2CHGA 4JVSB 5D3MB 1YHNA 3K0AA 4DKXA 4WZBE 3PQCA 3U3JA 2OCAA 2EFDB 1E2DA 3H84A 5KNDA 2PBRA 1FP6A 1JEDA 3VR5A 4AWXA 3UANA 3VU9B 5KO2A 2EYUA 3E5HA 2IUTA 2QM8A 2ZIAA 4LJ6A 4EPYA 3B1ZA 3DOFA 3IIMA 4CT5A 5JFGA 3B82A 3NDBB 2A5DA 4HLUA 4DIEA 1EFHA 1II8A 2VTKA 1QHNA 3L2OB 2GKSA 4PC7A 2OEPA 3NC0C 2EWVA 2QT1A 2ZSBA 1WF3A 3B5JA 1FNNA 4HB2A 3ADDA 3GLFE 2VEDA 1N6PA 2P5SA 3KKQA 2FU5C 2P2LA 4LBWA 3NVAA 3ZZUA 1GFIA 4RD6A 4AYTA 3SJCA 1M8PA 4AC9A 1L4UA 4QJ3A 2IXGA 2VQSA 3GLIB 3DKPA 5CK5A 4EPRA 1SVLA 3CH4B 3EC1A 5FOUA 1KI7A 1P62B 1YZQA 3EW9A 2IC5A 3W6NA 1UF9A 4PC1A 3ADKA 2ZETA 4KLNA 3X2SA 4ZIRA 2UKDA 1DE0A 1N5LA 3LVQE 1KI6A 5HPYB 4MUBA 3RVBA 5TDHA 2VHTA 1MR3F 4RFSB 3LWNA 1CRQA 1IN5A 3QPUA 4TLEA 4PC6A 1R4AA 2QENA 2F3TA 3VX4A 1OXVA 1KSJA 2FFBA 1S3GA 2QEQA 2NO1A 2QPAA 5H70A 5C2JB 2WMOB 4O2LA 3K0CC 1W0KD 1JBKA 3FKSA 2YOGA 4YMUA 4LYHA 3OIUA 4NCHA 2P65A 3EIHA 2WSSD 4G5GA 2FN4A 3EPLA 3FTQA 2HCBA 2AKAB 2IXFA 3BERA 3VR2A 2HF9A 3AP2A 1ETUA 3B13B 3PJRA 3CRRA 5FL7A 2QGNA 3WP0A 2XNSA 3QEOA 4Q1BA 4IXNA 4YC7A 1HEIA 1KKMA 2ZSDA 3IHWA 4YMTA 2H92A 3FPAA 2PX0A 2WJIA 1KI4A 3C41J 1E2MA 1N6OA 3KXLA 3I32A 1Z2CA 1ZRHA 3MJRA 1TNDA 5CM8B 3S1AB 1C1YA 3FWYA 3W5IA 2QQEA 3RS4A 4M1OA 1IHUA 1EX6A 3OE7A 1WCV1 3PVSA 4HAWA 4HUQB 1XJCA 3AVYA 4AG5A 2RGEA 1RZ3A 1TPZA 1F6BA 3T34A 4XVUA 1KMHA 1QDEA 3AV0B 3QVVA 1OH5A 1ZIOA 2FGKA 1UEJA 3MFYA 5TARA 2A30A 2KE5A 2JLZA 1SKYB 2B7BA 4PAQA 4GMDA 4XSGA 1E2KA 1ZCBA 3V4FA 1EXMA 1A2KC 4MH0R 2NPFA 4EPVA 2YV5A 3FYHA 3B1YA 2GVZC 4TQ9A 3W3ZB 4Z8YA 2O8EB 3Q5DA 1II8B 2YWHA 3D7MA 3R20A 1R0YA 2CK3A 3RS0A 3I1FA 2EYQA 3TLXA 3K9HA 521PA 4IDHA 5KDDA 2VHCA 3EWAA 4LBVA 2Q9AA 1KO1A 2WJJA 3EXAA 4OBEA 1CR0A 1WE2A 3LX8A 5FUWA 3AF4A 1PJRA 4P33A 5KPJA 5JECA 2HT1A 2ZYTX 1XTSA 1NN1A 1UFQA 2O8FA 3UIEA 2GETA 3T61A 4XVQA 2XAUA 1HY3A 1G3QA 4WA7A 4BEBA 3KX2A 1R8SA 3QKRA 4GSYA 3ZQJA 5FH9A 2IBMA 1N0UA 4ZIRB 2PX3A 3ND9A 3B1XA 4A6XA 1US8B 1QBKC 2V6IA 4IFBA 1RRGA 3N5CA 3OEHA 1KI6B 4DSTA 1XRJA 4B75A 3CH5A 1P9RA 3P27A 4Q18A 1H65A 3RAPR 2C04A 5C1BA 3VR6A 1A82A 4A2WA 2R8RA 2JAQA 2W2TA 4G01B 2P6NA 3MUFA 1UM8A 3LO5A 5FOXA 1XU4A 4BLPA 1KGDA 3BH0A 1W2GA 4AIIA 2FNAA 1TF7A 5CM9C 1HH4A 2ZJOA 1N2CE 1U9IC 4DLUA 4EDHA 2HXSA 5FBLB 4RD3A 3WNDA 1T3SA 3EASA 1R8QA 5HZHA 1HV8A 3TVTA 2FX3A 1TL7C 3RLFA 4ARZA 2HUPA 3CNOA 4PHGA 4MQBA 1AZSC 3TW4A 1OYYA 3MWLA 3QPWA 2ZS7A 3ETLA 2IXEA 1I4LD 1OIXA 1PZNA 1N6LA 2BMFA 3KJIA 4B3DA 4C0AC 3GJ3A 4QBGB 1NVUQ 4QJ5A 4EFNA 3EA5A 1YR7A 2JDID 2WJVA 5L3VA 4XJXA 5B57C 2AXPA 2XJ9A 1XWIA 3EA0A 3OEEA 3N2IA 4QFMA 2HYIC 3U7HB 1KK2A 2EU8A 4EAQA 1CR2A 3PUYA 4HLUC 2P6RA 5JI3E 3KQUA 4D80A 5L3SA 1E0JA 4D6PA 1RPZA 3CBQA 1MABB 5JEEA 3QG1A 1KMHB 1YZLA 2GJSA 1VHTA 2J5XA 2JIZA 1HT2E 2V8OA 4RVCA 5JRZA 3KUDA 3L43A 2FZLA 3EX7C 1XMIA 2HLDA 2XZLA 5JWRA 1NY6A 4R2HA 1FL9A 1GL6A 2AWOA 2GTPA 4ZCMA 4Q4HA 4Q1CA 4TQUS 4DSUA 1DBSA 4URVR 3PCRB 1UDXA 4WXPA 1NF3A 2OAP1 5J40A 3AM1A 3L0IB 4IFEA 3IEVA 3AVVA 2W6IA 5CIWA 2BBOA 4MGYR 5KSPA 2F6RA 4BZXA 1Z6GA 4WAUA 2ZI4A 2JLQA 1UKYA 3IIJA 5SZJA 4A0RA 3DZ8A 4B47A 2QUZA 2WJYA 3NIBA 2ZR7A 1MO3A 2C9YA 4ZDKA 1EWQA 4ZKDA 4XTCS 2ZJ2A 4O3MA 1NSFA 2RGDA 2ONKA 1E1RD 4TMKA 1EESA 4MYUA 2IYTA 4NYIR 1DTSA 1P6XA 2CXXA 4DLVA 2O8FB 2ONJA 4A0HA 4PSAA 1Y3AA 4XIGS 4LV6A 3QKRB 3OESA 2QTVB 2YJTD 4JVMA 4NH0A 3VMFA 5FTMA 4OHXA 1OSNA 3ZD7A 4MRVA 4D4MA 4KSBA 2B8WA 4Q00A 5EP2A 2QGZA 4UXJA 1B23P 1J7KA 4LX0A 3TQFA 1QHYA 3LBHA 3AKDA 2QMHA 1LTQA 1XF9A 3HPQA 4Q9IA 3REFA 4TL6A 1SQ5A 2WIBA 5IF9A 4IOLA 4DIDA 3SYNA 3GEIA 4OKSA 5JWHA 5KSYA 1PV4A 4LWZA 3B7GA 3MSXA 1KI2A 4FXPA 3TRFA 821PA 5G53C 2VSOA 4ZI2A 2PLFA 2J7PA 1NMXA 2C98A 1LF5A 2P3SA 3BB3A 3P32A 4Q7LA 3VX3A 3W90A 4CYMA 3B9QA 4ZDWA 3K0FA 2ZREA 3RANA 1U98A 4GMXA 3ZLJA 4ARZB 3WXMA 1NVWQ 4X8MA 1RIFA 2C9CA 2Z43A 1NLFA 1UDWA 3LD9A 3LX5A 4L16A 1FMLA 2H17A 3RRYA 4P31A 1XCMA 4JLOA 3ZJYA 3VQTA 2J59A 3VR1A 1RJ9A 1YZKA 1UBFA 2AN9A 1MO6A 3QG5A 4XWKA 1G8PA 2YZ2A 5J4VA 4DCVA 2VRWA 3WNCA 2C99A 5FPSA 1R5BA 5HZKA 4LC1A 4LYAA 3VHXA 3WRXC 1S96A 4EQ6B 1SXJA 4UKDA 3CPHA 1GG2A 1VHLA 2DHRA 1Q3TA 3BD9A 2OBNA 4Z1MA 1WXQA 4JLAA 1G5TA 3EAQA 5G40A 1Q1ZA 4MA4A 5C4MA 3C14C 1FUKA 3NBFA 3DVLA 3OHMA 3K8YA 4GRAA 4TMZA 1G5RA 4Z8XA 3TIFA 4LJ4A 5JCZA 1QVRA 1MRNA 1TUIA 2ECKA 2PH1A 2ZE6A 2ZJAA 1U0LA 2HF8A 4V0LA 4Z54A 3W8RA 3G5UA 2VSFA 1ZNZA 3GLHE 3PUZA 1Q20A 4TQAA 2F1IA 1Q12A 2XB4A 4OK6A 2EW1A 4CEHA 2V7QD 3BGWA 1M6NA 4TTPA 2WJGA 5AJXA 1ZBDA 2GAOA 1ZINA 2GILA 4OJQA 4DCUA 