4EPYA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epyA00
3W8NA 5CIWA 2F6RA 2ZR7A 2OCYC 2ZQ5A 2O0HA 3W6OA 4WAUA 2XJ4A 2C9OA 1Z0DA 4D0NA 4UQOA 3QG5A 4FWIB 3ETLA 4PR0A 3UWKA 4J0QA 5J4VA 4E22A 4Q5IA 5FR2A 3SFVA 2C77A 5TB5A 1XJQA 3K53A 1AKEA 2VBCA 1FUUA 5CJ2A 5DSZA 1YRBA 1WDTA 2B8TA 4H9GA 4B32A 3KQNA 1YKSA 1Z6TA 3L43A 2IF2A 5A0FA 1CRPA 3TUJC 1VCOA 3GLIB 1TNDA 4JBYA 3M6AA 4JL8A 4DT1B 1IONA 1R2QA 2EWVA 3X1ZA 1L7VC 2ZSFA 5FOWA 1VYTA 2EWWA 4Q9IA 1OXTA 3EZ2A 1K8RA 4Q4HA 3REGA 3CONA 1P60A 3CWQA 4HLCA 1Q57A 3D6TB 3LWNA 4Q9LA 3PV0A 3CBQA 1WRBA 1ZIOA 1NMXA 5KSPA 1VHLA 5GJWC 2HJGA 1NP6A 3GJ4A 3HDTA 2ZS7A 2JJ2A 3DZDA 2R8RA 3B78A 3WBJA 4IXMA 1JR3A 1HV8A 4B34A 4DLRA 2FSGA 3FE2A 4MYTA 5DE3A 4F4JA 3LQRA 1XMVA 2FFAA 3BH0A 4EJSC 1ZVQA 2OG2A 1I2MA 3GEEA 2DY1A 4P0TA 4RCYA 3KXIA 4NONA 4RVCA 3JZMA 4IDOA 2WSSD 2DCUA 3MJRA 4LV8B 1RC8A 4MKFA 5JI3E 2HYIC 1CKEA 4G5RA 2XB2A 5EQTA 4LJ6A 1ZCBA 4OI1A 2QTHA 2F1JA 5FPYA 3L0SA 4DDUA 4E07A 3EA5A 4IHQA 5GJBA 2QN6A 1G7RA 4C0QC 4GSYA 4OQLA 3AVTA 4Q4HB 5EZ5A 1R5OA 5FPTA 2CL7X 5FR1A 4NYJR 4S2EA 3RNLA 3K09C 4PSAA 4PHHA 1KI9A 1VTKA 4EJSA 3T61A 1RRPA 2WJIA 4YMVA 5J47A 1LFDB 3BFVA 4I1VA 5K8UA 1S3SA 3DO6A 1N6PA 4LC1A 5CJPA 5FL7D 4OJKA 3I73A 2QAJA 1TEXA 3NIBA 4Q1EA 3RYTC 4JYCA 1OFUX 2C5LA 4DSUA 3TMKA 5E7IA 2O8BA 3CR8A 3K1JA 1W36C 2R2AA 2Y8EA 4I4LA 4LYFA 3AP1A 4KJZA 1AZTA 3OE7D 3P27A 2ZIAA 3NEYA 5DNYB 2ZAOA 1ZM4A 1UADA 4AC9A 4CEJA 2VA8A 4NMMA 1S9DA 3TNFA 1KDPA 1OH5A 2BMFA 1FTNA 2OXCA 1N0VC 1XTSA 2FSIA 3AVXA 1NBMA 1XTIA 1NVVQ 1P2SA 3TR5A 3PEUA 5L3RA 4XD7D 4C0BA 4R98A 4WA7A 4D0LB 4DB2A 2JJ2D 1JR3D 5C46F 4A6XA 3QPWA 1Z28A 2CHVA 1VPLA 3B1VA 3C16C 2GCNA 4JT4A 4P4TA 4B33A 1M7BA 2B8WA 2GJKA 3OAAD 4JVMA 4MRNA 2Q9BA 2QM7A 1R8QA 2ZYWX 1SVWA 2J7PD 2O8CA 1QG2A 3NC1C 2SHKA 1T4GA 4IJMA 3GQBA 1OIWA 2ATXA 3CB4A 2AN9A 1GNPA 4KVAA 4KSCA 5DHFA 3FMIA 4CZ2A 5JRJA 1MRSA 3RS5A 4BUJA 1N6NA 4A8JC 4FMBB 4DVGA 4NH0A 1XTJA 1ZUNB 2BMDA 1SVMA 1XEWY 3X1DA 1Z5ZA 2WJVA 2C95A 2A5YB 3ZIAD 5CDFE 3SHFA 4MGYR 5FOUA 4V0NA 3NBYC 4PC7A 1QVRA 2JIZD 4PFSA 1CR4A 2ONJA 3K70C 5LD2B 2NO0A 2PEYA 1ZRHA 3VX4A 1T8UA 2BV3A 4CEJB 1G3IA 1ZJ6A 1JECA 5SZJA 2H5EA 3A1SA 5C2JB 1RYHA 5GVRA 3QOFA 2A2ZA 4QBHA 2WWWA 3A6PC 4DLUA 1G7TA 3CF2A 1GRRA 2HV8A 2YV5A 5P21A 1HE1C 4NCKA 1G4UR 4AKIA 4Q48A 4Y0AA 3RSLA 1ANKA 4GOXA 4OHZA 3JZAA 2VP0A 2G9NA 3FOZA 1E1QA 4AWXA 1G291 2J87A 2OLJA 4ZDIA 4TN1A 2GESA 4D4JA 1I2DA 2CXXA 4M21A 1QRAA 4X8MA 3GLIE 4E09A 1II8B 3THXA 5EP3A 4UNSA 1M7HA 1YVDA 5H8WA 3BK7A 4FMCB 2J46A 4BRUA 3DMNA 4YMTA 4B71A 1FZQA 1HA3A 3EZ9A 2LWIA 3V4FA 2ZS9A 3WMEA 3IPXA 3GD7A 1NKTA 2HXYA 4BRWA 4MRPA 3VNVA 2HDNB 4ACBA 2YWFA 2OEPA 4FI3C 5EE1A 1F6BA 4US0R 1BOFA 4DDVA 4DCTA 3ZVLA 4YMUA 3VMFA 1X8LA 3MD0A 4QGHA 3LDAA 1W46A 2PJZA 2WWXA 3UMSA 5DH9A 2KSQA 2EFCB 3LFUA 1TUEA 2AKAB 2HF8A 3KJIA 4LBWA 1NJFA 2WJGA 4M22A 1G5PA 5FFMA 3RHFA 2G1KA 1GFIA 4LBYA 4HUQA 1W4BA 1DG1G 1OXUA 2X77A 2OFWA 3SI7A 3T1TA 1CJVC 2FSFA 1DO0A 2QE7A 4D2IA 2PT5A 4I1OA 2ZRAA 4URUR 2IX3A 2A5JA 3U7HB 4BASA 3OEHA 3C41J 2IYUA 4BLRA 3U3JA 1E32A 1R4AA 3I4LA 4K46A 3VR4A 1T6NA 5J5CA 3LXXA 1ZNXA 3SHWA 2W0MA 4GT1A 4C0JA 1YR9A 4DCUA 2QP3A 1J90A 4ZIRA 5JI2E 2Q3FA 2FEOA 3DM5A 4DRZA 4JJZA 3THXB 5JWRA 2ODWA 1G3MA 1UKEA 2P67A 4B3GA 2G83A 3LVRE 3ND8A 2P5SA 1KO8A 3Q7QA 1G16A 3KX2A 1UJ2A 5ELXA 5AUPB 4JLMA 1EFTA 1DARA 4LX0A 3WHKA 4M9QA 1JBKA 4G5SA 3SQWA 4FWTA 3TVDA 3EZ6A 3E5HA 5F9HA 1IM2A 2FE4A 1KI6A 1R7RA 2ZRJA 1DTSA 4LI0A 4LV6A 1XEWX 4GBMA 1JR3E 1Q3TA 4M2LA 4POAA 3AKEA 1GSIA 1M2OB 2CJWA 1E9EA 4HUQB 4B3DA 1KKLA 4FN5A 1Z6AA 521PA 2ZREA 2F3RA 4C3ZA 4D82A 2KBFA 1YZTA 2IC5A 2WOJA 2WOOA 2XAUA 2ZJ8A 4Q1DA 1E0AA 4U02A 1ZM2A 5JECA 4URXR 5EP2A 3L2OB 2V7QA 2QMOA 3B1WA 3AKDA 3KTAB 3NC0C 4D26A 1UBFA 2FV8A 1OF1A 1KK0A 2OAP1 3FKSA 3AP2A 2AHOA 2F43A 3QXXA 1S4QA 2W2TA 1C9KA 1U8ZA 3GJ7A 4OK5A 1NVWQ 2ZSAA 2IYSA 2YNMA 5D3MA 3UG6A 4CEHA 2ZR0A 1KI4A 4Q9KA 4YMSA 4DDTA 1G5TA 2E9SA 5DGXA 1ZP6A 4BFXA 5CITA 4JIMA 1W4CA 3TSOA 1UDXA 4D80A 1FL9A 1OSNA 2FFQA 1EK0A 3WY9A 3I72A 3MUFA 4JLDA 3W90A 1COWA 1QHYA 4LV5B 1SVIA 4JLKA 1BS1A 3UWOA 4ZV4A 4OK6A 4OQMA 2VPPA 2OT3B 2WPDD 1ESNA 1L4YA 1P73A 4JYBA 2QAGA 2IS6A 4G0NA 1MO5A 4O25A 3WP1B 1S9HA 3HJNA 4BZPA 5B57C 1E0SA 1E2EA 3I61A 1E9BA 2QGNA 2R6AA 1NBME 3JVUA 3UK6A 2XXAB 4OHWA 1F2TB 1UAAA 3T12A 2HF9A 4GDFA 1UFQA 2Q9CA 1CJKC 2XTZA 4HLDA 4M1SA 4LSGA 1QHXA 4WIAA 5K8LA 5DISB 1KKMA 5F2EA 4UKDA 2QTVB 4PC2A 3H0KA 621PA 4RY2A 2VSOA 1SVSA 4OHVA 1E4VA 1KDOA 1WXQA 4AK9A 4PAMA 1HT2E 2JLQA 2NIPA 3PIRA 3FDIA 2P5TB 1NI3A 1E0KA 4MGKR 2G88A 4C0SA 4LJYA 3VU9B 4ZO4A 4S35A 3R8CA 5FUXA 3GLHA 4PQFA 3VKWA 4NYIQ 4I1SA 4JVLA 4HAWA 4PPQA 2EFEB 3QXJA 1P7CA 4MH0R 3FKSD 3BBPA 2F1RA 3KXKA 4KSBA 2QQ0A 1XEXA 1CR0A 4HLUC 5FI1B 4G5QA 3TUIC 5L3VA 3THWA 2QBYB 1RW4A 1W0KA 3PCRB 1CP2A 5DHAA 2W58A 4DXAA 3N70A 1I4TD 1TQDA 4QHSA 4C9BA 2ODNA 2AD5A 2GCOB 2A9KA 3BE4A 4C0KA 1PJRA 5F98A 2YHSA 3JVVA 1KGDA 1ZINA 2DFKB 1KMHA 1AZSC 1E79A 2CNWD 2YOGA 4LDJA 2Z43A 3CZPA 4IRUB 4DLVA 1W5SA 2GJ9A 5BYJA 4Q66C 2Z83A 1BH2A 2O8DA 