4EPYA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epyA00
1KNXA 1W47A 2AD1A 4MRSA 1KI7A 3WNCA 4AI6A 1E96A 1QHIA 1YZTA 2D74A 2ZAOA 2ZU6A 4UXJA 3TSWA 2HYDA 3K0FB 1XF9A 1D2MA 4MKHA 1ZVQA 4JL5A 1ZM9A 1Z0AA 1ZCAA 1P72A 3UXMA 5JRZA 2EU8A 4L16A 2OLKA 1IM2A 4Q4HB 3EC1A 2PMDA 3UIEA 2NO9A 1DO0A 4EPTA 2JIZA 1E9FA 2PMKA 2XTZA 3X1YA 4P0TA 4URWR 3VHXA 3THYA 1LNZA 2B21A 1DBSA 4DLUA 3GJ0A 1FFHA 3QIAA 3NBZC 1XEWY 1CS4C 2HJGA 2IA5A 1CLUA 1F6BA 2GCPA 4IKEA 4DSNA 1KI1A 4ILEA 4Q4AB 2Q6TA 3BFVA 3L0SA 4B2PA 3HYRA 3GP8A 4KAXA 1RYHA 5JHHB 4ASUA 3TUZC 4C30A 1CJUC 4GOJA 2ZJZA 4KYIB 1Z6XA 1QHNA 2J0VA 3S1AA 2XJ4A 5KDDA 1EX7A 2ONJA 1LF5A 2QAGB 2VL7A 1NY6A 4OK3A 4FINA 1TF2A 1UADA 1UDWA 2OCBA 3DEFA 2J59A 3P32A 1E9AA 4JT4A 5G40A 3EZFA 4A6XA 2B8TA 3RAPR 1L2TA 4RZUA 5J40A 4A0RA 2ZRFA 1G16A 1MR3F 3VR2A 2AK3A 4BZPA 1HV8A 4IOKA 1UPTA 1AN0A 4TL8A 4DLZA 5KPDA 3GJ4A 1G8PA 3WP0A 4MYUA 1ZD9A 1DOAA 2WJVA 5BN3A 2ZUBA 4W5WA 1G5RA 4QL3A 1RJ9B 1TAGA 1GL6A 2ZRNA 4FMCF 4BZXA 2J9RA 3AVVA 5UKDA 3QKSB 1S3GA 4WW0A 3CRVA 4LJ7A 4AWXA 1XZQA 1Q3HA 3H1TA 4FMCB 3K70B 4TMWA 1TEXA 1YU9A 1YHNA 2D7CA 2WIBA 4FWIB 3RANA 4YC7A 2WMOB 4NP6A 1KO1A 4JVMA 4R2IA 3Q85A 1NG1A 1TNDA 1UBCA 2PCLA 3BH7A 4FIDA 5BN5A 2UVQA 4X8MA 4PQYA 3SEAA 4Q4LA 5IDVA 4TYWA 2IXGA 1TQ4A 1YRAA 1FZQA 4B2LA 2REOA 5H1YA 3C41J 3AF2A 5E7IA 2W58A 4PZZA 1AM4D 1Y63A 2VBCA 4LJ4A 3EXAA 1TU3A 1XJ0A 1N3BA 1P4SA 4D26A 1Y3AA 4KHZA 3R9IA 4UNSA 4HI0E 1YZLA 4DT1A 3NDBB 1GOTA 3EA0A 3CLVA 1G64A 4LJAA 3RS2A 2C96A 3TGPA 1D2NA 2ANBA 2FZ4A 4B32A 2HT1A 3CPHA 2AKYA 3HPRA 3K9LA 4MYTA 3LLMA 1ZNZA 1W4RA 3OEHD 2BEJA 1QHGA 1YZKA 2IYTA 2ZTSA 4PHTA 3OFNA 2W6JD 2HLDD 1YRBA 3N5CA 1ZU5A 2Q9AA 2C98A 4WXPA 3WHLA 1BYIA 1Q1BA 4M0LA 5AK0A 2DB3A 4AY2A 1C4OA 2BKEA 3IBYA 1J99A 1NI3A 3PJRA 3OIUA 4PC6A 3ZLJA 2FJUA 1HT2E 4PXAA 3FFBA 4PC2A 4X8LA 1OSNA 2GEUA 2WZQA 3NEYA 1HYQA 3UWOA 3QXCA 3AKYA 1SKYB 1T8UA 3QKSA 2GJKA 4OQFA 4R9UC 1CXZA 1XRJA 4DIDA 3B1VA 4P4SA 2JLXA 4FI3C 2QN6A 1ZC3A 2X19A 2VP6A 3I73A 1P62B 2FGJA 1MO3A 1X8LA 1UKZA 2WAYA 4IJMA 2IYQA 4GRAA 2BBTA 2CMKA 1OH6A 4HAUA 3IKJA 4P31A 4AD8A 4QBHA 5SZIA 4GL2A 3U3RA 4AURA 2FGKA 4PC7A 3BK7A 2H16A 1E9DA 1OHHD 4F4IA 1I4LD 1CIPA 2IS1A 2QAGA 2QENA 1W48A 2QROA 4S35A 2PT5A 3CNOA 3CM0A 2GZHA 3D31A 1NBME 3ZGXA 1G3MA 3MRSA 4JLNA 4MGYR 3EPKA 2AFHE 3BAFA 4URZR 3L8YA 1OFHA 3GJ5A 1NIPA 3PXGA 2WSSD 5FI0B 1US8A 4DUGA 2GTPA 4NKRA 1V43A 4QJ5A 4DSUA 2FU5C 4MYCA 2W2XA 1N0VC 2F1RA 2P6NA 2QA5A 4XWKA 2CE7A 1S96A 1CR4A 4K81B 4DWJA 2ZJ2A 3MWJA 1Q22A 1VCOA 4GOXA 1W5SA 5BWMA 2V1UA 4JYCA 4DB4A 2GK6A 2A5JA 4BFYA 3GFPA 2GETA 4ZKEA 4JLJA 2DFLA 1TU4A 3QBVA 5KNCA 2O8EB 4C2UA 3TR0A 1HTWA 1RKBA 2CBZA 1N6LA 3A8TA 4EFNA 1TPZA 5AUPB 1MOZA 1HT1E 2OBMA 4W5HA 3NHBA 4YDHB 5FOXA 4GI7A 1SXJC 4EPRA 1UJ2A 2J46A 1W2GA 3UATA 1Q44A 1SULA 1WA5A 1ZAKA 4P4SB 5JCPA 3BH6A 5DI3A 4BZQA 5JS7A 2RGDA 2H8KA 3KJHA 2C9CA 2BMJA 5J4KA 4HZUB 3IPXA 1IY0A 2IYZA 3Q5DA 5JJLA 1E2HA 3FDIA 1JI0A 4XOIA 1XCGB 3LQRA 3HU3A 4OQXA 1T3LA 4Q4JB 3TH5A 4DCTA 1VHTA 4RZXA 2FWRA 3JVUA 3A1WA 1P3JA 5GJBA 2C03A 1TUIA 3LXRA 5L3RA 4F38A 1UBEA 4EDHA 2VQSA 4ZI3A 3UWKA 1XNJA 3N70A 2WWWA 5K8TA 3HJNA 4PC3A 3U4QB 2W2TA 1Z0KA 2F1JA 1M2OB 1HQCA 4I1OA 3NTUA 1VECA 2YINC 1AGPA 4G1UC 1XMVA 2XZPA 3FWYA 4D0GA 4P33A 4DLXA 2XXAA 2D4HA 3GQBA 1TQ2A 1OXUA 4AG6A 2G88A 2JA1A 3C14C 5B57C 2WWXA 1E1QA 2QM7A 4Q48A 1G3UA 4KSCA 2VHUA 4WBSA 3RHFA 3TLXA 3ADDA 2BBSA 4FCWA 2AK2A 4CVNA 5DO9A 1YR9A 2ZSBA 4D4JA 3DO6A 4N1AA 2ZS7A 2CCGA 4FMDB 2ZAMA 3LQQA 1GWNA 4PZLA 2WJIA 5TY0A 1KI6A 1R5OA 3LRPA 1Q1QA 1IXSB 3PUZA 3Q7PA 4Z1MD 1LTQA 4D25A 1NSTA 2ZR0A 1Q0UA 1Q20A 4B75A 4HAYA 5LBIA 4KVGA 1Q12A 5J5CA 1NY5A 1UEIA 5FOUA 2AX4A 1AKEA 2BIFA 2ERYA 4IRUB 5B2ZA 3B9QA 3E1SA 4IHQA 1NN3A 4BWYA 1E94E 4PANA 4AKEA 1D9ZA 2AKAB 1FP7A 1G8YA 2FNAA 1XTKA 3LNCA 2R6FA 4DSTA 2A7QA 1RW4A 1GL9B 2EFHB 3FB4A 1WF3A 2NOAA 1CEEA 1QG4A 1BMFD 1N6OA 1ZRHA 1UFQA 4TLAA 5FTLA 3FKSA 1JJ7A 1F5NA 4LYAA 1A2KC 2J0UA 3QG5A 2E1RA 3GEEA 1OJLA 2QQ0A 3Q5EA 4JLVA 3OE7A 4R98A 4PHHA 3ZZTA 5AUNB 1FNNA 4TMZA 2JAQA 2EVWX 2VLIA 1IAQA 2Z6VA 3I32A 4LC1A 3LXXA 5EXSA 4Q7JB 1G5TA 1HA3A 3H2YA 3L2OB 3QVVA 2OFOA 4D80A 1RVDA 1OH7A 4PFSA 3QXSA 2QMOA 1CKEA 5IF9A 1QVAA 3K53A 2W00A 2RB4A 1PVOA 4I1SA 2V8OA 1Z0JA 1XB2A 1VDZA 2UZIR 4M2LA 3SDZA 2PEYA 4OHVA 1KSJA 3O8BA 4JKIA 4PR0A 1UBGA 2OCYC 1OIXA 1Z47A 1ZNXA 1P5ZB 2BHRA 4B44A 4ZDKA 4ZDJA 4GT1A 1F2UB 2O5VA 1BH2A 1IN5A 1Z6GA 5FBWB 2VP4A 4OJQA 2IYVA 3TQFA 2L0XA 1VCIA 3KJGA 1TX4B 3CH5A 2XZOA 3SFZA 2FFQA 1CJVC 3R8CA 2ZRIA 1CR1A 3B6EA 2IS2A 4M21A 1GVNB 2BM1A 4QGHA 1E2LA 2XTMA 2IYUA 2JLZA 1VIYA 3I4LA 4HUQA 1I4TD 5EP3A 1UF9A 4ARZA 3TMKA 4DCUA 4TN1A 4IDNA 4LPSA 2XTNA 2I3BA 3OIWA 1SVMA 5CIWA 2C5LA 1GL7A 5TB5A 2IS4A 4HAXA 2GRJA 4LDJA 1JALA 3CRQA 2EYQA 4Q02A 5E7MA 4KXFB 4C0JA 1NMZA 3WNDA 4IFEA 4DZZA 4NDZA 1I2MA 4W9MC 3O8RA 3KXKA 4L9SA 4HATA 4QHYA 3LLUA 1TL7C 3UG6A 2JGNA 4KFSA 2NZJA 4Q1CA 5CB6A 1SKQA 1JXOA 4LY6A 1LW7A 2V3CC 3SQWA 1FTSA 1KMQA 2GILA 3D6TB 1CR0A 2BJVA 1B23P 3W3AA 3PVSA 1FW6A 1EWRA 4LYJA 1UKEA 2ZJ8A 