4EPYA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
b'GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epyA00
1XDBA 1M6NA 1SVMA 1MO4A 4Q9LA 5DISB 1AGPA 4ACBA 4AYTA 1E2FA 4OHXA 2H5EA 3BE4A 1WMSA 1DE0A 4Y0AA 2V3CC 3A1UA 4DC9A 3I92A 1E2GA 3H86A 2ZEJA 3PQCA 1W2HA 4V0ME 1GRNA 8OHMA 2KJQA 1ZM7A 2VHUA 2ZS7A 4OHWA 4U02A 4LJ4A 2R44A 1UADA 2PT7A 3ZVMA 4AI6A 1IJEA 3BGWA 2HJVA 4JLOA 4DLTA 4D0GA 5DGXA 1W0KA 5KDOA 4BFZA 1TQ2A 3WHKA 1KTVA 5JMTA 3PEWA 1SXJE 1UEIA 1RRGA 2HDNB 4ARZB 1ZRHA 4UNQA 3VU9A 1EESA 1HT2E 4JVSB 1Z6XA 2WWHA 2QEQA 3MWLA 1N5IA 1X8JA 4JVLA 2IS1A 4H9GA 1I4TD 1IM2A 4KXFB 1XB2A 1DAEA 5K8UA 2GA8A 3OEED 5EXSA 5F3WB 4QM6A 2XSZD 1L2TA 3KKNA 3O8DA 1E9BA 2FN4A 2EW1A 4GNKA 5CITA 4TMVA 2O8DB 1EK0A 1ZC3A 4QNRA 3NKVA 2JGNA 2LKDA 4OI4A 5JWHA 3WNDA 2GXSA 2AD1A 2QTHA 2V8OA 1YR8A 2CNWA 3EAQA 2ZSFA 3SJCA 2NO1A 1DO0A 1ZUHA 3RLFA 4IDNA 2SHKA 3NBZC 1ONBA 5TXGA 2C77A 2J3EA 4QBGB 1JQJC 2QTFA 5M04A 1A7JA 3PIRA 4QBFA 4UJ3A 2D06A 1T8UA 4HLDA 2RH5A 1SKQA 2ZI9A 4GRAA 3PUXA 3UATA 4PQFA 4I4LA 4QBIA 3CRMA 4LC0A 3GJ8A 4LBZA 4BRWA 4CEJB 1Z6TA 1ZM4A 4X8HA 3B2EA 4P33A 2H18A 1XTRA 4OBEA 1S9HA 1HUQA 5CM9C 5J40A 2ZI4A 5GVSA 2NIPA 3E1SA 1QBKC 4HUQB 3AVUA 2QGZA 3A1SA 3EIEA 2G3YA 3BJIC 3SU8A 4C7OB 3IBYA 5F9FA 2FPLA 4BFXA 3I62A 1KO4A 3ICEA 3QNUA 2QZ4A 721PA 4RY2A 2D7CA 5LPNA 4DHEA 5JRZA 3R9IA 2BMDA 3AEZA 2IHYA 2O8CA 4M9ZA 3AVYA 3TVDA 5KO2A 2ZJZA 4PHFA 1W4CA 4P32A 4PC2A 2LKCA 1E96A 3S1AA 2WPDD 1EFUA 1WE2A 2H8KA 3TUIC 3B82A 2D74A 1HA3A 1R0WA 1HURA 2ERXA 3KB2A 1GL7A 3LO5A 2REBA 1T9HA 1OFUX 4C3ZA 1NSTA 2XTMA 2GXUA 4Q9IA 1DS6A 1XTQA 1G17A 5TDHA 3K70B 4HI0E 4JLDA 2NPFA 1HV8A 2BJWA 2FNAA 1K5DA 2MSEB 2J7PD 2AHOA 2ZI3A 1ZNZA 2ZRJA 4A0FA 5E7IA 1IN5A 3KTAA 2XB2A 2AWOA 3MSXA 1D2EA 2BEJA 3UG6A 2VIIA 3K9LA 3R9XA 4IEIA 2GDJA 4LHWA 4QG7A 1G3UA 4TL7A 2FFHA 2EFDB 1YRBA 3SOPA 3AVTA 3FDIA 5CDFA 1KJYA 1NY5A 2O0KA 2ZTSA 1S1CA 5LBIA 1XEFA 5CK4A 3AQ4A 2YV5A 1F6BA 1ZMXA 1FX0A 1R5NA 4US1R 3DOFA 3FTQA 1G5RA 5CIQA 1D2MA 4Q02A 2FG5A 5DI9A 2ZAOA 2BMEA 2V7QA 1Q1BA 2GAOA 2OSBA 2WKPA 1ZD8A 3H84A 4Q21A 4RD2A 4B2IA 4Z1MD 2IXGA 1RW4A 3RS0A 1IBRA 2YC4C 4QBHA 5FPTA 1FP7A 4EJSC 2WWGA 2OUKA 3QKSA 5B57C 2GXAA 2H17A 5DIFA 2PLFA 5GJCA 3EARA 1BMFA 4PO9A 2ZE7A 1US8B 4RSGA 1RJ9B 1TQDA 4IJMA 5EE3A 1VYTA 4JIMA 5J5CA 3C14C 4JZKA 5E7JA 1EFRA 1NIJA 3THWB 3MWYW 1C4OA 2J7KA 4XJXA 1COWA 4PPGA 5EE9A 1YKSA 2UKDA 3EA0A 3MAAC 4OJQA 4AD8A 3SE0A 1RRFA 1VG8A 1Z29A 5AJZA 4HLCA 3A1WA 5KNCA 2RGAA 1CJUC 2W00A 3N2IA 1OE0A 3MRSA 3HPQA 3LQQA 1Q1QA 1F5NA 2PZGA 2QMEA 1DAIA 4WVFA 4FCWA 4Q01A 2ZAMA 2O8FB 2ANCA 4PSVA 3GLGB 2ZITA 3U44B 1T0HB 3TUZC 2ZYTX 3V4RA 3RVBA 1UBFA 3OIWA 2CCGA 4FD2A 4Q9JA 3LV8A 3X1ZA 3SYKA 1AK2A 4DCUA 3OE7D 2Z83A 3O8CA 5JWRA 1KYIA 4HLUA 3C16C 3LY5A 2C95A 3RRZA 4V02A 3IIMA 3ZGXA 1Z0KA 2VP9A 2OCAA 2ODEA 4Q4AB 2NTYC 4A92A 4GP7A 1B0UA 1R5OA 4DVGA 4J0QA 1NBMD 1HEIA 3SEAA 1DG1G 5JJKA 1N6IA 1WQ1R 2MSDB 2VHJA 3B7GA 3CB4A 3ZVRA 1AZTA 3OEEA 3U2QA 2VBCA 1QZXA 1GP2A 2XSZA 2BEKA 1XEXA 4PPNA 1K5GA 1XFAA 1Z47A 3LNCA 1AQUA 3I32A 1BYUA 3PV0A 5HE9A 3SC3A 5FPKA 1PLLA 2J41A 2Q3MA 5KSYA 3K70D 2J0SA 3VR3A 1E2KA 2PH1A 4OJKA 4U7DA 2P5TB 1OYYA 3HYRA 5FPSA 1ZM9A 2F1HA 5G53C 3CKLA 3SNHA 3B9PA 1E3MA 1NVVR 3FHCB 4Q18A 2IYRA 1L7VC 4RD3A 4OL0A 1E9CA 2GCOB 3U4QB 3AVOA 1YZKA 1G8FA 4XWKA 2IX3A 1BOFA 5L3SA 2QAJA 5JJIA 1SVOA 1ZINA 3REGA 1Q3HA 3W6OA 4M1KA 2FWRA 4B48A 2F7SA 4C0AC 1YZGA 4YDHB 2ZR9A 3MWJA 4MKFA 4P3YA 5CB6A 2VP4A 5HCNA 3AVWA 4Z54A 1NIPA 3NDBB 3R20A 1R0XA 1UEJA 2G0NA 4JVMA 4P4SB 4O25A 821PA 1L8QA 2IYUA 3ZJYA 4DIEA 5IRCD 3VX4A 4JBWA 3A58B 4QHSA 5F98A 1J7KA 3TW4A 4UQOA 5FTLA 1WRBA 2Y8EA 1IN6A 3QQ5A 2X19A 4HZUA 4PC1A 3HR8A 3M1IA 2JIZD 4G01B 2R6AA 2WZQA 3BWDD 4RJLA 3W3AA 4LZZA 4ZKEA 4HSEA 5KPDA 4B73A 2QG6A 2QM7A 4TTRA 2ORWA 2WPDA 3SI7A 4Q5IA 3KFXA 1RE0A 2IYQA 4WA7A 4PXAA 2O0HA 3H1TA 3K09A 1JR3E 1E9SA 1G7RA 2F9MA 4URVR 2ZE8A 5KSOA 4C0HA 3CPJB 1FMJA 2AR7A 3EWAA 3WMGA 2J7PA 3U7GA 1RPZA 2ZS8A 1E2PA 3D3QA 3RYTC 1MABB 1VCNA 2VA8A 1IAQA 3CH4B 2WJJA 3B13B 5P21A 2BOVA 2OAP1 3CF6R 4AYXA 2AKYA 4M4SA 2ZYUX 1G5TA 1P7CA 2P6UA 4FW9A 3BFXA 2ORIA 2CL0X 1QHHB 1KI7A 1U8AA 5CK5A 4JJKA 4ARZA 4RFSB 1ZNYA 4KSBA 1WBBA 5EXPA 1KSJA 1NJGA 1U0LA 3SR0A 4QJ5A 3CRQA 3I5YA 4KODA 4C0SA 5KTYA 1J8MF 4S35A 3T1OA 5AJYA 4RZ3A 2OBNA 4DCNA 1IY0A 1T3LA 3JVVA 4Z1MA 2GXQA 4A4DA 3B85A 3RRYA 5EP4A 1ZM3A 1TTTA 2O8DA 4TMXA 4CT4B 3TE6A 3K0CA 1SKYB 4AG5A 3EX7C 2KSQA 1CXZA 2ZRBA 5TMPA 1CF4A 3QPUA 2DWPA 3K9HA 4LHVA 4TYWA 1OH7A 5EUQB 1P73A 1FP6A 2ZJBA 4BE7B 4QHYA 4F93B 4EDHA 1W5TA 2NO0A 3V4FA 2RMKA 2PMKA 3TUJC 3MCAA 5FBVB 1M7GA 621PA 2WOJA 5FBLB 4MGYR 1IOZA 1UBEA 3IEVA 1G18A 2E9SA 2R65A 4DCTA 3CZPA 1OLOA 1X86B 2P0EA 4DLUA 1YVDA 4CEJA 1B23P 5KYKA 4EPXA 4M1OA 4QM7A 4DSNA 1AKEA 3CX6A 4NYMQ 5LDDC 2GHIA 2QMOA 3U3KA 5BW8A 4HUQA 1OXSC 1E9DA 2ZXUA 1VG0B 2CHVA 3PUYA 1NVUQ 4C7OA 2NQ2C 3QBTA 3OE7A 2IS6A 3K1JA 2C9YA 2V6JA 5FOUA 5L3VA 4LJ8A 1MV5A 1IY2A 5JSZB 4IDHA 4KLNA 2XTZA 3Q9LA 3WHLA 3TW8B 4L9WA 4W5JA 3TNFA 3AP2A 1GFIA 1VCMA 4XVQA 3PEYA 1T8TA 