2ZIFA

Crystal structure of ttha0409, putative dna modification methylase from thermus thermophilus hb8- complexed with s-adenosyl-l-methionine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
270
structure length
239
Chain Sequence
b'VHRLHVGDAREVLASFPEASVHLVVTSPPYWTLPGQLGHIEDYEAFLDELDRVWREVFRLLVPGGRLVIVVGDVAVARFGRHLVFPLHADIQVRCRKLGFDNLNPIIWHKHTNPYEPGAIIKTEIEYILMQRKPGGYRKPTQEQREKSRLPKEDFHRFFRQIWDDIPPFPLELAERLVRMFSFVGDVVLDPFAGTGTTLIAAARWGRRALGVELVPRYAQLAKERFAREVPGFSLEVLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative modification methylase
molecule tags Transferase
source organism Thermus thermophilus
publication title Crystal structure of a putative DNA methylase TTHA0409 from Thermus thermophilus HB8
pubmed doi rcsb
total genus 75
structure length 239
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zifA00
2C7RA 3T7SA 3KQYA 4DKJA 3KPVA 2AOXA 3BWCA 5LSAA 3OU6A 1IY9A 1KPGA 4XUCA 2Z6QA 1IM8A 3O31A 3GRZA 4GOND 5DM4A 3LX6A 4YUXA 3R24A 4PYMA 3TMAA 4HSGA 1NW5A 3M70A 3KR2A 2PT6A 3UWPA 4AZWA 4F84A 3NWBA 4NECA 3P9IA 3LPMA 1VL5A 1X1AA 1XDSA 1ZQ9A 3FRHA 1RI5A 1T43A 2PX4A 2QRVB 2GH1A 5EIFA 5EZQA 5BP7A 3OZRA 5K01A 5HZMA 5EZSA 2ZFUA 4QTUB 4YUYA 1SVUA 3JWGA 2YVLA 2ZSUA 4DCMA 4Z2YA 2WK1A 2PXCA 1RJGA 3NW9A 1VPTA 3DMGA 3S68A 3EVEA 1I1NA 1QAMA 5DT2A 3CCFA 2FPOA 3AWIA 4HTFA 4RX1A 3EVDA 3OE4A 2GPYA 3SM3A 5BW4A 3KQOA 3C6KA 3CJQA 3NTVA 4IKPA 3DMHA 2ZIGA 3P9CA 3GRRA 5CVDA 2FYTA 2ZTHA 5EMMA 3OU2A 5JR3A 1WXWA 1R00A 3G2QA 3BWMA 3PS9A 5G02A 5GP1A 5EVJA 1N2XA 3R3HA 2YX1A 1RJEA 3DP7A 2AOTA 1VBFA 2ZW9A 4AZSA 3UJ7A 1HMYA 4A6DA 3G7UA 1XVAA 3FPJA 5DTQA 1RI2A 1M6EX 5EEGA 4EQZA 1SQGA 4HTFB 4X41A 3OFJA 5DSXA 3ER8A 3R6TA 1TW3A 2VDVE 3IYLW 4YMGA 2XYRA 3KR9A 5DX0A 5T64A 7MHTA 4FSDA 2NNWB 2G71A 1H1DA 3KR1A 5EG5A 3AJDA 2V74B 4ER6A 3LECA 2P7IA 4BP3A 1UWVA 2YQZA 2AVNA 3BWBA 4OBXA 3GXOA 1ORHA 3F4KA 3G8AA 4C05A 2NP6A 5FCDA 4KDRA 4OBWA 2AS0A 1Y8CA 1F38A 2OO3A 2ZVJA 3A25A 3LBFA 3X0DA 1O9HA 4PYKA 1JQ3A 3UZUA 3VC1A 5FWDA 3EMBA 3VSEA 2B2CA 4R05A 1EQAA 1YZ3A 4U7PB 5DRYA 1EG2A 5DWQA 2OZVA 3P71T 2AOTB 5M5BA 1Q0TA 2Z6UA 3B3GA 3P2KA 4QQKA 3HVHA 3LBYA 3DXYA 2H11A 2ZBPA 3FTEA 5P8WA 3AY0A 4QTTB 4RTSA 3E8SA 3DULA 5K0EA 5E8JA 5CVVA 3D2LA 2I6GA 4P7KA 1YFJA 3GRYA 5DXJA 5K8VA 2IBSA 2AN5A 2Z6AA 3V97A 2IGTA 2CMGA 5KVAA 3UA3A 1BOOA 3MERA 1XCLA 4X61A 2H1RA 5HILA 5LQJA 5E9JA 4PYIA 4Y30A 1G60A 2AN4A 5K0LA 2HR1A 3G2PA 5MHTA 4KWCA 4XUEA 2P8JA 4RTOA 3JWIA 5DM1A 3TRKA 3KQMA 4BP1A 1PRYA 4RSRA 5C9ZA 3BUSA 4QDJA 2ZZKA 3OZSA 4RVGA 3PB3A 5CM2Z 5EMKA 4PYJA 1N7IA 1VP3A 5K0GA 3BZBA 2P3QA 5F2OA 1QZZA 5DM0A 4EKGA 1BKYA 3CJTA 3K6RA 3REOA 4PNEA 2UYHA 4PGGA 3HCBA 3UFBA 4X1OA 3AXTA 3EVAA 4EKIA 5DTMA 1R6AA 2CWWA 1R8XA 2K4MA 4E32A 5K0CA 1P1CA 3BWYA 3MGGA 2PWPA 5FQOA 1JQDA 2QYOA 3CGGA 4YMHA 4QQNA 2QM3A 1QAOA 3LCUA 4ER5A 4PCLA 1YUBA 3GNLA 5DXAA 4PYLA 4DQ0A 4GF5A 2G8NA 3Q7EA 3HCCA 4FZVA 5GIOE 3JWJA 1MJFA 3HM2A 3FPHA 1YB2A 5CVEA 3FYDA 4FR0A 2Q41A 3TLJA 3RIEA 1EJ0A 4HG2A 4GC5A 4WVLA 2ZWVA 1VQ1A 3I64A 4GOOD 5E1OA 5EIWA 4RTQA 2C7QA 5KQSA 4LG1A 2HTEA 3GDHA 3GWZA 5EMJA 3DLIA 4CTJA 1KPHA 4OA8A 5LQUA 10MHA 2AR0A 5GOZA 4RTRA 2BR5A 1R74A 3KPUA 1M0EA 1TPYA 1BC5A 3NDJA 2PBFA 2OY0A 1P39A 4LWOA 4M37A 1RJFA 3M33A 5HIJA 5T67A 2AOVA 1NKVA 1U2ZA 3C6MA 3OE5A 3SGLA 2JH8A 3T7TA 1YZHA 4FSXA 4IV8A 4AZTA 2DPMA 1QYRA 3I5UA 3G89A 1XDUA 2FCAA 1ZKDA 2ORED 3A7DA 2P1DA 1L3BA 2XVAA 3EPPA 3KQVA 3G2OA 4HGYA 4GQBA 4LWPA 4QDKA 2P41A 5U4XA 4E2WA 2EJTA 3AXSA 5ICGA 3LKZA 2UYCA 3ERCA 4GEKA 4RTMA 3UJ9A 4P7JA 3HCDA 1UFKA 3P2IA 1G55A 1NBIA 3EVFA 1PJZA 3M4XA 4F85A 4ER0A 5FA8A 2XYQA 2VZ9A 4OA5A 4HC4A 1JTFA 5DRTA 3KQTA 3GO4A 3EGIA 2OXTA 3TOSA 3E05A 1ZG3A 3HVIA 1TW2A 3KKZA 4C4AA 1RJDA 1XTPA 3EEYA 5E2AA 2OB2A 2PGXA 5GM2A 3HTXA 4GOLD 3DOUA 3BGVA 3NWEA 4C08A 4E31A 4DF3A 1ZGJA 3NMUF 3TFWA 1NW6A 5E1BA 4POOA 5IKMA 4HH4A 3KQWA 3L8DA 2A14A 1KXZA 1RI1A 4DCGA 1DL5A 5BW5A 4KDCA 3I9FA 2NXCA 4LECA 1WS6A 3SVZA 2YUIA 2XYVA 1JG2A 2H00A 3LDUA 4B17A 5CCBA 3ELDA 3DR5A 3FZGA 2BR4A 2R3SA 3GRUA 1L3IA 2YXEA 3DH0A 3IEIA 3ORHA 3HA3A 3OZTA 3LKDA 4PINA 4PONA 1G38A 4E70A 2FK7A 1JG3A 2DULA 2LD4A 4PIMA 1XCJA 1P91A 2UZ4A 5DTRA 4KIGA 4ZTBA 5CCXA 4QPNA 4A6EA 4BY9E 2EG5A 2QY6A 5JUWA 4MHTA 5HIIA 2ZBRA 2ESRA 1KIAA 2IDJA 3DLCA 2OYRA 4H0NA 1X1DA 4C06A 5ERGB 5FTWA 5IH3A 4P7FA 2F8LA 3TM5A 1HNNA 4DZRA 3B3FA 3ELYA 5CVJA 2PX5A 2JJQA 3A7EA 4GBED 4L7VA 3VYWA 4IV0A 5LR6A 3TPZA 2XVMA 4R8SA 2NXJA 3QOXA 5FULA 3GGDA 2HV9A 2CKDA 3I53A 4HGZA 3LDFA 5E2BA 3DTNA 3MHTA 2FRXA 3KPJA 4O29A 3K0BA 1MHTA 4RYLA 4EMSA 3TR6A 2BM8A 3MCZA 3P97A 3QOWA 2ZIEA 4UOEA 3B89A 2BM9A 5K09A 1VLMA 2P35A 1EJ6A 3CKKA 4FS8A 5LQNA 5FWAA 2IPXA 2ZCJA 3B7PA 4E2ZA 3THRA 2B3TA 2O0LA 5HIKA 2C7PA 2ONYA 4X60A 2Y1XA 2ZIFA 3GU3A 3UA4A 2V7EA 2VP3A 3RW9A 2PX8A 5HOQA 1AQIA 4BLVA 2UYQA 4PCAA 2G70A 3PX3A 3LHDA 4YV2A 1JG1A 2GAFA 3ELUA 5ICCA 4M38A 3G88A 3KU1A 3A27A 3CBGA 2O07A 5K0NA 1NV8A 3B5IA 4RWZA 3MB5A 5KS2A 3JWHA 1FP2A 2PSSA 4MIKA 5F2NA 1EAMA 4JXJA 5DX1A 2FK8A 3G5TA 1NT2A 4GOMD 2NXEA 3SSOA 5BXYA 3SXJA 5K0JA 3ELWA 2HMYB 3MTIA 3PTAA 3KR0A 3U81A 1UIRA 2FHPA 3G8BA 2BZGA 1SKMA 4IWNA 