2PMKA 2L0XA 3TR0A 1FP7A 3GCGA 4PPQA 3LXRA 1KDPA 4GI7A 3QXHA 1SVOA 4MGIR 4OQNA 4FINA 3DHWC 1E9BA 1Q1EA 2WKRA 1X86B 2OAQ1 2BMDA 4TWZA 1NBMA 1M74A 1W49A 2WWXA 3QEJA 1GRRA 2FG5A 2IUUA 4ABYA 4BFTA 2LKDA 4C2UA 1G7RA 4M0LA 1A1VA 5A0FA 1NJFA 1E2IA 1OXSC 2VBCA 4IEIA 2G6BA 2QI9C 2Z4RA 1CLUA 4TLAA 4I81A 3C8UA 3CWQA 2XITA 2DCUA 4HUTA 2VL7A 1HURA 1EG7A 4LJ8A 1CJTC 1E2JA 2EVWX 2RMKA 3AVQA 5CJPA 4BRWA 4FCWA 1KIMA 1G5PA 5FR2A 1GITA 1E2HA 3ZYCA 3AKEA 1D2MA 1ZD8A 5A4JA 4II7A 5LPNA 4JJZA 4NHOA 5B64A 1KJWA 5KSOA 2E1RA 4JL6A 5CYOA 5CDFE 5SZKB 1T5LA 2EFGA 2J46A 2CNWD 4RD2A 1N6IA 3RWMB 4OL0A 3T35A 1IN8A 2G0NA 2ZYUX 3X1DA 5DNYB 4DB4A 5FUYA 4P4SB 5FUXA 2ZM5A 1TUEA 4F92B 2AX4A 2ZJ8A 4JSTA 3REGA 2ODNA 2MMGA 2WBLC 4DDTA 4KFTA 2A5GA 2FEOA 3SDZA 1RE0A 2NO7A 4JVLA 3Q7PA 3AQ4A 1NVVR 2VHUA 4LYJA 4A2PA 2HEIA 3U44A 4NU0A 1FUUA 3TJZA 1XEFA 5HKKA 1CBUA 2OLJA 1E1QA 2GEDA 1KK1A 5CK4A 1AS3A 1M2OB 1YR9A 2ASEA 3DEFA 5IK2D 1UBEA 2OXCA 2JLRA 5AUOB 4M1MA 1EX7A 2OZEA 2XSZA 4RD1A 5DIFA 4DJTA 1KDTA 3WYGA 2YWEA 1SXJB 1W4CA 2FH5B 4OQLA 3ICQB 2ZRJA 4V0KA 2X1VA 3QKSA 1IN7A 1EFUA 2W00A 1KMQA 3K53A 3LLUA 4M9SA 2G9NA 2ZUDA 1DG1G 2WAXA 4HB4A 2JEOA 4LK2A 1NRJB 1H8EA 1IN4A 1KO5A 3WMEA 2X8AA 1F48A 2J0UA 4DDWA 4Q9LA 2BMEA 4ZCLA 2Z6VA 3HYRA 5JZVA 5KPDA 5FFMA 5KOYA 2C77A 1DG3A 3Q7QA 4B35A 1FTNA 4BFUA 1E9AA 2AFHE 3T1QA 1ESNA 1BOFA 4V0NA 1GTVA 2ZTSA 5K8TA 5KYKA 2FPLA 3OIVA 2YYZA 2QAGA 4D0LB 1NG1A 1FFHA 4JLMA 3PITA 1F2UB 2FE4A 3HPRA 3Q9LA 4PFSA 5L8VA 3FKSD 1OJLA 2ZRPA 3IBGA 5EXPA 2ZI3A 4R71A 4L15A 4L9SA 2AWNA 1WQ1R 1ZD1A 4G3XA 4M1WA 3NHBA 1JR3A 5E3HA 2BIFA 1GNPA 1TQDA 3LLMA 4A4DA 3VR3A 1SVMA 4DSNA 3LH5A 4K8OA 2J0VA 2QE7A 2ORWA 3SYKA 1TMKA 2JLWA 2FWRA 4PZZA 5FL7D 5A5GA 4RFVA 2V3CC 3NEYA 4DRZA 1BYUA 2GK7A 1XTJA 2QTHA 3K70B 2G1JA 2ERYA 2KSQA 5E7MA 1GKYA 1XNJA 1NSTA 4EJSB 1QZXA 2DWOA 2PZFA 4XD7A 4EPWA 5AUPB 1OFIA 2OSBA 2JLXA 2IS4A 4G0NA 4GOXA 3I4LA 3IHLA 4D4JA 4HB0A 4FN5A 3RHFA 4OK3A 1LNZA 3OE7D 3ZIAA 1II9A 4DUGA 5G41A 2QROA 2RCNA 4L8GA 1UBCA 4NYJR 1FQJA 1T91A 4OQXA 4PO8A 1Z07A 3GJ4A 2H8KA 4UXHA 5FUVA 3ZZ0A 4DLYA 4NYMR 4QHYA 2NG1A 4DCNA 5L3QB 1M1YE 2HJGA 2DR3A 5GVSA 3CB4A 3CM0A 1SXJC 4ESVA 5ELXA 4AURA 2A3RA 5UKDA 3AVWA 4FCTA 3U44B 4LYFA 1AM4D 2XTNA 1WMSA 4Q21A 1ZVQA 5GVRA 5DYGA 5BN4A 5J4KA 1DELA 1X8JA 1U8ZA 2RGAA 3ADBA 2Q9CA 2ZJZA 3CRVA 5F3WB 2OFOA 5ANRB 4V0OA 3FHOA 3TAHA 3BRWD 1XJQA 1O3YA 1XXHE 4JSYA 2CK3D 3IPYA 4KFSA 2DWPA 1ZP6A 5DGXA 3K9GA 1A4RA 3VKGA 2G83A 3THWA 1E32A 4IKEA 5JI2E 2WKPA 1IJFA 4PO1A 2BOVA 2CE7A 2NIPA 2NZJA 1KK3A 1EFRA 1GNRA 3GEHA 1DAHA 4LY6A 3DMDA 4AYXA 1JR6A 4OI0A 2J0SA 4QC2A 4U5XA 1D2EA 3FFBA 4NZYA 3VHLB 2J0UB 5LB2A 1QHGA 2FFQA 2FSIA 4MKHA 3E2IA 3THXA 5TB5A 4YDSA 4NP6A 1J8YF 3F5FA 2ZRDA 1HQCA 1ZC3A 2GBLA 3OAAA 3TUIC 4MRPA 4B33A 2Q6TA 5CYPA 3A8TA 1OT3A 2CLCX 3VR4A 2IYUA 3TUJC 2QAGB 4Q1AA 1I4DD 4JLDA 1NIJA 2GZAA 1HE1C 4OQFA 4EJSC 5FBVB 2JATA 1FNMA 2B8TA 4IDPA 3Q5EA 3B1VA 1SVWA 1GKIA 2IYQA 1VG8A 3H2YA 4QGHA 5FPKA 4XH9B 1P61B 1IXSB 2AR7A 3ASZA 4B2LA 4Q5IA 2BV3A 1X6VA 2FGJA 1XZPA 2Q21A 4DLZA 1JB1A 2DFNA 3AEZA 2I1VB 1NLZA 3FDIA 4KHZA 3RRMA 1ZM7A 3I62A 5KSZA 4QKQA 2ZE8A 1RC8A 1E0AA 4DZZA 5B2ZA 1AIPA 4BFVA 1D2NA 3O8BA 1FX0A 3X1XA 4QNMA 3TBKA 2IHBA 2LWIA 2ZYWX 1KY2A 4MUAA 4FIDA 1T0JB 1BKDR 1ZNXA 4R9UC 4Q1FA 2BCJQ 1OFTA 2QU8A 1N6HA 4WIAA 3OEED 3PIRA 3LRPA 3QXCA 2W6JA 3RABA 2QZ4A 2EQBA 4PO9A 4NCNA 1HUQA 1ONBA 4LBZA 4LSGA 1R10A 1V5WA 1VG9B 2BBWA 2CE2X 3NHAA 5FOSA 3WMFA 4DLSA 3U6KA 2VP6A 1NN3A 4MGZR 2QA5A 3BE4A 3SJAA 4MITA 3ND8A 4A0GA 4BZPA 5LB4A 5EJEA 4D25A 4QM6A 2JIZD 2RGXA 1QHSA 2ORVA 3A1SA 1W2HA 1AK2A 2PT7A 2HLDD 1SVSA 4DXAA 1I2DA 4CDGA 1NN0A 2QM7A 1GWNA 3DM5A 3I8SA 2DWQA 4QGAA 4B34A 3A1VA 3NWJA 4LJ9A 4B2IA 1U81A 2QRNA 5FL3A 1L4YA 2ZXUA 1J2JA 4FMBB 1I4TD 2W6ID 3KTAA 4JLNA 1KO8A 1Z2AA 3RYTC 2W2XA 3THWB 1G291 4PPNA 1XMVA 2HJVA 4ZI3A 1G3IA 3BXZA 1MV5A 3HP1A 3P26A 1VTKA 3QOFA 4URYR 2ZR9A 2WKQA 4JIMA 5AJWA 2ZI7A 5IRCD 1N6KA 4BFXA 5BYJA 1G19A 2QAGC 2AKYA 1EFTA 4ZDJA 1Q1BA 2CLDX 2XOKA 3CF2A 2MSCB 1AJEA 5C4GB 2RB4A 3THXB 4AI6A 2PJRA 2QN6A 3I5YA 1NY5A 3PR1A 2XTZA 3PUXA 3OZXA 4B44A 3ASYA 2QMUA 1JXMA 4GZMA 1OW3B 4C0QC 2OV2A 2ODEA 1E2GA 5G3YA 4O25A 4DLRA 3GLIE 4LJ5A 3CO5A 5H68A 1YR6A 5F98A 4M9ZA 2XGJA 3U60B 1OYWA 4QHSA 2OFXA 2Q9BA 2ZUCA 1AQUA 2FDCA 2IYYA 4N1AA 1EFCA 2XNDA 1NI3A 1QHHA 2ANBA 1VIYA 2JJ8A 3AF3A 4PX9A 2VA8A 4OQMA 1G8YA 4F93B 1R0XA 1AZTA 2DPXA 3ZZTA 2WZQA 2ZRLA 3GEEA 