2ZIFA

Crystal structure of ttha0409, putative dna modification methylase from thermus thermophilus hb8- complexed with s-adenosyl-l-methionine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
270
structure length
239
Chain Sequence
VHRLHVGDAREVLASFPEASVHLVVTSPPYWTLPGQLGHIEDYEAFLDELDRVWREVFRLLVPGGRLVIVVGDVAVARFGRHLVFPLHADIQVRCRKLGFDNLNPIIWHKHTNPYEPGAIIKTEIEYILMQRKPGGYRKPTQEQREKSRLPKEDFHRFFRQIWDDIPPFPLELAERLVRMFSFVGDVVLDPFAGTGTTLIAAARWGRRALGVELVPRYAQLAKERFAREVPGFSLEVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative modification methylase
publication title Crystal structure of a putative DNA methylase TTHA0409 from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 75
structure length 239
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zifA00
2ZBPA 3KU1A 1AQIA 8MHTA 5ICCA 2WK1A 2C7RA 4WVLA 2YUIA 1P1CA 3KQQA 3A7EA 5EHGA 3MTEA 3AJDA 3T7RA 2UYOA 4AZVA 4PNEA 3TQSA 5EIWA 3HVHA 4MIKA 4HRAA 2V7EA 4P58A 3B89A 5FWDA 3BKWA 1X1DA 2AR0A 3LDFA 3LBYA 4AZWA 1JG3A 1V39A 3UJ9A 2NNWB 3ELUA 5DRTA 2GA9A 3BWBA 3DXZA 4C07A 4E2ZA 2PXXA 5F2OA 3G8AA 4PYNA 4Y30A 5CVJA 2EJTA 2IPXA 3VSEA 3SR4A 4RTKA 5H02A 1XVAA 5EEGA 5FHQA 1VLMA 1N2XA 4RTNA 2GLUA 1T43A 1H1DA 3DLIA 5GM1A 2ZIGA 3HP7A 5F2KA 2GPYA 5DX0A 2PWPA 3UA3A 2YR0A 2VDWA 3GU3A 4U7TB 2C7PA 3G5LA 2ORED 4R6WA 5KS2A 2PX2A 1M0EA 1XCLA 4C08A 5GIOE 1EAMA 3MB5A 3SMQA 1YF3A 4GOOD 2BR3A 4V0RA 1BKYA 3GRYA 2PY6A 2HWKA 3I58A 3PFGA 1L1EA 3ELDA 4P7GA 4CKEA 3A27A 4DZRA 2EFJA 5C9ZA 3OCJA 2ZCJA 2B2CA 3LKZA 2IIPA 3HA5A 3EGVA 2NXNA 2YQZA 3EVDA 3FUWA 3KPUA 1KPGA 5JR3A 2P8JA 4IV8A 1Q0TA 2IH2A 1N7JA 2ZTHA 3P71T 4E31A 1EJ0A 2Y1WA 2FHPA 2P40A 5FADA 3CJRA 1DL5A 1ZHFA 1VP9A 2O0LA 3OU7A 3RW9A 4UOEA 5K0GA 2AVDA 3EVZA 4GOMD 3CGGA 3DTNA 3KQMA 5GINE 5HZMA 3FYDA 5LQJA 1XDZA 2F8LA 1R00A 5ICEA 3M6WA 1WS6A 2HV9A 1VIDA 2PXCA 4GQBA 4KVZA 5EZQA 4E30A 4E2XA 4YUVA 4CKBA 4RV9A 3THRA 4DA4A 3KPYA 4FGZA 3DOUA 1ZG3A 1XDSA 2ZIEA 4RVFA 4NECA 3BGDA 5EVJA 1FP1D 3CVOA 1XCJA 2B25A 1OR8A 3FRHA 5DTQA 4XCXA 4BP1A 2IGTA 4RVGA 3KQYA 2OO3A 1M6EX 3P2KA 3ERCA 4BLUA 5FQOA 3TPZA 3MCZA 5LR6A 3HVJA 3E05A 1WZNA 1NW3A 1I1NA 5CVDA 4EK9A 2ZWAA 1G6Q1 3B3FA 3K6RA 4AX8A 5EMLA 4X60A 4QTTB 4LG1A 2CMGA 5FCDA 4C05A 1G55A 4ER5A 5EKUA 4MQ4A 5U4XA 4C06A 3FUUA 1WY7A 2G70A 1L3IA 5EC8A 5T64A 3B3GA 2CMHA 3V8VA 1JSZA 2YXEA 4X61A 1FPQA 3D2LA 4FZVA 2FYTA 4P7KA 5K0BA 3GIWA 4DQ0A 5FUBA 3GRVA 4XUCA 2PJDA 4AUKA 5EMKA 3KR0A 2IBTA 3EVBA 4OQEA 3DULA 4RWZA 5E1MA 1DUSA 3GCZA 1P91A 2ZIFA 3HCCA 3I64A 3UJ6A 3EGIA 3HVIA 4R05A 3GDHA 3HCFA 4RVHA 5K09A 4R8RA 4LWOA 4YMGA 1ORHA 2PVCA 1UWVA 3OE4A 3PX2A 4PCLA 1RI5A 3A25A 1XJ5A 3QOXA 5G02A 4RTOA 3CBGA 3R3HA 3FPEA 1NW5A 1NT2A 4OQDA 4RVDA 2AS0A 2IP2A 4L7VA 3A7DA 4PYMA 4QQKA 3EVEA 1SG9A 2OY0A 4QDKA 4RYLA 5EZSA 3ER8A 1YUBA 3GWZA 4YV1A 2NP7A 3G2OA 4PGGA 3IHTA 4QVGA 4F85A 3FUXA 2G1PA 4FR0A 5ERGB 4PIPA 1HMYA 5LQNA 3BWMA 3TLJA 5DSXA 3ER9A 2UYQA 4JXJA 2G71A 3EMBA 3NVKI 4BLWA 4PYQA 5CUQA 3MCTA 3B7PA 3Q7EA 1MJFA 4OA5A 5E9QA 3SSMA 2PX4A 3C0KA 2OB2A 4HGYA 2Y1XA 1IM8A 5FQNA 5DM0A 2HR1A 1ORIA 3HTXA 3L8DA 4YMHA 3G88A 1VP3A 4X41A 3LGAA 4EQZA 4RTRA 4KIGA 3LSTA 4LECA 5E9WA 4YUXA 5EHIA 4RTJA 3GNLA 3NW9A 2H00A 3BT7A 3TM5A 3R24A 1O54A 3EVCA 3G2QA 3NJRA 4FS8A 5M5BA 4XUEA 4ER6A 3HA7A 2ZZNA 3FZGA 3ORHA 2IDJA 2JH8A 3NVMB 3R0QA 4KRGA 2UYHA 2NXCA 2P35A 4ER0A 2IFTA 1VQ1A 2ESRA 2AZTA 1SUIA 3FUVA 4ISCA 2GB4A 2P3LA 3EMDA 1DCTA 2CWWA 3NWEA 2EX4A 3KQTA 3PX3A 5P8WA 4BLVA 1R8YA 1I4WA 4KDRA 5T6BA 4BP3A 3OZRA 3PB3A 3JWGA 2O07A 3UFBA 2I6GA 2R6ZA 5DX1A 3V97A 2PWYA 5EIFA 5LQCA 1QAOA 4GEKA 1EIZA 4HH4A 4A6DA 3EEYA 5EPEA 3P97A 4MWZA 1UIRA 2GAFA 3FTFA 3KQOA 4GC5A 2XYVA 1IXKA 1M6YA 2Z6AA 4HTFA 3CJTA 2JG3A 4OBWA 1Y8CA 3EGEA 4RTMA 4YV0A 2DULA 1D2GA 1TW2A 5HIKA 3C3PA 2IH5A 2QRVA 2VP3A 1NV9A 3Q87B 5DTRA 5HIIA 3S68A 5DSTA 4A6EA 3OE5A 1YB2A 3HCDA 3C6MA 3TMAA 3M4XA 4FSXA 4HTFB 3BWCA 3EVGA 3OZTA 3UJBA 3VC2A 3TR6A 4EMSA 3PS9A 4IV0A 4PWYA 4WXHA 2QRVB 5B1SA 1PJZA 2AOVA 3IEIA 5CIYA 1U2ZA 5ICGA 5LQRA 1YFLA 3G2MA 2ONZA 2XYRA 3EVAA 5BW4A 3DP7A 3DR5A 5HIJA 4FSDA 4PCAA 2BR5A 4O29A 2QY6A 2HTEA 1SQGA 2CKDA 2OKCA 2XYQA 3GXOA 4M7RA 2B3TA 2JHPA 4RSRA 1YZHA 5DT2A 5FA8A 1AQJA 5DRYA 1VL5A 2AOXA 4G56A 4EKGA 3KR9A 2I9KA 5F2NA 5DWQA 4AZTA 4GOND 1X1BA 2OYRA 2BR4A 2Q41A 1R18A 2VS1A 2Z6UA 2EJUA 3DMGA 3DMHA 3R6TA 4GBED 1O9GA 2PXAA 3DUWA 3MTIA 1NBHA 2FK7A 5LQKA 3LCCA 2O57A 1HNNA 3MERA 1WG8A 3JWHA 4X63A 1ZGAA 3BUSA 5KQSA 5GP1A 2ZBQA 3KPVA 2PT6A 1JTFA 3NWBA 3ELWA 2XVMA 5EMJA 5ICFA 3HEMA 4HSGA 1EG2A 1QYRA 1B42A 2OBFA 4CKCA 3BZBA 5T67A 3MHTA 4PINA 4U7PB 1RJEA 4V0QA 4M37A 3CKKA 3FRIA 4H0NA 3REOA 4DCGA 4RTLA 3P2EA 1R74A 5FTWA 2VZ9A 2R3SA 3SSNA 2BH2A 4LWPA 2AVNA 1SKMA 3FUTA 3OFKA 3G7UA 4RTSA 4OX9Y 2ZVJA 4E32A 1QANA 5D1HA 1ZKDA 3OFJA 3HNRA 1VE3A 2C7OA 3I9FA 2P3QA 3KQPA 2NYUA 4E70A 5LSAA 4QQNA 4F84A 2XVAA 1P39A 1KXZA 1N7IA 5DM2A 1NE2A 2H1RA 5K01A 3VC1A 5EOVA 3DH0A 2WA2A 3RIEA 1JTEA 2IH4A 3G5TA 2OB1A 2PLWA 4PONA 3KR2A 5DXJA 5CCXA 1X19A 3MGGA 3SSOA 3TRKA 1RJGA 1BOOA 5HOQA 1KPHA 2PKWA 2GH1A 4RX1A 2UZ4A 4MHTA 5D1NA 3FPJA 3O4FA 3NDIA 3P9CA 5HIMA 3LKDA 1KHHA 