3HNRA 3TQSA 1VE3A 4XCXA 2GB4A 2NXNA 2P3OA 3C3YA 3OCJA 4P58A 4RVDA 5LQKA 4FP9A 2EFJA 2QE6A 4QVKA 2VS1A 2C7OA 1L3CA 2AN3A 2YXLA 2JH9A 5FHQA 1AF7A 1X19A 4Y2HA 4DMGA 3EEOA 3UBTA 4OQEA 3BGIA 5CUQA 3KPYA 1O9GA 3C0KA 1NBHA 4AX8A 2NYUA 3BKXA 2ERCA 2NP7A 2AOWA 2VDUE 2HWKA 1EIZA 3OU7A 2OB1A 5CIYA 1AV6A 1QANA 2PLWA 1ZGAA 5LQCA 3PLAE 3BKWA 3EVCA 2WA1A 4FGZA 2B9EA 4R8RA 4ER7A 3LCVB 2IBTA 2IH2A 2JHAA 4EK9A 2IH5A 5E1DA 4PYNA 4CTKA 5E9QA 4XUDA 5CD1A 4BLUA 4RV9A 4AZVA 3BXOA 1FPQA 2E5WA 5HFJA 2OPBA 3HA7A 4MWZA 1XDZA 5CVUA 3GIWA 1AQJA 3P8ZA 5EHIA 1SG9A 4RTPA 5GWXA 5FQNA 3FUXA 3EVGA 3DMFA 5D1HA 3MTEA 1YF3A 5C1IA 3M6VA 3KHKA 5EGSA 3SMQA 2OBFA 4FT2A 3NVKI 8MHTA 4U7TB 4V0QA 3TKAA 4E30A 2AVDA 2EX4A 3P9KA 4G56A 2BH2A 3LL7A 2GA9A 2AZTA 2IP2A 1KYWA 3FYCA 5K0BA 5KQRA 2P7HA 3KQQA 4KVZA 3NVMB 5EHGA 1DCTA 2YR0A 4AUKA 3EGEA 4X63A 1RI4A 2PX2A 4QPPA 4E2YA 5LQAA 1Q0SA 5EQJB 1JG4A 5DLYA 1JSXA 5HIMA 1F3LA 4MQ4A 4R6XA 1D2HA 3A4TA 3G5LA 1BHJA 3PVCA 3C3PA 4C04A 3PX2A 5EKUA 2PKWA 2BR3A 1KPIA 3G2MA 3MCTA 4M36A 1QAQA 1X1BA 3E7PA 3OFKA 3SX0A 3DUWA 3T0IA 2EJUA 4CKBA 4DA4A 3EGVA 1KHHA 5GM1A 3HA5A 3FPFA 3CC8A 3HCFA 3LDGA 4GC9A 4KIFA 5LQRA 3MAGA 5T6BA 3HVJA 5D1NA 1N7JA 1RI3A 3SSNA 4RTNA 3PT9A 5B1SA 3DXZA 3UJAA 4ATNA 2PY6A 5ICFA 1WXXA 4F86A 1L1EA 1JQEA 4OX9Y 1X1CA 2Y1WA 4PYOA 3UJCA 9MHTA 2CMHA 4V0RA 1DUSA 1V39A 2JHPA 3LSTA 2P40A 3UJ6A 4CKCA 4E2XA 3FPEA 3FTCA 4PGHA 4PWYA 3SSMA 1D2CA 2PXAA 2ZBQA 5FADA 5K0FA 3T7RA 4WXHA 1WY7A 4FT4A 3HEMA 1JR4A 3FPGA 3MQ2A 3RODA 3GRVA 3A26A 3ANXA 5K03A 2ZZMA 2O57A 4YV1A 1OR8A 3WSTA 2IIPA 5FHRA 1JSZA 1XXLA 3P2EA 4BLWA 3M6UA 4YUZA 3UJDA 5GIPE 2PT9A 1ORIA 2PXXA 2IDKA 3VC2A 1NW7A 3UJ8A 5EC8A 1NW3A 2B78A 1D2GA 4YUWA 4C07A 2PJDA 1VIDA 1SUSA 1INLA 5C0OE 1NE2A 1I4WA 3PFGA 2GLUA 2WA2A 3OPNA 2I9KA 2JG3A 5ICEA 5FA5A 2PVCA 4KW7A 4RTKA 3O4FA 3SR4A 1I9GA 3CJRA 4GUAA 3EVZA 5K05A 4MTLA 4KRGA 2OKCA 3FUTA 3B3JA 4OQDA 5KYGA 4R6WA 3UJBA 2PV0A 3HP7A 2I62A 1XJ5A 3EMDA 2QRVA 4K6MA 4PYQA 5E9WA 2JHCA 4RTJA 2G1PA 2XBMA 2ADMA 3R9XB 1G8AA 3QV2A 1SUIA 3LGAA 3BT7A 1WZNA 2YTZA 1O54A 3BGDA 4ISCA 2KW5A 3IHTA 3M6WA 3ID6C 5E1MA 1G6Q1 2VDWA 5E8RA 3GJYA 1JTEA 3E23A 4E33A 4CWAA 3FUVA 3FUWA 3TKYA 5EPEA 3ME5A 2N47A 1R18A 3FRIA 2AOUB 5DPMA 5DX8A 2UYOA 3EVBA 4ER3A 5GINE 3FTFA 2ZZNA 3THSA 1WG8A 3H2BA 1R8YA 3P9NA 3O7WA 5HEKA 1IXKA 1Z3CA 4RTLA 2YXDA 1YFLA 1FBNA 3LCCA 3HCAA 1B42A 4YUVA 3FTDA 5FUBA 4CXMA 1FJXA 5EEHA 4YV0A 5H02A 4CKEA 3KQPA 1KR5A 2O06A 3R0QA 3CVOA 3HVKA 2GS9A 3NJRA 2P3LA 3Q87B 4RVHA 1NW8A 4M7RA 4RVFA 2I7CA 4HRAA 4C03A 3PFHA 1M6YA 3DXXA 3IV6A 4PIPA 5EKXA 2HNKA 1ZHFA 2CL5A 2PWYA 2ZLBA 3TM4A 5DSTA 3ER9A 1KYZA 1NV9A 2AOUA 3V8VA 5DM2A 2R6ZA 3GCZA 2B25A 2IFTA 5F2KA 5EMLA 3I58A 4QVGA 3KPWA 5EOVA 4DM3A 3NDIA 1VP9A 2G72A 2ZWAA 1SQFA 1KP9A 3FUUA 1P1BA 1G8SA 4P7GA 2IH4A 1L9KA 2ZULA 3HCEA 1FP1D 3KQSA 2ONZA 4EVIA 3M6XA 2O05A
chains in the Genus database with same CATH superfamily
5F33A 3T7SA 4G5HA 4NTZA 2JF0A 2NX2A 3AESB 1U8TA 4E21A 1ZHOA 4R2JA 1ZCFA 2VTBA 4GOND 1UC8A 4ZA2A 1G5RA 3Q9SA 4IFBA 2D62A 1U3WA 5JQGF 4S2UA 5CVCA 1SQSA 2D2VA 3BMXA 5AHRA 5IDVA 2ZJOA 5AJVB 2Y4OA 4KE9A 1T43A 4RZIA 1HDIA 4TXNA 2F90A 3MCWA 3T5DA 5BP7A 5LKAA 3A4YA 1H05A 2AEMA 2VN8A 3U56A 1MDFA 3A6DA 1FW8A 3TW6A 4I5FA 3QU9A 1ZDMA 4GYKA 3D3QA 4YRRA 3U3MA 4D41A 2QVCA 1X3SA 2RGDA 1YS6A 3EDRA 1AHHA 1N1GA 3JAWB 3IKTA 3TD2A 2FQXA 2FX2A 3ZOKA 5JSZB 3EVDA 3K1AA 2EQBA 3V1UA 4BGUA 4PAWA 3TNFA 4JBHA 2FW9A 4O4LB 4AO6A 4DWJA 2QXYA 5J4VA 1WHTB 2C9ZA 3UHOA 2ZIGA 3ZPXA 4AXXA 4F8EA 4EJ2A 5EESA 1PJ2A 4OHFA 2G67A 4UFOA 2DPGA 3E9NA 3KD2A 3KEMA 4LE2A 4PS1A 3WKCA 4P3NA 2XWJI 2X5NA 1RRVA 1GTMA 2HPAA 4ZEWA 5TMDA 1U5AA 4BZZA 4EJFA 2PA0A 2HSZA 1RQLA 3DP7A 3PDCA 3VNBA 3Q98A 3D43A 1PZXA 2YJ3A 4RKEA 1PN3A 4M0MA 2ZOSA 2EARA 2D00A 4L22A 3VU9A 1I13A 3OC6A 4OBEA 2HHHB 3R6TA 4FFNA 4X44A 5JAIA 3OZIA 4PFSA 3UJHA 1CZUA 4HAUA 3KAQA 3SZLA 2G1AA 4AJ4A 1E6KA 4O2AB 4JWKA 1MC8A 4US2R 4KBGA 1BOFA 4RA9A 1XC7A 1K68A 2Z3ZA 3LE8A 4ZWNA 3A06A 4YO7A 4DG8A 2NQTA 5KNCD 1FFWA 4UNPA 3K4HA 4DGQA 3CLTD 4K2HA 4UE2A 4KUEA 4WBSA 2C9YA 4ON9A 4B34A 1HE1C 2H2WA 1QZXA 2QU7A 2YWCA 1Q7GA 3DAPA 4QDUA 4RMGA 3QU7A 3PC6A 4HDRA 3ZUPA 3FGPA 3QFSA 3OX2A 2JGKA 4HUJA 1PV4A 1A2QA 1M1YB 1OZHA 3CW9A 1A71A 1N5OX 1ZLYA 3HO6A 3FJ1A 3IVRA 1UT8A 2I6SA 4QQKA 3WIEA 3U4QA 3K1YA 2QDXA 4POAA 2H11A 1HDOA 2WTNA 1Z83A 2ZRCA 3E6AA 3JS5A 2CLLB 1AIPA 3LOQA 5AW5A 3TW4A 4BFWA 5BVHB 1PVDA 3EISA 5IUNC 5F5XA 1A9PA 2AWOA 1X7ZB 1RE0A 2HDNB 4HNQA 2X9GA 2HF8A 4EY3A 4F6CA 4N5MA 1U4OA 1ATZA 1X9HA 1SVOA 1UWCA 4HL6A 5KVAA 1NYTA 3UOAB 3F5QA 4BMDA 4ZQBA 2R66A 1QB7A 5K0LA 2HR1A 2ZI9A 1P74A 3H65A 2A1UA 3WLFA 5LD2B 1WE2A 2P8JA 4N0EA 2BI7A 1F5SA 4DLPA 3SJCA 4E12A 1PFGA 3TIXB 1GUBA 4AYTA 3PKZA 2HYIC 1XF1A 4NNOA 5CM2Z 2WU4A 2W93A 4HGQA 2WMDA 5ALZA 3I12A 1G63A 5FLEX 3BZUA 4W5HA 4W7HA 1PFVA 3ETNA 1MEJA 3LGSA 5ITZA 5TQVA 4CN8A 1J0DA 4J1NA 3GMTA 2R6HA 4AICA 2BUAA 1RWQA 4CW7A 1DADA 1KOJA 4OVKA 3KWJA 1UKEA 2G06A 2NU8A 1DAPA 5DBEX 2GCPA 4RENA 5IVKA 3RIGA 4PO1A 3CIOA 5BSWA 1M2OB 2I99A 3WOHA 2SECE 4WOPA 2HAEA 2WWVD 3B5EA 4DG9A 2BMEA 2WF8A 1YVEI 4YRLA 3EQ9A 3A28A 3JQ7A 1KBZA 