4EPYA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epyA00
2NO7A 3A8TA 4JYBA 5AJWA 3QXXA 3FOZA 4P33A 1SXJB 2ZRBA 1CU1A 2EVWX 2VHJA 3QEOA 1E6CA 4PANA 1XEWY 4DDTA 4PX9A 1DAHA 2YWFA 3NVAA 4ABYA 1N6LA 2BBWA 4ESVA 4JSTA 5DE3A 2NGRA 1IXZA 1UADA 3M0EA 5JLJA 1U9IA 2BEJA 5JSZB 1II0A 3EPJA 3SN6A 4NCKA 2GJSA 4RKEA 1DPFA 2N1BA 2OG2A 1AS2A 2RGXA 3GEHA 1DEKA 3TH5A 1VG0B 1ZUIA 2FSHA 3Q85A 4PSKA 1Z2AA 2WPDD 1SXJD 2VQSA 5EXXA 2H7VA 2YV5A 5DNYB 3QF4A 1R10A 3SU8A 3FMOB 4UXHA 1M2OB 1JPJA 3LAWA 2UKDA 1FZQA 1L4YA 4M1MA 4JLOA 1ODFA 2WJJA 1RPZA 3K70B 1P72A 2KBFA 2RKOA 3EA5A 4RD1A 4HDOB 1XXHB 2YC4C 2NO1A 3DZDA 5J40A 1IBRA 5M04A 1IN8A 1E9SA 1J2JA 4CVNA 3GFPA 1P73A 4V0OA 5AUQA 4KSBA 5ELXA 2IS6A 4US0R 1GG2A 1U81A 4YLGA 5G41A 4AKEA 2Z43A 1CJUC 4DCUA 1ZD8A 3MWKA 2JLVA 1W0KA 4ZDWA 1VYUA 1ZNZA 1DAFA 2ZE6A 4CEJA 1NMXA 2CLDX 2JATA 3OIVA 2PZFA 3PUYA 3WMFA 2JLWA 1E2HA 1FTNA 5F9FA 4KLZA 3B9PA 3VKWA 5CIWA 5GJCA 3U7GA 4JLPA 2QBYB 2QRZA 3B1ZA 2EFDB 2QUZA 5C4MA 2C5LA 3K70D 4I1OA 3SDZA 4OYHA 1ZUNB 1CR0A 4BASA 1W4BA 3FGNA 3W90A 4ARZB 3NBYC 5EXPA 2B8TA 4PAOA 4BLTA 2F43A 2OZEA 1E0SA 1K5DA 3KXLA 4KFRA 5FOSA 3QKSA 1B23P 3AVTA 2OFOA 4DLRA 3NHBA 1DO2A 2GXQA 4B6FA 2FEOA 1ZD9A 4BFVA 2P6UA 1L4UA 3IILA 3U6BA 5EP3A 3W3ZB 2LKDA 4YONB 2OFXA 3WP0A 1NMZA 4Q7JB 1D2EA 4LJ9A 4AYWA 2EFGA 4S35A 3FWYA 3ASYA 4GP6A 2NG1A 3KZ1E 1XDBA 2I3BA 2ZR0A 1GFIA 3FYHA 2QT1A 1LF0A 3ZVLA 1N0UA 221PA 1EXMA 2AWOA 2IA5A 3WBJA 5GJBA 2RGNC 4PC1A 1SKYE 4Q4LA 4NTZA 3SYNA 3ZYCA 4DLXA 721PA 4O3MA 3AVXA 2IW3A 5A5GA 1Z2CA 3KJHA 3KB1A 4Q66C 1QDEA 3CKLA 5FR2A 2AKYA 4KAXA 3UK6A 4EDHA 3Q3JB 4E09A 5EP1A 3VFDA 1JQJC 4H1UA 1R0WA 2ZSEA 3SHFA 3AF3A 5FOUA 1E9BA 2MSDB 4EFLA 3GLIB 5AUPB 3DEFA 4PO1A 5DI9A 2WPDA 4BFWA 3VNVA 2IEYA 4ITRC 2O0HA 3KUDA 3WP1B 2RHDA 1GM5A 1RRPA 5DHAA 1XMSA 1MH1A 2VTKA 5KSPA 1GKYA 4IJMA 4AG5A 3THXA 2BVNA 3EW9A 2F55A 3C8UA 3VR6A 2GAOA 2CMKA 2ZRHA 3QKTA 3IDQA 4V0MA 3RWMB 3CO5A 2FG5A 4LHVA 5AJVB 3AVQA 1TPZA 2F1RA 4BEJA 1G5TA 5CITA 4TYYA 4BEBA 3BB1A 1T0JB 3L8YA 4YDSA 4M9QA 2EWVA 2RGDA 3ZQ6A 1WCV1 1GUAA 2RGCA 4UNNA 4PZLA 4QGHA 1XTKA 2ZREA 2P0EA 1KKLA 5E95A 2OM2A 2IS1A 4Q4AA 2FZLA 1XEWX 4HSEA 2VHQA 2W6ID 4RCZA 2PEYA 2P6NA 2QPAA 1ETUA 4LYJA 5FBRB 1MO6A 1Z0KA 4RD4A 5BN5A 2W2VA 4DSOA 1OKKA 3O47A 4LJ5A 3WNCA 4HDCA 2V6JA 5CJPA 3U4QB 1NF3A 4TSFD 4OQFA 3L0OA 1JXMA 2EW1A 3CRRA 4XH9B 1GZSA 5LBIA 1SQ5A 3KJGA 3C5CA 3EAQA 3AGQA 3X2SA 2IUTA 4B75A 2CVFA 3QQ5A 4LHZA 4XOIA 1WBDA 1N6IA 4XVRA 2NMVA 1XJCA 2NO9A 2GVDC 4OHWA 2QG6A 4TYPA 3L2OB 4G01B 1OB5A 3VU9B 4Q9JA 1DELA 3LH5A 4OHYA 2VP6A 2P3SA 3DO6A 2HT1A 1CXZA 1G8FA 4Y0VA 4Z1MD 2ORIA 3B13B 3DDCA 1R8SA 1XTSA 4PXAA 3ONWA 2VHUA 4RD3A 4LJ7A 1IOZA 4KHZA 4RD2A 1N5KA 3SFVA 4U00A 4BE7B 3FKQA 4UNQA 2O8FB 5CYPA 4TLBA 4OK6A 2B8WA 2GTPA 4OJKA 3Q7PA 1ZVQA 2GXUA 1RJ9A 1S1MA 2IC5A 2V9PA 1P2VA 5C2JB 1YRAA 4GT1A 3GLHB 5AK0A 4G1UC 4JMPA 2AKAB 3UKDA 3X1XA 5FPYA 1YU9A 3GFOA 3QSYA 5E4FA 1HT2E 1VYTA 4I1SA 1YHNA 3EIHA 4MUBA 4N0EA 4RD0A 3UATA 1KTVA 2RB4A 4DLYA 3JVVA 3CRQA 5D3MA 1U0JA 4XJXA 4BLRA 4UNPA 5JWOA 1XPRA 4X8LA 1XPUA 1I4LD 2ZEJA 1XF9A 4PAQA 1SVKA 5TXGA 3TBKA 1E1QD 2OILA 3T12A 3OIYA 2ONKA 1NKSA 1HYQA 5SZHB 1GL9B 1KO8A 1OHHD 4QM7A 3AF1A 3ZGXA 3TVDA 1MOZA 5F3WB 1ZP6A 2WJGA 2IS4A 2PL3A 4KJZA 1FOEB 1DOAA 3NEYA 4ZV4A 4XWAA 2YHSA 2ZE8A 2CCJA 5FTNA 3RC8A 3CWZA 5JFGA 4GI7A 1X86B 2AK2A 1BIFA 4MYHA 2FFHA 3CLVA 4CT5A 4CF7A 1DARA 4OHVA 5EUQB 4TN1A 2E87A 2I1QA 2OO7A 2ZYVX 3H4MA 3GJ5A 4WBSA 3QKRB 4FMBB 1IM2A 1R4AA 2R2AA 1T91A 2IHBA 3CPHA 4A0HA 1E96A 1WQ1R 2W6IA 3KTAA 4ACBA 1Z47A 4M0LA 3MWJA 3BH0A 2VRWA 3NBXX 4A82A 4DB4A 4BRWA 2J0QA 3AUXA 1PLJA 1E4YA 2ZRKA 1JQLB 1XD2B 4V03A 4WXRA 2ERXA 2DR3A 1FQJA 4CEIB 2AWNA 5B64A 1H8HD 3C4JA 2A5YB 1SVSA 1XTIA 3NDBB 3W9YA 1QHXA 2XSZD 1YZLA 4HB3A 2OCYC 1EFCA 1SVWA 4BFSA 1TQ4A 4DVGA 4AKHA 3X1WA 1Z6AA 4Y0AA 2ZI7A 3OIUA 1OFTA 2G83A 2ZRDA 8OHMA 1PV4A 3LLMA 4DCNA 1UDWA 4IRUB 1BYIA 5KDOA 2NZ8A 2BMDA 2BKEA 3HPQA 3C5HA 3NH9A 3PENA 2JGNA 1X8JA 3BERA 1KJZA 1CKEA 1TQ6A 3IIKA 3QENA 5C1BA 1KMHA 2ZJ8A 1L2TA 2AXNA 2WWYA 2ASEA 1E9EA 2OLJA 2GZDA 4JL5A 1CJKC 2VSOA 4Z1MA 2QN6A 5F2EA 1S3SA 2AHOA 1IN7A 4JLVA 5JEEA 2JJ8A 2GILA 2J0UA 1J8MF 2GRJA 4MGIR 2CHQA 3CNLA 3SBDA 1XBTA 3U7EB 1G7CA 1H8EA 1JR3A 1TADA 3NTUA 1DVRA 2BOVA 4C0HA 1D9XA 2Q9BA 2RHMA 3R7WA 3FMPB 3WNDA 4LCBA 3AB3A 3CM0A 4ZDJA 4UJ3A 1Q20A 2ZPTX 3BD9A 1AS3A 1ZM3A 4WAUA 4QRHA 2WIBA 1G9XA 3T1OA 2IYZA 1N6OA 2CDNA 4HLCA 4HATA 3VX4A 2O8CA 2AD1A 4IOMA 3SEAA 1Q1ZA 1D6JA 1ANKA 1E1QA 1GP2A 2XGJA 4D0GA 1XZQA 5BW8A 2DWPA 4LBVA 4M1OA 5BQ5A 2F1JA 1OHHA 3GLHA 3VX3A 5FOXA 4Q9LA 3ZH9B 1US8B 2OXCA 2BEKA 4X8MA 5GADl 3K09A 4NCHA 1SXJE 2O52A 2Z4RA 2W2XA 3THYB 2G1JA 2YJTD 2GKSA 2FSIA 1KGDA 1M1YE 4CRWB 4Q7LA 2C9YA 4KITB 3HYTA 1K5GA 2HDNB 3CPEA 5CK5A 4BLPA 5EE0A 5F9HA 1J8YF 3K9LA 4IKEA 4PPQA 3SJBA 2WJYA 4V0ME 3IHWA 3ZD6A 1P2UA 1OH8A 1X8LA 4MRRA 3RLFA 1JJ7A 3GJ6A 4CT4B 1KDRA 2WWXA 4Q4HB 4BZQA 4TQUS 4BFXA 3IQWA 4GP7A 3NWJA 3AUYA 2G3YA 2BC9A 4FIDA 1AGRA 5BN4A 1RIFA 3KUCA 1H8HA 3LO5A 4KYIB 2CK3D 3BBPA 