3LPCA

Crystal structure of a subtilisin-like protease
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
340
structure length
340
Chain Sequence
b'APNDQHYREQWHYFDRYGVKADKVWDMGFTGQNVVVAVVDTGILHHRDLNANVLPGYDFISNSQISLDGDGRDADPFDEGDWFDNWACGGRPDPRKERSDSSWHGSHVAGTIAAVTNNRIGVAGVAYGAKVVPVRALGRCGGYDSDISDGLYWAAGGRIAGIPENRNPAKVINMSLGSDGQCSYNAQTMIDRATRLGALVVVAAGNENQNASNTWPTSCNNVLSVGATTSRGIRASFSNYGVDVDLAAPGQDILSTVDSGTRRPVSDAYSFMAGTSMATPHVSGVAALVISAANSVNKNLTPAELKDVLVSTTSPFNGRLDRALGSGIVDAEAAVNSVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AprB2
publication title The Subtilisin-Like Protease AprV2 Is Required for Virulence and Uses a Novel Disulphide-Tethered Exosite to Bind Substrates
pubmed doi rcsb
source organism Dichelobacter nodosus
molecule tags Hydrolase
total genus 122
structure length 340
sequence length 340
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3lpcA00
1Y3DE 4GI3A 1NLUA 1C3LA 2G4VA 1S02A 2W2MA 1R0RE 3CO0S 3D9QX 5JXJA 1Y3BE 2WWTA 5FBZA 3A3PA 1SUCA 1BH6A 1Y3FE 1DBIA 3WIUA 2WUVA 1AH2A 1Y4AE 3ZXYA 3DE4X 1V6CA 3WQBA 1WMFA 3F7MA 4K8RB 4MZDA 1ST2A 4NMXB 1SUAA 2ST1A 1SBIA 1YU6A 2V8BA 3DW1X 2ZWPA 5AVKA 3DYBA 3LPAA 1GT91 1TM5E 3LPDA 3OSZA 1PEKE 1THMA 2PRKA 2Z56A 3VTAA 4OMCA 2DUJA 4OV6B 1GA1A 1TM4E 2TECE 4CFZA 5I9SA 2E1PA 3L1KA 2SBTA 2Z2ZA 4M1ZA 3Q5GA 2Z2YA 1WVMA 2Z58A 1BE8A 1SUDA 4WOBA 4ZARA 1KDVA 1AVTA 1SCJA 4YN3A 1TMGE 4C3VA 4KPGA 3EIFA 1GTL1 1BFUA 3DE2X 4C3UA 3DE3X 2DP4E 2DQKA 3F49S 3F7OA 3DVSX 3DW3X 2HD4A 5FAXA 1A2QA 1GTJ1 3GT3A 5AVJA 1OYOA 1SBTA 1YJCA 2X8JB 4LVNA 3GT4A 2SECE 4ZOQI 4OMDA 4FONA 2IXTA 4H6VA 1IC6A 1AF4A 1SCDA 1SH7A 3BX1A 2PKCA 1R64A 3WHIA 4Z2AA 2SNIE 1TK2A 1HT3A 1Y4DE 1KDZA 5ARBA 1T1EA 3GCXA 1ZVKA 5K7SA 2P4EA 3DVRX 1JEAA 1P7WA 3EDYA 1UBNA 1XF1A 3VYVA 1GCIA 1NDUA 4JP8A 1PJ8A 1R6VA 1Y3CE 1YJAA 1SBHA 1SCBA 2QTWB 3AJ9A 2W2PA 3BPSA 1AK9A 3ZXXA 1T1IA 2HPZA 1SVNA 1SN7A 5ARDA 5JXIA 4BWGA 1SBNE 1TECE 4KG7A 3I2YX 1GNVA 1Y33E 1SIOA 1PTKA 2PQ2A 1TM3E 1WSDA 1Y34E 1CSEE 3VSBA 4DWWA 3SQOA 1AV7A 1YJBA 1MPTA 5B1DA 4NE9A 5JXHA 2IY9A 1TM7E 3PTLA 4WOCA 2W2QA 1P8JA 1V5IA 1TO2E 3A3NA 3DE5X 3DDZX 3TI7A 3DVQX 2ZRQA 3DE1X 3Q40A 2Z57A 2PMWB 5B1EA 2XTJA 3P5BA 3LXUX 2ZWOA 5SICE 3VHQA 1SUPA 5ARCA 1SELA 1BE6A 1KDYA 1SUBA 2ID8A 2WUWE 2Z2XA 1OYVA 1SCAA 1SIBE 4KB5A 3EE6A 4CFYA 1S01A 4LVOA 2W2NA 2B6NA 3SICE 3DWEX 1PFGA 3H42B 3CNQS 1EGQA 3LPCA 1GNSA 1WMEA 3DE7X 3PRKE 1KE2A 1C9JA 2SICE 1CNMA 1BJRE 3QMPA 1ZVJA 3I37X 3WIVA 3DE0X 2WV7A 1ST3A 4HX2A 4CG0A 5JXGA 3BGOS 3I34X 2PWBA 4H6WA 1IAVA 3DE6X 4H6XA 1EA7A 1T1GA 1SCNE 4HVLA 1SPBS 2XRMA 1KE1A 5CW1A 1Y48E 2Z30A 5FFNA 3T41A 5JMOA 3HJRA 1AU9A 4AKSA 1LW6E 1GA6A 3VV2A 1C9NA 3D43A 3QTLA 3UNXA 4B5LA 4NE7A 4RYDA 1C9MA 1OT5A 1BFKA 1VSBA 1SIUA 3A3OA 5AMXA 3AFGA 1SUEA 1Y9ZA 1NDQA 2ID4A 1GTG1 1DUIA 3QFHA 4DZTA 3TI9A 4DJ5X 1TO1E 2W2OA 2X8JA 1SBCA 1WMDA 4J94A 2GKOA 1TM1E 1Y1KE 5AQEA 3TECE 3VV3A 1MEEA 3GCWA 1P7VA 2PWAA 1AQNA 1S2NA 3I30X 1Q5PA 4AKTA 2PYZA 1GA4A 4I0WB 3AJ8A
chains in the Genus database with same CATH superfamily
2WVGA 5AVXA 1XHLA 2Q9AA 2BZ1A 1Y3DE 4JJIA 4IJKA 3L0IB 4OD0A 4RZ3A 5EYPA 2O1SA 3WV4A 1MXFA 1T0PA 3I01A 2O2ZA 1OA0A 2DM6A 2G4VA 3I9FA 3NKFA 4K9MA 4TVBA 4PY2A 3VU1A 1NQVA 2JCVA 1Z36A 1KDPA 4G1UC 4FIZA 1WULS 5ADHA 1P1JA 4ZN6A 2EV9A 3BAFA 2QZ9A 2JAQA 3ONDA 4TQUS 4LF5B 1G0NA 5JT1A 1G8YA 3H3XA 3BWYA 3V42A 2MR6A 2VCHA 3SQNA 2VZEA 5AXBA 3GEPA 5TDHA 4J76A 5KOYA 1BH6A 5CYOA 1YR2A 3SJAA 5EPUA 2DR3A 2GYYA 2FETA 1T8YA 1KPHA 1Z2DA 1GP2A 4MMXB 2EEZA 3ZN2A 4E31A 4C05A 2IH4A 3FVRA 1U28A 2D0IA 3D6FA 3QKSA 2OILA 5CVVA 1G3RA 1SXQA 1V6CA 2IIBA 1XEFA 1TQ6A 4I50A 3ZWNA 2XDQA 3MYRA 1Z0UA 1CU1A 2OV3A 2XXAA 2G07A 3O2NA 4D92A 2WFLB 3L0OA 4KQ9A 4V0NA 2C9DA 2I55A 3TF5A 2XODA 4BO8A 1NMSA 1MJGA 1E2FA 1L4MA 3HADA 3PUWA 4JLDA 4AK9A 4Y30A 1XCJA 4WBNB 4B3RB 3VYTB 3LX6A 4TQAA 4YJ3F 3CVUA 1GPJA 2IYNA 3C16C 4FZ5A 1GZ7A 3SSOA 5BQXA 4CI9A 1NVDA 4W5WA 4GLOA 2FEOA 5HZKA 1D09A 4HEHA 4P38A 3QVXA 3AT1A 1W1UA 3GC6A 4TQ9A 1YU9A 1XWFA 2OXCA 3U7HB 5JCPA 1T5BA 4GLJA 4MVJP 4XQEA 1VJTA 2W6IA 4FGUA 2VVTA 2VYQA 3ON5A 3CH4B 5AK5A 3R0XA 1D2EA 2O23A 3HO8A 4UVIA 4GMDA 4ZGBA 1J22A 2LVBA 2RJOA 2WWIA 1QF9A 1DVRA 2G7MC 3FJOA 3OJCA 4N8SA 3KK0A 2O52A 4MUGA 3KQUA 3RFXA 3CZPA 5HIMA 1OY1A 3DHNA 3HGTA 1XXHA 1OLUA 5L4SA 1AGRA 1P4JA 1CUFA 1CR1A 1KFKB 4KE6A 1RQXA 3MJVA 1G60A 1NJSA 2PANA 1XK7A 2SBTA 3CUEF 3ESRA 1C3OA 1OAOA 3HYRA 1HYBA 2VK2A 3DV9A 1TUBA 2O07A 2CLDX 2C84A 3ESXA 4NONA 1RABA 1X15A 1ATZA 1XN1A 1OGJA 2DBVO 1PG2A 1Q1BA 3FWHA 4KVZA 4R31A 2OBYA 4DLKA 4BB6A 3UMRA 1UAAA 3FWKA 3B52X 3DFZA 2WZQA 2ECOA 2ISCA 3RT7A 3UIEA 5CDGA 4OAPA 3ZDCA 1Y6ZA 4QOEA 4CEHA 2ZBRA 3IHWA 2QX9A 3GAZA 4BVBA 2PNFA 3IJEB 3EA5A 3PGKA 2PIAA 3C6KA 3OUTA 3QLEA 2NSHA 3EXHC 4RMNA 5ALNA 3F6EX 1SCJA 1J23A 3MIZA 4R69A 1R18A 3OE7D 3TZQA 2P0YA 4GH5A 2ATXA 4ZU6X 2EIXA 4TKZA 4LJ9A 3ZE1B 2WWGA 2FUKA 3BE4A 3E58A 2A78A 3GIDA 4D3XA 1JE0A 5CXUA 1E9CA 3S2YA 1XF9A 2YICA 2GZ3A 2HMAA 2IYTA 4F2PA 3DEFA 3TSOA 4HWSA 5C9ZA 2ZWAA 3W0LB 5KHLB 1OH6A 3RU9A 1OZ0A 3QLJA 4LBYA 1H9AA 2WHYA 1K7YA 5BVHA 1GKIA 3KBBA 3BDVA 4ZHQB 1EEXB 2H1VA 4D5EA 4B32A 4NYJQ 