4KVGA 4B2PA 3TRFA 1GSIA 1NBMA 5J4KA 5FOTA 4R98A 3DHWC 1N3BA 2OLJA 4LX0A 1TAGA 5GJVC 1N5LA 2OCBA 2IWRA 1G9XA 1LW7A 1N2CE 1OF1A 1E9AA 2JLWA 1YJ5A 1KIMA 2F55A 4WZAE 4LCBA 4BLRA 4A2QA 4C2TA 3UMFA 1G1MA 2JASA 1ZNWA 4KYUA 4A0HA 2N1BA 1KMHB 4M1MA 3PFIA 4DUGD 4YXWD 2YVUA 2C78A 4UNSA 3AV0B 4PC6A 2RGBA 1S3GA 2GF9A 4JLNA 1YHNA 5FTMA 3THOA 1QDEA 2IT1A 1XTJA 2OILA 3FWYA 5JFGA 2FMXA 3BAFA 3GLFB 4KJZA 4UJ5A 2AL7A 4MYHA 4M0LA 1NMZA 4R2IA 3MFYA 4HLUC 3UIEA 2ZE5A 3AF0A 3V00A 3ZH9B 5GVRA 3TVTA 2W2VA 3SHWA 4NL4H 4M1WA 4U5XA 3MJHA 1ZCAA 3O8RA 1G6OA 2VYFA 1NVWQ 3VHXA 3U6BA 4UXJA 2A7QA 4OQXA 5FOVA 5JBQA 3AF1A 1XCMA 4G5GA 4V0NA 1AZSC 3J81k 3C5HA 4YONB 2WV9A 4PZYA 1GVNB 1US8A 1LTQA 1RJ9A 1XJ0A 2ZJ2A 3QKTA 1S2MA 2HJGA 4TQAA 5DH9A 1PLJA 2JIZA 5JEDA 2W6JD 1SHZA 1XMSA 2PZEA 3PCRB 4LBYA 4JLKA 4IVRA 1QHXA 1U98A 2ZSDA 1OFIA 2ZROA 3LFUA 3WMFA 4DIDA 3D8BA 4JT4A 3P4YA 5LD2B 1ESMA 3IILA 4I81A 4IRUB 4IFEA 1UKZA 2A9KA 1TU4A 1ZYUA 1TU3A 1CP2A 4ZIRB 5HPYB 4DB2A 4C4PA 2O8FA 1IHUA 4BFSA 1XD9A 1W4BA 1EG7A 1Z8FA 3LBNA 3GLGA 1CJTC 4JL5A 3U44A 1KGDA 4LC1A 4ZV4A 4M1TA 1CEEA 3NH9A 5EXXA 2R6CA 2BKEA 2ZJAA 4QFMA 4CIDA 3QXHA 1NL3A 4QJ4A 4B43A 4ZCIA 4UXIA 1XCPA 2J46A 1HE1C 3ZZ0A 1CS4C 4URWR 3L0OA 2MSCB 1VCIA 1CJVC 2V4ZA 5EQTA 3MJRA 4D81A 1G41A 4Q4AA 1O87A 2N42A 3NXSA 4G1UC 4LJ7A 2N46A 2RCNA 1M34E 4OK6A 1FZQA 4TZ6A 3DKVA 1AQYA 3I5XA 1JPNA 1KHTA 2NOAA 3Q5DA 4PO1A 1GNQA 5AJVB 2CDNA 2O8EB 5AUOB 2QMUA 4KSCA 1YZNA 2OO7A 3AUYA 3K9NA 4NMMA 4UKDA 3R8CA 1NJFA 1E1QD 2X77A 5L3RA 2ZJYA 1KY2A 1R6BX 1LFDB 2IYLD 2QM8A 2GEUA 1KK0A 3NBXX 4NDZA 3K09C 2DHRA 1CR4A 1G7SA 1YZQA 3EZ9A 2HYIC 2J87A 3WP1B 1OB5A 1AM4D 2JJ8A 2IBMA 1KZ7B 5DI3B 2FJUA 3T34A 2V6IA 2IUSA 4KHZA 5JEEA 3BH6A 3C41J 5JHHB 1OW3B 3X2SA 1FQJA 3LX8A 4YMVA 4Q4JB 1SVWA 2GK6A 1E4VA 4B33A 2O8BB 4PAOA 4NH0A 3A4MA 2GCOA 2BHRA 3U4QA 5FPHA 3ONWA 2ZJOA 5KSPA 1K8RA 1YR7A 2C2HA 2ZI5A 3B60A 4RZUA 4Y0VA 3ZDQA 3QG5A 1R8QA 2IXEA 4IFBA 3B1YA 1DAFA 3ZD6A 4GDFA 2ZSBA 1KI1A 1VHLA 3MLEA 4DLWA 4LYFA 5HZKA 3NDPA 1E9RA 1R2QA 2WMNB 4QGFA 1PZNA 3LWNA 5TV2A 3SDZA 4P4SA 1Z0IA 1UKVY 3RRNA 4IOKA 5BWMA 3AKYA 3A4NA 4LYHA 2DPXA 1S9DA 1W47A 2FFQA 4FI3C 1Z22A 3AVVA 2Q9AA 4Q66C 4F92B 3NHAA 1TQ4A 3K0CC 3WRXC 4QJ3A 1KDOA 2NG1A 4JKIA 4PC7A 3U7EB 4CW7A 2WKQA 3R9WA 2ZRAA 3FVQA 3OEHD 2VHQA 4TQUS 2WJYA 2B92A 4GMXA 4DWJA 1BIFA 1HYQA 1AS0A 1XF9A 1ZAKA 2Q21A 3VR2A 4HZIA 3N5CA 1JECA 4JLJA 4YMUA 1XD8A 1UDXA 2ZUCA 5C18A 1YR9A 3B1XA 3DDCA 4I1VA 5BQ5A 4LRWA 1NG9A 5E95A 1G8HA 4D4JA 3VR6A 1XX6A 1TUIA 1KI9A 4XWAA 2OG2A 2R8RA 2WAYA 5GJBA 4LSGA 1KK2A 2YINC 2MMCA 4OYHA 1LB1B 1Z83A 1G3QA 1XXHE 4URYR 2EFCB 4DUGA 4YXWA 2ZRMA 4FMCB 2XXAB 1KY3A 3REFA 3ZQJA 1N0VC 1MABA 2P67A 1HQYE 2ZUDA 3LVQE 3CRRA 1JR6A 5EE1A 1II0A 3RDPA 4HAYA 1E1RD 4JSYA 2V1UA 2E87A 4JLPA 4CEHB 1M7HA 3WNBA 1HT1E 2QU8A 2FFAA 1QHHA 2XITA 4LHZA 5KPJA 2ZR7A 2PJZA 3L82B 4W5WA 5H8WA 2QSYA 4RFSA 1NVXQ 4LV6A 3FMIA 1K6MA 2QGNA 4AKGA 4QGHA 1A82A 4BLOA 4G5QA 2ZU6A 2VP6A 5K8TA 3RWOA 2B8TA 2ZI7A 3E70C 3OHMA 4KI0A 4LOAA 3KQUA 4DT1B 3QPVA 4KCGA 1KMQA 3LA6A 4Q1EA 1GL9B 5IF9A 4GFDA 4MYCA 2VP2A 5ANRB 1O3YA 3DL0A 4TTQA 1Q20A 2IA5A 3PG5A 4OQLA 1M7BA 1KI8A 3CIOA 2O5VA 4EPVA 1ZC4A 2IYVA 4I1OA 4O2RA 5K8IA 2XZOA 3KUDA 4MGIR 3C7KA 3K70C 4BLTA 3PVSA 2W6JA 2O0JA 4PAMA 2QPAA 2GTPA 2R6DA 1JJ7A 2ASEA 2ZRFA 2EWWA 2QT1A 3D6TB 1W36B 2QNRA 5SZHB 3BB4A 1IN4A 2EFEB 2ZPTX 1F2TB 1D5CA 4Q1BA 3LXXA 3U3JA 4XTCS 1S4QA 3TAHA 3OIUA 5JS7A 4IVQA 4KLZA 2R6FA 2IYZA 2ZVQX 1GZSA 2FU5C 2OBLA 1IN7A 1XRJA 1F2UB 2A5YB 1BH2A 5K8LA 1E32A 1N5KA 2V9PA 4M2LA 3W6PA 4JMPA 4V0OA 4CZ2A 1GOTA 2J59A 1NN0A 3GJXC 3O8BA 4M1SA 4YMWA 3SYNA 1W0JD 3TKLA 4DCSA 1DOAA 5FOWA 5LB2A 5JSZA 4CRWB 3HDTA 3NIBA 2RHMA 3AP1A 5J4HA 1OIWA 3EC1A 1J2JA 2BM1A 4WOPA 2W0MA 3QE0A 2FX3A 2ZJ8A 4H1UA 1P62B 1TEXA 1W2GA 4EPTA 2BCGY 3V9PA 2C98A 1KI2A 3I61A 3HR7A 1OHHD 3F8TA 3BORA 2BBWA 3GLIE 2J45A 1KAGA 1XTSA 3UMSA 2WJIA 4A0GA 2WWXA 3ZS8A 4IOJA 1E1QA 1R7RA 2ODNA 4HB3A 5ELXA 1A5TA 1W44A 1LF0A 1FUKA 4LYAA 3TIFA 1N6RA 221PA 3HWSA 1T3HA 1S0UA 1H8ED 4B74A 1KMHA 1QF9A 1XNJA 3SZRA 3ZYCA 4AK9A 2IF0A 4YDSA 3LW7A 3TR0A 2IF2A 3QBVA 2MMGA 1D9XA 4ZDJA 3P27A 3OAAD 1KNXA 1T4GA 1OSNA 4BFWA 4NE2A 3FOZA 4PX9A 3T35A 1IXSB 3GLFA 2GJ9A 3B5JA 1SXJC 4I1UA 2DWOA 3BERA 3ASZA 4H1VA 4C0QC 1P72A 1SVSA 5IK2D 2V54A 4MGKR 4Q1FA 3ADCA 3LLUA 5EE5B 3QVVA 1XU4A 4B2LA 3GEHA 3RNLA 3QXSA 3NBYC 5TY0A 3ZS9A 3KXKA 3ZIAD 3WBKA 4D0LB 5DHAA 3B1ZA 2F43B 3FHOA 1X3SA 2ZQ5A 1RZ3A 1E9FA 2K5UA 3FFBA 3R8FA 3EC2A 1NP6A 3DMNA 2J1LA 3GEIA 3GLHE 4FN5A 2FSGA 4JKYA 4BLQA 2VHTA 4M22A 2HUPA 3UG7A 1CLUA 1U81A 1QHNA 1YZTA 4IDOA 2ZYWX 2DFTA 3T12A 2WMOB 4BLSA 3OEHA 1R0YA 3ADKA 3ZQ6A 4Z51A 1FFHA 1W36D 2X2EA 2CLCX 2BWJA 4GOKA 4QRHA 2CE7A 1D8TA 4CDGA 2I3BA 4BLPA 3B1VA 3CF2A 4YMTA 2FFBA 4ZIRA 2ZJ5A 2NPIA 1ZBDA 1OT3A 4ZO4A 3IO3A 3QF4B 2WWIA 1JALA 4IXNA 2JAQA 2Q0HA 1Q1ZA 2EFGA 2G83A 1W46A 4HAZA 1XWIA 2XJ9A 3U60B 4O0MA 4B75A 1E1RA 3I1FA 2OCPA 3UPUA 2EFHB 3NC0C 3CH5A 2QMHA 3GJ3A 5KSZA 3UANA 4MRSA 4RD0A 1LY1A 1AN0A 4MRRA 1NI3A 4DLSA 4OHYA 3AVXA 