4Q1AA 2ZSAA 2XNSA 2C04A 3HU1A 4WVFA 1WMSA 2ZR9A 1CULC 1CEEA 3EPHA 3MSXA 1MR3F 1P9RA 4LY6A 3RAPR 4QBGB 4S2EA 5JECA 2F9MA 3K53A 4D6PA 4XVQA 2PCJA 4WXPA 1T0HB 4B43A 3SE0A 4DCVA 1UBFA 1Z07A 1G3RA 1SVLA 1GILA 1GDDA 4DDWA 5B58C 4CEIA 5H68A 1I2MA 4HZUA 2ZRAA 2TMKA 1LW7A 2OUKA 1I2DA 5J4VA 1R5OA 2PBRA 1PLLA 3I72A 4A8JB 4EJSB 2KB0A 3AF0A 1P6XA 2F9LA 2CL6X 4PTLA 1ZM2A 4ZCIA 2G1KA 2ZRLA 3N2EA 5CDFA 5H8WA 4NYJR 4IOJA 4M4SA 3NXSA 2BCGY 3U2QA 3D31A 3OZXA 3B85A 4XVUA 1FMJA 4PR0A 4PPNA 3A58B 1F2UA 1YQTA 4PHTA 3NBZC 2WSSD 4HB0A 3AV0B 3UPUA 1MV5A 1AJEA 2QGNA 4OHXA 1G8YA 2ZS7A 1FW6A 2EU8A 4POAA 2QROA 4LWZA 2RGGA 1PUIA 2ONJA 2C9CA 2FPMA 4JLMA 4NHOA 6Q21A 5KSOA 4MDFA 2O8DB 1KO1A 1UKZA 2QE7D 3PIRA 5EUMA 4Q47A 5IDVA 4L15A 2R6FA 1TX4B 4FD2A 1KSHA 4M1SA 2GETA 2XTNA 5JWRA 1NSTA 1FTSA 3REFA 1XTRA 4EJSC 1X3SA 4QC2A 1Z5ZA 2BIFA 3DM9B 1RRCA 1HV8A 2A3RA 2H16A 2AL7A 3OAAD 5EE3A 3F8TA 1P2SA 2LCFA 3AKYA 1G20E 5DGXA 1Z63A 5K8UA 5JCZA 1CBUA 2BDTA 1G6OA 1W4RA 4HLQB 3BB3A 1FL9A 3EXAA 2QM8A 4EPRA 4AKGA 2J59A 4ZKDA 3CX7A 1VYVA 2QTHA 4H9GA 4PQFA 1Q1BA 1W1WA 1E2KA 5J4YA 3OE7D 4NKRA 4BLSA 4GDFA 4II7A 2ODBA 1EGAA 2CK3A 4JVMA 5HE8A 4YMTA 3PEWA 5JHGB 4B74A 3WRYC 2WVJA 2MMCA 3O8RA 1JAIA 1W5TA 5DISB 3FB4A 4B32A 2RMKA 1SKQA 5FFMA 3QE0A 4ZIRA 2FV8A 4ILEA 1KAOA 3C41J 1NN1A 4M1KA 3QF4B 1AK2A 1NBMD 1NNEA 1G7SA 1AN0A 2H92A 1NVVQ 2VH5R 4FCWA 4P4SA 5SZIA 4TMZA 5HCNA 4OQLA 4NYJQ 1Z6XA 5LPNA 2HCJB 3QKUA 4B3XA 1HUQA 1AZSC 4IVRA 4QBHA 1YKSA 4NMMA 2GCOA 4MITA 3KXKA 3SFZA 2HYDA 5BYJA 4DBLC 4WZ6A 2VP2A 4TQ9A 1XMIA 1KK2A 4CYMA 1Q3HA 3NIBA 4XSGA 1T3LA 3Q9LA 4CEJB 2R9VA 1HY3A 4DWJA 1FPMA 5CB6A 1U9IC 1JBKA 3V4FA 2KSQA 3OEED 1CR1A 3TUIC 4DSUA 2WJVA 5FBQB 1OH5A 3NKVA 3KKNA 4TL6A 3WHKA 5KNBA 5GJWC 2WSSA 1EWQA 4JBXA 1XFAA 3HPRA 3I32A 4N0DA 1JR6A 1U8ZA 1ZM9A 2F43B 1DAIA 1UAAA 3CX8A 3QKSB 1ESMA 1QHIA 4A8JA 4C7OA 5EQTA 1FMLA 4BFZA 2BBSA 2RGBA 1YZGA 3I8XA 4EFNA 1PJRA 2ZANA 3PFIA 4AIIA 4QNMA 2WWHA 3NC0C 2FOLA 1S8FA 2QE7A 2NPIA 3PG5A 1BH2A 2Z83A 5E7IA 3ZJYA 1W7AA 3RANA 1T9HA 1SHZA 2ZRIA 2QAGA 1KZGB 1QZXA 1E1RD 4K8OA 1RYFA 2OXRA 4LHXA 3KQHA 3RS5A 2GDJA 4A2WA 1E2QA 3CNNA 3W34A 1AA9A 1HTWA 1KI9A 4L9SA 4M9SA 4NDZA 3LD9A 1TAGA 4EPXA 4US1R 2O8DA 1U2RA 1GRRA 1R5NA 2WWWA 3GLHE 1ZUHA 3HP1A 5FTLA 1SVIA 3DL0A 4JVSB 4AYTA 5KSZA 2IX3A 3KQNA 3W5JA 5HR5A 1GWNA 1ZW6A 1CJVC 2YOGA 1ZRHA 1TU3A 2AR7A 4TMKA 5TVKA 2CXXA 2WWIA 3NG1A 3OE7A 5UKDA 1G17A 2GXSA 2VPPA 5K8LA 2X2FA 4IEEA 3KKPA 4IXMA 2G0TA 1F60A 3OIWA 4NBSA 4F7WA 5TY0A 5AUOB 3BH7A 3DKPA 3RSOA 5G3ZA 1E9FA 3OFND 1NVUQ 2QSZA 4FN5A 1DAKA 1NBMA 1V5WA 1K6MA 5IK2D 5FTJA 4LK2A 3IPYA 3TGPA 3SOPA 5HZHA 3THXB 3AH8A 2IYRA 4B3FX 3C15C 4DCTA 3F5FA 3ADBA 3KJIA 3QUSA 1X8KA 2ZSFA 2ZUCA 1YJ5A 4C0JA 1E2EA 1JNYA 2PLFA 4ZKEA 2ZI3A 4MRNA 1JEEA 4Q1DA 3T5DA 2BWJA 3VR5A 5CM8B 4BLOA 2WOOA 3KB2A 3MWYW 3Q5DA 2FNAA 1RW4A 3BOSA 1G4AE 4TMVA 1KAGA 3TNFA 3WYAA 3I5YA 3A6PC 2VBCA 2A9KA 4WOPA 4D4JA 4URUR 3OEEA 4Z8XA 3THOA 4JLAA 2E9SA 4Q4AB 1P2TA 2J7KA 2PJZA 1RYHA 3CZQA 3U3OA 2VEDA 4F38A 4XD7D 1MO5A 2VP4A 1O87A 1S2MA 3TR0A 1S3GA 4PZYA 4Q5IA 3MAAC 3PEUA 4DLUA 1SXJC 2DBYA 2NIPA 4IVQA 4P4TA 3QXCA 2ZJ2A 2BHRA 2WV9A 4A1FA 3QI2A 3HJNA 4C2TA 3CF0A 1VDZA 3DOFA 3CF6R 5HCIA 2IK8A 1GRQA 3E1SA 1OV4A 2CLSA 4C0AC 2JIZD 5HZKA 1E98A 4GNKA 2ZYWX 2F1HA 1G6HA 1IN5A 2JLUA 4HB2A 4Q19A 2GJKA 3VHLB 4GL2A 1G5RA 4C9BA 5D3QA 2WMNB 1UDXA 3MUFA 1KNQA 2GF9A 4HB4A 1XRJA 1NMYA 1E1RA 1MRNA 2OLKA 2CLCX 3G82C 4A0FA 4RKFA 1AZTA 1RE0A 3UWOA 1ZIPA 4G3XA 3AM1A 4AC9A 2ZU0C 1TQ2A 2NOAA 5LDDC 3WXMA 1OKKD 1Z29A 3CH5A 2XJ9A 2D3WA 1AKYA 3I73A 4JVNA 5GVSA 2B21A 1U8YA 2DFNA 3K70C 2DCUA 1CF4A 3MMPA 1TMKA 3IKJA 3FVQA 4TYWA 1UBEA 1X1RA 1XWIA 1ZBDA 1UKYA 4UJ5A 2O8BB 5JI3E 5P21A 1RJ9B 3QBVA 2FEMA 2OCPA 3KXIA 5FL7A 3MG9A 3NEJA 5EE1A 3BFXA 2VSXA 3GLGA 3LRPA 2W2TA 3LY5A 5J4LA 4D0NA 1W4CA 4B48A 2J5XA 2RGEA 4HLUC 3KKQA 3QXJA 4R9UC 3LBHA 4B2PA 4DB2A 1QF9A 4A0RA 1QG4A 5D3MB 2BJVA 1D9ZA 3OFNA 4PC3A 2W00A 4CDGA 1R0ZA 2GXAA 3B6EA 1KI6A 3LDAA 1G3IA 1QRAA 2BM0A 2ZRGA 4JZKA 5IK2A 4D81A 1P5ZB 4QL3A 2O0JA 4GSYA 2QNRA 1DG1G 1KO5A 1KNXA 1G7RA 3TSOA 3K0EA 1A1VA 1NY6A 4H1VA 1UBGA 2WICA 4HDQB 1XEXA 1XTQA 1R6BX 2GJ9A 3PCRB 2CBZA 4LJ4A 3QF7A 3WHLA 2QPOA 4MYCA 4DLTA 3EC1A 2YOFA 1GAJA 4JJKA 1YRBA 2QMOA 1UKEA 5AR1A 2G77B 4PPGA 2L0XA 2QMHA 2Q9AA 4PC7A 4DDUA 4XD7A 3KTAB 1VHLA 2ZSBA 2GCNA 3RS3A 1D5CA 2F3TA 1YZQA 3SS8A 2ZS9A 3X1DA 1A7JA 2X19A 4DEXA 5EE5B 1E9DA 4G0NA 3A4LA 3X1YA 2GJ8A 4FCVA 4TTRA 1SGWA 3P20A 2JLRA 3SYLA 2JIZA 1N6KA 2J0VA 4AD8A 5K8TA 2PJRA 5L3QA 2AK3A 2XB4A 4LJ6A 1GNQA 5DHFA 3WNBA 5BWMA 2WIAA 4FW9A 3T61A 2ZI9A 2ZTSA 5AJYA 3DM5A 3V4RA 2W0MA 4AWXA 1XD9A 1LF5A 1UFQA 1LS1A 2WHXA 1PVOA 3L43A 4JS0A 2FH5B 3QBTA 3OEHD 4B34A 2QZ4A 3PUWA 3FFBA 2OCAA 3IUYA 2H57A 5B2ZA 5AWFC 5JJLA 4BLQA 4LJ8A 1N5IA 2QPTA 1W47A 2W0SA 3MJRA 4EPTA 4QXAA 1KMHB 3A1VA 4RFSA 4HUTA 1IHUA 1VIYA 1KSGA 2PX0A 4YC7A 4IFEA 3MFYA 1U98A 2QU8A 4QHTA 2VF7A 2DB3A 1G8GA 1T5IA 4M8NE 4R2HA 2V55B 1IN6A 5TARA 5FBLB 1HQCA 2G88A 2OSBA 4AK9A 4DIEA 2VLIA 2J0UB 2J1LA 