5FXMA 2H4WA 3TL3A 1VG1A 1J2EA 3AEUA 1Y80A 4HGRA 4INZA 4UMFA 5TQVA 1JHRA 2ACKA 1Z6GA 3W4KA 2DP4E 2GA8A 2EJBA 4AQYB 4FEAA 2IV3A 2FN4A 5DYNA 2AUMA 3H7AA 1M1UA 4OPMA 4PX9A 1ZIXA 5JROA 1P0IA 1R3UA 1E3WB 1R00A 3Q9SA 3UH0A 2Z5VA 4ZO8A 1OBFO 4C4TA 3VR6D 3JD4A 4C0WA 3HSYA 4LHSA 5PGMA 3V33A 4DLTA 3O3CA 4YRLA 1EFVB 3DOUA 4TX1A 1V2GA 1HEIA 1U5AA 4QFDA 4UBMA 3HCWA 2QD3A 1OYOA 3NQ41 2H7VA 2AYYA 4NV1A 2WM2A 4PQRA 1QGUB 3A6DA 3WNDA 1LJUA 1Z83A 4JBIA 1OASA 1VTKA 5CNKA 5ALUA 4C76A 1Z4IA 3OJFA 2ZTLA 2J9GA 3ZLVA 4DHWA 1DFGA 1QCCA 2XMSA 5DEIA 3RSSA 3KLBA 1T5SA 1H1LB 2VYND 3IVGA 4EYKA 1LEHA 4HMQA 4KQ1A 5GV8A 1SUWA 4TTAA 1R4NB 2JI7A 3WYAA 4OMDA 5LWQA 3CVWA 4FSXA 3CGWA 3A4YA 1LPPA 4Q5IA 4CCWA 1V71A 1SH7A 4JUCA 4HDCA 4B79A 1TU3A 4K28A 3N7TA 4ZDWA 2FB9A 3F6CA 4Q9HA 4DFDA 4Z2AA 1NW5A 2AEMA 3Q9LA 1HT3A 3VKWA 2JZCA 3KR2A 1VECA 2C0CA 2OQVA 1YE5A 2W9XA 4D4IA 3G68A 3HEAA 3U7EB 1VRCA 4FIDA 3N8IA 2ZRGA 4Q9AA 4N49A 4RF2A 3LQ2A 1OE0A 3RVPA 8LDHA 1FMTA 3Q6NA 3NBKA 3PNBA 4RJLA 3ZCPA 4EZBA 4KHPB 2I1LA 4NESA 4FNMA 2FP4B 3SG0A 4Z7NB 4QAJA 1CY7A 2WUDA 2XUFA 4IM7A 4J7UA 1M74A 3E3OA 5T5QA 3K73O 2OHOA 1E2JA 5CCEA 3IEKA 1X1BA 1YS9A 2PCJA 3EGOA 3MWEB 4HN9A 4TLAA 4UCQA 5IAGA 1CRLA 3ACDA 3PWTA 4LYJA 4RSRA 1G5HA 1JW9B 3PC4A 5GGYA 4CLHA 4EVSA 4GL2A 2NAFA 4MPTA 3F9IA 3OZAA 4IH4A 2VH2A 2W48A 3JAWA 4FDLA 4IIYA 1X9HA 3TLMA 2FPWA 2JBWA 3ZXXA 5I7HA 4W9MC 2XB9A 3ELUA 3GMDA 3PV0A 5BMVA 5JUWA 2UXCB 3MCWA 3U4MA 3KLPX 2R4QA 4FFDA 4C9BA 2WIFA 3IT1A 1WXQA 2XIJA 2OOSA 4UZSA 1WM1A 2IUEA 2WBLC 4UQLA 2G6BA 4R40A 5F2KA 1H2WA 3CW2A 3OC6A 4BKPA 2DHDA 3H9CA 5LQCA 2WWHA 2AIRA 1E9AA 3CUVA 2A1TR 3NHAA 3OKCA 4LUCA 1PQ4A 4MS4B 2GT1A 4ZDJA 2A5YB 1QG2A 4MKIA 1YBAA 1KYWA 5IDXA 2P62A 5HKAA 2TYSB 3A25A 4JR0A 4AM8A 1ACMA 1RJEA 2PQ2A 2RHCA 4WZBE 2KI5A 1I24A 3R3UA 4KYUA 2C00A 3AF6A 3P9SA 3VSBA 2XR1A 1OKKD 4ZT3A 1CHNA 4YPFA 3TTUA 3V2UA 4NICA 1Y9EA 3OIGA 4GWKA 4ESVA 1BW9B 3QMVA 4DMCA 2ZJOA 4BJ5A 2MSCB 1G20B 1KOJA 2YZGA 1MABB 2UZ1A 3A6EA 4KQ2A 1FU4A 4FHEA 3MINB 1GPAA 1UBOS 1YF3A 2GBLC 2XUGA 3EZ2A 4ERXA 3LVRE 3BHIA 1Q3KA 4ZA2A 4RQAA 2Q5LA 2PUEA 4IILA 3K70B 1WZ2A 5REQB 3EUAA 4BO3A 5CXXA 1YJ8A 5K05A 5D7BA 2Q2WA 2CHQA 4YWJA 2IFTA 2W58A 1LVUA 1TX4B 1Z7YA 1RXWA 3QEKA 3G82C 1ZR4A 3H17A 4RFLA 4X24A 2WK1A 3K5PA 2PLWA 2OYSA 5BYBA 4EX7A 1Y1RA 1KFEB 5FBWB 1GFWA 3H18A 3SHTA 4PBSA 3TNLA 3ADKA 1MO6A 4BYMA 3LVQE 2AC4A 3HDQA 3A28A 1NXXA 1GVNB 4XVCA 2OFPA 3F5DA 3C1TA 3L7NA 2IT1A 4BVJA 1JVNA 3RLFA 4BMCA 3HWX1 4Y2UA 2GKGA 3MMSA 1YVDA 1XK6A 1CY6A 3IUYA 3COVA 1P4RA 4PSKA 5DFAA 3SY8A 1KKUA 2QMQA 2WHEA 4EM6A 2CDCA 1V2HE 3SMQA 4FEEA 1UWCA 3OE7A 4MLPA 4OK5A 5EZYF 2JK1A 3GLSA 1XT6A 1ZRMA 2WD9A 4JL6A 5G40A 4N6NA 1SO8A 1IQRA 1IYZA 3S27A 3FX2A 3PHLA 1JHYA 2P2CA 5AW9A 1Y7HA 1KNXA 1UKAA 2Y3IA 5HTOA 4XIYA 2YY7A 1SIBE 2HRZA 3RIGA 5LWHA 3EGXB 2CF5A 1SPXA 4MHSA 1TF2A 5CPBA 4N5DA 1E9VA 1QHNA 4DXAA 5JAHA 3ZWWA 3JQAD 3R3WA 3STHA 2ZSUA 3BMNB 2B6NA 3I6QA 2X77A 3VKFA 1LPOA 1Q15A 3K8QA 2ZAOA 5ICSA 2PBLA 4F3CA 3IP6A 4TYWA 1WHSB 3N2KA 3B6ZA 3OQ6A 4MROA 1EGQA 3E7DA 5MGNA 3V3KA 3LECA 3BEDA 4LYEA 5TARA 4AJKA 5JARA 2OTCA 5FUYA 3FWNA 4EKNB 3T5CA 2P69A 1ZLXA 1RYHA 2VAWA 1KJ9A 4YQFA 4WKOA 2R1TA 5KJFA 4O0LA 2P9EA 5HEKA 5IMSA 2J3JA 1L1QA 3VR6A 1C80A 3W6ZA 2D00A 2COUA 4AKHA 3JQ7A 1C7EA 2BUAA 1XMIA 2VDRB 1E6WA 4YXWD 3AGQA 1SG9A 4M0UA 2GPWA 3RSFA 1ST3A 3L8MA 2WLSA 4TVKA 3TLGB 4CG0A 2ZTHA 1CDEA 4HTFA 4KQGA 4JLUA 1PT5A 2UXBB 1SBQA 2EKBA 3DE6X 5DGIA 3HM2A 1QOZA 2OECA 2YC2C 3ROQA 4ZHSA 1OAAA 5C5EA 4PR0A 3BTVA 1WQ3A 1YR1A 2VH1A 2JKVA 3ASVA 3SYRA 5K3CA 1L7NA 4E2FA 3PE4A 1ADJA 1XYVA 3LRTA 3DOEA 3EUWA 3IP3A 3KEMA 3GXOA 2ZPUA 1OX4B 2JEZA 4EARA 2Z30A 5EWMA 2RG7A 5BNZA 3K70C 2IIVA 1U8CB 1FRVA 1UK7A 2LV8A 13PKA 4R1UA 3TL2A 2HZ7A 3VAZA 3J81k 5FWXA 3QX3A 4EW1A 5B2FA 2XWPA 2B78A 3D43A 4YBZA 5A4AA 1KMIY 4F06A 2EXXA 5FBHA 4QYTA 2N47A 3N8DA 3DMPA 2V65A 1NFFA 3IQWA 4EUNA 4HEA6 2QXUA 2KM1A 2X0KA 4IZOA 5EN4A 1BDIA 2Z9DA 3SC2B 1VL2A 4MYTA 1BHQ1 3I1IA 4X00A 4F5EA 1COZA 2H5LA 2AB0A 1TYEB 4BX2A 4ER3A 1GZHB 3HO1A 4EKIA 5G0UA 3S44A 3IQXA 1G2OA 2YWCA 3MB5A 2MSDB 1H3FA 1MOQA 1UAYA 1AOXA 1SU8A 2I3GA 1Y9ZA 3LXXA 3PFWO 2GCPA 4R8SA 3DMDA 1PZNA 3WLJA 5JVDA 1NR1A 1TA4A 3EH2A 4FHFA 4PWYA 1JUDA 3GJRA 4UUPA 3C6XA 5KNCD 2HCBA 4I9UA 1XZHA 1SBCA 1D1QA 1YL7A 4PXAA 3EGEA 1FYWA 3R0QA 4BP3A 2WKRA 1ZNZA 5AIBA 1HL7A 2R00A 3LK7A 3NHLA 2PXCA 3RS3A 4EVRA 3TM4A 1EP9A 1DMRA 1EK2A 1T2EA 1A2KC 4Q4JA 4RLSA 1SURA 2BRUA 4FQ5A 4DV4B 4MUMA 4B47A 2EFHB 3CVXA 3TKYA 3B20A 2P3SA 4K26A 4LRUA 2H4HA 2PFSA 3G0CA 1PS8A 5CNMA 2JLUA 1N1DA 5I7FA 1TRHA 5JH7A 1HNXB 3W5IA 2GCOB 2Z4RA 3H11A 3DHYA 2YZ7A 1W44A 4BU1A 4WZAE 5CTJA 3EARA 2ZJYA 1GXSA 2VHCA 3VV3A 4DR5B 3R5SA 1SQGA 5P8WA 5K0ZA 1HE3A 1ZL0A 4OHXA 3ZJTA 2QOEA 5IHPA 2GFIA 1S6YA 4S1TA 3E22A 4IO1A 1GAXA 3AEZA 5BPFA 4N5HX 1QBGA 3AR8A 1Q5PA 1OKKA 2O8FA 4WAUA 1EAMA 1VGVA 2V7XA 4NBNA 2O4UX 3ECSA 3UJCA 1GGJA 4YY3B 3NNNA 4EUEA 3A6PC 2IS6A 3TZ6A 1CB7A 3I2FA 3NFRA 1P29A 3OURA 5KYGA 3QP9A 4P5DA 3BHMA 1OI7A 4I0WB 3ZX5A 1KMQA 3ER9A 2JVIA 2Y05A 3AHHA 1RMQA 4WBXC 5TJHA 1KDOA 2UAGA 5EP1A 1X7XA 2HYDA 4EQ6B 1K7SN 1HURA 3SS8A 1Z6QA 4C0XA 1JSXA 3RBVA 