4QVKA 3TOSA 1D2HA 3C6KA 3QOWA 2QYOA 3LCVB 5E1BA 4EVIA 2G72A 4QPNA 3FYCA 2PX5A 2A14A 5FWAA 1SUSA 5HEKA 3UJDA 5BXYA 4X1OA 3X0DA 3HCAA 1P1BA 2B9EA 3LL7A 4EKIA 3SGLA 4OA8A 3CJQA 4PIMA 2BM8A 3I53A 1RI2A 1NW7A 1INLA 1KR5A 2YXDA 3TFWA 5K8VA 1YZ3A 3NMUF 5KVAA 4DF3A 1L3BA 1F38A 4QTUB 5LQAA 3GRRA 5EG5A 3ME5A 1KYWA 5BP7A 1L3CA 1QAQA 2G8NA 4M38A 3P2IA 4B17A 2ZULA 3MAGA 2O05A 3BXOA 3HCEA 3KHKA 3T7TA 5CCBA 3T0IA 1Z3CA 3H2BA 3TKAA 3DXXA 5GIPE 1WXXA 5FA5A 1UFKA 3G8BA 2DPMA 3AY0A 3GRZA 4ER3A 4DKJA 1G8SA 2XBMA 3DXYA 3P8ZA 4C4AA 3KKZA 1RJFA 4E33A 5EGSA 3E23A 1G60A 1X1CA 1XXLA 3FPFA 4P7FA 3UWPA 3A4TA 3F4KA 2FRXA 2K4MA 2JH9A 4K6MA 3I5UA 3SM3A 3O7WA 5IKMA 2ZW9A 1EJ6A 3BGVA 2P3OA 3FTDA 3P9NA 4HGZA 4KW7A 1KYZA 3OPNA 3LPMA 3EVFA 3JWJA 3K0BA 5K0NA 5HILA 4IKPA 2KW5A 2PV0A 3IV6A 3TM4A 3UA4A 3E7PA 3KQSA 2ZLBA 4POOA 2UYCA 1G38A 3HA3A 2E5WA 1EQAA 3GO4A 4QDJA 2BM9A 3BKXA 2PT9A 3LHDA 3LX6A 4MTLA 5LQUA 4PYIA 1MHTA 4FT4A 4DCMA 4ER7A 2HMYB 3FPGA 3ELYA 2EG5A 3THSA 1JG4A 4Y2HA 5K03A 2PBFA 1FP2A 2QE6A 1F3LA 5CVEA 2AN3A 2C7QA 2FCAA 4KDCA 5CD1A 3R9XB 3HCBA 3SX0A 2YVLA 3NDJA 2JHCA 1IY9A 10MHA 2YTZA 5DLYA 2ONYA 5IH3A 4XUDA 5KQRA 2YX1A 2N47A 5GM2A 2HNKA 3DMFA 5E8RA 4ZTBA 2NXEA 5GOZA 1TPYA 2PSSA 4M36A 4YUZA 5EMMA 2YXLA 3LECA 2FK8A 3HM2A 2ZBRA 2AOUA 1BHJA 3OU6A 2CL5A 3P9KA 3UZUA 4DMGA 3G2PA 2VDVE 3VYWA 1QZZA 3TKYA 1VBFA 1WXWA 2VDUE 4CXMA 5DPMA 1JG2A 1ZGJA 3AWIA 5E8JA 4Z2YA 4HC4A 2AOUB 2LD4A 1XDUA 1JQEA 1L9KA 3LDUA 1TW3A 1KP9A 3JWIA 3PFHA 3KPJA 5K05A 3OU2A 3IYLW 4GF5A 1NW6A 2PGXA 1JG1A 3GGDA 5FHRA 3E8SA 4PYJA 4PGHA 2ZZMA 1I9GA 2Z6QA 3FTEA 5EEHA 5EQJB 1G8AA 1RI4A 5BW5A 1KPIA 2AN5A 1NW8A 4E2YA 3O31A 3EPPA 4P7JA 2I62A 3M70A 3AXTA 3UJCA 3M6VA 2JHAA 5JUWA 1PRYA 2OPBA 5DTMA 3M6XA 4GUAA 2IBSA 1NKVA 5DX8A 1XTPA 1D2CA 2P41A 3A26A 7MHTA 3WSTA 1QAMA 5C0OE 3ID6C 5K0CA 1BC5A 2H11A 5CM2Z 4IWNA 5K0LA 2ZFUA 1NBIA 3AXSA 2O06A 4FT2A 4HG2A 4OBXA 4F86A 5K0EA 4PYKA 1O9HA 1RJDA 3LDGA 2BZGA 2ADMA 2ZSUA 3UJAA 4FP9A 3CC8A 2FPOA 3PTAA 1RI3A 1YFJA 9MHTA 4AZSA 4PYOA 2P7HA 1JQ3A 4R6XA 3RODA 4YV2A 2B78A 2P7IA 4CTKA 2PX8A 2V74B 2AOWA 4RTPA 2QM3A 3PVCA 3KQWA 4GC9A 5C1IA 1KIAA 2ZZKA 4C03A 3PLAE 2NP6A 3HVKA 1RI1A 1NV8A 3PT9A 3B3JA 5K0FA 3SVZA 3C3YA 3UJ7A 4KWCA 5KYGA 1R6AA 1R8XA 3DLCA 3M33A 1VPTA 3M6UA 4C04A 4YUYA 4YUWA 1JQDA 2ERCA 3SXJA 3NTVA 1AV6A 3BGIA 2P1DA 3T7SA 3UJ8A 3CCFA 3MQ2A 4PYLA 5HFJA 3KR1A 3KPWA 1SVUA 4GOLD 4KIFA 2IDKA 5E9JA 2OXTA 4ATNA 2I7CA 2WA1A 3LCUA 5K0JA 2JJQA 5DM4A 5FULA 3G89A 1SQFA 4QPPA 4R8SA 5CVVA 5E1OA 5GWXA 3U81A 3FPHA 4DM3A 5MHTA 1JSXA 1JR4A 2GS9A 2OZVA 5E1DA 5EKXA 1X1AA 1AF7A 2ZWVA 4E2WA 3B5IA 3GRUA 2AOTA 3UBTA 3LBFA 3FTCA 3KQVA 4CWAA 3QV2A 5E2AA 5CVUA 4BY9E 4RTQA 2NXJA 1Q0SA 3OZSA 3P9IA 4CTJA 3EEOA 1ZQ9A 3ANXA 5E2BA 5DXAA 3BWYA 3GJYA 5DM1A 1FJXA 1FBNA 2AOTB 2AN4A
chains in the Genus database with same CATH superfamily
5A7GA 2GCOB 3GDWA 3R3JA 2XIQA 5IX8A 4DLZA 4HMPA 4TWBA 3A7EA 5LC1A 3EEQA 3VVMA 5EJ2A 5ECDA 2Y0DA 4M0LA 3D8HA 5CIWA 3T7RA 4PX3A 1M2KA 4MIKA 7YASA 5BR8B 1NIJA 2VEOA 5FPTA 4BFXA 4FINA 2DBVO 3K0HA 4BDTA 4ZAVA 2WJHA 2ZPTX 5F3WB 1DMSA 4HAVA 4G0UA 2PGIA 3ANLA 3BWBA 3QPVA 4XVCA 4YCCA 2PXXA 3G8AA 3IKMB 5CVJA 1GG8A 2DUJA 3VR6D 2XQKA 2PPVA 1LPSA 3MJEA 1WTCA 1BXRB 4LZPA 1THMA 2QQGA 2V97A 3CT6A 4GAEA 3AWDA 3GJ4A 4ND7A 4Z3DA 1S2IA 1PVVA 1BEUB 2AEEA 3R7DA 3Q7IA 4XM0A 2ISSD 4G5OA 1XEWX 5CT8A 4AN0A 1J7KA 3F90A 4WCDA 3FPSA 5ADHA 4K6HA 5D3KA 2WSYB 3DDNA 4Y6OA 5L6MB 1Z62A 4BQPA 4MA0A 1LQTA 1DGQA 1NR1A 1IG3A 2CEAA 4TWAA 2W8BA 5T8KC 1V3UA 4RK4A 3IDQA 3OI7A 4LF5B 2OQVA 1YB6A 4RNCA 1IMJA 4OQYA 1YRWA 1AXRA 2KE5A 2LZ0A 3SYTA 2C54A 4EBBA 1V6AA 4S0ZA 3SVTA 1L4UA 2IOHA 3BG5A 3JYLA 4RMJA 5BOSA 3PICA 4Q4LA 2ZCJA 5BVHA 5TRTA 2FLWA 1IQUA 1YVUA 1LBSA 3ETGA 3BQ9A 3WAKA 4CLOB 1PFUA 1YU6A 4B71A 3ROXA 4DLNA 3UV3A 2X3FA 3I09A 1ID1A 2O0LA 4IHJA 4Q4JA 1V26A 5EWJA 4WNCA 4OQNA 5BORA 3VQTA 3TINA 4IJ6A 1KS9A 1AK2A 1ORDA 2CNNA 1XEFA 2Q49A 3DTNA 3PQ5A 2FZ4A 3RYFB 4OP3A 4EBFA 5HZMA 2QL7A 2HF7A 4HAIA 1R00A 5FNZA 4RY8A 1BZYA 4Z4QA 1ZOSA 4G37A 1IY2A 1VBKA 1ZU4A 2ZI7A 2WUVA 3QIAA 4J07A 5ICSA 2QLTA 1PG2A 3VKHA 1IMOA 5FBWB 4WOJA 1E4OA 3K9HA 4DN6A 3ZGZA 3RNLA 6LDHA 1EM8A 1UMDA 3SEQA 1JNXX 1H94A 3QX3A 2ZWOA 2VUTA 1BRMA 4XCXA 1MC4A 2XA9A 4YB8A 5BRJA 1M6EX 4HDCA 5LBTA 3WADA 4JQOA 3G82C 1D4OA 2RHDA 3IFSA 5IHPA 3R8FA 3G0BA 3FYUB 2HF8A 3PQDA 3TTXA 3AVVA 5DO9A 4LDAA 4NICA 2FVXA 3W6UA 4DSOA 4WW0A 3OEEA 1XD9A 5CT5A 4YAEA 3KB2A 5DOZA 2HW8A 1VFNA 1PR6A 2JIZD 1V45E 5T64A 3B3GA 3VYSB 3FAZA 1PV2A 3T5TA 2IYTA 2JLVA 5F35A 1WCYA 4OTZA 3L9WA 2FYTA 3MELA 4BRUA 1T0IA 3C5WP 3CW8X 3OCYA 4R8LA 2HDNB 5AICA 1JT9A 2FPSA 3AEQA 3HKDA 3RB8A 5AW3A 1Z82A 5IEJA 5KTRA 4OGKA 2CK3D 2WF7A 2YWXA 4RF2A 2DMRA 1H2EA 2FSUA 4XFDA 1IZ9A 1F0NA 1VPDA 2H4WA 2PLAA 2V4UA 3LRXA 4WESB 5B4UA 5IVPA 1KI2A 3HCFA 2ZYDA 3ON5A 1EGAA 4IIVA 4HPXB 1NSFA 3IGFA 4G8DA 4J1TC 5ALYA 1GTG1 3LK6A 4QNNA 3AESB 4YRNA 1HGXA 4RDCA 3FD8A 3KUXA 3DUFA 1ZU5A 2EIXA 3ER8A 2XR1A 1A9PA 3KEQA 5ITSA 4LN1A 1TKAA 1XCMA 1NN0A 2C92A 2VG8A 3F7NA 1M34B 3UW3A 2QS9A 4P38A 5T57A 3KEGA 3L8EA 1PDVA 2OGZA 1U1DA 1KZHA 3LCMA 2GYVA 3KZCA 1KI9A 