3LPCA

Crystal structure of a subtilisin-like protease
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
340
structure length
340
Chain Sequence
APNDQHYREQWHYFDRYGVKADKVWDMGFTGQNVVVAVVDTGILHHRDLNANVLPGYDFISNSQISLDGDGRDADPFDEGDWFDNWACGGRPDPRKERSDSSWHGSHVAGTIAAVTNNRIGVAGVAYGAKVVPVRALGRCGGYDSDISDGLYWAAGGRIAGIPENRNPAKVINMSLGSDGQCSYNAQTMIDRATRLGALVVVAAGNENQNASNTWPTSCNNVLSVGATTSRGIRASFSNYGVDVDLAAPGQDILSTVDSGTRRPVSDAYSFMAGTSMATPHVSGVAALVISAANSVNKNLTPAELKDVLVSTTSPFNGRLDRALGSGIVDAEAAVNSVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AprB2
publication title The Subtilisin-Like Protease AprV2 Is Required for Virulence and Uses a Novel Disulphide-Tethered Exosite to Bind Substrates
pubmed doi rcsb
source organism Dichelobacter nodosus
total genus 122
structure length 340
sequence length 340
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3lpcA00
1C9MA 3BX1A 1SBIA 1GTL1 2IY9A 5AVJA 1SELA 3VSBA 4HVLA 1WMFA 1MEEA 3A3OA 1SCNE 2WUVA 1Y48E 3DE7X 1Y3FE 3H42B 3D9QX 5I9SA 4ZOQI 1R0RE 1AF4A 2P4EA 1OYOA 4CG0A 3DE5X 3F7OA 3I37X 3DYBA 2Z2ZA 1IAVA 5JXGA 5AVKA 2Z30A 2X8JB 3DDZX 4RYDA 3GT3A 4OV6B 4DJ5X 3LXUX 5AQEA 1P8JA 3ZXYA 1SBTA 1AVTA 1C9JA 4OMDA 1V6CA 4FONA 1NLUA 1HT3A 1BFKA 3TI7A 1Y34E 1YJAA 2XRMA 1VSBA 1Y4DE 1NDQA 1KDYA 1BE8A 1S2NA 1SUPA 5JMOA 2TECE 2GKOA 3VV3A 1AV7A 3EE6A 1TM1E 2ZWPA 4KPGA 1WMEA 4CFYA 5JXIA 3A3NA 1S01A 2SNIE 2PKCA 4C3UA 4B5LA 1AH2A 1XF1A 1SPBS 1Y3CE 1OT5A 3AFGA 2PQ2A 1AK9A 1Y3BE 2Z2YA 2PRKA 1GA6A 1GTG1 2Z58A 3OSZA 3TI9A 3WIVA 1DBIA 4ZARA 4H6VA 3TECE 1SBNE 1SUAA 1BH6A 4MZDA 3WQBA 3BPSA 4HX2A 4LVOA 4NE7A 4YN3A 1JEAA 1TMGE 3LPCA 4H6WA 3I34X 3DE4X 1SUBA 1AQNA 1ZVJA 1A2QA 1PFGA 2SICE 5FFNA 1TM5E 2XTJA 3I30X 3AJ8A 1ST3A 2PWAA 3GCXA 1Y1KE 3EIFA 2DP4E 1IC6A 3LPAA 4I0WB 1V5IA 1Y4AE 5SICE 3WHIA 3I2YX 1GTJ1 1DUIA 4J94A 1C9NA 1EA7A 1SBHA 1Y3DE 2QTWB 4CFZA 2HD4A 2ZRQA 3WIUA 2DUJA 1PJ8A 3Q5GA 1SCBA 3DW1X 3DW3X 4M1ZA 1GA4A 3BGOS 3QMPA 4OMCA 3LPDA 1BE6A 1GA1A 3VV2A 2W2QA 3VHQA 1GT91 4BWGA 2SBTA 3SICE 1KDVA 4NMXB 2W2NA 3PTLA 4C3VA 1SN7A 1CNMA 3DE2X 1SVNA 2IXTA 1C3LA 3UNXA 3P5BA 1PTKA 2ZWOA 2B6NA 5FAXA 2PYZA 5FBZA 1ST2A 5JXJA 2V8BA 1SIUA 1P7WA 4KG7A 3EDYA 5ARBA 1BFUA 1WVMA 3VYVA 5JXHA 3D43A 1WSDA 4DWWA 1TO1E 2DQKA 5AMXA 1SBCA 1YJCA 3CNQS 1SUEA 1WMDA 5B1EA 3AJ9A 1KE1A 1AU9A 1KDZA 1GNVA 4DZTA 2HPZA 5ARCA 1T1GA 3L1KA 1TECE 1NDUA 3QTLA 1SCJA 2WV7A 3GCWA 1YU6A 2WWTA 3QFHA 3DWEX 4H6XA 1PEKE 1SIBE 2PWBA 4GI3A 3CO0S 1BJRE 2W2OA 1TM3E 3ZXXA 1EGQA 2ID8A 4JP8A 1UBNA 1SIOA 3SQOA 3DE6X 3F7MA 4KB5A 1SUDA 1P7VA 1YJBA 1R64A 4K8RB 2ST1A 3DE0X 5ARDA 4LVNA 1TM4E 1Q5PA 3A3PA 2Z56A 2SECE 1SCDA 4AKTA 5B1DA 2W2PA 1GCIA 1MPTA 4AKSA 5K7SA 1OYVA 1KE2A 1T1EA 3T41A 1SCAA 3DVSX 3DE1X 3VTAA 3HJRA 1CSEE 2G4VA 1SUCA 3DE3X 1LW6E 3GT4A 3PRKE 1Y33E 2Z57A 4NE9A 4Z2AA 3DVRX 3Q40A 2Z2XA 1TK2A 1GNSA 1TO2E 3DVQX 2W2MA 1THMA 5CW1A 2X8JA 1SH7A 3F49S 1S02A 2ID4A 4WOCA 1T1IA 2WUWE 1ZVKA 1TM7E 1R6VA 4WOBA 2PMWB 2E1PA 1Y9ZA
chains in the Genus database with same CATH superfamily
1R4ZA 5DLEA 4HAIA 4E32A 2ANBA 3GY0A 4FNOA 2IY9A 2HYIC 2H17A 1OVMA 2YOGA 4EA8A 4B3HA 3JYPA 5BPFA 2WG2A 1G3UA 4XB6B 4LXYA 3DOOA 3R0IA 4P98A 5T4BA 2ZRJA 3H2GA 3NQ41 5EWMB 3E22A 1ZBDA 1I9GA 4J7XA 4NDAA 1E7QA 1A5BB 1P2SA 1YE5A 5T5QA 4OD0A 4C21A 2ZREA 4ZAFA 2JLUA 3JQGA 1HDCA 2XEDA 3EWSA 3QFSA 1MW9X 4MO9A 4MV3A 4X60A 1EYZA 3RBVA 3WRXA 1CS0A 2I4OA 3ZK9A 1YA6A 4YVFA 2MTBA 4XOIA 2FUG6 4GXTA 5K6AC 3VYUB 3SAJA 3B36A 1X1TA 1ZK4A 2WWGA 1EIZA 1XA3A 1BQ3A 5JCXA 1MGPA 4TV8A 3T1TA 1BKYA 1VJ5A 4BJ3A 3DXZA 4PC2A 3OZFA 1P9OA 3BIJA 1VYHA 1ECLA 3CH7A 1RAGA 1PF7E 1C3EA 2C9MA 2YW9A 5ECYA 3JPWA 4NBRA 3U7FB 1G5FA 1ULTA 4WLNA 5T3YA 4RENA 2NZ2A 3H2YA 2JHGA 4CG0A 3SK0A 4JA0A 1YIOA 4RCVA 4C2TA 4ZRMA 5FWNA 1SUFA 1H0KA 1NSTA 2FEAA 2HCRA 1J42A 5HKOA 1U63A 3B53X 3LC1O 9GPBA 2GJAA 3U7GA 1IAVA 3CUKA 1M0TA 4BMVA 4R2JA 4LI0A 1V0JA 1VE5A 1NVWQ 1ADCA 2JVIA 4NYMR 3SDZA 3I2KA 5FUWA 2Y0EA 5GGXA 3P9SA 3SFTA 3F5MA 2O5EA 1NNEA 3F9RA 1XJCA 2X8JB 4DUGA 3RTCA 2Y1WA 4MVJH 2NYAA 5JROA 1TCCA 2ACEA 1MJGM 1PRYA 3R75A 3VJKA 2AMYA 4H7EA 3NU1A 4F8YA 3ZWDA 3KQVA 3R6TA 3HKCB 6CHYA 1VSQA 4BV2A 3KO8A 4R54A 3ST7A 2H16A 3VR6H 4DR5B 1AVTA 2GF2A 1JQLB 3LDUA 3I5MA 3DL0A 2JI6A 2M1XA 3LDAA 1C9JA 2VSNA 2JAXA 3EN0A 1E7SA 4DNQA 1YHNA 5CFOA 3TCKA 1BXKA 2CCKA 2G80A 4M88A 2PS0A 3PZRA 5BV7A 1I94B 2XWBF 3TI7A 2P2CA 2W8BA 2XKJE 3NYRA 1XZCA 2XUDA 4R1OA 2O59A 4FQ7A 2AYYA 3I6IA 4DLLA 2Q5CA 1RBZA 1YDFA 5JD5A 1D7AA 1M2VA 5K51A 5HKBA 2MINB 5P8WA 1KDYA 4HGNA 5KQSA 2ZT5A 4XRRA 3H5RA 4GAEA 1FIUA 2RBKA 2R2GA 1I51A 4H60A 1D2GA 4WXYB 1OHHD 3TAXA 3QYJA 5ALJA 4FDLA 2ZWPA 3JRWA 5A4MS 1N3IA 4QXMA 1EM8A 1Q6ZA 2FSSA 4BN0A 2PX8A 3SEQA 5H7XA 3ZJTA 4MICA 1OTXA 1JDTA 1OSNA 4F21A 2WKSA 3ITKA 3RAGA 3O1HB 2IGTA 1FJXA 2PANA 3IMGA 3KRTA 1EUDB 3WRXC 2VQDA 3D8UA 1VG8A 4WOJA 3ZCPA 2OSBA 4BGVA 4UFPA 3TKYA 2FUG1 1MOPA 1CE8A 3MB8A 2W90A 1PJ3A 2OGWA 2FPLA 3H3JA 1DOHA 3L8EA 4K26A 4QJIA 5IU6A 3LUBA 5JTUA 4DCVA 3NBFA 1OAKA 2OCAA 4J49A 1YZLA 2X2FA 3AFGA 4Q6BA 3UZUA 5ALEA 1YTLA 2J41A 4RESA 4XTCS 1GPWB 1VB5A 3DNPA 5EXDA 3LCMA 2WUEA 2ZWIA 3U1VA 4P9NA 4E33A 3SNHA 