1NF9A

Crystal structure of phzd protein from pseudomonas aeruginosa
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
207
structure length
207
Chain Sequence
MSGIPEITAYPLPTAQQLPANLARWSLEPRRAVLLVHDMQRYFLRPLPESLRAGLVANAARLRRWCVEQGVQIAYTAQPGSMTEEQRGLLKDFWGPGMRASPADREVVEELAPGPDDWLLTKWRYSAFFHSDLLQRMRAAGRDQLVLCGVYAHVGVLISTVDAYSNDIQPFLVADAIADFSEAHHRMALEYAASRCAMVVTTDEVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords phenazine biosynthesis protein phzD
publication title Structure and mechanism of Pseudomonas aeruginosa PhzD, an isochorismatase from the phenazine biosynthetic pathway
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 72
structure length 207
sequence length 207
ec nomenclature ec 3.3.2.15: Trans-2,3-dihydro-3-hydroxyanthranilic acid synthase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 1nf9A00
1IM5A 3MCWA 3TG2A 1NBAA 3UAOA 3R2JA 3PL1A 2B34A 3HU5A 3O92A 3IRVA 3O90A 3OQPA 1YACA 1ILWA 4L07A 2WTAA 4WGFA 3LQYA 3O93A 3OT4A 4WH0A 1J2RA 1XN4A 3O94A 3R77A 3S2SA 1NF8A 1YZVA 3KL2A 3EEFA 3V8EA 4H17A 3O91A 4L08A 3TXYA 1NF9A 3HB7A 2WT9A 2H0RA 3TB4A 2A67A 1X9GA 2FQ1A
chains in the Genus database with same CATH superfamily
4FYHA 1Q1ZA 1FS6A 3DR3A 3MWDA 4UU8A 5BSHA 4AYTA 4INJA 1R6TA 4PXYA 1N5RA 2OHOA 4KODA 2GK3A 5DHUA 5AXAA 2CK3D 2XLCA 3AG6A 1MNQA 4WACA 1E20A 4FGJA 5IPFA 5LOVA 4DV7B 1CULC 1X0XA 2AJLI 2AZDA 1SXJD 2JJ2D 2Y0DA 5AKXA 4C3UA 1A98A 3O74A 5EWMB 3OOEA 3HGMA 1XU9A 1W2WB 3K94A 5EZYA 4UFOA 5CNJA 2O2EA 4HK4A 4LZOA 4DMFA 2WIGA 2NM0A 1F12A 2X3YA 4RF5A 3ZE8A 2FCRA 2IOFA 3O84A 3W4JA 1IATA 5TPZD 3PQEA 1RWMA 2XAAA 2Z6QA 3NBKA 2JW5A 2A0XA 2E0IA 4BNTA 3A6PC 2AF4C 2QTVA 4RACA 2X6TA 3TLXA 2WAXA 3LF2A 4IEEA 4B6OA 4AUEA 2Z8YM 2HREA 3MS2A 2FNAA 4YRTA 2O50A 2HPAA 2F4VB 2NO7A 3HUDA 4PVCA 1ZHFA 3LC7O 4ZP1A 3FMOB 5JAPA 3NP7A 2P2YA 3S1AB 2XTMA 4NYMR 1BGXT 1HKUA 2BSAA 1ZNYA 3HUFA 4MIEA 3R8XA 1RYMA 4Q02A 5E8RA 2B30A 4BKUA 3KOMA 3LOUA 1OXMA 2JGMA 3OIYA 2OBLA 4UTOA 4WNYA 3VZCA 4BQQA 5HQ3A 1QQ7A 3O4JA 4LMAA 3IIIA 1EDDA 4WKPA 4BX3A 4TTSA 4BEVA 5EE5B 4DC1A 3S8EA 1U5CA 2A86A 4I4TF 3EVTA 2LE0A 3E1GA 5FO1A 2R8BA 2WA1A 5CGQB 1E6EA 1Y42X 3AHJA 5IYZF 5A5GA 1PUIA 1J33A 2FN9A 4DLZA 5EJ4A 2GSWA 4P2BA 1PFVA 4BQEA 1JHUA 3U40A 3Q1KA 2A5DA 3V4FA 3G0HA 4JDPA 1IU9A 1EAYA 3MCTA 4PS0A 1KZHA 4AD8A 4BMOB 4PSDA 2WTAA 3NBYC 3RVKA 2APJA 1GL9B 4BVGA 3BWEA 3PHJA 4MUHA 1JHOA 2VT6A 3WI7A 2RGXA 1L4NA 1YZNA 1DC6A 3HDVA 3NWOA 4TMXA 1FTNA 1WW2A 4HN4B 4B32A 1DKOA 4C4SA 2CMDA 3IERA 3V7FA 3GH3A 4HPXB 1PD1A 3IAS1 2QP9X 4ZVLA 3BA1A 5JXGA 1U9IC 2XMDA 2ACWA 3M5PA 3BDVA 5AJHA 1T2UA 4DNOA 4ZK2A 5CLJA 3DOEA 4U7DA 5JAUA 2WAOA 1KVQA 3GUUA 3TGWA 2ZJ7A 3DTYA 1X7ZB 5G53C 1W88A 3WDSA 1QIHA 1Y6ZA 3RYTC 3KYJB 3PGJA 1ILEA 2QJOA 4RTRA 1KDTA 3CLRD 1KP9A 3A4IA 4DR5B 2PQ0A 3WWDA 3W2GA 2CVFA 5DI3B 4EO4A 4MI1A 1VPTA 1BCSA 1UXKA 2O8NA 3LDFA 4GGPA 1RLIA 3SX2A 3BG5A 1W1WA 3F5QA 5FA6A 1E32A 3IUEA 3AR6A 2GJ4A 4I8IA 4P80A 3KR9A 4Q9JA 3V80A 4A8TA 3QEJA 3UH1A 4ACBA 1Y3FE 1U0RA 3SXPA 5BQFA 2VDRB 3RTBA 3UWDA 3ER9A 2WMDA 1O58A 4R2XA 1NKSA 1UBJS 1CUIA 3A27A 2YJNA 3FY4A 3HO6A 5KWJA 3RSCA 3TDKA 1HT0A 3NVKI 2HK6A 4F1KA 3HZOA 4QHSA 2IRWA 2QMZA 1NQXA 3QY0A 4YIKA 1NT4A 5DDIP 3PIDA 3W2EA 2XPCA 1FP1D 1TT5B 1Q0UA 4D9EA 5CCEA 4E2FA 4PTLA 4MWZA 1SJ9A 2WZDA 2EERA 2V3VA 4TKMA 4X8HA 2FLVA 4KACA 3ZNOA 1ATZA 1E5QA 4GECA 1F5SA 1KMCA 3K5PA 1EM8A 3FVQA 2FSIA 2GEDA 4LPKA 4F4IA 4BPRA 2C7OA 2XF8A 5E2AA 1O4VA 4ZVUA 2VT3A 5J2UF 3ILHA 1R0XA 3I32A 4HAUA 5ALUA 3IO5A 3RFCA 1XAJA 1XK7A 2YWRA 3OIVA 3QI7A 3O83A 1TZBA 4M38A 1GQFA 4MWGA 5FFNA 4Z2YA 3ZDQA 3GEGA 4DQXA 3LCRA 4NL4H 5BWLA 1LV8A 1W0JD 2AG1A 4IIGA 3O4IA 2IUUA 2OV8A 3T5GA 3X43A 2D6FA 1HG1A 1IQ0A 3T54A 3G2PA 1M6WA 2P79A 1LTKA 1BQ3A 3HYNA 3V1LA 5JNRA 1HX7A 2JHGA 3ELWA 1IN7A 1DIHA 1CLEA 2O0JA 4RMJA 2BMJA 4ZYVA 2WYOA 1GT91 3CEAA 4L76A 2IV7A 5JMTA 1HNXB 2P30A 4C05A 5AW1A 3Q1LA 5LDDC 2I9KA 3Q8WA 5AKIA 5F76A 3BILA 3D02A 1T6NA 1FA9A 3J81A 3RHSA 1ODTC 4MVJM 3MD0A 2P9GA 3V1NA 1T2VA 2WKRA 3ZV4A 2PRZA 5HQJA 4KMRA 3BWCA 4BMVA 1MIOA 5A9SA 1FRVA 4QGSA 3M81A 4AO6A 4CKZA 1TTPB 3KVRA 4IDPA 3EVZA 2ZAMA 5G4KA 5DXAA 4YP0A 5KTOA 5JIBA 2CXQA 2C9MA 2D1SA 2EARA 3KVNA 1OSNA 4PGGA 1ID1A 3NAGA 4NV0A 3MAAC 3OY2A 3CWCA 4L73A 4R8SA 1Y0BA 4KK4A 4MB2A 3HDQA 4QPJC 4BU0A 2D8MA 3SAJA 4AJ9A 1OAAA 2NSJA 4MVJG 4E12A 3TXYA 4EY8A 1U9YA 3EJ6A 1UOOA 3BE4A 1L3CA 1QANA 2X58A 3H11B 3U3KA 3IP7A 1YQDA 5IKMA 2FI1A 4GP6A 3WLKX 4DLXA 3ZW7A 3DG9A 4ESEA 3VSAA 5FFMA 1O5OA 3QKRA 2XA2A 2CXHA 2CJYA 3CW9A 4EJSA 2IXDA 3R0ZA 3UJ6A 3D6UA 3WWEA 3PEFA 2VJCA 3GF4A 3LNTA 4LJ9A 1IH8A 3TGPA 4S1WA 4MEJA 3QA3E 1UP6A 4LZNA 2REBA 3L6EA 4UTRA 2DCMA 1JI3A 5AW7A 3C5VA 2VQFB 1OLOA 4AL4A 3AVVA 2PJZA 3CLSD 2OHGA 3KP1A 5LXTA 1DG3A 2F00A 3W6OA 1EVZA 1GKKA 1T26A 1YR6A 1XL1A 2VKTA 1CUXA 1H2EA 1QVZA 1XOIA 3ACBA 3HMKA 4OL0A 3LHIA 5M2QA 4B3GA 3G2KA 4PGMA 1N9GA 2ZBFA 4DHWA 3HNPA 4B73A 2RC5A 1E3JA 2YZNA 5C5CA 2G4VA 2WP0A 3B8EA 5EMMA 1KOLA 3VR5A 3RUFA 5BOSB 1JBQA 1XZFA 1H2RS 1QFXA 2FN8A 2O8VA 1G291 3IUPA 4GMGA 4OYLA 5ESRA 4MS4B 5SICE 1L7NA 4OLBA 1AN9A 1NOIA 3L7BA 3PNMA 4FWIB 1BA3A 4PNHA 1U94A 1G5FA 