1NF9A

Crystal structure of phzd protein from pseudomonas aeruginosa
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
207
structure length
207
Chain Sequence
MSGIPEITAYPLPTAQQLPANLARWSLEPRRAVLLVHDMQRYFLRPLPESLRAGLVANAARLRRWCVEQGVQIAYTAQPGSMTEEQRGLLKDFWGPGMRASPADREVVEELAPGPDDWLLTKWRYSAFFHSDLLQRMRAAGRDQLVLCGVYAHVGVLISTVDAYSNDIQPFLVADAIADFSEAHHRMALEYAASRCAMVVTTDEVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phenazine biosynthesis protein phzD
publication title Structure and mechanism of Pseudomonas aeruginosa PhzD, an isochorismatase from the phenazine biosynthetic pathway
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 72
structure length 207
sequence length 207
ec nomenclature ec 3.3.2.15: Trans-2,3-dihydro-3-hydroxyanthranilic acid synthase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 1nf9A00
1NF8A 3EEFA 1X9GA 3O90A 3O91A 2FQ1A 1J2RA 2WTAA 3TB4A 3IRVA 1YZVA 2WT9A 3O94A 4L08A 3TXYA 3R77A 3O93A 1NBAA 4H17A 2A67A 3PL1A 3V8EA 3OT4A 3R2JA 1NF9A 2H0RA 4WH0A 3S2SA 1XN4A 3HU5A 3KL2A 3MCWA 1IM5A 4L07A 3O92A 3UAOA 3TG2A 3LQYA 3HB7A 3OQPA 4WGFA 1YACA 1ILWA 2B34A
chains in the Genus database with same CATH superfamily
4GOOD 4WT7A 2AOTA 1ZUHA 1LW6E 1KEVA 4WAUA 5KSZA 5I4KA 8ABPA 4P98A 3U6KA 1X2BA 2QZZA 1A5BB 4Q3KA 4E15A 2WYWA 1GGEA 1RWNA 4NOLA 4BNVA 1LZLA 3R7WB 1XEAA 3T38A 2MYPA 3Q5DA 2YBEA 3WLLA 3GN1A 1Z82A 3IJPA 3BILA 2JJ2D 4KB5A 1RWPA 1M8GA 4FKBA 5I7EA 1D04A 4PG8A 5JADA 2F1RA 1WD7A 1V1MB 5IAOA 1XJWA 1EUYA 1OPRA 3RSGA 3RU3A 3T3IA 1MO4A 3B13B 2FUKA 2JH3A 1W19A 1P6XA 3OX3A 3PFGA 3WTBA 1BXRA 3ESCA 1RWOA 2AI3A 2GDJA 2EJCA 3QG1A 4OA5A 3HBAA 1FMLA 4DMLA 5CFNA 1PJQA 1XG5A 3L8DA 3RUFA 3HC7A 4UMDA 3O75A 4HDOB 4NCIA 3K20A 5K3EA 4QPNA 2JH8A 5DEOA 4OO3A 4FMDF 4ROSA 1KNQA 1BN6A 4Z51A 1YT5A 4WCFA 5KTOA 3KYJB 5J2UA 3RRYA 4DR1B 4BV8A 2QQEA 4FZRA 4NBUA 4ZVVA 1I13A 2E6UX 2E55A 3ANSA 2PZGA 2QMEA 4J03A 4G0QA 1I2BA 1W96A 4HLNA 4M87A 1D8TA 5HUHA 3DKPA 2IHNA 5JJ5A 4NOKA 3RC3A 3AVYA 3TMYA 2WPNA 2QAGC 1D09A 3OM0A 4M99A 2EL9A 4IIDA 3PL5A 2FH5B 4QODA 5GWXA 2QZ4A 3RS0A 3QVLA 2A86A 1OT5A 1KI1A 1QIDA 2XZLA 2HJGA 1KPIA 2BBSA 3QUCA 5EGNA 2IUUA 1TQ2A 1H2BA 1M74A 3FOWA 3UK1A 1XRPA 2GXAA 2C3MA 5AIBA 3MRSA 3BIXA 3K94A 4YWHA 1E9SA 2GWHA 2WUDA 1WMDA 1BEEA 4BKRA 1NJ8A 3T5MA 1A9SA 1EDOA 1TMKA 2DPGA 2NT4A 2RGYA 5KBYA 3L7MA 3HI4A 4QTZA 4LMPA 4PZLA 3OMWA 5JBNA 1QPGA 4EUHA 2G76A 1QS0A 2H2IA 2QRGA 4Q9IA 3KR1A 1SU4A 3S7ZA 1ADFA 4GC5A 3NYQA 1H2RS 2D1TA 3FPFA 3PR3A 1OXXK 4XM2A 3T3OA 2H0RA 3FFTA 3CVOA 3AFMA 4P4LA 5F9HA 2J0UB 2H18A 1RAIA 1QG2A 4MVJM 4S05A 1D6MA 1QK5A 2BKAA 4RTSA 1O0SA 2IHUA 5HK8A 5BQ5A 3QKUA 5LU9A 5E3IA 4I8XA 4UEOA 4B3IA 1W35A 3U7HB 1LI5A 2VXCA 3ZDRA 3SHVA 3USCS 1G3UA 4U00A 3GFFA 1UOEA 1YDHA 2Q49A 4R40A 5HTKA 5IEBA 2ZZNA 3M2PA 1V8FA 4HTFB 4NENA 3TOVA 4O4LA 5KC8A 1TJPB 4WX2B 2BFMA 3QV1A 4LRWA 5CPBA 4M7WA 1Y48E 4RM2A 3U3JA 2RKOA 3FWKA 5LKAA 1KYVA 1LPOA 2VTBA 1O0BA 4F3CA 3ZHVA 3VSAA 2YV3A 4M49A 1AXRA 4OK6A 4LUCA 1L8OA 1QFSA 1RM5A 1T5LA 2YWJA 2C5HA 2EERA 2QRLA 3LYAA 3CF6R 3OFKA 4XEUA 3LX8A 4CBVA 5ESDA 3IBCA 3P8ZA 4HH4A 4ALMA 1WF3A 1EP9A 4Q39A 2ONZA 1UBHS 5HTOA 4B3GA 3JX9A 2C29D 3GH3A 3JQ6A 3SQMA 4N5IX 4CL3A 3WB9A 3LZ6A 2YRWA 3DGFC 1IFXA 4QGBA 4YALA 3GNQA 1NOKA 5AVYA 3JD0A 4PHHA 3FUTA 1ODCA 1U4NA 2VHCA 2R8OA 4XKJA 5JEEA 1SB9A 2G5TA 1CJVC 5IBRA 4ZKEA 1L7VC 2GBPA 5IJAA 1LV7A 3WNBA 1CV2A 2JCYA 2HZ7A 5BQPA 1N9GB 2F1KA 3RROA 1G2QA 4K40A 5I7SA 2CJYA 1E7MA 4QKQA 3JARB 2B4QA 3LGXA 3PSHA 4HQNA 3W5BA 5J2TA 5DM4A 3JWHA 5D7BA 3VHQA 3GAFA 1GYQA 2OCGA 3DFKA 3DLPX 3NHJA 3H2GA 3G9QA 1HZZC 4FXPA 1O6FA 4OJTA 1QG6A 4XEHA 3ZE2B 2EFYA 3SEAA 3KQHA 4DNXA 4FBLA 1SQSA 1RAGA 2OFXA 1G8PA 3EXG1 1AGXA 3M5DA 1O0CA 3CUTA 3PR2B 3ZUPA 1SKAA 2V7XA 3ZKAA 3KR9A 3LUKA 2V3WA 3D3WB 3MBKA 3AH8A 1WSDA 2GZ1A 1WMSA 2PA3A 2QV0A 2K4MA 3CH4B 1MC8A 3LDAA 5AI5A 5ALEA 5FOWA 4J3NA 3RTAA 4ZIRB 2PYZA 4DMGA 4ND2A 2J31A 1FRNA 4TS9A 2J32A 1R4MB 5H7XA 4Q7QA 1L1FA 1B16A 3IEKA 5CMLA 1ABBA 1GAJA 4RYLA 5ITWA 4R8MA 1DDIA 1QBKC 3OIVA 1L7OA 4RSRA 4UULA 4PTLA 5KMGA 3RVMA 4RZSA 3OY7A 3ICPA 3JCZA 3RUIA 5EJ5A 2J8ZA 4J3FA 3ZNOA 1P8AA 2EYQA 3WBKA 3ONVA 4HADA 2R8YA 3HVJA 3I9LA 4RPJA 4XGKA 2BYTA 1YWGO 2FW6A 4L8WB 1HDRA 2O8VA 2OGWA 1QFZA 4MDYA 1KS9A 5GY7A 3GT3A 3U4AA 4KN6A 4F9FA 3J7TA 3Q72A 4LJ6A 4YLGA 5F1YA 1DB3A 4BNGA 3PR1A 4DCSA 1KZ9A 3OM8A 4RF4A 5GIPE 1L7RA 1FS5A 1TW3A 3AUKA 3EIFA 1U3UA 1NVGA 4JEUA 2H9IA 3WO0A 3JATA 5K0ZA 1XMXA 2FSSA 4PZ9A 5CBPA 4YJ2A 3HCWA 2W2QA 4Q3CA 5F98A 2X42A 2JFWA 1I0ZA 1P80A 2PZ8A 4DR6B 3WMWA 3L4JA 2Y0BA 1R74A 4X6YA 1E5VA 4QUHA 1HDGO 5EE3A 4HJRA 4YT4A 3G79A 3VNBA 5CK4A 1E64A 1QVAA 1IWOA 1P9RA 4YCBA 4CG0A 5I8PA 3ZY3A 4LE2A 4CKBB 2I80A 3D43A 2OHHA 1TAGA 2J87A 3ZQKA 1C3XA 1QFYA 3V1NA 3HB7A 4Q4JB 1ZFNA 3F78A 4F2HA 3L92A 1UWLA 2B7CA 3HV2A 3OIUA 5P21A 3DHNA 4FZVA 3FTQA 3CMMA 5TLSA 2NO5A 2K7FA 1Z62A 4X91A 4KCGA 3N86A 1ZGAA 2D62A 2H11A 4QOGA 4Q19A 1UPUA 4NCHA 1BFUA 3UXMA 4ACBA 3U7GA 3UOAB 5CNMA 5FTWA 4UU0A 3N6VA 1NT4A 1EFPA 4JBXA 5DXAA 1YFKA 1ZIXA 1VIYA 3JWJA 4ZI2A 2PA0A 3TXYA 4C5BA 1JPUA 3IP9A 5EKXA 1ECLA 1NX6A 1Q0PA 1OBCA 3EGIA 3MJRA 