5JJIA 2J7PD 3IBYA 2OCPA 5DISB 4U02A 4DEXA 2SHKA 4PQYA 3ZVNA 4JVNA 5TMPA 1WBBA 1G3MA 3K0AB 3SEAA 4B6EA 2IS1A 2REOA 1E3MA 1SVIA 2WMNB 3CX8A 5FOTA 2KI5A 4EFMA 3UWKA 4D2IA 4S35A 1OIWA 2H7VA 3BH6A 3GJ7A 2D4HA 1OFHA 1QHXA 4R7ZA 5F9FA 4PSVA 3IQWA 4FCVA 1TTTA 4PTLA 3QXJA 1ZUIA 4H9GA 4QGGA 4O0MA 1BS1A 4BFYA 2ZSFA 2OM2A 1T6NA 2BHRA 4DCSA 3SYLA 5FI1B 3SFVA 4CVNA 3GJ8A 4PHTA 2GF0A 2IA5A 3DM9B 1MT0A 1SXJD 3R8CA 2ZR0A 4JKIA 2CJWA 1GAJA 1RRPA 3BOSA 3CPJB 3IGFA 3LY5A 4PQRA 3UATA 2GF9A 4PZLA 4Z1MD 3RS2A 5JJKA 2NO9A 3CZPA 1Z22A 3PENA 5AUNB 3B9PA 1CU1A 1ZJ6A 3AVOA 1U2RA 1ESMA 4ZV4A 4UJ3A 2F1JA 2QPTA 2OCBA 4AKHA 1U8AA 4RZXA 3D6TB 2IEYA 5E7IA 3A4MA 5AWFC 2YC2C 2YOHA 1VCOA 2AK2A 2ZROA 2YC4C 4KODA 3VFDA 1Z63A 1SKYE 4P32A 2VHQA 2VIIA 1WDTA 1CJMA 3SBDA 4BEJA 1HE8B 2IWHA 1S0UA 3CRMA 4C0KA 1BMFA 5HTKA 5F9HA 3GJ6A 1XX6A 4Q9JA 1KYIA 1M7HA 1CJUC 1G7CA 3A1UA 1DO0A 4TYYA 2AD5A 3W3AA 4NTZA 4QM7A 3GQBA 3H86A 3E1SA 1L8QA 1D5CA 5DN6A 1NBMD 3BAFA 4XVRA 1A5TA 3RC8A 5BN5A 1ZCAA 2CMKA 4A15A 1J99A 3I72A 4B2PA 2KJQA 2Q0HA 5HE9A 1Y63A 3KKNA 1G17A 1OHHA 3K70D 1K5GA 3M0EA 1W5TA 4Y0VA 1E99A 3HDTA 3QBVA 221PA 2WPDA 2I1QA 4GZLA 1G8GA 3CX7A 4JYCA 4X8OA 2O8CA 1NIPA 1PLKA 5EP3A 4M1YA 1QG4A 1QHHB 3IQXA 4I1SA 2G88A 4TLDA 4IDQA 4B76A 1G7SA 3X1WA 1CKEA 1ZM2A 4G5SA 3KXIA 5JS8A 4M8NE 2ERXA 2D7DA 3OFNA 1S9HA 4DLXA 3B78A 3QF4A 5L3RA 3I73A 2W0SA 1EK0A 4DCTA 4TMXA 3LQQA 1II0A 5G3ZA 3Q72A 2UZ3A 5HKKD 2VP0A 4HZUA 4IDNA 1E0KA 1T0HB 3UMSA 2XTMA 1E1QD 5SZIA 1TU3A 4LHXA 3AVPA 4RJLA 2QG6A 1DO2A 1SHKA 2Z4SA 2J7KA 3IDQA 5CB8A 3JZAA 3WRYC 1UBGA 1XDBA 4MYHA 3FHCB 4IDOA 1E79A 3KJHA 1QF9A 3U4QA 3NBZC 2FFAA 3EIEA 5SZHB 1ELOA 2GZDA 2R9VA 2CJWB 1G16A 3RSLA 1VECA 2ZITA 4A36A 1A7JA 1KAGA 2CL0X 3CW2A 4BWYA 3VNVA 1BH2A 2ANCA 2W2VA 4HLQB 1KSGA 6Q21A 1H8ED 4POAA 3LBNA 2CLSA 4DSOA 1F5NA 4XSHA 3UG6A 3TR5A 1DAIA 1NMYA 4QXAA 2O52A 2RGGA 4GP7A 4P4TA 5CITA 1KAOA 1Z5ZA 3TVDA 5F2EA 3DPUA 3R8FA 1XEXA 1GZSA 4LI0A 2B7CA 4IXMA 2QAJA 2Q3MA 3LDAA 3GPLA 2IUSA 4RCZA 4TL7A 4WZAE 4TLCA 1KKLA 1MO4A 2YWFA 2ZI6A 4O2RA 3QI2A 1DVRA 1VYTA 4JYBA 2NO0A 4OJKA 1JAHA 2ZRGA 4M2LA 4HSEA 1TX4B 4US0R 2F9MA 3F3YA 4YMSA 1JR3D 3ONWA 2JCSA 2PEZA 4ILEA 2W0MA 3QSYA 4BFWA 4AY2A 3IUYA 1ZAKA 1CIPA 1XP8A 3MWKA 3AF2A 2QE7D 1OIVA 5DHFA 4D4KA 2ZYVX 1DAFA 3WNBA 1WBDA 1X8LA 2NMVA 3GJ0A 2IL1A 3EWSA 3WHKA 2YHSA 4AKEA 4P4UA 4FW9A 3BB4A 2P0EA 4QHTA 3C16C 2J3EA 1S3SA 2ZRBA 1S4QA 3BB1A 1O87A 4IVPA 2GZHA 2RGNA 4UNSA 1DAMA 4XD7D 1PVOA 1W44A 2BM1A 3WHLA 4IW3B 4JLPA 3V00A 2RGBA 2IYXA 2XJ4A 2ZJBA 3BFKA 3AGPA 1IN6A 4M9QA 4WOPA 4YONB 1LF0A 2O8CB 4CEIA 1RFLA 1ANKA 4OI1A 4EKDA 5GJBA 3VKWA 3ZIAD 4DUGD 4HAZA 2WJHA 2X19A 3PEUA 4D26A 1GSIA 1NP6A 1TU4A 2OXRA 4Y0AA 4URXR 4Q4AA 5L3SB 1JQLB 1ZNYA 4B3BA 1OPXA 1XPOA 1UJ2A 1W46A 2CHQA 5BXQC 4CW7A 3GFTA 4QBHA 4E09A 4Q19A 5LD2B 4RCYA 2O0HA 4A6PA 3QF4B 3I3SR 4B32A 5M04A 4HAVA 2JLUA 1SGWA 1Z0AA 3QKUA 3U61B 3GLGA 3MMPA 4Q4HB 1OXTA 4HLDA 4LDJA 4PR0A 1AKYA 1G41A 621PA 1E96A 2IHYA 2VSXA 2PLRA 2WM9B 4NYIQ 1W47A 3GP8A 1OH8A 4LCBA 1E9SA 1TF5A 2P67A 3NC1C 3K09A 2IYVA 1JPNA 1OFUX 4PPFA 1XTIA 2F43A 2GJKA 2GCOA 2OHFA 3HR7A 3PUVA 5FTJA 1DARA 1RYHA 1OXUA 1CEEA 1OB5A 5IDVA 2JA1A 1EFRD 4TYWA 1OXXK 5BN3A 4HZIA 4Q48A 5IT5A 4JT2A 3AKCA 4LJ7A 3TW8B 3RS7A 2C78A 4DT1A 3KXKA 2K5UA 4EPTA 2N1BA 2QMEA 2H5EA 3VAAA 3B8HA 4LHZA 3DZDA 3PUWA 3FOZA 1Q21A 3D3QA 2ATXA 5E95A 2KWIA 3AH8A 2GDJA 2ZJYA 1N0VC 1Z28A 3AGQA 4XTRA 4Q01A 3SFZA 4IEEA 4E03A 4S2EA 3SS8A 1CTQA 4PSKA 1ZUHA 3CRW1 1KDRA 5CJ2A 3L0OA 4MRRA 2OCYC 5KUTA 3H4MA 3VTKA 4I1UA 2WWFA 4KVGA 1JEEA 4TT3A 1IONA 1OB2A 2CCGA 3AVXA 3KKMA 3D8BA 5DSZA 3RS5A 1UKZA 1K5DA 1N5KA 4RSGA 5JWOA 1P60A 2WWGA 3K0EA 2WIAA 4TYQA 1AS2A 3ZVMA 4DLWA 3NKVA 4K46A 2ZRAA 3LAWA 3K0FB 1TEVA 5JMTA 3IILA 3ZS8A 4IOJA 4BUJA 3FMIA 4BASA 2Z83A 1KJYA 4HATA 4KVAA 3TNFA 1GNQA 5BQ5A 1TQ4A 3BC1A 1TF2A 4NONA 1U8YA 1VYVA 1Z6YA 3CKLA 3HJNA 5EE3A 1V43A 2OBLA 1RJ9B 2NQ2C 4PC3A 2FOLA 1XMSA 2H57A 4CEIB 1GIAA 5CIQA 2Z5FA 4GOKA 3T15A 2GXUA 5DE3A 2W6JD 2NOAA 1UAAA 4ASUA 2WWYA 3UKDA 3BJIC 2IF0A 4TYPA 1IAQA 4URWR 3U2QA 3QXXA 2DY1A 3P4YA 4TSFA 4GL2A 3RSOA 3UK6A 2JGNA 5LBIA 4BLRA 2GRJA 1Z3IX 2OILA 5CLQA 3FMOB 1S2MA 1GRNA 3H0KA 2G1KA 2ZE5A 1Z0KA 4IRUB 1P4SA 1Q1QA 421PA 2O8DA 1E94E 4YMWA 4B48A 1MH1A 1E6CA 3G82C 3L8ZA 3QBTA 3TAUA 1SULA 1N5JA 5FTNA 4P0TA 4Q1DA 1EGAA 1QRAA 1NN5A 1OE0A 4CEHB 2A78A 4V0MA 2MSDB 4QL3A 2QNRA 5AK0A 3LFUA 3MCAA 4FMCF 2R6DA 1U0JA 2ZVQX 