3VOSA 3ER9A 3LUCA 5IZCC 4IIDA 5CLLA 1J09A 3R5XA 4YQZA 3VNQA 4B87A 1UJ5A 4N5LA 4C21A 2FOLA 1X9HA 4B74A 3SSMA 4DGSA 3C0KA 1Z5UA 3M8KA 3NEPX 4RY9A 2E9SA 2XQIA 2WG1A 2DQSA 2O20A 4BCDA 2JDIA 4BNDA 2PJRA 5FO0A 3Q88A 2TMDA 2AW5A 4TZKA 1F06A 4X41A 2YJ3A 3OHPA 4MV9A 1X3LA 1W5TA 3DKIA 1IY0A 4KE6A 1MIHA 1JF8A 2WJ6A 1U8FO 1NP3A 4EI8A 1T4BA 3MPUA 4KFCA 4PQGA 4MVJI 5CLHA 1T3ZA 3NVMB 1PWXA 4HN9A 2HD4A 3KAJA 1XHEA 4EY7A 3K4PA 5C4IA 1X39A 2O7RA 3LQKA 1XMJA 3EEFA 4OQXA 1LUAA 3IAS1 1QS0B 1J5EB 1J2TA 4RELA 4DARA 4DXAA 2DOKA 4M9CA 1EDZA 1JHUA 2HBYA 4MUNA 1HORA 1JAIA 2GZHA 5L3RA 4RQUA 2XOXA 4L22A 1XDDA 1Q1AA 2AEFA 2WJVA 1FXSA 3A4IA 4MCHA 3EEYA 4KR0A 5KU1A 3C5CA 4HXYA 4B73A 5FOTA 1EZZA 2XYVA 2YY7A 2Q5HA 1M6YA 3R6GA 1NASA 4ZALA 1MJ5A 3CJTA 3VR5H 3IQDB 2VNAA 2JG3A 3ABIA 1GIAA 5AVWA 1D2GA 1DOAA 2M9MA 5EHNA 3C3PA 3GMSA 3O73A 4EECA 1Q1EA 2P3SA 1SZJG 2WTNA 4MUXA 2B3DA 3ONEA 1MC1A 4MV4A 1E4VA 2IXDA 4CDRA 5I9LA 5F1KA 1DKRA 4E4RA 3WRVA 4M0DA 5TLSA 1WXFA 2R6JA 2PZMA 3OWOA 4FJ1A 3UMCA 2RSLA 4WX2B 4NULA 5DYTA 3UICA 4ZOAA 3WLOA 4D82A 4KDEA 4CF7A 3L4SO 5FLEX 5JROA 4PPGA 1UBKS 1RWBA 1PAUA 2ONZA 5HKBA 2WUDA 2E4AA 2Y71A 4PIVA 1N77A 2BR5A 4UM5A 1RSZA 1PKEA 1SQGA 1ZONA 2JD2A 4JLAA 2PN1A 2JHPA 3O1IC 5DI9A 1YO6A 3RS0A 4H3HB 3WMRA 4DCSA 1SXPA 1H6CA 2B8NA 4W9RA 2W22A 4UJ3A 4IPTA 5IT4A 4YFVA 5DWQA 5JDCA 4MDYA 3H65A 1ISPA 5B2FA 3AR7A 4IDCA 3AB8A 2M6KA 3LC0A 3QKSB 4B34A 3MTIA 4B4KA 2OG1A 3IQZA 1KEZA 1N2BA 2ORIA 1HO3A 2KB0A 3V1NA 3AL3A 1CX9B 4RJLA 4W5QA 5T41A 1NOIA 1UM9A 4O4IF 5IHXA 3DVAA 2NO5A 1KEKA 3HEMA 3BSSA 2PTHA 3SLKA 3N5CA 4OQZA 1B42A 1Z15A 3F3SA 3IVCA 4EOGA 2QK4A 1BJTA 5CURA 2I66A 1G6KA 4I2NA 1EB9A 3CXUA 4RKYA 2ASVA 3ULKA 5BWMA 1J20A 2W6IA 1T2NA 1NPYA 3NR2A 4MVJA 4HGRA 2A58A 3GUVA 2ZWMA 3QA3E 1NLZA 2HRCA 4U7FA 1N2CE 4TN5A 3V1TC 1WMBA 2FE1A 3OFKA 4MRMB 3DYVA 4AC9A 3DOFA 4YAKA 1FUKA 1P1IA 3IOCA 3TBKA 4E32A 4MZXA 3DTTA 3SDSA 1HDEA 2A84A 2OD7A 1IHOA 1WNTA 2HSZA 4R01A 2CL7X 5K2OA 1XQWA 1R9JA 1SCAA 3HUFA 2WYOA 4QQFA 4DT1B 1IUKA 3EGXB 4X7MA 4K9PA 1LDGA 4NMMA 3CEAA 2B5OA 3T1HB 4IOLA 1JTEA 3U3JA 5LDHA 1NPDA 3OEHD 5CB0A 4QRIA 5DXJA 5JO9A 4KQEA 1GTJ1 3RT1A 4QRDA 1Z68A 1KI6B 3A8TA 3KZNA 2HXGA 1NF9A 1TB4A 3IULA 1ZY2A 4MHTA 1RM0A 3T3PB 3M2TA 5DLEA 1GUAA 1VSBA 2FG7C 4KQ6A 1K7CA 2YC4C 5FWAA 1K8QA 3EH2A 3P2YA 2JLYA 2O8DA 4KI7A 4PRYA 3AIKA 2C4HA 3G0CA 1YZKA 1QHXA 2GN9A 3MB8A 3OIFA 2HDOA 3NBYC 4V0KA 3AGPA 3ZH2A 1KR5A 1CJSA 5SV2A 2DFPA 4IIYA 2VDLB 5LQAA 4QTUB 2BT4A 4KO3S 1UBMS 1ZN2A 3LNTA 4H27A 5AVXA 3BMOB 3RTCA 4ZKEA 1K7EB 3G6KA 3UC9A 1OSNA 1VYTA 2G82A 1KBOA 4E4YA 4P98A 3V8BA 4MKRA 3FVRA 3WO1A 5CB4B 4I55B 3KC2A 1N6LA 4Y0NA 1OWLA 1VPLA 3WOVA 4ND5A 2FN9A 2VEDA 4XVQA 3RSGA 1GSOA 1ODCA 3KX2A 3BXPA 3AVOA 3N8KA 4U0KA 2AV6A 2GMWA 1POWA 3A4TA 3CW9A 3IV7A 2FRXA 3RC9A 4EM6A 3KEMA 2JH9A 4HRVA 3I5UA 4KO4S 5D6OA 2EP8A 2VP5A 4TKUA 3TLAA 2QD1A 4HX2A 2REOA 4MVYA 2XGGA 5ER9A 1I80A 5C4GB 1DPFA 1QIEA 2B6HA 3CW2A 2GK4A 1T1IA 2GBCA 1TYEB 1M2JA 3H9CA 4F92B 3LTNC 1XFAA 3CX7A 2KW5A 3PYMA 4MI6A 2HOQA 4HGOA 1Q19A 4XQ9A 3CTPA 3TBFA 4ALMA 4MDFA 1WUHS 1AF4A 3DL2A 3F6YA 4J0DA 4AWBA 1NUSA 2FN3A 3G59A 3MIIA 4K8OA 4TLAA 1JDBC 1XEXA 1PGQA 4DCMA 3QE9Y 2HU2A 1MHTA 1NUAA 1Z5ZA 2F48A 3AVQA 1CEEA 1J00A 2PUFA 1BXKA 2FRDA 1WKCA 3R77A 4M60A 1MFZA 4NL4H 4YLGA 1F3LA 4DCTA 2RMKA 5TMPA 4Q1AA 4HAXA 3GBSA 5F1YA 4LMAA 3KL4A 3SX0A 3E81A 1P9NA 2L17A 4WK2B 1FEZA 3PR3A 1H0RA 1EI9A 3TRHA 3F4BA 4NQZA 2D7JA 2W9XA 2HCJB 3ZE8A 4AUNA 3RANA 2QTFA 4CFZA 1A82A 4M7OA 5HM8A 1Z5GA 1DBIA 4M36A 1C9NA 3KO8A 2XTNA 3WKBA 3IKJA 1VKNA 5ESXA 5G0TA 3WWEA 1ZN9A 4OJKA 2Z2YA 3UXMA 5GJVC 1V6CA 1VCHA 4D44A 4LA4A 2IOFA 2FKAA 1RVDA 5G53C 2X7JA 3D8RA 3BSYA 3PHGA 1GDDA 4RHXA 2Z2IA 3TKYA 2P2SA 4WFIA 2QDKA 3W7BA 3PL1A 1TQ6A 2X76A 1W30A 4INOA 2ES4A 2WU0A 3OC0A 4HC4A 4A16A 4V0NA 2HNAA 2V59A 2AWNA 3U62A 2O19A 1NWCA 3VRHA 3GZNA 5KNDH 3VNBA 4FFBB 3L8CA 1WU8A 2V7XA 3V8QA 5JYBA 3FWKA 5JJCA 3JASA 3Q3VA 1VOTA 2P1ZA 3HZOA 4JWTA 4XKJA 5EUQB 1GFWA 1QIFA 3GGDA 1W1IA 2E82A 2XGMA 3LOPA 5IM5A 3VTZA 4BASA 1JB1A 5HCNA 2H57A 3AB7A 1MZVA 5BW5A 3OX3A 2O2JA 4E07A 2CJWB 2OYCA 5E4JA 2PCJA 1UQRA 4Q01A 4TXLA 3UCEA 2I62A 3VR3D 3KB1A 4KQIA 4L9SA 1FW8A 1IPEA 4EATA 2L42A 1AKWA 1W9MA 2UUOA 5KCZA 4F8YA 1SD2A 2W11A 3CE6A 1ZHOA 4JGGA 2BC9A 1L7EA 4EIWA 4H7EA 2XF8A 1WP4A 4LBVA 2EZTA 8LDHA 3WMXA 4EA8A 3F6SA 1D04A 2CYBA 5AK4A 1U2PA 1MX3A 4JAVC 1Z2EA 1QGAA 3GVHA 5DZSA 2RG7A 4WGGA 2EYQA 3T38A 4O4JA 3G9TA 5J3JA 1YFJA 1L4NA 4H0CA 6ADHA 5DT9A 2QKYA 3STWA 2Q28A 2OV4A 3OZVA 3SKXA 1MA0A 3LUHA 1U2TA 3W6OA 7ABPA 4PLHA 4FR2A 4HK4A 4BKPA 4YJKA 2EGUA 1Y3FE 2ZCVA 5B30A 1C7RA 4BGDA 2QR2A 4D8VA 4FYPA 3ABOB 1N7GA 3EA5A 2ZAYA 4LJ6A 5AQEA 4EQ6B 3C3YA 4MVJF 4EG4A 2VP0A 4G1BA 4YGXB 2ZG6A 1FTNA 2PH3A 1I2DA 1SJ9A 2GLTA 1GKYA 3BDAA 3JALA 4W6ZA 4U2KA 1XZFA 4I4LA 2PLNA 4B9AA 3OIVA 2FW0A 3BGIA 2XMPA 3N76A 2FMIA 4O8ZA 5J5CA 3EZGA 5J5AA 4BUZA 5CNIA 1G3IA 1A4XA 2BFAA 1R4AA 2SCUB 1E9CA 3L1VA 4IUCS 3P4XA 4OHWA 1J90A 4V38A 2W70A 3GLIB 1OC4A 5JI2E 3K0FB 3IPLA 3NBQA 4LDPA 3HDTA 4BC0A 2HQBA 3UATA 3F5DA 1W29A 3G9UA 3GR6A 1C30A 1MIOA 2EOAA 2BY4A 4E1BA 2XA2A 2QROA 3LBFA 2JGNA 