4O33A 4DA8A 1H6CA 2XTMA 2ACVA 3OA0A 5DM0A 4FU0A 3FZNA 4AMUA 4BB6A 1ZP6A 3MJCA 3FRJA 5KQMA 4J75A 5CH3A 2KI5A 2B34A 4GF5A 3CRMA 4MRAA 1EFCA 1US8B 1DCFA 1SULA 3IIMA 1X9GA 3FPCA 1XKTA 4D46A 3R7WA 1H5QA 4JQCA 5C37A 1ID8A 1R9NA 2F64A 2ZBEA 1UUFA 4G65A 3GJ6A 4IRMA 2Y3IA 1T2DA 4K05A 3GRRA 5DTRA 3TCNA 3UG7A 3FF1A 3EPJA 1C30B 2HHAA 1P0IA 1Z75A 1V1MA 2QQ5A 3PC3A 16PKA 3K9GA 4H7IA 3T3MB 1YL5A 1ESNA 1OROA 3B9BA 2PANA 2I76A 3DF9A 3H6KA 2AMJA 3MWGA 1P7VA 3OUTA 4HMQA 4IGFA 4V0KA 4CMIB 4Z99A 2ONKA 4H59A 3E3MA 4YY3B 4IAOA 2IHBA 5BQ3A 1IVSA 2GDZA 5HZGA 3ICOA 1SD5A 1HX7A 2QRKA 3G0OA 3EMVA 4KN5A 2WWVD 4HB2A 1R2QA 1F1BA 1C81A 2D54A 2O4UX 3CEHA 4FE4A 5COBA 5TT1A 4LMAA 4ANFA 2I03A 1BH6A 3K9HA 3VH1A 3T3NA 2P8SA 4GDFA 1QUFA 2CDAA 5LNK1 1Q95A 2Z56A 4AVYA 1R50A 1ZKDA 3UA4A 1D9XA 2EKQA 3Q7EA 4KKXB 2CD9A 1TQDA 2RJOA 5FNVB 3I72A 1RAFA 5D6NA 4BNHA 1DQZA 2DYKA 3AO0B 1KMIY 1NI5A 2AG6A 4NK5A 3WXMA 3GQVA 5DI9A 4KXFB 2QX6A 3HSYA 4YMIA 2JBAA 5JJBA 2Z6AA 4RH1A 3SM3A 4YTEA 5AQEA 1YR6A 3UMCA 3ICEA 2G70A 5KPJA 1V9SA 4CMEA 3BTVA 1M66A 2I6GA 1FPQA 3SZMA 4N6NA 5JS6A 1HDCA 1Y3BE 2G28A 2NVWA 1DG9A 3OIYA 3RK0A 4ASUD 1HT2E 3OCVA 2WJ4A 5AUPB 2IVFA 2OHOA 2JRLA 2R6DA 5D5HA 4ZAGA 4AI6A 2I3ZA 4YAKA 4C89A 3O8RA 2AKEA 3GJZA 4IYRA 1E6EA 2BFWA 1FL9A 2R6CA 3UFBA 5JSHA 1VHWA 1YQWA 3HNPA 1N0WA 2PPLA 2F4NA 5C2JB 4JI2B 4FZ5A 5DM60 3M7IA 3N2NA 4FEEA 3OJWA 3CX7A 4V24A 3AM3A 1TEXA 1U2TA 2NX2A 4IXNA 4YUYA 1QKKA 3RFVA 1QHXA 1D6NA 5FH9A 1Y37A 3I01M 2OM2A 3AP1A 1PV2A 2J0UA 3Q7SA 4H1VA 4Y6GB 2P2ZA 2IPAB 1PWXA 2PBRA 3TLXA 4IGEA 4HYYA 2VYVA 1BSVA 2GILA 5E4YA 4Y7CA 4D9HA 5B7PA 1T9GS 1XBTA 4JXKA 4YO7A 3R09A 2XIQA 3HSKA 3PHGA 3ZWXA 1QYIA 1UKVY 3DEAA 4PGGA 3KHSA 4JFRA 3ZH9B 3R5KA 4HTFA 1GUYA 4ZT2A 4D8YA 3W3ZB 4AXBA 2C2KA 4F5WA 5JY1A 1P0PA 2RIRA 1EYZA 3A6GA 2RI0A 3Q3JB 4IZ6A 4KODA 4WRRA 2NUBA 4YASA 4BFSA 1Z13A 2XE7A 4PLFA 3IDSA 3DKRA 4TLAA 5CITA 1SCJA 1XLTA 2QL7A 4HDSA 3O8DA 4DMFA 2C1ZA 3AJRA 5CVDA 4FQ7A 3VPAA 2Y4OA 5B6IA 3COWA 1ATZA 1T1EA 3WKAA 4BDTA 4BX2A 4EG7A 1E9BA 1HEYA 4RH3A 1MA3A 4Y67A 4MKIA 5DMXA 4MITA 2PV7A 1TPZA 4ROTA 4J6FA 2PKEA 3A4NA 4AMZA 1ZJ6A 1FW8A 1B2RA 2L18A 2ZJ1A 5TARA 2C3UA 3DZCA 3QI2A 4KQKA 4G0UA 2CXTA 3G9ZA 3U3MA 1E7SA 1EDDA 3J81k 1PR0A 1AF7A 2QP9X 1ISIA 3QELB 2RIPA 3LYHA 1YDWA 3DOEA 3EGXB 4ZI7F 3WL7A 1ZONA 2ZRAA 1DQNA 5IDYA 1N9GA 2OLEA 1QUEA 1AKEA 1VBFA 2RHCA 1HL7A 3VC1A 1EHYA 2FZCA 3T5DA 1GD1O 2YXEA 4XQ9A 1ZOIA 3JARA 2RCYA 3KTOA 2A9VA 4GMDA 2PZFA 4OMCA 5EE5B 1G66A 4WDQA 3HYNA 2PGDA 4AKEA 4HDMB 2Q0XA 2H4XA 2TMKA 5SZJA 1OU4A 2H1OA 5KOYA 3CPHA 2VJCA 3KM0A 5CCXA 5GOTA 3P0IA 4UFNA 5IVIA 4EG4A 1KORA 2NUTB 4Q3AA 5K3BA 5BSFA 4GYKA 4EKGA 3V42A 4HN4B 1V35A 4B3TB 2XZTA 3D7RA 5CYPA 4GWLA 3GZNB 1BE6A 1CR4A 1CKEA 3BVPA 5JTUA 1KQOA 2IPXA 1OH5A 3D3WA 3GDFA 4BLWA 3I32A 4YDSA 3HXOA 3D9QX 4Y9TA 3AK4A 1J5XA 3BSYA 1Z18A 2G06A 3DEFA 4NCJA 4CM1A 4ZIRA 1E9VA 1WKVA 3DVQX 1Y7PA 3HL0A 1R4MA 1P18A 1JSLA 4HX2A 3HH8A 3GVXA 3T7TA 1LBHA 5B1SA 1JQBA 2G1AA 1L4HA 4Z4HA 2OXEA 2OWDA 4R5HA 4A8HA 3T4PA 3E5RA 4LHXA 4GPZA 4KNVA 3RSLA 1G9XA 1QO0D 3EF3A 4I1IA 2H63A 1BE0A 2ODQA 3ORQA 3OWOA 1OZFA 4OI0A 2HEIA 4F1JA 3MRTA 2FOLA 3DTVA 1ORRA 4Q02A 5D86A 1FLVA 2OUKA 4DV3B 3AI7A 4GWGA 3FPKA 4Q5IA 1Y5RA 3R0ZA 2HOQA 5TPWB 3K0SA 4Z1MD 1ZU5A 3PD0A 5E38A 5LQNA 3AF1A 4Y30A 1AQNA 2UKDA 5CVUA 1TQ8A 4JENA 4KO2S 5KYXB 3B3AA 3IVMA 5CJPA 3K3PA 5IS2A 1I7LA 1YZKA 1M2NA 3ZEIA 4AD8A 4EPYA 3SLKA 5A2GA 1DAHA 5CK5A 3LW8A 3MAAC 1FFYA 3A70A 4Z4QA 1J2TA 1BQEA 4AO6A 1DKPA 3L0BA 3NHBA 2VPYA 1GTVA 1GSAA 3GUVA 4QDKA 5TS2A 2BJVA 3A4IA 3AEXA 1CFJA 3HLTA 5J5VA 3G8BA 5ILOA 1GRCA 4AKIA 3L6UA 1EX7A 4YRQA 3SSNA 2XCRB 2VQEB 2D5CA 1D4AA 3DMGA 2HA6A 4YUXA 5CFMA 4IOLA 3ONDA 4AU1A 1YQUA 1N2CB 3LBNA 1UEIA 4KI7A 4Q12A 4D5GA 2C77A 3BREA 3F47A 1LB1B 3OMLA 3VAYA 1X8JA 1SZJG 3P0FA 5IJ0B 2O8EA 2XT9A 3JYPA 4FYPA 4ZDJA 3AB7A 2AE1A 3AJ9A 3AM4A 3DCNA 3VYVA 2WJPA 1T8SA 1ULAA 2GKOA 1K8QA 2J3MA 1DKRA 3SE0A 5CFZA 5IUNC 2IOQA 5JCPA 1E8DA 1M33A 1K5DA 1O9HA 2RD2A 1H2XA 1OA0A 4F46A 5I7VA 3IAUA 3O93A 3IMCA 2J9XB 1SMKA 2ZI6A 4P4SA 4DV0B 1WMFA 1ZLYA 4P7JA 5IYZB 5C7LO 4UCWA 3VNQA 1E5TA 2V98A 4HAWA 4EY5A 2YXLA 1SBZA 2ZJ6A 4WEQA 1V7CA 2J3LA 2OCBA 2P4UA 2O9JA 2UUOA 4MJ3A 1POWA 2ZWAA 2VWGA 5JDCC 1NSYA 4KLRA 2ZXUA 3QEBZ 1DXOA 1C30A 1RBQA 1SPXA 1Y1LA 4CODB 1I2MA 1MAAA 3HJBA 5K03A 2QX7A 4BHTA 4A8PA 1J70A 4IHQA 1UODA 4CIVA 4CMIA 1SNYA 1QV9A 4D3DA 2BKLA 2YIMA 4CG1A 2Q3JA 3IVXA 2BHRA 3HGQA 4NPAA 5EVCA 3F73A 1JI0A 1X3LA 4A1OA 2P68A 5CDFA 2R1TA 3LPLA 3QE2A 2FSPA 2QEQA 3FMFA 5ESWA 5K8CA 4XGQA 4M8LA 4GKAA 5AKEA 3A1FA 2HK6A 4IXTA 1WDTA 1IXZA 4HGYA 4IIBA 5BR4A 1WVIA 2P2LA 3MS2A 4KZKA 1GPKA 4MW2A 4K86A 1UOOA 3S70A 8OHMA 1PK7A 3TZEA 1ZN9A 1CULC 3L7DA 5G1OA 2JK0A 3NTQA 2XY4A 2R6ZA 5AHRA 1M75A 1QGOA 2A14A 2R84A 3W8RA 3A6FA 1OA1A 1QVRA 5FDFA 1C0LA 1EFVB 2BGNA 4CF6A 5AW0A 3I61A 1WETA 5FBLB 3ZDCA 1RPZA 1KR2A 3K31A 2ARKA 3A9TA 3NR2A 3GAMA 3ZTYA 1NPDA 4AJ4A 2PGAA 2ZUUA 1QO0A 3IOCA 4CF5A 2VATA 4LJYA 5JCJA 4E5YA 4B3RB 3MT9A 2ZYAA 4IXDA 3MD0A 1XTKA 1NMEA 1X15A 1X7ZB 1G0NA 1TJYA 2RG1A 4J0QA 4KDRA 4M0PA 4OAQA 4BMZA 4E4YA 4AQYB 3VPXA 4IMPA 3NMUF 5DWQA 1JA0A 