3AP1A 3MWKA 1U81A 3B85A 4KJZA 4B3GA 3ICEA 5E3HA 1Q1ZA 5B30A 1ZJ6A 3C4JA 4QC2A 5AUQA 1G5PA 3V4FA 4BLQA 1OIVA 4OL0A 3AVPA 1K5GA 4RKFA 3B1ZA 2ODNA 4NYMQ 4JBWA 2V55B 3A4LA 1HY3A 2R65A 1LY1A 2OESA 4Q9JA 1QRAA 1JECA 3QOFA 4G5SA 1OV4A 3VX4A 3LWNA 4FXPA 1ESMA 5AJWA 2XAUA 5IK2A 1Z83A 5LDDC 1XWIA 3AUXA 3BERA 1XTQA 5KU1A 2FOLA 4NPHA 4I4LA 3EIQA 2ZRHA 3H4MA 2GBLA 4UNPA 4RZ3A 1E9CA 4TTPA 1IXRC 3GLIA 1AJEA 3H0KA 2DWPA 1RFLA 2O8FA 2O8DA 4GMDA 3CRW1 3MAAC 1AA9A 2CHQA 4H1VA 1Q57A 2YWHA 3BORA 4MKIA 3HU2A 2ZJ5A 2ZPTX 1DAEA 4C7OA 4A92A 3T12A 4ZCIA 1NIJA 3VKHA 1OXTA 4B2IA 1HURA 2JJ2A 4OHWA 1NBMD 4NCNA 2B7BA 1GKUB 4OQLA 5DI9A 1GKIA 1ZM2A 2FFHA 2W0MA 2ZR9A 2C99A 3OESA 3QUSA 3SU8A 2CL0X 3SHFA 5JSZA 1Z08A 1GRQA 4F91B 1JPNA 3KQHA 1A2BA 3IQWA 3QPVA 3C5HA 5SZKB 3PITA 2O0KA 1D8TA 5EE9A 4DCSA 4DVGA 1ZCBA 5FPKA 3P1JA 1M7GA 2QQEA 1P60A 2ZRAA 2KBFA 3IILA 3L0PA 3BBPA 5BXQC 2GESA 1D2EA 2JDID 2QGNA 1XEWX 1GNQA 5CYOA 2G1JA 3AKEA 4M1SA 5CLQA 1W36D 1GIAA 1GKYA 5DI3B 3FVQA 2GEDA 2WPDA 4X8OA 1X1RA 4LSGA 1NKSA 3IIJA 2TMKA 1G18A 2RGEA 4WVFA 4GP7A 4TZ6A 5KO2A 4JLAA 1TEVA 4IOMA 4CEIA 1X6VA 4GFDA 2QRZA 1RRGA 3QNUA 5F2EA 4YMUA 4IDQA 3LBHA 4CEJB 2OBNA 2VYFA 4MGZR 1JR6A 4DIEA 1EWQA 1G41A 1QVRA 4JVLA 4QBIA 4XWAA 4JBXA 1IN4A 1BS1A 2Z4SA 3TKLA 1U99A 4ITRC 1OFTA 3D3QA 3WBKA 3M1IA 2H7VA 2CK3D 3A1SA 4UJ5A 1E2IA 4LZZA 2QTHA 5GJWC 1BYUA 3IQXA 3CWZA 3U6BA 4JSYA 4BLTA 2V1XA 3U44B 1F3OA 2IYSA 1E2FA 3L0IB 3KXIA 3LX5A 1OYYA 4NBSA 3KTAA 1KK0A 2D3WA 3KQNA 2P6RA 3AVWA 3SJCA 1QZXA 1VG8A 2XZLA 4NCJA 5G3ZA 1KOFA 1CULC 5CLLA 1T0HB 4OYHA 1BOFA 4EFLA 2PBRA 1RC8A 3U7HB 3K1JA 4C0SA 2ZSDA 3U7FB 4EJSC 1NVVR 3CH4B 4KLZA 2YVUA 3NC0C 1VCMA 4EJSA 1YKSA 3NH6A 2FN4A 1XEFA 1MRSA 3LFUA 2LKDA 2V6JA 2ZITA 2QMUA 1U0JA 3NIBA 1MO4A 2GZDA 3X1DA 1M7BA 2VP9A 2GCNA 4NTZA 2IYYA 2I4IA 1ZBDA 3GFTA 3HYTA 3QEOA 1ZM3A 2C77A 5E7JA 1J8YF 1NL3A 1Q3TA 4QJ4A 2BWJA 3CWQA 3BGWA 4HB2A 4PO1A 1G3IA 3RSLA 1ZP6A 3EC2A 3WP1B 1VG0B 2ZYTX 1XJCA 2CE2X 2NO0A 5JFGA 3FPAA 4HAVA 1FOEB 3FMIA 2XITA 4QOSA 3GLFA 1JPJA 3DZDA 3ONWA 2Z4RA 4Q7MB 1E2KA 2R6AA 3K09A 2A5FA 2DR3A 3FKSD 5KYKA 1WB9A 4C2TA 2G6BA 4QGFA 1ELOA 3EWSA 2NZ8A 3C5CA 1FMJA 1BMFA 4BPBA 3NWJA 3KB1A 1P9WA 1VIAA 4D0LB 1ANKA 4AIIA 1NLZA 3ZIAA 1EK0A 2GA8A 2WOJA 5L8VA 4N3NA 2Q21A 4L15A 5CJPA 4F7WA 2WJGA 1N6NA 4BEJA 2VA8A 4Q9HA 3SQXA 2RGGA 5HKKA 1DARA 1JR3E 3GLFE 4YONB 3D7MA 3W5IA 3BB3A 1O87A 3OFND 5G3YA 3B1WA 5CK4A 5H70A 3UPUA 2VSOA 1A7JA 2AR7A 3NEJA 4M8NE 2OHFA 3A6PC 1KTVA 2I1QA 3A4MA 4XTCS 1SVIA 4Z51A 2YC4C 1QHXA 3RRZA 4CRWB 1ZD8A 5SZJA 4B33A 4M1MA 1Z8FA 1L7VC 1ONBA 3BB4A 5AUOB 4XTRA 2ZUDA 1G4AE 3ECCA 5AJVB 2VO1A 4KFTA 2ZI4A 4UNNA 5FUXA 5FL3A 1HE8B 3ADBA 5C46F 4LHWA 2O0JA 4LBVA 2H5EA 5HCNA 3DHWC 5F9HA 5TXGA 4MGKR 4XD7D 2IUTA 3LW7A 4A1FA 1UKYA 2A2ZA 1ZUIA 2FSFA 1KMHA 1E1RA 2HF8A 3EIHA 3T1OA 2HDNB 1II8A 3KX2A 2YYZA 4CF7A 1ZUNB 2CDNA 1CJMA 3B78A 3HPQA 1NLYA 4HLDA 4PAQA 2A9KA 1WRBA 2BV3A 1MO6A 4W7SA 2BDTA 4PPFA 2MMGA 4RD6A 4M9QA 3VFDA 2LCFA 5FUVA 3FTQA 1E79D 4B73A 3CRMA 3FOZA 5FTMA 1II0A 1W0JD 2DCUA 2J41A 2KSQA 3TUJC 1JJVA 4ACAA 4E22A 2ZE8A 4J0QA 4A8JB 4P3YA 3ND9A 3KZ1E 3PUVA 1N5LA 1T5IA 1EFCA 3F0TA 1RRPA 2RGNC 5FBRB 1WQ1R 4RFVA 4NH0A 3U6KA 2DFKB 2SHKA 2VHCA 1IN6A 1SVWA 2ZI5A 3NH9A 3CF2A 4ESHA 3BB1A 5LD2B 5HE9A 1PV4A 1QG2A 4FCVA 2ZXUA 2O8BB 1GILA 4WAUA 3QXXA 5G53C 3ZS8A 4OK5A 4F92B 1ETUA 3TRFA 4DHEA 1D5CA 1GZSA 1RIFA 5TDHA 2NO1A 2FEOA 3K0AB 1GUAA 3M0EA 3K0EA 3PQCA 5FOWA 3QPWA 3AVXA 2XGJA 1MABB 4UJ3A 4Q7LA 1ZNYA 2ZS9A 3U5ZB 3AH8A 4Q4AA 4RJLA 2O52A 1E2GA 1N5IA 1OXSC 1IN8A 4D4LA 4Q01A 4BFSA 1G20E 4KU4A 1U8YA 2QEQA 5FPHA 4LV6A 2UZ3A 4TTRA 3A1UA 5DYGA 1PLKA 3RS7A 3CB4A 1GRRA 2PLFA 1E99A 2JJ1D 4IVRA 4BECA 2WVJA 5JHGB 1G1MA 1IN7A 2WWGA 4Z8XA 3SYLA 4E09A 3T1VA 5BN4A 3VR6A 3GFOA 1E4VA 1S2MA 4X8HA 5EP4A 2B92A 4C9BA 2X1VA 4DJTA 1W4BA 2BM0A 1JBKA 2KB0A 1ESNA 4E5UA 5HR5A 2XX3A 1KI2A 2QT1A 4BEBA 4JSTA 4O2RA 5BW8A 2HEIA 1LB1B 2O8CA 2QTVB 2YHSA 1KAOA 5DNYB 2CJWB 3GMTA 4TMXA 4KITB 2QU8A 4DC9A 3UANA 2EYUA 3K0CC 3M4YA 1E0JA 1SVKA 4AKIA 1G8HA 1G8GA 5BQ5A 2QY9A 3OE7D 5DISB 2BC9A 3K0CA 2DFTA 4Q1DA 3CZPA 1KK3A 5FUWA 1GDDA 4QNMA 1H8EA 1N5KA 4JJKA 3U3OA 5FBQB 3KQLA 3F8TA 4AYXA 3H84A 1QBKC 2R62A 1WBDA 3L82B 1EX6A 4LJYA 5AR1A 3BRWD 4JMPA 3ZVLA 2H57A 4AK9A 5D3MB 1P9NA 4HLUA 3R8FA 1HE1C 2GCOA 4IOLA 4MUAA 1SZPA 3EPLA 4JVNA 5JJIA 1OXVA 3QE0A 5FR1A 2IF2A 2Q3HA 3D8BA 1XCMA 2J1LA 5D3QA 4MH0R 3U2QA 5J4HA 4A0FA 4WZBE 1EFRD 2D06A 4DDVA 4US2R 3THWB 3MLEA 3WXMA 3VR5A 5FBVB 2WJYA 3C16C 1NVWQ 1N25A 1NN0A 1SXJD 4DLRA 2YC2C 4IEIA 4TWZA 2ZJAA 3ZVRA 2OILA 4EKDA 4E07A 2QPTA 4DDWA 1U0LA 2JLWA 5B58C 3VU9B 2WTUA 3ZJYA 5FL7D 1ZU4A 1SGWA 2W2VA 4Q47A 5EXTA 1IBRA 3Q7QA 2QP3A 1KY2A 2RGBA 4TQAA 5L3SA 5JJKA 3RRNA 1E2JA 1T4GA 2NO6A 5KSYA 2WJJA 1TF5A 1R0ZA 5CK5A 3UMSA 3AVOA 2EWWA 2RKOA 3GJ3A 5EJEA 3AP3A 1OT3A 5C4GB 5KSOA 1X1SA 3GLHA 4Q1AA 3EW9A 3EA5A 5JRJA 2PLRA 3FHCB 1AGRA 2VTKA 2HV8A 2GAAA 1OH5A 1N6RA 2QPOA 1US8B 1JEEA 2VHQA 3M6AA 4B71A 3WYGA 1R0XA 3TIFA 4LX0A 5J4LA 2CNWD 2V54A 2CK3A 1NVUQ 1RRFA 