1P4GA 1FSZA 4D9GA 1CC1S 3NRCA 1P1RA 1YZUA 1N4DA 1HYHA 3SNKA 1DKQA 1GY8A 3GMDA 3NHPA 5CM9C 4ZHQB 3WLSA 4REOA 2V98A 1DLJA 2CLOB 2FZGA 2EEZA 2WJPA 4D4IA 2O5CA 4NZMA 1XU4A 1C8BA 2GFQA 5ICCA 3EXG1 4WVLA 1L4HA 1SCDA 2D2VA 3JSAA 1ZEMA 5HBGA 1BQEA 2QENA 2NUAB 3WXBA 3OZIA 5HVNA 3TQSA 2O2SA 5K3CA 3UXEA 2XGOA 5B3JA 5J4LA 2EW1A 1BAPA 2J67A 5FOUA 1IIRA 2AR0A 4BGIA 1XDGA 2HIGA 4BO1A 3ACDA 4C4OA 2NNWB 4M86A 4YXWA 3IB3A 1YE3A 4ZXPA 2OORA 4Z8YA 3N2IA 1G5PA 3U60B 5DNCA 4MWOA 3PL5A 1XVAA 1FYXA 5EFZA 3NG1A 3JRWA 2B0JA 1DEKA 2B1JA 3ICWA 1Q11A 4DJ5X 4CL2A 5BSUA 2IGBA 1DG3A 1IOWA 2R97A 4GI5A 1KY4A 4BHTA 5ALHA 2G0NA 3FHOA 4CR7A 3M1LA 5JRDS 4XFJA 4A1OA 3WBFA 1YQUA 1ZGHA 4RZQA 1HZZC 1XCLA 5ARCA 3ZQ4A 2G9UA 3UMFA 5HX7A 3B9PA 4IMIB 2GVZC 2V4MA 3QU9A 1SCQA 4BVLA 1ZJ6A 4UBMA 4XSHA 1AKTA 3BREA 2H65A 3KZMA 421PA 4NNPA 1N5LA 3ZXSA 4D0LB 1QHYA 2TMYA 3QPCA 1WV0A 3MW8A 2BFDA 2X5KO 3OCJA 3SGLA 2K7FA 2IIPA 2QZ9A 2RG1A 2YQZA 4QJ3A 1KPGA 1YTLA 3VJMA 1T1SA 4CV0A 5FPPA 4WFKA 3RGWS 3P71T 1M2EA 4MUEA 3WGLA 5K0ZA 5L51A 4CVNA 3QRWA 1KAQA 3NGLA 1Q1ZA 2QMUA 1A8UA 1AXEA 2P40A 4QJIA 4TTIA 2Q6VA 1V96A 1FX0B 4ZGWA 1VJ5A 3WKAA 3OU7A 1CSEE 4MW1A 4PS1A 3TZBA 5KQMA 3PE3A 2ZUEA 3CEHA 3DDUA 1U5CA 2HJWA 1AQ6A 5BR7A 1T35A 2SKEA 4UE3S 3C1AA 3K35A 2D0DA 4Z9BA 5JD5A 3E70C 4E2XA 4DUGD 2V7VA 3VUEA 5LD2B 2VJMB 1ISHA 3A6KA 1SQ5A 4HWOA 4LXXA 1IJEA 4HJXA 3WGGA 4E13A 3A4NA 2Q7DA 4FGZA 5EMHA 3GVCA 2J9YB 3CTMA 4OJYA 4OU5A 5KB3A 4NCHA 2M98A 3LHKA 4DIDA 2X77A 4L2IA 3WGJA 1JVNA 4RVGA 4NABA 3PLNA 4FKMA 3HP4A 5GGYA 1EFPB 2WBLC 4WERA 4XR9A 3ERCA 1W85B 3WKCA 2BEWA 2BHNA 1CZNA 1T5OA 1KL7A 5B1IA 1JEEA 1Q6YA 3EZYA 1QO7A 4WAUA 3H16A 1G6Q1 3VDQA 1YS2X 3ND9A 4LK2A 3DWIA 4PZDA 4NC9A 1Y9JA 1QIIA 1MDBA 2RGRA 5KQGA 4IDFA 2H85A 1ZMXA 1T5BA 2R8OA 4R2LA 3V32A 4RMIA 1UPAA 1WY7A 4NCNA 4DUZB 3A2KA 2JCBA 4O02B 3L7CA 4ZO9A 1V8PA 2D3WA 4OHOA 4RJ2A 2EKBA 2JLXA 2J4CA 2CBXA 3AW9A 3ENVA 4MO2A 3R41A 4LZOA 3VZRA 1EEHA 5K0BA 3Q8LA 4MEBA 1KWGA 2YJZA 1II9A 1KF0A 2OAEA 3AYZB 3DBLA 1UBGA 1Y81A 3FROA 2XW6A 3TDMA 2GPNA 5AKHA 4C6SA 3AETA 3DULA 3BPSA 3EY4A 4GH5A 1SZPA 4NS4A 4D96A 1GPLA 4KL8S 4MWTA 1H0HA 4ZVSA 1P74A 1VPVA 2VLIA 2VNSA 3B9BA 2OKGA 2Z5LA 4TMVA 1PUJA 2XD4A 3LU1A 3W6ZA 2DETA 4OH7A 4G8BA 3RRJA 4WNAA 3EDMA 3CIOA 5KJCA 4KIUA 1BE0A 1U3VA 1AC5A 3A7DA 3RUHA 1LDBA 2F7SA 1LC0A 1JR2A 1HE5A 3NIDB 3QLUC 3GWZA 4ZQHA 4YV1A 3H04A 2ZSKA 1NBAA 2IT1A 3NTUA 4C5AA 2NTNA 3V8NA 3O8OA 3FUXA 4FR0A 3EPKA 3DEZA 1OI2A 3DMPA 9LDTA 3W8RA 3UHPA 1C2YA 5HF5A 4RVNA 3E9EA 3GJ7A 2W7TA 3GLGE 1TYBE 1F5NA 2QN8A 1YDHA 3AY3A 3PIRA 4G1EB 5BN3B 4B84A 3MCTA 3MFQA 5AKGA 5SICE 2C03A 4BYMA 5LLDA 1CP3A 4BQIA 4Q9KA 2IWHA 5K3DA 3K32A 1MQSA 2O8BB 4Q05A 3WE7A 4GMHA 3GIDA 4GLLA 4F5YA 1J2UA 5LKAA 2HR1A 2OT3B 2W4MA 3S7TA 2W6JD 3UWDA 1JQJC 1BKDR 3G88A 5AM2A 2WAOA 3NBAA 5BT9A 1NX9A 2JFNA 3BK7A 4QHYA 1CUAA 2EFEB 5KC9A 1ZZEA 3LO5A 1ACJA 4JP1A 4PSAA 5TVGA 4JJKA 2IPNA 3ZLJA 3OX2A 8ADHA 1UOQA 2ATEA 6YASA 3VPDA 1J8FA 4BVEA 3E9CA 2P35A 2ZI9A 4H60A 5JCOC 5BV0A 4I2VA 4NYIQ 4Z1MA 1I4EB 3GRKA 4DLRA 1BGXT 4JJ7A 1D2MA 4M7PA 2AR9A 4C43A 5P8WA 4C6TB 5D85A 5HRAA 4MQMA 2HMTA 2JD0A 3JWGA 2FP4B 4G25A 1YL5A 1P7YA 3KWJA 5DEIA 1R5NA 2QLJA 2C4KA 3WRXC 1KC3A 1QVZA 3BFXA 3ABZA 2FR8A 2CFCA 4RFVA 3ZIAD 5A0VA 4BO5A 1U8YA 5DBOA 3L3BA 4OB7A 1CJMA 2HPZA 1N1DA 2ZB3A 4TSRA 1RQLA 3HEBA 3E7FA 3MFYA 2HKIA 3S28A 1S3GA 2AD1A 1CVRA 3AU9A 2Z6VA 1OLXB 3GBPA 1SIBE 1OXKB 4KHPB 4DSNA 3I76A 3LPDA 4E5KA 1IE3A 1PZXA 2D1SA 1H1LB 1KEEA 1K5DA 4CZ2A 2MSEB 4DQLA 2BFOA 1VJCA 2AOVA 2P77A 2C4NA 3O83A 4K3UA 2CVQA 4LHXA 4NENA 2CNDA 2P5UA 3L0PA 4P8RA 2VDMB 5SY9A 3TAXA 5HIJA 4FSDA 2WTBA 5JANA 5BVGA 2PO7A 3F47A 1NDQA 2XT6A 1D4AA 1UXJA 3N8GA 5THQA 5BN1A 1BVYF 4QWMA 4O25A 4TPKA 4ZCIA 1TVEA 1FXWA 1Z75A 1QIGA 2NSDA 3HJUA 1K2VN 3T5BA 3PC3A 1BYUA 1UP6A 2DCUA 1NR5A 2O57A 4MULA 3RFTA 3TTYA 4ZICA 4F5EA 5KSZA 4TM8A 1TFRA 2Z83A 1BQ4A 2F8MA 5EN4A 2VT3A 3NWBA 3EIEA 4J16C 4TTPA 5F3RA 3L7AA 5ICFA 7REQA 4KK3A 1SUWA 4J0GA 4RKQA 3IPCA 2OWEA 4MX8A 5IT0A 1SM4A 1KYVA 4WBSA 1W46A 2Q4DA 4B3CA 1W2HA 2QVLA 1O94C 1PE0A 1ZUWA 2HMWA 4DCGA 5GTDA 4ZEVA 3I5YA 1XWWA 3ABSB 3W8FA 5DYIA 4UNIA 1QOPB 4CMEA 1Z17A 2HHAA 4NE7A 5AI9A 3FUTA 3O93A 2OUIA 4RTSA 3JYQA 3P0IA 3VR0A 3PA6A 1P73A 3EVTA 4UOQA 2C00A 5D1HA 3WFIA 1E69A 3AF1A 3GPDG 1VE3A 4KLNA 5JAIA 1CDOA 4AQ7A 1R2QA 1S1CA 2ZYIA 4MI1A 1NULA 1GU1A 2YWHA 4J1NA 4DIUA 3ANMA 1WKVA 2PIDA 4YONB 3UFXA 4I4TA 1JDUA 1NVVQ 2H1RA 3LQFA 1UP7A 1Z33A 3JAWA 4H6PA 1H1TA 3F6CA 3FNEA 4NATA 3KT6A 1ZIDA 1U5AA 1CY1A 2A0UA 2FP3A 3AHIA 6AT1A 1M0SA 3IXQA 1VMKA 4Q9HA 2HGZA 2PKWA 4PHFA 3O2SB 2UZ4A 2E85A 5A4JA 2W6PA 5EP2A 5CDGA 4TMZA 3O4GA 4X20B 4QUEA 4LF6B 5AXCA 1LBIA 1AO0A 3EZ6A 5HEKA 5KZMB 2HI0A 3ADPA 3U3ZA 1QRTA 2DWQA 4F3TA 2EZ9A 3PIIA 4DSZA 1AQUA 4FYVA 3TFWA 4CM4B 1J1IA 2OAQ1 1YZ3A 4BV2A 4TZ6A 2Y8EA 1C9DB 1US8A 2BHSA 4MJ7A 3EAGA 4ZT3A 1Y9ZA 3T8YA 2NWQA 2AL7A 3IUSA 4HQKA 3RU9A 5HKOA 3B3QA 4RF4A 1F9AA 1LLQA 1V3TA 3T0GA 4NR0A 3WO0A 3Q2OA 4BEVA 5JYCA 3BXOA 4QOSA 1ADJA 4EG8A 2QT0A 2ZBDA 2CHGA 3BTSA 4L8GA 4I7EA 1J9EA 1WMEA 1ZQ1A 2XWPA 1E7RA 3MC1A 1JE0A 2C8VA 2INGX 1TIBA 3FZQA 4CG0A 4DCNA 