2HU7A 4XXHA 2AWNA 4Z1MA 3CG4A 2OVBA 4D25A 5FTNA 2EC5A 5HKAA 2ADFA 3D6TB 4M4SA 3TJZA 3IJRA 3PQ4A 1T2VA 5DBFA 5JQGB 3QWBA 3ND6A 4RK1A 5KB3A 5HZMA 4IJWA 4WNIA 2IS2A 1YB2A 3GX1A 2Z1NA 3EHEA 4QEZA 3U44B 1DOAA 2LBPA 4JZKA 3IKVA 4L78A 1R3DA 1XTIA 5HF9A 4UJ5A 2NQ2C 5IKOA 4AG6A 4HQRA 2QMUA 5L7WA 4EHDA 4BP8A 5EZYF 1GRRA 2ZSAA 4CEHA 2ZYTX 2GZAA 4HGRA 2YWFA 3MIZA 4ZCIA 1NY5A 3WDSA 5JV5A 3Q6IA 5FKJA 1U0JA 1QH8B 4MR8B 4A23A 4D4KA 2VZ8A 1EP3B 3TM5A 2FPGB 4QBKA 1FVFA 2VBFA 5CX4A 1NIPA 3T5CA 1S3GA 4MS3B 5C4GB 4BIIA 5IMSA 2M98A 5INTA 1W2HA 3C43A 2UXCB 5EXDA 1BWSA 1RRKA 2CNNA 1T5OA 3AI3A 3G5MA 3I34X 4JAVC 5DLDA 2FDCA 1T9AA 3VPCA 1KS2A 3K4HA 3RNLA 1CS0B 1RYFA 2ERXA 2AT1A 1OBVA 3DAOA 3SI7A 4DLRA 1A5AB 2DBVO 3DDWA 3NS7A 4GM4A 1Y81A 4XLTA 4B31A 3SR3A 1GAEO 2GCIA 3T6KA 1U2SA 1ZBQA 3W1EA 1EUQA 3LPNA 4X1YA 4H0NA 5JNVA 2PX8A 2W98A 3QFTA 3PKJA 1POXA 3A25A 5TMPA 1LK7A 3RUHA 4LRTB 2ORWA 3TM4A 3QBJA 3CKYA 5KS2A 5C8DA 3QWHA 3BXPA 3PQ8A 1P2TA 1XHEA 5EWMB 3U2QA 4KPEC 1S3FA 2JARA 4MZXA 1GL3A 2ZTLA 3IDZA 2BFDB 4FIDA 4C4SA 5DHAA 3OIWA 4GL4A 2ZI9A 1IDN1 1RRVA 5ECDA 4LC9A 3WYAA 3C45A 5L4LA 1LLDA 3OM1A 4TXHA 3K6RA 2F62A 1UT5A 4OTZA 3N0WA 2OBBA 3GZNA 3F67A 1HEIA 1I80A 1OJLA 3ZHOA 4AUMA 3UTCA 1SCQA 4GI2A 3ZGYA 5KNCA 1IWBB 3Q11A 4H7FA 4Y9DA 4ZV4A 3WLFA 1D4OA 5KYVA 2ETXA 5H9WA 1DMRA 1RXCA 3CUEF 2SKDA 1I3OA 2OESA 2QU7A 2M2IA 2ZT5A 4K46A 1BHSA 4LQ4A 1K5GA 4O5OA 1WW8A 1ODFA 2CSXA 2H48A 2I34A 2YVLA 4C30A 3CO0S 3RNOA 4BUZA 1W76A 1JZSA 2IH2A 2ZAGA 2JAQA 4G4SP 3VDXA 4YS6A 4DXDA 2XGGA 2W93A 2ZPUA 4OMUA 5JLAA 5KKAA 1WVGA 1R64A 5JVDF 5DLYA 4KBYA 1HFJA 3FNRA 2PMWB 4GEKA 3OY2A 5F12A 3ADCA 4EATA 2R7MA 5IX8A 2XB8A 3DDSA 4CMBA 5KYXA 3K1JA 1JFTA 5ETJA 3JQFA 2HHHB 1XCLA 1L4YA 3ECSA 1N7IA 3JQ7B 1RQ2A 4YV2A 4Y6PA 1VMDA 2QD2A 1HE1C 4JVLA 1SG0A 1K3UB 1U2EA 1FX0A 3QBEA 3QKIA 3UJPA 2A33A 1X1RA 2PSHA 3MUOA 1A4UA 1NUSA 1J2JA 3DO8A 3ADKA 2R9VA 2WOJA 3LA6A 3OZBA 4GWKA 2OQVA 3UAZA 2WWWA 3FJ1A 4I4CA 2WHXA 1H5NA 4WBXC 3P19A 4XFKA 5SV2A 3TIIA 2OENG 5EP3A 4J1QA 3G59A 4PRZA 4TTIA 2IL1A 1G291 2OHXA 1VP9A 2SNIE 4UE2A 1BXGA 3T7DA 5I9IA 2RHWA 4B4WA 3V8QA 1N2CA 2ATEA 4ALJA 2A9PA 1GZSA 2XTNA 4OQZA 4RELA 3ER6A 1SHZA 5HG0A 3ZNQA 4EBBA 2YHIB 2CY0A 1QH0A 1S5PA 4DQXA 2W6MA 3FNBA 2P2YA 4O4IF 5IJ0A 4DJAA 3LLMA 3IE1A 1ZICA 3WWOA 1AHHA 1KFKB 3C24A 3GLIB 3RJMA 1TTHA 3AM1A 1U7OA 3JAWB 4AB1A 1ZMBA 3GR6A 3FKQA 1U2DC 2BHSA 2J41A 4C7BA 3GYBA 1PYGA 5A2QA 5A4IS 2PPVA 5KOIA 4PVDA 4ND8A 2C5SA 2V6MA 2ESRA 3Q0IA 1TZCA 1FB5A 4ZQGA 3VFDA 1DC3A 3IR6A 3L0DA 4GKBA 4ZVNA 1LQTA 4F0JA 2XCOA 5EZSA 2H4JA 4FN4A 3W8FA 7MDHA 1CJUC 2OQIA 1TCVA 4QDJA 5HILA 3PX3A 1FTNA 1GWNA 2GYUA 5K0BA 1YNSA 5EE1A 1OIXA 1KHHA 1WQ1R 5K99A 1U7PA 5BMVB 1PKXA 3AKEA 4FYHA 3S2EA 3KAPA 3W79A 3X2EA 4F6RB 4CIBA 4WLNA 4KFCA 3W6PA 3ZLUA 2W2LD 4MQEB 2ETVA 2G7MC 2RI6A 4Q9NA 1GPMA 4LYDA 4QLOA 5ALOA 2DBRA 2QVGA 2TRSB 1XAJA 1JHOA 1QCYA 1CUCA 1JG1A 2ZKLA 3RSFA 4Y6LA 3GF4A 3V00A 3BDAA 3MYRA 3G7NA 3PD1A 2O6LA 2ZRCA 1MZVA 2FMTA 1VSUA 2AZDA 4NXNB 1DXQA 3I8XA 4NEQA 1C7EA 3MLBA 5WRFA 1M1UA 4XR9A 2FOXA 3TIXB 4C06A 5FV4A 4ZDWA 5IXYA 3PT9A 3CIFA 1KEKA 3PGJA 4R69A 4TMKA 5MHTA 2Q50A 3HDHA 5B57C 5A4KA 1JNYA 1O96B 2QAGA 3ZI4A 2P4SA 5E3JA 2ORYA 4JSTA 3NKLA 4M76B 1KERA 1EFVA 2XQGA 3H9EO 3QX8A 2I2FA 3IBFA 5K8TA 1YAHA 3KB2A 2NO9A 4QLAA 1FU4A 1XF9A 4AJOA 4BMCA 1YS1X 2GHRA 4FFBB 2YVKA 2R25B 3F4LA 3EXHC 5JO0A 2CLMB 1AC5A 3O94A 1WU7A 4TLLB 1PSDA 1WMEA 1NU8A 1X7ZA 2ZRBA 1SWVA 2FEAA 4JLKA 4EI8A 1ZOPA 1MTZA 4ALLA 4GPD1 1DC5A 1DIAA 3BC1A 5T6MA 1ONSA 5JCZA 5AJTA 2A8YA 1T36B 2XCIA 2D1SA 2NU7A 1SOVA 4L4SA 2X2OA 4EZIA 3MA0A 4QGAA 1O1YA 4R5MA 1J8QA 1QYWA 5JQGA 1VCNA 1U11A 3BXEA 4FYYA 4IDHA 2X0NA 4XI9A 1NSTA 3TSYA 3R40A 1YRWA 2R7NA 2Q2QA 1VKJA 1HDZA 2QSJA 2Q9AA 3BWYA 5LLDA 4BMYA 4W7HA 2RBEA 1E7RA 3RASA 4ZAYA 4MEBA 1IUOA 1GLNA 1T2AA 2CFTA 4ZPXA 3ZDFA 2XMPA 2GD1O 4I0WB 4HS9A 4U8HA 4WZZA 3E22A 4EPXA 2FY8A 1R0WA 4ZI5A 2NGRA 3WQBA 2HB6A 1YA6A 1QH8A 3QPAA 4MR8A 3UFXB 1RHMA 4NEHB 3RC1A 2FPGA 3ZH2A 5EMKA 3H4VA 1J8FA 2FPUA 4MS3A 5AKLA 2EZ8A 2OGZA 1Z37A 3QXXA 5ILQA 3C8HA 4HCJA 3FMOB 2UXDB 2J59A 4D4GA 3X3HA 1OZAA 4A36A 1AS2A 2VF5X 4A0FA 4DZRA 2W2XA 4U2DA 1QG0A 2FWPA 2XMSA 1BYUA 4B09A 2YRXA 4DGQA 1T9ZA 3E7FA 2EJTA 1GNQA 2FPKA 1DAKA 5GVRA 3ZCSA 4HZIA 3VYSB 4LAFA 4RW0A 4FONA 4N41A 4FZJA 9LDTA 2QVCA 3U4IA 2H00A 4YGYA 3ZS8A 1GN8A 1LDYA 5FD8A 3ZV7A 3I23A 1A2BA 3KKZA 1G4UR 1CC1S 1UPFA 3P9SA 5G0TA 3RI3A 1TUBB 4POAA 1EWQA 3D3JA 5E2IA 4NS4A 5CP8A 1FJXA 5KYUA 3M34A 3KALA 5EWMA 1XALA 1WUKS 1UWVA 2BFDA 2O0JA 1KR5A 3EZNA 3C3YA 3LC1O 3Q8KA 1OX5A 3FGNA 1JMYA 1ORVA 3M81A 4DJ5X 1HZZA 1XJCA 2W2LA 5JO9A 3HTXA 1T5SA 1NUTA 4V0SA 2HMWA 3IUEA 3VH2A 5LUBA 5LYYA 1WPXA 2WAAA 1IIBA 2G6TA 3C5WP 1PR4A 3IUNA 2NU9B 4YFVA 2ABWA 3QVGB 2WM2A 3K35A 3RC2A 3JQDA 2QXTA 5MFPA 2AN3A 2ISSD 2OBFA 2C9ZA 1ZM2A 1PL7A 1UAYA 2Y6UA 3E5NA 3QGMA 4FGUA 4D8UA 4U3JA 3GHHA 4MW5A 3JVIA 4LC1A 5A7GA 1X2EA 3MD9A 5TDHA 2UYOA 3PXCX 4ZT4A 4C2BA 4B45A 4MW1A 2G4LA 4OYYA 2NU6B 1TCCA 2FP4B 2FZWA 4ERNA 2W43A 3OF5A 3ROPA 1MB4A 1KBZA 5IAKA 3DYVA 1NW9B 5IK2D 4XWYA 2J9ZB 2Q2OA 2VNIA 2QTCA 2ZRKA 4FWBA 4M89A 4PAGA 2QTVB 4OLFA 