4HFJA 5ALNA 5B37A 3AI2A 3LI2A 4MW4A 2XIQA 3IBSA 1YB1A 3ZR4B 2NZUG 3G9QA 4Y9TA 2Q41A 4OLBA 2AG1A 3IIKA 2FMKA 3RNOA 3SIPA 5HRAA 1THZA 1DKOA 2FEKA 4LG1A 3M1LA 2I2XB 3C4QA 3DLIA 1NQOA 4EY6A 10MHA 1ZI6A 2BEJA 4GWKA 2BR5A 1LPOA 1Y7LA 1R10A 2OG1A 5ALOA 1P6QA 3ZQ4A 1SKQA 1NC1A 4LWOA 1GT91 3INGA 3CWZA 2XUKA 3H4TA 3OE5A 5BQXA 4D3YA 3W8RA 3T7TA 5B64A 3SR0A 3ZGXA 4WIAA 3A36A 3LA8A 3OFNA 1TLTA 4OKIA 4P84A 4IDQA 1HL3A 4GZMA 3UANA 4ZZ1A 5BQ3A 4KAXA 4OJNA 5DNYB 4DTCA 3A6PC 3GNSA 2P1DA 1N5LA 1VRVA 3O8QB 4Q4DA 3RQIA 2JFGA 5TIIA 1KAHA 1NUPA 4V0OA 4TV9B 1T13A 2IE0A 3QH4A 2VOJA 2FMIA 1RHRA 4J16A 4R0MA 4E5YA 4WK4B 4L73A 1EQ2A 4RZUA 1N0HA 4W1SA 4Z3DA 5BSFA 3TTWA 3KKZA 4A2QA 5KO2A 4EFLA 2OM6A 2A7XA 4DLLA 3A1FA 1ESNA 2EJWA 3K0CA 4UAGA 4TPKA 5EYPB 4WLNA 4B3BA 3BGVA 5DOZA 4C08A 4TTPA 3N2KA 1JHAA 3LUDA 2CEAA 3AUTA 3PR1A 3R3ZA 1QF7A 4BRWA 1F8XA 4YRMA 4U3JB 3PJRA 3QLVC 1M83A 1H2EA 3KYJB 4QBHA 2OV6A 2Q2WA 4LECA 1PDOA 1IBMB 1X39A 2OEPA 1ETHA 4RVUA 4ALLA 5I47A 3PD1A 3C6ZA 1RQNA 1DX6A 3OLXA 2QPOA 1BNCA 2QVGA 1JMVA 4W7IA 3D7RA 4BE4A 3TZKA 4EUEA 3E61A 3DH0A 4TYPA 3C8ZA 3IT2A 5EXDA 1PVVA 4F9FA 3RV3A 5JNWA 2V1UA 1WQ3A 1XB2A 1NI4A 3RAJA 2PD3A 2VNHA 4YP0A 3VTZA 3MWJA 3CS3A 1SWWA 1OU0A 2DQYA 2XMQA 2Y9PB 4Q93A 3W6ZA 4XSVA 4O4IF 4II2A 1ZYUA 4HXGA 3OWHA 2RCYA 3DKIA 1O94D 4G0PA 3ISVA 4NABA 1M8FA 5L3SA 4OUDA 4URWR 5E7IA 1JHMA 5JIBA 3OETA 3ZCPA 1HDRA 5JH7F 1RBMA 2XVMA 5F76A 2NXJA 3TOCA 2NYRA 1Z8DA 4TKZA 5DMHA 5CFOA 2RH8A 2X7XA 5BORA 2C0PA 3LDFA 3X1KA 1G21E 4GOJA 3SS9X 2ZDGA 2QNRA 4G1BA 4YCNA 1PQUA 1SFRA 1XN1A 2QROA 3FWZA 4MEJA 4XQ0A 1C7JA 1T6BY 5J1SB 5CURA 3MJSA 1C14A 2PRYA 3C5VA 3K9LA 3P97A 3B1JA 5THKA 3ZKWB 5CB6A 1LNQA 2JLZA 1UBGA 1MEEA 3INTA 1NKTA 4AX4A 4M4SA 4HMOA 2GLXA 3ZE9A 4ZVOA 3JQ9A 4YQEA 4BJHB 5SY6A 3T12A 2IEYA 1EE9A 3PD7A 2DUMA 1F8UA 2MSDB 4JC0A 3D0QA 4LVUA 5HOQA 1MW9X 3W5HA 1K7YA 3W9UA 3PX3A 1T4GA 3O73A 3F8WA 3UJ3X 1XWFA 4M38A 1OXXK 4ESOA 1X13A 4W5NA 3DBHA 3O21A 3I6BA 1KKMA 3JQBA 5EKTA 1EAMA 2G8LA 1I4OA 2Z5FA 5JJIA 1YE3A 5BNIA 1PUIA 4GOMD 4RFLA 5JCOC 3N2YA 3L7BA 3A0UA 3VR4D 4TS4A 3QUQA 1F0YA 2I4IA 1PR9A 3CX3A 1O95C 1NQXA 2IEAA 3NO4A 1MC5A 4L4ZA 1YH3A 2J46A 4PLZA 3LXMA 4GXNA 5FYQA 5CA1B 1TQ2A 2QRKA 4LHEA 1QKIA 3JYHA 4KX5A 4HYTA 1DX4A 4DV5B 3RAGA 4TSFD 1VMAA 2HSDA 5LZ4A 4OM8A 3V8EA 3KVOA 2XXAB 2Q7OE 1ZWKA 4QFBA 4Z7QB 3TW8B 5I9LA 3OEYA 4MVJM 3KVVA 1HEIA 1BYUA 4A0RA 5GTDA 4NG5A 2B8NA 5CUQA 2FWNA 4EBBA 2A84A 2MINA 4R69A 3PEEA 1X7ZA 1XLVA 3BJZA 1A96A 5FBZA 3CSDA 1E1CA 4RL4A 2HWKA 3VR2A 2OB1A 4IQ4A 1ES9A 3PLAE 3CNEA 2FU5C 5KWEA 3WVNA 3OKCA 1PK9A 2I78A 3C3CA 2AK3A 3QUSA 4ND2A 1FDVA 1JT2A 4QU8A 3FB4A 2IH5A 1JQLB 3SE0A 4MMXB 4YCAA 3TF5A 5K5EA 3AERA 4Q3OA 5HP4A 1H2RS 2QGFA 3EPKA 3AJ9A 4CTNA 5D7NA 3NYWA 4RULA 4KMMA 5G53C 2CLEB 2NSDA 1ISJA 3JYOA 2BGJA 2WIJA 4MWZA 1Y7HA 1WKVA 1ZA1A 1ZS9A 3M81A 1OWOA 3AHJA 4Z49A 3V4LA 1EA5A 4HXYA 4RK7A 3BBPA 2JJ2D 4CCAA 2Z2JA 4D3ZA 3LK6A 1KJWA 5B3JA 5EIXA 3CM0A 3E35A 3KYIB 1YZNA 3CNOA 4NX2A 2OMKA 2OBFA 2P9BA 2I22A 3ROPA 4AF6A 1QKKA 3KQUA 3RC8A 2IHZA 2LNDA 4RPCA 2A9FA 5C3MA 3IVCA 4UBNA 3MELA 4B6JA 2RGNC 3U3DA 4B6RA 2AZTA 3K32A 3D4NA 2HJWA 2JEOA 5BV7A 2P69A 4L2IB 2D5IA 2HA3A 3DBVO 1JKJB 2YR0A 1L8XA 3E2PA 3EVTA 2Q21A 3H8JA 1CZHA 3ZYZA 5ALWA 1H9BA 4RH0A 4B48A 1E0AA 3S8MA 3CZPA 2NVBA 2JK0A 2C2MA 3MFYA 5DVZA 4CL8A 1E6LA 3PVCA 3MT0A 2OSBA 3PX2A 1LQTA 3QKIA 3GLRA 4KMOA 8LDHA 5JVDF 3EOZA 5LP6A 3GLIE 2D0OB 5MHTA 4L8GA 4ALNA 4I4TA 1OFIA 2EX1A 1IXYA 3FZYA 4ZQHA 3TI7A 2GCNA 2X6RA 3S28A 4IQFA 3AB3A 2DVMA 5L7TA 4XX0A 4ZT5A 2HA5A 3WRXC 2Q9CA 1UBUS 3LSTA 3TRDA 4NCAA 1JYFA 5AW6A 1BMTA 1LPNA 2R8BA 3FPEA 3GOHA 5BSGA 3OTOB 1ZVVA 2OFWA 3EAQA 4DIDA 3P9SA 5FADA 3URMA 1ZUHA 5G4LA 2I65A 2V6GA 4U9UA 4D42A 1X1SA 2IEZA 4EJMA 521PA 1CVLA 1O77A 2V7UA 4JL8A 5FO0A 4Q4CA 3CZ4A 4YONB 4V1CI 3WL4A 1JSZA 3LHFA 3AESA 4FDLA 4LIPD 4AZ0B 1U2SA 1CNMA 4A03A 5BV8A 2CLFB 2NV6A 4UPVA 2FPGA 4DMMA 1X86B 2LIVA 1X70A 4LGCA 3I83A 1UZNA 2ZBFA 4NE7A 1SUSA 4KQ2A 4NYJQ 4G97A 5C0OE 1KVSA 4FYPA 2PRZA 1TEVA 4E94A 2WUFA 3EVNA 4GHWA 3WGVA 2HFJA 4EO4A 4JWTA 4QO8A 1H42A 5CXUA 3LKVA 3EVZA 5KYNA 1I1HA 1ZNQO 2BZSA 4KRGA 5DHTA 2YJ6A 3RHTA 4B47A 3NH9A 5K7SA 2LW7A 4M88A 1QRTA 4FN5A 1L5LA 5M5BA 2QRVA 4EJSC 2P6OA 2MTBA 2QZ9A 3CE6A 1MNAA 1B0ZA 1SGWA 2FSUA 1K63A 2ZB4A 1PQWA 1ZSYA 3ZTYA 2QPAA 1T1GA 1GPAA 4XGIA 3IDAA 4BQEA 1WZNA 2YTZA 4OK5A 5DCLA 1FUEA 4JP3A 2ZRQA 3NP7A 1CB7A 1TTQB 2G08A 1RW4A 4EABA 2ZGVA 2FUNB 5LDGA 3AR2A 4EUFA 5LB2A 3LAWA 1TT5A 4UQOA 5DYWA 4CF5A 2CJXA 1IHDA 1U7PA 2IUUA 1J7JA 2A4KA 3AM5A 3GPIA 4OLHA 1VYHA 2IHYA 4Y9RA 2AOUB 1UDWA 1CLUA 3OAAD 3RGGA 1P0MA 5FV7A 3F49S 1VXRA 2G4LA 3T15A 3NBQA 1R8YA 2JEZA 1ZIDA 2FVXA 4PX2A 2A0KA 3ZGNA 3MK31 1RDFA 2FW8A 4K46A 3E3NA 4R3UC 2NUBA 3FTDA 3GDOA 4HDMB 2BHSA 5J2TB 5DHFA 3TTXA 1ICEA 5GJVC 1KBQA 2K6GA 2JKVA 2XMCA 1O6BA 2QRMA 4YMSA 4YB8A 5WRFA 3NWOA 1FQWA 2J6BA 4KXVA 3U9SA 3IQDB 1VYVA 1C0LA 4D2IA 2V6FA 1QHIA 1UBTS 4L4SA 4LSWA 5IJWA 3NJRA 4V1CA 2M32A 4XQGA 2BI8A 1LA2A 4KFSA 1Z6ZA 2Q4RA 1LDBA 3H5NA 1A04A 1GR1A 4D97A 4QGSA 4X8MA 4JVNA 1U0TA 3VHLB 2OHGA 2ZT7A 1K92A 3M0EA 4ZYWA 5JXJA 5KPDA 2X4GA 5FOWA 1XRNA 