1L5OA 1U1CA 3PDCA 4CIWA 1RJFA 1Z73A 3QELB 4EI2A 4XR4A 2WV7A 1NAIA 3LLUA 4CMJA 3H9EO 2FLVA 3LUFA 4BMYA 2V7GA 4M1WA 4JUBA 4M9ZA 3IVXA 4OYHA 1CJKC 2QQ5A 1FQOA 2CXOA 2PH1A 5BN5A 4P3XA 4KN8A 2VPQA 2NG1A 3IP5A 2QVCA 3ZE2B 4C7JA 3A05A 2XB4A 4G5YA 3TTTA 2JLRA 3F1LA 2BUBA 2PV0A 4LNHA 3UA4A 3K31A 3NAGA 4CCAA 1ZCJA 2QD4A 4JKYA 1TYAE 2K5UA 2BM9A 4FFDA 4W5TA 3KDAA 3MIZA 4QDZA 1CULC 4XE5A 1YDGA 3QVGA 4X7PA 1E3WB 4ZAGA 5L3ZA 3UO8B 1MQAA 1VLLA 1DFIA 1P2UA 1Y6QA 4CU2A 5HS4A 1F2TB 4WBXC 3THSA 1QR2A 1FLDA 4DMMA 1Y3AA 3U09A 5FPQA 2XRFA 1VHWA 3BMQB 3IEMA 4B09A 1Q44A 3ZCXA 3BQMB 3F6EX 1G5TA 1BS1A 1E1CB 3FJYA 4ZVKA 4D79A 2HNKA 4K6GA 1UP4A 2AHOA 4JIMA 2NXEA 4WXYB 4AUMA 3MJRA 5A02A 1LH0A 4Z5XA 1L5FA 4PY2A 1ORWA 2R6CA 4N7MA 5LYJA 4EA9A 1RXSA 1H2BA 1Y8RB 3A37A 4NK5A 4NBUA 4RQAA 2JAUA 4DADA 2AC2A 5AUQA 2O0JA 3C8ZA 3FCSB 4KPUB 4BCCA 4DSTA 1H2AS 4JJIA 3SE0A 5F9FA 5HRCA 3PCTA 4BN0A 1KSFX 4B3BA 4WZAE 1Y8ZA 3OCCA 3SC4A 4ZGGA 4KQKA 3JQQA 2LD4A 3N70A 2W2KB 4TTAA 3U3MA 3GV0A 2WU1A 2YV4A 4ACAA 3Q85A 2REXB 5ITWA 4FXPA 4EB6A 5AJUA 3OF3A 1PV1A 3V46A 2DPGA 4NTZA 5K05A 2ZYAA 1GUDA 3N2GB 4GX2A 3FSJX 1ZITA 1Z2NX 2CF5A 5IJ0B 1WEHA 1JR3E 3OCZA 4L3VA 2OAP1 3VI4B 3O3CA 3D3WA 4C4PA 5BNWA 9GPBA 1GPJA 1OXXK 4RLSA 4OLHA 5KINB 1CQZA 1MC5A 4GRIA 3RUCA 2AN5A 4NYJR 1TUBB 1M2FA 1T0BA 3UV7A 3R2JA 2PFSA 1FRFS 1I3LA 1P4SA 3M7IA 1SVWA 4NDZA 4RZXA 1ZNZA 1N5MA 4E4TA 1WQ3A 5F78A 4KR2A 1T5IA 1JKIA 1Z4OA 3CE9A 1NLYA 1LLDA 1XVIA 3CRVA 3LPNA 2R87A 3MILA 1AU9A 4MB6A 4EELA 1JDPA 4LDQA 1P44A 3PIDA 3QXCA 1E3EA 1RDFA 1UMBA 3N0TA 1OAOA 2H2AA 2XDWA 1XZMA 2H2FA 5ALOA 4YRFA 2Y0PA 1MOPA 3GW8A 1Y5IA 2R62A 4HEA6 2FY8A 2VYVD 4ASUA 4CTKA 3PX7A 3I4CA 3Q3CA 1E5LA 1XGKA 1ZSVA 2AT1A 4JI3B 1YOVA 4EGAA 5JFOA 1BN6A 2V7WA 2H2IA 2VDJA 1VI2A 1M6WA 1KIFA 3B3JA 3IEPA 4JITA 3VR1A 1LRKA 1GEEA 4D46A 5HQ3A 1GUFA 5JTUA 4B76A 2B2NA 1B7GO 1Q7EA 3LYAA 4IIXA 4Q3OA 1C7JA 4JJAA 3W3ZB 3WLEA 1ID8A 3UN1A 3VPAA 4NV0A 4D0RA 3DKPA 3I72A 3EGDB 2H1OA 2QNIA 5JG7A 3I1IA 2QRQA 2ZSEA 1CNFA 3WB9A 1QGUA 3GG9A 4WPGA 4LC9A 1E9VA 3BEDA 1AM4D 2GCNA 3ODGA 3AERA 3PFFA 4NFHA 3G89A 2XB6A 4R8SA 3S1AA 2GS9A 3VSDA 3G49A 1V7ZA 2Y2UA 3LY7A 5F5NA 4KLRA 3ZWCA 4FHGA 2QX8A 3CN9A 1W2GA 3P9PA 2JAWA 5CVUA 3WV4A 2NXJA 4HAUA 4IDDA 3P9IA 4PZYA 4UTVA 5CXQA 2X9GA 3K4QA 4LI0A 3TGPA 4HDNA 3MOGA 2VXYA 3G0OA 2FHSA 1AT1A 4O1IA 5TC4A 1ECGA 4JI1B 1ZNYA 3ZWDA 2C2WA 2O9JA 2CGEA 3HCOA 4DQDA 1K7YA 2EKLA 5CCDA 3DO5A 3IKTA 1IY8A 1XNJA 4PNEA 5LFAA 3LHSA 2G17A 4D45A 3MJFA 3SJAA 1NQUA 1SU4A 3DAGA 1T0PA 4YJ3B 5IMBA 3IO5A 3EAQA 4LXHA 3PGMA 4CF6A 5KJ6A 1USVA 2POQX 3FNBA 4YVFA 4F06A 3HYSA 1MABA 2JRLA 4FYYA 5HFAA 4REQA 2B37A 5AK5A 4ZJZA 5FAKA 3Q8MA 1VLQA 3JWEA 3VSEA 2QSJA 4ITUA 5JAOA 2ZCUA 4ZHQF 1OH5A 1M6VA 4CM3A 4PBTA 3ZJVA 1VLMA 2Q45A 3FCCA 4C0HA 3G79A 1T4CA 3K9QO 2GLUA 1BXGA 1XJQA 3DZ8A 1ESDA 3IMEA 3KT0A 3QMPA 4J03A 1OI7A 3ROTA 4DE5A 4X5OA 3ZHRA 1TU0A 2FFRA 4G09A 2ECKA 2ZKIA 3JQFA 4EHHA 2AI1A 1Y8QA 1SCJA 2IBMA 5D3MB 3TMKA 3WSWA 2YZKA 5IC6A 1C29B 3PKJA 4WMLA 1CBUA 1W87A 3SMQA 5CA0B 1RD4A 1BKYA 2PY6A 3H86A 4R8MA 4X1IB 5KTKA 3SF8A 4BX3A 1RBQA 4I4IA 1GQSA 4ZTUB 3L9XA 2C77A 2EFJA 1ZYUA 3AOEA 2J6IA 1GKKA 4EX6A 2R66A 1NI4B 2AYXA 2PMBA 3AHGA 3CN7A 3DKKA 3SK0A 4TV9A 4BE4A 1SCKA 5KUTA 3FKSD 4HEHA 2J0SA 4IFBA 2C88A 5DGXA 4B43A 3BDVA 1POXA 4EKYA 5C8ZA 1XU9A 2PBZA 1T5HX 3VU9B 3KBOA 2C29D 3PBKA 1MNQA 2CXXA 2R44A 4L9AA 2JFXA 1H2ZA 4JYPA 4S24A 5AI6A 3IIKA 5F21A 9ATCA 3PC8A 4RLQA 3PE4A 2VI5A 3H0KA 4G86A 2Y4OA 3T4EA 3WFJA 1O8BA 3KQMA 4Z4EA 4LOHA 1WB9A 5KQPA 1L4LA 4CRWB 4QL3A 1L7PA 1XZKA 2BMVA 3M6WA 1BWSA 4PHGA 3EARA 2XCSB 4JXXA 5JSFA 3QTLA 1USIA 1QB8A 3GH3A 1ZHHA 2HHJA 2PZBA 1D0IA 3ZX4A 4D81A 2PR2A 2YZ2A 1XDSA 3K16A 1QE3A 5EVJA 2I6FA 5CX1A 1Z28A 2I6SA 3FOWA 2BKXA 4BP1A 1UBHS 2ZRLA 5TT1A 1NJSA 2PKRA 4AX4A 4QDUA 1T2CA 3TPZA 3TE7A 1N8SA 4QUJA 1JN0A 1TO2E 3OTOB 1LA2A 3KUDA 4ZRMA 5IAGA 5IVHA 3K9WA 2AFHE 1FRNA 3UHAA 2G0TA 2Q27A 4HZIA 4OMDA 5FCDA 3ZTWA 5JTTA 3C87A 3CVXA 1K6XA 3QY9A 4RZ3A 3S2EA 4C06A 3FUUA 5TEVA 5EC8A 3O9ZA 3FKJA 5IKEA 3AONB 2FXVA 3FE2A 1N8NA 1SUDA 1JHZA 4UBLA 1GCAA 1RQ7A 2GI4A 3TAUA 1UJ6A 1XA4A 2PFGA 2BDEA 4G3XA 1JKJA 3OJWA 5DGHA 3TDNA 1XN4A 1UC8A 2VAPA 3RIHA 5CFRA 1G8GA 3SDZA 3OUUA 1Z38A 3GLFB 2G6TA 1ZAYA 4WLFA 3QPAA 3BE5A 4IGEA 1II8A 4TXJA 1DUSA 1V5FA 2A1TS 3I64A 2JJ2D 2H1IA 2IK8A 4R05A 1PL6A 5G4KA 5CH8A 5CNKA 4QGGA 3VJKA 2VAXA 1W88A 1XEWY 2D1RA 2DE0X 1KDZA 2QSYA 4NBWA 5EE9A 4U4AA 4M9RA 5AP9A 1C1XB 3AX6A 3CZMA 3Q7RA 3R3HA 2M1ZA 1NT2A 1AKVA 1E94E 3A70A 3D5TA 4UMFA 2UVQA 2R9VA 1Z4QA 2YV2A 3G17A 3LXUX 4G5HA 4QO7A 4UZSA 4YRAA 2OENG 2R7LA 1UT5A 3GFQA 3MF4A 3T7EA 2XVZA 1C4KA 3OQJA 3PEVA 4UQLA 1AGNA 1SZCA 2Q4BA 2UAGA 4NZ9A 5CTAA 3UH0A 5BSFA 3OKPA 1C0LA 3JQGB 4ZRDA 5BUSA 4JXJA 2IP4A 1XZAA 3LCRA 4JT2A 1HYEA 4LOAA 4DR5B 5B5SA 4H7DA 4N3NA 5A3JA 1U4SA 4LGCA 4RS3A 4TKZA 1OREA 5TF0A 4W7IA 4H7JA 2Q0QA 3FVVA 4X6XA 1JHPA 2J31A 3PITA 2Z1NA 4A8TA 4JUDX 4GYWA 2MYTA 5FQNA 3T34A 4BTLA 4DMLA 4V1CI 2GRAA 4F1JA 1QHFA 5D6NA 5TSDA 5KAMA 4ZT2A 1J56A 4QG3A 2GEBA 4JNCA 3TZHA 5KJ1A 3NW9A 4TS3A 3CISA 1O08A 5IN5A 5HTOA 4WN9A 4N0MA 3MBKA 4DREA 4YPOA 