2HA7A 2B83A 1CUHA 1K7SN 3CZ5A 4WJKB 4AP5A 4AXXA 1BFDA 1JXQA 1UJ5A 2I7DA 3KUCA 4QXAA 3V1YA 1AUQA 4L16A 3FMPB 2AUMA 5JAPA 3RT9A 3BPSA 5JNLA 3B7GA 1E2GA 3JQ7A 1PZXA 1IN7A 1UPTA 2GASA 3Q3GE 4S3MA 3P5BA 4XW2A 4YV1A 5EVJA 3TKYA 1K75A 5JNUA 2JKVA 2XRZA 5DISB 2W6ID 2PXCA 4RSHA 3U3XA 3A36A 3PQDA 4WXPA 1DKLA 4ZPJA 3DTYA 3FGPA 5DBIA 3NETA 3TD6A 4EJSC 9MHTA 2RHMA 3KYCB 3PE6A 4J94A 2WKWA 4K87A 5B7NA 3BFVA 4BZXA 3STXA 3RSZA 2XYQA 3CRW1 2KSQA 1U8YA 1XTVA 5DNAA 1SEVA 1RWVA 2OECA 4LFBB 4XLLA 2QN8A 1ZQ9A 5GJBA 2MR5A 1PE0A 3EB9A 5GM2A 1YRQA 2P91A 4EW1A 3T1HB 2YHIA 2MJLA 2E49A 4NBTA 1BVRA 3UM9A 5AVWA 3FX2A 1EVEA 2JIDA 3R1IA 4MPTA 5HNKA 2H4YA 2QMHA 1CJKC 3W06A 3TLMA 1GFSA 1XB2A 3JAWA 5LWHA 3PC8C 5TJHA 1K3FA 1K86A 4WZ6A 1TTQB 4UFOA 3DFIA 4OB6A 4Y6OA 3T7RA 4DLBA 4YRGA 2GLUA 4JUIA 1BX0A 2G4VA 3GLUA 4GFDA 1NRXA 1GDTA 1RI4A 2O1SA 4ZC8A 1PG0A 4EF4A 4V39A 1XZNA 4MP8A 5EHXA 1KJJA 1NR1A 1YS6A 1K7XB 5DNVA 1EFTA 1ENYA 2Z1MA 3OKFA 1LUAA 1N78A 1T9BA 3R9KA 2IPLA 4OCZA 2K6GA 3NDJA 2HDOA 2WWYA 3NWBA 2NOAA 3GMSA 1Y9JA 5FQNA 3GCDA 4DF3A 3BRSA 1AY0A 1NKTA 2YY5A 4MS1B 4PRKA 4WXEA 5BMVA 3DDNA 1WL8A 2WU1A 5HS6A 1H93A 2WJ3A 3H3XA 2A1TS 3MJSA 2O2JA 4FMPA 4NAHA 4MQEA 4QUKA 3WHPA 4CMKA 5JAUA 2VK1A 4RA9B 3PEWA 1GCUA 1DEKA 5JECA 4HI0E 1N0IA 1KEEB 2P90A 4L15A 1M34B 4OHPA 2IW3A 4QWMA 5JZOA 10MHA 3ZWNA 2EF0A 3A7DA 2RGUA 3GP8A 1RTKA 3M5PA 2QN1A 4J1SA 1JTEA 4OX9B 2M1ZA 4M9XA 2OFFA 2PMCA 5GONF 4XCVA 2ATIA 4HXYA 5HJ2A 4JVOA 2O5RA 1ODIA 2YWHA 1CLUA 2XT6A 4L4XA 3LK7A 4R1SA 2GEVA 3GJ3A 1X70A 3EVGA 3DMNA 2GI4A 3UJBA 1M2FA 1RW4A 2IIBA 2R1VB 3UIEA 1QRDA 1U6IA 4EK9A 3JD3A 1O7JA 3NHLA 4L6IA 4WZBA 4FFBA 5KVSA 4JA2A 4HGPA 3T1QA 1SXQA 5IK2A 1OFVA 4JT4A 1DJOA 1XVLA 2EJVA 3OFVA 5I9MA 4KQ9A 1QG4A 4PPGA 1F2DA 3EY9A 4XUEA 5K0JA 4DLUA 2GBCA 1PS8A 2ZITA 1TA0A 5L95A 5ALIA 1E6MA 2BJHA 5F3DA 4WY8A 3AZOA 1WB9A 1EFUA 4URYR 1XVVA 1P1FA 1OYYA 2H1VA 2JJYA 2QJFA 2R4TA 1W0CA 1A9PA 1WP9A 4ZU3A 4EZBA 4XA8A 1VOTA 3NIWA 3O92A 1I33A 3MWLA 4RFSB 7ABPA 4MAFA 1A71A 4NP6A 2QDXA 1PT5A 1WZIA 3K0BA 1ZD5A 2ZCUA 1SJ9A 3KQPA 5I9NA 1CY8A 4DCGA 1KFBB 3EDOA 1JKFA 3I1JA 4XD7D 4ZT7A 2QPTA 1APBA 1EB9A 2AN1A 2BM8A 3KSDO 2WU8A 2DRIA 1PUJA 3LRPA 1OFIA 3UFXA 1DJLA 2Q4OA 3JQRA 3DVAB 2CE7A 1E1LA 4CCSA 2W4MA 4DE5A 1WVMA 2HLDD 3KLNA 4CEIA 1U0SY 4C0SA 4EKNB 4EHHA 3AL0C 4TT3D 2QTBA 3L2OB 3C8ZA 1OQAA 2C88A 3GLHB 4ND4A 2VJYA 3TFWA 2BE7A 4OU5A 2EYUA 2RC6A 1J8VA 4MGEA 4BFTA 2JHFA 3LOUA 2DC1A 4TUYB 2WHPB 2HAEA 4N39A 2GPSA 2P40A 4RJIA 1VCMA 5B7QA 1HTBA 1RWXA 1E8MA 1UIMA 4RGBA 1EH5A 1KVUA 2VYFA 2NYRA 3JXEA 1XQ9A 2WUFA 4B35A 2W2NA 4BFUA 3HWX1 5ICEA 4LJRA 1TUBA 3PE3A 4MGYR 4ZCMA 1VZ3A 4YA6A 2DHCA 3JRNA 3H86A 3WGNA 3QFRA 2HV8A 4EG8A 4F6LA 2BOVA 3TQRA 3WL8A 2GEKA 2J9GA 2ADMA 2JGLA 1RYEA 1AU9A 1V5IA 4P81A 3NFRA 4UVEA 4IL5A 1XIVA 1Y9EA 1OYWA 2VJAA 3H2IA 4MPDA 1TYDE 4B71A 1Q57A 2A0WA 2DT5A 2PLAA 4WUTA 5AKZA 4YRAA 4RTMA 2CCJA 3CW9A 5SYNA 4AS1A 1QV6A 4QM7A 1DJNA 4FSHA 1WZUA 1T13A 4CR7A 4RESA 2H1LA 2WKRA 3WBJA 5FOXA 1ZJ4A 4JUAA 3QVGA 1X7GA 1E5DA 1GCAA 2GAOA 4JC8A 1JQLB 3ZU3A 3CPJB 4EB0A 1LRLA 1MDFA 1Q14A 4RETA 3VX4A 3R3YA 1AS0A 2X0EA 3SJBA 4KV7A 4F4CA 1XZKA 2PR2A 3HO8A 3PNSA 4I1OA 4P86A 1ZGGA 2DWUA 3S28A 3LUGA 2GK4A 2NU6A 2FP4A 5DLQC 2QM3A 2EQ5A 3RC7A 1Z5PA 2GPYA 3QTTA 3EZ7A 4PBSA 1CBUA 1G0OA 2OFWA 3WNVA 5HRUA 2GD6A 4RX1A 5JWOA 3ADPA 3NTOA 3GGDA 1PZFA 3ECAA 4KQFA 4D8WA 4QO7A 2JD0A 1ZJWA 1AUOA 4RK6A 2WFMA 3FCUB 3A3KA 5IKPA 3NT2A 1J23A 1Z06A 4L27A 3PGVA 2RC5A 2Y1GA 2VDUE 1DX6A 3D6VA 1ZKMA 4RS3A 1T5TA 3EUEA 3I5MA 5CG1A 4TSKA 1RT9A 4G41A 2V7UA 5D01A 4FDTA 4YAFA 4F96A 4DNPA 1FJ2A 1VJRA 1NF2A 5BN1A 5CVTA 2C9DA 4KQ2A 1C0PA 3FW1A 4K6HA 5KJFA 3I9OA 1KI6B 2B5OA 3EPLA 1JH9A 3GJRA 2NZJA 3KYCA 2VZLA 4R05A 4OB8A 3I6MA 1WX1A 2CJXA 1EUDB 3R0JA 2W48A 4UE3S 1PNRA 3PXEA 2VT6A 1GUZA 3UUGA 1C4XA 2EJBA 2XQJA 3LKVA 4DQVA 1PD1A 4I36A 3Q8MA 1L4EA 1J56A 4O29A 4TVSA 4XD7A 4DT1B 2VPPA 2MTBA 2R87A 4Q3BA 1JFFB 4B6QA 1P33A 4OMDA 3TSZA 2POCA 1R4AA 2DQ4A 3PKIA 3MAGA 3R3HA 4QXQA 3AV3A 2I99A 4TLMB 2QNIA 4B81A 5FFMA 5KJEA 2JAWA 1IM5A 1HDYA 2C5LA 3U17A 3DKKA 1H05A 3DL0A 5JCOC 4QNMA 2XDYA 5F78A 4TT3A 2XOKD 1OD6A 3UW3A 1NMZA 3IAHA 2FK8A 3Q5GA 3ZVLA 4UD6A 5CNIA 4FOPA 2ZVPX 1EIWA 1TT7A 4AZSA 1RQ7A 4PIPA 2I2AA 4D92A 5JDCA 1H2YA 1JDJA 2HD4A 3KXKA 4HOYA 1L5ZA 3PNBA 4Q24A 4CTOA 4ZO6A 4CE6A 3RU2A 2OO5C 4CPDA 3TGWA 1SXIA 1FUYB 3KETA 1HYEA 2WP0A 3JQ8B 2ZP1A 1NWHA 1Z33A 2M6LA 1SC4A 4MS1A 3VGPA 3IDFA 2BRUC 5HHTA 4BLOA 3O82A 5G3ZA 5C8YB 1J9GA 3TQHA 2A58A 5K0SA 4YCDA 3C8MA 3AY0A 2JVIA 4RA9A 4Q37A 4IEIA 5IFLA 1AKNA 1V95A 2FB9A 4U7TB 4YI3A 1KEEA 2F3SA 1M34A 2IXDA 4GGPA 1QORA 3CPSA 1TKCA 1OXUA 1W0KD 2ZJ4A 3NBKA 3A6HA 2AJLI 1C9KA 3ED5A 1XU7A 2RFLA 4RM3A 4E46A 4ZICA 3A9SA 4BVFA 1CIJA 1I0IA 3HP7A 4ZZ1A 1JT2A 1LNSA 4NQZA 2A1IA 3ETJA 2IJGX 2JFGA 5EQFA 4HFMA 1P7YA 4GP6A 5A4FS 3N9IA 4WERA 1P2SA 2AFHE 3GEIA 1LWOA 5AVRA 2E82A 3ZHTA 1J06A 2H1WA 5BRAA 2G88A 2O2YA 2R1VA 2WF6A 3ZOKA 4R2XA 2ID9A 1SBQA 1KF0A 5BN4B 3GRPA 4D82A 3CXUA 3I0NA 4LZZA 3TQSA 1K5HA 2Q99A 2RGNC 3AMVA 3N74A 4WJZA 2VDQB 4BGIA 2QBYB 1HFKA 1TU3A 4H27A 3GIWA 5HQ3B 1BHJA 2HUPA 2V8OA 3DQQA 3F7TA 