4LZZA 4PHFA 5H8WA 2IT1A 2GXSA 1E4VA 3FFAA 3U3RA 2ODBA 4G5OA 4TL9A 3SHWA 5B58C 4U00A 1CXZA 2IS2A 3EPJA 3K9NA 4ITRC 2C8VA 2FSFA 4DT1B 1W4AA 2QQ0A 2XOKD 4HDQB 4KLZA 1E9RA 2GJ8A 1Q3HA 2CEAA 2JLVA 1L2TA 5EXTA 3F0TA 1COWA 2NGRA 1SXJE 2ZE7A 1JNYA 4ACBA 4XWAA 2D2EA 1I2MA 4ON9A 1BIFA 4YXWA 3K0CA 1YR8A 5GJCA 3WBJA 2VP5A 2DFLA 1IOZA 4UQOA 3RWOA 3ICEA 2FF7A 5KNBA 3GLFA 2BEKA 2XB2A 3FMPB 5HE8A 4LJYA 4C0HA 1G8HA 3FB4A 5EUQB 1R5OA 2BJVA 1AN0A 4M1KA 1W7AA 2F1HA 2XNDD 4NDZA 2A2ZA 3ZH9B 2O8BA 4KI0A 3A6PC 1Z08A 4DWJA 4OI4A 3BWDD 2IEZA 1Z6TA 5E7JA 1E2NA 5EXXA 4WW0A 4MRNA 5JHHB 2N42A 4AYWA 1E2PA 1ZMXA 1GM5A 4DDVA 3EPKA 2J9RA 2IYLD 1AGPA 3DL0A 4CT4B 1VPLA 1NBME 1DEKA 2H1LA 3DOEA 4UNQA 3W6PA 1WRBA 4B6FA 2DFTA 3LV8A 3X1ZA 4A1FA 4EPXA 1ZM4A 4GOJA 3OIWA 1Z6XA 3DMNA 4JBYA 1NNEA 4JZKA 1VG0B 5DHAA 2D2FA 1FMJA 3UPUA 1G18A 4RD4A 1GVNB 4PPGA 1S8FA 3QQ5A 3VNUA 3MD0A 3KJGA 3DDCA 3QKSB 2ZQ5A 1W48A 3QUSA 2VP2A 1W4RA 3AP3A 3KB1A 1RW4A 3LQRA 2YKGA 1R0WA 3PG5A 2OBMA 2XZOA 2O8DB 5J4YA 4IVQA 1AQYA 2GVDC 1P2TA 1Z06A 3C15C 2ZAOA 3TGPA 5TV2A 1IY0A 4DC9A 4HYYA 3SR0A 2D3WA 4JS0A 5K8UA 2QSZA 4Q7JB 3OEHD 1DAGA 1KI8A 4KSCA 2BM0A 1X1RA 5EE1A 1F3OA 4GT1A 1FTSA 4A0FA 1UKEA 2GXAA 1GUAA 1N5IA 3U5ZB 3T1VA 3MLEA 3QIAA 2RGCA 3SJZA 3K70C 2Q3FA 1ZUNB 1JPJA 1W0JA 2IYWA 4E22A 1G1MA 3T5GA 1BMFD 4ESHA 2OE2A 1W1WA 4TYNA 4R98A 1P2UA 1QVAA 2FPKA 2DYKA 3AF1A 5AR1A 5FR1A 4RKEA 4HB3A 4BRUA 2CL7X 2A9KA 5GJWC 4XWOA 5DN6D 1Q0UA 3R7WA 2YINC 5BYKA 1IJEA 4B3FX 1Z8FA 4JLBA 3V9PA 4DB2A 4I99A 2WOJA 4LC0A 5K8IA 3BORA 2ZU6A 1OHHD 3U3OA 5TXGA 3WYAA 3GLFB 1YZGA 2QY9A 4C2TA 2WPDD 2VF7A 3A58B 4I1VA 1UKVY 3BBPA 3G0HA 2KBFA 4A92A 2ZANA 2PJZA 3GMTA 1JXOA 1E2FA 3NH9A 4US1R 3EC2A 1W36D 4RY2A 2WVJA 4PANA 2F9LA 4BQSA 721PA 1FW6A 4H1UA 3PV0A 4TLBA 3ZVLA 3WYFA 1Z0IA 3SHFA 4HAYA 5AJVB 3OFND 4IJMA 5FOWA 2FSHA 2YOFA 3GJ5A 4YMVA 1G6HA 1P7CA 1N0WA 3B85A 5DH9A 4TTRA 4BLQA 1KDOA 2GCNA 1JR3E 4NMMA 5IK2A 2NZ8A 2O8EA 4LRWA 3EZ7A 3SBEA 1E9FA 4C0LA 4MKIA 3N2EA 1AKEA 3T06B 1XD2A 4YQFA 1ZM3A 3KQKA 3X1YA 4RD0A 1KI9A 3CLVA 4KAXA 4FMDF 2ZRKA 5DO9A 2OUKA 4KYUA 4UJ5A 4YDHB 1E79D 2ZVPX 4OYHA 1E2LA 4QGFA 4QG7A 2Q3HA 1P9WA 5AUQA 1MO5A 4LJAA 3HU3A 2ATVA 1FQKA 1ZNWA 2BEJA 2LCFA 4M1SA 1FZQA 3FKQA 4Z51A 4F4CA 2MMCA 4NCIA 4W5HA 1XEWY 2XZPA 4Q4JA 4TZ0A 1XB2A 1US8A 1ZC4A 3K0SA 1CJVC 1YZUA 3EG5A 3WY9A 3SN6A 2D06A 1KJZA 1KHTA 5FTKA 4NPHA 4KYIB 2JJ1A 4XOIA 4C7OA 3W34A 1M34E 2FSGA 2H18A 4M4SA 3L0PA 1HT1E 1CP2A 2HV8A 2OESA 1GDDA 1NG9A 3CX6A 1U94A 4H1VA 4E5UA 3CPEA 1TQ6A 5FBQB 2PEYA 3SNHA 1KSHA 4R2IA 1VCMA 1DPFA 4IVRA 1M7BA 3K9LA 2QL6A 2R44A 2A5YB 1OKKA 3SZRA 3EZ6A 2GCPA 3M6AA 4C3ZA 1G7TA 3HU2A 3EZ9A 4GNKA 3R7WB 2F3RA 3TKLA 4C9BA 3CONA 2ZS8A 1G9XA 4KV9A 1AA9A 1Q44A 4NCKA 3I92A 5J4HA 2RKOA 1ODFA 3WBKA 3SQWA 2FJUA 1A2BA 1Z0FA 2OT3B 2Z0MA 5JBQA 3GJXC 2BWJA 1JECA 3KDSE 1FX0B 4IHQA 2GEUA 4MGKR 1H8HA 3I8XA 4J0QA 4W9MC 2QSYA 4KFRA 3SQXA 2PCLA 5FI0B 3THOA 1T3HA 2V1XA 1GILA 2VPPA 4WXRA 4F4JA 2FA9A 4L9WA 3KUCA 4C0JA 2QPOA 1NJGA 4Q7KA 2AXNA 4B73A 3W6OA 1IY1A 1R0ZA 4DLTA 1XTQA 1Q22A 3EZ2A 1MABA 2V1UA 1XMJA 1VDZA 1R2QA 4PXAA 1CJKC 3CR8A 2F55A 1MRSA 4ZPXA 5EP4A 5KNCA 3A1TA 3UG7A 3QPVA 1KI1A 1T8UA 3U7EB 1G8FA 1VCIA 2A7QA 1SVKA 4KITB 3THYA 3JVVA 1IQPA 3NBYC 4OK5A 3AUXA 1LS6A 3J81k 2GAAA 3CNLA 1XTKA 1XD2B 3AVTA 1D9XA 2A5FA 4LPSA 1GKUB 2CDNA 4KXFB 3RDPA 2JLYA 3KTAB 2PCJA 3Q85A 4M9XA 3KQNA 3QVUA 2GEVA 3RRZA 3C5HA 2GBLC 2GHIA 2QMOA 2XX3A 1LB1B 3DKVA 3QE0A 2ZI5A 3SE0A 4TMTA 1KI3A 2JJ2A 3HYTA 3MJHA 4JT4A 3R9IA 3T1OA 4GBMA 2BKEA 1YVDA 5JJLA 2ZRMA 4KFUA 5EE0A 2GJAA 3O8CA 4Q4JB 2XXAA 3BS4A 2FZ4A 2J87A 3RRNA 2C2HA 1PLJA 2ZJ5A 1WA5A 3TE6A 2HCJB 3FHTA 3Q8XB 1P2SA 3IO5A 4C7OB 4HEJA 2BCGY 2UVQA 5TY0A 2XEXA 3N70A 1P5ZB 3CR7A 3I5XA 1TAGA 2J0QA 1GP2A 4OHWA 1BYIA 1G20E 4D82A 5HCNA 2ZPTX 5J5CA 1ZU5A 4TT3D 1JALA 3P4XA 4M53A 3CIOA 3M1IA 5BWMA 3EIQA 1HA3A 1SKQA 2DFKB 1Q57A 3K1JA 4D0GA 3AUYA 2W58A 4CF7A 3M4YA 1MKYA 2AK3A 5C18A 3KFVA 2EFHB 3GLHA 3UMRA 4JBXA 1JJVA 2CVHA 3LW7A 4EIWA 2JLSA 5EE9A 2FPMA 2CHVA 2E87A 1ZYUA 3SU8A 1CR4A 2ZRFA 1Z0JA 2G77B 3CF0A 5CB6A 4TZ6A 4X8HA 1L7VC 2X2EA 2EFCB 4GPTA 3SI7A 1X1SA 2GNOA 1VIAA 4V02A 3IO3A 3BFXA 3LXXA 4PQFA 4US2R 3O8RA 5DLQC 3BIFA 2BDTA 1K8RA 2RHMA 1J8MF 1LY1A 5FTLA 1XD9A 4ZDIA 4A9AA 3A4LA 4EQ6A 4ASUD 4P3YA
chains in the Genus database with same CATH superfamily