3FB4A 4LYJA 4QXAA 1KI6A 1SXJB 1MKYA 1N6LA 3BXZA 4XSHA 2QUZA 3FKQA 2O8EA 4Q4HB 4CVNA 2A30A 2YZ2A 3ZLJA 3N70A 4Q1CA 1IJFA 3W5JA 1W4AA 1G16A 1II8B 3GFPA 4B6FA 1MRNA 2QROA 3WXMA 5CJ2A 3RANA 3IPXA 2TMKA 4LHXA 5J4YA 1DELA 2YC2C 5F2EA 3OF5A 4E22A 2YJTD 5IT5A 4DBLC 1X8KA 4D25A 4MUBA 1C9KA 1NLFA 2DFLA 5KHOC 2OM2A 1MO5A 5DI3A 2DY1A 4HAUA 4A82A 4V0KA 4Q4JA 2PEYA 1KKMA 4PQRA 2O8BA 4XD7D 4L16A 2HF9A 2CJWB 2OFWA 4DLVA 1DO2A 1WXQA 4G5SA 3IHWA 1G64A 3WRYC 4WZBE 2OV2A 1Z2CA 1VDZA 3VR5A 4BZXA 2CBZA 4NYIQ 5KDLA 3R7WB 1LVGA 2ATXA 3KKOA 2ZRCA 3TH5A 1SQ5A 4I1SA 1Q21A 4B71A 4FMCF 1E2JA 2QTVB 3CUEF 1H65A 1GRRA 4A15A 1VMAA 2WJHA 1S1MA 2QAGB 5KDDA 2B7BA 3WNCA 2BMJA 1Q1EA 4C2UA 3EZFA 1S3SA 4KITB 5F9HA 2L0XA 4NYJR 1W0JA 1VIYA 4ERNA 1AIPA 4A6PA 3LQRA 2Z5FA 3W5IA 5FUVA 2IC5A 1OFTA 2FA9A 4NYMR 3DVLA 2CK3D 1N6HA 2EQBA 4UNPA 2HT1A 3E2IA 1OHHA 4TYNA 2VH5R 2I4IA 3T1VA 2QN6A 5HKKD 3PXGA 2QP9X 3QEJA 2ATVA 4MRPA 1WA5A 4B32A 3QKRB 3CWQA 2BJVA 2C99A 2HEIA 4NCHA 2YWHA 4AKEA 4LPSA 1E0JA 2PZFA 1H8EA 2NGRA 1YZLA 2J0VA 2XXAA 3SHFA 3LRPA 2ZRDA 1XD2B 1NG1A 3BB3A 1RKBA 4ZDIA 3OAAA 4JLAA 4WW0A 3GJ6A 2VP0A 5H1YA 5CDFE 1G8GA 3KJHA 5AJXA 2Q6TA 4CEHA 4POAA 1JJVA 3OIYA 1OXUA 4DZZA 3GJ5A 3U7FB 1CJMA 3QOFA 5IK2A 3DM9B 2YOHA 1IN8A 2CHQA 2UZ3A 1SXJD 4MYUA 4CYMA 3CPHA 1CBUA 2CL6X 4TMTA 1AS3A 2KI5A 1GDDA 4OI1A 3ZIAA 1ZCBA 2FPMA 3ND8A 5AUNB 3JVUA 3GJ0A 1U2RA 1XBTA 4DT1A 5B2ZA 3IDQA 4FCTA 4LJ6A 3VR1A 3X1YA 2YHSA 3HU2A 5KUTA 2G1KA 2WKRA 2GJKA 3C8UA 2EYUA 3LW8A 2JA1A 4LWZA 4ESHA 1E99A 1KNQA 2C9CA 2HV8A 3QXXA 4LHYA 2G0TA 3ICQB 1G4AE 3VX3A 1VTKA 3D31A 4HDOB 4KO8A 2VSOA 2HT6A 1G8PA 1TPZA 4V03A 3TQFA 1NN1A 2OEPA 4C0LA 3BC1A 5AUPB 4D4MA 2AWNA 2IHBA 3LBHA 2ZSEA 4RZXA 1F2TA 3PEVA 3MGCA 421PA 1XMVA 1OIXA 3AKCA 4U00A 4BECA 1SZPA 4AURA 2JJ1D 1NLZA 2A78A 2Z4SA 1AJEA 5FTJA 2IL1A 2P2LA 4MRVA 4LJAA 1AA9A 1Z28A 1UDWA 3LD9A 3AH8A 2VP5A 2NO7A 2Q9BA 1F2UA 4HLQB 4TMWA 1NKTA 2DB3A 2ERYA 3EZ7A 1CULC 1ZIPA 1U0HC 3AGQA 4F38A 3VKHA 1VHTA 2ZR0A 2C8VA 4DDUA 1OXXK 1TUEA 3WBJA 3Q5EA 4ZI2A 3HU1A 4D80A 4F7WA 1G3IA 2BBTA 4DB4A 3WP0A 3U5ZB 1DAKA 1EFCA 2OXCA 1G21E 4OQFA 3BFKA 3Q3JB 1Z63A 4B47A 2ZREA 4I99A 1NY6A 2Q9CA 1JI0A 4NCJA 3QENA 1P4SA 2ZRGA 4R2HA 2Q3HA 1MO6A 1OPXA 3ETLA 1P75A 3SQXA 4GMDA 1PVOA 4II7A 4LY6A 2FSHA 3U3MA 1N5JA 4TLCA 4DSUA 5LD2C 4HDCA 2F9LA 1I2DA 1ODFA 1KDRA 3D7MA 2XX3A 4HEJA 3ZVLA 1X1RA 3BIFA 3RS4A 2JLRA 2RGDA 3MMPA 4QGAA 1JEEA 3VAAA 3ZVNA 3QXJA 2KB0A 3LXRA 1GITA 3TR5A 4XD7A 4RCYA 1MOZA 1CR2A 3FHTA 1P2UA 4OK3A 2A5DA 4D82A 1ZIOA 2KWIA 1KI3A 1HTWA 2G77B 3WY9A 5G41A 3E5HA 4NBSA 2GVDC 1KOFA 1UKEA 2Z6VA 1NMXA 2QY9A 2ZU0C 5EZ5A 1JXOA 1MO3A 2F43A 4Q1AA 4FWTA 1TF2A 2WVJA 5DYIA 2H1LA 3RC8A 4JVNA 1OV4A 4K8OA 5DO9A 1OH5A 4EFMA 3RS3A 2QENA 3RS5A 4W9MC 4TMKA 3T1QA 1JAHA 1ZP6A 3TBKA 4O3MA 2WBLC 4B3BA 1ZU5A 4HYYA 4KBFA 4DEXA 4XVUA 3G82C 3QKUA 4MKIA 4P0TA 4URZR 2RGNA 1YE8A 2OESA 4YC7A 2CK3A 3CPEA 5C1BA 3B1WA 4PHGA 4C0KA 5KU1A 4JL8A 1OKKD 3H2YA 4GT1A 1NLYA 5FOXA 2H7VA 4KFRA 3QY0A 2BBSA 3K53A 5AUQA 2J9RA 5HKKA 1OXTA 2CLSA 3W9YA 3L0SA 5JZVA 2DCUA 2I1QA 4B35A 4MKHA 2B8WA 3BFVA 3Q7PA 4PPFA 2WOOA 1OB2A 3K0AB 2OLKA 3EASA 5FR2A 3DOEA 1Z6GA 3U7HB 1RRCA 1PJRA 3QF4A 4V0LA 4EPYA 1CRQA 4FINA 1AS2A 2FV8A 4V0MA 4DSOA 5BYJA 2F6RA 3LVRE 5EP2A 1G7TA 3SBEA 3SQWA 3IUYA 4JS0A 4KV9A 5AK0A 3OFND 1DVRA 1W5SA 3GFOA 4PFSA 5JI2E 2PL3A 2WSMA 4Q03A 3B9QA 2UZIR 4BFVA 3QXCA 2GK7A 1IONA 1ZU4A 2XNSA 4F4IA 5FBQB 4NHOA 3CW2A 1SXJA 2NO9A 1PV4A 2OXRA 1CU1A 4JLBA 4Q4HA 2QBYB 2WM9B 4LJ9A 5G3YA 4GI7A 3LX5A 3QSYA 1II8A 4AWXA 4PAQA 2ANBA 1P2TA 2PEZA 1NMYA 2P65A 2HCBA 4ESVA 2IW3A 3O47A 2AXNA 3M6AA 1KI6B 2NZ8A 4Q9KA 1GKUB 4IEEA 4AIIA 5FUYA 1Z0AA 3CNNA 3K9GA 1CJKC 2C03A 2IEZA 2VL7A 5JLJA 1RFLA 4PQYA 1TNDA 2YNMA 3BH0A 3P20A 4LV5B 4Q7JB 4BEBA 4GL2A 3T5GA 4N0EA 3HP1A 5SZKB 2GEDA 4Q7LA 3KL4A 2WJVA 2CJWA 5A4JA 2FSIA 4E5UA 3L0PA 1KDPA 2QRZA 1DAHA 1QG4A 2A5GA 2X1VA 4ZI3A 1CTQA 1FOEB 4TLBA 1KAOA 3R7WA 5DSZA 3X1DA 2JJ1A 2WAXA 4UNRA 3SBDA 3T61A 1RYFA 4LJ5A 2CCKA 1F3OA 5FTKA 2H92A 1BO6A 2IXFA 3QPWA 2BMFA 3PJRA 2QQ0A 2VLIA 4HAXA 1GKYA 1MT0A 1E94E 5J4VA 1M74A 3HJNA 2FEOA 2QAGA 4M9SA 4PZZA 5FL7D 4OKSA 2DFNA 1N25A 1A2KC 4XOIA 4B3GA 4DSTA 4EKDA 1FQKA 3BD9A 5HCIA 4DKXA 4LK2A 1Q12A 3FMPB 4PTLA 4WBSA 2ZRHA 2V1XA 4DLRA 4FCVA 1TMKA 1J90A 2IYTA 2P6NA 2JLYA 1NBME 1PLKA 3LH5A 2VPPA 1GIAA 4HB4A 2QP3A 2JLZA 3GFTA 2REOA 4FMBB 3KB1A 1IXZA 1XZPA 1XJQA 1A2BA 1Z0FA 1E2DA 2JJ2D 1E2QA 4JYCA 1W36C 2GESA 3GQBA 3UWOA 3H4MA 3W34A 4RFVA 2GAAA 3QKRA 4JJZA 1F60A 2EYQA 3I8SA 1I2MA 4G5RA 3BBPA 4JYBA 1JR3D 2GWHA 5DLQC 2D4HA 3VKGA 1MH1A 2EWVA 3CR8A 3K0FB 1LNZA 1KKLA 3GD7A 3NEYA 4BWYA 4IDPA 2RGEA 2G88A 2D3WA 1XD2A 1P61B 3CF0A 2PX3A 1OIVA 4BZQA 2YOFA 5JRJA 3DPUA 2ORVA 2OZEA 1I4DD 1Q44A 3C4JA 2GBLA 2XTNA 5EE0A 4E09A 2YYZA 3K0EA 1EGAA 3T15A 4BFYA 5FI1B 1QRAA 4P4TA 3X1WA 5BN4A 2B6HA 3VQTA 3NEJA 1KO1A 1KJZA 1KO5A 4D2IA 2OAQ1 4YMSA 3Q7QA 1DG3A 2BVNA 3AVQA 1E69A 3OIVA 3KZ1E 3P4XA 4DJTA 3FGNA 4ASUD 1DTSA 3T06B 2FEMA 3RAPR 1WCV1 3K0SA 2B21A 4BRUA 1KJWA 1LV7A 1ZNXA 2XOKD 