4EPYA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epyA00
2AK3A 2DBYA 4QL3A 4F4JA 2EQBA 2V54A 2HT6A 2ZRDA 1G3RA 2O0JA 1KZ7B 3EW9A 4B74A 2KWIA 1ZAKA 4GMDA 3K9GA 2QT1A 1VG8A 5EJEA 4HB0A 2B8TA 3OAAA 2WJIA 4CEHB 2ERYA 3FWYA 5JRZA 1EFRD 1W5TA 1W4BA 1KO7A 3BFXA 1S8FA 3VR4A 1MO5A 3MRSA 4MH0R 1MOZA 5J40A 1UBCA 2FZ4A 2C99A 2TMKA 3KXKA 4M9SA 4KI0A 1N6HA 2RGAA 3CPHA 3SHFA 2R62A 3W5IA 1XJ0A 2V7QD 3DO6A 1XDBA 3BB3A 4PPNA 4R9UC 3RDPA 4MGZR 3RSLA 3T1OA 1W2HA 3B85A 2IYQA 2RGNA 3C5CA 4L8GA 5HPYB 4GOJA 4CT5A 4RFVA 1E1RA 3IGFA 3EZ6A 1DVRA 1Z6GA 1XMJA 1LTQA 3OFNA 1X1RA 4KVGA 1XPUA 3IPYA 3AF2A 2Q21A 3GLGA 1DAKA 2ATVA 2BOVA 4OQMA 1KHTA 2ZI9A 5A5GA 2P0EA 2YC2C 1JR3E 3AV0B 1E2IA 1NG1A 3LDAA 4Q9KA 4DCVA 2SHKA 3QY0A 2QRNA 2WSSD 3GJ4A 4E07A 1TNDA 4O0MA 4TYYA 3AKEA 3VHXA 3W6OA 4DCNA 1DEKA 2ZI5A 5DH9A 1U0JA 2ZUCA 2F9MA 1KOFA 3BE4A 1BMFA 4YMWA 3WMFA 3OZXA 4Q9IA 2RHMA 5FUYA 2Q3HA 4TL6A 1YR7A 1KI8A 4URYR 3K09A 2EVWX 1DO0A 3K1JA 2EFDB 4II7A 3VKHA 5DSZA 2F43A 3T06B 1W36C 3U60B 1Z0FA 2JGNA 2HCBA 1KI2A 4QHYA 2NG1A 4FWTA 2H57A 1LS6A 1KMHA 3BK7A 3K0CA 4PXAA 1OH8A 1GSIA 4Q4HA 1XMVA 2OBMA 4Q1BA 1AK2A 2HF9A 1N0VC 1CR4A 2IYLD 3CNLA 2CVFA 1NBMA 2GCOA 2HCJB 2FMXA 1Q22A 3P26A 2Q9BA 3X1YA 1OLOA 1A82A 1F2UB 4L5BA 4LJ7A 4A92A 3GEIA 4N0EA 1N6NA 5TDHA 2P6NA 5J4LA 4NL4H 1AIPA 3KQKA 3SEAA 1R7RA 2J5XA 1XD2A 3GLHE 4Q1EA 4DSUA 3BRWD 1FPMA 1KKLA 1S0UA 1KY3A 1XTSA 2WKRA 4M2LA 4BZXA 1W48A 2FX3A 1KZGB 4M9XA 2W83A 4WOPA 4P33A 2DFTA 4O2LA 2QORA 5FL7A 4JL5A 3VR2A 4EUNA 2IF2A 4TLDA 1KI1A 3SDZA 1BYUA 4OI4A 4BLTA 4EQ6B 1GZSA 1ZD1A 1G5RA 5FBWB 3L8YA 2FSHA 3ECCA 3JZAA 3R8FA 4NYMR 3NH6A 2PT7A 3RNLA 6Q21A 1DAFA 4F38A 4ZDIA 4KV9A 5EUMA 4GI7A 3B1ZA 2HDNB 1WA5A 5J4VA 4X8MA 3CKLA 4Q21A 1IJFA 3BORA 1W2GA 1Q57A 2ZROA 3SQWA 1TQ6A 3FOZA 1NBME 3MD0A 2J7PD 5F2EA 1G41A 2DWQA 3AGPA 4MKFA 3U3JA 3WMEA 3UANA 2IWRA 2ZRGA 4N0DA 1E2GA 1JJ7A 2VL7A 2ORVA 5HCNA 2IHBA 1SKYE 3UXMA 4LJ6A 2CNWA 4JVLA 1IN8A 2W00A 3A4LA 4EIWA 2YZ2A 2ZE5A 4BPBA 3RS0A 1W5SA 1L7VC 1ZCBA 5TMPA 4LWZA 4BRUA 3TUJC 4LV8B 2FA9A 1LFDB 2J0UB 5AUOB 3OIUA 5KNBA 1UPTA 5GVRA 4Q18A 1AQUA 4LSGA 4D81A 1A2KC 1IN4A 4MGKR 4TTQA 3HR8A 3VTKA 2IYVA 4LCBA 3AP3A 2YC4C 3QF4A 5AWFC 5JBQA 2KSQA 3X1WA 2XEXA 3DL0A 5FUVA 2VSOA 4DCSA 3JVUA 4BFSA 3QXHA 3K0SA 3NEJA 4DLRA 1QHNA 3K70B 4HEJA 3ZVLA 1P60A 5CYPA 3LY5A 2ZYVX 3QF4B 4LZZA 1Z63A 2ONJA 3KFXA 4KCGA 2ZXUA 1GWNA 1VG9B 5HE9A 1E4VA 4LJ9A 1G8HA 2AD5A 2D3WA 2AKAB 4RD0A 2RGBA 3PQCA 2VP9A 2L0XA 4CVNA 521PA 1C1YA 4BEBA 4LI0A 3TK1A 4K46A 2AFIE 1JECA 1HT1E 1SVKA 2R6CA 4QBGB 5DI9A 4B6EA 4IDHA 2PT5A 5K8TA 4ILEA 2C9CA 3AGQA 3EC2A 4WA7A 2UVQA 5CB6A 2RGEA 4AC9A 4UNSA 2NZJA 4A36A 2PH1A 4HAYA 3OFND 2VA8A 2W6JA 1P7CA 2JLXA 1BO6A 3QKUA 4D0GA 1G7TA 2C8VA 4QNRA 3IDQA 4A0GA 3AKDA 3FHOA 1EFRA 2I1QA 1II8B 3CBQA 4DB4A 3QG5A 3LLUA 4X8OA 1GFIA 3PG5A 4B2PA 1P75A 4PQRA 4DT1A 3FE2A 4W5JA 1MRSA 1R5BA 3ZIAA 3D7MA 1VCMA 1E9FA 4MYUA 5IHPA 2WWGA 3AUYA 1IY2A 2AKYA 3SI7A 2H92A 4PAQA 1UBEA 1T6NA 5LBIA 3ZVRA 4ZDJA 5CM8B 4A6XA 3T35A 4EQ6A 3U7FB 5SZIA 3QEJA 2QQ0A 1LF5A 3LA6A 2BEKA 1Z07A 1W36D 1JJVA 3AF3A 1R2QA 4ZI2A 4L9WA 1CR1A 1RJ9B 5SZHB 2ZVPX 2ZJ5A 1XWIA 3VU9A 2REOA 1XEXA 2Q0HA 3CB4A 3FGNA 4EDHA 1KO5A 3ZZUA 4MDFA 1GG2A 1GITA 4Z8XA 1GOTA 2B7BA 3FVQA 1NP6A 4GP6A 4LK2A 1CIPA 2DWOA 3U44A 3UWOA 3IEUA 2B92A 1AQYA 2DFKB 1K6MA 3MGCA 4DWJA 4YMVA 2PZFA 2Z83A 2IL1A 1N6PA 3ADDA 4M9ZA 4D4MA 2FFAA 1G7SA 1WRBA 2ZR7A 2QI9C 3X2SA 2F1JA 3R7WB 5EP1A 3RANA 3BFVA 3Q5EA 4P3YA 3RRZA 2HJGA 4DUGA 1NMYA 4B43A 8OHMA 4KODA 3PVSA 4P4UA 2PLRA 3DOFA 4KSCA 2QPOA 4R2HA 3I8SA 3FHTA 4NYJR 1TQ4A 3C5HA 3EA5A 4LHXA 1KMHB 2PLFA 3W90A 4D82A 1LV7A 2QEQA 4G0NA 5JJLA 2FFBA 3IO5A 1COWD 4A8JA 4TYWA 5EXTA 4WW0A 4GOKA 1M7BA 4UJ5A 4F91B 3DVLA 3CZQA 1ZNYA 2VF7A 1B0UA 1Z08A 2GK6A 1NI3A 3F5FA 3MJHA 4URUR 5TV2A 1XPRA 5L3VA 1IN5A 4LX0A 1TTTA 4TLCA 1ZM3A 2ZI3A 2IS2A 3PXGA 3SFZA 3MSXA 3AM1A 3M6AA 1G1MA 5DHFA 2YNMA 1G4UR 1P4SA 2CE7A 1U0HC 1W4CA 2IXEA 2XSZA 3BJIC 5DIFA 2FFHA 2QMEA 4EFNA 3RWMB 2RH5A 3AVOA 2R8RA 4JSYA 3PENA 2D62A 2YOFA 3WNBA 1YZLA 1X6VA 2WIBA 4OJKA 2ZRMA 3A1SA 5KNDA 3A4NA 1XMSA 4V0NA 4OHXA 3IILA 3MFYA 3GLGB 2Z4RA 2X8AA 2WVJA 1IQPA 5GJBA 2QM7A 3GP8A 1DO2A 2VIIA 3T61A 3QUSA 1RKBA 4IVRA 3ZLJA 4BASA 2C03A 4HZIA 1DAHA 1MO4A 1DS6A 4JBXA 3OAAD 2BKUA 1E79D 3U3KA 3CNNA 4CEIB 1NLZA 1V5WA 4NYMQ 4AK9A 3R8CA 3HPQA 5K8IA 1OHHA 3CF2A 3LO5A 3ZS8A 3U5ZB 2ODWA 1VCNA 3WYFA 3U61B 1SZPA 2OAP1 4DRZA 4GRAA 1TF5A 3THOA 1EFUA 2OAQ1 4D2IA 4FIDA 1XEFA 1I2MA 2QBYA 3C8UA 1CJVC 1SQ5A 2EYQA 3W6PA 3GFOA 3ZD7A 2BBOA 3BH7A 2NQ2C 3KB2A 5EE9A 2PX0A 2MSCB 1F3OA 4O3MA 1JEDA 3NDBB 5JS8A 2XB2A 4B3CA 1ZP6A 3PEWA 5FTJA 4B2IA 3RABA 2GESA 4A0FA 3FKQA 1NN1A 3A1TA 5EXSA 4Y0AA 3SNHA 5HZHA 3TH5A 3NBFA 3A1UA 3QVVA 4G5SA 1J99A 1XD9A 1PZNA 4DSOA 4XOIA 3TW8B 2XJ9A 1XCGB 3CUEF 2NGRA 4HYYA 4PQFA 4R2IA 4ZDWA 4C0BA 2JCSA 5KDOA 1X86B 2KB0A 3RAPR 3ZVMA 2ATXA 1U8ZA 1KI7A 4UNRA 4D4LA 1AZTA 3HR7A 3SQXA 4ASUD 3VKGA 2JLSA 3GJ3A 4GBMA 1KAOA 1JAHA 4IDQA 3LD9A 4TSFA 2I1VB 3P27A 4LYFA 1E96A 2A2ZA 