1U9IA 1XD8A 4R2HA 2WOOA 2VH5R 3EPJA 1CRPA 1WMSA 1N6IA 4A4DA 3FHTA 4C7OB 2EFCB 3FE2A 3QI2A 2F1HA 1DAFA 4Q1FA 4NMMA 2FPKA 2ODEA 3LO5A 1CR2A 4UNQA 3K70C 4M9XA 2ASEA 2K5UA 1XZPA 3ASYA 1FUUA 1W0KA 3RWMB 1XPOA 5FPSA 1LF0A 2QMHA 1MH1A 3LVQE 4JZKA 4ZDIA 1LS6A 2GJAA 2R8RA 1E6CA 2ZRKA 5EP2A 2EFDB 4L5BA 2ODWA 2DFNA 4DXAA 1NRJB 1R6BX 4UXIA 2JDIA 1S9HA 4Q5IA 2OO7A 4A0GA 5JEDA 2CNWA 2R2AA 2RGCA 2HJVA 3E5HA 4G5RA 5J47A 2QP4A 3ND8A 1TF7A 1Z0IA 3EWAA 4G01B 4WIAA 1W36C 4G0NA 5A5GA 3VHLB 1XPUA 2FSGA 5DGXA 2YWGA 4Q4JA 1R5NA 4ZIRB 3BJIC 2JJ8A 4XSHA 1G8FA 1XMJA 2BCJQ 3MJRA 3A1TA 4LV5B 4PPNA 5FUYA 4Q00A 2JJ2D 2OAP1 4BFVA 2GCOB 1CJKC 3X2SA 4ZIRA 2OXRA 2X77A 5CITA 2OG2A 5FI1B 3W6PA 5GJCA 1OB5A 3W8NA 1XMIA 2CLDX 2OCAA 4GP6A 3CO5A 4C0AC 2JASA 2GXAA 1L4UA 1U90A 4DUGD 5C18A 3A58B 3PEWA 1UEJA 2GHIA 2MMCA 1MV5A 3Q3JB 3DPUA 4MYHA 5JECA 5JCZA 3KB2A 1G19A 3HP1A 4B3DA 2F6RA 3BS4A 1N5JA 3DL0A 4TLBA 2O8BA 1N2CE 3EZ2A 2VP0A 3VNUA 4JIMA 2QI9C 2RHMA 2BEKA 1Z0FA 4NONA 4WXRA 5AJYA 1OKKD 2F55A 3F5FA 2QL6A 3A1VA 2ZRLA 1E2QA 3OAAD 4NE2A 3RRMA 4PQRA 1YR6A 2ZRGA 3THWA 1P7CA 2NO7A 2QORA 3ZIAD 1FQJA 2HXSA 2QGZA 821PA 5JLJA 3BWDD 1OPXA 2GXSA 3W5JA 4DRZA 1ZINA 4LHVA 4XH9B 4LPKA 1R8SA 4OQNA 5GVSA 1VYVA 2VSFA 4JLKA 5DHAA 3SNHA 3TSOA 3G82C 2IWRA 3TVTA 3R9WA 4G5OA 4M9ZA 3SI7A 3T15A 1A5TA 3VTKA 4TL9A 4BRUA 2ZE7A 2ZR7A 3PIRA 4RD2A 3P4YA 4LUCA 4A2PA 1PLJA 4LYFA 5CYPA 3REGA 4R71A 4URXR 1YR8A 5ANRB 1SKYE 4G3XA 2GEVA 2XJ9A 4YLGA 1UAAA 4OHZA 3KKPA 4IFBA 5CDFA 5EE3A 1VTKA 4V02A 3OAAA 2JLSA 2OCPA 4K46A 4Q1EA 3W8RA 1KMHB 4NCIA 4OI4A 2OAQ1 2HF9A 1EESA 1AS3A 2QRNA 3KL4A 1L8QA 1WP9A 2H18A 4RSGA 2H1LA 4RCZA 4WZAE 1E69A 4U02A 4CGZA 4GBMA 5A0FA 5LB2A 5TVKA 1ODFA 3EAQA 3AVYA 3GLFB 3QENA 4A2QA 4D82A 4JJZA 4KO8A 2WSMA 1IXZA 4IDHA 3T5DA 2PX3A 2YNMA 3C7KA 5TARA 2IUSA 1N0WA 1XEXA 2J87A 3EIEA 3F3YA 4GMXA 3NHAA 4Q66C 3TSZA 3A37A 1G9XA 1E3MA 2ORVA 2F9LA 2JJ1A 3HR8A 3LBNA 2PZFA 1QHSA 2ZSAA 5L3QB 5BYJA 4DDTA 2XSZA 1G291 2B6HA 4PSKA 4EPWA 1ZW6A 2WBLC 4FMDF 1U94A 2W0SA 2DHRA 4M9SA 3DKPA 2WAXA 4NHOA 3MGCA 2ZRDA 4CT5A 3DM5A 4CYMA 3IBGA 1KO7A 5D3MA 3THYB 3P20A 3W6OA 2A30A 4HB0A 4IEEA 3SOPA 1OIWA 4OI2A 4I81A 1PUJA 3AGQA 421PA 1SHKA 1R0YA 1RJ9A 4JL6A 1GM5A 4TYQA 2RMKA 2CHGA 3RSOA 1KI8A 2QZ4A 4ACBA 2P3SA 5E4FA 3CF6R 1ZM4A 2ATXA 4TSFD 2WKPA 4ZO4A 4KFRA 3FHOA 1AK2A 2BBWA 5E95A 3RS4A 3FMPB 1MRNA 2JLRA 3RVBA 3U44A 4URUR 1XMSA 3CX8A 1G4UR 4URYR 3EZ9A 1KDOA 1E9SA 2IT1A 4BE7B 3I61A 2IX3A 2BVNA 2CCJA 1S1CA 2FH5B 4NL4H 2P5SA 2H92A 2QMEA 3L8ZA 5J4YA 2F43B 5C1BA 2V6IA 3SBEA 2YKGA 2B8WA 1KJZA 4JLPA 4NYJQ 1Z63A 3O8CA 4CEJA 5HE8A 1A1VA 4DCNA 4EUNA 2W6ID 4IDPA 1FX0A 1H8HA 3FKQA 4LC0A 4ZI2A 4EJSB 2AWNA 1CP2A 2IW3A 5FR2A 3K09C 1PUIA 1KI4A 3MUFA 1MT0A 2A5YB 3QF7A 1KKLA 2YOFA 2QPAA 3DMDA 2D62A 4QG7A 3KDSE 1EFUA 2W83A 4LCBA 4XD7A 4B35A 5JI3E 3NC1C 2V7QD 4MDEA 1NBMA 4Q4HA 4M22A 3MJHA 5IHPA 1L4YA 4Z1MA 4IW3B 3ICQB 2RGNA 3NG1A 3VAAA 3B82A 3SE0A 5CB8A 4II7A 2R44A 2DBYA 1J70A 3E70C 5KNBA 4P4UA 1YZUA 3K70D 2BBOA 3H86A 521PA 3TW8B 2F7SA 1TQ6A 1DAIA 1KDPA 1Q21A 1QHHA 1SXJE 1OFUX 3IIMA 3QG1A 2H17A 2OFXA 2GBLC 3LVRE 3VR3A 4C0QC 4QM7A 3AEZA 2PX0A 2YZ2A 1E2NA 2RGXA 4PSAA 5JWOA 1OF1A 4ON9A 1X86B 3AUYA 3SN6A 1XPRA 4Q03A 4GPTA 4PZYA 4DBLC 4UNRA 1LS1A 2IWHA 2NTYC 1I2DA 1KI6B 4D0NA 5C4MA 1AS0A 2HUPA 4O25A 4A82A 5EXPA 1DS6A 1Z07A 3S1AB 5F98A 5HKKD 2FSIA 2QAGC 4AYTA 5FTKA 3P4XA 3LBIA 4V0KA 3NXSA 3KKQA 4NYIR 5EE1A 1KK2A 3CPEA 3KXLA 1CRQA 2E9SA 2DYKA 3BD9A 1XXHE 1ZUHA 4D4KA 3PUXA 4QRHA 4PHGA 3LY5A 1OFIA 4HAWA 2IS6A 2J7KA 3K8YA 3GPLA 3EX7C 5KUTA 4BFZA 2FFAA 3QVUA 5GADl 4MDFA 3IGFA 4HLCA 2ZRBA 4PO9A 3ADCA 4QXAA 2QBYB 1CU1A 3L43A 4K8OA 4MKGA 2FZLA 1MO5A 3AGPA 4UXHA 3SFVA 3OEED 1QDEA 3U7EB 3OIVA 3CBQA 4LJ6A 3WNBA 1RZ3A 1JR3A 3TVDA 1G21E 3TK1A 1VG9B 2QT0A 1PJRA 2CL7X 1YR7A 3RS3A 1MABA 3AVTA 4HDQB 3UK6A 2IEZA 2EFEB 2D2EA 2Z0MA 4LGMA 2GXUA 4BGDA 3AF1A 4IDOA 1EG7A 3GJ6A 2AN9A 1GTVA 2ONKA 1FMLA 3AVUA 5LB4A 2FF7A 3T34A 5BYKA 3O8DA 3GLIE 2JEOA 3QKUA 1NG9A 3AKCA 3QF4A 3CR7A 3DM9B 1ZNWA 3IHLA 4YMSA 1GG2A 2ZEJA 2ZRJA 2QNRA 3TAHA 3TR5A 3B2EA 1NJGA 1Z6TA 4UQOA 1S0UA 3DZ8A 1KO8A 1NN1A 3SS8A 3GLIB 4IXMA 1W4CA 2AWOA 3B60A 4TLDA 1VPLA 1IJFA 4GSYA 2GKSA 2PT7A 2XB4A 2WSSA 2X8AA 4RY2A 1EFTA 4A15A 3WMFA 1W7AA 2RAPA 4D81A 1Z2CA 1ZM7A 2ZSFA 3B5JA 4JS0A 5SZHB 4HLQB 4CEHB 1G6OA 1YQTA 1KDRA 1CF4A 2ECKA 5KTYA 4L8GA 1W4AA 1FP6A 1ZYUA 2QE7A 5EE0A 3IDQA 2B7CA 3NBXX 1OHHA 4CZ2A 4O0MA 2N42A 1ZIOA 2REXB 1Z6YA 2KI5A 2P67A 1Z06A 2O0HA 4JLMA 3SC3A 5EQTA 3KKOA 2HCBA 1KJWA 2R6CA 4FWTA 1T6NA 4LJ8A 4HZIA 2VPPA 4HB4A 2CJWA 5FOSA 1T9HA 4IXNA 1UKVY 3CX6A 4B3FX 2WIAA 4ABYA 2OLJA 3B13B 2DWQA 1X8JA 2WPDD 2JLQA 4A6PA 3THXA 1KDTA 1KI9A 2OXCA 4GDFA 3U7GA 3JVVA 1E79A 2ZIAA 2LKCA 5H68A 4BLSA 1N0UA 4Q9KA 1DEKA 3J81k 1R4AA 3WHKA 3IHWA 2DPXA 3KKMA 4OQMA 1A82A 4HDOB 4LJ9A 1NF3A 1BO6A 1T5LA 2ZU0C 4POAA 1DO2A 3SR0A 3A36A 1GRNA 4ESVA 3SHWA 2OUKA 2WV9A 5L3VA 1P2SA 1JXMA 2WM9B 1AQYA 4QHTA 2FDCA 2X2EA 3VR1A 4A8JC 5FH9A 3GEIA 3NDPA 3W90A 3BFXA 2NQ2C 3EG5A 3LDAA 