3WMEA 5FUWA 4A8JC 1H8HD 4QOSA 1R8SA 5E3HA 4QC2A 3F0TA 3T1TA 1M2OB 4CEIB 1N6OA 5D3QA 3TK1A 1VKJA 3IHLA 3KFVA 3ZZTA 3THYB 4W5HA 3PUWA 1QVRA 3RWMB 4B3DA 5E7MA 4TLDA 3LBIA 4IOLA 3CR7A 1P60A 5FBRB 4ZCLA 1OKKA 5DE3A 5CLLA 4D6PA 1GM5A 4TL9A 1XMIA 4KYIB 4XWOA 2RGXA 3M0EA 3W8NA 2WTUA 2WIBA 3GLGE 2XNDD 1CR0A 3IIJA 2CE2X 2ZYVX 3GEEA 2QE7D 4ON9A 3MWKA 3BK7A 2AKAB 3EA5A 1Q57A 4D4LA 2ZRPA 1QG2A 1P5ZB 1XEWY 2PT5A 1Q0UA 1E9EA 4HDQB 4LDJA 1NSFA 5FOSA 3RS7A 4TT3D 2FSFA 1R5BA 5DYGA 1NF3A 3AUXA 3DEFA 2CXXA 3OFNA 4LUCA 1D6JA 4LI0A 5CLQA 2CLDX 2WIAA 4S2EA 2XB4A 2WICA 4GOJA 1WB9A 3EPKA 5IDVA 4TYYA 4QGGA 3U3RA 4OQNA 4GPTA 1ZD1A 1KSHA 5CM8B 4KAXA 2RGNC 2BM0A 4MITA 3RC3A 1ZVQA 3CZQA 5L8VA 1RIFA 5J47A 1T5IA 4QKQA 2GJSA 1IY1A 3F3YA 4KU4A 3HPRA 4Q48A 4TL8A 2GZAA 1KSGA 5AR1A 3BS4A 3DM5A 1NKSA 2FE4A 1S8FA 2F1RA 521PA 1RYHA 5A5GA 1E98A 4PZLA 4MRNA 1WDTA 1JNYA 5FL3A 2Q3FA 4FXPA 2HF8A 2CHGA 2C96A 5JS8A 1G3MA 4WXRA 4A8JB 1Z0JA 1N6NA 1Q22A 5HE8A 3KUCA 2IYWA 1LS6A 2FH5B 4M9XA 2HYDA 3QVUA 1P9NA 1UBGA 2A5FA 4GP6A 4E07A 1E0SA 2DBYA 4C9BA 3A1VA 4RD6A 4YLGA 1W48A 1KI4A 4KFSA 1T3SA 2Z0MA 1U94A 4EFNA 3L43A 3PUVA 1OH8A 3SFZA 5EUMA 2J0UB 3NHBA 3RS2A 2E1RA 1II9A 3UK6A 1XCGB 3UMRA 3FMOB 4IDQA 1XTIA 4TTPA 4X8OA 4BQSA 4DXAA 4WIAA 2WWYA 4GZMA 4A2WA 5J4LA 4Q19A 1F48A 3A6PC 1UJ2A 5HR5A 3THXB 2GCNA 3UKDA 3KQLA 2GKSA 3A36A 3FYHA 4HAVA 2JEOA 1G7CA 4KVAA 3SN6A 5FL7A 4Q7MB 2FZ4A 4EPWA 5DN6D 5JCZA 2IUTA 2VQSA 2KE5A 1G291 1ANKA 4IHQA 1FMLA 3W6NA 1PUIA 4MGZR 5G40A 5FR1A 3TSZA 4NYIR 5SZIA 4TLAA 4OI2A 4BGDA 2G1JA 1I4LD 4EQ6B 1ESNA 3GP8A 5C46F 4IVPA 4D0NA 4ZKDA 2QL6A 1P2SA 1DBSA 4WZ6A 1FPMA 4HB2A 4WAUA 1KDTA 4TQ9A 5AJWA 2BBOA 3FFAA 1E0AA 2JJ2A 2RGGA 1N6KA 3ASYA 3TSWA 3VHLB 1OYWA 2RAPA 1DEKA 4CF7A 4FMDB 1A4RA 4DDTA 1N6PA 2D2FA 3KXIA 3TLXA 2F3TA 1CIPA 2PX0A 3FE2A 2Z43A 4MQBA 2AK2A 4A0RA 3K0AA 1HE8B 4F4JA 1G3RA 1JR3A 2R6GA 4PSAA 5EP1A 4TYQA 2LCFA 4ILEA 1TF7A 4TWZA 2AFIE 2BKUA 3JZAA 1Z0DA 2I1VB 3SJAA 3VR4A 1XXHB 1AGRA 4C0JA 2ZI6A 3B6EA 3T5DA 1D2NA 4US2R 1XPOA 3VKWA 2R9VA 4M8NE 3FKSD 2QAGC 2REXB 2YWEA 2QA5A 3TGPA 4AY2A 1CKEA 1TEVA 1U8YA 4GOXA 3U3OA 3WYAA 1E4YA 3EWSA 3BH7A 1IXRC 1KSFX 3SJBA 2A5JA 4L15A 4EFLA 3LLMA 4C30A 3GCGA 3GJ7A 2AK3A 3L8ZA 4R7ZA 1R4AA 2ZRIA 1U9IC 1N0UA 4ASUA 2QBYA 3PR1A 3N2EA 3IIKA 2AXPA 2ZSAA 4BFTA 2ECKA 3PEUA 3KJGA 4Q00A 4BZPA 3K8YA 2XOKA 1SKYE 2CL7X 1H8HA 1NN3A 3IGFA 1SHKA 1TL7C 4EIWA 3EIHA 1NRJB 4PSKA 3IQWA 1FNNA 4RD1A 1CRPA 4URXR 3Q85A 5EZ6B 3AKDA 5D3MB 3LAWA 4Q7KA 5EP3A 5KNDA 2QPTA 5DHFA 2UVQA 1YU9A 4RD4A 2JLSA 4DEYA 3UWKA 2D2EA 3EPHA 1A1VA 4N0DA 3RSLA 3ZZUA 3CRVA 1XPUA 1AKYA 3EXAA 5H68A 3L8YA 4MDEA 2GBLC 3CRW1 5CIWA 2XNDA 4FIDA 2WWWA 3Q72A 2PCLA 3HU3A 1RC8A 2QE7A 2NMVA 2DR3A 5FTNA 5KOYA 3KQKA 3KDSE 5HZHA 4IOMA 1EWRA 5JJLA 2XAUA 2ZVPX 3AGPA 2R2AA 2C9OA 3CNLA 1JQLB 3DMDA 2VO1A 2VSXA 3NWJA 1J99A 3LDAA 1E79D 2IS2A 4TT3A 2BIFA 1JB1A 3ND9A 2ZIAA 1UPTA 1X6VA 2NZJA 2V55B 3TAUA 3IO5A 1ZJ6A 4Q9HA 2IS4A 1BKDR 1E2EA 3IKJA 3OESA 1X8LA 1V43A 1ZUNB 1GL6A 3QUSA 2DYKA 5B58C 4D26A 4M1YA 4Q4LA 3DZDA 2ZRLA 4CT5A 1E2LA 3TQCA 4EJSB 5KNBA 3GLIB 2PLRA 1RVDA 5CB8A 4NCIA 1ZUIA 1JBKA 2P5SA 1GRQA 4JL6A 1EFHA 1QHSA 2B7CA 4OK5A 2J5XA 4ZCMA 1S96A 3K0FA 2FZLA 4W7SA 3AP3A 2H57A 1P9RA 3NC1C 2OFXA 3ECCA 1BYIA 3CONA 3CM0A 4IKEA 1Z07A 1FNMA 3JZMA 3IPYA 3MUFA 4PPQA 5G3ZA 2GETA 4BEJA 3GLFE 4RKFA 1XPRA 3KX2A 2FF7A 1L4YA 2XJ4A 2IYXA 4L9SA 3VNUA 2BCJQ 2VSFA 2VF7A 1YRAA 1NNEA 2VHCA 3IBGA 1SULA 1OXVA 3OZXA 3QJYA 5B30A 1UBCA 1C1YA 4BUJA 6Q21A 2ODBA 4PHHA 2RGCA 5FH9A 3SYLA 1VYUA 3HYTA 2W83A 4JBXA 3AM1A 2IYYA 5JHGB 1VG1A 4DLZA 5GADl 2JLVA 5BN3A 1U90A 3IQXA 2P3SA 4MKGA 1QHIA 1GNPA 1E6CA 1X1SA 1ZD9A 2HLDD 4A36A 3EZ2A 1KK3A 5DN6A 2ODWA 3VFDA 4ABYA 3MD0A 5L3QB 1XMJA 4LBWA 2WHXA 2LWIA 4NZYA 4BASA 3AKEA 2JATA 3C15C 3GLHB 3KKMA 4CEIA 1TX4B 4XTRA 4E03A 2YWFA 1SVLA 1QHYA 2JDID 4RKEA 4OQMA 3THYA 1MR3F 3NTUA 4M53A 1E0KA 1TF5A 1Q3TA 2C5LA 4BFUA 4AKIA 4NKRA 4B76A 1DADA 1YQTA 2AX4A 4LV8B 4JLMA 2XZPA 1Z06A 1E2MA 4OHZA 4DCVA 3I72A 3I73A 1P3JA 4MYTA 3QG1A 3AVPA 3KJEA 4ITRC 1M1YE 1VIAA 2D62A 3FPAA 2ZE6A 2P6RA 1PUJA 1VPLA 4B3FX 3ADDA 3TMKA 2JLUA 4ACAA 5C2JB 1Y3AA 5CYPA 4R71A 3KXLA 5FPYA 5JECA 1SGWA 2F3RA 2JLQA 2X2FA 5SZJA 3L2OB 2XZLA 3FKSA 2D7DA 1XP8A 3I4LA 4RCZA 1JEDA 1KZGB 1KO8A 1R10A 2Z4RA 4QL3A 2OBMA 4NTZA 4URUR 1XZQA 2AN9A 4JT2A 4A9AA 3EPLA 3C5CA 5JWOA 4PC3A 1MRSA 2EU8A 3PUZA 3VU9B 4GBMA 1CR1A 4GZLA 3RRMA 4LBVA 3B78A 2CVHA 2J0QA 3IEUA 2W58A 4TMZA 3AF3A 2FGKA 4ZDWA 4L4UA 1FUUA 4KFTA 2WSSD 4CGZA 3EG5A 1GKIA 2ZS9A 1NVVQ 2AFHE 4M21A 3ADBA 1FL9A 2R62A 1WP9A 2O52A 2W6ID 2W0SA 4X8LA 2ZETA 3SFVA 1L4UA 2W2XA 5HTKA 4ZPXA 1GG2A 1Z6YA 2ONKA 5BYKA 2IEYA 4A8JA 5FBWB 4NYJQ 4Z8XA 5JI3E 1E2NA 2HCJB 5EXTA 1HH4A 1Z3IX 2OFOA 4L8GA 4XIGS 3KQNA 1FTNA 2W2TA 1U0JA 3AB3A 4TSFD 4LGMA 4JBYA 1NN5A 4TYPA 2DFKB 2X8AA 1T5LA 4FMDF 1XJCA 4MA4A 4B44A 2ZRKA 5LB4A 5EJEA 2J0UA 2CVFA 1J70A 1E2HA 1G6HA 3BB1A 3CNOA 1EXMA 1W49A 4NCKA 1HY3A 5TARA 1Z2AA 5TB5A 1LS1A 5TVKA 2RKOA 1EWQA 4US0R 3THXA 5E4FA 3L0IB 4A1FA 3VMFA 