1ONBA 4CM4B 1H22A 1ZJZA 5I4BA 1KOFA 1BSVA 1ZU5A 4GECA 4W5JA 5DW0A 3B1YA 1HDGO 1VG0B 1GTG1 1R6XA 4NMHA 3SIPA 3AW9A 1I80A 2FPOA 1LK5A 3S28A 4OQYA 1IXKA 4PLHA 3UT0A 3WWPA 1ZH0A 3R5XA 3AF1A 1V1MA 1WOMA 2YZNA 3HGTA 1YRWA 3NASA 3B13B 4OHVA 1ZGBA 1BWPA 2IUSA 1SEPA 3IERA 3HCEA 4KE7A 1LRJA 4RF4A 4YIKA 1U1CA 4X1KA 4YEDA 5IJ0A 2P6NA 2ODTX 3IL2A 2ZYIA 1QH1B 4MUEA 1JBEA 1UODA 1XKXA 3LY9A 1XZQA 4R01A 3TSZA 4EVIA 3LCRA 5CLJA 1RI1A 1G21E 4KX5A 2PNJA 4C30A 3NXKA 3DYIA 1M1ZA 1AV6A 3OG9A 3TTVA 1PJSA 3KSUA 3JAKA 3Q11A 4L8WB 4DCCA 1B2LA 3CEAA 3ND6A 4GUAA 1U0NA 4E15A 1JIIA 1BRTA 1SVOA 3IUEA 3ZOKA 3KOUA 5BYKA 4G89A 4JQCA 1VTKA 4KBGA 2AQIA 1WCIB 4KDFA 1CJSA 1G291 4BTLA 3A7EA 1RMQA 3IKLA 1IDN1 1GZUA 2RKWA 4WZAE 4AY4A 2H57A 4OATA 1ZONA 1AN0A 4K5QA 4N7MA 2H1LA 4Y2QA 4YRCA 1WW3A 4ZOAA 4L0CA 2JH3A 4BPRA 2VDOB 4D56A 2ISQA 5K45A 1SG0A 5CK5A 1PT6A 5C1DA 4WL0A 5CXXA 2JBHA 5BMVA 3NC0C 3R5TA 3ETLA 1AZSC 2MR5A 5LBIA 2VYFA 4NHOA 2QIPA 2BGJA 3D6VA 3P45A 4L6IA 3HL0A 1R9NA 4QRDA 5H82A 3TX2A 1OB5A 1QQAA 4EHDA 4IHJF 4FBLA 5EVJA 1Y7HA 3TIVA 3ZE6A 3IEXA 4LXIA 2ZKIA 3UY4A 3FBWA 4B3FX 4B2YA 4JXZA 2JIQA 2V7UA 4OXIA 3U4DA 2R6AA 3VNUA 4F96A 2IDKA 1FC0A 4EA9A 1NXPA 1NF8A 1H69A 3I2YX 5DGHA 2CLHB 4EW2A 4G07A 4IVQA 3O1JC 5B7NA 1DG1G 4LECA 1E6LA 4FIDA 4OHKA 4LZJA 1RM4A 5FOWA 3UJ3X 2VKTA 4CE6A 5TGZA 1PO7A 2HIMA 2Q41A 4QJBA 3TIGA 6REQA 4E3ZA 1XTPA 2XV1A 1FSGA 3UBMA 3UGQA 1MD9A 4TLEA 4E14A 3G8YA 2Q3DA 1V96A 3A04A 3DPIA 1ES9A 1VE7A 1G17A 2JBAB 1AB5A 1Z0IA 3B7GA 5JFGA 4OG2A 2DJIA 4GZ6A 2EJUA 1KIMA 4GOND 4G0UA 4R1MA 2YZGA 2BHRA 5HS6A 3AL3A 3PVCA 4QPNA 2E48A 1Q83A 2NUTB 5CBPB 5D3QA 3WLSA 4BLQA 3FWPA 1MAAA 1CLEA 3U7QB 4Q16A 5I6DA 2FF7A 1E0DA 2L82A 4IGIA 3F9CA 4X66B 1I2MA 4RELA 4DLUA 2V0NA 4HD8A 4LYEA 5CM8B 2P2ZA 1JDBB 1DQZA 2FRVA 3DUFB 3NONA 1M34B 2WT4A 3ASYA 1H5QA 1S0UA 2UZ1B 3H75A 1XXHA 4A15A 1DQSA 1QVAA 3T9DA 1J0CA 2A0XA 2O3RA 3GW8A 4IRUB 4EGJA 3VDMA 4FN4A 1J09A 3EQ2A 4M1ZA 5CDTA 4W9NA 5CVVA 4W5TA 2WV9A 2HBRA 1A9XB 2YIMA 1L1EA 4P08A 4UFOA 1V7ZA 1LS6A 1EPUA 1HBJA 2I34A 1PR5A 3HYSA 3MJ4A 3OWOA 1LQTA 3OZBA 4NWIA 4U7HA 3CSUA 1H9BA 1Y6QA 1HC7A 3OCJA 4UXJA 3B3QA 2DKNA 4XPIB 1RPZA 1UBUS 5DSZA 2A84A 2AEEA 2GZHA 3FCYA 3MWDA 3WICA 2XXAB 3O8QA 3M6FA 4GICA 4P0PB 3E9YA 1QG0A 2HJGA 1WQ4A 2RGDA 1LEHA 2QHXA 1UPUA 3N6XA 2RAUA 4NCHA 1ZD4A 3A1NA 2GS9A 5FHRA 3OY2A 4KR3A 2BGRA 4AMZA 2N47A 1TE2A 2C04A 4E2FA 4HWGA 1DBVO 1AKEA 1OWNA 1F2UB 1RLTA 4S24A 4DAOA 4FYIA 5SYAA 3MJDA 4FC7A 5FBRB 2NSDA 4CHTA 5K8CA 2NVUA 5LB4A 3SHOA 1M1YA 3IE1A 3ZQ6A 1KOLA 2AYXA 3CF4A 1GL7A 1XTBA 3FB4A 4JBGA 3T5PA 4KR7A 1J56A 2D0IA 3IR5A 2BMDA 4W1SA 1FX0A 2WHYA 1OLXA 5REQA 4V3BA 2PEYA 3EDYA 2XSZD 4FX2A 4AJLA 3PHCA 4Y8VA 3A6LA 3GN1A 4GI5A 4RBNA 3RUCA 3ZDFA 3ZYCA 2Y92A 1BYUA 3PI6A 3GUZA 3NANA 2FMTA 2NU7B 3EIQA 4ZHQB 3N9IA 4XZ3A 4TMTA 4R7ZA 5TQJA 3VBCA 2B98A 3L77A 4LGCA 5I7SA 1UFVA 2ERXA 4MWZA 3U81A 1Q20A 5TIIA 5K8LA 3CLUC 3P32A 5L3QA 2P90A 1UQUA 1T0IA 1I1OA 2V4MA 3OKPA 3EA0A 3UMBA 3BE8A 3BDAA 5EJ6A 2JH9A 2RGUA 5AH0A 3I9OA 1V16A 2E4VA 1UIRA 1SUEA 1LDYA 4NG5A 2GPTA 1KR2A 4XIGS 2QTZA 4U7WA 3HB7A 4G2NA 5GIOE 3KZXA 5FUMA 3B7PA 1CQIB 1Y6GA 2JGJA 1GQSA 5L45A 4JLJA 4ETIA 4MKGA 2IH5A 3FZEA 1UK6A 3MHPA 5ENDA 5E9WA 4DCGA 4DZTA 3OX4A 3ZWYA 2B0JA 5KO2A 2EBFX 2B8TA 5K6RA 1Z88A 1E77A 1PZNA 1NDUA 1CZUA 3F8WA 2VA9A 4KHPB 2Y71A 2ZU6A 2HBZA 4P2GA 4ZZ1A 2HLDD 2QMHA 1Z45A 1TYDE 3H9EO 3HCWA 1QFXA 1C9DB 2ZWVA 5KQRA 3GLTA 3JQAA 1BE1A 1L4UA 1A9YA 4Q48A 4W9NC 5EPUA 3IQFA 4XQCA 4GEGA 1OAAA 2QTRA 3AF5A 3KKPA 3W5IA 3WLMA 4AZTA 5H70A 1QLJA 4LXXA 3LECA 3KALA 2QDXA 1BJKA 2MR6A 5LXTF 1OZFA 4HXGA 4B46A 5B4UA 4ZTUB 2PUAA 5EJFA 1CIJA 2F1OA 1ZU4A 2YYAA 4ZZ2A 2GJ4A 1AB6A 3R44A 3FFXA 4QUHA 4LAFA 1GP2A 1GLVA 3ZCQA 5EE3A 1X38A 1P29A 1TF7A 4LNUB 4YAJA 5TARA 1Q44A 4F46A 1TDJA 1HRKA 4Z8YA 2C42A 2JAWA 5GONF 1LRKA 4Y0NA 1OD6A 4FSHA 4YRTA 5C0OE 3H4IA 4Z49A 4G5YA 5ELXA 2GCOA 3H11A 3VH1A 3R3YA 2W6JD 1QIFA 3I72A 4PGHA 1F6WA 1AJEA 1RJ9A 4DG8A 1QRDA 3SSMA 1EINA 1TPZA 1Y81A 4UMFA 5CFZA 3PPXA 4Y6PA 2OCPA 3UCEA 2CF6A 1PHPA 5JDIA 3L7BA 1EE9A 1IWPB 3L9XA 4GBMA 4BZWA 1E3TA 2PA0A 2WSLA 3FBTA 1KH1A 1JBKA 2QN8A 4AJ2A 3HWSA 4JHXA 3SE0A 3T3OA 1G5HA 1TVCA 1A7KA 1WABA 4GXNA 4QDZA 421PA 3H6GA 1QBKC 2FFAA 2KW5A 2RIPA 4P4NA 4R16A 4U7DA 4XE5A 4QJ4A 2WPDA 3QRWA 4B3IA 1LPMA 2Z09A 3CONA 5FTLA 1ZH4A 2DVMA 3EXG1 3TLEA 1OFUA 1R2QA 1P5ZB 2EDAA 4NP6A 3TWOA 1S2MA 4OREX 3F6RA 3KTDA 1ZA1A 4QYSA 3W2HA 3AFMA 4MTLA 3T7RA 4BX8A 5JJKA 1RXVA 2C7RA 2QYTA 5K7SA 4L2IA 4G0WA 3W6PA 3FKSD 5GVRA 1KJQA 2XE6A 3KE8A 1KE2A 5IVIA 1NKVA 1E98A 3Q7EA 3I2HA 4HDAA 3NIWA 4JL8A 3EEIA 1HNWB 2VT7A 2PUGA 4TN1A 3FI9A 3ZZNA 4CKBB 5J2UB 3ZU4A 2D2VA 1CSEE 1PR9A 3IGFA 3K09C 4GLFA 3TLMA 3W7VA 2FN8A 2A3RA 1GUZA 2DKFA 3LTNC 3HJNA 4N3NA 5LIPA 2HMWA 3G2JA 4JD5A 2G5PA 3OEEA 1X1CA 3B6ZA 4LGVA 3AETB 1I24A 2H9IA 1TT7A 4D57A 1US8B 4RY9A 2BMEA 1W5TA 4Q47A 3WFZA 3Q98A 1Z29A 2AB0A 2H1WA 1YZVA 1NW5A 1XPOA 4LJ6A 3RGWS 1G8AA 2C5AA 2VRCA 3IJRA 2ZZKA 4MARA 4ZAVA 4PINA 3TJMA 4EGAA 4ZT5A 2EJCA 3A6EA 4EHFA 1X13A 5EZ6B 4Z3OA 1TK2A 4P3XA 2YJNA 13PKA 1U0OC 1WLYA 3LDFA 1NC1A 1QS0B 4M9ZA 2I9KA 1NW8A 2FPSA 4G1VA 1SK9A 4V0RA 