2A5DA 3MWLA 3FMFA 4TT3D 3TE6A 1V5WA 1R7RA 1VYUA 1M74A 3OIYA 2F9MA 2DWOA 2G83A 4WOPA 4DKXA 1U2RA 2BJWA 3SJZA 2VP5A 721PA 3CUEF 4NU0A 5F3WB 1XTSA 4B3CA 2C78A 4V03A 1B0UA 2VEDA 1X8KA 1EXMA 3RC3A 2DY1A 4WA7A 1ZC4A 1KHTA 2P0EA 3GJXC 1E1QD 3RLFA 1O3YA 3RWOA 3UG7A 4ERNA 2UKDA 1N6PA 4U7DA 2O8FB 1W1WA 1GSIA 4CDGA 4AG5A 2OT3B 4YMWA 1P2VA 2ZM5A 3IEUA 1DG1G 1XFAA 3KKNA 1P2TA 3IUYA 2G0NA 1NMXA 3KUCA 3PCRB 4JVSB 2D7DA 4BFTA 2AL7A 4HSEA 2R6DA 4ZCMA 1F48A 3I92A 1F2TA 4M1KA 1YVDA 3QXJA 5HZKA 1SQ5A 1UBFA 4FW9A 1JAHA 2KJQA 3X1XA 2GAOA 2FPLA 5CJ2A 5EUQB 3VX3A 2C9OA 2C95A 4C0KA 2P6UA 2CLCX 2YJTD 2ZRCA 3CONA 2PH1A 2ZVQX 4QGGA 1J2JA 3QKRB 3ADKA 4PQFA 2GF0A 2FE4A 4OHYA 5EZ5A 3HDTA 1R5BA 2WICA 3FGNA 4GZLA 4BLRA 5K8LA 2BKUA 2IYWA 2WWHA 4PX9A 3ASZA 1I4DD 5P21A 1KSGA 3VMFA 4RD1A 2PZEA 4LBYA 4PPQA 1DAGA 4PAOA 1XTJA 2Y8EA 1K6MA 3GLGA 5LD2C 3UKDA 2ZJBA 4TYYA 4TMVA 4XSGA 3SZRA 1R2QA 2KWIA 2EQBA 2FV8A 4A36A 1JQLB 1OXXK 3BH0A 2AXNA 3LA6A 4Q19A 4QKQA 121PA 221PA 4LBWA 5L3QA 2FPMA 2X2FA 2ZS8A 1WBBA 4HEJA 1S1MA 2NPIA 1HQYE 2C04A 4M1TA 2ZJOA 4JYBA 2IHBA 1M7HA 2VRWA 3LX8A 5JI2E 1DTSA 3I3SR 4GNKA 4HB3A 4M4SA 4MITA 3L0OA 1NMYA 1DG3A 4G5QA 3O47A 4RD4A 1D9XA 4V0NA 4CIDA 3B8HA 3U60B 2J0QA 5H8WA 3T06B 3W34A 4LYHA 4QM6A 4E03A 5B64A 4Q1BA 5HZHA 5FFMA 5EE5B 1RE0A 3T1TA 3ETLA 4TMKA 4B34A 4KYUA 3PUWA 2OEPA 4BQSA 3AP2A 2R9VA 2FG5A 4Z54A 1E2DA 1OW3B 2OV2A 3KFVA 4FN5A 4NYIQ 2KE5A 4Q9IA 4MRRA 2J0SA 1VYTA 4C0HA 2QM8A 3IIKA 3K0AA 2VP2A 1HUQA 1CJTC 1KI3A 3GEHA 1NN5A 1OH8A 1AKYA 5HTKA 3Q9LA 1GAJA 1F60A 1KSFX 1VKJA 2VHTA 2Z43A 4QBGB 1EFHA 4CEHA 1E9BA 2FMXA 4RD3A 1E9RA 5KHOC 2GF9A 4XIGS 2IBMA 3PEUA 3PFIA 2ZROA 1S8FA 4MA4A 1VCNA 1Z2AA 1E98A 1P2UA 2A5GA 1XXHA 3IO5A 3LAWA 4MRNA 2IYRA 2IL1A 2YWEA 4MUBA 4R7ZA 2D2FA 5DE3A 4EQ6B 1W44A 4MQBA 4LBZA 4B3XA 1BIFA 2PCJA 2PJZA 2QP9X 4A8JA 2J0UB 2O8DB 3R20A 2ANCA 1KO5A 4ZV4A 3QF4B 1E0AA 1P75A 3MWYW 2IF0A 4M1OA 4I1VA 2JLYA 2CHVA 2ZANA 4C4PA 4Y0AA 4B48A 4C3ZA 4YMVA 1XBTA 4OBEA 3RC8A 2FX3A 3OHMA 1XDBA 1A4RA 3TQCA 3QSYA 1PLLA 2WJHA 3I62A 1J8MF 5TV2A 2A78A 2G77B 1AIPA 2CXXA 3HU1A 2ZYVX 4IVPA 4YQFA 1F2UA 2QAJA 3VKGA 4XWOA 5DLQC 5FOTA 3B1XA 3V9PA 2BMDA 4AYWA 4HYYA 4ZPXA 4U5XA 3QKRA 4P4TA 1WE2A 3K9HA 4JLOA 5DSZA 1E2PA 2WWFA 2C8VA 1FNMA 1K5DA 2GVDC 2GVZC 2WMNB 3RS0A 1XD2A 2AD5A 2GZAA 1R0WA 2XEXA 3KUDA 4NCKA 1E9EA 1G7TA 3JZAA 5DN6D 1KY3A 4JBYA 4DLTA 1TTTA 3ZVMA 4QHSA 1X3SA 4PAMA 2ZRPA 2IC5A 3BFKA 3WMGA 1KKMA 1TMKA 3Q72A 3REFA 1P61B 2MSEB 5J4VA 3MMPA 2REBA 5DIFA 3VU9A 3GLHB 3RDPA 3BC1A 4BRWA 3AV0B 4UKDA 4JLDA 1KZGB 5HCIA 2ZE6A 1JNYA 1G7RA 4HUQB 2WKQA 4H9GA 2AFIE 4KVAA 1GNPA 1IHUA 1UDXA 5IK2D 5AJXA 4Q7KA 2WKRA 3ZH9B 3P26A 3B9PA 1IQPA 4BLPA 5M04A 3QKTA 1M34E 1E4YA 3EZ7A 1JEDA 1U98A 4YXWD 4F4CA 1E0SA 5JEEA 3FYHA 4KI0A 2ATVA 2YOHA 2C9YA 2ZVPX 5KNDA 4QNRA 5GVRA 1QHHB 2XOKD 2GXQA 4DCVA 1J90A 2RGAA 3DKVA 4RFSA 2IUUA 3C15C 3K9NA 1DE0A 3PUYA 1QHYA 4L9WA 2FEMA 2V9PA 1E0KA 4HZUA 1COWD 3N2EA 3T5GA 1R10A 3I5YA 2OE2A 4CT4B 2J45A 2RHDA 4TTQA 5CM9C 4Q18A 4Q9LA 3T35A 621PA 1C1YA 3LD9A 2N46A 3OEEA 4JT2A 4BASA 1OB2A 2GJ8A 2G0TA 3I72A 4C0LA 3DVLA 2Z83A 3DOFA 1AZTA 1XTRA 4PO8A 2GK7A 4TQUS 3AM1A 1SHZA 3ZZ0A 4AC9A 2EW1A 5EXXA 1RPZA 2XB2A 1KGDA 3R7WA 1KO4A 1SVSA 4LOAA 3DOEA 4TL6A 1NVVQ 1UM8A 3NKVA 3IPYA 2JLUA 5KSPA 1TUEA 3RYTC 3JZMA 3V4RA 2IXEA 3PG5A 4OHXA 2VSXA 1HEIA 1VHLA 1N6HA 4RD0A 1DVRA 4DEXA 3NBYC 1G3QA 3WYFA 2PL3A 5CDFE 4HLUC 4EPXA 1OLOA 1VG1A 2BCGY 2GNOA 2ODBA 4QBFA 4TLCA 3MG9A 3GLHE 4DLSA 3TUIC 3KTAB 4LJ5A 4FMBB 2OFWA 2F3RA 5JSZB 1IJEA 1D6JA 2QBYA 1TADA 3X1ZA 1AS2A 1PZNA 2ORIA 3BXZA 3T61A 3AB3A 5DN6A 4ZKDA 5TMPA 3X1WA 3ZVNA 3AVQA 1KIMA 3EZ6A 5IT5A 2BMEA 4RZ2A 4BFWA 3KQUA 2NPFA 4TT3A 3K9GA 2VF8A 2YOGA 2G9NA 3WYAA 3ZQ6A 2VIIA 1C9KA 2IYXA 2PJRA 3PENA 3SBDA 5JBQA 2Z5FA 2JCSA 4V0MA 1OYWA 3PEYA 3THXB 3KQKA 1E2EA 1FPMA 1WXQA 4MKFA 8OHMA 2XXAB 3K0FA 5DYIA 4DT1B 4JLBA 5AJZA 2F3TA 4M1WA 1FL9A 4A2WA 2F1IA 3PEVA 4KBFA 2F43A 4KCGA 1H8HD 1W2HA 3U61B 4PC1A 2E87A 1YJ5A 3CPJB 4EFMA 1H65A 1YZNA 3VQTA 3SYKA 4RCYA 1T3HA 4CEIB 5A4JA 2ERXA 5IRCD 2PZGA 4NZYA 1XD2B 4V0ME 2P65A 4B6EA 2IYLD 3CIOA 1AQUA 3HR7A 3VR4A 4AKGA 1W0KD 2W6JA 3GLGE 5F9FA 4PPGA 1KK1A 2J3EA 3E2IA 1Z29A 5FTJA 1Z22A 3I1FA 3OEHA 4DLYA 3B1YA 5K8UA 4US1R 4AKHA 1DPFA 1E32A 4F93B 2RH5A 2JATA 1K8RA 1SVLA 4V0OA 3HWSA 1VMAA 4N0DA 2ZETA 4DSOA 2HYIC 1T3SA 4N0EA 4ZDWA 4M53A 5DH9A 3BE4A 5KSZA 1U8ZA 3I5XA 2CLSA 3EARA 3TBKA 4B74A 2AXPA 1II8B 1TQDA 2QE7D 3WRYC 2Q3FA 3FFAA 1SXJB 1FX0B 4NCHA 5CM8B 4B6FA 5JZVA 1NJFA 4I1UA 4FD2A 2XNDA 4A0HA 1P73A 1YZQA 3ZYCA 4LV8B 1N6KA 2YWFA 3TJZA 3W6NA 4EQ6A 1KZ7B 4ZCLA 3ZQJA 3DDCA 4YDSA 4DB2A 2XSZD 1JQJC 3TW4A 4QJ3A 1RYFA 2WWIA 4G5GA 2BMFA 2O8EA 5FOVA 1JB1A 2O8CB 3ZDQA 5K8IA 3GLGB 4GOKA 1E2MA 1LV7A 3U3KA 3CF0A 1U8AA 5GJVC 2OBLA 2P2LA 5KDOA 2CL6X 2V4ZA 2VF7A 5FL7A 4LRWA 4NYMR 4OK6A 3RS5A 1YE8A 2I1VB 4TYNA 4B76A 3FMOB 3ZD7A 1JAIA 2LWIA 2G3YA 4KV9A 4HAZA 2ZQ5A 3Q8XB 1G7CA 1SXJA 2WWYA 3CZQA 3T1QA 2IHYA 4OI0A 4GZMA 3EASA 4KODA 3ZD6A 4B47A 5JWHA 4TLEA 1T91A 1DELA 