1E9SA 2QY9A 4DDWA 4LYAA 1ELOA 4IDOA 4HLDA 2ZE6A 3FHCB 4Q9HA 5FBLB 4DEXA 1JPJA 3HJNA 4MKGA 1N0UA 1YZKA 4NPHA 1W1WA 3DM9B 2O8EA 1D2MA 1GNPA 2WAXA 2QTHA 1WQ1R 2HJVA 2V6IA 4MKHA 4FN5A 1G6OA 2H17A 2PZEA 5P21A 3TQCA 2C2HA 2GZDA 5EE0A 2WSSA 2OFWA 1U81A 3AUXA 2WOOA 3PEVA 4GZMA 3SN6A 3WP0A 4PO9A 1BIFA 1RRGA 1DAEA 3RHFA 1EFCA 1GRQA 4A0HA 4G5GA 2OUKA 1M34E 2GCNA 5HR5A 4ZCLA 4XSGA 1ZIPA 1II9A 2GTPA 1HQCA 3AP2A 3U2QA 4D4JA 1NN3A 3EG5A 5EZ6B 4Q47A 1OKKA 4PC2A 1L4YA 2CHGA 3LBNA 2OBNA 3GLFE 4IXNA 2O0KA 4DDTA 1KI3A 4R7ZA 1ZD8A 2ZRIA 2GVZC 3WYAA 3QI2A 2J0SA 1G3MA 2GJSA 2WJGA 1W0JA 2ZI4A 1XTQA 3JVVA 4LBZA 2ZYWX 4BFZA 1HURA 1HUQA 3KTAA 1D9XA 1EESA 3GFTA 1M2OB 4M1YA 3NBXX 1N6KA 5HE8A 4KAXA 1UBGA 4JT2A 4X8LA 3ZJYA 3ONWA 3FMPB 5GJCA 4XVQA 4M1SA 4XWKA 2PCJA 1K8RA 1LF0A 2ZREA 4PSVA 3SBDA 1E2FA 3I32A 2R44A 2VF8A 2GVDC 4PFSA 4QGGA 4Q7MB 2E87A 2ZRFA 4QG7A 1JR3A 3UMRA 3WBKA 4HATA 2GETA 1GTVA 1M1YE 5K8LA 4CEJA 2N1BA 4MUAA 2NO1A 1ZNZA 2GBLA 1ZU5A 3K9NA 5JZVA 1DG3A 3GLGE 1A1VA 2CDNA 4BLSA 3UMFA 2VSFA 3T1QA 4NKRA 3CNOA 3K0FB 2CCJA 1XZQA 1NVWQ 1SVOA 2QMHA 2UKDA 4I99A 3LLMA 1KGDA 3AF1A 4NBSA 3Q7PA 2J0VA 4BQSA 1E0AA 5BWMA 1TADA 1ZM2A 2J7PA 4FCVA 4NHOA 1Z6AA 2GEDA 3B8HA 4K8OA 5J47A 2EFEB 3ZGXA 1HYQA 1FP6A 1PUIA 2XB4A 4AI6A 2QP9X 3KQHA 1UADA 1GAJA 4Q4JA 3T5DA 1QVRA 3GEEA 5GJVC 4LBWA 2REXB 1F48A 3H84A 4JYCA 1DARA 4OQXA 5FUWA 5BQ5A 3PCRB 3LH5A 1T3LA 5SZKB 2ZR9A 1XF9A 1JBKA 1EK0A 3GLHB 4KLNA 4V02A 1DG1G 3J81k 3QENA 2ZRCA 1KJZA 5TY0A 2V3CC 3NTUA 1CRPA 4OI0A 2RGGA 2H7VA 2D7DA 4B75A 3KJIA 3UK6A 3A36A 3BC1A 3PUZA 2QPTA 4KBFA 2NPFA 5JFGA 3WNCA 3UMSA 1SGWA 2IYWA 1I2DA 1HV8A 1SKYB 2XXAB 3BWDD 3QKTA 2WPDA 1E9RA 3W9YA 4UNPA 3TE6A 4C9BA 1E9EA 4KHZA 2ODBA 3NVAA 4LC1A 1ZD9A 3CRVA 1W49A 4BLPA 5J4HA 5F3WB 5AR1A 4JVNA 3AH8A 3KQUA 4C0QC 4DXAA 3AVPA 1KJWA 4WIAA 4CEHA 3RSOA 4PAMA 5BXQC 3ADBA 2IT1A 4LY6A 2IYSA 5JI2E 2OCBA 5KUTA 2J46A 2VHTA 4BECA 1GKUB 3TJZA 3L43A 1BS1A 3REGA 2ZRLA 1XTIA 4YXWA 5DYIA 2ZRBA 2ZEJA 5DHAA 5EE5B 4QJ4A 3K0EA 1TPZA 2V7QA 3UIEA 3LAWA 3VR1A 2JLVA 2G9NA 2PBRA 4RKEA 5EUQB 2JDIA 1F5NA 4L9SA 4POAA 1AN0A 2GZHA 3GJ0A 1FMJA 4JS0A 4URXR 3E70C 3QF7A 4BFXA 2V55B 4BZPA 3GJ5A 5K8UA 4IKEA 4RY2A 1JQLB 4HAZA 3RVBA 1G18A 3PIRA 2IK8A 2P2LA 3T1TA 1W4AA 2KI5A 2IX3A 1UAAA 3K09C 2EWVA 2WWYA 1ZM9A 2Q6TA 3PUVA 4L4UA 4Y0VA 1MO6A 1S3SA 3H86A 4ESHA 3SJAA 1GKYA 1CRQA 4V0LA 1T91A 4S2EA 4QXAA 4NCIA 2JLRA 2IUTA 1N6OA 3U3MA 1JQJC 3DHWC 1NL3A 3K9HA 4LPSA 2FV8A 2V6JA 3P1JA 5KPDA 4TMXA 1NY6A 1ZUNB 3CF0A 1IY1A 3NKVA 4KFUA 4ZO4A 1Z0IA 1QG4A 3CRW1 3SFVA 3SYKA 4DVGA 3LBHA 3NIBA 4BLRA 2H5EA 4MA4A 3GPLA 3MCAA 2DWPA 5CYOA 1WMSA 2WJHA 1Z28A 2QRZA 421PA 5KTYA 1BYIA 3VNUA 2PL3A 2RGXA 4Q1AA 3PR1A 4NH0A 3L0OA 5KOYA 4PHGA 2XOKD 3C14C 3O47A 4G5QA 4JSTA 1OF1A 5JRJA 4FCWA 4RCYA 1VIAA 3TSOA 3KUDA 4CYMA 5C2JB 4DDVA 5LD2C 1AM4D 3M0EA 5B57C 1TQDA 3VFDA 4TL7A 4D26A 2WAYA 4OHVA 2BIFA 2DHRA 4WZ6A 4OI2A 5AJVB 2MSDB 4LYHA 2ORWA 5J5CA 1O87A 4ITRC 4QM6A 5GVSA 5G3ZA 2HEIA 4M22A 5C4MA 2CCKA 1E2QA 1R4AA 3A6PC 1VG0B 4TWZA 3T1VA 4L16A 1R8SA 5KYKA 1M7HA 2ZU6A 1S2MA 3PEUA 4HZUB 1UKEA 1E2HA 2F55A 3VX3A 2FGJA 4JJZA 3N2EA 2OXCA 1KDPA 4FWIB 5CLQA 4QNMA 1N0WA 4S35A 2GF0A 2IC5A 821PA 4IVQA 4GFDA 5JWHA 2V9PA 4ACAA 4TQ9A 3AVYA 1T9HA 1W36B 3L0IB 4AG6A 3VNVA 1UKYA 4XWOA 3CPEA 3I1FA 1YZGA 4FMCB 2ZPTX 3I8XA 1CJUC 3W5JA 1ETUA 3DOEA 3QKRB 3EC1A 4I1UA 4TN1A 2HLDD 2FH5B 3FDIA 3PEYA 2O8BB 2YOHA 3ZIAD 3U4QB 5CJ2A 3NHBA 3TQFA 3QEOA 2OLKA 1Z0DA 1SXJD 3W3ZB 4OQLA 2R6FA 1U0LA 4HLUA 3KX2A 1JR6A 4NCJA 4U7DA 3D3QA 1TMKA 2B8WA 4E22A 4TYNA 4CZ2A 2FPMA 1O3YA 4KJZA 1G8PA 1US8A 5JI3E 2ZYUX 1J70A 4GPTA 1P9WA 5FTLA 1R6BX 5JWOA 4CIDA 1NSTA 4MGIR 5DN6D 4PC6A 1XX6A 1OH7A 1QBKC 3RRMA 1E4YA 2MMCA 4IOLA 2C5LA 4AKIA 1XTJA 5L3SB 4MYCA 2RGCA 4UQOA 1G5PA 1IJEA 4Q19A 1YQTA 2IYYA 2X77A 1N3BA 1SVLA 1SVMA 3C41J 5DNYB 5G41A 1GL7A 1XNJA 1E2EA 4M4SA 2QA5A 3CRRA 2W6ID 4A2PA 2IXFA 1VCIA 2PJRA 5HKKA 1IN6A 4AYWA 4YMUA 2FE4A 4P31A 2CNWD 2VLIA 4HB3A 2R6DA 2QBYB 1T5IA 621PA 1QF9A 4M53A 3C7KA 3OEEA 2QM8A 4ZCMA 2G77B 1DTSA 4US0R 3FMFA 2IUUA 3IQWA 4BUJA 3VMFA 5BN5A 1GNRA 1OV4A 2HLDA 1MR3F 4YMSA 4Z8YA 2J0UA 1ZYUA 1BKDR 3OEHA 1AJEA 3CRQA 4V0MA 3K8YA 1IY0A 1CR2A 5JWRA 1ZRHA 5LPNA 2DR3A 3H1TA 1IM2A 4NE2A 1S1CA 4C2UA 2A3RA 1DOAA 1EX7A 1XXHA 3KKQA 5FBVB 5J4YA 5M04A 3OIYA 2AHOA 4HLUC 2ZRAA 1ZVQA 3NWJA 4TTPA 1L2TA 4WBSA 3F8TA 3GJ6A 4CRWB 4C7OA 3WNDA 1ZW6A 3WP1B 3NC1C 2BVNA 2D4HA 5DLQC 1SKQA 1CJMA 2JJ2A 1P5ZB 4RD1A 1OT3A 4QJ3A 3KQLA 3RRNA 4OBEA 1E79A 5CK4A 2VBCA 5KNCA 1EGAA 2QUZA 4OKSA 5G53C 1VCOA 1M6NA 3FPAA 2XITA 1SHKA 1P2UA 4ON9A 5J4KA 5JCPA 1KSHA 2W2TA 3U7EB 3W8RA 1CXZA 5F9HA 2DFNA 2WBLC 2LKDA 2JIZD 1LY1A 4ARZA 5C46F 4C2TA 4IXMA 4DLTA 2GK7A 1XTKA 4P0TA 1GVNB 1WB9A 1RVDA 4A8JB 5FUXA 4A15A 1YR6A 1FNMA 3BS4A 3LWNA 5AUPB 4DLWA 4TQAA 4XSHA 1G8FA 4US2R 5CIWA 2ZQ5A 2YWEA 2WWWA 5JHHB 1II0A 3KFVA 4A82A 2G1KA 2XNDD 4CW7A 3B9QA 1OFUX 4UXJA 3LFUA 3BD9A 3UG7A 4HI0E 3GFPA 2A5DA 4HAWA 2IXGA 2UZIR 4PZZA 3B6EA 3UG6A 5IRCD 1KJYA 2GCOB 2JJ8A 3MG9A 3THWA 5H70A 