1II8A 1PZNA 1X1SA 2ZRNA 1QVRA 4GMDA 4UXJA 4XIGS 1K8RA 3D6TB 3LW7A 3BFKA 3TAUA 5JRJA 1HT1E 5DI3A 4QOSA 4TLAA 2P67A 2G0NA 3AP3A 1SVMA 4GZLA 1HEIA 4EIWA 3R7WB 3B2EA 4IDOA 3D3QA 3ND9A 2ZRJA 1GTVA 3H0KA 2IT1A 2R44A 4MQBA 1DG3A 1W2GA 2VP5A 1Q22A 2KE5A 1JJVA 2RGAA 4PO8A 1DS6A 2O8CB 1ELOA 2GBLA 2O5VA 1NIJA 5EE9A 2C98A 4PSVA 4LRWA 4OQNA 4MKHA 1CR2A 2O8BA 1VG9B 2BM1A 3EARA 3AP2A 4NU0A 4L5BA 4C0SA 1H8ED 1JR3D 3CF2A 1Q1QA 4YMSA 3CX6A 4E03A 1ZIOA 1GKIA 4D4KA 2Q9CA 3IGFA 4M22A 1BMFD 4ON9A 1BOFA 1P75A 3A4NA 2PMDA 1UF9A 4D82A 2WSMA 3KQUA 3OESA 1OXVA 2ZXUA 4LV6A 1V43A 2QP9X 1YR9A 3RRNA 1IY1A 2LWIA 1QHSA 5FTKA 3B1WA 5FI1B 5KNDA 1JB1A 1KI1A 3LBNA 2REBA 1UBCA 4G5SA 3BS4A 3SC3A 3UMSA 1WXQA 1ZM7A 1FUUA 4P4UA 2NQ2C 3AKDA 2FSFA 4IFBA 4HAWA 2PT7A 4DJTA 2PCLA 3ZQJA 1KY3A 2EFEB 2HJGA 1YR7A 1GRNA 4AI6A 1R7RA 2ZVPX 3QJYA 4O25A 5G53C 3M1IA 5IRCD 4RZXA 1L7VC 1A5TA 1Z6TA 3K0CA 5K8IA 2KWIA 4ZCMA 2Q0HA 2AN9A 1MRSA 4IDQA 2YKGA 1W44A 4O0MA 5DLQC 1VG8A 4CEHA 4NYIQ 2IYXA 4EPYA 1NJFA 2A5FA 4JSYA 3K09C 2J7PD 2FFQA 3OEHA 3CR7A 4C0QC 1P9NA 1S1CA 3R20A 3WRXC 3FMIA 2ORWA 2ZR7A 5KDLA 3JZMA 2ZM5A 1XMVA 4HAYA 5KHOC 4O2RA 1E9CA 2ODNA 2OESA 3T1QA 1ZC3A 4HZUB 4MA4A 2UVQA 3G5UA 3ZZUA 4MRVA 1WF3A 1HE1C 3BIFA 3EG5A 3HDTA 4AYXA 3RNLA 4L9WA 2EQBA 3FHTA 2MSEB 2W83A 1NVXQ 1ZINA 2NO0A 3ASZA 3HWSA 4IXNA 1J90A 1KO7A 1XD8A 5GVRA 4Z51A 1P9WA 4OI1A 1M74A 1JALA 2HYIC 1F2UB 5JS7A 4A36A 1E0KA 1ZCBA 1TUEA 2NZJA 4I1UA 2JLXA 4DLSA 1NN5A 2D2EA 1OXXK 4N1AA 4WIAA 4DSNA 1E2NA 1VKJA 3IO5A 4LX0A 2OBNA 2N46A 4HAXA 3B1YA 2QA5A 1T3HA 4PZZA 3MRSA 3K9NA 2ZI4A 4KFUA 1NG9A 2WM9B 3E5HA 1M6NA 2PEZA 3IBYA 4ACAA 3AVVA 5F98A 3LW8A 2FJUA 4LJAA 1BMFA 2JJ1D 4QNRA 4UXIA 3VKGA 1ZM4A 2C9OA 1B0UA 3T34A 3UXMA 2ZIAA 3DHWC 4WZBE 4B35A 4RZ2A 3QIAA 1XJQA 2F3RA 4Q18A 2JASA 4D26A 1E69A 3K8YA 1X6VA 2VYFA 3GJ0A 3ICQB 1E2GA 3H86A 4J0QA 1LB1B 4A2QA 5BXQC 4V0NA 1EFRD 4QKQA 3RWOA 3LX5A 4KBGA 3IEUA 3W8RA 4QHYA 1RKBA 4GMXA 3IIMA 1NLZA 3J81k 2QORA 3EIEA 2BKUA 1UKVY 3PITA 4KI0A 4R2IA 2ZS8A 3T1VA 1IY0A 2OFWA 1UPTA 2QT0A 4DSTA 2ZI6A 3GLFA 2JLSA 3PEYA 3B78A 2B7CA 2H5EA 3TAHA 3L82B 1KKMA 3LV8A 4ZIRB 2R6AA 2FSGA 3SJZA 2EFCB 2J7PA 1CJTC 5JJIA 2ATVA 3TKLA 4XTRA 2QSYA 1LFDB 4P4SB 3UANA 5JZVA 3KKMA 2YOHA 1ZNYA 5L3VA 3LLUA 3KX2A 3H2YA 4GOXA 4HAZA 2FPLA 2GCOB 2FF7A 4ZI3A 4W5WA 1F2TA 1EFHA 3VTKA 4QBFA 4Q1EA 4A9AA 1OH6A 1U0LA 4BFUA 1A2BA 4LOAA 1G19A 3VQTA 1TNDA 1ZAKA 2C95A 2J9RA 2XNDD 2WKQA 1E32A 4E5UA 1CJMA 1EFTA 3M6AA 5FUXA 1VCOA 3BWDD 2F6RA 4MGYR 4M9ZA 4OI2A 1R0XA 1OPXA 3CIOA 2ZJOA 3ND8A 3PUZA 3I5XA 3A1WA 1WB9A 2ZE5A 4L8GA 4C4PA 2YYZA 2ZJBA 1NN0A 4LYFA 4QJ4A 3PR1A 1RVDA 3PXGA 4FINA 2FMXA 4FMDB 4C7OB 1UEIA 3TUZC 3EC2A 1KI8A 1E9AA 3O8BA 1TTTA 1NVVR 4KV9A 2AD5A 1Q0UA 1UM8A 1N3BA 3QY0A 2YNMA 3DKVA 4IDNA 1F6BA 3LFUA 2BMFA 4L16A 1NN3A 4TZ6A 1FNNA 3UG7A 1S9HA 4QHSA 3RRZA 4JYCA 3BRWD 1F3OA 5IHPA 2QAGB 4MGKR 2HV8A 4URWR 1NSFA 4MKIA 2JJ1A 1VTKA 2ZUBA 2CNWD 2D4HA 4YQFA 1YE8A 4QGFA 4LSGA 1HE8B 121PA 3FE2A 3HR7A 4FMDF 4TMTA 5FOWA 4P0TA 2X1VA 1MABA 3MLEA 1XPOA 3PV0A 4OHZA 1E2PA 1M34E 2JEOA 5CIQA 3AF4A 1EFRA 3CRMA 2DWQA 2X77A 2V4ZA 2Z6VA 1NY5A 5CK4A 4A8JC 1ZJ6A 1S9DA 3D7MA 1E9RA 3T06B 4C0BA 4NYMQ 2D06A 1NKTA 4WW0A 4FCTA 4DDVA 3P4YA 4OK5A 5FOTA 3VMFA 3TVTA 3H1TA 2FX3A 3Q8XB 2ZRMA 1N5LA 4LBWA 1ONBA 4P3YA 4Q1FA 1QBKC 1P4SA 5DIFA 4N3NA 2QAGC 3C14C 2X8AA 1QVAA 3RS4A 4JBYA 3TSZA 1UEJA 2NTYC 2ZAOA 2DFTA 4Z54A 4IVPA 5LD2B 2JCSA 1Q21A 3R9IA 3DOEA 4XSHA 1HURA 1XCPA 5E7JA 2JA1A 1NRJB 3W6OA 3U60B 2C99A 2WKPA 1KI3A 3QG5A 3O8DA 5ANRB 4US2R 4Q1BA 2QGZA 1AM4D 4NCNA 1NIPA 2FGJA 4LPKA 3SJCA 2OBLA 2XNDA 3DVLA 1EWRA 1AIPA 1D2MA 1AS0A 1JAHA 1EK0A 4GOJA 2WWFA 4WZAE 4YXWA 3GP8A 3ZZTA 4A6XA 2G6BA 4GRAA 2QQEA 1XNJA 4M9XA 1ZU5A 2G9NA 5JRZA 4DHEA 1BS1A 3EX7C 4PHHA 2PH1A 3CH4B 3I62A 2X2EA 1M7BA 1MO3A 4DZZA 4ASUD 2CE7A 2H1LA 3TRFA 2CCKA 2D7DA 1A2KC 4TWZA 1JXOA 1QHNA 2IYVA 3GPLA 1E0JA 2GCPA 3TQFA 4F4IA 5C18A 4TLCA 1YZTA 3V9PA 2FPKA 4MYUA 3VR4A 2JLYA 3K9GA 4DCSA 2P6RA 1JPNA 1E99A 4LJYA 3TR5A 1R2QA 3NDPA 1OFHA 1C9KA 2XEXA 4FI3C 4OBEA 3R8CA 2PMKA 1HH4A 2CNWA 4NP6A 3U7HB 5C46F 4QFMA 4FWTA 1LY1A 2R6DA 3K0SA 4YDHB 1T8UA 4D4LA 1OIXA 3KFVA 4IDHA 2A78A 3CNOA 4Q00A 1JR3E 3WMGA 3EZ6A 1WP9A 5AJZA 4JVLA 3A4MA 4TL8A 3GMTA 2DPXA 2PX3A 2GESA 4KODA 4QM6A 1OIVA 4FMCB 1OLOA 1Y3AA 4KFTA 3A36A 1W46A 4UNRA 3THWA 4FXPA 1TEVA 3L0PA 2C8VA 3LVRE 4TLEA 3GLGB 4OJQA 3O8CA 5DO9A 5H1YA 1VHTA 3UMRA 3QG1A 5J4KA 2ZQ5A 2R65A 1H65A 1VMAA 5FPHA 2YVUA 3ZVMA 2XZOA 2P65A 3BGWA 4LDJA 2CCGA 2AFIE 1FP7A 1KI6B 2JAQA 3TSWA 1RRGA 2O0KA 1Z0AA 3WYGA 3RHFA 2FN4A 2XZPA 4PHGA 4IEIA 4Q4JB 1P60A 2CJWA 4FMCF 4HUQA 4O2LA 1E2IA 1T5LA 5FL7D 4KFSA 1G4UR 4DT1A 1UJ2A 2GVZC 2JLQA 3I4LA 4YMVA 1XEXB 2FU5C 2PZGA 2XXAA 2HLDA 1N6NA 2FFAA 2HF9A 2B6HA 1TU4A 2QP3A 4DRZA 3P27A 1KK0A 1Z6YA 4KLNA 4B3BA 3C7KA 1KJYA 1XTJA 2ZSDA 1T6NA 4QBIA 1N25A 4B73A 4BWYA 1OFUX 4B2LA 3R9WA 4TZ0A 4EQ6A 1HA3A 3EWSA 3WY9A 1IXSB 4G5QA 2B7BA 1E2LA 1KHTA 1DAGA 3VR1A 4OQXA 2H18A 4QJ5A 3FHOA 2Y8EA 3U3KA 2ANCA 4M1WA 1FX0A 2VSFA 4F93B 