4AZ0A 3R8XA 1NLUA 3FZYA 5KQPA 1F9EA 1T4BA 3IMEA 3BMCB 3ZEAA 5FF9A 4WK2B 4AG5A 1QX4A 4CKEB 1GQOA 3SQMA 2FMXA 2AG5A 2J6HA 2OCAA 3DMFA 3PVSA 2X2PA 5IW8A 1JQJC 3ZNQA 3ZY3A 1TZJA 3O9ZA 2QR3A 2RKBA 4LCBA 5JNLA 3UTCA 3KQWA 1RFLA 4GEGA 2F3QA 4Y1RB 4IDGA 1RRCA 2PG3A 3A3PA 2XD9A 1R9JA 5JG7A 3EPKA 1NQXA 2NX2A 4YRIA 2HBRA 4FE4A 2EW2A 2VPXA 3S2UA 1AH2A 1RWKA 4UHKA 2ENUA 2JGDA 2W5UA 3CUWA 1C30A 3L7CA 2AEEA 2JA2A 3DF7A 1WPGA 3GLGA 5E3IA 4GT1A 3TGWA 3RDPA 2BFMA 3AHDA 2GTHA 3IBCA 3LI2A 4FFSA 1NTRA 2GASA 2QY6A 3BUSA 5G3YA 3WMEA 4ZI7F 2G88A 3FIJA 5ED4A 4DDKA 4DJDC 1YBFA 2HWXA 3EAQA 4AZTA 3LCRA 1GKKA 1NX6A 5AOAA 1ORRA 2GWHA 4JYMA 1V0JA 4EFMA 3GUZA 2K2WA 2F8MA 2QYHA 3DNFA 4J1SA 5B3AA 4QFBA 3ORRA 2GN0A 3JQAA 4U39A 5GZ6A 2IA5A 1CDDA 4N01A 2O8EB 1X9GA 5I47A 1RRMA 3G2LA 1AZWA 2V8BA 3EZGA 4ACAA 2O2HA 2C4KA 5CA0B 1AKUA 2RG1A 4IHJA 1YE8A 3KQLA 1D4FA 1ZU5A 4KVFA 4QO7A 4Z53A 4EGAA 2ONJA 4P0QB 1K63A 3W2TA 2V96A 4R2MA 3SZLA 1GRNA 3JARA 3LPAA 1N3LA 1C0EA 3K92A 1J49A 4HRYA 3H1BA 2Q7XA 3D8UA 3OWOA 4IX1A 3OZVA 4OXQA 4RVHA 1T13A 1W47A 4MA5A 5D3QA 3PNLA 1PEKE 1THMA 2H51A 2HSWA 3NBZC 4KE8A 4QGFA 3SXUB 1KJJA 1R2QA 4FC6A 2P8JA 1WP4A 5CNIA 4CF4A 1U4SA 1O9BA 2HY7A 5JR3A 1W5AA 3U17A 2I91A 4YXWA 1LF5A 2OAGA 4IGIA 1YCFA 2V7PA 1E1CB 2YMQA 3A6FA 2ATEA 3PNSA 4PYIA 3S40A 4CTKA 1XWWA 2JD0A 2DECA 3B3GA 3K2EA 2PN1A 3FKJA 3U3ZA 2YXBA 3VU8A 2I3AA 4ZIRB 2CCJA 1H6BA 3N8HA 4KQFA 5AP9A 3OICA 3WYFA 4ALKA 3MHTA 2GA9A 1ZD8A 1MZVA 1W48A 2BFFA 3FVTA 2JI6A 3Q0TA 5KNBA 5HIKA 3D8SA 4MVJE 2GUGA 3P0JA 2R8OA 1S96A 1EFCA 2H1WA 3PVZA 1LQ2A 3AM1A 1ZN7A 4F6RB 3REFA 1UBMS 1A4XA 4XTCS 2F64A 1GZVA 4WOBA 3AW8A 1VFPA 1I8TA 1XDSA 1L8QA 2J41A 3IBFA 3WLAA 5HRAA 5KYYB 3KJGA 5J1TB 2FJ0A 3CNLA 3AIIA 1E2BA 2AWNA 1SG0A 2ROQA 2QM7A 2WHQA 1GYPA 4DUZB 2GEJA 1XLVA 3C48A 3OZTA 1NX9A 2PSHA 3EQ7A 3FSRA 5FOXA 4JQZA 1KC1A 3C8DA 5I9LA 5J1SB 4YPVA 4PQEA 2I1VB 2XYRA 2JRCA 4L57A 1QYXA 1U6IA 2CJWB 1US8B 4O25A 5ALMA 4KQHA 5NLLA 3S70A 2OENG 3WRVA 3QKUA 1W76A 2WF7A 4EECA 4B9AA 1CUEA 2FSPA 1ISHA 2OFWA 4NRDA 5JSZA 2V7WA 4HDSB 4C3UA 4QUBA 4EENA 2OCPA 4HX9A 3IE2A 3RC2A 3IT0A 3PS9A 3I58A 2DPLA 2I78A 1ZJ5A 3GQBB 5CT4A 1E8MA 1K7EB 4K1LA 4J2TA 5E3JA 4C04A 2R66A 3FGOA 3NU1A 3THXA 1W85A 3VYUB 2NUPA 4B0PA 1M2OB 3X1ZA 1EWTA 4R2JA 2HA2A 4PTZA 1FS4A 3V8BA 4WZBB 5KNCA 3PGXA 5TT0A 3ZI0A 2X9LA 1QS0A 2BKUA 3BULA 4HLUC 4QBIA 4YA6A 2A84A 5CU7A 2QAJA 4K3UA 5TRTA 3ZHBA 3AVYA 3UHOA 1I2AA 4Q6BA 4W5JA 4J1TC 5KS2A 3EPRA 2AOXA 3VHXB 3VR6H 4DE5A 1GPMA 4J9UE 1II8A 2HSJA 3E4CA 4FE3A 1U31A 1RWMA 3KQNA 2QBYB 3CVOA 4R84A 3EOZA 3L3BA 2I5PO 3MNFA 4B3TB 4JB3A 1Z7BA 4I81A 2DSTA 1O0SA 1XZNA 3EIOA 1C7ZA 1EBBA 4PIPA 3TG8A 3KO8A 4LDPA 5DWVA 1I1OA 5KJEA 3U4DA 2ZPAA 4MR9B 1O5TA 4IDPA 1EGVB 3FOAA 5E4JA 1H2EA 1S4QA 3HVKA 1YAHA 4QBGB 5AKIA 3C24A 4DV6B 3EMDA 4GC5A 1THTA 4ZZ2A 1G6OA 3UKDA 4YR9A 5EP4A 2X6RA 5A02A 2V8OA 1XRSB 3WHIA 1E18A 4ENPA 3GY0A 3QW4B 1SCUA 5KSPA 1R5OA 1NBOA 2J5RA 1HZZA 1XHEA 2RCNA 1TK2A 1PLKA 2FZGA 4LIPD 1CJBA 2XNCA 1RYMA 3NFYA 4IF6A 1ETUA 5CJPA 5E9AA 4BNKA 1QP7A 3QWAA 2GLXA 1CY0A 5U1PA 1INLA 1MC4A 4MQEB 3NHWA 1IUNA 2G5CA 1W4CA 3BXGA 1Z0JA 4NABA 2VTDA 1Q1AA 1FTYA 1P7WA 2FN3A 2Y1OA 1PGPA 1EE9A 1ECCA 3FCYA 3HE3A 4IX9A 2OA0A 4B5KA 3EEQA 3VYVA 1JN0A 1XDBA 4BFVA 2QZSA 5LCXA 4M9UA 5JNVA 2HNBA 1UOOA 4RKEA 2VUSA 4MV7A 4OQQA 5LMUB 1K66A 1Y3CE 4EKGA 3LUFA 2HAEA 3LC0A 1OW3B 2OBNA 3DHEA 2VPPA 2DY0A 2I6GA 2QTWB 1L4BA 4DCOA 5ITZA 1D0VA 5K2OA 2G0TA 3IQDB 2FCAA 1CEYA 2H48A 4R8MA 1YJQA 4CKBB 2I1QA 2PQ6A 4Z9AA 5CPFA 4AZ3B 1A4IA 2O8DA 4NZZA 2AC2A 3UC5A 3I9MA 3VKHA 2XOEA 1A5AB 1T91A 2G82A 1YDMA 3PICA 4JGBA 1Q7EA 2GHRA 3AEKB 1UFOA 4IMJB 4S1OA 2YMMA 3HCRA 3STYA 1VCOA 2WSBA 3NJ4A 3OJOA 4BNHA 1DO0A 2Y93A 3HP7A 2TRSB 3OT4A 5KTMA 1NRWA 3FYUB 4P82A 4BCCA 4RCYA 4YMWA 3S2FA 3UBMA 4ADSG 3WGIA 1YK1A 4KG7A 4XH9B 4ZCSA 3MGAA 3BXOA 3TW0A 1M6VA 1UWLA 1JB9A 3K16A 3NWJA 1J90A 2ATVA 1F48A 2L69A 2X58A 1JTFA 4C6RA 2VUTA 5DXFA 2AR0A 3GNLA 2QW1A 1O3YA 2DETA 2WG1A 1RWPA 3IYLW 5E0KB 1V26A 1M3SA 5JI2E 3NC1C 4CNBA 4MYRA 4JXJA 2MSNA 1KI2A 2OE2A 5J4YA 1F4LA 2FK7A 1D6NA 4AUKA 3IS3A 2J0SA 2ZYWX 4TMVA 1ZMRA 1HTBA 4HEJA 2YVAA 3OZGA 3PQ7A 3VKVA 2J9ZB 4H7KA 1OV4A 2YZMA 3FSGD 4B6JA 1GL9B 1V7CA 3MG9A 1ZBQA 3EGCA 1TM7E 4JL8A 3D8HA 4K9NA 4Y6GB 5FPQA 1DE0A 3OTQA 3ZBQA 4BNFA 2EWVA 4DSNA 2EEPA 1CUUA 2VDUE 5EJMA 4PR3A 1SXHA 4B3CA 3KD3A 2ONKA 3BSYA 4NU6A 4OBXA 3P8ZA 1TO2E 2CKMA 4BE7B 3RADC 3KVRA 5CH5A 4RF3A 2K87A 3DE5X 3PC8C 5U4QA 3VDNB 1K8RA 1FLNA 2JJYA 3E2IA 2XUJA 1L8AA 3CIOA 1UADA 3GBPA 3AU8A 3NIBA 2J45A 3N1UA 4CL8A 1EM8B 1S7GA 3UF0A 2J67A 4XM0A 2RGNA 1AA9A 2VIIA 3FPKA 4MKRA 2Z83A 3G0DA 4HUQA 4NS4A 2GF0A 5JCOC 3I2KA 3ZHTA 5B1EA 4CF7A 5BSFA 2H2GA 4V0RA 1Y6GA 2GEDA 4HWPA 1KKMA 4XWWA 5HVNA 1U8EA 2Q2NA 2HI0A 4X7RA 1G4UR 2JLSA 3MAGA 2AEFA 3TINA 4HUTA 2VRWA 2HJ9A 1H0KA 1R6TA 2CVZA 2ID8A 5IYZA 3FZGA 3JQRA 3OZFA 3STWA 2YWEA 1XZLA 3H6KA 3F2VA 121PA 2ABWA 3QJYA 1WUTA 2D3WA 3FUCA 3IUEA 1YVRA 3ML1A 2OXEA 4G25A 3E84A 4ND8B 5KJ6A 1DPFA 1KVSA 3T7EA 4FYVA 4X93A 2GM4A 4NBRA 1XP5A 4DLZA 4OFZA 4X5OA 1ZK4A 1I5OA 1U6JA 3LS2A 4FGZA 4MIOA 5FOUA 3L0SA 1D8TA 1VKRA 1MEOA 4D6XA 4OLBA 2O8FB 