3AP1A 4Y0AA 3TOXA 1XMPA 2WYUA 3CX4A 2N3ZA 3MRSA 2CDRA 1SGWA 2N42A 2WU1A 2PLWA 3U60B 1DKQA 2NXNA 4DB4A 4JLKA 1O0CA 3CVYA 4JEMA 1ETHA 4KAXA 3DZIA 1DX6A 4J16C 2EOAA 5L3ZA 1LPAB 1LPSA 1D6MA 1VC2A 2ZDGA 2V9PA 2FPWA 3MOGA 4RYLA 5DIZA 3WQBA 3OPYA 1WZUA 4HNQA 4V3BA 1P2TA 1MAHA 1U9CA 1MC4A 1TQ8A 3UHOA 2BGIA 1BN6A 4RSGA 3WLSA 4ZPXA 4DZTA 3DL4A 1QOZA 4OQQA 4H7PA 4X62B 1IL0A 4W5OA 1E94E 3LRXA 4LV6A 4Q6BA 5AOBA 3TVYA 5AFSA 4QM6A 4FQ5A 4QSMA 4V2UA 1DDIA 3RJ5A 2HF8A 4BFXA 1J5XA 1VLZA 4K9PA 3M3PA 1T9GR 3DAGA 3OEWA 2ZATA 1DG1G 3OIFA 3KVOA 2D5AA 5DLPA 1GOTA 1Z2PX 2OILA 3DOJA 1KWKA 3OE5A 2D5CA 3ELYA 1FU7A 1FMCA 2ONKA 2W2LA 5ALDA 3IAS6 3TH5A 4D3FA 5KU1A 4ZDJA 2IBMA 3QYFA 5E1OA 4OXNA 2I2FA 1H6CA 2PG3A 4UMDA 3ZJ5A 2PNJA 1NNEA 1ZD3A 1PGQA 2Q2OA 1TXGA 1UIRA 1YR3A 5AJWA 5KYVA 3ESRA 4G1BA 4ODIA 4Z0HO 3PPIA 4GI1A 4RANA 1G20E 3HC7A 1Q0LA 1Z4PX 2I76A 4KE8A 3AYZB 4KIWA 4QPPA 4Y2XA 5FTKA 3WADA 2ZJ4A 3G2QA 1HO3A 1ZGGA 1UFOA 3R77A 5F64A 3GPDG 5FTWA 1Q7GA 5A3SA 4KSCA 3ZS9A 1SZCA 4JJ8A 2AFHB 3HB1A 5HZMA 4QQRA 2XWJI 4JLAA 2K7FA 4ERNA 1XLVA 2CSUA 3L6BA 5TQ0A 4G5GA 4HRAA 5IAKA 2ATEA 1OXKB 3Q5GA 4HFMA 3DEYX 4DA6A 4C7XA 3DZJA 1K8ZB 4OIMA 1U7UA 4AT1A 1L4LA 4H9GA 1A4IA 3RG2A 5IFLA 3GYGA 1A8IA 3RYHB 3FTNA 4J1TC 1S2LA 4R71A 1PTJA 1ICEA 4AZ3B 3MPUA 1E62A 1ES9A 2C5GA 4H3SA 2CVHA 5E2BA 3ZGLA 1EJBA 1HDXA 5TB5A 5C7YA 1P0IA 1VE3A 1JMYA 5F78A 3SHQA 1DCKA 5JW6A 3INRA 5J47A 2IHKA 1R4MB 1ZESA 2HU5A 1EQ2A 5LA6A 3ZVNA 2JHCA 4H3KB 2YRXA 2PH7A 1AV7A 1SR8A 4PFKA 2QOEA 4CM6A 3TKAA 1E0JA 2V7QD 2Q7DA 4J4TA 2HCRA 2FPPB 3IPXA 4RF4A 1TM7E 1U1FA 1D6JA 3B6ZA 4X6LA 4OQYA 1HBJA 1E1RD 3A14A 3FBTA 2M98A 4WK4B 2JLXA 4YQFA 2A3RA 3EX7C 3AUJB 3RQIA 3DVAA 1OIWA 1Y80A 3QKUA 1DFIA 3L7IA 4GVLA 1E7YA 4PSVA 1NULA 2DFTA 4EJMA 2YJGA 1V1JA 2ZR7A 1ZXBA 4NWIA 1JI0A 4BO4A 4WK0B 4CG0A 3G68A 1K63A 4CIBA 1KS9A 1SZJG 1IJBA 1FS5A 2GPSA 1DGQA 4WOBA 4MNTA 3DPUA 3HE3A 4RK4A 4FBLA 4L2IB 1C3EA 4FU0A 3BGWA 3G5AA 3M83A 4O25A 4PCUA 4TMYA 2A4MA 4QDTA 3ZZNA 1N4DA 3MB8A 4QJ3A 2OZPA 1EFTA 1FP4B 4Y2UA 1RBMA 4HQ6A 1ODJA 1RAHA 2OT3B 4O8CA 3CV3A 1NOJA 1SOWA 1Z6ZA 4KQIA 3W4IA 5CVEA 4QTUB 4CIAA 1FY2A 1ONOA 3N5CA 4UMEA 1BJRE 5BUCA 4EHAA 2BFWA 3W9SA 2GZ2A 4JWKA 4DMRA 1QTQA 1GAXA 1KFJB 3EUEA 4Q16A 2ZUTA 4NYIQ 2DQ4A 1M7GA 1ZK3A 5KTTA 2A5FA 4IFBA 2OE2A 1AUOA 2ID9A 2DU8A 3DZKA 4LA4A 1RHQA 3D7LA 2IDZA 1NA5A 1QMPA 4J2OA 1RXIA 1ZPDA 3GVIA 3KTFA 4ZOLA 3JWJA 3WP0A 3AB8A 4Z9BA 3GFVA 5KDLA 5LWHA 4QTXA 1NKTA 2QJRA 1FDWA 2ISCA 1FE8A 2FPIA 2YDXA 3C1TA 4D97A 4DZZA 1V16A 1C0LA 3Q7EA 3WLEA 4EB0A 3QG5A 4IXWA 1VRVA 2RH8A 3RJMA 3R3JA 5AK6A 1E18A 3SE0A 3LK7A 4GLFA 4HJRA 1OKKA 1PWYE 2WIAA 1Z0KA 2CVQA 2EZ9A 1XQ9A 2BEVA 2G1AA 4CM9D 3K2QA 3RF6A 3SC2B 4NU0A 4O4IA 3DBVO 3OTGA 4AXBA 2PUCA 1DS6A 3PTZA 3I0NA 5E9AA 1XTBA 3H4VA 1RQPA 3OCUA 1RHMA 3ESBA 3QX9A 5FUWA 5FD8A 3LVQE 4EPWA 5E1MA 4EGCB 4IDFA 3UOAB 3VKWA 2ODTX 3T94A 3WLMA 1EX7A 4LOKA 1B6GA 4Q9KA 4YMUA 1Z0JA 2WNIA 1WXQA 4X92A 3TB4A 2J6BA 4R2KA 1XF1A 4A0RA 3AOEA 1G3MA 1PT5A 1ZUNA 2QA5A 3B52X 3KV1A 4TMVA 3MQFA 3ZY5A 1KEZA 1DZIA 4DCUA 3QXXA 3K9HA 1NVEA 2W6ZA 1EFHA 4O4HF 1OLXA 1FDRA 1KKUA 1ZM2A 2IYWA 4GMDA 4EB6A 2NP6A 3K1TA 5D86A 3ZKWA 2PMDA 4KFTA 3KSBC 2VTDA 4JUIA 4W6ZA 1XB2A 2WE8A 1N6LA 4Q1CA 2HLPA 2DPMA 1VI5A 2AGVA 5JWOA 2PX6A 3G0IA 2OBFA 3D7KA 1EWKA 1BS1A 3P45A 5FWAA 2IH4A 1UPUA 2ECQA 2C4TA 1DLIA 1G8KA 1VJDA 1JHMA 1ZCJA 4L3WA 4S2EA 1YVRA 3I3SR 1QG2A 3TZHA 3EVGA 3AG5A 3RSGA 2Q99A 4KN9S 1AXGA 1L1RA 2J3DA 3K9WA 1KEVA 4N18A 4OOEA 4U7TB 3T7KA 4IOJA 3K0KA 1Z37A 4JLVA 3D0RA 1Z5NA 3BWDD 3U0BA 1YOVA 3EPRA 1U2ZA 5F52A 4D8TA 1NAHA 3PGA1 1L7XA 3PJEA 2I33A 2JATA 1PUJA 1Z0DA 4FZJA 4JVOA 4NQZA 4A2CA 4D79A 3BE8A 3BAFA 5ALXA 3T5BA 5ELXA 2CJWA 1FMLA 9ATCA 1JUDA 2VQ6A 1MJHA 1II8A 5KO2A 4J7AA 2IKQA 3CJQA 4FKZA 4W8GA 1U4NA 3TEFA 3ZWPA 1UKEA 1X7XA 2QTTA 2GGSA 3A9UA 5TRTA 3W2IA 5MFPA 5JSZB 4TUYF 4OBEA 3FPHA 3RG8A 3FGZA 1ZINA 3SC4A 2DHCA 5KVAA 4Y2PA 2X42A 4A8PA 3R7SA 1JJVA 2QN2A 1U0SY 2NO0A 3P9IA 5KYWB 1K4YA 5TY0A 3HVHA 1ZQ1A 2ADMA 3JQ6A 3Q6IA 4GKAA 4RPIA 3G9UA 3W1WA 2BGNA 4TV8F 2W4MA 4Q9AA 2DCUA 4MSUA 4HUTA 2YVQA 3P20A 1G6KA 2BUBA 3U0VA 1AUXA 3ZWMA 5LL6P 5DW0A 3PR2B 1DJQA 5E7QA 5JDCA 3PNLA 4CXMA 4HR7A 1L4EA 5IK2D 2GKOA 1XRPA 4F2PA 5KX5F 4YT8A 2A78A 4QDXA 1AK2A 1KIMA 3FSEA 1XAHA 4F6LA 2Y3IA 1OGYA 3HN6A 1G0OA 4MUAA 2IQ5A 2JCYA 1NZJA 1P7PA 1GCUA 3MGKA 2FZ4A 3BYZA 3C3JA 4HMPA 5BNIA 1EK1A 2QG6A 3AOEC 3UMRA 3N6XA 1X13A 5IRCD 3Q6NA 3GNQA 4WGGA 4E0BA 3GROA 3GVCA 3NFYA 3BXHA 1RPNA 4GOXA 4Q3AA 1I2AA 4EX7A 5JALA 1GAJA 2Q6OA 4KXFB 3F4LA 1GV1A 1SD5A 2ZRPA 1YASA 3AHCA 3OBIA 4M4SA 5B64A 1P0MA 3I73A 5HSGA 2EX0A 4DDUA 4DC0A 4F9TA 1OD6A 2J0QA 2O8DA 3NATA 3GWGA 1ULSA 1FSZA 1P4RA 3HBMA 4JI6B 1R6AA 1GGFA 2PTHA 1ZKDA 1CQIB 3OZGA 1QB8A 1P75A 4HJXA 2WFAA 1GGNA 1XLTA 1SEPA 2VC2B 4O1IA 4TTTS 4G84A 1Y3BE 4GPIB 1QK3A 2IYPA 4HAXA 3ZJYA 1ULAA 2C29D 1PVDA 1H4QA 4J4HA 1YZFA 1A27A 5IC5A 3TOCA 4Q4JA 3WGTA 4DIDA 2I7TA 2JK0A 3TPZA 1CS0A 3IRUA 5MF6A 2C04A 4MDYA 1LRKA 5G40A 2ORWA 5LB4A 2UZ3A 2HN9A 3BC1A 1P9WA 3BRCA 3QUBA 4H4DA 4MZDA 3USES 3NGXA 4AKEA 4AWXA 1AV6A 3K6SB 1CF2O 2W6ID 2GERA 1YBMA 1B74A 3NRCA 4G1CA 