1GOTA 3DDCA 1G9XA 1X1SA 1GKUB 2AK3A 2D06A 4IOLA 4PHTA 2BM0A 3RRNA 1SQ5A 1Q44A 1KJWA 4KYUA 4AKHA 4TMKA 3G0HA 1XBTA 1CR2A 1KIMA 1U98A 2H92A 1E2LA 4Q00A 2GAAA 3DM9B 3WNDA 2IBMA 3AUXA 4JLOA 4PO9A 5KNCA 1HURA 1OIVA 1NVVR 4M1TA 1G64A 3K8YA 3U4QA 2X2FA 1RPZA 5JJIA 2OBNA 3CX7A 3AH8A 3O8DA 3CF0A 4LUCA 1VIAA 3CW2A 4JLJA 2VLIA 3PUZA 3CRVA 4XTRA 1E9DA 1OHHD 1OE0A 2RGXA 4LJ8A 1XWIA 3CNLA 3L8YA 3WYGA 1G21E 3HR7A 1J2JA 2QRZA 3GPLA 2N1BA 1AS2A 2IXFA 3RS3A 2EQBA 4MKHA 3SJAA 3NDBB 2WAXA 3SN6A 5IRCD 4AYTA 2OZEA 1NN1A 5E7JA 4N3NA 2D62A 4OYHA 1DVRA 3K9HA 4KBGA 1W1WA 4IW3B 3PEYA 1GILA 2BJWA 1NN3A 4CIDA 4MKGA 4BZXA 2H8KA 2VEDA 1RRGA 2F9MA 1N25A 5AJWA 5IT5A 3ECCA 3W3ZB 3IGFA 2YWEA 2WWYA 4QNMA 1W0KD 2ASEA 2WBLC 5M04A 3EPJA 3GP8A 1XPRA 2JLUA 1Q1BA 2IXGA 2ONKA 4Y0VA 3RC3A 1DEKA 2HLDA 2ZI9A 1Q0UA 4D4MA 3KL4A 4TSFA 2D7DA 1KAOA 2ZRGA 1E79D 2O8FA 2DFNA 1F3OA 3BH6A 1KAGA 3A4LA 2IW3A 2ZEJA 3U4QB 1W48A 2ZJBA 2VP4A 4Z51A 4U00A 2W2XA 1VECA 3D7MA 5H68A 3QEJA 4CF7A 1KO4A 3S1AA 1OXSC 2UKDA 1N2CE 3T35A 2PH1A 2WHXA 1NG9A 1KNXA 1VCNA 4HZIA 5EXXA 2QA5A 1X1RA 2B7BA 2NO6A 3LX5A 1D6JA 2CHQA 1NG1A 2UZIR 3NVAA 2GXQA 1KDRA 4RFVA 5LPNA 5DLQC 5D3QA 3SZRA 2IS2A 1CS4C 4GL2A 4OI4A 1XD2A 3VX3A 4NDZA 3TSWA 5FTNA 2FJUA 1K6MA 4AYXA 1DAIA 1TUIA 1Z2CA 1N0UA 2X8AA 1S3GA 3GJ3A 1NVXQ 2V1XA 5AJVB 5FPHA 3BJIC 1P75A 3GFPA 2IYTA 3NKVA 5FOVA 4Z1MA 4DLYA 2V3CC 5IK2D 3O8CA 1EFRA 1E2PA 1G6OA 3ASZA 1G41A 2VHUA 3MRSA 1QHSA 3CUEF 3VKGA 2IT1A 1N5KA 1GL7A 3X1WA 1NVUQ 3U44A 1OT3A 3MWLA 1A82A 3CO5A 4MRSA 3U3RA 2WWGA 3AUYA 4HB2A 2CBZA 4NTZA 3F5FA 1E2NA 2VP9A 4KCGA 2XEXA 5DN6D 3MJHA 3WHLA 2FGJA 4DSNA 5HCIA 5TY0A 2Q21A 4JZKA 1W7AA 4KFSA 4CVNA 3A4NA 4TWZA 2PL3A 3B60A 3I8SA 5FH9A 2P6RA 4PHGA 3MGCA 3PQCA 4WBSA 3AF0A 1ZU5A 2ZYTX 4UXJA 2ZI4A 2XNDA 3OZXA 5JFGA 3MFYA 2R65A 4LJ7A 4TSFD 4HSEA 3X1YA 4MITA 4DSOA 2IEZA 2IWRA 3B13B 3CH4B 1T5LA 1XD2B 1P2UA 1Y3AA 2ZJOA 4Q21A 1GKYA 2GF0A 3GCGA 3PFIA 4BFUA 1D9XA 4O0MA 3AV0B 2GILA 4BWYA 2CMKA 3CZQA 4B76A 4QXAA 4X8HA 1CULC 1T3SA 3WRXC 1OH6A 2QTFA 4HATA 3A1WA 4JS0A 4HB0A 2JJ1D 5CLQA 4KVGA 4IKEA 1Q3HA 4A6PA 1E69A 4HDOB 3U3MA 2D4HA 3C15C 4E03A 1P4SA 4MRVA 2PZFA 4Z8XA 2G77B 1KY2A 1SHZA 2PEZA 3THYB 2JDID 5KNBA 1E94E 2P2LA 4H1UA 3TE6A 3B8HA 3HYRA 1IOZA 2A3RA 2X1VA 3K9LA 4TMVA 3GLGB 1KI8A 1NF3A 1YR7A 2CLCX 2RAPA 3C8UA 3UPUA 4TT3A 4EKDA 1EFRD 1LS6A 4KAXA 4A0RA 2QI9C 3QKRB 3QBTA 4XVQA 4NCHA 1O87A 3C14C 4V03A 2VIIA 3W8RA 3K0FB 2KB0A 3PVSA 1XCGB 2A7QA 5G40A 2QT0A 2ATVA 1BYIA 1CR1A 1KMQA 2QPTA 2RGDA 3GLHE 4GOKA 4Q02A 1S96A 1GAJA 1Z0FA 4KYIB 5G3YA 1WB9A 4RFSA 1CJTC 2Q3HA 2W6IA 1XJCA 1SXJA 1XDBA 4RSGA 1E1RA 1VG8A 2PZEA 4RJLA 5KHOC 5A5GA 2I1QA 3HWSA 1I4LD 1XMIA 2VH5R 4M1MA 3CH5A 4HZUA 3GMTA 1BKDR 3RABA 1GP2A 2WIBA 3BS4A 1FMLA 5JHHB 5JLJA 1PLJA 3Q5DA 4GOJA 1DELA 1M7GA 2AFHE 5AWFC 2ZUDA 2WJJA 2ZJZA 2B92A 4JSTA 3RS7A 4KO8A 1I4DD 3ZD6A 3C4JA 2WIAA 3KB1A 1FNNA 1E9AA 2C8VA 2XZPA 2GRJA 5EXPA 2BBOA 3AVYA 3K0AA 5C4GB 3FKQA 2J0SA 1W4AA 2GA8A 2H18A 4W5JA 3FVQA 3TAHA 3QXHA 1IXSB 1KSFX 1SVKA 4NYMQ 3HR8A 2QSYA 4FIDA 4EPRA 5G53C 3NXSA 5LB4A 2A5FA 1PVOA 3ICQB 1XTRA 4UNNA 1YQTA 4YXWA 4CT5A 4YC7A 1OH7A 1T3LA 4RKEA 1LNZA 2BVNA 3QJYA 4D6PA 2YJTD 3KB2A 2OAQ1 4RZ2A 3IBYA 3DOFA 3ZZUA 3BIFA 4AI6A 2DFTA 5CIQA 1K5DA 1H8ED 1Z0KA 2WWFA 3F8TA 3RDPA 4A4DA 5HZHA 4QM6A 1AA9A 4GZLA 2JCSA 2C99A 4N0DA 3UKDA 1EXMA 5J40A 4CEIA 2AWNA 4TYYA 1DG3A 5KNDA 2N46A 4PZZA 4LWZA 4OHXA 2JLZA 1IHUA 4XSGA 4ESVA 1MO6A 1W44A 2D2EA 1J8MF 3LA6A 3ZVMA 5JCPA 1Z22A 1UM8A 3G82C 5EE0A 5TMPA 2IYYA 2W6ID 3O47A 4NYIR 3PR1A 5B64A 3AF3A 1O3YA 5FTLA 2QENA 2FFBA 1F2UA 4B6EA 3VHXA 1HQYE 2PCJA 4GPTA 4PTLA 4HEJA 5KSYA 1G3RA 1W47A 4NBSA 1GWNA 4ZI3A 2RGNC 4WZBE 4PZLA 2H1LA 1ZC4A 1ZIPA 3MAAC 3OIYA 4JLBA 3PITA 2XGJA 4HLQB 2A30A 1Z6GA 3ZS9A 4IXNA 5FUVA 3K09A 3L0PA 3KUCA 2ZETA 1WA5A 4P4UA 3WBKA 1KK1A 3TW4A 1G18A 1TPZA 3VTKA 2DHRA 1P62B 1FNMA 4CEIB 1Q1EA 3LBHA 3W6NA 1ZM3A 4IDQA 2RH5A 4EDHA 5HE9A 1JJVA 2EU8A 1QDEA 1J70A 4YXWD 4A2WA 5KDDA 4MKIA 3LO5A 1RRFA 2HT1A 4ZDWA 3TGPA 5CYPA 2CDNA 4GRAA 4RD2A 5HTKA 5JRZA 3EARA 4WVFA 1IJFA 4EJSB 4DWJA 1F2UB 2IUUA 4K8OA 3CWZA 4LYJA 4WW0A 2B6HA 1S8FA 2IYQA 3AM1A 3MWKA 1P61B 2BMEA 2JA1A 4AG5A 1HTWA 1FQJA 3NEJA 5LB2A 3QG1A 2O8BB 2HCJB 1ZD9A 1XRJA 2H57A 3B82A 5E7MA 2FPKA 4QHYA 4DCNA 4B3CA 4EFMA 1QHGA 4PAOA 3RRZA 4LK2A 2VL7A 4KLZA 3MWJA 1CBUA 1BMFA 2YZ2A 3GFTA 3GLGE 4OK3A 1XMJA 5AJYA 1EWRA 2C96A 4YDSA 3CR7A 2GJ8A 4KFRA 2OM2A 3UANA 4C7OA 1KI7A 2AXNA 4URZR 3B9QA 1JB1A 4OI2A 3LBIA 5JJKA 4Q1AA 3K0SA 3U3KA 3REFA 4A8JA 3OEEA 1A7JA 1FTSA 4EPXA 4Q7LA 3QF4A 3OIWA 4NCJA 1G7CA 1XTKA 4M4SA 5JWOA 3A58B 4EUNA 4JKYA 1U9IC 3PG5A 4YDHB 4IVPA 2O8CB 1NBMD 1P9RA 3N2EA 1E2KA 3QQ5A 4UNPA 4A0GA 4TQAA 2FF7A 1VMAA 2G3YA 4AY2A 2IYZA 4ON9A 5A4JA 4MDEA 2DB3A 2ZSBA 2ZRPA 5HKKA 1TU4A 2AXPA 1Q21A 3UXMA 2FG5A 1U0LA 1XCPA 3BRWD 4A9AA 2ZANA 1DAFA 1DAHA 2YWHA 1FFHA 1W36D 2L0XA 2RHDA 1U2RA 3SYKA 2R6GA 3I62A 2CL6X 3BXZA 1XFAA 1AN0A 2JLSA 3W5JA 1R8SA 1GL6A 5DIFA 2QG6A 1TQ6A 1V43A 3MG9A 3F0TA 1K5GA 5DYGA 2CE7A 4LRWA 