5JJKA 3EIQA 3ADKA 3K0AA 4C2UA 3EPLA 3AGPA 3P26A 4PSAA 1VECA 2HXYA 4ASUA 2J87A 3U44A 2EYQA 2QMEA 5G40A 3X1ZA 3U7FB 5E3HA 4AY2A 2IYTA 1WRBA 3CRW1 3CR8A 4JLKA 5L3QB 2BV3A 3SHWA 3KL4A 3ADCA 4Z8YA 4ESHA 2QENA 3UMFA 1FP6A 2BMJA 4TLDA 1EFUA 4JLDA 4TMXA 3W6PA 2B92A 2BJWA 3AF2A 2V6IA 2YWEA 2W6JD 1HQYE 1G8PA 3GJ7A 3ZIAD 3GD7A 1CS4C 4Q1CA 4QGGA 2P2LA 2VIIA 4GBMA 4RFSB 5CDFE 1OYYA 2SHKA 3GEEA 2BCJQ 1YR6A 3QOFA 2UZ3A 2ZYTX 1N0VC 3P1JA 1GNRA 4PHFA 1RZ3A 1PLKA 4E22A 4MUAA 5LB4A 4HAVA 1OYWA 1VCIA 1P3JA 2FFBA 2ZRFA 3VR3A 1II8B 4YMWA 3P32A 3F0TA 1G5PA 1KDPA 4X8HA 1FUKA 1MT0A 4AG6A 5KU1A 2WKRA 4Q7MB 4PQYA 4Q9HA 2FGKA 3IBGA 1J70A 5DI3B 3U3MA 3OF5A 1DADA 3ZVNA 1Z06A 3EZFA 4KO8A 1GSIA 4EPVA 1R8QA 4W5JA 5TDHA 3K0FA 4HYYA 1Q12A 2P5SA 2V8OA 2LKCA 1TUIA 3GEIA 5DYIA 5EXTA 4BPBA 1GOTA 1LNZA 3Q72A 3LXRA 4B2IA 4JT2A 3EPKA 2C03A 1N5JA 3V00A 3ETLA 3AVYA 3FHCB 4UQOA 1NLFA 3QPWA 2E1RA 1LTQA 1XX6A 2BBOA 2FWRA 2NO6A 2WJHA 3CW2A 3GJ3A 3MD0A 5JHHB 2IS2A 4URVR 3GQBA 3CWQA 3GCGA 4PFSA 4Q01A 3DPUA 2WBLC 4DIDA 4ZDIA 2O8EA 1KSFX 1MO4A 1GITA 1Z0FA 1J7KA 1G7TA 2AXPA 3PQCA 1DAEA 2IYUA 2REOA 4P32A 1VCNA 5SZKB 5JI2E 2C77A 5KOYA 3B5JA 3JVUA 3UG6A 2QY9A 2XJ4A 3SQWA 2NPFA 5DSZA 3CUEF 3NHAA 2C78A 2A5DA 4GOKA 2N42A 3FTQA 1E4VA 1E0AA 2R6CA 3QVVA 1Z3IX 2HUPA 4Q4JA 2VL7A 1G1MA 1M7GA 3LNCA 1GKUB 1LS6A 2ANBA 4PAMA 5EJEA 5KPDA 4D25A 3I3SR 3QNUA 4M1YA 4B71A 5CM9C 2J41A 2A7QA 4GFDA 3VNUA 1QHGA 3RDPA 2AFHE 2WTUA 2GBLC 4F4JA 5FR1A 1DBSA 1U99A 1AQUA 4HI0E 4JIMA 4I99A 4LBYA 3EWAA 2MSCB 4LYHA 1GIAA 3LQQA 5FPSA 4CEHB 2C96A 2HCBA 3EASA 1SULA 4RFVA 5JEDA 3KFXA 5CYOA 2W6JA 3RABA 4MKGA 1A4RA 2ATXA 3ZIAA 3RS2A 1XZPA 1BO6A 4I81A 1DAMA 1Z0IA 1SXJA 4TQAA 4BQSA 3HU3A 1OH7A 4KVGA 5TB5A 2IUUA 3SZRA 1NI3A 1TF2A 4JKIA 4LC1A 1W48A 2IYWA 4R7ZA 3A1SA 2ZRCA 3U61B 4M1TA 4KXFB 4TT3D 2VHTA 2D62A 4YMUA 5JSZA 3TK1A 1KO4A 3IIJA 4HZIA 4B6EA 4IOKA 3S1AB 4ZPXA 2J0SA 5FOVA 4CZ2A 2W58A 3TUJC 4QJ3A 5J4HA 1ZNXA 1RFLA 2QTFA 2CVHA 3K0CC 4G5RA 2ZVQX 3P4XA 1J99A 2IEZA 2QAJA 1S96A 2YINC 5FUVA 1Q57A 1KDTA 2CHVA 2GHIA 1G41A 3BK7A 2CL7X 3N2IA 5EP2A 2V54A 2FE4A 4NZYA 4NYIR 4Q03A 3RC3A 3FPAA 1VIAA 5FPKA 4BZXA 1WA5A 3TW4A 1IXRC 4W5HA 3T35A 1IONA 4MGZR 5IF9A 4PO9A 5EZ5A 3RSLA 2OE2A 3U5ZB 3ZDQA 1XXHA 4ZCLA 2A5GA 1KI4A 3FDIA 1QG2A 4JL8A 2D2FA 4CW7A 3LBIA 2KJQA 1ZC4A 2GF0A 1N0WA 1P7CA 3W8NA 4PQRA 5J47A 2QRNA 4HAUA 2CEAA 1KJWA 3SJAA 3H84A 4HLUA 1ZNWA 5SZJA 2HT6A 3ZLJA 4M53A 3AVPA 5IT5A 3AEZA 4TYQA 5AUNB 3EZ9A 3LX8A 2QBYA 2RGNA 4LPSA 3REGA 1YR8A 4DUGD 5FBVB 4D4MA 1G8HA 1KSJA 3M4YA 3B1XA 3QXHA 5BYKA 1OB2A 1N2CE 4ARZA 2ODWA 4Q21A 3UWKA 3OHMA 4CGZA 3BAFA 3MCAA 4M21A 3SI7A 4F92B 5KTYA 3TLXA 3RVBA 4C0LA 4JKYA 5DH9A 5JWHA 5DN6D 2RCNA 2F1IA 2MMGA 5FL3A 1EG7A 1TEXA 1A82A 1NBME 1W36B 2CE2X 2GAAA 3B8HA 3IPXA 3GLFB 3EZ7A 4UNSA 2IXEA 3RRMA 4ZI2A 1S4QA 2ZJAA 3HU2A 2OAQ1 1G291 4DKXA 3T1TA 2Z0MA 2JLZA 1CIPA 2XTZA 3QEJA 3SBEA 2VHCA 2ZROA 1NL3A 3W5IA 2ZJYA 1PUJA 3I8SA 1TL7C 3GJ8A 4OK3A 1OXTA 1F48A 1KI7A 1W49A 5FUWA 1Z28A 4C30A 2I4IA 3CPJB 3PUXA 3QXSA 1F2TB 4BGDA 3TIFA 1T8TA 1W36D 2GNOA 1NVWQ 4JJZA 2J46A 2K5UA 4TT3A 1W0JD 1U90A 4PC2A 3K1JA 5KO2A 1M8PA 5FH9A 3DMNA 2A5JA 1DO0A 2WZQA 4TL9A 1KY2A 4OKSA 3AVWA 2OBMA 3PJRA 4G5OA 1LV7A 1OE0A 5JCPA 4R71A 1W36C 4AURA 2Q3MA 4W7SA 4LV8B 1AGPA 3GLIA 4RZ3A 1Z08A 3N5CA 1CRQA 5FBWB 2ZJZA 4A6PA 3LXXA 3T5GA 4LV5B 1NG1A 1U94A 3NC1C 821PA 5L3SB 3BXZA 4JBWA 3EZ2A 5KPJA 1NP6A 2JJ2D 1P61B 1CTQA 1E94E 1KOFA 1OXUA 1E2FA 3LQRA 1DTSA 4TMWA 4I4LA 5KDDA 2IHYA 2V3CC 2C2HA 4OI0A 4F91B 2VP0A 3R9XA 3S1AA 4D0LB 2XOKD 2V1UA 4A2PA 3GFTA 2GEVA 4LBZA 1YVDA 1C4OA 4OL0A 2ORVA 5JS8A 3MWLA 3E2IA 2YZ2A 1N6HA 4TSFA 4CIDA 1CR4A 2IUSA 2IF2A 3BH6A 3U3RA 4PPFA 1MABB 4B47A 2WWGA 3K9HA 4DUGA 4MRSA 2PT5A 3GJ4A 2UZIR 4XTCS 3GLGE 2D74A 2FDCA 4LYAA 2GK7A 4L4UA 4URZR 4EFMA 4M2LA 2R6GA 3BJIC 2EFHB 3W3AA 5L8VA 1IQPA 2R62A 1E2DA 1GL7A 2JDID 1XCGB 2QQ0A 4AKIA 5DN6A 3KQLA 2ZAMA 3B9QA 1FFHA 3U4QA 2WOJA 1OJLA 2IBMA 2Z4SA 1VG1A 1KZ7B 1BYUA 3L0IB 1OIWA 2IWRA 2WAXA 3BB4A 1QHHB 1G18A 4A0GA 4JLNA 1YZUA 1SZPA 3EA0A 2Z5FA 3T15A 2YWHA 1JECA 3VU9A 5HPYB 1G3MA 4D80A 1XB2A 4UKDA 2Q3FA 2XZLA 3RYTC 2IWHA 1FNMA 4HLDA 4LC0A 1GL6A 1IY2A 1I4TD 1T4GA 1OF1A 4KVAA 2V7QD 1JEDA 3PVSA 4MYTA 2VA8A 3SNHA 3ZZ0A 4B33A 5AJXA 2HJVA 1T3SA 3FMFA 2VP9A 1II9A 1L8QA 5HTKA 5B30A 621PA 4C3ZA 2OV2A 1D2NA 2O8FA 2IL1A 1R5BA 5JMTA 1EESA 4BZPA 1LVGA 2A2ZA 1W0JA 2HF8A 4IOLA 4U5XA 5CB8A 1AQYA 4OQMA 3B1VA 1SKYB 2OHFA 4D2IA 3U3JA 2ZRPA 3VKHA 1GVNB 3ECCA 3UIEA 1CRPA 4NYMR 4ERNA 1Z83A 3KJEA 1W5SA 4URYR 4ZO4A 2DWOA 5FUYA 3B82A 3DZ8A 4LHYA 1XJ0A 4A92A 1W4AA 3HYRA 1G16A 2QMUA 1ZCAA 4R98A 4MH0R 1D8TA 2JJ2A 4Q48A 4NL4H 1GNPA 3NBFA 2IYLD 1M7HA 2GZHA 1ZD1A 2VF8A 4V02A 3BORA 5KSYA 1Z0DA 2R8RA 4JLJA 4NE2A 3ICEA 1WDTA 1G3QA 4YXWD 5BN3A 3KDSE 2DY1A 2OEPA 1VPLA 2XOKA 3CRVA 2BMEA 4DEYA 1E2JA 1P62B 1S0UA 1YZNA 2DFLA 3KQKA 4QGAA 3ZS9A 2Q3HA 1U0HC 1CLUA 3IQXA 4V0KA 2XB2A 3FKSD 4EKDA 2REXB 2XSZA 1COWD 2QL6A 4LHWA 2IYSA 5G3YA 5L3SA 3D8BA 3L8ZA 1KK1A 3U6KA 5HE9A 4B3DA 3QKRA 