3HV0A 2O1SA 2NUTB 5J23A 2WHXA 1N2SA 1V8ZA 2QU7A 1ZI9A 4RV4A 3ZCPA 2C20A 3FNBA 1QVWA 2JGLA 4G0PA 3HA2A 1VE7A 1YAHA 3B6EA 4MWBA 4B4VA 4MQFA 2PRIA 3L18A 4RHTA 4J9UE 1WEHA 2BDEA 3QPBA 1JIIA 3QX9A 1U7PA 2RAPA 3CW8X 3S55A 1F2TA 2FQQA 3BH7A 2JH8A 4RHCA 1PNVA 4G1UC 4L4RA 2RHTA 1J70A 2XKAA 2VO1A 4UARA 5HJEA 4X5OA 3V34A 1RMTA 3VKHA 5BW4A 4D56A 1PQWA 4K6HA 4Q9KA 4GI2A 1N1GA 1DKPA 1XCOA 2B34A 5E2AA 4WZ6A 4B7AA 2WYWA 2YFQA 1GNSA 3LGSA 4E07A 3BCSA 4DCPA 3BFVA 1LJ8A 2ZIXB 2PRSA 3L06A 4A26A 3LY7A 1Q83A 1QFYA 1P2VA 1UBOS 4IH9A 2C5GA 1OLXB 1G8SA 1C9YA 2PV7A 4L73A 4LV5B 3IIEA 1UXHA 3JQRA 4JT9A 5P8WA 4BWVA 1HQYE 3T5DA 2IK8A 4HUJA 1WB9A 1RYNA 3P20A 121PA 5I7SA 5DWDA 1OXMA 2G25A 2PL9A 4ZPJA 1WEKA 2DU8A 2AFRA 3IE0A 4Q3LA 5BSTA 3V4RA 2XXAB 1UMBB 3IAFA 4FQ8A 3D6UA 4WQMA 3TH5A 2FPSA 4IHAA 2I80A 4IYRA 3AXTA 1RYFA 2I1LA 4M54A 4FM9A 5J47A 5B55A 2JIRA 3EZLA 4PZ0A 1CQJB 3N58A 3WBFA 3F1KA 4BQPA 3DOHA 3FTCA 4YXWD 1XZBA 2Y0CA 2VH1A 1IVSA 3DDUA 3IP7A 1E7SA 3F6YA 2KBEA 3GDWA 4Z7OB 1MTZA 4AZVA 5KNBD 4YRAA 2YXNA 2VJOA 3WK8A 4HDNB 4O4HB 5I9LA 2JVKA 3H9UA 4UE2A 4MPJA 1L5GB 1FYEA 1XZDA 1ZUWA 5C35A 4MPPA 4YDRA 2JFYA 3O3MB 2VLIA 3K6SA 5DK6A 3DV2A 1SCKA 3GZJA 1TMOA 5ER6A 4P4SA 3U4DA 1W36B 5BW5A 1X80A 1MOZA 2NZVG 2JARA 2ZB3A 2ID8A 3C74A 4IO0A 2IS6A 5K6TA 4DAOA 1JEYA 2DPYA 4JLJA 4L5BA 1RRFA 1GL7A 3CY6A 2A9VA 5AIAA 5DX1A 3RI3A 4HYEA 3R7LA 4F4DA 4ZU6X 3AB3A 4QVIA 1R6VA 3GJZA 5G1OA 4KH1A 1U9JA 4LF4B 1JQKA 3KT0A 3PDUA 3M6WA 2M6LA 1E5QA 1ZHHA 3ZVRA 1T9GR 4BLOA 1BCRB 2ZRIA 3R3YA 4MVWA 1ZL2A 2PTGA 5TVKA 3X2EA 5IJZA 3G9ZA 2WIGA 1JU3A 1POXA 2XBUA 3G8BA 4MYTA 1UADA 5T6MA 3BQMB 4L3WA 1NDQA 1XBTA 2I4NA 2PBZA 4UNPA 4E5DA 9ATCA 2HL6A 1KOFA 5JCPA 3U4QB 1PFUA 4UMEA 5JLJA 5LP6F 1WZNA 3O47A 4G63A 4MHSA 5DVZA 1OBFO 5A3VA 2ILTA 1GPBA 2ISCA 2OECA 4CBVA 4DQ0A 4KG7A 5AKHA 1W94A 3DUWA 4NBTA 4BKQA 3MWJA 2IW3A 3WGOA 4A8JB 1GZDA 4IWNA 3F46A 2CFIA 1T9HA 1YRBA 2BGJA 3FE2A 4MVJE 5B1IA 3O8DA 5C0OE 4LHYA 4HMOA 4CZ2A 1CF2O 4XRRA 3L6OO 3QU5A 1NVXQ 2G40A 5EG5A 3CNQS 2FPPA 5LQCA 1RI1A 1OILA 1U5AA 1NBHA 3DHNA 2P9JA 3N2ZB 4TPKA 4HEQA 1HQDA 5IMBA 1JFFB 2PAAA 4TM7A 1I51A 2GHRA 1HBJA 4KDCA 3WRVA 2QP3A 3VHRA 4ENQA 4AFNA 7REQB 5KVVA 1XEXB 2NPIA 1JAIA 4NG4A 1JTVA 2XUQA 4UAVA 2NU9A 3LA6A 4FZVA 5AJZA 1FW8A 1F2UA 1KS9A 1ZU4A 3ODPA 3VJMA 3UTCA 3ZY2A 4E0BA 2CBZA 3WDLA 4CFSA 1QF6A 4UU8A 2CV1A 3WYCA 3BL6A 4KVZA 4PTYA 2AJTA 4H18A 4MJLA 5CEJA 3HNRA 1DLJA 2PL3A 3GFBA 4G1FA 1R5JA 1SUPA 3PFGA 5D3QA 3HS3A 4UHBA 5F5XA 2ZSIA 4WN3A 1DRUA 2RHWA 3FYDA 4UTVA 1QXSA 3S29A 3KKPA 4HSGA 1A8HA 1FPMA 2TMKA 1G6OA 5AKEA 2D54A 5J63A 4HDRB 3FCXA 2GA8A 3GCWA 3P5BA 3PBKA 4ZOLA 2REXB 5JAQA 2QP4A 4C3VA 1SZJG 2GBPA 2V0GA 4JBWA 3GZ4A 1NKSA 4URZR 3ANTA 2JHCA 3FLAA 5TR9A 3QLVA 4JL8A 1IL0A 3ZY4A 5LD2C 1ORHA 3M5CA 4PLPA 1HTWA 1XNGA 4JJFA 1K68A 5JAPA 4JT8A 4ETMA 4BPBA 1T10A 1DKUA 1DQYA 2P2NA 5DNWA 4KMSA 1ZIPA 1WM1A 2QMZA 5DP2A 1AURA 2POCA 1TVKA 2ZUVA 5DI3B 5F78A 3ZJUA 3R9WA 3BILA 3CSUA 3OICA 3UMFA 4FYWA 1TQ2A 3Q7IA 4GX5A 1RI3A 1H6CA 2G8LA 5L3QA 3ZDEA 1C7JA 1AZWA 2ZJ1A 4GE0A 3ZU4A 5C53B 2JASA 2AFHB 1TYCA 4KRGA 4Q3NA 3KSAC 3I61A 2Y1DA 3AVUA 1EK6A 4YCMA 1J06A 1WLSA 3RUIA 1TFRA 1DV1A 2R86A 4OGLA 3TMKA 3EF1A 3CA8A 1QMPA 3D6FA 3H5OA 2Z8ZA 2C5LA 2HGSA 3ACBA 3KZ1E 3QSGA 4UNIA 3KR0A 4ODIA 4UDYX 2ADOA 1UDAA 5BR7A 4KPEC 2VBGA 1U4SA 1GG9A 1Z6QA 2JFFA 5LIRA 2UXCB 3GLGB 1V5FA 1T8TA 2COEA 3E53A 2H7XA 2Y0EA 3GAAA 3L40A 3OZ7A 4MR8B 1SUCA 1WXHA 2I22A 1DWOA 1RQNA 2FN7A 4L4SA 3UAGA 3TZCA 3O4IA 4RZ2A 4YREA 3T3EA 1EWRA 1EP2B 1W5AA 1XSEA 1O95D 2BAGA 4LRYA 1J2UA 3F8WA 4GP6A 5FHRA 2ZIUB 5BW6B 2F43B 1ECLA 3TSOA 2QJRA 1V8BA 4CEJB 4AKIA 1E1RA 2IU4A 2V7GA 3N2GA 3QJGA 5EJMA 5HCUA 2B92A 2EKLA 5SV2A 4L95C 1JDBB 4JR0A 5HJ2A 4Y6QA 1ZIXA 3V2IA 1SHJA 3FCSB 4UU0A 5JHGB 3E4DA 1BHJA 4EZEA 4J75A 3SF0A 5CFPA 3C6YA 4CI9A 4KWIA 3C6QA 4XWYA 1DHRA 5EPUA 1BQ3A 3FMVA 4KNWA 4FEAA 4M6WB 5FOVA 1XA3A 3SD7A 3TSZA 3HO1A 3VUFA 1KEZA 3HADA 1OV4A 1VKJA 1N6RA 4XGKA 5L95A 2GWRA 2R8EA 2E82A 4O8CA 1NP7A 1XZMA 5IW8A 5ADHA 1P9NA 2IPMA 2DPHA 1KGSA 2VP4A 2PBFA 2W8BB 4DC0A 3A3PA 1VMKA 1M1YB 2ZRHA 2V54A 3A9UA 2WFZA 4IZ6A 3JVUA 1XD8A 2ZU0C 4HFRA 1PD0A 4FOPA 4WVFA 3TLCA 3HO8A 1F8YA 4BJ3A 1V3TA 1YQUA 3CNNA 2B3DA 2PGAA 2BH9A 2YHAA 3Q88A 3N0WA 5L6LB 1RRKA 2LBPA 2WUGA 2WJ6A 4EM6A 5CIYA 5CDUA 3S44A 3H2IA 3ES9A 1ORVA 3ZD6A 2O3SA 3W05A 4RL6A 3DXXA 1DAKA 2C8JA 2HOQA 3TD6A 4UQLA 1ZW1A 2BGMA 3C97A 3KBBA 1OX6A 3EEIA 1LBHA 3OOWA 5B3JA 4FFOA 4J7AA 1XVLA 3QFTA 1XMPA 1N1EA 5CLQA 4RYLA 4JP3A 1WCIA 2NT4A 