1AKRA 1N5MA 3DAOA 5CDFA 2RKWA 1N6OA 4FJ0A 4NXMB 2GDJA 3I8SA 5AKHA 1RI3A 4QHYA 4GOKA 4XIYA 1CY7A 2C7PA 1A4XA 1YUBA 2BEKA 1B8OA 1THZA 3HCRA 4G89A 5DTRA 1CK4A 1PLJA 4BC1A 4ZJZA 3VU9B 4LE0A 4Q3KA 3A1UA 1AMOA 4R41A 2I4TA 4AG3A 5LZ8A 3CUVA 2V6BA 1GD1O 4X9XA 3PYLA 1M83A 1P9LA 1XD2A 4JVLA 2Q0QA 3ZPXA 3ANLA 1OLSB 5JDCC 2ETVA 3HPRA 3DLCA 3MWEB 4PO9A 4YJ2F 3ZHRA 1DJPA 3FD8A 4WLOA 1UDXA 3A6JA 2DVMA 2ZJFA 4HWGA 1UBRS 3GUHA 3BH7A 1C0PA 2ONYA 3OPQA 4HDMA 2X0FA 1LXCA 2EFYA 3T1VA 3R3UA 1BDHA 2FUG1 4PR0A 1GZUA 2G5PA 4IM7A 4AKIA 1U80A 1OT5A 1DMSA 1NLZA 3O1JC 1P6UA 1IK4A 1XYGA 3WFZA 5A4KA 4PC6A 2IS6A 1W4BA 3JATA 4N41A 1Q17A 4A10A 3W04A 1FMFA 5FA5A 3SKVA 3HY3A 4YCBA 4F04A 5U4XA 1A2QA 2O52A 1DAFA 1EP2B 3JWEA 4PX5A 4UCXA 4FZ3A 1GQ2A 1SD1A 1Z7WA 3KC2A 3FHLA 3UW3A 2QDXA 3IT3A 4GBED 4WA7A 1C7EA 4ND8A 4WINA 5D85A 2PX8A 4B09A 1GGVA 3P9RA 3PQ5A 4OLHA 3M34A 4Q3DA 1RSZA 1ESDA 3W78A 1Z25A 4R9RA 2BGWA 1VA4A 4C4XA 3NIBA 3FI9A 2UUOA 2QT9A 2GBIA 2HMWA 2X77A 4J3FA 4NV1A 2WUGA 1OXUA 5IG2A 1GVNB 1BQ4A 3HO8A 1AQJA 1J9GA 3Q88A 2HXSA 4XR4A 3UMMA 2AG0A 4HDNB 5FBLB 2GN6A 5C7IO 1E0SA 1INLA 1RWVA 3WLRA 2IX3A 1PBTA 1SVKA 1UBCA 3V7UA 1KVUA 3OFND 4EW6A 1YAJA 5FTLA 3VJKA 3ZEIA 1SOAA 4ASUA 3VKGA 4UULA 1NXQA 2RHGB 4FFWA 2IGTA 3HN7A 1KMHB 3L43A 2E5LB 1M1NA 4DLVA 1X0VA 3KE9A 3A0RB 2JI8A 3B3JA 3HR7A 1B3RA 2RK6A 4L8FA 4D74A 4LF9B 4IJ5A 2M32A 1ZH6A 3PPVA 2RGRA 5BUZA 2WHEA 4ZT3A 4PQFA 1SO8A 3BTVA 3DOFA 2Y27A 4MV4A 5TNXA 5BV1A 1QE3A 5C1BA 4IRMA 1KEUA 3PFIA 4ZIRA 1YJQA 1U90A 3DNFA 1LSJA 4WY2A 3SIXA 4QPCA 5CB4F 5JJCA 1OBOA 5J2TF 3B9RA 3DE0X 3SJBA 1E0DA 3FDIA 3I1JA 2C82A 3ZD6A 4I0WB 3HADA 5ARDA 5IAEA 1UCFA 3O0DA 4XUEA 5ENDA 1YB7A 2FOLA 4MJXA 2PUWA 2DBRA 3GEPA 4R2IA 3ZHSA 4LRWA 1NI3A 2V5UA 3WFJA 3L92A 3DLHA 2FJ0A 4E6PA 4F2WA 2N75A 4JVSB 2DYKA 3CTMA 5BYKA 1ORDA 3A1FA 2WD7A 2ZBDA 3O2SB 4AC9A 3U56A 2XDQA 3K0FA 3STTA 2JG3A 3C70A 2C0QA 3IHKA 3A36A 1EKXA 4G4SO 5HK8A 4PANA 4RFSB 1DAIA 3RPEA 1IOWA 4P4SA 4AKSA 1SCIA 2P69A 4AIRA 4KTVE 3UMJA 3H9QA 3W2HA 1PSDA 4KIGA 3LDHA 2AX3A 4YMVA 4G0YA 1Z5VA 4IIYA 1UOQA 4RZUA 1MO5A 3K2BA 5JVDB 2JKYA 3GD5A 4GR9A 1TZMA 4IIVA 4KBYA 3TDNA 4UXHA 1YNOA 4QYTA 1PWHA 3C1UA 5AXDA 1BXRA 2IE8A 4UJ3A 2OAP1 3PXUA 4PFJA 3W3AH 2ERXA 2HBZA 4R51A 1M2OB 3QVKA 3OZ7A 1K0FA 1MJGA 2YFQA 3ELUA 4MJ3A 4D0SA 5SYMA 5GJBA 1K7CA 5KTMA 3UCXA 1XHEA 3CQ9A 2OHJA 5M5BA 3F78A 1EX1A 1OFHA 3CR8A 1MO6A 1XI2A 2IXTA 1RT9A 3LX4A 3QY9A 5EN4A 1SCKA 4FC7A 4R8MA 2QUHA 4ZYWA 1P4JA 3ANXA 2XWSA 1JHAA 3UT5B 2GYYA 4QG3A 4CLRB 4XLZA 4XRGA 4MWCA 1OI4A 1FJGB 2PUVA 4I8DA 3SHVA 3KUKA 3T4EA 3ML1A 3QVXA 3QTBA 1NUHA 3G2LA 3I9LA 4RVNA 2QVXX 2C2KA 4X60A 4ZVPA 1V1RA 3ZS8A 1Y9ZA 3THXB 1KE2A 3CNBA 4LRQA 3KWMA 3RC2A 3R5XA 3SQOA 4AJHA 3S2UA 4O2BA 5DV9A 3D59A 4FVTA 5JFOA 1RM0A 3FOEC 2PSEA 1NHWA 3PS9A 3JQDA 1K2WA 4M8NE 4W9MC 1MV8A 1RWBA 2GF9A 4OFZA 3I6QA 5REQB 3E7XA 3ISVA 2RAVA 2XA1A 4OOFA 4OMDA 3OE4A 2HLDA 5HF8A 2XYVA 4AN0A 2QENA 1EVEA 2RH9B 4IXNA 5EQFA 3QFTA 4LWQA 4PX2A 1WZNA 3GK3A 4YJ3F 1BD3A 1OH5A 3UAOA 4D4HA 1T6BY 2DFLA 2VWPA 3M49A 1NLYA 4KTTE 4NC9A 1Y7IA 3H2BA 3GDFA 1DQRA 1GRNA 2FQQA 1WRBA 2GN4A 2Z04A 2XWPA 2Q29A 3UFXB 3KQTA 3NHYA 4PXAA 1EGAA 1C81A 2AD5A 1E5VA 4ONEA 3A4TA 3OWXA 2VF5X 2GI4A 3HFRA 4PRZA 5AOCA 4XAQA 5BV0A 2DQZA 4TGLA 4J7UA 3AJEA 3PWZA 5IUJC 4YHHB 4XX0B 2QX9A 5K1ZA 3EGCA 1Y7HA 4MYRA 3NHBA 4YAIA 2JJ2A 4FHEA 3VZDA 4GT1A 4LSZA 2P9FA 3U7QA 4AZ0B 3CYFA 1IEXA 3BJEA 3FNGA 2QXUA 4H08A 1ZOIA 3PRHA 1A04A 4RF2A 1V5WA 5J40A 3RK0A 5HJEA 3PNKA 4FX2A 4DSTA 1E9VA 3VDXA 4RDXA 5LD2B 2NT4A 3ICEA 2O5VA 1T1JA 5EEHA 3HM9A 2EWMA 1AQUA 3DZCA 2HBYA 4IUBS 4KNWA 4B9EA 5IAOA 1CEYA 4FN4A 3F2VA 1ISRA 3BHNA 3V7WA 4NZNA 1YRQA 4OJQA 4Y6QA 3NTXA 2BR5A 3Q72A 1WW3A 1F8UA 4UPVA 1YHYA 3CCFA 4MW2A 5JH7B 4NH0A 4QEKA 5IVHA 3GP8A 2J33A 3FZNA 2B7BA 2FUG6 2JLAA 5ALGA 2VF7A 4DRZA 2YWHA 4FE4A 1WXWA 1F2UB 4NZPA 1NYQA 4R69A 1EDOA 2H1CA 3STVA 4E11A 4ETIA 3GLGE 2MR6A 5ALSA 5LDGA 1FNNA 2GBCA 1T1SA 4Y1GA 2BGGA 3A6FA 4R8KA 2AFIB 3SS7X 5B4UA 4RDCA 1H1LB 2FHPA 2Q2VA 1GRVA 2ZIZA 1GNVA 2G06A 1VIYA 2PFSA 3QE2A 2E82A 2FPMA 5B3LA 2QJWA 1NI5A 3VSCA 3BHIA 1EXNA 4CKWA 2GCNA 5DNDA 5CNKA 3RADC 3FWZA 5JSHA 2HX1A 1SVSA 4ZYTA 3W3AD 1C1HA 1SH7A 3LPAA 4Q9DA 4C43A 2GNOA 4WY5A 5FJIA 2OHXA 1JKFA 1R4AA 2B9VA 1DAOA 2PUHA 2X9GA 3LY8A 4U2EA 4YGXB 5G1OA 5KYUB 5C7LO 3FYDA 4R81A 1I7LA 2J9ZB 4JD5A 3TZQA 4G9EA 3K1AA 1XA0A 1ZRHA 1KEEA 4YCLA 1ZUIA 2GF0A 1K92A 3Q15C 5C53B 1X1SA 3HHEA 5LCXA 1LNQA 5FI0B 4W9NA 5LP1A 4OHVA 4BQNA 1DUSA 3D5QA 2XQJA 2NYUA 3BTOA 4IYJA 1Y6FA 4XQCA 1KAMA 4X91A 4G0WA 3D9QX 1Z07A 2Y0CA 3VOSA 4DV1B 1EP1B 2RBEA 3E8SA 3EQ7A 3NWPA 1SRRA 2GS9A 4DNXA 1OASA 3DEJA 1KYZA 4FFBB 3TDMA 3K16A 4AZWA 2Q9BA 4CGYA 1GLGA 3MTEA 2R48A 3G5TA 1UPXA 1PV2A 2R1TA 2PJDA 2GZ3A 1SXJC 4G0OA 4TXLA 1EG2A 3UYKA 2QGFA 1X7WB 3WIVA 1ZM7A 1CDOA 2D4AA 4D9IA 5KKCA 5FQNA 4TLCA 4Q1FA 2ID4A 4OI4A 5SYAA 3U44B 2HQBA 1KI7A 1VLQA 1ND6A 1YCDA 2X8LA 1E2MA 3PKZA 4QUHA 4U3JB 3RS9A 3DOHA 3RT9A 5BYAA 5JQGA 4GC5A 4IMJB 4CHGA 5ENVA 1W85B 3FPAA 4RS4A 4DR1B 5JAQA 4CF3A 5DK6A 3W1EA 1KR5A 3N9IA 3KE8A 4KCGA 3LJKA 4UUBA 2MSNA 3G2HA 3ADCA 3AC0A 2WRZA 4IMPA 3ECAA 1P1RA 