4AC9A 3EPJA 2OHFA 1TQ6A 2IK8A 3CWZA 1U8ZA 1E79A 3M4YA 3P32A 4JSTA 3WYFA 4MDFA 2RB4A 4R9UC 3KKPA 3X1XA 4B3CA 3P26A 5FFMA 3GJ4A 4EQ6A 1WBDA 1DAMA 121PA 4FWIB 2WJGA 1YR6A 2O8CB 3CO5A 5FUXA 1ZW6A 2QORA 4Z8YA 4A6XA 2QPOA 1GAJA 3H0KA 4RZ2A 4B6EA 1XEWX 4OI0A 4ZDKA 5CJPA 4LJYA 1P9WA 2A3RA 4PR0A 3S1AB 1QHGA 2GZDA 3QF7A 3PITA 3CX7A 4PO8A 3QIAA 2CEAA 2BC9A 1XTKA 1GILA 4KFUA 3KQHA 1OH6A 2QP4A 3W8RA 3EIQA 4LPKA 4XVRA 4NONA 2OT3B 1EX7A 4B34A 3NVAA 1DAGA 5B64A 4F91B 1VECA 1XXHA 2JCSA 4G0NA 1QVAA 2HXSA 3KTAB 3VTKA 2WWFA 2VEDA 4TL6A 4DRZA 4UXHA 2BDTA 1RRPA 3KJIA 2AD5A 2DWQA 3DZ8A 1W0KD 2IUUA 4M9QA 2RHDA 3EZ6A 4MH0R 3U61B 3NG1A 3U6KA 3A8TA 2ONJA 2FPKA 3FMFA 1D9ZA 1SVIA 4NPHA 3QEOA 1FX0B 2JLXA 3F5FA 1T0JB 1G19A 4GSYA 4O2LA 1W1WA 2HLDA 3DO6A 3THWA 1GNRA 2GJAA 4K81B 4IW3B 2HXYA 5DNYB 3AF4A 2CCJA 4XH9B 4AYWA 1UM8A 3PENA 5AWFC 1P6XA 1Z5ZA 2KBFA 5CYOA 4AG6A 1VG9B 3QKSB 1UF9A 2ZUBA 1LF5A 1VCOA 2VF8A 3UXMA 1KO7A 2FOLA 1BS1A 2QRNA 3DKPA 1VYVA 2GVZC 5D3MA 2F1JA 2CMKA 3P1JA 2JDIA 2CNWD 1UKYA 4Q1DA 4OHVA 1G20E 4NCNA 4G3XA 3I8XA 1OJLA 3CLVA 4Q47A 1E2IA 2G6BA 3BRWD 3TJZA 4DDVA 2FGJA 4B3XA 2GJ8A 3EW9A 2OE2A 4HUTA 4PHTA 4X8MA 3RABA 1T6NA 4F4CA 4D4KA 1G8YA 4HATA 1JPJA 2NO6A 1T91A 1J8YF 4G5OA 4QNMA 4RVCA 2EVWX 3B8HA 3TSOA 4HB0A 1SVKA 3CX8A 3BOSA 1Z6AA 2GZHA 1WF3A 2ZRNA 2PCJA 3VNVA 3AF2A 2GEVA 1V5WA 1U99A 2PMDA 4WXPA 2IWHA 1Z08A 1KK1A 1DPFA 1EFTA 3Q8XB 1IQPA 4N1AA 1FW6A 2GNOA 2FDCA 4P4UA 1HQCA 1P2VA 4BPBA 2QT0A 2PBRA 4MUAA 3A37A 1GUAA 3ZD7A 3A4LA 5H70A 5JCPA 2F1IA 2XEXA 1G4UR 1OFHA 2GILA 3W3ZB 2WSSA 1M8PA 4EJSA 4K46A 1XEXB 2KBEA 5GJWC 3GLIA 2GCPA 5C4MA 3WYGA 2ZM5A 1UAAA 1U9IA 2W6IA 2H16A 2OCYC 3QI2A 1ETUA 2ZANA 4NP6A 2IYSA 1EX6A 1DARA 4TN1A 1ZM2A 4DLXA 1JXMA 4C0BA 2XGJA 3KKQA 1W7AA 1G5PA 2YOGA 4NU0A 3G0HA 1FTSA 4EAQA 4AKHA 4TSFA 2QQEA 2QSZA 3RHFA 3SJZA 5A0FA 2QI9C 4N3NA 1W4RA 5UKDA 4EPRA 5IHPA 5L3SB 4TZ0A 3NH6A 4EUNA 4UNNA 2C04A 1Y63A 2YWGA 5BXQC 2YKGA 3GPLA 3G5UA 1UFQA 2GRJA 4DLYA 1R0ZA 4P31A 3SS8A 4HAWA 4DDWA 2V7QD 5FI0B 2G9NA 2BV3A 4YQFA 4QHTA 1YZUA 5L3QA 3MG9A 5C4GB 2VTKA 3RSOA 4JLVA 2PJRA 3CBQA 1GWNA 2VRWA 5BN5A 3GLHA 1BMFD 4IXMA 3A1TA 3W90A 4L5BA 1JAIA 4KBGA 3NBFA 1GTVA 4HZUB 4PANA 1EFRD 1ELOA 2GF0A 1COWD 3GMTA 1TADA 4TLEA 4A2PA 4XSGA 3I3SR 2A2ZA 1N0WA
chains in the Genus database with same CATH superfamily
2IYFA 3V2IA 1JQAA 3HDHA 2O9JA 2CYCA 3T5BA 3M9XA 4Q9LA 4BVGA 3NZEA 3KEQA 3RQIA 1QRTA 3EWIA 3FPHA 4X5OA 3TX2A 3D7LA 1HMYA 3PC3A 2OXIA 3UNXA 2R7LA 1Y8QA 1VP3A 1QH8B 4FDAA 4FX5A 2VOJA 2XLCA 4HGRA 4GBJA 4BMXA 3NTRA 3WFZA 2HAEA 4DC9A 2JCVA 1YDWA 2A14A 2FZ5A 2QD1A 2HCFA 2V5VA 4IWYA 4AJ4A 2HQOA 8OHMA 1M72A 1RM3A 1ZM7A 2VHUA 4XFKA 3GDFA 5DXJA 2HK8A 1C9DB 3QU4A 4J90A 5EJAA 4C05A 5CDHA 2OVBA 1PV2A 4WKPA 1H6DA 2B5WA 4FGJA 1XRRA 3G2IA 3KB6A 5FAXA 3UENA 1IJEA 2DFVA 3W7AA 3W1VA 4O4LB 4H6WA 4DLTA 3FVTA 4KPFC 4D0GA 1CJCA 1JLKA 3UOGA 4N7RA 4QXMA 4QSHA 4BFZA 5KDOA 1CWUA 4PYQA 3WHKA 2I67A 3UO8B 2O2IA 1BFUA 2G67A 4ZEOA 3W4JA 1UEIA 5ESXA 3HEAA 1ZRHA 4OHCA 1HT2E 1SU7A 2FJPA 1JIQA 2QEQA 2R8BA 3PQFA 4WY8A 4BYMA 4JVLA 2PRZA 2WG1A 4YI3A 3OEED 5EXSA 4EMTA 1LDBA 4PYOA 2Q3EA 4X20A 2LDBA 1TTHA 2R84A 1RC1A 3OJFA 3M33A 5IXSA 1NNI1 3U1BA 3VC1A 1JZSA 1PR4A 3AJAA 2O2YA 2ESRA 2FEXA 4AJOA 1YKGA 1ZCFA 3KQQA 4ZYLA 2WG2A 4OP2A 5KQPA 5C34B 3KV3O 2LKDA 3WNDA 1IOWA 2AD1A 3HFSA 4OFBA 5FV7A 2V8OA 4TXLA 2P6PA 2VN8A 4XARA 2ZSFA 4OMUA 4NE7A 4NE9A 1DO0A 2V74B 2H08A 2QGFA 4PWYA 1AMNA 4CM4A 3VKUA 4UPVA 3WWZA 5LU8A 1H85A 1JQJC 1MIHA 2RHLA 3N6VA 4C22A 1A7JA 3PIRA 4UREA 5GV7A 3LWBA 1FS5A 2D06A 4TKUB 4WOCA 1AT1A 3NBMA 3WV5A 4XPIB 2ZI9A 3B5EA 3PUXA 4PQFA 2P68A 4GGPA 4I4LA 1O9GA 4QBIA 3ZXYA 2VWPA 2CKMA 1ZM4A 2M1XA 3AETB 1P4GA 3CV3A 4P33A 2H18A 3EIXA 4OLFA 5DT2A 4CCYA 4EEXA 4DJEC 2CL5A 1X7WB 2ZI4A 3CZ9A 2GAIA 1ZWLA 4ZAVA 3QE2A 1T2UA 5GVSA 4RY9A 4UOEA 2WU1A 4YMIA 3T7CA 3Q3EA 3QX3A 3EIEA 3MTGA 3SU8A 4BU1A 3MTQA 1ISGA 1K3TA 1N3IA 3A1EA 2FPLA 5CX1B 5F9FA 1ES9A 1KO4A 1V4NA 1GPLA 1W35A 2D8MA 2GCGA 2X6TA 2QZ4A 4EVIA 4LAFA 1UEXC 4LDAA 2ATCA 1JFSA 2XOXA 1ISMA 3O0DA 4PGGA 5F7ZA 2C92A 5DNAA 3L7OA 4ZOEA 3TL6A 1JHQA 1MT3A 4HHEA 1Y9AA 4M9ZA 3TVDA 1LD3A 4GKJB 3KUKA 2VSNA 2ZJZA 2IKQA 2WP8J 4WZZA 4PHFA 4KC0A 4P32A 1ZVJA 5AOAA 3LTNC 2DM6A 2LKCA 4ML3A 3A0UA 3TUIC 1GRVA 1M2FA 4L4RA 1GL7A 3T41A 4WESA 4W82A 2GPJA 4P2BA 2GXUA 3DUWA 2R7NA 4Q9IA 5ADWA 1G17A 5TDHA 3A04A 2II6A 5C8DA 1KXJA 5LDHA 2NPFA 1HV8A 1K5DA 4TN5A 3PGXA 1YH3A 4L73A 4RK6A 3S2UA 2ZI3A 3SC2B 4JLWA 3B8EA 2EC5A 1XDSA 1YJCA 1AQ6A 3HRHA 4OLJA 3AT1A 5F2OA 2O3JA 2AWOA 3MSXA 1D2EA 3UG6A 1V3VA 2ZUFA 2NSHA 3EISA 5LMUB 1D2RA 2C57A 4TL7A 2QL5A 4NABA 1UPUA 4M0DA 4C0XA 3AVTA 2AB0A 2BMVA 5EIEA 1ITZA 1PEKE 2O0KA 2PXXA 1P0IA 2G5GX 1M6YA 2J0EA 2ZTSA 1ORDA 2FY8A 2Y2UA 3N2LA 5ALXA 1F6BA 1R5NA 3TZEA 1GTMA 1EUYA 2YY7A 3KQYA 2ALJA 3IJPA 2PG3A 1RHKA 1HYBA 3RW9A 3F98A 4BGEA 4DR4B 2C20A 1XQXA 2GAOA 3FIJA 4Q21A 3BK1A 4BE9A 3OA0A 2IXGA 4UHFA 1YUMA 1JZQA 1IBRA 4X7BA 4BV9A 1GHTA 2I3AA 2ZWVA 4MS4B 3P0FA 4EHAA 3N0TA 3P2OA 4EJSC 2Y76A 2CW5A 5B57C 5JH7A 