3OPYI 4Y9SA 1XMIA 4YNBA 4AROA 1M6HA 3Q4GA 3G5AA 1T6ZA 3V2GA 1BCSB 2Q8NA 2QE6A 4CMGA 2XUOA 3UHAA 3DE6X 1XEWY 4FLMA 2D13A 3HGTA 3VRHA 3BK2A 4H60A 4I9GA 1FJGB 3TI7A 4AJ9A 3HHEA 4DTCA 4CL0A 4TPKA 1UCFA 2BSAA 2X76A 3ZQJA 4JLJA 1ZNQO 4QDTA 5L53A 4L3OA 2PM8A 4RFSA 3DZHA 3NAMA 4DGSA 2PTGA 3HL4A 2ZJAA 3E9QA 5BR8B 4RXMA 4J6EA 2RK6A 5LOVB 5CVJA 3DCJA 4DQKA 2B3TA 2D3TA 4EF5A 4G5RA 4NULA 4NK4A 2H08A 4IW3B 5IDWA 4MW6A 5AVUA 3V4ZA 1D6SA 3QPDA 5EKTA 4AUNA 4CZ2A 2VWQA 2J7PD 2BGLA 2ZJ5A 2Y9PB 1X9HA 3CJQA 1AUVA 3FOAA 3CHYA 3GJ4A 3AVUA 3SYMA 2GSDA 2XZDA 2Z3VA 1VE3A 2PS9A 3IPAA 1XNRB 4P3KA 1SXJC 5JRDS 3IFSA 1CP3A 2ZETA 3B8EA 4IHJB 3W2GA 1UPAA 1NW3A 2IYSA 3NHWA 4NCAA 5KYGA 1WZNA 2BN4A 2Q3CA 2VYQA 4M9QA 4P4UA 3STTA 4DSUA 1DBWA 2H1SA 3FLAA 1LWNA 2CUTA 4PQRA 5F2KA 2YMLA 1ZI9A 2WHPA 1P5HA 2ZSFA 3GUCA 4P5DA 4BAZA 4NU5A 4W5TA 4ZXFA 3GLFB 4GR4A 4GYWA 1JAYA 4D4IA 5CDFE 2YJ3A 4I1SA 2WOOA 5JUWA 3H1GA 2XTZA 3MINB 4MVJI 2YV5A 1ISJA 1MJHA 4Q00A 3VKFA 3PGMA 3ZD6A 1TC1A 3IGFA 4ZAWA 3CW2A 5C5EA 4BTVA 4DLLA 3CEPB 3RUEA 3ROKA 3TR6A 3LP5A 2YVAA 3A3OA 4DIFA 1BOOA 3WXBA 2E37A 2BR5A 3QSYA 3SZOA 1L5KA 2VK2A 4CF3A 1W29A 2AZ4A 1X39A 4BIMA 4HRVA 3HM9A 2H2DA 1UWCA 2DKFA 1PL6A 3HCPA 4GMKA 3GEBA 4ZVTA 3M8KA 4X7MA 4PF1A 2X23A 4WKNA 4FMCF 4G1EB 4RWEA 3NPAA 3QQ5A 4NX2A 2XMZA 3FNIA 1OOEA 2IVZA 1BA2A 3CU5A 1PJSA 4GLOA 3VVCA 1W94A 2QMZA 4QD3A 1W0KA 3GGSA 2KBEA 3I2HA 1VLMA 3A10A 1QU3A 3ANXA 2C7RA 3P4XA 1TCUA 1CSEE 3OCWA 3ANLA 3H5IA 4D3YA 3ORFA 5TMDA 3CVWA 1ORWA 3EFBA 2X9LA 1PLLA 1I1OA 3RVDA 4CDMA 4MHOA 2A2ZA 4K9KA 3P96A 1T10A 1E4OA 2VH5R 3V33A 1HO3A 1P6UA 4YP1A 4HWKA 1LDBA 2Y1DA 1VG0B 4LVNA 2O1EA 4LRXA 4O0LA 4BKMA 3PPWA 2C96A 3LC0A 4BMSA 1GCGA 4CIDA 4B48A 2ZJYA 1ICEA 2PUVA 2VG8A 3S55A 1GZ5A 1JHYA 1YJCA 4HP8A 4JH0A 3DG9A 1G3IA 4GBGA 1CYDA 2I3BA 5DIFA 2J9YB 2VUSA 3SFVA 4KNYA 3D6NB 1N8SA 3CLUC 1H2ZA 3RWMB 1WKBA 2WP8J 3TMKA 2IHZA 3KX2A 4QFCA 3RVKA 4IIXA 4C05A 2ATXA 1V3QE 4PR3A 3QFHA 4DDVA 4POOA 2GNAA 2QTMA 3AF3A 5B2ZA 1U8ZA 1XLUA 3OECA 4MK4A 4LRQA 4XASA 2RGEA 1R4NA 3IMGA 2M32A 1KI6A 1M76A 3B6EA 2JGFA 3DCYA 4P54A 1ZD9A 4EJSB 5DGDA 3DE7X 5A5EA 4WLOA 3DAYA 1EUDA 3PUWA 3TDNA 3RC8A 1WXQA 3SZUA 1Z6GA 3H9QA 4OQPA 4BNTA 3IIKA 3PV0A 4UHHA 1UH5A 3VSBA 1YHNA 5E3HA 2RARA 3DR3A 3ZCVA 2FMXA 2C4WA 3TSCA 3TSOA 1CUFA 1J2UA 2J1LA 2IU3A 2QTRA 4IH4A 2W70A 1KH1A 1RE1A 3F5FA 4RV4A 3C3XA 4EAQA 3I30X 2X9VA 1I8TA 2FPSA 3SS9X 3SYTA 4DSZA 1EX1A 5F7ZA 2HLPA 1U2DA 3HKCB 2ENUA 3A6ZA 4UAGA 1PU2A 1Z25A 5K0CA 3FY4A 3H84A 1NQTA 2HRQA 5SY9A 2HTEA 1H1LB 1W9HA 3H13A 4CI9A 1ODKA 1SVNA 1YASA 1LX6A 3IAS6 1M73E 3AIIA 1Z83A 4MYDA 4KHZA 4KO4S 5J2UF 1D07A 2B36A 2CYAA 1JL3A 2H9YA 5IT5A 1TRKA 3OCJA 4JUBA 4IWNA 4TV8F 5KHLB 4F92B 1GSHA 2I6TA 4YRMA 2I4NA 3ETDA 4RJJA 4IVQA 2WIDA 5LC1A 4LK2A 1HDXA 3D5QA 1G55A 4EECA 3JQ8A 4AKHA 1LV8A 1M6WA 4CR6A 3VYWA 5CFPA 1IMJA 2GJSA 1EZZA 3OO1A 1NXXA 4GYYA 1XNHA 5ENDA 1V6CA 1BMDA 2C8KA 2X4DA 5C8YA 1MO3A 5IVHA 1RADA 1E9DA 4IVRA 4XYBA 1QYXA 2HQ1A 2JD2A 3IB3A 3ZGLA 2EQBA 3ET5A 2F8TA 4EY3A 1CEYA 2QA5A 2VSQA 2C9YA 3DLAA 2FJUA 1OTHA 5LBTA 4JN6B 1OXKB 4HWOA 1CUGA 4TL9A 4M1SA 4X00A 3V2UA 1J4AA 1FVXA 1IEVA 5CLGA 3DQPA 2I78A 1EAYA 3FCCA 1WPGA 3NNNA 4AMGA 2JI6A 5FOTA 2R97A 4RADA 2WAYA 4EHKA 4IMJB 4DHWA 3OO0A 3HYTA 1CY7A 1FSFA 1YJ5A 1GLVA 2W90A 3PDIB 1RBZA 2PGXA 4PCUA 4F11A 1GFZA 3O4IA 2AC2A 2X40A 2MU1A 1H6DA 3L8HA 5GZ6A 4XJVA 2ZIXB 4BGVA 2Z2XA 5C35A 2XKBA 1VLVA 3EXHA 2QBYA 5TQ2B 2BDUA 2LCFA 1EUCB 1K8XB 4Q1CA 4OBXA 3UB3A 5HQ3A 2ZIWB 1DWOA 2GCNA 2HO4A 3GRFA 4HPXB 4NJMB 4OLJA 5KHAA 3UBMA 4CKWB 1DFGA 4Q0MA 2K2WA 1BCSA 3OWHA 3TWOA 2I4TA 1XKXA 4G0NA 1HOTA 2P5TB 3DMYA 3K70D 1Q7TA 1KRHA 2ODWA 2RGCA 2ECPA 1GGFA 2YYSA 5DO9A 4B6FA 3BGOS 5JD4A 4P4NA 1N2CE 3GFTA 1OB5A 5IVDA 1DCMA 2PU5A 1AQ6A 2PHZA 4E30A 4HYTA 2O19A 5IUKC 2LW7A 2IZ5A 4RGYA 4ENTA 3RS4A 1WDWB 2Y05A 3HK2A 2WA2A 2TS1A 1K4YA 1TMOA 2VC2B 1IRIA 3GWGA 1L5OA 2QTGA 5J3JA 4M0KA 2FGJA 2PX0A 3EARA 3FHLA 3UCXA 5LOVA 5I8ZA 2ZSKA 2GBFA 3BWBA 4ZT6A 5YASA 1FFEA 2FMFA 3L43A 1JYSA 1RR6A 1OX4A 1KNXA 1WW3A 1BWPA 3KNZA 3UH0A 3DHWC 1JQJC 3CKLA 4AN4A 5BYAA 2H1RA 1IM2A 3VR4D 3O3NB 5F9MA 4XGIA 4U6SA 5H68A 4MVJF 3L1JA 4V1CI 1H0KA 1WHSB 4MUKA 1MG0A 4TSFD 4O08A 4LK3A 4UNPA 4MXDA 4N8SA 5FP0A 5KVQA 2BISA 5AW3A 4QYIB 1ZM3A 3Q6NA 1MC4A 3LD9A 2YUIA 4IHJA 3CWQA 5BORA 5C9ZA 1NNSA 4JB2A 2Q41A 3IPRA 2ZUSA 5AVVA 5G0VA 3U9SA 4BNDB 1VI6A 4GKJB 5HVNA 3FNQA 1JDVA 1UIRA 2ZRFA 5CVCA 3ZK7A 2H3EA 4YGXB 3GD7A 1FFSA 3T0IA 4RMHA 4NOJA 3GLFA 4K8RB 1BXKA 1JHVA 1GDDA 1OPXA 1V47A 4M7OA 2FX2A 1UJCA 4I5FA 5K2MA 5TJ9A 1XEWX 3MINA 4UDYX 4BE7B 1XPUA 3RUCA 5AJVB 2EKZA 3CM0A 1VJCA 5CJ2A 2PRSA 5CYGA 1MCZA 4NV3A 4TS3A 1L9KA 3F9RA 5K8JB 4EHBA 3IODA 4FFPA 5D51S 1XEFA 3ZLVA 4BP3A 8GPBA 1XDGA 1H8HA 2F8SA 3EDCA 1W88B 2MSWA 3EA0A 4BNFA 1OBFO 5ALMA 4LDRA 5EMNA 1FIUA 2P1DA 1X14A 5HBGA 1G41A 5LA6F 2FZKA 3IIIA 2V0CA 2GO1A 1E9EA 2DTEA 1U0GA 2FG7C 4TN1A 2VQSA 1R5OA 1FDOA 1YIAA 2B4KA 2QL5A 4MEAA 4X3PA 2B30A 5CDSA 2RG7A 2DZDA 3A1EA 1F51E 1G20B 5KYTA 1PN3A 3QTBA 1HOXA 2J07A 4IO0A 4PYRA 2MSKA 1PW7A 4PSAA 4YJ2F 5ALXA 3RIMA 4KN9S 5IF3A 3L1HA 1SCBA 1G7CA 4M86A 2WRZA 4YRRA 5BSUA 1BS9A 