3ACBA 3EIWA 3BD9A 3F73A 4GICA 4PYMA 1U2ZA 3ETEA 2DUMA 1WBDA 1L5YA 1Q6ZA 2VP9A 4ZVOA 1EWKA 3CNQS 1DBPA 3GA5A 3M89A 8MHTA 1XKLA 1ZMBA 3TPCA 1E4YA 2E3JA 3B6JA 4B6QA 1VG0B 4QYIB 4WZAB 3W06A 3QYPA 1XDDA 4OHFA 1THZA 2RGGA 3TRFA 1CW2B 4PYJA 3OSUA 1RHKA 2Q2OA 2FPMA 4I1PA 1RPAA 3R4VA 4A8JA 2NYVA 4S24A 3FYUC 1FRNA 3FWYA 1JT2A 2JGMA 3QMPA 5ALKA 5EKDA 2AXQA 1MC5A 3HCOA 1E1QD 3ZYCA 4ER5A 2HX1A 2BAGA 3ZH2A 4JJGA 5F3WB 3V00A 1YA4A 3U3KA 2CWDA 1WXGA 1OAKA 2P9FA 2PL1A 3C74A 4A26A 3IXLA 3OPNA 3SQLA 3HKEB 3QF4B 1SB9A 2OPBA 2R85A 4YRGA 1Y4SA 3JYPA 3L43A 1EA7A 2IZ5A 4UOZA 3ZW9A 2C29D 1NUSA 3CB2A 4LOJA 4X85A 4LDQA 5MDHA 3AK4A 4M55A 4DANA 4EATA 2O54A 3D1JA 1JXMA 4I66A 3P71T 5JJKA 3U0VA 1CZNA 4XKJA 2EERA 4AMBA 3ISTA 5CFRA 4YRJA 4BRUA 1UDRA 2CUNA 3ZLBA 1NJ6A 5LLTA 1P73A 2LIPA 1KO8A 3ZZ1A 1TA9A 2Q3JA 3IA2A 2ZQZA 3IUBA 4PYKA 1NXPA 3A4MA 3HDHA 3WYDA 2H3EA 5K3BA 5KWVA 1R9MA 4E3ZA 3RQIA 2FR1A 4ZO7A 1SHZA 2R2AA 4X6XA 3H87A 4FDVA 2AMVA 4AY3A 5CXQA 1G7SA 1G2IA 1S9HA 4U5XA 5LIRA 3QY0A 4RQUA 1ADYA 2E7ZA 1XTBA 1KVQA 1O57A 4Q3CA 2C2WA 2GYWA 4V1CI 5ES4B 3P2IA 1W2WB 2A5JA 2QVGA 3BXXA 3ET5A 4QJ4A 3RTBA 2ON6A 4DF3A 3L0DA 3ELBA 1K08A 3WNQA 5LP6B 4NU8X 4Q7LA 1SOMA 1A7AA 3A3OA 2Z8XA 4D96A 1PI3A 3NWBA 4YUYA 2HK6A 2H5JA 5AMXA 5CYGA 4CKWB 4URXR 4L73A 1LNQA 1B15A 3MJFA 1UBGA 2JFUA 4NWIA 1E3LA 1AIPA 1V7QA 1KMHB 1Z45A 2ZJAA 4OL9A 1GTG1 3W2EA 3FTCA 2OMKA 3DP7A 4QGBA 3WLMA 3OPVA 4K8OA 3QFHA 5ES3A 1FFYA 4O4HB 1XNHA 3R5JA 5EGNA 4C0QC 3RE1A 3RROA 2DT5A 1QH1A 3SF8A 5KNCH 4PNEA 5FUWA 4U9IS 2O48X 4ISCA 2UKDA 5TX7A 4PE5B 3NALA 4HDKA 1VJGA 1AHIA 3ZW7A 2HV9A 1RRKA 2PJDA 4OSPA 1ZQ9A 1QZUA 4KR6A 1EQAA 5HF5A 4DSZA 4NHEA 1JWBB 3G79A 3UJAA 5LBIA 2Y0CA 3KEQA 2YJ6A 5EVJA 1Y5NA 2AN4A 5L3ZA 1B6SA 4EPYA 5ADUS 5ESWA 3BT7A 4YAUA 1ZQ1A 3GEMA 1YCDA 4NFLA 2ZU6A 4JB8A 2HHAA 2QAGB 1T0BA 1ZD5A 2AZDA 4AULA 4RGYA 1NW9B 1TUGA 4ZALA 4TZTA 4GLLA 4LYAA 1CUIA 3STVA 3UFXB 1KJ8A 2C3MA 3EIXA 2ZIUB 2QPLA 2VTEA 3VZDA 4KHZA 4TV8A 3MC1A 3FSGA 1L4KA 3KKEA 3WIDA 4B17A 1DC6A 1FTGA 4BCBA 4O2BA 2BV3A 4RL4A 4S04A 3TQQA 4UTRA 2HTEA 1DIRA 4JQCA 4KIUA 1TAHA 3IB6A 4JI1B 2XE7A 1ZMTA 3T1NA 1KBOA 1EINA 1D2CA 4R6WA 4C7KA 2I54A 1DC8A 4ZT5A 2WF8A 5LYJA 5BRJA 5HHTA 2QX7A 4HKTA 4YRQA 1SM4A 4UHEA 3LC7O 1Q0QA 1C3LA 1MUUA 3M5WA 3NIDB 4G1VA 4TUYB 4IJQA 5KMGA 3E4DA 4B6PA 5LP1A 3TBFA 4KN6A 5K1ZA 3O8LA 3SPXA 1M5UA 3AWDA 1LI4A 3BSSA 1ENZA 2FEKA 1VA4A 1GKLA 3ZDYB 1KJYA 4LDRA 2F3RA 3OQIA 1T6XA 2D2EA 5A5FA 3Q7EA 3QVMA 4UD2A 5EFZA 5H9VA 1XRJA 3WMXA 5FBZA 4H2DA 4QODA 4DAOA 3FKSD 2FEAA 4KGVA 4BBZA 3PIRA 2GPYA 2ZK7A 1KFCB 2W6NA 3PCRB 4IDHA 5BSMA 3CLTD 4NC9A 4WACA 1TQ8A 1APBA 1FP4A 4NDAA 3RSZA 1KI9A 3LT1A 2G9VA 3AVTA 1PRYA 2PXXA 1GZSA 1JEQB 1TJ3A 1RBQA 3MOIA 3RI3A 1VHLA 2GJSA 2EZ9A 1GQRA 2GBCA 3HZOA 4ZV4A 3GFFA 2IZ0A 2YQ4A 2PGXA 2V6IA 2QM8A 2EFJA 4R2XA 1MR3F 4RC9A 5CT6A 2ZUTA 1P44A 4A03A 2JAXA 4K6CA 4PFQA 3TUIC 1EK0A 2HMSA 5FUXA 4B7AA 4Q21A 1FNDA 3BC1A 4S0ZA 4Y0NA 5AW1A 5KCZA 2A9OA 4G37A 3FWPA 4F38A 1ZOOA 2JANA 1B8OA 5LP6C 5KEIA 2DBYA 4RIGA 2KSQA 1CZKA 4ETMA 1LC3A 1WOMA 3K0FB 3KV1A 3OWHA 3U80A 3ZY4A 3O94A 4JT8A 5TV2A 4AN1A 2H1HA 1X8KA 4C87A 3PE3A 4D7AA 1II9A 5DT2A 4GVXA 3T99A 5HP4A 4PX3A 1U9IA 4RBNA 1U5BB 2PKYX 4KVGA 1PJ4A 1BKYA 1U3GA 1J8MF 5FNVF 1USVA 4W8HA 3GPLA 2ZWPA 1USWA 4X91A 5AM5A 4P53A 1K92A 1CUSA 1W35A 1KETA 4A6EA 1GV1A 2GSWA 3HMQA 1UDWA 4EPRA 1CF2O 2QVZX 2HUNA 1ONSA 1YVUA 3MD0A 4CL2A 3HXKA 1NYTA 3T4XA 1RWWA 3QNMA 3HSKA 4AZVA 5TQ2B 1RIIA 2QG4A 4Z99A 4HS4A 3C3EA 4BN0A 1A8SA 3OFSA 5H7XA 4W5NA 4OHOA 2GBPA 4CM3A 3MCVA 3KYCA 2OY0A 1XGKA 2PU7A 1E1QA 3CKLA 1EJBA 4LQ4A 5CM9C 5L3RA 3W2IA 3ZK7A 2CXPA 1BG6A 5F51A 3ANMA 2WMNB 3TLZA 2V3WA 1DQSA 2OVBA 4X61A 5J2TB 4YDRA 5TQ0A 2R751 2WSMA 4PLGA 1ECLA 1K4YA 4BC1A 4L6AA 5C3MA 3RYTC 3ZIUA 2AUNA 3O5AA 2I7CA 3L93A 4TN5A 1HGXA 1FQKA 4Y1EA 4MP6A 3NTLA 1QE5A 2YWDA 5BXYA 3M9WA 4YWHA 4GOND 5K3OA 4C4SA 2PT9A 4QRIA 4F93B 1RAIA 3GI1A 3JYHA 5JD5A 5CDHA 3H4TA 4M6WB 5T3YA 3EAFA 1JTEA 1IVNA 2CNKA 2XIQA 3WZLA 3C6BA 4MWGA 1PT9A 4TV9B 5FEUA 5HSGA 3ZEIA 1X3SA 4AN4A 1NF8A 4MW0A 3VU3A 3HL4A 4FYMA 1KR5A 2QM0A 2WMYA 4F3NA 5FBVB 1IOWA 2ZTUA 1BNCA 2B5VA 3UYKA 1TCVA 4BVAA 3OEYA 3PQ5A 3ZDXB 4DC1A 3H75A 1IXSB 2XB4A 3DBVO 3QOFA 4RVCA 3R6WA 4H0FA 4IIHA 4AJIA 4X7BA 1FLAA 2XCSB 3M5DA 1MNAA 1T5HX 1YRAA 1USKA 3PVCA 4A8TA 1VZ3A 3Q87B 5JJIA 2CLKB 4AURA 3L40A 5ECYA 4F91B 3LWBA 3D1LA 1VZ2A 1QCDA 3JPWA 2Q45A 5A7GA 5KYKA 1Q2XA 2RKOA 4CR8A 1VHQA 4CQMB 5HM6A 1NVXQ 5AHKA 3TXYA 3JATB 4RU1A 3MWDB 4WGGA 5IVDA 4H17A 3RYFA 2GVZC 3GFGA 4RQBA 4H59A 1MIOA 2OZVA 3ZGNA 1QRUA 3AMVA 3AERA 2I7TA 3OIFA 4JKYA 3O73A 4F4CA 1E0AA 1GAWA 2Q5HA 3DDUA 4R3UC 5JPCA 2FPUA 1EUYA 3G49A 4MRRA 2DXIA 1FW8A 2JHFA 3I23A 1WHTB 1PJ3A 1MMFB 2YINC 4Y9UA 3AB3A 2D5IA 3VSAA 3OLCX 5AVJA 3T94A 2I6QA 1A9PA 4RWZA 2OV1A 4OYLA 1Z6TA 4EJSA 1Z5VA 1IWPB 2WJGA 3FPLA 4ZQHA 2PH5A 2PH1A 5GV7A 1J8YF 2VZ8A 1P6QA 5TMDA 3L1VA 1G5PA 1J25A 3OOSA 4FFMA 3VU0A 2O3TA 4X54A 4F5YA 2XCRB 4ZQGA 4WLNA 2VBFA 2F3UA 2QLNA 1OSNA 1P60A 2RGWA 4M99A 4OTZA 4G4IA 2C9BA 2C1EA 3HY4A 3AI7A 2J5KA 1H42A 2FWBA 1JALA 3PQ2A 4DIMA 2Z1MA 4M9ZA 1PJRA 4MOWA 4YUWA 1XTZA 1J8QA 1EDOA 1GR1A 