1EFRA 2Q9CA 3LW8A 4HUTA 3UMFA 1JR3D 5AWFC 3AQ4A 1IY1A 1Z0DA 2J7PD 1W36B 4EPYA 1XP8A 4LHYA 4PTLA 4OKSA 1KJYA 1S4QA 1CTQA 4KFUA 4DLWA 1KAGA 2JLVA 3PR1A 1U0HC 2WHXA 4L4UA 1NVXQ 2C2HA 1YZGA 3QQ5A 2HCJB 2XNSA 3GJ8A 1XEXB 2GJ9A 3CR8A 3W9YA 1WDTA 2GJSA 4URVR 1Z5ZA 4HDCA 2ZI3A 1IOZA 5DHFA 3RABA 2Q9BA 3QEJA 4ASUD 3MFYA 2ZREA 3SJAA 5HPYB 2NGRA 1T0JB 1NLFA 4TQ9A 1OKKA 2VHJA 1Z6AA 1II9A 6Q21A 2QTFA 2Q3MA 1IY2A 5JMTA 1XU4A 4BFXA 3KJEA 4OJKA 4ARZB 1GITA 4LWZA 4D2IA 4I99A 3UMRA 1Z3IX 2JIZD 1QF9A 3QBTA 4RFSB 3IEVA 2ZRMA 2ZUCA 4MRPA 3QJYA 4XVQA 2QUZA 3ZZUA 2RCNA 2IXFA 1P9RA 1HH4A 4XVRA 3CNLA 1XD9A 5G41A 2QG6A 2FFBA 1XJQA 2PEZA 4LHZA 3TNFA 4LI0A 4D4MA 1SVOA 3EPHA 1KNQA 2ORWA 2MSCB 4EPVA 2HXYA 3BOSA 4O3MA 5LPNA 2V7QA 4TYPA 3CNNA 2AHOA 4KBGA 5EZ6B 1M8PA 3U4QA 1U9IC 2NIPA 2ZI7A 4PHFA 4W5JA 5KOYA 4Z8YA 2KBEA 3MCAA 3ZS9A 1LFDB 2QSYA 4C0BA 4XVUA 2N1BA 3OZXA 1F2TB 3RNLA 3N2IA 3AKDA 2EWVA 4D6PA 3LV8A 3W3ZB 1S3SA 1EGAA 3AF0A 3I8SA 3PV0A 2NMVA 1P6XA 2W6IA 3WRXC 3VKWA 3R7WB 3I8XA 3R9XA 2J7PA 2OSBA 2OZEA 2ZYUX 4IVQA 3G5UA 1XX6A 2CEAA 2ZYWX 1COWA 1XTIA 3TAUA 4B43A 4NYJR 2HLDA 1Z28A 4M1YA 4BFUA 2Q0HA 1NP6A 1M1YE 4O2LA 4RVCA 3THOA 1R8QA 2XOKA 4CW7A 5KPJA 3MD0A 1GNRA 3CX7A 1G7SA 1W0JA 4JKYA 2OM2A 3KFXA 4DDUA 1KSHA 1ZIPA 2GDJA 2FSHA 4IOJA 4YXWA 1DAMA 3CW2A 4TSFA 3WBJA 4XJXA 2A3RA 3MSXA 4A9AA 4US0R 1NNEA 1DAKA 2ZE5A 1BKDR 1NSFA 4QFMA 4TMTA 1DAHA 1AZSC 1G3RA 1G6HA 4FCTA 1J7KA 1GP2A 3CKLA 4V0LA 4OI1A 1E1RD 1LVGA 1MKYA 3SYNA 4DEYA 3A4NA 2YV5A 4KLNA 4JL8A 5FBLB 2XNDD 1W5TA 5EP1A 4P32A 1M6NA 3KJIA 3P27A 4EAQA 3AF4A 1W49A 1FQKA 4S2EA 4MGIR 2MSDB 4Q21A 1IONA 3GJ7A 4QGAA 1G17A 1S9DA 5CIQA 4LHXA 2ZJYA 3AF3A 4WZ6A 1DADA 2HT6A 3LH5A 4F4JA 1RRCA 1XXHB 3B7GA 3WMEA 3G0HA 1T8TA 4EIWA 1KYIA 2GWHA 5KDLA 3VNVA 1OE0A 3CRRA 1XCPA 3NVAA 3C8UA 1FUKA 2CCKA 3NBFA 3V00A 3WY9A 2IEYA 4RKEA 2CVFA 5FTNA 2P5TB 2R6GA 4DLVA 2BOVA 1CBUA 5ELXA 2NG1A 2QSZA 3BIFA 4MRVA 4TZ0A 3SJBA 2J5XA 4LK2A 1ZMXA 1Q1EA 2ZSEA 1ZD1A 3QY0A 4H1UA 2ZI9A 4Y0VA 2ZI6A 3DMNA 4BLOA 4BUJA 5L3SB 1W46A 3IO3A 1FTNA 5FPTA 4KSBA 3K0SA 1GFIA 4YMTA 1H8ED 3QXHA 3U3JA 3GD7A 3QPUA 4TL7A 4B3BA 2EFGA 5JWRA 1NKTA 1WCV1 5FPYA 2IK8A 5C2JB 3OF5A 3RRYA 2FA9A 3U3MA 2CVHA 5JS8A 4U00A 4PSVA 2G1KA 5EUMA 3GCGA
chains in the Genus database with same CATH superfamily
2GB4A 1W47A 4N7MA 1EK1A 4AI6A 1E96A 2IOFA 4B3TB 4AN1A 3RW9A 2ZAOA 1SUEA 2JA2A 2HYDA 3GIWA 2V7BA 3RTCA 1D2MA 1DTWA 1H2WA 4RPJA 4WUTA 3IEIA 4MKHA 4JL5A 5EWJA 3V1MA 1YL6A 3K0KA 3BWCA 1N34B 5DB4A 3G68A 4UZFA 3S1LA 2OLKA 4HJRA 3JQEA 1C0PA 1D04A 3OM0A 4HGZA 4HN4B 5A6SB 1AUQA 1Q84A 5JY1A 5LUBA 1YMVA 3IV6A 4BB9A 4P36A 4MV5A 4CDMA 3B3QA 3THYA 2WTBA 5C8DA 2A67A 2M1ZA 2PUAA 1XROA 1XEWY 1BDBA 2IA5A 2ZSIA 4HDSB 3PFGA 5JDCC 1F6BA 2WVGA 5BYBA 3SXPA 2ZJ3A 1KI1A 5KOHA 1XZDA 4ZFNA 1V7CA 2OKGA 4XJTA 1Y1RA 1QJCA 3FSGA 1T2EA 3L0SA 4B2PA 2ENUA 3EGOA 5TPWB 4P4GA 1ZUD1 3GP8A 2I91A 5JFTA 1UZAA 1A72A 4GOJA 2ZJZA 1FLNA 2FE1A 3F5MA 1PRYA 4M9UA 3S1AA 4A2CA 4XA8A 1EX7A 1BWPA 1LBQA 1M6YA 5CCDA 3A26A 3G13A 3MW8A 1COZA 3UT6A 4CMAA 1X7GA 4IFTA 2HMAA 3C48A 1U7XA 1TT5B 2H07A 4ESEA 1L2TA 4RZUA 5J40A 4YDQA 2ZRFA 2Y67A 3KJXA 3HZHA 4YAIA 2YR0A 4DTIA 4MP8A 1NP7A 4BZPA 4K5QA 1PVVA 4QFDA 1QFMA 1AN0A 2IKSA 3ZH2A 2UUOA 4DLZA 2W8BA 5IDQA 3OZSA 4M9RA 2I2XB 3L6OO 3R5HA 1LJLA 1SA0B 5KB3A 1DOAA 2WJVA 3EUFA 3HB0A 2P9JA 1F8FA 1RJ9B 1UCFA 1W59A 1TAGA 2DAPA 5MFPA 1JDNA 1Y3IA 2J9RA 5UKDA 2YJZA 4JYMA 5ITWA 5C8XA 5C8VA 2RGRA 1UBHS 3DKIA 4V1CI 1W25A 1XZEA 3O5AA 4H3KB 3BMCB 3U62A 4Z4GA 1SBCA 1USUA 2BUBA 4YI3A 1GPJA 1Q3HA 2FPSA 4TMWA 4O4LB 3W4JA 2PKCA 1P1RA 1TMGE 2CVZA 3DVQX 2GTHA 1YHNA 3RANA 5BMOA 4YC7A 4Y67A 2DY0A 1N5DA 1EINA 3O95A 3UOWA 3DC7A 4JVMA 1HRDA 2Q99A 3KYJB 3SXUA 3PPXA 4V39A 4J1QA 4U5QA 2UVQA 4KGZA 2P9ZA 3DFIA 4DCOA 3WJ1A 3P2KA 5IDVA 3ABQB 2XDYA 4G1MB 5HIMA 1YRAA 2XY4A 4MYSA 3W4KA 3BSWA 1FZQA 4IYRA 4RQUA 5H81A 5A2GA 1EVEA 3R3UA 2REOA 2R68A 5H1YA 7MDHA 5E7IA 3JW8A 1RT9A 3L77A 1L7EA 2C84A 4PZZA 3FZEA 1TYBE 4UVIA 4NOMA 3UHAA 1TU3A 3F47A 4JQCA 4YPOA 1Y33E 1N3BA 4RZIA 3ODGA 2QX9A 4DG5A 2HRRA 1GPNA 2NYUA 2WM2A 2Z08A 4IO0A 5TSDA 3TLAA 5BV7A 4HBGA 2O2GA 5CA0A 3V1KA 3EOBI 3EIOA 3RAGA 2OQ2A 5EHZA 4GKJB 1P8AA 3LNTA 4NRDA 5ALMA 3EA0A 2DQ4A 1X7ZA 1G64A 3VAZA 3MPUA 3RS2A 3EY9A 3T9EA 2C96A 3RV3A 1U28A 3TGPA 1B43A 1D2NA 3GDWA 1N1EA 4HP8A 3KLPX 2XQGA 4B32A 4FBMA 5JDIC 3HKEB 4P80A 4X3CA 3VTFA 2Z58A 1Q50A 3VH2A 1R6AA 3ENKA 4MAFA 4MYTA 3SAJA 3VPAA 4KO3S 3OEHD 3KAJA 4IR7A 1XLWA 4FWBA 2DG2A 1YZKA 3HCRA 4N12A 4TS3A 1EJ6A 6LDHA 2BSQA 2AGVA 2Z5LA 5HZGA 2VZLA 3DE0X 1K27A 3WOVA 1EK5A 2HLDD 3N5CA 3LBAA 1CIJA 3R3HA 2CB0A 1BYIA 2XTAA 2J5QA 5AK0A 5K0BA 4D5EA 1QV7A 1C4OA 2QZ9A 2IDJA 2BKEA 4INJA 3IBYA 4MCHA 1NI3A 4RAQA 1L5LA 4F60A 1GQRA 1RWMA 4LJKA 4N41A 2JAPA 1ZD5A 3OIUA 3EQ7A 1B16A 4PSUA 4D57A 1ABBA 5G0UA 4H7HA 4PXAA 1HT2E 4DAEA 2MIIA 1OBCA 5EEGA 1YRLA 5A0TA 2AF3C 1CRWG 2I7XA 2ZYIA 3DLTA 1UPUA 4KAJA 1MX3A 1XA3A 3NEYA 4N5LA 4ED9A 3K15A 3AKYA 4MVWA 4CPDA 4R9UC 2C2KA 1MAUA 4OQFA 1J8VA 1P8JA 1XE3A 2ZATA 3Q7SA 