4C0LA 5TB5A 2CCGA 2H8KA 2JIZA 1D5CA 1BMFD 3CWZA 1CBUA 2GRJA 4QJ5A 4FMCF 2ZSBA 4BZQA 1XCPA 3O8DA 2CXXA 1FZQA 2DPXA 3FB4A 5C4GB 5IDVA 1AS2A 3TUIC 3ICQB 1RJ9A 3TRFA 2LKCA 2WJYA 1NRJB 1NF3A 1NMZA 2HYDA 1E1RD 4O2RA 4W5WA 1XJCA 2FGKA 5BN3A 2ZUBA 2ZAMA 3THYB 4I1SA 1FP7A 3GLIA 3B9PA 1SVWA 3G5UA 1D2EA 2WWFA 4Q7KA 2QE7D 5LB4A 4PC1A 4Z1MD 4HB4A 4QGHA 2WWIA 3DZDA 2FSIA 3CR7A 4KVAA 2ANBA 1TF2A 3HYRA 2K5UA 4U00A 2ZUDA 5CB8A 2QG6A 4DLXA 3QBVA 1S9DA 2IHYA 5JHGB 2J59A 5DISB 4F4IA 2IF0A 4UXIA 1RE0A 4IDNA 2P3SA 2ZTSA 1T3SA 1Z0AA 121PA 2JLUA 2Q9AA 4KSBA 4G5RA 4B73A 1QDEA 4QOSA 1OKKD 4XD7A 1Z22A 1E2DA 1ODFA 4OI1A 1X1SA 5AK0A 1NVVR 4LJAA 5E7MA 2ANCA 1NY5A 4C0KA 1E1QD 1EG7A 2QENA 1MH1A 1E2KA 2GEUA 2P5TB 3KKPA 3K0AA 5KSYA 3I5XA 3AVTA 1OXSC 3EPHA 1KK1A 2IYZA 2YVUA 3IIKA 4RZXA 2MSEB 4DC9A 2OE2A 2NPIA 5KSOA 1HTWA 1ZU4A 3IHWA 4WAUA 5KSZA 3QKSA 1XTRA 1YZUA 3X1ZA 1W44A 1YRAA 1DBSA 4YC7A 4JBWA 2YWGA 4LUCA 3SR0A 3U4QA 5F9FA 721PA 1TEVA 2GNOA 4QRHA 2ZSAA 1Q1QA 2KJQA 4Q4JB 4TL8A 4DIDA 2OCYC 2ZJOA 1QRAA 2DCUA 1XRJA 2GJKA 3AVQA 3SBEA 4TSFD 2F9LA 2A78A 4DIEA 1NG9A 1I4TD 2IBMA 3TVTA 1TX4B 4A0RA 2YWFA 5DI3A 3KKNA 3EA0A 2VP4A 4MYHA 4MKIA 4DCTA 4EPYA 3EPKA 1KI4A 2EU8A 1KNQA 1W0KA 3CONA 2O8DB 3VKWA 1FMLA 1OE0A 2X2EA 1Z2CA 4I81A 3Q3JB 3WXMA 4B76A 3TW4A 2OO7A 4M0LA 1I4LD 2D06A 5HZKA 1U8YA 3EIQA 1H8EA 4YONB 4E5UA 3FFBA 4NTZA 4RD6A 4KLZA 2GDJA 4BFYA 1HQYE 3FKSA 2F6RA 3ZD6A 3IPXA 1KKMA 3UWKA 1CLUA 1SXJC 2IYXA 1XD8A 1XZPA 3A8TA 3TNFA 1OH5A 2QGZA 2JJ1D 1E1QA 1QHSA 3O8BA 2QP4A 4JKYA 3UATA 5KSPA 3EZ7A 1W4RA 2P67A 4RFSB 5D3MA 1SXJE 1P9NA 4KXFB 2NZ8A 2ZIAA 1RC8A 4D25A 4XIGS 2I4IA 1N6IA 5EP4A 2Z0MA 2H18A 4TMZA 3N5CA 3TKLA 4DDUA 4RSGA 1CULC 1U99A 1TL7C 3ZYCA 5B58C 4U02A 4NP6A 2G88A 1E9DA 1P2SA 1U2RA 3VR3A 5HTKA 2OT3B 1TF7A 3C4JA 4KU4A 3EPLA 3VHLB 5E7JA 4OHZA 1YVDA 1ZC3A 2PCLA 1N2CE 3NHAA 3EWSA 1QG2A 3V4RA 1YJ5A 1E2JA 2BHRA 5JECA 2ZYTX 2YHSA 2RHDA 4DCUA 2DY1A 4PHFA 5FOUA 2R6GA 1D8TA 5FL3A 1CU1A 2W58A 2AK2A 2Q3FA 3O8CA 4LHZA 3KDSE 2G1JA 4HAXA 4IFEA 3U6KA 2VQSA 4BFTA 2AFHE 5EXXA 1X8LA 4IOKA 2ZS9A 3N70A 1YR8A 1IBRA 3CX8A 2WPDD 1Z47A 3B2EA 3A1VA 5AJXA 3KL4A 3B1WA 3CLVA 4Q4HB 2HUPA 4EPVA 4ZKDA 4Q9JA 1NIJA 2XOKA 1HEIA 3AKYA 2G83A 3ADCA 1RZ3A 1QHHA 1OB2A 2OESA 3CO5A 2NMVA 1WXQA 4KBGA 2QQEA 4MDEA 1DAGA 4JJKA 5L3QA 4JLDA 2RGNC 4Z54A 2HV8A 4LBVA 3PUYA 1KSGA 4AURA 4NCNA 2ZRNA 1AA9A 1Q3TA 3KKOA 2P6UA 2MMGA 3EAQA 4M1MA 1NIPA 5FR2A 4JLVA 5H68A 1CF4A 2QPAA 3P4YA 3TVDA 3B1VA 4GOXA 5E4FA 2WWXA 1CJKC 1R10A 3TAUA 4MRVA 2WTUA 2DB3A 1HE1C 2A30A 3QE0A 5EQTA 4TTRA 4PO1A 3B1YA 4ZIRB 2C78A 5CK5A 2BJWA 3BERA 3R20A 3H0KA 1FUKA 1G291 1N5KA 1KYIA 4DLUA 2QTVB 1NJGA 4JZKA 1L8QA 4P4SB 4HDQB 2O8CB 1AKEA 3NBZC 2GXUA 1NVXQ 4PO8A 3AQ4A 4LDJA 2X2FA 1WE2A 4MRPA 1FFHA 4OHWA 5TARA 1GL6A 4JVSB 4I1VA 1L4UA 1OPXA 3RC8A 2GZAA 1JXMA 3THXA 2OHFA 3REFA 1EWRA 1CR0A 2IEZA 3THXB 2FEOA 4KO8A 1DAMA 1TQ2A 1E98A 1VDZA 1Y3AA 2F3TA 2FOLA 4BEJA 3ZS9A 1D2NA 3LX8A 1R5OA 1OXTA 2P5SA 1DPFA 4Q1FA 1A5TA 1Z29A 4H1UA 2ZITA 4N3NA 1KSJA 3TSWA 4QGAA 4XVUA 1P6XA 1TAGA 1UJ2A 2E9SA 3SJBA 2BWJA 2PMDA 1GL9B 2GA8A 2CHVA 1LW7A 2QT0A 2P65A 2IUSA 3Q9LA 1G3IA 3D31A 2Q3MA 3HU2A 1TEXA 1ZNXA 3X1DA 3KJEA 1OFTA 1N5LA 3MMPA 2VHUA 4IVPA 4M21A 4OK6A 4PANA 5FL7D 4L15A 1RRPA 2W6IA 1NVVQ 1KI6A 1CTQA 1OXUA 2NO6A 5CIQA 5UKDA 1E2LA 3A37A 1P9RA 2PZGA 1OYWA 4CDGA 1OW3B 1G19A 1VHTA 2R2AA 1RYHA 2C9OA 1M8PA 2XSZD 4NONA 3PUXA 3MWKA 4ZDKA 5EP3A 3NH9A 5FPSA 4YMTA 1FTNA 3CH4B 1DAIA 2ZETA 2OFOA 1UFQA 4A2WA 1KDOA 3OESA 4DEYA 4GZLA 4P4TA 1JR3D 2BBTA 2ZI6A 4WXPA 1FX0B 1R5NA 2VH5R 2BM1A 1U9IA 4QBFA 4ZPXA 4DHEA 4D80A 3I92A 4B34A 4G01B 2IS1A 2IYTA 1Y63A 1Q12A 1GRRA 3ZDQA 1OFIA 5EP2A 1KDTA 1FQJA 1XBTA 4RJLA 4Q7LA 1QHYA 2OILA 2XZPA 3MWLA 1WDTA 2KBEA 4MITA 1XJQA 2IS4A 2BV3A 3CZPA 3LBIA 2OV2A 3FTQA 4TYPA 2QU8A 2YWHA 5C1BA 1NN5A 4QHTA 2XZOA 2W6JD 2G0NA 2AD1A 3GEHA 4JLOA 4GMXA 2C96A 2CK3D 4US1R 2GWHA 3QNUA 4XH9B 3R9WA 3PFIA 3MLEA 1R0XA 1PUJA 2J9RA 5KDLA 4D0NA 5A4JA 3IO3A 2BBSA 1S1MA 1VYVA 3LXRA 3AVUA 3KKMA 5E3HA 4QC2A 4A8JC 2VP0A 3AVVA 3LVQE 2PJZA 1E9BA 4AKHA 3M4YA 3P4XA 3IKJA 4UKDA 3OEHD 4R71A 1J2JA 3E1SA 1KDRA 3Q7QA 1P2VA 2GILA 3T12A 2BMEA 2ZVQX 4EJSC 4F7WA 3CX7A 1HA3A 1X8JA 3EIHA 3K70D 4TMWA 4P32A 2RGDA 1Z8FA 2X19A 2CL0X 3V9PA 4ZI3A 4PC7A 4EKDA 2VTKA 4J0QA 3OEED 4E09A 3F0TA 2BM0A 4UNNA 5FTNA 2CJWA 4DLVA 4MRRA 2O8FB 3CH5A 4BFVA 1MV5A 1UKZA 2ZSDA 2QMOA 3SJZA 4URVR 2QAJA 3GLIE 3VX4A 5TXGA 2C95A 2Z5FA 5CITA 4C0JA 4Q01A 4W7SA 4AYTA 4KFRA 1CKEA 4CGZA 3L8ZA 2O8DA 1T5LA 4JBYA 2B6HA 4NCHA 1FOEB 2V8OA 4X8HA 2JATA 1Z6XA 3DDCA 4TT3D 4JT4A 2OCAA 3SC3A 3RS3A 3IQXA 3IBGA 4B3GA 3NBYC 1E2PA 2GXAA 2WM9B 4AD8A 5IK2A 1RRFA 4TLBA 1D9ZA 4KYUA 4MQBA 1FQKA 2CK3A 3AEZA 1KSFX 2IYUA 4ZIRA 3SJCA 2ZRHA 3BXZA 5FBQB 5IT5A 1OB5A 4JLMA 3C16C 2GJ9A 1W0KD 4IEIA 2ZJYA 3P32A 4Q1CA 4TMTA 5KO2A 1PLKA 1J90A 3E5HA 4LV5B 4GDFA 2CLSA 2BMDA 1V43A 2CVHA 4MRSA 1ZNWA 4Q48A 4NYJQ 4CEIA 3EZ9A 1N6RA 2BKEA 2QAGC 3TUZC 3K0AB 4PSKA 1SHZA 3F3YA 4YDHB 3ICEA 1P3JA 1YKSA 4LHYA 1MRNA 2QSZA 