1FQKA 1XXHE 2I1VB 4U02A 2QEQA 4RJLA 2HXSA 2ZETA 3G0HA 3SQXA 3GJXC 1KYIA 1KK3A 1F5NA 4GPTA 4LUCA 4Q02A 3WBKA 2D7CA 4IW3B 4TL7A 1XD2A 2PLRA 1Z22A 4NCJA 2IXFA 4ZDKA 3THWB 2KI5A 5EZ6B 4TTPA 3AQ4A 3RS0A 2JDIA 2F7SA 3W6NA 1XMJA 2HEIA 1Q1EA 2QTVB 3N70A 2J45A 2YWGA 5A0FA 3TJZA 4EAQA 4A15A 1Q3TA 3A1TA 4NH0A 4EPWA 1ZU4A 5FPTA 421PA 4LI0A 5L3RA 1WE2A 4BFTA 3LWNA 4HEJA 4XWKA 3CONA 3E70C 2XX3A 2QM7A 1JI0A 3RS7A 2A30A 4A4DA 2CJWB 521PA 4HUQB 3VR2A 1QHYA 4LZZA 1G21E 1IAQA 4DT1B 5TV2A 2V7QA 4NCIA 5J5CA 3IO3A 2ZE7A 3IEVA 4OI4A 2XXAB 2AX4A 5DYGA 2Q6TA 4LGMA 1KIMA 2GWHA 4Q9KA 2H8KA 3RRYA 5HKKD 4E07A 5C4GB 3A37A 4EQ6B 1QHHA 5JBQA 1U8AA 4KSCA 1ESNA 5A4JA 4PC6A 2XAUA 1EX7A 2ZJ5A 4QG7A 4JT4A 4K46A 5FTMA 3LVQE 3C16C 3Q7QA 2EYUA 5KYKA 1G64A 3SYKA 1OSNA 2GJAA 1FX0B 2XITA 4RY2A 3K0AB 5EXSA 3AP1A 4EUNA 3CZPA 4G5GA 1VCMA 2HLDD 1N6PA 2IYQA 2PZEA 3U44B 1AKEA 3ADDA 4WA7A 2BBTA 4DLWA 1YZKA 1XEFA 4X8OA 2VO1A 4I1VA 1IJEA 2OAP1 1XU4A 4F4CA 1G3UA 5KNCA 2DFKB 5B57C 1RC8A 2ERYA 1WBBA 1OW3B 3GLIE 4RD6A 1US8A 4BUJA 4W9MC 5EP4A 1IN4A 3ZD7A 2WAYA 2IF0A 3THYA 3MGCA 1E2MA 1Y63A 3JZAA 4IDPA 2OCBA 4NONA 4DLVA 1OXSC 1E79D 4GZMA 3TQCA 4KCGA 3FKSA 3FFAA 1COWA 4FWIB 3MJHA 1DE0A 3HR8A 2IYYA 3ZS8A 2RAPA 1KI2A 4KYUA 2ZI5A 3SR0A 1KDOA 5FI0B 3B60A 5LD2C 3AVUA 3PUVA 2RH5A 4Q4HA 2H17A 3I92A 5E7MA 2DHRA 1SVOA 4BFYA 1ZYUA 2KBEA 4B3GA 2DYKA 4Q7KA 2CHGA 2GEUA 3QPVA 1Z6GA 1TQDA 2OT3B 3PEVA 4KBFA 1I4DD 5CLQA 3K0FB 3R8FA 1BKDR 3KKOA 5KUTA 4BECA 1KMQA 4JL6A 1E3MA 1XP8A 4XWOA 3QPUA 4RSGA 2ZYUX 2P5TB 3BE4A 1N6RA 1Z8FA 2GK6A 4V0LA 1O3YA 5GJVC 4C0KA 1Q44A 3AKEA 2O8EB 1CP2A 1NLYA 4K81B 1OFIA 4DC9A 4EJSA 4RVCA 3I1FA 3L0SA 1NJGA 4MRPA 2ODEA 4DXAA 5TMPA 3A1UA 2GA8A 1OT3A 1TF5A 1W0KD 2QP4A 1ZMXA 4NPHA 5HKKA 3AVOA 4RZUA 2ZU6A 1TF7A 1XCMA 5LB2A 2ZITA 2CL0X 4U7DA 2QI9C 3IHLA 1IJFA 3TMKA 5CJ2A 3WYFA 3BFVA 2EWWA 1W2HA 3WMEA 1Z0JA 3AKCA 4B44A 3CB4A 1R0YA 1MKYA 2Q21A 2WJIA 2WMOB 3LA6A 4BRUA 4Q9IA 2FZ4A 3OAAA 3VHXA 3GLFE 1EX6A 2GEDA 2J3EA 4P31A 3QVUA 4MDEA 3NH6A 1RRFA 2XTMA 2V1XA 3VAAA 3BC1A 3TE6A 2FA9A 2IXGA 4MKFA 4DLZA 1SHKA 3DMDA 2ECKA 3F3YA 3Q5EA 3TW8B 5CLLA 5H70A 4JLBA 4TTQA 3B7GA 3ZVRA 4B3CA 2GZAA 1C1YA 4B76A 4URXR 3I61A 4TYNA 4RCYA 4KU4A 1E79A 2ZUDA 4IHQA 2YC2C 3CBQA
chains in the Genus database with same CATH superfamily
2NO7A 4ZYVA 1Z7WA 4DJJA 3BRCA 3QXXA 4KDRA 1W75A 4N6OA 5EKXA 2I33A 2JVKA 3DSRA 1W30A 2VHJA 1M1YB 3AKZA 4PIVA 4PANA 1XEWY 2B1JA 3U40A 4DDTA 4HDSA 4XUDA 1DAHA 4LN1A 1FU4A 3Q98A 4QWWA 1P4HA 3D6NB 4UBKA 3EAGA 4WNAB 1SIBE 1IXZA 5DE3A 1JTFA 2B8JA 1DEAA 5JLJA 4IPTA 5JW6A 1RHRA 2BEJA 2J9FA 4D5EA 4DV0B 2ZB2A 1M1NB 3O2QB 2D5IA 2JIDA 1J2YA 4N12A 2GUWA 3MMXA 3EFOB 3MEQA 3JVDA 4GRIA 3T9DA 4NU8X 3NUGA 4K9DA 4BJ5A 1HE5A 2W2MA 3R5HA 3TH5A 3WLKX 4B31A 4OHFA 3PYXA 3Q85A 4BB5A 4PSKA 4DIMA 3L49A 1Z2AA 3H0CA 4BQQA 2ZP1A 4YJDA 5JZOA 2F1OA 1C80A 4X41A 2VQ3A 3N75A 5ELLA 1ESCA 2AYXA 1JPJA 3LAWA 1FZQA 1I7NA 1GEEA 1W88A 5C1IA 4AZTA 2XBMA 3O9ZA 4IJWA 2PBZA 1XT6A 3VI3B 2O59A 5J40A 2F3SA 5M04A 1T2UA 1E9SA 3K6SA 3EVGA 1F06A 4CVNA 3GFPA 1P73A 4P86A 4KSBA 5ELXA 2IS6A 1ULHA 5JAPA 2L82A 4AKEA 4MUHA 3EFEA 1CJUC 2ZTLA 1YNOA 4AUMA 4FNMA 2RHCA 2Y66A 2JLVA 1RI3A 1VYUA 1QFMA 1DAFA 2ZE6A 1NMXA 1E7RA 2CLDX 4FWBA 4M8KA 1KRWA 1JSXA 5DMHA 1QOQB 4WFJA 1SC9A 1ENPA 4KLZA 3B9PA 1NQVA 3EXIA 1B2LA 4J1SA 1EK6A 3GH3A 5C3UA 2QBYB 1SCNE 2QRZA 2V98A 3PQ2A 3OQIA 1QQ5A 2ZSUA 3ONNA 1HZZC 1QB7A 3NASA 4HF7A 4O4JA 2B78A 3G1WA 4HSGA 1BMTA 1CR0A 1G0NA 1NOKA 1YQWA 2QLMA 3FGNA 4OTZA 3NBYC 2B8TA 4XCQA 2HLHA 4PAOA 2F43A 5AKIA 5LMNB 2FPPB 2FW0A 3MBOA 5LM3A 4KFRA 1OX6A 5C1PA 3QKSA 4YV1A 2BFFB 5FKJA 5JCJA 1NC3A 2CD7A 2O2CA 4DLRA 3NHBA 2QR2A 4Q3LA 4N39A 4BBJA 5BR8B 3AM3A 4U2GA 2FEOA 3O3CA 3UQZA 4F7DA 5KWIA 1KEVA 4YV2A 3RTGA 1Z37A 1YQDA 2GGSA 4TTIA 4BFVA 5D2CA 2PR7A 2DZDA 2KMLA 3GU3A 3R3HA 2CFTA 2D2IA 2FAXA 3IILA 1MOQA 2QRJA 4P3PA 4WADA 1ODSA 3U6BA 5EP3A 3PGVA 2QD1A 3KG2A 2OFXA 2PGXA 1EVLA 1V1RB 4K05A 4HQNA 1D2EA 3R5JA 1JFLA 1D04A 2WHRA 3UMYA 1F2VA 3ASYA 4Q16A 1RYNA 2Q0SA 1CWUA 3FWPA 1OI4A 3HVUA 4W8OA 3IOYA 4MNTA 1GFIA 1L9XA 1U2DC 3TPZA 5L53A 2QT1A 1LF0A 1X80B 1XWFA 4XARA 3SX4A 2IP2A 221PA 2AWOA 4F84A 3U19A 5JU6A 3CJQA 3H4TA 1N1DA 2GZMA 4PC1A 4W8GA 3TRDA 5AKYA 1CHDA 721PA 2IW3A 2YHBA 4JV5B 1T6BY 1F2DA 4Q66C 5ENVA 1QDEA 1E3SA 2GN1A 4MW0A 1KMIY 1NC1A 2PZ8A 3UH0A 2EQ5A 3I09A 4LRQA 3T7SA 5K4GA 2GM3A 3N53A 1P0QA 4U7GA 1ZXBA 2V0CA 4G0PA 1WKCA 5G2OA 1IHPA 1N33B 3VFDA 4IG9A 5H3HA 2AN1A 3QLVA 1R0WA 2ZSEA 1SHUX 3OTGA 4QDXA 2ZIWB 2YZGA 2B0JA 3OO0A 5EIAA 4HN4B 4MLPA 1MX3A 4CDNA 1QGDA 2IEAA 3PZRA 5H59A 1CEYA 3DEFA 3GRAA 4INPA 4WLUA 2PUHA 1VLHA 4RUKA 4BFWA 4H1TA 5A1JA 1ST2A 2IEYA 4ITRC 3P94A 4J91A 3ZHBA 4PTZA 3NVMB 4YRSA 1ZJ5A 1GM5A 3EVDA 1RRPA 2QJTA 4JJAA 2RJ3A 4X97A 5BP7A 2VTKA 4LXIA 4DMLA 2UYCA 4MS3A 2C97A 1T2EA 2H2HA 1XTTA 5KSPA 5KJ6A 1GKYA 4JYPA 5E6SB 3THXA 3TPFA 5F7OA 2CMKA 1USWA 3CEPB 3OZBA 2J3QA 3QKTA 4EHLA 3RWMB 4BNNA 2GARA 3Q10A 1YZVA 4GE0A 4RH0A 3HYNA 3C5EA 4GEGA 1DOZA 5CHYA 3VJLA 3WL4A 4B82A 3R9XB 