2ASEA 3L8GA 4L4UA 2A35A 1ZRHA 3RJZA 1FS4A 2XGSA 4QRDA 2VJQA 1GEEA 4CHGA 1ZINA 4J9UE 3OT5A 4CKCA 2OXTA 2PDAA 3UF0A 3UMMA 4DW8A 3FDFA 2QTHA 3LXRA 3LLVA 2H1HA 2D6FA 2ZRIA 4BVJA 2REOA 1NBWB 1P7WA 3O0TA 1YULA 3BORA 1ISHA 1ND6A 1NNI1 2ZRPA 2Z3WA 3AHHA 4Q16A 4QHTA 5ESXA 4HQOA 3OE7A 5BVHB 1KYQA 3LQYA 1F0NA 3LCCA 3O4VA 1D2AA 1AKRA 5TX7A 2IZ7A 3R5SA 4IJKA 5HR5A 2FYTA 4GX0A 4EMSA 1LJLA 1GPLA 3JZDA 4OYLA 5L6LB 4QQKA 4IS3A 1DARA 4MJLA 3JQ9C 3RM3A 4JLVA 3KVNA 1G3MA 3IPYA 3FUUA 4PZ0A 3U4MA 1NBIA 4HWRA 5G1NA 3HN6A 4A9AA 1VKOA 2PWYA 2OSBA 1BD3A 1UKEA 4E2WA 4EJSA 2OHVA 5KNDD 3IOMA 4PX3A 5CT4A 4B17A 1E9FA 4Z4CA 1GG8A 3BJRA 2CXNA 1Z0DA 2IOFK 1C9DB 1VHLA 1CRLA 4U6QA 1IIRA 1M2EA 4WZAB 4U2CA 4EF6A 4EVIA 1LY1A 5FL3A 2H31A 3T5PA 3NHKA 1QNFA 4MUJA 3HXKA 4C7MA 3DFMA 4ENWA 4YRDA 1Y5NA 1Q1ZA 2JGKA 3LQFA 3EJ6A 1LRJA 2GN1A 2JGNA 3NRCA 1RJDA 2C2BA 5BYJA 4Q6BA 5CDGA 5KDOA 2H5IA 1B8UA 2O0MA 3PC8A 1CF9A 2QRPA 3O95A 2X7HA 1UC8A 1ORIA 4LOIA 4M8KA 4JLMA 3HKCA 4C22A 2DXIA 3CWCA 3BFKA 1IQPA 2AN9A 1NKVA 1ZSVA 3A6JA 5IUJC 3QPUA 3C1UA 4H3HB 3VSEA 2O2ZA 3WHKA 5CLFA 1U8UA 1RPJA 4LYAA 2GJ8A 4FMDB 2CXOA 4C7OB 4Y2VA 4GPTA 1L7PA 5EA2A 2GNPA 3PPIA 5EQTA 4C43A 3ORSA 1XSEA 4E12A 4BNXA 4AFNA 2FSUA 2O8NA 3L7KA 3WS7A 4PC1A 3DOCA 3FHOA 5K20A 4U6NA 3H75A 2KS6A 4AP6A 4JYZA 5HRAA 1KIMA 1T4GA 1OIVA 2FR8C 3MELA 4DL9A 3BSSA 3R3SA 4J3JA 4QJ4A 4WK2B 2FJ0A 1NONA 2IIQA 1ECCA 1LA2A 3A6DA 3CSDA 4QGHA 5EEGA 5IDXA 4QJ5A 2PCLA 3IQXA 4ZRDA 1M54A 3OLZA 3FRIA 3B48A 4HGZA 3DM9B 2B4TO 4LOAA 2FLWA 2CMFA 2GK3A 1A2QA 4MIEA 3IBGA 4RMIA 1T2EA 1XWWA 3ZWVA 4FGWA 1YI1A 2P0YA 4TM8A 3H7IA 4CW7A 2I8CA 1Z35A 3IP3A 4U7HA 4YJHB 4E5NA 3DC2A 3H5AA 3KDAA 2DLCX 2X41A 3K53A 3SQWA 1XDZA 1XYVA 1W0JD 1X74A 2HNKA 4HQ6A 4L07A 4AW9A 1QRAA 3R7LA 1FP4B 3BRCA 3ICVA 4OFXA 2X4IA 1P62B 1IE3A 2FUG6 1T4BA 3AF2A 3QVSA 3E0QA 3DP7A 4WY2A 2A6PA 3JQAD 4M0MA 4PRLA 5E9WA 3TLGB 4BEBA 3UJHA 1DDOA 3NBZC 3TPFA 3I9FA 3KLMX 1RWWA 2BI7A 4WY5A 5BWCA 4DVJA 1E4YA 1P29A 3U1VA 1YKGA 2ZIXA 3F4BA 4J0KA 2QU8A 4B7CA 5IKMA 5TQ2A 2UVDA 3H9CA 4H7JA 4ISBA 2Z57A 3HCRA 3U7RA 1I6LA 3X1WA 1UC5B 1K8YB 3KE9A 5E95A 4CKWA 4NJMA 1TJ5A 1SHTX 4WLEA 3DC7A 3WLQA 2X9QA 5JIBA 4DM4A 4AY2A 1JTVA 2UYYA 1A9QA 3GP3A 3LAWA 3PFCA 4GM0A 2EBHX 3OEYA 4P5PA 3OPXA 4HNTA 4GC9A 2HCFA 1E2BA 2IP4A 5B2FA 4NATA 3HVUA 1TAQA 2GYYA 5CLLA 1ST2A 1E77A 2C3YA 2VOEA 4N3BA 4QDXA 5KPDA 4TWIA 1L5FA 3MTIA 2EFGA 2HGSA 2B0CA 3LHDA 4D9BA 3ULKA 5HF6A 3ZD9A 2J48A 3KT0A 2BMFA 1JKJB 2VXBA 3ZGZA 3GLIE 1CQWA 2RHLA 2ZU0C 1IEWA 3CISA 3KEQA 3PJGA 1P7CA 1W93A 3KUKA 2B4AA 4UMEA 1M5RA 3HUDA 3LT5A 3CZQA 3HGMA 4Q21A 2VBGA 4MV4A 1P4SA 2CB0A 1JKXA 4KQ6A 4NV0A 3TTTA 3FZGA 4MWOA 1AN0A 4DA9A 3CF4A 3PNLA 1QZXA 4IXWA 4JKOA 3KB8A 5EOVA 1ADCA 2YMMA 1WHSA 1JHMA 3ANYB 2HXGA 1R5BA 2ZJ0A 3FUVA 3NTRA 5EFZA 4FHZA 2W00A 5LBIA 2PH7A 2WB4A 4NBLA 3STVA 1P2DA 3TE7A 2NIPA 2XMBA 3JD4A 5CLJA 3IT0A 1SXJB 2P27A 4OJNA 3EDYA 4UZSA 3U7FB 3QLTA 3H05A 1E1QA 2QSYA 2ZWVA 3ZTTA 3QXSA 1SOAA 4P0TA 1ELOA 3F6SA 2ZR9A 3D1LA 3KLPX 3EH2A 1ISGA 4O1MA 1QAOA 1ZMRA 1H4TA 4K88A 3VPHA 1VJ0A 2B8TA 2JGIA 3OG9A 4U7FA 1C80A 1NN1A 3LCMA 3TAXA 4QOSA 2Q5CA 4UREA 3VPDA 1Z2AA 3RV3A 2A4MA 3B1WA 3I0ZA 4GKKB 5TV2A 1UQTA 1EE1A 1Z4QA 4OIMA 3SDSA 2IY9A 5BWLA 1X7YB 4KO8A 4UUQA 1VHQA 5LQDA 2HQRA 3L82B 3PFHA 1AHIA 2WUVA 1W88A 4HAYA 2PY6A 3KEMA 3E9CA 3Q1LA 3OJOA 3VZDA 5TRTA 4L6AA 3WLIA 4A6XA 1TLLA 4YMUA 1QDUA 4GT1A 2Z5GA 4B8WA 1K4MA 4M0EA 2PN1A 3H87A 1JB1A 5HA5A 4G1MB 2AXNA 2Q2WA 1LSOA 1T0IA 2WF5A 4I08A 3R3UA 1M1ZA 2W22A 4KH1A 3PQ3A 2DEUA 2D2IA 2OZLB 4ZMBA 1NURA 2FCAA 1ZXXA 4IJMA 5HOEA 1HC7A 5EESA 3EIQA 4C7JA 1W0JA 4B3HA 1JKIA 2MYTA 2PEZA 1JE0A 3OQVA 4I55F 4TROA 5EJ8A 1M0EA 1J25A 1BXZA 3N0VA 4A92A 5ALWA 3CLSD 5AUNB 2C9BA 1M6VB 3FTCA 4IFTA 1LSUA 2FVXA 4X44A 3AT1A 1A88A 3TUZC 1S3IA 1RC8A 4M2LA 4BYGA 5CT5A 2LDBA 4KRGA 4DUYB 1VL6A 3E81A 4ZA2A 3W9BA 2QRJA 4YUZA 4CDRA 4FEGA 4W8HA 4W63A 4AJKA 1T4DA 1ORHA 1P61B 3QEJA 3OTIA 4HX5A 2KM1A 1XRQA 4WXMA 2C5AA 4C04A 4CG2A 5BVHA 1MX1A 3FHCB 1SQ5A 3QE4A 1RP7A 4R1UA 2ORED 2I5PO 2A5DA 2GF0A 4WECA 3CF4G 3ONWA 1GPWB 1MKYA 2YIJA 5D7NA 4J0DA 4B82A 1JF8A 3WGVA 1YRBA 2BMDA 1H42A 4EJFA 5A1TA 4JCOA 1B14A 1UFKA 1UM9B 4QFBA 1Z5WA 3ZD7A 3BD8A 3U1TA 3FVVA 3NTXA 3R9XB 2C92A 4Z9AA 5AOBA 3C6BA 3EGWA 5IXJA 2WJVA 4GRDA 4NPCA 4EP1A 1OHHD 2GX6A 1G4AE 1KDYA 5LDDC 1AE1A 2WHQA 1E5QA 5SYAA 4PBRA 1IHYA 4CKYA 1FEZA 2IF2A 5EIFA 2C54A 4IIUA 5DX8A 3EVDA 3MTBA 2JASA 1WMBA 4RDIA 2X2FA 2EGUA 4FI3F 1Z68A 2W2PA 4JCCA 4RMJA 4BASA 3NBFA 1U7WA 4OQLA 2IOHA 4EJMA 3H04A 1YH3A 5J63A 4TL7A 1ECJA 3FVRA 2VJLA 1WBJB 3DL2A 1O5TA 4H16A 1I01A 1KZ6A 3AOGA 4ICIA 3WIBA 3ZVKA 1C5KA 3P2MA 2PK3A 3H7AA 4K9QA 5KREA 1SXJD 5G0UA 1N4DA 3G2IA 3M6MD 1P1IA 1Y3HA 3MS4A 1JHUA 1W1IA 3JZIA 1L8QA 3DE0X 4URWR 5JCOA 4B3MB 2OAEA 3KZNA 3P94A 2JLXA 2GZ3A 3H9UA 1O97C 4RUKA 4XRGA 3NGXA 4C7OA 1Z38A 2PRIA 4BQOA 2VNAA 5CM9C 3UWOA 2R2GA 4GPEA 4HB4A 3EPRA 4BLSA 1N2SA 3IO3A 4Y18A 2O8DB 1IK6A 1DFIA 5EN4A 3HG7A 3WGOA 3CZ4A 1HMYA 3B52X 3GLSA 3PHLA 3ZJUA 2PS3A 2IBMA 2CHEA 2ZU6A 4PNPA 4GM1A 2OO5A 2NYVA 3D64A 1XZMA 4DR5B 3N2LA 2PL3A 2ZWIA 2XQVA 5IWCA 4TLEA 4ZQHA 1KAGA 2BRUA 