1M2EA 1KAEA 3EOAI 3JYNA 4V24A 4IV5A 4N8EA 4WOPA 5EESA 3NOXA 1UOQA 5M3BA 1HT2E 3BWEA 2G80A 1DNPA 4NZOA 5KYVA 2M1ZA 4ZAGA 3A32A 5A7HA 1GEEA 3FI9A 4M1WA 1Y4DE 5JSHA 4JLPA 4PYOA 5ERXA 1NQOA 2VUIB 4G8JA 4BKQA 5TF0A 1Y8QA 4UPEA 4WA8A 4IHAA 5JASA 2FFRA 1JQ3A 4J2OA 5IJ9B 2XKAA 4KZPA 1X7GA 1T4GA 4OUDA 1M34E 2WTEA 4F8JA 2MSWA 2NZVG 4MW6A 3IJ5A 3B12A 3HFRA 3NHYA 4AYTA 5JECA 4Q9JA 1GU1A 2Z3WA 4IUBS 1GCIA 5F5NA 3AG6A 1IUPA 3I0MA 1TKAA 4GZMA 3UJ8A 1RWVA 4IFIA 1ZGGA 3I05A 4JUAA 1DX6A 2O2JA 3LXMA 1UFKA 2NV6A 1R6VA 4Q93A 4RK0A 1ZX1A 5CXSA 1IM2A 1XD8A 2VJBA 3HP4A 3OJLA 3T0IA 3V4SA 3WJ7A 1YI1A 1T9GS 2IHUA 5B1SA 3Q1KA 1N2BA 1SCBA 1UXIA 5DI9A 1O54A 3SFTA 1DAKA 1QAOA 1T3TA 3QFFA 5FKJA 4E46A 1RTTA 4OXNA 2HWKA 3FKSA 2RKWA 4DUGD 1I80A 1TXGA 1FEZA 3K5IA 1IG0A 4BDTA 4QHYA 1A76A 3IEUA 1A04A 1IM8A 1K5DA 1OBOA 1RACA 3I1JA 4NXNB 3P9CA 1T8PA 2EKZA 3RKSA 3ZK9A 4O2AA 1UF9A 3RM3A 4B7CA 5JCJD 3PQEA 4F85A 3K1TA 2PS1A 2VYFA 2JBHA 2ZB7A 3GGJA 2ISQA 3IAM1 3IO3A 3RYHB 1Q77A 3GO4A 1FS6A 9MHTA 3LXRA 4RHCA 1Z0IA 4Q3LA 4U0JA 2DR2A 4I4IA 421PA 5CB6A 1N6HA 1M8JA 5DCYA 2PKQO 4OU4A 1L5ZA 1ZXXA 2ZUDA 4MZXA 4QEDA 2CW5A 4RVOA 1TJNA 3WICA 4KFUA 2C5LA 2ZCUA 3H8SA 2P30A 4O4IF 1GVHA 2D0OB 5FYQA 3R3VA 1OWLA 4XWOA 4B3SB 4XFDA 1SZCA 2AH5A 1HLGA 2NU6B 1YJBA 3DAYA 1XCBA 2C2YA 1ZG3A 3CS3A 1QNFA 1DB3A 1QC5B 3DG9A 3DWGA 5LPNA 2A8YA 1BGXT 3GRCA 1G8PA 4GGOA 3B3AA 4DMUB 4X8MA 1RKQA 3R3ZA 3SX0A 2W2QA 1E1DA 2ODNA 1V1MB 1R7RA 1Q3TA 2CB9A 3CY6A 4NSNA 4MJ7A 2PUHA 4FMPA 3LYAA 3BXEA 1N2IA 1ZSNA 3LQQA 3OLQA 5A3SA 5T8KA 4HDMA 1IDN1 3K9WA 3KVOA 4CM6A 4AS1A 1KH3A 1Y4ZA 3VRHA 3HJAA 4OLFA 3FCUB 1FDUA 2UZ0A 3FYHA 2HJWA 1HFWA 1P4AA 5LDHA 4G89A 1LFAA 4NJOA 1N1EA 4B4OA 4W1RA 5ALXA 1DFIA 5A4MS 3D6UA 2W93A 1N3YA 5C18A 1M2VB 4IFBA 2A0XA 2Z57A 2AOUA 5DCLA 1N6KA 4GSLA 2FDCA 3HYTA 4FZRA 3UWOA 4J03A 1ARZA 4PAQA 3TWOA 2IYZA 1C7JA 4U8HA 3MILA 1LK7A 4Q48A 4U7TB 4D4GA 1T0IA 1C9YA 2XMDA 4LXYA 4EG6A 3FPCA 3HCAA 1E89A 4MAMA 1KFBB 4TMYA 5JALA 1SVIA 2D4AA 2XUDA 2V97A 3OQMA 1EX9A 4G0YA 1A0OA 4RHXA 1YS7A 4G0MA 4RSGA 3NMUF 1ZH4A 1N2SA 3D6HA 2YFYA 3TPZA 3C4VA 5GZ1A 4CYMA 3ITNA 1NE2A 2YXNA 4BC0A 2IXGA 5IANA 2GM9A 2R44A 4PPQA 4WFKA 3EUEA 3SYMA 3T5MA 1CP2A 1EI9A 2C42A 2PQ0A 1MA0A 5AYVA 4MKHA 1KP3A 4D46A 4ARCA 2WJYA 2HHLA 2FN8A 4C7VA 1HV8A 4J0EA 1XRLA 4PPYA 4G0OA 4CFYA 1WP9A 2CNNA 3DTTA 2EBHX 3C97A 1WSWA 5AHXA 3DJFA 5EFOA 1KVRA 3SICE 2Z4SA 2Z5LA 4JEMA 3K0EA 4ZQIA 4CLOB 2VZ9A 3G7SA 3WRYC 2ZXEA 4PV7A 4OB7A 1L5HB 3C5EA 3TLAA 1P2TA 1K0UA 1OYYA 1YNSA 1L6IA 2NO9A 3CRZA 4KJZA 1WMEA 4Q4AB 2BTOA 4RK7A 4XDZA 5EMHA 3KCNA 5JNTA 4YVFA 3R1IA 1E9DA 5GPBA 2W4IA 1VG9B 1Z8NA 2PWYA 3UMYA 2VT3A 4AJ4A 1OFVA 1FVHA 1HI9A 1I3KA 2XWQA 3KFVA 4NKRA 3WWEA 4ZTZB 3CWCA 3H3JA 1ZVJA 2YX1A 4HXGA 1W93A 1MHPA 5JC1A 1HMYA 1ODTC 4URHA 4CMJA 5BWCA 3AKYA 3E05A 4UNNA 1ZHOA 1M7BA 1JHMA 1MIHA 4O5OA 3SVZA 2IDJA 4M36A 2VKQA 4FPXA 4Z4FA 4NEGA 2NT4A 5JRJA 1R12A 4IHQA 1P0FA 1CS4C 2ERCA 1PNVA 4FYJA 5CA1B 3R9WA 2UYGA 4X8LA 4YAEA 1Y82A 1JQKA 1TCCA 4IHKA 4JKIA 4WKBA 4XM2A 1U3CA 1LPNA 4E3WA 4KOAA 4DQ0A 1H4SA 2H00A 4AMGA 3MBOA 4I2VA 2Q49A 5BN1A 1CQJB 4CEIB 3I6IA 1BVYF 1PL8A 2J0UB 4I55B 5DI3A 4R1SA 1HLDA 2ONZA 3PXAA 3DVAA 3A9RA 4PYNA 2EARA 5ALFA 4HGQA 3GLQA 1YZKA 4O08A 1KRWA 3EGDA 5CDUA 5JZSA 4DRXA 2C2KA 4HN2A 1U7UA 4BB9A 2P27A 4JI8B 1Q11A 2MTBA 4LSWA 5LZ5A 1I7PA 1WCIB 4BGVA 3HYSA 5DZSA 4OSOA 4GMKA 1PZGA 3MTJA 3AYZB 4IXWA 3CXUA 3T54A 3WDSA 1WCYA 1U1GA 1WRBA 1VYTA 2YCBA 4J4BA 4JODA 5E4YA 4CTMA 5KWIA 4WXEA 1H1TA 1E1KA 1XXHE 1L5LA 3ZWYA 2WIKA 3LX5A 1SKAA 2FPGB 4WUVA 1AURA 4EKDA 5FWYB 1IWBB 4GXNA 1UT8A 1L3BA 1YZLA 4Y9DA 3SD7A 2WB4A 4BLUA 1YE3A 4HO1X 3TJRA 1SQ0A 1E2LA 1XCLA 4WASA 2Q2QA 3AR4A 3NV9A 2BFDB 1DLJA 1JG1A 5IEJA 4JBYA 1Y4UA 2PX8A 1XNQB 1O95C 2GR9A 2REXB 4MUNA 5AW6A 3QPBA 3BXPA 2LBPA 4DUGA 2VEOA 2JLQA 1B0UA 1NXVA 2N9UA 2ANCA 4ITUA 4KIFA 2W2OA 5HW0A 3H83A 3OHPA 4DNQA 2HW8A 2B2XA 4OFWA 5DM2A 4NNOA 5DRYA 3N3BC 3JQBC 4GFDA 2IUUA 1I3LA 3VUEA 4DYHA 4YXFA 2RAUA 1RSZA 4RVFA 3CB4A 5JCJA 1HORA 2F4NA 2K5UA 4CKCB 2FRXA 2AG1A 2ZIVB 3KPJA 3KQSA 4EYOA 5JSKA 1JPNA 4MRMB 1JB1A 1G1MA 1JJVA 3U09A 4N5MA 3UGQA 1OXXK 3E5MA 2F55A 4AI6A 3AOEC 4D3YA 4MS3A 2G36A 2FFHA 2YWRA 2HJSA 1Q3HA 3LA6A 1G8HA 4G0ZA 1KJQA 2VKTA 3SYLA 3TECE 2YIMA 4V0MA 3ANNA 5HKLA 3D7LA 5IK2D 3LYUA 2QP4A 2TMKA 4FEYA 5DJ5A 5FQOA 4CIXA 3NS7A 1S9DA 2O5VA 4D8XA 3KELA 2YV5A 3F1LA 2C1ZA 2TSYB 2QI9F 4LQLA 3S5JA 2PY6A 5J2UB 4L1KA 2GO1A 3EULA 2XAUA 5BW8A 1JHXA 4TTSA 1H0RA 1QFMA 2R7KA 3WHLA 3FMPB 2GGSA 2HRDA 3TFQA 3ZGXA 2A86A 2P7HA 2REQB 4YV0A 5BSRA 3KL2A 4LMBA 2C7GA 3COWA 3F7TA 1RLIA 5ESDA 3W9SA 5J5CA 1GFIA 3UJ3X 1ZIYA 4IYRA 1YZGA 3HXMA 4QJBA 2L19A 4C43A 3NVKI 4Y2YA 1W2HA 3N2IA 5CVUA 1IBKB 4GI3A 2VQDA 1NHGA 3UW1A 1U9CA 3K09A 3ZE9A 4PF1A 5A5EA 2QV0A 3WHPA 4OI0A 2P35A 3F8SA 3GZTB 4PZZA 2C07A 4GI2A 3G0GA 2WJAA 2FKNA 5JXJA 4JUDX 4O4LB 3L4KA 3FR7A 4ZJZA 3MTBA 5J4LA 2XGSA 3GJTA 3QGMA 1JF8A 3VH3A 4GBGA 3IBYA 3PFKA 4JC4A 4TRNA 5E4FA 5EG5A 5A3VA 1SUCA 3DZGA 3ZHRA 3K1ZA 1G66A 2XNDA 3QKIA 3VO8A 3UGKA 2X40A 3T9EA 2QRVB 1KI6B 2JIBA 1QGZA 1LKZA 4HNTA 3P2OA 5AM1A 4E30A 3CF0A 4L27A 3FUXA 4B84A 1Y4AE 4BCDA 1HFJA 