4ECAA 3Q8KA 5C8DA 1RQ7A 4NFLA 3GUHA 2G0TA 4J3NA 3DZDA 3O74A 4J6EA 1A9TA 3PV0A 1F0YA 5AXAA 2W6PA 3GEBA 5CW1A 1W35A 3EXHC 4ZVLA 2GEJA 4EF4A 1H5NA 4PS0A 4CM8A 2Q0XA 1KMQA 4AZ3A 2WUGA 1C7RA 4ZVTA 3WL8A 3Q8LA 3F0TA 4QRIA 1S7GA 1QJCA 3EVBA 4BXOB 4GF5A 3MD0A 4XWWA 2QZPA 2QKYA 1K63A 2AYZA 2BTEA 4D6XA 4BN5A 1XI2A 3NEYA 4DUPA 4NBNA 3GLVA 2J6BA 3PWSA 4L4RA 3N74A 5JDIC 2GBCA 2N75A 3BXFA 4V0NA 5JTTA 5EIBC 1OI4A 7ABPA 3TTTA 4EG1A 2E5FA 4TS9A 3UHAA 2EATA 3MTAA 1RBQA 2JCXA 1LBTA 3IUYA 1T15A 1VPEA 1AKVA 1DRWA 1SBIA 2Q6OA 5DNCA 3VU0A 3PA8A 3WLPA 1GGHA 3T1OA 1RWBA 1E4YA 1RQRA 2QNRA 1FSZA 1JJBA 1RKQA 2EWVA 3DQZA 1MABB 3GJSA 4P36A 3JQ6A 3SC2B 3VNBA 4D3FA 1CQJB 1U9JA 1ZIOA 3SKYA 2CHUA 4IIEA 4G5RA 4NZPA 1MB9A 1SZDA 4C43A 4DSUA 4EATA 2A8YA 4F4IA 1E2BA 2JLAA 1P5JA 5GJBA 3RPEA 1VJ0A 2YHBA 3JALB 3KXPA 3PUVA 5D2CA 5FPTA 1E4EA 3EASA 1KRXA 5D86A 3PI7A 1LWOA 1NJSA 1P4HA 1V3TA 1PCXA 1MFZA 5A7GA 2PT9A 2BM9A 4B44A 1KK2A 1Z6PA 5FYDA 3RSHA 2C8JA 4QYIA 5DMXA 4ZC8A 4DDVA 4QYXA 1EH5A 1R0SA 2IGBA 3OX1A 2IPMA 5CDUA 2E5LB 2I4TA 1XD8A 2HNBA 5E1BA 3PK0A 1PV4A 2VH5R 1E3SA 1OYOA 1KBOA 3GJ7A 4G2TA 1MIHA 4BVHA 4AQ7A 3F8SA 5I47A 1GQ2A 1LKZA 4H1HA 2M9MA 2VZ9A 3P2YA 3I37X 4QT0A 5SYNA 3O8LA 2YQZA 1X7DA 2Z95A 3L7JA 1KZ7B 2XUJA 5KTSA 2IF2A 4LE2A 1ECJA 1AKRA 3RC3A 1ONNA 1Z6GA 1OWMA 5DCWA 2D6FA 3GBSA 2SKDA 5FWXA 3B9PA 3GD5A 4IL5A 1U8TA 3ZGZA 4NBKA 5SZIA 3NIFB 3R4VA 2H0QA 3DDZX 3W5JA 4B3JA 3HJCA 2IS2A 2J08A 1VYVA 1VECA 3DLCA 4BEWA 3G9XA 5EHXA 5PGMA 1RCUA 1ZL2A 2R5FA 5ICMA 1XRNA 4FHEA 4OK5A 3UK2A 3OM9A 1O08A 4BFWA 2H4HA 3TOXA 2WIDA 4QOFA 3DJYA 3I04A 1E1NA 2CYBA 2OV3A 4UOQA 5DJ5A 3DKIA 2C0CA 3C3YA 4PZYA 2QEQA 4TTSA 3THWA 1SXHA 2VA8A 3OJXA 4EA7A 4W63A 1U3UA 4ND7A 1RPTA 5DPMA 2Z6UA 1FYDA 1NN1A 4RULA 1NLUA 1XMVA 1Z36A 1E96A 4HAUA 2CD7A 3LFUA 1LBEA 2NV2B 4I1VA 2Q5EA 3PS9A 4UULA 1VSBA 2IL1A 1AZLA 3LKVA 4PF1A 1RRVA 4G1MB 4EKYA 2DY0A 4MROA 2PS1A 1U3VA 2OLJA 1PJ2A 1IB6A 1L7EA 3FYSA 5K9ZA 1APBA 4FWTA 1FBTA 1HDOA 1S2NA 2EP5A 2X2PA 3BK2A 4XQ0A 1XZDA 4Z1MA 4D9EA 3K6SA 2R751 4B4UA 4YV1A 1ONPA 1SD1A 1CQZA 1VBKA 2ZYVX 1C7JA 4OBWA 5K0TA 3JQGB 4GPBA 3ABSB 1TM1E 4RLQA 2A59A 3CT4A 2C57A 3HY3A 2QAGA 2XD9A 3B6EA 1QIIA 3BIXA 1SU7A 4EWLA 1V47A 5A02A 1ZFNA 3UKDA 2IYYA 3HDTA 1WMSA 2AG5A 4TV8B 1UJBA 2Z4SA 3ON5A 5LU8A 1ZEJA 1ZD5A 4G9GA 1OB2A 2G72A 3ANNA 3PUKA 4PLPA 4EKIA 4YA6A 5LMZA 3FVRA 2I80A 4J16A 2HXYA 1Z56C 2ZT8A 5B1HA 1FNMA 3MUFA 3N2GB 3R7FA 4HDMA 2XXJA 4IXWA 4YV0A 1W30A 3NKFA 1X9HA 2OLEA 2H0AA 2C61A 1OT5A 2OEPA 2D1QA 1NVKA 4Q9AA 2P1ZA 4U4AA 1RFGE 5JSQA 1K08A 1UJNA 2YY6A 5JHGB 3K5WA 4I55F 5EYPA 3I2GA 5IVKA 1PTJA 1UC9A 2FR8A 3GUVA 1W0CA 2PVPA 1IWBB 3OM1A 4X41A 2GRUA 1F8UA 2HR1A 4XDYA 4LYJA 1TIPA 5KNLA 3RU2A 4MA5A 2EZTA 1YB4A 2HWXA 3DP7A 4FCTA 4FDAA 4TQGA 2OZVA 1XROA 4OQNA 5AK3A 4C0JA 3Q9LA 5C8YF 2W11A 1RXWA 1DXOA 3BFVA 3IMCA 1KI6A 4J0CA 1N0IA 1QCDA 1P7PA 1Z2DA 2Q4BA 5LNK1 2J5XA 2I4LA 5JD4A 3GXOA 4WX2B 3R77A 4OUDA 1HDZA 1LLDA 3D3WA 4XEUA 5TVGA 3NETA 2B36A 5CLQA 4CIDA 2ZJBA 3C1UA 4WDRA 3DVAA 5JCJD 4QX6A 1YIAA 3WGUA 4KO2S 1D0SA 2PK3A 3BPSA 4BGUA 2XMDA 3BMCA 2IXDA 2IUUA 3O2SB 1FYWA 1Q0UA 2C29D 5BNIA 2C2OA 2D00A 1LRLA 5HTOA 3T94A 1SZCA 4RHYA 1ZA2A 3Q0IA 1CUVA 4S0XA 1TYAE 3CVJA 3OJOA 2WYHA 5NLLA 1GIAA 2GUWA 3PG5A 4ZVPA 1QB8A 1EZZA 2XPCA 1A3CA 1FFCA 2QXTA 3JRXA 2CLEB 1IFXA 3UJPA 4ARZA 4ABTA 2XE8A 2XTJA 2JFUA 1MRNA 3C97A 3MTBA 4GR5A 3I30X 1JFTA 3EWNA 4L9SA 4FFNA 2NYVA 1EM8B 1XEWY 5LPNA 2C1XA 2UUPA 3I5AA 3JVVA 4YAEA 1UR5A 3DAFA 2WWFA 3FNHA 4OLAA 2GYWA 3W1WA 5K0FA 4NZOA 2WSBA 3GNLA 3OCYA 1EHYA 2QAGC 4KLZA 4EMTA 3WB2A 3KQPA 4J1QA 1JFFB 2G9RA 3ND9A 2FK8A 2H4YA 4ND8A 2J3HA 2XGJA 1ZMOA 2Q4RA 1DTWA 1ANKA 1E1RD 1UWCA 1NT4A 3H9GA 4J1NA 2ZSEA 2XLBA 3Q87B 4CF6A 4JCCA 1JEDA 5KNCA 4KFRA 4J16C 2ERCA 4F84A 1KEKA 4X8LA 4N39A 1N3BA 4AM8A 3NH9A 1KY5A 2DWQA 1PYDA 4WKOA 3WXBA 2ZBEA 4A82A 4YAGA 3THYA 4IJUA 1PGOA 2FQ1A 3UB2A 4QM7A 3ICQB 4RFSB 1BGWA 4KXUA 9LDTA 1D2MA 4U2FA 1J5XA 4D6PA 1XQ1A 4Q3NA 2FR8C 1TTQB 2GPBA 2QD2A 4GOMD 4QBFA 2JASA 2V54A 3IILA 3G0OA 4W4TA 3WMXA 3LUPA 3WYFA 1GU1A 4PVCA 4B84A 1AF7A 4F7DA 1WDMA 5KX5B 1YDMA 4G4SO 4V3CA 1DAFA 3DQPA 4HY3A 2Q46A 1TZBA 1V3UA 1NAIA 3AK4A 3GVPA 4ID9A 4Q1FA 4XJVA 4ZAXA 3A11A 5FO1A 4DDHA 1V35A 4HRYA 4G0QA 2WIAA 2DLDA 3BB1A 3BHJA 4OHOA 3IFSA 2B69A 1PZEA 5DT9A 2ADMA 5U1PA 4MQ4A 2P9YA 1P74A 3U61B 1CEYA 4D3XA 1AA6A 1Q92A 3WYGA 4FFMA 3E5NA 1BE6A 1ZCBA 2BD0A 1GA1A 2HFKA 2DCMA 3EG5A 4WFJA 3BOSA 5JMPA 2W4MA 5FJIA 2O2GA 3SLKA 3U7EB 5K8IA 1F2TA 1OX4A 2XYHA 3VHQA 3PLAE 3G5UA 4LZNA 2AVNA 1I7PA 1WCV1 1Z7BA 4KLNA 4HFJA 1VHQA 1XCJA 1YL6A 4Z0TA 5FV4A 4LZLA 4JB0A 1NR7A 3S7ZA 4X3PA 3LVRE 3DE2X 3EGDA 2P68A 3S1SA 1XMQB 1CKEA 2ZIFA 3L1JA 4MS3A 1JFVA 2JI7A 5A0VA 1NP7A 4BU1A 5K0BA 3UNXA 4F5ZA 2FOXA 3RFUA 2G06A 1SU8A 3OZCA 4YV2A 2IQ5A 3DCNA 2I6TA 3UUFA 4ZZ0A 3ILHA 1SR8A 4JV5B 3GLIA 1CD5A 4GP7A 4M8NE 4Y2TA 4ETWA 2VAXA 4W7SA 1YR8A 3QPVA 3W34A 2I33A 3H87A 5B55A 1B6SA 4UAUA 1FDSA 4G5OA 3WLQA 3LYHA 2BFBB 4RWZA 1U4SA 2YJ4A 5JLJA 1ZVMA 4TL8A 4Q9NA 4C08A 5IM4A 1PWYE 3GFFA 5BQXA 2BV3A 3EVTA 2HSZA 3IQDB 1BCRA 1H1LA 1ZCAA 3IP9A 4IW3B 2BFWA 4F3NA 1ML3A 6REQB 4P86A 3FN4A 