2NUPB 3DS8A 1O97D 3AJEA 5CFQA 1FJGB 1XRNA 2NXCA 2WLTA 2FMUA 2XWJI 4I5GA 2DERA 4EHNA 3VXKA 1YR1A 2WVHA 4KFSA 3TJMA 1Z6YA 2CWWA 1E2FA 4G84A 1AN9A 1OTYA 4G07A 5ULLA 3RUDA 3A9SA 3QUAA 2BGGA 3TSOA 3E6AA 1V16A 3V97A 5DX1A 2R6ZA 2GWRA 5ED0A 3DSRA 3U7EB 2PUJA 4C88A 4N4AA 3U4QA 3SXUB 1Y7IA 2FUG1 2FV8A 5DMXA 4JP8A 4ZC8A 2HO4A 1M2HA 3N1UA 2QJTA 3DE5X 3V33A 2VP3A 3QXJA 3VO9A 3K09C 2D0IA 4QQ8A 3NIBA 1H2FA 3HCDA 2RCNA 3QYAA 5IVIA 3OMLA 4E46A 3LTEA 3FCXA 1KI4A 1VKOA 5FTMA 2X4GA 4M1QA 5DGDA 3EOAI 3UJBA 4EMSA 4Q6BA 3ICOA 3ILSA 3FNHA 3HYTA 4WXHA 2LWIA 3GZ4A 4PLYA 2IJGX 1X70A 4CCSA 3H11A 4LZNA 1YFLA 4DB4A 3RWBA 1AKEA 2ISCA 3HSSA 4TL7A 1WETA 1KO4A 1N1GA 2OKCA 3AI3A 1CB7A 1DTWA 3IMCA 3MWJA 2IQ5A 2AOXA 2B20A 4MUIA 3ED5A 1JHRA 4NI5A 4GOND 2P4QA 1DHRA 1NTOA 1PR9A 1V1RA 1RWQA 3OQBA 4UM7A 2Y2VA 4DIFA 1A98A 3KKEA 2C2HA 4K26A 4O8CA 3N59A 1QE5A 5EP3A 3ET5A 1Z18A 2JASA 2LIVA 1P9OA 1TGVA 2HLNA 4FS3A 4YMGA 5JJIA 5NLLA 3N28A 3CVYA 5TMDA 2I1LA 1NVKA 1JTFA 2AMFA 4V1CA 3ELWA 5DM70 4TV9F 1E9DA 1DPGA 1U0OC 1EG2A 2G5TA 2O4CA 2OEPA 2OOSA 3MWEA 4Q3NA 1K8XB 1OFTA 3BRSA 2REQB 4BNZA 1Z9BA 1RYEA 3TECE 4NPHA 4Q15A 3VNVA 3N53A 1NHWA 1EVLA 3CKKA 1FP4B 4IGIA 3UJHA 1AMNA 3WK6A 4R2IA 3AGQA 5CG2A 1IWOA 3JZIA 1CS4C 1GPAA 3B1VA 1UBUS 4JJZA 4CUJA 2JIOA 3LT0A 4AO7A 2RKOA 3AEKA 3PUWA 3WBBA 1EWRA 1ZKDA 4PG5A 1FFDA 1G2QA 1O57A 2X8AA 5HDQA 3K9FC 1N9GA 2FR0A 3I73A 4RD6A 1G3RA 3AM3A 5IEBA 4QUKA 4EHDA 4F84A 3ICPA 4M6WA 1EFTA 4BO9A 1SU8A 1N7IA 1SKQA 1WEKA 1E2EA 4FWBA 1EFRA 1VB5A 3VC1A 5BV8A 5C1OA 3QLVC 1OC2A 3U4HA 1ZVQA 3GJ6A 2Y92A 2ODWA 3QLJA 4Z0NA 3VKGA 3HN7A 3ETEA 3MGGA 4P08A 1RJGA 3HVUA 1KPHA 1YQ9A 1Z2OX 2IOYA 2XUIA 1U3WA 2FZKA 3F5QA 3R8XA 2IYPA 1C3VA 3SICE 5A3RA 2QZZA 2WB2A 1GGMA 5L9AA 5BW8A 4QVKA 1HSOA 3C6KA 2WF9A 3FSRA 5E1BA 2ZATA 3OJ0A 3MWDB 3TIIA 4ITRC 4A8HA 3GRCA 1OLSA 3KXLA 4Q18A 3NVDA 4EGQA 2A9VA 2VK2A 3CWZA 4OA8A 5A1TA 1C4XA 3AW8A 4JA0A 3I53A 2YXDA 4I6GA 1KOGA 5IU6A 5KVAA 3GJXC 3QFSA 3QVWA 4ZZ2A 1ML4A 1E2IA 1H4VB 4EZBA 1F38A 2PD4A 2PZJA 2R6FA 2XX3A 3IH5A 5KWSA 1Z6XA 2NO9A 1B6TA 2YH2A 1JA1A 3TG2A 1QCZA 1QAQA 2XUHA 2G8NA 3NYIA 4C87A 3HCEA 1FJHA 2IV7A 3T7TA 4AZ0B 1J2EA 5C18A 3VJLA 4ILKA 4LX0A 4DLTA 2O8VA 1U2DC 3SBOA 1WXQA 2YJGA 4U63A 3SFZA 5C51B 1YSCA 4D4LA 1WMFA 1E0SA 3KSUA 4ZC1A 3WQQA 4KMRA 4RXTA 3TTVA 1B2RA 1QG6A 4E33A 2CW5A 1CZRA 1OFVA 2D1QA 4R1OA 2O8CB 2GJ8A 1JLMA 1JAZA 1LPOA 3OCWA 1W73A 2X14A 3RS9A 3SYNA 2F4VB 1E8MA 1RAGA 1XDWA 2PAAA 3WQRA 3PR1A 3OZFA 4CCYA 4DA8A 2IS6A 2VQ3A 5JIBA 1ZZGA 2P2NA 2Z9DA 3ONWA 3M6FA 5K0NA 4AM8A 4Y2PA 1X7YA 2UYCA 3RSHA 3BIFA 4P3KA 3NDBB 1RYHA 3LHDA 3JATA 4NP6A 1F5SA 4N5HX 4OHFA 1J8QA 1HFKA 2FDXA 2MJLA 1Q1BA 4FT4A 3D1LA 4PYIA 4MV5A 3ELYA 1QU2A 5F7ZA 4ZZ1A 1PS8A 2ZT8A 4U1RA 1QQAA 2PBFA 3KYBA 4EMBA 2J5KA 3DV0B 4O33A 3K5PA 4FM9A 2EG9A 1ZS9A 2VA8A 3M83A 1ND6A 1V1MB 4BKQA 3R9XB 2L19A 3KJNA 3BTOA 3GGOA 1RABA 4UARA 3UPDA 1GTMA 4BRSA 4YUAA 2YNMD 1ZNQO 2QRJA 2FEKA 4ARVA 3UB2A 1RRGA 5JH7A 1IYZA 5L40A 1H4QA 3ZK9A 1Y5NA 2QVXX 2RHOA 3O5AA 3LA8A 4DNPA 4LWQA 4XI9A 2CL5A 2WQ7A 1X7WA 3FBWA 4HH3C 2GXAA 4JI7B 2I65A 2ARKA 5IJWA 2GEUA 1QGDA 1R88A 3NHKA 5ILOA 4FMDF 1LV8A 4G36A 3AF2A 5EKSA 3VZQA 4ENWA 3GA0A 5LOVB 4DLXA 2QVYX 2WSIA 3NBMA 1ZGJA 4FKZA 4QA9A 1ZRHA 5C5CA 3I45A 2AOUB 2CB9A 1K97A 1Q15A 4HNSA 4KOAA 3LBHA 2JAHA 2IUYA 2V8BA 3C48A 1EUYA 2WY2D 5M04A 1P0CA 2Q62A 4L5JA 2Q4RA 3QTBA 4ZV7A 4HWPA 3HXMA 3A11A 3U56A 1ZD3A 2A1UB 1LSSA 2ODNA 3GJRA 4PGAA 2CE7A 5B3KA 2DXIA 3O4RA 4ABTA 4F6RB 2ZI6A 2W42A 3T9AA 2VYQA 2QAGA 1E3SA 2XTMA 4Y9UA 3L92A 1T9AA 2EHDA 4GI7A 3NHMA 4IF6A 1BXZA 3E58A 4QC2A 4J7XA 2PEZA 4UD6A 1HDZA 3IRVA 2R6DA 1LK7A 1MMFB 4ONEA 4BX0A 2ANCA 2OV1A 5D5QA 4IYRA 1PW7A 2RHLA 4GGOA 4ROSA 3WL7A 2HUNA 1RHMA 2KI5A 3DGEC 4FHEA 5EQDA 4ZAWA 4CFSA 3W3AH 4NZPA 4TRJA 4TUYA 3ZJTA 2P9GA 2O7SA 3TLXA 2XA1A 1RJDA 3F6PA 2BZGA 3D31A 1Z0FA 4JLVA 2FPOA 4M88A 3KYDA 4YX9A 1Y6GA 1EYZA 6REQA 1BHQ1 1E3DA 3QMVA 2ATVA 3BIXA 3JPYA 1P7VA 4GXQA 1PT9A 1Y4SA 2WKSA 3QKRA 3CLRD 1QONA 4KXYA 4MPPA 1MX1A 1HT0A 2A57A 2PK3A 1R0YA 2I2AA 4DRXB 1T9ZA 1S8AA 4DPKA 5BPHA 5EJFA 1AX9A 5K0FA 1EZ1A 3RC7A 3AKCA 1EINA 4N01A 4URYR 5HG0A 3VR4A 4EB6B 1IUNA 4XWYA 2VA9A 2OK7A 5TF4A 1R8XA 4AURA 3H18A 3JY6A 1MU0A 3X1XA 4EX7A 821PA 3QVSA 1ZX1A 4JP5A 4V0MA 1JAYA 3UJ8A 1G17A 4DWWA 3TOZA 3RVDA 3GLVA 2H6EA 1IZYA 4KIFA 4X44A 3VGJA 3HEAA 3QE4A 4D9CA 3UKDA 2KS6A 4IHKA 3HJFA 3LCUA 4MW2A 4NFYA 4E5VA 1A8IA 5FL7A 1CFZA 4JVSB 5CVVA 3W77A 4WACA 1M2NA 1P31A 3L0IB 4S04A 2XAUA 1NF8A 2DFLA 2OFWA 2OZVA 4CG3A 3N3BC 2BP7B 3B5IA 3CONA 3RR2A 5G0SA 2CXHA 3VBCA 2F3SA 5AIAA 2D59A 3GGCA 1EWYA 3WL3A 4BMNA 1LRLA 2BUCA 2Q2QA 4RTQA 1NAHA 2NZ8A 2C96A 1CRZA 3TRFA 4PEVA 5EWLB 3MEQA 1ABBA 1UWKA 4P0TA 4XPZA 3D64A 3QE2A 4EW1A 4KMOA 1T6YA 1YKFA 1UC9A 2F8TA 1E1QA 3GLHB 4LQCA 2I4NA 4WKGA 3SHWA 5IT5A 5F1OA 2HLDD 4FFRA 4UMDA 5G3YA 1YZTA 3B6EA 4BFYA 2JBWA 1Z47A 3HVHA 3OBBA 4G24A 1CUIA 4GPBA 4BBZA 4F2HA 1V9CA 4UKDA 2J9ZB 3AF0A 1NVFA 5FX2A 3DE3X 3GGJA 3QENA 5D00A 4D02A 4M54A 4C0KA 1JG3A 2VJAA 2O5VA 4S1NA 3VOAA 4CM8A 4DY4A 4XQCA 3SR4A 3D1JA 4RTKA 1LI7A 3E3LA 2HREA 5F12A 2OOKA 3EMVA 2B83A 3UHOA 4M8LA 