3UAYA 4ZICA 5JY1A 1E1RD 3F6RA 3HHPA 4Q3AA 1SXJD 4C7JA 1QWOA 1ZH6A 3MS2A 1R8YA 1H2HA 3THSA 4XRRA 4DBLE 2Q4OA 4EVQA 1K5PA 2J9FA 3UAGA 2DQ4A 1N9ZA 2V5VA 3P4XA 5TY0A 4TSFD 5CFPA 4BNXA 2WFMA 2I7DA 1VCHA 2YRFA 3HB9A 4MZDA 3TLCA 3SEQA 3WKDA 4DPMA 1DKMA 2PJRA 3WQQA 2Q4RA 1BVRA 1ES9A 5BW5A 1VPVA 2GNOA 4NMXB 1RBMA 2OG2A 4CVNA 2GNAA 1GAEO 2JA1A 1XZKA 3LHSA 1JHPA 3OCZA 4PRZA 1ZCJA 4LGVA 4UC0A 5AJZA 1EK5A 4GEKA 3I9NA 1CZUA 1DT3A 1BC5A 4QFMA 4MMZB 3LCUA 1EP2B 3D2BA 3WMWA 3T7TA 2R0QC 4G2TA 4QTYA 5FPTA 5J23A 3QU4A 1H5NA 4I4TB 2F43A 3RSOA 1NPDA 5K8CA 2JHCA 1M1YA 3BN3A 3PPVA 2E85A 4V1CA 1SQ5A 4QA9A 1YVEI 3D8NA 3NJRA 4KQMA 4E4YA 3LQFA 4KLZA 3AEQA 3OIYA 1IXZA 5DWQA 5CFLA 1PL7A 2CBZA 3QBVA 2IHKA 2JFWA 2Q5OA 3L0YA 3DGFC 4KFTA 4TM7A 1Z73A 1A8QA 2V7VA 1GPKA 2YBEA 5DISB 4IDBA 4H1WA 721PA 4KAFA 1VHWA 4REMA 2JLBA 3ZV4A 4WESA 5JD6A 3CZCA 4TLDA 1HRKA 1PVOA 2XBMA 3NX4A 1T0UA 2QROA 4CDNA 1MXHA 3RBAA 1J9GA 1JP7A 1TADA 4CFZA 2FMFA 3MCTA 4ROSA 5JJCA 4RD2A 4DBVO 2NVOA 1HDIA 3IBSA 1M34B 4IXTA 5K4AA 3H13A 3O4HA 5J9FA 4WTOA 3ESCA 2BFPA 4DDHA 1GQSA 2FEWB 5BYJA 5LOVB 4FOSA 1AV6A 1DBRA 3ZLTA 4KIWA 3GMSA 4LS3A 1MO5A 4DWVA 4YJ2B 1W0KD 1G8GA 4MB0A 4JLOA 4PS0A 3A6LA 1Q44A 3PFFA 1L5QA 4MR7A 4D3ZA 2VNAA 4F7DA 2A7XA 1EUDB 1WZNA 1MX3A 1AVTA 2YH2A 3TL6A 3QUAA 2GF9A 4EGCB 1FE8A 2QRPA 4FCTA 3TOXA 3UMJA 3V4PB 4KNYA 3ZVMA 3UO8B 4TSKA 1DG9A 5M7EA 1U9YA 4RIFA 5HQ3A 1FX0A 3DV0B 2GTIA 1JDVA 1JGTA 2CXSA 1K98A 2OR3A 3DDSA 2DY1A 2QMZA 4ABYA 5JS7A 4XSHA 1XA0A 5BQFA 3QE9Y 1T2CA 1XVVA 2ZBFA 2A1IA 5CMLA 1RHRA 4DIFA 1L7OA 1BWSA 3GCGA 4MYUA 3RVBA 2WUFA 1JHQA 4GOLD 4P3OA 1QHYA 4EBBA 4BGEA 1YGPA 1CUCA 3LDUA 4LK2A 1L3IA 3JVVA 4U6SA 4ZT2A 2ZE7A 3U4IA 1I2DA 4YROA 4R0NA 2NPOA 3ICCA 3F7OA 1RWQA 2X8AA 1RE0A 4OBEA 3DZCA 4R54A 3R7SA 3TYXA 4WNIA 4XB2A 4UQPA 3LP6A 3NDPA 5IBRA 3I6YA 3KOWA 7REQB 1PR6A 1YQUA 2HMUA 4I1UA 3IAFA 1DOAA 2P6RA 4FYWA 3S1AB 5HM8A 3QVGB 1KHTA 4UXHA 2GK7A 2RK3A 4U4AA 1KZ6A 1C4OA 4RK6A 1A2QA 1KP9A 2BKEA 3NO4A 4CGZA 3M9XA 2VOEA 3AKEA 3AF0A 3F5SA 3B89A 3EBPA 1I2BA 1SBTA 3IH5A 4XQCA 4YAKA 1JEOA 5TEWA 1P1BA 1UM9B 2A9KA 5LB4A 2BFAA 3ZY6A 3LSYA 3TNJA 2J3LA 3MCAA 3QVOA 1HE8B 2YYYA 3A05A 2QJTA 2P9GA 4MAAA 3ZQJA 5KPDA 1IK4A 2KWIA 3OMXA 4GS5A 1IOZA 2EW1A 1IPHA 5GJBA 1E5LA 4U2FA 3I0ZA 4U1RA 1UWKA 3VH4A 1IEQA 2QUAA 2BR4A 4RY8A 5IK2A 4DM3A 2CNLA 3IL2A 3HK2A 4ENRA 4WK4B 2J0VA 1KF0A 3FFTA 1M9NA 4B2LA 4L9AA 4EW3A 2P2YA 4LDNA 4QOGA 3T4EA 2V6GA 3PXGA 5TT1A 4HVAA 1VL8A 4OYYA 1D4AA 4WIAA 1V95A 3N7UA 4ARVA 3NBXX 4GHWA 4OLAA 2HO4A 1E6KA 2YKGA 4EF6A 4G9BA 1W7AA 4IWYA 5E6UB 2APJA 4DMFA 1PIWA 3GZNA 2ODBA 1MQAA 2XWSA 1W4ZA 3VR4A 4PAOA 3EDQA 5AIAA 3CVYA 3L8EA 1UKYA 1U2PA 5A7FA 1LZKA 3AUUA 3FA2A 1L5SA 2Q41A 2DH6A 1UP6A 3TSCA 1RQ7A 1ACLA 1T6NA 3C3BA 2UV8A 4N5LA 4RKQA 5KX5B 1O6GA 4YEDA 2Q99A 2J3HA 2XB6A 1KXJA 3Q7PA 1Z33A 4MEAA 4O1IA 3OQ1A 2DZDA 1N6IA 4MB2A 5FPYA 4NFHA 4DZRA 5EYPB 1BS1A 3Q4GA 1YIAA 1Z75A 2OGUA 4QFCA 1ECFA 2IDMA 4PX2A 2PWZA 2QRKA 1N4AA 1UBTS 1F2VA 1HQDA 1W5TA 2QF7A 5E38A 4NR0A 1HT1E 2ZG6A 5IM5A 4DDMA 4WXMA 3BRWD 2OLJA 1TZCA 3OD5A 5DNDA 1EB9A 3QOXA 3IMKA 3DDOA 3RVDA 4PBTA 2I4TA 3BRCA 4W1QA 1SVUA 4QEKA 5AOCA 1LK0A 3AJDA 4L3WA 4RTKA 1W0CA 1EXNA 3R09A 3QQ5A 4FWBA 4TXNA 5LVAA 1E1RA 4AY4A 2FSHA 1SXJA 3C85A 5GONF 4FR0A 3VX4A 3OE4A 1YJXA 2A9FA 4MW1A 4DG5A 1JEYA 1P2BA 1D4OA 3KB1A 3NW9A 5D6OA 2CFOA 2FSFA 2PH3A 4G84A 3D0KA 3FCXA 4J4HA 1RLOA 2ODAA 3WFJA 5I4BA 1YQXA 1K75A 3A7EA 3H2HA 4LBZA 4XAQA 4E5NA 1M8PA 2BM8A 3SFVA 1TVEA 2FX3A 1E2HA 3PEEA 4HVTA 1G17A 1W0JD 2OD9A 2W7TA 3MFYA 1R6BX 2I6UA 4NTZA 2XA1A 3SIRA 4I50B 4DTIA 2XDQB 2WRZA 2B2CA 2DWQA 4W99A 2FRDA 2XXAB 2F3PA 1JYSA 4Z49A 3EZXA 2GN6A 3WNCA 3SIWA 4DWWA 5AUQA 2C95A 4OFXA 5B3LA 4YT8A 5G1NA 2JFOA 4KK3A 3CLSD 4AJHA 1TGYA 2QKYA 1G6HA 1IXRC 3CCBA 4X63A 2FDRA 1PJSA 2XNJA 4NE9A 1ZYUA 5AK4A 5JXHA 2IY9A 3RSQA 4KN9S 1BROA 1CF9A 1KYZA 2QJRA 2FHPA 1J8VA 3F3SA 3HS3A 2D1QA 1M2HA 1IN5A 3JZFA 3M83A 2ADFA 2JGFA 1AMOA 1LV8A 4F72A 3ZJYA 3E7FA 3L6EA 2IPAB 1FFGA 5JMPA 3IP1A 1H3EA 1VLMA 3OHSX 1EFAA 3I1FA 4UDYX 3GD5A 3Q3GE 5AI5A 2V6BA 4BV3A 4YUXA 4B48A 3ID6C 1H1LA 2HMWA 3HDJA 2PGAA 4G3XA 4EPXA 1ORIA 4B4KA 2ZRQA 3OBIA 4QRDA 2CUTA 3ZU3A 4MDEA 5C32A 3CF2A 3GH3A 4MK4A 3RT1A 3TJZA 1FY2A 5C1IA 1XXHB 1OLUB 1YZFA 1FXWF 4KYVA 3ZZ0A 1J21A 2P1RA 5K8VA 4FYXA 5H0IA 1WMAA 3KXIA 1VE7A 4DQUA 4BNZA 1X7ZA 1GTMA 1SD2A 2RHGB 2C5AA 4EHAA 2D1TA 4A9AA 1TUBB 1W0KA 2WP0A 3KOUA 2IYWA 4DARA 4ZANA 1P72A 2VH5R 1SELA 3DAOA 2C4MA 3AH8A 3GJQA 4W5RA 2IBMA 2X41A 1OWPA 3MUEA 3CF4A 3HU5A 3I12A 4G9GA 3SX4A 1RCFA 2PGDA 2WJIA 1SC1A 3H9BA 2J8ZA 3TNFA 5KTYA 2IX3A 2R8ZA 3I3SR 4HWKA 4U7HA 5LMNB 3TDKA 2NXEA 3B6MA 3QFSA 1VKZA 1FZTA 2Q4DA 4HEA1 1PF7E 4NG5A 4ENTA 1F20A 3MQFA 4TRMA 1J0BA 2F8LA 3BQMB 4OP2A 2W2KA 4NVRA 2I99A 2ONYA 1I7QB 2Y99A 3A2MA 2XT0A 4M46A 2VDNB 2NSJA 4IXNA 3QBJA 1XELA 4BLTA 4DV5B 3E23A 4LVOA 4V0QA 4F3KA 3QKWA 3BKWA 3HY6A 4OH7A 2C5HA 3NIWA 1IOVA 1OTXA 4L7QA 4L74A 3PLRA 1HL3A 2VT6A 2FWJA 2XCLA 2XMRA 3B48A 3M5CA 3OZUA 2NV2B 4M3NA 4R81A 5BQOA 3H1TA 3UXMA 1JSZA 5AHOA 4WN9A 3T3IA 4F2HA 4GX1A 2C4UA 3FOFC 4I5FA 2G71A 2A1TS 4MUHA 3C2QA 5BVHB 4EL5A 4EQZA 3RUFA 