5DW3A 4EM6A 4FZJA 5ICGA 4HS9A 2PLFA 3PFFA 1ZEMA 4PO9A 3HM2A 2ZE7A 4RSGA 1TQDA 2GHQA 4IJMA 1VYTA 4Y2YA 1I7QB 2COUA 1EFRA 1NIJA 1QYXA 4J0CA 1VLMA 4PPGA 3EA0A 4OJQA 5ECDA 3G85A 1FFBA 2GI4A 4FNMA 4IV0A 2QVYX 5AJUA 1XELA 5M3BA 4UE6A 1QFZA 1VJGA 5A3SA 5A03A 4BXOA 2OB2A 1ECFA 4BL5A 3NDJA 4BV2A 4DXHA 5KNCA 3AESB 4KQGA 1RI2A 1H2FA 3HYSA 4UMFA 2W00A 2FYTA 3N2IA 1XA3A 5D6OA 1UBRS 3HPQA 1JKJB 2W6ZA 3LQQA 2X0EA 5BNZA 1XZIA 3MT9A 2VXOA 3FPJA 4Q01A 4YT5A 4J3JA 2ANCA 3VJMA 2PRYA 3F67A 5GM1A 5JSYA 2F3SA 4BTVA 3DDZX 2QTGA 4XGIA 3RPEA 1F7VA 2RSLA 3V4RA 3RVBA 4CXMA 3VPBA 3X1ZA 4FD2A 4Q9JA 4ZCTA 2YZMA 1NBWB 1MJGM 2HHCA 2HU2A 1H4VB 2DVMA 2ZR8A 3IVAA 4OG2A 4HWTA 4E31A 3DAPA 1KYIA 2AC2A 1EBFA 1PD0A 1KP2A 3NBAA 1PTJA 4BX9A 1DP4A 2BP7B 2VP9A 2OCAA 3CCFA 1STOA 2GTIA 2ODEA 5A4KA 1RP1A 4IY1A 1SBHA 4GP7A 4ZCQA 3UTDA 2WD8A 1N92A 1M5TA 2J4FA 1VQ1A 3OOEA 1UP4A 4AUKA 3SEAA 2NTEA 3QTLA 4PZUA 4U7JA 2VHJA 3CCBA 4E5YA 5DW0A 3M5CA 3CE9A 5A2GA 4K7JA 2VHYA 3GT0A 2VBCA 3RIHA 1QZXA 2AFRA 3W6NA 3O75A 1RLOA 4OX9Y 1XEXA 3NWPA 1DRJA 4H31A 1K5GA 3RRXA 3BL8A 4LFCB 4AIRA 1GQOA 1GA6A 2E21A 3BXHA 1Z47A 4HNAA 5D5PA 1AQUA 1CD5A 1WD7A 1EI9A 1BYUA 2EV9A 3I32A 2WUFA 3PV0A 4MWZA 2BYTA 2BR4A 4J0JA 3PDWA 5ALJA 4LWOA 5JJBA 2PL5A 4XWYA 3UOWA 4RK5A 4IIGA 5MGBA 4CMKA 2XI4A 1PX2A 3IIEA 3KPUA 4KXUA 3V8NA 4U7DA 5FPSA 2PZKA 2F1HA 1F0YA 4RVHA 1IUOA 2EDCA 1LU9A 1VL1A 3E4CA 1E3MA 2PY6A 1L7VC 2IPAB 2PD4A 3UA4A 3VC2A 4LDRA 2OO3A 1K9VF 1QGOA 5CVDA 4CM8B 4H7EA 5E9AA 1SVOA 3F7MA 1J06A 2C59A 2QTLA 1WMDA 1H94A 3V4VB 4O4JB 2PKYX 3DTVD 4P5DA 1RJFA 1ZESA 1O58A 1TJ5A 4N8SA 3TW0A 3VU3A 5DXFA 2YXLA 5K3FA 3AVWA 4X71A 3GN1A 2ZB8A 3AZPA 4FFDA 1E7YA 1BE8A 3NDBB 4KBYA 1NT4A 1R0XA 1YQEA 5TMBA 5B1DA 4FKMA 1L8QA 1QFJA 2IYUA 4J29A 4S0ZA 3OZBA 5DULA 2JH8A 5TEVA 2ZDHA 4BKUA 1VXOA 1R9MA 5TVGA 2JVKA 3TW4A 1M6HA 4G4JA 1URPA 4UQOA 3WG9A 4QVIA 5FTLA 5B3AA 1THMA 1JRLA 3IOYA 4XQ9A 1IN6A 2FLWA 3ZDZB 2AIRA 3N9IA 1ENZA 1AXEA 5GV8A 4I7EA 3TDKA 3H97A 4MR8A 5JZOA 1HQDA 4ZKEA 2OORA 1CUDA 1JYSA 2OZVA 3IC5A 4HSEA 4K9SA 5H3CA 2QM7A 3AR8A 3TTTA 3WL6A 5HRCA 3ZE1B 4CKBB 3SI7A 2GN8A 1XDZA 1XVAA 5JCXA 2ZSUA 3WK8A 1RE0A 2C5EA 3WNVA 1KZHA 1L0BA 2QV0A 1QU3A 5IN5A 2X9NA 3TEFA 1RKXA 3HV2A 1E9SA 1G7RA 4W5OA 4KDRA 2F9MA 2X40A 3CEPB 3CIFA 1U8TA 3RJMA 3WKBA 1NLMA 2Q50A 1L5LA 4UM5A 1OWMA 5FDFA 3JATA 1FMJA 2CXPA 2P75A 1CUIA 1BWPA 3WMGA 2ZS8A 3D3QA 3RYTC 4MWGA 2HWXA 1MABB 2MR6A 2HW8A 2CDRA 2FPPA 1LX7A 2DP4E 3G88A 4ZVSA 1OILA 5P21A 4K9KA 1Z0SA 3CF6R 4MPTA 5KAMA 1PE0A 1F2DA 1RWWA 3BAZA 5E2IA 3FUWA 3NO4A 5EOVA 4DEVA 1AKQA 2VF4X 1Y8RA 4JK3A 1UODA 3T8YA 4DCMA 2PANA 3G13A 5IZ4A 3PU6A 2QRLA 2CL0X 2C2OA 4AMYA 3D8HA 2F59A 4JJKA 4C4TA 3MJ4A 4ARZA 4KNYA 1C8KA 1OAKA 1TECE 2HUNA 3O3NB 3M1YA 3THSA 3FCUB 1P91A 1RVV1 4AN1A 5FUBA 4YAFA 4BWGA 3HYCA 4HNSA 4QJ5A 3PD1A 2X2PA 4MPDA 3ITDA 5KTYA 3SHTA 3OZUA 4IFIA 1FSFA 1P7VA 3DEYX 3NHZA 1ZM3A 4IXDA 3V4OA 4CT4B 3I01M 1V9LA 2PUVA 4C5AA 2ODQA 4F6CA 2QD5A 1JMVA 5T8KC 4P98A 3ZY4A 4LYEA 3T4EA 5HSGA 2KSQA 5I7WA 1AO3A 4KH1A 1RXCA 3ZBUA 1JEAA 4BVKA 2BGMA 4TYWA 3K9HA 3E22A 3G8AA 5EUQB 3THWB 2HADA 3QTTA 2ZTHA 1PX0A 2BFWA 4QHYA 1NOIA 1B41A 2Z8YA 4EDHA 4D9JA 2NO0A 4CFYA 1Y7PA 5FBKA 1PZEA 2Y0BA 3SOZA 3V4FA 3ZI0A 4CM6A 1S6YA 3TUJC 3MCAA 4DTIA 1L4BA 2D1SA 5FBLB 1UBEA 1Z5NA 5A5EA 1E6WA 1R00A 1Z88A 2NADA 2XY4A 3A1NA 2R65A 1L5KA 4JV5B 1T26A 3KWFA 3ORFA 4NNPA 4XCVA 1CSEE 2EDAA 4CEJA 1M54A 3E9NA 5AKKA 3WMRA 4DSNA 4YRZA 4DR5B 2XNHA 1QGUA 1T6ZA 4RORA 1AKEA 4RZSA 2YUIA 2EKDA 5H9VA 3U3KA 3ID6C 4PLPA 1HG0A 3VZPA 4C20A 2ZXUA 5DTJA 1J56A 2C9BA 2CHVA 3P0JA 3T9BA 2NQ2C 3OE7A 2BFAA 2P8JA 1V8DA 3K1JA 4R2KA 1KMMA 4DA0A 4IKPA 5FOUA 4LJ8A 5HQ3B 1JKXA 4M9RA 4C01A 2XTZA 5FLXA 2VDKB 3CHYA 2LCQA 3SZLA 5BVGB 4W5JA 5EAIA 2X0DA 3TNFA 3AP2A 4E5DA 5I9NA 3IOMA 3T9AA 3ISTA 4B2PA 3GRCA 1XVTA 2EBFX 5E2AA 1GSIA 1NBMA 3K2QA 5J4KA 5K0JA 5ITZB 4JFRA 3VR2D 3UK0A 3EXEB 4LX0A 1VIVA 2FP4B 4FOOA 3U16A 5EY5B 1RC0A 3AUUA 3BA6A 3CJTA 4O5AA 1LW7A 1OF1A 3UXEA 5HM6A 3M4XA 1CUGA 4H4EA 2VF5X 4UUBA 4MW7A 4W6QA 5C7OO 4AWAA 4ZPJA 5C81A 4A2QA 1H1DA 1L8XA 3RROA 3WGIA 3NW9A 2AQIA 2SCUA 1G1MA 2JASA 2QR3A 2Z8ZA 1ZK2A 3AL2A 4FBMA 5E4TA 3SX4A 5BOSA 5IDXA 1EYZA 1XCLA 4XJTA 2N1BA 2FXIA 4LDNA 4LEIA 1KMHB 4JI0B 4DUGD 4R31A 3A6LA 5G4LA 3WS7A 4UNSA 4PC6A 4J0DA 1VBNA 2X4DA 3QHAA 4LY9A 2OSVA 4ZAFA 1CFJA 5EUBA 1O0CA 4JLNA 3THOA 2XT0A 3AZQA 2VQEB 2RHTA 2B78A 2IT1A 2XYRA 3FWYA 2FMXA 1QCCA 5KEIA 4NV3A 4UJ5A 5ULLA 1SC3A 1G0OA 1BZYA 1M0WA 1UKBA 3KKEA 1J5EB 2GRAA 3UWMA 1UZNA 1BXRB 1NXOA 5EIBD 2VJMA 4W4TA 5A3VA 1CQJA 4NX2A 5GVRA 3TVTA 3WK6A 1F12A 2W2VA 4FYVA 4NL4H 4M1WA 2ID4A 3ZKWB 1WMAA 1JAZA 5A3RA 1KYWA 1TLTA 2VYFA 1NVWQ 1UBUS 4QT4A 2LE0A 2VJYA 1HE2A 4BHTA 2HWWA 4UXJA 3HR4A 2A9VA 1RQ7A 3AF1A 2D1YA 1WM1A 3T7TA 1NVDA 5D86A 2YFKA 2J4CA 2W6QA 1Q7TA 4F4DA 1U3UA 1M83A 4ZZIA 2D1RA 3I64A 1YDEA 4PYKA 5JNLA 3WGYA 5AVQA 4CLRB 4JQCA 4N76A 4Z4QA 2NUPA 3TWOA 1ZVKA 1S2MA 3ACDA 3LPDA 3HJHA 1PLJA 2JIZA 2RBKA 3HCEA 4KN5A 4TQAA 5JEDA 2W6JD 1IBMB 1XMSA 4IICA 1YJXA 4LBYA 5FNVA 3MELA 