5TJHA 4JBGA 1XTBA 2YBEA 4LIPD 4ZANA 1ZM9A 1VHJA 2OHHA 5J2UB 2Q1WA 2CXSA 1NXWA 1G0NA 3EPRA 4YJ3F 4GIBA 5LA6B 4DV5B 3LT4A 3INGA 4TL8A 2PX2A 1JDNA 2O23A 4LXGA 1NMXA 1ST3A 3AR3A 4ECAA 5CFLA 5LZ5A 1S2GA 2Z04A 3EFOA 5G3ZA 1GA6A 2YV3A 4GMKA 3ISTA 2QNRA 3RYIB 3UT0A 3HBAA 4R7GA 4P0QB 4OLFA 3I4FA 3RS3A 4M76B 3LE8A 1BJRE 5CITA 1T9HA 3TZ6A 2XRZA 2F2TA 1DAEA 2IEYA 3O8QA 4HXFB 3RJTA 5D3ZA 4OXNA 2BYTA 4XJSA 5EE3A 3WK5A 1Q0TA 1Y1RA 1IATA 3R3VA 4Z2AA 3EDQA 4CETA 4NOMA 2VJKA 4HAWA 4LJ7A 3WR5A 2R11A 4PXSA 2X6TA 2YHBA 3W1WA 1IAQA 4XJVA 2AX4A 4HZGA 1FNDA 4YYEA 4PLVA 5B12A 3DE0X 1R6XA 1SKAA 3MJVA 4RA6B 3TSWA 3RAEC 5CA0F 4N8SA 4BATA 4MR9B 2EZUA 4GOMD 4K3VA 2PKEA 1KI1A 2I54A 2VPPA 1BDBA 4YMSA 2O3QA 3SHOA 3GDFA 1CK4A 3PHJA 1W5EA 4WZZA 3CT4A 3UMBA 4XQ0A 3SBEA 4R2KA 4BB6A 1ZVJA 5JH7F 3COPA 4GWGA 1AGPA 2R4QA 1RWVA 2C7VA 2X4IA 3MZ0A 3NEJA 4MNTA 1EFUA 2PR7A 1FNCA 4RGYA 1E1YA 4YJFA 1QVVA 4UUMA 5F51A 3VR4H 1K3TA 1VBNA 4WXEA 4BP8A 1AUVA 3FRHA 2OZLB 5IZ4A 3C3BA 4MOWA 1XZHA 1XXHA 2BIFA 1PUIA 2P27A 3W9BA 1F0PA 4F04A 1SCIA 1HM5A 3IURA 5GZ6A 1NMZA 4PRLA 1UJ2A 1OFIA 1RZ3A 2HBZA 2ZUWA 4M0MA 4AYWA 2Q6IA 3P9XA 4HDMB 4ER5A 5A9SB 2VH1A 1SKYE 3OKAA 5U4XA 4C7OA 3EXHA 1NJGA 1PJSA 3CBQA 4QULA 4RGBA 4KE9A 2BKAA 3TN7A 3K6SA 1OOEA 3GRAA 4KGZA 4Q7KA 4PX9A 4BO8A 2NUTB 5KOYA 2AJCA 2RGEA 2C97A 3OCVA 3ZHCA 2J87A 3B9QA 3QYFA 4KOEC 4FGUA 2N0SA 1CETA 4AUKA 5HUJA 4FQ5A 3AC0A 3T3IA 1NVMB 1QO0A 2BZ0A 1KO1A 4ZVQA 3RVRA 3LLCA 4D0NA 1SHZA 2GKSA 3R7SA 3S4YA 5FYDA 4D42A 4GMGA 4R8RA 1OASA 3DZCA 4GLOA 3HLYA 1VJGA 3D6JA 1E8DA 1FMCA 3OY2A 4W82A 4AMZA 1OGJA 1MAAA 2J09A 3DD5A 3GELA 1X77A 4O2BB 4Q3BA 4RVDA 4TUYF 5DVZA 2BTQA 4IVQA 4HFJA 4MUYA 4NU8X 4OKIA 2GBPA 4PGMA 4UHBA 3HB1A 5J2TA 5JD4A 2QBYA 3X1YA 5HM6A 1QC5A 3W5VA 2NP7A 2CVHA 3ZZ1A 4BOYA 5ECWA 1QBKC 1GPH1 1VSTA 5LB2A 4BNLA 1DQSA 4YO7A 4OYYA 4FHZA 1ZK3A 1IBCA 3NV7A 1Z0IA 4MEAA 5J4HA 5LP1A 1JU3A 1XZ8A 3KQUA 1EFVA 3G2KA 2ZK7A 4YRBA 1RPZA 1FMTA 1NATA 3HJTA 5AJHA 1W5BA 4OU4A 1Q50A 1T6BY 1ZA1A 1ZJ4A 3H9QA 3PRHA 4M1ZA 1CF9A 1NFFA 4FONA 5F5XA 1BE1A 3RI3A 1DBVO 1EX7A 3B1WA 4WOBA 2H7CA 4UUNA 4GP7A 4YDSA 5A4MS 2UXCB 2O8CA 2FKNA 2NO6A 3BMCB 2V03A 3BCRA 1A88A 2HJGA 2AFIE 3BIWA 3WIOA 3BT7A 3DBIA 3R0ZA 3TM5A 4DC1A 3DAHA 4D4JA 3LWBA 5JD3A 5A6SA 3K0AA 1U2GA 3A1UA 3NJRA 5C8VA 4LC0A 2PL9A 4GLBA 1EWTA 2JIZA 3KEFA 1L5LA 3ZBUA 2J4FA 2FEPA 3A0UA 2GZSA 2PA0A 2A9FA 1VA4A 1Y1TA 4L4UA 5G1PA 5TDHA 2GAAA 2NU6A 2VF7A 4BLVA 2IYWA 1DV2A 2GF0A 1RC0A 3AI7A 3OZBA 3HTXA 3S8MA 3ASZA 2DTDA 3OZRA 3BXEA 3PB3A 3PCXA 5FB3A 3QEAZ 4JDUA 5DYWA 1LZKA 5EJ8A 4OI1A 1PYOA 3NAQA 3FWPA 3GFSA 3PNBA 3WG9A 1PG5A 4QODA 2E4YA 2BZSA 3BL8A 4ZO8A 1ZXBA 3WFZA 1SA0B 3ORQA 1LSJA 1UAGA 2JVKA 5FI3A 1FU7A 3RBVA 3ZI4A 1YIDA 2RGBA 3RV4A 4BC1A 5AVYA 1SQSA 4RZIA 5K3FB 4PZPA 1TW2A 4WK6A 3H0EA 3PDWA 2FSSA 3VU8A 2C99A 1AHHA 1W0KA 2VHUA 2A0FA 1M1UA 2LV8A 2XCTB 1T6NA 4LWZA 2YOGA 1L7NA 1F2VA 2IXTA 4GR9A 1NHGA 3EVGA 4RPLA 3IUMA 1JLSA 2JK0A 3CKLA 4MPTA 1GDHA 1JXAA 5IG2A 4Y2UA 3V9PA 3VBEA 5CIYA 1Q2XA 2VF8A 5BW4A 2J5BA 4C0XA 4D5GA 4LOKA 3COJA 2F55A 1XJCA 2CUZA 3IJEB 3G9QA 3GNQA 2GN6A 4GNRA 4QSHA 5KTMA 2E5FA 2AXNA 3I05A 4K0KB 3V80A 2MINB 2FN8A 5E2IA 2VS1A 5EQTA 2JFYA 5DLQC 1NBOA 1KP2A 2B9VA 2PMCA 5F4ZA 2AJLI 4XUGB 3ZCVA 1RXVA 5U4QA 1Y9DA 3RDPA 8GPBA 2JGKA 1PU2A 3C2QA 1AE1A 5C5IA 3THYB 3WZMA 3I2HA 3AF6A 3HXOA 1U6KA 1XMVA 1E0JA 2W93A 3CXRA 4B7UA 2E18A 3UB3A 1S7CA 3EQ2A 3LDAA 2FFHA 1D1TA 4M8KA 3KDPA 3RSSA 4KXUA 3QI7A 5ALFA 4MQ6A 1UZUA 2XJ4A 3FRIA 1PJQA 3RVSA 3KTAB 3EBPA 4JBLA 1JDBB 2PUCA 5MN6A 2NTVA 3WBJA 4UM8B 5ER6A 3FLBA 3VH1A 4FR5A 2JEZA 1R27A 3L0YA 4BZXA 5HCUA 1XK6A 5TQ2A 2YN4A 3ZHBA 5IKPA 3IQXA 3WLNA 1QMGA 5CT4A 4GHWA 4U7HA 4W1QA 1Y3IA 2WHYA 3DPUA 3SIPA 1WNFA 4B6JA 3VO1A 3DOIA 4HLNA 3E7WA 3P5BA 5A06A 4ZFNA 3QVVA 2BGUA 1DAMA 1QV7A 1NFQA 2HTFA 2VBGA 3D6HA 4P6VF 3UAOA 3VH2A 3VVLA 1JIXA 3CNNA 1SHUX 5T4BA 3AP2A 5TS3A 2BFCA 1VHTA 3DZHA 3KTFA 1GAWA 3DZBA 4MUMA 1HX7A 3E22A 1G2IA 3EULA 4XWTA 3ZE1B 4UCWA 2GA8A 2NTYC 3NDIA 3S29A 5KWEA 1RHQA 2WHEA 3BXFA 1K63A 3PXGA 5CFMA 1LY1A 2UZ3A 2B61A 3BB4A 3WL8A 1G8JA 2XD9A 2A14A 3JPWA 1NF3A 1X6VA 3W04A 4RMHA 2ZITA 3EUWA 4D9FA 3CZ5A 3CHYA 2FSIA 3QKTA 3CJQA 2ZJ4A 3TZQA 4CEJB 1UPXA 3U7FB 1E2JA 1L5GB 3E1GA 1P1HA 4M55A 3P9QA 3PNOA 4LZJA 4YRLA 2EWWA 4RK6A 1M8GA 2O2IA 3ME5A 1LBQA 2XCOA 4L95C 3ZW9A 3HYLA 1PNRA 1LBHA 1L3CA 3O84A 4HLUA 2EQ5A 4PFQA 4UQPA 1R50A 5IAOA 2BFMA 2P30A 3P2IA 3PDIA 1RZRD 4ZODA 4RAOA 5DF1A 2IVZA 5K20A 2X1MA 3B7GA 4BO6A 5GIPE 1TA9A 2PG3A 1EG7A 1YJ8A 2IYUA 3I9V6 1MW9X 4F91B 3CRNA 4DIKA 4NCXA 3JU3A 3SDBA 3QWAA 1DINA 4MGYR 4WH0A 5EPOA 1GZVA 2D2XA 4MUHA 4YRRA 3KKZA 1TL7C 5ARBA 2B92A 2VK8A 1JLRA 1H65A 1C0EA 1HT1E 1ECBA 2P9TA 3ASUA 3GD5A 4P7FA 5JAQA 3ZVRA 5IJZA 1E2GA 1T3SA 1DB3A 3K6JA 4HRXA 5J63A 5CDFA 3ZCSA 5HKKD 5K8UA 3K72B 5G0WA 1MQ9A 4E22A 3URMA 3UA3A 3HN2A 4AJLA 3DE7X 4HQLA 3WOHA 1KR2A 1JS1X 5JDCC 2B1QA 1TKRA 2CF6A 4FEAA 4J9UE 3S3TA 3SFTA 3BE8A 2NIPA 1JA9A 2I1WA 1ZCBA 3EDCA 3OJOA 3A6FA 1UBCA 3MGAA 4JUIA 3I5AA 3GFRA 5FBLB 5CFNA 8AT1A 2FN4A 1QM5A 5KVSA 1CHDA 3F73A 2I6UA 5JC8A 4F9FA 4UUAA 4FN4A 1OXBB 3K05A 4ZU6X 5C52B 