4DIDA 2H8GA 4YCLA 3X2EA 2IYOA 3WK8A 1RJWA 2P9YA 4PIMA 2BT4A 3KVYA 3AEUB 1Y9DA 2BMEA 3GELA 3DNPA 3GLGE 2BHSA 1I5EA 4HFJA 3VZPA 1IB0A 2X42A 4INJA 3F8WA 1CEQA 2HIAA 3EDOA 3NHRA 4RZ2A 5BPHA 3UCEA 1XEXA 1TO6A 2V7TA 5DBGA 4D25A 2C2MA 3M7IA 3OOEA 1FSGA 4ETNA 3TQHA 2Z8YA 2ORED 4PHTA 4Y3UA 1CJSA 2V45A 2F1HA 3D3QA 2A5LA 2ZJ5A 4RV5A 4S35A 1EHYA 3DEZA 4YUZA 3KR0A 4X62B 1D6JA 2XBUA 2R2GA 3FMGA 3IUPA 4TTRA 2EQ5A 1S2GA 5CW2A 4YRBA 2LPMA 3RV4A 4H7JA 4LZOA 1S8NA 1U7OA 2ZI6A 4AIIA 1LS1A 4OHRA 3WS7A 3EZYA 1MJHA 3GZJA 3H05A 5ECGC 2VHVA 4XEHA 2ZTSA 1UZUA 5DBOA 2IJGX 3MINA 2H5EA 3KJHA 3ROGA 4FMDB 4BZXA 5L51A 3V8MA 2Q3HA 1VIAA 4NBLA 5JD3A 2J5QA 3WSWA 3WGYA 3JWJA 4C0SA 3KX2A 5IT9A 1VPWA 3PWKA 4ESHA 2VI5A 4KJXA 3EQ2A 2VWQA 3KSRA 3F1KA 3AKZA 1YQQA 1XAJA 2XCQA 1KDRA 3KQVA 1U8AA 4OHWA 4OOFA 1B43A 2AVDA 2WEKA 3RFUA 3V2GA 4XDYA 1U65A 2PZFA 3IMCA 3MLAA 4FFOA 2V7QD 3S2ZA 3KLMX 4ZYXA 3O90A 1H2FA 1EPUA 3CPJB 3PDIA 3PI6A 4Q00A 4LJ5A 1TU4A 2OQIA 5HFJA 3I3OA 1LSOA 2XQIA 2ZBPA 3PUHA 5DEOA 5LFAA 1KO7A 2CLSA 2P79A 3GJ5A 2JJ8A 5CVDA 4F1KA 4TTPA 1FSFA 1MV5A 3OZRA 5EZQA 3SSMA 2HA5A 3A2NA 4M1EA 1O97D 1PJQA 2BN4A 1NDQA 5IKOA 1TB4A 3O4GA 4LGYA 2JAPA 2WU4A 3K72B 1LX7A 4LVCA 4F21A 3C7DB 2JHGA 3BRWA 1AMUA 2YJ5A 3F90A 3VC2A 3DS8A 1YASA 2GH1A 1WQ4A 1TO1E 1BOOA 3T95A 3OTIA 5AHWA 1N6OA 3NDBB 2FU5C 4KIJA 1W96A 2HSDA 2IYPA 4PNZA 4FTWA 1ZA2A 2NP6A 4YT4A 2I4NA 2IWHA 2AOVA 3LWDA 3JAWB 1MHTA 1B26A 3T3OA 3I9JA 2L17A 2VPQA 4RD1A 4KMRA 2H08A 2B5WA 2ZETA 1DQPA 1KY2A 4PYRA 3WKCA 1JG4A 4R0MA 5BMVB 3ICOA 1QJCA 1TM1E 3DAFA 4UARA 2XW6A 3IP5A 1SKUA 2AA3A 2E9SA 1LNSA 3UEOA 1UXGA 1QGED 1W0JA 4CUJA 1XIVA 3GGOA 3DH0A 4OH1A 3R40A 4DEVA 2VHTA 5GZ3A 4QHTA 2C7RA 5EKTA 3PHBE 5FLYA 4HWRA 4KWHA 4QL3A 2V4ZA 5LDDC 3KSMA 3IC5A 2VAVA 1FP7A 4H18A 3DEKA 4M9RA 1ZD2P 3O92A 3T52A 1F17A 1GIAA 1UC5B 5EAIA 4QDJA 3DC7A 3IAAA 4G8DA 5HJ7A 3L8GA 1ADGA 1NVFA 4UHBA 3HTXA 4XUEA 4PLVA 1FMLA 2RBGA 2JIOA 5B4TA 1KQPA 3ABRB 3NHBA 2ZIEA 4LV6A 4PFJA 2PGJA 1GRVA 3H5LA 4C08A 5JLJA 2CBGA 1JWAB 7ADHA 1V3QE 1P2DA 2GMWA 2HRCA 2QU8A 4H27A 1ISIA 3RUDA 4EITA 1AKEA 3TK1A 8OHMA 1ECGA 2R8YA 2UZ1B 3KU4A 2DJ5A 3CKKA 5JDCC 2C82A 4Q4CA 3NYQA 3QM1A 2H3HA 2WPDD 4ENQA 5IC6A 3FPHA 1V3VA 3UB3A 7MDHA 4YV7A 3MBKA 4R3NA 3WLEA 1FNNA 3LFTA 4LNAA 4U7GA 3AF3A 3D9QX 5C80A 1SC9A 1Y3BE 1DRJA 3OM0A 4WT7A 4D81A 4AG3A 2P4SA 1VCIA 2XMCA 1JV2B 4JSTA 1K4MA 4MGKR 4RDIA 1VLZA 3KDPA 3DZJA 2QN2A 3BDAA 3GVCA 5JZOA 1PZMA 3SBXA 3KYJB 2IL1A 2H2IA 1SC3A 1SUFA 1WOYA 4NK5A 2NQTA 3PDJA 1TGVA 1NULA 1ISJA 2VJMB 4XRGA 2VPWA 2VP4A 4KWTA 3RSCA 3G5UA 2JI9A 4LCEA 3ZV5A 1G8JA 1X70A 3CKYA 5HGXA 4QNNA 1LI7A 2CXRA 4TRRA 1TUEA 2J3MA 4WJLA 3OTOB 4JN6B 4LY9A 3S8EA 3LBAA 4G41A 3RCBA 1CJCA 5UKDA 1R16A 1N2HA 3SDBA 1QR6A 4L75A 3U48A 1LF0A 3GYGA 1QIMA 3KZXA 4DBLC 5KJ1A 5C52B 4YAWA 2FQ1A 1KOLA 5DHFA 4HNRA 1Y8RA 4B35A 5FLXA 1TEHA 1WD7A 3AZOA 3IT3A 4FZJA 4LQDA 2CXOA 4OYHA 2ZJ6A 3FTNA 4IG9A 2VF8A 3ND9A 3W5DA 5TGZA 3NTQA 4RYLA 4CQNA 3ZU4A 4RWEA 3GLFA 1L7MA 1XU7A 1SNYA 1BHO1 2Z0MA 3R24A 4Z1MD 1CNEA 4Q37A 1ZC3A 2QUKA 4PBRA 4EY6A 4KCGA 4EJ2A 4E1VA 4D0GA 4BQSA 4DA0A 2AFVA 4YV2A 2NQ8A 2HF7A 2YV3A 1NI4A 3FPSA 4GAEA 4D9GA 1GSIA 2OM2A 1TVKA 2RHJA 4IZIA 3PF8A 4BIMA 4GMGA 3G7UA 3AHCA 3NCHA 5IDYA 2D74A 2EL9A 2UZ3A 1P6XA 3IESA 3S4YA 3ZWMA 3C43A 5DKFA 1NZJA 2K7ZA 3K9CA 4ZAYA 4QXMA 3AUFA 3NTRA 4AG6A 1DIHA 2PRKA 3O38A 3V4OA 4JXXA 2KHZA 2JVKA 2Z56A 5IAKA 1SQSA 2FX2A 3KOYA 5AKXA 4BBAA 1WS6A 3GIWA 3N2KB 3CXRA 4L4SA 4YO7A 5BV2P 3RV3A 3L6OO 5KREA 3SWWA 1OZFA 1URPA 2QN3A 4J8PA 4L85A 2EGUA 4OV6B 2O59A 1CC1S 4GKJB 3DZ8A 1USGA 1QOPB 4EG7A 2R1TB 1RI1A 1EDZA 2XXBA 3E8SA 4FKMA 1WZUA 4AZWA 4HYQA 4WLOA 4F04A 4C7MA 5LQUA 3JQ7B 2G8NA 4IW3B 4OYRA 4GZ5A 1A9YA 3IKLA 2BMVA 1FQWA 1IXKA 4ZMRA 2Z2YA 1UK9A 3CUTA 1FYEA 3GEIA 2G09A 1BXGA 2HHCA 2EP5A 1W19A 1RP7A 2CDBA 2EJUA 4HTFB 4KLCA 5ALQA 1QDEA 1QU3A 1BE8A 5AO9A 1FJ2A 1Z9BA 1N33B 1RNLA 1MX9A 2HADA 2VDVE 1MOSA 4AZSA 1T26A 4HOYA 2PUTA 2JJ2D 3KCQA 3NAQA 1JJFA 4MQ5A 4BVHA 3UBTA 4F4UA 5MN5A 5BWNA 4YYEA 1CVIA 1JQ5A 4QUAA 4ZOCA 5ESRA 1DWQA 2A35A 1UBFA 4BLWA 5DOVA 1BD3A 4BAUA 4I4CA 1AY0A 3CCCA 3TR5A 1Y6JA 2F1RA 5G2OA 1O4VA 2VQSA 3G7NA 5BQ5A 4DA8A 4EBFA 4M49A 3DBHA 5C5DA 1EJ2A 1PWXA 2ILVA 2FUNB 3TVDA 3G3EA 1TEXA 2Z2JA 3U44B 2ZJFA 5EWMB 4ZDIA 2BBSA 5G4LA 5IXJA 2XOKD 3EF3A 1KRXA 2V7QA 3NJ8A 3T06B 3ZU5A 5FWXB 4ZP1A 3ICEA 4HG2A 5E2BA 2O8DB 1NUUA 9ABPA 2ZVPX 4ONEA 2JATA 3NPMA 3DE2X 4HFNA 4HPWA 1Z0KA 4RJKA 2CYBA 4QXPA 4DDTA 5DVZA 4UAGA 1U5CA 3KD2A 4YJ3B 3EG5A 3TNYA 3X2SA 2DAPA 4MDFA 3W5AA 2LDXA 1CQXA 2Q6TA 3FSEA 1QYWA 1BX0A 3KAPA 3SBEA 1Z22A 4CT4B 4QM7A 1VA5A 3GB9A 3IKTA 2E6KA 4GLFA 1NURA 2V5UA 5C1DA 1U2RA 1FDIA 3IQZA 3P97A 2IVFA 5TGTA 2RC6A 2WSIA 3FOBA 4CM9D 2R8PA 2XWBF 3QEAZ 5JQGA 1LTQA 1KJIA 3BK7A 1GEGA 2C54A 2ZAYA 4DB2A 3ZZNA 2DULA 2EGGA 5KQRA 3N87A 4WY2A 1BRMA 5JVDB 4OBWA 4O8CA 3HNOA 2FRVA 4RVUA 4B6RA 1UJ5A 3F9RA 1CUXA 5DP2A 4Q1EA 1FBNA 1KTVA 2CVPA 5DYIA 4DHEA 5ALEA 1B42A 1U0EA 3V34A 1HMPA 4IIJF 3QX8A 1OVGA 4LWZA 1R0YA 4R01A 1IBCA 4ID9A 1SK8A 4WDRA 4OJMX 3DUFA 1DEHA 4QPCA 2HU2A 4M0EA 4ZZIA 5AUNB 4Q4JB 1YVPA 2FXIA 3CSDA 4KI0A 4PEVA 2NUBA 3WV5A 3M6LA 