2JHPA 3DMTA 1TYBE 3WL7A 5AUPB 2Q3BA 4N8SA 3G79A 2FE4A 2UZ1B 4IYRA 3URMA 521PA 5LFAA 2G76A 4Z49A 2H1OA 4OX9Y 1F3OA 1W87A 1Z38A 3HYCA 2HIHA 3QSGA 1SKUA 4WEOA 1JFFB 3TIIA 1I8TA 2DKFA 4BYMA 1MABB 5T4EA 3ELDA 4CJXA 2IELA 5BWBA 3EG9A 3ZU6A 3JTEA 2HXGA 4IV0A 1E5XA 3N3AC 3Q5EA 3F6RA 1NC1A 1D4FA 3QLVA 1T3HA 2FK7A 4G9GA 2ARKA 4XDZA 3ZN2A 4A23A 1L7OA 4Y2QA 4WCFC 2XUFA 1ZRNA 3EQ9A 5H82A 1WXIA 3JQ8A 1ZJJA 1Q1AA 1ZD4A 3E2IA 4N6OA 2XF2A 4J0IA 5EHQA 4BMSA 1JHRA 1N4AA 3UA4A 5AKZA 1ODCA 3K2EA 3L1VA 3EODA 1HQDA 3D64A 3CH7A 1M6NA 5CU7A 4W8HA 4Z9YA 5HW0A 2BSXA 4ALLA 3GU3A 4Z3KA 5D3ZA 1SCAA 3IP9A 2D1QA 1OF1A 3QW4B 4F1WA 5C0OE 1JSLA 4XPZA 4AJ4A 5JZMA 4WTOA 4UVIA 1ZHOA 4QU5A 3GCZA 5LMCA 2J45A 4A6XA 3RVNA 4C9BA 1TM5E 3H3JA 1KI2A 3UAGA 1RAAA 1T9AA 4WBNB 4W9NC 2YMQA 1VPWA 2I7DA 3DW3X 2NW6A 1E60A 4DR2B 1PJLA 2BGKA 1FSPA 4J0JA 3IP1A 1WPRA 1AE1A 2DUWA 2HA3A 3MGCA 4ARBA 1M1YB 5IABA 2G36A 2H1WA 2TSYB 3MCZA 5DIFA 3RYIA 2ZZNA 2HA4A 1T8TA 1UINA 1PJBA 3S44A 3WYGA 4DLBA 1E61A 2NOAA 2BF7A 1Z35A 4P7KA 1Q2XA 3Q8XB 1J5EB 4TZ6A 2LWIA 1NBHA 4HTFA 1G8GA 1MO2A 3V46A 2QS9A 4CFSA 5ADUS 2BFMA 5ITZB 2YBDA 4JYAB 4IZOA 2JEOA 2GFQA 3CLRC 1R0LA 2I2AA 4CMGA 5JCPA 1U3CA 4Z53A 1QS0B 4JBYA 3WVNA 2XDWA 2VPWA 1H42A 1ZH4A 2WG0A 3FPFA 3LYAA 2QYTA 3Q12A 3QM1A 4L5JA 5EWMA 4LWPA 3FPBA 1M2EA 3SXUB 1IY8A 1N2GA 1BC5A 1IZ0A 2CCKA 3NXKA 3SQLA 3PC7A 4TLAA 4U4AA 1GGEA 4UKDA 4D56A 2R2GA 2Y1EA 1BW9B 1YE8A 1PFKA 1NQWA 3R09A 1PHRA 4JP5A 1CY1A 1XZLA 2LIPA 3SZOA 3CUSA 4H1WA 1U7ZA 3INTA 4HL6A 4N49A 2W6MA 3C8DA 3AHIA 4OHMA 3TX2A 3DEFA 5AW2A 1FJ2A 3ECCA 4QO7A 3ASYA 1ZUHA 2QG9A 1W73A 1Z56C 4WIAA 4DNFA 1IY2A 4ANFA 5CW1A 2BPOA 4NS1A 5JRJA 1YI0A 1UH5A 4P4LA 1H6BA 1YI1A 2ON6A 5C81A 4OQMA 4LF4B 1W25A 2NPIA 5JADA 3D4NA 1CY6A 4FGZA 4IKPA 4D1YA 2OAGA 4MGZR 4R0VA 5B6JA 3QLVC 4CEIA 1QYVA 5AHKA 3WGIA 1TB4A 1XDUA 4JMPA 4ZMRA 2DLDA 1DMRA 1NSTA 1XPJA 4P33A 5HUJA 3W5CA 1MAUA 3TRJA 1I9CA 5TARA 1D7AA 3ND5A 1ZD8A 1GITA 4KPUA 1PD0A 2OHFA 2ORED 5HP4A 2VTEA 2ZWPA 4G0UA 4K6GA 1GTSA 1UDWA 3OIUA 4TX1A 4UFNA 5AM3A 4UHDA 5JSKA 3T9BA 2VRCD 3UJ7A 4L7VA 3BSSA 2FUNB 1E77A 4F7WA 4KREA 3BCRA 2JLUA 5ALMA 2CB0A 2BZ1A 1QHHA 3FJ1A 5HIIA 1S96A 4CUKA 2O4CA 1PBNA 1WUHS 3KTAA 2D7DA 4Z8YA 2BP7B 4OGLA 4DA7A 1OFGA 2EG9A 3BXGA 1KAHA 4OGGA 2VDWB 4BVLA 1JIUA 3OWOA 2HL6A 3OJCA 3NNSA 4X7RA 1Y4UA 3SS8A 2F8SA 4ROTA 5AI8A 2H16A 1EVQA 1H3FA 1RCFA 3N2GB 4FSDA 1IZ9A 2WIDA 4ZOBA 1GYRA 4Z4GA 9GPBA 3OZVA 4D9GA 3IB6A 3I09A 3ICVA 3EEOA 1ZUD1 5HILA 1SU7A 1X92A 1K66A 4L4XA 4D41A 1HMPA 3L0YA 1UBOS 2NO9A 3THOA 5B36A 1Q0PA 2KM1A 3RC3A 4L0QA 3F9CA 1RAEA 1LJUA 2C7VA 4PG8A 4FSXA 2AG5A 4M1YA 1X7ZA 3OM8A 4ZQGA 4ZEXA 2VATA 2AZMA 4ZO4A 3V2HA 1HMYA 5AYVA 3HEAA 4FMDF 1VYTA 1L5QA 3OJWA 1X77A 4KYUA 4Y3UA 5F51A 1ZFNA 2FJUA 4S04A 3ER8A 5DI3A 2AD1A 3MF4A 1CZOA 1K2VN 1WCXA 2W6CX 5I7UA 1WXFA 4CW7A 5FB3A 1HLDA 3L1KA 4BVKA 4PYQA 2EFDB 5F3DA 2LV8A 2VKQA 3RC1A 3OTOB 3PE4A 1UQTA 3GFTA 2G9VA 2ACEA 1M8FA 4W1QA 3ZXIA 5T4HA 2C59A 5JPDA 4ZKDA 3ITKA 2PLNA 4TXHA 4NK5A 2JKVA 3F6SA 1L4BA 3QPCA 4H17A 3PE6A 3G13A 3Q5DA 5D01A 3WYCA 4B4WA 3C3KA 1SXJE 2GPBA 2J85A 3KBOA 1ELOA 4L16A 4V03A 1JMVA 1T4DA 3IE0A 2QSUA 1O89A 2CHUA 1Q6YA 1JHPA 3OJFA 4HUQA 5BSGA 4NCNA 5CITA 1LPBB 4Y2VA 5KNBA 1TT5A 1MCZA 1QNFA 4X1YB 5LMUB 1L8AA 2C2XA 4BLWA 3VR6D 3CLSC 5I7SA 3K72B 5ALYA 4JT9A 4KSBA 1XUOA 2V7GA 2X0NA 1X80B 1X2EA 2QR2A 1GA4A 5KJ6A 6YASA 4ACAA 5CX4A 1I36A 4EFDA 3SSNA 3IQXA 4RLHA 4QUBA 1QHSA 1Z0SA 2OC9A 1LPMA 4IOMA 4IIFA 2XZLA 2WJGA 2EJTA 2G83A 3HKEB 3AEUA 3S2ZA 3VNRA 1NLFA 5F73A 2YY6A 3EZGA 1C1DB 4LPSA 4UPDA 1EVYA 3G3EA 3KVYA 4JXKA 4YRCA 4Y7CA 2BCGY 1C3XA 1MPXA 1OZGA 1VIAA 4O2RA 5EP2A 3IVAA 1O6GA 1NFRA 2FW6A 2V4UA 1DRWA 3EQZA 1R4NB 3TSYA 4AMGA 4EABA 5K05A 1PRYA 1TK9A 3A8TA 3TB6A 5CYGA 3C15C 4R7ZA 4CIWA 1N9ZA 3C1AA 4RD0A 2OYRA 2XCIA 3UJDA 2E55A 2YMMA 4JN6B 4TS1A 4I9UA 3MJ4A 1J24A 2B8WA 4M1MA 3B7GA 3FNFA 2F1IA 4BLUA 1ULUA 3DO5A 5I4KA 1R5JA 4M1WA 2JIRA 1T15A 3NJRA 1J70A 1KU6A 1VIMA 4LJ6A 1KIFA 2ZU0C 2VBGA 3D4OA 1EFKA 4JFAA 3LYLA 1Z29A 1Z3CA 2BW0A 5AKKA 4QU0A 1JQBA 4F38A 1K3FA 5LPNA 5JCXA 3W5SA 3G0CA 4HLDA 3JSAA 3QIVA 2J8ZA 3ROMA 1RBZA 1V8BA 3OESA 3KFVA 3SICE 1U3FA 4TYPA 3STHA 4AX4A 4W5RA 2OHHA 1KNQA 1NM5C 1XJ5A 1MQ9A 5KWEA 4NZYA 5KUTA 2FFAA 4PN7A 1NUUA 3V1KA 5KQRA 3ZWWA 3AIOA 1GUZA 1QZTA 1Y6GA 1LF5A 1E7SA 3NWJA 4HAYA 2YOFA 4P83A 2FPOA 1GG2A 2G0AA 3DTTA 3QQPA 5DFAA 2D1RA 2J0VA 4BNLA 4Q7KA 3L05A 3O94A 4B83A 3VI4B 1Z75A 1W5FA 4PYLA 2ZT7A 2IHBA 4FOOA 1VKJA 4WQMA 2CEAA 4WXPA 1HT1E 2HIAA 3ZIUA 1J07A 1UKVY 4TVOA 2Z1MA 1I2BA 1JIXA 2CLFB 3L7LA 4A82A 1TADA 5JHGB 1KH3A 4KHPB 3ZZUA 2Z43A 1HA3A 1MFPA 4OK6A 1BXZA 1LK7A 5DLYA 3ZIDA 4P35A 2EJUA 4IIJA 1OAOC 4QLBA 1QTIA 1ISPA 2FQWA 1SQ5A 1WSWA 4A5SA 1C3OB 3HDHA 4B33A 1QHNA 3CISA 3EIOA 4L4YA 4LHYA 2F3TA 3UENA 3S70A 5GP1A 1SKQA 3EXFA 1ZBDA 3GJQA 3WMRA 1LWOA 1B26A 3F9RA 3SE7A 2YN4A 2ZE6A 1PTKA 3LPDA 1COWD 4RM3A 2C5FA 4X1IB 3J7AC 3DV0A 4E2WA 4GQAA 2V96A 3BQNB 4LCEA 5FHRA 3S68A 2BRUC 3V6MA 2I87A 1AMNA 1K06A 3AQIA 1Y98A 2YZ7A 5SY4A 1WUTA 2P1RA 3KSMA 3MTAA 3TMAA 2C9YA 3HUTA 2NXCA 4WVLA 2UU9B 2QD2A 4MS4A 4AJIA 3EGWA 3NDIA 4G0XA 1G5HA 