3TOCA 2K2WA 2NO4A 3DWIA 1ZHFA 4P4SA 5F78A 1G98A 2ISQA 2QI9F 3L1HA 2JLXA 3M49A 1A77A 1B4DA 1EJ0A 2PTHA 3CUTA 3D02A 5TE9A 3CUVA 4B8WA 5C34B 5DHRA 1BQEA 1MO3A 2FGJA 3I6YA 4IJMA 4M8LA 2IYQA 3JQCA 1MB9A 1L7NA 4AD8A 2H29A 2WIFA 5FT9A 1I3OA 3S68A 3ZCQA 3HA5A 2FGKA 1RCFA 2X7XA 1AO3A 2R3SA 2GZ2A 5KYVA 4YCBA 3KHTA 1Y3BE 5G4LA 5T8KC 1CIPA 2PAAA 2H9AA 2QENA 2IS1A 2QROA 3OPVA 1RADA 1L1RA 3C3KA 3QITA 1O95A 4JD5A 4QTTB 4BJHB 2JVJA 3FPFA 3N0XA 4GXQA 4HFJA 2AZXA 2VQFB 5LBUA 1J0BA 2OXFA 5FO0A 1NBME 3ND7A 3ZGXA 4A91A 3NM5A 4UUPA 5LMUB 2X2OA 3MRSA 1PBTA 1O8CA 3LIPA 4RL6A 1XT6A 3AUTA 3FX2A 5BUSA 1A76A 3KE8A 2YUTA 3U7QA 3X1MA 1NIPA 3PXGA 4DUGA 3X43A 2G9QA 2FU5C 2NACA 4J76A 1BCSA 4MYCA 5AK5A 4KXUA 4MWBA 4TKUA 3MS4A 2P6NA 3PS9A 1SURA 4WDRA 3UF0A 4I50B 1NDUA 4DRYA 1B0ZA 4PINA 1UJNA 3D43A 3P2YA 3G17A 1BFDA 4ZVVA 3KE9A 3IOCA 4EZIA 2VN8A 3MWJA 5TRTA 2B1JA 1P4RA 1K86A 1TD1A 3OPQA 4IV0A 4W5TA 1T29A 5BRJA 2GK6A 1ZL0A 3CW9A 5KINB 3SZ3A 2I22A 3JS5A 1AZWA 4JLJA 1C8LA 4LY3A 5H7XA 3AR3A 3NS7A 2OMEA 3NGLA 3RG8A 1KDVA 1E18A 1HDIA 4JXKA 4KZKA 3EXEB 1HTWA 1RKBA 1GUDA 1NVFA 2AMVA 2Y3IA 1Q5PA 1JKFA 1TPZA 3GMSA 1MOZA 3GVCA 3IAXA 3K1YA 2XVMA 1ULBA 1YBVA 4W5HA 3NHBA 3DAPA 4YDHB 1WZIA 1D7AA 2R6JA 5FOXA 4BCBA 1SXJC 2MT9A 4EPRA 4CR8A 2J46A 1W2GA 4P1ZA 4EGQA 4C1BA 1EVZA 1ZAKA 4HZGA 5D1NA 1M2VB 3II6X 5DI3A 1SC6A 5JCPA 4Q3AA 1FMTA 1LI5A 2P30A 1FS5A 2IUEA 3I6IA 1RQXA 1MBZA 1QOZA 2GS9A 2IYZA 4EI8A 5IS2A 5JJLA 4W7HA 3LQRA 1YK0A 3WMWA 5CDUA 3HU3A 4OQXA 1RXUA 1NWHA 1T3LA 1UZUA 1Z9BA 3OPMA 4DCTA 5CVTA 3IB3A 1I10A 4L4ZA 4D3DA 3LXRA 4N49A 1RLOA 2OV1A 2QSUA 3HCEA 4FB4A 4ZI3A 2BHLA 3SY8A 5CDYA 3HJNA 4PC3A 2V7PA 2IP2A 1Z0KA 2F1JA 2A0WA 2W2TA 2DGDA 4MWGA 1M2OB 5BPFA 3NHFA 2C5EA 4GR4A 2O2SA 4I1OA 4QVGA 1VECA 3N7UA 1EJ2A 3GCDA 1NAHA 3O1JC 3KJFA 1IUNA 1FYFA 1EP1B 1WMDA 1XMVA 3DBRB 4ENTA 4P33A 3ZHXA 1YDHA 3IJ5A 5IBRA 3GQBA 5DM70 5IYZB 2JA1A 5DLEA 2WWXA 4UM9B 1P31A 2DETA 1QQ5A 4FGZA 1EHYA 3TLXA 4EJ6A 1HDCA 1UXIA 2X5XA 2AK2A 4KVZA 1NPDA 4JBLA 4CVNA 2C7GA 3LTNC 3L8MA 2YTZA 2ZQYA 2KX7A 1VSVA 2ZS7A 3KDAA 3FCXA 3QBEA 1E1MA 5E38A 2CXOA 2IZOA 1I94B 5K0NA 2WJIA 3BGVA 4C04A 2WTNA 2P69A 1LCIA 4S1OA 1LTQA 4Z1MD 5JD3A 3HC7A 4ALMA 4H1HA 3ESQA 1Q0UA 1I1NA 5DGDA 5K09A 5CH3A 2HREA 4GOOD 5ALDA 2AQ8A 2A0XA 1TGYA 4MRMB 3TIGA 1F4VA 1KYZA 3U17A 1UBOS 1OCEA 5HKOA 5KYYA 1T2AA 1VGVA 3HXMA 5FJIA 1KZYC 1NN3A 4BWYA 1YOBA 1YSCA 1DPGA 4AKEA 4FM9A 3H1FA 1USGA 2I03A 2VCHA 1RYMA 3L7BA 1FP7A 2Y1KA 2PNJA 1XRSB 1U3TA 1YJ8A 2R6FA 3DG9A 3HNPA 4D56A 2BL4A 1GL9B 3EQ6A 2VEOA 4IG9A 3PFFA 1U1DA 3MERA 1QPGA 3AIMA 4E14A 1RWNA 4R6XA 4Y6LA 5C3MA 4RIIA 5LDDC 4ZAZA 1PFYA 1W5FA 1NVBA 1F5NA 2A0KA 3HNOA 3UFBA 4FILA 3T5AA 4FJ2A 2J0UA 1MT3A 3FG9A 1IVNA 3Q9UA 4R5HA 3AHEA 3BREA 1HO3A 3CKKA 3KOYA 3OFJA 2OV4A 2VAXA 3BTUA 5F21A 3ZZTA 5AUNB 5LP1A 1EXVA 4TMZA 1NUTA 4TUYF 4EF5A 3P0HA 4HXEB 3I32A 4LC1A 1YNSA 2HK9A 3KSRA 2JFNA 2A8YA 2OHVA 5FDFA 2JAHA 1JDBC 4MS4A 3TDKA 4ATNA 4NAHA 1HA3A 1SUDA 3L2OB 2OYCA 1E7MA 5KNCD 1E6KA 1XKQA 4E32A 1VHWA 2BGRA 2UZ4A 1OH7A 2CEKA 3IT1A 5IF9A 2QMOA 5L7TA 3RGGA 4C22A 3BBLA 2IV3A 1Z0JA 2CXSA 3L7JA 4YFVA 3QU9A 1T2VA 3ZNOA 2VHXA 1XB2A 2MINA 2W11A 2UZIR 3L0YA 1NAIA 5TQ2B 2ZIVB 3I45A 4X41A 2O0LA 3KR1A 3IEXA 4RENA 4B17A 1OIXA 1U4SA 2HU8A 3F9RA 1P5ZB 3ED1A 4Y2GA 2IV2X 3RREA 2F4NA 4Q16A 1Z6GA 1EXWA 3HVIA 5KYWA 2GBPA 3FRIA 2VJQA 4CF4A 3KYDA 2IYVA 4LHEA 4DPMA 5JCJD 3K6SA 1VCIA 4RZHA 1TX4B 5KCMA 1MH9A 3R8CA 3B6EA 5KHLB 3H2IA 5IT9A 2FSPA 1XNQB 2BEVA 3CU5A 6AT1A 3L6RA 3K16A 2QTVA 1MOSA 1VIYA 1FFXA 4ZEOA 2Z56A 2JFZA 5SICE 3B2QA 1R9GA 3TMKA 3UM9A 1PDVA 4IDNA 4DCUA 1DFGA 4ENUA 3F4LA 1FXUA 1OLUB 4LPSA 1RLJA 1TM1E 4HDKA 3TLGA 3NAZA 5DP1A 5ALTA 1E5DA 4LDJA 4XDHA 5E7MA 3HZZA 4LI3X 2HF7A 1N33B 1V25A 4CQNA 1V6AA 1THZA 4YIHA 1P7ZA 1XMPA 2NUPB 3ZYZA 1NMZA 3WNDA 1ZZGA 1YV9A 4GVLA 1EGHA 2Q6OA 1BE0A 1I2MA 3BK2A 2YQZA 1SQFA 4NDZA 3KXKA 4FN4A 5DX8A 3ZY4A 4QHYA 3LLUA 3UG6A 4X6XA 1TVMA 1PG5A 5KWEA 3KTOA 1J2TA 3BKWA 4LY6A 1ZGZA 2HA0A 2ZIGA 4Z9FA 2Z2YA 1CR0A 4RVFA 3WK4A 3DLHA 3DTNA 1M2FA 1ZA2A 3D54D 3W3AA 4OB8A 4ZEVA 1FW6A 2UXCB 2WUFA 1Z73A 3MWKA 4M60A 4K87A 3I9LA 2JKVA 1ESEA 3ABIA 3C4JA 3ZY5A 5B30A 1YDFA 1U6IA 3DAGA 4OL0A 1ODLA 4LZNA 4D9EA 3SKXA 1G59A 3AVPA 3FTCA 1G21B 2UVPB 3AEXA 3I34X 5TIIA 3VZRA 3BMCA 3F4KA 3IOMA 4YP5A 4R8KA 1Q7RA 2R65A 3TI7A 1LY1A 2E18A 1WP4A 3ESBA 1G8JA 2WC1A 3GRAA 4R7TA 3L04A 4UVGA 3PHJA 5F52A 4NE9A 4ZU6X 5IK2A 2QG9A 3HJUA 3JD4A 4DMKA 4H4DA 3QNMA 1Q17A 4W9NA 5KU1A 2HH9A 2FOLA 1QE5A 2G5TA 5BSTA 1JFFA 3TLMA 3W2FA 5DF1A 1E9CA 5LQJA 1SKBA 4FBLA 1E1KA 3E3OA 4O4HF 4OFZA 3H0KA 2MCFA 1SOVA 3NHRA 3GDHA 5SY4A 2GHQA 2AC2A 4JI5B 2O8FA 2O8DA 1SM4A 5EIAA 4HVCA 5EI5A 2J4DA 3VDNB 1UIRA 1J5XA 4GH5A 4WCFA 5CA1F 1XL1A 1ACLA 3CEJA 1SG9A 3TIIA 2P9FA 1JEQB 4UBKA 3IRUA 2ZPTX 3W0LB 4B7UA 3E58A 1XGKA 2DM6A 1NIJA 2Z5GA 1L8XA 3O91A 4Q3LA 4A92A 1N2EA 3IMFA 4JYAB 1I6LA 3NETA 1G38A 3NNSA 5DMXA 1RNLA 4JQOA 2FN7A 1DIBA 2JJ2A 3VPGA 2RCYA 3LUAA 5DTMA 2D1FA 2ALJA 2JRCA 1GKUB 3DTVA 4OQLA 2BYTA 5EHNA 1UP4A 3MWFA 