1Q11A 2VAVA 3ECCA 4A6EA 3PD1A 4MUJA 4X0EA 3WYDA 5JY6A 4RLQA 3KQLA 1UAGA 2C2OA 3OT1B 4YJKA 1MC8A 3L05A 4DS3A 4OHCA 2QJWA 4DG8A 4UE3S 3QKIA 4AX8A 4D3SA 3UTDA 1C30B 1BDBA 1VLMA 4IILA 5EHNA 1KSFX 2ZJ3A 5EZ6B 3AEYA 1GR1A 5K4AA 3TECE 1GD1O 4FNOA 4BJHB 5HDQA 2BMWA 5H0IA 4LCJA 3CCFA 2JGIA 5TT0A 2IUYA 4M8LA 1XDZA 5FB3A 3ETJA 2P9ZA 5KU1A 2WAAA 3G13A 3MB8A 5L9AA 2BJWA 1I1OA 3N8GA 5BPFA 4KLRA 4ZYVA 4CHTA 3HYSA 4JC0A 1XZCA 1A8IA 3FOAA 1OTHA 3NT2A 2OHHA 4RF2A 5KNCD 4L4XA 3DEZA 3D7SA 1RPJA 3U7IA 3E1GA 4R2WA 4BNFA 3Q8WA 4ZZ3A 5DM4A 2IF2A 2WF7A 4QJ4A 1X7ZB 3DBHA 1TD9A 2IHJA 2VKQA 3DCNA 1C9NA 3OF5A 3QUQA 1Z25A 2P6UA 2C97A 5JCXA 4MQEB 2V7QA 3K5WA 4R0NA 4JP8A 3MGCA 4JKYA 4ZCIA 1L8AA 4C4PA 4AG3A 1E8MA 3WLSA 4H7JA 2JGEA 1FVXA 4RZ3A 4ZWNA 3N0XA 1XOIA 3CUEF 3OIDA 2Z8XA 3M3HA 1K97A 2GERA 3MRXA 2M9MA 3C4VA 1T9CA 1RJWA 2Q6VA 2PX8A 5P21A 2AFIE 3AB7A 3MNFA 3SOPA 5HKBA 3HLTA 5BSEA 1QHIA 1XPRA 5AHOA 2R47A 5JO0A 3DWIA 7AT1A 2P9EA 3DAYA 2JJ2D 2I0FA 3DA8A 4G41A 1CR1A 1U5BB 3JD3A 4G0MA 2HTFA 4FZRA 3PF8A 2ZIWB 4K6FA 4RE5A 2Q5JA 4I3FA 2ZAMA 1LTKA 1FFCA 2GESA 3BWBA 3CV3A 1UEIA 1C81A 5CXSA 5HP4A 4CGZA 1P1KA 1XYGA 2WJ3A 3CJRA 3L92A 4IIVA 4V03A 2BHTA 2CNKA 5BORA 1U9CA 1OC4A 2VNIA 4NU8X 4OB6A 4LF8B 3C7KA 3LCJA 3BD6A 4FGLA 1T34A 4KZPA 1ULHA 3KL4A 3KQHA 5ALQA 4U4AA 3SCZA 3UCXA 1Z4JA 1HE3A 1QLJA 1X8KA 3IIKA 3HXOA 5M3BA 2GM5A 1U9IA 2GNPA 4BECA 2F4NA 1B15A 5TJ9A 4BFSA 1VJGA 5K3FB 2CNWA 1JWBB 1IWOA 2R2AA 4XWTA 4RBNA 2IX3A 1XEWX 4P6VF 5FA8A 2C7GA 5KHOC 1PG0A 3QJYA 2EBFX 5LR6A 1DIAA 1S1MA 4KCGA 4V0ME 2II6A 3BKWA 3CPSA 1PUIA 2C1EA 3ZGXA 4CV3A 4AF8A 1YIAA 4EL5A 4BKMA 5C32A 4WZBE 2HJ9A 3DV0B 3R4VA 3PB3A 2BSXA 3PQCA 3SSAA 5FNZA 1E2DA 2VJQA 5JFOA 1AKMA 2J5KA 3N2KB 3NTXA 2P68A 3HB1A 3PCXA 5I51A 3UOAB 1U0FA 1DB3A 1G6KA 1X7WA 5B1HA 4L5CA 2IUTA 2YMLA 1TYAE 1SNYA 3EF0A 3PWZA 4EPYA 1H2HA 2F9FA 1OZAA 1SC6A 1VJCA 3B82A 2A5DA 3NOVA 3IL2A 4HLUA 3NDBB 1EFHA 3ZWOA 2VTKA 1A9PA 2EW8A 3DMHA 5LMCA 2HSEA 5DFAA 1JJIA 1MXFA 2QX4A 4FONA 3S70A 2QVLA 3F5SA 4C5BA 1H85A 1AKUA 1I1NA 3QX3A 1W581 1FNNA 3WIOA 3LWDA 6REQA 1NXSA 1ZITA 3DTYA 1GAWA 4PIPA 2VI5A 3ZDXB 4GWKA 1V1MB 4LBWA 2FU5C 4S05A 1BC5A 1GFIA 1SOAA 1GUDA 1Q7BA 4RD6A 5DT9A 3GLIB 2VQSA 4EHJA 3LYAA 1QKIA 3NR2A 1SKBA 2D3TA 1H2XA 3UUEA 1A5AB 1QVVA 1ONNA 3BRCA 2VVTA 3UW3A 3W6NA 3QTLA 4ZIRA 1N8KA 3U7GA 1KMCA 4JDPA 3Q6MA 3R5KA 3MPOA 1M8FA 1T4MA 1VRWA 3EUFA 3K8ZA 3ROZA 1KI6A 5HKLA 1MU0A 1SUBA 2V8BA 3EBLA 3RVBA 3UA3A 2I71A 4ZMRA 3ABIA 2DRIA 5ESXA 1VJ1A 4QQ8A 4ZRDA 2QENA 5H02A 5CFMA 5FIUA 3BA1A 1OXVA 3KM0A 4HX2A 1S3GA 4KJXA 4RZHA 2WWVD 4BE4A 4ZZIA 1H4TA 3W5AA 1W30A 1DEOA 5LCXA 3KSUA 1XZGA 3HKEB 4O2LA 4U6SA 1JBKA 3VM6A 3FKSA 1OASA 3ZGOA 3RYFA 2HK9A 4YMUA 3F6BX 3HKBA 4Z3DA 1QANA 1L7RA 3NATA 2F48A 1RXUA 3OIUA 4Q9AA 5AW9A 1K75A 3JYQA 4YUYA 3PC3A 5JDCC 2FN4A 3F3SA 5CRIA 4TRJA 2PHZA 4L08A 2AKAB 3UJ6A 1VL8A 3DNFA 3IAHA 3AP2A 1ETUA 3CCBA 4PSUA 1RQ2A 3B13B 1AOXA 3CZMA 1B16A 3NOXA 5KZMB 1NBIA 2WD7A 3HJAA 1YJQA 4ZAZA 3V6LA 4Q1BA 3CZRA 3IHWA 4D5GA 5EJAA 3NALA 4GR9A 3MXTA 1GGKA 1L5WA 1OC2A 5JNVA 1E2MA 3KXLA 3NS7A 4L0DA 3I32A 1J20A 1W93A 4FGWA 5HSGA 1TNDA 1UUFA 1P5FA 2XRZA 4R3WA 1PX0A 1R4MB 5TSDA 3GEPA 4B1FA 1CUWA 3DT8A 4WNIA 5DCYA 5B1EA 2GPTA 1XKLA 1ZH6A 3EULA 3RS4A 4E4YA 3G9XA 5HQJA 1WCV1 2WILA 3HWRA 1CUZA 3UGTA 4OFXA 1Y9DA 4MMXB 1WXXA 4AF6A 4GLJA 3FGZA 5G02A 2PKCA 1XJCA 2I6TA 4JVOA 4F5EA 1PJ3A 2RGEA 3G0IA 5BWLA 1GU1A 1RZ3A 3TIXB 1F6BA 4RK4A 5GOZA 2P9TA 4RANA 2VZ8A 1TT7A 3T7JA 1FEZA 1KMHA 4QEDA 3QVVA 5KHAA 4Y6LA 1ZIOA 4OU5A 4CCAA 2GEKA 2KE5A 1QLHA 1NUSA 1NDUA 3CH6A 1CF9A 4YJHB 4RU1A 4DIMA 4DC1A 4A0SA 3ZUGA 2IJGX 4PAQA 1NT2A 2ZQZA 3AZPA 3H9GA 1DUSA 4N3GA 2AOVA 1M5TA 1RBYA 4XSGA 3V4FA 1EXMA 2HMUA 1A2KC 3GJQA 4EPVA 3FYHA 2VYNA 2FK7A 2GVZC 3QW2A 4TQ9A 4EMSA 1GPWB 5I6DA 5LQMA 3DE6X 4YHHB 2O8EB 1II8B 3WKDA 4GU5A 3DF7A 2PSEA 3DCJA 3I1FA 1RZVA 3EVNA 3K9HA 5FBHA 3TLXA 4ZEXA 4BRWA 4BNTA 4W1SA 1QLWA 2VHCA 3DWEX 4TQGA 4DNXA 4RIIA 2ZUFA 3GYGA 4OLBA 2IHTA 1WNFA 1KO1A 1UJBA 1WMFA 2WJJA 5FUWA 4GKBA 5D3ZA 3V42A 4ILKA 2WHPA 1GJRA 3COWA 3COZA 1VA5A 3OOSA 2ZYTX 3VU1A 1XTSA 4LY0A 4E1BA 5AFSA 1NN1A 1QAMA 2HI0A 1MZVA 2C0PA 3CUSA 3FCUB 4PRKA 4Q9NA 3T61A 4C0XA 2XAUA 3ANSA 1MT3A 3CCCA 3RAJA 3TIGA 1V6SA 2G4CA 3I4CA 3KX2A 2DJ5A 2QTVA 3DZGA 2PX3A 4JUFA 3B1XA 5K3SA 3VZCA 2V5VA 4DVJA 1NRXA 1W96A 3G17A 5SYAA 2VHVA 1FSGA 3UXEA 2NU7A 1T0BA 2P9QA 5EGSA 1AB5A 4XB1A 1XRJA 2GA9A 3CH5A 4ZCQA 4WXEA 