3R0JA 1DGQA 2Y4NA 2QSYA 2LUOA 3AR6A 4U00A 5LC1A 3KOXA 1CUWA 2BGMA 2O0JA 4ARUA 1F14A 1R74A 2P5SA 3C3BA 4ND1A 1WSAA 3ENVA 4KRYA 1ORRA 1YL7A 3TB4A 3TS1A 5E7IA 2O8VA 2C8LA 2W5UA 2WHPA 5AMXA 5FEMA 2P77A 3NVKI 1XPRA 3A32A 3NLLA 5DTQA 4IQ4A 4PWYA 4YJ2F 2FSPA 3K4PA 3DJFA 1KK0A 3HZZA 3JYLA 5B7GA 2XTMA 5AHRA 4G4SP 1JAZA 5DWVA 2OILA 2HNKA 2ETVA 3OT4A 1ID1A 2C1EA 1HEIA 1MRSA 2G09A 4W8GA 3O8RA 2V0GA 3Q41A 2FFQA 3NM4A 4C04A 1EK6A 1Q0LA 1XXHB 4NZZA 1Z2AA 1L5HA 3I09A 3THXB 4IDQA 3ABOB 3T06B 2ZPAA 3H86A 3QKRA 2ZWMA 1SCJA 5J2TF 4KQKA 5IT9A 2IZ0A 4I4TA 4IQGA 2IWRA 5L53A 1YU6A 2ESRA 4N5DA 3MWEA 3OCWA 4IDNA 4MTCA 3ZE7A 4PYIA 4UU0A 1TK9A 4ITVA 4A1OA 4RQBA 1X80B 1W0JA 2WKWA 1Q7GA 3JATB 3WVNA 4DLKA 4GE0A 4IOLA 4D99A 1WSWA 1Z4NA 2OD2A 2PWBA 5IJXA 5JR3A 4DCSA 4GO1A 4ZT6A 1VBMA 4LK2A 3WLJA 1GLGA 1YS6A 2C3PA 2VK2A 1K3FA 1T8RA 3KAKA 3OOSA 4GI3A 2CVZA 3CO0S 4RACA 3U13A 1OREA 1IL0A 1H0HA 2A78A 4PIMA 3MWGA 1NFRA 3T1QA 4PR0A 4FFDA 3W3AA 3LXXA 4H2DA 4TS1A 4TXNA 3T5BA 5IDQA 1NUSA 1NVTA 4HUQA 1STOA 5K20A 1Y5NA 4X3OA 4BIIA 1UPFA 3MMSA 4ARCA 2FDRA 5CXUA 3BJZA 3LTEA 1AX9A 2D62A 3ZXXA 5FPSA 4KXYA 5FUYA 3WISA 2V74B 4I1YA 1XZJA 2ID8A 2HBYA 2BFEB 2CD9A 2LCIA 2PX3A 3ETCA 4OQDA 4KNYA 1XJQA 1C3JA 5E3HA 4X91A 1JEYA 5REQB 5T8KA 1F0PA 3W0LB 4MEJA 2NV0A 3KVYA 1QWSA 3F2IA 4IV5A 3VC2A 3CVYA 1DTSA 2A30A 3IHWA 1JJIA 3OZEA 4GKAA 2FPGA 2V7GA 3LC0A 2LW7A 3FPBA 5GGYA 2QLJA 1MX9A 2B92A 1T91A 3AHDA 4Z5XA 1G1MA 1E6UA 1N7HA 2PR2A 2XUIA 3U0VA 1LSSA 3OQ1A 3JZIA 2CXHA 5HMLA 3TLKA 4FYHA 1OMOA 3VVCA 4G25A 2XVZA 4I8IA 5BYAA 1F8YA 1I5OA 4UARA 2RE8A 1PR3A 5IAAA 5JYBA 1O6BA 2FZ4A 3EJ6A 4JBXA 4JSTA 3DEHA 4KMSA 4MUYA 2VTKA 3QEOA 2IT1A 4JJFA 5GZ1A 3JQ7A 2HMTA 2NLOA 3EH1A 3QKIA 2Z56A 2R1VB 2H7XA 2QV7A 2R8RA 3PC8A 2OKGA 4RGYA 5B1DA 2PBFA 3ZHZA 3MQ4A 2J3IA 4LDZA 5B3LA 4DVGA 1ZICA 3A28A 3AI1A 3C5CA 3OA2A 4GZMA 4HNUA 2BMAA 3PD1A 3F6EX 3L9WA 3NVDA 4YRSA 4GOLD 1X15A 1MO3A 4HTAA 4TT8A 2BTOA 7MHTA 2GAFA 2WJYA 3IAHA 3MIIA 3MMNA 3GVIA 4B79A 1T1EA 1OPRA 5FA8A 3DLAA 4QEZA 2ZXFA 3K53A 1QP4A 2O06A 4ONEA 4ZYVA 1HT2E 3SZMA 2AJCA 3OFKA 1TX4B 1JAXA 1K6MA 2RGAA 5I8ZA 3JQAB 4RVHA 4OXXA 1YOBA 2NT3A 1Z0DA 3AUXA 4P0QB 2VOEA 1EMDA 4OHYA 2VHUA 5EE9A 1ZR2A 1Z3CA 3AC0A 1V48A 3QOYA 4L8GA 2B8NA 3UN1A 1G8JA 1EZ1A 2D5CA 1RNLA 4JLWA 5D7NA 2J9RA 4RZ2A 1W6RA 2G77B 4JYCA 1DQNA 2Z08A 1U2PA 1P4GA 2VNHA 1M76A 1FUIA 4K9PA 1CFZA 4DAEA 2ZVJA 5FNVF 1T25A 1PQWA 3L6UA 1ZMRA 3HB5X 2ZBGA 3QVVA 5CGQB 1EP9A 2C98A 1PK8A 1USVA 3EXHB 1GNSA 4YFVA 1VP3A 2ZJ6A 3DNFA 3K9GA 1S9HA 4BQFA 2RIRA 3FYUA 3DZHA 2AJTA 1PWEA 3NVAA 2YVLA 3N2IA 2VP5A 1M2NA 2GCOB 5IH3A 2FG5A 4U7TB 2GSDA 2P4HX 2WJVA 2EZ9A 3D5EA 4PYRA 3SXPA 3TAUA 3CNNA 3T15A 1FDTA 3CTPA 5IAJA 5BSKA 3L1IA 1SFRA 5CDYA 1RJ9B 3BKWA 4MCHA 1WSBA 1LD3A 3MZ0A 2HNAA 3Q8WA 1SH7A 2PMCA 2PZFA 2W2KA 3U3MA 3ZHBA 1EFCA 2IS4A 3DCYA 4C78A 4HEA6 4HUTA 4C0AC 3LOQA 2O8CA 4UHKA 4X94A 5GPBA 5KYUA 4PRKA 1KO4A 1U2TA 4K6KA 4QPZA 3QBVA 4UVIA 4ZGWA 3SVLA 4FYWA 1ESZA 4E51A 2VUSA 2ZS7A 3EUAA 2WUWE 3QMWA 2NU6A 1Q3KA 1Z74A 2ZKLA 3BD6A 5EXEA 1OPXA 5AKEA 3GFRA 5DBGA 1XZHA 4EG8A 4PLTA 3K2IA 3KQUA 2E1PA 3BAFA 3UM9A 1W85A 1Z82A 2AFIA 1NQVA 1T3HA 3KYDA 3HJHA 4M3NA 3SM9A 3ADDA 2M6LA 3KWLA 3FLAA 1XDWA 3CLSD 4N7RA 1UJCA 4LY0A 2NO0A 4UHHA 3RRJA 2XQGA 2AZMA 4RCZA 2QSUA 3IV9A 3VU8A 4BQRA 1YMQA 3PC8C 1CY7A 3WBFA 1QO9A 2CNNA 2PUDA 2YIDA 1XOIA 2X5KO 3QEMA 4ZVVA 1U31A 2P0AA 3HWRA 3P9PA 4I9HA 4DANA 1T5BA 5JAHA 3JRNA 3H1TA 1EWRA 1PSWA 2QZJA 2WW8A 3RW9A 4LW8A 1DQRA 3AM4A 4BTVA 5A3QA 2EHDA 4FINA 1IRXA 4R83A 4AC9A 4AKHA 3OIDA 3ELBA 2XGMA 3PHGA 2WZBA 4DBLC 3QVSA 4L8LA 1CZRA 1F3OA 4MX8A 2JNWA 1VCOA 2WA2A 4I5GA 3RRZA 2OV4A 4R6XA 2VWPA 3AP3A 3VZQA 1EEXB 5CBKA 1WCXA 4OEHA 5BN5B 1RZ3A 3L49A 1U7XA 3DLHA 1NXVA 3JV7A 4CRWB 1O57A 4RLFA 4NV0A 1XNQB 3AY3A 4L72A 1GV0A 1W4AA 4HZGA 4RVGA 1HH4A 3DDOA 4F06A 2QTCA 2P6UA 1NMSA 4TVOA 2XKKA 4EMSA 1UBGA 1LPAB 4OIFA 2HIHA 4JK3A 1E62A 4JQOA 3FB1A 1X87A 5GOZA 2IEBA 2JGRA 2MMGA 2AV6A 3R3XA 1U2SA 2CDAA 5ENZA 3EXG2 4EUFA 3UHFA 3JWJA 4O02B 5CB4A 1N78A 4AZ3B 1AQYA 2BMVA 3FYUC 4S05A 2ORWA 2V7TA 3ESRA 1UBHS 1SOWA 4FLMA 4R9NA 2VK8A 4P38A 2IS1A 4TKUA 3LXUX 5AQEA 5DNYB 4GI7A 4DEVA 3M7IA 4NEGA 1V8FA 4MV5A 2I03A 4JX9A 1E5QA 5HM6A 2ECOA 1G6OA 3WLOA 3KXKA 2PE5A 1NWCA 2YH2A 3EUEA 4R1SA 4UM8B 1NRWA 2XXBA 3VAYA 4EG7A 4Y2SA 3G0CA 2BFOA 1L7MA 2EF0A 1G2IA 3L0OA 4CKCA 1EWYA 3PF8A 3PE3A 3TRHA 3L7LA 3FM9A 3GAFA 3LCVB 1JWAB 1WP4A 3AF0A 4RM3A 2OMEA 1YCHA 1B8PA 2WYVA 1ZRNA 2EXXA 3MGGA 3D3KA 2EV9A 3PITA 5K3FA 5KOIA 4X7RA 1F3LA 3HY6A 4YRKA 4BASA 2AN4A 4LRXA 2PN1A 3LKDA 2D3WA 4MQEB 4LY9A 5AUPB 2ZUFA 4D92A 3QQ5A 1YB7A 3ICCA 1E9SA 3VNSA 5ER6A 4B5KA 3AR7A 2VC2B 4IEEA 4A2CA 4L28A 1SXQA 3ER9A 2VQEB 4TMFA 4RHXA 3ZGLA 4PPNA 3GJ3A 4OI2A 2Q1UA 3IUNA 1DC3A 1QGUB 1A8SA 3G5TA 1KFJB 3NHBA 3V4LA 3BCHA 2VIIA 4QYIB 3VI3B 4XJXA 2FTKE 4YQFA 1UBLS 3C43A 4RNDB 5CD1A 3ZU6A 1E2LA 2ACKA 4LDJA 1Q2UA 2Q2NA 4KE6A 4JFRA 2XQKA 3A0RB 4UMVA 2PUFA 1D6SA 1V25A 3PEUA 3S29A 1QDUA 3IE0A 4P4GA 2MSKA 3HKBB 1OH6A 4DW8A 1AK9A 1IBMB 1H8HD 1N2CB 2QF7A 4P35A 4ZCTA 2YWEA 3ADKA 5AKXA 3ZVMA 4FEAA 4GRAA 1JSCA 1ZCFA 4JYMA 1WVGA 2YBDA 5EMHA 4ME6A 