3G17A 2AYZA 2QZZA 2ONCA 2Z8XA 3SHVA 4OMFG 3LFUA 3WMFA 4A0SA 1P33A 3K7EA 1X9HA 4DIDA 4INOA 5LA6B 4YRIA 1ESMA 3IILA 4I81A 3K9CA 2A9KA 4EYOA 2JHPA 3EDRA 5F77A 1TU3A 2HH9A 1Z68A 5HPYB 3C7CB 5HQJA 2K2WA 4PRKA 2RG1A 4LE1A 1W4BA 4IXTA 3WI7A 3B2QA 3LBNA 1CJTC 4RM3A 5DM2A 4JL5A 1QTRA 4KNWA 1S2DA 4M1TA 3RFTA 5BMVB 3IXQA 5LWQA 1CEEA 2FFRA 4QFMA 3RI3A 4OBWA 4D8VA 1NL3A 1G5QA 2J31A 3JV7A 3JQEA 3VDMA 1EAMA 3UK2A 1EGMB 5IH3A 3QJ5A 2GBFA 1Z25A 3X1KA 1CS4C 3JQAA 4KN8A 3R7LA 3P2MA 4C7BA 2MSCB 3NHFA 4D79A 5JALA 1Q6ZA 4KQKA 2FG6C 2YV3A 4YTEA 3BZWA 4LJ7A 4O4JF 2N46A 5CIYA 4EJFA 1O0BA 1YOBA 4QPDA 1X1QA 2PRSA 1J8DA 1I4WA 4RM2A 3BRQA 1JPNA 3ZXIA 3EY4A 5FULA 3ANXA 1YIOA 3ZNPA 2QJWA 4BQOA 1AXRA 2AG5A 4KSCA 3IOCA 4R83A 5CDTA 1AX9A 3A9CA 4PYRA 3TLJA 1H1TA 1E4EB 2B69A 2GKGA 3STXA 4KXNA 3OLWA 2G9UA 2DHRA 1G7SA 1HXHA 3DC2A 4U6QA 4BUZA 2J87A 3ZWYA 4U0KA 5IXYA 1KZ7B 3TD6A 5FI5A 2BGJA 5A9RA 3U13A 1DBPA 4KHZA 3JYNA 3BH6A 1IAVA 4K9DA 5JHHB 2IIQA 3X2SA 1YS2X 1NP3A 3GMSA 5H16A 1NBIA 4XA8A 3FYCA 3QBEA 5TE9A 2O8BB 5BRNA 4NZOA 3E35A 4KXMA 3SNKA 2GCOA 5EMKA 5FPHA 1GPBA 3A3OA 5D87A 1K8RA 1YR7A 2YCLA 1NMSA 2PWAA 3I3OA 3OZEA 1AC5A 4UZEA 5LZ4A 4PO3X 2QX6A 4WASA 2E18A 3GNLA 4IFBA 2WD7B 2BM8A 2W2PA 3QEKA 3RVDA 4JUCA 3HXKA 3MLEA 1VHLA 3C3JA 4N9QA 4ANFA 3C1OA 4DLWA 1HEUA 4LYFA 4D02A 3GQVA 2MHCA 4ZYVA 3SDZA 1PZNA 2JVJA 3LWNA 5TV2A 1U5AA 1SPXA 4YROA 4GLFA 1I1NA 5U9CA 2PS1A 5LLTA 3MOIA 4GC9A 2E49A 4IOKA 3RRNA 1V4BA 3A4NA 1K6IA 2DPXA 3ZHQA 1UQTA 4LJLA 2JFQA 4O29A 4I3GA 5H5JA 2GUWA 2H1HA 3SM9A 5EIHA 3AVVA 5DCWA 3VBCA 1WCIB 2Y1KA 4F92B 2FPSA 3AFMA 3NB0A 4QGBA 4QJ3A 5I8WA 4U63A 3LP8A 1XK6A 4JKIA 4AQYB 1JBQA 2F8LA 2E5WA 2QRVB 4YQZA 5K3DA 1VHQA 3UICA 1AS0A 3OC6A 3RJZA 1ZAKA 1WIWA 4JJIA 3D8TA 1K92A 3N5CA 3KZKA 4YMUA 4F3TA 2Q3LA 1XD8A 1HRKA 1Z2PX 2ZUCA 1E5TA 1XUOA 3B1XA 2VAMA 2WRZA 5E95A 4GYJA 2YQ4A 4OMDA 1E6LA 2OBFA 3P4UA 1EHIA 4XWAA 2NQ8A 3RAGA 1NJ8A 4DZRA 3EFEA 2OG2A 2R25B 2CBGA 3ETNA 4GR5A 2YINC 2GEBA 2KW5A 2MMCA 5EG5A 1UAYA 4EI2A 5MGNA 4OYHA 4PU0A 2VNJA 2ZIUB 3I2IA 1Z83A 2XXAB 2EFCB 3ZTYA 3FLAA 2ZRMA 4FMCB 2B4KA 1GXSA 3BMOB 4CMEA 1MIOA 1N0VC 1QGED 4CL8A 5G0UA 3GRZA 1X1BA 3R41A 2FQQA 1U9ZA 3LVQE 5B36A 5CCEA 6GPBA 5HJ2A 4PSCA 5HXAA 4DCOA 2VTDA 3EGEA 3AFIA 1OA0A 3WNCA 2VJOA 4HAYA 4JSYA 1CZHA 1DQZA 2V1UA 4P7GA 1U7XA 2A6PA 1M7HA 2PSSA 3LPAA 5KHAA 4J6EA 3UHAA 2QU8A 4CEHB 3R3HA 1QHHA 1S02A 4LHZA 2PJZA 2QSYA 4GE0A 4RFSA 2BGIA 3WTBA 3K20A 1ENYA 4UQPA 2CYBA 2QGNA 3NHYA 1A82A 3ZCRA 4BLOA 2JZOA 1ESEA 2J9FA 4Y6LA 5DSXA 1KOJA 4F5YA 2VP6A 3ZU2A 4QBKA 3UMGA 1R8XA 2ZI7A 4KI0A 2JARA 5FV4A 2PQMA 1SD2A 4DT1B 5IVKA 3HRIA 4ER0A 1LW6E 1UMDA 5HBGA 3RTEA 3LTEA 4R1PA 3T1YB 2Y0CA 2ORYA 2XRYA 4IWNA 1YMVA 2ZXEA 2OV6A 3PG5A 1CDEA 1RR6A 4HDSB 5BYAA 1E5LA 1P45A 3C24A 3VAYA 4EPVA 1S2GA 2I80A 2IYVA 1I2AA 3QRWA 1JR4A 3MBKA 1I9GA 2HHAA 4PAMA 5E0KB 2QPAA 2GTPA 2QT1A 3Q2IA 1W36B 1X8XA 1G20B 4GL4A 4DJFC 3ANYB 3BT7A 3CH6A 2JF0A 1JDJA 2I54A 1QYWA 3OCYA 5LP6A 4N6GA 2ZPTX 1F2TB 1D5CA 1BD4A 1NI4A 2X8BA 3U3JA 1DI0A 4LCJA 1JLRA 4PY2A 5AESA 1AY0A 2DBZA 1PDWA 5BP7A 3Q5GA 1EE9A 1S4QA 3NPMA 4IVQA 2AE2A 1OUMA 5E9QA 3PB3A 1GGKA 4H3VA 4E3WA 4DCPA 2XE4A 2VQFB 2OBLA 3P9RA 3N2KA 3X43A 1XRJA 1F2UB 4BNWA 4PSUA 4CKCA 4C4YA 1PR1A 3E23A 4JMPA 3KZVA 2HO5A 2EJWA 1NN0A 3MLAA 4B9AA 1W0JD 4G0WA 4DCSA 5LB2A 1UBHS 3MIZA 2FX5A 3VPFA 1OTHA 3K6KA 2RE8A 3HDTA 3NIBA 4EHFA 2M98A 2P9ZA 1OIWA 4XGKA 1J2JA 1IFXA 4FE7A 3AW8A 5EEHA 2HIAA 4XGNA 4ZC8A 4H1UA 5LQCA 1HDXA 2DGDA 1P62B 2GBPA 1TEXA 3DF7A 2DBRA 4YVFA 5G1PA 2XYVA 3PVZA 2XDQB 2QW1A 3GA5A 2H1VA 3PQ4A 2LPMA 4JUAA 4RMIA 1IG3A 5AM1A 5K4GA 1EVIA 3UMSA 1Z0ZA 5EHGA 1ORVA 2RC6A 4H7JA 1RYEA 1YE5A 4A0GA 5C1OA 1JVNA 3ZHOA 5ELXA 4ND2A 1E1QA 1G2OA 2NU9B 1DL5A 2WHYA 1Y98A 4KQEA 1LF0A 3I5UA 4LYAA 3AR4A 221PA 4BNDA 4NNOA 4F9FA 4DDVA 1T3HA 1S0UA 2HPAA 4E33A 4B74A 4E6EA 4WY2A 2VZLA 4FGKA 3NHKA 1E1YA 2X3UA 4CMIA 3TEJA 2HDOA 2HPHA 3GG9A 3ZW7A 2XGMA 1KNXA 1QO9A 4I6JA 3LC0A 2O59A 3T7IA 2HMAA 5TJHA 5LA6F 1IXSB 4HDMA 2H2WA 2XUPA 4OQYA 4ER6A 1KH1A 3K30A 3QMPA 3TTVA 5JXIA 2DWOA 3OWOA 4NBVA 5AM5A 4FHZA 1W52X 2IODA 3ASZA 4IGFA 1IB6A 1P72A 3LF2A 3QFFA 5BRJA 6CHYA 1IBLB 2OGUA 1M2GA 4NPAA 3T7JA 3HJRA 3QVVA 4WBNA 4IDDA 1R0KA 4JQOA 5A1JA 1I4OA 1CG6A 1K5PA 4WV3A 3NBYC 1LJ8A 4JSRA 4MS1B 5TY0A 4MGEA 5F21A 4F04A 4EF6A 1PD1A 1Z39A 3V4PB 5FJIA 1UBOS 3OOSA 5BSRA 2CZQA 1RXVA 1EA7A 2J1LA 2VUSA 1NV8A 2ZJ1A 3G9UA 1SB8A 3GRPA 1ODIA 5C7LO 1NUQA 1JI3A 2VNAA 5IFKA 1FSZA 5DP1A 5CG2A 1QHNA 1PO7A 3O92A 4G0YA 4IDOA 3EMKA 1GQQA 3JSAA 1M2VB 2C7PA 1R0YA 4O4HA 1GTJ1 3ZWNA 2V4UA 4OAPA 3V2HA 1L3CA 2CWWA 4GOKA 2YHAA 1M0TA 2CE7A 3COZA 2YIJA 3BJMA 2P4UA 4WD3A 1UQRA 5TF4A 4EJSB 3BKWA 5JXGA 3SM3A 2QV7A 2QN8A 4WERA 2ZJ5A 3P0IA 1ZBDA 3SSNA 2FSVC 3IO3A 3Q0TA 3E9ZA 4J4TA 4M46A 1NXWA 4RHUA 1H5QA 4JGBA 4MO9A 3ZG6A 5LVAA 4NG4A 4JI5B 2FCAA 2HMWA 1U8FO 2O2SA 4R1NA 4JDUA 1M1YA 2JAQA 2QLBA 5F4BA 4EY7A 4QO7A 1GG5A 2UYYA 1Q1ZA 2EFGA 1PL0A 1PTKA 3CH7A 1WOYA 1Q2XA 1WDKA 4E70A 1K0UA 2FZKA 5E3JA 5CHYA 1I5RA 1XWIA 2XJ9A 3U60B 4FBLA 4O0MA 