4D25A 2XSZA 1TF2A 2HJVA 2R6CA 2GCPA 4JJKA 4DB4A 2ZRDA 3I3SR 1RJ9A 5E4FA 3OIUA 1IJEA 4HDCA 4PC1A 2I4IA 3A36A 1C4OA 1FOEB 1XMSA 3E1SA 2P65A 3CPJB 1UF9A 4B2IA 4TTRA 5C4MA 2V8OA 3SR0A 2ERYA 1GIAA 1BMFD 4Q4AA 3BWDD 4QHTA 4B3XA 4DLZA 4UXIA 1SXJE 4TQUS 4V0MA 3QBVA 1ZD1A 4G01B 1HYQA 3X2SA 1OKKA 1M34E 1P6XA 4PC6A 4Q47A 3D3QA 1U8AA 4D81A 1A2BA 2VP5A 1HEIA 2OLKA 3M0EA 2F55A 2BIFA 3BFKA 3OIVA 2GWHA 1XNJA 1KI1A 1E1QD 3ZDQA 3I8XA 2QNRA 3K70D 1YZKA 4L5BA 2JLRA 1D2EA 5B58C 3BOSA 1W0JA 3QUSA 4TL7A 4DIDA 1II9A 2QY9A 3GJ5A 3P1JA 4CW7A 2BBTA 2CEAA 1A5TA 2PLFA 4QJ5A 2IUTA 4B48A 4BFSA 3QSYA 4ZI2A 1DPFA 4A82A 1GNRA 4KBFA 1L2TA 3TK1A 3H86A 4DHEA 4OBEA 4MYHA 4IDNA 2ZUBA 5L3QA 3RWMB 3KQHA 1OW3B 3Q9LA 3SJZA 4MYCA 1Z3IX 3ZS8A 2ZS8A 2BJVA 5CK5A 2MSDB 2FPMA 2YC4C 4PPFA 2WJYA 3IDQA 4A0FA 3H2YA 1E9CA 1T9HA 4MQBA 3SBDA 1CU1A 4LHXA 1KK3A 1MOZA 4ZIRB 3BB3A 4LJ9A 5BW8A 4OQNA 1VKJA 3B5JA 2GK7A 2W00A 1MABA 2BMJA 2QE7D 4B43A 1TU3A 3B7GA 4CYMA 4HAXA 1VYUA 2ZJ5A 4EPVA 3BERA 4TL9A 2J0VA 1OLOA 3HP1A 3OEHD 4RD6A 1ZM9A 2J0UA 2OSBA 2ZRKA 3R20A 2XZOA 2B7CA 4LPSA 1GUAA 4GNKA 3ZQ6A 1JXOA 3D31A 5JCZA 1EWQA 1T91A 1GM5A 2AWOA 1KI6B 1D2NA 1KSHA 1M1YE 1DAGA 4LBZA 4K81B 3TW8B 2WMNB 4TYNA 1BIFA 1NN0A 4DLXA 2VQSA 2XX3A 4AIIA 2DWOA 2BOVA 1G3UA 1P2TA 2CJWB 1B23P 4ZDKA 4R7ZA 2DWPA 2XJ9A 1UEIA 2CVFA 3PUWA 4P31A 3AQ4A 1PUIA 4D0GA 4TZ6A 1EFUA 3EZ7A 2ZM5A 1C1YA 1GNQA 1GVNB 2IYXA 3N2IA 5GJCA 1W0JD 4NPHA 2OE2A 1GZSA 5TARA 2X2EA 3OESA 2NMVA 5AUNB 1MR3F 3KJHA 1OFHA 4NYMR 3L8ZA 5IHPA 4PO1A 2BCGY 3SC3A 3QI2A 4NKRA 1LVGA 3IHWA 2FDCA 1EESA 1JEDA 3CRRA 2F43B 4LJ4A 4V02A 2CCJA 2FX3A 1SGWA 2RGAA 1MABB 2DFLA 4IOMA 1SVOA 2W2VA 1RYFA 1G8FA 5CB6A 5D3MB 3IHLA 4F91B 4CEHB 4QGGA 5B30A 6Q21A 4NCNA 3NBXX 2V7QD 2VP2A 4C0LA 3ONWA 2ZU0C 2WTUA 1HY3A 1ZAKA 1G8PA 2IYRA 4AKEA 3GJXC 3I5XA 4BFYA 2ZRBA 2VRWA 2E87A 5GADl 4CDGA 1U81A 1LB1B 4WZAE 2ZJAA 3VR2A 5AR1A 4EPTA 2ZI3A 5B2ZA 1AS0A 1D9ZA 3U3OA 2QAGB 2JJ8A 2ORIA 3KJGA 5EXSA 2D2FA 5KDLA 2FN4A 3HYTA 2AR7A 3OF5A 1E96A 2ZYUX 5J4KA 2C98A 1KTVA 2VSXA 1YHNA 5CK4A 4GI7A 2JLXA 3T5DA 1FP7A 1COWD 4HI0E 2CLSA 1II0A 2A5GA 2ZROA 2JEOA 5IDVA 3SJCA 1ETUA 1KI2A 3DL0A 2PX3A 5E3HA 2IS1A 3NHAA 1W2GA 5FTMA 4B2LA 1AQUA 1Q12A 3QXCA 1ZNZA 3AF4A 4HLUA 3FTQA 1MO3A 1L4UA 2Q9AA 4TLEA 3KKMA 3T5GA 3QXSA 4XJXA 1VG0B 2Q0HA 5JEEA 4I81A 5JWHA 2XOKA 3M4YA 3WP0A 4W7SA 3T06B 2YWGA 2XTMA 2PZGA 1JPJA 3EPLA 3LLMA 2WICA 3U7FB 3NH6A 1DBSA 3GLHB 3AVPA 1Z07A 1CJMA 1NSFA 4TZ0A 2ZUCA 2DYKA 2IXEA 1NL3A 2GK6A 2VSFA 1YZLA 1TX4B 1UEJA 2AX4A 1XEXB 421PA 3THWB 3KXLA 1LY1A 1N3BA 2N42A 2NO1A 4ZKDA 4BFWA 2PCLA 1KJZA 2QEQA 3CM0A 4M1OA 2QU8A 4NHOA 2GAOA 3BH7A 1DAMA 4ERNA 2OCBA 2BEKA 4KFTA 1EX6A 1OXVA 4JBWA 1WQ1R 1E4YA 2D3WA 1XCMA 2HCBA 2C03A 1JAIA 1KMHB 2EFHB 4M8NE 2ANCA 5FUWA 4C0HA 4URWR 3GJ0A 4B75A 2LCFA 4QBGB 4IVQA 2ZITA 3G5UA 4O2LA 1FP6A 3BGWA 4PPGA 4PSKA 1DAEA 1QHHA 2NOAA 1WCV1 4FW9A 4RZXA 1UDWA 1OYWA 2O8DB 3R7WA 3ZVRA 3OFNA 2JLVA 1Y63A 4EFNA 2QORA 4LCBA 4BLOA 3IQWA 1N5IA 2IK8A 4TLCA 4ARZA 2NGRA 2IEYA 4OHYA 1U0HC 2Z5FA 3A37A 2VHTA 2GNOA 1GRNA 2G0TA 2Q3MA 4RZUA 3KQKA 3SQXA 3BB1A 5HR5A 2V6IA 5FPKA 2VHJA 2WMOB 4A15A 4OI0A 4IOKA 4EQ6A 2CL0X 3TRFA 4O3MA 2V54A 1N6HA 4B35A 2J9RA 5HCNA 1N6OA 2NQ2C 5CYOA 3ZZTA 1W49A 4P32A 5FTKA 4F93B 3ADKA 4PAQA 3P4YA 4MGZR 2C9YA 4JBXA 1U0JA 2QQEA 3W6PA 3W9YA 3FFBA 1LV7A 3AP3A 3CRW1 4AKGA 3Q3JB 2ZVPX 3IO5A 2GJSA 3EWSA 5KUTA 1WBDA 2WKQA 4QNRA 2V4ZA 1TL7C 2K5UA 1TQ4A 3EZFA 1YJ5A 3ZJYA 2D7CA 5FOXA 3E70C 2ODEA 2AFIE 2ZSEA 3A8TA 4XVRA 3ZLJA 1NN5A 2VHCA 1DAKA 3ASYA 3NHBA 4LJ5A 1FX0A 2ZR9A 4KHZA 2V55B 4A92A 1Z63A 3B1ZA 3UIEA 721PA 1KO7A 2O8FB 5C18A 1XF9A 4FCVA 4ASUA 5LDDC 4A1FA 4JSYA 1YR8A 2GXUA 2ZE7A 3I5YA 1Q20A 4Q1CA 2VO1A 1S1CA 4GMXA 3NTUA 3QPVA 2CE2X 2ZYVX 3S1AB 3RAPR 3Q85A 2DBYA 2ZRMA 2F3TA 1U94A 2H17A 2QP4A 2ZRNA 2HLDD 4KI0A 1JNYA 1HUQA 3PENA 4DJTA 2QPAA 2JASA 1W4RA 5JZVA 1XPOA 2XTNA 4JVNA 1MO4A 1E2QA 2PLRA 1TTTA 2BKUA 2GBLC 1BO6A 5KU1A 4V0KA 3UG7A 1QHIA 5FBLB 3QKUA 1IN8A 5EJEA 1VYVA 2VYFA 2IL1A 3U7EB 1M74A 3K0CC 4BE7B 4R2HA 4DUGA 2R6DA 1XZPA 3H4MA 2WSMA 3QPUA 4LPKA 3PUXA 3SE0A 2JLYA 1T0JB 4B44A 4QM7A 1Z6YA 2CCKA 2JAQA 1Z0AA 5G3ZA 1P9NA 2RGGA 3FB4A 5G41A 4B3BA 5EE5B 4FXPA 3U44B 4TYWA 1YE8A 3TQCA 3UMFA 1E2FA 3ICEA 3AGPA 4Q4LA 1IN4A 3CNOA 5EZ6B 4ACAA 1FX0B 4BFVA 4XH9B 4AD8A 3AF1A 1T3HA 3L0OA 3LRPA 2IYWA 4HB4A 4Q01A 5EP1A 1FW6A 4XSHA 1HE8B 2GBLA 4L9WA 4EFLA 1OPXA 4DT1A 4Z1MD 2A5DA 3AGQA 2C78A 2CHGA 3KZ1E 1S1MA 2FSHA 3QIAA 4II7A 5BWMA 1MH1A 4JLNA 3LXRA 4YMWA 2KWIA 4TTPA 3A1TA 2ZSDA 4BLSA 4TLAA 3UMRA 1KI3A 4BPBA 3WXMA 4XWOA 2ERXA 3HU1A 2CLDX 4AG6A 1OV4A 2V6JA 2I3BA 3U5ZB 3FGNA 4ASUD 2QM8A 1Z08A 2C04A 1KK2A 3A1VA 3I32A 3IUYA 3GLFA 2ZJYA 2ZE5A 4N1AA 1QF9A 2IYVA 2Z4SA 2OCAA 4G1UC 1M6NA 3EW9A 1HT1E 4M53A 3SS8A 2NO7A 2XNDD 4MUAA 1G3QA 3QNUA 1QHNA 2RGEA 3IQXA 1UKZA 1Q1QA 3F3YA 4CT4B 3LLUA 4DLWA 3QVVA 4TMWA 1Z0IA 1CLUA 3EIEA 2OCPA 2ZAMA 3QKTA 3NG1A 5FL7A 1CF4A 3KUDA 3LNCA 2QROA 4A0HA 1FUKA 3CPHA 2D74A 1HQCA 1XJ0A 3CPEA 4DUGD 5GVSA 3VNUA 2GTPA 4B47A 1T0HB 