4HOYA 3NWEA 3K31A 1W59A 2D0PB 1QF7A 3HADA 1R8YA 5GIPE 4M9XA 3PPVA 2AUTA 2QBYB 1IRIA 4R3NA 1DBIA 4JGGA 4G65A 2EZ8A 3V34A 4EF6A 2PZAA 1LX6A 2JCGA 1Z6XA 5BN1A 4NVRA 4NS1A 3FRJA 1WTAA 4DMFA 2QQ0A 3T7JA 2VBIA 4HSEA 3EC7A 3BZWA 1SUAA 3JCZA 5AVQA 3IPRA 4XB1A 4QTZA 4HXFB 2I7CA 1BE0A 3CLTC 3USZA 2QT9A 4P83A 3FVVA 3PFNA 1TKBA 2Y0CA 4Y1FA 2GESA 2ZU0C 3HJAA 3THWB 1KJ8A 1JIUA 4AZVA 5K05A 3BDVA 3IC5A 4IFBA 3VSAA 3QELA 4UBMA 2BKLA 3TM4A 1T1SA 3VMFA 3EFEA 1GADO 2IODA 3UV6A 2WAYA 1QYIA 4RLHA 1EAMA 4EAQA 3UWDA 1FF9A 4BO2A 2HLHA 4DXAA 2FPMA 5GONB 5I9MA 4Z4HA 4U8HA 5KWEA 5KOJB 2CLMB 1SUIA 3EXFA 5KVAA 1B6GA 2YVQA 4HZIA 4RK1A 4BFCA 4WPGA 2PZEA 1ADBA 4OUKX 2EQBA 3N2ZB 1IULA 3N6VA 4PRZA 5E7JA 4YQYA 3RUPA 5B2EA 4ZJUA 3NPMA 2J9FA 4NOJA 1RVV1 2A2ZA 2JL1A 3L04A 3LFTA 4LZPA 3I32A 1Z2NX 4ZREA 1P3JA 2BBSA 1YRHA 3TTSA 3ZGVA 3Q8XB 1Y1QA 2QAGB 1WUJS 2R11A 1S3FA 3O21A 4U7FA 4CTJA 5EQDA 2BELA 4I4NA 1UEIA 3ONWA 2O57A 1BXRB 1DQPA 4FZJA 5A0TA 1DV1A 1XTSA 1TEVA 1UM9A 1ARZA 1V11A 1T0UA 2G08A 1EG7A 3KLNA 4OAQA 2E4WA 5GY7A 3X1MA 5EESA 2VJDA 1MA0A 4U9HS 2P79A 3DM9B 3BWEA 4FZVA 4YRAA 4HDMB 5H80A 2NP6A 1CJVC 3CF4G 1NVXQ 3BSYA 4N54A 1QDLB 2ON6A 4RLSA 4L9WA 1WX1A 4YLYA 1UXJA 2F1IA 3QUTA 5TEWA 1SQSA 2CFRA 3OD1A 2OT3B 5FLXA 3WK7A 1FQJA 1GL9B 1W5AA 1WDWB 4AWBA 1OT3A 1JG2A 1RR6A 2CGEA 3E4CA 3MGKA 5HJ2A 4MYUA 1HUQA 2OB2A 2ZETA 2FN4A 3V46A 5C8ZA 4RQUA 4PZAA 3S2EA 1F2VA 3RIEA 1QC5A 1IM8A 4MUJA 1NUHA 1T4BA 2VYNA 4XIJA 5BSWA 1Y42X 1HK7A 1IZ0A 2EX4A 2OENG 3WIUA 4UUMA 1OJ7A 2I2AA 1CRLA 4FXPA 4H0NA 2D59A 1W2WB 2OBBA 1IM2A 5DTJA 4OX9Y 3Q5GA 4AJPA 2F55A 1PD1A 4FGWA 1YDEA 1X2BA 4LOAA 4WLOA 1SMKA 1Q22A 3NDRA 3OY7A 5J40A 1A97A 1KI6B 3W6NA 4F9EA 3JR3A 4KE9A 1YQTA 1Z0UA 3B1WA 4IEIA 4UMEA 2ZQZA 3VX4A 5BW5A 4OUDB 3BJIC 4X6LA 1EU1A 2FPRA 4UUNA 1VKRA 1NJ5A 2JDIA 1PLLA 1XNHA 3JQEA 3PVZA 1DT5A 1GPNA 2AXEA 3HG7A 1EUYA 3P0RA 3WBBA 3ZWXA 1NVVQ 3VV2A 3K1AA 4BFSA 1RHJA 2IYSA 3H8SA 4M1SA 2FQQA 4IDAA 3TL3A 1Y6ZA 2WEKA 5IYZF 2JLVA 3G9ZA 1BA3A 1QX3A 4PQFA 3SMVA 3ACBA 2QGNA 4DMUB 1I4DD 2WKQA 2ZROA 4R8LA 3HCAA 3K0BA 4E5KA 4EO9A 3OQOA 4DYHA 1A8QA 4M49A 3ZY4A 4PHCA 1SVLA 4BNYA 3IPYA 2F48A 4CGYA 2QX9A 1QGOA 4GWKA 4REMA 4BN4A 2ZUDA 2ZUTA 3K71B 4RZIA 4R1LA 4NS4A 4CJXA 2HRCA 4JJ7A 1UMBB 1POWA 2NTYC 3U3KA 4O5OA 5AICA 1RXCA 4S04A 1WAMA 2C7VA 3CG0A 3GOHA 1FMFA 3LY5A 3D6FA 3N0VA 3C70A 1EJBA 3WI7A 4AW9A 1IONA 2Q2VA 3I9FA 3QXXA 4HWSA 4UTXA 1QV9A 4C06A 2JI8A 1N6OA 5BRJA 4AZWA 2K5UA 4G0VA 4ND8B 3KUKA 1DTWB 1RWVA 3SX2A 2ADFA 1ZOOA 2FEXA 2QL5A 3KT8A 1YR6A 2C59A 2FXIA 2EAUA 2Z2IA 3VOTA 3OU7A 3Q0EA 1LI4A 2R8YA 1W96A 1Z7WA 3WS7A 3NBAA 3C15C 4BWYA 4DRYA 2E3JA 2CMKA 3E2IA 1UAAA 3H8VA 2NQ2C 1X86B 3IVMA 3UT5A 4UOEA 5JJBA 2CLFB 1IY0A 2DQKA 1C0LA 1KJZA 4YUAA 1EP1B 1WKVA 3AY0A 1I0LA 3RVLA 3FTNA 1KGDA 1U81A 1THTA 2HAEA 4MW6A 4NBSA 5G0TA 4XDGA 4FB5A 2J3QA 1PS8A 2XE4A 3TOZA 4FR2A 4AJIA 1G9XA 5BNZA 4L5CA 1KE1A 4HDKA 5HFJA 3N05A 3HEAA 2EG5A 3VU9B 5CLIA 2HQRA 1USKA 2VXBA 1ZXBA 2Q5OA 2IIBA 1ITZA 1YQ9A 1V9CA 1A27A 2A0UA 3V4FA 4IJMA 5JARA 5K4HA 5KWJA 1FY2A 4X1YA 1K4MA 3CUWA 3AU9A 4TTVA 2P69A 1GG2A 3D0KA 2EBWA 3FUVA 3PF9A 4FD2A 4FYKA 4PEVA 2OBXA 1QQ7A 3R5HA 3DWEX 3GJZA 3EUFA 1D9ZA 1WHTA 3MTJA 1M5UA 1RYDA 1KMMA 2H2FA 1ZWKA 5BN4A 3BQMB 3IO5A 3MCVA 5KIAA 4RKQA 4YJFB 4OQQA 4GIBA 1HETA 4ENRA 4PZ9A 4YPOA 3KQYA 1GKKA 3NJRA 1GFSA 1QKIA 1Z68A 3QW2A 4LBVA 3AKEA 4FWIB 2XUPA 1N2HA 1KP2A 3B60A 4S3MA 5H1YA 3T9CA 2NZXA 2ZUSA 2VLBA 5DV9A 4M7PA 1RQNA 3RSLA 2YJ6A 3CYFA 5JQGA 2HA0A 1L4FA 3OQVA 3WG9A 2QG6A 3PNKA 2Z5FA 2JIDA 2PUCA 5ES3A 2XCUA 4OQMA 3UMCA 1PP4A 3MJCA 4JIGA 2HXGA 3N53A 3N7AA 4LOKA 4D02A 4EEXA 3ZWCA 3ZCTA 5ECDA 4W99A 3ZU3A 4GOJA 1T4DA 3AEQB 3BS4A 2EIXA 3D7RA 3RT7A 3RSZA 2DX7A 2ZAMA 3L7MA 2JJ8A 3OCUA 1VQ1A 1XNJA 2D0OB 3GZNA 1AUOA 4FFVA 4FDVA 4WA8A 1GYQA 4R8MA 3CVOA 1J0AA 5L3RA 2I54A 3GRRA 3K6RA 4KB5A 1ZH6A 2VNJA 2IK8A 3WL7A 4C1NA 3IP1A 3G2HA 3F1KA 3O3OB 1TUEA 1FU7A 4MWOA 1EK2A 1ZRSA 3IX7A 3L3BA 5G1NA 3UWSA 3KD3A 4F5YA 2BKXA 4WNYA 4O2AF 1SXIA 4ZCQA 3R3ZA 3WGYA 4DE5A 2VF8A 2OYCA 4AUKA 4YJGA 3OEHA 3WKEA 1QH8B 2XYRA 2EWWA 3A3PA 4HK4A 3PXUA 1JLLB 2J4CA 5A06A 1IOVA 2Q1WA 4F9FA 5ALKA 3IH5A 3CX7A 3IEVA 3GARA 5FWAA 3SXUA 3P94A 2EBHX 3WLTA 4LS3A 4MPJA 2COKA 3K1ZA 1UJ2A 2W6OA 3IOEA 3W8FA 3A27A 2IH2A 5FBVB 3TKLA 2ERYA 3QKRB 2PH7A 3UJCA 2OB1A 3C6XA 4X20B 1E7MA 4MKRA 1C8BA 2QRNA 3EQ9A 3MWEB 5IAKA 3TIIA 2B2XA 2AOUB 1YULA 2GQ0A 2QW8A 3KVOA 3L8FA 4V0LA 3GNSA 1KU0A 3TW8A 3PXEA 1E20A 5AW2A 2HXSA 5IWAB 4K3VA 1KQPA 1BQEA 1T2NA 2V7XA 4I55B 4KQWA 3SD7A 4AG3A 1W29A 1GNTA 3DMRA 1E5VA 1U8UA 2AR7A 4N12A 2XIJA 2AH5A 3LT5A 3P8ZA 5AOBA 3H5TA 5EQFA 4BNDB 4EB0A 4NOKA 4D80A 1G3QA 2HGSA 2Q7XA 2Z57A 4URFA 4KPEC 4R2KA 3Q6IA 1EFPB 1EEHA 4ZVOA 4ASUA 3PR2B 1UEJA 2X13A 4HUQB 4Q3CA 1VL5A 4BZXA 3WGJA 5CVJA 1FVFA 1H2WA 4UCFA 5C8YB 2ZJ4A 2R7MA 3IP8A 3TEFA 3GJRA 2EW1A 2Z2XA 1K1EA 3QKSA 1SHZA 2PMFA 4NICA 3N2EA 4L76A 4FLFA 3FH0A 5TRTA 2RH8A 3TEMA 2YWJA 3KKOA 4K9RA 1WPGA 1XD2A 1ZKMA 5IT4A 1GV1A 3AYZB 4IQ8A 2Y66A 4BC0A 1JEYB 3IQWA 3S68A 4JN6B 4ALKA 3KS9A 4BVEA 1Z47A 1ZGZA 1X92A 2B25A 2WU4A 3LKBA 4WASA 1B8VA 4XUGB 2FPGB 5K0LA 3ZIDA 2JPDA 2Z9BA 