1Y8ZA 5IDWA 2BJWA 1XDZA 2AR7A 2QRNA 2KPOA 1U0EA 1YS2X 3CS3A 2HA2A 1KDOA 4GDMA 4WZAA 1MAAA 3T5AA 1EMDA 1ORRA 4F1JA 4XUDA 1CUBA 3DMHA 4M0CA 1TM3E 3PF9A 3CRVA 3AY3A 1BFUA 1BMFD 1YHNA 2QMEA 1VFPA 5E8JA 4KR6A 4GEKA 2W2XA 3M70A 4N5DA 5JWHA 1V26A 1CR6A 3T9DA 1S9HA 2X8AA 5JJIA 3FFAA 3IOCA 4HS4A 4MV9A 1W5SA 2IZ6A 1E5LA 5ALEA 4R3NA 1XZCA 2VDPB 3V8EA 3AU9A 2O2JA 3S81A 3G0GA 5MFZA 3VPSA 3DAHA 5LP6F 1H85A 3AHGA 4K46A 2A7XA 3OF2A 1O96B 2P2SA 1CD5A 1I6MA 3I04A 4XYGA 1ZU5A 1P74A 3DT9A 3WKDA 3L46A 3T0FA 3ZDRA 3FF1A 4BQSA 3ZUPA 2Z2KA 3V97A 2PKYX 3SBDA 5HFAA 4FLFA 5DTQA 3V2IA 3KK0A 1T8WA 4H35A 1DU4A 1U8FO 1QGAA 2P4UA 3HRKA 2BGLA 4G1FA 3H5WA 4KWTA 2P9TA 4G25A 4EG5A 1EE9A 5HZHA 1JPJA 3FZQA 4QULA 4EEKA 5LMNB 4QVKA 3BFVA 5HCUA 1YQ9A 5BW6B 3WWOA 3V4RA 4HGQA 1E6UA 2C4WA 1BCRA 2B35A 1C7FA 1EWYA 3EBLA 2CT8A 4KL8S 2A1UB 1E9EA 2QI9C 5GZ6A 3PLAE 4NFLA 3LUPA 2WAYA 1G2PA 4BMPB 1PJ4A 1GR1A 2QXYA 1Y8RA 4RKQA 5BW4A 5KQGA 1NG9A 4BBJA 5CA0B 2WA2A 2FWAA 3TMYA 4MCJA 3TLGB 4XYEA 1LRLA 4IF4A 3M0EA 3FF4A 3QX8A 3GPBA 5A4FS 2PX3A 2JL1A 1G9SA 4LGYA 1JECA 2VCYA 3F73A 2AFHA 2ZIUB 1Y33E 2V7TA 3RJ9A 1EB8A 2VLBA 4U2GA 4HX9A 4N9QA 3RDPA 3U26A 4Y6LA 3WXMA 4BO9A 4X00A 4EQ6A 2EP5A 3GRFA 3K0EA 4PCLA 4UCQA 1K6JA 2QD5A 3WSVA 4HOYA 4RD2A 4B7ZA 2D1TA 1QIJA 3I34X 3ZDZB 2Z4RA 3TTXA 1G60A 1UPBA 3MJSA 3DB2A 1MVNA 4JDUA 1GRQA 1KERA 1KI3A 1M3SA 2CL6X 1LBIA 2JZCA 5IK2A 3G89A 1VG9B 2NO5A 3GGPA 4JUDX 4GI7A 1W581 4K86A 1J8YF 4FYYA 1K3TA 1NBAA 3LW8A 3PEEA 2RGEA 3L0IB 3GRYA 4O5OA 1X7YB 3NBXX 3OQIB 1G5PA 1RRKA 3IRVA 3BDAA 4LWOA 3GLSA 1O6FA 3FIJA 4BDSA 1E2NA 1RCTE 1FTGA 3QEMB 3KU4A 1DNPA 2SKDA 3HCDA 3NT4A 2Z2ZA 1EDEA 3LCVB 4LVNA 2FGKA 4HX2A 4HLUA 3DXZA 1Z4IA 2QRVA 3OEYA 4HAOA 3O9ZA 3MBKA 2MHCA 1QK5A 4FM9A 1YQUA 3SBOA 2H54A 3VYWA 3MYRA 1DO8A 1II0A 4WUVA 3UK6A 5FI5A 4G2TA 1GFZA 3UIEA 2AI2A 3F8WA 1SXHA 5F33A 1FFXA 3ZXYA 4L2IA 3VZBA 5FLXA 5DM60 2JRCA 2XNDA 4RHEA 4B6PA 4EKEA 4HB2A 2OLEA 1LFDB 4BQOA 4IDGA 1FYVA 3H0EA 2DXIA 1EFVB 1SB9A 3PLRA 3RS3A 3RYFA 4ZYLA 5IDQA 4AS2A 2FR0A 2CLMB 1KO5A 3N59A 3NC0C 4RMHA 4K87A 5E0KB 4TTJA 4GXQA 4TXNA 1YFLA 2G9UA 2W8ZA 1QH0A 1PU2A 3BERA 1CE8B 2CBZA 4N3CA 4FR5A 3TFQA 3ND8A 4DSZA 4B80A 2PAAA 2VJLA 2ZM5A 2E5FA 4L85A 1KYQA 1YT5A 4PX9A 1IXRC 3WJ2A 4OATA 5T8KA 5CT9A 1WLYA 3NR2A 5DGXA 3T8YA 2HO4A 1NRXA 1KVSA 2AQIA 4MQ4A 1UP7A 3QFSA 1YUMA 2CL0X 4HWOA 1JEQA 1L3BA 1PQ4A 3ZKAA 2O8EB 2L19A 4ZWNA 3OU2A 3PUJA 1JKJB 1LK0A 1ZH2A 2JFXA 3R3VA 1OC2A 4Y2TA 2CZCA 5DNWA 1JLMA 2XXAB 1W5AA 5JV5A 3I05A 3F96A 3TX6A 4ECAA 2FDCA 3G17A 3JPWA 4Q0MA 3ESCA 2VO1A 5SZIA 2V6GA 3U4DA 2V3CC 1Z6AA 3U3OA 4I50F 4LV5B 1XQ6A 1TCUA 3LUFA 5LZ7A 4FFOA 2XX3A 3B6EA 3E22B 3ZNPA 1VIVA 4HY3A 2RJOA 5BNWA 5ER6A 1T1RA 2HA7A 3H5NA 4GE0A 4QPDA 4MRRA 4XOIA 1TKBA 4RKEA 3V4ZA 2WLSA 1SBYA 1FIUA 1DBVO 4JYCA 3GRVA 2JGFA 4CCSA 5KKNB 4EJ0A 1CUSA 2PUGA 1RLOA 2CVZA 2NPOA 4FDMA 3BWVA 3NWEA 3RROA 4BJ6A 2UXDB 1H2ZA 1VKZA 2OORA 2AHOA 4NBLA 7AT1A 1V3VA 4JJEA 4PU0A 1RI1A 4QYSA 4XM0A 1JBEA 4EBBA 3BJZA 4EG6A 8LDHA 4ZARA 4B3JA 5FEUA 1YFZA 2POQX 3BVPA 4X3PA 5DHSA 2O2DA 1XLWA 3Q3JB 3LQKA 3QYPA 4C4RA 4HGOA 1ZMOA 4ILEA 2B92A 1GSOA 1D4AA 2BFCA 2CXSA 2J07A 5JNLA 3T3NA 2GVZC 2QL6A 4OK3A 4MW9A 1MJNA 3U17A 1EXDA 1T91A 4ETWA 1QV7A 2OA0A 3WGQA 1Y8AA 4C89A 3LXUX 3OVMA 2OFPA 1GNTA 2J5KA 1RRFA 1RWKA 3MFQA 1NE7A 1GPUA 2I8AA 1OGIA 2A0WA 4AN4A 3HBAA 1JDPA 4ZCQA 2LP4Y 4Y30A 4EHFA 4KQHA 1RC0A 4OJYA 5IBRA 4B76A 4YUXA 4Q4DA 2YMPA 4PX3A 1WO8A 3O4HA 2PKRA 4KXMA 3LQ2A 4GYYA 4RLQA 2IYVA 1XZBA 3S2IA 3L0CA 3VNBA 4EKDA 2SNIE 4D3ZA 5EJ9A 4EF5A 3OHPA 5DJ5A 2QV7A 3PWKA 4EMSA 3D3NA 3MCWA 4LXUA 4X97A 5MN4A 4RMIA 3P71T 3X2FA 1CJVC 1TM1E 3UM9A 3WRWA 3B9QA 1ULTA 4RPCA 1V47A 4Y1RA 4OO3A 2LNDA 2WKSA 3VKFA 2IYTA 4KFSA 1SCDA 2BGRA 1ZD1A 1ZEMA 2HD4A 2J9YB 2HCFA 2YS7A 3DKIA 3FYUB 3QUAA 2ZK7A 3JQFA 2ATIA 4XB1A 4DIFA 2G7ZA 3WAJA 2C9BA 4JHLA 5AOVA 4UAGA 2LD4A 3GGGA 4KQ6A 4UNRA 1BWPA 2ENWA 4LRXA 4RSHA 3H6GA 3LHFA 3VVCA 1D2RA 5F3RA 4A7PA 5C5EA 4Y98A 3EA4A 1K6XA 1O77A 4M9SA 3G6KA 4MVJE 3CF2A 4BXOB 1MT3A 1QH8A 3D8NA 2H07A 4CODB 4LI3X 4EVRA 2OLKA 1ESMA 1TOAA 2FPSA 3HJNA 5ILGA 1QZXA 3T1NA 4GMFA 4CCYB 3IPYA 1LK5A 2B0JA 1A88A 1E4OA 1WNTA 3NDPA 3PJRA 2JNWA 2XWQA 1IB0A 4JLOA 4QL3A 3ABSB 2DECA 3V8MA 4DPMA 1SA0A 2PE5A 4KR3A 4Q3LA 5BW8A 1DBWA 4YAEA 1J7KA 1PHPA 1X94A 4QARA 3RB8A 3ZDYB 3TW8A 4C21A 1GJRA 9LDTA 3H2JA 2R4TA 2I1WA 3IOBA 5AW4A 3B1YA 4P0QB 2ZJ6A 5FO0A 5I7EA 5KI6A 3IBSA 3UK2A 1I7DA 1EA7A 4NOLA 4M88A 5AI0A 4LGVA 2V7XA 3LPNA 3WGVA 2ZE8A 5JASA 1O0SA 3QWHA 2GSDA 1SPBS 1RAFA 2D4HA 2GCPA 3UGJA 2HLHA 4TV9F 1HURA 3MGGA 4FHFA 3VRHA 1GCAA 5COBA 3GUZA 1P2GA 1QG0A 3EVCA 4YACA 1ZIYA 1XEWX 4IV8A 4O1HA 1G1MA 3AWDA 3W90A 1VSQA 1YQWA 3HFGA 2FCAA 1J2RA 4L9WA 4CIVA 1YR8A 3DE3X 3QHQA 4WD3A 3WDKA 1IWOA 4QDUA 1ZW1A 1G7SA 1XZEA 5AD1A 4AECA 2WG1A 4MB0A 1PDWA 5DHPA 5DCLA 2M2IA 4JC4A 5KDOA 2FUKA 3AESB 3AU8A 3GOHA 1EFRD 3QEOA 2AX4A 1F6BA 1Z0IA 4HSEA 2XT6A 3T7TA 1KQFA 1JJIA 3BSWA 3JRWA 1C9YA 1JIJA 5E3IA 3SU8A 4XASA 4XWAA 4J0QA 3RFXA 1EQUA 3QWIA 2BGUA 4WEQA 4RXUA 4ENSA 4PYNA 3W34A 2R8ZA 4WFKA 3RK1A 4ZD6A 1T1IA 1Q1GA 3G59A 1F4VA 2IPAB 4AS1A 1LTHR 2Y0BA 1NUPA 