3H84A 1UBGA 2WM9B 3OE7A 1DO2A 1NSTA 2J7KA 5SZIA 2WV9A 3TBKA 1ODFA 2BKEA 2GKSA 4TQ9A 3R9IA 1T8TA 4YONB 5JMTA 1MKYA 3P26A 1QZXA 4QJ4A 1F5NA 3FFAA 5KYKA 1WMSA 1G8HA 4RFSB 4XD7A 2HXSA 2OUKA 1WF3A 1SXJB 2G6BA 4I99A 3LW7A 3T1VA 4Q7JB 4EPYA 2DR3A 2O0JA 5BN3A 4TT3D 1MRNA 1N6KA 2AD1A 2UZ3A 1ZD8A 4JKIA 3GLFB 1TF5A 4HZUB 1A1VA 3AVWA 3RS2A 4GZMA 2J0QA 1JI0A 2CCGA 1N5JA 3FPAA 5K8TA 3OAAA 4BLTA 3I92A 1YR6A 3TIFA 4X8OA 3CNNA 1JAHA 2J7PA 4OKSA 1E2DA 1ZNWA 3LX8A 3ZGXA 2NPFA 2OXRA 1J7KA 1Z6XA 4PPNA 1ELOA 1ZW6A 1SXJD 4IVRA 4LC0A 1SHKA 1X6VA 1E1RD 2EVWX 4MGIR 2RGCA 4Q9HA 3AVQA 3K0AB 1ZUIA 1TF7A 1GKIA 1XPUA 2OV2A 1G5RA 2ZPTX 4XIGS 4M1KA 4RD4A 2NPIA 1ZYUA 1OH8A 4TMXA 1E2MA 3SYNA 2OFXA 1XX6A 5LD2C 3TKLA 3BFXA 3EG5A 1AIPA 4MUBA 3ZIAA 5JEDA 2YKGA 4KFUA 4KXFB 3MCAA 2ZTSA 4KV9A 5KTYA 4DZZA 2O52A 3DVLA 1GL9B 2JIZA 1U90A 4R2IA 2MSCB 1N6IA 1W5TA 2OHFA 4EIWA 4JMPA 3R8FA 2REXB 4NE2A 4GFDA 4R71A 2RGBA 3J81k 5BN5A 821PA 2VP6A 4W9MC 4F92B 5BQ5A 3WYAA 1IY2A 1MT0A 1R0ZA 3E2IA 4ZCLA 5F3WB 2HYDA 2IHBA 3GEIA 4NU0A 4Z8YA 2RGNA 3EXAA 2FZLA 3MWYW 2ZI6A 5EP4A 1FQKA 2W0SA 5GJVC 3THOA 3LY5A 3ZZ0A 1NMZA 1IY1A 1ESMA 2FZ4A 2JLWA 5CM9C 3IIJA 3T1OA 1WBBA 5FBQB 4RKFA 2PMKA 4IFEA 3IEVA 3LQQA 1OFTA 1VDZA 4HUTA 2ANBA 2V9PA 5SZKB 1RRCA 1JXMA 2H16A 3PEWA 2HUPA 4O2RA 5FBWB 5HPYB 1KO1A 5IF9A 2NG1A 4AYWA 2R62A 3QY0A 1AQYA 2QT1A 1KHTA 3RS0A 5FPSA 4V0OA 1PUJA 1UPTA 5DYIA 3ZD7A 1G8YA 1Z29A 3QENA 1NIJA 4P4SA 4QOSA 5J4HA 4PXAA 2FH5B 4QG7A 1E2IA 1R5NA 1ZUHA 2ZRHA 3EC2A 1II8A 2QZ4A 1KJYA 4QRHA 4BLQA 4DCSA 1X8KA 1G17A 4PHFA 5F9FA 1NMYA 2C9CA 1E6CA 1DOAA 3KKPA 2VTKA 1R0YA 1AKYA 2OBMA 4C4PA 5TXGA 4G3XA 1G1MA 2DWQA 4LHYA 2UVQA 1GG2A 221PA 2A78A 4FD2A 1Z06A 3KFVA 4DDWA 1XD8A 1CRQA 2ZRCA 1W36B 3RSOA 4DSTA 4YQFA 3SFZA 2G0NA 3RWOA 5DO9A 2GF9A 4ESHA 3P32A 4D4LA 1ZCAA 2OBLA 4U5XA 4LZZA 2LKDA 3EWAA 1OXXK 3KKQA 1EFCA 2REOA 1E2JA 1IXRC 2TMKA 2Z4RA 3Q5EA 1LW7A 1IXZA 4PQYA 2ZRLA 1XU4A 1JEEA 1PLLA 4HYYA 2XB4A 2G1JA 2OFOA 1A2KC 1JR6A 3RRYA 2REBA 4JL6A 3CRQA 3RRMA 3CLVA 1XEFA 3AKCA 3QF7A 3L82B 1NJGA 4A2QA 1KSGA 1H8HA 3C7KA 5KPDA 1NLYA 5TV2A 4P4SB 2ZE8A 3SBEA 3RC8A 1U9IA 2FGKA 4FMDF 4IDPA 4FCWA 4JL5A 2KI5A 4Q4JA 3DHWC 4IEEA 2WKRA 4JT2A 2XZLA 1XXHA 2GETA 4ILEA 2YVUA 3TJZA 1ZNYA 2R9VA 4RD3A 2C2HA 4DBLC 4XVUA 4C7OB 2RKOA 4ZPXA 1KSJA 2XITA 4TTQA 2WKPA 4BECA 3RLFA 4A8JB 3KJEA 3NDPA 4GP6A 1RFLA 3FYHA 1IN7A 3AKYA 4HAVA 2NZJA 4GP7A 3QF4B 1LF5A 4PC3A 2RCNA 5AUOB 4JLPA 1E9FA 3M1IA 3EASA 1AM4D 2WAYA 3K70B 2J5XA 2F1HA 1ONBA 1Q22A 3FWYA 2ZRIA 3LAWA 3GLFE 3PUYA 3O8RA 1RVDA 1YU9A 2AK2A 2JATA 3WNBA 4DEXA 1Z2AA 4NCIA 4WOPA 1P5ZB 3RS4A 4Q1FA 5FBRB 3OEED 2F9LA 1YZGA 3U60B 1RZ3A 2IS4A 3QVUA 2RMKA 5EUMA 2NO9A 2P6UA 2IYLD 3B1YA 1DE0A 2ZI7A 4B74A 1KYIA 3QEOA 3NBFA 3NH9A 1KNQA 3ADBA 1G8GA 2KBEA 4QBIA 4V0LA 2IWHA 4Q7MB 3VQTA 4B6FA 1SKYB 4DIEA 3U7GA 4OQXA 5C1BA 2BBSA 2IUSA 3A4MA 4WXRA 1GRQA 3KTAA 1JQLB 3IILA 3LW8A 1UBCA 1KO5A 4JLVA 5FOTA 5FUYA 2P3SA 5L8VA 1IAQA 3ZYCA 3SJBA 2BWJA 4TLDA 5HKKD 2NZ8A 3KKOA 4Q4JB 4WXPA 2I1VB 1YZUA 2Z6VA 2ZE6A 1XXHB 3GJ6A 3SDZA 4Q19A 1RJ9B 2IA5A 4TL6A 1QVAA 2WPDA 2GEUA 4F4CA 3KQUA 3SOPA 3A1UA 3WNCA 1GDDA 1H8HD 2EYUA 5CLLA 3LV8A 5JBQA 1CJUC 3GFOA 4Q4AB 2QRNA 2XSZD 2HT6A 5EE9A 4F38A 1KDTA 1KOFA 4IDHA 1X8JA 2ZJ2A 1R0WA 1PV4A 5FBVB 3BD9A 4L8GA 4LGMA 3L0IB 3C5CA 3TVTA 4UJ3A 4UNRA 1G4AE 2OO7A 1LF0A 1NLFA 4TL8A 3B85A 4RZ3A 2GXSA 3LBNA 1ZU4A 4L4UA 3U61B 3HU3A 1VCIA 3V00A 3TLXA 2FEMA 2ZRFA 2XXAA 1PLKA 1F2TA 4AURA 1X3SA 2QGZA 2MMGA 4QBFA 2W6JA 5KSZA 3RVBA 1BYUA 2VF7A 4KODA 4XWKA 1IY0A 5AJZA 3U2QA 1GTVA 3UATA 1OKKD 2EYQA 2FA9A 4Q7KA 1ZC3A 2BCJQ 2EFDB 3NBZC 4ITRC 2QAGC 2GZHA 5AK0A 1UKVY 1J8YF 1JQJC 4OL0A 2J41A 5ANRB 1NKSA 5LBIA 4BFZA 4QKQA 1UKYA 2F7SA 3VU9A 3IKJA 3K0EA 1YZQA 1Z83A 3KKNA 4PZYA 3AVUA 5L3QB 1EGAA 1PZNA 1R6BX 3IBGA 4C0AC 2IF0A 2QP9X 5KDOA 5JSZA 4PSVA 2CNWA 1V5WA 4IOJA 2QL6A 1P9WA 1XB2A 2W83A 2H7VA 4Z54A 2WVJA 4QGAA 4DEYA 2QBYA 4DLTA 1M8PA 2E1RA 3LVQE 3K9GA 1NRJB 3SEAA 3EIQA 4BEJA 4XTCS 5J4LA 1IN6A 5J4YA 2F1IA 1G6HA 1T5IA 2GCOA 2GZDA 4UNQA 1NLZA 4ZCMA 1VCMA 3MSXA 5FOSA 1OFIA 3EX7C 1NY6A 2QMHA 4MA4A 5FTJA 2FOLA 4BEBA 4EPWA 1OYYA 1R5BA 2EFGA 2R44A 3DMDA 3VR6A 2J0UB 4F4IA 2WJHA 2Z0MA 1AGRA 4FINA 4PX9A 3FHCB 2CK3A 2HEIA 2GHIA 4RD0A 4L9SA 1WE2A 3B1XA 3TAUA 3D8BA 3X1XA 5BN4A 1TADA 3DPUA 4DCVA 3SYLA 1DADA 121PA 1JJ7A 2JGNA 1OHHA 5EXTA 3DOEA 3R9XA 2P0EA 2WZQA 1SULA 1OIXA 4X8LA 4Q9JA 3BC1A 3BORA 4MYUA 3V4RA 3MLEA 3H1TA 3ND9A 3T15A 4NYJQ 1FPMA 1Z8FA 2BDTA 4IEIA 5DI3A 2QUZA 2W6JD 1OB5A 1EG7A 3FMOB 4Q03A 1LTQA 3VKHA 4XOIA 4Q1BA 3ADDA 5JSZB 1G7SA 2J59A 4US2R 3RANA 3CRMA 3I1FA 4HAYA 5KO2A 3WRYC 1US8A 2FFHA 3DEFA 4KITB 3LH5A 5L3SA 1P3JA 4TYQA 1G20E 1KY3A 3CIOA 3FMPB 1P72A 4TMTA 4HB3A 3TUZC 2GZAA 3KFXA 2GDJA 2YOHA 1VHTA 4ZCIA 4LOAA 2ECKA 3B6EA 1F48A 3CX8A 4FCTA 3HPRA 3WMFA 2QMUA 2XNSA 3EPHA 1TMKA 4IFBA 4LY6A 1JPNA 1X86B 1E99A 1WP9A 2AKYA 2KE5A 4QJ3A 3PJRA 1SVLA 1NNEA 1CIPA 4UJ5A 1XD9A 2BBWA 4PANA 4C2TA 3BAFA 5HE8A 4RD1A 2ODBA 1NIPA 2R6FA 1S2MA 1ZBDA 3KDSE 1VG9B 4QFMA 