3S2IA 2A9PA 2H9YA 1DJPA 3ASVA 1H65A 4FHCA 4ND8B 1HYEA 3ENNA 3VR6A 5CLFA 2YHUA 3S0JA 3WR5A 2W2TA 2HKIA 2HO4A 2P6NA 3M9LA 5CA1A 1VZ2A 5FOXA 3BMQA 1XU4A 2E7ZA 2AUTA 3GAZA 4EFNA 3ZGLA 1XRMA 1KAQA 4AJJA 1WMBA 4MDYA 4QJIA 3K73O 2GZ3A 1O97C 2YZKA 1TF7A 3H5WA 4MP3A 2Y1KA 3D4OA 1YVRA 4BNHA 4B5KA 4UCQA 3SXPA 3HM9A 4N41A 2HZBA 4LZWA 2A0FA 1P29A 3BMOA 2AQKA 4MV0A 4RD3A 1RZUA 4AVYA 1NGSA 3NVMB 3EASA 3E2PA 3ND6A 4PVDA 3ZCUA 2SKDA 4KXUA 3LY8A 4OJNA 4CL0A 1TZ2A 2BGTA 1UMCB 3JRWA 2NP7A 1CP3A 1RWMA 1JHYA 3VPFA 2HUPA 3TLJA 4IUDS 4MQBA 4AB1A 4EB8A 4O4IF 2DX7A 3DB1A 1ZEJA 3GP5A 4ERXA 3WA7A 1D4FA 3WL7A 1IIRA 3IEXA 2XBLA 4XD2A 1A5BB 2R66A 4PNPA 2PQ0A 1NVUQ 2WJVA 3WK4A 1W5FA 3Q41A 2AXPA 3QOXA 2IEAA 2D5LA 2C0CA 4DABA 1MB9A 2HDOA 3R7FA 5D5PA 3U40A 5I7UA 3L4JA 1JG1A 3U7HB 2CNDA 4JNCA 2EAUA 2ZSHA 2EU8A 4TZTA 4EAQA 2B1RA 1GZ4A 4EUSA 3ZZMA 1IXKA 4D80A 3RUHA 1WIWA 3WK6A 4N54A 2QRVA 1ZESA 1E1KA 2HADA 3R5SA 4MOWA 4QGBA 4BCBA 3BSFA 3KHUA 3L43A 3ZHVA 3HKCA 1XMIA 4GR5A 4B46A 2HLDA 4I9GA 5MDHA 2FPRA 1RWBA 3Q2IA 3UFXB 4WZAB 2GTPA 2AWOA 3CEAA 3NM4A 3O2NA 4NDAA 4JU9A 1EUCB 5LDHA 2IRWA 2DUJA 2B78A 1DBSA 4DSUA 4URVR 5K8JB 5K45A 7YASA 5EINA 5CB4A 3RROA 1NULA 2IPNA 3ETCA 4IFEA 4CCYA 4ZVPA 2XE7A 1JBEA 3AVVA 1HZJA 1Y82A 3K0BA 3TB4A 4KWCA 4QXPA 1YF3A 4E4TA 5E9QA 2OOSA 3FNIA 2I2DA 4GUAA 5E2BA 3PQDA 3ZJVA 2A0KA 3HBFA 4N39A 2E89A 1AC5A 3UB2A 3X43A 5CGZA 5FP0A 4TGLA 3UT6A 4LI3X 3DUFB 1PS9A 1QOZA 2C9YA 2JD1A 1GGEA 1IU9A 1SB9A 5IYZF 4O3MA 1ECCA 1ICEA 2ZJ2A 4TMKA 3UENA 1EESA 2QJTA 2EFJA 3K1TA 4OH7A 5ALHA 3NTVA 1P6XA 3Q8MA 3QVGA 2O1EA 1L1EA 1UOPA 4XIGS 4LV6A 4DHWA 2EX1A 3OESA 1DC6A 4JB8A 5CT8A 2PWBA 4ONEA 1NTRA 3D5QA 3T5MA 3ZHSA 3ZD7A 1YIDA 3IUPA 5YASA 4DAEA 3DLAA 3DEKA 2H2AA 3Q0TA 5GONF 2RHHA 1QVZA 3IEIA 5LP6C 1D0IA 1J7KA 4UUNA 4LX0A 2JCGA 3HCFA 4DQXA 1PW7A 1QHYA 2HWWA 1OLSA 1WETA 1N3LA 3IALA 1HL3A 2FMIA 2H51A 3CUWA 3ULKA 1YDMA 3CE9A 2BHLA 1XF9A 3HPQA 1ZR2A 3OZAA 1G38A 2OAGA 1SQ5A 4TL6A 1XDDA 3RGGA 3UEOA 5CCXA 5KHLB 1GUYA 3SYNA 1N0HA 1FVFA 5A4DA 2BE9A 1GKKA 1BXGA 2E85A 3TRFA 2C2GA 3NHLA 4NJMA 4RIEA 1WPRA 2GR9A 2RAVA 1XKTA 4MVJP 3SC2B 2RFLA 5C1OA 3VX3A 4UOQA 2QQFA 3MOIA 3VZSA 1U98A 3OZIA 2ZB8A 1XQ1A 1F38A 2HHJA 4D98A 1GQQA 1PTJA 4U6NA 3JQAB 4D9NA 5BQXA 2QX6A 3FUVA 4LQ4A 4IMJB 2A7XA 4O1MA 2C9CA 4YRQA 4CKZA 1UDWA 3LD9A 2R97A 1FMLA 2H17A 2IEBA 3FPEA 4P31A 3RRYA 3N5KA 4YASA 1RI2A 2W43A 3HA7A 4C2AA 2Y67A 1CB0A 1Z9BA 3GRRA 3VR1A 1FFWA 2XNJA 4O02B 3GMIA 1M2OA 1XRLA 1XELA 3TFQA 2BFDB 3HKDA 3WGTA 4XWKA 1MX1A 1TW2A 3IKTA 5E0OA 2E49A 1FQOA 1PEDA 1YACA 1L4EA 2W2LA 3FGPA 3MJCA 3MTDA 4MZXA 1L5HA 3U3XA 3WNCA 3ZWDA 3ZLUA 1E2BA 3FPCA 2OENG 2QUHA 4LYAA 5ALEA 1J1ZA 1S96A 3EGIA 3S8MA 4UKDA 1VHLA 4NDNE 5I9NA 3D54D 2OBNA 2WFLA 4JB3A 3VYTB 4CLHA 1G5TA 3EAQA 1HOXA 1Q1ZA 1FE8A 1W2WB 1QUEA 3V2GA 5ENZA 3N05A 1C8KA 2VAXA 2VOEA 2XPCA 3HXKA 1IQRA 1OFUA 3KKKA 1F7UA 4NZZA 1PL8A 1R6TA 1RJGA 1QVRA 1KR2A 5E9WA 3HJGA 1ISJA 3KJFA 4MS1B 3D7NA 3T1NA 1I32A 1ISMA 2CXSA 4MAMA 4W9RA 3WSVA 2HF8A 1BHSA 4V0LA 9ABPA 5AD1A 3O2SB 4O2BA 3HB9A 4OREX 2CFTA 3WHPA 3G5UA 3PUZA 4RTMA 1Q12A 4TLLB 3D4LA 4WK6A 4X24A 4M87A 4DDHA 4F21A 3AFNA 1ZSYA 2WJGA 1ZBDA 2GAOA 2VHXA 1SK8A 1S3IA 2PMKA 1KBOA 5IZ4A 3VVMA 1UDRA 1FP7A 1YJAA 3GCGA 4RXUA 4HNHA 2YS7A 3IAEA 2QRMA 3QXHA 1PR3A 1WXDA 3TGLA 1SVOA 2EARA 2GPNA 3HMKA 3HY3A 4MGIR 3LDFA 1X1QA 1K63A 4HH0A 2VDKB 3DHWC 4OQNA 5DTJA 4AIRA 3AHGA 4LF5B 2EGHA 3PQFA 2EG9A 4MKXA 3AG5A 4EI9A 2WDPA 3W5BA 3V4LA 2IYNA 4UUOA 4AXBA 1M1NA 2IUUA 4C2UA 1VMDA 1DKOA 3KL2A 4BBZA 5IDQA 4CL2A 4IG4A 2G6BA 3KLBA 1I7PA 3UCFA 4TLAA 1M2JA 4I81A 3OF2A 3RRXA 1FDRA 3C8UA 1R4NB 3CWQA 2IYOA 2PUHA 2VDWA 3DULA 3JVDA 5J5AA 4C05A 1B6RA 1JLSA 3TQSA 1A1SA 3PNBA 2JIMA 3UF0A 3AVQA 5JS1A 2WJZB 1EUDA 4Y1RA 3DBLB 1UC4B 3BHMA 3ZYCA 5JISA 5JSHA 4WY5A 4II7A 1GQSA 3S5JA 2E55A 4G0OA 2E1RA 3OZTA 5T3UA 2EFGA 1P7WA 5HQ3A 3RK1A 2R5FA 4Y6GB 3T35A 1IN8A 2G0NA 3S2EA 1JR4A 4HJXA 4I50B 5KNCH 2VEOA 2YNMD 1JP7A 4YWHA 1TUEA 3F4LA 2AX4A 2ZJ8A 4JSTA 1WG8A 3REGA 4F2WA 1A5SB 2C0QA 2A5GA 2FEOA 4WCFA 2H0RA 4D3DA 1GUFA 4KWHA 4TLMB 5H9VA 1A88A 1NVVR 1S8NA 1XF1A 1ISSA 4NU0A 3EEFA 4X71A 1XEFA 4W6ZA 4CN9A 1DI0A 4KACA 1BWPA 5JVDB 2OGTA 5F12A 5AW0A 1RSZA 2AZ4A 4FYMA 2J3KA 4AP5A 4QARA 4BX0A 5AVYA 1EDDA 1L5VA 1AS3A 3II6X 1R16A 5CK4A 2C92A 1GRVA 5HRCA 4U7HA 3DOUA 3EGOA 3ZLVA 1UBEA 2ZBGA 2OXCA 3VHQA 3GXOA 5IBCA 4U63A 1W52X 3EFHA 1ISHA 3DH0A 5C1DA 3ETEA 4L07A 3U4CA 