5CXUA 1X94A 2HJHA 2QR5A 3IP5A 4TKUB 3W2EA 4F5DA 1GGMA 2AJ8A 2SBTA 1LNZA 3F8TA 4HNAB 1LLUA 1DAOA 3WYNA 1Z6AA 4KQHA 2B92A 5NLLA 4REOA 4DIOA 3MFYA 3HU2A 3MWDB 3MT0A 4Y2QA 4YJHA 5J5AA 5C1PA 2BGJA 4FYKA 3TKAA 2E4YA 1MQAA 3TRDA 1AMOA 2XB2A 5IG2A 4GS5A 5CT8A 2AEEA 1MABB 1GILA 1RYBA 5BSHA 1DBRA 3ETNA 4QU8A 4JI1B 1E20A 1TQHA 3PA6A 3Q8XB 4I2VA 4DXAA 4F7WA 3IKTA 4R71A 3AY7A 5CT6A 1JT9A 4DQLA 5CG2A 3QVMA 4JMLA 1JSCA 4HNHA 1RXWA 4REMA 5C5DA 5LQCA 3TLGA 1PP4A 3OJXA 2ONYA 2FR0A 1SUSA 1FNNA 2A9FA 1CUSA 4DVGA 3LQRA 4CI0B 5DF1A 5F4BA 5I6DA 4XFJA 2QPOA 3MJHA 1Y6JA 3NNSA 3QIAA 3IPCA 5MDHA 1QIMA 1DEHA 4JJGA 1WR8A 4YJFB 3RVSA 3WSVA 3Q98A 1OAKA 3WDKA 4BPRA 1X8KA 3A04A 1U9ZA 2RGNA 3OCUA 4R2HA 3A28A 1VKNA 2ILTA 1AKUA 3T7KA 1GPUA 3C6MA 1TYCA 3BAZA 5AXBA 2BHLA 4A8TA 4S04A 4EX7A 4N12A 3DDOA 3WA6A 3CLUD 2HFKA 2EBWA 4YAJA 4CF4A 2ZWOA 3CZAA 3EQ9A 4NMLA 1DHTA 3PFWO 1GG9A 1A2OA 3C0KA 4UBLA 2ZUDA 4JUCA 1XHFA 4LC0A 1EXDA 2UYCA 4MI6A 1SKBA 3JVVA 5CURA 4C0LA 3RQSA 4MRVA 1IULA 1PKEA 1KAMA 4FDVA 3A26A 4F12A 4Q1VA 3GJTA 1M8KA 4BKPA 5BMOA 3WIDA 1NVWQ 1JKJA 4UU7A 3WYCA 4U5QA 2NYUA 1ILEA 3TECE 4AUKA 4KTTE 3THYB 1ISPA 2QLMA 5HJEA 1GPAA 1OWPA 3DLIA 1JHDA 2I2BA 2O50A 4GGOA 3VR6H 4E2YA 1DTSA 1I4WA 1OHHA 1TZBA 2OV8A 1H0RA 4DZTA 1S1CA 2N9UA 3FN4A 3UMYA 1Z5ZA 3G68A 5L7TA 4UE6A 2AH5A 1JMVA 1IEXA 5IRCD 4Z9BA 5A04A 1UBMS 2B4RO 4GO1A 4DM7A 2OTCA 1IJEA 2R85A 5IZ4A 1ZD4A 2CHVA 4GQIA 1N5JA 2C94A 4ZI7B 2IY7A 2PYIA 3UWPA 5ESRA 2VDNB 1F0KA 2FEOA 1JG3A 4JJIA 1NJ5A 4KXWA 4LDJA 2HA0A 2CJWB 2VZ9A 1SXJA 3DEKA 5FPHA 2XT0A 1GGKA 1SU7A 2P79A 3IX7A 1CHNA 4N0DA 2RBKA 3EJWA 3M0EA 7AT1A 1CIPA 4WBNF 1KP3A 3K72B 1NJ6A 5I9BA 2GHQA 1MQSA 2X58A 3JD1A 2VTDA 2UXBB 4FFOA 3R7NA 5H81A 1IOWA 3UYKA 2FZ5A 4Y8VA 1INLA 2PBLA 4KO1S 1E79A 3NTLA 1GP2A 3K0CC 1M34E 2FN4A 1PF7E 1EDZA 2J3QA 1LDMA 3BGDA 2CVZA 2JHGA 4R01A 5FR1A 5HOQA 4HFRA 4G36A 3IALA 3ZY5A 1OF1A 1QGZA 2BE9A 2YC4C 3B3GA 3GAZA 1NQUA 3HA7A 3PG5A 1SKQA 4RVOA 1RBMA 4G1FA 4JEMA 3HVRA 3L18A 4OHCA 3OPNA 3ERCA 5EWLA 4AZ3A 2FKNA 3C98A 4M21A 3VTZA 3VYTB 4GKVA 1JPVA 1I7PA 3R7DA 3TL2A 4B5LA 1LFAA 1R8SA 3SC2B 1DG3A 1K2VN 1OFUX 1WPQA 1XAIA 2FPRA 3WMGA 3U19A 5EL0A 4ETWA 3PD7A 3S44A 1A77A 4MVYA 4GMFA 2WM8A 5DK6A 3MLEA 4AY4A 5IJWA 1QANA 1ZI8A 4RF5A 3HVIA 1UXIA 2H7VA 1UANA 5CH8A 1WZEA 1UKCA 1UMKA 2X0RA 2W6JD 1P5ZB 3SIPA 3GLRA 5KTSA 3MGCA 2D7CA 1YJXA 4DG9A 5JSUA 1HNXB 3DZFA 3F7MA 3O21A 4WADA 4JI6B 3SZGA 2Q6IA 4P4GA 1R15A 1Z34A 3OQMA 1M6VA 1YL7A 5TQ0B 1MPXA 1C8BA 2QNBA 3ZV3A 4BVEA 3PQ7A 1QJ4A 1A98A 1Q7RA 2ONCA 3A1TA 3CT4A 3Q3HA 1RYYA 2WIFA 4O5AA 2C00A 3IHKA 5AMXA 3TX2A 1E3WB 1PR2A 2D1FA 3IQGX 4Y2RA 1GGNA 5AM4A 5FOVA 1OI3A 3FWZA 2WJHA 3ENQA 3GUHA 4IKEA 4IIVA 4Y1EA 3BWMA 4EYQA 1VPWA 2VJOA 2FRVA 1H3FA 2WJIA 1N2EA 3LL4A 3VPGA 2OA0A 5KKCA 1P9WA 2EW1A 2Z43A 4QVKA 4DR7B 1GAWA 3AKCA 4TTSA 5LJLA 1Z74A 4KK4A 1EZ1A 1KIFA 3KWFA 4N49A 5KU7A 5LP6F 4G89A 2XBLA 3NV7A 1QTRA 3T7CA 3LQKA 3T0FA 5LU8A 1NM5C 1SB8A 4GG1A 3BH6A 4GYJA 4BQRA 1YQ9A 1THMA 2EZTA 3ROGA 4YYEA 2J0SA 3IILA 4U0KA 3WK6A 2IOYA 4JBNA 4UNQA 5EJ9A 1C4OA 1MORA 3QWAA 3MGAA 4CTNA 2FGKA 1JBKA 1VPLA 2ZLBA 5C32A 1Y7TA 1PS0A 2GN2A 3P9IA 1Z2EA 4JK3A 4QXOA 3D4NA 3GLHE 1I6WA 1W85B 3JASA 4J7CA 4K9LA 3OBIA 4WXRA 3TFQA 1P2VA 4C7KA 2V7QA 4DJDC 1NLUA 4JJEA 5SYMA 4OBWA 1D8AA 3N7AA 4CCAA 2O1XA 3LJKA 4W1SA 2QX4A 3ZZUA 1N2HA 2C07A 2VP4A 3IOYA 4I1UA 3NM5A 2HDWA 4U2BA 3IJ5A 4GMHA 4UJ3A 4CQLB 1FDIA 1ZH6A 1ZCJA 4GXQA 5JEDA 4D4JA 1IBSA 4Q7KA 1GNLA 3U4CA 1MRNA 2J4CA 2X1LA 1YZNA 5TF4A 1FTSA 4MCAA 1P60A 4M60A 2N1MA 4ZT5A 2VJPA 3Q9LA 3V4SA 3MCUA 1OI7A 2Y1EA 3H5LA 2OYCA 3SIXA 5D5PA 1NNEA 3EZGA 3ASVA 1TVMA 2Z2YA 3CSSA 3SFTA 5F23A 2CNBA 3O26A 3VZRA 3ZWDA 5B7GA 4OH1A 1CETA 1L7NA 3FTNA 1K2WA 1B15A 4MUIA 5ALUA 3MCAA 5CBKA 2JZOA 1EGAA 2YDYA 2O8DA 2WM3A 2FFQA 4V3BA 4DOMA 4TQ9A 2IDKA 1RWQA 2DQZA 3QLUC 1U3FA 4ZOAA 2A94A 2IYOA 2XZOA 1II0A 1QIEA 4IQGA 4OP3A 3SJZA 3OOJA 4I5IA 4I2NA 1EDBA 2GAFA 4ND1A 2EHJA 4RPIA 4S1PA 4TKUA 1HORA 3V7WA 1OH8A 4XZ3A 1JR3D 4YEDA 3TIFA 3OVMA 4NS1A 3VSDA 4DUGA 4HNAA 3NC0C 4LYYA 2X9GA 2C7VA 3WRXC 5HZHA 1T5IA 3QBDA 4FSXA 4PSKA 2R3SA 4A2WA 4RNDB 3COZA 3OUZA 5D5QA 3H18A 3K7EA 1IHDA 1UDXA 1P8JA 2KBFA 2FN3A 4GAEA 4WLUA 3RYIA 1GUFA 4EHFA 2FAXA 4GBMA 3GGCA 4JX8A 2XMDA 1MABA 1WPRA 2RHTA 3QEMA 4EEKA 3I1YA 2F3RA 3OM9A 3R7FA 1ZL2A 2ZCVA 1DWUA 4EY6A 3NM4A 3EZ2A 3PEEA 5K5EA 4J7AA 4DIKA 2JLVA 4YQFA 5B1IA 4OVKA 2Q6OA 3MEQA 3KC2A 3MQ4A 2FUNB 3H3JA 3DT6A 5HIMA 2C42A 1MU0A 1V9CA 1P4JA 1ZO8A 1F5SA 3DQZA 4QPCA 2QP4A 3MMZA 5KDDA 4YJFA 4RVUA 1FDRA 3EMBA 3IA7A 1V96A 1FA9A 3PC4A 2AB0A 2P6OA 2C9MA 2QD5A 3CEAA 2CXSA 4R9VA 1EFRD 4Y2XA 5C8VA 4DB2A 1KA9H 1QHEA 1TYZA 2ID7A 1JDPA 3TBFA 1X13A 4HQLA 5EZYB 1ZD1A 3D7LA 3LZCA 3Q0TA 4BC0A 1AKQA 1W25A 4NFLA 4AIIA 4MVJP 4RL4A 1TUEA 4YAWA 3QUSA 5C46F 3EBPA 4JJ4A 5AP9A 3IP8A 4RL6A 3UWSA 3KYIB 2O3QA 4MR7B 4ZHSA 5TVKA 4C3OB 1PDWA 2PRKA 4M7RA 1GXSB 4KE7A 4TYNA 2DP4E 3VR4H 1U3CA 1UEXC 2FVYA 4NICA 3C6YA 3THYA 1BA3A 2PT7A 4JI4B 3MMPA 6REQB 4AJLA 4O1IA 1V4VA 3THOA 4GLFA 3TLEA 3T1TA 4WK6A 1M83A 3EH1A 4RD1A 4Z3OA 2IH5A 4LCJA 4B44A 3NCTA 1V3TA 2I3GA 4OM7A 4ZOBA 5K4GA 1I4TD 3KWJA 