4M9ZA 2ZVQX 4B73A 2EW1A 1E0JA 2GVZC 3CKLA 4C2UA 1HH4A 1D8TA 3CX6A 2X19A 4I1UA 1VG1A 1TQ2A 2RB4A 4BZQA 1SKYE 2FU5C 2GJAA 4LJAA 3WYFA 2YC2C 5JJLA 4KLNA 1CEEA 1AK2A 2GEVA 2MMCA 4TMZA 4LHWA 2WWHA 5DI3B 4UXHA 2CK3D 1E9SA 2KJQA 4Q18A 2V1UA 4G5GA 1KZGB 3VFDA 2O8EA 4D4KA 3ZH9B 3BB4A 1XXHE 3C5HA 2BEJA 5BXQC 3Q7PA 1E98A 2PBRA 4LHZA 3P4XA 4ABYA 3U6BA 1US8B 3IIMA 4W5HA 1Q1ZA 5IK2A 1H65A 2FWRA 5L3SB 4M9XA 1A4RA 4M9SA 4MRRA 4BLPA 5HZKA 3TH5A 2GXAA 1FMJA 2BM1A 4ZDJA 1U8YA 3IEUA 3ZVNA 2YYZA 2BC9A 3LD9A 1RE0A 5KOYA 4L15A 3SNHA 1TEVA 4C30A 3U6KA 4V0ME 4JVSB 3W5IA 4YLGA 3EAQA 2ZXUA 5DN6A 3IIKA 5JS7A 5DI9A 2BHRA 2AL7A 4NP6A 1R0XA 4CGZA 1AS3A 4FMDB 3Q72A 2QMEA 2QPOA 4M1YA 2FNAA 5KSOA 4QL3A 1N0WA 3DKPA 1IN5A 3B9PA 4P3YA 2Q6TA 4M0LA 1IBRA 3P20A 4OQFA 3FHTA 4F7WA 2B21A 1N6LA 1B0UA 2GVDC 4WZ6A 3VHLB 2FPLA 4DC9A 4LBVA 2XOKD 1XP8A 5K8IA 2FMXA 3B2EA 4LYAA 5TDHA 3VR1A 4LYHA 3R9WA 4URYR 3DKVA 3ZQJA 3VR3A 4W5WA 1IQPA 2O8EB 2NTYC 3AF2A 3FHOA 5CM8B 2PX0A 1CXZA 3QE0A 5KPJA 1KZ7B 2DPXA 1E9RA 2WWIA 3AEZA 5EE3A 1QHHB 5JHGB 3EA0A 4TYPA 1E3MA 3SU8A 1E2GA 4URVR 4PO8A 4TLBA 3R7WB 1AJEA 3CF6R 1CTQA 1RKBA 2CVHA 2VF8A 2JJ1A 3O8BA 3QKSA 4HDQB 2YINC 1E2HA 3K9NA 4NZYA 2J3EA 4RCZA 4ZKEA 5JS8A 1R10A 4DKXA 4ARZB 3PEVA 3W34A 4CRWB 1SZPA 4QGFA 3N5CA 1S0UA 2JDIA 4OJQA 4A2PA 2YOFA 1XZQA 1Z0JA 1YRAA 1QG4A 4JLAA 4R9UC 5CB8A 2ORVA 5E95A 2OILA 1U99A 2IHYA 1D5CA 2LKCA 4E5UA 3IO3A 3OFND 4EQ6B 1DS6A 4A36A 2VHQA 5CDFA 3IPYA 4LHVA 1N6RA 1OB2A 2ZI5A 2PT7A 4US1R 4BQSA 3THYA 2J1LA 2PMDA 3VAAA 5AJXA 3Q8XB 4H1VA 4M1WA 4GMDA 4B3FX 3PUVA 2ZU6A 5SZHB 4PQRA 4FMCF 3OHMA 3GLGA 4HAZA 1ZMXA 5FI0B 1TAGA 5FL3A 3PXGA 4L16A 3VR5A 1Z47A 1J99A 3QKRA 3EIHA 1YZNA 1G19A 3NWJA 4MDFA 5UKDA 1D2MA 1GITA 3MMPA 3K0FA 1LS1A 3AVOA 1EFHA 3T1QA 5BYKA 3V9PA 2O0KA 3QKSB 3ADCA 3KQLA 4U7DA 1L8QA 4KU4A 5AUQA 4QC2A 4XWAA 2RHMA 1SKQA 3W3AA 4N0EA 1F60A 2PJRA 1AGPA 3DZ8A 3T34A 3GLIA 4DLSA 4G5OA 1MV5A 2J45A 1XTQA 2O5VA 3TSZA 5TVKA 2ORWA 3GJ8A 5H1YA 1RIFA 3HU2A 1NY5A 4BFTA 2OESA 4HAUA 1N5LA 2P6NA 2QSZA 3K0CA 5EUQB 4P33A 4NL4H 1W2HA 3GEHA 3TQFA 2GEDA 1VIYA 8OHMA 1QBKC 3AB3A 3AVVA 3EC1A 1UBEA 2MSEB 1SXJC 5H70A 1ZM7A 3FMFA 1JALA 3TR0A 1P2VA 1OJLA 1H8EA 4EAQA 4BGDA 3WMGA 3EPKA 1EX7A 3HPQA 4B2PA 2WSSA
chains in the Genus database with same CATH superfamily
2XCUA 2PA3A 5B6JA 2V03A 5A7GA 3SHVA 3EY9A 1XNQB 4HD8A 5KQLA 4OH7A 5EHIA 3PHCA 4IDGA 4OJNA 1K0FA 1GCAA 2H2DA 2R7KA 3QG5A 4KSYA 3UWKA 4B87A 4CF4A 3FSEA 4L6AA 4E88A 1QV9A 5FORA 4ZICA 1Q74A 4FFMA 2XXBA 3IAM6 4B83A 2C77A 4EUHA 1XJQA 3NHKA 1Z5NA 1QIFA 2PUJA 3FPKA 5COBA 3RRXA 3UFXA 4EHJA 4JI0B 1HYHA 1EDZA 2LD4A 3DT6A 4EMSA 5HWSA 3NGMA 3GRZA 1EUDA 3RYFB 4B32A 4ZAXA 3A6DA 1YKSA 1QGOA 2E3JA 3L43A 2IF2A 4RIGA 4J1NA 4BL5A 3GLIB 4DA9A 3CIFA 5TLSA 1ZXLA 1QGED 1SBQA 1EDEA 1LVUA 2HLHA 3M6AA 4MMXB 1C7FA 1PK9A 4UTZA 4DT1B 2HLNA 4J0IA 4CMIA 1P4GA 1IONA 1R2QA 3X1ZA 4J0GA 1SUBA 3ORQA 2ZSFA 3MSCA 4UASA 3JQBA 1R5JA 4P53A 4QT4A 3CONA 3L7BA 1WDLA 5LIRA 1AURA 5CXUA 2OECA 4L74A 3V4SA 4AG3A 4LDQA 4AY4A 3V33A 5BUCA 2EEZA 5GJWC 1O95C 1NP6A 2EARA 3GJ4A 3HNOA 4HX9A 1RQ7A 3HDTA 1G2OA 1OQAA 1EG2A 2ZS7A 3SNKA 2QRMA 3FCUB 4QPPA 1XIVA 2JJ2A 4QD3A 4QEZA 5AO9A 3WBJA 4MULA 1FJXA 4OHMA 1HV8A 4B34A 4BB5A 3LYAA 5GPBA 4AWAA 4YJDA 1R6VA 5DE3A 3V8EA 3MTDA 4C4AA 3LQRA 3UUWA 2P9YA 3BH0A 4FKMA 2IV3A 3T9FA 1ISHA 1XMPA 4WY8A 2JKZA 1BE8A 1T2UA 4EJSC 5KC8A 1ZVQA 4JODA 3GFRA 4YJ3B 9GPBA 3H1FA 4ZGBA 1YFLA 3IV9A 4MVJG 2OGSA 2DY1A 1CFJA 1JG3A 2FEWB 1OGYA 1A4IA 4GLJA 4RVCA 5F2OA 4DW8A 4XYLA 1L5YA 4LHEA 4JJAA 2W2LD 4DADA 4K1XA 2XT9A 1I9CA 2BW0A 2JZOA 1TCUA 1BQ3A 3ORRA 2HYIC 5BV2P 1CKEA 3O5AA 1GKLA 1WCIA 4LE0A 2XGOA 4PLZA 5EQTA 2QTHA 2F1JA 5IVPA 3NJ4A 3OBIA 1F3LA 2JHGA 1UMCB 3L0SA 3INRA 4E07A 4EARA 5F7XA 1PSDA 3EA5A 3FIJA 3GT4A 4GX5A 1AF7A 1FYEA 3FNEA 2QIOA 5EJAA 1XMXA 3A6KA 1U2PA 2BZSA 4GSYA 4UZSA 3AVTA 2G0AA 1EX1A 1GZVA 1V25A 4JU9A 5FPTA 5C81A 5FR1A 2HH9A 4NYJR 4B5LA 4MQMA 1KJ8A 2GLUA 3GUZA 1V6CA 3RPEA 4EJSA 1QYRA 3ZE7A 4H4DA 1CVIA 3DO6A 2X6RA 4LC1A 4MAMA 5FL7D 2OHHA 3ASVA 3NIBA 4OJKA 3QFFA 4KVZA 1YO6A 4Q1EA 5DX0A 3RYTC 1XRSB 3CLTD 1YJBA 1OFUX 2C5LA 1X7YB 5EN4A 3HYLA 3TMKA 2VKQA 3MELA 4MR7A 5E7IA 4AN1A 3CR8A 2O8BA 1E8DA 3ITEA 1CJSA 3M7IA 4GE3A 5CBKA 1UM9B 4R83A 3OE7D 3P27A 3QU7A 3Q10A 1GNLA 1AKTA 2BSXA 3EBLA 3PVZA 1V3VA 3C3JA 3HR4A 1CZKA 4M8KA 1WZIA 4KE7A 1QTNA 4R8KA 1S9DA 5THKA 1KDPA 4NOJA 2KPOA 1FTNA 2EJVA 3EQ6A 1N0VC 1XTSA 2Y4OA 3STUA 1KPHA 3A6JA 5EC8A 4EYQA 2GFHA 3FZYA 3PEUA 5L3RA 1X1TA 1ZN9A 1JH8A 1YHZA 3V7YA 4RMJA 4DV3B 4DB2A 4WGFA 1GTZA 3N3AC 1JR3D 3QITA 1QF7A 4YFVA 1T6BY 1XE3A 2B82A 5AP9A 4MW0A 4YK7A 3B1VA 1IIRA 4ZK2A 4P4TA 4B33A 3K3PA 3UV7A 4YJFB 2G25A 1J9ZA 2J7PD 5T4HA 3QWIA 5EWLB 4P7JA 2WUFA 3LVBA 4UE3S 4CCAA 3PFFA 2O8CA 4LJKA 4XAQA 4HGOA 1POXA 4O1HA 4TV8F 3MQFA 4BKUA 4ZV7A 1ZESA 1GNPA 5A5EA 1K98A 2C61A 1BW9A 5REQB 3ZU6A 3L7KA 4FDUA 4BUJA 4D4HA 3DR3A 4YAOA 4ZVKA 4I4TB 4FMBB 1DLJA 1HGXA 3TD2A 2OKGA 5MDHA 1SVMA 3C98A 1LUAA 1Z5ZA 2WJVA 5LBUA 3T5BA 5KVAA 2A5YB 4L4RA 2P90A 