4MWCA 2QPTA 4P9NA 4OGFA 4YMIA 1GNPA 1Q22A 1WEHA 2DWPA 2JKZA 4LECA 5JH7B 5HPYB 3BRSA 3H11B 5JLAA 2Y0EA 3X0DA 4AY5A 2XTMA 1AM4D 5KU1A 3NHSA 4F56A 4QARA 1DXQA 1GITA 4HJRA 3C15C 1GXSB 3CNOA 4LE0A 3QE4A 5TMPA 2FQQA 3RK4A 5FI3A 4GVLA 3E22B 3AFIA 2ZUSA 1FRZA 1M5RA 2YCLA 2JIRA 1U2TA 4LRSB 4ZO6A 2D54A 2DHCA 4KU4A 2AGVA 2B61A 4IDFA 2ADOA 2JCSA 3G85A 4LDAA 1AGPA 2FMIA 3TRIA 2IPLA 3ENVA 4DLVA 3EDYA 2I34A 5AM2A 3HR7A 3GFSA 2WIJA 3LX8A 3IIMA 4C5CA 4C4ZA 3W2FA 1QP4A 2C83A 3N2NA 4BUCA 2WPDA 1ZINA 4E32A 4EL0A 5K0BA 2AXEA 1SUSA 2EBUA 4F6RA 1BMFA 2L82A 1L4HA 1NE7A 1PDWA 1M10A 3IEPA 1X7XB 5HMMA 1V5FA 2JCBA 1E0DA 1JECA 3NGXA 3W6UA 1ZY2A 3AUYA 4G5YA 2ZKIA 1C7IA 4TMXA 4DNPA 2BE9A 2VDQB 3GVHA 5EE0A 3B5JA 1GR0A 1PR1A 1PBNA 3CINA 3V55A 2DERA 2OCDA 2WD8A 4ZOEA 3RANA 5DN6D 1P91A 2B8EA 3HUTA 4HLNA 1QKKA 1P39A 4MUBA 4EEXA 5LMCA 1NKVA 1GG9A 1ZN2A 5IF3A 2TMYA 3ADOA 5EIWA 1BGVA 1S3FA 1SN7A 2A0WA 2LIVA 4GKVA 4LRYA 3H8WA 5ARDA 2XLCA 4LFCB 2VT7A 2YN0A 2C5GA 4CIVA 1HNNA 1NP3A 2MINA 2JGDB 4X6YA 1OI4A 1C30B 3S2SA 1YMQA 1X8LA 4HDSA 4LMRA 2OSVA 3A1TA 5CP8A 3GLGB 5ADVA 2HOQA 1H85A 3IDFA 1RS0A 1F8XA 1B1CA 2FQWA 2X9GA 3H6GA 4QPNA 1SIOA 2VP6A 4P86A 3JQ8A 1ZVMA 3WLIA 1X1RA 4UEOA 4CM4A 2ERYA 3AYXB 2PZGA 2IS2A 3HV0A 5A4FS 1DO8A 1RI4A 1KEWA 1QONA 2YWFA 3O82A 1UKEA 2YN4A 5DIZA 1IZ9A 3TPFA 1BJKA 3A1FA 2CL5A 2ZBUA 4M9SA 4ZXFA 4JBWA 3EDCA 3UZUA 2C7PA 2F9LA 3JQAB 1YACA 2MU1A 1NVVR 1HNWB 4B4DA 3D7RA 3KXDA 2V7EA 1FPQA 4WOCA 3DAPA 1EX1A 4IHJB 2FFBA 4IKPA 3UWDA 4P34A 3KDSE 2CVQA 4NCKA 4ZAZA 4EPWA 4OHMA 3V6LA 3JARB 2X0EA 2EZ8A 5MN4A 4QXRA 1KL7A 2R00C 1LJLA 1GCOA 3BHJA 3N7AA 3A3NA 4H6PA 4OK3A 4R2HA 4CMIA 1N6LA 4RMHA 4EHJA 3IA7A 1BWRA 2B9VA 1Z5NA 3CH6A 2VZLA 4QJ3A 5JDIA 1CLUA 1QTIA 3CTMA 4P0TA 3L49A 4DQXA 3FDFA 1VJCA 2FPXA 4P3XA 2BIFA 4YT2A 1KZ9A 4WH0A 2I2FA 2Z6QA 2D7JA 1Q0PA 3A31A 3LW7A 3ZK8A 3PYMA 1L3CA 2HLNA 5C5IA 3PUIA 3FPJA 1GOTA 2FLWA 3VPCA 2IEIA 5LXTF 4RHFA 1U7TA 4DLNA 5LQMA 4DIUA 1F14A 3TDMA 4BLVA 1PS9A 3OM8A 5SICE 1NLZA 5EJIA 2BFFB 4B7UA 2YZKA 1PHPA 1NWHA 3AX6A 3DJYA 2QE6A 2VP3A 1SXGA 2JJ2A 1BE6A 1XJ0A 1KDYA 3JYQA 4Y6QA 1ISGA 3IHTA 3OESA 3RG8A 4DM4A 2OCGA 2DGDA 4OI4A 1NW3A 3BJIC 1I9GA 5C7LO 1BXKA 3E9NA 5I4IA 3HN2A 2I4LA 3ETGA 2VPIA 3HEMA 1RAEA 1ABBA 4YMVA 1S3GA 2PXAA 2XOKA 5BYKA 1JKXA 2I80A 3JD3A 4QREA 3ZWKA 4DA7A 3ZZTA 1IZ0A 2C2XA 2XQFA 1GRCA 1F0PA 3DT9A 3M6IA 3GEEA 4AJNA 3ROPA 1ZK2A 2DKOA 3G17A 2IU6A 4FX5A 2PWPA 4NZYA 5FADA 4EF5A 2C7VA 2NNLD 3AFMA 2G1AA 3W6NA 5C8VA 5FO0A 2X15A 4KQCA 1VJ1A 1FMJA 2WG2A 3WJAA 1QH9A 4DSTA 1GCAA 4JBXA 5C8YA 4NCIA 1XTKA 4MQFA 4CTJA 3OE5A 2G1UA 3A4LA 3BFVA 2KBEA 4C6TA 5JSZB 2I3ZA 3W4IA 3AZQA 2HCRA 4A15A 2HH9A 4MA0A 3I9V6 4CM9A 3CV3A 3O4JA 1ODSA 1CNMA 1CFZA 5IC5A 3NONA 1BHSA 2PGNA 2O20A 2OO5A 1RJFA 2P2LA 4GYJA 2AQHA 3FPGA 4DN6A 4XQ0A 2Y6UA 4G0WA 1D6MA 1W85B 2OHVA 1EZ1A 2NUPB 2ZVQX 2N46A 4Y2SA 5K6TA 3U4CA 2G5TA 3ESDA 5JRDS 2RJNA 2YVLA 1P80A 3K9QO 4D41A 4RD3A 1JFVA 1N8NA 2LKDA 3GDFA 1QS0B 4Q6WA 5L4LA 2QGZA 3ORSA 2BR3A 5ETJA 1NJ5A 4DR3B 2Q3BA 4CDGA 1JEJA 2FGKA 2O2IA 4EMBA 1L4LA 2D4HA 2IHTA 2WJWA 2POCA 2ASEA 3HBJA 3LCCA 4MR8A 3R7AA 4LF9B 2VPYA 2WJJA 2ZULA 2R1ZA 4ZYVA 3M6MD 1EVLA 1OIVA 1QHHA 5DXJA 5BORA 2ZM5A 2XVXA 1QO7A 3BVPA 4C88A 1OXMA 1L4UA 3BXZA 3N0RA 3OLXA 5GM1A 1JLSA 2XA9A 3TLJA 1XPJA 4R7TA 3MCZA 4JEHA 4IIDA 2PM8A 4P92A 3LYLA 1A7UA 4DYVA 1R0KA 3KP1A 3HKBB 5KSOA 2UYQA 1RLMA 3K35A 2HREA 5EZ6B 4UW9A 2RD2A 5J59A 1IQUA 2ZP1A 3AP2A 4RDCA 2H59A 1UC8A 2E55A 4GMXA 5EIOA 2H54A 5CEJA 3ZJUA 5E1MA 1GRQA 3AFHA 4WNYA 2IF2A 1V8OA 5KVSA 1SCUB 1EXVA 3GK3A 4LTMA 3FCOA 4G63A 2ES4A 1KAHA 2OQRA 5B53A 1Y7TA 2FZ5A 2PS9A 4OI1A 2P0AA 1VSBA 1IHUA 4I36A 1GAJA 4P4NA 1PLLA 1VC2A 3BMOA 3JRXA 3W34A 1ZESA 5BRNA 4XI9A 2F59A 4WL0A 4YP5A 4EG0A 1E3MA 2HCJB 1PX2A 2Q3LA 1QLHA 3AFGA 3B9PA 4J0DA 4JQSA 4L0CA 1VL6A 4RUKA 1V8ZA 3WX0A 4DCPA 1PJTA 4F3YA 3G8DA 3SE0A 3UK2A 3B6KA 1GNRA 3QXXA 1PVVA 4INOA 1XV5A 3PUJA 3FWZA 4LY6A 3WNVA 1QWSA 3U4HA 4XX0A 1K8XB 1TEZA 4BFCA 5FOQA 3H86A 2O06A 2C5BA 2D2IA 2XCOA 5LA6A 5ITZB 1UJ4A 4AP6A 5AKEA 2Y1FA 5SY6A 1CEEA 2H31A 4RADA 5BN3A 3VDQA 3PDHA 4I1OA 1CUHA 2PXHA 4EGQA 1H4QA 1MOZA 4P4UA 4P35A 4QRHA 4W1PA 3LD9A 2B7LA 4MIKA 5J40A 3C1OA 3RVKA 4JI6B 3T8YA 4C3ZA 4MW9A 3UUWA 2N1BA 3NP7A 1X13A 1L5GB 1BA2A 5DHRA 2AFHA 1D8AA 7GPBA 5G1PA 1J1UA 4IYJA 1FNMA 3G9TA 1GJRA 2D7CA 2OKGA 4FHDA 1DTSA 4X7MA 3WSTA 2BMFA 4UQOA 1P5ZB 1IWOA 1DI0A 1SHKA 4NJMA 2PKQP 5AW2A 5B1IA 4Q1CA 1XQWA 4F5DA 2GLUA 2N0SA 3QHQA 4XPZA 1M6VB 3W2HA 5AW4A 4FD2A 2Y0PA 1UZLA 4BV9A 5DDIP 4EZIA 3GN2A 4F46A 1ZM7A 3V4ZA 5F77A 1RLTA 4NCAA 3BH7A 4X71A 1A2OA 5FFFA 3UATA 4BVLA 1F3OA 3TZBA 4IEFB 4YCCA 3G0IA 1V6SA 3CUKA 1TYZA 2IIPA 5CX4A 1GD1O 3AEXA 2ZBEA 2RGXA 4EG1A 1OH7A 3H4MA 5EJ9A 3F5MA 3VGJA 1UKZA 4DNFA 3CRQA 4DEXA 1JG2A 2M6LA 1T2DA 2DG2A 1W94A 4QGAA 2VJLA 2ZI3A 1I4WA 4MS1A 1B7GO 1GKYA 3R0ZA 3T9CA 7YASA 2R86A 5DU2A 4B3JA 1ZICA 1KERA 2X19A 1LDNA 2YHIA 1G8SA 3OQPA 4PG7A 1Q7GA 2LCFA 1J56A 3LP5A 4UBNA 2BLNA 5ICCA 2PAAA 5IARA 2FSGA 1O1YA 1VPTA 3QE0A 3VNVA 4I9NA 5T4FA 4S2UA 2VO1A 1GUYA 3TBHA 2EL7A 2R6GA 3W5HA 3EXIA 3KTFA 4CIBA 4DLBA 1SB8A 3UJ7A 1JHUA 4JP3A 4EG3A 1IMOA