3DKPA 5FPTA 1UDXA 2WJJA 5L3QB 5E7IA 2CHQA 1KK3A 2PEYA 4Z51A 2VHCA 3LW8A 4NDZA 3ZVNA 4BFUA 3SS8A 3TIFA 3R9XA 4DUGD 4ZV4A 3Q5DA 4B3FX 1OHHD 1ZINA 1G16A 2JA1A 4YLGA 3RRYA 2J7KA 4IW3B 4QKQA 3AF4A 3AB3A 4FI3C 3QG1A 2XZLA 2AX4A 4EPTA 1NKTA 1TU3A 221PA 2KBFA 5KU1A 3KQNA 4WZAE 1E69A 1X8KA 1ZC4A 2OG2A 1T0JB 3W6NA 1W47A 2CBZA 4RD3A 2CL6X 2ZAOA 1YR9A 4JLPA 4XTRA 4B6FA 1GRNA 3QKRA 1PV4A 1QHIA 3THYA 2ZRJA 4A6PA 1P72A 1Q1EA 2FJUA 4YXWD 3AKCA 2H1LA 2YOGA 3BAFA 1KY2A 5GJWC 4TMVA 2JJ1A 1KAGA 2ZJBA 4RZ3A 3CF6R 3P20A 5AJWA 1RFLA 3A1WA 3KZ1E 3MJRA 4M9QA 3EX7C 2NO9A 5LD2B 3SYLA 2CLDX 2VPPA 3B5JA 4WVFA 2QAGA 5FOXA 5D3MB 3R7WA 1KO8A 5KPJA 2EFCB 4BRWA 3ASZA 1JEEA 1XEWY 1RIFA 1IXRC 2I3BA 1M7GA 3KUCA 1BOFA 4R98A 4BLOA 1G9XA 3ND9A 4DSTA 1RRCA 1N25A 3BGWA 3ZZTA 3HYTA 4BLQA 5FTKA 3IEVA 3GMTA 1VKJA 3RYTC 2GJ8A 2V1XA 5CJPA 5JCZA 1ZBDA 2NOAA 4W5HA 2BC9A 1AS3A 2EWWA 4WXRA 3QJYA 4PHHA 1YZNA 3I5YA 5JMTA 4URWR 2ZE7A 3VU9B 2GCPA 2F43B 1Q44A 4DSNA 2FG5A 2FU5C 4RCZA 5GADl 1MT0A 3WYGA 1FTSA 3CM0A 3O8RA 3U7GA 2OSBA 1WBBA 2EFHB 4KFTA 2AXPA 4OYHA 2ONKA 2F1HA 5DI3B 4DLYA 4JLJA 3M1IA 5CLLA 2ZJAA 4HAVA 3EARA 1KI6B 5HKKD 4B3XA 5CM9C 2D2EA 2F1RA 2JJ2D 2ZRPA 4IOJA 3VQTA 4UXHA 1II8A 3CR8A 4JLNA 4JLAA 5FFMA 4H9GA 2HXSA 2VSXA 2YV5A 4GSYA 1P62B 5IK2D 1JPNA 4NZYA 1SXJB 1ZMXA 4XTCS 3U3RA 2J1LA 4OL0A 1A4RA 2OZEA 1ANKA 4JKIA 1SULA 3TLXA 4O25A 2BMJA 2NO0A 4B3BA 1XXHB 2VO1A 5JS7A 5FOWA 1GIAA 3L0SA 2OFXA 5ANRB 4HDCA 1OXVA 1JNYA 1KK2A 2IYRA 2WZQA 4PPGA 4BWYA 4U5XA 2WOJA 1XP8A 2QN6A 2ZSEA 4IRUB 1H8ED 2A5JA 3CX6A 4FCTA 1VG1A 5AUQA 4Q7JB 1CP2A 4RZ2A 1AS0A 1D6JA 3B82A 2OCPA 2XGJA 4OQFA 2O8CA 1Z06A 2O5VA 2WHXA 1R0YA 2AN9A 4I1OA 5L3RA 2IS6A 1G5TA 2HF8A 2AWNA 4M1WA 3I73A 1CJTC 4JL6A 2ZI7A 1HE8B 3QXJA 1U94A 1UF9A 3DMNA 2YJTD 1ONBA 2ODEA 4Q02A 5EZ5A 3KXLA 3OIWA 1HH4A 5BW8A 2QP3A 3BH6A 2GHIA 1F2TA 4CT4B 1AKYA 1OIVA 4LJYA 2EYUA 3IBYA 4IDPA 3L0PA 3SHWA 2HYIC 2VRWA 1N5IA 4HB2A 4B32A 4EPWA 3RS5A 2GXSA 3FMOB 3GLIB 3B1XA 4G3XA 2IW3A 2ZS7A 1LNZA 1GUAA 1E0KA 1R0WA 5H1YA 4B44A 4Q4AA 3MWJA 3EWAA 1VYTA 3W3AA 1ZCAA 1VECA 1NKSA 2G3YA 5E95A 3BBPA 1ZM4A 4DLSA 1UDWA 4F93B 1DE0A 2J45A 3T15A 5FH9A 3RS4A 1MABB 2XXAA 2B7CA 1G6HA 1XPOA 2YINC 2WKQA 3GCGA 5DN6A 1QHHB 4M8NE 1QZXA 2WJVA 2GXQA 3AF0A 2XAUA 1G7CA 3NEYA 2D2FA 3ZH9B 1FW6A 4LBYA 2JAQA 3WRYC 3I61A 3THWB 5KDDA 1G8GA 2OXRA 1A2BA 1A7JA 1Z2AA 3ADKA 2FZLA 4NU0A 2O0HA 3GLHA 2C77A 2GF9A 4QM7A 3HWSA 4LYJA 1GP2A 1SXJA 2CMKA 4RKFA 1WF3A 2XJ4A 3DMDA 3HP1A 1TUEA 2Z43A 4F92B 2FSFA 1IONA 5F98A 2XTZA 4I4LA 3VR6A 4PPQA 3L2OB 1S96A 2ZS8A 1FUUA 1PLLA 3PJRA 1NLYA 1IHUA 4QBHA 4QHSA 4JLKA 4M1OA 3QQ5A 5FR1A 1KO1A 3EPJA 3W34A 1KMQA 1DELA 4Q9LA 1NNEA 3L82B 1FNNA 1LVGA 3WBJA 3K0FA 1JI0A 3PUWA 3G0HA 3NXSA 1Q1BA 1XD2B 4NYIQ 4B35A 3EASA 1LS1A 1NJFA 4D4KA 4CEJB 2PX3A 4FW9A 4RFSA 2H16A 4D6PA 1MO3A 4HUQB 1F2UA 1VIYA 3BOSA 4CF7A 1PVOA 2QROA 4AIIA 4KYIB 3B7GA 1CS4C 3PITA 1H8HA 4C7OB 1YHNA 1WCV1 1NBMD 3H4MA 3TSZA 1E0SA 3BH0A 4HLCA 3CPJB 4EPRA 4C4PA 2BBWA 4IFBA 2GAOA 2N42A 4HAUA 4LPKA 5JEEA 2IEYA 1H65A 1N6LA 2FEMA 3RS2A 4GP7A 1E2MA 1SVSA 2GJAA 1ZUIA 1EFTA 2ZR0A 1J8MF 2FPLA 1OXXK 1IXZA 3G82C 3I72A 3KB1A 4DLZA 1EWQA 5LB2A 2QE7A 4IJMA 3LQQA 3ND8A 3OE7D 4TZ6A 1Z3IX 3K0CC 4BE7B 1XXHE 2DFLA 2XX3A 4NMMA 4URZR 4MUBA 4EAQA 4TZ0A 3IIMA 3A58B 1C4OA 2R9VA 4Q03A 2QSYA 2ZANA 1HY3A 2AWOA 2GBLC 2WSMA 2XTMA 4AKGA 3ETLA 5A0FA 4NCKA 5DYGA 5EE3A 5AUNB 3QBTA 1Q3HA 4MRNA 3WHLA 3KJHA 1Z6TA 2AXNA 4Q00A 1VHLA 2Q9CA 3V4FA 4F4CA 3RC3A 2E1RA 3QKSB 3U3OA 3S1AB 4A4DA 2QMUA 2O8EB 1Q0UA 2NTYC 1S4QA 4JIMA 1HT2E 3LV8A 1BH2A 3MAAC 4OK5A 4M1TA 2BJVA 3WY9A 2WMOB 4FMDB 2BDTA 5BYKA 5FPHA 4YQFA 1U98A 4MYTA 2P6RA 3K53A 2WWHA 3CRMA 2FF7A 1Z0JA 4V0KA 3B13B 2NO7A 3UKDA 2A5GA 1FL9A 1MABA 4ACBA 1R0ZA 2BMFA 5FPKA 3U7HB 2X1VA 4PTLA 4GNKA 4LRWA 1Z0KA 1G21E 2JDID 3RWOA 4XJXA 4IEEA 2OM2A 2ZRKA 4Q4AB 4B2LA 3GJ8A 1GDDA 2Z4SA 4DZZA 2PEZA 3W8NA 2QZ4A 2A7QA 4QGFA 5G3YA 2GEVA 4PX9A 3RS7A 1KNXA 2R6AA 3QOFA 4B71A 5JJKA 1F2TB 2F3RA 1NVUQ 5B2ZA 5C18A 1GNQA 1YZTA 3I3SR 5AJZA 4Q4LA 4DJTA 2LWIA 3OF5A 4LJ4A 1RYFA 2VP6A 4IHQA 2O8BA 2W2XA 2RCNA 3TR5A 4AG5A 5FI1B 4LJ8A 5G40A 1QHGA 3NC0C 3CW2A 4B47A 4V0ME 3BFKA 2VP2A 2FPKA 4JYBA 1VPLA 3OIVA 1RPZA 3NG1A 4TT3A 3HU3A 4FD2A 5AJYA 4D0LB 5BN4A 3OHMA 1PLJA 4UJ3A 1U90A 4LJ5A 1H8HD 4PHTA 5LDDC 2ZM5A 2V4ZA 5FOTA 3AVXA 1IN7A 2FNAA 4WZBE 4ERNA 4PR0A 4W9MC 2EFGA 4HZUA 5JSZA 3QVUA 3I62A 4TYQA 3QXXA 1UM8A 4ABYA 1E6CA 2C04A 5DO9A 4RZUA 4C0AC 1JALA 4RD4A 4AKEA 1RW4A 4LHWA 2ASEA 4C0SA 1E9CA 4G5OA 1TUIA 2CJWB 1S9HA 3MUFA 2ECKA 5FOVA 2RKOA 1UKVY 3B78A 4YDSA 4JL8A 3HPRA 3K70C 2C98A 3LW7A 4DBLC 3JZMA 3FYHA 2JLQA 3MWYW 3QXSA 4ARZB 1XEWX 2BEJA 4TLAA 1QHXA 1G20E 4PAOA 2D74A 2F7SA 4LC0A 2OEPA 3T34A 2REBA 4N1AA 4PPFA 1EFHA 2PMKA 4XD7D 4A2QA 4LGMA 1P2TA 4B48A 3E2IA 2V1UA 4FINA 1NN0A 4HDOB 2YYZA 1IXSB 1NMXA 2WICA 2XNSA 1E9AA 1GILA 3D8BA 1NLFA 2KE5A 4AY2A 1SVIA 2O52A 1U8AA 1UEIA 4RVCA 2W0MA 1Z5ZA 1KIMA 1Q21A 4E03A 5CDFE 3QPWA 4Z1MA 1ZM7A 2VHQA 4AYXA 3V00A 1DADA 3Q8XB 2WIAA 3K9LA 1U9IC 