3ILYA 4QJ5A 4B09A 1SAYA 4LFBB 2CNBA 4YDHB 7REQA 2AK3A 4FDTA 5CCDA 3EBOA 3WLKX 4IUCS 5IAOA 1J2JA 4XARA 1U4NA 3O4FA 3WLFA 2HY7A 4FFOA 4ESHA 3OH8A 1D03A 3CHYA 5DDIP 2NP7A 2EP7A 2WJZB 3MELA 4QQRA 1TD1A 2HU2A 2ODWA 2ZJ5A 2Z8YA 3KV3O 4F2PA 2NU8A 1HZZA 3JQ7B 4BKRA 1TYEB 3N28A 2BR4A 1CEXA 1R0BA 3ZHRA 5BNWA 4W82A 4WAUA 2WK1A 5SZHB 1NIJA 4PG8A 2DF8A 2XYVA 3D7NA 3K32A 5IK2D 4EITA 5FTNA 4JYBA 2Y2VA 2PGIA 2PUTA 2W4QA 3ONNA 4WXMA 3DFIA 3ZZUA 1T3LA 2JLQA 3ZOZA 2IYXA 4AYWA 2BI7A 5CFNA 3AHHA 3MOIA 3ROPA 1U8FO 3V4ZA 5JD3A 1XLUA 3AQ4A 1R1DA 4HFNA 5TGDA 1QE3A 3S2IA 2F4VB 3LUDA 3HGMA 5A9TA 5T6MA 2FUCA 5KI6A 1NVUQ 2IHBA 3USES 3L2OB 3HXMA 2PLWA 4JQZA 3T3GA 3QYAA 5AW4A 4MAAA 1XTQA 3DULA 3WWDA 2QNBA 4M9SA 1KGSA 3J81k 3MBIA 3TSAA 2FLWA 4Q9KA 4X8HA 2GZ1A 2B1IA 3MTQA 3AUYA 2Z6QA 2KPOA 1C8VB 3LS2A 2X15A 5DHRA 4X97A 1MZPA 1H0RA 2JCVA 4FFBB 821PA 5TXGA 2C2XA 1RKBA 2FI1A 4ZT7A 3QU7A 4R31A 1EVQA 1QB7A 5B53A 5LQRA 4ZGBA 5AUQA 3PDUA 4AYTA 1K66A 1TLFA 2ZB3A 3OZVA 4ZOEA 2B5WA 2I76A 3FYUB 3PIRA 4GQAA 5C80A 4ZZIA 5JEEA 3MCZA 5KQPA 4YO7A 4FEEA 5BXQC 2P5UA 1ZM9A 3INNA 1D6NA 3BORA 3EB9A 2LV8A 1TT5A 1KEWA 2R1UA 2W6CX 1VZ3A 5FL7D 4CN9A 3T4EA 4CETA 4BB5A 5KREA 4MWDA 4LF7B 1J2UA 3VM6A 1JQAA 2P91A 3ZQUA 4EK9A 5KQGA 3NIBA 2O8CB 1T5TA 5KYUB 3I3SR 4FGJA 3BWBA 3GAZA 2NPIA 1BMFD 1GU0A 3G2OA 3GFOA 4ZN6A 1Q1QA 5F1PA 1WBDA 2VNIA 4DR4B 4BP8A 2NU6B 4OMDA 1V6CA 1UQTA 1T2DA 4HO1X 3FZGA 3BAZA 4BQSA 4JB2A 1BEZA 2P9QA 3NIGB 3PTZA 4MVJA 3KYDB 4YXWA 1VLZA 4QUJA 5AFSA 3V6MA 1NDQA 2C7GA 4LPKA 4UXIA 4Z8XA 4ABYA 4Z0PA 2J3KA 3BFPA 3PQ6A 3MM4A 1GN9A 2KYRA 2LPMA 1GXSB 1L5WA 3IP6A 5G40A 3K9HA 2PGOA 2XGOA 3VR6A 2GFIA 4PX5A 1E89A 4RMHA 4YRLA 3VV3A 1VIMA 3FVTA 4LY6A 4NOLA 3F74A 2QVLA 4AJ9A 1FJGB 1XELA 4RS3A 4LHXA 4O2BF 2GUGA 3T0GA 2XLCA 3OLQA 4U8GA 3Q2IA 2Q7DA 2FSGA 2PVCA 2VAWA 5E4TA 5F2OA 4ZALA 3VDQA 1MF7A 1H3FA 1ISJA 3AR9A 5BYBA 3Q9SA 2H8GA 1JVNA 2NVOA 1F60A 3M1LA 4GEKA 4TRNA 4IGAA 3GYBA 2ZUVA 4IRMA 4YJ2B 2OFFA 1S89A 1YHZA 2XUFA 4AB1A 4RTSA 4CEHA 2WC1A 3I3OA 3E7DA 5CPBA 1N7JA 2I62A 1KXJA 3DFFA 1SXGA 4TS3A 2FFHA 2PUWA 3A31A 5FWDA 1J22A 4HMOA 3ZDCA 2PSFA 3IMKA 4BQEA 1N0UA 3TLZA 1YUMA 1JZTA 2VDVE 1N2XA 1B0AA 3A3YA 2OCGA 1W7AA 4JUIA 2I3BA 3JU3A 1U2GC 1N6LA 2C9CA 2VDQB 4PRLA 4NI5A 3D3JA 1HPLA 1F06A 1SKUA 3BWVA 4HS4A 2E2WA 2VJAA 4UTPA 5J2TB 1Y37A 3MLBA 4IDPA 3HA3A 4BKMA 1ZJJA 4QSMA 3GIWA 5B37A 4BP9A 1T2UA 4RPKA 4D42A 5C35A 2YZKA 2QW1A 1E2KA 1Q0PA 5H3CA 2ZLBA 1VL0A 3NNDA 4NAUA 1KFKB 1BW9A 1N8NA 1PV1A 4OFZA 3PXXA 3OP4A 3MGCA 4KQJA 4MCAA 3D0QA 4PNPA 4QNRA 5EXSA 1WXWA 4Q19A 4B2LA 5I45A 3OQMA 3SF8A 3HBLA 3FDZB 3TLCA 4LXUA 4MSUA 3H1GA 3L40A 4DCJA 1YCFA 4HMQA 1JA9A 3E4DA 3U39A 2VT6A 4G4GA 3AIOA 4XVUA 4G1BA 4N01A 5KYYB 4IMJB 1TRHA 3HJGA 1PVVA 1PI3A 3L02A 4ZVQA 2O5CA 1J1ZA 2BR3A 3AILA 5L9AA 1HLDA 3DA8A 2XYPA 3TPFA 5B30A 2PIDA 1A82A 4KUHA 3VU3A 5CCEA 2JGIA 3MA0A 4KH1A 4Y9SA 5K3FB 4E88A 5M7EA 1JEAA 1OXXK 2AHOA 4YREA 5C18A 2IITA 2Q3FA 4Q5IA 4AMYA 2H3HA 3OTHA 4KWCA 4K6OA 3BE6A 4J8PA 3CRZA 4RSMA 1VCNA 4AY5A 4DVJA 5JC1A 3QKTA 4BFTA 1Z5NA 3BE4A 4YUWA 2ZPTX 3AJ8A 1DOAA 1TW3A 2PH3A 1I13A 2BEVA 4LHSA 1ZUNB 2F3SA 4DKXA 1C7EA 4GP6A 5CB0A 1JE1A 2JFQA 1O0SA 4M0MA 1QCZA 2CXPA 2GJSA 2VP9A 4B3RB 3LP8A 4B32A 3V1KA 2V97A 1SA0A 5AJYA 3I8XA 1EFUA 2VDUE 5LZ4A 3RH0A 1R6TA 1DUIA 1GVNB 1QH0A 2GLTA 1SCKA 4FHCA 1C1YA 3OIVA 4Y0AA 5HJ7A 4L0QA 3BULA 3RVOA 1LK7A 1Y0BA 1U8AA 1Y3DE 1DI0A 2H00A 2WHRA 3GRKA 2IFTA 4P5DA 4EIWA 1A5AB 1JIXA 1URPA 2Y1CA 3R6WA 3EEYA 2GN2A 1ONOA 2JJQA 5HTKA 4L57A 4EHKA 3HN7A 3IDFA 1Z35A 4IINA 5G53C 4EM6A 1G8FA 3QUQA 1CEEA 3DD5A 1KP9A 3L41A 3NHPA 2R6JA 1HZJA 2YV1A 2JRLA 1J0EA 3M5WA 1L8XA 1UXOA 4TGLA 3RS4A 4YRNA 4B7UA 3BWXA 4FGSA 3GUCA 5AJWA 3LVFO 3VOSA 2RGWA 1XTZA 1IDOA 1XZEA 1R9GA 2QSJA 1Z6QA 3O82A 4CXMA 4TQUS 3VVBA 3ASZA 2C7OA 4KI0A 3ZIUA 1C0EA 1KIAA 3LQ4A 2YV5A 3PJFA 3QENA 1DMSA 4MITA 5AP9A 3RVDA 3NTXA 5F78A 1SCBA 3HYLA 1OKKA 4YJ3F 3QJ5A 3U4HA 2FVXA 3CCCA 4IIBA 3NBXX 4OMCA 4IZOA 3SDSA 3SP1A 4F2GA 5A4DA 4NCXA 3KZOA 5AVYA 3NTUA 4HS9A 3WHPA 3EEOA 1I6KA 5FNVB 2GD6A 1UJMA 2W2QA 3VGJA 4GXRA 3G17A 3ZI7A 3EDCA 3DTTA 4TLAA 1B0UA 5D1HA 2I71A 2XI4A 2Z4TA 4IWNA 2J0EA 3W6OA 2WQ7A 4OFBA 3OUZA 1SN7A 2PYIA 2I4NA 5EZYF 1ESNA 1Q0QA 3D5TA 1H8ED 1J24A 3K9CA 5DI9A 1RADA 4XGKA 2JFWA 1E8MA 3ZJVA 1XZKA 3P5BA 1PJBA 3R0ZA 5I4IA 1T0HB 3HXKA 1YWGO 2J31A 3GFSA 4NBLA 1SXJE 3B1KA 4QDUA 1W36C 2A9JA 1V11B 4UDOA 1UM9B 1EXNA 2WTBA 2XQIA 3U4IA 1BMQA 2OK8A 4UREA 3UOGA 3AVYA 4LCBA 3L01A 2YQ5A 2GNOA 4PGFA 1T2AA 2QU7A 5JXJA 4NRDA 2GRAA 3MJFA 3EA5A 4GFDA 1P7WA 4IILA 4HEJA 4KN8A 2RHOA 4E2XA 4UJ5A 3O2JA 1DC8A 5BVHB 3QWFA 3MG9A 1S9DA 1QCYA 1CPYA 4CKYA 4BLOA 4V1CI 5ELMA 1V8DA 2YWFA 2VDWB 1XAJA 3EEQA 4KAFA 4WOKA 3SJCA 4FMDF 4OLHA 2PVSA 4RMIA 4DPLA 4OSOA 4JHLA 1UEXC 4AX4A 4P7KA 3T7IA 1EGHA 3T7EA 4DIUA 4JS0A 1LFDB 1LUAA 2BRUA 2FWNA 2A4MA 2WSSD 1IBCA 1OV6A 1GZSA 1FP6A 1QC5B 2WF5A 3BF7A 3BRSA 5HJ5A 3RYCA 1QU3A 4CM7A 2H06A 1CV2A 4DV4B 1OBFO 4BJ6A 3R3UA 2WYOA 4EW1A 1R8SA 4H15A 3VZCA 1E2PA 5ALIA 2P7IA 2HM7A 3TR0A 4M9UA 2JGKA 2D4HA 2EFHB 4WCFB 3I1JA 1WHSA 4M8LA 1PQPA 4FUQA 4MV7A 5KJEA 4B33A 4BS9A 3GLKA 1U2EA 2Q6IA 