3Q7RA 4A8HA 1UMCA 3D0QA 1TAUA 3I1FA 1FCJA 4DMHA 2WUGA 3GPCA 1QNFA 2QMHA 4E5NA 3UJNA 2WVHA 2AYYA 5J5VA 3BQ9A 2RH4A 5CYGA 3FKJA 4OHYA 3PJEA 5EYPA 4DLSA 2JK0A 2Z3WA 3AM3A 5FA6A 1MQ9A 4WKNA 2RAVA 4LYJA 5JAQA 1LK0A 1SXJB 1N6LA 4XSHA 4BO2A 4TVOA 2AJLI 4Q4HB 2YZ2A 4FFRA 1O89A 4JUDX 5EWLA 4ISCA 4D3SA 1MZVA 1G16A 1II8B 1W4AA 4B6FA 1V25A 3WXMA 1OASA 3UHJA 2WMYA 4F2WA 1GQ2A 3FDZB 4BN5A 5IKEA 2ZATA 2Q5OA 4YYZA 5FRDA 3TFQA 2BFDB 3RJTA 2EL7A 3UV6A 5J4YA 3PF8A 5F2EA 2LIPA 5IT5A 4DBLC 2YMQA 4I66A 3Q12A 5K1ZA 3CURA 1C9KA 4FFOA 4RPJA 1XLTA 2BDUA 1MO5A 3KELA 5AK4A 5DI3A 1DTWA 4L07A 3TOCA 2WF9A 2Z4TA 3PUJA 4FNGA 3HEMA 2X8LA 1P4RA 4JZYA 5CFQA 2O3UA 1IQUA 4I8XA 4MHSA 3E7WA 2NVUB 4E11A 3PSAA 1YSCA 2BZ0A 4L16A 2P9HA 4XD7D 1AUVA 1ZN2A 4ZWNA 3DLAA 1DO2A 4HWSA 1IXYA 5L95A 1ZVVA 2FWNA 5KCMA 4TX1A 1TB4A 2GPYA 3GF4A 2HXGA 3DZCA 4HP8A 4NYIQ 3HKCB 4Q34A 3D64A 4QXRA 5KDLA 1JYEA 4C7XA 4EHDA 2UVPA 1AUOA 1SQ5A 4RTNA 1R6XA 3A4IA 3H5WA 4FMCF 1E2JA 2FR0A 2G72A 2W48A 1FDSA 1MLDA 2PTGA 1ZG3A 3AHIA 3FUTA 3K05A 1RM0A 3L3BA 4KYTA 3BILA 1VMAA 4AVYA 2Q3BA 1Z5UA 2QAGB 5KDDA 4RA6B 1R15A 1Q1EA 3PHGA 1NXVA 4M0PA 3OPMA 1Y7TA 4QPNA 5F9HA 2L0XA 3ZDCA 4DV2B 2B1QA 2QTNA 1BHSA 2VCEA 4QU5A 3SQDA 4DLKA 3ND7A 3H18A 4ERNA 4X6XA 3B1JA 1N0HA 4KN6A 4R2JA 4JXJA 1KAHA 4EB6A 4CTNA 4X45A 4QTTB 1S4MA 1VZ3A 2QIOA 1LA2A 3E0QA 4A6PA 5HUQA 4YWHA 2IC5A 3OMXA 1OFTA 3HB0A 2GR9A 2C3OA 3DVLA 4M0FA 3NTQA 2CK3D 5BPHA 2G71A 4DV5B 1TM2A 4WZAA 1BU8A 4CL0A 5EHXA 1XZAA 4K9PA 4Q3BA 1A9OA 2HT1A 1CUSA 4DC0A 2I8AA 4LQLA 1OHHA 1RAEA 4ESOA 2JNWA 4FDTA 3TLMA 1T5DX 3HA7A 2QN6A 3M5PA 2CLKB 4KG7A 5K4AA 5HKKD 3T9CA 1W85A 3GQBB 5LP6C 5T6MA 2B4AA 3F4KA 3SZOA 3CWQA 2J5BA 4L6IA 2C99A 2HEIA 1WD5A 4QYSA 2XEDA 1DKMA 5E38A 2C88A 4LXUA 1HG1A 3ICWA 2BFNA 3OU7A 3JX9A 1JHPA 1SN7A 1H8EA 4P3XA 2IZ5A 5KMGB 3VNBA 1PGPA 4CNQA 4X44A 1F0NA 2J0VA 3LOQA 2YY5A 4QIHA 4R8RA 1GZDA 2W4IA 2C7OA 1FQOA 2ZRDA 1XD2B 2ON6A 3GVXA 1NG1A 5JDIC 1JS1X 1RKBA 4WMLA 1PJTA 4H35A 1S8AA 1XO1A 1SUDA 1XMXA 3S4YA 4TLMB 4C4SA 1O0SA 1Z18A 3NI2A 5CDFE 1G8GA 2M9MA 4J7AA 4UVDA 4I4NA 4MVJD 2K7ZA 1E1CA 2IY9A 1N7HA 4D0RA 3KR0A 5L6LB 1SFRA 4Z2YA 3ZLUA 1KS2A 4RY0A 1R0RE 2Q5JA 5IK2A 3PFHA 4EGAA 1GGHA 4TVKA 5IT9A 5IKPA 1ZA1A 4ZZ3A 2P40A 1E5VA 4MYUA 2JFPA 5CLIA 3TZBA 3DONA 4URHA 5HKBA 1YTUA 4YIKA 2XCIA 1Y1TA 4DUYB 1I33A 1PRYA 5T64A 2QMZA 1FRQA 4LJ6A 4XQ0A 1C14A 2YHSA 5KUTA 2WEKA 4QDXA 2FK8A 5JXHA 3LW8A 1CCWA 2C9MA 2EYUA 4OF4A 1RYZA 1J8QA 2WTBA 3LHIA 1CC1S 2JA1A 3R1IA 4B7CA 2JGDB 2ACKA 3CWCA 5ARCA 3P9QA 4M8IA 5B53A 1GQSA 2G0TA 1U1FA 4N7BA 5I7RA 3MFQA 4GOND 4AXBA 4B6OA 4HDOB 4JR1A 3EQ2A 3F2VA 3GH3A 1G8PA 3TQFA 2OEPA 1DFGA 2ODTX 3LO8A 1CLEA 2JFXA 2IHBA 4RZXA 4MAAA 1MENA 3ESYA 3EZGA 3NWOA 3M8KA 3OM0A 3PEVA 3N75A 3PQ3A 4PLZA 4KUGA 2JLVA 1WXFA 1SIOA 3EWNA 4H6VA 4BECA 3P9PA 2ISCA 1JEQA 2A78A 5CURA 3A10A 3H42B 3EFHA 1AJEA 2RHGB 1WX1A 2Q0SA 2ZJFA 3EFBA 4WPGA 5FTJA 1CE8B 2P2LA 5F1YA 3V1YA 1OX5A 4Z1OA 1Z28A 4B84A 3JQFC 3AH8A 2HN9A 3O91A 4TMWA 4IO1A 4WOJA 1NKTA 2ERYA 3TN7A 5DCLA 2IIPA 3D6JA 1CJBA 5REQA 3ESRA 1A8HA 1U04A 2RBEA 4RPIA 1OXXK 3P5BA 3OUTA 4CF6A 3HVRA 1SWWA 4HWPA 3DLTA 1WXDA 1BX1A 4ZI2A 3ZDXB 3GUZA 2YWXA 1K8XB 4LDQA 5CVEA 3M4JA 2CVQA 2Q1SA 3U5ZB 1DAKA 4PLHA 5C7YA 1G21E 1LBHA 4OQFA 3S99A 3BFKA 1RJEA 2VA9A 3Q3JB 1XOIA 1Z63A 5D51S 1SR8A 2PZJA 2ZREA 4REMA 3KBOA 3HCWA 5KJ6A 1TZJA 4X3PA 5KWSA 2Q9CA 3EGVA 3I6YA 4NCJA 4QFBA 4FFSA 4AW9A 4TWBA 1VE6A 4NLLA 4R2HA 3UWSA 3UCEA 4OVKA 3SQXA 5IDYA 5MHTA 1PVOA 1QONA 3N0WA 3GGCA 2A59A 1RXUA 1EHYA 3WSWA 2JFFA 4ND6A 4TLCA 4AJNA 1KEEB 4HDCA 2VS1A 1HORA 2JHFA 1M1NB 4NXMB 3FVRA 3L0BA 1BE6A 1M8KA 4D7AA 2NUAA 1CIVA 2RBGA 3EMBA 2C1XA 3ZVLA 1X1RA 1NX6A 4L95C 3M6LA 3MMPA 1GGEA 2IIVA 3S68A 3EDOA 5BSVA 3VAAA 2BI4A 4L8WB 4KWHA 5C80A 3INYA 1L3IA 2KB0A 3AEUA 3PKJA 5F2NA 1GITA 3AEYA 3IB6A 4ND8A 4IIBA 4DMGA 1P2UA 1M2KA 2AZTA 4MV8A 4OK3A 1T4CA 2Z2YA 1ZIOA 3W6UA 2EP5A 1VLLA 3FDFA 5DT9A 4FIZA 5AW1A 1XF1A 4R16A 4M36A 5T5QA 1X92A 4PZ0A 2JBAB 4Y6QA 5G41A 4WLEA 1YBMA 2GVDC 1N4AA 1KOFA 1UKEA 5LC1A 2QY9A 1GR1A 1Y5LA 2ZU0C 3FJOA 1JXOA 3G0IA 4LC9A 3OQJA 1JF8A 4MEAA 4DNFA 4ZYXA 4KMOA 2Q29A 4QFCA 3RAEC 1LFAA 2Q1XA 1OJ7A 3NAMA 5DYIA 4LXYA 5SY9A 2CVZA 2H1LA 3RC8A 4K8OA 3QOXA 4DARA 5CFNA 1VHWA 4G5YA 3RS5A 1YRHA 2BFCB 3GWGA 2ZG6A 1FE8A 1JAHA 4KXQA 3CS3A 5DLPA 3TBKA 4O3MA 2PYZA 4HGOA 4DEXA 4QUGA 1I3OA 1QRRA 1YFLA 3NU1A 4TV8B 1U8EA 3QKUA 1Q74A 4QLAA 3Q4GA 3G2HA 2OESA 4R8SA 1KJQA 3CPEA 4WKOA 1AHHA 3B1WA 3WGQA 1ZUWA 3BXOA 4NI5A 4C0KA 5C1BA 1UWVA 2VXYA 3KVRA 3H2YA 4KX3A 1FLVA 4NFHA 1NLYA 2EP8A 2OQIA 2YBEA 3A06A 3DFIA 1B14A 4YRKA 2H7VA 3FETA 3T1HB 4LK3A 2J9RA 1T9KA 4RGYA 3W9YA 3I30X 1NPYA 2F48A 3ZNNA 5AVOA 4ER5A 5AW2A 5CW2A 4D44A 4AU1A 4G8BA 2XIJA 3GDGA 2C2YA 3K0AB 1JXQA 4ZREA 2OLKA 5IBPA 4EA8A 1JT2A 5I8PA 2FXVA 3PHJA 3QF4A 3PNPA 3SKYA 3VYTB 2GPTA 4FFVA 4AO7A 4IYRA 3Q3VA 3MJDA 2QSJA 1Y9DA 2I1WA 1Y6FA 2F6RA 1L7EA 1QKIA 1NBOA 3JQ8B 1JQDA 3DEKA 3LVRE 1GL3A 3L6RA 3L1IA 5E4YA 3U7IA 4DV3B 1U5BA 1W6UA 2JPDA 4EEKA 1X9IA 3IUYA 1UCFA 3LPMA 1QQTA <