3VR5A 3DPUA 4RD2A 3U6BA 3QPUA 2A5YB 4QFMA 2QAGB 1T8UA 4XVRA 3LNCA 3DEFA 3U44B 1J8YF 1JB1A 2CLCX 2DYKA 5DE3A 1FX0A 1G8YA 2RAPA 2ODNA 1F60A 1OJLA 1YE8A 4EPXA 2D7CA 1KO4A 2J41A 2WKPA 4NYIR 2WV9A 3OE7A 2F1IA 3ZZ0A 4EJSB 5B64A 1WP9A 2ERXA 3RLFA 3FMIA 2QL6A 2JEOA 3QIAA 4FMBB 2ZE8A 1ZUHA 4EFMA 3GLFB 1G64A 1VYUA 4GT1A 3R9IA 4PQYA 1LB1B 2VP5A 2JLYA 4AWXA 1F6BA 3C15C 1K5GA 1VTKA 2QNRA 1G7RA 2XNDA 3BIFA 4Q66C 4B3DA 4DT1B 3TR0A 2FFQA 3ZQ6A 5JJIA 1GKIA 4M1KA 4OK3A 5D3QA 3SZRA 2FDCA 2W0SA 5L3SA 1E3MA 2RB4A 1G3UA 1E0JA 2XTNA 2N46A 1E99A 1YU9A 1Q1ZA 1S3GA 4ZKEA 1Z83A 3H2YA 4JMPA 4DB2A 3LQRA 1E2NA 4KFSA 3TGPA 1NSFA 4BGDA 5JLJA 1T0HB 1GM5A 5HCIA 3Q72A 4PZYA 2ZU0C 3LVRE 4TLEA 3AP1A 1W7AA 3IUYA 1N5JA 4B33A 1US8B 1AGRA 4KITB 4ZCIA 3WRXC 1R8QA 3EZFA 3EIEA 1TU4A 4LV6A 3HDTA 1X3SA 2VHJA 3ASYA 4P4SA 2CL7X 2LCFA 4TL9A 3S1AA 3VAAA 2HXYA 2G6BA 3QXCA 1EXMA 2AR7A 4A9AA 4EFLA 4HUTA 1WBDA 1Q20A 4JLBA 3I4LA 3EZ2A 1MKYA 3GLFA 4Q5IA 3X1XA 2GKSA 3WMGA 4TMKA 1OSNA 2CEAA 2EW1A 1I4DD 3SE0A 3TAHA 3AVWA 2J87A 3GJXC 2HT1A 2BCGY 4IOMA 5FOSA 1XU4A 4EJSA 4XWAA 2JLZA 2CE2X 3QSYA 3B60A 4G1UC 4HLQB 5FTMA 3HU1A 1B23P 5FPYA 1UEJA 5BYJA 5H8WA 1Z6YA 1JXOA 3CIOA 3BB4A 1OIWA 3SOPA 3FFAA 1W46A 3IIJA 1XMIA 4PSAA 5FI0B 1W0JD 4QBIA 5KHOC 1KI9A 3D6TB 1QVAA 1M74A 3WHKA 1CEEA 2J3EA 1P73A 1C9KA 5FBRB 4OQNA 1KK0A 4PC3A 2UZ3A 2RMKA 1P61B 3QPVA 2O8FA 4PZLA 3DZ8A 1T4GA 2OLJA 1G3QA 1T8TA 2ORIA 1E94E 2A9KA 2R65A 5SZJA 3PV0A 1ESMA 4V0OA 2IWHA 4HUQA 3ZQJA 1XCMA 3TMKA 2QTFA 4C0HA 3GD7A 3KTAB 1AZSC 2G0TA 2Y8EA 2Z6VA 2ZJ2A 3LRPA 3LXXA 4LOAA 2FWRA 2JLWA 2C9YA 1IAQA 2GAAA 1J7KA 1EX6A 4OHYA 5L8VA 5EE1A 4V03A 3KJGA 4LHVA 3KXIA 5CDFA 4BFWA 1OIXA 2ZJ8A 3IHLA 3SU8A 2WMNB 5IF9A 4DKXA 2IA5A 1KTVA 1E32A 3N2IA 1ESNA 2BCJQ 3SYNA 1YRBA 2OBLA 3TBKA 4H1VA 4MGYR 1OFHA 3GJ7A 3FKSD 1IOZA 1G4AE 4C3ZA 2NIPA 4ASUA 2QGNA 3GQBA 1OYYA 2FN4A 4K81B 4FXPA 5EXPA 1AGPA 2YKGA 1PJRA 2B21A 3Q85A 4Q1DA 5JSZB 1XFAA 2W2VA 1COWA 5JEDA 2AL7A 3DM5A 1ZIOA 3EXAA 1UBFA 1T3HA 1ZJ6A 5TVKA 1OH6A 4A1FA 2ZJZA 4GL2A 2FSGA 2ZSFA 2A5FA 4FMDF 3BB1A 5DGXA 4HSEA 1YZQA 3CWQA 4OJQA 4UNQA 4ESVA 5B30A 4JVMA 1XEXB 4TQUS 1G17A 2VYFA 5ELXA 1K5DA 3DKVA 3UPUA 3NDPA 4C30A 3T5GA 3A4MA 2J0QA 1VMAA 2VEDA 2JASA 1JAIA 3LX5A 1XB2A
chains in the Genus database with same CATH superfamily
3LYHA 1IBKB 4F4JA 2V54A 2HT6A 1G3RA 1IJBA 3EW9A 3MILA 4B74A 5HQ3B 1R4NA 1U28A 1ZAKA 4EZIA 2QT1A 4FU0A 4XGNA 4Y6GB 1EJ6A 1VG8A 3AJEA 5EIBC 2B8TA 3OAAA 4YRDA 4UUQA 1ZD2P 5KWVA 3FWYA 1PYOA 3UOGA 4M8KA 4NBKA 2R4QA 1W5TA 1JA1A 1KO7A 2VPZA 2EHJA 1V95A 1DOHA 4JC0A 4L5CA 4P3KA 4Y2HA 5H59A 3UXEA 4UUAA 1CRLA 1UPBA 2AEMA 5J40A 1UBCA 3KR1A 4AB1A 1M2EA 2O19A 4DV0B 4KI0A 3CTMA 2RGAA 2G28A 4CTJA 1ZMTA 3SHFA 4FLMA 3G7UA 1HOTA 2J3IA 1L7RA 3BK1A 4XQCA 3UJBA 2V7QD 1EHIA 3BB3A 1B26A 3CLHA 3PFNA 4MUJA 3JATB 3N8HA 1B6SA 2DVMA 3KKKA 2IYQA 4MGZR 1ZXBA 4F5EA 1RC1A 3NHPA 3HACA 4PR3A 4RFVA 5CH8A 3IGFA 3EZ6A 4YAOA 5AI4A 4LF4B 3JATA 4N49A 2XMQA 3OFNA 1LBTA 4HG2A 1XALA 4N5LA 5IC6A 5AVVA 3UFXB 4Z0HO 1X1DA 4MVJM 3RWBA 3FZYA 1U1EA 3DLIA 5CGQB 2Q21A 3SK0A 3B7WA 2I7TA 4P9NA 2FW7A 4ZWNA 4WH0A 4C14A 4PNEA 1KDVA 1JG7A 1GO2A 1KHTA 3A0UA 1EE9A 2ZI9A 3OCUA 2Y76A 1Z7YA 1JR3E 1E2IA 3LDAA 4JJIA 3ZCSA 4WZAA 4B84A 3PNLA 3VPBA 1PEKE 4OP2A 2G9QA 5ULLA 2ODTX 4JLUA 3VC3A 5IT0A 3GJ4A 3JYHA 3I04M 4LY9A 1TNDA 2C4UA 2F8LA 4MUYA 4O0MA 4JEMA 5DP2A 3G85A 4J0GA 3RRFA 1U3DA 2VSNA 2ZI5A 1PFVA 2F9MA 3BBLA 3GLKA 2X3UA 1KOFA 3BE4A 2PZMA 3AUAA 4JYZA 2IV3A 3QSGA 1T13A 2Q4BA 4UTZA 5FUYA 2HA4A 3DAPA 4YDQA 4GX0A 1TD9A 4BWVA 4KREA 3RVRA 4F9TA 4JC8A 4NOMA 3M1LA 1DO0A 4LRUA 3TLEA 1BH6A 1I3MA 1XP5A 3FZNA 4IHAA 2F43A 2Q45A 4RV4A 3BHNA 4RVFA 3OZAA 1RRVA 3PPVA 1RQRA 2PH3A 3ENVA 3QNMA 2AN3A 1ACJA 2XD4A 5JV5A 1HDZA 3LVBA 4L1KA 1P39A 3HY6A 5D01A 3I39X 3K0CA 3KLMX 3I37X 1GSIA 5CFNA 1XMVA 4PAGA 4Q1BA 4YBRA 3BD8A 3K9QO 1Z68A 3LQYA 1V3VA 4KAFA 3CNLA 1K6IA 1U2SA 5B3KA 1NBMA 3PPIA 3ENZA 3QUQA 2O2HA 2FMXA 1Q22A 3LCCA 3P26A 4G25A 2Q9BA 4LSMA 2O1WA 3SF8A 3B89A 3H42B 3X1YA 1A82A 4R8VA 3FBTA 4A92A 4EAAA 2HJHA 4J2OA 1H6CA 2P6NA 3VR6H 1U7PA 3PJFA 5AYVA 4PHCA 1GPUA 5LUAA 2E4UA 4L50A 1UK9A 1U7WA 1XD2A 1YNOA 2CNBA 2J5XA 2P2GA 3EGWA 3O3NB 1XN1A 3R6DA 1WUHS 2DP4E 3N87A 1FPMA 1W2WB 5DX8A 3RC2A 4EKNB 4MJLA 3NHYA 3U7JA 4PSDA 1C8VB 5IYZB 1K8XB 3IC5A 3EGXA 1C4KA 4EHJA 3DE6X 1KZGB 1JDNA 1OX5A 2DFTA 4G56A 2LTAA 2Q4OA 4MDHA 1JTEA 1WCXA 1TVKA 2XMPA 3MTEA 1ZMBA 4IJWA 3A6HA 3SDZA 3UAWA 4ATNA 1NQOA 1YR2A 3RS9A 3VC7A 4IGKA 4OI4A 3QLVC 1ZD1A 1G5RA 3PNSA 1M6VA 2E18A 4YRPA 2HX1A 4C89A 2PT7A 4RYDA 4JOSA 4FGKA 3RNLA 4CLOB 4XVHA 3Q8WA 1JDPA 4ZDIA 4EUKA 1RAFA 3HB7A 4GI1A 4GI7A 3HDVA 4I9UA 5EUMA 2AEEA 3H1GA 3T52A 3CZRA 3KV3O 3L6BA 5C7OO 3U7FB 1OVMA 1B0ZA 3FTEA 3K73O 2WHPB 4Q21A 2PIAA 2BISA 4KWTA 2AOUA 4NICA 2ZXEA 1Q57A 2H8GA 2ZROA 4Y6SA 1S7GA 1DC8A 2PKRA 4XYLA 1RXVA 1UJMA 2Z8XA 3OZWA 3S2FA 4F7DA 4QU8A 5F2EA 3F67A 1E63A 1S2LA 1NONA 3A3OA 3AGPA 4MKFA 3ZNPA 2YR0A 2XUQA 2PWPA 4X9XA 3BMCA 1N7GA 4ERXA 1BDJA 1G9TA 1XRMA 3WHIA 1UOEA 4I5DA 1T6YA 2C3OA 