4ZJPA 1N2GA 3BDVA 1KDTA 3VOSA 3WYGA 3VHXB 3TNLA 16PKA 1SXJB 1F9AA 2B0CA 2FH5B 2GLTA 2XDQB 2G9NA 2W00A 3K53A 4M9SA 1KMQA 5G0UA 4Z6KA 3JQ9C 4BO0A 3D3WB 4KMRA 4M0CA 1SR8A 4CQLA 4HB4A 3I52A 1I01A 3RKSA 3S28A 4K8RB 1KO5A 1SPBS 2PQ2A 5DJ5A 5AKXA 2VJKA 3MIZA 3B5IA 2HREA 5JROA 1UK6A 5KPDA 5FFMA 2LV8A 3WHIA 1GCUA 2C77A 5KIAA 2WT8A 5IKMA 5KX5A 3Q7QA 2XWQA 4R68A 5C8YF 2XMBA 1ULSA 3DMTC 3BZBA 2AFHE 1PRYA 3T1QA 5KYGA 1NJ1A 2AI3A 4QU8A 2NSDA 2YDYA 1GTVA 3JRNA 1U7DA 3P9CA 4KDFA 1TYBE 4EG0A 1RVV1 3RIXA 3NFRA 3OIVA 1DTWA 2F1KA 2HA3A 3ED1A 5EZYB 4OATA 5LA6F 3ZWPA 5HOEA 2XAAA 2FE4A 2XUIA 3AFMA 1EUQA 3Q9LA 2PSFA 3TKAA 4CLOB 2ZRPA 3DW3X 2ZI3A 4E32A 1NOKA 2AWNA 2JKVA 3CU5A 1WQ1R 5FTWA 1MB4A 2AS0A 3PFBA 4I4TA 1HXHA 1E5VA 2GI4A 4RIGA 4XGQA 2WU0A 2QTAA 2WUDA 4N6OA 4ZA2A 3QTTA 5EZSA 1GNPA 2YW9A 4DSNA 3LH5A 1ULUA 5C7IO 3QA3E 2P9FA 4KRXA 1RI4A 2ORWA 3SYKA 2FWRA 2PZKA 1C7RA 1DP4A 3CXUA 1E3DA 4PZZA 4UOEA 4QZVA 2V3CC 3NEYA 3SEZA 4DLBA 2AEJA 2GRAA 1CB7A 1XTJA 1Z17A 2QTHA 1IPHA 3PGJA 4X90A 1RM4A 2ERYA 4W5TA 1H0HA 2IEDA 3H4VA 4ESOA 1H42A 2QQ5A 4DIUA 1QZXA 4QRIA 4HEHA 2JRLA 2IS4A 3ANYB 4G0NA 4KPUB 2WJ4A 3WJ2A 3IHLA 3BXOA 1W19A 1LC0A 3CGGA 3PR2B 1HQKA 4FN5A 5HIIA 4OK3A 1GEEA 1ODJA 2P79A 4DUGA 1NE2A 3VZDA 1FP4B 5A0TA 5BQFA 4L8GA 4MR7B 4WFIA 1TLTA 3A0UA 4UXHA 1UBJS 1QIHA 4DLYA 1JIXA 1UPAA 4NYMR 2FXVA 1M1YE 2AB0A 2R60A 2WT4A 2DR3A 5CXXA 3RRFA 3NTQA 1J2YA 1PAUA 2IZZA 5GVSA 5SY6A 4ESVA 1MGOA 2VATA 5UKDA 1QRUA 4MMYB 4RVSA 3AVWA 4A8HA 1GLGA 4UC0A 4C78A 3RU7A 3G9QA 3G7SA 2XTNA 4UM9B 3ZCTA 5GONA 4DQKA 1CJSA 4DPLA 2R1VB 1Y37A 2VWHA 3K31A 4D4GA 4I1RA 1ZGHA 2HPVA 2RGAA 3EIWA 1L4MA 1GCOA 3KLOA 2EKDA 3K2QA 3GU3A 2J5RA 2EXXA 3KU1A 3QTBA 4B3MB 1SKMA 5ANRB 4V0OA 2IV2X 2PIAA 1WSAA 1P18A 1NJ8A 2SECE 2Y6UA 4GLFA 4IDEA 4MMZB 5DGXA 3RASA 2CK3D 2XODA 3HN6A 1EQUA 3K9GA 1A4RA 3NRBA 4BNLA 1E32A 1U7OA 2G36A 1X39A 3DO8A 4IKEA 5AVWA 1AMOA 1GPLA 2BZ1A 3BWYA 4XIFA 2EX0A 3PDIB 2NIPA 5EJ8A 1JJAA 1QGZA 1KK3A 1C3EA 1D2GA 1GNRA 4I50F 1BDIA 2JJYA 4AYXA 3IVGA 1JR6A 4OI0A 2H06A 2YWDA 2FX5A 4U5XA 1YJBA 1KYYA 2TRSB 2W2MA 4RYDA 5AHKA 5ITZA 2OY0A 3PQ5A 3T5TA 1BXRA 1PX2A 1J1UA 2J0UB 4IHJB 3G8AA 5HMLA 2EBHX 3UV7A 4PF1A 4JQZA 5HOQA 3BTUA 4K9QA 3THXA 5TB5A 4W99A 4YDSA 4NP6A 5K1ZA 3R23A 5DHRA 2ZXFA 1PL6A 3F5FA 1HQCA 3GUHA 4ZQEA 1ZC3A 2E48A 4N47A 2DTDA 3R3WA 5ITSA 2GBLA 2XMGA 3L93A 4MRPA 1FYWA 2DQYA 2Q6TA 4HO1X 3H83A 3PK0A 1T2NA 2H52A 5AK4A 4B4UA 4BEWA 5CBPA 3EGCA 2I8AA 2IE0A 4FHEA 3VR4A 2VT2A 2DQ4A 3OOEA 4A03A 1NIJA 1T5HX 2KLBA 1I14A 1EEXB 3HEAA 4NENA 4EBFA 2JBAB 5JD4A 4P53A 3JAWB 4F0JA 1GKIA 2FZKA 4Y2RA 1RHQA 4X95A 1D07A 3BTVA 4YGXB 2GEFA 1AG9A 1Z6ZA 1PFWA 1JZQA 5FO1A 2P30A 4IDCA 2JLAA 4XQGA 2IOFK 1P61B 4JELA 5JMOA 1XDUA 4L4YA 4DCGA 5C8ZA 4G4SP 4Q5IA 2QUIA 2BV3A 1G98A 3R0VA 1JSZA 1F4VA 4OYYA 1XZPA 2XYPA 2C4UA 4I36A 5AXAA 4DLZA 4BAUA 2V7XA 2H48A 3NP7A 3PA8A 3ID6C 2ZE8A 3LPAA 1RC8A 1M1UA 4BOYA 4R54A 3H3XA 1K27A 3DDOA 3P71T 1BJKA 3A27A 1K5HA 1RNLA 3X1XA 5AKLA 3TBKA 4RDCA 2ZYWX 1C1XA 1TUBB 1VP3A 3KEFA 3B38A 3GHHA 3DLHA 1QK5A 4R9UC 1AKTA 1LX7A 1ZNXA 4L3OA 2A9RA 4YJ2B 4YAUA 1UAYA 3N1UA 3KPYA 3OEED 5JT1A 1SVNA 1Y9JA 3QXCA 1NT4A 2W6JA 4IS2A 2NAFA 4RHXA 5LSAA 4LXIA 4EG8A 5HGXA 2HU7A 5EGNA 1UJMA 1V5WA 1Y1QA 2BBWA 2PO5A 1U7XA 4DLSA 2H4JA 3TTVA 3B36A 1Q50A 4UOZA 1W5BA 2WR8A 2F3PA 1JFLA 4PV7A 3BE4A 4ID3A 2IV3A 3WWPA 4DDMA 4Z3KA 5LB4A 5CAEB 2ZT8A 1Y80A 2JIZD 2RGXA 1SWVA 1C0LA 4YY3B 1M34B 1CZHA 1OX4A 4WN9B 3A1SA 1W2HA 3SX4A 3VH4A 5K0BA 4QAJA 1IZ8A 1I2DA 4PG5A 4CDGA 2ZM6B 3NONA 4QULA 3RFCA 1K4KA 1GWNA 3Q9UA 2WU3A 2DWQA 3H5LA 4FFPA 1G20A 4OB7A 2JB9A 3C3BA 4OXNA 4WDQA 5KAPA 1XO1A 3JASB 1XLWA 1F0PA 2PXAA 2B35A 3JD1A 2HFJA 5FWXB 1OI3A 4W8GA 1QU2A 2W9XA 4JOQA 4MWZA 1KO8A 3V32A 2I2AA 4MLCA 1G291 5FF9A 4DBZA 5ED4A 1JKJB 2C2WA 1HDRA 4PPNA 3FDZB 3C3EA 4QSMA 2PTHA 3BXZA 3I8OA 4F1WA 2NU8B 4ZI3A 1WQ4A 1E3WB 1PI3A 2NT3A 2ZR9A 2WKQA 4URYR 3CLHA 3W7AA 4BFXA 3QJ5A 5AKYA 5BYJA 3HVRA 2PA3A 2QAGC 1J22A 4RY0A 4KRYA 1F8FA 1U7WA 3AR2A 1N8NA 3HQ4O 2QTRA 1Q1BA 4D46A 4PO3X 1KZYC 4PLZA 5C4GB 2JFWA 2BJHA 3K5IA 5F5NA 2HHLA 2R8XA 3LC1O 3GVCA 1LCIA 1OTYA 3PR1A 5KBYA 3I5YA 1A2OA 3C3YA 5EQDA 3EDOA 3OBIA 3SSNA 3DDSA 3L7YA 4C0QC 4LWPA 3IVAA 2IXBA 3GLIE 3MD9A 3GUUA 4O25A 4LJ5A 3BT7A 2ECQA 5F98A 4M9ZA 2XGJA 3ER8A 1OYWA 4QHSA 4O4LF 3LHDA 1AQUA 3MYYA 3VZBA 4KNYA 4NOKA 4UCFA 1UBHS 5AHXA 2ATEA 1TYEB 1ES9A 3AF3A 3ET5A 3QUCA 2R25B 5E38A 3IUMA 4BO7A 2ZRLA