1WKBA 2WNHA 3EUFA 4RNCA 1NW4A 4IILA 3R7WB 3GLHE 4XJXA 3FRJA 3IQGX 3EY9A 4AS3A 1F3LA 2EHDA 3LZCA 2EG5A 3MRTA 5KSOA 3B9PA 1BTOA 3RU2A 4KWIA 1PL0A 4RV9A 1YWGO 2CNWA 2HRQA 1QHFA 1AZSC 1TYEB 2WJZB 3D0KA 3DFKA 5D84A 4BNDB 4DARA 3DTNA 4FOLA 4K9QA 2HF9A 1KPHA 3MWEA 2C2OA 2EZUA 3MM4A 4OUDB 4TQ9A 4CR8A 1E2PA 1OU0A 1C4XA 2YIVX 2CN1A 1XU7A 1YZGA 3L1HA 3KXDA 4F2DA 3L5OA 4YR9A 1PO7A 2WT9A 1GV0A 3EPLA 2ZSFA 1IHOA 3KLNA 1Q3KA 3UAWA 1I5RA 4DGQA 5AIBA 4EWLA 5AW8A 4CM8B 1T2AA 2LDBA 3LRPA 4II2A 1C50A 2XKAA 2F43B 3E4CA 4WFIA 4DADA 2YCBA 5EE3A 4DY6A 2BFDA 1DKLA 1GKUB 2ZI7A 3AERB 3LG2A 2GZAA 1VL5A 2HRZA 2ZRKA 4QFBA 5F5NA 5HBRA 5CFRA 4HAZA 2XGMA 1I1OA 2Q1WA 2NZJA 4DDKA 2OCXA 1D0VA 5G1NA 4ZDKA 2AOUB 4U7FA 1XZQA 3BFKA 2VFAA 2HSJA 1XVUA 2UZIR 1CR0A 1FDSA 1G21A 1PQYA 1RP7A 2Q5QA 2FX5A 2B99A 5JCOA 1IQRA 4TYWA 4MW4A 4P32A 1FSGA 5L4SA 1RM5A 3QBJA 1UBLS 3WQRA 3VPXA 3HJGA 3ZU5A 1QFJA 2PVSA 4RCVA 2Z8ZA 4M1SA 1L5HA 1N2SA 2ZRCA 1XXHE 1Y6JA 3I1YA 2XUAA 4RVOA 5H59A 1RZVA 4BKPA 4UTNA 3SK0A 1A96A 3CRRA 4G0ZA 4KVFA 1FVXA 2UAGA 3AV3A 2YHBA 2AN9A 3SJZA 3WZMA 4IDNA 1LJLA 2VP4A 4DIKA 2EJVA 4YX9A 3IIEA 5KBYA 1NFQA 5GAJA 3R5TA 2JVIA 3CG0A 1YE3A 3GC6A 3H4MA 4KZPA 2AR9A 3IAHA 4Y67A 1P2VA 5C3MA 2HSWA 2N47A 1CERA 4EW2A 1KIAA 2H65A 5FF9A 4LDNA 1YZLA 5C1OA 1Z13A 4ZO6A 4C07A 5IN4A 3HGQA 3UB2A 2JCSA 2YWBA 2VK8A 2KI5A 4LQDA 4PLHA 2UXCB 1FW6A 3PIRA 4LHZA 4EG8A 5LQAA 4FIZA 5ALNA 4WXRA 4Z3OA 4DCVA 3T38A 3KELA 4TT3A 4JQZA 2D3TA 3FTFA 1WB5A 3INNA 1CUHA 3DA8A 2FEXA 3F3SA 4UHEA 1CB7A 3AL3A 3K70D 4K9SA 3UJ8A 2ZT6A 1QH1B 1D4ZA 2B83A 3DNMA 3S55A 5A9TA 3T9AA 1CUYA 1I6WA 4B6FA 1N3BA 1ZZGA 2TYSB 1MA0A 3FKSA 4FGUA 4JS0A 5CT8A 3SZUA 5IUNC 2WFLB 3U7IA 2HMUA 2ZBEA 5EI5A 4EFLA 2MSLA 2ZPTX 4P4NA 4WLUA 1QO7A 3JD3A 1T13A 4JSTA 3RU3A 1U2GA 3D43A 4AULA 1FFAA 4BHTA 4IJMA 3ONWA 1ZGCA 1UADA 4MYHA 4WFQA 1HKHA 3IQFA 2FSVC 2HK9A 3VFDA 4QT4A 2VZ9A 4KP7A 1N6HA 3HVJA 3TLYA 2C77A 1T4MA 1H0KA 5K0CA 2RC6A 3LQRA 4XRRA 3DP7A 1JLSA 1KMMA 3H1TA 4FMCB 5FRDA 1AIPA 1U3UA 2GXAA 4DA0A 2BI8A 1OAKA 1SUIA 1YC5A 4M76B 2NZWA 5I48A 1SC3A 4QPZA 4EAAA 2AN4A 4Q37A 2GK4A 4FFSA 4Y0NA 3NEYA 3VMMA 5LKRA 3JAKA 1DQZA 3OZCA 4HXGA 5I9SA 3VR4H 5FTJA 1ZIPA 4U2KA 4E5DA 1VGQA 2QWXA 5JJBA 3IHTA 1DELA 2W11A 5T57A 5BSVA 5A62A 5KQPA 3C97A 3JAWB 2OZVA 2P9EA 2HWKA 1X42A 3PB3A 4YK7A 3V8NA 1A2OA 3KT3A 1YULA 2JCXA 2I3AA 1IZZA 1NMXA 3LUKA 3PC8C 4M54A 3LKZA 3TRFA 5KNCH 1E2LA 1L5KA 5C34B 5ICFA 4MH0R 2XTAA 2EYQA 5EZYF 4PFSA 3HCWA 3ZWVA 2O8BA 5CDHA 1SCBA 4QFMA 5AP9A 4K9LA 5E9WA 5HS6A 1AS0A 4TWJA 5IKOA 3ZWAA 3ASVA 2DWOA 1O94A 3NNNA 3VKUA 1N1MA 2FWPA 2ZUBA 1XQWA 3FCEA 3P4XA 2XQVA 4E3WA 8ABPA 2QRGA 3PGLA 5SV2A 1P60A 2GAOA 1Y3IA 1N3YA 4IJKA 2FRDC 2XE4A 5HKKD 2J6IA 3WP1B 4L95C 4ZDIA 1LW6E 4Y8VA 3X1KA 4XVCA 1HYEA 2JARA 3DKVA 3K0SA 1QDUA 2ZRLA 3V7YA 4XD2A 1XDGA 1BKSB 2EDCA 3GEBA 2QIPA 2E4VA 3RSLA 2YHSA 2PL3A 1XCGB 2C96A 2QQ0A 2FQ1A 1VBMA 1Z34A 4M1QA 3RIHA 1M7HA 3INGA 4JT4A 4MMZB 4IS3A 4MRNA 5E4YA 1VPDA 3LW7A 3LECA 3PQ3A 5EINA 2QNRA 2R6AA 3O2NA 2YC4C 3DE6X 1VMEA 2GM3A 4R1PA 1VJTA 3T41A 4RPGA 2IU4A 1B14A 5DBGA 4D3SA 4ALNA 1CRQA 3Q0TA 1O6CA 4ZJPA 3GI1A 4GO1A 3UGQA 5ILQA 4BCDA 4KYTA 4GLBA 4LKOA 2QVCA 4QDOA 4C5BA 1GKLA 4V1CB 3BMCB 1F06A 1VKRA 1XMIA 2WINI 5ADVA 1A7KA 3DQZA 4UE6A 2J08A 4K0RA 4LYHA 4ZI7F 5IHPA 3JARB 1TCAA 4RA9A 3H1BA 4E6EA 2ZSHA 1CR2A 5AUQA 1C2TA 5DGDA 3UFXA 5P21A 4ZU3A 2WHRA 4YRMA 5KOHA 1XWIA 5TJHA 1J1ZA 5IMSA 2JIOA 3L4KA 1ZXXA 1B2RA 2H7XA 2O0MA 3DLIA 4KO3S 4N5NA 4R7TA 5FNZA 4EYSA 5AW9A 5KNDH 5KTYA 2R4UA 3U7EB 1CWUA 4M1KA 4NR0A 4HNVA 1V11A 3IJPA 1ECGA 4LJ5A 4PSKA 5EIWA 2Q2QA 5HNKA 3WE7A 4QM7A 5ALZA 5H80A 5LQMA 5I9TA 4AZ0A 2JC3A 4CEJB 1N7IA 2FP4B 4XWGA 5CIWA 3OG9A 2P40A 3RC9A 1MO4A 3A3NA 1NJ5A 3HS3A 1DEOA 5CH8A 3RC8A 1YIOA 5HR5A 3U7HB 1RI4A 5C51B 1TVKA 1VHJA 2XQFA 1RQXA 2QMHA 4PZLA 2PL5A 4URHA 3WAKA 4B4KA 5JTUA 1GEGA 4C3ZA 1QH9A 3GLGA 1YNSA 2VOEA 1DAPA 4EK9A 3JV7A 4MR8B 5EXXA 4C4OA 5J4KA 2PTGA 3ZGXA 4BV9A 5K01A 2PM8A 1H2FA 1IAVA 1S5PA 3B1ZA 5A0VA 3ETDA 4DG8A 3HRHA 1HDZA 1BX3A 1U02A 4KQEA 4MR9A 4E5MA 2DFNA 3JCZA 3EFOB 2GAAA 4JGIA 4AF7A 3TUIC 8ADHA 5C8YB 2JIPA 3K9CA 4GRDA 5C4IA 5IT5A 2AFIA 3WB2A 3AVUA 2G09A 3C7TA 1EK2A 1H1LA 3JRNA 1KZ6A 1QQTA 3QPAA 5ADWA 3GEHA 3IVGA 4DJDC 4BBAA 3LO8A 3A1NA 2E87A 3VR4D 2VHYA 2NIPA 3BCUA 5AKJA 2PA0A 4PLYA 4M0DA 2V7UA 1OYOA 1U0NA 2F67A 1P1JA 1ZI8A 2A57A 3Q3CA 3FLAA 2VPZA 2JJ1D 4MTCA 5K3OA 3TSZA 2PUDA 1LPPA 1RHUA 4TTVA 2CD9A 3PQCA 1VXRA 1E64A 4L15A 4NZ9A 4EW3A 1DFHA 2IOQA 1SQFA 4JP1A 5KYUA 4ARZA 2VP3A 1F38A 3M9LA 3NAQA 1Z33A 4QTTB 2B5VA 3U2QA 5AM0A 4KFUA 3FPSA 5AK4A 1JR3D 4D43A 2ECPA 4PIMA 3PLNA 4MDEA 3AI1A 3P9XA 3L41A 4C3OB 2GPWA 1PV4A 1HC7A 3MXTA 1QWOA 2FN4A 4N7MA 2DT8A 3NIFB 3E3MA 1I3LA 1VMKA 1U3GA 3E82A 3IP3A 3AX6A 3CX7A 4IG9A 5J63A 4L72A 4YUZA 3U7GA 4I5EA 5CVDA 1WZIA 1VL1A 1EFLA 1QRAA 4ZAWA 3AFNA 5FLYA 5IJ0B 4MUIA 1OB2A 2H3HA 3G2OA 2OPBA 4HSGA 4O63O 4QC2A 2P75A 5H9VA 1QF7A 2CKMA 1C4OA 2HWWA 4PCAA 4PE5B 3T3PB 3HNOA 3KQOA 3PFCA 3PXCX 5K0NA 1Q1BA 4GW3A 4UBJA 5FV4A 2RE8A 3A2LA 4CETA 2V4MA 4OYHA 3GG2A 2I4RA 2F1JA 2Q45A 2BCJQ 5FYDA 2AXPA 4BWGA 2W93A 3OM0A 4M6WB 5SZJA 3UV6A 