5HFJA 1H0SA 2BRUA 4Z4FA 4BTEA 1W5EA 2AYYA 1XRMA 3QUSA 4LE2A 5JQGF 4XKJA 3HVUA 1GRQA 3L1UA 1DKRA 1A2BA 3PPWA 3C5HA 2VJYA 3N2GA 2FI1A 1QIIA 3LUDA 4QREA 3RYHA 3E9CA 5EE9A 4JXZA 4OX9B 1FYEA 4H3SA 4G85A 5E6RB 5KSZA 1K7CA 2D13A 3L0PA 2KBFA 4R1UA 3AZPA 4FLEA 2GESA 1D2EA 2JDID 4JI1B 1IWPB 2NU6A 5CR9A 3QX9A 4DARA 1GNQA 1SCBA 5CT4A 1Y3HA 3E03A 3MCUA 1I6KA 1SOUA 1HPLA 4D92A 1ZJ5A 1W36D 4M88A 5GONA 3E15A 4CMGA 2GD6A 3N8HA 5HX7A 3AC0A 1QTQA 2ET6A 2BKLA 3OH8A 5FPPA 4OXYA 3L8CA 4MA0A 4RGQA 2KM1A 4BNUA 5A3SA 3IE1A 3G88A 4JITA 1VGQA 3IIIA 4GBED 5CPFA 1TEVA 2IHTA 1WDWB 1E20A 2I3ZA 1YB6A 4IDQA 1ZK4A 4HD8A 2I3AA 2Z9BA 5JNTA 2AV6A 2B8JA 2CHUA 2E3JA 1EWQA 2FYTA 4N03A 4LWQA 4XWAA 5M2QA 4BDSA 1BS1A 1HQKA 5A5DA 2BR4A 1BJKA 2PL9A 2Q49A 2VXOA 3Q3CA 3D3QA 3HTXA 2JIOA 4M0CA 1WXDA 4AX8A 1DCKA 4EATA 3RSCA 4N65A 4LNUB 4C6TB 1E2IA 1F2VA 2H2FA 2QTHA 2QR2A 3PK0A 3THSA 3TOZA 1C9EA 3IQXA 5LZ2A 3M9LA 3RIHA 4JP5A 2BGKA 1ADJA 1BN6A 3AR7A 3IJRA 3OZEA 4CCAA 3U44B 1PZFA 4RABA 1JSCA 2C97A 2PS0A 4LKOA 4ALNA 5C5DA 1DGQA 1KK0A 1L5VA 3KB6A 1QU2A 3TOXA 1XSEA 4QICA 1MQAA 5JATA 3AVWA 5HRAA 3C3CA 2XZLA 3G0GA 3M3PA 1ACMA 3FSEA 1ONPA 3HXTA 3NATA 5G3ZA 4CLDA 1TA0A 1CULC 1EFPA 4QPNA 1Z2NX 1T0HB 3TRJA 1BOFA 1O96A 3W7VA 1RC8A 1SUSA 2ZFUA 1Z8NA 3C3JA 4DMHA 5ALYA 3KWJA 2IHVA 1H2XA 3PI7A 1Z6QA 2QLBA 3A0UA 4KN6A 1HMPA 1PZMA 3QA3E 4BBJA 2PYIA 3QVKA 2NNLD 1RR6A 2VUHB 3W9BA 1X15A 3PC8C 3CVVA 4EABA 2WFLB 2V6JA 3R5KA 4AG3A 3JQ9C 3T3HA 1QP8A 2OBFA 4ETIA 3DQZA 3WV5A 4LMBA 3EDYA 1LRJA 3EXFB 4PZAA 3U9TA 2AZ4A 4S0ZA 1T24A 5AHOA 1CNMA 1ZBDA 5CXQA 1IJKA 5CXXA 1PEYA 4BMPB 3FA2A 2I6TA 4W1QA 3M6FA 5E7JA 3TLCA 2WPNA 4OJMX 5JMOA 1Q3TA 1QQ6A 3TW8B 3E2MA 3PTZA 5CAEB 4FYMA 4OU4A 2AI2A 1IZZA 2ZYTX 4UBLA 2JBAA 3IEMA 3TXAA 4NVRA 5FBKA 2NO0A 3OZDA 4O4JF 4OATA 1ZEMA 1FOEB 3S55A 3FMIA 2XITA 3C3WA 5FULA 1UKBA 3ONDA 3GLFA 3ONWA 2W71A 1JMKC 3QFHA 4Q7MB 4ZPJA 5FD8A 3L01A 1ZI8A 1JPVA 2PX4A 1PFUA 2A5FA 2CDCA 2DR3A 1CUCA 1GXSB 2G6BA 4QGFA 5ALFA 8ABPA 3B51X 4E5NA 3EWSA 1HDXA 2PZJA 1FMJA 1BMFA 1VSQA 1ONOA 3AW8A 2XCQA 3NWJA 4XPIB 1P9WA 1VIAA 1XP5A 2FR8A 3NJ8A 4ZO9A 3RK0A 2AOUB 1ANKA 1FJHA 1PJCA 2VZ8A 4JASB 3ZI7A 3ZIAA 4AUMA 1RPAA 2WOJA 1DKPA 4P54A 4HPJB 1YI1A 2A9VA 1R0RE 2WJGA 3L8FA 5AQ1A 4NZZA 4RXUA 3MQFA 1LFAA 4N3CA 4Q9HA 2RGGA 5TF4A 5JXJA 3L7DA 1JR3E 3Q8WA 2G8NA 5CG1A 2A94A 5JSHA 2QPLA 5BYAA 3W5IA 2PKXA 2OAGA 3OFND 3OC0A 4B8YA 4P4NA 2BTQA 1GSOA 3TSYA 2WW8A 3B20A 5H70A 3VPHA 1EE1A 3L41A 3UPUA 4EFKA 1A7JA 4HQNA 4ONEA 5IKXA 4BNTA 4GRDA 1QH1A 4AICA 1OA1A 2CUKA 2TECE 5IANA 2XUQA 5GIOE 4IM7A 3CZ9A 4DM4A 2Y1OA 1E64A 4L3WA 2X40A 3ET5A 3P96A 2CLKB 4KYVA 2CD9A 3ZLUA 5IEJA 1M1YA 1C3OA 3SZLA 3UGQA 4Q6WA 5B36A 3ECCA 5EJ7A 1AB6A 3O2QB 4JQYA 1VIMA 3EPPA 1UEXC 3OM8A 4C89A 4JBHA 3LCJA 5K9ZA 5FUXA 1OWPA 5K0ZA 1H6DA 1HE8B 1ODIA 1T4BA 1YS2X 3IP6A 1CEYA 3FOCA 2D2IA 1QOPB 3H5IA 3R3VA 3DHWC 2VUTA 3D8HA 4WXEA 4F4UA 1GQQA 3C7DB 1NHGA 1TW3A 4WFJA 3WJ7A 3A70A 1X2BA 1ZK2A 4MVJF 4DNXA 3DHEA 4LXXA 1GCGA 1NSYA 1VA4A 2GZ3A 4IXTA 2HUNA 3TE7A 3V33A 3SZGA 3EEOA 1JWBB 3BXGA 3HVKA 4EMUA 2C2OA 3B78A 4CWAA 5LZ4A 2DKNA 1NLYA 2FQ1A 2RC6A 3OP1A 4Q3EA 4ZTZB 5CYGA 2BV3A 1AT1A 4BVEA 3LZDA 2V0NA 5BQFA 2BCEA 3N5KA 1Q15A 4JB8A 4QUBA 2Q7XA 4J8PA 1VL6A 3FTQA 1E79D 3BIXA 5TQ0A 5BV8A 5FNZA 1REQA 4RZQA 2I87A 5FTMA 3IRVA 3M34A 3RU9A 2Y92A 2J41A 4INZA 4QRDA 2ONZA 2C4HA 4HDAA 4PLFA 2ZE8A 4J0QA 5COQA 2ONYA 4YVFA 4A8JB 4ACAA 1XDUA 3VDRA 2H2AA 2O7QA 1EFCA 3EFBA 5FBRB 4BLUA 4LVCA 3F98A 2DFKB 4UQLA 3WE7A 2SHKA 4UDYX 3ECAA 4EITA 1IN6A 1SVWA 2D0IA 4G5YA 3CF2A 5EJGA 3BB1A 2OVBA 4OMUA 4ZALA 5IVIA 2Z9DA 4ESHA 1QG2A 2FG6C 5JV5A 3LX6A 4LTNA 2ZXUA 4J90A 2C4TA 4MUKA 4U2GA 4WAUA 5E4YA 5G53C 5IFKA 4CYMA 3C8HA 3I1IA 3VR2D 3FWKA 4M1EA 1OAOA 1QU3A 1RIFA 2FK8A 3QFSA 5IBCA 5TDHA 9MHTA 2R1VA 2ZVJA 1GUAA 3NBMA 4K9LA 2SECE 3S40A 3AHHA 3ZHCA 2J8ZA 4CUJA 1MGOA 1A9PA 1WV0A 1N4AA 4R84A 3RSFA 1Y7IA 2I33A 3LC1O 8ADHA 3RODA 3U5ZB 1H6AA 2W9XA 3I2GA 4HS4A 3B1JA 4QECA 4Q4AA 5CDGA 1I6WA 1IN8A 2QG4A 1TVKA 2C2GA 2X8JB 4EYSA 4PYLA 3UZUA 5IXJA 2AN4A 2QRKA 3A06A 1CPYA 1NBWB 4LV6A 2UZ3A 4H59A 4BLVA 5AVVA 1M5UA 1EDBA 3OTIA 4RADA 2PLFA 2JJ1D 3DVAB 3H05A 1LQUA 3UYLA 2WVJA 2W2NA 3LSTA 1G1MA 5REQA 5K0GA 3DXYA 4E09A 3W8DA 1OTXA 5L4NA 3MYYA 3H1GA 4PU0A 1S2MA 3DUWA 1XU9A 4X8HA 1YBAA 2B92A 4C9BA 2X1VA 3G3EA 1TC2A 5B58T 4DJTA 1JBKA 3E5RA 3JAWB 1ESNA 4TVOA 4EHHA 1OX6A 1JL3A 3CRNA 5HZHA 4Y6SA 1LB1B 2IIBA 4TKMA 4ARIA 3G2OA 1D8AA 1LJ8A 2NUPA 4BNWA 3KZNA 5DNYB 1W76A 2CJWB 1K4KA 5CBPB 1CVIA 3LWZA 2Q4DA 4TMXA 4KITB 4X91A 1RSZA 1QR6A 5CFMA 2RI6A 2B30A 3TG8A 3TLGB 1QVVA 3WJ2A 1G8GA 2M1XA 2O2XA 4LZPA 5DISB 4ZJUA 1XZLA 2BC9A 3LLSA 1C3JA 3OUZA 1PO7A 3HG7A 1LLUA 4QSHA 5FUWA 4C0XA 1PR5A 4KMMA 2GCGA 1H8EA 1JDSA 2WZCA 4XQGA 4Y6GB 4ZTUB 5FBQB 3F8TA 4O1IA 1KJ9A 3H84A 4AYXA 1WBDA 2R62A 3LCRA 2X4DA 5AR1A 4XARA 3D2LA 3ZVLA 5HKAA 5J3JA 1MG5A 4AK9A 5I48A 4TTTS 3JD0A 3R8FA 2GCOA 1EEHA 2YXNA 2Z09A 1W6UA 2P11A 1SZPA 4MJXA 4AMGA 1ZRSA 1TYAE 2D0PB 4REMA 5G0WA 3RUEA 2IF2A 2Q3HA 4BJ5A 3D8BA 2Y0BA 5D3QA 