3MXTA 3QNMA 2RHWA 3N76A 5SY9A 3NYWA 4QDXA 1KY5A 3NBYC 3QFHA 1NMQA 1BXZA 3PHLA 5LD2B 3O93A 2NO0A 1AQNA 1RPNA 2B3TA 3WYCA 4CMCA 3TEJA 3AIOA 4HAIA 4IO1A 2E82A 3SSAA 2AZDA 5SZJA 2NP6A 2YN4A 2B30A 3IS3A 4MWSA 1EWTA 3AM5A 1RYHA 5IS2A 2NM0A 2C1ZA 1HRKA 3QOFA 3GLTA 3E7PA 3VSBA 1JU3A 5DRYA 3QHQA 4BMSA 3M33A 2V74B 3GU3A 4DLUA 1JWBB 1LEHA 2HV8A 3X2EA 2YV5A 4WJLA 1RHUA 1WWKA 3P9SA 3SX0A 3OJWA 4ETIA 4IIGA 3RSLA 5JXIA 3AU8A 5AOCA 4OHZA 3R3UA 1E6KA 2A1TS 2QLNA 1X15A 3A4TA 5A4AA 4ATNA 5E6SB 1E1QA 2EF0A 3R3HA 3RIEA 4D43A 3NHSA 4ZDIA 4O08A 3DKIA 3EFBA 3BJRA 4ZRMA 1R88A 1VKOA 3EH2A 3TZKA 3GUCA 3OH8A 4RSRA 4RTKA 1BCRB 5EP3A 3WLLA 2EKQA 3G1WA 3BK7A 3CXRA 4WASA 3TSAA 4ZZIA 4TROA 2EAUA 4YMTA 4LJRA 1TCBA 1FZQA 1HA3A 2VA9A 1MV8A 1N3IA 3WMEA 2X7XA 4MRPA 5C80A 4LZNA 3RVJA 1LH0A 3L02A 1RJGA 1MVOA 2HDNB 3IB3A 2OEPA 3FUTA 3IR5A 4FI3C 3E35A 4CIXA 4U5QA 2WPNA 2XHEA 1RCUA 4QOGA 2JFPA 1BROA 1RQLA 2O3UA 1NT2A 5IVIA 2ETVA 1X8LA 3EGDA 3MD0A 3MT9A 3RVDA 4XA8A 2GM5A 1SB8A 5CXXA 2WWXA 3WWPA 1OAOA 3CW9A 3LFUA 2JHCA 1U04A 1LRKA 2HF8A 3DDUA 3G8YA 1CQIB 4IP0A 1NJFA 2WJGA 2J6CA 4M22A 2ZT5A 3BXEA 3U7JA 2G1KA 1MZPA 3NRBA 4D3DA 1O77A 2Y1OA 1K06A 3PQ4A 4HQ6A 1OXUA 1NVKA 2J5QA 2OFWA 1K2VN 3QLUC 4LXUA 5K3CA 1CJVC 2QE7A 1DO0A 1Z8NA 2BFMA 3DZIA 4EFKA 1JEYA 4QVIA 5AIAA 2IX3A 5F52A 2ZSUA 3K0KA 4KWHA 2EKBA 1E32A 1QU2A 5IC6A 2ZAYA 3I4LA 1KYTA 5J5CA 4LGVA 5AW1A 3TZBA 1UIRA 3G9QA 3PFHA 4DCUA 4ZIRA 1E1LA 2PMBA 2QK4A 2O9JA 2XYQA 3DQZA 3HGMA 4N54A 4DRZA 4EK9A 4F3TA 1PZEA 4HR7A 2ODWA 2X5NA 4Y2TA 1G3MA 3COZA 3DJFA 2X0JA 4PFKA 4NQZA 4OHCA 1I13A 2Q6IA 4Y1RA 4A26A 3C6QA 1N2CA 4W8GA 4YPOA 3DDSA 3IP1A 1HK7A 2XV1A 4OLJA 3KX2A 4ZYTA 5LQCA 3N2KA 5JT1A 2PBFA 5ELXA 2DPLA 5DWDA 3LECA 3N2YA 5GV7A 1J06A 2C3OA 2CNBA 1FFSA 2WRZA 2B2NA 2YIDA 1JBKA 4M9QA 1UPXA 4MLCA 1F17A 2PV7A 3RTAA 4DTCA 1AHHA 1D7OA 4FONA 2O7NA 5F9HA 1KI6A 4LI0A 5EWJA 3WWDA 4YO7A 1B6SA 4GW3A 2RHRA 4PRKA 4D45A 3N7TA 4JC4A 2Y9PB 1MQSA 1GSIA 1DC8A 1Q6YA 3MB5A 1THGA 2HHAA 3IUMA 3PVCA 4R3WA 1OCEA 4B3DA 4QZVA 1KKLA 5B4UA 3M8KA 1Q0TA 2V6GA 2F3RA 4DXHA 3RK4A 3RAJA 1Y9AA 2G9RA 4G85A 2XAUA 4DZTA 4RK0A 3W2IA 2ZJ8A 4Z4QA 1ZWKA 5DYWA 3T9AA 4KPYA 5HFNA 5D1NA 4XGKA 1NXXA 4RYLA 4URXR 1ZGHA 3ZX5A 5EP2A 2WHRA 3MXOA 1NX6A 4G25A 1M5TA 2QUJA 3CJQA 3M2TA 4Y2GA 1F8GA 2FV8A 4YO8A 5EI5A 1EFPA 1KVUA 1KK0A 1OI4A 1Q0QA 2OAP1 3E7XA 1SWWA 4HH4A 4RS3A 3AP2A 4HQOA 5IG2A 2F43A 2PN1A 5H3CA 3R44A 2VAWA 1U8ZA 1DZIA 1N2CB 3GJ7A 1UXIA 1ISMA 3HCOA 1NVWQ 1OREA 4P2GA 4OIFA 4RY9A 5DV9A 5D3MA 3UG6A 3VOSA 1JEAA 4B6RA 5CA1F 2EFJA 1FBTA 3EIXA 1OYOA 1W52X 1G5TA 3K1TA 4G41A 2HBZA 4R41A 1ZP6A 2VHEA 3E9NA 3NO4A 4B4WA 1ONSA 4JIMA 5LCXA 4BFXA 4CHTA 5JD4A 1Y3FE 1EK0A 3V1MA 1Q15A 2FWPA 2O1WA 2ZTUA 2ZIUB 3B3FA 2KLBA 2NYVA 3I72A 3MUFA 3PQ2A 4JLDA 3DFFA 5SYAA 4HPJB 3RQSA 4JLKA 3FDZA 5DX8A 5C53B 4ZV4A 5C9ZA 1GPMA 2PYDA 4E7PA 4OK6A 1HFKA 3AEQA 4NDNE 3MINB 4OG2A 3DYVA 2VPPA 4J0JA 2OT3B 3X1MA 1ESNA 3VZPA 2AW5A 4EHKA 1F9EA 1OWNA 3GXOA 4RC9A 2W4IA 1DBRA 3D6NB 3U0BA 2NAPA 3HJNA 4CIVA 1XUOA 1E9VA 2Q2NA 1E0SA 1CNMA 2B1QA 2UYYA 2WNIA 3I61A 1UXJA 2HFKA 1BFDA 2VHZA 1NBME 1E4OA 1WZCA 2VT6A 4BMYA 4YCMA 1F2TB 1UAAA 1L7NA 1ESEA 3T1NA 4ZT7A 4GDFA 2PT6A 3DBLA 5DHRA 5AQEA 1PYOA 3H1AA 1WMAA 3LKBA 3PQ5A 3AU9A 3N6XA 3AM3A 3MT8A 4HLDA 3ZGZA 4JT9A 5K8LA 1GGMA 2GBGA 3PNOA 2JIQA 3IOCA 1KKMA 3S99A 4OJYA 1W88A 4XDYA 4RY2A 3E8SA 5JW6A 2KLHA 1E4VA 1EFLA 4H6XA 4FHDA 2YV2A 3IDOA 3L8CA 1QZTA 3PIRA 3FDIA 1UC4B 3ZXSA 1T2VA 1DMRA 1ZH2A 4LJYA 4M0PA 1T6ZA 4DMLA 3IJPA 3G7UA 3IEXA 4GX1A 3ESRA 5FUXA 5I9TA 3GLHA 3T0GA 4NBTA 1AD2A 1YSCA 4RPHA 1U28C 3OWXA 2CHEA 1ZJZA 2QYOA 1QIKA 4MS4A 1P7CA 3OECA 4IQ0A 4N5DA 1LSSA 3ANYB 5L6LB 5G4KA 4MO2A 4ZT3A 2CJYA 3KXKA 3LWDA 4FNMA 4I08A 5CVCA 1IAVA 1SC1A 2LXNA 1TTQB 3S68A 4BZZA 1OU0A 1MFPA 3OPXA 1NV9A 1A9SA 1E3WA 5BORA 3KCNA 4CLRA 3NT4A 1W0KA 3PCRB 1CP2A 4DJAA 3SBXA 3RE1A 1YJAA 2WG0A 2BR5A 2PUDA 1I4TD 2Y27A 4B7UA 3BSSA 1DZ3A 1A9ZA 1QGYA 3W7VA 2CNNA 5CB4A 1DBVO 1PJRA 1P2DA 4PPYA 2R7LA 2DY0A 1QM5A 2ZT6A 2VDWB 1KGDA 1WDKA 4XUEA 1FP2A 1IMJA 2HMUA 3WK6A 2ADMA 5CH3A 2OQIA 3OE5A 1DIOB 4LDJA 1TK2A 2Z43A 4QUEA 3SIXA 3LKDA 4IRUB 1ULBA 5BYJA 3L8HA 4N4AA 4EG8A 1DKRA 1Z12A 5AW0A 1HT0A 1SUWA 5EXDA 2O8DA 1GOTA 4MPJA 1CIJA 1SD5A 2NUTB 2AK3A 4U9HS 4IOLA 4OQEA 2H2GA 3R9XB 3OVMA 5K3EA 3G0HA 1WHTA 4DV7B 1U7ZA 2GM3A 3FG9A 1QX3A 3H2JA 1KIMA 3A1DA 4YA6A 3ER6A 4DCMA 2O3TA 2GAAA 2XUDA 3DM9B 3WNDA 2JFVA 3NV7A 1HURA 1DAOA 1EK5A 4I8XA 4FS3A 3RB8A 5DWVA 3D7NA 3INGA 3U4QA 5JJIA 4DDMA 3HCFA 5JO0A 2OBNA 1HDCA 3GAMA 3CX7A 3ETGA 2NZUG 1DX4A 1KIAA 1U6IA 3HJUA 4QELA 4ZAYA 2DJ5A 3CRVA 2NT4A 1E9DA 1OHHD 4LJ8A 1XWIA 2ZWVA 4R0NA 3JARA 2D0OB 5KJ1A 4C2AA 1SC4A 4CUJA 4CLRB 3LYHA 4IILA 1K8YB 2I67A 5A03A 5E9AA 1LTHR 3DMFA 3ICOA 3WNZA 3WZMA 2IXFA 3T3PB 3GLSA 2XYRA 1AMUA 1CUFA 3NDBB 2V59A 3SN6A 1O54A 4EUFA 1REQA 4ZI7A 2ZG6A 5I4CA 4ZVRA 2K7FA 3HRHA 4TSKA 5E7JA 1B14A 2Y05A 4KBGA 4IW3B 4DIBA 4O2BF 3R7NA 1GILA 1PR0A 1T8YA 2BJWA 2XVZA 3DL4A 5D2CA 2XUFA 1IB6A 2WJZB 3TBHA 1AK1A 2F9MA 4BZXA 2XCRB 1VGVA 