4ALKA 1D3AA 2QVXX 3QXGA 2Q7XA 4P35A 3M6UA 3ZU5A 3CNHA 4BEBA 1HNZB 2D1RA 3ZGOA 4TXHA 1GZ6A 2KS6A 2RGDA 3VU8A 4BDSA 1WCV1 1GUAA 2VDLB 2HMTA 3VOAA 2BONA 3EC7A 2XWBF 1E7QA 1LDBA 3DV0A 5JSQA 3UUWA 1T9DA 3FYSA 5FYQA 4HXYA 2HRQA 2HRBA 4OPMA 5E95A 4E0BA 3K8QA 2IS1A 2JCGA 3ZZ0A 4N8EA 3OLVA 2G9VA 5KYYB 2VHQA 1Q7TA 5FDFA 4WH0A 2ZPUA 4RCZA 1PR1A 3OQNA 2QPAA 3OZFA 2C5HA 4KQFA 4LYJA 4RM2A 1GQRA 5FBRB 3WK4A 3UMGA 3JAMA 4RD4A 3WB0A 1L1FA 3ZDYB 1WB4A 5L6MB 4DSOA 3FMGA 2BJHA 1FMFA 3ITKA 5LQRA 3ILSA 1J9GA 5DB4A 3PBKA 5E1OA 3K5IA 3E22A 4XH9B 3L0OA 1EHYA 1JXMA 4F2HA 1SKBA 4MB2A 2OKGA 3KJGA 4NNOA 1A8UA 3DE5X 1I3KA 4CE6A 4RDIA 3I1IA 3QQ5A 5K3SA 2H11A 3K2EA 5EY5B 3EGWA 1XJCA 4J16A 1GUFA 3PE3A 5AM2A 4RENA 2GVDC 2C07A 4PFKA 5SY9A 3JD4A 2QG6A 1CS0A 4TYPA 4DF3A 2G8LA 4YPVA 5JXIA 1OB5A 3MYYA 4HXEB 4H3KB 2FW8A 2CJXA 2R85A 3AIMA 5LOVA 5CVUA 4E30A 3ZIUA 3FLMA 4XSVA 3U4HA 3IL2A 2YWXA 1BWSA 2P3SA 2H5IA 2PLAA 1OFUA 4Y0VA 2VZLA 2VTBA 2ORIA 2PQMA 3NORA 3B13B 3DDCA 4UMDA 1GYQA 1R8SA 3H9QA 5EHNA 4BNGA 1JR4A 2VJNA 3PX3A 1IOZA 4LJ7A 4EOGA 2A86A 2L18A 4U00A 2PLNA 4BE7B 1VJCA 5EN4A 2O8FB 3NAZA 3P9ZA 4JH0A 4P7JA 3WI7A 2I7DA 3S40A 3Q7PA 1ZVQA 2GXUA 3KQMA 4EYGA 1QFZA 1S1MA 2IC5A 3ZWPA 4BU0A 4H7KA 3Q2KA 1KIAA 3EXG2 4F6RA 5KVCA 1WDLA 3DT6A 3GB9A 1XO1A 4G1UC 3UKDA 5IXYA 1M34A 4MPRA 1SCBA 1YU9A 3IP5A 2EG5A 5E4FA 1VYTA 4BQPA 3UN1A 4N0EA 4H7DA 1JDVA 2WT4A 4QPJC 5LUAA 4KVFA 3J81A 3O7MA 3OSZA 2ST1A 2XMRA 4UNPA 1HL3A 3WISA 4X8LA 1CT9A 4BLRA 1O0SA 3EVAA 2ZEJA 1XF9A 1K4MA 2NZVG 3O94A 4KSYA 5JISA 3RAEC 4KRFA 3T99A 3BGVA 1Z2NX 3PQ5A 1RWMA 3JQEA 4IIUA 5G0SA 1IBSA 4FILA 3WOVA 4BCDA 4DDKA 5KBYA 4JSRA 1NKSA 1P31A 1HYQA 1GL9B 1V16A 4XM2A 4QM7A 4KRGA 3GCDA 4R1OA 4YCJA 3TVDA 3UBTA 2OK7A 1K9SA 3JQBA 3KVRA 1XQ1A 1FS4A 3NEYA 4KH1A 4XWAA 4AFNA 2CCJA 4AS1A 3HEBA 5JFGA 3W7BA 4XZ3A 2J8ZA 1C30A 1WNFA 1Y9ZA 1KIFA 3HDGA 4RIFA 3G2IA 4ICIA 1DARA 1W25A 2JIMA 5AFSA 5IAJA 3H4MA 4BO3A 4C1NA 5MHTA 4R8LA 3DBLA 4WBSA 2JJMA 1RM4A 1C9YA 1E96A 3AHHA 3KTAA 5TEVA 3TLJA 2GYUA 1TA4A 2E21A 2PBLA 1PTJC 1O89A 3BH0A 4A82A 3QW2A 2JEYA 4U9HS 2RI6A 3GRZA 1ZCFA 2O2EA 3P0RA 5CXSA 3WQQA 4TZKA 5FQNA 1XD2B 4V03A 4LXHA 1WHTB 4C3VA 3KAJA 2DC1A 3C4JA 2P79A 3BXGA 3QPAA 5EIHA 2GDZA 2M32A 5A0VA 2KPOA 2LIVA 4UZSA 4NIMA 3TLBA 1YZLA 4BFSA 1SVWA 4B3MB 1T5BA 1TQ4A 4AU1A 3HI6A 4JAVC 4S1TA 1R74A 3VDQA 4Y0AA 3K5WA 1QH1A 3UO8B 1CQPA 4FS3A 2IX9A 4HRAA 4CMGA 5KREA 4D43A 3KSAC 1UDWA 4IRUB 2YV1A 1K63A 1HE4A 2OV1A 5EHIA 4ZQHA 4G1BA 3G0OA 5DBFA 3VKVA 5KDOA 3PDIA 4N76A 1NBEA 2P4SA 1ZVMA 1O6FA 3F5MA 1XDSA 3QENA 4X94A 3HI4A 5C1BA 1IY8A 5AM5A 2DGDA 5K4HA 3I4CA 3PXXA 1D2CA 4A0QA 1AK1A 5IDXA 1E9EA 4D0SA 1CJKC 1ZO8A 3LC2O 3LQYA 2G72A 2QN6A 4YP5A 4Z1MA 2G1PA 1F8XA 1GGNA 1MBZA 4ZHQB 4K1XA 1J2RA 1T9CA 3PX7A 4G5XA 3K15A 1RQRA 4EB3A 4QTYA 4MGIR 4M99A 4CG2A 1OBOA 2MINB 2C0PA 3CNLA 1KWKA 2QRUA 1GV0A 3SBDA 1HE2A 4ERXA 1HRKA 3NHKA 3KPUA 3NTUA 3GHHA 3CLTD 2BSXA 4RVHA 5KKCA 2J3LA 1OMOA 4K9NA 1KP2A 5TRTA 3LECA 3R7WA 3DHEA 3M6IA 4IQ8A 3HJAA 3AB3A 1SCUA 2CNLA 2XD4A 4JODA 4YRLA 2B2CA 1LJLA 5U4QA 4F0JA 2IXBA 2ZPTX 1QG6A 1A9TA 1UM9A 3BD9A 3LHSA 4QPZA 1AS3A 2XV1A 5KYKA 1BRMA 4QRHA 4CU5A 1G9XA 2QTGA 1N6OA 3DOOA 4HLCA 5C8VA 1XNQB 1H9BA 3KSDO 4I5GA 3KLBA 2JFQA 1UZNA 3D2LA 1DP4A 1MB2A 3LKDA 1D6JA 4ZHQF 1ANKA 1E1QA 1OD6A 1GP2A 2REQB 2VDOB 2W2OA 2X4DA 1LLQA 2QTZA 1EFPB 1HLDA 2E4VA 4NU5A 4M1OA 4XX0B 4EUHA 3ZNOA 3D3KA 1RPAA 4R6XA 3TZBA 5IXSA 1OHHA 1U1EA 2W8BB 3E7WA 4FMPA 5IMSA 2GM4A 1MORA 2AFIA 2XNKA 3ZH9B 3ESAA 4X8MA 1QJ4A 1DCFA 4F8YA 1SXJE 3THYB 5I9BA 1DSSG 2YJTD 3WRXA 2FSIA 3WJAA 1QM5A 3ZCPA 4JI1B 5FWDA 4MVJM 1M2VB 4LXUA 1JE0A 1XQ9A 3MLAA 4I5EA 4PLWA 3CPEA 5CK5A 3X44A 3QITA 2VCYA 3W5HA 4ZAVA 2WJYA 1DTWA 4OH7A 4F3KA 1P2UA 1L5OA 2C0CA 3KNZA 3LWBA 4ILKA 4AZ3B 1X38A 2V97A 4CMIA 3O95A 4ZZIA 1OH8A 1DBVO 2BEVB 4MRRA 3RLFA 4BMVA 3BXXA 4R2KA 1KDRA 4Q4HB 1AHNA 5FIUA 1QZTA 4XEHA 1WD7A 2BC9A 2G3YA 2ZDGA 1RIFA 2HL6A 5LP6C 1H8HA 5GOTA 1ULAA 4KYIB 4JD5A 4CIWA 2CFRA 3BBPA 4AVYA 4DC1A 2ADMA 2G80A 4Q1AA 4B83A 1JHVA 4AZVA 3E9CA 1FQOA 4QREA 4UCQA 1EZ1A 1CEEA 1ZHOA 1Y6QA 3MSXA 3WL5A 2FPRA 1VRVA 4N03A 4I4CA 3AK4A 3CRZA 3AINA 4GZ5A 1KARA 2C3PA 3K53A 1EB9A 4WXPA 1JA9A 4DCVA 2IUYA 1HZJA 3DDHA 4EVIA 1UBFA 3DXFA 1TQHA 3O3OB 2GFHA 2Y1GA 2NSDA 3CS3A 4Z86A 5AYVA 1SVLA 4NXNB 1F0YA 1GDDA 1KXZA 1M3SA 2IZOA 3ZWVA 1ZHHA 5B58C 5DNDA 5A3SA 1LW7A 2XRMA 2OUKA 3KXPA 5J4VA 1YRHA 5ICFA 1LBTA 1A9XB 3BRQA 3I72A 1EJ2A 3B53X 4EJSB 2PAFA 2YJ6A 3AW9A 5EJ6A 4ZCIA 3RFXA 2WUEA 5C5EA 1LX6A 3CEMA 4MW2A 4KQ9A 1JSLA 3TD2A 4YRMA 1XMQB 1H2AS 3P71T 4N0PA 3SF8A 3A05A 1TVEA 2P2NA 5LQCA 4LQLA 3U2QA 4XVUA 1HMYA 3GY0A 1WULS 2I8AA 2VHZA 4AJOA 1OI3A 3DLPX 4PPNA 3H8WA 3U1TA 3B3GA 4CDRA 4HZGA 2IJGX 4EATA 5B4UA 1FB5A 2WSSD 4PQEA 2Z08A 2Q2OA 3I6IA 3RYHA 3DMFA 2ATCA 2XT0A 3KTDA 3W6UA 2IU3A 5DGDA 5K2MA 3FOEC 4HWTA 4MP3A 2V7GA 3EMVA 5EXDA 1G8YA 5KWVA 3DUFA 3JAWB 1NMQA 2X3YA 3ER6A 4EY3A 2X0RA 2QROA 4D9GA 2RGGA 2ONJA 1JH8A 2X9LA 4JEIA 4NJEA 4RZSA 4TTTS 2O8DB 4LCJA 4UQPA 5EXEA 3TZ6A 2ZZNA 1G5QA 1PJCA 