5FYDA 2X5KO 4OJTA 4A0FA 2OCGA 1Y80A 3TZBA 1HKUA 1BTOA 2YXBA 5TEWA 2ZBPA 2HR1A 2YIVX 3VR5A 4TVSA 3U56A 5TR9A 3EY4A 4DHWA 5LP6F 1Y8RA 2D4AA 5B2FA 5HF5A 3ZVRA 1J00A 2JARA 5HCUA 2Q6KA 4ZO8A 2I76A 1J8QA 1HYHA 4YCMA 1J1UA 4P3PA 5L45A 3TL3A 3IDAA 5AVQA 3EGDA 4UW9A 3KV1A 2RBEA 1BQ4A 4EVQA 4Q1VA 2X0IA 3D6UA 1DL5A 1B6SA 3E35A 4KR0A 1OZFA 5F33A 3ZJYA 4BWFB 5JALA 3PDIA 3L5OA 4D8VA 1ORTA 2DR0A 1B1CA 1Y4UA 2FOXA 3INTA 4G4SO 5JJCA 1TB4A 4GR5A 1T4GA 3H7IA 1U0FA 2C88A 3R23A 3UMMA 3L4JA 1ZJWA 5KSYA 2WJJA 1GTMA 5EHXA 1VLQA 3AU8A 3MT0A 3MTJA 5CK5A 3UOAB 2EWWA 2RKOA 4NICA 1XHEA 2H7XA 3AP3A 1BXGB 2LD4A 3ESRA 3PUKA 4FX2A 1ISFA 5C4GB 1L5WA 1W8IA 2BMWA 3EA5A 3PE3A 4Q1AA 4YUYA 4DREA 1ONSA 2J4FA 1BVYF 16PKA 5BWCA 4X7PA 1QH9A 1T26A 1US8B 3CTPA 1EK6A 2VHQA 1P3Y1 3S8YA 3PNLA 2B9EA 1R0XA 3TIFA 3WYGA 4X00A 4Z9XA 5J4LA 2BKVA 3FYUC 3HBFA 3IAEA 2CK3A 3V48A 4KH1A 3R6WA 4JSRA 4R2HA 4V2UA 2VDRB 3HDQA 2PZLA 1WMSA 4ZRDA 3FGOA 1N6IA 4Z4QA 4MJLA 5ULLA 1CRPA 1FSSA 1L5FA 4QA9A 4FKMA 3N76A 2B8EA 2EFCB 3HU5A 3NPAA 2PX6A 2BPOA 3FE2A 4M1QA 1ZH6A 2F1HA 3N2LA 4Q1FA 3U4AA 4RBNA 2PKRA 4GUAA 4HGOA 2QUAA 4EHJA 5BN1A 1CR2A 1TLFA 1NYRA 2GA9A 2O3TA 3CGGA 4HGRA 5AQEA 1FFGA 1I2CA 4CN8A 4YRIA 2CLIB 2ASEA 4R9RA 1UBMS 3I4CA 2EG5A 2LGJA 3LT0A 4X1YA 2Z1MA 1FUUA 3FPKA 1W0KA 5CLIA 5C1OA 2CUZA 5CM2Z 2QMHA 3ZHUA 3EH2A 5CEEA 4JZKA 2ZOSA 1J23A 2IQ5A 4NMWA 4YCDA 4KWTA 1NXTA 2PH7A 2GYYA 5MGBA 3UWDA 3JARA 2EFDB 2HSGA 4L5BA 5B4VA 4D96A 1WXWA 3IP3A 4ARBA 1K6XA 2M9MA 4GLLA 1WDMA 4ENQA 3ZDAA 1S9HA 2Y0DA 3B53X 5LMZA 1LSSA 1IBMB 1UBRS 2OO7A 1G8MA 4IZHA 1ADFA 2RGCA 3E5HA 2BDEA 2OD7A 2PWZA 4MR7B 4AZ0A 1E5LA 5JW6A 1Z0IA 3DBRA 1MEOA 4G81A 4KN9S 3RR2A 2NU8A 5EJEA 3VHLB 1RQNA 3PXUA 2CN1A 3QEKA 5HJ5A 1U31A 1XPUA 3MTGA 1R5NA 1Q7BA 3V3KA 3CVUA 1S3FA 2JJ8A 4ZCPA 4F0JA 2BCJQ 3VYVA 3MJRA 3MMNA 1EYZA 2G9RA 4E6EA 4F85A 5FUYA 3IOYA 2EG9A 2OAP1 3LUJA 4GWGA 4BFVA 2TMYA 1K6JA 4X9XA 4OKNA 1CJKC 2Q5QA 4EG4A 1VE5A 3ROFA 3X2SA 5AW3A 2QTBA 4JP3A 2NTVA 4IIJA 4GP6A 2OCAA 1OBFO 4ZHQF 1VM6A 4S1TA 3EXG1 2GXAA 3PNYA 3ZWCA 2P8SA 4DUGD 4ZD6A 1G6KA 5F4ZA 3ACBA 3RPEA 5T3UA 3GA5A 2OCDA 4BJ1A 3V2UA 1MJ5A 4IZOA 1Y9ZA 2DU8A 4MYHA 4ND2A 1X7YB 4PIMA 5LIRA 1CY0A 3SYMA 3EEYA 3MJTA 3M5CA 2IGTA 4B3DA 3KHUA 4LRQA 5A3JA 1XVUA 1KQNA 4AJIA 3P5SA 4EHLA 2BFBB 2BGMA 2QI9C 3BICA 2Z8XA 3OP4A 4HNGA 4LW8A 3A6JA 4ARSA 2F55A 4FGKA 1PV2A 2JJQA 3WAJA 4RVNA 3FGPA 4NE2A 3T0FA 1Z74A 1B00A 1KFCB 2IVFA 4QU5A 3DXZA 1YR6A 3GJRA 2IPOA 2ZRGA 4HDMB 3VVLA 3MWDB 4BB6A 3THWA 4MWEA 2CYBA 3GZNA 3LU1A 5CT9A 4XM0A 3W5JA 2O07A 4LHVA 4XH9B 4AJ2A 2IKQA 5MGNA 2YZMA 3NEAA 2G70A 1SCQA 2VSFA 4TKLA 3AB8A 1IY8A 1XRNA 2BKAA 4FEEA 3M6IA 2HKIA 1WHTB 3A1FA 2HQRA 1A71A 3QLTA 4M9ZA 2VSNA 3T15A 3VTKA 3OX2A 1TI7A 3KR0A 3P4YA 3REGA 4LYFA 3HI4A 4CCWA 4KN8A 2FPRA 3I0ZA 4LCEA 2OFFA 1AXRA 1L7DA 4C07A 5JO9A 5CDFA 1NMEA 3WSVA 4A16A 5B6IA 3R7BA 4RVHA 2OUIA 1WO8A 2I7VA 4NZ9A 2ADOA 4TRJA 2W6OA 3PSAA 2QIOA 2NZ2A 1AS3A 1P74A 3O6VA 3QVGA 3A05A 3KL4A 4RSGA 5JMWA 1SQ0A 2XMCA 4QZVA 4PLGA 1RI2A 3JQFA 3V1YA 2QIPA 4ARVA 1E69A 1NNUA 2IOHA 1VXRA 3N7AA 4MP3A 3INYA 2O1EA 5TVKA 4FB5A 1WHSB 3L8EA 3AVYA 4A8HA 4BVFA 1VKZA 1CG6A 4D82A 1ZBQA 1K7SN 1T5SA 4RHUA 2WSMA 4P7JA 1TQHA 3ONVA 1IXZA 3G5MA 3OX1A 1PS8A 3TLZA 5ILOA 3I8OA 3JATA 4H7FA 2IUSA 1N0WA 2BAGA 2ZZMA 1ZVMA 1XEXA 2J87A 3L7AA 3TSZA 4IZIA 4OBBA 3IE2A 4L22A 4P0PB 3D9QX 4IKPA 1SD1A 2JJ1A 3AXSA 2I80A 5FWNA 2C07A 1DEOA 3X0DA 2PZFA 1QHSA 3O90A 4JENA 4ANFA 5J2TB 3UK2A 4E2YA 5JMPA 5JCOC 2XSZA 1KYXA 4EPWA 1ZW6A 1JZQA 3OMXA 5IJ0A 5BR1A 1AVTA 1AUXA 5CB4A 1H6BA 2DHRA 5LYJF 1OFGA 4NHOA 1WCIA 3GNLA 3KOWA 2WD7A 1KO7A 5H0IA 4AY4A 2XCRB 1RXVA 3NHJA 1WUTA 1VHJA 5E1BA 4IEEA 4EG1A 3IBTA 4ILKA 1MJGM 1ZGBA 3LQYA 4YJ2B 1XVTA 2PGXA 4WJZA 421PA 1SHKA 3H6HA 3TVYA 1RJ9A 2OK8A 1BHQ1 1K8ZB 4LQCA 4TYQA 4DEVA 1WW2A 1KVSA 2CHGA 5TC4A 1S2GA 3U4GA 3JWJA 5E4FA 1THMA 1GO2A 1HBJA 2ATXA 4BTVA 4EQZA 1EHIA 3PC6A 2BH2A 2Q8PA 5FXMA 2GN4A 1GV0A 4WBNF 1ORRA 2XUJA 5H5JA 3ISTA 1EGQA 1QK5A 2YXDA 2J5BA 2JFVA 3KQYA 4Y0NA 5AMXA 3RVBA 1SIWA 4FEGA 1XQWA 3TS1A 4BE7B 4HDNA 2NN3C 2IT1A 4DYVA 4ETMA 2BVNA 2CCJA 1S1CA 2GYUA 1KWKA 2XVYA 4JYZA 3CZMA 4BZZA 3TW8A 2EBFX 2QMEA 4GQAA 2PGLA 2X3FA 5CTAA 1DUSA 1CEQA 1FP4A 5C1BA 1YS7A 3HDYA 3SBEA 3AHGA 4H27A 1KJZA 3OE4A 4HX2A 3WK8A 3ZKWA 4HBZA 5HE8A 4DCNA 2Y99A 2HRQA 4EUNA 4IDPA 5AVOA 1H8HA 3OJLA 4TWAA 1ZI6A 2AWNA 1AKRA 5K2OA 4MVCA 2ZJ1A 3K09C 3L7YA 1LRKA 3MUFA 1MT0A 1W85A 1HEYA 3KZXA 3QW2A 1YA4A 1KKLA 2YOFA 4HNSA 3SEZA 4B7ZA 2VQ6A 2HSZA 4FZ5A 3DMDA 2YFQA 2F8TA 1VP3A 4LCBA 2W90A 3CO0S 2ES4A 2OCIA 2V7QD 3B3JA 5HF6A 5INTA 4BXOA 4MDEA 2RGNA 3F90A 5BRAA 1JHXA 3H9EO 5I9TA 2WHRA 2R44A 2XQFA 3MA0A 1N57A 2CZCA 4WQMA 3H86A 2DHQA 1V7PC 1YD7A 2J31A 3FPCA 3FUWA 4DWWA 1Q21A 1QWSA 1QHHA 1SXJE 1OFUX 1PGPA 1UZNA 3VO1A 2GBLC 2JIBA 3D3WB 3OHSX 5CNMA 3ETGA 1KY5A 4IXDA 2C4KA 3RJZA 4Z9YA 1OF1A 1U02A 3UQZA 4IUCS 1XPRA 1U6JA 3SN6A 1D2HA 3QE4A 2B1QA 3H0CA 4PZYA 5EY5B 1E6MA 4F72A 4UNRA 2W6ZA 4BX8A 2OSVA 1I2DA 1J2RA 1KI6B 1XTPA 3L4SO 4YUZA 4YY3B 4JA2<