1PJTA 5AJWA 1RZRA 1TIBA 5AHWA 3IGFA 3TDMA 3KQOA 4G84A 3W3ZB 2B2CA 1XN4A 2ASEA 2HMSA 4DBLE 2UYHA 1M8KA 2GD2A 1Q1BA 2L2QA 1A95A 1JAYA 2HU5A 2VPZA 2O0LA 3GRKA 1KA9H 4JJFA 1SEPA 2ZI9A 2HLDA 3C3XA 3O9ZA 4FFLA 3A3NA 4I55A 4IHAA 2PMFA 1RACA 2XUZA 3BMNB 3PLNA 1QRUA 1W29A 2BKVA 5H83A 4F9GA 3DKRA 2WVAA 2LIPA 1KAOA 4ENVA 1BEZA 1ZJ4A 2L18A 1E79D 1Y1PA 2DFNA 2YXEA 1QQAA 2P7HA 4YS6A 5MN6A 1DJMA 2WU3A 3MD9A 2IW3A 1NWCA 3LPNA 1L4LA 2G04A 2ZEJA 3MWFA 3U4QB 1HE3A 4YALA 1LQTA 1YR2A 2AR9A 4EI2A 1N4DA 3ZWOA 4U00A 2W2XA 4J1TA 2WC1A 4QQNA 1GYPA 4MYDA 5AK3A 4P92A 3UBMA 1U2DA 2XWBF 3P71T 2PH1A 1NG9A 3HSKA 5L7TA 2P6OA 2YS6A 3LX5A 2UZIR 1EWVA 3NVAA 1U7DA 3ICPA 2GXQA 1KDRA 4HXYA 1EVYA 3VPDA 1DAPA 2PUBA 4RFVA 5KNDH 5ER6A 2RIRA 5DLQC 4AY5A 3SZRA 1I9GA 5CLFA 4QXRA 3C1AA 3G2PA 4WUVA 2Z8ZA 1ZMOA 1DC6A 4NDZA 1GPWB 4R3NA 1SIBE 4S2UA 2Q1YA 4D3XA 4OU4A 2UVDA 4KACA 2WR8A 4QTYA 1PFUA 5ITWA 3AQIA 1Z2CA 3B3GA 3I6YA 3RT7A 2WQ7A 2X8AA 3GJ3A 1IPFA 2DBQA 1P75A 1JQ3A 1NJ5A 2IYTA 1O97D 2Q4OA 3D59A 3LWZA 3QWFA 1UOOA 5LYJA 4ZAGA 2IEBA 3WZ2A 2JGAA 1GDHA 4AO6A 4OHBA 4WK2B 1Y3HA 1G41A 2Z8YM 3H8WA 4WNAB 1QHSA 3CLUC 3VKGA 1GL7A 3DTYA 1NVUQ 4PG4A 4D02A 2EZ8A 4FR2A 1A82A 2Q6OA 3RYHA 3DO8A 4I55B 3UHOA 5A4IS 2OV4A 3DB1A 1D4FA 2AYXA 3MWEA 3PNKA 2O5CA 3AUYA 1JKJB 2CBZA 2NTNA 4NTZA 3F5FA 4O1MA 4OU5A 3K8QA 4M0DA 4MS3A 4ZJYA 2I80A 1G8MA 1TO2E 4B3BA 3Q1LA 1P3DA 2R8XA 3GNTA 3DXXA 4DSNA 1W7AA 3UUEA 3CLHA 2NSYA 4TWZA 4ZOLA 5FH9A 2VATA 4YP7A 3RJ9A 3N2NA 3PQCA 4WBSA 3AF0A 3OLXA 1W85A 2OZKA 5K6AA 1HG1A 1KKUA 3OSZA 2WM8A 2ZYTX 3OX2A 4KQEA 3AL3A 2Z57A 4RF3A 4UXJA 4EYEA 1HKHA 5FJIA 3OIGA 3EPRA 1Z4KA 4O4HA 1MAAA 3D7KA 3Q0IA 5JFGA 4TSFD 4EGQA 1XC7A 3O8NA 1T5DX 3AJRA 3PKZA 1P3Y1 2PWAA 3FWZA 4FHFA 2IZ1A 2VYQA 3D5QA 4MQEA 2J3QA 2DTDA 2GASA 4HUJA 3S8MA 7ADHA 5I5EA 3VR3D 3A25A 5EJGA 3NM6B 2ZJOA 1MEEA 3F46A 3O7MA 4Q21A 5EKDA 1ECJA 4CM8A 3PQ8A 2HRRA 3HVRA 2QY6A 2QMQA 3K16A 5KYVA 3AV0B 4KE9A 2RC6A 4DXDA 1PQUA 4F97A 1KDZA 1ZLXA 2Q5OA 2QX6A 4HB0A 4EGCB 1EH5A 1UMKA 2GI4A 3UJ8A 2BN4A 4IKEA 3DUWA 3RHZA 5D6OA 4A16A 5IU6A 1VL5A 4A6PA 1E69A 3AJ9A 1QKJA 3BDIA 1V5GA 3C7DB 2X0FA 1P4SA 3RYHB 5EHNA 1NSYA 4BWVA 4E03A 3MWEB 1FLDA 4E4TA 3THYB 1SHZA 1V9SA 3HDJA 4GKAA 3K0HA 4Z4EA 4NCXA 2NACA 2EIHA 4BMVA 4H1UA 2EHJA 1ZHHA 5L3ZA 2X1VA 3BQMB 3K9LA 2VFAA 3KYCB 1MEOA 3K9WA 1KI8A 1WB4A 2RAPA 2XKJE 3GGOA 3PJDA 4RVFA 1OILA 5DNWA 5B6IA 2ZW9A 1TU0A 1M0SA 2RIPA 5F5XA 3UPUA 3EVDA 1RJDA 4ZOLB 3IVXA 5FRDA 4EL0A 3QBTA 4XVQA 5G0SA 3KT8A 4RJKA 2VIIA 1JBQA 2B4TO 1ZOIA 1WTCA 3HS3A 1RAGA 2JFZA 5G40A 3IEIA 1BYIA 3WLRA 1S96A 3GA7A 1RRVA 3FPLA 3JQ8B 5TIIA 2Q3HA 5ALDA 3WK4A 4OGWA 1KVTA 1WZEA 1VYHA 3OQOA 3RNOA 1EWKA 1VGQA 3CLTC 3X44A 5I7EA 2O3RA 5KYNA 2PSHA 3HWSA 3QE4A 3BRQA 2ZUTA 1JYSA 2NLOA 4CM8B 2FPRA 3RABA 1QPGA 1IXYA 2Q7OE 4L7VA 2XNHA 4CR7A 3C6ZA 3K6RA 4HRAA 1FMLA 3EK2A 3Q5DA 4P8RA 1M7GA 3L6RA 2F8LA 5ILGA 5KTOA 3L01A 4YV2A 4C07A 1OLUA 1U8XX 4YRJA 1I4DD 3DQPA 4D44A 3C4JA 3ZD6A 1TYBE 1UDCA 1KEZA 5ES3A 3LY9A 2H4JA 4OP3A 1E6WA 1I2CA 4PBRA 4ZJUA 5C4GB 4K0RA 3FKQA 1LZKA 5GZ6A 2KW5A 3FVQA 4PSCA 2Q2QA 4O4LF 3LT4A 1SVKA 1KSFX 2NU7A 3EWNA 2QSYA 4FIDA 4CNBA 3CVWA 3CF4A 4AWBA 3EQ8A 4ED9A 2X13A 4BP8A 4RU1A 5JO9A 1RBYA 1Z2PX 5HXAA 1OLSA 1TMGE 3BL5A 3C74A 4UUOA 2YASA 4LDRA 1K5HA 3H3FA 4BPRA 4OO3A 3TOXA 1C1XB 4TT8A 5BXYA 4YC7A 5ITVA 3CVVA 3CUUA 3P96A 5DTJA 3T5TA 3FYCA 4EVRA 5KREA 1J0DA 3GRYA 3ZZUA 3M9XA 2P1ZA 3F78A 4ZI5A 4BQOA 1K5DA 4C7VA 3DTVB 2O20A 2VPXA 2AFVA 3WTCA 3TIVA 5ULLA 2XWJI 3OE1A 4NZMA 4BYMA 2AWNA 4NV0A 1IBMB 3IVCA 1DG3A 2JFXA 4PV7A 3KD2A 4KXYA 2XUJA 1M34B 5A0VA 4AZ3A 2XDQB 1R9JA 3O2NA 4PZZA 5KNDA 4OKIA 2IY9A 1CK4A 3RREA 4D56A 1UOQA 3HCPA 2Z58A 3AUSA 4EW2A 3K30A 3T3IA 5LQNA 5I9BA 3RVLA 4CN8A 2BMWA 4R2LA 2XQKA 1W44A 1ZH8A 1FP4B 4P2BA 4RIIA 4XB6B 3P2IA 1Z22A 3L07A 1UM8A 3W4KA 2CB9A 4UVDA 2W6ID 1N3YA 3HLYA 1J2YA 4NYIR 1RSZA 5ESDA 1WIWA 2HIMA 4ZVNA 3WNVA 1F2UA 1LVHA 1RWMA 4B6EA 2OKCA 2JGFA 3VHXA 4ZYWA 2O57A 4KMMA 2E4WA 5H7XA 1G3RA 3IKLA 4NBSA 1C9YA 1FLAA 1KQPA 1P5JA 2PS9A 3AUAA 5E2IA 4HDMA 4PONA 2XB9A 1GLGA 2H5IA 5EMNA 4LF6B 5T7BA 1DB3A 4LXYA 1OLSB 1UDBA 1ZC4A 1ECLA 1SD2A 1UANA 3MAAC 4ISCA 1WCXA 1X94A 2V98A 3MS4A 1IEVA 3ENVA 1PT8A 5KVVA 4AULA 1VE7A 2ZJ0A 1WW8A 1NR1A 2ZOSA 2I1LA 3ZS9A 4UOQA 4IXNA 3K09A 3L0PA 3KUCA 3G5MA 3HKEA 3KYIB 3LQKA 1TW2A 4WN3A 2Q1TA 1H2WA 3SHTA 3ZJ4A 4C5AA 4I1YA 4KWEA 4UBNA 1MX9A 3D3NA 1K66A 1AV7A 1K08A 1GPKA 4JQCA 3VTKA 4L8YA 3NNSA 1P62B 5HOEA 2Z4TA 2BFFA 3D8SA 1WNFA 1BE6A 1ZM3A 4CODB 2RH5A 3ZE1B 4EDHA 4RXMA 1JJVA 4BBAA 1LSJA 5BNZA 1PJZA 4RMNA 1A4UA 2C4HA 1CY4A 2IHZA 3WMRA 1YJ8A 4MKIA 4A2WA 5KDDA 4AQYB 4TRRA 4HY3A 1HLGA 2COUA 2Z98A 4V1CB 3QUQA 1NTOA 4ZDWA 3CVUA 3TGPA 3W1VA 5HTKA 4EWLA 1E3DA 3LQ1A 1NW8A 3S29A 1C9MA 1F2UB 5EFZA 4BOYA 4BVAA 4WW0A 3N28A 3PXCX 1XU9A 1GQRA 3D2AA 3IPRA 2FCAA 2B6HA 2PXXA 3D2CA 1KH2A 4HNAB 1E2UA 1P61B 4AX4A 5JJBA 3AM1A 3NEJA 5LB2A 4TZKA 3GFBA 1SOUA 1H2EA 2PGJA 4NBRA 2VJKA 3HFGA 3V1NA 5KMGA 4AZSA 4C43A 2WB2A 2J9XB 3O38A 2PWZA 4EELA 1Q0ZA 4DCNA 1JFFA 