2XDQB 1J5EB 2PZBA 1J06A 3LP5A 1PU2A 2RK3A 3STXA 2UXBB 4F2HA 1O0CA 5EJ9A 3ZX4A 1J5PA 4RL6A 1ECGA 4A8TA 2NXNA 1B16A 3DOCA 3TSYA 1MUUA 3K1AB 4L02A 1QG6A 4YWJA 1J9ZA 2ZM6B 2X9NA 2R7AA 4PR3A 3PJEA 4CIAA 4QZVA 1U11A 1QRUA 2BFPA 1Y4ZA 5EXPA 2P6PA 4K9DA 1PL0A 5JVDB 1SIBE 2C0QA 1C7ZA 2K2WA 4OCZA 4UM5A 4C87A 1DRVA 3BN3A 5C1BA 5GP1A 1D04A 1HFJA 1UAGA 1C30B 4ZGGA 1Z7GA 3OI7A 4IY1A 2WP0A 2ZSAA 1N2GA 2ZR9A 5HQ3B 5JECA 4JJ8A 3ZE9A 1F1BA 1OIXA 1TZKA 3K8OE 2FG7C 1HE8B 2Q3HA 2Y1EA 1FYEA 4R3WA 3KB2A 4ROTA 3TTUA 2H11A 3RWMB 1FXSA 3DMPA 2IPNA 3M9LA 3MMZA 1KYWA 4UW9A 5G2OA 4CCAA 1NJ2A 4GP9A 1JNXX 4TYMA 3L7CA 1GQQA 1TYCA 3KHTA 4MLZA 4X5OA 4LX8A 1X1RA 2A35A 4QYTA 5B64A 3ONDA 1H1TA 5F9FA 3VNRA 1TUBA 1XE3A 2QLMA 3ABRB 3C6ZA 3AZPA 3II6X 3PLRA 5T7BA 4L15A 2IOQA 4MYHA 4XAQA 2HF2A 1RP7A 3QYPA 1GCGA 1X3LA 1Z28A 4ZVUA 1G38A 3IQZA 1M6VB 3HC7A 1YRLA 2OZPA 3SS7X 4UEKA 1JKXA 3BG5A 3OPNA 3DUWA 1ADGA 4DMCA 2F1KA 3DNMA 3F7MA 5LDHA 1JDJA 3PNSA 5BR4A 3UAOA 4MEAA 5GM2A 1EVKA 1CXZA 4R0VA 2GHTA 1MO6A 3P1JA 2VZEA 3HK2A 2VYVD 4EQZA 1KNXA 3G2MA 1II8A 2V9ZA 1IEWA 1PW7A 1X14A 4LZAA 3T9BA 3WIBA 1YS7A 2HPVA 3H5AA 3DWGA 3ELWA 4O4LA 1VLHA 4ZKDA 1RE1A 2F9FA 3Q1KA 4KIGA 5FIUA 1W2HA 4XD7A 3H7AA 2BRUC 1H2FA 2NQ8A 3EXIA 3H5VA 2KX7A 4LBYA 3TNFA 1EE2A 4YROA 2W2PA 1KHTA 2BGKA 1G9SA 1VG1A 2W2LA 4ZYWA 4KQ1A 3DEJA 4PLCA 2IZ6A 3I6BA 3X1YA 3COZA 3FMVA 1XNGA 2XTZA 4FYJA 1MAWA 1V43A 1R6DA 4DUYB 3BMNA 4M55A 3OTQA 5KINB 1KKLA 1NF2A 2UVDA 3TXXA 1LF5A 3KOZA 5CGZA 2X8BA 1H2HA 2E55A 2WM2A 2QNIA 1XDUA 3C16C 4OQLA 4YNBA 1Y8RB 2FSFA 4R2IA 1E6KA 4DN6A 1WHTB 1VPWA 1BXGA 1JHXA 3MINB 3L0SA 4GVLA 2BGGA 1LW6E 1Q1AA 3EGXA 3OJLA 3PJGA 4LGYA 1JXAA 1HQCA 3MBKA 4KQXA 1HT0A 1KO7A 5DBOA 1KAQA 1CUUA 2YWBA 3RU9A 1SK8A 3GRYA 1A5ZA 1L6IA 3DB2A 1QYWA 1VXOA 2F3RA 2RGEA 2NO7A 4PTLA 2JHAA 4RY2A 5I8WA 3DDSA 2IS6A 3K7EA 2YINC 5IUKC 3SYKA 1ISMA 2QVYX 3QY0A 5JNLA 3PICA 1TO6A 3QXGA 1ZD2P 3JD0A 4IIJB 3CUYA 2O8EB 4PLGA 1YS9A 3M89A 5K4AA 4J0HA 1ZK0A 1C7FA 2BUAA 2AT1A 3P9YA 1UBSB 1BEEA 1SHKA 4PONA 3F4BA 3H1BA 4OB6A 1CF2O 5HOQA 1Q1EA 2R79A 2XUQA 3A1SA 1M33A 2XYGA 2GPYA 2WHQA 3EZLA 1U2DA 4A8PA 2HDOA 2NZWA 3GZNB 3JYQA 4RD4A 4ZI7A 4KV9A 4MI9A 1QQ5A 2QVGA 2G9ZA 1E6WA 3ASUA 4JITA 1XGKA 1CDZA 1L4GA 2B1QA 2JS7A 4QAJA 3BF8A 3LD9A 4QNNA 2UUCB 2GVDC 1OV4A 1W93A 2O2ZA 2AC4A 2HF7A 4XIIA 5L7YA 1PZGA 1P6XA 1U8CB 2UVQA 1U3GA 1U1IA 3WHLA 2CHEA 4NCNA 4PSDA 2ZTHA 4YCJA 1WQ1R 5FOUA 4YJGB 4ZD6A 1LLFA 3EIXA 3WGTA 5INTA 4IRXA 1KI9A 2G5GX 2QMOA 2WTXA 4W7IA 3ZE1B 4C6TA 1G8GA 2R3SA 5E95A 1B14A 1U0GA 2FGJA 3FZQA 3P0FA 3QUCA 4CKEA 5I7HA 2A6PA 4ZCLA 4OU4A 1I6MA 3N7TA 3OJFA 5DLPA 3X2EA 1X7HA 3QIVA 4DMRA 1EFKA 4EO4A 3VAZA 1NSYA 2G7ZA 2HCJB 4NULA 4UVHA 3S5JA 1RZVA 2D0DA 1U28C 2CJFA 3NDIA 2CW5A 4EDHA 3A3OA 1G5TA 4URYR 3R9IA 1ZC4A 3H13A 1SCNE 1FFAA 1TTPB 3HDQA 3PGXA 5DYWA 2XR1A 2BPOA 3GDFA 3T35A 3TW8B 2G25A 4R2XA 1SKYE 3PFFA 1YVDA 2BR5A 5AHKA 1WB5A 4G26A 4J43A 3ROEA 3T34A 3JYHA 4DBZA 2V6JA 1E61A 4W8OA 5AM0A 1Y7TA 1Y3FE 1J4AA 3H42B 2XB6A 3OEED 3O4JA 4I1UA 1L7VC 1PR1A 2HRDA 3G82C 4PZ0A 3REQB 3ROXA 1XEFA 4BNMA 2FV8A 4RY8A 1A5SB 3PQEA 2IP4A 4UHEA 3EOAI 2ECFA 3R7WB 1ZHHA 1E69A 5IZ4A 3HMQA 4BCCA 4DIEA 4MLCA 5AW8A 2VRCD 1PT9A 1LJLA 4E11A 1DG3A 1T10A 4Y2YA 3QV2A 5F35A 5BRAA 1KYYA 2OHGA 1C2YA 1ORDA 3B3AA 4AS1A 1QU2A 1SHUX 3WIOA 2VCHA 3ENKA 1DFGA 3DYBA 1TKCA 1YZTA 2Z2ZA 1P61B 4IKEA 5JXGA 3FYCA 4GMDA 3BD7A 4R5HA 3QHAA 3CSDA 4JBHA 3RRXA 3NTLA 1XD2B 3P5SA 3W5UA 2QG4A 4ZI3A 2VO1A 1UOPA 2EDCA 1NBEA 4L27A 2EGHA 3VPFA 3ORRA 4MYSA 3H5LA 4WINA 1G3MA 2VPXA 3TQOA 2AI2A 5ALSA 1AGXA 5IYZB 3AYXB 3VR5H 2VRNA 3UF0A 4XDHA 3PDWA 3TH5A 4G6ZA 7REQB 1UMDA 2QTVB 2X42A 3DMDA 1J9EA 2Q29A 4JVNA 4MDFA 3A0UA 4YO8A 3E8MA 1E5DA 5DTMA 1U2DC 5THQA 1JR6A 4X93A 5DSXA 4GLOA 1YC2A 2ACVA 2W6NA 4XTRA 2YJTD 4E21A 3W6ZA 3SHFA 1PZMA 3QLUC 3GPLA 2FAXA 4C6HA 2WVAA 2X9LA 4GG1A 3IEPA 5EXTA 3OKCA 4WCDA 5JALA 3I5XA 3EBPA 5ECWA 5H4HA 2E9SA 1ZNWA 4PLFA 1A7AA 1GGNA 4HYQA 4MVWA 5D01A 4CL2A 1P2FA 2CVFA 2L18A 2OV2A 2WD9A 3UCFA 4D26A 5JIBA 4YCDA 1JDSA 4UBLA 3SZGA 2CBGA 1TRKA 2ZE6A 2OVFA 1WZUA 2JBWA 3KPUA 1GPMA 3DDUA 4WLUA 2VHYA 2HDNB 4JDPA 4KQ6A 3RK0A 3BMOB 5B1IA 1F5NA 3AUUA 4NPCA 1DFHA 3AI3A 3FHLA 3ILSA 2O7VA 1E18A 2AZTA 1Q1NA 1SUPA 3HBJA 3P9QA 3VFDA 3VJMA 5CEFA 4FVTA 4ENPA 4RK4A 3RROA 1DKPA 4XVQA 4WT7A 3ZBUA 2RI1A 5KYXB 1JG1A 3RJMA 1QAOA 1LLCA 4IQ0A 3RSQA 3I6YA 4R1QA 2MU1A 5KSOA 1ZI9A 4JBYA 1TTHA 2V7VA 4ISBA 2C82A 4AS2A 4FS8A 3PQ8A 4L07A 4MYDA 5C2JB 2OCYC 4X62B 2IYTA 1UP7A 4LK3A 1RACA 2EARA 4AMGA 4BJ5A 4J2TA 4M98A 2L69A 3W2GA 2OGUA 3UC9A 3WIDA 1RLMA 3VISA 4QU8A 4M9CA 1YCDA 4PG7A 4Q7LA 2HQOA 1N5IA 3PWKA 1E3WA 3A6FA 3C7CB 2QD5A 4P5PA 4TXMA 1WCYA 5C5DA 2JD0A 2PHZA 3W2EA 3TINA 1ZXXA 2O2SA 1Z4OA 4DLAA 3PFCA 5ALXA 4B45A 4AY3A 4ZJYA 3BXHA 4C0XA 4ANFA 5I9IA 3UHJA 3NAGA 4B8WA 4Z7JA 1DBWA 3O5AA 4R8RA 1VKNA 1A69A 5GAJA 1DU4A 5D87A 4ZU1X 2Z2YA 4IDGA 1P62B 3QWAA 1QX4A 3AVVA 3IR6A 5BSUA 2YHAA 3IRUA 4RJIA 5L8VA 3T1HB 1A98A 1BD3A 2Y9PB 4FSDA 2IYUA 4RJ2A 5HGJA 1NIPA 2JA1A 1T8YA 4M22A 5TS3A 1RHRA 1XL0A 4H6VA 1ACLA 3ICWA 4O59O 1I7LA 3PFGA 1CUAA 1T5OA 3TECE 2X1VA 4CMAA 1G8SA 4P31A 5LOVA 5LU9A 