2HRCA 2R8XA 4MP3A 4LJ6A 3OLVA 1IN8A 1KVSA 2W00A 4UUBA 4ZT5A 4I4CA 1N4AA 5K4AA 1XMQB 1L7VC 3G5MA 4RCVA 1E60A 1HFWA 2VJMA 4KEAA 4YPOA 5TMPA 4LWZA 1SH7A 4PE5B 1W1IA 3BD7A 3GWZA 3OIUA 5KNBA 1UPTA 3M6WA 5K8VA 3CUWA 1AQNA 4Q18A 4LSGA 1SU6A 4D81A 5IH7A 4B4UA 1WD5A 1Z7WA 3G5LA 1EHYA 1QIIA 2VTVA 3C8DA 3L06A 1E5LA 4GXQA 5GV8A 2PRZA 2YC4C 3PNYA 3LL7A 3QF4A 2GLUA 5AWFC 1K4YA 1A9SA 2I2DA 1IHXA 4YWHA 5JBQA 2CWWA 1TUGA 2WI8A 4DCSA 4I55F 4NCBA 3MNFA 3M49A 1J9EA 4YPVA 2JJQA 1YKFA 3RT9A 4EUHA 2PZJA 3ENNA 1RWVA 2QVYX 2WU8A 3LY5A 4LZZA 5K3FB 1TQHA 1YHYA 2ONJA 4QA9A 4OX9B 1GWNA 1WIWA 2CHUA 4E4YA 2JKYA 1MFPA 2H1IA 2R8OA 2AJCA 2QVXX 5BV8A 1GTRA 4I6JA 3CR3C 4RDCA 5CMLA 3V3TA 1C50A 3PQCA 2QY6A 4H7HA 2VP9A 2YIJA 3NC4A 2YDXA 3WLAA 2ZQYA 2OD2A 2X9VA 521PA 1C1YA 5FLYA 1H6DA 3TK1A 3E84A 5GZ6A 3TS1A 3GUCA 4QBGB 4UEQA 2NV6A 5CAEB 4S1WA 3AGQA 3N3BC 2BFFA 4J0JA 3RNOA 4AC9A 4CQMD 4UNSA 5IC4A 2DHQA 3RYFB 2WYOA 2VA8A 2F4VB 2AV6A 4D0GA 5DK6A 5T41A 1TT5B 2J67A 4EKYA 1II8B 4NCXA 1J7JA 5CA0A 4DB4A 4OXKA 2ZB3A 3LLUA 4X8OA 4B2PA 1WUIS 1NMSA 2XGOA 3CISA 2GFIA 4QDJA 1Z7EA 1TZJA 2OKCA 4W5JA 1MRSA 3ZIAA 3D7MA 3FJ1A 4UHCA 1VCMA 2A14A 3SZOA 2QZPA 1WUKS 3ZWWA 5JC1A 1IY2A 3DKKA 3ZPXA 1F0KA 2WSLA 3K5WA 3QUAA 2IRWA 5D3ZA 5PGMA 2XECA 4OHCA 3FXAA 3TLMA 2XV1A 4B4KA 1SUSA 1OBFO 3MTBA 3K3PA 1MHPA 2BEKA 2VQ6A 3G13A 4LWQA 4QTZA 3WSWA 1XWIA 4I46A 2YYYA 2FZGA 3D59A 3FGNA 1X15A 3UJAA 3C6MA 1KO5A 4JSRA 3ZWMA 4C7MA 1YVRA 4NECA 4EDHA 4FOTA 1P0CA 2NZWA 4Z8XA 1R3DA 1GOTA 1F1BA 5K45A 2HDOA 3VVMA 3U44A 1OZAA 3UWOA 4BVAA 5IVKA 2B92A 1AQYA 3O95A 3PD7A 5A5FA 2FUKA 1X7YA 3DE4X 1FUIA 4FFWA 3EEOA 2J30A 3ERCA 5BSWA 1O95C 1E4EB 3AEUA 2ZR7A 2OZVA 4M76B 2J3LA 4A82A 3Q2OA 3ZHBA 1FBTA 2QI9C 5C5EA 2F1JA 4B6OA 3RANA 1FSSA 4CF5A 2C5GA 3Q5EA 4Y1RA 4DSZA 1Z6PA 4DUGA 4ZK6A 3P96A 1I3NA 5GINE 1VPDA 4JP5A 4R2HA 3R8XA 4O08A 3FSJX 3BEOA 1Q91A 3C3XA 4RABA 3C5HA 1VJ0A 4HWOA 2JH9A 5CCBA 2JFPA 2ZQZA 4OUDA 5FAXA 2A1TS 4TYWA 1E9VA 5BWBA 2AUNA 3BA1A 4QXRA 1TO1E 2R47A 2EL7A 2QJOA 1MX1A 1Z39A 3DBHA 3JQ9C 3ADPA 1ZS9A 3DVLA 1JA9A 4R2WA 4URUR 1Z08A 3MJHA 5TV2A 2BM8A 2H7YA 2RKBA 2DJ5A 4W9RA 1IN5A 5L3VA 2DKFA 4LMAA 3C0KA 4S0ZA 3IP9A 3PXGA 2EKLA 1A04A 2ISSD 4C5BA 3V2IA 5FR2A 2JVJA 3V3KA 2CE7A 4KUGA 3L05A 3PXXA 3VC2A 3ZHQA 5DIFA 4ITVA 1P33A 2PWAA 1TMOA 3RWMB 1P8AA 1XDZA 1FDIA 3AVOA 2PRJA 4JSYA 4RQBA 4C07A 3PENA 2FFJA 3W5AA 1VZ3A 3Q0EA 4WZAB 2PV7A 3ICCA 3DD1A 4EITA 1BTOA 1A97A 1U2ZA 1EK5A 2CBXA 2QQGA 4HWGA 4XQGA 2ZRMA 4EGQA 5DT2A 3A1SA 5KNDA 1XMSA 4V0NA 3NP9A 2CLFB 1P4HA 1W5EA 3K15A 3MFYA 1CUZA 2Z4RA 1SBZA 3B1FA 5CNJA 2HHHB 1C80A 1HFJA 3CEHA 1MAAA 4N82A 4PQGA 1JU3A 3N0WA 4QATA 5E2AA 4YCMA 3HVKA 1Z5VA 4MQFA 4FTWA 5K6RA 1VGQA 4HN9A 3FTNA 2UYQA 1BAPA 4XWYA 1SBYA 3DPSA 4IZOA 4MEBA 3KTOA 3CNNA 1KJQA 2C2ZA 1H1LB 4BHTA 5TSDA 1NLZA 2YV3A 5BN4B 4H1TA 4YAKA 1OHHA 3Q1KA 4Q3DA 1N8TA 2C3UA 1JFRA 2ODWA 3LCRA 3ZS8A 1SZPA 1CR6A 2OAP1 2PXHA 3COYA 1FP2A 3G2MA 4CKBB 1EFUA 2OAQ1 4ER5A 4FIDA 2SCUB 3M6VA 1XEFA 1I2MA 4FLEA 2P5UA 5KJFA 2H2FA 3QRWA 4L3VA 3GFOA 3FWZA 4OB8A 3GEMA 3OPVA 4Q3BA 1CB0A 3RO7A 4GPBA 5C3UA 2YWCA 4H1HA 3KB2A 5ERYA 2DBZA 5AIAA 2OZKA 3F2VA 4O3MA 3A9RA 5LA6F 2R87A 1R4NB 1T8SA 3I09A 3KE8A 4IGFA 1QGUB 1PDWA 1IUPA 1OXKB 2X8WA 4A8PA 4G0WA 4A0FA 3FKQA 1NN1A 4IINA 2BKLA 5K03A 2FPPA 2Q6IA 4LDAA 5HZHA 1TTHA 4BO2A 3NBFA 2AG6A 3IV6A 3MN1A 3A1UA 3QVVA 4G5SA 1J99A 1OV6A 1PZNA 2I22A 1E1MA 1MDFA 2VYNA 3HFRA 2XJ9A 3C97A 3I2KA 4HYYA 4PQFA 1T43A 1V1MB 4HNUA 1ACMA 2KB0A 2N3ZA 2A0XA 4UNRA 2VHWA 3STYA 1NXWA 4D4LA 1QCDA 1KKUA 1WCIA 1HOXA 1R0BA 1PJ3A 4GBMA 4QOHA 4UHEA 1I7QB 1PWYE 5KYWA 1THZA 5LOVA 1LVUA 3LD9A 1NFQA 3EUWA 1UOOA 3F6YA 4LYFA 2G1AA 5FNVF 2A2ZA 4ZT4A 4BP8A 2EW2A 3A1NA 2V7TA 4LYAA 1V96A 2INGX 3EXHA 4C7XA 2ZE6A 1EK1A 5FBLB 3U31A 1L5ZA 2OZLA 1W1WA 2SKDA 2W93A 3NJRA 3R6GA 4H0FA 1PEYA 4B7UA 1DKNA 3TTVA 1EFKA 2QTHA 4MKHA 4HNAB 1PEDA 1ISPA 4L22A 1XKXA 2H17A 5P21A 5M7EA 3DWGA 5EE0A 2GZDA 2Q1XA 4H59A 1ZZGA 2EV9A 3LLCA 4RHEA 5C31A 4GZMA 2O1EA 3LPAA 4I5FA 1M2NA 1PWHA 1YIDA 4TSRA 4U8HA 4M89A 3RJZA 3TKAA 2NV0A 4G5GA 3M4ZA 2OUKA 2XWBF 1M34E 1SFRA 1TC2A 3HKBB 4CMKA 3KDAA 3BMXA 3PUJA 3UCFA 4KWIA 4XSGA 3HUFA 1RZRA 1HQCA 2ADFA 4D4JA 1U5CA 1QQBA 1E1CB 3EG5A 4KP7A 4Q47A 5BUSA 3E9ZA 4EG1A 3GCDA 3GLFE 1XHFA 4K0RA 5JCOC 4DDTA 1J09A 1RM4A 4MPRA 1NE2A 3WYAA 2LW7A 5TQ2B 4XJVA 4A6DA 6REQA 2J0SA 1G3MA 1TJ3A 1XTQA 1W5BA 1ZXXA 2PM8A 1HURA 1HUQA 3QX7A 1D9XA 1OBOA 2EKPA 3EJWA 1M2OB 4M1YA 4MKXA 4RVSA 5TR9A 3T38A 2NPOA 3D5QA 4EY8A 1UDBA 3CURA 3ORRA 4CM9A 1Q95A 5ALWA 3H2JA 3ONWA 2OXTA 3EC7A 2D00A 1ZPDA 3FMPB 5GJCA 1EVIA 3WL3A 1X77A 2HRZA 1QP8A 1RWNA 3DDUA 4J8PA 2IP1A 5HKBA 4CL2A 3VDQA 1YSCA 3LWZA 1RCUA 4FFDA 3TN7A 2VF8A 2LIVA 1QGOA 2GVDC 1BQEA 4PZDA 1JQ5A 2OO5A 1XLUA 3AI3A 2VZ8A 2E87A 3O7WA 4G0ZA 4Q7MB 4YUZA 5E0KB 3UMRA 3UWMA 4HATA 1GTVA 1RTTA 4CEJA 5F7ZA 2MYPA 2Q2WA 2NO1A 5KNDH 3URMA 2GBLA 5JZVA 1ZU5A 3FLMA 4O3FA 2YN4A 3MUOA 5TQ2A 3GLGE 1A1VA 1DG9A 1YASA 2VSFA 1MB9A 3QP9A 1R16A 3NP7A 3K0FB 1LKZA 3D43A 1SVOA 4MA5A 2PQ0A 4AJHA 