2I8LA 2W42A 2IFTA 3NGMA 3WGZA 4IS2A 1NVDA 2RAFA 2BKVA 5EE9A 4QBKA 4NXNB 1SZPA 1F8GA 3HKDA 1KP9A 3RC1A 5JMPA 1JIKA 3OPYA 3VKFA 2GXSA 3H5VA 3AVXA 5C8ZA 3C6YA 4IEEA 2ONZA 3KP1A 1R3DA 4YECA 1QFMA 5FI5A 2RGWA 1QQ7A 3UA4A 1XVUA 2E49A 3W5UA 1G8KA 3PWSA 5L7WA 2HPZA 3UJPA 3F6RA 3AONB 4CF7A 4IHKA 1IY9A 4MDFA 2QDKA 4WKCA 4C6HA 4PLWA 3RRJA 1PJQA 1MCZA 3SYLA 4MGYR 4HSGA 1E0DA 1HDXA 5EJ9A 4AZ3B 2ZKIA 4RVOA 1PZHA 2FLVA 1Y3AA 1RMYA 2PHZA 5F1OA 3E5RA 3JQAA 4KAAA 1XHFA 1JFRA 3RIMA 5K01A 5JASA 1ZAKA 2B8WA 1CUWA 1HDYA 1NDQA 1P1FA 2CHVA 2YVLA 2XQIA 2ZSUA 3CFYA 5KU1A 1QP4A 1RJGA 3T3DA 4BMXA 2PYZA 1SZCA 1AN9A 1A7KA 3GELA 1XRJA 3BWDD 3ZD9A 4R9VA 3GLUA 3URKA 5BUCA 4RX1A 4TKMA 5KTPA 1VJ0A 4JUIA 2RG7A 5TY0A 4E88A 1B16A 1EP9A 1X15A 1GZDA 1GGMA 2JIPA 2CLIB 2ODQA 5KSOA 2ECQA 4N0QA 3LNCA 1Q2UA 3GPLA 1WZEA 4ZT2A 1GGVA 1YBHA 4H16A 8OHMA 3H2IA 1DHRA 3SS8A 3W7BA 4BQQA 4IMRA 1HMYA 5FR2A 1A4XA 3ENNA 4KITB 1XNRB 2OGZA 4BRZA 3N87A 2Q5CA 1W4RA 3GHYA 4MV3A 5LYYA 1N77A 5DSXA 3KSBC 2VAMA 3FHOA 3BN3A 5HFNA 5AQEA 421PA 2J3HA 5DX0A 1USKA 1UJ6A 1WPXA 5KAPA 3GRKA 5LMCA 5TQ2A 1ZK3A 3H86A 3HJGA 3W79A 1MO5A 4ZVNA 1QVVA 3ABQB 3K2QA 1UDCA 4IIBA 4KQKA 5JALA 4QOSA 4NKRA 2WHYA 2VKQA 4Y0VA 4UATA 2YQZA 3RJZA 3RSFA 3WP1B 2X7JA 1UBJS 1CEQA 2DECA 3MAJA 3SVTA 2CHGA 2MYUA 4NCXA 1QGUA 1XWIA 3FHCB 4FJ2A 1K5PA 3E48A 5K1ZA 3FSRA 2QMQA 3QX3A 4FE7A 1EQAA 3ZHTA 3B48A 4JCOA 3KDAA 2OZVA 4ND4A 1CWUA 4GPBA 4RADA 4TTVA 1JWBB 1QZTA 2XUOA 3CUSA 5GONF 4QREA 1C4XA 3VDMA 3JXEA 4OMCA 1ZVQA 4EB3A 3ZI7A 2AG0A 2XCRB 5P8WA 1JR3D 3AY0A 1O96B 4UVHA 3DULA 5T4FA 4Q4LA 8ABPA 5K0EA 2OCKA 1YFJA 3GJ7A 1IXZA 3MGKA 2O9JA 4IFIA 1YMQA 4D82A 1MMFB 4ZYTA 1JXQA 4IH9A 1V5GA 1QH1A 1RAAA 4BFLA 2R96A 1NXTA 2O54A 3TCXB 4BZXA 1VBKA 3ZE6A 3IR6A 2Y27A 2AN4A 4NENA 5FTKA 2W9XA 2R6FA 4BNYA 4DGSA 5ALDA 2WSMA 3I9JA 3ZV6A 2EQ5A 4QG3A 3HU1A 3KQMA 4MRMB 4QODA 3NOOA 3T1OA 1J33A 1V1MB 4LSMA 4RZQA 1Q1QA 3RARA 1VC2A 4PQRA 3HJAA 2II6A 2QZJA 4QDJA 4ZRMA 2BMWA 1PNRA 4IVPA 3EJWA 5EMKA 4YJDA 2HA0A 3R77A 2E4WA 2GCIA 1KXJA 2ZRPA 4EZBA 5BMVF 5C7OO 5DXFA 2ID9A 4JSRA 5SY9A 4QJ3A 3ROKA 2UYHA 1TI7A 4XXHA 4JI1B 4Q1FA 5HXAA 4X7PA 2VHVA 2AX4A 4MRPA 5DTMA 3SU8A 1CE8B 4R1QA 4UZEA 1XO1A 4LGMA 2CWWA 4PG6A 2CVQA 1VI5A 5LNK1 4MKIA 4E32A 1IJBA 3VU3A 3HC7A 4DV3B 3LXUX 3NBYC 5JYDA 1DFGA 1POXA 2AR7A 1HE2A 1JR3E 3MEQA 1LVUA 3DLAA 1SKBA 1CZKA 3OX3A 4N0PA 1IIRA 5JQGA 1F6BA 2OA0A 4OAQA 3U7QB 1QU3A 1OT5A 3UB2A 3ZKAA 3WTCA 2GSWA 1GDDA 4KQ1A 4RMHA 3RUFA 4YRFA 3SIRA 1HNZB 1MF7A 3WYCA 1K4YA 1SPBS 3B13B 3EA4A 1YOBA 3EGXA 2H1CA 3GDHA 2WYOA 2XTAA 3F7OA 3QG1A 2O6HA 3TH5A 4DCSA 4FGWA 1KF0A 3OSUA 4N18A 3FFAA 1S2GA 3MG9A 3IAXA 3B8EA 1P39A 2GEKA 5JG7A 2QVLA 3WK6A 1YCDA 2ANBA 3H83A 1EK0A 3QWBA 3O4RA 4UJ3A 1YZHA 3QW4B 3V8RA 5KX5B 2Z2ZA 4HT3B 4IOKA 3BG5A 1KK3A 4AQDA 4KZPA 1JYEA 3FRJA 2WG0A 3AB7A 4HN4B 4IQ8A 5CJJA 1YWGO 4GQBA 2XTJA 4D25A 4PBSA 1E6EA 3LKZA 1Z35A 4OQNA 4RXUA 5C8YA 2GZMA 1XVTA 1K1EA 4X66B 3VDRA 4RTMA 3HCDA 4DXHA 2NUAA 1A9ZA 1W88B 4MS4A 3KQKA 5KDOA 4OLFA 4Y7CA 2QBYB 3W2IA 3V3KA 2ZRKA 1JTFA 2AYZA 2VSNA 3TOXA 4J0QA 3EEYA 2EIHA 3PXDA 1U1EA 5GM2A 1LUAA 3FVRA 4BYMA 1GDHA 1WIWA 2APJA 5L7YA 1T25A 3Q3GE 5KNCH 1DDIA 4EHKA 1Q17A 3HR7A 2PX6A 4Z86A 3HYRA 1XZNA 3RRXA 3TIIA 4NRDA 3TBHA 1FSSA 5I3CA 2VF4X 5JWHA 1KXZA 2O3UA 4BBJA 2AEEA 4KDCA 2RI6A 1MPTA 2LKCA 2VUTA 3QYPA 1M66A 4FFVA 3ESBA 4NVRA 5H16A 5A6VA 2CFRA 3LBNA 1N2ZA 1JI0A 3IJEB 5JC1A 1XZ8A 3EPRA 5IK2D 1COZA 1BGXT 4NZPA 4MCIA 4OV6B 1KDVA 3RU7A 1L3IA 1L8OA 2QE7D 3PFBA 4ZQCB 2GHIA 3NKLA 2BMJA 4UFNA 1JG3A 4PIMA 1WEKA 1XCJA 2YHAA 1VI6A 1NVVQ 4ZCSA 3WQRA 4WHMA 4BY9E 3ZBPA 2CVFA 2PSFA 3KIPA 3PI6A 4ALKA 5J4HA 2RJ3A 1EFRD 1FF9A 1XE3A 3EY9A 3HB1A 1JBKA 3O8DA 5ENZA 3S1AB 4F46A 3GEIA 4HBZA 2EP7A 4K7JA 1PNVA 2H5JA 3EIUA 4FXOA 2F8LA 4P7FA 2EFYA 4GKJB 3G0DA 4EI7A 3F0TA 3KFVA 4PZCA 3C3AA 5DE3A 1N3YA 3C5EA 3OPYI 1KZHA 1W19A 1E9VA 4I4TF 1Z47A 3TPZA 2HTFA 2BSXA 3N0XA 4PANA 3LY7A 1J8DA 2YWFA 4HGZA 4NOMA 5CB4A 2ZS7A 4YEDA 5CX4A 1X87A 2EYQA 5KYVA 3K0BA 1PGOA 2FZ5A 4ZRNA 2ZDHA 1Q3KA 3RRZA 1XQ1A 2ZI3A 1KK1A 1RFGE 1TA9A 4LOIA 5THXA 3JATA 1ZJ6A 1YKSA 3B89A 5D3KA 5IT0A 1QIMA 3I3OA 4C0SA 4NEQA 3RJTA 4BGIA 4KFRA 1EEHA 4X00A 3WRXA 4WT7A 2ZCJA 4IHJA 5BQ5A 2QP4A 3Q0EA 1G0OA 3K1AB 3T3NA 4D81A 1RYYA 5EXXA 1J8QA 2BGTA 2O14A 2QJTA 1BJRE 4TTJA 1PWHA 4ARVA 3QPAA 3CRQA 2BE9A 1FMLA 4FB4A 2LKDA 2H4JA 4Y2TA 4LPSA 1XFDA 1QH8B 3FMOB 3CW2A 2C1ZA 3A27A 3H5RA 2O07A 3TN7A 2Z1MA 3EWAA 3W06A 3N2ZB 1JR6A 2H63A 3NORA 2X4DA 3CG0A 3GRFA 3W2GA 5E3HA 4I4IA 1NVWQ 1L7NA 1EYZA 3AKZA 1SMKA 3HBLA 3SXJA 3ZVMA 5CEFA 4XM2A 3ELWA 4FEYA 2IHJA 2PZFA 1II8B 2GK3A 3LX4A 3FGOA 4PSKA 5DHUA 4UTVA 1I6WA 1OFHA 3KL4A 2VVTA 2BZGA 1IC6A 5ADVA 2D0DA 4JS0A 3R41A 2B1IA 1E9CA 2H52A 3GEMA 4KQ6A 4QOJA 1E3JA 5B2EA 5HPYB 2AMVA 2IZ1A 2UVPB 5FL3A 5BVGB 4FZJA 1IHPA 4M1QA 3QPVA 4UMDA 4Y18A 1OYOA 2R87A 2VLIA 1FX0B 1N2CE 3IAM6 1ACJA 2VT7A 2AZ4A 2WJGA 2CKMA 3M4NA 3SFTA 3WDKA 1PSZA 2NO4A 3JSXA 1NJ5A 2F43A 3S2YA 5CT8A 5GJBA 4PBRA 5LYJA 3WGQA 2FPUA 2W4MA 4NYMR 3EEOA 2FMTA 4BMZA 3COVA 4P4LA 1OFTA 4INOA 4PLPA 5CITA 4LFAB 2IS4A 3W6PA 4DUZB 4L6AA 3QY9A 5FBLB 1M6VA 5KHAA 