1VL6A 3U44A 4FW8A 4UEWA 5ALLA 1FUYB 1U2TA 1O9BA 1UT8A 1XJ0A 2QTAA 2VJAA 1G6OA 3B82A 3EHDA 3GZJA 1DUVG 3NKVA 4MA0A 4PY2A 1FDIA 3QOXA 3KUCA 4YB8A 3ET5A 2O7SA 4E09A 1FTWA 1RKVA 5CIQA 4EI7A 1NVBA 1W85A 1XRRA 4ZRMA 2J3HA 2NNLD 4WXHA 1WUYA 3OD1A 3ZTWA 4JBWA 2VP5A 2V6FA 3VNVA 3A3PA 3G8CA 4IJVA 1Z4NA 1PK7A 5FL7D 3AT1A 5LYJA 4B7UA 1HDGO 3WNQA 1O08A 1X19A 5C46F 1SKAA 4QUJA 2UZ1A 3FMIA 1B41A 1FVFA 4RMGA 2OOKA 3S28A 1VHWA 1Y9DA 2Y66A 1WF6A 1D4OA 4PSUA 2Q9UA 4OXRA 4MGHA 5AUOB 5B1EA 4IIXA 5LLSA 2R62A 3M6IA 3PEYA 5EP4A 5E3JA 3L1UA 3ADPA 3K9GA 1XTSA 3AVTA 1P0CA 5CBPB 4QU9A 2PKXA 4ENUA 1DKMA 1URPA 2PVCA 2PZKA 2R5NA 2C9DA 4KUHA 1R0RE 2CNDA 2I4MA 2DFPA 4FZ5A 1G6HA 4INZA 1UQUA 3EYWA 4DMMA 3AEQB 3FKJA 3Q7QA 4IV5A 1JHVA 4X93A 1ZP6A 3FVWA 5LMZA 2EFCB 2O19A 5JG7A 1TJ5A 5CP8A 5IVIA 2B4YA 1K8XB 2ZS9A 4WADA 4YUVA 3EZXA 3A2KA 5AJXA 4F3YA 1LI5A 3W2FA 3T7JA 4KR9A 4WY8A 3L93A 2ZIWB 4M9CA 3F3MA 5LXTF 4Z9FA 1DTWB 4M0MA 1F8XA 4EYEA 3E81A 5AW3A 1NUAA 1YMQA 5MDHA 4C0HA 1KQOA 3R7BA 2QMQA 4HQFA 2VF8A 3M1LA 2HJSA 2ZYDA 4MS3A 1GHTA 1SCUA 4MW5A 4OTZA 1JQEA 1KI8A 3ZY2A 1G7CA 3CLUD 4OHOA 3PNYA 2PSFA 2F1HA 1ORWA 1ZEJA 1ZD9A 3KZNA 4KSYA 3TXXA 3C45A 2UYGA 3E9YA 3LFTA 3I72A 1L5WA 4MRMA 1JIIA 3BRQA 2QROA 3TRDA 2K6GA 2YUTA 5ITZA 2J3IA 4RJJA 2FEMA 1BVYF 2JIMA 1KSHA 3P2YA 1TL7C 2YW2A 2AW3A 4UNPA 1U0HC 2Q27A 3EEYA 1DBIA 4JJFA 2FRXA 2D5LA 4HC4A 4PPFA 4BAUA 1MAWA 3L0ZA 3L4SO 2BBTA 3VAYA 3VH2A 4MDHA 3RVQA 1U7XA 1CUAA 1UOPA 2FWBA 1QO9A 3P8ZA 3IJRA 4N03A 3SGLA 5LLDA 3FH0A 1W93A 4RCYA 3LKVA 2ZKLA 1JIQA 4QJ4A 4B75A 1N2OA 3COZA 4QWMA 1TKAA 4AN1A 1BFDA 4GWKA 2PZLA 3CX6A 4W5JA 5D6OA 4MB6A 3UCEA 5F7OA 5HE8A 2W2PA 4DXDA 3OCXA 4YRLA 3TJRA 1PZFA 1IBLB 1RRGA 3DVQX 4GRAA 2AVDA 3EJWA 5EUBA 1HFJA 1SELA 5B2EA 8AT1A 3OX3A 1XJWA 1K9VF 4MWEA 2ES4A 1ZOSA 3LKDA 3MJDA 3KKMA 4N47A 4NPHA 3VH3A 2IP1A 4AI6A 2NWQA 4OSEA 4RGBA 5JYDA 4KQ9A 1X1TA 3DZ8A 5DGHA 3FHCB 3FMGA 2G70A 2DAPA 3IAM1 4QQFA 3SKYA 3TSCA 2EU8A 3CUYA 1EFUA 4BS9A 4CE6A 1M66A 2L82A 4H1UA 4S1VA 4D9MA 2AC2A 4HF7A 1SVWA 1T5OA 3IV6A 1KYVA 1KOGA 3PD1A 5CB0A 2IDKA 2SCUB 3HVIA 4OGWA 4D4KA 2X7HA 2OK7A 1V8DA 2XD9A 4ID3A 4JKYA 3GBPA 2NNWB 3PEVA 2WTXA 2YWXA 1KK3A 3F67A 4OBWA 5FWXA 4IIEA 5C32A 3T7IA 1KDZA 2XUHA 4CKCA 4RPLA 2ZRAA 2VYND 4XGNA 3PDUA 3FPEA 1DTEA 1OPXA 5JDIC 5C5IA 4FEGA 5JI3E 5H16A 3L0BA 2P3QA 2ZRIA 4I6JA 3RRXA 2HH9A 1QGDA 4R1LA 1N8KA 3KT0A 3SF8B 2BSQA 4L5CA 4XARA 2XOXA 2JBAB 2W2KA 4TTIA 3NO4A 3QE9Y 1IHDA 2GPYA 2OSVA 1N8NA 3IO3A 4RZSA 4BO8A 4ZQIA 3MSCA 3LU1A 5HEKA 5L3SA 2DRIA 1EP3B 5IT9A 2R8RA 3H13A 3T52A 2B36A 2BI4A 2P1ZA 2WAMA 1RZUA 5EIOA 2HCJB 3COWA 1NVVQ 4YCSA 1PK8A 1TIKA 1C30B 1K4KA 1W0KA 3CO5A 4MQ5A 3NV9A 5BN1A 5B5SA 4WZBE 1A8PA 1G8JA 2AS0A 1F6DA 5FPKA 2ECKA 2X23A 3HZZA 1SBIA 4PWZA 1HE5A 2V8BA 2YNMD 3LIPA 1X7HA 2WJHA 3A9WA 4X64B 6CHYA 5KWSA 4TL8A 3HK2A 2CUNA 4KC0A 1K86A 1XD9A 3L8GA 5C4MA 2R7AA 3FCAA 4I55F 4RL4A 4OQZA 1NBIA 2CFIA 5TQ2A 4OJKA 4TMTA 4JHXA 2IXGA 3HXMA 1RD4A 1WU8A 2W22A 3IELA 3P2OA 3LP6A 5LUBA 4YRIA 1W2GA 2NUAB 2PX0A 4B79A 4DL9A 1PT9A 4X85A 2PU7A 1V7PC 4RL6A 5BRAA 1P73A 3VVMA 3VZPA 2DFDA 3SM3A 2IH2A 1P3Y1 3GH1A 1ORVA 5ES4B 3BCHA 3NIDB 1EXVA 3A06A 1E7WA 1P5JA 3ZDXB 5KCZA 4P4UA 3JD2A 1WZCA 1BYUA 1XRLA 1JS1X 3CT4A 3LQ1A 4BTEA 4EUSA 5IBCA 3O8QB 2I62A 4YRPA 1HEIA 2I6SA 5ALIA 3ZZ0A 1GLVA 1O6BA 2PCJA 2QT1A 2RHTA 2IU6A 1IB6A 3G8DA 1ADJA 5BVGB 3KO8A 4ND1A 5EWJA 3SQMA 1I0IA 4FUQA 3S2FA 2VJDA 2D54A 5KIAA 4ALIA 3JZFA 4S1OA 4EQZA 3NTOA 3CB2A 1H2AS 2C31A 5HF5A 2P3LA 4O02B 3VGJA 5EE1A 1WY7A 4K6KA 1NMZA 3OFKA 3ECSA 1Z82A 3R4VA 1A9ZA 1MEJA 4EF6A 5K20A 1PNQA 4NLLA 3QK7A 1USWA 1PGJA 4V3CA 1IWBB 3EVFA 4WLEA 1OA0A 4PLWA 5D00A 3H83A 4PN3A 1F8FA 2F3SA 5HTKA 2FKNA 2D06A 4Z4EA 3C48A 2V74B 2LVBA 2HNKA 1HTWA 2QTBA 1KJ9A 2QTGA 2ZIFA 1P5ZB 2IBTA 1GEEA 1YRAA 3LT2A 1SKMA 1UT6A 2QM0A 4HQLA 2H1IA 4FILA 4IFEA 4IO0A 3D5EA 2Q3LA 4FCWA 4UBMA 2EKLA 2QUIA 1J4AA 1NY5A 2AMFA 1Z47A 2PMCA 3NGMA 4LVUA 1JLRA 4O4IF 5CUQA 2Y99A 1LD3A 3C3EA 4MV5A 1N77A 2QXTA 1E8MA 1ZY2A 2FSFA 4AJ2A 4C0LA 1GL7A 3M4YA 4Z1OA 3E9QA 5EL0A 4I46A 5JXIA 1V2GA 1C8VB 2J9GA 3DBHA 3KLBA 1S7GA 4M0FA 1NDQA 4IDEA 4UEOA 3JY6A 5JMPA 1M6HA 5EMHA 2BLNA 2VAVA 1I14A 1X8KA 2G63A 2JEYA 2OCKA 5I6DA 1E92A 1S89A 2X1HA 3CH5A 3ZE9A 4UUPA 2XNHA 2PX2A 1THMA 3CPJB 3LGXA 3R6TA 1WOYA 2H1LA 4FJ1A 4PPNA 4EJ2A 4B46A 4O08A 1PJQA 4RXTA 2XE6A 2DJ5A 4WJLA 4ZZ3A 3C5CA 1NP6A 1OC4A 3ZGVA 4YASA 3CE9A 1E6CA 3PD7A 1H5NA 1UQRA 5BN5B 1J2EA 1NBMA 1RIFA 2W0MA 5B1DA 1LUAA 1S2OA 2JLYA 4MS1B 5GONB 1KPIA 1R9NA 2JGIA 2Q5LA 4PZAA 2B5WA 3ZDBA 1CTQA 5HRCA 2EQBA 3DT8A 1IPFA 2JKZA 5L51A 3ZLJA 4C7JA 5AHRA 1FX0A 4B6RA 1C7QA 2YINC 1UANA 3OJXA 1C3OA 5DT9A 3OWHA 2YUIA 2ZRFA 2WSMA 3KXKA 5A5DA 2D0OB 2G77B 3PWSA 3NBMA 1R10A 4BB5A 1KO4A 5G3YA 8MHTA 4MUKA 2F1OA 2Z5FA 1MFZA 3CH4B 2WY2D 4AJOA 4FFLA 1GSHA 3IMEA 5KSYA 3SEZA 2B98A 2JGLA 3OH8A 4HAIA 4U9UA 5K0LA 4NPCA 5FNVF 3BH6A 5EY5B 5FAKA 1M1XB 1M34E 4LN1A 1A9YA 1LY1A 2F8TA 4QUDA 2UUPA 3FKQA 1FDUA 2Q5HA 3DEIA 1D1SA 3EZYA 1DAMA 4DKJA 1H3NA 5B3KA 3AETB 5CDGA 2GTIA 4FC6A 2ZUEA 3RARA 2ZETA 3AWIA 3WQHA 4B44A 4DV6B 5FI1B 3ILSA 4ZICA 3K8OE 4RY2A 5JFTA 2MSKA 