4QASA 3KU1A 5TC4A 2DQKA 3LLMA 4OQYA 3SMQA 3AF1A 3UJPA 3DMPA 5AVSA 5EJ4A 3Q7PA 3QHQA 2EJTA 4BQSA 4DANA 4WZBB 1POXA 2VWPA 4D3XA 3KR2A 4HMQA 4JB8A 4X92A 2X4DA 3CTPA 4YJ3F 4R1SA 4FCVA 5ALIA 1Z6AA 1K9VF 2GEDA 3QYAA 3BDVA 1ONSA 2EFEB 4I8XA 1PUIA 4OGLA 1DJPA 2WIDA 3ONEA 4HQLA 3N58A 3HG7A 3TZBA 3KQHA 1ATZA 5HF5A 1UADA 1GAJA 4BKPA 2RHWA 4ZAGA 2REXB 3V4PB 2C8LA 5ITVA 2J4CA 4CF6A 5BQ5A 4P86A 1S5PA 2ID7A 4YR9A 5IJ9B 4ZCRA 1R12A 1L3CA 1XF9A 3GLHB 3HCBA 4KLNA 1KOLA 1NBIA 2I3GA 2OZLB 2WU1A 4X62B 4XM1A 2CFCA 4TXNA 2FK8A 2HA3A 2W2KB 1KJZA 3GFBA 3DDOA 3FPLA 2O2ZA 3QENA 1M2FA 4KQFA 4IWYA 4ZAVA 4AG3A 2CMFA 4EX6A 1CRPA 3BSFA 4Y2XA 1RLOA 2PGJA 2CMHA 3R41A 4M99A 4AVYA 4MR8B 3U62A 4W7HA 1Z82A 1BX1A 4MVJA 3PUZA 4HUJA 5I51A 1SCKA 5KX5A 2QPTA 2VHVA 3FUUA 1SCJA 4JGIA 3ZWKA 3RBVA 3UMSA 1ZVKA 4Z0NA 3GG9A 4D4GA 4FFPA 3WL8A 1MC4A 5BRJA 5KOIA 1SKYB 2XXAB 4AJJA 3W9YA 1E9RA 2BE9A 1X80B 1TAHA 3C98A 4C9BA 2IDJA 2APJA 1R0LA 4LNAA 4IO0A 1SZJG 4B7CA 3HJFA 4GLLA 1U0SY 2TYSB 3CRVA 4MP6A 4DIMA 1DC5A 1IDN1 1P7YA 2YJZA 1QYWA 3DE5X 3IXQA 5CEJA 2DPLA 5F3WB 4F45A 1B1AA 1UP6A 1O0BA 5CHEA 2DLDA 4UM5A 3HKEA 5JSUA 3STWA 4EW1A 3KQUA 1GJRA 2Q6OA 2VAPA 3OTIA 2IT1A 2OCBA 5M34A 1XR3A 2VJOA 4L51A 2ZCJA 3D4LA 2FX2A 3TJZA 5CTJA 2Q0QA 1RT9A 2VVTA 3TLGA 1BHO1 2X14A 1J5XA 2W48A 2ZEJA 5DHAA 5EE5B 5GQSA 3UC5A 1TPZA 2V7QA 3O73A 2IPOA 3LAWA 4JA0A 5A3QA 1SMKA 4BOYA 5FPPA 2IY8A 4RKEA 5IAAA 5CR9A 1AH2A 1RLTA 2G07A 4FHFA 5FB3A 3PHJA 3GJ0A 1P5RA 3WGHA 2D2IA 3QF7A 1D1SA 1Y48E 2PGOA 5DYWA 4BFXA 3GU3A 3EN0A 3A0RB 3O0TA 3JQFC 1VBMA 5DWQA 3GJ5A 5CT4A 4YCCA 5BT9A 4J75A 2FMIA 4IIJF 4ZO9A 3RVBA 3S40A 5J3JA 2IK8A 3GUVA 2JD1A 3VI4B 2P2LA 4XLLA 1QUFA 2IX3A 2PRKA 4MSUA 4R81A 2EWVA 2BMAA 2FRXA 5KIAA 1C3OB 2D4AA 3U4IA 5CM2Z 5I9BA 5MN6A 2WWYA 2QLMA 1QK4A 4Y0VA 3S2GA 2OAEA 3GDWA 1XE3A 3G1WA 4MHSA 3ISJA 3P2OA 4ESHA 2C7RA 1CRQA 1T91A 1UJBA 1KJJA 2V59A 1BXRB 4WK2B 1N6OA 1GQOA 2VTEA 1YT5A 3K9HA 3O1IC 3H1BA 3LGSA 4GLJA 3WQHA 2FV8A 3TD6A 3P1JA 3S70A 5CCEA 1GT6A 1PN3A 4TMXA 5D84A 2G17A 1NY6A 4S04A 2I65A 2WF6A 2Y3IA 2ZB2A 3CF0A 3GNSA 4FK8A 2B3DA 3IAS1 3NKVA 4ZC1A 4DZTA 1F8YA 3CRW1 3SYKA 1NJ2A 2FWPA 3TYXA 4BBAA 4J0KA 3ZE7A 3ES9A 3VU3A 1OGIA 3GZNB 1RQ2A 3VA7A 1ECJA 1PS0A 1C3EA 3A10A 4NH0A 4XE5A 1NP3A 3UF0A 4PHGA 3EGEA 5B7PA 3D5EA 2RAUA 4UTOA 1WXDA 4DY4A 1VIAA 4M8LA 3TSOA 4RIHA 4DDVA 4FDLA 3TEMA 5CFPA 1ND5A 1IM8A 1O08A 3UT6A 2QG4A 1T4DA 2XOEA 4GPD1 4PBRA 4TL7A 4DCGA 3MT9A 4D42A 1USKA 4NMWA 2DHRA 4OHVA 4WZ6A 4OI2A 5AJVB 4B45A 1OLSB 5JASA 1VJ1A 3W2FA 5C35A 1DOZA 5EZSA 2JVIA 1F4PA 1JF8A 1JIVA 3HKDA 3VO9A 5G3ZA 2QVCA 1Z34A 4M22A 4C88A 1JP7A 1IIBA 1DX6A 2P9GA 4R8MA 3MTIA 1XHLA 3HYNA 3C87A 1E4EA 1ISGA 2M6RA 3IJPA 4IGIA 5FA5A 3RYIB 5J5AA 4AXBA 1IRXA 3UVEA 1X39A 2I8CA 3PEUA 4LYGA 4MW4A 5DXJA 3RVNA 5JCXA 4O63O 4EGCB 1E2HA 3U39A 4F5ZA 3WOHA 2F55A 3VX3A 2NACA 3RJ5A 3IA2A 2QRUA 5T4BA 1KDPA 4DQDA 4N0PA 2CXHA 1N9GA 2P2DA 2W2NA 2JH3A 1VL2A 3ZD8A 2C7QA 4GC9A 5U9CA 2YW9A 2V9PA 1DTEA 1XZLA 4J1TA 1M5UA 5DHQA 4D4IA 3KZKA 3F5MA 2WJ6A 2IPXA 4TUYF 4ZEOA 2HU7A 1DEHA 3VNVA 2YWBA 3C6KA 3CPEA 3FLAA 4FMCB 1M33A 1ABEA 1PR6A 2VKQA 3I8XA 9ATCA 4GWLA 4I1UA 4IV5A 4TN1A 4PYRA 3FDIA 1J20A 1P91A 1Q0SA 4DW8A 4UPEA 5AI6A 1ZMOA 1G0OA 2MSKA 1U0RA 4BNWA 1W8IA 1DT3A 2HBYA 2OLKA 5DW3A 2I3DA 4GP9A 2AUTA 2R6FA 4IHJB 4HLUA 3CJRA 4GVLA 4Y2VA 3F4KA 4LQLA 1QIHA 4PCLA 1J1UA 2B8WA 3Q3CA 1U2GA 3AESB 1RCTE 4YI3A 3FOEC 1G4HA 4MWEA 5BRNA 3HDYA 1Y7PA 4KJZA 1GPDG 1VLQA 5FPQA 5EJMA 2XVXA 4PS1A 3INYA 4AQ7A 1VBKA 1G21A 2I55A 4TKVB 3SQNA 3FCEA 1R6BX 2HHAA 1O89A 2Y05A 3JPYA 4I9HA 4ER0A 3BPSA 2AQIA 4CIDA 1UZAA 2JFBA 4QXPA 5FTLA 4J03A 1FYFA 2O06A 2ZTUA 3OCYA 3QUTA 4OY3A 5IUJC 1VL5A 4GUDA 4DMMA 1QBKC 1RI4A 5A06A 2MMCA 4FMPA 4IOLA 3FOCA 1N92A 3ZWBA 3AT1A 2OORC 2X2PA 1XTJA 1JQAA 1YDWA 3FHLA 3H2HA 4Z7QB 4RESA 1T8PA 1YCDA 5L3SB 1B8PA 3EH1A 5JVDB 3OP4A 5C1DA 4QFCA 3BJEA 2GZ1A 4ZC8A 3DR5A 4ND1A 4HR7A 1MJNA 1EGQA 2BSQA 1E6EA 3USES 4Q19A 4YJGB 1YQTA 2IYYA 2O05A 1SVLA 3F4BA 3TPCA 2PMBA 3C6YA 4AS2A 3C41J 4OU5A 3AM3A 1XNJA 1E2EA 1FVFA 5J2TF 1Q7RA 3EZNA 3GVPA 3VPGA 1B6GA 2PSHA 3B8EA 3CRRA 2UXCB 1S8NA 4A2PA 3O83A 3CW8X 1VCIA 2V9ZA 3LP6A 2Q62A 4FYYA 1EK6A 4YMUA 1XZFA 4Y3UA 3LUFA 3LYLA 3TRJA 4CIWA 2CNWD 2VLIA 5TS3A 3ZE0B 4IY1A 3ZNOA 1C8LA 4DMHA 4KXYA 4XIYA 1QF9A 4GSLA 2QBYB 5JNRA 3OEEA 3GYBA 2QM8A 4YP0A 3L0YA 3WGZA 3NIGB 2A7XA 3A3KA 2V3WA 2AFHB 4UU0A 4Q9DA 1P2FA 5ECDA 4QSHA 1GSAA 5HIMA 5IT4A 2UVPB 4YMSA 1JMKC 1MR3F 2IOQA 1B8UA 2Y68A 2OGZA 1HZZA 2AJBA 4XZ3A 3OEHA 2VRCA 3EULA 4MUNA 5ILQA 4YQEA 4YRAA 5YASA 3P5BA 2XCRB 1CR2A 4RPKA 5JWRA 1B3BA 3FAZA 1UT5A 1P1IA 1TK3A 3NVMB 2GHQA 2B8EA 3Q0IA 1VI2A 1T24A 3TL2A 1VRCA 4QVGA 3WNVA 3ZI7A 3ONDA 5IWAB 2P5YA 3L8HA 5FBVB 4L75A 5DNCA 2R751 3HA3A 1WNTA 2JFZA 1F20A 3L4BA 4X5OA 3U1BA 3CU5A 1NXTA 2Y1GA 3MW8A 1EUDA 5EHIA 2ICAA 3PDHA 2H54A 5DP1A 2PJUA 3DZKA 3F8TA 1UBLS 3HY3A 3M4NA 4C7OA 1ZW6A 5I3ZA 3E9CA 3NC1C 3LUPA 2YMMA 4D44A 1ESZA 2HZ7A 2H9AA 2PKEA 2AC4A 1JXQA 4K7JA 4RD1A 1OT3A 3BXHA 4P3PA 4ESOA 4QJ3A 3KNZA 2R86A 4OTZA 