4BP9A 4PO8A 3T7EA 621PA 2BD0A 1XX6A 5KWJA 3ITEA 3I5AA 3EVCA 2G8LA 2NO1A 2CJWA 1ZN8A 2GK6A 2Z3ZA 4UTVA 1MTOA 2JIOA 1XQWA 3G23A 4ZVOA 4EO4A 5CNJA 1NJGA 5T57A 1P44A 4QOJA 2YZNA 1Y42X 4GI3A 4TN5A 2HU2A 3GU3A 3LIPA 4MLPA 5CR9A 4ZAFA 1BAPA 4BQEA 1U02A 1CE8B 5IXSA 2WUGA 2X6RA 1K8ZB 1RAAA 4I99A 4X6LA 2F1JA 4UM9D 1NNUA 2FK7A 5K3CA 4TRJA 3DNFA 1V11B 2AJTA 2HPAA 2E1PA 5EJGA 2VCHA 1MA0A 2Z30A 3ZV5A 3K2EA 4D0LB 5KQSA 2EWWA 4HH1A 3OZXA 1HNNA 3EGDB 3MTEA 3KZXA 4U8GA 1VA4A 2B1RA 2QS9A 1GLGA 3V8RA 3FSGD 3QOFA 5LQKA 4FNMA 4UMVA 1LPSA 1R0RE 1JH8A 5KCZA 4TTPA 1SVUA 3UMBA 1N75A 2I7XA 1C0EA 2H52A 3SC2A 1MJFA 3G2PA 1RKVA 3CS3A 4B7UA 4YRBA 2A0YA 1KDPA 5JS7A 4EA9A 4L7QA 4HO1X 1NHGA 4N3GA 3ETEA 3N7TA 2DUNA 3TW0A 4WINA 1GZVA 1TM4E 1U8CB 3JWGA 3ESRA 4JBWA 1PFYA 1XRSB 3TQCA 5JVDB 4ZGWA 2X4LA 2ZR8A 2G77B 1LDNA 3NH6A 4GXRA 2RJ3A 3LO5A 3OJCA 4GDMA 4JJFA 1P45A 2AK2A 3W90A 4EOGA 3D4OA 2R7KA 1EHIA 3CZRA 4YDQA 1UAAA 1T9HA 1WUTA 5TQ0A 2QG9A 1T3LA 2VDVE 4A3SA 1RHQA 2ISQA 3HR7A 5K4AA 2Q5HA 1P91A 2JIQA 3BGVA 2C2ZA 3HCBA 3FSJX 1GPNA 1E3WA 1TQ6A 4GX1A 4P53A 5K05A 3DJYA 4FLEA 4MLCA 3GDOA 4QQ8A 4D3FA 3SS7X 4EGSA 3W05A 1ZUNA 3OU7A 1D0VA 2HSEA 4G0XA 3EQ7A 2GZ2A 4DSAA 4YCCA 1NW7A 2FW0A 1WOYA 5A71A 5SZIA 1EFRA 4EGQA 5EPEA 1KJWA 1AK9A 2WYUA 3KT3A 3E4DA 3TOCA 1J07A 3FCOA 4UM7A 1GN9A 1U6JA 4KFRA 2GA9A 4UATA 3BEDA 4O4IB 2H2FA 3FNFA 3ZZNA 4ZYYA 1U8XX 3CEMA 4QWWA 5BYKA 3JQ9A 4NIMA 1NT2A 1UXGA 1EE2A 1C4KA 2A7XA 3RBVA 5IDQA 3ZDDA 3G2HA 5EMMA 1N5DA 1Q0TA 3HXPA 1UKAA 1W2GA 1P74A 3C4QA 2QD4A 2Y93A 5F52A 3RLFA 1Q0RA 1VC2A 3QUAA 4FFDA 5EJFA 2E3JA 4P7BA 2ECOA 1ZYUA 5EWJB 2VN8A 1ILWA 1WXEA 3RIHA 1XLWA 1W85A 1QTIA 4CU5A 1YUNA 2C99A 3HXLA 4LXXA 1DZ3A 1FLNA 3DA8A 1LRKA 3HDQA 4G5SA 5EZ5A 2Z9CA 2O2IA 3C7AA 3O5AA 4I9FA 4CQMB 4ITRC 4M8IA 3W3AD 2EBUA 3R20A 1ZC4A 4JQOA 2XB9A 1TDJA 1MC5A 1CRZA 2IX9A 2QYTA 2ZB2A 4IIJF 1QHGA 1Q84A 3HFSA 2DETA 4DYVA 1OT3A 3TOZA 1QONA 4Y2PA 5BMVF 1A7KA 1KOJA 1ZMTA 1HSOA 3WGJA 4LBVA 4W9MC 3HKEB 3B2QA 1RNLA 2B8WA 2FDXA 2KW5A 3DWFA 2Z2JA 1ZX1A 5GGYA 3L0IB 3N8KA 1UOPA 2PMKA 4YP0A 2PAFA 1JX6A 3IO5A 3BULA 2Z95A 1E3JA 2X8LA 1ADJA 4QUIA 2DAPA 3P45A 1Q1GA 1M1YB 2YYAA 3BA6A 4A15A 3GCZA 4HEHA 3ETGA 3ZWQA 1JFSA 3VZPA 4ED9A 1N0VC 2DF8A 2WTXA 4X9XA 2E7ZA 3K92A 5AKXA 5DX0A 3SJ7A 4O4HF 3UUFA 4MVJD 4ETMA 4YV7A 4F9TA 2FR8A 3FETA 4TMVA 2SKEA 3TCKA 1B42A 2I8LA 3TNLA 4KZPA 4C76A 1Q1QA 1DKNA 4N7JA 1KPGA 2GXQA 2JCGA 2CLSA 2XEDA 4WN9A 4KH0A 4I4LA 1DUIA 2Q8PA 1YKFA 5DSTA 1ZQ1A 4ZD6A 2YNMC 2P65A 4G5OA 1EGVB 1COWD 3BIOA 1EQ2A 1NWCA 1T9KA 3QP9A 4P2BA 4RLHA 4EGAA 1RHRA 1FYXA 4C88A 4I8DA 2HU5A 1Z4LA 3A05A 3LX6A 4V0MA 4IIHA 3ROZA 4A0HA 3L40A 4QQRA 4F91B 4FYIA 4R1MA 4QVIA 1AXGA 2JEOA 4FW8A 3FYUB 5CCDA 2FZ4A 4C0XA 5I9LA 1TUGA 4G1VA 2RB5A 1XN1A 4E13A 1Y3CE 4ZOLF 4GX2A 1OXTA 1SCUA 4E7PA 2HA3A 4CJXA 4PYIA 5U4QA 4MDHA 3UV6A 1FSGA 1HEUA 3NDBB 5LQSA 1QJCA 1HDEA 1E2EA 4B2PA 2WD8A 3HEMA 4KQMA 3PIIA 3ER9A 3ICCA 3DR5A 3MCWA 5HF5A 1L5GB 1UK7A 1G5TA 4Q4HB 5I7WA 3LBIA 3UGJA 1K7FB 2BEWB 2P4QA 2ON6A 3OF3A 4MNTA 4X66B 4JU9A 3WJ1A 4UU8A 1LPAB 2Q3BA 4EI2A 1SBNE 4KR6A 1F6BA 4KQXA 3ROEA 1R6XA 4YMHA 4WOJA 2WTNA 5JMWA 5K1ZA 4L85A 2WFAA 1D03A 4A0SA 2H2HA 5GVSA 2HK9A 5BN3B 2N0SA 4RY9A 4EGCB 4NNOA 1BEUB 4E5DA 5IJXA 4AS2A 2I2DA 2JIMA 3KSZO 3F6EX 2H1FA 3QMVA 3CZPA 1GXSA 1MMFB 4YT5A 4ZYLA 3QA9A 1CQIB 3RSOA 3IR7A 3OZDA 5CFOA 2UYGA 3A1CA 2I9PA 3A31A 5FUVA 5D8DA 1JIKA 5F35A 1MPTA 2Y2UA 3ND8A 4PZYA 2IP2A 1ZJYA 3ANMA 3MCVA 2AR7A 2ZUFA 6REQA 1L6IA 4X1KB 3LL7A 2IS6A 4DDKA 3CVXA 1M5TA 1KEPA 4CQMD 5CXXA 3IDOA 5JISA 1QHSA 3R3VA 2GEUA 2JI7A 4WVFA 4WNAB 5L3QA 3G5TA 4R83A 4D6YA 3O3MB 3IXQA 3B53X 3PXXA 4H3VA 2BTQB 1UDCA 3HNRA 1XTUA 3DAGA 5IEJA 4UEQA 3FWPA 2XWQA 2PBFA 1K88A 2Z58A 1X42A 3H83A 2Q1WA 5K7SA 2Y0DA 4CF7A 4EYEA 5EFOA 1FRFS 1QZTA 5AYVA 3AB3A 2GN9A 4KSYA 3TBKA 2Q6TA 1TA4A 1MVNA 1T0PA 3K1ZA 5CW1A 4KVGA 1CE8A 2J30A 3PUXA 2Z8YM 3RHSA 4FDMA 4OGGA 1IZ9A 2ODNA 3CBQA 1CNMA 3T4UA 3DTTA 3HRHA 4DIUA 4JDPA 1QM5A 4Q34A 3A1NA 1YE8A 4EUSA 4JUFA 1KC1A 3E7DA 4PONA 4ARCA 5IDVA 1QE0A 1VB5A 3EVZA 4Z9YA 4Y3UA 4ZYTA 3HJCA 2IZ6A 3HBFA 1XWFA 1SR8A 2EWMA 3H5NA 3KTDA 4P3YA 5EIBC 2YY7A 1VSVA 4UC0A 1PAUA 2GKSA 3GDGA 3MWEA 4MJXA 4E07A 4N3CA 1U1IA 1Z0JA 1G6OA 3FI9A 2N46A 4IQ0A 4KWTA 5COQA 3B1XA 3VO2A 4C0QC 4DA4A 1W36C 3PQ6A 4H17A 3P4UA 3PL1A 1X19A 1YS2X 2COKA 3NBUA 4LZLA 4D0GA 4Q4AB 4PWYA 4CN8A 5KNBD 4Q9JA 1ZHHA 4KYUA 4R1NA 5E8JA 4OXYA 1COWA 3HBMA 1XP8A 2DWQA 3G02A 4C5CA 5LD2C 3FLMA 4KIGA 1AKWA 2COEA 1ZGZA 2SECE 3GBSA 5LL6P 3AP2A 4WCVA 5JXHA 1J7KA 3DVRX 3ISVA 4KDCA 2WJZB 3WDLA 3LCJA 4Q4DA 2VSXA 1J2RA 4I50F 5JXGA 1Q92A 2ZVJA 3FPLA 1MOZA 2V4MA 3L41A 4F71A 3EUWA 3LT2A 3TZBA 3EPHA 2EEPA 3CV3A 2DR2A 5ALRA 3FBGA 1U65A 3CWZA 3LNCA 3NJRA 5DHUA 1UXKA 1U0EA 3P2EA 4COOA 4K6CA 1DG1G 1F8GA 3B8HA 3REGA 4MINA 1YMQA 1Q7CA 4JL6A 1NSFA 2EFDB 4PS0A 5A0FA 4F9GA 4MJ7A 5I47A 5B37A 1RKBA 3RGGA 2QLJA 4QO8A 3WNCA 5ICMA 2F55A 1JFVA 1FRZA 3FVWA 4QRIA 2C1XA 1XD9A 5EEHA 1OWOA 4S1TA 1C1DB 3D1VA 4MV0A 3IMKA 4QDOA 4QOIA 5ED4A 3KBOA 1X77A 3DLTA 3HJUA 5HP4A 4F4FA 4KUGA 1G7TA 1N0UA 4R3NA 4H0CA 1C3EA 4JQZA 3OAAA 3IOEA 1ECGA 5GJVC 4URZR