4RJJA 4YUVA 4Q47A 5AW3A 4WK4B 2MIIA 3NIGB 4RNDB 4FD2A 5HVNA 3NETA 2GBIA 4BGUA 2GETA 4MUIA 5LNK6 3BJRA 1NSTA 5JWRA 2O8VA 1FTSA 4RETA 4E2WA 4FDLA 1HX7A 1N8SA 1X3SA 3P8ZA 4Q3NA 1XU7A 2ODPA 1NUUA 1Z5ZA 1Z7YA 2BIFA 1KR2A 1RRCA 1HV8A 2A3RA 2ACEA 1ES9A 2AL7A 2H16A 3KR1A 4DL9A 1IVSA 3NCTA 3W5BA 2X7JA 1AUVA 3F8TA 1D1TA 3R7LA 3AU9A 3AKYA 1G20E 2YIVX 1Q84A 4KEAA 4D98A 1B8PA 3EZNA 4WMLA 5K8UA 4NOJA 1CBUA 3SMVA 2RBGA 3BB3A 1WW8A 2QM8A 3DWIA 1XZLA 4UMVA 4Q6BA 3C4QA 2WTMA 3JQGB 1HTTA 6REQA 3AR3A 3CGGA 4BU1A 5F23A 5I5EA 1E2KA 2G07A 3NTOA 3OE7D 4NKRA 5J4YA 1DWQA 3WRWA 2JAUA 4II7A 1DUVG 1HLGA 1RLIA 1NPTO 1R0LA 1YS6A 1P9OA 3JWIA 3Q9UA 4RANA 2OBBA 4Y2YA 4YJ2F 4HV4A 1VLQA 3FBTA 2A0XA 2O5EA 2J6IA 3W5UA 2GYVA 4NE9A 4CGYA 3OURA 5HRCA 1HDYA 2WVJA 1SPXA 2QW0X 3NRCA 4RPLA 2MMCA 4PZ9A 1W59A 5FUQA 2GTHA 1UH5A 4HEQA 1XZFA 4V2UA 2PUJA 1YR2A 3IPAA 4BZWA 5DP1A 4KRXA 1BU8A 4MMYB 5K3OA 3BSSA 3OZRA 1VZ3A 1NNEA 1AN0A 1NVVQ 2CBGA 3OCWA 4TMZA 3I9JA 3I52A 4BNTA 1Z6XA 5LPNA 2HCJB 1HQKA 1RXVA 1E18A 1N7JA 5A4MS 4B3XA 2PUDA 4JXXA 5NLLA 4Q9NA 2Z5VA 2GPJA 3UMVA 9ABPA 4O1IA 1NW9B 3SFZA 4DBLC 4AY6A 4NQRA 1ACMA 3AC0A 3SIRA 2GZ2A 1Q3HA 2XOEA 1F38A 3NIBA 4OQEA 2HX1A 3ELDA 3W8DA 5IM5A 4BNDA 1SELA 1PT5A 4CEJB 1U0OC 2ZKLA 4DWJA 1IMJA 2XUDA 1DQPA 4KN9S 4OLBA 3PWTA 4YT5A 4QTZA 3KJNA 4CLRB 1FSPA 1E6MA 3TUIC 3ZE9A 5FBQB 3WMXA 5K6AC 2R5NA 1O9HA 2QRHA 4TLLB 2FUCA 3WHKA 5KNBA 1EWQA 3LC0A 3F9IA 3I32A 4N0DA 5DM2A 1C7JA 1QQ7A 1XZGA 1LBEA 1ZM9A 2D3TA 3DAHA 2YH2A 3OF3A 4G85A 4OFWA 4XQEA 1UAAA 2WIKA 3Q7EA 3PZBA 3R75A 3Q8LA 4EIWA 4JC5A 2ID4A 3IE0A 4BNVA 4FONA 4LRTB 2BBSA 5BN1A 2RGBA 1YZGA 1YS9A 2WYVA 3H97A 1PJRA 4UREA 5EWJA 3ROXA 4RVSA 1OLSB 2ZANA 2IZ6A 4AIIA 4CM6A 1SCJA 5L6LB 3KLNA 4QNMA 2WWHA 5CLHA 4DLNA 4X62B 4ZV7A 1S8FA 1GDHA 1LXCA 3MC1A 3V8VA 3ABZA 1W7AA 4L2IA 4B6RA 2FJ0A 2ZRIA 1KMMA 1KJIA 2D1TA 2QAGA 5I9SA 1BEEA 1ISIA 3HP7A 4BNHA 2YYAA 4D57A 4EGSA 3BL6A 5F5NA 1A69A 2Q9UA 3AEQA 4XI9A 3RS5A 2MYTA 2I4OA 4WKGA 4WLOA 1SRRA 3CNNA 4X7RA 2FX2A 3W34A 1F4LA 2W90A 4L9SA 4M9SA 1Z4IA 4ND5A 2FWIA 2YV2A 1OBCA 3DDOA 4CV3A 4US1R 2BGWA 2X14A 3HCOA 2H4ZA 1AK9A 1R5NA 3GLHE 4OHKA 4X91A 4ALNA 4I55F 4ID9A 4TT8A 2ISSD 1I9CA 4H3VA 2CKDA 4HYTA 4KKXB 1GWNA 4LXXA 4WZBB 1TAQA 1ZRHA 2YOGA 1TU3A 2AR7A 4WBXC 5TVKA 4EUSA 4TM7A 2VYNA 1Q6YA 1Y1SA 4M36A 5IEJA 3GVPA 3H6HA 3D8TA 1UK9A 2MYNA 1G17A 1R6XA 2N9UA 5K8LA 2X2FA 1YBHA 3A6LA 3GRFA 4IEEA 1RAHA 4IXMA 5T4HA 3OOHA 1MG0A 2B37A 4FLMA 4GOMD 2MJLA 5TY0A 3P0HA 3BH7A 4QECA 3DKPA 1PR4A 1V3QE 4BXOB 1NVUQ 3KKZA 5FWAA 5EA2A 1Z8HA 4R31A 1M6EX 5A5FA 3IVMA 4JYAB 1RJGA 3CZCA 3FZGA 1Q95A 1BJTA 3MJSA 3HKBA 4D9KA 2QRPA 4QTUB 3EGXB 4OB6A 2ZYDA 3AH8A 5K0ZA 4C6TA 1AHIA 2ZCVA 3RD5A 1W73A 3C15C 3LUPA 4RVDA 4YGXB 4DMRA 5ISMA 3ZWBA 4X6YA 3ADBA 3ZDAA 5EYPA 1WMDA 5SY6A 1YQ9A 1AQNA 3AFGA 3HA5A 3TX6A 2EZUA 4GMFA 2QAIA 1FUIA 4G24A 3T5DA 4Q1DA 4MQUA 1OQAA 2Q4EA 5CM8B 5TPZA 2WOOA 3MWYW 3IP9A 2FNAA 1OU4A 1VHQA 3PHHA 1K5HA 1G4AE 1R6UA 2EHDA 2WHEA 4LDPA 1KAGA 4RPJA 4U5QA 3TNFA 4ZJUA 3I5YA 5CR9A 2VBCA 1U7ZA 4E2ZA 4WOPA 2DQKA 3A6PC 4LQ4A 1PSDA 1KEUA 4WK6A 3ZE8A 4ZFNA 5CXUA 4Z9YA 1KYQA 4MVWA 3U3OA 4CIAA 2Q4TA 2P9FA 2E7ZA 1PG2A 2RGUA 3OTQA 1P91A 1P2DA 3M9XA 5SYMA 2CB9A 4DLUA 2ZTUA 1YE3A 2ECPA 4CUKA 4EHDA 2BHRA 2WV9A 4WDRA 1W9MA 3DLBA 4Y2XA 2YBEA 3CF6R 4OLJA 5HCIA 3BGOS 2IK8A 2HIMA 1YASA 5DF1A 4B5LA 5I7FA 3O2JA 3WWCA 3R7AA 5HZKA 1SIOA 2BGTA 1RABA 3D1VA 3UKJA 1KC3A 5ITZB 4GNKA 2X8JA 4L8VA 2XNJA 3C5WP 1YRWA 3D4BA 4JBNA 1AF7A 3KEFA 3M2TA 4FFNA 5B1HA 5TMBA 3IE2A 3NHRA 4F2GA 4HB4A 4RY9A 2YN4A 4A0FA 1TT5B 3IT1A 2K6GA 1EU1A 2EX1A 3DBVO 1AZTA 5LYYA 2ZBGA 1N77A 4Z9XA 3D0RA 4AC9A 1XZDA 4JT9A 1H2YA 2NOAA 4YMIA 3V4PB 1JEQB 5JROA 2IE0A 3CH5A 4TWAA 2W2QA 2XJ9A 2OBXA 5C80A 5EJ5A 1ABBA 5G4KB 2DH5A 2PYIA 3KKLA 3QVGB 4TSRA 2OZPA 1WS6A 2PV7A 1QIIA 1ZRNA 2Z2XA 1MXHA 4UJ5A 4GR4A 5BRAA 2JIQA 4C87A 1NFQA 1RJ9B 1VI2A 2DUMA 2EG9A 2XODA 3QBVA 4TKVA 1YRLA 5LZ2A 2XUQA 1U3WA 1ENYA 3NEJA 3BFXA 5BNIA 3GLGA 1A77A 3LRPA 4AJHA 3O38A 4ZOCA 3LY5A 3HGMA 4A7PA 5DNAA 1W4CA 1IRXA 3O93A 3HVHA 1MFZA 1UC4B 4F71A 3UAYA 3QXJA 2NVUA 5FFFA 4D9BA 1BHSA 4EB6B 4FX5A 2AI3A 1C2YA 3LBHA 5FBKA 5LBUA 2VJLA 3NTVA 1LK5A 3WGOA 1N34B 2IH2A 3ZCVA 2GXAA 5B2EA 1SG6A 1TIBA 4OLAA 2IODA 3B6EA 1G3IA 1QRAA 4BBPA 4LF7B 1QU3A 5FPPA 1P5ZB 4QL3A 1PD1A 1GQFA 3EDOA 4GSYA 1VJDA 1Z4LA 4MAFA 4ZTBA 1K7YA 1YJXA 3V97A 3O3NB 4N65A 4ER5A 3PEYA 2I7VA 4OUKX 1KOJA 3AWDA 1A1VA 1HEYA 1DX4A 1XE3A 2AOVA 2W2PA 3CMMA 4MKXA 2J07A 3IPRA 2WICA 3D6JA 3WQHA 4DS3A 4DMCA 3O1JC 4LJ4A 2YICA 2BTQB 4RZQA 2FP4A 4I4TB 5I8WA 3JQFA 4OMFG 1WSBA 4DLTA 3EC1A 3UXHA 4MV0A 5E4JA 5BSFA 1GAJA 5A5DA 4M0UA 1P1RA 3RHSA 2POQX 2P4UA 4JJKA 4L9AA 4K6HA 3AT1A 3EYAA 3B6JA 4U2DA 2GCIA 1QGUB 2ZKIA 1U8CB 2Q9AA 3GUYA 2OXIA 4XD7A 4FNOA 1CIVA 5IASA 2DSNA 2GCNA 3AHFA 3KHKA 4KXXA 2H5LA 3RS3A 2F3TA 3HM9A 1JDPA 4XYLA 3TOZA 1SAYA 1Y5NA 1ZGJA 1IBKB 3LRXA 1S5PA 4RKQA 3RSZA 5EE5B 1SN7A 4MAAA 1NVAA 2WNHA 3G2NA 3N7AA 1KEPA 5B3LA 4D3SA 1Z18A 5IN5A 5AVZA 3ICOA 4JK3A 1TPYA 4XASA 4EL5A 5JV5A 