1ZGAA 2XVYA 4MW5A 5T3YA 3UY4A 3FIUA 3ZDXB 4AT1A 5JZBA 1NRWA 4WFQA 4R8RA 5CHYA 1VE9A 1VPEA 4L4XA 5IJ0A 2QENA 2QZPA 4HNAA 1WHTA 5IC6A 4W5OA 1QGED 1GG2A 1KEZA 3KKEA 2Z2XA 3B70A 1QOPB 1OC4A 1G8GA 4WNIA 2C3YA 5AI5A 3I37X 1L4YA 1T8UA 2JAUA 3UG6A 3ITKA 2QN1A 2IXBA 2CE7A 5D00A 1Q0LA 3I42A 3CF0A 2IP4A 2XKBA 4CN9A 1DRKA 2EU8A 2OR3A 2NGRA 4KTTE 1XNQB 4G63A 4MQLA 2GN8A 4YJGB 3HY4A 1E2NA 3ZWOA 1IUKA 1CQPA 4EG8A 2QP3A 3ZYCA 4W63A 3KHKA 4J0CA 1PS8A 4WXRA 1HK7A 1X14A 5DM60 2W2MA 4ZKDA 4H1TA 4WX2B 4NBNA 3M6MD 4JR1A 4NBTA 5JD3A 1ZESA 2BP7B 2UUOA 4EQ6B 4GMGA 1XLUA 4TWAA 2QW1A 5H80A 4FVTA 2GZ3A 4LQDA 4RMIA 1KORA 1Y34E 4KG7A 2L82A 4MJ7A 5EE3A 4PRYA 5LZ5A 1QP7A 2PH5A 4CMIA 3T5MA 1ZMTA 4S1TA 1D2HA 13PKA 2B30A 1FU7A 3CZAA 4C04A 6REQA 1IL0A 5CB8A 4M36A 3H4VA 2J9FA 3OD5A 4IICA 2JH3A 4PY2A 3WGKA 1AMUA 5JH7A 3FPFA 3CC8A 4CCSA 1KRXA 3T6KA 1QH0A 5JCOA 4BKRA 4KVAA 5K3OA 2VRNA 1QIDA 1WW8A 2XD9A 1QCDA 2AXQA 1HETA 4KGVA 4W1QA 1S9DA 1JZSA 2OGWA 2Y1WA 3A6EA 1DX9A 1U0JA 1DUSA 2YUTA 3BWVA 3SLRA 1HT2E 2Y66A 4DA7A 1THTA 2ZUEA 4LDAA 1AO0A 2WV9A 5GY7A 1DE0A 1JSLA 4G26A 4A8JC 4CLDA 1X42A 1NKSA 4DSZA 4YMVA 3NPMA 3PUYA 3ZJ4A 4HGPA 1DIAA 4CMAA 5B3JC 1TF2A 2GESA 2IYWA 4FJ1A 2VF5X 3W34A 3UK6A 1RYHA 5ALVA 1D03A 1TJPB 2RAVA 3CXUA 5C2JB 3UJDA 4EUNA 3L46A 4Q3CA 1EVZA 1U7XA 2PEZA 3EFOA 2D13A 2B78A 2XCOA 3GUVA 3O6VA 4UKDA 2WM9B 2BBWA 3ZEIA 1INLA 4E5DA 1E6MA 5AK0A 2QYHA 2ZR8A 3DVRX 2AI2A 4YJKA 5BYKA 1BDMA 3HO1A 1E2KA 4RTKA 4B6OA 3ULKA 1BQ4A 3OF3A 1W8IA 1TIBA 2C0CA 4FEGA 1O6ZA 3P7MA 1CRQA 4IXWA 2Q5EA 1ZCBA 3F3KA 4OQDA 2VNAA 3HP7A 4JNKA 2FPXA 4K6MA 2DY0A 4OXQA 4W1RA 3U4DA 5DGDA 3USCS 3IVGA 4NH4A 1J5EB 2JRLA 1FJHA 1R0KA 2CXSA 4FEAA 2Y8EA 2WM2A 3D0RA 1YZVA 3LGAA 4GO1A 4JFRA 1WAMA 1I10A 1GRQA 4KV7A 3AIMA 1DBQA 2YWEA 3CW8X 4G4SP 5JXGA 5EFZA 4N4AA 3P45A 1ARZA 1L0BA 4LYGA 1NIJA 1CRZA 3U1TA 2D2XA 1J8MF 1XQWA 3DFMA 1U8ZA 1WUJS 1Y33E 3AUJB 5B1DA 2IS2A 2F9LA 2RHMA 1MAAA 1OI4A 4AS1A 4C2BA 2N47A 3VU8A 5DPMA 2EWWA 1YBAA 4KQCA 3LC0A 5ADUS 1EFKA 3KKKA 1JJ7A 2MSLA 3R7LA 1MVLA 3SXPA 1FBNA 2BN4A 3HFGA 3CH7A 2QD1A 1PJLA 3MJFA 3OKPA 4GMFA 3IDSA 1Z4QA 3BIXA 3N28A 5EY5B 5LBUA 3AG5A 3BJEA 4DLRA 4Z4HA 3GAAA 2ODNA 1XGKA 1NVAA 1RQ2A 3BJMA 4UE3S 4BO8A 4O4JB 2O06A 2VTBB 4H3KB 1ECPA 3CSSA 4NF2A 3PXBA 1TJ4A 4QGAA 3WKDA 3VYTB 4K03A 3DOFA 2XAUA 4HB2A 4HRAA 4ZYLA 4G9EA 5EKXA 3E7FA 1VXOA 3M6FA 2HNKA 1WLSA 4BWFB 1MH1A 1V8ZA 3B36A 1QGUB 4HQNA 5DSTA 2AOUA 2C8LA 5A9TA 1RM4A 3WRYC 2E1PA 1XMIA 1S1CA 1SU6A 2A0UA 2B25A 4QFMA 4C4YA 4CODB 4C4OA 1DJMA 4J4HA 3O2QB 4I08A 5KCMA 1IAQA 2XITA 3KLOA 3HU2A 5DYNA 5FEMA 5JNUA 1VSUA 1ILWA 1L6RA 1ZK4A 2DBVO 2E4ZA 2X0IA 2A5JA 2ZT6A 4JSTA 5MFPA 3NTOA 4LHXA 3D3WB 4UC0A 1KVUA 2VHCA 3WLEA 4AKSA 1BDIA 2D4AA 5F7XA 3EXHC 3GW8A 1LC3A 2UZ3A 3PGKA 4GKBA 2FSIA 3H6GA 1RJ9B 4KFCA 3HUDA 1FRQA 4XUCA 5JY6A 5IAGA 3AEQB 4C9BA 1P17A 4Q3BA 4R01A 4YMTA 4AZWA 5B7QA 3IP6A 4REOA 1C7QA 5J23A 5EHQA 3Q2IA 5AVKA 5KQGA 5ITSA 4DZTA 3OLYA 2XZLA 1XZAA 3AR8A 2YWXA 3D3WA 1XV5A 2ZFUA 1QG2A 5B7GA 4D9EA 3C3DA 4WXPA 1FUYB 2D3TA 4HRYA 2MSEB 1Z13A 3UTDA 4QPDA 4LRTB 4RD0A 3B2NA 1CIJA 4B8WA 3CH6A 3M2TA 2JBHA 1WBDA 3AM4A 4J7UA 4Q9KA 2A57A 2AFHA 3KQOA 3C6KA 4WJKB 4AKIA 1QGYA 4J0FA 2O50A 4IJVA 5IZCA 4IIGA 4LX8A 1RVV1 4IJ6A 1U9IA 1WM1A 3FD8A 4M55A 2ZEJA 2X0FA 3RUHA 4BNLA 4Q9HA 5G02A 4YX9A 4U2KA 4A8PA 3QVOA 1GHTA 1JHXA 1K06A 2YMLA 4INZA 3DE5X 3HWX1 4CF3A 1KO4A 1R0CA 4I50F 3THOA 4ERXA 2PA3A 3UFXA 1RIFA 4C0WA 2O8DA 4OGGA 2IOYA 2REQB 5AKEA 2C4TA 4IMJB 4QGHA 3TX6A 4CL2A 5AKXA 1WO8A 3G1TA 1QTIA 2HRZA 4LDNA 1FJ2A 4YCJA 4Y1GA 5AOCA 3ZU2A 4NONA 2GPSA 2QTBA 1A9XA 3KR9A 3IB6A 4RKQA 4MW6A 2NNWB 2OQRA 4YO8A 3AJDA 2LP4Y 1XRQA 1OZGA 4ZHQB 3WMGA 4DDKA 3OJWA 3ZWBA 2ARKA 4DARA 1KVTA 4QHTA 4DYVA 4C05A 1QHFA 5ALPA 3PDUA 1U3TA 3STTA 4GMHA 4GE0A 3OO1A 1F38A 4PG8A 2G9VA 2OO3A 4OI2A 4JJFA 1E2LA 1O9HA 3CF4G 2IE8A 3VC1A 5FWDA 1IEWA 3PRJA 1G9SA 2Q99A 4ZJZA 6REQB 2B7LA 3BDVA 3OMWA 2XRZA 1KEVA 5CM8B 2W6CX 4HNUA 1MUUA 2DHDA 1WQ4A 1G3MA 1YQWA 3KZNA 2Y4NA 4M0KA 4S0ZA 3S2SA 3ICQB 4JJGA 4E14A 5H1YA 5FOUA 4PCUA 4IDGA 1LSUA 3ADOA 3IEPA 4JHLA 1NJFA 1WUIS 2Q7XA 4XZ3A 1Z56C 4RIFA 4L75A 4B4UA 3W6UA 3NONA 5CGZA 4CEHA 2QQ5A 1NMSA 2HB6A 1JDBC 2X13A 3WS7A 4AY4A 4EARA 2EF0A 4COKA 3A1DA 2UUCB 9GPBA 2H1LA 5ESWA 3DM9B 4P34A 4C87A 2C5LA 4Y30A 1ZBQA 1BROA 1BXGA 3ASZA 4OHUA 4KVFA 3N8GA 4LHSA 2GJ8A 4KXNA 5C7IO 4XUEA 4V2IA 4RTOA 1K9SA 2IYZA 2Z6VA 3DMTC 1QIFA 1P8JA 1QTNA 4KQGA 1H8HA 4AC9A 2X8BA 2UXCB 2G6TA 5GOTA 2WWFA 3DO8A 3AI7A 2Q62A 5DM0A 2WFLA 2YFHA 2B4AA 4KWHA 1F6DA 4PGGA 4IZIA 3WRVA 3MRTA 4LWZA 2GBLC 3G85A 3GEEA 3JQFA 4RU1A 2CLDX 2K4MA 3CPHA 1VJTA 1QYWA 2C98A 4RZ2A 2IVFA 4FYJA 3TTYA 4ANFA 2HA7A 3PQ6A 1AH2A 1OJ7A 1MB4A 2FY8A 3HKDB 3IBYA 4U2FA 1YUBA 1W1IA 3GYBA 1ADGA 3I92A 3ZTWA 5FTLA 2AW5A 4GF5A 1T3LA 1O0SA 3CRMA 1LLQA 4XLLA 1OX4B 5BOSB 4AY2A 3NIWA 3ON5A 3K0KA 5FUQA 2I6XA 3HY3A 3JZIA 3U44A 2J5QA 3TAUA 2R1TB 2SCUA 1CB0A 2HIHA 5F98A 4JP1A 4RTQA 2HRCA 1OWLA 1T2CA 4KL8S 3H0KA 721PA 1PNTA 1NNI1 2X77A 3PHGA 1R4MA 5B3AA 3MUNA 2BGUA 4ZKEA 3QMPA 3E1GA 3TOVA 3W9BA 4RTRA 4LKRA 4LTNA 2DTEA 3JWEA 4TWRA 5KQRA 3PC8C 2OYSA 1NKVA 1VJGA 