1IUOA 2H2WA 1RJ9B 3J7TA 2AV6A 4GR4A 3BXPA 3IEIA 4CI0B 5DCUA 4X1KB 3MIZA 3WOVA 3C5HA 3QENA 1HYHA 4P38A 3CVVA 4R1SA 3FWHA 5EVJA 3IAM6 3H9CA 3RVJA 2WZCA 3CSDA 4CF6A 1OQAA 4KXVA 3DE2X 2QU8A 4UZSA 1IFXA 3OIDA 2YJTD 2VLIA 2ZBRA 3FOCA 5F2EA 5DBOA 3LY7A 1VYUA 4GMHA 4MVWA 5FWYB 3TAXA 4BB9A 4F86A 1LEHA 4O3FA 2JAHA 3EXHB 1A9XB 4CIXA 4DLYA 1DIRA 3R0XA 5IHXA 2UV8A 4K6FA 5IVPA 1NJ6A 2FFQA 2JFUA 2QQGA 5AHWA 3D31A 3MWDB 2ZAIA 5EQJB 4MWSA 4W7HA 5THQA 5LOVB 3UBTA 4Y6RA 4WLVA 1CNFA 2H1FA 3Q41A 3NDBB 4PNEA 1FU8A 3UWSA 3ONFA 5BORA 1T4CA 3D6VA 3AR9A 5AM5A 2ZVDA 1UEJA 1M1YE 4M0LA 3W06A 5CXQA 3TFWA 4B3CA 3HYSA 4N12A 3VDRA 5AI6A 5CM8B 4P08A 2PLFA 3VA7A 4DG9A 3JQQA 2Q6IA 4H7IA 3ZD8A 4QVGA 1M8KA 2BKEA 2CB9A 4GP7A 3EXG1 2E5WA 2WVJA 3P7MA 4ARUA 1H05A 4Z1MD 1NR7A 5K8VA 2P5UA 2A9KA 4R9NA 3WMXA 4ZYUA 2BYTA 1IC6A 2TRSB 1UJBA 4HLNA 1EUDB 2WJ6A 3FZEA 3OZBA 4UTPA 2G04A 2ZI3A 2K87A 2XYPA 3TLGA 2ZZMA 2ZTLA 3BXZA 1FK8A 1UFVA 2ZTUA 4R3UC 3IQEA 3ND7A 7REQA 5CDTA 4PNZA 3WL4A 1JG3A 1IOZA 4LWZA 5ARCA 5HMLA 3ZHTA 2ICAA 1GPAA 4JEUA 5NLLA 4LXXA 5HQ3B 4KJZA 1PJAA 1FCJA 2WLTA 3FMPB 4TQGA 5EE0A 3ROXA 3CEMA 1AGNA 4IRXA 2GFHA 1WB6A 3PL5A 1WPQA 5EERA 3TNLA 3C85A 2CUTA 3MGBA 3PFHA 4JVNA 1OBFO 3DO6A 4DY4A 2JFWA 5L95A 3OQ6A 2XDAA 4TRMA 3EZFA 4NOKA 2X9VA 3QMMA 3AUAA 3KOZA 1FYXA 3ED1A 4C3VA 4DSNA 2YIMA 2D0IA 3HKBA 3KZCA 2F6RA 1ENOA 2CLKB 2OXFA 3BWYA 4MUGA 2PMBA 5DYNA 5GOTA 4W1RA 4UQLA 2PZMA 3FFXA 1Z6PA 3WYAA 3DE4X 3GEIA 4BFUA 4EA6A 4AKHA 4WOJA 2ECOA 1G98A 2A0FA 2EBUA 1P77A 1X7YA 3O7MA 3EC2A 3IUMA 3OQIA 1RXWA 2ASEA 4Z7OB 5J4VA 3U4MA 4BNUA 4A26A 4LXHA 4XIIA 1C9DB 1V2HE 3WS7A 4ZGGA 4YHBA 2MIIA 2CFCA 3P0FA 2Z8YA 1T3TA 4N40A 4P82A 4XTCS 4F85A 3WBFA 1KNXA 4JIGA 4RYDA 5H1YA 4JI7B 3RIGA 2V58A 3EF0A 2AI1A 5TVGA 5EJEA 2H5JA 2RBGA 2ZB4A 1NGSA 1P8AA 3PTLA 2F7SA 1GY8A 1R6BX 3L7NA 4M0UA 5CJJA 3KB2A 1W88B 4G5FA 5L3RA 4QJ5A 3WLOA 2ZKIA 3K6JA 1CB0A 1OV4A 2X0DA 2QR3A 5DNCA 1Z6QA 3OEEA 4CKXA 1H5QA 1T3LA 4MCAA 1DFGA 2PJRA 1U0JA 2WDPA 1EFVA 2Q4EA 2LRHA 1BCSB 1MXFA 3Q9UA 2PEZA 4FFRA 4LHVA 1LB1B 4R8LA 4M9RA 3FFTA 3OLVA 4LE2A 5BT9A 4X7BA 1USUA 2WQ6A 4DRYA 4H3VA 1JPVA 1VP3A 5EMLA 2ZDQA 3FE2A 3R5HA 3K8ZA 2EZTA 2JD2A 3SX4A 3JR3A 3U5TA 5HF6A 4V0NA 1MF7A 3BK7A 3WGHA 4CBVA 1WD5A 4JOCA 3LWNA 1EFRA 1K27A 1NQOA 1RWOA 2IE0A 4M49A 4LC0A 5TT1A 1YZ3A 1CNMA 3BF8A 2B2XA 1BAPA 1G0NA 2QSYA 2WVGA 4CMIA 4ECEA 4G4SP 3R6DA 3OZDA 4P5PA 2Y71A 4U5XA 1W47A 4XLLA 1V4NA 3ZXSA 1NWHA 3KQVA 3KYDB 5LQJA 1Y8CA 1YZUA 3FJYA 3NHZA 4F60A 3EARA 3R9WA 1POXA 4HG2A 5IC6A 3V8QA 2EL7A 3I58A 1QQAA 3LT4A 2XXAA 4RPKA 5CD9A 2J4CA 3C7DB 1YRHA 2RBKA 2BDEA 3B3QA 4HNAA 1EM8B 2E4UA 4ZQHA 2RMKA 1GM5A 4JK3A 3I4CA 5HA5A 4EG7A 3AVXA 1A95A 2XSZA 2QDKA 1W4ZA 1AS3A 2JGKA 2WMYA 1VZ3A 2D74A 3CEPB 3O26A 4PCVA 3GLIE 4MAMA 4MUBA 3VC7A 3U3MA 3EVEA 1YFKA 3GFOA 2UYQA 2WI8A 4EHLA 1B1AA 1CETA 5H7XA 3I9NA 3JZIA 1GYQA 2NU6A 2IS1A 1KJQA 5KOJA 4MARA 4AKGA 3H8JA 4JR2A 1RXCA 1DEHA 1R64A 1VPLA 1VL0A 3EBOA 2YQ5A 4DJEC 1ISHA 3Q0EA 4F56A 4BTLA 3GDHA 3WLJA 3KOOA 4IW3B 5T4FA 5I5EA 3EG5A 2Q8QA 3D2CA 3H2KA 5IKPA 3CVJA 4EG4A 4R5MA 5KEIA 3HM2A 4WCVA 2IQIA 5LQNA 1ZGAA 2FPRA 2X4GA 4OEHA 5ESWA 2ZREA 4DRXA 1U3DA 4G4GA 5GZ1A 5KVCA 1C41A 4UVHA 1FU4A 4Y6SA 4IMRA 5HRAA 4F2HA 1F17A 4ND3A 1HT3A 4PSAA 2R2AA 3OUTA 3DM9B 4WN9A 2HU7A 3PDIA 1CY0A 1Z0ZA 1KZ7B 1XTZA 4G2NA 5A9SB 1QIEA 2JPDA 2GTHA 2FWMX 2R6HA 1EK0A 3C6XA 1PZMA 4LVCA 5BV2P 3T34A 3CNNA 1BYIA 1T3GA 5G4KB 5JNWA 3EGEA 4M36A 2P35A 4QU8A 3WGNA 4DEVA 4BJ5A 2BFFA 3AIKA 3QE0A 1GDDA 4MI3A 2XAUA 3R0VA 4B84A 2QUKA 3UH0A 4AB1A 4Z2AA 3HCOA 1U2PA 1CU1A 3RIXA 1DSSG 2C2HA 4U2DA 4UBKA 3BIWA 3TTVA 1RBYA 3E7WA 4TLBA 3H05A 1Z73A 5EIEA 1JA0A 1A82A 1OXBB 4BUJA 4TS3A 4KQMA 1TYAE 3OJ0A 1SUAA 3UOGA 3W8RA 4DIEA 2WIJA 5JBQA 2VNSA 4Y2RA 4M0PA 1TX4B 1EZ1A 1HOXA 2HMYB 1VIDA 2OBXA 1AA9A 3FSGD 5K7SA 1YZKA 2RI6A 5ES3A 3QKRB 4W99A 1YDFA 1HE1C 1WCYA 1UK7A 1VMIA 4XGQA 1PI3A 1U5BB 3ED5A 4GYWA 3MN1A 1GU0A 2HSDA 2OCLA 3OCZA 3M3DA 3K9QO 4PTYA 1FDOA 4C6RA 3IKTA 3OEHA 1MJFA 3TRHA 1LBEA 3GWZA 2MSDB 3IVCA 3LMKA 4DLUA 4HDSA 1P1KA 2HK8A 4LY3A 4OXXA 4UQPA 1SAYA 3I0MA 5JCZA 1CFZA 3CGWA 2WWWA 3GVHA 3QVGA 3LBAA 4MVJA 1V7CA 1QHIA 2PGAA 2QW8A 3BGSA 5CCDA 3VR2A 1PQUA 2H85A 5C52B 3BXEA 3QVUA 1JH9A 2VH2A 2C2BA 3ST7A 3I8OA 1BFKA 3EXAA 4G1MB 3JQBA 5HS4A 4BLOA 1R3DA 4HH3C 3WWYA 2BDUA 2C99A 2EGHA 2MJLA 3GT4A 4I7EA 5DXFA 2X6RA 3ENWA 3KTOA 1HM5A 4UCWA 2FF7A 3KKOA 3F1LA 3LTEA 3O31A 1NUSA 3GUYA 3ZWKA 4BN4A 3I2YX 3I3OA 2V5VA 3JASB 4LBVA 5AVXA 4WAUA 1NN5A 5IUKC 5DLQC 1AH2A 3KUDA 5H0IA 1I10A 1LDMA 4GQBA 1JMKC 1OFUX 4LDPA 4OP1A 1ORIA 3SN6A 4ZMSA 1Y4AE 2J7PA 4GSLA 4HCJA 1CNEA 4Q3CA 3RWBA 3X44A 1IJEA 4ZI2A 3OQBA 1FXSA 2P9HA 3O2QB 3AHEA 2ZBUA 1L7PA 3R0QA 3HCNA 4IWXA 4E51A 2E49A 3QF4A 2B4TO 1CT9A 4QEZA 4XWYA 3WL5A 3HDGA 4AX8A 3GDWA 4ER3A 1Y4DE 4DMLA 4K8RB 2VSYA 3TIGA 3N74A 2QSZA 4G5YA 2R47A 3ABQB 1R0KA 3L40A 1F6WA 2DFKB 2ZB8A 4RWEA 1NW3A 1ZWKA 3ENZA 1OX4A 2C5HA 3G5MA 2V65A 1ZN9A 4J43A 5EHZA 2BHLA 3D4IA 2ZSEA 1QB7A 4BJ3A 1C7IA 5C35A 3VOAA 1XTPA 2YS6A 1UWVA 2XMBA 1ZSVA 2QMUA 3EIUA 2PUJA 3ONEA 4OKIA 4W9RA 4XQGA 1F9AA 1ADBA 1D2EA 3K73O 1FZQA 5HKKA 3R2JA<