3E1KA 4TTRA 5CMLA 1H2XA 1R8YA 3BK2A 2JLRA 3DW3X 4J0GA 4J9VA 4LVUA 4RIEA 2ASVA 4AD8A 4EDFA 2ZYGA 2C2YA 5K8TA 1PT6A 1QU2A 2XB4A 3WNBA 5AW4A 5BUCA 2WIAA 4FW9A 4ZCPA 2LD4A 5IARA 2QRMA 2PUVA 4KUHA 3TIIA 4QOHA 2W0MA 3GUCA 1TYDE 1SKAA 2ONCA 1XD9A 4FGZA 1V48A 2ZWMA 3L7IA 4GLFA 4PNEA 1USIA 1V7ZA 2FH5B 4B34A 4B46A 4HHEA 1TKAA 2OUIA 5C52B 2Z3VA 5LQJA 3DAFA 5JJLA 4MWEA 4BLQA 3FRIA 2FW9A 3MJRA 3TBHA 1L7QA 4EF6A 1SBCA 3ZHYA 3A1VA 3CCFA 1T0IA 4JJGA 1LPOA 2LVBA 2PX0A 4YR9A 4IFEA 2P5YA 5HRUA 2FEAA 4CCYA 1O4VA 2VF7A 2FN9A 2DB3A 1G8GA 3RVNA 1DJQA 4M8NE 3M7IA 1WTCA 4ZWNA 2FOIA 2PVCA 3UM9A 4AK9A 4DMUB 1MB9A 2VLIA 3OE1A 2HHAA 3VZRA 2CDRA 4OLFA 2C7OA 3CFYA 2J1LA 1II8A 3OY7A 2JIRA 4JB8A 4WN9B 4MQFA 1XP5A 4ZEMA 1DEOA 3KIPA 4NOMA 2OG1A 1N5RA 2E4UA 3C3AA 1ZVJA 1EFLA 3UUGA 1HT1E 4IS3A 5DI3A 3RS9A 5L9AA 3ZE1B 5AIAA 2P67A 5IUJC 4TWBA 4IDOA 4TRMA 3ND9A 5KTPA 1PFQA 1WXIA 4IV0A 1GPYA 2OB2A 5CFOA 1B1AA 1VM6A 3F2IA 1QZZA 3IAS6 3RTDA 1YQUA 3NOVA 4JHXA 1W2GA 4W8HA 4BKMA 1Q22A 2R1ZA 3UJDA 2KE5A 4PO8A 1I6WA 5EE9A 1TGYA 1NIJA 2UVPA 3BMOB 4I7EA 1C3VA 1M6YA 4MKHA 3UAZA 4ZU6X 2O8BA 3EARA 3K16A 3QFTA 5TT0A 3AP2A 1YJAA 2BKAA 2IPNA 4C5BA 2ENUA 1MMFB 2P6PA 4KYVA 5DHRA 1P1BA 2C2BA 3RFCA 1Q1QA 2OSVA 1JIVA 2R7NA 4XPZA 4AZSA 3EISA 4ZAZA 4EF5A 1GKIA 3HYSA 4ND2A 4WNCA 2FSPA 2Q9CA 3A28A 4HOYA 2QUBA 1AMOA 2HNAA 4ON9A 3WLEA 5KHLB 1UF9A 3KQUA 2AG8A 2WSMA 4E94A 2ZXUA 2C2OA 2QP9X 2HREA 3I42A 2LWIA 2XNCA 1Z5NA 5D6NA 1QHSA 3KD2A 3WJ2A 3V1UA 3F3SA 3OTWA 4QFBA 5I48A 1R88A 4G5SA 1VE7A 3BS4A 5EPEA 3UMSA 1JHYA 1K2WA 1ZM7A 2VDUE 4P4UA 1GHTA 5BSWA 3ELBA 2BFEB 4JR2A 4Y0NA 2VRNA 2HPHA 3OJ0A 4HAWA 4NJOA 2PT7A 2R68A 2PCLA 1CR6A 1CE8B 2FLVA 1KC1A 2QWXA 2FN8A 3GJTA 1CQJA 3CT4A 5B4VA 3LQ1A 4LY9A 1FDIA 1ZVVA 1GRNA 4M8IA 2Q50A 5HIKA 1CDOA 1GU7A 3MELA 5FAKA 5A4KA 1CB7A 3WVNA 3KYDB 1DJPA 4GMHA 2CXTA 4RZXA 3TRHA 1A5TA 1T2VA 1Z6TA 2XKAA 4PZEA 4DIKA 5CCEA 2KWIA 4IDQA 2YKGA 1W44A 6ABPA 2PY6A 4PRZA 1A7AA 2G9UA 1V6CA 3RJ5A 2EBUA 5JYEA 4MWDA 2FFQA 1HG0A 3OEHA 4OFXA 3CR7A 4DZTA 4J9UE 4UUNA 3FMIA 5GIPE 5HFNA 5JRDS 1N5DA 4HAYA 5KHOC 1I5RA 3KOZA 1FVFA 1E9CA 3Q87B 2BM9A 2ODNA 2OESA 4BTLA 1DTEA 3RJ9A 1YULA 4HZUB 4MA4A 4OL9A 5DASA 1E61A 2B36A 2GX6A 2XZDA 3G5UA 2YWRA 3Q40A 5AK6A 1L7EA 3T7TA 2AVDA 3PGXA 4L8FA 4MRVA 1EJBA 2J9ZB 1HE1C 3EG5A 4P4LA 3HKEA 2NXNA 3OX3A 1X9GA 5AIBA 2VQ6A 5I01A 3OFVA 4O3FA 4PGAA 4WXEA 1K97A 1NYRA 3WNQA 4LMRA 5JMOA 1T8YA 3K5PA 3RK1A 2NO0A 4X64B 4V1CA 2A0YA 2CXHA 4X24A 5BR1A 1KO7A 4EKEA 4KIFA 4A6DA 4Z51A 4OI1A 5BV2P 4CFSA 1E6KA 2H4JA 2IYFA 1QXSA 1RXWA 4KQGA 2WE7A 3DCJA 1E0KA 1OAAA 2AOUA 4MKZA 1ZCBA 4ZMRA 2V4MA 3HQ4O 1NF9A 1IG0A 1BS2A 3K20A 1E64A 1XYVA 4DLSA 1RLOA 1AQ6A 2JBAA 2PFKA 3SLRA 1VE1A 5JC1A 1RWWA 3PWKA 4N1AA 3TZLA 4GZ6A 4GYWA 2JFNA 2W2LD 4ZJZA 1E2NA 1DIRA 2I2BA 4GWLA 1GR0A 3MINA 1XVTA 3AR4A 3CZAA 3RQSA 3FROA 4JP3A 5LR6A 4OMUA 3SDSA 3W06A 2TMGA 1B6GA 3NW9A 1LFAA 5LXTF 4RVFA 4ED9A 3K9NA 3OICA 5GP1A 4ZEOA 4BO0A 2DY0A 3E5HA 2PEZA 1UQTA 2WILA 1O96A 2XLCA 4ACAA 1U28C 2I91A 3WLPA 2WI8A 4DY6A 4UXIA 4GYJA 5A04A 3VKGA 1UP7A 2C9OA 2Y1KA 2G5GX 1M75A 3QIAA 3LCVB 3JQAD 3CLTC 3Q6MA 2JASA 4D26A 1E69A 3FF4A 2H48A 5K3FA 2EAUA 3K8YA 3JZFA 4GSLA 1I3NA 2H00A 2QR3A 3R74A 1P1JA 5DW3A 2O2XA 3RVKA 2PJDA 5HMLA 2POCA 1JNXX 4YXFA 1C1XA 1HFJA 1K27A 1LRKA 3C6ZA 3HSSA 3IEUA 3LX5A 4KBGA 2KYRA 3QUQA 3QVOA 4HQLA 4KQCA 4F5WA 1S8OA 3D64A 1NLZA 1V2HE 4L0QA 4F12A 1V4VA 1PHPA 1PL7A 3R5SA 4NQZA 3CBGA 4Q6WA 3G7SA 3J80A 3GUVA 4HGPA 3UAWA 4ALIA 1FBNA 4R2IA 1K3UB 3T1VA 1PS8A 1ZLYA 1IY0A 3TAXA 5B4TA 5K0GA 2FMIA 1UPTA 2R00A 1MH9A 2ZI6A 2PUCA 1VBNA 1BVRA 1YIOA 3TAHA 1KZ4A 1MVNA 3IALA 4RQBA 5B6JA 2PQ0A 2CLKB 5LP6F 1KKMA 3L7NA 3PC3A 4LZOA 1OREA 2OL4A 2J7PA 4YASA 4ZANA 1KL7A 2ATVA 2FQWA 3VV2A 3TKLA 1UMKA 2QSYA 3EXG1 1EGHA 1FRNA 1UMCA 2O2SA 3PJFA 4FGJA 4P4SB 4CLDA 7REQB 1DXHA 1ZNYA 1G2QA 2F1KA 4CIYA 5BUSA 3RH0A 4AJ4A 3H2YA 4ZYTA 5FULA 1JFFA 1EVEA 2D8AA 2GCOB 1JEYB 2R4TA 1GPKA 3NHWA 1LW6E 4A9AA 4QBFA 1WR8A 5EJ7A 2G06A 3DJFA 3L7CA 3A11A 4DNPA 1HEUA 2PGLA 1VOTA 1A2BA 3HN7A 4BFUA 4ZO8A 2QJWA 2C95A 4LSWA 1CY2A 2QX6A 2PH5A 4PG4A 1CJMA 4EHNA 3ANTA 4D9HA 1VCOA 4GI3A 1Q7GA 5CT6A 4MI9A 5AKGA 2RH9B 3IXMA 2J6CA 2C2ZA 4OI2A 2H08A 2ZJOA 3D9QX 5IM4F 3PX2A 2O07A 1CUCA 3A1WA 4ZVMA 1WB9A 3V46A 4L8GA 5TQ0B 3R0ZA 4EYOA 4UOEA 3R24A 4GR5A 1FLVA 2XUHA 3T9FA 3X3HA 2IEBA 2I78A 2W9XA 1WOYA 2XGSA 3B36A 3DEIA 3PXGA 4FINA 1EE2A 4FMDB 4C7OB 3DONA 4DGSA 1KI8A 5JNTA 3BZWA 3O8BA 2XEDA 4Y67A 1B6TA 3TI9A 2GK4A 2JHFA 2O3SA 3A2KA 1N3BA 1J06A 1QANA 2YNMA 1ZGCA 1GRVA 4LXGA 3KLPX 4U2BA 1Z5WA 3LFUA 2BFOA 3D7LA 3K0BA 4L16A 4ARSA 3T3DA 1PRYA 2BKVA 3RRZA 3DCNA 1Y0BA 1D4FA 3HLTA 1G63A 4JYCA 5DRYA 4I1PA 3H8SA 4U9UA 4R1MA 5IHPA 4TUYA 2HV8A 2XRFA 4G0MA 1VBFA 2VOJA 3KTOA 3TL3A 3EVZA 1E4EB 3GRPA 2D4HA 1XK6A 4YQFA 3PCXA 2C7VA 1A72A 3DDUA 1QPZA 4DHWA 3B9RA 1TMGE 2CVZA 1I10A 3AUSA 1E8DA 1C0EA 3FE2A 3HR7A 2FUG1 3CYFA 3FPSA 3E2PA 4FMDF 4BAUA 5JO9A 1RCFA 3VPBA 2IEDA 5DNWA 4DKJA 1SA0B 5G0TA 4LY0A 5BRJA 5CIQA 1PEAA 1EFRA 4EUEA 3CRMA 2YZKA