2BI4A 1JB1A 3B60A 2HWXA 5H9VA 1MEOA 1EM8B 3B38A 1XDUA 3DT6A 3Q7SA 2F9MA 3KQVA 5BNZA 2EZ9A 5ICGA 4LWPA 5LBTA 2RI0A 4LX0A 2DPXA 3M5CA 4CDMA 4D8VA 1MO2A 1PL6A 4AJEA 2CGEA 1F0NA 5CRIA 2XZOA 3H16A 2ORIA 4E2FA 2Q0SA 2VQ6A 5DEIA 2B3DA 2RMKA 1IZZA 3M4XA 4YAWA 4EPYA 4HC4A 1P5ZB 2BFOA 2GNPA 2WT9A 3D1LA 3TL6A 3ZE2B 2Q49A 2FCRA 3BHJA 1K5HA 1GL6A 3MSCA 3OZDA 3MINB 1XTPA 4YRTA 5ALIA 4NC9A 1SELA 1A3CA 3NKFA 2OB2A 5E2AA 3QPWA 4V02A 3O8QA 3TUIC 3H1TA 1KGDA 1SHKA 4IUYA 2ZTMA 3FBWA 4FILA 2ZJAA 5FL7D 4Z7OB 1LI4A 2W37A 1XZEA 1WS6A 5JXIA 1JVSA 4US1R 1N9GA 1KMNA 1N2SA 2HNAA 4MKRA 1S2LA 3UWOA 5HUJA 2H48A 5CCBA 1FYEA 2VJYA 1RWXA 4MPDA 3IHWA 5LYJB 1XNJA 2X76A 3ORHA 3HA3A 2E6UX 1VIMA 3T7IA 5DM70 4IIXA 3J81A 2PUBA 3IQWA 2GZAA 3CB2A 4J1TA 1P91A 5DIFA 3TNYA 4D45A 5KTNA 4O59O 2PJRA 1NU8A 3DWIA 4FFSA 3ET5A 5GONA 4FBGA 1KIAA 2BJWA 3QF4B 2EJBA 1FNDA 3INNA 2GNAA 4I55F 4QBTA 5CX1B 3UMJA 4DL9A 2AQIA 4FC6A 1W0JD 5IH3A 4D9HA 4E15A 4DCVA 3CTMA 3IPYA 1U0BB 3SG0A 2FW7A 4HQRA 4CLXA 3HDHA 1EFDN 5IAKA 7REQB 1GRNA 2WT8A 3QELA 4TKVB 4AJNA 1AUXA 1DINA 1O57A 3ICPA 3LUKA 1GV0A 3ZHRA 5TPWA 4ONEA 3FYUB 3ZZTA 3CR8A 1ABFA 5AJYA 3SZUA 5EJ2A 1RM3A 3TDMA 1BQ3A 3I1FA 4Y9DA 1FNSA 1E6WA 4B2PA 1HO3A 4ZQFA 1W2WB 2R6DA 2JLVA 2J67A 2HIGA 4TLEA 2BLNA 2WBLC 4OQFA 2BM8A 2FG6C 5CU7A 5C7YA 3CCBA 1LDMA 4D9BA 3PEWA 1L5WA 5KI6A 4DEXA 1YJ8A 4R1TA 4W5RA 1M2JA 4MWOA 2VNKA 4DCUA 4HWTA 4OUDB 5AQ1A 2B3TA 1M34E 3KDPA 1BFUA 3ROMA 2V7EA 2VP2A 1Z4OA 1H9AA 1JBQA 1JIVA 2E82A 1OTHA 4AP9A 3ZBTA 5LUBA 1EZZA 2MDTA 3O4GA 2G5TA 4YV2A 1MFZA 1WU8A 3GJTA 4AWAA 3AM1A 2AXEA 3ND8A 2GBCA 4FCTA 3MGBA 2X0EA 3SDSA 3UMFA 2FKNA 3FVTA 3A37A 2PAAA 4KDFA 4FS3A 4RHTA 1K75A 4TVOA 2Z09A 3N74A 2FK8A 1D3AA 2V03A 5BXYA 4MRNA 2FWJA 1YA4A 1JI3A 4YP6A 2Z8ZA 3O1LA 1RSZA 2BISA 3BORA 2LVBA 4INPA 5LQSA 1GCIA 4ESEA 1NQWA 1WMSA 3AR3A 1SKMA 2VNIA 1PWEA 4IDDA 1ISPA 2H1WA 4O5AA 1CJVC 1SXJE 2YN2A 2IC5A 3NR2A 4QPJC 5F7ZA 3OCJA 4LZAA 4YUAA 1CQXA 4DB2A 4FP9A 4A23A 1X80A 4HEA6 1NW9B 4NY1A 1TYAE 2J87A 5E3IA 1OZAA 4X9XA 1H5QA 4JBNA 2PUWA 2VQEB 1Y7IA 2POCA 2AN9A 2GPBA 4INJA 2H1FA 2BMFA 1Z16A 5LU8A 3PF9A 3S2FA 2ZJ7A 4PSVA 4OQEA 2B0CA 3BGIA 3KUCA 2FFHA 3RS0A 1ZUNB 3CTPA 3OI7A 4BEBA 1M1XB 3HWRA 3ICCA 4G09A 5AI6A 1U98A 5CDYA 1AT1A 2NP7A 1VLHA 1TL7C 5LQCA 4TMFA 3BKWA 4H1HA 4QYWA 2WA1A 4FGUA 5DNDA 4BC0A 5DBIA 2UZ1B 4ER7A 1Y82A 3IA7A 1KMHA 2RFLA 4BE9A 3UYKA 3SJUA 3N6RA 5IC4A 4S1OA 3QLVA 1BXRB 1UADA 1XCPA 3TTSA 3H6KA 2OPBA 3VV2A 1SA0B 2YVKA 3OQ6A 2D1RA 4E09A 3H7IA 4G65A 3SEAA 1KZ1A 4OL0A 1OFVA 4FYYA 2B8EA 2EKBA 4MSUA 4IJWA 1VCOA 2P2ZA 1N5JA 1NMQA 1SCNE 3DMFA 4Y1RA 2QLTA 4BNWA 3KSRA 1J2TA 1XX6A 1Z06A 2NU7B 3NVKI 4HXFB 1ID1A 1TFUA 3R5TA 2C92A 4TLMB 2E89A 5KNCA 5KTRA 3M7IA 3JD0A 2P7HA 3IULA 3QQPA 1L5MA 4QJIA 3DR3A 4YPFA 4EENA 4X63A 2Q1UA 3OQOA 4KP7A 1U8XX 5E4YA 1YOVB 2AC7A 4FQ5A 4LAFA 2MT9A 3G0CA 4RNCA 4YROA 4O5OA 3R0IA 1FPMA 4JX8A 2ZDQA 4TL8A 4N48A 3AGQA 3G5LA 4ZANA 3C3PA 2BRUA 4M1KA 5K6RA 1N9ZA 1U7TA 2BR3A 3IC5A 4KPYA 2H59A 4CM5A 4C0BA 1XMVA 3MGAA 3HCFA 3OIDA 5KDDA 2I4TA 3I6YA 5IULC 1Y63A 4UHHA 5HMLA 2ZJFA 2MYPA 4GVXA 1QMGA 2OHFA 4KXLA 1UPBA 4H6XA 1ZJ5A 5JVDA 2RGNA 2OVBA 2P40A 3VNAA 3PUKA 1ZH2A 5FB3A 2DWUA 5JWRA 1H66A 4ND6A 1SU7A 2ZJ8A 2Z43A 1TF7A 1Y7TA 1ZXXA 4M0UA 3BMCA 5DSZA 2C2WA 3VRHA 2REBA 3D4BA 3UAOA 3PPVA 1W48A 1USGA 5LA6A 2HJ9A 2C29D 3QEMA 4MUMA 3WYFA 5IW8A 1W59A 4UTXA 3AVYA 3ZJVA 5FHRA 3RT7A 4KQIA 4M1MA 2DYKA 4YFVA 3TOZA 4BASA 3SP1A 2E6KA 3A1CA 3E0QA 4G9BA 1XDBA 2BTEA 3L0IB 2Q5FA 4MKHA 3ZGVA 3M4JA 4AJ1A 5HIAA 5KWSA 4KNYA 1D2GA 3HUEA 5SV2A 4EFMA 1AMOA 3OP1A 1ULZA 1OUMA 2IXAA 1IJKA 1VMIA 1ZMRA 2JEYA 3BXGA 2Q45A 3H7AA 3QVLA 4O4IB 1MIOA 2BFBA 3OPNA 5L45A 1L7AA 2PS0A 5ICEA 3NHKA 4R1SA 4UXIA 3CEJA 5EKDA 3R74A 4LRYA 2EKQA 1OZ0A 2HADA 2H9YA 1XRLA 3DYIA 3LBIA 1K98A 3OM1A 3OTQA 4N6OA 4UULA 2NPOA 4M9XA 4Q6WA 4R6WA 3T1NA 3UJBA 2PV0A 3TLGB 4DKXA 2I62A 4Q4AA 2V97A 2VHUA 3EGXB 1QFZA 3JQAB 1NOKA 3MRSA 4DFDA 4UM9B 4HNTA 3CSUA 1SRQA 5ES3A 3RWBA 2IITA 3W2TA 5ALLA 5AUQA 3AOEC 4GXTA 4RW0A 4S1PA 4FFRA 1Y6FA 3GLFA 4RLHA 1UT6A 1VCHA 5EXSA 5K8TA 2ZIUB 5IBPA 2C3MA 3GP8A 5BOVA 1OYVA 4F9EA 1M10A 4AMVA 4H17A 2IEBA 1E1KA 4LDRA 1P4JA 4E5MA 1BX1A 1ZJZA 4ZOCA 4D3FA 3KELA 4HMPA 2PK3A 5E0OA 4KR7A 3FTFA 3EAGA 4ZZ2A 3UB4A 1EU1A 3A9SA 5FPHA 3FRIA 4ER3A 2XUZA 1WPQA 4JI2B 2GZRA 3PNLA 2KM1A 4R7TA 5C1DA 3RH0A 2QZZA 4TOIA 3EG9B 3RS9A 5F1PA 3H3XA 2CXUA 1ULBA 1OHHD 3CA8A 3FOEC 3PCXA 3UPDA 3JZDA 3QKRB 1H6AA 1HORA 1Q0HA 1U3FA 4B0PA 1ZJWA 4ARCA 1N3IA 3VFDA 4YV0A 3T95A 5EN4A 1KR5A 4IG9A 4NZOA 4D9CA 3LO5A 5HRCA 3OQNA 3M83A 5EP2A 4ZK2A 1E9FA 1MAUA 2FE1A 3EODA 3QVGB 4IUDS 5E3JA 3VV3A 2PNFA 4O2BF 1X74A 4H4DA 1JJBA 2CFCA 3D59A 1NGSA 3LUBA 3O1HB 1EK1A 4KI7A 1C3OA 3MOSA 1EI9A 4JKOA 4RPGA 4W9NA 4ZAVA 4HI0E 1FP6A 1UWKA 3HUTA 4QU5A 5F2KA 3VZCA 2MHCA 2CJYA 2CUNA 2V7XA 4HJRA 1F12A 4DMFA 5KYXA 2Y93A 3R7BA 2X6TA 4EGSA 4F3CA 5ICMA 5JARA 2HJHA 2V9PA 4U9IS 1R6DA 3CR7A 3WB0A 2FAXA 4C20A 4YVFA 3M6XA 4LNAA 4IDHA 5DGXA 1JNXX 5BNWA 1Q22A 3LYAA 4MR7B 1VYTA 4RY0A 3VXKA 2FI1A 1E92A 4RK0A 4DKJA 4X20A 1YVPA 2QZSA 1RCTE 3FXAA 5AXDA 3IJRA 5LSAA 1FUIA 3D2BA 3PQ2A 5B3KA 3GRZA 