5HS4A 1NFFA 5G53C 4C3UA 3FPAA 5B3JA 1UBNA 1SHKA 2HQBA 1P2UA 2Y66A 3MYYA 1FSZA 4KQ2A 4ON9A 5J4KA 5MN5A 2OVBA 2VN8A 3ACBA 4HAIA 2D1FA 3U7EB 4BEVA 4V2UA 1XLTC 2FWBA 1MENA 3U7RA 1K06A 5K2MA 3SDBA 4ARZA 4C2TA 1SB9A 4J1NA 1U1FA 1LPMA 2GS9A 3U48A 3OPYI 3F73A 1GVNB 1WB9A 1TGYA 1XLWA 2ACEA 1MOQA 3KSZO 1MIHA 5AUPB 4TQAA 4XSHA 4MYRA 5DHSA 3KV1A 4JI2B 13PKA 4EGJA 4US2R 3UMVA 1DCFA 1VL8A 1GFWA 2YWEA 1QCZA 3PJDA 2QMYA 1ZNQO 4IUCS 3ROEA 2QT9A 3NIWA 5CHYA 1G2IA 1P2DA 2QTZA 5LIRA 1IHOA 2VUHB 1A5BB 3C6ZA 3F3MA 4X64B 3LFUA 1E5TA 2AOVA 4S2UA 2Q1SA 3GGCA 4R0NA 2PKYX 2PZBA 3GFPA 1UXIA 3LHFA 4EVIA 3E18A 2WTAA 2PO5A 1YCHA 2HQRA 3D6HA 3MG9A 2JJ8A 1Z5WA 5ALZA 4C29A 2R7NA 5LQKA 1WCYA 4LDNA 3THWA 2OO3A 3QELA 4M6WB 3INNA 5BMVB 5EJ8A 1P4JA 5FEUA 3CZ5A 3NU1A 1LK5A 3PGXA 4QVKA 1XJ5A 5IM4F 2Q5EA 2ZSBA 3O8DA 4RUKA 2VYQA 1T5HX 1QE3A 1JU4A 2PXAA 4LMBA 1MHTA 2QI9F 3ZV5A 1JVBA 3TUIC 1TIPA 2AFHA 4FX2A 1IJKA 1NF3A 1NMZA 3P97A 2HYDA 1E1RD 3OZFA 4IHJF 4O2RA 1CUYA 2RAVA 4ZQCB 4ARVA 1TYEB 1XJCA 2AZDA 4LXYA 2WZBA 1W30A 1GRCA 4CLOA 3ZW7A 1E2UA 2WLSA 4M0CA 3BL5A 3GLIA 2JCBA 1QB8A 4QX6A 5K0NA 3TIVA 1P7VA 2IEBA 4PS0A 6PFKA 4Q7KA 2F9FA 1V6CA 1E1DA 2P9FA 3HJCA 3MTDA 3O4IA 4QGHA 2PRSA 2DBQA 3RK1A 3ZGYA 5HA5A 3KYCA 4KVAA 2ANBA 1TF2A 2K5UA 1COZA 2H59A 3CO0S 1V45E 2BDEA 1O94D 2DLNA 2OPHA 4DPLA 4DRXA 1KH2A 2RONA 2ZDQA 5KB3A 3WR5A 4IR7A 4EENA 4KI7A 1M0EA 5CT9A 2X5NA 3O82A 5IHXA 3QX9A 1XTZA 3KT8A 4UXIA 4XRRA 5E3IA 1T1JA 1T3SA 4N9WA 4UM9D 121PA 4RK6A 4Y6QA 3EBOA 3FVVA 4YP5A 5HFNA 3WADA 1BCRA 4PSCA 3R9XB 5DTJA 1OWMA 1GTG1 3AHEA 1EAYA 2RSLA 5AK3A 2VK1A 4XD7A 4R0MA 2ZWIA 2FLKA 3EGIA 1F8XA 3ABIA 4WKOA 3SX4A 3F78A 1NVVR 4LJAA 5AK0A 5E7MA 5JU6A 1NKVA 3RM3A 5LYJF 4FPXA 4O4IA 3DBRA 4C0KA 5EI5A 1E1QD 1EG7A 1MH1A 2GEUA 4X60A 4F86A 3HRKA 4WOBA 5F7OA 4BRZA 3OJ0A 3DGFC 4XIFA 1E3WA 1UQTA 3KHSA 5LLDA 2JK1A 1KK1A 3H9GA 3IIKA 1NZJA 1PAUA 3F74A 2HPAA 3LPLA 5CPFA 5E1OA 2NPIA 3I0NA 1WO8A 1ZU4A 2Q8QA 3HNRA 2YL2A 2FUEA 4BNZA 2AVDA 1NC1A 1NT4A 4JT9A 3BZWA 3DVSX 4UMEA 4WAUA 1QV9A 4K9LA 3EXIA 1PGPA 1LC0A 1W25A 2RCYA 2YWGA 1L5RA 3DAOA 3FTCA 3W3AH 4E1AA 5LR6A 5F9FA 2G4CA 5BVHA 4Q4JB 1IRIA 4TL8A 1Q1QA 2KJQA 4RV9A 5DTEA 3DFMA 4E5VA 4NK4A 4BB9A 3VOAA 2V74B 1JHRA 1UZNA 2OCYC 1N0HA 2HSWA 1ZK3A 2V58A 2ZJOA 4KDFA 5T6MA 5T4FA 5F1PA 4TRNA 4YRLA 3D7KA 3T9EA 3WLNA 5KOHA 4TSFD 1NVMB 3O9ZA 1NG9A 1Y7LA 5HFAA 1TX4B 2HMTA 4A0RA 3NANA 6CHYA 3KKNA 1Z37A 4MKIA 4MYHA 5C3MA 2NU9A 1VC2A 1QV7A 3CONA 4B3SB 1D0SA 1OZFA 4IUDS 2PE5A 4DZRA 2JGMA 3WXMA 1GAXA 2W2LA 4HQNA 2WYVA 3WC4A 2C4MA 3TW4A 3ZJVA 2YRXA 1I4LD 3IURA 3E9DA 3GROA 4YONB 4J3NA 5HZKA 5IFLA 2B5OA 1N4DA 2P9ZA 2QL5A 2AOXA 3COSA 4FUTA 4IMPA 4RD6A 5D1HA 2DGDA 2OECA 4ZD6A 3PIDA 3D7LA 1L8LA 3EODA 3W8FA 5ICEA 2IYXA 5DMHA 5A2GA 1YONA 1UBOS 5GP1A 4TM8A 3ZWPA 2HPHA 4F8YA 1E1QA 2CWDA 1QHSA 3JV7A 5BW5A 2QP4A 4EF4A 3UATA 4KK4A 3IJRA 3LQKA 4RFSB 3ZBUA 3EXFA 4HTFA 1SXJE 4DC1A 1P9NA 3KR0A 2WW8A 1RC8A 4FHDA 5LQJA 2I4IA 2A33A 2CJFA 3CS3A 3JQAA 2BI4A 4DWWA 1WB6A 1HDGO 4RSGA 1Q7BA 2QRVB 1UAYA 1TL7C 2EW8A 4M0EA 1ONOA 3IMKA 4JBIA 4TX1A 1P2SA 3S8EA 3DMHA 3MT0A 4ZJYA 1JG3A 3CSSA 3I1JA 2OKGA 5CFOA 3FBWA 4KU4A 2GD0A 2I6FA 5HF6A 1J8DA 4RACA 2KHZA 3NO4A 1HDIA 4BKOA 2GHRA 1JHOA 3O26A 1WY5A 2ID4A 2PCLA 4LXUA 4BMCA 1NC3A 3NHAA 1QG2A 2FEXA 4KTTE 1MG5A 1QYDA 1NWHA 2EKQA 2V7XA 3RJ9A 4R71A 1XNRB 2HSZA 1ZVMA 2YHSA 2QN2A 2HJ9A 4IKPA 4PHFA 4MS3A 2R6GA 1CEYA 1NW8A 1TFRA 3O8CA 4LHZA 2TS1A 3OX1A 3ST7A 3K2BA 1M2VA 4LSWA 3GAZA 4Y18A 4EEKA 4DR1B 4CG2A 2B1RA 1I5RA 2ZBVA 2ZS9A 1FC0A 4IXTA 2VJBA 3B2EA 5CX4A 1FIUA 3STXA 4F97A 5AW8A 1CVRA 5AJXA 2FZWA 3TLYA 4Q4HB 1DHTA 4PGAA 3D7SA 1Y1KE 3H6KA 2XOKA 1RZ3A 4J2HA 4HS9A 4NC9A 5F7JA 2I9PA 3H17A 1WXQA 3C70A 1V3UA 4TT8A 3ZNNA 4GXRA 1CG6A 1SA0B 4B3JA 1QFXA 2P69A 2X8JA 5KYVA 1VE3A 1QR2A 2NADA 4R2MA 4FEGA 4NEQA 4CDMA 4AURA 1LPBB 1GN9A 2VWGA 1FRFS 2NZXA 3ZU4A 3X3HA 4EYQA 3B3AA 2C4HA 5H68A 4N76A 3P4YA 3I52A 3P4UA 3B1VA 5E4FA 3TVDA 3SXUB 2WWXA 3DKIA 3HZZA 1CJKC 1QJ4A 5LQRA 3UOAB 4TS1A 3D6MA 5FBHA 3V8BA 2IH2A 3CEAA 3VYRB 3PDIA 4J6EA 3HA5A 3JYOA 4CPDA 4PG4A 2RH4A 4GLFA 1G291 4EJ0A 3DZFA 1YZ3A 1KYIA 4G63A 4H7JA 1XKLA 3TR6A 4P4SB 1JTFA 1CERA 1P44A 2P2CA 4FYVA 4K03A 3NBZC 4MW2A 2GXUA 3MELA 4KNWA 4LDJA 4ZOLB 1C9DB 4N8EA 4YV0A 2VDMB 5TARA 1GL6A 4MCAA 4MLDA 4NOLA 4OEHA 3ZDFA 5SY6A 4GYKA 1Q1AA 1T3TA 2ZSUA 2OHFA 3REFA 5KX5B 5CDYA 2GPTA 2IEZA 3THXB 3MWGA 3IXLA 3IEPA 1MFZA 2VFAA 4KO8A 1TQ2A 4Q15A 1E98A 2Z08A 4MUEA 3IEKA 4YACA 1WETA 4BN0A 4BQOA 3PKJA 4FKMA 1D2NA 3ZS9A 4CMCA 1R5OA 2W2KA 1VJRA 2W5UA 4NULA 3KSBC 4H1UA 3GXBA 1WTCA 3TSWA 4CKWB 1N57A 1XYYA 4QGAA 1PR4A 1YFJA 4O8ZA 1YS7A 1GV1A 2PMDA 3TIIA 2Y0BA 1GL9B 4ZT7A 3BQ9A 1Y5MA 1V3TA 3ESZA 1YZYA 2UZ4A 1MVNA 1A8QA 1G3IA 1W85B 3R6WA 4N48A 3PDIB 3HU2A 3NYWA 1ZNXA 4IIFA 4NZMA 3X1DA 2NU8A 2VK2A 1AKQA 4IVPA 2VHUA 4L15A 3SXUA 2W6IA 4JOQA 5AM0A 1NVVQ 3O4GA 1BRTA 2G71A 4KQWA 3TI7A 2NO6A 1YTLA 3HCEA 2I6QA 5CFLA 3I5AA 3QVKA 1XVUA 3GI1A 1YUMA 5UKDA 4MWSA 4QYSA 5LP6B 3T7EA 3TZKA 3NXKA 1OYWA 3D3EA 3D8RA 1EFA<