2I66A 2WNHA 4DZZA 5EIFA 1U6JA 2QUHA 5CB4F 4XGNA 2GKGA 3OZWA 3WNQA 1QGED 3P19A 3B6JA 3AEUA 1Y9AA 3O4VA 4BFUA 1ZM2A 4TOIA 2WFMA 4PBRA 5JSUA 1XPJA 4AJ1A 4N5IX 1OCEA 5JNRA 4YMVA 1R7RA 4LVOA 4WBXC 5EJ5A 5HCIA 3SQMA 2ZSUA 1WU7A 4H1UA 3LC2O 5E6UB 2GT1A 3B5EA 5KJ6A 1VM6A 1DAGA 3RLIA 1H2AS 4Z1MD 1IHOA 3GGGA 1TIBA 3TLGB 4U0KA 3PDIB 2BSQA 2V7PA 4QOEA 5TE9A 2H6EA 1N7IA 3BREA 1CDOA 3H5NA 3V97A 2RGYA 1Z06A 1FQKA 1ZOSA 2YC2C 3T3DA 2HV8A 1O5TA 2PZKA 3G5MA 3VKGA 1Q0ZA 1BN7A 2A67A 2ACWA 4HVCA 1IVYA 1TVEA 2EOAA 3TUZC 1E1CB 2JGDA 2GXSA 1YGYA 2OM2A 4IJ6A 4RD1A 5CCXA 2GXAA 3DF9A 2F6RA 1UKBA 5J3JA 2QRUA 4PIVA 5M3BA 2FA9A 2NT4A 2PQ0A 3GJ8A 4K8OA 3SEFA 4YFYA 1GZVA 1J2EA 4HRAA 2I0FA 4MVJE 4N03A 2AQHA 2FW7A 2XMQA 2R97A 4NONA 5JD6A 2I6QA 2ZIAA 4IMPA 1HOXA 1D09A 1TK3A 2IE8A 4HLCA 4IXTA 4ER6A 2IYQA 1QCCA 3D7KA 2JANA 3FUTA 4PG4A 1E8NA 1MH9A 2CY0A 2YDYA 4MUIA 5KC9A 4BAGA 3VKUA 1KJIA 2VUHB 1KAOA 4WN3A 1Z0SA 2VZ8A 4Q1VA 3WY9A 3FYTA 1YOVA 1VL6A 4IJKA 4RGBA 1CVRA 4R2WA 1ILWA 2WNIA 4CQJA 1HWYA 3RS9A 2MJLA 4LYYA 3IBTA 3STVA 3EDRA 4XSVA 1N2IA 1WR8A 2PLRA 2LKDA 4Q15A 2B35A 3TCXB 3TQHA 3UJ7A 1Z4PX 1JFRA 2PUHA 3LL7A 4MQUA 5AHOA 2D1FA 1PDWA 1VA4A 1P0QA 5L3ZA 4LNAA 3NM5A 4ZI2A 3VR0A 2W00A 1LI5A 4UUPA 1CG6A 1E4OA 2POCA 4NX2A 4WD3A 3T4UA 3TOCA 4JYZA 3EARA 1T36B 4KFCA 4KP7A 3TNYA 3L07A 4CT4B 2Q3BA 3EQZA 1L7OA 3T4PA 4FGLA 4CQMB 1SNYA 3L1HA 3WL6A 4DZRA 3RR2A 3PX7A 3UEOA 3QXHA 2QPOA 1GPYA 3NAQA 1ZD3A 2E4YA 5E6SB 4U63A 3UG6A 4AWAA 1ESMA 5A03A 5JZBA 4IHQA 5MFZA 3ORQA 5FO0A 3CRVA 3SS8A 4KTTE 4C0WA 5CYFA 1ACMA 1XRJA 1FFYA 4GZLA 4TWBA 3ZHQA 3MWLA 1L4KA 1AHHA 5HIKA 5DISB 2H1OA 3GLGA 1FS4A 3K0AA 3ESBA 4NMXB 2P2LA 4INAA 4H7PA 4NZMA 5B1YA 3CU5A 3G6KA 2B3TA 3HKEB 4DTIA 3I45A 3EGIA 3PQDA 4C3VA 1VIAA 2AF3C 2DTDA 5F7JA 2QR2A 4HWTA 5LUAA 4TRJA 1W36B 1DAEA 2C4HA 2QUAA 2UVPB 1DBPA 4IFTA 5E7MA 4BO7A 3E84A 1YRYE 2W9XA 3EWAA 4JU9A 1FBNA 3G7NA 4RFLA 3F97A 4QGHA 4B3DA 3CN9A 1TB4A 2QX4A 4QQKA 1Z12A 4CEJA 1EX7A 4ESVA 2ODAA 2JJMA 2PA3A 2JF0A 3VRHA 5JH7A 1JTEA 2A88A 4K9MA 1S8NA 4OI0A 1N5RA 2OFPA 3V42A 2CXUA 2RC5A 2Y93A 3GVHA 3HHEA 3LPMA 3D6AA 3Q72A 4KLRA 4BU0A 1SA0B 3MFQA 2DBQA 4K0KB 1WXEA 1SIUA 1Y6JA 2QMZA 3CPHA 2IY7A 4FDMA 4R8SA 1XEXB 1RZRA 2EJWA 3JPYA 2QN1A 3PIIA 4C29A 3RYFA 2VHWA 2BFNA 4S1NA 1G8HA 1IN6A 5HCNA 5IZCC 5JJLA 1ZIYA 1VE1A 3OM0A 2ZRDA 3N2LA 4X1IA 2VT2A 4QQ8A 3B9RA 1EX6A 1NURA 4OK6A 4JKYA 3S2UA 3ZXIA 3QVTA 3AVUA 4CT0A 2I1VB 2PX6A 1M8FA 4BAUA 3A70A 1K9SA 4ALLA 2IV3A 1D6MA 1QJ4A 1L3CA 2WSIA 5ES4B 3TE6A 1AHPA 4I7EA 1ZKDA 1GY8A 5JYEA 4UUQA 5KCZA 5FLKA 2YXDA 5H68A 5B1EA 5DGDA 4OOFA 4F1KA 1CJKC 1IQRA 5KYVA 1U99A 3V2UA 1VLQA 3D2AA 3M6VA 1ULZA 3PGA1 4MK4A 2HO4A 5FI3A 4UNRA 4EZEA 4KKVA 2IBTA 1D2CA 4ZPXA 4K9NA 2F43A 1ZI8A 4H17A 3NIDB 3VSCA 2CBZA 1PR0A 3QTLA 3V8MA 3V1MA 4RIHA 3KSRA 5UKDA 1LBQA 1JA1A 2B94A 3QFHA 1K6JA 2Q2OA 3K2BA 5JSHA 1J2TA 2IOYA 3ROGA 1WZ2A 2BZ0A 5H9VA 1XCPA 3F46A 5B12A 1Z16A 3LZ6A 3LIPA 1WWKA 4QFCA 4TSFA 2YY7A 2XWQA 4UM7A 1AHIA 1B93A 2R8BA 2AN5A 3JQ8A 1QNFA 4JI2B 3QEJA 1JJVA 4LVUA 3LG2A 3O92A 5AKKA 2JLWA 1JQ5A 4NJMB 3VO2A 3PNOA 1R8XA 2FZKA 1Y1SA 3PDHA 1TM3E 4KX3A 3DP9A 5KCMA 1FCJA 5E0OA 3BUSA 4KUGA 2H0RA 3MWKA 5IT0A 2VTBA 2FJ0A 3AINA 3PUHA 1JHDA 2BZ1A 3M6WA 3V2IA 1KC1A 2RH9B 3OPYI 2PY6A 4DCPA 3LYAA 5E1OA 4O3MA 5DRYA 2PSHA 4RX1A 1CX9B 3WB1A 1P91A 2PAAA 4OJMX 3UAGA 5A9SA 2HMUA 3R9XA 1U65A 2ATEA 1EVYA 2IIVA 4J91A 4QELA 3L4SO 5B58C 2PNFA 3NAMA 4YHHB 4OP1A 4BV8A 3B82A 4BNVA 2VSXA 4G3XA 5IP5A 3W79A 3NBUA 2CMHA 2QTHA 3BJMA 3G5AA 1AUQA 1X6VA 2BLLA 3C3CA 1BKSB 1YR7A 1GG5A 1OGYA 1U3WA 4UAJA 4OYYA 1JAHA 4M8SA 4D4LA 4F7WA 2O0HA 1N92A 2NUPB 4J29A 3H97A 1JS1X 2J6CA 3ANTA 4O2BB 5KS2A 4K9QA 4Q3OA 4YMWA 5JY1A 5LQJA 2C9ZA 4G0PA 4R2LA 1FVXA 1FMTA 1YFKA 4OJNA 1C1XB 2N0SA 1Y8QA 2NXJA 1DJPA 2O7SA 2QI9F 4LCEA 4D44A 1XRMA 2R1TA 2QX8A 2NVWA 3QVLA 1SHJA 3IJ5A 1NGSA 4MMXB 4PFJA 2JFBA 3A26A 1Y5RA 4X84A 5CT8A 4KXXA 3V9AA 1LSJA 1K6IA 1W0JD 3O3MB 5ERXA 3WRWA 3BA6A 4QGBA 1G16A 1XFAA 2F3UA 1GZ6A 2H2AA 1ETUA 3E3OA 3ZK8A 4E30A 3GA5A 4JP3A 1OIVA 5A3RA 3VTAA 3O91A 5JADA 4RU1A 3C8MA 5E38A 4DNOA 2XT6A 1ZHOA 3CGGA 4Y6QA 3FIJA 4KGVA 2ZGVA 2Q45A 2WDZA 2N42A 4YMIA 4Q9IA 3V6LA 4OQXA 4AZ0A 5DI3B 4DF3A 1K27A 5G0WA 3OTOB 1QKKA 3AX6A 3W3AD 2IEIA 4HUJA 3DHVA 3PEYA 2ZBUA 2IHVA 3CXRA 16PKA 5EPEA 2R86A 3ND7A 2R4QA 3NHFA 4FQ8A 4W1PA 2WTMA 2P1DA 4HT3B 1GYPA 5AK4A 3ESCA 1QTIA 1L7PA 4G1EB 3Q88A 3J7TA 2GVZC 1Z25A 1YU9A 4BO1A 3I01M 4BYMA 2PKYX 1KDRA 5K3OA 2JATA 3AHJA 2FN3A 521PA 1Z6TA 3JWIA 3E9ZA 1UPXA 1DEXA 3CIOA 3M81A 2LXNA 1OLSA 1U3DA 2J5BA 3FI0A 4P4SA 4ZQFA 4HBGA 4RTPA 3IOCA 1NXSA 4PVDA 2B20A 2V5VA 3F4LA 3IUSA 3LUJA 3WGLA 1OH5A 3O83A 4AECA 4N48A 2WSYB 3ND5A 3QPAA 3RG2A 2YDXA 2AD5A 2H1FA 4IXDA 4KZPA 2PZMA 1KEZA 1S02A 4P4LA 1T9KA 1C9YA 1MJHA 1JEOA 4IVRA 1IM5A 3Q7PA 4D9GA 4UTNA 3O0TA 4JBLA 2JIOA 1Z8NA 2TRSB 3ZY6A 1UDXA 3PJRA 5ISMA 3P2JA 5DKFA 3WV5A 3S3TA 2LVBA 4R3UC 1R6VA 1T13A 2H9AA 2ODBA 5LQCA 4EZBA 1Z8FA 5HOEA 2QTFA 5LD2C 1NQOA 2AWNA 2MSNA 3T4XA 2ROQA 2MYPA 1YH3A 4ZQGA 3SU8A 3QEKA 3TBHA 721PA 3BRWD 1IH8A 1JXMA 3GJ0A 4B7AA 1HO3A 3NI2A 3T7SA 3ZI4A 3RFTA 4BV9A 1CEQA 1CJCA 3EF1A