1GCUA 1YJXA 2W6MA 2YYAA 3WL8A 3WA7A 2O7RA 1RAEA 1A9TA 3N6VA 4KLZA 3RFXA 3RS3A 1U5BB 3S5JA 5IRCD 3LPMA 1VL5A 1ZQ9A 2DTDA 4RHUA 3BB3A 2WIDA 4ZZIA 3QNWA 2CYAA 4JP8A 1FSGA 4IH4A 3AFMA 3MD0A 3CX7A 2AX3A 4NHOA 1HZZC 5IVDA 1IDN1 1QF9A 3U17A 3S68A 2IT1A 4E1VA 2MIIA 3IPRA 2YWBA 1GUYA 4AO7A 1YR9A 4ID9A 4IJUA 4OLJA 3GYGA 3TTVA 2RK6A 1YTLA 3AUKA 2WYIA 3JX9A 1FJGB 2IODA 2X8AA 3NTVA 4F0JA 2BFWA 1H2AS 2VHXA 4P8RA 4BECA 3TTTA 1VB5A 3K0CC 4DXAA 2ZSKA 3CPJB 4I55B 1AB5A 1NNSA 3L6CA 1ZZGA 4HDSA 2BEVA 1JHZA 3BFKA 4C0AC 2O7QA 1GD1O 1NSTA 2YL2A 3NUQA 2E4YA 3RUCA 2J0UA 1U99A 2G0TA 2QRUA 3GT3A 1JZQA 3EBOA 1TOAA 2GKOA 2XA1A 5JSKA 1RI2A 1Z0JA 2A86A 2G77B 2V7WA 3CKYA 5EEGA 1R5NA 2FMXA 3PQFA 4BN0A 3WNVA 1CUXA 3BXXA 2EKZA 3CLSC 4JLBA 4OHOA 1S02A 2H92A 1H1DA 2I33A 5I7HA 1KQGA 3Q2OA 4CNQA 4C7BA 2BL4A 1AB6A 4UVDA 3TR6A 1QG0A 3QHQA 2FZWA 4RHCA 2VUIB 4Y2YA 3VM6A 1XMJA 3EBLA 4N65A 3ZHSA 2CNOA 4IDNA 2CDCA 4AD8A 3GT7A 3IDZA 1WCYA 2WWXA 4N7BA 1L4UA 3KT6A 2ZVQX 1YV9A 3IEXA 1QGOA 2IF0A 4CEIA 1FYWA 1YNOA 3NH6A 3I6QA 3NVDA 3P71T 2ZI5A 1C50A 3PNPA 4Y2RA 1YGPA 1AM4D 4ZCIA 3ZWQA 2KPOA 1Z88A 3A6FA 3VJKA 3PQ8A 3HJRA 3NS7A 1NXSA 1KR2A 3EXEA 1FNBA 3KOOA 4JAVC 2W8BB 4MTCA 5CVVA 4ZK6A 3LNTA 1J07A 4F4IA 5FWNA 4BNIA 2O48X 5DXJA 1P1IA 1UQTA 3QTBA 4ZVTA 4DRXB 3SS7X 3GLFE 4FYWA 1V4BA 2CMGA 1PTKA 4M76B 4LGYA 5T57A 3V4PB 1Y5RA 1QKJA 4BHTA 3O8RA 1NRJB 1RRPA 1EP2B 2VOEA 5E9JA 3SC6A 4DA0A 3AO0B 3BTSA 1V47A 4PX9A 1QGDA 1MORA 1V2GA 3K09A 4R31A 3EPJA 3DMYA 1GN8A 3E18A 4HYEA 4AI6A 2JLYA 1IOWA 3JD3A 4A0GA 2GEVA 2GK6A 2NTEA 4NFYA 3QXCA 1BRTA 5G4KB 1IK6A 4GP9A 2PGNA 1JFSA 2PUVA 4ZV7A 1UBLS 2ZI7A 3K70D 3M4YA 1AGYA 1KERA 4M1EA 3CCCA 4WFIA 3QPBA 4W6QA 1QP0A 2F8SA 4RO0A 3KS9A 3WICA 1NNUA 4MYSA 1KJIA 5K0CA 1U5CA 1J1ZA 2OPHA 1UBEA 3KEGA 1CP2A 2WU8A 2VATA 2B4QA 4K6KA 3WIDA 3MTBA 1BG6A 1QBGA 4LC1A 2ATIA 3K7EA 1X7XA 2VBGA 2AN1A 2W2VA 1QQ5A 3OPYB 4S2EA 1RYNA 1TE2A 4N7RA 4NQRA 3U0BA 4EJ0A 1EX9A 3OIWA 1DIOB 4UAUA 4EF6A 1IEVA 3PGXA 3LLMA 5AVJA 3BL5A 3HM9A 4KYTA 4Y2QA 1H0RA 1H6BA 1KVQA 5EWMA 3O2SB 5LUAA 4GC5A 2AR9A 2ZWVA 3H3JA 1MABB 2P9EA 5HFAA 1GSOA 3ADDA 5KQSA 3R7NA 1FRNA 5KYKA 4XVRA 1P8AA 2F3SA 3CRVA 2CY0A 2VA9A 2XCLA 3O03A 3ROXA 1QJCA 1Z0AA 3QKSA 1A1SA 5K99A 3ISJA 2ZVPX 3K71B 2W5UA 5DNWA 1HEYA 1RJFA 2ZYTX 4PO9A 4RK1A 2IEGA 4EI9A 1U2ZA 1B76A 4CR8A 4QHSA 3NYQA 2HSEA 3JR7A 1JKIA 5CXSA 2DPMA 5EWJA 2VP9A 1VPWA 4CLOB 3TKLA 4JVOA 2IOHA 5K0BA 3U31A 5CFQA 2GCGA 2HREA 4DS3A 2HCFA 3KETA 4OATA 4L0DA 3AKDA 5FI1B 3DMPA 5J2UF 1EXWA 3N75A 1A9QA 2UU9B 4ZHQF 3GLHA 3DB1A 1PR6A 4D98A 2VZ9A 1DZ3A 2MSCB 1ZRMA 2BSQA 2M6LA 3GEHA 3TPFA 1ITZA 1J0XO 1M75A 1ZG3A 2AW3A 3AFGA 1CQWA 2J0SA 1FFHA 3AUYA 2ZSJA 2HMWA 2PGXA 1UDRA 4GOLD 1VHLA 4GMKA 1UBCA 2BFNA 1Y3BE 5AXBA 2W2TA 4YP1A 5LZ2A 4BYGA 3PRKE 1EGVB 2WMOB 4IOJA 1DIGA 1DL5A 5AUOB 1E94E 1L7EA 3NCHA 4A3SA 3E22A 4ZTZB 2X3UA 2O23A 1X92A 4OGFA 2AJCA 2XDAA 3O3NB 1SKYE 5JZ9A 2WZBA 4O0MA 4P5DA 1PTJA 3OOWA 4QQFA 3UO8B 3T3MB 3DZDA 2G40A 1Z0KA 3LKDA 2NUTB 3AR5A 3X1ZA 4I4LA 3NHAA 3ZE7A 1Y4AE 3HA2A 3BILA 3TCKA 4DJ5X 1ISRA 4HQ0A 4LBWA 2C3UA 2WTXA 5KC9A 2UZIR 2DWCA 2PSJA 3RUEA 3S55A 1LPAB 3N59A 5HIIA 4ROTA 2QGNA 2VTDA 3IMFA 4PPNA 4Q9IA 2K87A 2WU3A 3AKCA 4C06A 4HGNA 3NDPA 2XMZA 4JGGA 3ZHQA 2PJUA 3QIAA 3NGLA 4UZSA 2ISQA 1FMJA 3TM5A 2AKAB 4OU5A 4UEWA 2WOOA 3U4IA 5M3BA 4F92B 3LYHA 3RK0A 1NUUA 1QZ3A 4LF4B 1UJNA 4HLQB 3NBFA 4TL7A 2XUFA 3OEWA 1IG3A 1P7PA 4HZUB 3DTNA 4LJ4A 4MUYA 4EY5A 2WVGA 2IZOA 2FRXA 1ACLA 2XMRA 1LJLA 3KPJA 3RU9A 4LDQA 5I7AA 4WGFA 1GYQA 1W0KD 2NVUB 2ORYA 1D0IA 1YB5A 2FFQA 4Q82A 1I9CA 3HN2A 1GUZA 2LCIA 1T2AA 3QOWA 3SEFA 3CONA 1C7EA 1OIXA 1IY0A 3CKKA 1G2QA 2O5CA 1CIPA 4YLGA 2X8WA 4N5IX 3A2LA 3GUZA 3AHGA 4HAOA 5HIKA 1GQRA 3RRMA 4NYMQ 3ILYA 2I4LA 5DNVA 4YH1A 5AYVA 2C7GA 3WAKA 2PM8A 4RPLA 3V8QA 1NVEA 1S0UA 4HK4A 4I7EA 2I66A 3VPHA 3ELUA 4FBLA 4KUHA 1CHDA 3CBGA 4C4SA 3VI3B 1QE5A 2V9CA 3MB5A 4LXHA 2P2YA 4JC5A 1XTVA 3PUJA 1X1TA 3HB9A 1P5RA 5G1PA 3AC0A 2XXAA 5C7LO 2VJDA 1BH2A 3DDWA 5JH7B 5KPJA 1LF5A 1G20A 1DC7A 1CYEA 3OESA 5T8KC 4YMWA 3VAZA 3EOAI 3G1UA 4Q7EA 2BAGA 1JHQA 3V1NA 4FFBA 4FYVA 4RS4A 4MGHA 5FBHA 4LXGA 2Z08A 4TKLA 1N8SA 1GKKA 4ZOLB 3ZQUA 4QT0A 4K9SA 3EPLA 2V7BA 5KDLA 4B8ZA 2YS6A 1PU2A 3IQGX 4UU0A 4Q1BA 5EZ6B 3CZRA 4E07A 1XSEA 1KYVA 3EQZA 5ENDA 1KYYA 1YK0A 3JQ7B 4FCCA 5AJZA 5DO9A 1AF7A 4ENVA 1CZOA 1ZGHA 5B5SA 5CBPB 2FOXA 2RHBA 3AG6A 3B1KA 4AG6A 1I3MA 3Q12A 1EIZA 2IUEA 4EEZA 3MF4A 5D6NA 1QQ6A 4ID3A 3LUGA 3MSXA 1TUEA 3WNCA 3U3OA 5IN5A 3H9UA 3R5SA 2GWHA 3PWKA 2Q8PA 3FYTA 4ETWA 2X2EA 2IZ7A 3SM9A 1JT9A 1N34B 2Z8YA 3R44A 4E1AA 1HQKA 4KE8A 4NE2A 3DWFA 3E4DA 1IN4A 2JCBA 3E70C 3TAHA 1C7RA 3AR7A 2O6LA 2W6JA 1OPXA 1UAAA 1UJMA 1F1BA 2HWYA 1EE2A 1YDMA 2ZXEA 3IQEA 5D51S 3MXTA 2CVPA 2AFRA 3K5IA 3AK4A 1C1XA 4MVJE 1L1FA 3RKRA 2PR7A 3L02A 4ZFNA 5JPDA 2QM8A 3L6OO 3SEQA 1XZQA 5A4DA 1NF3A 3HI6A 3HKEB 4M54A 1QK3A 4W5WA 4AMZA 2DQZA 4EZEA 2A78A 2I2AA 2J48A 1B1CA 1SCUA 1KP3A 3OZAA 4X95A 3SQWA 1KYWA 2VDRB 4CLHA 1ZH4A 4HAIA 3VYUB 1Q7TA 2QLBA 1QO0D 3L1KA 3CUYA 3IHKA 5MN5A 4ZI7B 1NMZA 4HBGA 1XQ9A 2BHNA 5B58T 1FRFS 2DFLA 4P5EA 2TECE 1HFWA 1I2MA 2ZRNA 1QO7A 