3TR5A 4BNGA 3KVYA 2PPLA 1AA6A 3OEHA 4UNRA 3LPCA 1O95A 3KAPA 2JRCA 3ENKA 2XIJA 4B82A 5AW7A 1YL7A 1TF5A 2XBLA 2YVLA 2R1TB 5TS2A 4O1MA 3OEYA 4UNNA 2AI2A 1FSFA 4B33A 4BO7A 4H7HA 4OK5A 4DXDA 2A78A 2JCVA 2NAPA 3EZXA 5SZIA 3Q7TA 2BLNA 4NS1A 3UMJA 1K27A 3CRZA 3BMXA 3FMVA 2MSLA 4NFSA 4DQVA 4GMDA 4N8DA 4CQNA 1KAOA 1MUUA 1GADO 4FYXA 4YWJA 4MVJE 2VTBB 4LGYA 3JYPA 2B6NA 2V7QA 3G2PA 4H3KB 4DJEC 3UAWA 2DJIA 4D9MA 1VBFA 2IW1A 3A0RB 5L3QB 3ZGOA 3OQ6A 2HDWA 4AMVA 3L06A 2TRSB 4G2TA 4PQEA 3IL2A 2BBWA 4CJXA 4JS0A 4XGIA 4ZOLB 1E20A 1HETA 1JQEA 3LDUA 4K40A 1KP9A 2F1IA 2IHUA 3OKCA 1QK3A 4ZEXA 5F2EA 1CZLA 2EIHA 1NQOA 4WLVA 5HMMA 1FDVA 1NW6A 3WGUA 3SYRA 2I91A 3PLRA 2QL9A 3DEAA 5GY7A 5EQJB 1NRIA 2O6HA 2QUHA 3FOCA 4Q93A 3P0JA 5HXAA 4UUOA 2GF2A 3O31A 5IJXA 2YRFA 1NUQA 3LCJA 1ENZA 3BB3A 4BZPA 1CUEA 1FNBA 1JNYA 3U4GA 3UJCA 5KWJA 5LOVF 2JLUA 3QSYA 1VLJA 3H4MA 2F64A 4YXWD 1YDEA 2OSBA 2WG2A 3DKVA 2AZXA 1W7AA 1MFPA 1SURA 2F90A 3LM8A 2CZCA 2GPTA 5JSKA 1W8DA 4OI4A 2WB4A 2O1WA 1XCOA 3MSCA 5CDHA 1E6KA 3PRYA 4RIIA 1PN3A 2PAFA 2DKFA 2VCYA 5TGZA 5JISA 1SXQA 3D4IA 2DF8A 1Q0QA 4PYKA 1WHTA 3P0RA 3RQSA 2G5GX 1GZHB 4B46A 1U0NA 4COKA 4WUTA 1C14A 3UJAA 3RLIA 3ZHTA 4IX9A 1PEKE 3A1SA 2QF7A 3CLUC 4MCJA 1BFUA 1R0XA 1TUGA 1ZBDA 2CFOA 3B38A 3NTLA 1YQWA 1WF6A 1PNTA 1EK5A 2P7HA 4Q82A 5EP4A 1Z4PX 2AOWA 4GC9A 4YQYA 2ZZKA 2RGGA 3IOBA 2DUNA 3QI2A 1Y3HA 2XOKD 4TXNA 3NP9A 1KA9H 4Z4HA 1EUCB 2IBTA 3F1KA 3IAEA 2DQ4A 5DGCA 1VPWA 4KWCA 1NUHA 4ENTA 3FTQA 3IDSA 3R7WB 4P4UA 4F7WA 5B7PA 3NTVA 4N6NA 5JXGA 5ES3A 5GAJA 3QK7A 4KIWA 3FFWA 4PYLA 4RLFA 1F14A 1JJFA 3OM9A 3S6JA 4AJ4A 3HL4A 4NJMB 1ES9A 4WINA 4MWDA 1SXJA 2F3PA 1QLWA 4ND2A 5TE9A 5CJPA 5IYZB 5JZ9A 1VBMA 3B13B 4FZRA 2VHZA 5DM4A 4M99A 3U81A 1I4DD 4K2HA 1TEHA 4BFZA 5I4KA 1X1AA 1WXEA 1D7AA 3OKFA 5FJIA 5KSPA 2DHRA 1A4RA 5C5EA 4DV3B 1NW9B 3CH4B 3F5SA 1X94A 3SX4A 4MROA 4B0PA 4J94A 4KR6A 1JIUA 2OHGA 2ZIXA 3O8LA 4XEHA 4OK3A 2XT9A 1B6RA 1LQUA 3VR3A 3GJYA 4JJGA 5KYUA 1U6JA 2JGAA 3LF1A 3JSXA 4EJ2A 3AFOA 2IS2A 2AOTB 2VHYA 2QA5A 3L6DA 4FOPA 1A5AB 3AQIA 4ID3A 1X13A 4NPAA 1ZJWA 4PV7A 4MJLA 1R0KA 4NBLA 4Q48A 5AW2A 1ENYA 3GEBA 2JNWA 4DB2A 5AO9A 1RXIA 4P58A 2IYXA 2WKRA 4YJGB 1PLLA 5FWDA 2OGUA 1QVRA 3FBGA 1QYCA 5FTKA 3UJ9A 3UK7A 2GA9A 4PC6A 4PLGA 3UOAB 4RESA 5JLJA 2XMRA 3DC2A 4L4YA 4AFNA 1YBFA 3TI7A 2QTHA 3VFDA 2RD2A 3IBFA 3WJAA 3WSVA 2J08A 3C3EA 4RF3A 3VPSA 3I04M 4A7PA 2QSUA 4F46A 3F7MA 4QBGB 2VWHA 3PUZA 1GYPA 1QKIA 3REQA 1T43A 4PZ9A 1EK0A 3ZZTA 1U7TA 5GM1A 5F2KA 1ESZA 2DRIA 1GGNA 2HJVA 1Z6TA 3JQBA 3LPAA 3P9RA 3FVWA 1UC5B 4OB8A 5D7BA 4D9IA 1QQBA 1NJ2A 2WJJA 4GKVA 2C58A 3GU3A 3HKCB 1ZH4A 3G5LA 1DARA 1JKMA 3B2EA 2H3EA 2QW1A 5KS2A 1DRVA 1GPYA 4MB0A 2C5FA 3JQPA 1B0ZA 2HSJA 1B4DA 2D8MA 3MB5A 3MLBA 4Y9SA 4B6OA 2BEKA 2UUCB 1UMCB 2RONA 5FPYA 2FJUA 3F96A 4WJKB 3GLGB 1JEJA 2QN1A 3I58A 5J4VA 5LZ7A 1PGPA 2YFYA 1P2DA 2EP7A 3H13A 5B58C 1KDPA 1XQ9A 3C7TA 4YI3A 2C8KA 3RTGA 4XM1A 2WW8A 2V65A 2ZTLA 2L69A 2XQJA 3U3RA 5COBA 4FK8A 4CLHA 2V7PA 4LF9B 2BJHA 1LNZA 3UUEA 4UASA 3TLZA 2J32A 2ZYSA 4N9WA 2QZSA 1DKMA 1Y4DE 2WM8A 3DMNA 4NHEA 2Q5LA 2IEDA 5EZ6B 4A3SA 4EFNA 2QMYA 3FYDA 1ZL0A 4Y98A 1DS6A 2F00A 1GGHA 4CUKA 1P45A 2NU8B 2FZCA 3NNDA 3PQFA 1RVV1 3PNVA 3KOYA 4HL6A 5ENDA 4NG5A 5H83A 4WWHA 2GAJA 3AVWA 4GE3A 3IUJA 4FD2A 3KPYA 1WPRA 2RJOA 1Y33E 3EF3A 4NU0A 3C3MA 4PSKA 3TNFA 3DLHA 3RRFA 2BRUA 3AEUA 1BMQA 1BFDA 1R16A 2HCFA 1PZFA 2W0MA 4XA8A 4C0BA 2CT8A 2D5LA 3VDNB 5JDIA 1IOZA 3HVJA 3EJWA 3H1FA 1L8OA 4DHEA 1IZ7A 3D6TB 3EISA 4QM6A 4A1FA 2X0RA 2RAFA 2P5SA 2WJ3A 3EJ6A 3E3OA 1SUBA 3T5PA 2NSLA 2RCYA 1JHVA 1UKBA 2QVBA 2PS3A 3QOFA 3R0IA 1PQ4A 1SCNE 2AI3A 3UGTA 2G76A 2PFKA 3QF4A 2P79A 4Z7OB 4Z7JA 2FPXA 1RAHA 1CUHA 2GCEA 4UU8A 1IXYA 1TO6A 1U0HC 3MYYA 4DV6B 2ZVQX 2PA3A 4FC6A 5B3JC 2CV1A 1V43A 4JK3A 3TTSA 4OQEA 4POAA 3IE1A 4B6SA 3W5UA 2YJNA 3GCXA 4BKUA 1D8TA 3ZDDA 4US2R 5LNK6 2ZPAA 1VHLA 1F8FA 2OORC 2JBAB 5C7OO 3IILA 4O4HB 4U9HS 1ORHA 2FF7A 4PCLA 4XXHA 1WKBA 2VNJA 1LTHR 3A25A 2GPWA 3FIUA 4CLRB 2V54A 1JKXA 3WMEA 4AMGA 1B2LA 1NW5A 1LDNA 4CEHA 4K6KA 4ROTA 2FDRA 3C1UA 1L5MA 1VL0A 1Z88A 4Y7CA 4KWHA 2JEOA 3NJ8A 4EW3A 5KNCD 4FE3A 4H17A 2IZ7A 2ZBEA 4UNSA 2R6GA 2RHMA 4J2TA 4HQ6A 2R1ZA 3OTWA 3GVXA 4IJVA 1CY7A 4IICA 4M8IA 3OPYI 3DVRX 4WASA 1ISJA 3KLPX 5CBPA 3QVXA 2HBQA 1G1AA 4OAPA 4BLWA 1DFGA 3GNTA 2BLLA 4EG5A 2H2WA 3VAYA 5DHTA 1K08A 4G8CA 2EJWA 2JEYA 3KS9A 5JPDA 4FVTA 4LI3X 4YAOA 1G21A 2JFZA 4O2BF 2Y1XA 4BFVA 4BE7B 2C1EA 2QD5A 5EWMA 1J25A 1EXNA 2A5DA 1ORIA 3EZ9A 1QFYA 4HKTA 4LE2A 3BH6A 1SVIA 5LXTA 3D4NA 2XHEA 4BEJA 3ZIUA 1ISFA 4URZR 4HDSA 2XB8A 4WKBA 3T9CA 3FPKA 4J3JA 4XB6B 4G23A 4YRCA 3FNGA 3MGBA 3EVCA 4B7XA 3GFPA 4KPEC 4D4MA 1F12A 1ZIOA 3R0QA 4LISA 1E2HA 1KQNA 3P7MA 4AROA 1CY4A 3E3AA 4MR7B 4YCSA 3T7DA 1AG9A 3DG9A 1VQ1A 2H4YA 4V2UA 3B82A 4LFBB 3X1JA 2YZMA 2RKWA 3M4JA 2JF0A 4AQDA 5AD1A 4WA8A 2EX4A 3KQTA 1F2UB 2W6OA 2KBEA 3BD7A 3PX3A 2P6NA 2QTNA 4M7WA 1GFZA 4GZLA 5E4YA 1SBHA 2YVUA 4BMPB 1Y37A 3V7YA 1RHRA 3HFGA 3RKSA 1Z7GA 1M0WA 3FPLA 3MGCA 3UB4A 4MWZA 1GTSA 1JQLB 1K89A 4TQGA 3IHWA 5DW3A 1VXOA 2OMEA 1N0HA 1KZ7B 1IXKA 1ZCFA 1YCDA 1LX7A 3NS7A 1