2OB1A 1ULZA 4O4IB 4RJJA 1C3VA 2JK0A 1YB2A 1CBUA 4EG1A 2H11A 2YXLA 3O90A 4PIVA 2O06A 4OK3A 5JJCA 3KPJA 3II6X 3CR7A 1FYWA 1U0RA 2IV2X 2AJTA 3GMSA 4WK6A 1AN9A 1TK9A 3CCFA 3HB9A 1KI7A 1LWOA 3DFMA 3REQB 4HNUA 1QB7A 4FS8A 2NQTA 5JPIA 3WKEA 4BNZA 4KH0A 4P80A 5IT9A 1F7UA 2HWUA 3TGWA 5JS1A 1I4EB 4PG8A 1SZDA 2JGMA 4EPXA 3SJ7A 5B12A 1XZFA 1T9GS 1RTKA 2P3OA 4J94A 5HW0A 1LC0A 4R84A 4Z9AA 5FDFA 2I2WA 4EUNA 3K35A 5I7RA 3BWVA 4JKYA 3WIBA 1GPBA 4WINA 4WKPA 4IVPA 3ZHCA 2Q5FA 4H7HA 1E2KA 2ENWA 4TQAA 2AMLA 4V39A 5CA0B 4K5QA 2CVZA 2Z9DA 1N34B 3LP8A 4AY2A 2V9CA 1YUNA 1HDZA 1SBZA 1ZI8A 4HDRA 1CRLA 4P1ZA 3JAKB 3UF0A 3GAFA 3ZU4A 1U0LA 2ZSJA 4BVEA 1QK4A 1DBIA 1G8JA 5EJ4A 4Q4DA 3A1FA 1VE5A 5HBRA 5I4IA 5LQRA 1ZHOA 2GSWA 2PRJA 1DAHA 4S12A 4AZ0A 1WPQA 4GYWA 1W36D 3ILVA 3KD3A 2VHYA 3OZRA 1U2RA 3FNFA 4A2QA 1S02A 2WU4A 4AVYA 3BXZA 4HGYA 2RHHA 3HWWA 4U7PB 3BCUA 3E58A 3PNSA 1JL3A 1Y5LA 4RK5A 1PWHA 4M9RA 3W5JA 4F6RA 4MWBA 4PGFA 4M0EA 1PS0A 2QG6A 4YJGB 1D2GA 2FW9A 2VNAA 3MG9A 1H0SA 4HNSA 3T4PA 1WD5A 3VO2A 2Q8PA 2XSZA 1HQKA 3AR7A 2GCPA 3N2LA 4JOCA 1F1BA 4F96A 4X45A 3I3SR 2WE8A 1KIFA 3FLMA 3M4ZA 3N8GA 5BWBA 2VZLA 3CN7A 4GX0A 1KETA 4PCVA 1FRVA 2O2EA 2CGEA 3N5KA 4PC1A 1NUQA 2AI3A 2I4IA 5KQPA 3JU3A 4AKTA 1XMSA 2A1IA 4GGOA 3MWDA 3E48A 2FHPA 3W8DA 4C4XA 5TR9A 1STOA 1GV0A 1VPDA 4Y1GA 3SLKA 1BMFD 2PM8A 5KTMA 3BWDD 3L4BC 4KOAA 4RL6A 3VNQA 5BSHA 6NULA 1U3WA 1VBFA 1TRKA 1AXGA 2JARA 3NGXA 2PIAA 1VSTA 3CUWA 3K1AA 3KJZA 3OPVA 1OKKA 1P6XA 3PPWA 4PC6A 1NATA 2DSNA 1YU6A 3KHUA 3SYMA 4MUJA 1MZVA 3M0EA 5FWYB 3KKKA 1I2BA 5JQGF 1SKUA 4BNHA 4B45A 4LS3A 3VYTB 4L6IA 1XNJA 2QR5A 2FPPA 2K6GA 3ZDQA 3PNQA 2O54A 5ERGB 1NJ6A 1JZSA 2RJNA 4K87A 2WMYA 4R2KA 1SBIA 3BOSA 3OY2A 5HKLA 2P5YA 3TNJA 3SC4A 3T5AA 1W0JA 4EI8A 3PWKA 4DIDA 1FTYA 1C9JA 2Z5GA 1IY9A 5HF6A 3S7TA 3WJ7A 1PR4A 1NA5A 1VHJA 3MMXA 5U4QA 3U17A 2UYCA 1L5NA 1PK8A 3LT2A 1FU8A 1QFSA 3K94A 4YUVA 4ZI2A 4TS3A 1PFYA 2UYOA 3MZ0A 4KBFA 1L2TA 2VAXA 2O5EA 3EDYA 3HZZA 4KZPA 3H86A 3HYCA 2B8JA 4Y2PA 3AWDA 5A71A 5LJLA 4Q7EA 3ENKA 4BBZA 2HWXA 5COAA 1Z7BA 2XIJA 3MWDB 1OW3B 4BB6A 1CQXA 1N2BA 3F7TA 3O94A 1K7CA 1Z3IX 5IT4A 2ZS8A 5AVVA 2BJVA 3BWBA 4DG8A 4XRGA 5CK5A 5I7UA 2PAAA 4DR4B 1VPVA 4EP1A 1E9CA 3GFSA 4M60A 3EIOA 2VK8A 4Q05A 5E38A 3SBDA 1Z75A 1UMBA 3NHFA 4MB0A 5IHXA 3IP6A 2AN3A 4LJ9A 1GPJA 4OQNA 1D1QA 1M2VA 3IVMA 3GH1A 2O05A 4MSUA 1FDOA 5G0UA 4RDIA 4GOOD 5CGZA 2K4MA 4BGUA 1NJSA 4WFIA 1K6JA 4B43A 3NP7A 4K03A 5DN9A 1PJAA 4CM1A 4CYMA 1UBHS 3FGOA 3ANTA 1VYUA 2ZJ5A 4XPIA 2AG0A 1CUBA 1DWUA 2AOTB 2G4CA 3ZZMA 1PJ2A 3NC4A 4RD6A 2FPPB 1ZM9A 5DLPA 3F49S 4Z4IA 4Z4FA 2QXUA 2OSBA 2J5KA 2ONCA 3H87A 4A23A 1J5XA 1JXOA 2B4KA 2WP0A 2GEFA 1IWBB 1UEXC 2QTWB 2VDJA 2IIPA 4IXWA 1ML4A 1DAGA 3DLPX 4GSLA 5LQDA 3TW8B 1A5BB 2P1RA 2LCIA 4TYNA 1BIFA 4TGLA 4DLXA 1CUEA 5KOJA 1GAWA 1H6DA 1ECCA 5HF9A 2DWOA 4AIIA 2P91A 2QTAA 2ATIA 2FW8A 4WOBA 2GKGA 3ZNPA 1B23P 1WUIS 1UEIA 4XQCA 3IJ5A 4TZ6A 2J4CA 3VSAA 2B5OA 2RG1A 4D0GA 1EFKA 4BX8A 4D7AA 3USZA 3ZLVA 3EVEA 4ZQFA 1YFZA 1GVNB 3H18A 2IYXA 5JD3A 4GVLA 4YAIA 4NPHA 2V7UA 2FSVC 3M2PA 3AUFA 3DDNA 3OPYA 4MWEA 3WOHA 2CDAA 1C8LA 5TARA 2OOKA 5HJEA 3CXUA 2CL5A 4N65A 2VNHA 4QX6A 4F3CA 4EUKA 4J29A 3FR7A 2G5TA 4NYMR 3L8ZA 5IHPA 3SC3A 2BCGY 3GB9A 3QI2A 1K2WA 1LVGA 2I6XA 2QS9A 3IHWA 3LRTA 2O48X 2QXYA 1JEDA 3VPGA 4FGJA 5K3OA 2I6SA 3MAGA 2J9GA 3OOHA 4V02A 4XYBA 2ZUEA 1O89A 1P4HA 4UATA 1V7QA 3ILYA 1BRMA 1LJUA 4TPKA 2HTEA 4ALJA 5FKJA 4OUKX 4QXQA 4ETWA 4IG9A 2BKXA 1G8FA 4DJEC 1CRZA 1J20A 1E1NA 4LXXA 1SO8A 4F91B 3QI7A 4MO9A 5I7WA 3NBUA 2HNKA 1MNAA 3O75A 3NAQA 3NONA 1ZAKA 2EIXA 2EJBA 1FLNA 2I8CA 3AI1A 3K0BA 3K96A 4HS9A 4AKEA 4CCWA 3I5XA 5BV1A 4FX2A 1OWPA 4TTAA 4JLWA 3BMQA 1I0ZA 1LLUA 2P7IA 2C7GA 3HGTA 3OEWA 2Q2OA 4M38A 3UW1A 1XZ8A 3LBFA 4EPTA 1PD0A 3QEKA 1MJNA 3TIIA 4K88A 1D4AA 2YNMD 3KC2A 1UBSB 2PMCA 4PU0A 4DWVA 1VM6A 1H6CA 4YCBA 5CH8A 4FFOA 2ZYUX 3I9FA 2I03A 2Z04A 1KTVA 1UBUS 3KTOA 4EHLA 5CK4A 4XUCA 4OUDA 4GI7A 5F73A 4E33A 2JLXA 2ZJFA 4FEGA 2CUNA 4YV0A 2IU6A 2CLSA 1XYYA 3OPYB 4YMHA 2IS1A 1OBFO 3SJCA 1NXQA 5E3HA 2BGGA 5HUQA 4LDZA 3STXA 4UMFA 3HXMA 3WQBA 4TX1A 3ZD8A 1EUCB 1RHKA 2EOAA 1M76A 2H52A 4JYPA 1VLLA 3LS2A 2Q9AA 3B36A 1PE0A 1VP9A 1XQYA 2WF5A 1FFXB 3KKMA 4FSHA 3SR3A 1AC5A 3TTWA 2OORC 3KAJA 2Q5JA 3HKBA 4IH1A 4X1OA 1YR3A 1G1AA 2XB8A 4JX9A 2ZWOA 5A1JA 3TG2A 4LSZA 3R7BA 2XTMA 2FPOA 4JXJA 3EPLA 2EV9A 2GTIA 2AQHA 5KYWA 2EJTA 3ZCRA 2XKBA 1CUCA 3HKDB 4XR9A 2OBFA 1F51E 3FVVA 1CW2B 1YWGO 1CJMA 1O97C 3I04A 4O4JA 3MIIA 2IXEA 2Y1GA 5IXJA 2GK6A 1SR8A 4I19A 4MYRA 3ZDFA 1MGOA 1I0LA 3CBGA 3D5EA 3KXLA 5TSDA 4MRMA 1MC1A 3OO0A 4FMPA 4GO1A 1DKPA 1KJZA 1AGXA 2W6CX 4MVJE 3MT7A 5GINE 4WNCA 4WN9A 3BH7A 4HQKA 1IULA 2I2AA 3FZEA 5AK5A 2QZ9A 2BEKA 1RXIA 1IEWA 2HQRA 2PX8A 2ZIVB 1OXVA 3I4FA 3PGMA 4FYIA 1E4YA 2D3WA 1SXIA 1XCMA 3F5DA 1JAIA 1KMHB 5FUWA 1EAMA 4LE2A 2LCFA 1H3NA 4WOKA 1EJ6A 4O2LA 4PSKA 1Q2XA 1J2RA 2CZCA 2VJMB 1QHHA 2NOAA 2R6R1 3BGWA 2XA1A 4GPZA 3FVRA 3LL7A 4FOTA 1GD1O 4RZXA 1X7XA 2XUGA 3SZMA 3GZJA 4JC0A 5EKTA 3R7WA 3FI9A