3JD1A 3I32A 4GAEA 1TYZA 3WL7A 3BIOA 2PRSA 2VAVA 2WWIA 2J45A 3VDQA 2BH9A 4LPKA 1AXRA 3JQDA 3R9XA 1YU9A 4FI3C 1F4VA 1IZ7A 2O0MA 4G37A 1P44A 1AN0A 2HMVA 2VQ3A 2W0MA 2FG5A 3FDZB 3HKCB 5GM1A 3U3JA 3M5PA 4EQ6A 4HZIA 3W78A 3K5PA 2A0WA 2AZDA 5CTJA 5T6BA 1GTZA 4ZCLA 3D64A 4CKEB 1I94B 2J4FA 1FMTA 4FOSA 1DQNA 1PG5A 2AUMA 3QVUA 5TS3A 3REQA 2E4XA 2AFIE 3CWQA 1V39A 1XQXA 1B2LA 5DW0A 4B7CA 1NOJA 3L0OA 1WW2A 1V8FA 3D3JA 3JQAD 3CXRA 4RJIA 1Z38A 4X65B 4LYJA 2C2GA 2PPVA 3SZGA 3EDMA 5H81A 5HCUA 4XWOA 1ZPDA 2B35A 2X5OA 1Q1EA 3N3AC 4UM8B 4RETA 2AKEA 4PO8A 1E5XA 1TX4B 3AJ8A 4OI1A 4U8GA 2J0QA 3OCXA 1LLCA 3TINA 4RGYA 4DQVA 1TKBA 4H3VA 4MJXA 4ND5A 3IAM1 3X1YA 3O90A 4FXPA 5D87A 1DHTA 1LI7A 3OIVA 4P4SB 4TLLB 4DR6B 1V7QA 2FZGA 4YC7A 2UZ1A 2WJZB 3TVTA 2J3EA 1NE2A 2IYTA 2PL9A 3QWIA 4NPCA 5KWJA 2GLUA 3OEEA 4OJYA 4BAZA 5FA5A 4HVCA 1THMA 2J5KA 2VDWB 3FMIA 4GUAA 4ASUD 3GGPA 4MTLA 1DAGA 2CFOA 3MMPA 4BGEA 1G66A 3EB9A 2VIIA 1G1MA 2FPWA 2WF6A 2XUQA 2WVHA 4W6ZA 4KPFC 3ZWVA 4BJ5A 5FH9A 1WV0A 3T1QA 1HMPA 2D2FA 5E9WA 5GVSA 1K6IA 4TT3D 3TDNA 1SUEA 2IY9A 3LOPA 3ZQ6A 3MTGA 3V7FA 5C5EA 2HN9A 3SX2A 3IV9A 3A9UA 1Z5VA 3ITEA 4ZEOA 2ZSBA 2XEXA 4ZGBA 5ADHA 3QUBA 1OASA 4J6FA 4DLKA 3SIXA 3HLTA 3UXMA 1LTKA 1X80B 3R3SA 1JTEA 2CJPA 4HAZA 1NYRA 5NULA 4CGZA 3LX8A 3ROZA 2OMEA 5GMOA 1FDTA 3B1ZA 4YRNA 2P30A 1XEWX 4P9NA 3VZSA 2C07A 2YASA 4DSOA 3WLSA 1LBQA 3F9CA 1PYDA 2WNSA 4G4JA 1B6GA 4M2LA 1K88A 1OBHA 2ZBEA 4FFWA 5HKBA 3COPA 3DVAB 2FWMX 2X1HA 1MAWA 1UDAA 3H1EA 4EMUA 1IG0A 1ZXBA 3ODPA 2J9GA 4ZO8A 5KC8A 2DM6A 5TNXA 3L6RA 1G18A 3UH1A 3VU9B 2GGSA 1GOTA 1A9SA 1U6JA 1UK8A 3L6EA 3K2EA 4DQKA 5DNEA 3PK0A 3M2PA 1CZLA 2AUTA 3U4HA 2PKQP 2OBBA 4PTLA 1RWVA 1N6HA 1H22A 2RGXA 2QLMA 1NW8A 3VYRB 2VDJA 3VPSA 1SA0A 3GVPA 4V1CB 2P6MA 5JLAA 4WCDA 2M6KA 2ZLBA 3MWKA 3H5LA 5DNUA 1EFAA 5TMEA 3CISA 2EVWX 2QXUA 2HA2A 4BO1A 1ONSA 3NDIA 1I5EA 1N32B 2W2QA 1Y8RB 1G8YA 1M1YA 2I3DA 3G9ZA 1QK5A 2QX4A 1D5WA 2N0SA 1QV9A 4JI3B 1NI4B 4P80A 2C04A 1WSWA 3MQFA 4D0SA 2VXCA 2JJ8A 3F90A 3IUJA 3VO8A 2R4UA 5LPNA 3QF4A 4JNCA 2C7RA 1KJNA 1FTQA 3TSOA 4RH3A 3U2QA 4BRUA 3FFTA 4QFCA 1Z7YA 3OU6A 2ZYRA 5JCZA 1KPGA 2JIMA 2XJ9A 4RCVA 4WPGA 1A5AB 1VFNA 3L5OA 4CKWB 2BGLA 1D8AA 2ISSD 3B2EA 3T9DA 2A92A 1J9GA 1U7WA 2OO7A 4ZO9A 3TMAA 4JA0A 3VZRA 3A1EA 2Z4SA 4PNZA 4UEOA 3H2KA 3MW8A 3ACDA 1GRRA 5KMGA 3QVKA 2IX3A 3HU3A 2YIDA 4MUNA 5DISB 4XSGA 4KR9A 2Z4TA 2ISCA 2PGJA 4ECEA 4MWBA 4K05A 2W2LA 5JEDA 1XMOB 2CHQA 1TUGA 3WG9A 1GU1A 1P3Y1 1YDFA 2PKCA 4NAHA 4Z2YA 2Q5LA 3RHSA 5JHHB 2GFQA 2ZAYA 1VLQA 1J99A 2OBMA 1MVOA 1TAGA 3T41A 4M1OA 2BD0A 2NTNA 1T9GR 2UAGA 3IP9A 5BW4A 5E2IA 2Z9BA 1QTRA 4LNUA 5IWAB 1ZK2A 2V8OA 2ZSFA 4XAQA 4C0JA 2H29A 2ODPA 3G2IA 1H2XA 2UUBB 2FSVC 4NJMA 1R00A 2VNSA 2YY5A 2ZIXB 1K8ZB 3THXB 2F48A 4RA6B 1W4AA 1PZNA 1XMSA 2R79A 1P73A 1JKMA 2VPWA 3CWCA 4B2YA 4BWGA 2RHJA 4CIVA 1KSFX 5TRTA 3W4KA 3NOVA 4S35A 4DJDC 3G7UA 5DBHX 1M6EX 3IERA 4GI2A 3RAPR 2ET6A 2ST1A 1EFRA 3HSKA 4BCDA 2PQ6A 3OFJA 2GERA 4JU8A 4RS3A 1GQFA 2A0YA 2YV4A 5CD9A 5CG1A 5T64A 4AVYA 3LQQA 1Z22A 3PRYA 2R6CA 1G6OA 4YRAA 3BULA 3I30X 3DJFA 4ARUA 1PBNA 3BD9A 1J9EA 1JHPA 4BP8A 2LXNA 4RGQA 5IK2A 4EGFA 5CYGA 4OMUA 3JZFA 1WZCA 2Z9CA 1IN1A 2DZDA 2AFHE 2J6CA 3B6KA 3CQ9A 1JLHA 1WVIA 1IPEA 1AK1A 2VDPB 4AJPA 1GAJA 1Z73A 1O0BA 3MWDA 1WSDA 3OOYA 4UCXA 4U7WA 4AIRA 4LMRA 5T4EA 4E46A 4PZYA 3SWWA 2NOAA 2AOTB 4Q21A 4YJFA 1DWUA 3TSAA 1IBCA 1FC0A 1NDUA 5BW8A 1WBBA 1GJRA 4HQLA 1MO4A 5KTMA 2AHRA 3FNRA 4XWAA 4CIYA 2XUIA 2VQDA 4QTTB 3VO2A 1QXSA 2IXTA 4AIIA 2Q2NA 1GRVA 4FC7A 3L6BA 2G1UA 4GPD1 2HQSA 1DJNA 3AFIA 1WXHA 1F06A 5F7OA 3UWSA 1Z3IX 4N8EA 3VSCA 2IUTA 2IGTA 3OLQA 2XDWA 3VZPA 3W5DA 2H18A 2YOFA 3MM4A 4OP2A 3MT9A 1CYDA 1XCLA 1DOAA 1O6CA 2C9DA 2H2FA 2DH6A 3K94A 1XU4A 1QYDA 4K81B 4KH0A 4XQ9A 4JXXA 4LXYA 1Z15A 5AVOA 3MLEA 3GA7A 4EGCB 2AYYA 4TZ6A 1Z39A 2JAQA 3I4LA 4ENRA 2G76A 4UM5A 2IS6A 2GTHA 4QT4A 1B26A 3I3SR 4CIAA 5ALTA 4G23A 3AQIA 1B6TA 1FTWA 3WQHA 1JEAA 2CXXA 3TI9A 2Z56A 4EX7A 5JJKA 3PB3A 1OXTA 3DVQX 4D8XA 4RK4A 2Y1CA 4QZVA 4QQRA 1A2BA 2ZE5A 3SF8A 4ZT7A 1CDZA 4BEWA 3UFBA 3NZEA 1UEXC 1YDEA 1Y3HA 1OGJA 4JR0A 2P90A 2VBFA 1YT5A 3H8SA 5TQ0B 2PMWB 1GVHA 1T5LA 3MOGA 2TMDA 4K26A 3BWXA 4NEGA 4XWKA 4Q24A 3PEFA 4XD7D 3V7NA 4JN6B 5MGBA 2CN1A 4DMUB 4V0KA 2QM3A 1KU0A 3S8YA 5FYDA 4PZAA 4PCLA 4CGYA 3M3HA 1C4WA 4DQ0A 5BQOA 1YQQA 2JIZD 2TRSB 2QM7A 2DBZA 3NWPA 3W1WA 3CPSA 5G0TA 3HS3A 5G0SA 3CN7A 4YK7A 3NHLA 1L4BA 4O2AA 4C6TB 1LTQA 1OBFO 1YVDA 1RKXA 1XZLA 4M3NA 4XRRA 5FPPA 1DC6A 4EYEA 1P4SA 1CY6A 2CCGA 3EZ9A 2PZJA 2IIQA 1E61A 2IWRA 1TM7E 2I9PA 1RP1A 2YOHA 3CVVA 3QUAA 4RWEA 3AHDA 1EGHA 3SZMA 1NLFA 2DEUA 5TS2A 3AY3A 2P67A 4EY7A 4DBZA 3PDHA 4ZTUB 2HHCA 1CLEA 2CMKA 3O9ZA 1QYRA 5KTSA 4NZMA 4QYIB 5JFOA 1NVVR 3A7DA 3QBDA 4IIEA 1X7WA 2Z2IA 4L3VA 4EFKA 5IYZA 3LUAA 2QQ0A 4HPWA 2Q3JA 4I5DA 1C0IA 4GEKA 2GI4A 2JANA 2IYXA 4R9SA 2H2HA 4IF4A 4O4LA 1T9AA 3EVFA 2VYNA 3VC3A 1K7SN 1TQ8A 5HF9A 2C83A 2MCFA 3GFOA 3CRZA 4H4CA 3DM5A 2QX8A 3H2ZA 3M1AA 5KX5A 4GI7A 3DPUA 1RJDA 3B5JA 4DJFC 2QA5A 4HPJB 2AFHB 2CXQA 3HDVA 2IHNA 1A88A 5CX1A 5AHXA 2OD7A 3WJAA 1KDOA 2CXTA 4S12A 5KINB 4N8SA 3W4JA 4CEH